2HWWA

Structure of pin domain of human smg6
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
160
Chain Sequence
b'MELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSENNDDLILSCCLHYCKDKAKDFMIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Telomerase-binding protein EST1A
publication title Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 57
structure length 160
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13638 PIN_4 PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 2hwwA00
5K8JB 1O4WA 1A76A 1BGXT 5SV2A 5ECYA 5HMLA 5FV7A 3ZDBA 1TFRA 5L6LB 5HMMA 3ZDAA 3ZDEA 1V8OA 2H1OA 5HNKA 3IX7A 2IZOA 3H7IA 1MC8A 3H8JA 3Q8KA 4CHGA 1TAUA 5L6MB 3QEBZ 3I8OA 3QEAZ 5ECWA 3ZDDA 5ED0A 3H8SA 5HP4A 1A77A 3TNDA 2H1CA 4XGRA 5ECDA 5H4HA 3Q8LA 1V8PA 1W8IA 1XO1A 4WA8A 1YE5A 1UT8A 1TAQA 1UL1X 1UT5A 2HWYA 2MDTA 3ZVKA 2BSQA 1EXNA 1RXVA 2IHNA 3Q8MA 1V96A 4MJ7A 2DOKA 3H87A 3DBOB 3ORYA 3ZDCA 3ZD8A 1Y82A 2HWXA 2FE1A 5H4GA 1B43A 2QIPA 4XGQA 1RXWA 3H8WA 2LCQA 3ZD9A 2WP8J 2HWWA 3QE9Y
chains in the Genus database with same CATH superfamily
4V02A 2GZ1A 2RH9B 4RGBA 3AUKA 5D7NA 1ISSA 3QE4A 3N8GA 1YQ9A 3V46A 2AEMA 3KOZA 4CQJA 3O2NA 2BR4A 2WM2A 2UZ1A 2QX7A 2CFSA 3D31A 3R9KA 3UJPA 4H3VA 2R8YA 4L76A 2W2LA 1U4OA 2HDWA 4ZVVA 4Z4EA 3AKDA 4P31A 4IIBA 3K1ZA 1QVWA 3WR5A 5KCZA 1I01A 1V8FA 1HL7A 2X2FA 2BZGA 2FZ5A 2OG2A 3I83A 4RIEA 4BKUA 5B3JC 5AKJA 2J33A 1YS2X 5BT9A 3AW9A 4QOIA 5FOWA 3C3DA 2JF0A 1G60A 1Z75A 3ANSA 5AW4A 2V4MA 4B4UA 4KL8S 5KVVA 3P27A 3B13B 3O9ZA 2R85A 3HXPA 4KPYA 1UPUA 4C3UA 4AKIA 1GARA 4U8HA 1CS4C 3U3OA 2PFSA 3R5TA 4BEBA 1Y80A 3WWEA 3URMA 4ALLA 1P39A 1CS0B 3BBPA 4CPDA 3TQHA 5TT0A 4Q47A 1NHGA 5JJKA 1GY8A 1KZ4A 3OZBA 4CEIA 5DBHX 1TCAA 2GCNA 1OD6A 3RUCA 2QGNA 1CY1A 5FTMA 4CT5A 3IL2A 2H4YA 1C4XA 4MRRA 4HD8A 4E7PA 4CN8A 4HMPA 1KEEB 2NU6A 4Z0TA 1L7RA 4E5VA 2XOXA 3F3MA 4F3CA 4B3JA 4BNHA 4W7IA 2VSOA 2ZI5A 2JBAB 1WSBA 3M6AA 4F3RA 2JHGA 1GTSA 5ALOA 1P4RA 3MLAA 3S2ZA 1MPXA 1QQTA 2QUIA 2WJ3A 4MSUA 5EHGA 3K05A 1UXIA 2GUGA 4NWIA 5LNK6 4UHDA 1PT8A 2WZCA 4X1KA 1IHDA 2JS7A 3PEFA 1CYDA 4R2MA 1BJKA 1C81A 1MLDA 1WU7A 2HK8A 5B4TA 4FDLA 1PZFA 2B6HA 3G02A 1J0AA 4RZHA 4MTCA 4JUIA 5IU6A 2I22A 3LCRA 5EHQA 2NUPA 3W2HA 2XXAB 2Z0MA 5KJEA 4R3UC 5EJIA 3GLFA 4W7HA 2VJCA 2PL3A 1ZM9A 3MOIA 1FZQA 3H2ZA 4DTIA 2OYRA 3RAGA 4EX7A 1NN1A 4YUAA 4TM7A 2JKYA 2JLQA 3CRW1 4RESA 2XMGA 5BN3B 4QA9A 2GVNA 3EVGA 5IKPA 3JAWB 2B69A 1XAIA 4F6RB 3GNTA 2GZHA 3D3JA 1ZWLA 4G8BA 5HJ5A 1MJGM 5KTNA 2ZUEA 1OXSC 3ZHVA 4MA0A 2C4KA 3PNQA 3ND6A 2HPZA 3QIVA 5CDFE 2IBSA 1DKNA 3SIXA 1JH9A 2QL9A 4FHEA 3GJ3A 4NECA 3HVKA 5B6IA 1RPJA 2Z4TA 1CHDA 5DN9A 4F6CA 1LNZA 1TCUA 3ETLA 2RSLA 2BEJA 2VN8A 4EYGA 2SICE 4D9EA 3BL5A 1VL2A 3HGQA 4LYDA 3ZIAD 5EJEA 2HCTA 1XZDA 4PC3A 3SX2A 2G40A 4RETA 4MDYA 5FAXA 3FG9A 4MR7B 5EE9A 1QHHB 1ONSA 1U0HC 2QTVB 5KB3A 3OIGA 4FYMA 2HR1A 4OXXA 3F6SA 4LFCB 2W4QA 1P0IA 3IP8A 5U4QA 5JXWA 3TH5A 1NBWB 2EV9A 4LNUA 2PL1A 4KJXA 5BOSA 4YRLA 3F6PA 2JHPA 3V9AA 4V1CA 4PSDA 4I4TA 4MGEA 5NULA 5KSOA 1N1GA 5AW7A 5F5XA 2O2ZA 4FHDA 1TF7A 5JZBA 3LP5A 2WG1A 2GPJA 1Y63A 2WU3A 5IJZA 3G8BA 2DHEA 2HEIA 2O2DA 4AO6A 1QX3A 4N8EA 4KBFA 4E1VA 4CTNA 2WTMA 5C8ZA 4B43A 2ZBRA 3CCFA 1JSZA 4JVMA 2FEKA 4QRIA 1L5NA 2I66A 1Q92A 3PJRA 3JVDA 3UJ7A 1W1IA 3LHSA 3QU7A 4QPCA 2NV2B 1XQYA 4AX4A 2PSJA 2VBIA 4DLZA 5JBIA 1Y42X 1JKIA 2D3TA 2V7UA 3L40A 4YJ3F 2VJMB 3E2PA 3TS1A 4OMUA 1ZU4A 4BNFA 3O8RA 3SQXA 3C8UA 2AN5A 3DDSA 3KEMA 1PHRA 5CB4F 2G6BA 3GA5A 1M83A 3QH4A 4LQDA 5E2BA 2WSSD 1HYEA 1RAHA 3EVAA 3K9QO 5JSZA 4MO2A 2OA0A 5KKNB 5B6JA 4HLCA 3QP9A 3EGOA 3KSAC 5ALJA 2YMLA 3MAGA 3GDWA 4Z54A 2XWSA 5CFRA 5LVAA 3R7FA 3S2IA 3HA7A 1P2DA 1Z06A 3QOWA 5DM60 1ZH2A 2K6GA 3H4MA 3MRSA 3DVSX 2POCA 3OM0A 3UMGA 4YV2A 3MYYA 5BQ3A 3FYHA 4FD2A 2ACVA 4ZOLF 3H2GA 2IE0A 4LSMA 4HH3C 4ZP1A 3SSMA 4YPVA 3HYSA 3MUEA 5KYYB 3W5DA 3AOEC 1N3IA 3UJNA 3TLGB 1W34A 1ZCAA 5H4HA 1HURA 3IJPA 1P0FA 1FRFS 1ZN9A 4AJPA 3TL2A 3U19A 3KDSE 2W0MA 3DE2X 7REQB 4LF5B 2W6IA 4LWPA 3C5VA 5AKHA 1N6NA 1UFVA 1FP6A 3AO0B 4JXXA 1WTCA 1XFAA 5IVKA 1G3MA 4FBMA 1V47A 2GNAA 2Q1UA 1Z5UA 3D2BA 2XUDA 3SR3A 1JJFA 1DKOA 2ESRA 3WWDA 3C1AA 4PSVA 4AFNA 1PZGA 3DFUA 1EE2A 3KO8A 3LQRA 3OKFA 3QU5A 5EI5A 1WR8A 4LMBA 4WKPA 4P3PA 3PFGA 1N5OX 1J06A 1WLYA 1M10A 5AI6A 1OAKA 4JY7A 1M7HA 3FUVA 4LZAA 5AKLA 3WK6A 3UQYS 2RHLA 3QPDA 3ZX4A 2IJGX 3S7TA 3M2TA 3MMZA 4GSLA 1WB6A 1JBKA 4J8PA 1B8PA 2ZRPA 5IC6A 1N25A 1Z2NX 2OC4A 3F6BX 4NFSA 4K6FA 1ZA2A 2WPDA 3AR4A 3GN1A 4TTPA 4YAOA 4B75A 4BMXA 1XLTC 2QP3A 1OOEA 1SVIA 3R5SA 4CIVA 4CV2A 2GSDA 1EQ2A 3HFSA 3IEVA 3PHJA 1C3OA 3CKKA 2JVIA 1ZN7A 3Q2IA 4HNHA 4X45A 3KQNA 2XRZA 1MAHA 1V11B 3PEWA 4IQ0A 3IALA 4JJKA 1YK0A 2JLUA 4TLAA 1MNAA 3LTNC 4IJWA 5LA6F 1UQTA 3IQZA 2MCFA 1WSWA 3K92A 7AT1A 1Z17A 2MJLA 1U3UA 3TLZA 3BTOA 4LVOA 5EUBA 1SBQA 3T4PA 1IDOA 2Y1KA 5ALKA 5GGXA 3RHZA 3ZNNA 3N2EA 1VPTA 5FNVA 1Y1RA 1S2DA 1MO2A 4YAKA 2CUZA 1NWHA 2DX7A 4HNTA 3GNLA 4IMPA 3F71A 3IIKA 2O3QA 2RJOA 2VKTA 4WGFA 4RMGA 4TX1A 1FXWF 2IXGA 4B7XA 1M67A 4Q9JA 4KQIA 4B74A 3KZXA 1JJBA 2OYCA 5GVSA 3D8HA 2AFHE 4GRDA 3NGMA 3JVEA 5C3UA 3D8BA 4KVFA 4U9UA 4EI7A 5KQLA 3BXPA 1XMXA 3FZGA 4BN4A 4EY6A 1N5RA 4D4MA 4JLAA 4B7CA 4I14A 1P6QA 4EG8A 3I58A 4Q3AA 3H04A 5KYGA 2QLLA 1L7NA 3R3HA 1W2WB 1RNLA 3CM0A 3AR5A 2KBFA 4N7BA 3C0KA 4I1OA 4V0KA 5J2TB 1UZAA 4F1WA 4ILEA 3GJSA 2IGTA 2OFXA 3EISA 4H7DA 4JUBA 2J5RA 2RGGA 3TEMA 5JXGA 4C7KA 3V7FA 1EXVA 1WX1A 3A7DA 2JFGA 2PMKA 3PTZA 3VR3D 4HWRA 4L72A 4RDIA 1OH5A 2R84A 2C7GA 1DZ3A 4UEQA 4KPEC 2E0IA 1NT4A 1PL0A 2JDID 4AT1A 4OHYA 4UU7A 1HYGA 1STOA 1TTPB 4P0TA 3B9BA 4C2AA 2F55A 1O6BA 3TNJA 2C7BA 1MX9A 2FRVA 3DHNA 3PUKA 1RI1A 2IY9A 1WM1A 2EBUA 5LYJA 1J8DA 1U8CB 2YHIA 4MLZA 4AP6A 1VSVA 4G97A 1GGMA 1HEIA 2V7VA 4KQ6A 4QUKA 4M76B 5F2EA 5ARCA 4RVCA 3NAMA 1Q7GA 4EUKA 2VWQA 3UMBA 3VO1A 4OHXA 3KOOA 1TEZA 2WVHA 1C1DA 4PX2A 3G2MA 3FDJA 4RLSA 3IQEA 5LZ5A 5L3SA 4G1CA 5KJ1A 2NW6A 4KMMA 3IVMA 4X7PA 2QRJA 3OI7A 1DJOA 1JPNA 2JJQA 5FPHA 4Q12A 3WSVA 4HWGA 1UP6A 2FZGA 2YUTA 2NAFA 2FPXA 3FCYA 1AQ6A 3L43A 3T8YA 4TMXA 4DPKA 1TT7A 3FGNA 4BX8A 1ZJ6A 5FTWA 2QVXX 5KTTA 4C0QC 3AKEA 2OCKA 1HLDA 1TK3A 2R47A 3L8MA 4LSGA 2Q3HA 4HRAA 1YDHA 4KVGA 3OX1A 3FPFA 4UDNA 5K3AA 4WD3A 4QYIB 4TOIA 3OQJA 2O8CA 2HO4A 1T2NA 1RHUA 1WXGA 2BGJA 2JFQA 3ZKWB 5WRFA 4MI6A 4LG1A 1Z12A 2GRUA 4DB4A 4JFAA 4X62B 1KR2A 3Q7SA 3QF4A 1FLDA 1U04A 3FPJA 2VCHA 3GH3A 5FBQB 1SOAA 3LWBA 4EJSB 4HH0A 4N8DA 4C0LA 3WL8A 3T1HB 3HDQA 4ZCSA 5SZJA 4C43A 1KRHA 1UXOA 1IPEA 1SQGA 2HJVA 4NESA 1L9KA 4HS4A 1XP8A 5EGSA 3ZNQA 3DHYA 3EZNA 3QOFA 4X71A 3TO5A 3NJ4A 5E3HA 2C96A 1QV6A 2QLFA 4G0OA 2PUFA 4RV5A 1SU4A 1ZOSA 4TQ9A 3JQ6A 2HWWA 2I4NA 2Y1WA 5FBVB 3ADPA 2FPSA 3CT6A 4YIKA 1XU4A 3HVJA 5JLJA 2QUHA 2QORA 4TWIA 1GNLA 2NT4A 3A10A 5JS8A 1XCLA 3DVAB 1J1ZA 1NRXA 3ZWVA 2B0CA 3BCUA 4R1TA 2AJBA 3GIDA 5COAA 2HRDA 1FSGA 4M1MA 4RK5A 4V2UA 3DO6A 4OFZA 4NNPA 5HCNA 4ZI7B 1YFJA 3EQ6A 3QMPA 1AS3A 1SIWA 3O9VA 1PT9A 2VK1A 1JQEA 2Z4RA 3DZ8A 3WL4A 3H2IA 2YFYA 4EY3A 3RVQA 1E7WA 1EJ6A 1S02A 2WT4A 4LE0A 1EX1A 4M0DA 3DC2A 4QQKA 1KAGA 4DWVA 3M89A 3E58A 3GAFA 4WX2B 3T1TA 2HL6A 9LDBA 3ZHZA 4OREX 2QU7A 1EIWA 1SIOA 4HX2A 5AK4A 4U63A 3C45A 3W2TA 1E89A 3C15C 2FQ1A 4UFNA 1S3IA 1XA3A 3B53X 3TRKA 3ZHSA 1Y7PA 3IQIX 1VE7A 4A6XA 4NU6A 3AUYA 2IE8A 4CM6A 1JXAA 3K2IA 3OUZA 2WTEA 3NHSA 3WYBA 1B1AA 3ZWCA 4Z2AA 2HHAA 2R25B 1JI0A 2WTAA 4UUAA 1BG6A 4QUBA 3LQ1A 1VMAA 2YJ3A 3H18A 4G25A 1LPAB 3I4FA 3N2ZB 4CFSA 2JLZA 4A2CA 4A1FA 2CLLB 3BF8A 3AKYA 2G25A 3OTGA 3PGLA 2IEBA 1LDBA 2VTBB 5K0SA 3D0QA 4IWNA 1HEYA 2RAPA 2ICAA 4YT8A 1HNXB 4A91A 3GLSA 1VMEA 3GLUA 3GOQA 2G08A 3H8SA 4ONEA 1XRNA 4DCPA 3LOQA 5IJWA 2FETA 1IUNA 3GFTA 5DSXA 5JWHA 2P9CA 4FT4A 5T4BA 3OPYB 1QP4A 1SVSA 2G72A 1YONA 3BD9A 4FD3A 2PR7A 4WECA 1NF9A 4C9BA 3DTVB 2QTHA 5EY5B 3VC1A 2OO5A 2QJTA 3SFZA 1DC8A 4ZYXA 3GJXC 4OXQA 4WJKB 1ACLA 1LRLA 3UT5B 2QE6A 2EWVA 1WCYA 5MF6A 5DVZA 2AK3A 3K70D 1E18A 3JZMA 1HE1C 2GUWA 2PR2A 3K8ZA 2OHVA 1MOPA 4K03A 3VNSA 4D43A 2R62A 1VFPA 3Q7RA 1HQYE 2XYRA 3D7MA 3R23A 1F2VA 1RPZA 1DIAA 2YZNA 4GPBA 1CUJA 1VXOA 2X6RA 3MT7A 4V0ME 1KDRA 3WWOA 1B8NA 2X2PA 1B1CA 2CL6X 2FG5A 5I9BA 3ML1A 3V7NA 3L4KA 1KI3A 1TJPB 5ALLA 3TECE 2RHOA 3TRIA 1QU3A 2CHVA 3RREA 1XK7A 1EG2A 2BM1A 2HF8A 2J5BA 4NZ9A 2CCGA 2XYGA 2D4AA 1UIRA 1CZRA 1EU1A 1II8B 4RTQA 1CEQA 5DP2A 3KSRA 3UF0A 4UTPA 4XXHA 5ALGA 2WM3A 4JFRA 4XD7D 1XJCA 1XXLA 3AWDA 2IW3A 5JVDF 3B3JA 1O96B 3HB5X 1SIUA 3DEJA 2EIHA 1ETUA 4J76A 1NJ5A 4P4NA 4TLMB 1NJ2A 2O3RA 3AR8A 4RF4A 3NWPA 9ATCA 1LXCA 1R8YA 4DMKA 1Q6ZA 3F9RA 3T34A 3UYLA 4EBFA 3EBPA 3DA8A 3U7JA 2QRQA 2XOKD 2B6NA 4I46A 1F06A 2ASEA 2WMNB 3AVUA 2JL1A 1M72A 2G6TA 3LCMA 3MRVA 1JEQA 1FUYB 4JHLA 2CFCA 3CWQA 3ERCA 3IE2A 3L3BA 3VV2A 3JS5A 5KOHA 1H3NA 1ZVMA 4JYCA 2LIPA 1OIXA 5D5HA 1WTAA 2D1FA 4KDEA 1U81A 3I5AA 1P6UA 1LRJA 2JVKA 1RKQA 2X4GA 1Y8QB 3GAMA 3K7EA 4MWOA 4MW4A 2J3LA 2QGZA 3ILVA 4GM0A 4HDQB 1K97A 4RANA 4DV2B 2UVPB 1T1GA 2XUFA 2BFFB 1B8VA 1PI3A 2ZBUA 2B3TA 1TUBB 1V4NA 3C8HA 3LKBA 1BKYA 5A06A 4RL4A 1P44A 2EX4A 2CF5A 2VXOA 4ZO4A 3WGKA 3M82A 1FVOA 4M9CA 4RPKA 3ENZA 4DV1B 1MEEA 3WRXA 2AV6A 3CZQA 4J43A 1F9EA 1G8GA 5CEJA 1W75A 4OHUA 3U44B 3BSFA 2P75A 2ZCUA 5E4YA 1UBOS 2EKBA 3SC3A 3V2GA 1CFZA 5JY1A 3EEBA 3MIZA 4XCXA 4E21A 1Q3KA 1HF3A 1MOQA 4WZ6A 3JARB 3WO0A 1MR3F 2ORWA 3OPYI 3FB1A 3Q8KA 1I9GA 3O73A 4R1SA 2PA3A 3ASUA 3JQ7B 2NU9B 1Q95A 1WW2A 3EG5A 3NBQA 2YYSA 2GCPA 4OYYA 4WCFB 3RU7A 3ADKA 3IUMA 4GO1A 1HTTA 4Q0MA 2OL4A 4TZTA 3VYWA 3MK31 5EIEA 2FPGB 4JJZA 3QMWA 3TR6A 5L3QA 2VJKA 4JJ6A 2IWRA 3BCSA 3A9WA 3FHJA 2CE7A 2D00A 4BNMA 1RJ9A 1L7VC 2G0TA 1AQJA 1GCUA 5KNDH 4PZEA 1ZR2A 1V7QA 1CS0A 1KGDA 3PJDA 2F3QA 3DYIA 3PDWA 4YJFB 1SC3A 1RZRA 1AZSC 2CJYA 3HB7A 1HTBA 3WADA 5A2QA 1RLMA 3M6UA 3VHXB 5LMCA 1NZJA 3KYIB 4TKMA 3AVTA 3U48A 4BNNA 5HKKA 2BTQB 3HR8A 4HN4B 2DGDA 4KDFA 4RQAA 2W6MA 3UOAB 4Z5XA 5I3CA 4QIHA 1KTIA 1JFLA 4FGLA 1Z4LA 4I19A 5U9CA 2OV6A 1BZYA 2Y66A 4TTSA 3TZCA 1G291 3GR6A 4LV8B 3G79A 4JI0B 4Y9RA 4IDBA 3L7AA 5EJ4A 1F2TB 5LLSA 4PNZA 1J0XO 1JMYA 3FMVA 5AJZA 2PSDA 4X8HA 4G0WA 3KKMA 1KZ1A 1SKAA 2FSSA 1VJ0A 5AK6A 4DCOA 1QAQA 1TNDA 3T0FA 3W8NA 1NLZA 4NE9A 2NZ2A 2RC6A 3OA2A 2H92A 4HB0A 2XXAA 3K31A 4CUZA 3B8EA 5SZKB 4JQZA 3UOWA 4OHFA 3WJ2A 1R7RA 4GUAA 1AZTA 1J8VA 2JIMA 2QMQA 3CTPA 5AYVA 2UYYA 1S0UA 1YB7A 4Q4AB 4L8VA 3ZDFA 4PQFA 2V9ZA 1K4YA 2JZOA 4GGOA 2C54A 4JSRA 4HSEA 1A8PA 4NIMA 1NBME 5AW5A 1YFZA 2ZRBA 3KYBA 1MT3A 1OWNA 4F6RA 1T3SA 3N2IA 2NUAB 4FMDB 1I4OA 2UYHA 4Q18A 1O5TA 4FHZA 5JBNA 5ALQA 2H16A 4TT8A 4NK4A 4GDFA 3EXFB 4QUGA 5FR2A 1ZAKA 5DPMA 1Y5LA 2R9VA 3ED1A 3F0TA 3LLUA 1QZXA 4TWZA 3RBAA 2CXUA 3DBLB 1VA4A 4B6SA 2DRIA 5JHGB 3H99A 2OBNA 2G1JA 3MELA 3R5XA 3GMDA 4NC9A 1SCNE 1KK1A 4LNAA 1GUYA 3UUFA 1CQWA 5ECYA 1WW8A 4GOKA 3IMGA 4MR7A 5FV7A 1QHHA 2QTVA 3BIWA 2CHFA 1W94A 3WAGA 3RTBA 4W4TA 4HAYA 3RYHB 4Q21A 5IKMA 1P72A 3L1UA 3P0JA 4HQKA 4A8JB 2QV7A 4DSTA 4DRYA 1Z6PA 2V0GA 5JMWA 2AJDA 2IU3A 2H1OA 1FLNA 1XYGA 1ZK0A 2J0UB 3UB3A 3I45A 3AYZB 2JJ2A 2Q5OA 3FNHA 1VLHA 1OH8A 1IC6A 2C8VA 2G9UA 2JGDB 3FJYA 3FOCA 3KL4A 4ALMA 2GCIA 2NVWA 1QQ6A 1U8UA 2PUEA 2WYUA 2V98A 1TADA 4I1IA 5BPHA 3OJLA 2WUVA 1HDGO 2BI4A 4BJ6A 3EVTA 4GPIB 1LQUA 2VPPA 2WUWE 3ZWNA 4EJMA 3BTVA 4I55B 4LRYA 4WKGA 5DT2A 4O3MA 2QI9F 3ECSA 4MV7A 1X7ZB 4IICA 2XCUA 4P53A 1XCOA 4QRDA 1QQ5A 2YXDA 3L04A 4KIGA 3SKYA 2CXHA 3ZXUB 5BSHA 3KZNA 2CXSA 3REQB 2B2CA 3WL3A 1UZUA 2XCIA 1KKLA 2FRDA 2VJMA 1JPUA 1WB5A 5EXTA 1SCAA 2WVAA 3WBFA 1CG6A 3QX8A 3CURA 4NS1A 4F8EA 5AKKA 4A0SA 4BO0A 3TNDA 1LFAA 4Q3KA 4NJEB 1D2HA 1RBZA 4QEZA 3V2IA 4YT4A 4LMPA 3BRWA 3VO9A 1LPPA 4F3KA 1EDEA 1K0UA 1B74A 1TK9A 4FQ7A 4GI3A 5A4AA 3HB1A 2WHYA 4HYQA 3RK0A 3QLUA 5CA0B 3H83A 1Z0JA 2DKFA 1JEAA 1OZFA 1XVVA 2PZFA 3HXLA 2DR0A 3A28A 3DFMA 1DDIA 1J1IA 4BVLA 4ZVPA 5D6NA 1XE3A 2XPCA 4LXXA 3HWX1 1DBQA 1JJVA 3OIFA 4HWTA 1KZ9A 1C8BA 2C2HA 1N2BA 4I7EA 3TZEA 1C7EA 5C46F 3I61A 1W4CA 2N42A 3X1YA 3R0XA 1QPZA 1HTWA 2J32A 2W6OA 3TLGA 4ALIA 4YDQA 5K3EA 3P32A 3AIIA 2WUDA 2JLVA 3DMTA 3VYUB 1FVFA 4XA8A 3ELBA 1MCZA 3K72B 4FFRA 5CTAA 7REQA 4MJ7A 4AL4A 3JQAD 1JDUA 2EL7A 3H84A 1GZUA 2TRSB 1NAHA 1G8FA 1AS0A 4KMRA 1HA3A 2PMEA 1NGSA 4Q00A 1E7SA 1T8YA 4X9XA 1TD9A 1ZGGA 1NNUA 3SN6A 4BBZA 5HW0A 1T5OA 1W36C 1AV7A 3AESB 3WJ1A 3ONNA 4HATA 3HCPA 4P6VF 4Q05A 4EUNA 2BM8A 1FMFA 4Y7DA 1LPOA 2F1JA 3W8EA 3FLBA 4NULA 3NUZA 4XGIA 1GL9B 3WX0A 1CR2A 2YJ4A 4P9NA 2R68A 2CT8A 3TQIA 1ODKA 1P1BA 3FPEA 3OJXA 2C94A 2W6NA 3MJVA 1YVEI 3TTWA 5H8WA 4EKGA 2ZJ8A 3K0HA 2X22A 2AMLA 4O29A 4KUEA 1ZK2A 2H18A 2VAWA 3IGFA 5ED4A 5BYKA 4JCCA 3DWEX 2FH5B 1JDJA 3W7VA 2YIVX 2G06A 5CNMA 3UH0A 1Z4OA 2ECPA 3MMPA 4PYOA 4Y30A 2TMYA 1SQ0A 2YOFA 3HJGA 3I9KA 4P3KA 5JEDA 4PYQA 3DLTA 2V7QD 1OBVA 1EFAA 3AM1A 4QDOA 1KEZA 5BW6B 1O8BA 2B78A 1M54A 1V11A 4XDGA 1U7PA 3W2GA 4BLTA 3VGJA 4XIFA 2D59A 4JYZA 1A2OA 5AIBA 2C4VA 4B6GA 2G04A 2I7TA 2ORIA 2GJ4A 3AEYA 5ENZA 4BC0A 3KHUA 3U4DA 2DH6A 3CIFA 4V0OA 5A4DA 2JIZA 1OWPA 5J59A 3A6LA 5LQDA 4EKDA 4TYNA 1IN1A 1BVHA 1ZRNA 5KYXA 4JP3A 1NBMD 3MBIA 1L5ZA 1Z3IX 2R1VB 2P3LA 1SU6A 3W3AD 4QT0A 5EWLA 3SFVA 4YONB 4YMLA 3T5AA 1ZIXA 1HM5A 1ZCFA 2C3UA 1I5OA 3OAAD 1GG8A 1M66A 3JTEA 1HPLA 2ES4A 1JHXA 3ELUA 4XSGA 4CLRB 3PEUA 3CUEF 1CIVA 4EYSA 1SXPA 1E9EA 3U49A 2P4UA 1K8RA 4KVAA 2CNDA 2RHTA 1E59A 3NKLA 1X1DA 3FI9A 2NMVA 4H7HA 5BN4B 8ATCA 2WIKA 1SHJA 1Y1SA 4F91B 5J2TA 1LQTA 3WB9A 5KOIA 1X8JA 1QRAA 1KAOA 2LGJA 4FP9A 2WWTA 3CIOA 4N6OA 1CTQA 1VZ3A 1ZUNB 3QE3A 3FYSA 4N40A 3SJZA 3AIKA 3SVZA 1U8XX 1U9CA 3UENA 4Z49A 1NVXQ 4MIYA 3IILA 1JW9B 3LQYA 3OECA 2GN0A 1K27A 3DDOA 1CY7A 2GHRA 4UEWA 4G0VA 1ZGZA 3SJUA 3NG1A 1PO7A 1U94A 2R8RA 5JLAA 2XVYA 2NTNA 4PC1A 1UBFA 3JQ9A 4XJVA 3ROGA 3ZDZB 1U1FA 3SVLA 5IM4F 4DWWA 4EHAA 4TKVA 1E6KA 4H7JA 3D9QX 4RPIA 3CS3A 2OFPA 4LJ8A 2CF6A 2Z2XA 2I7VA 4QYWA 4K3VA 4B73A 3W1VA 4RIIA 4B6EA 2GZ3A 4TGLA 2IBTA 2R79A 2IZ5A 2DPYA 2WLTA 3HU3A 3LJKA 5JMPA 4U7DA 2Q9UA 3AB7A 4ID3A 4KRGA 1S8AA 1CR4A 1L5GB 3BT7A 3EUWA 2B7LA 3IOCA 4X00A 1NIJA 2YJGA 3NT2A 4ILKA 5F4ZA 2P2CA 2XE6A 2HJHA 5IKEA 4G0XA 3PA8A 1G0OA 1LCIA 4UPVA 4RGYA 5CM2Z 2PCLA 4BGVA 4K6KA 3RIHA 4KV9A 5BUZA 1QFZA 1FUKA 4JGGA 5ALYA 5KSWB 3TGLA 3U4GA 1JIXA 1YO6A 2CXOA 2EHJA 4ICIA 4JIMA 2BKLA 4BQEA 2EQ5A 1UBMS 2YIMA 4NDNE 3E1GA 1NLYA 1H4SA 3ICCA 2FEWB 4RPHA 2C77A 3WLPA 1HC7A 2GK3A 2W43A 3PD0A 4QYIA 1MQSA 3GEEA 4YQFA 4MHSA 1C7ZA 1GD1O 4LTNA 4X20B 1PG2A 3TZ6A 1KP2A 1N7JA 2V7WA 3CPEA 4BX2A 1W5FA 1VYHA 1M6YA 3AUTA 1CUVA 5B2FA 2I0FA 3D7NA 3DYVA 3FX2A 2RDMA 4EJSA 1TYEB 4L4SA 1I4EB 1VRCA 1JUDA 5J47A 1XEXB 1G3UA 3PE4A 1ADCA 2XKAA 4JLNA 1RWPA 2LXNA 1UKAA 2RBEA 1H2XA 4JP5A 4B3CA 3WB2A 4DE5A 1SD5A 1SBTA 4YVFA 4GVXA 1UJ4A 4K87A 4DLBA 2CXTA 4ERXA 3ZV6A 1TKBA 4X3PA 2C8KA 3HEBA 1PR4A 3WV5A 3U7FB 4HFNA 1RQLA 2OQ2A 2C7QA 1OKKD 4RVGA 2C95A 3I76A 3LQ4A 3ZWBA 3KJGA 2VT3A 4TYYA 1OJ7A 2IDKA 3C8DA 4PQRA 4MUAA 3BXXA 4C21A 1Z2OX 4BJ1A 2ZCVA 3LVBA 3LQKA 3PUIA 4YJKA 4E4TA 1OFIA 3QWBA 1OXTA 3A3PA 3AHIA 4MAMA 4RX1A 5LZ4A 1NUHA 3R7NA 4P7KA 1QGDA 4JT2A 2FW7A 1IHXA 3O8QB 1E3QA 1ZD4A 1OBFO 4KZPA 3EEIA 4G65A 3AGQA 4ND8B 4B6FA 2AMVA 5B3LA 1KEPA 4ZMSA 3ZR4B 5JRZA 1SRRA 1S9DA 1CF4A 3TGWA 4XWTA 2DCUA 1R66A 3MNFA 1JPJA 2R48A 4WFIA 2XGJA 2AR0A 3AJRA 3CW2A 2ZB8A 1ECFA 4GS5A 4PLCA 4UASA 1JR3D 4IHJF 1XV5A 4Y1FA 1R5NA 3CLUD 2X0IA 2Z5FA 3I30X 1GRVA 4RF2A 1LW6E 4KP7A 1QYWA 3IV6A 1NBIA 2QTWB 4KJZA 2CVOA 1GPKA 1XQVA 5JCXA 4FX2A 4TS4A 1YZFA 4QWWA 1SUEA 4GP7A 2E5LB 1E2UA 1U6JA 4NBTA 2PH3A 1I6LA 4C6TB 1O77A 5KI6A 2ZRLA 4BIIA 3H0KA 2YZ7A 5F51A 1F6DA 3VZBA 2ODNA 2XZPA 1T36B 2R8XA 5L40A 2NZWA 2JIOA 2Y1EA 2ZR9A 3OJWA 4H4EA 3RS8A 4CRWB 5KHLB 2ZYDA 2ZSBA 1U9YA 1Q0RA 3ITKA 4QVGA 1L5RA 3DTVA 1XZNA 4M88A 2TMDA 4PZYA 4LOJA 4K9NA 3T12A 3U7EB 2A1UA 2EJBA 2YJZA 4GLJA 1H8ED 1E2LA 3LUHA 5I8ZA 5D5QA 2BDEA 4OU4A 5D1NA 4CMEA 4DMMA 3IV9A 3DQZA 3UT5A 1T8UA 2FX2A 1OX5A 3T6KA 5EEGA 2XB4A 4GF5A 4IILA 1XRPA 1PFQA 3RC3A 2IYXA 4BP1A 2GEDA 3ZHXA 3FRHA 3TFOA 3R5JA 3T5CA 2BLLA 3SYTA 3NDIA 1QZTA 1VDMA 1SA0A 3MOSA 3HKEA 1L1QA 3UAGA 3WGZA 1WDMA 4ENPA 5KKCA 1OFHA 4N0MA 4MRAA 1D2RA 4IUCS 1FYFA 3MJCA 5DCLA 2CLHB 3CUWA 3U4CA 4M98A 3ICWA 1SQ5A 1P61B 2WQ6A 4XDYA 1YCHA 2FHPA 3EW9A 2EKQA 3B5JA 4ZT5A 3SXUA 3ZHBA 1PV2A 3V42A 2MIIA 4HRVA 1II8A 1NF3A 1TO1E 1XWIA 2HLDD 3I72A 4HDNB 4RK0A 4CV0A 4EEKA 3MG9A 1AGPA 1Z26A 1E9CA 3KNZA 4KXWA 5TPZD 3ZJ4A 4AICA 3R77A 5IJAA 4IH4A 2NO9A 1U7TA 3WK5A 2OO5C 2X42A 1I2AA 2ZIVB 3G5UA 3JY6A 4RY9A 4UU1A 1EFPB 3WYFA 3ESQA 4BB6A 2EATA 1KJIA 4S0XA 3CV3A 4KI7A 5SV2A 4QT4A 1F8GA 2X40A 3C6MA 4F1KA 5HGXA 5JYBA 4I5FA 1H94A 2BKEA 4J0FA 4N76A 3CH7A 1H8HA 1PBTA 2ZRFA 4DGSA 2EVWX 3NMUF 3HCEA 2YQ4A 1X0XA 4YAWA 4NFYA 2REOA 3PGVA 5LC1A 1XAJA 5IEJA 4HB4A 4WXEA 5IT9A 3ETCA 3KZOA 2VYNA 5E9AA 3FHCB 3K5HA 1FQJA 3ZWKA 4D9KA 2BHRA 1WB9A 1YJQA 3PGJA 3JYNA 1J2JA 3U3XA 2E4UA 4R7ZA 3EGEA 3V4LA 1SD1A 4IXMA 2X0KA 4M1EA 4KO2S 1MRNA 1OJLA 2V5AA 2UVPA 4Y2TA 1G6KA 4LDQA 3RW9A 3G9QA 2XHEA 3OFKA 3GXOA 1YIDA 3RGWS 4OLBA 3MPOA 4GM4A 1G8YA 1JALA 1A4RA 1SZCA 1IMOA 3M33A 2CL0X 3FROA 1VJTA 4II7A 1L5SA 1B15A 1GVHA 1PZEA 4CKEB 2F3PA 5CBKA 1O89A 1VP3A 3J81A 1NUAA 5CJJA 2I1QA 4CVNA 1N3YA 2PUHA 4FE7A 5CLFA 2BTEA 3X1XA 3QHQA 2WM9B 3MQFA 5TXGA 1KF0A 3HY6A 3JQ7A 2NU9A 4D0GA 4BPBA 1EQAA 1NNSA 1WUKS 4PX9A 3V3KA 4N3NA 4LFAB 16PKA 3CMMA 4WCFA 1S96A 1SUPA 3LCCA 4ROTA 3ITNA 5LP6C 4BKMA 1MV8A 4QPNA 2I7XA 2ZSEA 2FPGA 1Q20A 1F51E 2G80A 5FL3A 3T7AA 2DR2A 4BNLA 1JHMA 1YUBA 4FB5A 1EVYA 1CZNA 5GONF 2V7TA 3QELB 2NADA 4RZQA 1DKMA 1U3VA 2O2XA 3KQWA 3T7KA 5TQVA 1T8PA 1JAXA 3IUSA 3KLBA 4P7GA 1P7ZA 4IKPA 4QHTA 2AZTA 3VDNB 5JAOA 3OU2A 3L7DA 5IMSA 5KYNA 3U7GA 5E9JA 3SMVA 3AZQA 5A5FA 2FR1A 3VHXA 2Z9BA 5YASA 5J3JA 2FVXA 1DQZA 2OD7A 3O4GA 1BHQ1 4HUQB 4HLUA 4LK3A 4DCTA 3E82A 2B7CA 1KAQA 1Z13A 1MO6A 2ZE8A 2ZPTX 4B5LA 4DDUA 5ETJA 4YCBA 4JBXA 1IPHA 3Q0TA 4LOAA 1SG9A 3R0IA 1REQB 3FUCA 3SIWA 3AM4A 4LNHA 3V8EA 3L41A 5D3MB 5B6PA 4M8SA 1EEHA 3O8OB 1F2TA 3ZHYA 2ZIUB 1W36D 2YV5A 2Q50A 1DCTA 1H0SA 3MCUA 5BSWA 1BIFA 5B58T 4KGVA 1EDZA 5LMNB 2WQZA 5HCIA 2RK3A 3GLGA 3ZGYA 2JGEA 4XZ3A 2ZR0A 3PRJA 2JEZA 3QI2A 1LVUA 2ZWOA 2R6AA 4KWEA 3WRYC 4DWJA 2PRSA 3QPBA 5FEMA 3HWRA 1PAUA 3USCS 5EXXA 2HMUA 4U7GA 2NO5A 4JSYA 4ZANA 3H8WA 4BB0A 4Q4AA 1YJCA 2KQUA 3ZH9B 5KO2A 4NCAA 5TQJA 4DJTA 2HWKA 5F3WB 4UCQA 5FL7A 2P2NA 2JH9A 1PZHA 2Q7XA 2IYRA 2ZVPX 5DNCA 3GP5A 2MR6A 7MHTA 5KQPA 2ZJOA 2YJNA 3QVGA 4A82A 2NUAA 3OX3A 1SK8A 5TX7A 4BLRA 4W5TA 3HM9A 3UHJA 1P19A 1ENOA 3ZDXB 3IODA 2WWIA 1L5FA 3RCBA 5LR6A 2H52A 3RF6A 1HNWB 3KX2A 2P8SA 5FQNA 2W2TA 3CCBA 1TM3E 2BFCB 2ZPUA 2XJ4A 3P97A 2A88A 2C2GA 3PT5A 5J63A 3S3TA 1ETHA 1P4GA 2QTMA 3EUAA 4QHSA 2A9FA 3K6RA 4OHBA 1QYVA 1GAXA 1EWKA 2C78A 1ZQ9A 2G1KA 4RAQA 1U9IA 3PD7A 3RYHA 1Z38A 2ZROA 3U4QB 1GT6A 2CLFB 1MC8A 5HRAA 2FZVA 2ZI7A 5FO0A 1G9XA 1I4TD 3GUCA 1Q91A 2ZTLA 2C04A 2AXEA 5FOSA 4F2GA 2RH4A 3SZGA 1WXEA 5CURA 3U3KA 1S01A 3ZVMA 1NM5A 4IXTA 3NI2A 4M1YA 4MLDA 2PMDA 1I7DA 3P9PA 4JEHA 4K3UA 3Q0IA 1JHAA 4Q7LA 1PDOA 1ZUIA 2IV2X 2N75A 1SHUX 2WJJA 1IATA 3I39X 3L5OA 4LX8A 5EMMA 2G82A 3MM4A 4ZVMA 3AP2A 3V7YA 2ZAYA 4GKBA 4N18A 1G5HA 4S1NA 1KDTA 1LGYA 2CFRA 1QH8B 3VR6H 3FF4A 2VLBA 3OTHA 4EPRA 1QG0A 3KUCA 3QUCA 1CR1A 4FN4A 2HCBA 4I55A 4TPKA 3ZE8A 2I6SA 1VYVA 4BQIA 1X7ZA 4NAHA 1OXMA 1JLLA 3H1PA 1CE8B 4NAUA 3R0ZA 4EG5A 1I7NA 1O1YA 2IUSA 1W2HA 2NPIA 3FZQA 3NGXA 1QO0A 5EWMB 3VSDA 4DCVA 4KO1S 2BGLA 3NEAA 5IDXA 1LUAA 1O5OA 4RY8A 2YH2A 3GRPA 1T9CA 3HN6A 1E9BA 3PRHA 1WEKA 4FFBB 4Y7CA 1MRSA 3RABA 3VR2D 5JSYA 2CDBA 1FFHA 4L74A 2M6SA 4NNJA 4M21A 2VLIA 4M9RA 1AK9A 4L4ZA 2IYWA 4U39A 2Q8PA 3EK2A 4RIFA 4C0WA 2XRMA 3BWBA 2EW8A 4FDMA 4W5RA 3VKHA 5IK2A 3E3LA 4QFDA 2VP5A 2NYRA 5D3QA 4IEIA 4BNIA 3A6PC 3LD9A 1NW7A 4E14A 3U4AA 3EGIA 4O6VA 3TVTA 1RVDA 4O5AA 2AN3A 4C0KA 4E5NA 2CNOA 2JHCA 2PH7A 2LTAA 3C3AA 4ND5A 4RSRA 3EMBA 4O4HB 3PXGA 3DLHA 4D0SA 3P7MA 3K0FB 3ZGLA 1PZMA 2Y93A 3TNFA 1USUA 3ZWYA 1QP7A 2UZAA 1P33A 5HA5A 5E7IA 1WHSB 4TWBA 5A0FA 2X0FA 4YUXA 5IH7A 1N78A 3P9KA 4MVJA 2E37A 1JZSA 3KG2A 5TE9A 2FRDC 3I2YX 3ISVA 3KFVA 2VSQA 1NJ6A 4XDHA 3GBPA 3OCCA 1WBJB 3BSWA 2JG3A 1FZTA 1VOTA 3V55A 4ARCA 3BE5A 3AEQB 3LLSA 1Y3FE 1GZ6A 1CUHA 1P73A 3KFXA 3PFWO 3QKUA 4LHEA 1ZRMA 3RRXA 2DUNA 2XTZA 3LX6A 3NHYA 2EZ9A 1NQAO 3UGTA 4DHWA 4BQQA 1WE2A 1MC5A 3AESA 5F52A 1M2GA 3O83A 2XYHA 5COBA 5DNWA 3GRCA 1Q1GA 1N2JA 2R6ZA 1SC9A 2UYGA 3IMKA 5FXMA 4CI0B 4YAIA 1M8KA 4MQEB 4ML3A 4MZDA 5D51S 4DANA 2WYWA 4G0PA 3ZG6A 1UUFA 3JQAB 3R3XA 5DCWA 2GEUA 2O8NA 3EW7A 4NQZA 4QXRA 5C5DA 1KK0A 2IDJA 3K30A 4IZOA 2Y2UA 1U80A 2ODWA 5AM5A 5FD8A 5IYZB 5DGHA 4F84A 1YB2A 3D4BA 1QRSA 4ZO9A 2Z2JA 1GLNA 3UB4A 2BL4A 2OC9A 8OHMA 4L3OA 3SNKA 3IP7A 5FF9A 1NBOA 2PG3A 4XASA 4CCYB 4B79A 2WJAA 5FOQA 1UMCA 4FW8A 2ORED 2ZSJA 3FHOA 2O54A 2X7HA 1CYEA 1MFPA 2ETXA 4NR0A 3P9YA 1TL7C 2WY2D 2QUKA 4R69A 5BSVA 1T9HA 4EKEA 5LXTF 4K26A 3PWTA 1T2UA 2IZOA 4C4YA 4X3CA 2B4QA 3RVRA 4X92A 1RQGA 3UFXB 1DT5A 2HB6A 4BMOB 3V1LA 2RGYA 3OZGA 4ND2A 1GFZA 3NVKI 4P82A 4JWTA 4QBFA 3S2UA 2B7BA 3O8BA 5A04A 1MEOA 5LIRA 3P9CA 4K88A 2WHQA 3HDTA 5LD2C 4PSAA 3K1JA 4IUYA 5I7VA 1XUOA 3HY4A 4FBLA 4KRXA 3OC6A 4GLFA 4HYEA 4WUVA 4BNXA 4EFDA 3A3YA 4RF3A 4M0MA 4CKXA 1K4KA 1HQKA 3OQNA 4CLRA 2PSFA 3SEFA 4DRXB 1XA0A 3L6CA 4QVIA 2NN3C 4QUIA 4FINA 5FNZA 4Q1AA 5CHEA 4RE6A 4DT1B 2CJWA 3SLGA 3KJHA 3DZDA 1YR8A 4NU8X 4OQDA 5BN4A 2HGSA 3CRZA 4FILA 2D7DA 4EB6A 1K6MA 4PN3A 1P2SA 4F2WA 3OCWA 1T25A 3UK7A 2RAUA 3EGDA 4OK3A 4DSZA 2D1TA 1B42A 3BXEA 4OX9B 3A1SA 1X19A 2C4HA 4UBLA 2FEPA 1C1YA 3VR0A 1P4HA 1F0NA 3E4CA 3SF0A 3SLRA 3CXRA 3WLEA 3T3IA 1G4HA 3BGVA 2Y0DA 2Q1WA 4D0NA 1K8XB 4EUSA 1HI9A 3OQHA 4YRDA 4AYTA 1ZXXA 2Q99A 1SWVA 1AMUA 1QOPB 3LA6A 1LNSA 3EYWA 4MIEA 1H4QA 3PUHA 1X3SA 5B4UA 3UAXA 4RIHA 4JT4A 3VJMA 4E5UA 1WDTA 2AC7A 4RACA 1XG5A 4O2BF 1ZA1A 3FCCA 2D0IA 4KNYA 2VOEA 1GRRA 3AU8A 3K16A 3RRNA 3PUJA 3CLTD 4R5HA 1UOQA 3JRNA 1VYUA 3RBVA 5D3KA 3HP4A 3VTZA 1VSUA 1KYWA 4X24A 4Q9LA 4EYKA 1E58A 4HYTA 2IYLD 4WPGA 2NACA 4HRXA 4RENA 1C9JA 2WKWA 5HF5A 3VNAA 4E30A 1RQXA 4I99A 1V3QE 2WV7A 4FEGA 4MUEA 2J3HA 3FPAA 2HAEA 4OYHA 5G41A 3INGA 2VG8A 3RHSA 3NT5A 3KVYA 2D3WA 1CY0A 1XJQA 1ZKMA 2OUIA 3RIXA 1UK9A 3TIFA 4BVKA 3BIFA 2PS9A 1B26A 3DOHA 3ZYCA 1M2WA 1JG3A 1XFDA 2V54A 3BB4A 1ZW6A 2BFAA 2WMDA 2XD4A 5AI5A 4B87A 4BPRA 1LPBB 2ZAGA 4C07A 4CFZA 3THRA 1NVEA 1QDEA 3JR3A 1W9HA 4FUQA 4L07A 3A6GA 5FPYA 5TQ2B 3W9SA 1XALA 3BX1A 3PRYA 4MS4A 3JQ9C 3I9V6 3ORHA 3NHAA 3OY2A 3QEKA 3C8ZA 3LSYA 4OQYA 4U7WA 3RTAA 5DNEA 5HMLA 1GNQA 1Y3AA 2VHYA 4RV9A 5TJHA 3ZXIA 4X20A 5JU6A 4WADA 1AMOA 1LBHA 3UTDA 4LYHA 4KGDA 2XNSA 1BE1A 2P5TB 5KJFA 4Y2PA 4S05A 1LFDB 2ODQA 4C7MA 3HN7A 1E7QA 2CNWA 3PC6A 5LQSA 1M6VB 3R7LA 5EJ9A 1XEXA 4CKBB 4PHTA 2CXNA 2ERXA 2NZVG 1D2AA 3K4HA 2CHQA 4KITB 5CVVA 3F7OA 1EA5A 3HJHA 2XUGA 5F3DA 1CKEA 1CR6A 3IX7A 2B9VA 1AHNA 1WKCA 5J5VA 3EULA 1JH8A 1Y8CA 5LDHA 2H7XA 2I6TA 2ZBVA 2AVNA 2HFKA 3E7PA 1T10A 4FFSA 1L7PA 3R8FA 4DR7B 4YP6A 5I01A 3V1KA 1AHPA 3S44A 1L3CA 4KOEC 2DFNA 1TDJA 1WCIB 4FN5A 4MS1A 4XLZA 1T8SA 3JWGA 4JBWA 2QAGA 3VU0A 3QOYA 4XLTA 1BXRA 4HGOA 4I2NA 4MUMA 2A57A 2OGWA 1OTXA 5LFAA 2J0QA 1XZJA 2YWDA 2PM8A 2Y1OA 3CLSC 2QA5A 2H1RA 4IF6A 3CFYA 3HJRA 1IHUA 4UHJA 1GGKA 3MN1A 4NK5A 3HKBB 3C3MA 3CVOA 1IUOA 3HZZA 3IEPA 3JW8A 4BCBA 3PD1A 4NSNA 3O8QA 4ND8A 2GKGA 4EJSC 1TVEA 5EIXA 1I6MA 3R1IA 5AK0A 2OD9A 2MTBA 3W3ZB 3WGJA 1G5RA 1A72A 2VI5A 3UWMA 1EGHA 4LF9B 3R3SA 5T67A 1FPQA 1GTJ1 3GRFA 2LVBA 4H59A 2H65A 4TTRA 3ROEA 3V8RA 5KHOC 3HJCA 4G8JA 5I6DA 3TD2A 1BEEA 4N5HX 5IT5A 3AL2A 3CJTA 2QDKA 4TSFD 1AKQA 4LV6A 4RA9B 3R8XA 3TQCA 4CBVA 3ZHUA 1GVNB 1XT6A 3NTLA 4W7SA 3X1ZA 3PK0A 3HHPA 3UKDA 3B1YA 2P9HA 1HFJA 2ZUBA 3T3DA 1CY6A 2Q4RA 4C6TA 2YXBA 5K6AA 1VKJA 1WOMA 4KHPB 1I2BA 2PLFA 4QU5A 3V4ZA 1L9XA 1DUIA 4AKHA 1BS9A 2Q5EA 4BBPA 1T36A 1JV2B 4NJMB 2RK6A 3DBOB 5KNBH 1WBDA 5KREA 2I6FA 1YRAA 3NTXA 3QVXA 4OL9A 5FPSA 1X38A 3C3EA 3TINA 4D57A 1U9JA 2M6RA 1EESA 4ZZ0A 4B5KA 4NEGA 3MWDB 2I3BA 5B53A 3PQ3A 2I2FA 4IOLA 1FLVA 1I1HA 3HZRA 3IDQA 4XKJA 4KQHA 4NYMQ 1TJ4A 5T4FA 5I3ZA 2BM0A 2DSNA 4B81A 2G4LA 4BQRA 1CLUA 1RXIA 2AMFA 4Y6SA 3ZBPA 3FOEC 3DOFA 2GGSA 3UVEA 3T7DA 3DEIA 1CHNA 1FDWA 1ZMRA 1IM2A 1LTHR 1PBNA 1TUGA 4YCAA 1DRUA 3TOCA 4D6PA 5EZYF 3CVUA 4A92A 1FJ2A 1TMKA 4DA9A 3NDBB 3ZIUA 5F7ZA 5MN5A 3N2LA 4YJ3A 3P2MA 4YRQA 3VU9A 4PFKA 3OFND 3OQBA 4Y0NA 3T15A 2FU5C 2GJSA 3IJ5A 3RTCA 5CB4A 3O3OB 4XJSA 2JA1A 2PK3A 4HDNA 3QM1A 4X65B 1QGAA 1GPDG 1SOWA 2D4HA 2FUEA 2WK1A 4K9KA 4LCJA 1ANKA 3D6UA 4Y0AA 3R75A 4YYZA 1QVAA 4QDZA 1KS9A 3UKJA 5HJEA 2V7GA 2XQKA 1EFPA 4BQFA 3ESYA 3SQOA 1B0PA 4CMEC 2V8OA 3Q3JB 2P79A 2CZQA 2XE4A 2HDHA 5L8VA 3OIDA 4J0GA 2I4TA 2O0JA 3IJRA 3KZVA 3EPLA 3P9NA 1ZEJA 1Y6FA 1W4RA 2WA1A 1ZINA 3JQQA 2ZQYA 4WOPA 4R2XA 1DU4A 1BS1A 3HVIA 3NBMA 1OROA 4M89A 5THQA 3TOZA 5K0JA 5I5GA 2AFIA 3VKFA 4LYEA 4FNOA 2J1LA 1JZTA 1QCDA 4HI0E 4DMRA 2WFAA 3T3OA 3AF5A 4YMHA 2UXCB 1R50A 2DJIA 4KFCA 2DH5A 3O4IA 1GGNA 2BFNA 4FONA 3PXUA 2VUUA 2HXSA 3DVLA 2WFZA 4UEJA 3HDHA 1F8UA 1D2CA 1U99A 3IS3A 3H4TA 3OEWA 1J8MF 2E6UX 3F96A 1Y34E 3BRSA 1BJTA 5E7QA 1L4KA 1V1JA 2V6FA 1PYOA 3KWMA 4RDXA 1DQPA 3DMGA 1LBEA 3QKWA 4M0KA 4NOMA 4YXWA 3SQMA 4D3FA 4D4JA 4YREA 1G7SA 1DBPA 1UZLA 1XLWA 3STVA 1LSJA 2VATA 4JBYA 3VKWA 1C4WA 4J0DA 3WRWA 5IT4A 3FPSA 1X0VA 4PG6A 3EXG2 4QU9A 4KR7A 1NURA 1N8TA 5DHRA 3ZI4A 5JI3E 3AVVA 2XLCA 3HJAA 1LJLA 3LPDA 4KFRA 1M8JA 4NCNA 2YRFA 4E5KA 4OHCA 3ZCVA 2FV8A 1GZHB 1Z0ZA 3OP1A 1L7MA 5FULA 2NVUB 4C0AC 1XTTA 1A2BA 1OXUA 4OXNA 1A9PA 2OKGA 1BH6A 1NI3A 4JC5A 5IC5A 2AX3A 4WLVA 3ICPA 3OQIB 4XWGA 3K9BA 2XGGA 4N03A 3UK2A 4YDRA 3RC8A 4EY7A 1NVAA 1UJBA 3PLNA 2W11A 4RDCA 2EFYA 1HLFA 1OU0A 2REXB 3OJFA 5TB5A 4A0FA 3AUFA 3QELA 2W2MA 5IF3A 2C5BA 2G67A 3FJ1A 2C57A 3FDIA 4JUFA 1DXHA 4RM2A 4LZJA 4NBLA 3RM3A 3TDNA 4MO9A 1PWYE 1XWWA 3WG9A 4PE5B 3LCUA 3OOHA 4NHEA 3EEFA 4JKYA 3RYFA 2FMFA 1ZH4A 3TSWA 1GUZA 4US2R 1OSNA 5P8WA 1QHGA 5GV8A 1M6HA 3JYHA 4FEAA 1G55A 1RRKA 2EBFX 3KXKA 2V74B 4NV3A 1II0A 2L2QA 4HUQA 1KA9H 4ISBA 3ZHCA 4NCHA 1JHRA 1MX1A 3DS8A 3ANLA 4RTJA 4M99A 5JC1A 3AUXA 2H3HA 3PPIA 4J29A 4BFXA 1KERA 1QM5A 2PVSA 4M1QA 4B47A 5IX8A 2CLCX 3K0AB 4QTZA 4RVOA 5D3MA 5EKDA 3T4XA 3AW8A 1N2GA 1OZGA 3EPRA 1B0AA 3O8OA 1IWBB 3AL3A 4IVNA 4MV4A 4WCFC 4XVHA 3RKSA 4CM4B 2Y1GA 4PYKA 1Z8NA 4W5JA 1P1FA 4CNBA 3L9XA 1F20A 4XD2A 5AJYA 2O8EA 1R00A 3DCYA 1SURA 2P11A 1OBCA 1RWOA 4LXYA 5MFPA 3HCNA 1WEHA 4KC0A 3W4JA 2ZE7A 4OH7A 1IRIA 1IWOA 1X15A 4UDOA 1KEUA 2QWXA 2PZJA 2G9VA 4MV6A 2QBYB 1DC4A 1T26A 1MB4A 1G59A 4MQLA 2I99A 3AJ9A 1MIOB 3P0IA 2LKDA 1J5EB 2AYZA 2BBTA 2Z58A 3K4PA 4DPMA 2UKDA 1QB7A 3R0QA 1II9A 4EI9A 1W5SA 1IBLB 1FP2A 1R88A 3A7EA 4BEVA 1W0KA 2CCJA 1BE8A 2C1XA 4HLUC 1D09A 3DV0B 4OG2A 4AM8A 2BZ0A 4RV4A 4NEQA 4ZAYA 2Q46A 3C3WA 3OU7A 3GEHA 4KYVA 4YRPA 3CUKA 4E0BA 4JU9A 5KSYA 3VYRB 3ZWDA 4D46A 3MGKA 3AF3A 3K94A 2CWDA 2P68A 2F64A 3A1FA 3LLVA 5D00A 4UZFA 1GJRA 4RPGA 4L57A 2Q4EA 4MEAA 2CV2A 1WSDA 2GWHA 2Q62A 3C3CA 1E3DA 1J5XA 3GV0A 2BFCA 3MFYA 2NVBA 3GGSA 3QG1A 4Q9KA 3Q2KA 3OJCA 1DAOA 3SK0A 2DP4E 1X7YB 2GERA 3E84A 4JI4B 2JB9A 1DTWB 4Z6KA 4I50F 2OP0A 5KU7A 1ZBQA 1NRIA 2Z2ZA 2BBOA 2CMHA 1CUGA 1FFEA 1UBSB 1VCIA 2QE7D 3CN7A 1W581 1XAHA 3D3EA 1M8PA 3MAJA 1E79D 4MKHA 5CT4A 3U4QA 4LHSA 4EATA 5MFZA 3ZZ1A 4GPZA 4D8XA 2OQRA 3ABRB 4U0JA 1O54A 3CUVA 5HPYB 4XQEA 4DIMA 4V0MA 4OB8A 1ADYA 2BJVA 1FVXA 1K89A 2CL5A 1YUMA 1KDVA 1QV9A 1G7TA 2N9UA 1J00A 5ILOA 4UARA 2VQDA 4ETMA 3WL6A 2FVYA 4JX9A 3NHBA 2O5CA 3FVVA 4P5DA 5BVHB 2IYOA 4F4IA 1NC3A 4KE6A 4ZI3A 1NJ8A 1YQGA 4CDRA 4QEKA 1CV2A 4CDMA 2BYTA 2W98A 1X74A 4ENRA 3AVQA 1KNQA 2ISSD 1O8CA 3LFHA 1PJ4A 1ESMA 2C2BA 4UNIA 5GAJA 1DNPA 3DUWA 2P9BA 3U0BA 4A0HA 2PV7A 1KWKA 4OCZA 1CE8A 1KNXA 2XBUA 1PD1A 3AVPA 4UC0A 4R84A 4XUGB 5EWMA 4OVKA 3SM3A 2LW7A 4BQSA 4UAJA 2D1QA 4QTYA 3KL2A 5D5PA 1U9IC 2GF2A 1SBHA 2GB4A 3GFFA 3OOWA 1IE3A 2J46A 2Z09A 4FCTA 6NULA 1N75A 1WDLA 4OQQA 4FFBA 4L8FA 2Z43A 4BTVA 4UEOA 5MN4A 8MHTA 2YYYA 4UJ5A 1LTKA 2VK4A 4ZCTA 3SQNA 4UNNA 4DUGA 4EK9A 2O52A 1NM5C 2DPXA 2BPOA 4BQNA 5EFZA 1WS6A 4B09A 3HABA 4F96A 4EO4A 4N1AA 2W2QA 2ZDHA 4M1WA 5IJ0B 1GTZA 3EFBA 3IAM1 1AGXA 3H0CA 1AE1A 2QX8A 3GELA 1IRXA 3I6MA 4HGYA 4PHCA 3FNFA 3WISA 3S55A 4GGMX 1J2YA 5BYJA 1I2DA 1EZ4A 1LZLA 2FKAA 4GI1A 2J45A 4X1YB 3ASVA 4FWBA 3GLVA 1RXWA 521PA 1EMDA 1PR3A 3OOYA 1WHSA 2O6HA 5DNVA 1ULUA 3OD5A 1TU4A 1XDDA 1ZO8A 2EEZA 2XB8A 1YZVA 2WV9A 3B5EA 5EPOA 2AXNA 3ZJUA 4Q3NA 4EA9A 4C7OB 2YTZA 4CMIB 4WVFA 1R2QA 1UMBB 1XEWX 1MKYA 3AEQA 2WHPB 1NF8A 2P30A 2HSZA 3PX3A 3LQQA 2QXYA 2G4CA 5AHXA 2QPOA 3HUDA 1E2QA 5GOTA 1D6SA 1XXHE 1OYYA 3G68A 3WDLA 3ZZNA 4C4RA 2HU8A 4ZGWA 3MCAA 1BEZA 4MQEA 4G1MB 1UZMA 4IH1A 2X8JB 5JNLA 1P81A 2PGDA 2KX7A 1UFRA 3M6IA 3KB1A 4PONA 1JG6A 2XKBA 2ZBEA 1QNLA 4J1SA 1GPUA 2HX1A 4M0CA 4YMSA 3SP1A 1FSPA 5BNFA 3X2SA 2FPPA 2FF7A 2ADMA 2H11A 5IYZA 4U2EA 5L7WA 1SFRA 1GU1A 5KWJA 4ZQGA 1W76A 5DMHA 2WJYA 5F2NA 1LJ8A 2Q4TA 1MAAA 2UV8A 5LMUB 3KU1A 4MUXA 4TZ6A 3WOVA 5JPCA 1XD9A 4RVFA 1Q84A 2D5BA 3KVOA 1VIAA 5K9ZA 1TF2A 5E6SB 1GZVA 2OO7A 3GLTA 4L8LA 2BKAA 1UOOA 2FFHA 2J67A 3KOXA 3N75A 4YI5A 4B3IA 5L6MB 2VJOA 1I13A 2B9EA 3ONDA 2XVXA 3CU5A 1OIWA 5ED0A 3KPWA 2JAPA 4JQOA 3ZGVA 2ZSDA 5KNLA 2FJ0A 1EWVA 4DDVA 2JD1A 2Q4DA 3BD6A 1X39A 4UM9D 2F43A 3K73O 3DEZA 3E3NA 3EH2A 3RVSA 3ANMA 1E2GA 3FE2A 3T1YB 4D9BA 4TTTS 1U0BB 4JYPA 2EKDA 2O8DB 3OJ0A 1KMQA 1X42A 2HLHA 1T35A 2O7VA 2I2WA 2YYAA 3KYCA 4LE1A 5TV2A 2V8BA 3HRHA 1USKA 1QF7A 1G42A 2PVPA 2Q3LA 4KHZA 4F2DA 4KLZA 4D8VA 1YZ3A 4MYRA 3WDKA 4DRXA 4GFDA 3B1VA 4XWYA 3W9UA 1A9YA 1UL1X 4JLUA 5DHPA 3BL8A 1NVGA 2O2GA 3W5IA 1ZPDA 5EIOA 2W5UA 2WAXA 3ILSA 2BCEA 1Z5GA 2I1LA 1G4UR 1JGTA 1GDDA 1DTEA 1ENYA 1GWNA 1HFKA 1GCGA 1KMIY 1MT0A 1NV8A 2OVFA 1P7CA 2QM7A 2RHHA 1YR9A 4W8GA 4ZJPA 2QD1A 4LA4A 4OO3A 1ZYUA 4ZWNA 2Z6AA 3FWPA 1XZCA 1P3DA 3LPAA 3GGDA 1DBWA 3D5QA 1KMNA 4OHRA 4U2BA 5FPKA 5JNVA 2P2SA 2HW8A 2NO0A 2Z98A 4ECAA 2RIRA 1NMQA 2QT0A 4UCFA 2R7LA 1RVV1 1MC1A 2QQGA 4G4JA 4TXHA 2BONA 2O14A 3DXFA 3LWZA 3NM4A 3TPCA 3U09A 1L3IA 1GT91 5EG5A 2A4KA 4IIFA 5CA1F 1B43A 1DMRA 3CKMA 5FI3A 1XWFA 1U7OA 2GJKA 1F0PA 4BC1A 4J0HA 4TLLB 1PQ4A 1INLA 1YH3A 1TQ6A 1C3JA 1SHKA 2PU5A 3IPYA 1WXWA 3OO0A 5ALVA 4EP1A 2DQZA 2FP4B 3O4HA 1AC5A 4IIJF 4RMHA 4YC7A 4E3WA 4NTZA 4K1LA 1E5LA 1P9LA 2GAIA 3NHLA 4IDAA 7GPBA 1QHYA 1XCGB 4FEYA 4ZGGA 4GX2A 2WI8A 2OR3A 3LBNA 3H9JA 3ZW7A 4UVIA 4G37A 2HWUA 4B3GA 2HRZA 1OT5A 3A32A 3BCRA 2G28A 1NSYA 4R2HA 4TS1A 3TL3A 3U7QB 1XROA 4BVBA 4IRUB 1ZITA 2EC5A 3PRKE 5AJTA 3TE7A 2B20A 4HXFB 3V1YA 1IQPA 2CJFA 2QRHA 4RH3A 3ZDEA 4RCYA 5HYVA 4J7CA 2G9QA 2WKQA 1FF9A 4ER0A 2JI4A 2F48A 4O4LB 3L79A 5LUBA 4DSOA 3EYAA 3L8FA 1OVMA 5IAJA 2TYSB 1UQUA 4HGQA 2W2PA 2I4IA 2JH8A 3BYZA 2B94A 3ROKA 2OBMA 4DG5A 3FVRA 3ZTWA 1LLCA 2ACWA 4DEVA 1O0CA 1KRWA 5AHKA 4KDRA 1SG6A 1KOLA 2GDZA 4CKBA 1HFEL 2QVGA 4MW0A 2OMEA 2ZIZA 4LV5B 3FYTA 4H31A 4HVCA 1L4BA 3LNCA 2WWWA 1SHLA 3VU8A 1ZUD1 1NP3A 5JD6A 2DE0X 2VKQA 3C4VA 3QF7A 1JHQA 2HA3A 5J1TB 1XMPA 3V8NA 3CVXA 1WCIA 2HMTA 3M6FA 3OX4A 1A5ZA 1K3UB 2QP4A 2F8LA 1WMFA 4Z3OA 2CCKA 1W8DA 2GPBA 1UC4B 4X97A 4HN2A 3TRJA 2F17A 2AOTB 5J23A 5K6AC 5F77A 2UVDA 1V2HE 1M1UA 2ZREA 3COZA 1YD7A 2J0EA 3HKBA 3JQDA 2CYAA 1RYZA 1Z0FA 5REQB 3BZBA 1JKFA 4WLFA 3SZUA 3THOA 4KLNA 1O6FA 2I4OA 3ZWOA 1DDOA 1QZZA 3WYGA 4LFBB 2EFGA 3IH5A 4L9RA 3WGTA 4R2KA 3FTPA 5L9AA 2WVJA 3LC1O 1CUXA 2DLCX 3VPCA 1OXVA 1AKMA 2V3VA 3FA2A 3KUKA 4RHCA 5K0LA 4DG8A 4RH1A 3BWYA 4CTJA 4GPEA 4DM3A 2BUCA 5BWCA 1Z08A 1W0JA 4BP3A 3OTOB 5D01A 1GFSA 2CLSA 1DXOA 4MUGA 1CRQA 3QYFA 1X1SA 2YIJA 4F3YA 5F12A 1YDEA 1BYIA 3AF4A 4RA9A 1YMQA 3SHTA 1ODIA 2WHEA 2ILTA 3NXKA 4Q02A 3BQMB 3FCEA 4QXPA 7ADHA 2UZ3A 3TJMA 4JI3B 4CCWA 4CM1A 3VPSA 3NNSA 2VF5X 5ENVA 1X2BA 5DCYA 3TIXB 3LS2A 1PEKE 3FJOA 4P98A 3CWZA 1N6LA 4G07A 2A4MA 4BN5A 3O31A 1L4HA 4BMYA 1H1DA 2Z2IA 2YUIA 3K6JA 4G24A 4JOSA 1O7JA 2GYWA 4QDKA 1RKUA 2AWNA 2R5WA 3D59A 3E5HA 3DDUA 4I4NA 4KBYA 4BGEA 2DT5A 5BMVF 1V9SA 4DEXA 5SYNA 1YZQA 3EOAI 3K20A 4QJ5A 2C2WA 3TSAA 1PS0A 3MWDA 1E9FA 1I36A 3ZWXA 4BMVA 2C2OA 5DM2A 2DFTA 2ZSUA 2V4ZA 3PUXA 4RJLA 4UXJA 3I3OA 3GZJA 1Y5RA 1SKQA 4KQWA 4PICA 5F76A 1OC2A 5ITZA 5CW1A 2JFBA 4H6PA 1DQRA 3ZNPA 4A6PA 1R0XA 3F7TA 4J0KA 1PL8A 3TLKA 4K9SA 3Q7PA 3JSXA 4RF5A 4UE6A 3UG6A 1DE0A 1R0WA 4YJ2B 2OGZA 1VHDA 2PX0A 4XSHA 5DLQC 3SEZA 3DKKA 4TVOA 2QVBA 4TS3A 1VGVA 4J07A 4N9QA 2FFQA 3AIMA 4DUPA 3L7YA 3TJZA 3WYEA 3ZV3A 2OHHA 2E7ZA 3KVNA 4BNYA 4IY1A 4DARA 4YRAA 5KYXB 2OXEA 2EQAA 4CMGA 2PFGA 5KIAA 1XTKA 1O94A 4UOQA 3FVWA 5JSKA 1I2MA 4ABYA 4E94A 5A4JA 4LJ6A 2PHZA 1UZNA 3AUJB 3ESRA 2GZ2A 3NS7A 4DCCA 1VBKA 2HLPA 1OXKB 1XC7A 4KUHA 4MX8A 3AILA 5CLQA 4PYMA 3SC6A 1VRVA 3WP0A 3DAPA 4RNCA 4PO9A 3A2LA 2AG1A 1WP4A 4JR2A 4IZHA 1L8XA 1RHJA 3I1YA 1Y4UA 3O4JA 4KFUA 1E9DA 4BFYA 3IBYA 1O0BA 5LB4A 1NRWA 1B6RA 1IY0A 1Z07A 5JQWA 2VTEA 5T6BA 2CSXA 3D81A 1KH2A 2V3WA 3EWSA 4JI8B 1D4OA 1Q0HA 4FIDA 3MD0A 2IOFK 3OU6A 4PR3A 1J8YF 3C39A 3FGPA 1THGA 1I3MA 3CR8A 3HP1A 4IS3A 5K3SA 5E8RA 1O2DA 1B0ZA 2XNDA 1A9QA 4B9EA 2R6DA 4ZYYA 3BSSA 1FYWA 1Z34A 4FDVA 2VF2A 1E1RD 1XRSB 2J08A 4M9QA 1IQRA 3ETHA 4BBJA 5C32A 5JAPA 2QS9A 2FPOA 2JAWA 4RFVA 4AN1A 2I8LA 4ZTZB 1BXZA 1KH3A 3I6BA 1XPJA 3KCQA 4PGFA 1V48A 1H2RS 4F1JA 4RM3A 3F5MA 1DB3A 3PVSA 4HADA 1NKVA 4I3HA 4OAPA 1NE2A 3ZVLA 6LDHA 1T91A 1JBQA 4ZHQF 1S3GA 1RIIA 5DBFA 2BKUA 4RVHA 3EXEB 4G8DA 4HGNA 1DINA 1QE0A 2B34A 2HA0A 1FEZA 2A7QA 3AIOA 3I8XA 3KK0A 4O8CA 3HCCA 3M83A 2NVUA 1NBHA 4YS6A 8LDHA 3L0OA 2NYUA 3R3ZA 2BKVA 4YV0A 1SXHA 3R0JA 5CT9A 4P38A 5FCDA 4BNVA 4HQOA 4R9RA 4ASUD 3D4PA 2IXFA 1QTQA 1UKYA 2IYVA 1RYDA 3OPNA 3IP5A 3ESZA 4TTAA 3Q3IA 2NU8A 4FYYA 5CX1B 3Q3GE 3CB2A 3A4VA 3MTIA 1COWA 1U0RA 2C3MA 4ARUA 3AK4A 5TEVA 2EERA 2Y68A 1P5JA 4CL3A 2ZUCA 4AQ7A 2COEA 1G20B 2ZU6A 3ND7A 1HT0A 4J49A 2Y92A 2QN2A 4LJSA 4ZRNA 2V65A 3QE9Y 1Z56C 1PGNA 1I7SB 4AW9A 1GZDA 1NX9A 3T3EA 3HA2A 3E9QA 2WDZA 1LI7A 2YQ5A 4XYMA 4RLFA 1UAGA 1NAIA 3F4BA 3NBXX 4OOFA 2O8BB 1XN1A 4S0ZA 4QG7A 4EQ6A 3G88A 2OHIA 2XDYA 1QYRA 2GHTA 3EGWA 3K0AA 1UM8A 4H3HB 4JJIA 1P2VA 1HDZA 3QJGA 3O84A 4K7JA 5ALTA 4CM4A 2VUIB 3DE4X 2VTKA 3EDQA 2QN7A 3IQDB 4PZPA 3UV6A 3VC2A 5KNCA 3EZ2A 4D4HA 5J4LA 4R1UA 2AHOA 3I0ZA 3M4JA 5FTNA 3WKCA 5LQMA 5LL6P 1ZOIA 2ZS9A 3KXDA 2H2IA 2X7JA 3A1TA 821PA 1TJNA 2B8WA 5F5LA 3C41J 4TYWA 1CERA 1XJ5A 1QGOA 2A9JA 2LCFA 4EY5A 1R0BA 1JECA 1FK8A 1OI2A 2O4CA 3KWLA 4GBJA 1ZH8A 3K5IA 4QGBA 2XDWA 1RRFA 1SUFA 2B2XA 3ZBUA 4UPDA 4CF4A 1SBIA 4BNKA 4MQFB 1TZKA 2FY8A 1A1SA 3KQYA 2XH8A 4R0NA 4U2CA 4BKPA 5M5BA 2CY0A 5TGDA 2WWRA 4XB6B 3TIGA 4RLQA 3DTTA 3DV0A 1E96A 3K5WA 1KHTA 1ES9A 1AH2A 2CHUA 4V0LA 2A3RA 1ZBDA 1LQ2A 1T3GA 3JATB 1VPEA 3VZCA 3L1IA 1PUIA 1SPBS 1OFUX 2YV3A 3QXSA 2NVOA 1TM5E 4R0VA 1R6BX 2R8BA 3GJQA 1R27A 1JR2A 4K5QA 5HKLA 1Z63A 3I9OA 1ZK3A 3PSHA 2RGWA 3VX4A 1RQ7A 2JI9A 4HPJB 3QXCA 2ZYHA 4Y6LA 2B8EA 3GCGA 3W5JA 4G0QA 1E2MA 1K2VN 4N9WA 1E7YA 1Z83A 1DTWA 2J3IA 2BCGY 1Z45A 4KQKA 4WNYA 5H02A 2YNMA 1A50B 1SY7A 4FCVA 4CDGA 1RE1A 4L02A 5F4BA 4ZICA 5L4LA 2FZKA 1YRBA 3Q11A 2LUOA 4OJMX 1MAWA 1GL6A 4ZMRA 4FYIA 3LIPA 4EA8A 3VKGA 4N12A 2OCIA 3KAPA 1FSZA 2IOFA 1NLFA 4CMHA 1DT3A 1HSZA 3GLFE 1VYTA 1XDBA 4DKXA 5BO5A 3LDFA 4E5PA 3ESBA 4AJNA 2DSTA 3A05A 3A9CA 4C88A 4LSWA 5AKXA 4C1BA 4CG0A 3EGCA 1YC2A 3P4XA 5BVHA 1XEWY 4MVJM 4HOYA 5HCUA 2CFTA 4W5WA 4EHDA 3GHHA 4IFIA 1RLOA 2FGJA 1DBRA 2JRCA 3B3FA 4URZR 3LYAA 1P2BA 3AVYA 3RK4A 5I5EA 4QTXA 1FDOA 3GCXA 3IA2A 3UMMA 2R4UA 3FKSD 4J94A 3LFTA 3N0XA 2A67A 4D9FA 2WF6A 4Z4CA 2NYAA 1BWPA 4LJ9A 3VV3A 2ON6A 4F9EA 4HS9A 3HCRA 4OBWA 3ISJA 2QJOA 4XIGS 5JD5A 1W19A 4OMFG 5LOVF 2B1IA 1QFMA 1KI8A 3GW8A 3UHAA 1Q77A 3V7UA 4TMWA 3R20A 1K9SA 4F5EA 3FOBA 5CGZA 1XKLA 3KKQA 4WBNB 4UULA 2M6KA 1Q0QA 3C5HA 3ZPXA 4XVUA 4IIEA 1ISRA 1XCPA 2WINI 2C8JA 3C70A 3QV2A 5IJ0A 1X7HA 3HDGA 5K8JB 1JE0A 3MJ4A 5DK4A 3UFXA 4A4DA 1IVSA 1EHYA 1A76A 2O5VA 2CHGA 3ZTTA 4QG3A 1X80A 4AF8A 1R8XA 3MUFA 1QYCA 2PJZA 1UKEA 4X1YA 1L5OA 2V9PA 3KB6A 5G3YA 3N7AA 4YWJA 4DA7A 2Q2WA 3FBGA 3PGA1 3IUPA 2GETA 1GPYA 3LX8A 3VMMA 3ZGOA 4OQMA 2PKQO 2DFPA 1POXA 1MO3A 4FLEA 4GM1A 5IVIA 4DC0A 2J9RA 2O50A 3U9TA 1VLMA 3L7JA 2F3TA 4C7OA 2IZ0A 3R44A 1PJAA 1UMBA 4R5MA 3NWJA 5I9NA 5IXYA 3L9WA 3R6TA 1JAZA 3H9GA 1WCWA 2QUZA 4AJ2A 5HQ3B 5M04A 3FSRA 1XELA 5DHTA 5FTLA 1Z28A 4KPFC 3SFTA 4CGYA 4GIBA 4UPEA 4I1SA 4W6QA 2Y1LA 3VOSA 3OZWA 4WKCA 1V35A 3SPXA 4BEJA 2AOXA 4C4XA 2X8JA 4DNXA 2EARA 2HPHA 4REMA 3NOVA 1RM0A 4D4KA 4BBAA 1NX6A 1V7CA 3P26A 2AQHA 3DD5A 2IP2A 5FYDA 3WI7A 5DBOA 1E3JA 5ESRA 5AVSA 1P5HA 3S5JA 2B5OA 1BCRB 1AV6A 1EUDA 3H2JA 4OQPA 2ATVA 3DD1A 3HI4A 3LUCA 2IC5A 3P9IA 2BMVA 2I2BA 1V5FA 1I10A 2B0JA 2W2LD 3O5AA 4RHTA 3HB0A 4BCDA 5B1YA 1PJBA 2BGTA 3L6BA 4EQZA 4V0NA 3PNOA 3ZJVA 1RAFA 2G5GX 1CULC 4JOQA 1Z0DA 1AB6A 3CRQA 3OHMA 2C9CA 5CH8A 2RI6A 2VSXA 2R0QC 1DRKA 3UJCA 1CP2A 3PFHA 4GGPA 2BGGA 1QIMA 1Y8ZA 3DSRA 4XPZA 4UBKA 2C97A 5L4NA 4L9AA 1B6TA 4RS4A 1EFKA 3L8HA 1OHHA 1G9SA 1RWKA 3FTNA 1ZGHA 1YL7A 3G89A 4LK2A 1QS0B 5JISA 2VJYA 3UC9A 4F9FA 5J4HA 2GAOA 2Y99A 4QSMA 2CLOB 1WVGA 3LPCA 4Z9FA 5EXPA 2QMZA 5EJAA 1GU0A 1WQ4A 3CEAA 4W5QA 4MPPA 4JMPA 3BREA 1EE9A 2C7VA 3RVJA 1YVUA 4PO8A 4WCVA 3MF4A 2A5DA 3THXB 4CLHA 1X14A 2Q1YA 3CN9A 3ZD7A 3N07A 3NTOA 4QXQA 1KOJA 4ZVUA 3EVEA 1E1NA 2JFHA 3FZNA 3PL1A 4UM9B 1IN7A 4UHHA 3DE7X 4NLLA 4ZVLA 2WVGA 3G2IA 1W88B 2ZULA 1XZGA 2X5JO 1SZDA 3PEEA 4L6CA 4R54A 5ESXA 5F78A 4MR8B 5JTTA 1I14A 4RTNA 5K3DA 1MRZA 4F46A 3HVHA 3L6EA 1T6XA 3ZBQA 4G26A 3DBIA 4EMBA 1E6MA 3SBDA 1AN0A 1S2MA 3BGIA 5HBGA 3QWFA 1P4SA 4BO6A 1TK2A 2VSYA 1E32A 3AUAA 4P80A 4Q4DA 2Q21A 3INTA 1T9GS 1LJUA 3OE1A 1DAFA 4L4XA 4US0R 4HRYA 2PY6A 1F38A 1QP0A 4Q4CA 2NQ2C 3EMKA 1PS8A 1U28A 5KTOA 1U1CA 2B4TO 2O2YA 1DQYA 2RGDA 4X6UA 1ST3A 2R6HA 5SICE 4CDNA 2AMYA 4TROA 4P4UA 3LHIA 4IXNA 4TXMA 4JI7B 2ZYTX 3I92A 5LBTA 4GNKA 1Z47A 4DB2A 5HE9A 3K0CA 3A3NA 1PWXA 2RFLA 1P1IA 4L5CA 4AURA 4AULA 4C0HA 1G5FA 3OM1A 1AHHA 1H5UA 3O3MB 3WNZA 3HKCA 5HJ2A 1U0SY 1NBAA 621PA 2UZ0A 3PKIA 1GPAA 2X5KO 2ZITA 3I2FA 5T57A 3U7QA 1YKGA 4RHFA 1V37A 2CVPA 1E0KA 1L6IA 4UUOA 5LNK1 3D8RA 3FSGA 2ARKA 5LZ7A 4EL0A 3W4IA 5CEEA 2CXRA 5BR7A 5TARA 3LW8A 4JX8A 5CH3A 5EZQA 2YXPX 1ISHA 2EKPA 4R9VA 4KU4A 5KWIA 3BFJA 5JV5A 3PUZA 4H6VA 1JQJC 2GFQA 3EQ2A 1P7VA 3NEPX 1QIDA 1GFWA 5ELMA 2HN9A 3S2SA 3DTYA 5HEKA 3OEYA 3TOSA 1R0CA 1U3WA 2QENA 1WXFA 4HNGA 5JCZA 2C1EA 1XSEA 4EPXA 5AUQA 3AF2A 3EGXB 2A8YA 4OHPA 4QO8A 1BMDA 2Z5GA 4QYTA 4WGGA 3INRA 1IEVA 4I8XA 4KNVA 1C0LA 2A0YA 4PBSA 2YWGA 4TM8A 3U61B 1P5ZB 2KLHA 1FQKA 3U1TA 1J20A 2J87A 2EBHX 1KR5A 4IDOA 2GPTA 2BFDB 5L53A 2FQYA 4Q4JB 3G9UA 2J6HA 1QZUA 3PCRB 3L1JA 4NAVA 4L27A 4PFSA 1JIJA 1XTZA 1Z8DA 3EY4A 4NVRA 4Q1FA 2PZEA 2H1LA 1EK6A 1KP3A 1ND5A 4XQCA 3S6JA 3L0IB 4UZEA 5KYUB 1OXXK 1SCQA 3ABOB 2PZBA 3E2MA 2WUEA 1FTSA 1DPGA 1WW3A 4D2IA 1UJ5A 3GEDA 3O1JC 4MV0A 2UUAB 1CIPA 1W48A 3KAQA 3OE5A 2UUCB 2HA5A 3B1JA 1VKHA 3AB3A 3O9MA 1MJGA 1LDGA 1GEGA 4M0FA 5K2MA 3WLJA 3AXSA 1YL5A 2AOTA 4BO1A 5CX4A 4KDCA 3V1MA 1EIZA 2A2ZA 2ZYIA 2F8TA 4DJJA 4EUFA 1HGXA 1WABA 3E9RA 2PRKA 4H15A 3FMIA 4KQJA 4GMFA 4F4UA 3ADDA 1E3EA 2G7ZA 2P91A 1G7RA 2XQVA 4J03A 2Y1XA 3AY0A 3ABZA 1GL3A 5CDGA 4MP3A 1R0ZA 4E33A 3I4LA 2O19A 1I94B 2QGFA 5A71A 2NXWA 421PA 4AKSA 1F1BA 4R41A 1B2RA 4LI0A 4DQUA 4PQYA 2Z3ZA 1P4JA 1L5HB 3DKRA 4GMDA 2BEKA 5BOVA 1K3TA 1N9ZA 4K9OA 2WHRA 2W6ID 4O1IA 4PSKA 5K20A 1WUIS 4LUCA 1SKBA 1FX1A 1NFRA 2AYYA 5K0CA 4YR7A 1DCKA 3DW1X 1EK1A 4DJFC 3LDAA 1W7AA 3EZFA 3M6MD 5ADHA 3URKA 2BGWA 3LDHA 4PLPA 1LC3A 3IA7A 2JZCA 2PXXA 1U4NA 1LNQA 1NQOA 2H4JA 3ETNA 4REOA 1WNFA 3MT0A 4GOJA 4CLOB 4PV7A 4M53A 3TIIA 4GI2A 3F1LA 4L78A 2A9QA 3AR9A 3C7AA 4CLEA 1IHYA 4FZRA 4LF7B 5IDVA 2GWRA 3EMVA 4FOOA 1ZEMA 4LXTA 1FFSA 5TQ0B 3A70A 1OGJA 2OBYA 2C99A 1WY5A 1G6HA 1PWHA 4XDZA 1C2TA 2WPDD 1Q5PA 3CGGA 1VB5A 4YJ2A 1K1EA 1YTLA 3OQVA 1KWGA 5B58C 4B40A 3COPA 1D0IA 4NZOA 5KZMB 3RUFA 5LDDC 2FPRA 2VDOB 4QGSA 5C5CA 3UJHA 2YW2A 4H1HA 4L5IA 5GP1A 3PC7A 3GJ8A 1UDXA 4N54A 4S2EA 1EBUA 2C5LA 4BYMA 3O91A 3LT5A 2PX5A 2JFVA 2FN4A 4MPJA 4DY6A 3R76A 2H1VA 2C88A 4FLFA 2X23A 2R1UA 1EK0A 5GY7A 5BR8B 3ESCA 1HX7A 1RQRA 4MDFA 1NYLA 1SGWA 1TXGA 2FF5A 1R6AA 4WOBA 1KKUA 3V1NA 1IK6A 4BNTA 3DL0A 3QZUA 4IJ5A 4U7JA 2P9ZA 4NENB 3NEJA 3KJFA 3EIWA 3BDIA 5BN1A 1XA4A 4CEHB 1KGSA 1XZPA 2XW6A 1M6WA 1ONBA 1QMGA 3GVCA 1E9RA 1G2PA 5AQEA 3JCZA 2KMLA 3QJ5A 3QQPA 3DM5A 2ZWIA 4Y2GA 4GVLA 1KBZA 4IVRA 4WKNA 1EWQA 1ZJZA 2WFLB 3AI7A 2LE0A 5CFNA 3VU1A 4KR6A 2J7KA 3ZCXA 2I87A 4AJOA 3AY7A 2WBLC 1RYFA 2HLNA 3OLZA 3RVBA 2AFVA 3W5CA 5EHNA 1TQ2A 4MYHA 5AM1A 1PJLA 4YTEA 1FY2A 3D8SA 4JLVA 2OSBA 3DBHB 5G2OA 3Q8XB 3PNYA 1V1MB 3WRVA 4RKRA 1YR3A 3PC2A 4JJEA 4DA8A 1D07A 4DV5B 1ZHFA 1KPHA 2EKZA 3H3JA 2QU8A 2QAIA 3NAGA 3WLAA 3TGPA 5DZSA 3IXLA 4NH4A 4I66A 5JTUA 2I1WA 1CUZA 3G0IA 1OAOA 3NJ8A 5DO9A 1N2XA 5AVQA 1FDSA 3CINA 2VP2A 3QPWA 2FPIA 5I7RA 5ARDA 4O4IB 2ZJ0A 4QJIA 4TMZA 1U11A 4UAUA 1Z6ZA 4O4JB 2KBEA 1UBLS 3EXEA 5HZHA 5EMNA 2C5EA 3MSXA 3E4DA 4LZNA 2JGRA 3BE4A 1B7GO 1KQFA 5K0GA 3EFHA 4R31A 1J4AA 3L92A 4B4VA 3I2HA 4HPXB 1JVNA 4L1KA 3ETGA 1KSGA 1EVEA 4AJHA