2HWWA

Structure of pin domain of human smg6
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
180
structure length
160
Chain Sequence
MELEIRPLFLVPDTNGFIDHLASLARLLESRKYILVVPLIVINELDGLAKGAGGYARVVQEKARKSIEFLEQRFESRDSCLRALTSRGNELESIAFRSENNDDLILSCCLHYCKDKAKDFMIRLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Telomerase-binding protein EST1A
publication title Structures of the PIN domains of SMG6 and SMG5 reveal a nuclease within the mRNA surveillance complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 160
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13638 PIN_4 PIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 2hwwA00
4CHGA 1Y82A 3QEBZ 5ED0A 3I8OA 3DBOB 3ZD9A 5HMMA 5K8JB 1A76A 1UT8A 3H8WA 1BGXT 2IZOA 1MC8A 3ORYA 1V96A 4XGRA 5ECDA 5HP4A 3QE9Y 3H87A 5ECYA 3ZDDA 2IHNA 3H8JA 1YE5A 1V8OA 4XGQA 5HNKA 2BSQA 4MJ7A 1A77A 1UL1X 3QEAZ 1V8PA 1W8IA 3ZD8A 2HWWA 3Q8KA 5FV7A 1O4WA 2H1CA 3Q8MA 1EXNA 3ZVKA 3ZDEA 1XO1A 2DOKA 1TAUA 4WA8A 1TAQA 2WP8J 1B43A 5SV2A 3H7IA 2HWXA 5L6LB 1TFRA 3H8SA 3ZDBA 3ZDCA 1UT5A 3ZDAA 2QIPA 2MDTA 1RXVA 2H1OA 5H4HA 5ECWA 5HMLA 2FE1A 5L6MB 5H4GA 1RXWA 2HWYA 3Q8LA 2LCQA 3TNDA 3IX7A
chains in the Genus database with same CATH superfamily
4BX2A 3V1LA 3N8GA 3B1ZA 3CQ9A 2D7DA 3L6CA 2O14A 5DBOA 3TG8A 1N2CE 1N5MA 2O0MA 4QARA 1TT5B 5DBEX 5IAKA 1KGSA 3GG9A 3C7AA 3T3MB 1ZHHA 2X6RA 1UMBB 4MEBA 5BVGB 2GBPA 4K1LA 4KVGA 2YH2A 4QGSA 5JAOA 4C78A 3GLIE 3WSVA 1L9KA 1B26A 1GQSA 3VH1A 3BWVA 3G85A 4IXDA 5BNZA 5LUAA 1GA6A 1SU6A 1GKLA 2IW3A 4O5AA 4CTKA 3ZQ6A 3EQ2A 1XA4A 4C1NA 2UZ1A 1NZDA 3M1LA 2R3SA 1QRRA 5CP8A 3GNQA 3C3WA 3M81A 3N8DA 2ODQA 3EWIA 3PNKA 1M8PA 3TW8B 5CYGA 1OYOA 2IHBA 3DGEC 1IUPA 3ITEA 2XD4A 4EGAA 1TF7A 1XVLA 1G3IA 1RCTE 2OD2A 3WNVA 1DBWA 4PGGA 1C7ZA 3OM0A 1MTOA 4IDPA 4LC1A 5IDVA 2WD7A 2H4WA 3F5SA 1D4OA 3KYBA 3N70A 3SSMA 1GPUA 2YHAA 3K2BA 4EJSC 5DLQC 5KB3A 1FTSA 3QBTA 2EKPA 3BEDA 4DPLA 3O74A 1N8NA 3KVOA 4LDQA 4KIGA 3RAFC 2IHNA 1X8LA 2FX5A 2PXCA 5CR9A 2RCNA 1IY2A 1Q50A 3DAPA 3R6GA 3MT7A 4BVEA 5L9AA 1M1NB 5IF9A 5LXTF 5MDHA 4YRKA 3A1CA 1MW8X 1FQJA 4N5LA 1KO8A 5BUZA 3OAAD 1NAIA 2GKSA 1DBRA 5IMSA 3RFFA 1GPAA 4I50F 3ADKA 2EZ4A 2RFLA 3WGTA 3FG9A 3DQZA 3UVEA 2SHKA 3ZUGA 2W2QA 4UJ3A 4D82A 4GKBA 1M1UA 1QH1A 2ILTA 4ZV7A 1BX3A 1TVEA 3F7TA 2NT4A 4PAGA 2IV7A 4U4AA 4OLBA 3BSYA 4UCFA 1R4NA 3EMBA 3GJ3A 3EZFA 4MI6A 3D8SA 4L2IA 2C42A 2LIVA 5KOYA 1QOPB 4QYXA 3KB6A 1X86B 2XT0A 3K31A 3GFQA 3MTDA 4JUFA 3NKVA 1V4VA 3RC7A 4HATA 1ZMTA 5TSDA 5EMNA 3HKEA 4JEUA 4F9TA 2V5VA 2VYNA 4RHFA 2GJ4A 2Y77A 3EEOA 3JVDA 1XZAA 4OUKX 4DCPA 1YKSA 4IV8A 4N5HX 2ZZNA 1YBFA 2WUDA 1H3NA 1VPDA 2J5KA 1ORTA 2W8ZA 4NCJA 2VT6A 3E58A 2WM2A 3NVMB 5IKMA 1M2HA 5D51S 3B70A 4MV7A 3C0KA 1C1HA 2CDNA 1F8YA 1WDKA 1VYVA 1NPDA 1VBNA 1CLUA 2QIOA 1U2DC 3OQJA 1IEWA 2GDJA 3A32A 2UUPA 4F92B 3A04A 3E9CA 2CFRA 2GHIA 4N5NA 3ZQ4A 4BKRA 1KDYA 1B3BA 3MRTA 3ILVA 2A5YB 3RHZA 5EVJA 4TMFA 1C9NA 1P29A 3DTYA 2Z6QA 2HRBA 4KV7A 5IAEA 1JU9A 1NY6A 1XZBA 2BKUA 3LQ1A 2UYGA 2JIPA 2YMMA 1T3TA 4L22A 3URKA 3KQYA 1KVRA 3ZV7A 1AKNA 2JFWA 3H9BA 5D7NA 2I3GA 4DM3A 4RWEA 3DTVD 2P0AA 1CZNA 2EJTA 3DV0B 3KKMA 5CW1A 4ARUA 1Z22A 3ZXSA 1P5RA 4L72A 2ST1A 3HA2A 5CNJA 3SZLA 4MR8A 5JLJA 4DB4A 2I65A 2WQZA 3RBAA 1E1QA 1FBTA 4BLVA 1GL3A 1RXYA 2PFGA 2JCSA 1KJ8A 3UYLA 2E89A 4PTLA 3GRPA 5JXJA 3ET4A 1DJNA 1JDJA 2I2WA 3A14A 3FSGA 3BGSA 1AQ6A 4KGVA 5BN1A 1Y4DE 5C1PA 1T6ZA 3I52A 4MRPA 5IKPA 5K2OA 1Z5WA 3HDQA 2EKZA 1RAAA 1A5SB 4YEDA 2A9KA 3ONDA 3SXUA 2ECFA 4BWYA 5LBUA 2AF4C 4UEQA 4WNAB 3UOAB 3UXEA 4EHDA 2M9MA 4X7MA 4UHFA 4AJEA 1T4DA 1BKDR 1NQTA 1UXHA 1EDEA 3EVFA 3AVWA 2B98A 2PX2A 1OZHA 1WF3A 3NS7A 3TFOA 1T4BA 1T0BA 1YV9A 3EXFB 3OJEA 3X1JA 2PG3A 3DONA 2YJ4A 2HK8A 4ZXPA 4LWOA 1ZC3A 2ON6A 4JJIA 3BWMA 5B6IA 2EWMA 5A06A 1D2CA 4WX2B 4RHEA 4QDUA 4AY2A 1JBEA 4M7PA 5LNK1 2P9JA 4US1R 2DHRA 4N65A 3LW7A 4URYR 2PBRA 3IR6A 4YJ2B 3OA0A 3AFGA 5IBRA 4BMYA 2R5NA 4QDTA 2XW6A 3CVOA 1U3FA 1P17A 3M4YA 2Q5JA 4LSMA 4M99A 4FBLA 1Y34E 5AVJA 3LBFA 2X4LA 1H3FA 3ZCPA 2OM6A 4K81B 5EINA 3C39A 4WK4B 4FD3A 4R2LA 5HZMA 2GN2A 1PSZA 3BPSA 1NMYA 1CJVC 3IDOA 4Q1FA 5EJIA 3X2EA 2W2PA 1T5HX 4EATA 1O6BA 4IQFA 4MB0A 4OHBA 4X8HA 4EJ6A 2OENG 5C8XA 4B9EA 2BHNA 3FRJA 1DKRA 1IUKA 3BL8A 3DLCA 1LDBA 1OBHA 1R6DA 1SUWA 3O38A 4PC1A 3UBMA 2XDAA 1U28A 2HV8A 1Z8HA 3NVDA 4YYEA 3LVBA 2JBWA 3TZEA 1L4GA 3MXTA 2ZJ7A 4B35A 5SZHB 5GONF 4IQ0A 4LJLA 4S0ZA 1XA3A 2W6OA 3Q3GE 3SJCA 4ZCSA 4KOEC 2V6BA 1S2DA 3DD5A 1VG0B 2WJHA 2W00A 3KU4A 3SF8B 2W43A 4QOGA 4KQMA 5LQMA 4RADA 2JD0A 4F04A 5K0ZA 3AETB 3U9SA 4AC9A 4EA9A 4YDRA 1VL8A 3R5SA 1T9CA 2Y1DA 2RE8A 4XQCA 4YBZA 3N07A 1Z7YA 4LYEA 4JDUA 1Q91A 2ETXA 3OU2A 4R9SA 3U9LA 4JELA 2AUMA 4KU4A 4BOYA 1ZVJA 3BB1A 1X2EA 3L5KA 4B4DA 2CJYA 3OT1B 4BNFA 1DIAA 1UAGA 4EOGA 1B14A 1W75A 4B3FX 1V5FA 3JRXA 5ICCA 1WXDA 4NU0A 1KZ1A 3KUUA 2W7TA 1G4UR 4K6OA 3RS3A 1DS6A 4A0SA 1YA4A 3HGMA 1N32B 5EXDA 1K8RA 1C3XA 1TIKA 1PDOA 1Z4OA 4IP0A 1EAYA 1QZXA 5H9WA 2GB4A 5BUQA 2PAAA 1L5QA 1TZMA 2XYPA 3GQBA 3P0JA 4HN9A 4G0MA 3FIUA 1LK0A 4PTYA 4E31A 4B45A 3P9NA 2Q49A 5DYWA 1NPTO 1NPYA 1O95D 4A27A 5ICSA 1VZ3A 1AX9A 4O0MA 1AM4D 1DP4A 1EXMA 4HP8A 1B8OA 3UPTA 1DC4A 4DVGA 2ZE5A 1E5TA 2YWFA 3FHLA 1GPYA 1SEVA 1SQSA 3UCEA 4PO3X 4BIMA 4RY9A 4YR7A 4RVUA 2MINB 2JKYA 4P92A 2DETA 1E1CB 2W22A 1K27A 3MTJA 1D5CA 4A2CA 5I8ZA 4G8JA 2JKZA 4MWEA 1AKEA 3RIMA 1XNGA 4MAMA 2WJYA 4AS3A 1S2NA 3VR2A 1K06A 3JD1A 1I9CA 3R44A 3W2IA 5I7AA 1NBWB 3UAZA 5ADVA 1Q20A 2CNKA 4KTTE 1AH2A 2O7SA 2XITA 4RKEA 4UHBA 4JYPA 4UEJA 1W4LA 5LZ8A 2ZYDA 1Q7CA 4G0NA 4N4AA 3DZBA 1A7UA 5LZ7A 1ONPA 3SZ3A 1U1CA 1F7UA 4BMOB 3C3XA 1BGWA 1LBQA 2QLLA 3VPGA 2ECQA 4FQ8A 3Q98A 3QFTA 3IIKA 4UXIA 1MB3A 1NV9A 3HM2A 5BOVA 3AQIA 1VZ2A 4C07A 3E61A 1J1ZA 4FJ1A 2FPLA 3T35A 5MN6A 3VC1A 3ZDFA 5IDXA 5E8JA 4FWTA 3VHRA 5IRCD 1AQJA 4XSGA 2ZBRA 4HH3C 1OI4A 5KUTA 3G6KA 5AHRA 4XSVA 2HMWA 3H05A 3G2NA 4MV6A 1TE2A 3WYFA 3ZKWB 2EF0A 2WYHA 4CMIA 4HQFA 3A9SA 3R9XB 1A5TA 2D3WA 3O1JC 3C5WP 1MQSA 4KWTA 2PKCA 2NO9A 2ZDHA 4FFBB 4K6KA 2XKKA 5M5BA 1GZVA 4I9UA 3ZZTA 4PYNA 4QXPA 3E9EA 2C84A 2IPOA 4EAAA 3TTYA 4Q0MA 5LPNA 1AS0A 1LDGA 4X5OA 5HIMA 3ZV4A 4YUZA 3OKCA 4BL5A 2CZGA 1DTWB 3F9RA 4FMDB 5FR2A 5BSUA 2GCGA 4PV7A 3U6BA 2UUCB 2GJ8A 1XCBA 1ZI9A 2VDPB 1U0LA 4KPUA 2WIDA 3K20A 2WIFA 3THWB 5F3WB 2C3PA 1GGJA 4IMPA 4M1TA 1F6BA 1EUZA 2CXXA 2C95A 1P61B 3MPUA 4ZC8A 3OA2A 3G5MA 3PXGA 1G1AA 3CG0A 4NV3A 2B6NA 5TLSA 2X0KA 3R3UA 5BOSA 1F0YA 2DWOA 3IVXA 5KWIA 1V11B 2QTZA 1JMYA 4XVHA 2Q4TA 3SHQA 4KQGA 4WEQA 3DMNA 2YVQA 2QY6A 1JHPA 3OM1A 3PRJA 4O2RA 4TPKA 1OZ0A 1NXXA 1QBGA 2FR0A 5IKOA 1E6MA 2GXAA 3DLAA 4N9QA 4YRBA 5DULA 3RANA 1U0JA 3EA4A 4YJ3F 1DG1G 1UPCA 3LPCA 5ILOA 1WB4A 3S8YA 2WK1A 1CDEA 1U2GA 2C4MA 2QR2A 3PFFA 4UDXX 5BYBA 4OEHA 4F11A 2H57A 2Q3HA 2ZRHA 1CEEA 3VPCA 3OC0A 2IU0A 3VZPA 2YV2A 2Q3LA 3D6NB 5CAEB 3OY7A 3H1GA 5JD3A 1R8XA 3NAZA 2GPYA 4MP8A 3VHXB 1XDZA 1YRHA 2VLBA 3K72B 3T3IA 1DEHA 3ANXA 4BGUA 1YASA 1N34B 4QGBA 1F2TA 5JQWA 3NHMA 4M4SA 1UH5A 3THRA 4KLRA 2FPRA 3G13A 1KMMA 3LT1A 1EDOA 4ZVTA 3AZOA 3AOGA 1Y9DA 1Y1TA 1YC2A 4FEGA 1BX0A 3LFTA 4MKGA 2TMYA 4MP3A 3RUDA 1IATA 1YVPA 2A9OA 2CBGA 4ZT4A 5AXAA 3V8PA 3KU1A 2AHOA 2AZDA 4FBMA 3CCCA 4E2FA 1E20A 3QXJA 2WD8A 4CF5A 3C8HA 1WETA 4OHRA 2DQYA 3FE2A 1MG5A 2FWAA 2PTGA 1SBNE 4XGKA 1KE1A 4C0QC 1CS0B 4JP3A 4DPKA 1J22A 4MQ4A 1EBUA 3GLHE 1X7ZA 4NJMB 4PPQA 3WMXA 1N0VC 2Q5HA 3OO0A 4PLGA 2OBNA 2V6MA 3HWRA 3D5EA 3Q40A 2IU3A 4BFCA 4NBWA 3WP1B 3JQPA 4DEYA 3NHUA 4YJDA 3KJHA 5GGYA 1NVEA 1U80A 1WUHS 2F3PA 4TYWA 3DWFA 3ZWQA 1TW2A 2QL9A 1YOBA 3MA0A 2WFMA 4CNQA 4X85A 3VKFA 4CGZA 1AZLA 1OPXA 2B3TA 1Q0QA 3P2YA 4JR1A 3S2UA 2OORA 3FTPA 1TU0A 3OFNA 4CLEA 1UPXA 4F9FA 1Q7EA 3A1UA 3KZXA 2B0JA 4QYMA 4BJHB 5HRAA 2HMAA 2UVQA 4IDEA 1P62B 5D1HA 1P1JA 1UC9A 4GSYA 4AN1A 2E4UA 3C8UA 1GAEO 3JQ7B 4WNYA 1PK9A 1UC4B 4CG3A 2ONJA 2BCGY 3V4OA 3MGGA 1U02A 3B5IA 1P8JA 3E70C 5JDIC 1R5JA 2IY9A 1KVTA 4WOCA 3VOSA 5JZ9A 1U3WA 3PQ4A 4Y2XA 5KTKA 1FYXA 1CEYA 4GX2A 3AVYA 3HKCA 3OCZA 2XB4A 2PU5A 4YDHB 4F45A 4MGIR 3A4VA 1PL6A 4C06A 1KI6A 1WPRA 4KR2A 3HRKA 1PD0A 3C1OA 3DBRB 3UT5B 1QKIA 1TYAE 3D6TB 3IJRA 1N1MA 1Z0DA 4IXNA 3NDRA 4DZZA 2ADMA 2AXQA 1THTA 2OG2A 1F20A 3EGDB 4GLLA 3V8VA 2AMYA 4R1UA 4AJ1A 3W78A 2G0NA 3WL5A 1UP6A 2E7ZA 4J1TA 2JLUA 2XCTB 2R1TB 3JQGB 1GSOA 1PFUA 2NVBA 4XYLA 4KPEC 4PO9A 3AFOA 3OUZA 2XMRA 4X60A 4LV8B 3T9AA 1Y9ZA 2DUMA 4J2HA 2UZIR 1P6UA 1A7JA 1Y1SA 2P2LA 2YS7A 4XUCA 3OIYA 4Z51A 5DN6D 4BATA 1QC5B 5KIAA 1UPUA 1L5OA 1NMEA 4B6FA 1XRLA 1OFIA 1YULA 2OGZA 3EEFA 3N2GA 2A84A 2O7VA 4UUPA 5B58C 4GNRA 1IY0A 3K9WA 4C0AC 2VZ0A 2R87A 3U31A 1BCRB 5EIBC 3AU8A 3ONVA 4YRMA 1OH6A 5K6AA 1Q19A 3ORHA 2IE0A 4XKJA 5F12A 5EA2A 3I53A 5JV5A 4FCTA 1YS7A 4ZJZA 1FDWA 5T67A 1YR9A 2R25B 4HAYA 4RM2A 1YB1A 2TYSB 3DEZA 1E0DA 1JT2A 3U6KA 2VK2A 1EA7A 3A31A 1XF9A 1IHDA 1U7PA 4M86A 3U1VA 1LLFA 4I1UA 2QXUA 1HDCA 3AJ8A 1YQTA 1ZN9A 1GUBA 2CXUA 2IJGX 3PUHA 4U2FA 2IBTA 3R5TA 3OQPA 2CV1A 1YVUA 3ABZA 3L4BC 4LIPD 5CJ2A 3ZIUA 3BE6A 4BQIA 4ALNA 3RABA 4NMHA 5ED0A 3AVUA 3A2MA 4MVJD 5CFPA 3OIUA 4LXYA 1P74A 3MC1A 2HPZA 5AKYA 3SIRA 5AM3A 2C61A 3E6AA 2IYSA 2ZU0C 1TGYA 2I7VA 3PI7A 4P2GA 5GJBA 4F56A 2BI8A 4C0BA 3U4CA 2XUAA 3GCGA 4YRFA 3U4QA 1Q21A 4MOWA 1AMOA 3BIWA 1JJFA 1ZICA 5EJ4A 1YK0A 1ONBA 4MQFA 3V2GA 3U44B 4WZAA 1RI2A 4P4LA 3LY9A 4S35A 1SQGA 1ZUD1 2CYAA 2EP8A 3INNA 1J97A 2O2JA 1OROA 4ZZ1A 2Z8XA 3BORA 1UMDB 1QGYA 3C15C 1PJSA 3WGKA 2HXYA 2WU3A 2DHQA 2GFHA 4AVYA 5CB4A 3TQCA 2ID4A 2GYWA 3OZVA 4X92A 3GPBA 2X7XA 3I4FA 5EWJB 3WHIA 5KYXB 3KQKA 1QGZA 1RI3A 3ER6A 1OC2A 4FINA 5D3MB 2FQQA 3JRNA 4MAAA 3DNPA 2ETVA 5CJJA 4G2NA 3GFRA 3KTAB 5K9ZA 3ERCA 2C98A 1TYEB 4IRUB 2FG5A 2AYYA 4F06A 2E18A 3FWKA 1M2GA 4KXNA 1E3DA 4KVFA 3FZYA 4LHSA 1R6AA 3C3CA 4RQUA 2IU4A 4TLBA 1C1DB 2OXIA 4EMSA 1FLVA 2VBIA 4MPRA 4IW3B 1SWWA 4NAVA 5F76A 4RMHA 2OAP1 3MMPA 4KCGA 3OCVA 4DQXA 4M37A 1NQVA 3JALA 3PRHA 1VKJA 1PSDA 4NFYA 5DI9A 2XB6A 4U7FA 1FSPA 3F7MA 2WB4A 2A6PA 1EQUA 2YC2C 3IOYA 1BKSB 1XMSA 2H8KA 1JLHA 3RC8A 2OORC 1MKYA 4G23A 3B9RA 4A8JB 2IYFA 3GFVA 3K8ZA 3G2LA 4FYHA 1AGPA 4PX3A 4YPFA 4B0PA 2BHLA 4G2TA 3IP6A 1GPNA 4U0JA 4ER5A 1HKUA 1L5HB 1SKAA 1N2BA 1W2HA 2QJRA 1WMEA 4HG2A 5D3KA 4NOMA 1O1YA 1Y4SA 2WOOA 5IANA 1UQTA 1PSWA 1M0EA 4D0RA 3L1HA 5HQ3A 2XTMA 1IZ7A 2Y1CA 4OLHA 1N2EA 4DZTA 3NX4A 2P5TB 3ELDA 3HFGA 3OI7A 1XLTC 2WTBA 4I50A 5T4EA 1RP1A 3SIXA 4G5QA 4C22A 3G5LA 1MTZA 1D1QA 1M34E 3ZZMA 5IUJC 1KJNA 5AXBA 4UCXA 5L51A 1C2TA 1A7KA 2BKVA 1Z83A 1FFEA 5ADUS 4AO8A 2GHTA 3B53X 5EWLA 3VA7A 5AVRA 2WD9A 2OY0A 2WWRA 3TUJC 1UOOA 5JI3E 2QLFA 1YUNA 1K6EA 1EGAA 1V5EA 4J7AA 4KRXA 1GTSA 3A0UA 2D2VA 4RELA 2O3TA 5KOJA 2ZAOA 1RHQA 4GX1A 4RDIA 6CHYA 3MG9A 1Z0FA 1ECPA 4R3UC 1OX6A 1JR3D 4QJBA 3ZE9A 1ZN7A 4OSOA 1CW2B 2FLVA 1V8FA 2VRCD 3UM9A 5LSAA 4BWGA 2FSPA 1MORA 1QX3A 2B0CA 3BMNA 4A2PA 2OHGA 2W4MA 3JZIA 3KJFA 3DT6A 4K9DA 1E64A 3IBSA 3I83A 3TBKA 1GXSB 4YP5A 1PUJA 8AT1A 1SZCA 1FYFA 1HRKA 4LXGA 3GVCA 5DTQA 3QKWA 4O4HF 1H69A 1E62A 3DUWA 4OQMA 5A4DA 2QL6A 4ZQFA 1U8EA 1ATZA 4DF3A 5K6AC 1O8CA 1NQOA 1P9LA 2D5AA 2EATA 2WF8A 4R2KA 4O4LF 4XVRA 4K9MA 3REQA 4ENWA 4H7IA 3LKBA 5D3ZA 2ZUSA 2XUFA 2XDWA 1QLWA 2YY5A 4YHBA 3PFGA 4KR9A 1NQWA 4NY1A 5ECGC 1K2VN 1H1LA 1YJBA 4KITB 3KQWA 1Y8QA 5AIAA 3I30X 2Z04A 3OMXA 2IXTA 4TWJA 1M1ZA 5EUBA 2EQ5A 4C05A 1NSYA 2IYYA 4G4GA 4CLRA 4GZ5A 4WNIA 5BR7A 2A1UA 3B1YA 3O6VA 1PWYE 3UOWA 4D3DA 1YJCA 3QPUA 2JIOA 2PRZA 2E4AA 2YC4C 4IJWA 4DLNA 1DLIA 4B6OA 1CP2A 3G8AA 4EDHA 5DLPA 1VIMA 3DXZA 1VJTA 4FS8A 1GQQA 2R60A 3VYRB 1QOZA 2HV9A 4MI1A 5F1PA 3GRYA 2NO5A 4OGKA 3TQIA 4C14A 5EJ9A 3E5NA 3WDLA 1Q22A 4MR9B 1OAAA 1UPTA 5MFPA 3WIOA 3YASA 3TLCA 2X5NA 3VU1A 2OV3A 1S3FA 1QXSA 3QVMA 3OX2A 3A9UA 4TKLA 3WJAA 3K8OE 4EGQA 2KW5A 3NPAA 1OV4A 2G9UA 4ZOLA 3RHTA 1T9GR 1QAQA 2Z9DA 3QLEA 4HDCA 2VKTA 2FH5B 3IEIA 4E15A 3KQTA 5A02A 2XMPA 1K0UA 5JMPA 1W35A 4ZJYA 3OLYA 5E95A 3SXPA 1RWQA 3HPRA 4JJ4A 3IAM1 3T3NA 1O5OA 3P2EA 4WHMA 3GJ7A 3HCWA 2WWXA 4NABA 3BUSA 2FPPB 2C0PA 4D41A 1SHUX 2UDPA 4EG5A 5L3QB 1JTFA 3ZY6A 2GNAA 4BKOA 1SVWA 3VR6D 1NVDA 1YBAA 2CFCA 3OP4A 4M38A 4Y2YA 1T8YA 4ZHQA 2O50A 3V2IA 4DABA 1TK2A 2ACWA 4J0FA 4RGBA 3WHLA 2ZI7A 2FB9A 1VI2A 4BDSA 4GEGA 2OK8A 2ZI6A 2ES4A 3B13B 3IP3A 3SBXA 4BX9A 5KQMA 5LZ2A 3NIBA 5EHIA 1K7SN 4U39A 1SHKA 5HK8A 4EPVA 1L4LA 5HKOA 4PCLA 5JSYA 1AS3A 2YJZA 4TLMB 3ND9A 2QD5A 1T1SA 1G42A 3B52X 4AIIA 4DA6A 3VMFA 3W5CA 5G0SA 2HUPA 1CY6A 2QD4A 2QPLA 1MJNA 2EDAA 1SOAA 5SV2A 3VGPA 3KXPA 4TTTS 2W6ID 3UK2A 5IT5A 2GMWA 5AW6A 3FNRA 1NW4A 3L6BA 1V3VA 2VS1A 3EQ8A 4F5YA 3EJWA 4Z6KA 2FR1A 3Q0TA 4CI9A 4XWOA 3BHIA 5GONA 4EW1A 5KWJA 3GEPA 4GI7A 2I3AA 1TEXA 2NADA 2QE7D 2Z98A 5F78A 4F7WA 3S2SA 3PTLA 3I5YA 2OCBA 1YJAA 4FZ5A 1PV1A 5EXEA 2GZAA 1PR6A 1NM5A 1BU8A 2VXCA 3AUAA 3VGJA 1RXWA 1T3GA 5A3SA 3AJAA 3W5IA 1EVLA 4Q4DA 5KHAA 4UEOA 3WNCA 1Z8FA 3E35A 2A0YA 5CYOA 1JKFA 2BEWB 1Z33A 4PLTA 2P6UA 2BEKA 3TLGA 2ZVDA 1EEXB 1YDHA 3I9OA 4GH5A 5DYGA 821PA 2B37A 2VWPA 2W2LA 3ZWKA 1L1FA 3B85A 1PL7A 2OAQ1 2J6IA 5CGQB 3RU7A 4EVRA 4X84A 5LWQA 3ZCQA 1E89A 1X3LA 1J8QA 3L92A 2D1FA 5TPZD 4LZNA 2C7BA 3AHJA 3HSYA 1ZN2A 4N0MA 2FZ5A 3A4LA 4QOIA 4UBJA 5E9QA 1DKNA 1Y1QA 2HJRA 1SC6A 1P2DA 3JVIA 1V45E 4B46A 2F8MA 3CXRA 3DFIA 4MMYB 4D3XA 4QPCA 1G7RA 3HN2A 4ZD6A 1M7HA 3L06A 1IQPA 3I2YX 4P3KA 3R75A 5ITVA 2P5UA 3PP8A 3IKJA 1G64A 1NBMA 3GVXA 1TQ4A 4J49A 4RZXA 4BCDA 5BWBA 5BSEA 3B20A 3PVZA 5I7VA 1MT3A 5EVCA 3SQNA 3V4FA 5KSZA 2WU4A 4CKZA 4OXRA 2OESA 2BFNA 2VJMB 4FQ5A 5JT1A 4JR0A 4CM9A 4MUJA 1S4MA 2BR5A 2VYVD 1VMEA 3PFCA 1YZTA 3RFVA 3TD9A 5CDTA 2NV0A 4GKJB 3PICA 1WUJS 3SKVA 5TARA 1Q7RA 3PDIB 4NOLA 2JIBA 3M6IA 3DP9A 4EUEA 3BZBA 4CE6A 2VJKA 4ZRDA 1E0KA 1H2AS 1VG1A 1ACMA 4KQHA 1V26A 1A5ZA 1V1MA 1PGNA 1POWA 2BONA 3MHPA 1I2MA 1E2IA 4HXGA 3O4VA 3HU2A 2PL1A 3R20A 5D00A 3U61B 3QPAA 4J4TA 2ZCJA 1W94A 4KLZA 3F8TA 3CR7A 3HYNA 1LZKA 2ZXUA 2VQ6A 3HDYA 3OD5A 2VXYA 4JC4A 3L8MA 1P18A 1M1XB 2QMYA 2QW8A 1ZOOA 2H48A 2ZIVB 3BK2A 3JD2A 1C8KA 3MD0A 4ICIA 5EFZA 3BXEA 2ZBFA 4BUZA 2YN0A 4CGYA 5IASA 2Z6AA 1S02A 1C0EA 1IH8A 5B2ZA 3O4IA 2JFYA 3IAS6 3AXTA 1BTOA 4XB6B 3ZNOA 1QIMA 4DDUA 1NVBA 4ZXFA 1NYQA 4ARZA 5B36A 3IVAA 2C7GA 4GPD1 5LQKA 1E98A 2G4LA 3T41A 2VXOA 1RPAA 3ER8A 1WJGA 1SJ9A 4B7XA 1A4IA 1Z4LA 1E92A 1KYTA 4IV0A 1O89A 2WP8J 3NHYA 4V2IA 5AWFC 3AG6A 1A9SA 1RR6A 2UVDA 4Q12A 5K3AA 1NU6A 2C92A 3I8XA 1U2ZA 4ON9A 4ZQHA 3QX3A 3PFNA 1RTTA 2BCEA 1T2NA 3N1UA 4INJA 3I09A 1MAHA 1QS0A 5KTRA 1KRXA 5K0EA 4WOJA 1V8BA 1DIOB 2MSWA 3LBNA 3EPJA 4I6GA 4BCBA 4B5KA 4F12A 2OR3A 2O2CA 4RA6B 3JQCA 3KJZA 4DJDC 4FB4A 4URWR 2HNKA 1SCQA 3KZKA 4TRNA 3V4LA 2QTHA 1YJXA 2D62A 2VJCA 4BVFA 2HU8A 3HO8A 5G2OA 3N8NA 4LGMA 4EAQA 3DAOA 4UJ5A 2AKAB 5ENVA 1XZDA 4X95A 2ODNA 2Q99A 4ZYXA 2GHQA 1HC7A 2OO7A 4G85A 1E6UA 3GHYA 5HUHA 1C9EA 2CUZA 5ALGA 6PFKA 4TRJA 2CLHB 4DLVA 1SCDA 3VYWA 5CG2A 1SUCA 2AMVA 3IAAA 1G16A 5AOAA 4ER7A 3H3JA 1OFGA 1T1RA 3RFTA 5KAPA 4YDSA 1I3CA 2NQ8A 4QJ5A 5K0GA 1AKWA 5ALYA 5K09A 1WG8A 4YJ3A 3VPDA 4OQ4A 2JLXA 1T9GS 4CT5A 2O5VA 5CFLA 3ISVA 4JNKA 4AZ3B 5TS3A 4B47A 3HBMA 2LBPA 3E9RA 3OE5A 5DHSA 5CT9A 3SZRA 3UTCA 4J7XA 1LWOA 1MO4A 4GLBA 1CJTC 1ZD5A 2C5FA 3I1FA 1GVHA 1VA5A 1EQAA 3IQFA 2GTIA 4RFSB 3T5GA 3WGQA 2P0EA 4GE0A 2QD3A 3KJNA 2AJ8A 4U9HS 3GUCA 4UKDA 5ALOA 2J7KA 3QXGA 4C2TA 2FN3A 4GVLA 3N5CA 4N5MA 3KPVA 2YZMA 3KKLA 3KYCB 5AKKA 5A6SA 5J4LA 4RVFA 1D0SA 3HFJA 4Y2RA 2C9ZA 4D4GA 1B4DA 3CT4A 1AN9A 3EXEA 4NFSA 3TOZA 4XUGB 1NP6A 3DOEA 4DW8A 5J59A 1T25A 3KWMA 2O8NA 3QVXA 1P73A 3NIGB 2P2NA 1TJNA 1P81A 2DPGA 2JZNA 2W2OA 4FXPA 4WEOA 4L08A 2QORA 3FR8A 1XEAA 2Q0XA 2MMCA 4LZAA 4TKUB 5JAMA 3VR4H 2H1WA 3W77A 2HJSA 3RNLA 2ADOA 3BHJA 4MO2A 1P44A 1K1EA 1JHQA 2YXBA 4IRXA 1XV5A 3UCXA 3UUEA 3I6YA 5L8VA 4EYOA 1DARA 3NW9A 2VSFA 4MRAA 1C3JA 1YQQA 1QSGA 3SC2B 4Y0AA 5IYZF 1GADO 1RLUA 2BWJA 2OHOA 4GMGA 1JG1A 3EGXB 1A9QA 1EDBA 3KTOA 4JX9A 4MPJA 5BV7A 5JNUA 3AL2A 4II3A 4DA0A 4RESA 1CSEE 1QUEA 2VDWB 3FXAA 3N59A 3G0OA 1E77A 2BM8A 1E6CA 3TTUA 5EWMA 1V7QA 2AT1A 4GF5A 3VVLA 1E2JA 2AI1A 2ZSBA 4JSTA 4DCMA 1VSVA 3HCBA 3N53A 5EUCA 4QFBA 5BWMA 2IYNA 4OMDA 4PN3A 1MA3A 3HWWA 3LKVA 3NOQA 3P0EA 4RPIA 4TS3A 4N7MA 4F3RA 2LP4Y 4Y9UA 3OZ7A 5LQSA 2XZOA 1DIGA 2XE4A 2QDKA 2WU1A 3G8YA 1SKUA 4GD3Q 1IFXA 5LP1A 2XZLA 3NWJA 1RLIA 3GCZA 4N54A 2BIFA 3GAZA 3LSTA 5H02A 1PG2A 3QKSA 1HY3A 3GDFA 4R54A 4RHUA 5D85A 5JJBA 2SKDA 1GZ7A 1E0JA 1MAWA 3P4UA 1LV8A 2OFXA 3OHPA 5L7YA 3TQRA 4FFWA 2Z2JA 1MB0A 3SYNA 4E4YA 4UXHA 3BH7A 1T36B 3KT8A 3UAXA 3DYVA 1DRWA 4JI5B 1V2GA 2RH5A 3PYMA 4S1OA 3O91A 2O8DA 1YCDA 2JHFA 2JJ1D 3N3BC 2Z3WA 1GWNA 1AG9A 4QG7A 3TW4A 3E48A 4REOA 1KH3A 2CJFA 1Y7LA 1PUXA 4HB2A 3OZUA 3VPAA 1RZRA 1M2JA 1QWSA 4BFVA 4EEZA 1JV2B 3TTXA 4A92A 1JHOA 5DI3B 2MYNA 4RULA 3STUA 1CU1A 3AP1A 3ET5A 3HY6A 5ALRA 1HI9A 2GSDA 2OM2A 1M2NA 2BUAA 2Q4DA 3BRQA 3LY7A 3ITNA 3OQ6A 3RT9A 1AV7A 4ZZ0A 3S81A 1Y9JA 3ITDA 3JASA 3ASZA 1OLUB 3RLFA 1NGSA 4YMTA 1NKTA 2RGAA 1MX9A 4Z3OA 1HNNA 4JKIA 1U2RA 4Q3OA 1E61A 4N3NA 4ZWNA 2JBAA 4PGMA 4AURA 3JXEA 1J5EB 4MEJA 3FMOB 2V4UA 2Q9BA 3PXUA 4A0HA 3ZGOA 2J3EA 3T3HA 3CVWA 3A05A 1OC4A 1TF2A 1SBTA 1O94C 4KWIA 1I6LA 2OLJA 2P77A 5K99A 3D31A 5TPWA 4BCCA 2WU0A 4IXWA 2D7CA 4M0PA 1RKVA 3IUBA 5H16A 4BMDA 5LU8A 3ZBPA 3KC2A 1QV9A 1E96A 3CH4B 1U7ZA 3UB4A 1FP7A 2XYGA 2VAPA 4AP9A 1A9RA 1U7WA 4ER3A 2CZQA 1FDIA 2YVLA 2EJWA 4X6YA 3ZE8A 5L3SB 4Z4IA 3GJSA 3L8FA 1HQYE 2QTMA 4MV5A 2Y0CA 2NVWA 1HOXA 3VSEA 4LYHA 4DR2B 4MWGA 2EX4A 4DRXB 3H65A 4GC5A 2OT3B 4S1WA 3FH0A 4Q24A 3OZRA 3FSJX 1Z6AA 2MMGA 3JZFA 3WBJA 4G9BA 5F98A 2YV4A 2ZAIA 5BRJA 2QVXX 2AC2A 2B1IA 2JDIA 4MJ7A 3ZCRA 5H8WA 3DT9A 1M2EA 1EB9A 4YRAA 2XEXA 1IUNA 1UZMA 4JJGA 3TRIA 2YIMA 1AB5A 4A0QA 4B6SA 2VL7A 1N2CB 1TJYA 4DPMA 2ZYVX 3LXRA 4OQYA 4IG4A 4E4TA 5HS4A 3WLKX 2JCBA 5K05A 4W9MC 2YFYA 1U31A 4M0MA 5FF9A 3CN7A 4L9WA 4Y2JA 3GLIB 1BQEA 4K6HA 3EIEA 1K8QA 2I8AA 4L3WA 5BURA 1HQDA 2VYCA 1FTYA 3G0BA 4TWRA 5IT4A 5JAQA 4P34A 2AV6A 3MGAA 3E22B 4QUBA 1L5NA 1G6Q1 3KAPA 3HCEA 1UM9A 3GOQA 3CNHA 3NASA 5C1OA 1XEFA 5JPCA 3AY6A 5T4HA 4O0LA 1E8DA 1FMTA 4HQNA 2I67A 5CDFE 1ZONA 1ODSA 3LWZA 3OOWA 4KWCA 1TW3A 4YI3A 3TL2A 1GOTA 3UZUA 3KZ1E 1UDRA 4D45A 3OMLA 3BFJA 4CIVA 2A92A 3RBZA 2OBMA 4PW0A 1Y42X 2VJQA 4MS4B 4P84A 5A03A 1ZH6A 4JT8A 2ISQA 1DGQA 2BTQA 2HF8A 2W6QA 3P2JA 1M0SA 2ZPAA 5K8UA 4JBYA 4C4YA 1X39A 1UDAA 2EG9A 1QDLB 4EHKA 1FRNA 2HWXA 4U2DA 1LK5A 2ZSEA 3ZU4A 4UPEA 4C0WA 2FOIA 2PMFA 2CW5A 1ZU4A 4UEKA 3S0JA 2NTYC 1DXQA 1KAHA 1I7PA 4Q4HB 1ZCZA 5D6OA 4AJ2A 4H1UA 2JGAA 1ACLA 2ZSIA 1EP3B 1Y89A 2VF4X 2WFAA 4PXYA 4CHTA 2YIVX 5ED4A 5AI5A 2C3YA 5EYPB 4TV8B 1ESNA 4WH0A 1M5RA 1FFDA 4ITUA 4V0RA 5DNUA 3ADDA 4OAPA 1N2IA 2VA9A 2J6CA 5COBA 2YOFA 5HM6A 1JHAA 1KKLA 1OBFO 2FETA 3KPJA 5EPUA 3VHQA 1FFXA 2GAFA 3HR4A 1ZJ5A 4KQ6A 1PJTA 4RTKA 3V34A 3LUHA 1WZ2A 4Y2PA 2D0DA 1MNQA 4Q4AA 2CWWA 2ECPA 5EGSA 5IDQA 2G80A 3A36A 4LCEA 3BK1A 4JBIA 5EIWA 3TZCA 5J2TB 1RPTA 3PD0A 2IPMA 2OUIA 3EDRA 3IERA 4PG6A 2O0LA 2BFMA 4A0GA 4AXXA 1T6XA 4LRSB 3QKRA 3DE3X 1AKYA 1ZCAA 4QYTA 2ZETA 1Y6QA 3K6KA 4KE9A 5C8YB 3IUNA 4I4CA 1G21E 1WW3A 3ELYA 4C30A 4PLVA 1T4GA 5H1YA 1W76A 1VLMA 3DMFA 1SU4A 2P1ZA 5ESRA 3P45A 5SZKB 1NR1A 2CK3D 2G9VA 4CPDA 2BW0A 3TIVA 5J4HA 1BN7A 2CUKA 2QVGA 4LDPA 5FI1B 3ZUPA 3LJKA 2X4GA 4L75A 3I1YA 5D5HA 4HNSA 1UINA 3CX3A 4LXUA 2XSZA 4Y6OA 3IXMA 2HQRA 4NFHA 4OSPA 5IULC 3RC2A 3JR3A 2IYVA 2CNWD 3EUAA 4LC0A 3FHJA 5TGDA 1O6CA 2RB5A 1W85A 1K4YA 4G86A 4GX5A 5AVYA 3ETDA 1KARA 3RUCA 4Q9JA 1EFUA 2R751 2UXBB 2CKMA 1ADFA 1NW6A 2AE2A 2BP7A 2VP0A 3MQ2A 1WBJB 3TNYA 3L04A 5THKA 5JWOA 2FFAA 5GZ3A 4MICA 1GNPA 4RVOA 2C7PA 3VJMA 5BWOA 2HO4A 3MUFA 3GJ5A 1UT6A 2XXJA 4CM6A 3QLUC 1LI4A 3D02A 3EDCA 3WFJA 2C77A 3CKKA 4TL9A 5HXAA 1YZYA 4Q4LA 3G7SA 3VZSA 3W9SA 1GG8A 2ZCVA 3PEYA 2M6LA 1BWQA 2R48A 4KWEA 5LL6P 3OHSX 4KK4A 5EPEA 2WSBA 1RWOA 4WY5A 2PQ6A 3ICPA 2GBCA 3H6GA 4YBRA 2BMEA 4A5SA 4JYBA 3A1WA 5DTEA 4IMJB 1EH5A 4JGIA 2F1KA 1RS0A 4N3BA 3PX7A 4H0NA 2JEOA 3E7FA 2JLWA 4ZVMA 1DMRA 1Z4MA 2XXAA 3W5SA 5JEEA 3GLFA 4WSOA 3U3OA 4AM8A 1N8SA 1VBFA 2GAOA 4PPNA 3L41A 1JGTA 3P0IA 3AF6A 3Q5EA 4N39A 3VPFA 1ZIDA 5HQTA 4I6JA 2Q41A 4HH4A 1C41A 4OXIA 4BFXA 4ZI7A 1GV1A 4PSDA 2C82A 4UDOA 2XQIA 5HR5A 5GJCA 2J33A 3WBKA 4EBBA 1MABB 3WX0A 4Q9HA 3T1TA 4FGUA 2KPOA 2EJBA 4C5CA 7MHTA 1ZW6A 3OLXA 1SXIA 2NU7A 5BT9A 1U90A 1VI6A 1QO0A 2ZR8A 3K1AB 5FLEX 1KOJA 3DT8A 1CFZA 1W9MA 2OMKA 4JT2A 4QOFA 3WAKA 5JTTA 1Z56C 3ASYA 1XNRB 1HDOA 1NN1A 2A9VA 2WG1A 1EX9A 3AB8A 3EQZA 2CYBA 4AKEA 2O1SA 5BPHA 4QO7A 4TWIA 2I2DA 3LL7A 1W73A 2GK3A 2DPMA 4X41A 1L7VC 5ALNA 4OI0A 4LRYA 3LCJA 1CF2O 3HCNA 2JF0A 3IS3A 3ZPXA 5JY1A 1LQUA 4Y1RA 3N7AA 3HXOA 2WE8A 1LWNA 1NE2A 4H6XA 4XUDA 3DXXA 3TRJA 3WLQA 3NANA 3RYCB 1JLKA 2QAGB 3R4CA 1PW7A 1Y3IA 2QM0A 2R6HA 3FR7A 3KJEA 1KAQA 4KLCA 4BB5A 4B71A 1H2XA 1KBQA 2ZB2A 3F90A 1JSRA 5DWDA 2QN1A 1UEJA 1SUEA 1GSIA 1ULUA 2J30A 2PLRA 3DL4A 4GQAA 1KY2A 4S1NA 3W5BA 3SQWA 1GTRA 5DCWA 3LCCA 1KI4A 1LUAA 1OIWA 4IDGA 4EW6A 5E0KB 2JPDA 3UY4A 4YK7A 1OD6A 5IXJA 1WCIA 1IOZA 4P4GA 5H3HA 4YMLA 2XF2A 3AB3A 3KL2A 4F3YA 3BMCA 3EISA 2H2GA 4YCDA 4EF4A 4GM0A 1KEPA 3IAEA 4LVOA 4PXAA 2VTBB 1SCBA 1Y3BE 3I58A 2QUBA 4Z4HA 1EAMA 5KYUA 4K2AA 5HF9A 5B7QA 1ZKMA 1NNLA 1D2NA 2ZQYA 5LOVB 4ABTA 1GNRA 4Q3BA 3ZWXA 5LYJB 4UQPA 2PMCA 2HDOA 1BE1A 2PDAA 5IVPA 1AGNA 2DCMA 3RU3A 1UIRA 3IRUA 2ZJYA 5CVDA 1IWBB 1C0LA 1SIOA 4Z7QB 2PCLA 3GA7A 2PV0A 1NZJA 4PE5B 1MZPA 3HKBA 3ZWDA 5E1OA 4OGGA 5FQOA 2NGRA 1H5NA 2CXTA 3CLRC 5J63A 2QGNA 3TINA 3LUKA 3VJRA 1EEHA 4DIFA 4DCCA 4HGQA 2CJWA 2WE7A 3THYB 3EASA 2I7DA 1GPDG 2JRCA 1O54A 1JR2A 3CKMA 5JWHA 4DIEA 4ZU3A 2EG5A 3JWJA 1M33A 3AEKA 4YREA 1VKZA 3G2MA 4FMPA 2QLNA 4HFRA 4R83A 4TQAA 5DYIA 4ZVKA 7ADHA 2YQ4A 3C7TA 4DR4B 2QRVB 4M88A 2NACA 4K9PA 3RSZA 1A1VA 5BQ3A 3NHRA 3O9MA 1GCGA 5L3VA 1L6IA 2V54A 3OIDA 4BBPA 4IDHA 3UJDA 2XGJA 1P9OA 2ZWMA 3CKYA 3LM8A 4LWPA 3TDKA 4MLDA 1FPQA 3PL1A 1XQYA 2PZEA 3PYXA 3R8XA 2GX6A 4CODB 2HMTA 4DR1B 4TXLA 3SJAA 5DK6A 1KAMA 1YIDA 1EM6A 4PINA 3QMWA 3G2IA 1O77A 3AHIA 3UWPA 3WIDA 4EMTA 4FW8A 1EIWA 2G5CA 3C6KA 2CHQA 2P79A 2VXBA 4LG1A 1Y7IA 2E0IA 3KHSA 5ALQA 5GPBA 4RYDA 3TR6A 4BMPB 5AQ1A 2BKXA 3ZDAA 1WMFA 3EH1A 2LGJA 4IGKA 2I76A 4PANA 4Z1MD 1HORA 3AEXA 4J1SA 1SBIA 7MDHA 1ZI6A 4EQ6B 1DCTA 3RHFA 2IH4A 4DMGA 5KHLB 1KEWA 4OU4A 4XCXA 3NM4A 3VVBA 3QWIA 2XKBA 3NONA 5LKAA 5C9ZA 5H80A 4U2GA 1Y3FE 3TI7A 4OXNA 2QVLA 4HHEA 4RF4A 3PWZA 2O2EA 1BXGB 3OAAA 4QYIA 5DGDA 3NHJA 4URVR 3VO1A 3L9WA 4YP0A 5A3VA 3HXLA 4UULA 1QYDA 4C0SA 1KORA 1XXHA 4YMWA 5KNDH 2PE5A 3F71A 2JAUA 3FNEA 2PWZA 3FUCA 4TKZA 3ZN2A 2V7GA 5K8JB 4IJQA 1M0WA 2NTEA 1ZVQA 3CEHA 1RHMA 1TECE 4PNZA 2XRFA 4P7KA 2VQDA 1E3QA 4KX5A 3MCZA 4WOKA 3Q85A 1DAPA 4WXHA 4ZAFA 2GBIA 4KFCA 1RDFA 3BMOB 1K3UB 3MXOA 5BR1A 1G20B 1CK4A 3D9QX 2YWHA 2WG2A 2D5LA 3G2KA 1CUJA 5DTIA 2O20A 3QU4A 2PUFA 1K98A 3HJTA 3LIIA 1X7XB 3DW3X 3NRBA 1AUOA 4B6PA 4WUVA 3RTAA 4J4HA 1J06A 3VISA 1LDYA 3SOZA 4PRLA 1Z73A 4TOIA 2IYPA 5GV7A 4BO0A 1W29A 4EJSB 2BGMA 5CDHA 4ENUA 2B4QA 1KZYC 3RYIB 3KM0A 1N0HA 1YQWA 2WNHA 2B6HA 4GP7A 2XUIA 5J1TB 1TTQB 4HDKB 4QICA 2IUUA 2FPIB 2UZ3A 4OH7A 2XHZA 4RHTA 4YCSA 4BO9A 2AKEA 1T6NA 1TQ6A 2AG1A 2PRKA 3PGLA 3SICE 3I2IA 2GCNA 4BNTA 2FR8C 3F9IA 1O57A 5CBPA 1Z5OA 1G4HA 1SCUA 4YJ2F 4AMBA 3CINA 2ZRLA 4UNRA 5J1SB 3D1JA 5KJFA 3QHAA 5JOQA 2VNSA 1IZ9A 2DFLA 2MR5A 4KPYA 2RG1A 4QU5A 5AVZA 5INTA 3DTVA 1NG9A 2FFQA 4W5JA 2H1CA 5JNLA 4OBWA 1GCAA 3T7KA 5JAUA 4IUDS 2VG8A 5FADA 4H18A 1EFPB 5JZSA 3VR5H 4AJNA 2GSWA 2IHKA 2REBA 3IAXA 2RGBA 2BI7A 5JH7B 1T29A 1BEEA 2AI3A 1SVSA 1PFWA 4EYKA 4AUMA 3S3TA 3LUJA 3QPDA 1VB3A 1N36B 1US8B 1G8SA 1LPPA 3OWHA 2DR3A 2R4TA 3QE3A 1UWCA 1T5IA 2WC1A 4L8WB 5ELMA 2A14A 5B6JA 1JR4A 5CK4A 1N9KA 2FHSA 4J0KA 2D1SA 4QZVA 3PSAA 2IDKA 3X0DA 4ETIA 2RH4A 5E1MA 5E6UA 5IYZA 5CB6A 2JLSA 3Q3IA 1TZBA 1WZCA 4QRDA 2PMWB 4IDOA 2GTPA 2P6OA 1G8GA 3IKMB 5HSGA 1AQIA 3DHNA 3Q9NA 1NOJA 1Z2CA 3AJ9A 1RXEA 1X1BA 3N86A 4GHWA 4D8WA 3AUSA 5E3IA 2YXLA 1P9WA 1SQ6A 4CKCA 4KQFA 1IBSA 2HA5A 3R3ZA 4E0BA 5C3UA 1WCYA 3CV3A 1U9YA 1BO6A 1FOEB 1YQEA 2F67A 4F1WA 1PR9A 1UDWA 1CF4A 2BRUA 5SY6A 1HYBA 3LE8A 1Z2EA 2XE8A 4XA8A 5TQ2A 3P71T 3AIIA 2ZSAA 1AGRA 3OOHA 5T7BA 1FFYA 4Z9AA 2OGTA 3D4BA 5KVSA 3K35A 2AXEA 2C94A 3OX4A 1IZ0A 2HF9A 3HP4A 3R76A 4WOBA 3W3AH 3TWOA 2N3ZA 3JD4A 5K5EA 4KXMA 4V0QA 4CBVA 4DE5A 1NURA 2I1LA 3QY0A 3WJ1A 3PPVA 1PK8A 2JGLA 4HEJA 4ECEA 1YS6A 2AN5A 4QHSA 1BSVA 3AERB 5AJHA 5BXYA 3MJFA 2BFEA 4IFBA 4FHFA 2WW8A 3QEJA 2Q7DA 4B3GA 1GGHA 2IZOA 3W9BA 1U1IA 4UD2A 1C81A 2PEYA 3FD8A 4E6EA 2IF2A 4TKVA 1X1CA 5AJWA 3RGGA 2OCPA 2I7XA 3OECA 4EH1A 5BNWA 5AOBA 3OT4A 1ZNXA 4RKFA 3QYPA 3K0KA 4LJ7A 5KTOA 4O2BA 1JQLB 1ND6A 1X7YB 3GARA 3UC9A 2YNMD 1VHLA 3EXHC 1DO2A 5CT5A 2Z8YA 1F3LA 1XZGA 3HV2A 5SY9A 2ZUEA 5CB0A 3BX1A 3EIUA 2OGSA 4IPTA 3CF4G 1R16A 5ARCA 4XD7D 5P21A 1XMIA 5K03A 4RLQA 3TOVA 4IV5A 2AB0A 2CLIB 4TTAA 4RBNA 4UBLA 1PGPA 1T8UA 2L18A 2ZYHA 1FK8A 3NYWA 3Q88A 2VT3A 4CF3A 2D0PB 2UZ1B 2CMGA 4N49A 3NC4A 3KO8A 4EYQA 1TD9A 5C5CA 5DHRA 3AR7A 3PGXA 3PJEA 3U13A 2ZS8A 1AT1A 1D3AA 1T10A 3AEQA 2WD7B 3SLKA 1SKYE 1G2PA 5EP2A 1O95A 2ESRA 4Y6LA 4CV0A 1ILEA 3VNUA 2XUPA 2X9VA 2XTNA 1PT5A 1QTRA 1QORA 2ZIWB 3MM4A 3SQLA 4FMDF 3ND5A 4P4SB 4FI3C 5FTKA 3KSRA 3Q3VA 2D1TA 1I4OA 1U2QA 4JEHA 4YRGA 4MUHA 1TKCA 1ST3A 4CDMA 3IH5A 2OXCA 3OHMA 4FC6A 1PR5A 2YWDA 3Q8XB 4C88A 4BLPA 2OBLA 3HN7A 1L4FA 5E6SA 1XTQA 1ZFNA 4PXSA 1CUFA 1PJ8A 1VJRA 2W6JD 3L4SO 3QVOA 5DLDA 3DEYX 3AK4A 1CR1A 1X92A 2DFKB 3GDGA 1U3DA 1JYEA 4AWAA 4G5HA 4L2IB 3RUHA 2XQVA 2IKSA 4AF6A 4O8CA 4NE2A 4BFLA 1ADCA 3KJIA 3M1IA 4XFDA 4XDGA 2FXIA 1P1KA 2IEGA 1D2AA 1FL9A 2HSJA 2I4RA 4TXJA 3HKEB 5DGTA 4B4OA 3VR4D 2NUPA 2C4UA 5T4BA 1E3WA 4CF4A 2FOLA 2J32A 1MH9A 1MFZA 4Z7NB 3TW6A 3F7NA 4OQZA 4ALMA 4DDHA 1J2UA 5AUPB 2HCFA 3EYWA 3F3SA 1UM8A 3IEKA 1QANA 2XCUA 2FEKA 1XHLA 5ILQA 4EO7A 3MNFA 1ZISA 4YA6A 4YX9A 4WMLA 2ZDQA 4P81A 4KFUA 3WZLA 3UGQA 3WIBA 1ZEJA 1E9EA 4EHFA 1XMOB 4WBNA 1U7HA 1QV6A 3MS2A 2HCRA 3A9CA 3E82A 3QFHA 3QE4A 1U8YA 1KI9A 1DE0A 3HBAA 2C2ZA 4EARA 1M34B 1FQWA 3V8MA 4E33A 4DLSA 1NBEA 4UVHA 3NTLA 3CVYA 3I2GA 4UNPA 3T4EA 3A1SA 4XWWA 1S9DA 4I8DA 4H77A 3NCTA 4IIJB 5LLTA 1QVWA 3JYLA 4HVLA 3GG2A 4M9UA 3DE4X 2O8FB 1IQ0A 2DT8A 4ZDIA 1NMZA 4RZUA 4U9UA 2ORWA 1DEAA 5COQA 4ZVRA 3ZCXA 3F6PA 4EENA 3CA8A 3RYFA 5KPJA 2V7WA 4L8VA 3CUVA 2IOFK 3GPDG 4LHYA 4MR8B 5KCMA 1X2BA 3LO8A 4H15A 3PFHA 2GPNA 4N48A 1E5VA 2PGXA 3AM3A 3ENVA 2Y9PB 4I8XA 3T12A 4AG5A 5AM4A 3K3PA 5TQ0A 3PS9A 4QPPA 1FJ2A 1I33A 1RJEA 3C6XA 5DOZA 4CQMB 4L0MA 3AUTA 4XIGS 4H1WA 4IIYA 4LAFA 1F5NA 5K3FA 4G1MB 1KI2A 2P5SA 5KNCH 3UMYA 1T5DX 4RE6A 4EHAA 2AZXA 4HNAA 4RANA 4JBXA 3OLQA 3LF1A 5E4FA 5LKRA 1E6EA 4K9RA 1ZOSA 2IEZA 1B0UA 4I5EA 4KDRA 3WLEA 5BN3A 3K9BA 1RQPA 1C4OA 3UMBA 2OHJA 1E9SA 2HCBA 1ZR2A 1SUDA 1SHZA 1QYVA 3EXG2 5I4CA 1PCXA 3D2BA 5CMLA 1GCUA 2QX6A 1XZFA 3GLFE 1KC3A 1NP3A 1P2VA 2CMFA 4NH4A 4PNEA 1MBZA 1RI1A 3LWNA 4JLVA 1V8ZA 2FPMA 5CEFA 3RS7A 1JIIA 1KS9A 2HBRA 3C16C 3NTRA 2YOGA 3KYDA 2VJNA 4DWJA 3RTCA 3L8GA 4EY6A 2H2AA 2QZ4A 1IAQA 3DO8A 4UMDA 5AW3A 5KDDA 4HFMA 1INLA 1N2SA 1FTGA 1DRVA 3UUFA 4MJ3A 5IG2A 4M1QA 1M76A 1U8AA 2JRLA 3NFYA 4NFLA 3NMUF 2GEVA 5C7YA 5FNVF 2WUFA 2P5YA 4FOTA 1VL1A 2ACKA 5ES4B 4R40A 2RI1A 2VR1A 1J70A 5FPPA 2OP0A 1J20A 3DFFA 3DOOA 3FAZA 4RJIA 2AE1A 3QHQA 5I51A 4I9HA 4XRGA 1Q12A 3JWIA 3PQ5A 3IALA 4ED9A 1LSSA 2Q4EA 4RA9A 4F8EA 3QSYA 5I9SA 2IEBA 4GOKA 3IMGA 3RRXA 1GILA 2C2WA 1RQ2A 1MO5A 2OHHA 4R1PA 4BNGA 3TYXA 1QCDA 4G67A 1E3LA 2K7ZA 4GYWA 2JLYA 3LV8A 5KJEA 4KRFA 2C03A 3QELA 4HNRA 1VIVA 2OHXA 2B8NA 2J48A 3B7WA 521PA 1D2HA 3NUQA 1UJCA 2ZI9A 2FUNB 4GR5A 4KR6A 1L4YA 2I4LA 4LJ5A 4TM7A 3L9XA 4RL4A 1PYOA 4G8CA 3DXFA 4U7DA 3OFJA 3TNFA 1X70A 3O2SB 4ISBA 1UJ2A 4B4UA 3N05A 3ZU6A 4QXMA 4MW0A 2J5BA 2I2FA 5K6TA 1LNZA 5HJ2A 3EODA 1PEAA 4J43A 4M3NA 3OWXA 5G0UA 4AY3A 2ZVQX 2AJCA 2UZ4A 1DLJA 4M76B 1VC2A 3ZX4A 4OXXA 3I92A 4J0IA 1BJKA 2E55A 5FA5A 3PTZA 2P4SA 1PGJA 1KDTA 4YUVA 3SPXA 4FX2A 3JX9A 3GLGA 2G08A 1EU1A 4FFSA 4TMYA 4X44A 1UKBA 4QPNA 5TX7A 4J0EA 3H8WA 1MJFA 4H7KA 1ZM2A 3S8MA 4FX5A 4ZOBA 3WB1A 1CWUA 2YWRA 1L9XA 1JEDA 1V3TA 4OA5A 3GQBB 2IIVA 1UZNA 2JIRA 2DGDA 3LUDA 4RH1A 2R7KA 3RYHA 5AK3A 4F84A 4TVKA 4H0CA 4IJVA 4KJZA 2HPAA 4U3JB 5K0NA 3O4JA 3AHHA 3K0AA 5DN6A 4QTTB 4J16C 2FUEA 3K0CC 1YT5A 3QSGA 3OJWA 5AKHA 1U7DA 3SEFA 4D74A 2W42A 4ZU1X 3VR3D 5DN9A 1XPRA 4IEFB 3GYBA 4DB2A 5H3CA 1N6KA 2YWEA 3A4IA 5FWAA 2DBQA 4A1FA 1A77A 4K6FA 2ZSHA 3ONNA 5K0BA 3I12A 3W5UA 1W8IA 2CNDA 4B79A 3ILYA 1TT5A 2PA3A 1CE8B 3GT7A 3N2ZB 3KUKA 4LDNA 2P4HX 2BC9A 2XJ4A 4G63A 3K2QA 2OZEA 2Q29A 4YMHA 2MTBA 1XROA 3DCNA 3W6PA 3WLFA 1M72A 3X43A 3TZHA 3ETGA 3INTA 4FZJA 4Z8YA 3DOJA 1FXUA 2NYVA 2Q1TA 3WMWA 6AT1A 1EK6A 3CMCO 2C83A 3KEQA 2ID7A 4IMIB 4RPGA 2I8CA 1GHTA 1BWRA 5IBPA 1KXZA 3TW8A 4JMLA 1GVNB 1GG2A 2Q1SA 4P3XA 4P82A 2CE2X 3HACA 3O93A 3TSAA 1RM5A 2KBEA 2WA2A 1GN8A 1EK0A 3EIOA 4MVJA 2DERA 4HY3A 4ATNA 2NYRA 1USUA 5CDSA 1E63A 1OKKD 3DMHA 3EA5A 1RIIA 2ATIA 4ITRC 1NHGA 2VZLA 4R7GA 3ZTTA 1P3Y1 1ZU5A 1PL0A 2QN2A 3FWZA 1YL7A 5EEHA 1M1NA 5EKTA 3ZQJA 4CTNA 2B5WA 3FCSB 2ZRBA 4JJZA 5I5GA 2PKWA 1XU4A 3QVKA 1K4KA 2BEJA 4XFJA 2BHRA 4MHOA 1EDDA 2Q28A 2PX3A 1ZZGA 3QH4A 2FF5A 3PC2A 2HNBA 2OPBA 1X42A 4QVKA 4FWIB 1KDPA 1WUKS 3G02A 3MVEA 3GGCA 1RCFA 5DT2A 1MQ8B 3TSCA 2YYSA 5DM0A 1Z4QA 3ZCSA 3PC7A 3FTEA 1IXKA 2VOJA 5EP4A 1HL3A 1SG9A 2F1HA 3V1MA 3OKFA 3FUVA 4G26A 4LTDA 2PCJA 1P0CA 2W2MA 1LC3A 4B44A 5BOSB 4D9FA 4N7JA 3E3LA 3MCVA 5LZ4A 4QD3A 3HJFA 1QYIA 5KHOC 2ZYUX 2FN4A 4DUPA 2H2WA 1Z13A 3WIVA 3BVPA 4XWGA 3T5DA 4NI5A 3PUKA 4S04A 2ODBA 3AVXA 1USVA 2X3FA 3LD9A 2HRZA 1EX1A 1Z8DA 4REMA 2ZBEA 1I3KA 3HB1A 3KQSA 1NVVQ 5EJFA 3UAOA 1QO7A 4BNXA 3KIPA 4RU1A 4HDRA 4MKRA 5JPDA 4OQQA 4EPTA 4R68A 5DTRA 3R6LA 1XJQA 3ELUA 1UT8A 4G5OA 5E4TA 5FEUA 4WGFA 1VBMA 4PR3A 1ETHA 4E2YA 1Q57A 1DXYA 1PYDA 3UMCA 1CUVA 2WJGA 3SHVA 4RFLA 4RVCA 4JI7B 4KVZA 4BVJA 1NF9A 2XWQA 1AQYA 3IC5A 1Z5PA 1YQDA 4G1EB 2NZUG 3HJAA 4LGYA 4NBTA 1II8B 3VV3A 1FB5A 2WWFA 3ENQA 3FAKA 4BBAA 1T6BY 4JLPA 4ETWA 1R8JA 2H1HA 1OFUA 4IEEA 5EP1A 2IWHA 4L3VA 5A9RA 3I34X 1Y6RA 3B60A 4CRWB 3U16A 1KYIA 2DBRA 3P26A 2CCKA 3QFFA 3BWCA 1IIBA 2ACVA 3F78A 4NZZA 4DMFA 2O1EA 2IK8A 1N8KA 3IYLW 1H22A 4OL0A 1ESEA 1XMXA 4C6TA 3C7CB 2N9UA 5MN5A 5GIOE 2H85A 2HRRA 2RHHA 3L5OA 1YZ3A 3EIFA 1B6RA 3FY4A 5A5GA 5KOHA 3W4KA 4DUZB 2Y1GA 2M1XA 2PN1A 4PC7A 3DE6X 2O1XA 2A57A 5SYMA 3UV3A 1MENA 5KKNB 1IN8A 3DKKA 1JR3A 4D9GA 4PY2A 1J8FA 4PZPA 4RYLA 3TL3A 2FRXA 3HH8A 2Q21A 1EKXA 2VRCA 1GL7A 1SY7A 3HHEA 1HQCA 2RHTA 3NTQA 4WNAA 3UMFA 3OESA 3IOBA 3QOFA 4EI8A 3V6LA 1DPGA 1LU9A 2QAIA 1U4SA 2CFOA 4KDFA 1GZSA 2V6GA 4RS4A 3RV3A 3OEED 4YMUA 3UAVA 1GEEA 1NQ5A 1RWMA 1UP7A 3T15A 4EY7A 1GDDA 1PTKA 2BV3A 1MOZA 4I1YA 1M66A 2NO7A 3GFTA 4I0WB 4II7A 4X7BA 4YTEA 3WADA 5BQXA 4IYJA 1UJBA 2NU6B 3CNNA 3ZU5A 1Y4AE 3QVTA 3R7NA 3ICEA 4OFWA 2V45A 1MVOA 3TUZC 4R5MA 2PR7A 1GQYA 5E2AA 3F5FA 3PFWO 2VHEA 4ZANA 5IXYA 3E81A 1TU3A 2B34A 3GN2A 1L3CA 4MWOA 3D7SA 1PZXA 2FUKA 5GMOA 4FKBA 1LH0A 4C0XA 1S1CA 4YS6A 1H8HD 2XZPA 2RI0A 4MV4A 3VVMA 1RJDA 1DIBA 1O96A 2ZJ4A 2C3MA 4LXTA 4C0HA 1Z82A 4RE5A 2BZSA 3BA1A 5CG1A 4LISA 3IEPA 4WZ6A 3WE7A 4CKBA 4MAFA 1L1QA 3UENA 2VYFA 3A4YA 4FDAA 4GXTA 4I19A 4LWZA 4MR7A 3FZQA 3TXXA 1HDXA 2Q3BA 3OSUA 4A36A 3IAS1 4K3VA 4NYMQ 4TRMA 2DZDA 4QE3A 3W34A 1UQRA 2B1QA 4KQEA 4RPLA 3WSTA 1PNQA 1N7HA 2JI9A 1Z2OX 4BU0A 2SCUB 1MO6A 1XRJA 2IYWA 3G89A 3SQXA 1AQLA 3ABIA 3N2GB 3OQVA 1GPH1 1WCV1 4JH0A 2XYQA 3SF8A 4BRUA 2A4KA 3MEQA 4A2QA 3JQEA 3RB8A 1AZWA 3AETA 4C4ZA 4S2EA 3AO0B 4KUHA 1BXKA 3LZ6A 5EUMA 1RWXA 1YA6A 2BEUB 1L7RA 1PZNA 3ZEIA 1T5TA 3TDMA 4D9KA 1MPXA 3CEMA 3F46A 4QYWA 4GUDA 3S2GA 5BNTA 3AR2A 3E53A 1HE3A 3M2PA 3FYDA 3OCUA 4MA0A 4DV7B 2GF9A 2FV8A 1DOZA 3QI2A 4ZT3A 3VR6A 3DLHA 1QF9A 4JK3A 2WV7A 3C6MA 3UGKA 2GRAA 1B3RA 1IN6A 5D01A 1AJEA 1OIVA 2GUGA 4QM7A 2LKCA 3C1UA 4QAJA 4AY5A 5KVCA 3OE7D 4LUCA 3JWHA 5LUBA 1L5LA 3VQTA 1RLOA 1AKVA 3M5WA 1CB7A 3AG5A 1P77A 2P0YA 4HLDA 1S2OA 3ZV3A 3TM4A 3OTIA 2BGRA 4AECA 1ZQ1A 4PIPA 1RWVA 1ZRNA 4JMPA 3IUJA 4OHZA 5F1YA 1LJLA 1SRQA 2P9HA 4RS3A 3OSZA 2CB0A 1YL6A 2CZCA 3AOEA 3WLHA 4ER6A 2Z4RA 4N6GA 4U5QA 1G3MA 4MI9A 1COWD 2W6IA 3D0QA 4ZKDA 2H5JA 1CY1A 4CMEC 2IYLD 3U4QB 1HXHA 2B4YA 3W8DA 4BAUA 4YRNA 1RAIA 3GJXC 1AO3A 5HA5A 3UJPA 2BH2A 1RQRA 2P2YA 4UFPA 1HNXB 4XQGA 1RBQA 2RBKA 2JH9A 2VK4A 2Q50A 2QE7A 3GCXA 3JVEA 4Q7LA 2D59A 4BB0A 3LDAA 4XLLA 4JCCA 4FFRA 4Z7OB 2FCRA 3WRYA 4GM4A 5EAIA 2Q6IA 1ZH8A 3LWDA 3T5MA 4DCSA 1EWVA 1GT6A 4C4SA 4YUYA 4Z86A 1QKKA 4KN6A 4I4NA 3CC8A 3HZZA 3EPLA 1K6JA 3SX4A 2OCDA 4ZRMA 5KNDD 4BLUA 1Z6QA 4AKTA 1Y0BA 4RKYA 4YR9A 2NSHA 1TRKA 5J2UA 3UKDA 3A6ZA 3HBJA 5DP1A 1LDEA 3LDHA 2UAGA 4UZSA 1ODIA 4DIUA 1CY7A 2FJPA 2CHGA 2VKQA 4FD2A 4WE3A 5FI0B 2FRVA 1NVWQ 1ICIA 2DUUA 4ENTA 4Z4EA 4OHYA 3JALB 4RK0A 3OTWA 5TPZA 3TG2A 1G8KA 4ZTZB 3RTDA 4DHWA 1ZYUA 3AUFA 1E3MA 4H6WA 3ZKWA 1IM8A 1KOLA 1YKGA 3V7UA 4FTWA 4QPJC 5KDOA 1KHHA 4DY4A 2COEA 5C7LO 1CUEA 4IRMA 1IRIA 3BJMA 3LT2A 1PX2A 4FFBA 5CUQA 2P6NA 3T95A 1HT3A 1Y6ZA 2C5EA 3L0DA 3MJDA 4Y98A 4OBEA 4J9VA 4EGCB 4U00A 1RXVA 3IIIA 1WIWA 3IEXA 3RHSA 3Q4GA 4HLUA 4RIEA 1B1AA 4NARA 3CZ9A 4KKVA 1QNFA 3ROFA 4BWFB 3H5WA 4Y1EA 5L6MB 3R74A 2FEWB 5HQ3B 4V03A 1SC4A 2VYVA 3DWEX 5AHWA 3U7FB 2PKRA 3L6EA 4JNCA 2E82A 4OCZA 4P32A 4UHKA 4NCHA 1A8UA 3VX3A 3U56A 2AFVA 2DSNA 2NVUA 4Q47A 4MCIA 1E2GA 4YT8A 4B4WA 3NHAA 1CQXA 3VAZA 1V11A 3QMPA 4KQ2A 5EWLB 3VMMA 4V3BA 4D0NA 3N87A 2XBMA 2M32A 2W8BB 2XCQA 5DWQA 9LDTA 3T94A 3KZVA 4E88A 5C5DA 1JEAA 2MIIA 3AY0A 4WKCA 1HEUA 4QPDA 4R8MA 5E3JA 3LBIA 1LF5A 1U2TA 5GZ6A 3LHKA 4CQMD 5AVOA 2Q6TA 5A4MS 4YH1A 4J0HA 5HBGA 2DQSA 4IZHA 3SNHA 3OZTA 5ALLA 3G9QA 3UA3A 5TV2A 2PUDA 3CSDA 1EQ2A 1GUYA 1UMCB 3LCMA 3O3OB 4LCJA 2ZTSA 1S8FA 1ISPA 3PUWA 3IKTA 1E2LA 2O7QA 2O0KA 4B17A 1TTTA 1TVKB 2YRWA 5BYJA 4NSNA 5CAEA 3DAHA 3L6UA 3IQHX 3LRPA 2V6FA 2X2OA 3AZQA 4FT2A 3VHXA 3Q15C 5E7MA 5EXTA 5HKAA 4JLNA 3LX6A 1SHLA 1K3FA 5CVUA 3IMKA 1OR8A 1NMXA 4EZBA 1T0JB 3VSAA 1Z18A 4FHCA 1G59A 1BOOA 3REQB 3SS9X 1MNAA 1D6JA 1UEXC 1XP5A 3ESQA 3MCWA 1WBDA 3RVJA 4E5NA 3ZHUA 1ZM4A 2HPVA 3E5MA 5EMKA 1WVMA 3W8RA 1H1LB 1JQBA 3K9QO 2FXVA 1NDHA 3DH0A 3NALA 4KDEA 2D54A 4OJTA 5CLGA 4AYTA 3DD1A 2L17A 3A9WA 4GO1A 1B00A 1CS0A 4KODA 4QNRA 2W0MA 2X42A 4KZKA 4RJTA 2A1UB 1XQWA 3FF1A 4FKMA 4NJMA 1KDRA 2WSSD 1C3VA 5H82A 2B5VA 1G21B 1YUMA 1YCHA 1MAVA 4FCVA 1PJRA 4MW9A 4LHEA 1S89A 1JH8A 3H3XA 5CHYA 3QXCA 4TLLB 3D4IA 2PRYA 4MUGA 4J91A 1LJ8A 1U3VA 4UVEA 4IVPA 5GY7A 4LVNA 1JMVA 3W3AD 2YMPA 3VV2A 3P2IA 5CX1A 4WCVA 4XX0B 4CL2A 1JG6A 3K5HA 4ZCIA 2X23A 1SZDA 1UK7A 3GP8A 3HEBA 1N25A 5A0TA 4QUKA 4NCKA 1IM5A 5DOVA 5F2KA 4J3JA 1PR3A 4ZOLB 3VR0A 3WWOA 1WB6A 4M46A 2Z3VA 2XE6A 3SHWA 4NMWA 5B6PA 3C85A 4ZYZA 1V9CA 1JJ7A 4S12A 3SJZA 4JLMA 3AWDA 2GVNA 3AV3A 2XMSA 3FNHA 3B8HA 3HZOA 2DPHA 1TFRA 3JQ7A 3N75A 2V7XA 1ZVMA 3PXCX 4IIEA 1XAGA 4ZIRB 5C18A 3WRYC 1UBGA 2ZRMA 4PBSA 3CWZA 3STXA 4YUXA 1VMKA 3PQ3A 3FNBA 1A27A 3BDVA 4L6IA 4RTSA 4FGSA 3D43A 4Q3DA 3UB3A 4ZHQB 2JA2A 2H65A 4M8LA 3RF7A 2AFHA 5K8VA 2H4XA 3LECA 2HQ1A 3NFRA 3UT5A 2ZI5A 3F2VA 3ZZ0A 2H6EA 1PWHA 1XQVA 2Z09A 5IP5A 4ZZ3A 3ZHRA 3EGDA 4EB0A 5D5PA 1EWKA 5K7SA 4RHXA 4IHJB 3VNBA 4X00A 3OT5A 1TQ8A 3DF7A 4X7RA 2EERA 3BRWA 3Q9UA 3VI3B 2R1TA 2XHEA 4I5DA 4YWJA 2EJCA 1N2XA 1RMQA 1RYBA 1LVUA 2DWUA 2JFNA 2PX0A 4L4YA 3TKAA 2J3IA 3PHHA 2H1RA 4OK5A 5I6DA 4GGPA 4MWTA 1XOIA 1WUIS 1QC5A 4MB2A 1FNCA 2FMXA 2IYAA 2DPYA 3HLYA 1OBVA 4EY5A 1FX1A 1P9RA 2F55A 3LIPA 1YD7A 3LYUA 5F5XA 1UDBA 4HLUC 1OT3A 3K30A 1MEJA 3KFLA 5TF4A 3W8NA 5J4KA 1F4PA 3NBMA 4KHZA 2AVNA 1QR6A 1WMAA 4GZMA 1GP2A 1SKQA 1P1CA 1KO4A 2BUCA 3QYFA 3U4MA 4EFDA 4BTVA 4XZ3A 1AKMA 1MOSA 1RYHA 5K8IA 5LLSA 2NMVA 3DVRX 3WOVA 3ND7A 3GEMA 1C9JA 1M67A 2AFIE 4PYMA 7ABPA 1QIFA 1TVMA 2WLTA 4GOJA 5L4NA 3H9EO 5ALVA 4XJVA 5LU9A 2R00A 3TD6A 1G18A 1E2QA 4JUBA 5TY0A 4LXHA 2E1RA 4IH9A 2CNOA 4ARSA 1J49A 3DVLA 1OF1A 5FTWA 2PGNA 3TVTA 4Z0TA 2GCPA 1FYVA 1EMDA 3FCXA 3NAQA 1YWGO 4X1OA 3GEEA 2ZRGA 1ZLYA 5P8WA 2R68A 4B7UA 3QEKA 1B7GO 2V6JA 3DFZA 1XALA 2ZPUA 2H9YA 1RPJA 4KI7A 4U63A 4M7RA 2ORYA 1GGNA 2XUJA 1ID1A 5KSWB 2O54A 2JJ1A 4BLWA 5HX7A 4CU2A 1T2VA 2ZDGA 3A6EA 3O4FA 4U6SA 1VHTA 1RAEA 4L0QA 2E9SA 2YHIB 4Z9FA 5ER9A 1KR5A 4L6AA 5L7WA 3U44A 3FVVA 3MJHA 1UOPA 4QSMA 3QE0A 1Q6YA 3EVZA 3L1JA 4XFKA 3GJRA 3NXKA 1XL1A 1ZD3A 3Q8MA 4GRDA 4U9IS 4Q01A 4PG4A 4YP9A 1A5BB 1CP3A 5HEKA 2PUCA 1F3OA 4MRRA 2WRZA 2Z5LA 4LMAA 1X1AA 2HZ7A 3F3MA 1LSOA 2C9OA 2QYHA 2EHJA 5KYXA 2GBLA 3NH9A 2ZR9A 2QTNA 4DWOA 5IH7A 5E7JA 5GOZA 1WY7A 4MW7A 3U7RA 4FDMA 2AG8A 1ZP6A 5FYQA 3LQQA 4RMNA 1FVXA 2P9BA 3KTAA 1V1MB 4FYYA 4M6WA 4EO9A 2I87A 1OGYA 2CDBA 3C8ZA 2AG0A 3P9QA 4B3IA 4CTOA 3KAQA 3FA2A 5FWDA 3L1IA 1L5ZA 2X7HA 3P9PA 3QVSA 4OJNA 2EX1A 5FLYA 1A9XB 3CLKA 5CFQA 3H1FA 2Z4SA 1JDVA 1RKXA 3FKSD 3M5CA 2QTGA 3L7MA 4J75A 3J7TA 4HNUA 2H2IA 3EX7C 3GMSA 2F4VB 2KMLA 1VSUA 2BFDB 1L7EA 3HXKA 4D7AA 4PGFA 2C97A 1E3IA 2W6PA 1KDOA 2ZUDA 4LI3X 3U7IA 3A58B 3UJ9A 2IE8A 1UFQA 3IR7A 2PVSA 3RS9A 2PGDA 2FSFA 4MVXA 1NBHA 5KOIA 2OQIA 5DXFA 2GYYA 3AFMA 3G5AA 4ARZB 4NXMB 1A82A 4JC5A 3M9WA 2FE1A 1V4NA 4NBSA 3GVIA 1W87A 4QOSA 4A8JA 1Y6GA 2B1GA 2CBXA 3WLLA 3LKDA 4YCCA 3O31A 4L27A 3G49A 2CVFA 3C4JA 1MRZA 1VLHA 3MJSA 4JDPA 4Z3KA 5JNVA 2Z30A 3HJRA 1L5HA 4TV8F 1O0BA 3NGLA 3NOXA 4JL5A 4E12A 3HM9A 5K45A 4HPXB 3CRQA 4UZFA 4Z2YA 3A37A 8LDHA 1QS0B 2O2ZA 4OYYA 1IBMB 4DS3A 2VTDA 2JBHA 2QROA 3CE6A 4HGRA 2BL4A 4OHXA 1W59A 2V98A 3MMNA 5E1BA 5ALMA 1UPAA 3U81A 3VU9B 3FCAA 2DX7A 2PS9A 2I62A 2C2OA 4RACA 1D9XA 3RS5A 2RGWA 4C5AA 1R66A 2EBFX 4LXQA 2AC4A 2BMVA 2PD6A 3UA4A 2G9ZA 1UJ4A 2FW0A 1C5KA 2I8LA 2OOKA 2BMDA 2RCYA 1YKFA 3HCPA 3MYRA 5J2TF 3R0JA 3UXMA 3OZXA 1KR2A 4WBSA 3QUSA 1TZCA 2DUNA 2I6FA 1LFDB 1V4BA 4H27A 2IX9A 5C8YF 5JSUA 5C53B 1U8FO 4G0YA 4AW9A 1F12A 5B57C 1ECCA 1NUTA 3GZTB 4PPFA 4IGFA 5CK5A 5FOWA 1D04A 2YW2A 2YZGA 3HA5A 5EN4A 5EP3A 3LQFA 3RKSA 3IMCA 3SS8A 2HDWA 4JN6B 2IS1A 3O84A 1MF7A 6REQB 3QXHA 4BPBA 1VSBA 2HHLA 4O08A 2PZKA 3HJCA 4LBYA 4I3HA 2EZUA 2BDUA 3F5QA 1WX1A 1ZDMA 2BF7A 2BN4A 2QS9A 4HRAA 4PFSA 1GXSA 5EXXA 1U5AA 1X8JA 1NFQA 1JR3E 2V3VA 4RTQA 1UBTS 1ZM3A 3EXIB 1KEKA 3II6X 1XTIA 5FHRA 1XU7A 3GFSA 1JEYA 3HBFA 1K89A 1BNCA 3ZVMA 3KT3A 4LRWA 2PTHA 5ICEA 4MV3A 3UF0A 3HB5X 3SU8A 5G4LA 4AQYB 1P7PA 1OA0A 2KLHA 3MTEA 3PEWA 3KKOA 4XDYA 5A6SB 1KTVA 4IIDA 3JARB 4XARA 1ZI8A 1ZM9A 2XQKA 2R00C 3B1JA 2APJA 4OVKA 2QEQA 3RV4A 4L5CA 3X1YA 4G9EA 3NWOA 4DKJA 2GO1A 2YOHA 3ES9A 2D2XA 3MAAC 2FSGA 4QYSA 3SBOA 1JIUA 1LBIA 3HXTA 3V32A 4B31A 5KWEA 5M29A 1FNNA 4G5SA 1XVVA 4GWLA 4ALKA 3LQKA 1G5QA 1BS9A 2X5XA 4UTXA 1F48A 1WRBA 1GKYA 1P75A 2PJRA 1G8PA 2WHPB 3QEOA 2YN2A 4QLAA 2HK7A 3VAAA 3ESDA 3DXYA 3PQEA 3LYAA 3E27A 5I8PA 2PSFA 4OHKA 1RIFA 2L19A 2R6FA 3RS4A 2IEDA 4HWKA 3NAMA 4KFTA 4QPZA 2P9EA 2EAUA 1UIMA 2A4MA 2WJJA 3ECSA 1G5IA 5G02A 1HEYA 2FEMA 5A05A 2DTEA 2V4ZA 2CK3A 3KDAA 5DX8A 1M10A 4K1XA 3DE5X 3CZAA 1NC3A 4G56A 4RM3A 2OZKA 1L8OA 4V0MA 1J2JA 4XCVA 2BMAA 5DHAA 3WNDA 3RC9A 5B4VA 1W5EA 2A3NA 5EWMB 1T2UA 1T34A 2ERCA 3STWA 2CNWA 3IPXA 2JI4A 2LDBA 3KX2A 4RQTA 4ZREA 4AUNA 3SN6A 1AXGA 1N6PA 4EKIA 2FPGB 5DIZA 1Y8CA 1FYWA 1JZQA 3MWGA 1IN5A 3PCXA 3QKSB 2BLNA 4RWZA 4YFYA 3N58A 2JD1A 3E0QA 3PUYA 4WY2A 2IV3A 2VTEA 1ZL2A 3D3EA 5AM1A 4GOND 5J47A 5IJ0A 1HKHA 1ZS9A 5HWSA 1JFVA 1ISIA 2PVCA 1GZHB 2JAXA 2P9TA 5DF1A 5GP1A 2NP7A 2J0VA 3D6JA 3CTPA 4N8SA 2PEZA 5ALPA 4V1CB 1E79D 1TCVA 1APBA 1MQ9A 5G0TA 1NJ1A 3PLAE 1YGPA 5EKUA 1T8SA 1AXEA 4BMZA 3DMTA 4KXLA 1PE0A 4J2TA 3ECAA 3IPLA 1X7DA 1IJEA 4J0CA 2A94A 1TUBB 4FGLA 4JA2A 5KJ6A 5KYWB 4LJ6A 2W4QA 1EJ2A 4CL3A 3O8RA 4AS1A 5C2JB 1FP4B 1ZBDA 2YYYA 3WOHA 4D8UA 4IFIA 1LNSA 1EA5A 2OBFA 1E9VA 4MUMA 3VTAA 3G2HA 1Y80A 4OV6B 1NTRA 1KEUA 2GN9A 2IW1A 3SMQA 3ZDDA 3B3GA 1W0KD 4DMMA 1QDEA 4G3XA 3C3AA 4RZIA 3N28A 5C4MA 3OJFA 3U3JA 1X8XA 3FBWA 3JASB 5JHGB 2V0NA 1LQ2A 2LNDA 4IJ6A 2WWWA 3S68A 4OJQA 1N5DA 2Y2UA 3SEZA 4Y7DA 4DIKA 3W1VA 2KI5A 4RDXA 4LF4B 1GFWA 3I9FA 1IONA 3VH3A 4F5WA 2Z56A 4NCAA 2BEWA 1CJKC 4OL9A 4TSFD 3H9QA 4NE9A 3ZHBA 3LF2A 1TJ4A 1U0GA 4AIRA 4IH4A 3C5CA 1P7ZA 2Q07A 1K7EB 3IFSA 1XZNA 5TPWB 5LOVF 2Z9BA 4MKIA 4KN5A 1ZSVA 1Z35A 5LYJF 2IL1A 2VZ9A 2ZIXB 4TLCA 4AN0A 5T6BA 3GI1A 4A1OA 1TEHA 2QSJA 4B81A 4EKNB 1IBLB 4W9RA 4CTMA 3WDKA 4FKZA 5TXGA 2NOAA 1N57A 1YB2A 4HH1A 4XLZA 4ZMRA 3P9ZA 5AI8A 3RSQA 1Z0AA 2I4IA 3M5DA 1HO3A 3NNDA 3KEGA 3QJYA 2P7IA 4OLJA 4Q66C 1ZPDA 5K1ZA 3U3XA 1OFHA 1RYFA 3UG6A 1M3SA 2WM8A 2XMCA 3DJYA 4PHCA 4PLHA 4YACA 3DKPA 2NUTB 1TTPB 4JB8A 5FORA 3WSWA 1VYHA 2I9KA 1GGFA 4RVSA 2FMFA 1UBRS 3CNBA 2V58A 3SNKA 1DQNA 2D4HA 3EZ2A 5DPMA 5KBYA 2XB2A 2QENA 4ZPXA 1I13A 2YTZA 4PLPA 1GUZA 1PVDA 1FW6A 1M74A 1KY5A 3M3PA 1QRTA 5E9WA 1IZZA 2OAGA 3IKVA 5AUQA 2MWMA 1D03A 1OLXB 3FVTA 4LYDA 5EZQA 4N3AA 2ZSFA 4RJLA 5FPYA 3DPIA 1XSEA 2GYVA 1BYIA 4I9NA 4HWOA 1OPRA 4O4JA 5F9HA 1T0UA 1NWCA 5DJ5A 3TQQA 3ZYCA 3WICA 2WOJA 3QOWA 1OX5A 4DSOA 2BMFA 5DMHA 4ZCPA 4ZDKA 1UAAA 3ANSA 1PG0A 4JXXA 3VTKA 4OY3A 2QTFA 2ZSJA 4MV0A 1NUSA 1ZHOA 3MHTA 1NA5A 4L4XA 4YQFA 3SZUA 2DQZA 2FGKA 3T5BA 3ZHYA 3EYAA 2D2IA 2WKPA 4HS9A 1OY1A 3DO6A 3I4CA 1YS2X 5A5DA 3RTBA 1Q83A 5TMBA 1IBKB 3N6RA 4HBGA 3HXPA 2QUIA 2AYZA 1SKYB 3KCQA 4IMRA