2HWWA

Structure of pin domain of human smg6
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
160
Chain Sequence
MELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSENNDDLILSCCLHYCKDKAKDFMIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase-binding protein EST1A
publication title Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 57
structure length 160
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13638 PIN_4 PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 2hwwA00
5SV2A 2HWYA 3DBOB 5L6LB 4XGRA 3ZDBA 4MJ7A 2FE1A 1MC8A 1Y82A 2DOKA 3H8JA 1RXWA 3ZDAA 1V96A 3IX7A 3ZD8A 3Q8LA 4CHGA 1TAUA 1YE5A 1UT5A 5HP4A 1V8PA 4XGQA 5HMLA 3H87A 3TNDA 3H7IA 2LCQA 3H8SA 2QIPA 5HMMA 5K8JB 3QEBZ 1BGXT 5L6MB 1A77A 1XO1A 1UL1X 1B43A 3ZDEA 3QEAZ 2H1CA 5H4HA 2IHNA 1TAQA 2HWWA 5ECWA 1A76A 3ORYA 3Q8KA 1TFRA 5ED0A 1V8OA 2MDTA 1EXNA 1O4WA 2WP8J 5ECYA 1UT8A 2HWXA 3Q8MA 4WA8A 3ZVKA 3ZDDA 3ZDCA 5FV7A 2IZOA 3ZD9A 3I8OA 3H8WA 5H4GA 2H1OA 1W8IA 3QE9Y 5HNKA 2BSQA 1RXVA 5ECDA
chains in the Genus database with same CATH superfamily
1ZVJA 2SKEA 5D3ZA 3V00A 2C7PA 2O7VA 5HQJA 2R6HA 2JVKA 5JZ9A 3FOAA 3E7XA 1SBYA 4ND2A 4WK2B 3RC7A 4F8YA 1PYOA 3CKYA 3KAJA 1CNMA 4DLUA 4L9SA 3O82A 3I2HA 3KAPA 1ZITA 3QIVA 1NR7A 1XELA 2JFWA 3HWSA 2CNNA 3Q3JB 2XWPA 2WKWA 4J0CA 4MJ7A 3LX6A 4D56A 4DPKA 4DXHA 1ZXBA 1SUFA 5AYVA 4EY3A 2X5KO 3LVQE 2VP0A 2VT7A 3HTXA 1G98A 5K6RA 2I1VB 4PRYA 1M0WA 1I1QB 2XB8A 4O4JF 2BVNA 1UBGA 3UGQA 5ADUS 4NYIQ 3RVLA 6CHYA 1E2FA 2ETVA 2X8JA 3DBRB 2P4EA 1H1LB 2VXBA 4GLFA 5EIWA 2MJLA 3IRUA 4E2ZA 3S27A 1M3SA 1FVOA 5HRCA 1YCGA 4NV3A 2DHEA 3PNSA 1Z0SA 4RDCA 3JQ8B 5F9MA 3TYXA 4PCVA 2YRWA 1W2GA 1WLYA 6Q21A 3UAGA 2OXRA 2AC7A 3OEED 1N0WA 4TTQA 1E4VA 4UUNA 1I6WA 2W43A 3DEHA 1LFDB 4EFLA 1M2FA 3O84A 3KPJA 5LZ8A 4NZOA 4Q1VA 1A5BB 1K4YA 1NI4A 1AZLA 3A9WA 3O9ZA 5BV0A 2V6JA 1Z2OX 3T7DA 1JWAB 1RW4A 2J59A 1S96A 2YV3A 3RSSA 2YVUA 3E70C 1Y4ZA 2PH7A 1KKMA 5K8TA 5BYJA 4CTKA 4NZNA 1HEUA 4WNYA 5P8WA 5I48A 9MHTA 1KORA 3M0EA 4M7OA 2VATA 1U8UA 4H35A 4NU5A 3F6CA 1JQJC 4OXIA 1Y7PA 2OHXA 5E3JA 2ZI4A 4INZA 2JIPA 2ZR0A 5BNZA 2Y1XA 5JS8A 3QPDA 1Z6ZA 3UB3A 3LQFA 2GZAA 4RVCA 1C3LA 1NJ5A 4CJXA 4JBWA 4FXOA 4X65B 1CZOA 2JI9A 4OYHA 4X7BA 1CG6A 2B7LA 3L0OA 4Z0PA 3FLEA 2DGDA 4JI0B 4WFJA 8GPBA 1K3UB 4UPVA 1L7AA 1XV5A 5F64A 3HG7A 1DBWA 3RT7A 1E2LA 3UH0A 4FZ5A 1KS9A 3K0BA 3SQNA 2JFXA 1H66A 3CH6A 2AHOA 3S1SA 1U7PA 2E6UX 3F6YA 4UUMA 3WDKA 3ICQB 4DWWA 5HJEA 4GMXA 1SCQA 3OQOA 4MQFA 2IITA 1Y3IA 1ZH8A 1K6JA 1W85A 2Y9MB 4IDFA 4MLDA 4OXXA 1T91A 4NH0A 2WWTA 4RSMA 1J0EA 3WADA 1A76A 3ZKWA 5BXQC 5JBNA 4GXTA 1NBEA 1I3MA 4P08A 3OIUA 4TTSA 4Y30A 5FI5A 3RVPA 1O58A 5AHOA 3GJSA 4G0YA 3MPOA 1DQPA 1ATIA 1DSSG 1TB4A 2II6A 2V03A 3JYNA 3OUTA 5EUCA 5KCMA 1ADGA 2UV8A 5TB5A 3TH5A 5DM70 1Z34A 3HS3A 1WUTA 1E9RA 5GADl 1HZZA 5EEHA 4NCAA 2NG1A 1B7GO 2HJHA 3IUPA 3MTDA 2ZYTX 4DIUA 2FUKA 1VL6A 5FI3A 4B3SB 1PT7A 1PNVA 5JCOA 4GMFA 3RU9A 3DO6A 4B31A 1LZKA 2OV2A 3HXMA 2DE0X 5D00A 1ZGHA 4ZYYA 1N57A 1T5HX 1CS0B 1TYBE 3UT5A 2HNKA 1P4HA 1ID1A 4F96A 1HNZB 1RJEA 3AVPA 4ML3A 1QCZA 4IQGA 2HNBA 3EZ7A 4TLLB 3QLUC 3FYTA 3IT2A 2NU7B 2P6RA 2X2OA 3REQB 1JKJB 1S4MA 1VC2A 2XTMA 4R1SA 3DLBA 2B25A 1GGNA 5AXBA 4W5TA 1QJ4A 3O9VA 3WIDA 3GAZA 3ZQ4A 3FYDA 4BMVA 4I4TB 3IXMA 1U7WA 4Y2TA 2YHSA 3WGZA 1FTNA 5T4HA 1HEIA 4JLUA 3IQHX 1O6FA 3NHAA 4LWQA 4OP3A 3TFOA 1QGUA 2LDBA 2HSZA 4Y6PA 3DXFA 5KVCA 2ZWAA 4MUJA 1WCIA 3HA3A 3I04A 1FDTA 4WY8A 3WMGA 4D5EA 3AR2A 4QHTA 2PSDA 4FNAA 1ACLA 3R8FA 2ZVDA 3JWPA 3KB8A 5D6OA 4EBBA 3AKZA 1VGRA 2D06A 1PZMA 1XHFA 4BFZA 3ONVA 2HBRA 4MB6A 2I6GA 4P82A 5CMLA 4YRIA 4LF5B 3UH1A 2HHCA 4HQ6A 4X6UA 4RD0A 1W30A 3GLKA 3PUIA 2QI9C 2ZJ5A 4CW7A 4DDUA 3CT6A 4YDHB 3EWIA 5DM1A 1CRQA 1GCIA 3AG5A 3JD2A 4PPGA 4C4ZA 2V7EA 4N41A 1Q83A 2PAFA 3HJUA 3IJEB 4A5OA 3VJRA 3SJCA 5ESDA 3BJMA 1KQNA 3ZGYA 5KTSA 2KE5A 4WOBA 4BL5A 1NXXA 1OX4B 2XZPA 1CY1A 2WPDD 4Z5XA 5ESXA 4G0OA 2DUJA 3BM5A 2QIPA 4XSGA 3LDHA 5D1HA 2XT9A 4RGBA 3UWKA 3CSDA 1CCWA 2WA1A 5G1OA 1FYXA 3LF2A 3PJEA 4DKJA 4G4GA 3D4LA 1XROA 2BOVA 3EDMA 3OWXA 1TQ2A 3A37A 3QOFA 1JN0A 3PJFA 2EX4A 1P18A 4C08A 4QJ3A 3EPLA 2ZZMA 3EDCA 1OF1A 1X13A 1D2CA 2GAFA 4YWJA 3OMWA 1WSBA 4UOQA 3SNKA 3M9WA 3KB2A 5EJGA 1JDUA 4NOKA 5CUQA 5AUNB 2C95A 3KQUA 2BMDA 3PL1A 1WMBA 3L92A 1K7YA 1NW5A 4OAQA 3OM9A 2FPWA 3ND5A 3RF6A 1A5AB 2NSDA 1ZHOA 4B33A 1T2DA 3UATA 2JGLA 1W0CA 3OM1A 4E5DA 5CH5A 3GMTA 2VPTA 4A6EA 1GEEA 4HTFA 4EHJA 5C34B 2DQYA 5LLDA 2G9UA 1R9GA 3QUBA 2AEJA 3KZ1E 1GTVA 2M1ZA 3AM5A 5TJ9A 7AT1A 3MWJA 1DKMA 2A6PA 4MGYR 3EGEA 4I1VA 3WMRA 4JK3A 2XQFA 1DLJA 3NTQA 4H4EA 3AIIA 1Y1TA 5CVDA 5AVJA 3H99A 1NNI1 2CXUA 2LV8A 4ZYTA 5JCOC 2PQ2A 2VH1A 3C5EA 3VOBA 3OIWA 2JGAA 1G16A 3E5HA 1ESNA 3U3OA 5A5VA 5FWXA 1DC5A 3RHSA 4GECA 4MINA 1ABEA 3BKXA 4LV5B 5KPDA 3R3JA 3FCYA 2OZEA 4KO3S 1A4XA 1ZX1A 2BWJA 2ZYVX 1GUYA 3ENQA 4H27A 1RLOA 3N7AA 4IXTA 4PVCA 4TWBA 2FF5A 3BTSA 1EIZA 1FSZA 1FFXB 2H4XA 2R6FA 4Q3EA 4XJXA 5AM3A 4RK7A 4N0EA 1SURA 4NCKA 3A05A 2GRUA 3B3JA 1Z6TA 4REOA 3LGXA 5ITZB 5CDUA 1UPXA 2GYVA 3KK0A 5E6SA 4TRRA 2HJGA 4PSUA 4AS3A 2YJ3A 2WYIA 2ZRPA 5IAKA 3FPLA 4P84A 1PJAA 5F73A 3V4LA 1KSFX 3R3YA 3WRYC 4EGSA 4EG4A 1MPXA 2PWAA 4NMWA 4BYGA 3L1HA 2RB4A 1IMJA 4IF4A 3IIIA 1Y1LA 1QYCA 2BCJQ 3C6QA 5ECGC 3EBLA 3TQTA 1QP0A 3K6KA 1LTQA 2NUBA 2CKDA 3BCUA 3CRQA 1DO8A 1WB5A 4OF4A 4PZEA 2BGRA 1Z8HA 1NF2A 4KO4S 2BP7A 5AUQA 4AY3A 2QUAA 3AR7A 4A4DA 1HLDA 4I1OA 5EXTA 4CN8A 2WTBA 4FEYA 5IAJA 3T4PA 2FLKA 5CJJA 3YASA 1XHLA 5JNVA 4LHSA 4PEVA 3RTGA 3ZC3A 4CKYA 2FRDC 4OJQA 5DGIA 3WYGA 3JWIA 3ZQKA 5ALQA 3C7DB 2BTEA 3GT3A 3ZNQA 1C9YA 1OFIA 3EBOA 3PIDA 4Q21A 1NVTA 3SIXA 5GQSA 3UW3A 1XTTA 1XAHA 2ZI6A 2WUDA 2I6FA 3DUFB 2ZB7A 5HKAA 2NTVA 4JKYA 4XX0B 2XV1A 3B48A 4I4LA 4M7WA 5CGZA 4CM8B 4EI2A 2C31A 3N59A 4OO3A 4S05A 4EMTA 2JHPA 5DW0A 3RKRA 5ILOA 1J8DA 4NP6A 1R8XA 3I9FA 3OJFA 1K7SN 4CRWB 3IB6A 3P9RA 3QWAA 4YDSA 4DV1B 2OE2A 1TEXA 3ABZA 4B7CA 3D8TA 4JCCA 1NOJA 1SB8A 3JVEA 2R6DA 3A06A 2H1SA 4GFDA 4UNPA 4LYAA 2GTHA 2Z5FA 5GVSA 1E63A 5IKXA 4WZBA 3HC7A 3M2PA 4IMRA 4U63A 1DXQA 4X71A 1EFTA 3ZIUA 3ZHCA 2X0NA 3V1UA 3W7AA 3ZGVA 3ZS9A 4FFWA 1EFVA 3STHA 5JCPA 1BXZA 1M2OA 2GGSA 2J6HA 4ISBA 2UUPA 2Y1GA 3EIOA 1WIWA 3QQ5A 3KSBC 2VRCA 1JXAA 4AP5A 3C3BA 3EGDA 2F59A 3OQNA 4M76B 3O4JA 3QV2A 3KZMA 2R11A 1D03A 4IV0A 5FBHA 1A88A 4FHCA 3AM3A 2WRZA 4AM8A 1Y8RA 5KS2A 4UVHA 1E1MA 1TK3A 2D0DA 1NAHA 4L50A 3RROA 1FSFA 1OZFA 4TXNA 2WIAA 1C4OA 4OSEA 3QHQA 4MWCA 4QYMA 3SQXA 3CVVA 1NVKA 2PY6A 3JPWA 2AFVA 1P5RA 2VJMB 1Q11A 4ES6A 3B3AA 4W9NA 1MENA 5JD5A 1XZ8A 3BMCB 4C7OA 3OZVA 1NG1A 3WGQA 3RPEA 2GERA 1OBHA 4TLEA 1NMYA 1BVUA 1KEEA 1FYVA 1UBMS 2FZ5A 3BF8A 3KT0A 1TM5E 2AOWA 1KAOA 1AU9A 3GCDA 4GDFA 2XIJA 4I14A 1QFJA 4JBXA 4ATNA 4GSLA 1YJ5A 3JQ7A 4F8EA 4FILA 3NKVA 4WAUA 5JFOA 2ZRMA 4M9CA 2QN9A 1T6NA 2D5AA 1ULBA 2BL4A 4G1EB 4J7CA 1L4BA 2CHFA 3EOAI 5CVJA 5IU6A 4Q37A 1WZNA 3PQFA 1O5TA 3ER8A 1RQ2A 1SGWA 4TKMA 1ZEJA 1RI2A 4HJRA 2COKA 4JP8A 4Q01A 4YEDA 4CI0B 4AZ3B 5FIUA 5IC4A 4Y1GA 3D3NA 3I2JA 4L16A 1OMOA 3WGNA 2ZSDA 3HVIA 4JASB 1YE3A 1I3NA 1P31A 5DBOA 1KMIY 3JWJA 5KVVA 3TG8A 4FI3C 3ONNA 1RP7A 3KHSA 4YQYA 1IN1A 3X1YA 1BGVA 2AH5A 4UEKA 4B8YA 3FDZA 3NDIA 4GU5A 4NCNA 4YQFA 4L3VA 3OHSX 2H29A 3HBFA 2YL2A 2Q29A 3EF3A 5L6LB 1PS9A 2Z6UA 2Y8EA 4BIMA 3DZIA 1YBMA 1GAWA 4O4HA 1JMKC 1CNEA 2ZSHA 4J0DA 3EXEB 3NBZC 4S1VA 1OZHA 5ERGB 1QPBA 1KWGA 3LVRE 4CTNA 1KU6A 2X9GA 3N2NA 2DSNA 4GI1A 3F5SA 2QX7A 1E89A 1WHSB 4X6YA 1I0ZA 5F3DA 2Y9PB 3OFJA 1RRPA 4LRUA 4YIHA 3WK5A 2ONYA 5B1IA 1QG0A 1ZBQA 4M86A 5DTMA 3SYLA 2O9JA 4GC9A 3SXUA 2OG2A 1UMCB 4E88A 5KDOA 3I9LA 3W78A 3DWGA 3G9TA 3NRJA 4GOMD 4RUKA 1Y0BA 2E9SA 3AH8A 5CCXA 2CL6X 7ADHA 4GYYA 4AQ7A 2FX5A 4GOOD 2WVGA 2HIHA 3ZIAA 5DLYA 2G8LA 3Q7TA 1FYEA 4QOGA 1HDGO 1P1BA 2OV1A 1PNOA 3PX2A 1XZNA 1SUBA 3EDQA 1QSGA 2BFEA 4L7VA 1UXOA 5C8YB 3CUVA 3PPWA 5TQ0B 1UBOS 1DCKA 5AW6A 3D8NA 2OXEA 2R7LA 4RF5A 3AR4A 1P7VA 3TQRA 1WXHA 1TMKA 4GVXA 4MR7A 5AMXA 3EVDA 2NTYC 4Y6GB 1HYHA 2WJZB 3MBKA 2Q99A 1X7WA 2OP0A 3V4PB 4EG1A 4Y6OA 1S4QA 3KU4A 3SDBA 5DNYB 4LE2A 4A2QA 3KOXA 3NZEA 4KN8A 3UJ6A 5JW6A 2FRXA 3ZLBA 1SKBA 3QBVA 2C9OA 3H5AA 3H17A 4CMKA 2D8AA 2UZ1A 3ZGLA 3CJTA 1JFSA 2ASEA 2DECA 2H4ZA 3KQOA 2X8BA 1MVLA 1YDGA 3R24A 2JGKA 1NT4A 1KDOA 3KKQA 4WZBE 1V0JA 2QYTA 1S7CA 2UAGA 2OAQ1 4MV3A 3B5EA 4L57A 4XUCA 3ZVLA 2WWRA 4BYMA 1P0QA 1X7ZA 1Q1EA 1JFVA 3SBEA 2X9VA 1X87A 5EZ5A 2ENUA 4M1KA 3TIFA 5JRJA 1BXRB 1P9WA 2CMKA 2KMLA 3LBNA 2TRSB 2ATEA 1PQPA 3F6SA 1TJ3A 1C7QA 3CRMA 4AY4A 1SXIA 5AJHA 4F5EA 1VYHA 4KAJA 1ORWA 1T2FA 1JTEA 4MNTA 4ZAZA 4HFMA 3U4HA 1J1UA 4F1JA 1EK1A 2AZ4A 5FA8A 1LXCA 4G26A 4J90A 1A9QA 2VDMB 3KYCB 4XQEA 4F3CA 3NWEA 1R0SA 3SDZA 1Z0KA 2I34A 4YMSA 4FUTA 4EITA 2I4MA 4GWKA 2H4WA 4Q4AB 1WXWA 2AE2A 3RGWS 4TXMA 1VA4A 3F5FA 4W5HA 4E70A 4QFMA 3PT9A 3KZXA 4UD6A 5HS6A 1SCKA 4NY1A 3RGGA 3CNLA 5FA5A 1DWPA 2AN5A 4E09A 4Z53A 3BCSA 1UBFA 3I8XA 4WD3A 4FW8A 1NVBA 5IVHA 3S29A 3PCRB 4QGAA 4RMNA 1BH6A 1VZ2A 1XRMA 2P6PA 1RABA 4O1HA 2A9RA 4QYWA 1ZZEA 3VZCA 4DCNA 5J4KA 1QRTA 4OXKA 4CKBB 3KDSE 3GYBA 4GPIB 3W8DA 3WB0A 5C7YA 1ZRMA 4B3DA 3WXBA 5JXGA 1ONNA 2CYAA 1PFVA 4BZQA 1T1JA 3LUPA 2W37A 2HBYA 1JI3A 3IV7A 2BW0A 4G63A 4H08A 2WYHA 4U1RA 1KFBB 5FTMA 3A2MA 2FFJA 3QKRB 3W5VA 1OBVA 3E18A 4LF6B 4XB1A 1XMVA 2A1TR 3K1TA 3W05A 1WXFA 5CDFE 1IN4A 4BKUA 2Z04A 2VNJA 4AP6A 1SZDA 5LQUA 3AY0A 1TF5A 1YE5A 3NDPA 4HB0A 4AAYA 1XTIA 3GVPA 3SWWA 2PX0A 2XQIA 4YAGA 6AT1A 3X0DA 4JNKA 1RYMA 3N2KA 4KXMA 3RR2A 3SYKA 4F4HA 4Z4GA 3QE4A 2WG1A 4IIGA 2E4XA 2O19A 1Y80A 4HAYA 3RT9A 1UJNA 2AEFA 3FFTA 2JJQA 1G3QA 3JQGA 4XVQA 5LP6F 3AUFA 3L07A 3OOHA 1C2TA 3ZCVA 4D26A 2FN3A 4J8PA 1HFJA 1FFGA 4Q9NA 5TQVA 3A4LA 4BGUA 1NA5A 2HA7A 2COUA 3GZJA 2V58A 5T41A 4ZIRB 2DSTA 1PW5A 1C41A 3IR7A 3WLAA 2LTAA 2V65A 5JMPA 1K63A 3FSGD 1M6YA 3LIIA 1Z4NA 2BFAA 3F47A 2JI8A 2BHSA 3D4IA 4P3OA 1JWBB 2Y0PA 2P75A 3N2ZB 1NBHA 4GM0A 4ZOLF 4K1LA 4YP9A 5K8CA 1G6OA 4A3SA 1RZUA 4B1FA 3EODA 4OQEA 2OCLA 3AYZB 1GPH1 1UJ2A 3DHEA 3K1YA 4X66B 2C7QA 4FZJA 1PJ4A 1GL3A 3GGSA 4RIHA 1WRBA 2H5JA 2L0XA 1JMYA 4RSGA 3TLGB 3TJMA 1I33A 1ZWKA 1UP7A 1Z4OA 2W2XA 2ZG6A 3OSUA 3RJ9A 3U48A 1WUKS 1Y5LA 2CC2A 4C0AC 1P61B 2V3VA 4YRLA 1ULUA 1QV7A 1RM0A 3W3ZB 1UAGA 2VJDA 5I7AA 1EE9A 4WBXC 4IDCA 4A8TA 4YXFA 3W5BA 3WLEA 5LXTB 1I5OA 1R16A 1RJ9B 1Q21A 3IPRA 4OXQA 2AX4A 4IGFA 2CEAA 4CUZA 2C59A 1A5ZA 4HGOA 3GFOA 3QPCA 1VMDA 5CA0B 1BVRA 1H85A 2GN2A 5DISB 1CJCA 1GT6A 4KXQA 3T9CA 5ALJA 1YBHA 1RU3A 3ZHSA 4F84A 4F46A 4V1CB 3HQ4O 3WGMA 5ALTA 2H2FA 2AK2A 2NZYA 2PSFA 4BDTA 2CLCX 4K8RB 1HDRA 4I9UA 2C0PA 1HQCA 3COSA 3INYA 2KJQA 2NO7A 3KJZA 5E7MA 3QXGA 2P40A 4BX0A 3JZFA 1ZNYA 1Z45A 2G76A 3M5DA 3QLUA 4HX5A 5EXSA 1SXJE 1NLFA 4JB3A 3V9PA 4EF5A 4PO3X 1WXEA 5DTEA 4NYMQ 4CM9D 4JITA 4S04A 3V7UA 5T7BA 3GMIA 4LG1A 3BHIA 3IJRA 4I50F 2IOQA 2PX8A 3GFQA 3HB9A 1SU4A 3UKDA 3FYSA 3MN1A 5BUQA 2GPWA 1DX9A 1N3BA 2JCSA 1II8B 4IMIB 3LT1A 4DDTA 5HUHA 1BKSB 1DAFA 1PFQA 2CVPA 2QNRA 2DWUA 3TSYA 1U9IA 3UKOA 4G5OA 1ZD2P 4C6SA 1BE0A 4O4LB 1O96A 3KL2A 3N87A 3A2NA 3GQVA 3HRIA 3F1KA 4FQ8A 2QN8A 1Y98A 4BAGA 2VZ8A 1LJLA 2F9FA 5E6UA 4A73A 4CYMA 2ODWA 4IVRA 1X86B 2QRPA 2HDOA 3BTVA 3H5WA 3NKLA 2IEBA 3OUZA 5E95A 5AD1A 3U44A 4AIRA 3QNUA 3TW4A 3DWFA 3N28A 4G1CA 4P7BA 1C1DA 1CQXA 2IP4A 3NDBB 1GKUB 1E3JA 4I6GA 4MV6A 4KN5A 4LVCA 5I8PA 3ELWA 4HXFB 5DNVA 2YJTD 3B12A 2WM2A 2BISA 3OEEA 4GX1A 1T36A 2L18A 2PKRA 4KIWA 5FPSA 2I8AA 4BNLA 3OI7A 3HJGA 1Q2UA 3L7LA 3L0PA 2E82A 4ND1A 3THYB 3VC1A 2PGJA 2VAMA 5IXJA 2I2XB 2J3JA 3R5KA 2JGEA 3HB4X 5FYDA 3B36A 4P92A 5ALWA 7GPBA 1MB2A 3RUDA 4NFYA 2H8KA 2H2HA 2WV7A 4EZEA 2YXBA 4LBVA 2V9ZA 1ZJYA 3EYAA 4H18A 1FPMA 4L15A 4PHFA 5AH0A 2XYPA 4YH1A 1WNFA 4Z9YA 4AWAA 1ZXXA 1YQUA 1TM1E 3GIDA 3IRVA 3JQFC 3M3PA 2R1TB 3TLAA 4D9CA 4QT4A 3TF5A 3IO5A 1JUDA 3QEKA 4P3XA 1GN9A 1D7AA 1ZIXA 3COWA 3I6QA 3ISJA 4EG5A 1JEJA 2E37A 1VBNA 4UTXA 2DQ4A 4TZTA 3L7BA 4HWSA 4X7PA 1SULA 3CR3C 1IJKA 1HYEA 4BQNA 2A9KA 2XQKA 5SY6A 3EFBA 5A4KA 5NLLA 4HFNA 3C14C 3L6RA 1EXMA 5COBA 4BZZA 1AO0A 5EWLB 3SHTA 4BVEA 1ZC3A 4E32A 1ST2A 3B9BA 4QGBA 3LHKA 1P2UA 5KYWB 3A1TA 4PLFA 1U2PA 4JWTA 3W7BA 3W5HA 1Y6RA 1SBQA 3GPIA 2IPAB 3GUYA 2HV8A 2C0QA 3F3SA 2C7VA 4RFSB 4RNCA 4L8YA 3S44A 1N6HA 1XZJA 4HAIA 4KTTE 1W46A 4OMFG 5GONA 3ZWWA 1N2HA 1I2BA 4B9AA 1AKQA 4JH0A 1GNTA 1KZYC 3AR5A 3DDNA 3NPAA 4LMBA 2JFHA 4PAOA 5J2UA 1SU7A 4OHVA 4A5SA 3WOVA 4V0OA 4BGDA 5EERA 2KBFA 5LJIA 2VFAA 3PEFA 2XYVA 4AJOA 1QXSA 2QL5A 2WAAA 3B9QA 1L8QA 4DA0A 3CM0A 4B32A 1ZHHA 5I9MA 4D3FA 4GRDA 2JJ2D 5KJCA 3OJWA 5JD3A 2EHDA 4L08A 3EEQA 1L4UA 3RFUA 3FBGA 4Q82A 2NQTA 5DBEX 1X1TA 3K5HA 2X8LA 3WRYA 5LQAA 3WAGA 1PAUA 1OBFO 4S3MA 3VFDA 4ER3A 4NVRA 2JATA 3GRFA 3KG2A 1H6DA 1HT2E 4ZT5A 2BFBA 1ZYUA 3HSYA 4LAFA 1OREA 3L02A 4L22A 2WF5A 3A9RA 3I2YX 5DI3A 4IDNA 4WQMA 4EELA 3E35A 2FPIA 3NHWA 2HWYA 3QOXA 5C8DA 5BMVB 2P68A 4K03A 3TZKA 2EARA 1AO3A 4TWRA 4CG2A 4LRQA 1EUDA 4YR7A 1NQOA 2HAEA 3U9SA 4ZOQI 3W5AA 4OQPA 1E9FA 3PXEA 1V43A 3EXHC 3OIVA 3QMMA 4WLNA 3CPSA 2M6SA 4URXR 4PR0A 3RRZA 4B6JA 3EWAA 5HWSA 4H0FA 4EJFA 4DTCA 3LCJA 4MAFA 4ZVSA 5FOVA 1SVOA 4CV0A 4EMSA 5A1JA 1VJCA 2H65A 3X3HA 4CEJA 3UUFA 2FR1A 5HEKA 3V8NA 2IUUA 2G28A 1NJ1A 1T0HB 3C7TA 4ASUA 4KZKA 3M2TA 1SUPA 4LECA 1CUAA 1SJ9A 5A9RA 2PZMA 4XGIA 2NYRA 1CLUA 3W3AA 2X6QA 4HAUA 1IMOA 3I6MA 4UBMA 3L4KA 4OHWA 1QTNA 4LYJA 3SEAA 4HQLA 3GRRA 5FBQB 4MQ6A 3OMLA 3IUMA 1MHPA 5JQGB 1YSCA 5LMNB 5C52B 1JEDA 3L41A 4UHCA 5K0NA 4D9EA 3IODA 1SKYB 4RVOA 3JAWA 3CWQA 3IAM6 3AG6A 5FNVF 4ZXFA 4C4SA 1I7QB 3U5ZB 1XJCA 3LH5A 1RRMA 3FCXA 4KQWA 1KO8A 2GCOB 3PRHA 3S1LA 4ZDKA 3ZWBA 2QBYB 1RM3A 3I62A 1JEQB 1O6GA 1F14A 1NFRA 2D8MA 3PCXA 3H4VA 2B4QA 4OA5A 1P0FA 2IEIA 1G8SA 4DSNA 2QUHA 2V6IA 2W6CX 2XDQB 4W1QA 5DNDA 4MP8A 1W0JA 2Z3WA 5LWQA 4LEIA 4UEOA 5EWMA 2JAHA 1EFUA 4GWLA 5E7JA 4FIZA 1ACJA 3FMVA 4D46A 3NYRA 4TKVA 4X8OA 2V97A 1XSEA 3NHPA 2NO9A 1EBUA 4AJEA 4D0GA 2CLIB 2GBCA 3WDLA 1TGVA 3OT4A 2WLSA 3AUJB 3DO5A 3F5DA 4H60A 5COQA 3ZX5A 2AC4A 2NVWA 5HF5A 3WMXA 1PZHA 1NVWQ 5A7GA 1NBWB 3VC3A 3HYRA 1E32A 5JY6A 1DTSA 1JWLA 1MX3A 1YIAA 2WD8A 3W3AH 2IS4A 3A1CA 3TNFA 4EUNA 2XJ4A 4UBJA 4UFPA 2ZAYA 3BC1A 2UYQA 3RVOA 5BR8B 3N75A 3NR2A 3CY6A 1XPJA 3HKCB 4OQQA 5DM4A 1IPEA 1TMOA 5DKFA 2Q3FA 3WVNA 3R0QA 4YV2A 2I33A 1KI4A 3BXZA 2MSNA 1R7RA 3ODPA 1Z83A 4W6ZA 3ZHVA 2FQQA 1JLMA 4RIIA 4J0QA 3R0VA 1RC1A 3JVUA 1VPDA 3OKAA 4MO9A 1Z13A 3D9QX 1F8XA 5DXFA 1MOSA 4ZVLA 5C5CA 4GIBA 2XNDD 3NTLA 4PYLA 1DO0A 4YJHA 3LPAA 4MRMA 1EGVB 1GSOA 1S2GA 2XRZA 4AN4A 1JE0A 4M46A 1KP9A 3PK0A 1Q7TA 2IHUA 2WKPA 2ORWA 4P4SA 2RMKA 3D43A 4HGRA 1DHRA 2P27A 2R2AA 2PGOA 4PICA 5BN3B 1AGXA 2XZLA 4HPXB 4AMGA 4EQ6A 4B3HA 1LI7A 1S01A 1FXUA 2XCUA 3A36A 2BAGA 3CWCA 5BQ3A 1GG2A 2IF2A 5JPDA 2FN9A 4H6XA 4C30A 2ZYUX 4AICA 1W87A 1VYTA 2VSOA 1Z0AA 5IDXA 1U81A 1T8UA 2NU9A 2D2XA 2XHZA 1H5UA 3DE6X 2OZLB 2ZUDA 3IILA 4RH0A 3SOZA 4RTNA 3B6EA 1S89A 1E7MA 5DMXA 2J4FA 1JFFB 3EH2A 4FX2A 4NJMA 1T4GA 3HB0A 3BFKA 2PH1A 2C8LA 2AYYA 1QGAA 1XZIA 3K1AB 1DEXA 3UUGA 4C0XA 3G82C 4AMBA 3V8MA 4MS3B 1MP0A 4RD1A 3H0EA 4BRWA 3NXSA 2Q0QA 4NAVA 1U4SA 2ZUVA 2BDUA 4V2UA 2Y1FA 4PU0A 3JR7A 1GPMA 5JJBA 2PDAA 1A9RA 3WHLA 5C1BA 2C82A 2H7XA 5AQEA 5CFZA 3EVZA 4JP5A 3JVDA 3HUTA 2VXCA 1K0UA 3IP1A 1PR4A 4BLTA 4B0OA 1K98A 2XOXA 4MPPA 3QBJA 2LBPA 1PUXA 4RVGA 4FFRA 4EZIA 1MJ5A 1AURA 1O3YA 1QIKA 1UDXA 1S02A 3M6UA 1VE3A 5HW0A 2XKKA 4MQLA 4KMMA 4NPHA 1SU8A 2WYUA 2PQ6A 5AXCA 3VJMA 3C3YA 2GA8A 3O4HA 4FFVA 5I8ZA 3D59A 3TLGA 5CB4A 5CYOA 5JFGA 1YZLA 3VH1A 2JHAA 3FYCA 3WIBA 3HMQA 3UICA 1RRCA 1QTQA 3LSYA 4C88A 2NO0A 3D64A 1PGNA 5JBQA 1P1JA 2BYTA 3WLTA 1TJ4A 3A6GA 3OETA 1Z4JA 1T5SA 3AV3A 3DP7A 3QVJA 4XJTA 2C9DA 4CMIA 3D81A 4FEAA 2R8YA 1V4NA 2VDJA 3K30A 2I7XA 3M83A 1E3IA 2ET6A 1KIMA 3I6IA 4ZREA 3G1TA 4M36A 1MJHA 3NBAA 3THRA 1VKHA 2JFVA 2WSLA 1EWVA 2Q0SA 1FFSA 5HZMA 4PGGA 5CW2A 5EIHA 5P21A 4UPEA 4U2GA 1SVNA 1Z3IX 1GXSA 4GUAA 1GAJA 3ZE7A 2GFIA 3QEMB 2EQBA 4M21A 4KPEC 3EFEA 5LVAA 5AJZA 4WNCA 4RXTA 4UU1A 1JV2B 2QTFA 4UE2A 3M8KA 1O5IA 1LV7A 4M0CA 4DDKA 1E2IA 4IDOA 2P67A 4XWTA 2BFCA 3CURA 5FO1A 3N07A 3NC1C 1YQTA 4DMKA 3LI2A 5ED0A 3FVVA 2A4MA 2VWGA 3GXOA 3KQYA 4LOJA 4GQBA 2I66A 1KTVA 3OPNA 4NH4A 3VDNB 4A27A 4EARA 3P5BA 2HK8A 3QVOA 1LBEA 4IV8A 4JLVA 1DIAA 1L6IA 1DLIA 1PJ2A 1U90A 2HQSA 2HWXA 3KC2A 2WUGA 4ILKA 3WISA 4FU0A 3MHPA 4BRZA 1O95C 4V3CA 4B6SA 5THKA 2O8FB 2QRVB 4LN1A 5IVKA 3RFFA 2YIJA 3BEOA 2OENG 5GJVC 4MROA 1H2WA 4B34A 1J9ZA 4J29A 4QXQA 1OWMA 2HU2A 4A9AA 4CIDA 4WESB 2A92A 3E3MA 4ARIA 1J24A 2JFQA 3NU1A 4QXOA 5FV4A 3UA4A 4JJFA 4G84A 4DRZA 1IN6A 3ACDA 1OI2A 2QVCA 1G19A 1MIOA 2BHTA 4DAOA 1EAYA 5ECDA 2FAXA 4BO4A 3PL5A 1UWVA 3VNUA 4N82A 4LNUA 2ZIFA 2W00A 4E5SA 2FWRA 4C87A 3P2EA 2XF2A 4C2AA 5SZJA 2OCGA 3FUCA 3SY8A 5IDYA 4OSPA 3JY6A 3PFGA 4JOQA 3EIEA 4X62B 1W4ZA 2OD9A 1IIRA 1PR0A 2WJHA 3S6JA 5FHQA 4BMCA 2IS6A 1KP2A 2WNHA 5L3SA 3SJBA 4MIYA 4CEIA 4TQAA 2JI7A 4B3JA 3VU9B 5K3DA 3SYTA 5IBQA 3TGLA 1P0MA 2FPXA 4PSCA 1PVOA 2C2ZA 2EWVA 1GVHA 3LL4A 4MLCA 2H18A 3H1BA 5CHEA 5E7IA 3FROA 4N6OA 1DXHA 1TQ6A 4ZYVA 2ZJ2A 2ONJA 3IQZA 1X1QA 3BK1A 3W1WA 1EXVA 5F33A 1HV8A 3TEJA 3LXRA 1LSUA 3F2IA 1AKRA 4RZQA 2XIQA 3IMCA 4GKVA 1UJ4A 3A26A 4NESA 2X6RA 1XWIA 1ICIA 2Z1NA 4XIGS 3RVDA 3BG5A 4XSHA 4KR3A 3EZ9A 3H2KA 1O1YA 3KDAA 1UDRA 4EDFA 1NUTA 2G8NA 4YMGA 2H1VA 4MS4A 3TZBA 5LBUA 3MJDA 2BEUA 1R00A 3IP5A 5K0ZA 2QSZA 1QLJA 3M1YA 2DERA 3LKDA 1XDZA 2XBMA 3LWNA 3DLPX 5KJEA 2FLWA 2AX3A 2Q9UA 3HEAA 4UZSA 4B3RB 5KSZA 2I7CA 1CULC 1SG0A 2GN8A 4IJUA 5JDIA 1PFKA 3FOEC 1PR9A 3TNYA 5A2QA 5KTRA 2WKRA 3AU8A 3UQZA 3HWRA 5EGSA 3QLVC 1BA2A 2QWXA 1T8SA 4NCXA 4JROA 4JXKA 2IIPA 3RIEA 2GHIA 3WK8A 3IQFA 5ES3A 4P22A 4M53A 4ZO9A 1YQDA 3R3WA 1HR0B 1HFWA 2HDNB 4POOA 1RYHA 3HJNA 1IM8A 2IYEA 1Y8QB 3KALA 2MOKA 1DWOA 1MJNA 1TU3A 2TYSB 4KJXA 1TAQA 3PZBA 3H1EA 1QH1B 4UVGA 3REOA 4BGVA 3FUWA 4R8VA 3LDFA 3PQ2A 1MR3F 2HFKA 4Y6SA 4I3GA 2O8DB 4AL4A 2G5TA 4B35A 4B83A 2FMXA 2OXFA 3R0XA 3PXXA 3WLLA 2W93A 3DMYA 4JJ4A 4U2EA 2JCGA 3IHTA 2B8TA 4MGIR 4PLCA 5F5NA 1O4WA 3EVTA 4ECEA 3EMKA 2LUOA 3EOZA 4H15A 3GRAA 1Y81A 5DLPA 4EPWA 2XE4A 4ND7A 5DBHX 2YWJA 3MJ4A 3QF4A 5KYVA 3W8NA 1UJMA 2HLPA 3DL4A 4YQZA 4RJJA 2HQRA 4C76A 4QUDA 1BKYA 4ME6A 2FG5A 2ASVA 2ZRQA 5KDLA 2BUBA 2HQBA 4XPIA 3MRSA 3EJ6A 4LFCB 2XB2A 1P9LA 2IWHA 3S2SA 1Z6AA 5AKXA 5KB3A 3TD6A 4JEHA 1RTKA 3O3OB 4BFXA 2ZUBA 4DYVA 2QLFA 4MTCA 2PSHA 1KSJA 4R9UC 1KI1A 4NMXB 1I4LD 1H2FA 1QZ3A 1UM8A 3PEUA 5C8XA 3IBCA 1QC5B 3UYLA 1U7ZA 3F90A 3PNLA 2WW8A 2JLZA 2WHEA 2OV4A 3HYTA 2FV8A 2QHXA 5AI0A 4LJ7A 4BFTA 521PA 5CU7A 3HEMA 4XH9B 2CLLB 4IDAA 5CIQA 2Y71A 5B3JC 3KTAA 1PLKA 3C3DA 1RC0A 1XMPA 3UK6A 1ZWLA 4WDQA 5A0FA 3L7NA 3PQ8A 2M6LA 4RGYA 2CV0A 2WKSA 1J06A 4ALKA 1MPTA 2R1ZA 1L4EA 5JR3A 1WQ1R 4UXIA 4BB5A 4F6RA 3G17A 3L0BA 3ZWOA 1B0PA 2GX6A 3WNVA 5EMHA 4AKHA 1TAUA 1RDFA 1OTXA 1UT5A 2KHZA 5H81A 1YUNA 2IYUA 3C45A 3P0EA 3UY4A 4DF3A 1XZCA 2W8BB 4UCWA 4NK4A 3U7IA 2CT8A 1RWQA 4S1NA 4PG6A 3AI3A 3IHKA 1M0EA 3G9UA 4AURA 1F0PA 2QN7A 1EP1B 4HEHA 3AB3A 3BIFA 4FEGA 1BQ4A 3NBFA 5LYJB 3I05A 5FEMA 4X84A 1NZFA 3QMPA 5HIJA 5FQOA 1KS2A 1NF9A 3O75A 3ZHQA 4LDNA 4MKZA 2FMIA 4Z9BA 5BSRA 3QXHA 1KY5A 1NBIA 3DDSA 4G8JA 4Q1FA 2C5BA 3MRVA 4DL9A 3DXYA 3FDXA 2GAIA 4JT8A 5GZ3A 1INLA 4K9KA 4PNHA 5LMZA 3EPKA 3K9LA 5EXEA 1M34A 5CVUA 5J59A 3SI7A 1IHUA 1FXSA 1Z16A 3A04A 1N7JA 3CBGA 4JN6B 1QOPB 1PTJC 4BNJA 2PZBA 1VLZA 2Q7XA 3ACCA 3ZZUA 3X1JA 3E5NA 1MRNA 1QZTA 2VF7A 4PZCA 3S2GA 1ZUNA 1IWBB 1MXHA 1B93A 1CBUA 1PF7E 2RI6A 3OQ1A 4TS9A 4WZAB 3VHXB 1S8OA 4CEHB 1QR2A 1XD8A 2QYOA 3PHIA 2I4TA 5CVCA 1UBCA 5HPYB 4MW7A 4QWWA 2IUEA 2H7VA 2P9ZA 1J0XO 2FR0A 4X93A 1NIPA 1XNGA 2ZB4A 4FK8A 5FHRA 1FVXA 5LU9A 5HKOA 4G4SP 4XB2A 1E5VA 3BREA 5GINE 1F9AA 1GYPA 1P3DA 1IG0A 2V0CA 3KT3A 4R8MA 4MICA 2AXEA 4BEWA 5I47A 1E79D 4GP9A 3G2MA 1FNNA 3DMPA 2PXAA 3NOXA 4N49A 3FYUB 4TV9A 2D3WA 5I3ZA 2ZM6B 4KLRA 2FSVC 2O6HA 3NANA 2PR2A 3WICA 3RK4A 1P2FA 3K70B 2OGSA 4NZ9A 1P5FA 4K40A 4UC0A 1WD5A 1GLGA 4BZXA 4JVOA 1I10A 1V37A 2IDMA 3ZVKA 1TLLA 2QAGC 4UHJA 2ZUCA 1XRRA 3NPMA 1DFIA 4UHKA 3I6YA 3SEFA 4NJOA 3LZCA 3ZHZA 3Q3GE 3AK4A 2A2ZA 3GLSA 1F2VA 2EC5A 1WZIA 3NGMA 3O74A 2GFQA 4H17A 4ID9A 4L4ZA 1I14A 4PBTA 4Y6LA 3U6KA 1ID8A 3RBVA 1UDBA 2GAJA 4DMMA 2J48A 4F4DA 2NP6A 3RYHA 2Q5QA 3K9HA 1EFLA 1EX7A 1YQGA 2XUIA 3OC6A 1IY0A 4G0XA 5K8VA 1CUCA 3WRWA 2AMFA 2O7NA 1LPAB 2BMVA 2AF3C 2OT3B 5SYAA 3JARB 4TLMB 5I4KA 1Q7GA 4U6SA 1K1EA 4IUBS 5J5VA 4CM9A 3F1LA 2VHCA 4FE3A 4CQMB 2FA9A 2QLTA 3M1LA 1CEEA 3ZWMA 2FZ4A 3TVTA 5IH3A 3QXXA 4IHQA 4KLNA 5THQA 2LVBA 1L5HA 3EXHA 4C20A 4QODA 4RZSA 4Q19A 3MQ2A 3ROPA 5JV5A 1A04A 2GJ4A 2PK3A 1WW8A 1RYDA 2VYVA 2XUPA 3JYLA 3MTBA 1C3VA 3OC0A 5CDYA 1ZGAA 5JSZA 4I9HA 5HS4A 2F1OA 2GYYA 2IV2X 3ZWVA 3OJEA 2WHRA 3KLPX 3UBMA 3QWHA 4BN4A 3Q7RA 4TOIA 1FFEA 1NTRA 1SHJA 5CT5A 5DP1A 1ZM7A 3I8SA 4PYIA 1W36B 3H18A 3IMFA 3QFTA 2XTAA 3CZ4A 1WNTA 4GI5A 4ITRC 2NW6A 1I01A 4HFRA 4ARZB 4EY4A 3CR7A 1D2AA 1X19A 1YL6A 2R7NA 5FTKA 3IDSA 2FZGA 1QB8A 2WHQA 5DW3A 4PLGA 2LXNA 4RA9B 5CEJA 4B7AA 8AT1A 3F4LA 1R0YA 1Z0FA 3GJTA 4KR6A 4C2UA 3WNDA 3OD5A 2XB9A 2XNKA 2RH9B 4I46A 4QO8A 3ZCSA 4ABTA 2JIOA 3NAGA 1FP4B 2WFLB 1ZD4A 5DF1A 3CHYA 4H3VA 1NMQA 1XXHE 5E2AA 2D2FA 4K86A 5IMSA 1JXOA 1RWPA 1YS7A 1J8FA 3PX3A 4G07A 3H1PA 4NL4H 1ZIOA 4QFDA 3V1LA 1FVFA 1ZESA 3U31A 3WJ1A 4MVJM 4UVEA 4MV1A 1U5BA 2LKDA 2V54A 2WJ3A 4JQOA 3AW8A 4P54A 4YACA 5IYZA 1XCLA 2EJCA 3FZNA 4L72A 4PBSA 5JNLA 4XWYA 2IHYA 4KOEC 3OQMA 1X1SA 1GRNA 4K6MA 4IYJA 4LKRA 4REQB 3UKJA 5BQOA 2VDLB 2WT9A 3W1VA 4HUTA 3H83A 4XE5A 1G8JA 2P2DA 4BO1A 1FCJA 5LOVA 4DR4B 2Z4SA 3SP1A 5JS7A 4N4AA 1IVSA 2WJIA 4E15A 1HT1E 5B55A 3NOQA 1WMEA 1DUSA 2HYDA 3FTDA 4PCAA 3ZQ6A 3MCWA 4PW0A 1EUZA 3PC2A 2G9NA 1T6XA 2ZU6A 1FW6A 1RT9A 5AO9A 4IF6A 4GYJA 3DKKA 3HJCA 1QONA 4URUR 4UZEA 5F2NA 4O4HF 1NN0A 1JIUA 1M34E 3G7SA 4LCEA 4JYZA 2LWIA 1G8PA 3UAWA 2W8ZA 3WOHA 1FE8A 4PTLA 1KY2A 3QYFA 3ZWYA 1KEVA 1QQ7A 1SIBE 2H1FA 3P9QA 1C3JA 4L5IA 3FR7A 1YRLA 2YC2C 3MINA 3L6UA 5K3EA 2C4MA 3AFHA 3F6BX 4YJFA 4HRAA 10MHA 2RJ3A 2YZ7A 1MX1A 5J2TA 2V9CA 3FB4A 2CFIA 2E1RA 3BSWA 3AOEC 1VPLA 2H9YA 3DJFA 3QXSA 2NZ8A 4CQJA 4B5KA 2IH4A 2FW6A 2XBLA 3HKBB 2EL7A 3ROZA 4BVAA 5HNKA 4KQJA 2R1VB 2WJWA 1Q19A 3BFXA 3N6XA 4IBOA 1G8AA 3M5PA 3HA2A 4O2AA 2VF2A 2WT4A 2P3SA 4F0JA 1GZVA 4YRMA 3GDFA 1KZGB 1RZVA 4QUAA 1GQRA 2Q3CA 3FZEA 3ZHXA 2VTVA 2D1FA 4OJKA 3Q7QA 4YYZA 3HN7A 2NQ8A 4KODA 3CN7A 2Q6VA 2PZEA 2VJNA 5E3HA 1M1YE 5CAEB 4MKHA 4IILA 2JAWA 3U4DA 5CM2Z 4DPLA 2Z9BA 2CJWA 4IV5A 2NPFA 4FLEA 4MPTA 1NC3A 4LXGA 1XLVA 5G0WA 4ZI7A 3FR8A 1WBBA 1TCAA 4KFUA 4NLLA 4OGGA 4F72A 2DBRA 2EQ5A 4PN3A 4P98A 5IMBA 3OE7A 3P94A 3VQTA 4CMJA 1KDYA 3DTVB 4D3ZA 1LS1A 4DCPA 1B3RA 4Q6WA 3SE0A 3B1XA 5IS2A 1RJDA 2ZS9A 1D0VA 2AFRA 5MF6A 3QTTA 2XXAA 4R2MA 5HRUA 3K8ZA 4B6QA 3PUZA 4FOLA 4G0PA 3EXFB 4FEEA 3A58B 5FJIA 1S8NA 2A5YB 2JGDA 1GUDA 3OCWA 5DHTA 4PNEA 3GFTA 3R9WA 1RRGA 4J3FA 2BMJA 2OBFA 9ABPA 2QR5A 1NNUA 2C3UA 4LJAA 2I8CA 4B4WA 1KE2A 3I53A 3IHLA 4K9DA 2B4YA 3TN7A 4ZVOA 2DM6A 1V1RB 2TMKA 4IGIA 1YQEA 3U49A 4WK4B 1X0VA 1XWWA 3EQZA 2ZYRA 3F9RA 2ZBGA 3U3RA 1DKNA 5K4HA 1QO7A 3WNQA 3Q7PA 2FP3A 5AQ1A 3N6RA 2I9KA 3ZY2A 3T0IA 3UENA 1JLSA 1H23A 4QDKA 1P8JA 2GBLC 1OYVA 1VKJA 1Z5ZA 5AI6A 5CXQA 1IIBA 2C94A 5EHXA 2P2ZA 2J09A 4TSRA 2A30A 5IDWA 1JHXA 2JRCA 1EI9A 3LKBA 5BN5B 1J0BA 2XF8A 3O4FA 5MFZA 1Q84A 1QHHB 3DLIA 4OHUA 5F7JA 3L8ZA 1OYOA 1AGPA 3U3KA 3A32A 4XFDA 4JC8A 4LCJA 2VZLA 4NULA 4NSNA 4S1PA 1YBFA 3H6HA 1G21A 5D3MB 1KAMA 1LPBB 2I76A 1CQPA 1DRKA 1KEPA 1H22A 4YP6A 4C4PA 5I9LA 3DPUA 4RADA 4P2BA 1EXWA 7ABPA 5AFSA 2A0KA 1K89A 1A9SA 1OT3A 1T6ZA 1N5DA 2VPXA 3BGVA 3V8EA 3C7AA 4E4YA 5LU8A 1FRQA 4WIAA 3KFXA 3LY5A 1YNSA 4YJGA 4EPTA 1QE3A 3GFBA 1DQSA 3VNBA 2PLFA 5BR1A 3PT5A 1Y9DA 4GYKA 5G0VA 1Y3BE 3EFOB 4Q15A 4UNRA 2UVQA 4IH4A 5IARA 5DN6D 1O95A 4ZOEA 4DDMA 1XEXB 1F9EA 4YUZA 1AQNA 3LUJA 3FMIA 2EKPA 1P2DA 1KAHA 2HOQA 3G8YA 4UZFA 4BEJA 4WPGA 1MLDA 1I36A 4GPBA 2V96A 1RIIA 4I5GA 2FW7A 3I28A 3A9CA 1D0IA 3BXHA 4J4TA 4C1BA 1FA9A 1LJ8A 1H9AA 2PL3A 2XNDA 2Y0EA 1JNXX 3K0EA 4FMPA 4I99A 1YOBA 2JLUA 3QTLA 4XYLA 4XLLA 1VBMA 1KJWA 4WN9A 5CXSA 5DOZA 1CIPA 1ZZGA 1D6JA 1VLVA 1BRMA 1U3UA 3A9VA 3CPEA 5B64A 4RTPA 1U3TA 3T35A 4PYMA 3BJZA 4ZVNA 5U4QA 3HABA 2IYZA 3QW4B 4YGXB 3L4EA 3OQPA 4K46A 3GA5A 2AMVA 4K87A 1POWA 2C29D 2HT1A 3QKUA 3WNBA 4M1TA 3EVFA 1E5DA 2CK3A 2O54A 2WEKA 4PXYA 2C5FA 2W0SA 4W63A 3CH7A 1S5PA 4ZZ0A 5JIBA 3JXEA 1SQ6A 4TMWA 1M1XB 1FMCA 4H31A 3RSHA 1QF6A 4JB2A 1G9XA 2YFYA 2WNIA 2DBYA 3NUGA 4W8OA 3FNHA 3IBFA 2YV2A 3QRWA 3UMBA 5FTLA 4N5LA 4DUGA 2CL7X 4HWPA 5B7PA 2UUCB 1ULSA 1VZ3A 2H1LA 1K2WA 4TMFA 4DA7A 2Y0BA 1X2BA 4AZ0A 2YMQA 3NCTA 2YHUA 1MC4A 1Z2PX 2GPAA 3GNQA 4G23A 4HMQA 4JELA 2W6QA 5AHRA 1U3VA 1JKFA 1YDWA 3GGPA 2GN9A 4I5EA 4PSVA 5IWCA 3OZGA 1ISJA 2EEZA 3FZGA 3IEMA 4NFLA 4C7XA 5K8IA 1JA0A 2Q5JA 1JG7A 4YRBA 4H16A 4R1UA 4BX9A 2CMFA 4HI0E 1D9XA 1TU4A 2BZ0A 1KERA 4AQYB 1AM4D 1P1RA 2PFKA 2FGKA 5FLEX 5EHGA 1S3GA 1WCWA 1RXYA 2ID4A 4JLBA 1YGPA 1BVYF 1LI4A 5DJ5A 1TIKA 3R41A 5F52A 2ZRKA 1JZTA 4AS2A 4RK6A 4YAEA 1Q2XA 1VHJA 1ZJ5A 3VMMA 3PTAA 1B00A 2QP9X 2QRJA 4K81B 5DGTA 3VSAA 4OHPA 3OKFA 3ZCPA 2A8YA 4P7JA 1NVVQ 2G0NA 1UPTA 4NMMA 3CH5A 4OI4A 4MMXB 5C7OO 4PC1A 1OT5A 2K5UA 4IDHA 4XVHA 4C06A 2QW8A 1KI6B 3DTTA 2JEYA 1W5SA 3HRKA 4I8XA 1UBSB 3T9BA 1ELOA 1VL0A 2HY7A 3Q6NA 1HZJA 4MWZA 3S8MA 3KZKA 4YAWA 2Q4OA 5AK5A 1NRIA 3WWOA 2L2QA 3OQVA 1BD4A 4TLCA 1B14A 2YCLA 2FWBA 4OOFA 2UYCA 2HHLA 2E3JA 3TCKA 4PZ9A 4Q9LA 4B4UA 1LBSA 1U8TA 1X7YB 3NNSA 4HUJA 4QARA 1XMOB 3DFFA 1MDFA 1XTKA 3FRJA 3T3NA 2JFGA 1YZYA 5G3ZA 1Z0DA 2JGRA 3ANSA 4YN3A 4OBXA 3TGWA 2HL6A 1T4CB 4D3SA 1E3TA 3U1VA 1IEWA 4X1IB 1L1EA 4L95C 2PUVA 4BO3A 3L3BA 2DX7A 1PG5A 2PMEA 1HG1A 4JEIA 3L6EA 4IH9A 4WXPA 1Y4AE 2PMWB 1GPLA 2XKAA 5TR9A 3ENWA 1UBRS 2A5LA 2YHIB 4PTYA 1CKEA 1P7CA 3JQAB 3BGOS 3G89A 3I0MA 2QI9F 4FOSA 2BZSA 4A0RA 4EKIA 2WFMA 1APBA 1SC4A 3HXTA 3WX0A 3TNLA 3VYVA 1G21E 3WLJA 2PYDA 2W58A 1PGQA 3SVTA 4IHJA 2AW3A 2CBXA 2XD4A 1UBNA 3M4YA 2BI7A 4DY4A 1XRSB 1QS0A 2MMCA 2QG9A 1E77A 3CUKA 2ATCA 2BJHA 1ATZA 1CR1A 3G2NA 4N7JA 1FUIA 2WDZA 1B16A 2X8WA 3A4YA 4HZUA 4A82A 4IFIA 2V1UA 2W2LD 3A6EA 2IY7A 1EWTA 5K3SA 2ZRNA 1TA0A 5EZYA 3BWEA 4LFAB 4FPXA 4KE8A 4PNPA 4S2UA 1DKRA 3U9TA 1JG1A 4RVNA 4LYGA 4GI7A 2NZXA 3PC6A 2Q1WA 3DMFA 2BTQB 4MV8A 5A9TA 2IIVA 2JF0A 3EN0A 4LYDA 5AKGA 1KWKA 2XTJA 5B3JA 4ETWA 3LS2A 3NV9A 4DQ0A 3I73A 1IB0A 2EDCA 4PHTA 3H8JA 4RAOA 3S55A 3B6ZA 2X14A 1C4WA 1GQFA 2YIDA 3NH9A 3NGLA 1ZKMA 3KS9A 2R5NA 3EF0A 5DNWA 2BFMA 2EJWA 2PD4A 4BNGA 1AHPA 4JLSA 1RMTA 2PUCA 5BW5A 1QRRA 2ECPA 1A1SA 3U7QA 5JD4A 1IJBA 2VH5R 1FX0B 1N5JA 1SCDA 2CNWD 2I3GA 2C88A 1YZKA 4TUYA 1V11A 1XDDA 3GLGA 2QDKA 2R7AA 2AQKA 3QU7A 2VAVA 1UWKA 3K8YA 4OIMA 4YYEA 3BE4A 1SIWA 5EG5A 1YS1X 3CPJB 2EZ9A 2QZPA 3U0VA 3I42A 1K68A 3HDYA 3KQPA 2I2FA 2Q3LA 2RHCA 1P73A 1GD1O 2HXGA 4RDIA 3TTUA 1V25A 1HLFA 5DZSA 3H0KA 2CLMB 4HGPA 2OV8A 2CDBA 4O4IB 4YECA 5GONF 2IH2A 3OQ6A 1T9BA 3GPDG 3OCJA 5CXUA 1Z0JA 3UMCA 1KMCA 2YY7A 4X8HA 4WXRA 1EVQA 3ZDRA 2VA9A 2R7KA 4PRLA 4ZEVA 5K03A 5T6BA 2P79A 2IKSA 1LC3A 5TGTA 4UMVA 1U0LA 5B4TA 2J8ZA 3E9ZA 3N2EA 3M6XA 1NVXQ 4Y9UA 3HI6A 5C3UA 5TPWA 4QBFA 1TZCA 3ILYA 4JX9A 4CDRA 4XQ9A 2NNWB 1CRPA 2XE6A 3MGCA 2PIAA 2I1WA 1I6LA 2J7PD 2O1SA 4L76A 1KJIA 1NNLA 1Y4DE 4X85A 5INTA 1H3FA 4MKIA 2HJ9A 1VSQA 3LSTA 2CDRA 2E87A 1ZD1A 1LLFA 2QJTA 1QYVA 3EQ7A 3GMDA 1DBRA 2ES4A 2EVWX 3HR7A 2KB0A 3PGJA 4IINA 4ZC1A 3UT0A 4GL4A 4EI7A 3QK7A 1E2EA 1GU0A 3ITKA 4L6CA 5CIWA 4GAEA 4L27A 1ZKDA 2AR9A 3B53X 4XOUA 1W2HA 3AHDA 1MB3A 4FLFA 1JRLA 4QM6A 2BFFB 5J4YA 1XA3A 4DG5A 1N9ZA 3I4FA 4HB4A 4QECA 3P71T 2FSVA 3L8DA 3QOYA 2NV6A 3ZJ5A 4AT1A 1AHHA 4EHNA 3C97A 1BX0A 1R9MA 3KT6A 1UOPA 4F86A 3RS4A 5JS6A 2OO5C 5JWHA 2Y0DA 3A3PA 3DV9A 2YJ4A 4EM6A 1EA5A 1JLLB 4GMKA 5C1PA 2NV0A 4MVJD 4CM4A 2ANBA 1U1IA 2C42A 2B0JA 5K2MA 3ILVA 4FFNA 2QAGA 1ZCZA 4BXOA 5I4IA 2JEZA 2POCA 4NQRA 3L7CA 2RGYA 1I2MA 1ZNQO 4KQXA 4BFLA 1NXPA 4ENRA 3IS3A 3JAKB 4MEAA 3THXA 1F20A 3H2HA 3PDIA 4J1SA 4JKOA 4S0ZA 1C9KA 3BMOB 3FWYA 1HTTA 2J9RA 1TCUA 1QG4A 1U7TA 2ACWA 3JASB 3NHUA 2XUZA 2J9FA 4DT1B 5EPEA 1WF3A 2YWEA 4NXMB 2CHUA 1NVMB 2DQSA 1WTAA 4ZVUA 1YJ8A 1SBNE 4ARBA 1Q0PA 1UM9B 2O2SA 4HWRA 3QH4A 1MO3A 1LH0A 2GD0A 2O1XA 5E6RB 2EYUA 2H59A 3GAMA 3UHOA 4LYFA 2O3QA 2H7YA 4R1OA 1BJRE 2C97A 5IVDA 3RS3A 5DNUA 2AFHE 1TLFA 5H83A 1CE8B 3P2JA 4ZYZA 1GNVA 1EK0A 4GMDA 1JYFA 3WK7A 4U2FA 4ERNA 5BWCA 4LXQA 3WK4A 1QU2A 3MCAA 2G7ZA 1UDAA 1MAAA 1YWGO 2G1AA 3BBPA 2HWUA 4IFEA 4IX9A 4O29A 2PKQP 4QATA 3DBRA 1PWEA 1H1LA 4RKYA 4JUIA 3DHYA 1RM5A 1DL5A 1GEGA 3ECAA 1URPA 4X45A 3DYIA 4I6JA 5FOWA 4GZ3A 1RKQA 1U6JA 2XYQA 1T29A 1T2EA 3JQ8A 5CYFA 1QLHA 1U2ZA 2VQDA 2JK0A 2HSEA 1GFSA 3D1LA 3EISA 3IAFA 4FGUA 5B3AA 3O2NA 2ODBA 2KLBA 4TWAA 2R9VA 2V5AA 1PEAA 4K0KB 4PFSA 1E1CB 1L4GA 4MCAA 2O7QA 1HETA 1KAEA 5CJPA 1ZR4A 1JAHA 4G0QA 3L6DA 4L8VA 1MEJA 2IXDA 5IKEA 1XTVA 3N5KA 3P32A 4DLSA 2IRWA 4E5UA 1OKKD 3FBTA 1NRWA 1N4AA 5HE8A 2O8CB 5BN1A 1VJRA 1XD2B 2FSPA 1CFZA 1GNQA 2IE8A 2EP8A 3CIFA 3JRXA 3H3JA 4KH0A 1OWOA 2ZBQA 3QXJA 4DMRA 4M8SA 4Z4HA 4LXIA 2YUTA 4F91B 1EGQA 4O25A 1ORVA 1QHXA 1P2BA 3QIAA 3ZDBA 2BBWA 3A1EA 3FETA 3HI4A 3HCBA 1CUJA 3ZH9B 1Q3TA 3MC1A 4LDQA 3PQ3A 2D6FA 1GG9A 5LQSA 2JJMA 3M49A 5EWJB 2AOVA 2W71A 4WY5A 1HQDA 1HORA 1T8PA 2JLCA 3QGMA 4FI3F 4ZVKA 1OFVA 4BN5A 1GPDG 3PQCA 2XPCA 1UWCA 2ZSFA 4WX2B 4DG9A 1ZNZA 1L5YA 1NXQA 3FD8A 3SS9X 2FWJA 3NHZA 5IHXA 3R44A 2P91A 1QLWA 3I83A 4P80A 4DC9A 3K6SB 2QZJA 3TPCA 3CCCA 1A9PA 1TCCA 3HVUA 4ZTUB 2QZ4A 4RM3A 5CITA 1X1DA 3ORHA 3RREA 3JTMA 4N5HX 3LGAA 3FPAA 1D6MA 3LLVA 1FBNA 4DIOA 4CL2A 2ORIA 2OC4A 1YVPA 4IQ8A 4RO0A 4RTQA 3DAGA 3FNBA 1WV1A 4QUJA 3ZE8A 2GZ2A 3O2QB 1RAAA 2I71A 3FE2A 4MWSA 4XCXA 1V1JA 3EQ9A 4J03A 3CEMA 3WTCA 2AXNA 1KY4A 1DUVG 1Z4KA 3FWNA 5EE1A 3RUFA 1CV2A 3HKEA 4BATA 1CS0A 4JIMA 1RE0A 4BU0A 3LUHA 4X7RA 2G1PA 2R65A 3AOEA 3J7AC 1KL7A 5DYTA 5F51A 3S99A 3V4ZA 4I19A 5IABA 1PD0A 3ESDA 3LAWA 4IRXA 5T3YA 4HNTA 3REQA 1JKJA 1N2SA 1G291 3MS2A 4J43A 4Y2RA 2IYOA 2P6MA 1Z8FA 2B94A 2BHRA 3UUEA 4PIVA 1KPHA 2BMWA 4EH1A 1N1EA 4I4TA 2V3CC 3HCOA 1PV2A 4G0NA 4WL0A 3T1VA 2XZOA 1S2LA 3UMYA 4E7PA 3F5MA 3L7KA 2AI3A 3UHFA 4E5MA 5J58A 1FSSA 1PV4A 1X1EA 3E22B 1L4FA 2Q2QA 3UWSA 4HLDA 2VS1A 2HKIA 3LO5A 4I5DA 2OXTA 5AW5A 1X74A 3OWOA 1UKVY 1ZN7A 1ZUWA 2YY5A 1P91A 2X3FA 1NQWA 1OA1A 3H0CA 2R7MA 2ZTMA 4B6RA 3GJZA 2ZI7A 3Q1LA 4PLZA 4OI0A 4HVLA 1G2QA 1ZN9A 4F60A 2HK7A 4R8RA 3RTAA 1UK9A 4EG0A 4EY7A 3KSUA 2IY8A 5FBZA 2ZR7A 1KJ8A 4ZGWA 3ICWA 3N8HA 5GIOE 4KG7A 4QLBA 3GJQA 4U2CA 2Q28A 2QRQA 1RAFA 4AZTA 3DNFA 4E31A 2C1XA 3C3CA 3B20A 3MJEA 1QGDA 4R05A 2G72A 1N8TA 4YRFA 5LZ5A 5KNLA 1UIRA 3SHWA 1OX4A 1BO6A 4FGJA 1V6CA 4R3WA 4BMSA 5EE3A 4BO9A 3U4MA 1PQYA 5CM9C 4AXXA 1RVDA 1H8EA 3ZG6A 2Y4NA 1RPJA 3NC0C 2PGXA 3IDZA 3GA0A 3MBOA 5T8KA 3T5BA 2WYWA 1E5TA 4HY3A 4JHLA 4Y2XA 5I01A 4LUCA 3EX7C 2OHOA 2KSQA 1O89A 1P5JA 3HB1A 4MW6A 3E84A 3THOA 1LTHR 4FYYA 3ON5A 3SDSA 2C9YA 1I4TD 2ATIA 2GLXA 3V55A 2X0IA 1NJ8A 1D2NA 4FGSA 3UJPA 1H93A 2YS6A 2Z2KA 1BHQ1 3E48A 3PQDA 1D4AA 3VZBA 1T25A 3FCEA 3L1IA 1GT91 1DJOA 2IEGA 3QM1A 3L04A 3SXJA 3FTCA 2PA3A 2ZETA 1CQWA 3D5QA 3E8XA 3WLPA 3NX4A 1WCYA 1HL3A 5FWYB 2NQ2C 2DUWA 3R6TA 4MV5A 3HE3A 1XT6A 2XUHA 1DOZA 3KUUA 1JEEA 2H11A 1SKUA 3BRSA 1KR2A 3N3BC 4Q9KA 3TKAA 4MCIA 2X0DA 4OOEA 2VBIA 4GBJA 4ZVVA 4O8CA 2IGBA 5L4SA 3L06A 4KWEA 4G4JA 3OJXA 2ECOA 4RKQA 4LZAA 3L5OA 4LPSA 1ND6A 1C9JA 2BEWA 3TRKA 4I55A 4OD0A 3V34A 1EQ2A 2Z1DA 1D0SA 2QTTA 1GKYA 1PR6A 3DBVO 4HLCA 1T3TA 3WQRA 4QEZA 4C3VA 1ILWA 1RQPA 1ESEA 1WMFA 2QSUA 4EW6A 3DEJA 1FFXA 2GOYA 2Q0XA 2I55A 3ZJ4A 4DM3A 1G8MA 5AP9A 3CKKA 2DQZA 3OZUA 1BKDR 1QIDA 4PFJA 1G20B 4GHWA 4IJKA 5H70A 2XMQA 3N8DA 1J2YA 4IKPA 4EB8A 5ITZA 2WOOA 2C04A 3U09A 1CT9A 1F6BA 3QY0A 2AOXA 3GELA 1PQWA 4CM1A 3PDHA 3EIFA 3GG2A 3HUEA 1DPFA 821PA 4Q4HB 2ZJ0A 2B4AA 3PRJA 2FPGB 4XIIA 2JFOA 2VEDA 5ENVA 1ZM3A 2C20A 5BSFA 3MMPA 2Q27A 1TMYA 2NUTB 2WJ6A 1XTJA 1TYCA 4B4VA 3N0TA 3ZXSA 4PX2A 2FEPA 2JIBA 2CLFB 3ZYCA 5AJUA 1K27A 3O7WA 1IYZA 1MCZA 1QOZA 1VLJA 1ZSVA 5LN1A 3I52A 2XCTB 1ZU4A 5B7NA 5KQGA 4XYMA 4ZU3A 1WSAA 2OCYC 1GPNA 3FSJX 4NYJR 4EYEA 2H52A 3IUYA 2AN9A 4WKNA 1GKKA 2E4AA 1YKFA 4FYPA 2NYAA 4JBHA 1W8DA 2VSXA 3AESB 3G0BA 4O5OA 2MINB 2TMYA 2ZWPA 3AVXA 1LZLA 1F4PA 3AM4A 1W6UA 1E9BA 1G4AE 3JYHA 1IULA 3JQBC 1JHDA 3MWEB 4IIFA 4G6ZA 1RPAA 4ZAFA 3VDQA 4GPD1 5A5FA 5HCIA 3DUFA 4HH1A 5HP4A 4BWGA 1RLJA 2Y92A 2ZYSA 1A9TA 4XX0A 1CJVC 2BI8A 4CM8A 3T4EA 2BF4A 4ALMA 5CT9A 4J2HA 5AVOA 3QKTA 2RARA 4LK3A 4BNTA 2HLDA 3UT6A 3V7FA 1PTKA 2P9GA 2QTBA 4GZ6A 3W7VA 3MCUA 4JGBA 5BR4A 1NVVR 4ZVQA 1MOQA 5TJHA 2OWEA 5CH3A 3MK31 2HO5A 3AMVA 3MRTA 4BDSA 2OCKA 4L9WA 1RPZA 1N32B 4C7BA 4ZYWA 1VPEA 1CUUA 2W7TA 4WNAB 2F00A 3IBTA 2C4VA 1AV7A 2ZOSA 2PGIA 4XWGA 4DADA 4JDUA 1G4UR 2F4NA 1UDWA 1VL1A 2GAOA 1G3UA 2JRLA 2ZYAA 3GROA 3IDQA 4TMZA 4TVKA 2HGSA 4YJ3B 4HH3C 2FYTA 4JSRA 4FNGA 1DZ3A 1E18A 2FNAA 1P2GA 2Z3VA 2IXAA 4HRVA 1BMQA 4L85A 5CT4A 3ZWCA 1YJCA 2P3LA 1UH5A 4FR0A 4JJ6A 1SZPA 1JIVA 4NCHA 4NNJA 2XOEA 3CF6R 4BQQA 2GO7A 2C5GA 4E4TA 3BCRA 2PFGA 2NVUB 4KBFA 3ZV3A 1NV8A 3OA0A 2PRZA 3KIPA 3BX1A 1P4GA 4KX5A 5J47A 1QG6A 1FZQA 1T9DA 2IQIA 2IYNA 3JSAA 4OQZA 1X92A 1FJ2A 3ZZ1A 2VBFA 4J0FA 4G86A 1WVMA 1NMZA 1VLQA 4C21A 3K71B 2JLWA 5LUBA 3SJ7A 2VJMA 1EUCB 2M1XA 5GZ6A 2WAYA 4ZJPA 5DGHA 1ZUIA 2BEKA 3R4CA 1CUYA 2QLNA 2ZUWA 3BMCA 4M9RA 3ROGA 4DZTA 3GMSA 4PV7A 2ZUUA 4YI5A 3ZW8A 2ONKA 3HH8A 4DN6A 1KBQA 4G85A 4MWGA 1ICEA 1KHTA 3RVMA 3M6FA 3EPRA 1E0SA 1LNSA 3PR2B 3QKIA 3RJTA 1NE2A 4TWIA 5ULLA 3HCCA 3UJNA 3USES 1M0TA 2E4WA 2ZXFA 2AHRA 3ILHA 1TZ2A 4N39A 1M7BA 1PK7A 1JKIA 1R8JA 5CHYA 2XCSB 1TPYA 2GD6A 3PQEA 5CK5A 2NUPB 3RHTA 1VB3A 3MTAA 3BORA 1XB2A 1MC1A 3CEAA 4OYYA 5LQKA 1DKOA 5EE5B 4AZ3A 2BC9A 1U02A 4ZV7A 1N6OA 1T2CA 4P7KA 5TARA 5CD9A 4TYNA 1J49A 4IS3A 3B9RA 1C30B 4PC2A 5LZ2A 4YWHA 3UCFA 5JQWA 4CLRB 1QP4A 3PHLA 2XGJA 3U60B 2D3TA 1J8MF 2LKCA 3E1SA 1IUNA 3ABOB 3E23A 5E9QA 3OEHD 3SD7A 4FE4A 1RHQA 3HHEA 1L7QA 3P4YA 3SEQA 1MW9X 1XKLA 4XWAA 2OGTA 4WCDA 2D4HA 4LC0A 1PYGA 5LYYA 3B1WA 3O47A 1QYDA 1JALA 2J31A 1E94E 1KI8A 1Z5VA 4TS4A 2GO1A 5GPBA 3EXEA 1G2OA 3GLRA 3EEFA 2H51A 4BP9A 3AHEA 3TRJA 4I4CA 4HNVA 3IEVA 3FGOA 3FIUA 2P3OA 3KR2A 3OY7A 4D9IA 3PC7A 4TZ6A 5JJIA 4Y67A 3S2YA 2GLTA 3IVGA 4H77A 3CRNA 3HHPA 4MIEA 4OFWA 3GLFB 5E8JA 1QQAA 3JYPA 3R7SA 1V5WA 1MORA 2QTAA 3IQIX 4URFA 5EQJB 1NATA 5HRAA 2ZWMA 1UKAA 4PRZA 3COYA 4QPZA 3UK7A 1UMCA 4TN5A 4KGXA 3ZTWA 1JQAA 2NAFA 1J4AA 2B0CA 3LFTA 3OOWA 1Q0RA 4KQIA 4TV9F 2QZZA 3AXSA 5FLKA 3TW0A 4QM7A 1ZU5A 2FEXA 1FTQA 3AEXA 3GRKA 2I1QA 1RQRA 2CXSA 3L0SA 4XDHA 2Z6AA 5C8YA 3LK7A 4MGZR 1SC3A 4RENA 4YMHA 3LX4A 4HS9A 5TQ0A 2DKOA 1W47A 2G08A 2OBBA 3O03A 3F46A 1VG9B 2HGZA 3GGDA 1KR5A 1LPSA 1E9CA 3TB4A 3GVCA 3KJQA 3NM4A 4RF4A 2JFBA 4X3PA 3WL6A 2K7ZA 3X1WA 2J45A 3OCZA 2IW1A 3AF3A 5DCLA 4NE9A 1BU8A 1XCBA 2ZBDA 3RCBA 1RXIA 2Q21A 5JLJA 4AYXA 1TQ8A 3B38A 2B82A 1H0SA 3GOHA 5AHXA 1DO2A 5JJ5A 1OVGA 2KWIA 3WG9A 1KIAA 1NR1A 3HO8A 2X86A 5AOVA 4DMGA 3BH7A 3FMOB 3B2NA 3SX0A 3GDHA 3H6KA 1JEAA 2OMKA 2ZBUA 4E2XA 3T5AA 3A1FA 1KYTA 1U28A 3N2GB 1OU4A 1KJJA 2Q45A 4MH0R 3ET5A 5HUJA 2E21A 1PJBA 3Q0IA 3STYA 2WD9A 1M9NA 2QV7A 1YI1A 5BPFA 4FP9A 3IE1A 3DZBA 2Y1LA 3PHHA 5CLLA 1OV4A 1BXRA 3UWOA 3A2LA 5IK2A 4KUGA 1LRJA 4DR3B 4ZI3A 4BP8A 2BEVB 3I01M 4FGWA 1FLVA 1H3NA 1SUIA 4RH1A 1SIOA 5EIOA 2I65A 3K09C 2OO5A 3TIXB 3EZLA 4CIVA 4B45A 3BGWA 1HE8B 3K5IA 1M2HA 2DPGA 4MDFA 4ARAA 3PWZA 1XDBA 3H5TA 3RE1A 2UU9B 4M8NE 5DTQA 4N48A 1H9CA 3VI3B 1CY4A 4D9NA 2VI5A 3EZ6A 3KYCA 3NBUA 4QVKA 4C4OA 4CI9A 1T15A 1UPAA 1V26A 3F0TA 3IAM1 3S5UA 3TLCA 5HOQA 1YZ3A 4XX1A 4DNOA 4INPA 4G81A 4HD8A 2ZPUA 1Q77A 2FW9A 1Z5UA 3PC3A 1R6TA 2GRJA 3O8DA 1TNDA 2V5VA 3RYCB 3H13A 1VIYA 4EUKA 3PE4A 2X9NA 3MW8A 4QGSA 3PKZA 4QTTB 2P2LA 4DILA 1HURA 4DLZA 3LYHA 3ADDA 4MW0A 1J7KA 3F9CA 2YOHA 2WDPA 4CKBA 4FYVA 1Q92A 3KQHA 3DA8A 3IT0A 4IICA 1KGSA 5CM8B 4ZAYA 3LWBA 3SK0A 3P9NA 3ZV7A 4UW9A 1PDVA 1MO6A 3KX2A 3T38A 3QKRA 4MYTA 4QXPA 4XTRA 5EJ9A 3SBDA 1RMYA 4ESEA 1E1QD 5IYZF 4W1SA 1F8FA 3RANA 2FOLA 3T9DA 3WJ2A 1RNLA 3BIXA 4LSZA 2PUEA 4CFSA 3SG0A 4CM3A 4RFLA 2OL4A 4KGZA 2WB4A 5TNXA 1Q20A 1SCAA 1Y9AA 2PT9A 3EQ2A 2I03A 4M7PA 2WMOB 3RAEC 4NIMA 3N8KA 2OM6A 2BF7A 4Z3KA 4Z8XA 1DKUA 2CNWA 5ALIA 2MSDB 4QJIA 3TNDA 3S1AB 2ZJYA 4ZOAA 2AFIB 2AR0A 4JOCA 5FUXA 2YN4A 5GOZA 2WWGA 1GR0A 4GUDA 3VR3D 1F0YA 5I7RA 4MS1B 3UEOA 2RHRA 4JI4B 2JDIA 3B6KA 1E20A 1ODJA 1Z39A 3CZAA 2PS9A 3HBMA 5DULA 5GMOA 3N7TA 4GZ5A 2GF9A 4OKSA 4A16A 4YRGA 5A7FA 5BSEA 4V0LA 5JAHA 3KXLA 3GDGA 1F12A 3KKEA 4J6FA 4ZT3A 5J2TF 3T0FA 2H4YA 3PKIA 5GV8A 2B1IA 2JFYA 4MVYA 1IUOA 3VR2A 3R0IA 4OK6A 1JJ7A 4LV6A 4ZOBA 2ORED 1SD2A 2VPQA 3KYBA 3EXIB 4ILEA 3LFUA 1W35A 1NBME 2H1CA 1CEQA 4O2AF 5KJ1A 2ZIGA 1R5BA 1PS8A 2PSJA 2F3UA 4XOIA 4EKGA 5K20A 1QF9A 2IU4A 3F4BA 3WBBA 5EQDA 2XLBA 4GBGA 2WZDA 3VI4B 3IMEA 4GI2A 4HHEA 4QE3A 1JKMA 3RRMA 1D2GA 3ONFA 4RBNA 2GXQA 5CH8A 1RZRD 1H2BA 2GK6A 2XRFA 3GAFA 4ON9A 2I8LA 4YIKA 1JDTA 2RHLA 2YZMA 3L7JA 3OLVA 3PUWA 5AKJA 5IW8A 1VTKA 3MAAC 4FX5A 5EYPB 3TIIA 4BGEA 3ER6A 5HXAA 1L7OA 4ZI7F 5LXTA 1JAXA 2J4DA 3D3QA 3DAPA 1RJ9A 3EIHA 2F62A 1G5TA 3KCNA 5B1HA 4YRZA 3S0JA 1A8UA 1KZ7B 2RJNA 4IMPA 4BBJA 1VI2A 2QT0A 4URHA 5GM1A 4YY3B 2X2EA 4TN1A 1YC2A 3SMVA 3W9YA 2H1IA 4FT4A 4L8WB 4Y7DA 5CA0A 2CMGA 2P2NA 2PO5A 2VK4A 3ELUA 2PVSA 4OYRA 5FULA 3EZ2A 4AJ2A 1QQBA 4V1CA 5ALOA 3HR8A 4BQFA 4MVJA 4WSOA 2WUEA 2XCQA 1DC8A 3SFTA 1MA0A 4IIJB 1V3QE 4YT8A 2ZSEA 4YO8A 1OWLA 2QW0X 4I0WB 1MJFA 1Y3CE 4PX9A 3R9IA 1MTZA 5E4TA 4PGHA 4DCJA 1UAAA 4RU1A 3FSRA 3L8GA 5FAKA 1RWMA 4MKXA 5L95A 3N1UA 5ALRA 2OA0A 4N65A 4Z9FA 3UMJA 2EGUA 1TJNA 4ZT2A 1DX4A 2J08A 3STUA 1ZVMA 4L3OA 5EMKA 2OEPA 3I09A 1Z5NA 3PI6A 2AXQA 3SSNA 4EJMA 2YKGA 3LP6A 7MHTA 3CUWA 2YZGA 1PQUA 3SSOA 2EJBA 4LBZA 4C7MA 5K0EA 4V0MA 1PR1A 2W2QA 3A11A 3PC4A 3GH3A 2Z6QA 3OMXA 1Z6QA 2P35A 3HZOA 1YT5A 4O4LA 2GLUA 4C3ZA 5LQJA 4EYOA 4HEA1 2W6JD 2VLBA 3N8GA 4J9VA 5IZCA 2EFYA 1FBTA 3KL4A 1Y3FE 4IKEA 3ORFA 4PVDA 4IQ4A 2PUWA 1QO0A 2X3YA 1GCOA 3L1KA 1ZOSA 3K94A 4KQ1A 4WY2A 1RS0A 5ALMA 1YR8A 2SKCA 5GZ1A 5ELXA 2O59A 3O31A 1U8AA 1CZUA 1EQUA 4YV1A 1R6DA 1LNQA 4I8IA 4KLAA 1EHYA 1TKAA 3N53A 4L75A 3PUYA 4MVJH 2J0QA 4L9RA 2FW8A 1PK9A 2JGNA 3LUDA 3TRIA 3GFVA 4BCCA 3NIWA 4CM6A 4ZDJA 5CA1B 2X0FA 3S8YA 1WB6A 1J07A 1ZOPA 3WI7A 4UATA 1PWHA 1T5IA 2VP2A 1H4SA 1EZ1A 4Z7OB 3IH5A 3TD2A 1ZJ4A 1E66A 1FNMA 2ADFA 3THYA 3IP9A 4R1NA 4DZZA 5A3RA 4MTLA 1X8JA 3SHOA 2R6CA 4HGZA 5DK4A 1FNSA 5I9TA 4EG7A 3D4BA 1H0KA 3D8HA 4URWR 1UXKA 2VP3A 1FDWA 5JFTA 5H59A 2QTRA 5LL6P 5JAIA 3SHQA 3B70A 1OKKA 1F5SA 3AY3A 1H2HA 1EJ2A 4W5NA 1YULA 2GZRA 3NGXA 1Y5NA 2R1TA 1U99A 4K9PA 1E0KA 2XMZA 3DNPA 1YBAA 1SBTA 4EAQA 3GEIA 2O0LA 4GPEA 2BIFA 1UK7A 4EEZA 3T7RA 1L5QA 3PGA1 3ETLA 2FQYA 3KR0A 4EA8A 2YXEA 4JJZA 2AEMA 1R3DA 4RCZA 2K2WA 5EWLA 3WGTA 3Q9UA 5ARDA 1FLNA 2ZRDA 5BYKA 1SEPA 1WCXA 2VCYA 1EK2A 2AC2A 4DEXA 2QTWB 3ZQJA 4J0JA 5B6PA 4BNWA 3GBVA 4OHXA 3W2FA 4RFSA 1XCJA 1SNYA 2A9OA 1H0HA 5TEWA 1WWKA 4AWBA 1KMHB 1NKTA 1ZG3A 2L69A 5F7OA 3SOPA 5JY1A 2IBTA 5GJBA 1ZY2A 4B46A 1TUGA 2VSQA 2BV3A 3RVRA 3MJTA 3QU2A 3QWIA 1N6LA 1IUKA 1JW9B 4N8DA 3D7RA 2C07A 4UNIA 4ABYA 4C2BA 1LFAA 3DOEA 4ZA2A 3EXAA 4K2HA 3VPFA 4L74A 4TWJA 5FWDA 3VKGA 4WLFA 3OEWA 1CHDA 4DMCA 4ZDWA 5CDSA 1YFZA 3FF1A 4J1QA 3I9V1 4JJAA 3I5XA 2QVBA 3UMMA 2CSUA 2E48A 2QYHA 3T15A 4ZMBA 4HJXA 3ZK7A 1IPFA 3JSXA 2X5OA 4F1WA 3FOBA 4NG5A 2ZAGA 2YNMD 4NZYA 4YRCA 5FH9A 2P9YA 1PX2A 1F1BA 5K4GA 1YB7A 4B7UA 1S7GA 2AJDA 2NSHA 3TB6A 4I2NA 1AS0A 3BICA 4K28A 1ECJA 5LP6B 4WVFA 3R9XB 5G3YA 3DL2A 4BRSA 1EM6A 1XZEA 2HJVA 1C0PA 2F3PA 2QUIA 3GB9A 4RVDA 2C8KA 5FOTA 3OECA 3CN9A 1SMKA 1KBOA 2F1HA 2GAAA 4FD2A 4IIHA 3CKLA 1U80A 5AK6A 5BMVA 1N7IA 1N75A 3GJ3A 1Y48E 3CT4A 4JUCA 3FNFA 1P9NA 3M6VA 1FP2A 4OREX 2C3OA 5T57A 4F9GA 3FDJA 4MUYA 2J5RA 2QZSA 5CNKA 2C5HA 2QT1A 3CPHA 3V2IA 3SZMA 3VJKA 3GUHA 1X80B 1OYWA 3LNCA 2GJSA 5CFOA 2JS7A 1YAHA 2O0HA 3ZVMA 3QELB 3U16A 3CX7A 3NHLA 4D9HA 1YO6A 3W4JA 1NP3A 1LEHA 4YRRA 1FJXA 4YLGA 1FLAA 2ZITA 2YHAA 2DWCA 3K7EA 1K66A 3NTVA 3OT1B 4M1MA 1IZ8A 3SKXA 2VAPA 1YZQA 5BN4B 2XWQA 5E3IA 5ITWA 4D8YA 1BE1A 1C4XA 3DE3X 3EZFA 4U02A 4DSOA 4F2HA 4C78A 1JBEA 4UTRA 3FNRA 4ND6A 5CR9A 1X8KA 2QU7A 2EBHX 1DS6A 2WTAA 3IR5A 3Q40A 4PS0A 3TSCA 1LB1B 1RR6A 1V7QA 2TMDA 2WJAA 2O14A 3S3TA 4RDXA 4V0ME 2HJSA 3HU2A 2VPWA 1OD6A 5JQGA 1FUEA 4FGLA 5IT5A 2ZZKA 3FKJA 1B6RA 3T5MA 3ZCXA 5KNBD 1F5NA 4X9XA 3B3FA 3U7HB 1YASA 1FK8A 4KE6A 4JLNA 2FFQA 4G5SA 3K35A 4KMOA 1XVVA 4QTUB 2WWXA 4K9MA 2TECE 2GCOA 2JIZD 2VUHB 3D2BA 4B85A 1RCUA 3T3MB 3UJHA 4R16A 1JEQA 1BH2A 2QBYA 4HRYA 4MJ3A 1WUYA 1N6KA 3U5TA 2R48A 3UAVA 3ASYA 5JI2E 3PNKA 3UN1A 2OBXA 4IHJF 5LCXA 5EMNA 4Q05A 2Y1CA 2HSWA 3ZDQA 3GHYA 3ROXA 3NW9A 1G2PA 2XITA 1GGJA 4MR9B 5DB4A 2IHNA 2EZ4A 2J9XB 1DEAA 1TKCA 4WEOA 4GR4A 1SVSA 3IIJA 3NEPX 1A3CA 4JYPA 1QCDA 1E2MA 4J2OA 4LOLA 2JAOA 4P1ZA 2CXQA 4C0SA 1AKEA 1RQLA 2EV9A 5DASA 5BUCA 4E03A 1BDIA 1TADA 3EXG1 4ZC8A