4U2KA

X-ray structure uridine phosphorylase from vibrio cholerae in complex with anticancer compound at 2.13 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
245
Chain Sequence
b'KTVFHLGVTEADLNGATLAIIPGDPARVQKIAELMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVPDFDVATAMKAAAQESGATVHMGVTASSDTFYPGQERYDTFTGRVVRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRTQATLKETEARSIKVVVEAARKMLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title X-ray structure uridine phosphorylase from Vibrio cholerae in complex with new anticancer compound at 1.17 A resolution
rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 85
structure length 245
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2kA00
4TXHA 1JDSA 1PR6A 1PK7A 3NBQA 1YQQA 4EB8A 4JOSA 1Z36A 4OGLA 1ODJA 1SJ9A 1ZL2A 3NM5A 4FFSA 3DP9A 1TD1A 1I80A 4K6OA 1RXCA 1VHWA 3OZCA 4YMLA 4TTIA 1PW7A 1SD1A 4E1VA 1TCVA 1LVUA 4G41A 3BL6A 3KUKA 1PKEA 1OVGA 1T8YA 3LGSA 1RXSA 1PK9A 2ON6A 4TTAA 1V3QE 3KVYA 3EEIA 4DA0A 4TXNA 1NC3A 4TXJA 1ODKA 4D9HA 1JE0A 4DAEA 4NY1A 1JPVA 2HSWA 4YNBA 1RYZA 2XRFA 1TGYA 5F77A 3INYA 1K9SA 5F7XA 4NSNA 2AI1A 1ULAA 3OCCA 1A69A 1YQUA 3DJFA 2IQ5A 4M3NA 3O6VA 4R2XA 5CCEA 4DARA 3OZDA 1Y1RA 3LA8A 1ULBA 4QARA 1U1EA 4ECEA 1CG6A 1A9SA 1ZOSA 2H8GA 4TTJA 1TCUA 3ODGA 2RJ3A 3UAYA 2QTTA 2OXFA 1Y6QA 2A0XA 5B7NA 2PGAA 3T94A 1OUMA 1NW4A 3BGSA 3DPSA 3QPBA 4GMHA 1T8RA 3BJEA 3EUEA 4TXMA 3EMVA 1VHJA 1T8WA 3FB1A 4DA7A 4YO8A 3OOEA 3ENZA 1Z34A 1A9TA 1RT9A 4M7WA 4L0MA 5IU6A 1Y6RA 1Z5OA 4G8JA 1JDVA 4EARA 1Z5PA 5CYFA 4D8YA 4U2KA 2Q7OE 1SQ6A 4GLFA 1A9OA 4TS3A 3DF9A 1YRYE 4L5AA 1RXYA 4G89A 4F3KA 4NS1A 1ODIA 4MCIA 4MCHA 3KVVA 2ISCA 5F76A 4F2WA 3NM6B 4LNHA 4DANA 2BSXA 3PNPA 1A9PA 1LX7A 3GB9A 3PNSA 2GUWA 2HRDA 3PHCA 3UAWA 2QSUA 4I2VA 1C3XA 3FWPA 5KB3A 1Y1TA 4WKOA 3UAZA 4L6IA 3FUCA 5B7GA 1ECPA 1PWYE 4F3CA 5IFKA 2OC4A 1OTXA 4D8XA 4X24A 3OZBA 2HN9A 4H1TA 3MMSA 4YJKA 2B94A 3E9ZA 1SD2A 5FAKA 1V2HE 5EUBA 3OOHA 2P4SA 3E9RA 4JWTA 4OGKA 3P0EA 1JYSA 4TYMA 2QPLA 2HWUA 1PBNA 4TS9A 4F1WA 1QE5A 1RFGE 1JP7A 3KU4A 1T0UA 3BSFA 3E0QA 3GGSA 3FOWA 1YBFA 3IEXA 4DABA 1Y1SA 1TGVA 2AI3A 4QASA 1A9RA 1RR6A 3IOMA 4RJ2A 4TXLA 3LBAA 1V48A 3U40A 1B8OA 5B7QA 1VFNA 3MB8A 1JE1A 5EFOA 3UAVA 4LDNA 4OY3A 1N3IA 4F2PA 4MARA 1K3FA 3UT6A 5I3CA 1K27A 1T8SA 3F8WA 1RCTE 3UAXA 1VMKA 4LZWA 1Z33A 5JPCA 3OPVA 3OF3A 2QTGA 1RSZA 1PR2A 1U1FA 1PR4A 1Y1QA 2AC7A 1U1GA 4D98A 5K1ZA 4GKAA 4QATA 1NC1A 4WKBA 2OC9A 4IP0A 4L5CA 1Z38A 4LNAA 2QDKA 1V45E 1ODLA 4WKPA 4BMYA 3OZEA 3K8OE 3D1VA 4DA6A 3PHBE 1Q1GA 2A8YA 3KVRA 4QEZA 4BMXA 1YR3A 4BMZA 4KN5A 4BN0A 3O4VA 1RXUA 4OEHA 1G2OA 4OJTA 1JDZA 3NM4A 5CXQA 5F7ZA 4D8VA 2I8AA 3K8QA 1OU4A 5CCDA 2A0WA 5C80A 4DAOA 3DDOA 4P54A 1OV6A 5CYGA 4QFBA 3FNQA 1U1CA 2AI2A 5CXSA 1WTAA 1PR1A 1Z37A 4OF4A 1FXUA 4PNPA 1Z35A 3FAZA 4PR3A 1Z39A 4M1EA 5F7JA 5F78A 4WKNA 3SCZA 3KHSA 4UC0A 1U1DA 1PR0A 2I4TA 1Z5NA 3C74A 1A9QA 5B7PA 4JP5A 1LV8A 2OECA 4R2WA 4DA8A 4LKRA 3EUFA 5DK6A 3P0FA 1PF7E 1JDUA 5F73A 1V41E 3TL6A 1JDTA 4QAQA 4L5YA 1PR5A 3ONVA 1XE3A 4R31A 4GLJA 5EPUA 1V4NA 1M73E 1B8NA 1CB0A 1OTYA 5F7OA 4WKCA 2A0YA 5ETJA
chains in the Genus database with same CATH superfamily
1CR0A 1BROA 2CLMB 5I9IA 3ZJUA 2DUMA 3OI7A 4RGBA 5ARBA 1QK5A 1ZCBA 2ZRGA 1TAHA 4FXOA 3CLTD 4RETA 1IXYA 1U3WA 1XZNA 4O1HA 3DH0A 5F5LA 2BGRA 2OFWA 5B12A 3LLCA 4F86A 2FSUA 3CS3A 1GXSA 1IPFA 1Q1BA 1YS6A 4CMIA 4RK7A 5ALWA 2R8RA 4X7RA 4BS9A 2RFLA 1TTHA 2W6OA 4WDRA 5FFFA 1EFPB 1NQUA 3WB0A 2OR3A 4FGJA 5IJXA 4D5EA 2B2CA 1K0UA 1Q7EA 5T4HA 4KR6A 3AVVA 2RBEA 5K5EA 3MJTA 4YAKA 3OWOA 3UCEA 1LGYA 3WZMA 4UTRA 4AY6A 1C9NA 3HI6A 3OPYA 4K7JA 4RGYA 3UMFA 1MAVA 2UV8A 4KGZA 2QIOA 5H68A 2FKAA 5JTTA 2YJ4A 4CT5A 2BWJA 3LXXA 3VSDA 5ECDA 3KLPX 2VSQA 1L5ZA 4E1VA 3ETJA 1BW9B 3RS8A 3M83A 1XSEA 1MNQA 4R8SA 4Y2JA 3T3PB 1GLVA 5ED4A 2FCRA 1BH2A 1PFWA 3OQIA 5LOVA 1G9XA 1YA8A 1DQPA 5DXFA 2G04A 1S0UA 2V96A 4MZXA 4AMBA 1RD4A 1AE1A 5EAIA 4ZMSA 1ZGJA 2EBUA 3HCAA 2WWYA 4OI1A 3PUYA 4ENSA 3LPLA 4I5IA 1VMEA 2NTNA 3H05A 4TTAA 4KOEC 4ACBA 1K66A 3LDHA 3K30A 2CT8A 1C9KA 4P86A 1MIOA 4XD7A 3RVRA 3HK2A 3HH8A 4X85A 1MLDA 4IJWA 4KLZA 3N39C 2C07A 3ANYB 4Z54A 3V5NA 3B2NA 4CM8B 4F93B 1WWKA 4LG1A 1JE0A 5CCBA 4AYWA 3WO0A 3WBBA 3FPSA 4KBYA 2QNIA 3OFJA 5E2AA 3SMVA 3OLYA 3ER8A 1NI4A 2Y1CA 3ZR4B 1SRRA 2XKJE 5TPWB 2D7CA 2F3PA 4UJ5A 2WT4A 1T3LA 1YL7A 4RCVA 4ETMA 5HR5A 1XF9A 1JFLA 3IKVA 1K0FA 3H1PA 1PL0A 4X3PA 1GCAA 4G65A 1XZBA 1HDRA 1KJYA 1KVUA 4HV4A 5D3KA 3FGPA 3LQ2A 4XGQA 1B1AA 2OAGA 3DR5A 4DCTA 5FNVB 4PPNA 1KRXA 1M9NA 3NASA 4I1PA 3ESYA 4L8GA 5HIMA 4JUAA 5K3DA 2H4HA 4GI7A 3SR4A 3WLNA 1P4RA 2ZRDA 5BYJA 1M6EX 1C4OA 1RQXA 1U0SY 2DWPA 4CLHA 1G21B 2P9CA 3KR2A 3MTBA 3Q3IA 4BGVA 1OGYA 2H51A 4UE2A 1Y1RA 3PDWA 2HQSA 3F5QA 5A4KA 4HXEB 3LH5A 2JFQA 1E4EA 2VH1A 5AJXA 4KFUA 4XW2A 3NHPA 1HRDA 1XAIA 2G5GX 2NADA 4I55B 4KFCA 3HM9A 3GLIA 3K6SA 4TZTA 1E2BA 3STTA 1O9BA 1WUKS 4LXIA 2ZG6A 3WB1A 3IA2A 2DX7A 5KREA 3EZNA 2IYZA 1N5DA 4QQFA 4K6FA 4YLEA 2NSLA 4L15A 4R01A 5CVVA 3OTIA 4WZZA 3TJRA 1DADA 3V1UA 2IIBA 4HHEA 2WB2A 5L6LB 4KN9S 1FYEA 1H2ZA 4YCAA 1ADBA 5JQWA 4ARVA 1UZNA 3CPHA 2FR8A 4AMGA 2C5HA 3VPCA 3M33A 3TNFA 5JS1A 3GZ4A 3ZBUA 4JC0A 5HRCA 1IUKA 1P5ZB 2NG1A 1QYVA 1C0KA 2YZ7A 4JX9A 4P80A 1AUVA 3B1KA 1ODFA 2X7HA 3DPSA 3HMQA 3C3BA 2E89A 3UFXA 1T1EA 4HFJA 4UTZA 1E2QA 3BJEA 1NVKA 5LLDA 1ZUHA 4IJUA 1GV1A 3CB2A 4OQEA 4D8TA 3G0BA 1W49A 521PA 1TMOA 2O2HA 4RZXA 5JMTA 3QPVA 3TE6A 1PR9A 3BFPA 1GAJA 1FFGA 1O0SA 3TW0A 3MYRA 4CQMD 5K8IA 5DKFA 2BH9A 1XRSB 1S2DA 3NHMA 4PTYA 2CXHA 4AFNA 2FN7A 1ONSA 1TQDA 4P83A 3ZDRA 2JAWA 2H1RA 1ZD1A 4M55A 2YHUA 3JWGA 1Z25A 4M7WA 4R8RA 7YASA 1NXSA 3PEYA 3ZIDA 1NBWB 2BZSA 5BOVA 1Y7TA 3CVOA 4QGSA 1V5FA 5D1HA 3TJMA 4BWFB 4Q4CA 2B2XA 3N0RA 2NSDA 3ICPA 1QHHB 3KEOA 1QJCA 3L7CA 1MX9A 4D8YA 3REFA 4DFDA 2EGGA 1NW5A 2BHLA 1C0PA 4DLNA 1OA1A 3AZQA 3GFFA 4WKGA 4K8RB 2ZB7A 4JVSB 1GZ6A 3ZXUB 1M8PA 1U90A 1RRPA 1KOGA 2BTQA 3KZ1E 1CUUA 3SEAA 1A9XA 3A9VA 1NDHA 3VH4A 3HDYA 4ZJUA 2I6UA 2PXXA 1HEIA 4I1YA 3WAJA 4DLWA 1I7LA 4EB6A 3EEBA 5HHTA 1JU3A 4EHIA 3B60A 1C1DB 5L7TA 3KJXA 3PUJA 1DRVA 3NM6B 3G5AA 4HJRA 3ZE2B 4I99A 3QX7A 1UXGA 4HDMB 4CMHA 4KUGA 3HZZA 2CK3D 2D2IA 2BZ0A 3ZY2A 1KA9H 3E84A 3HWWA 5ABPA 3UXYA 4LZOA 1UBHS 4MWZA 3ROQA 5HWSA 5WRFA 3IOEA 4MWGA 5EP4A 2RONA 4Q7JB 3UK1A 2WM2A 4XIFA 5HF6A 4X97A 1ZRSA 2RH5A 1NFRA 1T4CB 1P17A 2BI7A 2C2HA 4Y2RA 4H7JA 3WYFA 5LYJF 5DJ5A 1OC4A 1L5HA 4O4LA 3Q3VA 2JI6A 2X13A 3RYCA 1I30A 2ZSHA 4L6IA 3STXA 3ZXYA 3K71B 4YXFA 1DIHA 5LMZA 5FUBA 2AYXA 3SN6A 5L8VA 3UK2A 3WGJA 4Q12A 3KB8A 4C5AA 1K97A 4Q4AB 4TKMA 3HRIA 1ESEA 4GNKA 3CPJB 4WZAE 2Z1NA 4BYGA 1IEWA 1SXPA 2HYDA 1KZ9A 2B94A 2QTFA 3IFSA 4HVCA 3FOFC 2HJVA 1LQTA 3FMOB 4BAZA 1VB3A 4EF5A 1POWA 3W90A 4QBFA 1C3EA 3RABA 4D82A 3O4HA 4S2EA 5KTTA 3F6RA 4KFTA 1NVFA 4XB6B 1APBA 1B8PA 1OFHA 4H1WA 1BQEA 2VK8A 4JR1A 3DP7A 5D5QA 3MLAA 4D6YA 1I4TD 2JIRA 5JNVA 5DMXA 4HQFA 1ITZA 3FDZA 3LYAA 2PQ6A 2QF7A 2VSYA 2XKAA 2VP5A 4PLGA 4S3MA 4EH1A 4FHCA 5A6VA 5J4LA 5ILOA 1QRSA 4NATA 2C5EA 4PLPA 1L4KA 3NHYA 5CLFA 1OAKA 1UOOA 3DKVA 4FK8A 4EKEA 1EP2B 1KDRA 3NHSA 2RI1A 4MWDA 1VKOA 4P3KA 3KSAC 4MEBA 3TDKA 1M2HA 2AEJA 2PGJA 2Q5FA 3DONA 4HGNA 4UHKA 3EEFA 4N8EA 4NYIQ 3O74A 1LQUA 3R3HA 2PS3A 1EVIA 3JZFA 1UC9A 4YPVA 3WOHA 4FFDA 1KMNA 4EY3A 2P6PA 3EC2A 1VCNA 1V1RB 1P4GA 1E2EA 1B8OA 2JLRA 3VR6H 3FTEA 4GR4A 1ONNA 4Q9LA 1EU1A 1AGNA 1YE5A 2GN2A 1E2KA 1LZKA 1MU0A 1E3MA 1Z5GA 1NW8A 1TTPB 2PXAA 2RB4A 4O8ZA 4L5JA 3W78A 2V3CC 3I12A 4ML3A 4CKEB 4JUFA 3PUXA 4RTSA 4Q93A 1T91A 3ND9A 4HQ6A 3V8EA 5JXIA 1VLQA 2O5EA 1UBRS 1CERA 2P0YA 3AFNA 3M6FA 2XUJA 4BV3A 3P4UA 4JLUA 1Y5LA 1VJDA 3TECE 2NU7A 3PYLA 1VCMA 4MHOA 5JPIA 3I0MA 5CDGA 2G17A 4OYYA 4GQBA 1WNFA 3A2KA 3NWJA 1ULUA 3LOPA 2OB1A 1Y89A 3S8EA 2GILA 1GZVA 3CNNA 3EVNA 4GYWA 4CDRA 1TK2A 4YAEA 3UPUA 2IJGX 1DRJA 1Y1QA 3R7BA 1NDUA 2O19A 3VV3A 1MC8A 2B99A 4N03A 5K1ZA 8GPBA 5FOTA 1PFQA 2QZPA 1UM8A 5JSFA 3HHPA 4K3VA 4R0VA 2C9OA 5H3HA 5F52A 2WIGA 3LBYA 3CTMA 2W6QA 4BVFA 3IT0A 5HSGA 1G18A 1IWPB 4WVFA 1NYQA 4UDNA 4BO7A 2AXPA 1JDJA 2A9OA 2AG6A 2NUAA 2P77A 2Z09A 5EIOA 3S1LA 3S4YA 4GPTA 2XYGA 1MB3A 4D79A 1MVNA 4E7PA 5IKXA 3HYLA 4G0WA 4ZOLA 3O8RA 1FLNA 3BIWA 5ALZA 1BHQ1 3AJ8A 2IU0A 4AP6A 4EKGA 1ZRHA 4NH0A 2W48A 3SVZA 3X1JA 1J97A 4ZXPA 1ZW1A 3FDFA 4IS2A 1SUDA 4ND5A 4X3CA 4LMAA 4KB5A 2JLVA 4GPIB 4NDZA 1R5JA 1PSDA 5GIOE 1YS7A 5CT5A 4PBSA 1SKMA 3FZGA 2H1SA 4MI9A 2FWBA 2QN6A 3N8HA 4H35A 2XNDD 1T29A 3G2JA 1P1RA 2A8YA 4FGZA 2VAXA 5ALGA 5E38A 3A10A 2JBAA 4ZVSA 4WZAB 3X1WA 5E4TA 1N2GA 1NM5A 4GYKA 4LWPA 2BMFA 4XWOA 1R5NA 3SC2B 3TSOA 2QRUA 4HFMA 5H5JA 2IYVA 3QOFA 4G0OA 4MB2A 4CCYA 1FXWF 1TYCA 2JEZA 2ZRCA 2Z56A 3NUZA 4Z0HO 4HX2A 4IMRA 2WE7A 3V4VB 7GPBA 1Z56C 4BNZA 3ERCA 3PCRB 4JXZA 2Y0EA 2VNHA 2IPNA 2ZUSA 4JLPA 2K4MA 1KHHA 4PAOA 4CR6A 1HURA 3LBIA 2Z6QA 1QMPA 1Y8QB 1TCAA 2H4YA 1CZRA 2F8LA 3C6MA 4QE3A 3ZV6A 2WFAA 2Y1GA 3IQXA 2CNBA 4BGUA 2V6BA 4YRFA 2PKQO 4CMCA 3C7CB 3EDRA 5GP1A 3IS3A 1X7YB 5AESA 4YJGB 1A5SB 3K35A 3OUUA 3W6OA 4BO2A 4RMIA 3LOQA 3C7TA 2C31A 2C3PA 5AXBA 5FRDA 4POOA 3BB1A 4RE5A 4R7TA 1U4SA 3DBHB 2NTJA 1T0HB 5IHXA 1CLEA 1FS6A 3A14A 1DOAA 1XJ0A 4EK9A 2M98A 4N18A 5FTLA 3NANA 2WQ6A 3SD7A 3LUHA 1ZIYA 1URPA 3OKPA 4J1SA 5F4ZA 5A05A 4HDNA 5JD4A 3D8BA 4PE5B 1SXJC 2IYRA 3M6MD 3HBAA 3WX0A 4QDXA 3W6UA 5IHPA 4QNRA 3UJ3X 4NZNA 1F8UA 4IICA 3VTZA 2BW0A 1PJ2A 4RZUA 3LA6A 1J00A 5DN9A 1Z35A 1R00A 2Y6UA 4MVJI 2HRQA 1IVNA 1QCDA 4PR3A 2QRVA 5BSUA 3ZE0B 4YLYA 5FWNA 5G40A 1CEYA 1WKCA 4DSUA 3EC1A 1N3YA 3GP5A 1XL1A 1L6RA 1E6UA 4BZZA 1IDOA 3ILVA 4I9NA 1K3UB 2YS6A 3NTUA 4KYIB 1BGWA 3R0XA 5UKDA 3KQOA 5E3JA 1V8DA 4C76A 4KMSA 5CLQA 4B3MB 3EPRA 3QQPA 4YPFA 1YQEA 1KO4A 3DLCA 4UC0A 3DOFA 2R25B 3FYUB 2DBVO 1JFRA 4L7VA 3NS7A 4I6JA 4MIOA 4BXOA 1TA4A 1UKEA 2AXEA 3Q72A 1E98A 1XD9A 1Z0ZA 4FI3C 1Z29A 4LXYA 2VP6A 2RH4A 1Q7CA 2DAPA 1RRKA 4MWEA 1P74A 1Q7RA 2XX3A 1VE9A 5AK3A 1ZOPA 5T8KC 1G3UA 2NU6A 4IWYA 2CXPA 4R2WA 4HG2A 4ROTA 4YT4A 4GYYA 4AMZA 1EX1A 2HWKA 3OM0A 2ONYA 1GSHA 2E49A 3D3JA 4QRIA 1QTNA 2JAUA 4HLUC 5C0OE 1XZEA 1YDEA 4AZ0A 3P0FA 2SNIE 3N8IA 1CUXA 2PRSA 5JAMA 5HM8A 1XEFA 2X14A 2JGFA 2ZE6A 4MKRA 1G66A 1B41A 2JIZD 1LPNA 3GZTB 5CR9A 1LA2A 3LWZA 2XTAA 1LX6A 5LA6B 4CN8A 1FFYA 3ZWXA 4JVMA 1YZKA 4FCCA 5I8ZA 1YNOA 2XB6A 1JR3A 3GVIA 3ZI4A 2WD7A 3GLGA 3WWPA 4J2OA 3A0RB 3STVA 5JAPA 1YZLA 5I7VA 3R4CA 1U3DA 4I1OA 2VQEB 3D59A 3L1KA 1T1RA 3ISTA 3M8KA 2C29D 5AI9A 1YIOA 4N0EA 1X19A 3DXXA 4Y9DA 5JVDB 4LFAB 3CONA 5JJKA 5CNMA 5FJJA 5DHPA 3WIUA 2WIJA 4JYCA 1Z5WA 4OLHA 5AW3A 2AEMA 1PL6A 1L5WA 4H1UA 5IC4A 5KYWB 2VYQA 3DKRA 3L4BA 4MVJE 4NZZA 2VBGA 3W5AA 4GQIA 3EIEA 2A0YA 4BLWA 2AV6A 2D00A 3USZA 3NBYC 2XDWA 5C53B 6PFKA 1P7WA 4H0FA 3L9XA 3RAJA 1NTOA 2ECPA 2K5UA 3DZHA 4Y2VA 2IF2A 3IUQA 2COUA 2Q29A 2HMWA 3IQGX 3JD3A 2X7JA 1E60A 4IDBA 5ERYA 2A7QA 4JOSA 3TSAA 2ACKA 3HZRA 1W1UA 3QA9A 3R75A 4C6HA 1IBMB 4RQBA 3LVBA 2XE7A 3V1NA 1YS9A 3TZLA 3PICA 2XUFA 3EXHC 5EPOA 1ICIA 1OLUA 4G09A 3W8DA 3ZCUA 5JSQA 5TVGA 1BMFD 2G88A 3PQFA 4FPXA 4IWXA 3WV4A 2J5BA 4DQKA 5LN1A 3P19A 4TTPA 4DZTA 1RWQA 2R1ZA 3MOSA 2HRBA 2OSVA 4PYJA 1U11A 2F00A 3H11A 2RC5A 2WPDD 1NPTO 4QOEA 3EC7A 4R8MA 3TUIC 2JIQA 3NTVA 1PU2A 4TTIA 5K20A 4S1TA 2H4FA 2OLJA 5U4XA 1SD1A 2GA8A 2YJTD 3O2SB 1FEZA 1QH8B 1SVKA 3AHGA 4A8JB 1UJ4A 4JJZA 4OLBA 1CU1A 2CL6X 4QO7A 4XRGA 5KNDA 4KLRA 1HO3A 2V6FA 3F2VA 3FX2A 4NENB 1KI2A 1FFSA 1T6NA 3OHSX 1FTNA 3Q6MA 1EXWA 4RSMA 4NYMR 4UOZA 3Q8KA 1XVVA 5K8LA 2VTBA 3NIDB 1HT1E 1B8UA 4ZI7A 3TQOA 1R4MB 1Z9BA 3M6UA 2JCBA 4G25A 5TGDA 3P2IA 1A76A 4M86A 2FLVA 5CPFA 1ML3A 5DHAA 1PZFA 2EXXA 2HKIA 3EIOA 3OJCA 5HIAA 3W2FA 3BMCA 2G4CA 4JS0A 4WOBA 1C3OB 5CA0F 4V1CA 1KEUA 2XYQA 3CWQA 3HBJA 3G3EA 2Q1XA 4O0LA 3A28A 4KI0A 3B6EA 4M1ZA 4WN9B 3B9RA 4QKQA 5FV7A 4MS1B 1GN8A 4QNNA 4C6SA 4QM7A 2AQ8A 3PGLA 3NGXA 2BKAA 3Q2KA 1KSHA 4Y6GB 5IVIA 2UYYA 3F7OA 4EG3A 3VPFA 2X0RA 3H5TA 4NJEA 2H8KA 2PANA 3IQDB 4DAEA 1OJLA 3FCSB 1X80A 3CHYA 4NY1A 4EJ0A 3TRIA 4JJ8A 1WY7A 3FW1A 4AJKA 4YMVA 5C8YF 5K0TA 1OFVA 4WBXC 5A0TA 2R60A 2B5VA 2JZNA 5F77A 5TS2A 4WBNB 2BGKA 1RYDA 3RO7A 2C2OA 4NFSA 4F9GA 4BV8A 3MLBA 4GPAA 3VHXB 2CXQA 3MXOA 3WAGA 4QG3A 2CDNA 2VYND 3TX6A 1LW7A 3PUZA 7REQB 1E1NA 1CRQA 1MB9A 1ULAA 3BF8A 3GDOA 2CCGA 2J9XB 1LDEA 2DY0A 1MQAA 2TMGA 1A69A 1YQUA 4CKBA 4HQLA 4E7OA 5LZ2A 1OWOA 1V26A 2NUTB 4M3NA 4WTOA 5C3UA 4K5QA 2B4AA 1EFVA 4R2XA 5IF9A 4ZCSA 5JJIA 2P9FA 4J94A 1X7GA 2ZETA 4ZOAA 4D9CA 1XIVA 1H4QA 2JFXA 4YAOA 5LP6A 4PG4A 4AMYA 1N9KA 3GCWA 4ECEA 3G9XA 4Z3DA 3NHRA 1VIDA 4MUFA 5FYDA 1JT9A 2C9CA 4NE9A 1JXAA 2OZLB 1OLOA 1YVPA 3OY2A 1ZH4A 5IJAA 4PAQA 8AT1A 3VNQA 4KSCA 3P2KA 2EFCB 1KI9A 2ZUVA 4RH1A 1ZM4A 2G40A 4TTJA 4WV3A 1UC4B 3RSZA 1US8A 2Q0XA 1E2PA 4NOJA 1RLOA 1TJNA 2B7BA 3KR1A 5C9ZA 4ENRA 4ER7A 3COJA 1P9NA 4CEIA 4ZZ1A 8MHTA 1JVBA 1RWKA 3L8YA 1P1BA 3U37A 3KWLA 1SAYA 5IK2D 2YIVX 3H9JA 4D81A 1YOBA 2FQ1A 2JJQA 2PGAA 4ZO9A 1G5PA 3Q98A 4MR7A 5DT9A 1KTVA 3D43A 1MHTA 3AETA 3JZMA 4HB3A 3QKUA 4M9XA 1DKOA 1QWSA 4DV7B 4WEQA 3KYIB 3IR5A 1RRCA 5HKKD 1EXNA 4E2YA 2F3QA 1HR0B 3JQAA 2D1TA 1K8ZB 1T8WA 4Y1FA 4B7CA 2BMVA 4B71A 2C0PA 1ABEA 1WU7A 2XNSA 3T7TA 4W5RA 2FMFA 1Y4ZA 1NVUQ 1J33A 1EUCB 3EXEA 3LBHA 2FFAA 1UAGA 2GVZC 3MJCA 1Z34A 1W7AA 2YDYA 2PMBA 1M1NB 1WB4A 2O2SA 3HHEA 1N2BA 4OL0A 3ORYA 1N4AA 4ZZ0A 4RDXA 4KXQA 4EUHA 4L0MA 4XPIB 4LTMA 1T6XA 4KPUA 3FMVA 2WBLC 3DAOA 4E13A 2XRYA 2P7HA 1ZAKA 3CRRA 2QNRA 5DNVA 3QYFA 4EARA 5A3SA 2REXB 4EHNA 3VTKA 3Q3EA 2JI9A 3AKYA 3OM8A 4QYTA 1ANKA 2XBLA 3Q3HA 2CLOB 1WCXA 3T5GA 4D80A 1G16A 2VJAA 4UU7A 4AP5A 3LKBA 4CQLB 3DZ8A 2SHKA 3A1EA 4KXMA 1VHTA 4WLEA 2IZ6A 2Q5LA 2CNDA 4QXRA 2F4VB 4W5OA 4CODB 2PJDA 3AR9A 3NYRA 2FHPA 2C3OA 2NVUA 3M3PA 2JA2A 4J1QA 5JQGB 2QNBA 1PEYA 2GARA 2C4VA 3WXBA 3VMFA 1JECA 1P9OA 1RLUA 1USKA 1CE8B 4LSGA 3KYJB 4QXQA 2YYSA 2ODAA 2O7SA 3SF8B 3VZQA 2EDCA 5F76A 5D7NA 3E5RA 3K2IA 2ZRFA 1O94C 2XMCA 2L2QA 3A6EA 3D6NB 2B37A 3TL2A 4B76A 2IEZA 1GNTA 2IUEA 1ZWLA 4MVJH 4RACA 4UQLA 4I50B 1SA0B 1I4WA 2MSCB 1R0RE 4PLVA 2WWRA 3FFAA 5B4VA 4GAEA 4ZIRB 3A6LA 1RKUA 2ISSD 3BQ9A 1SIBE 3K05A 1PIWA 3U5ZB 1XRPA 2OZVA 1ORDA 1PGNA 3BG5A 4C5CA 1DG9A 3QELB 4Q19A 1XQYA 2OCXA 5AYVA 1OR8A 2IYLD 3TXAA 2PLWA 4MJXA 3SYTA 2VIIA 3G2NA 4DBLC 5K6TA 3CLVA 1ICEA 3RSGA 2P9BA 1G8GA 4KV7A 2WUGA 4DE5A 3T3MB 3JVVA 3JVEA 1F2DA 5CBPA 3M3HA 5CMLA 4ZODA 3WFZA 2YXLA 2ZANA 3OAAD 1W8DA 3DAYA 4D4GA 3VUFA 2P2NA 1HV8A 4KIWA 2ZXFA 2P4SA 2XPCA 2Q45A 5AM0A 4CLEA 5FUVA 1ABBA 5DEIA 3OJLA 4YALA 1QCZA 4FZJA 4HCJA 4IH9A 4UMVA 4TYMA 2QPLA 2PYDA 3GFTA 3CO5A 3NVAA 3DNMA 1TE2A 3AY7A 1F06A 1Z68A 3QVLA 4FTWA 5GONF 4RV9A 5F21A 3K4PA 2ZB2A 4BFVA 1F51E 3ZWOA 3RHFA 1BA3A 3V55A 5BV8A 5EMLA 5M2QA 1LVHA 2BRUC 4Y2HA 3OHMA 4DJTA 2HNKA 4IY1A 4ZQBA 4MV3A 4AL4A 1T9KA 4XYLA 5B6IA 1N75A 1AMNA 1CV2A 3ANSA 3MCWA 3QKIA 5JJ5A 1I2DA 2C2WA 3K9BA 1E4YA 4FNMA 1OFUX 4TL9A 4OB8A 4UNNA 3ILHA 4UMEA 1I5RA 3WHIA 4JI4B 2Y77A 3HUEA 3AVYA 2RIRA 4RVDA 2NU8A 5A3VA 1F3LA 3QLUA 2XD4A 1A9RA 3PKIA 5ICCA 4IXDA 5I9BA 3EQ2A 2ZJ7A 4Z86A 3T5TA 1HQDA 4Q48A 4NNOA 4GFDA 4A8TA 2AZDA 3UBTA 5FA8A 5M34A 1NY6A 3BJMA 1GL3A 1YDGA 4WCFB 3WKAA 3V8BA 1GR1A 4CW7A 4DM4A 1W2WB 4DY4A 4YYZA 2JFHA 3IKMB 1W5SA 421PA 2HQBA 1AGYA 5IDVA 3D4NA 4EFMA 4QVIA 4X8MA 3OQNA 3OZRA 2IHUA 2LNDA 5K3FA 1UJ2A 2EJCA 4J4TA 4PO1A 5EZQA 4GBMA 2QBYA 2IKQA 2IS2A 4CM9D 1BCRB 3FNGA 3MPOA 1TKCA 4H27A 4R8KA 4B84A 4BO0A 1ST3A 3KZMA 2QRQA 2I7TA 4D9BA 4Z4IA 4BP8A 3HN6A 2YZMA 3ICQB 3T1VA 5EXDA 3RU7A 4E07A 3KQPA 1VE7A 4EY6A 5CFNA 4G4IA 1VMKA 5BRJA 5FD8A 4J2HA 5DI9A 1C1HA 1X3LA 1M10A 3FMFA 1G5HA 1IIRA 3IBCA 1ACMA 3Q11A 5IX8A 4DV0B 3D0OA 4O33A 5ALHA 3E6AA 3WR5A 2VEOA 4UAVA 1NURA 2FUNB 4RZ2A 5E4JA 2PU5A 3PC3A 3RVPA 3VR6D 4B7XA 4BCCA 1NBOA 4RIFA 3DDUA 3OTQA 2F43A 2YVQA 5CB8A 2Q4EA 5AVTA 1Y9EA 1RM3A 1YQTA 1JEOA 1HEUA 1K7SN 4GBJA 5EE0A 4ZFNA 4BKQA 2FJPA 2G08A 3IMEA 3HJGA 3KSDO 3T3NA 3I1IA 3T54A 1Y82A 1HUQA 3I9NA 4RD2A 5HF8A 1B00A 1XLUA 4NRDA 1N0IA 3PTLA 3SAJA 3USCS 4WLNA 3S27A 3SSOA 1WXXA 1BFDA 1WZIA 4O4IB 4W7HA 3B2QA 1C1YA 3GEMA 3C39A 4TRJA 5LWHA 1K6EA 1NVEA 1W0CA 1V45E 1UMCA 2ZRAA 4QUGA 5EIFA 5H4GA 4QBGB 1EIWA 2IHTA 1XJ5A 3U56A 3Q3GE 1W1IA 4WFQA 4ZOCA 3RKUA 1QQ6A 1E6MA 3ZGYA 1GZ5A 1JIKA 1QVVA 1QMGA 5CB0A 10MHA 4KGDA 4LV8B 3WGYA 3AF5A 1CJKC 1W5BA 1JHYA 3L7OA 2WM8A 4FINA 4II7A 2M1XA 2VPTA 2LDBA 4BX8A 3IEIA 2FPKA 1QWOA 1H2FA 2A33A 1B8VA 1SBTA 3QPAA 4IHJF 4GI3A 2CJYA 1OOEA 2PSFA 3E9CA 4P93A 3ZPXA 4BMZA 1P2SA 5K6RA 5L4SA 1QYDA 4UTXA 3ROXA 2ORYA 1BD4A 3DPUA 3GRRA 1WZUA 1E1DA 2WLTA 2PMFA 2IHJA 2XTNA 3I09A 4L5IA 4NMWA 4Q37A 2B7CA 1CVIA 3CJTA 3FFXA 4QG7A 5JSYA 3LUFA 3IDOA 3IUYA 3L1HA 5HJ5A 1EJ2A 1XPJA 2OHOA 1QO7A 4IMPA 3EVCA 4OHVA 1Y4SA 2JIDA 1SVUA 4H7IA 3EZYA 4A6PA 4IGFA 1NY5A 5FYQA 1MV5A 2XA9A 2YFYA 3OJWA 4Z2AA 2RAFA 2Q1WA 4NU6A 3PXBA 1Z73A 3R6GA 4CDGA 5B2FA 4M89A 2G5CA 3V4RA 4FMCF 2OUIA 4MX8A 3W6PA 2WYVA 3AUFA 3S1AB 1TZCA 3CIOA 1RQ7A 4LVCA 4N65A 1E9SA 5CYGA 2IUFA 5BN5A 3M4NA 1Z6YA 2C20A 4FOTA 2PD3A 5E7MA 1ZA2A 3MINA 2C7OA 4RPGA 2X6QA 1GGFA 4NYIR 4M1SA 4L9AA 3F8TA 4BIMA 3PIIA 3TLBA 1T5TA 4DJJA 5AVXA 3JQ7A 3WL3A 4W82A 1KDVA 3BX1A 2IXTA 1SQ5A 2P2YA 1H0KA 3H9BA 3ESRA 3RSLA 5U9CA 3AF6A 5AMXA 3TZCA 3H99A 2O2GA 2C42A 5ES3A 3SJUA 4QDJA 4HD8A 2CJWB 1W9HA 1T8PA 1E0JA 5EWMA 5IDYA 3F6YA 3HBNA 4OJNA 4EBBA 5ENZA 1U3UA 3DWFA 3CUVA 4Y2SA 2HF8A 4GPZA 2DXIA 3KHSA 3OIVA 3QKRA 3QYPA 4PRZA 4X71A 3AW8A 5E1DA 5EIXA 1ZCZA 2XITA 3S8MA 2I0FA 1B23P 1Z5NA 5C7IO 1NLMA 3IL2A 1X13A 2C59A 4MR9B 3S81A 2PK3A 1CUWA 1H2YA 1XTBA 4ND8B 3GP8A 1R4AA 1SBQA 5T4EA 4QUEA 3TEFA 2E5WA 4Q05A 1F12A 5DK6A 5LU9A 3JWPA 1MPXA 1EBFA 3SHQA 4EYSA 2R84A 5JO0A 4UBMA 1FPMA 2ZTVA 3PSAA 5JRJA 1EFLA 1XB2A 4LHSA 4CI0B 1HT0A 5AM2A 1DKUA 1V4BA 2Q4TA 3P4XA 5EESA 3TVDA 1VPWA 2VYVD 1E7SA 1XJWA 1QE3A 1U9JA 3OIUA 3AGPA 3V2GA 1D2CA 3F6SA 3LJKA 3EGCA 4BC0A 2DUUA 1PR5A 3GFVA 2X1MA 3BDAA 3GGOA 3ONVA 4QXOA 5LZ7A 5TVKA 3CX6A 2WD8A 2P5TB 3RD5A 2ZIVB 3E05A 3TFQA 3HFSA 3I6IA 3WBKA 1F0NA 3DE0X 3G68A 4FSDA 3WSVA 4YAUA 1YFJA 1CF4A 4PGGA 3HVRA 2P8SA 3MGCA 3U26A 3AOEC 3F6CA 2OM2A 2HIHA 4J7CA 4QFMA 5L51A 3L0DA 3KUXA 2OYCA 2O52A 4XD7D 4HH4A 1KVTA 1USGA 2HQRA 2X76A 3TNYA 1BCSA 3I01M 1SUAA 1FNMA 4HLQB 3R3SA 1YD7A 2VK1A 2Z3WA 3CUUA 4PM4A 3EG5A 3LGAA 3UHFA 4WNAA 2XDQA 2BC9A 2QM3A 1O87A 2CHVA 4E03A 3PGXA 1ZK1A 4EG4A 2PRJA 3DD1A 3H87A 3RTCA 4J16C 2OBNA 1E9EA 2JGMA 3HO8A 1Z4KA 4ID3A 3A2NA 3GR6A 1SRQA 3ICCA 3R2JA 3Q1LA 1EQAA 4FFSA 2PKRA 4UVIA 4YP7A 4N0PA 3GT7A 1JJBA 3M1LA 1AO0A 3S2GA 1K5DA 4PR0A 4W8HA 2FUEA 3P2JA 4K6OA 4JELA 1RXCA 2AMYA 1JSRA 2QQ0A 3EB9A 4ALLA 1Q3HA 3C6QA 4TSKA 5JASA 5HE8A 3PD7A 3JD0A 1FFEA 3PZRA 2ASEA 1LC0A 2MYTA 3ZZMA 2IUUA 4IOMA 5IAGA 5EKDA 2M6SA 4I81A 3OG9A 5LYJA 3BUSA 2YHIA 2PEYA 2XOKA 1I3OA 2JH3A 3VKUA 5A1TA 3M4ZA 2IDJA 2F9MA 3IVAA 1VMDA 4NCBA 2W22A 1OXKB 1RJ9B 3A4YA 3BWMA 3D2LA 5L3VA 5EKUA 3TL3A 5CITA 3K8YA 3W5BA 4RVFA 4BLQA 4LJ5A 3CX8A 4FI3F 3N70A 3UICA 1GUYA 4E70A 2RGYA 5BMVF 1LTHR 1ZSVA 1NDQA 1XQWA 1XHLA 2VKQA 2VHVA 5M3BA 1PD0A 2V6IA 1THMA 3QUTA 4TTSA 2VRCA 2P9TA 2V03A 3FAKA 4V02A 5EXEA 4RV5A 1ONOA 3PLRA 4NIMA 2OQRA 1U4NA 4IDAA 1C9JA 1HNNA 4TRRA 1USVA 4U6NA 3ITNA 3EEIA 3GVCA 4M9QA 5CVJA 3BXHA 3ONFA 1VECA 2HH9A 2UZIR 3QYJA 1GGMA 5IWAB 3H9UA 4FN5A 4IDNA 4A5OA 1H4VB 3IBYA 4DJEC 1NT2A 4O2AF 4RTLA 1GCGA 2PRZA 3ONEA 3KHUA 5CXXA 4JT8A 3LCMA 4P3NA 1TAQA 3WLAA 2IITA 4JODA 2P1DA 2A88A 4B75A 1KIFA 4KP7A 2HU8A 4F3TA 1N2CA 4C0XA 3TZHA 4QVKA 5TPWA 3S8YA 3ID6C 1MD9A 2N1BA 1ETHA 2X9QA 3ENQA 3BWDD 1OZGA 2WUVA 4YXWA 1K9SA 1U2DC 2ZTMA 1X8LA 5CGZA 4X1OA 1GPAA 1P9LA 3LUJA 1QQ7A 2H1HA 3CNBA 4NV3A 2FSVC 1ZCAA 4BFSA 4BFLA 2MINB 3MZ0A 4OX9B 2QIPA 2QVZX 1Y3BE 3AJEA 1U0NA 4JBGA 3ZQJA 4E33A 4HJXA 4PYKA 4X94A 5EE5B 1JKMA 2IQ5A 3JQ8B 5E7QA 4DLXA 3KQUA 1HYQA 1WXEA 3RSHA 2I66A 3L6DA 5TIIA 4WHMA 2R1TB 3HRKA 3T7SA 3LXMA 4ZVRA 4EQ6A 5EMJA 1PUJA 4ZCTA 4G0XA 2C97A 1DCMA 4AULA 2FY8A 1H2XA 1XDSA 3C7KA 4EIWA 3OX1A 4L73A 2Q6VA 2Q6KA 5EQJB 4MA5A 2NV6A 4PLFA 4DCPA 1P2BA 4OK3A 5L4NA 4PQFA 2YY5A 4XDGA 3NT5A 1WB6A 2EG5A 3BBPA 3M2TA 3TOVA 5F2OA 1GTL1 1JQBA 1Z07A 4XX0B 3Q8LA 2W9XA 4JQOA 3BD6A 4MVJP 4ERNA 2Q8QA 3LUPA 1HE4A 3AM4A 1D6MA 1IHDA 2Y0PA 3IPRA 1EA5A 4KO8A 4YRIA 3SX4A 5JMPA 2O06A 4TTRA 3W5HA 3VHRA 2ETVA 4LOHA 1MW8X 3OBBA 2HWXA 3FPCA 2HDOA 1L8AA 4L4ZA 3EH1A 3GAFA 2YY7A 1P9RA 4GMHA 3ZVNA 1WHSA 4BVAA 1NW7A 3GHHA 3S70A 4DGQA 5IAJA 2GJSA 4N12A 2K6GA 4RHYA 2PZKA 2ATIA 5KTSA 4H9GA 4PLTA 1TF2A 4B0OA 4BBPA 3FVWA 3TRHA 2C96A 1SO8A 3GA5A 4JBHA 2IUYA 3BZBA 3ENZA 1WZCA 4YGXB 4GXTA 3G9QA 2X5XA 1NAIA 5TV2A 1JSLA 1E3JA 2NZXA 2D13A 2NWQA 3DLPX 4P9NA 4MW5A 2XR1A 3HLTA 4N82A 3I62A 1SCAA 1A82A 1OXVA 2WA2A 1DNPA 1ISIA 1ZA1A 2P6OA 3L7LA 2VQ6A 4Q02A 4XYMA 3RIMA 1CNMA 1HG1A 3KEGA 3KOYA 4GP7A 4C0QC 4UTPA 4NNJA 3DMGA 1I36A 1P8JA 4RGQA 4QHYA 4ZTBA 2WHYA 4WGGA 4KQJA 2VZLA 2HU5A 5IKMA 3U7HB 3RS7A 3RW9A 4UE3S 1KEEB 2Q7OE 3ZU5A 4P4LA 1Y42X 4QLOA 3V00A 5IZCA 1DIBA 5KBYA 3O8CA 5KTMA 3N6XA 1LSJA 4WUVA 4M7PA 1NR5A 1M8JA 2HC9A 2A9FA 1WZNA 3DMHA 3N59A 1W36B 1JV2B 1VXOA 4F4DA 3AVUA 1FXWA 2VXOA 4NE2A 3R6DA 5EJ5A 3H6HA 2ECOA 4TUYF 4B46A 2UZ0A 3OOJA 4G1UC 3STHA 4CEHB 2PMDA 2X6TA 2VQSA 1CVRA 3OCJA 7ADHA 2WTMA 4JT9A 3EZXA 3T9EA 5KYUA 4GM1A 4CNBA 1NOJA 5AKLA 1PYGA 2WJ4A 4HLNA 1P91A 2B6NA 3L43A 1RBMA 4QTUB 4A26A 3E5MA 2OHJA 3GFPA 1BU8A 4B1FA 1Y63A 3ZE8A 4COKA 2ZE5A 3UJDA 4K88A 1O54A 1OASA 2HRDA 3E4CA 4FDMA 4OU4A 5D3MB 4YRSA 5KVSA 1XMJA 4XGRA 1WMAA 4JXJA 1Z2DA 3GH1A 4MITA 4Q34A 1N0UA 1SCNE 3QEMB 5G53C 1ODTC 4GYJA 4JP2A 1J0EA 3K92A 1DBWA 3R9XB 1NFQA 3ZV3A 3FCOA 1U8TA 2Y05A 3DL7A 3MNFA 3GF4A 2R6HA 3K9QO 1SMKA 3EA4A 2IZ7A 1BTOA 4BB9A 4E6EA 2ZTLA 3MWFA 5HCNA 3FPLA 1BRTA 4HDKB 3FPEA 3LT5A 5B57C 1QIHA 4LRSB 4RK5A 3PWTA 2J5XA 3UKJA 4RF5A 3QA3E 3C5WP 2ILTA 2DT8A 1DEHA 4XA8A 3SJ7A 2JGLA 2VF2A 1DEAA 3FYDA 3OJ0A 4Q4AA 1BC5A 2GD1O 5C4GB 1UKBA 3RC8A 4MGYR 3P9QA 4FB4A 3MWYW 1U7HA 3ENNA 4ZQHA 4DLZA 2RB5A 3H2BA 3JWJA 4UBOA 5KHLB 1HDEA 2AF4C 3IMGA 1BMTA 1RYMA 2IPMA 3OEHA 1HMPA 5CIYA 4JCOA 2ZIXB 4PZEA 1KDYA 1OD6A 1IUOA 3DV0B 1Q1EA 1PT7A 2J7PA 4GXQA 4NEQA 1W2GA 4FLMA 3AH8A 2X4LA 4S12A 5K8VA 2HJRA 1W87A 3VTFA 1J7KA 3ED1A 2VHWA 1G2PA 3RFCA 4EFKA 1RI3A 1IG0A 3PITA 4GE0A 2PUAA 4FZVA 5FF9A 4AJ2A 3V1KA 4ALIA 4BNHA 3IT1A 1ZGBA 3K70C 2QX8A 2ZJ8A 3I0ZA 2OKGA 3GLFA 2UXDB 2DTXA 2Q3EA 2C9BA 4CIDA 2XZLA 2HV9A 1NJ1A 2PX8A 2R6GA 2QTHA 2NXEA 2GXUA 1AM4D 1RTTA 2NOAA 3B9QA 2WKRA 1ZCFA 1MFPA 2J07A 3PT9A 5CHYA 4YLGA 3QHQA 4YEDA 4AG3A 3A3YA 1T2VA 1F5NA 1WXQA 2QG9A 5EMNA 3WYAA 1HLPA 4KRXA 1XNGA 2A78A 2GBGA 1P1CA 2C83A 1UQUA 1F1BA 4M1MA 4RULA 5JSHA 1V7CA 3BD9A 5EJ9A 3GXBA 5B7QA 3UB4A 2OWEA 3BDIA 1QPZA 2WU0A 4M38A 4DCSA 4YCDA 1JE1A 3FKJA 4XIGS 3KKLA 4QGBA 3C0KA 3D5TA 3NYWA 4FFBB 1NAHA 3Q8WA 4RTMA 2P6NA 5HMLA 2JGDA 2IX9A 4MUJA 3BHJA 5EKSA 4CKEA 1NR1A 5JAOA 4YRAA 3NCHA 3LHDA 3G5MA 3SXUB 2NVWA 1UBEA 2QV7A 4DQ0A 2OV6A 4U0KA 3NHFA 1F5SA 3NYIA 1JEEA 2GN8A 4G2TA 1LI4A 2Q3LA 4GRIA 1JLHA 1Y37A 3A1DA 4KR9A 1TVEA 2V6GA 3WL4A 1T3HA 4WACA 1BDBA 2Q7DA 2FDRA 1XLTA 3JU3A 4BLPA 2NZ2A 4LZWA 1AKRA 2R7MA 4LZLA 4WXRA 1UEIA 5HMMA 1X39A 2QTGA 3NO4A 3FG9A 5GOZA 3O0TA 1BXRB 4RTQA 1RPJA 4OX9Y 2NVBA 1Y1KE 2YV2A 3A1UA 3WMFA 1WV1A 4XJVA 3EQZA 1XELA 3NTQA 3ORHA 3T41A 1M2OB 4M8KA 4U63A 2CNWD 1W47A 4I2NA 1D04A 5IMSA 1WMBA 5EJAA 4ESEA 1S3FA 3VA7A 5EJ6A 5I7FA 4DQVA 1N0HA 3BCSA 1Q3TA 2CV0A 1EFRD 5H9WA 4I9UA 1CQWA 3FNEA 3IBSA 1PHRA 3NONA 2AQIA 3QYAA 4Q1DA 4BEVA 1KWGA 2XXAA 3KOZA 3IKJA 5ALJA 3X1XA 1UT5A 2J3DA 2P11A 1ODLA 3VHQA 4AYTA 1H0RA 3IEVA 3OT1A 1R8XA 2GEBA 1Z0DA 4G5HA 4LYEA 5T5QA 2PT7A 5KEIA 1O6ZA 2CVHA 4IX1A 2V6MA 3JAKB 5IBCA 1O95C 1B6RA 1VJ5A 4U0JA 3NOOA 1R66A 3IKTA 1QIMA 4B3HA 1YF3A 1R18A 1H66A 1JAIA 1OKKD 1I6MA 3ILYA 4L85A 4BZWA 3AEKA 2G77B 2DY1A 2V0NA 3IJPA 4HNUA 5JJCA 4WOKA 3ECCA 5CA0A 5CLJA 4DPLA 4RFSA 1R8SA 1SZPA 2JKYA 3R7NA 1GQQA 3OQOA 1VCOA 1ZIXA 1RCUA 1D1PA 1RYBA 1M83A 1Z2PX 2VPQA 1XNRB 1HEYA 1IOLA 2DQZA 3A06A 3C8MA 4I9FA 4AWXA 1YO6A 5JSKA 3HB1A 1SBIA 4F5ZA 4QWMA 1J56A 3S28A 4BCDA 4RM3A 1KYXA 2IELA 3FRJA 5C8YA 1B42A 1AD2A 1UPCA 4PINA 3EAGA 1VCHA 1GRRA 2XQGA 4MVCA 4BNDA 4RNDB 4JNCA 4UEKA 4OXNA 1GARA 1GKKA 3L7IA 4HQOA 3C3AA 1I1NA 3RVJA 1DAGA 2B82A 2FPPA 3ZC3A 5BSRA 5AVSA 1C0IA 3M9WA 1YKFA 4XDHA 3I2JA 4MUMA 1VKNA 3QLTA 1W581 3SFZA 4AT1A 2RK6A 4HWGA 1TNDA 5IS2A 2Q0SA 1X7ZA 4U5QA 1GO2A 4E21A 3LCVB 4EB0A 3O8OA 3K4QA 2AI2A 3ISVA 4AWBA 1R6VA 5JATA 1C3JA 2EGHA 1QQTA 2WFZA 3OHPA 4RHUA 5G3ZA 5JRZA 4H17A 4JLSA 3EGWA 2PX5A 3K5WA 3FUWA 3ZHYA 4OHCA 2VYCA 4CI9A 3CNLA 4EO4A 4E3ZA 2QM7A 2QPAA 2VPZA 3LS2A 3MWLA 2XGGA 2L18A 3LL4A 1I0LA 4IUDS 5EE1A 4EYGA 5EP1A 2I22A 4OYRA 4QQNA 3P0HA 3O90A 2IV2X 2VJNA 3ZCSA 2GK4A 3HA3A 4LN1A 4RX1A 1LI7A 4UU0A 5F78A 1UH5A 3UO8B 2IYEA 4FR5A 3KXKA 4WKNA 2VP2A 1TA0A 2GYWA 3B1ZA 2ZK7A 3DKKA 1C30A 3WVNA 5K2OA 1HZZC 1ESZA 1OWPA 2P75A 4Q7LA 1E4OA 1VA4A 3L40A 4G5FA 5JZBA 1GNSA 2VHCA 3AHFA 3PWZA 4OSOA 1L4EA 2ZBPA 5LL6P 5CM2Z 4QPNA 3I30X 4H16A 4J90A 1D2GA 3TW8B 2PS1A 1SUWA 3OE7A 3EZLA 4PYOA 2PJUA 3E5HA 4YMIA 4ZC1A 2GEJA 4MYSA 4NJMB 3TD2A 2C7QA 1LS6A 1EM6A 1P2DA 1NL3A 1RBQA 1QDLB 1YZUA 2P90A 1I7SB 4C4OA 2QZSA 3GRPA 1EPUA 5DZSA 5J9FA 5IDQA 3EIHA 1C50A 2VHYA 2ZRNA 4K1LA 1D1QA 3VR3A 4Q7QA 2X1HA 4WK6A 3QE9Y 1JDUA 4E5DA 2BHSA 3TI7A 1T3GA 3AZPA 3CEAA 4Y2TA 3ZW9A 1U9CA 4C4SA 4ABTA 3FVRA 4O2BB 1DT5A 2GWHA 4WZBA 3R76A 1OH8A 5AW4A 4A82A 1Z8FA 4RH3A 1WPRA 4C0SA 1WMDA 4Z7JA 1G2IA 1GZDA 2VWGA 2HTEA 4X6LA 1MN6A 3NIBA 2GPNA 5I7SA 2IGBA 3JX9A 2W2PA 1L1EA 2RKWA 3MOIA 2Q6OA 3SC3A 3X1MA 5I8PA 1RNLA 4CMBA 5CTAA 1OLSA 3SYNA 5JVDA 2ZVDA 5B58T 3ZDBA 1ZHHA 3OQ6A 3KQVA 3ZJTA 3EUWA 5SZHB 2V55B 2FUKA 3GT0A 4JJFA 1E1CA 4TT8A 3OUZA 4NBNA 3NPMA 4WKCA 4YRPA 1YK0A 3EWIA 3GJ5A 4CUZA 3JVDA 5IVPA 1WB5A 2FMUA 1U2TA 4PZUA 3QNWA 1VP3A 3KFLA 4OAOA 4YRJA 1O9HA 5H7XA 4EA8A 1V25A 3DYIA 4GEKA 4TVBA 4BOYA 3ZVKA 4OYHA 3IV6A 3L0CA 4R5MA 5JR3A 1IN8A 1GM5A 4B6RA 2QMUA 5B2EA 2BHNA 2QP4A 1A71A 2Z57A 4FFRA 4PW0A 1T10A 2JRCA 4E14A 5D01A 1BDIA 3TR6A 2WAXA 4DR2B 5IMBA 2FUCA 3T3IA 3VU9A 2J4CA 3ZE1B 3GLRA 3C5HA 2VWPA 2ZWIA 1EUDB 4YMLA 1R74A 1VPDA 1YMUA 1Q12A 3AR5A 3D8SA 3E22A 3DHVA 4FE7A 1U1IA 4N3BA 5SY9A 3SYLA 4P0QB 4ITRC 5FFNA 2G7ZA 4DMHA 5HQTA 1PNQA 2AEFA 4C4RA 1ML4A 2FN3A 1I1HA 1QANA 1CKEA 1I3LA 3U6BA 3JQDA 4F2DA 1OJ7A 2KB0A 3S7TA 4OIFA 3SJZA 3QUAA 1DUVG 3B3AA 4E5PA 1DAFA 5HUHA 1T1JA 3A8TA 1N8SA 1DJOA 4C43A 4U3JB 5K8CA 3IEPA 2W8BA 1MJHA 1SB9A 2J09A 4EKDA 3AHJA 3RWOA 2BUCA 3A9UA 2FUG6 5AJHA 2HW8A 3T4EA 5CX4A 3SG0A 2HRZA 1A8IA 5GONA 1H9BA 2W2LA 1HL3A 4L95C 1LZLA 2BKEA 1ORTA 3EJ6A 3ZD6A 5FOQA 4XVQA 2RGEA 1DC3A 4HRXA 3X44A 4FBMA 5KX5F 5HRUA 4YECA 1E2DA 1XD2B 2XGOA 2H29A 3JQPA 3FMIA 1I4LD 4YVFA 3EXIB 3C2QA 2JATA 3ET4A 1JG1A 3IAM1 4BNNA 2CLKB 4MUNA 1DAPA 1YR7A 2IDKA 3G9TA 2GMWA 3E2PA 3LO8A 2PG3A 1P7YA 3BKWA 1Q0PA 4IOLA 1CRZA 5KSPA 1KARA 1CY2A 3C8ZA 4XWGA 3SKVA 5IJWA 1EKXA 3A27A 4RZQA 4CL3A 4B6EA 1NJFA 3HJCA 4EP1A 4HI0E 5BORA 3MILA 4GOJA 4GZMA 4RK4A 3CCFA 2BMJA 1J0DA 4S1PA 5ILQA 2RGUA 2DT5A 3SBEA 3UGTA 4QLAA 2FSSA 5ICEA 5MN6A 4HT3B 3Q7QA 1R0WA 3BVPA 1GNLA 2QW1A 3VC3A 4BB5A 1IOVA 1Q14A 4MNTA 1Z0SA 2JGKA 4IW3B 1XP8A 3F5DA 1Z4IA 2H11A 2Y8EA 1AUQA 3VSAA 2J0QA 4JBYA 3U0BA 3VYUB 4YRGA 1G98A 2XT9A 2V65A 3ZD9A 3OZDA 1AUOA 1LLUA 1D9ZA 1UR5A 3LA8A 3KJEA 5BSMA 2Y66A 3BIFA 2UVPB 3I01A 2QLJA 3VGPA 2J3JA 1EZ4A 1XXHE 3TOZA 5F9FA 3GPBA 4MV5A 5HTKA 1G8KA 1TB4A 1V9CA 2WFLA 3KZVA 1DJLA 1W30A 1DV1A 4XOUA 1AMOA 3LUBA 1MOSA 2FN9A 3ASZA 2YQ4A 4IDGA 1XK6A 4DCNA 1NOKA 1XTZA 2OMEA 2ZI7A 2OQIA 1CQJB 4AZ3B 4FNOA 4LXQA 1HNXB 4RIHA 2WHPA 2BEJA 2R2AA 5KTPA 1KORA 2OXFA 2R44A 1Y6QA 4MCJA 1G8AA 3GUCA 3QVVA 4MVJA 7MHTA 4BTLA 1LSSA 2YMQA 5JCOC 2EV9A 2ZI5A 2QN3A 1QOPB 4BWYA 1KQFA 2NO7A 1QZ3A 4RK6A 1UKVY 4V0QA 4B47A 2WKQA 4X63A 1IN4A 1OUMA 3N28A 3SQOA 1NQAO 3TG8A 4Y0AA 9ABPA 5F9MA 3KPWA 1M1YE 1U0LA 2HK9A 4O2RA 3BMQA 1RJWA 4YK7A 2WSLA 1STOA 1SNYA 2DF8A 4TXMA 2ZIZA 3PFGA 3PEFA 3U7QB 3QFRA 1JG3A 2FEPA 2OHXA 1SCIA 1XT6A 4RD1A 2BLNA 4ZAWA 2YBEA 4DA7A 6REQA 2HMTA 4LY3A 3A31A 2R85A 1KU0A 2YJ3A 3K0CA 2QL5A 1KZYC 4Q4LA 3KWFA 3ROZA 2XNHA 4RLFA 4UHBA 3UJAA 2O8FB 2ZWPA 4CVNA 4IJMA 2QUKA 1F4PA 2H9AA 5F1OA 2JH9A 4CIWA 3BS4A 4Y6LA 4Q9DA 5B1YA 1NWHA 3HJNA 3PC4A 4UQPA 5HX7A 2PUBA 1JKFA 2DUNA 1COZA 1PS8A 2WJHA 1COWD 4LW8A 4BO3A 3FSJX 2RHTA 3FETA 1RP7A 3LZDA 2WJAA 2IODA 2QROA 1I1QB 4B6QA 1WKBA 3ORSA 3TOCA 5HZGA 2BGLA 1WL8A 1WDTA 2VBIA 2OHHA 2P30A 1Z6GA 5EN4A 1E3TA 3RFTA 3ZN2A 1ZQ1A 1DARA 4PX2A 4CL8A 1A5TA 1YVEI 2X5NA 4BFXA 4D3FA 1T34A 3MWEB 3EXFB 4UD2A 3TIVA 4DLRA 3WYNA 1ZMXA 2FLKA 2ATXA 2CXNA 3QX9A 4IHJA 5BVGB 1AHPA 4I6GA 1RADA 5T57A 4ZPJA 1EA7A 1R3DA 1Z45A 3GXOA 2HWWA 2OCPA 2D1QA 3BMOA 3OIGA 3UAGA 1M67A 1FJHA 4NS1A 3EGDA 2JI4A 1WXGA 3PE3A 4R6XA 2X8AA 1H8HA 1O97D 4TQAA 3VXKA 1KNXA 2DFVA 2AA3A 4B3DA 4FHFA 1S7GA 5CD1A 2OO3A 3D2BA 2CE2X 2IP1A 3ZHOA 2QGNA 4JR0A 2FQWA 3LSTA 4AURA 4OQNA 4D46A 2NN3C 4HGQA 1GN9A 4IXNA 3T3DA 3G7UA 4JXKA 2C94A 3FVQA 3TGPA 4K40A 1OU0A 4N4AA 4NOMA 4U8HA 4UEWA 4WQMA 1QG6A 3KJNA 3DOOA 2A5YB 1KAEA 1L6IA 1X15A 3WIBA 4ETWA 4NQZA 4RTOA 1FUKA 3M6VA 4FILA 3WKEA 4ZIRA 3AV3A 1TO1E 4RTRA 1G6HA 5KNCH 4YHBA 1EFCA 3GOHA 2ODQA 4M21A 1TJYA 3RU2A 1P8AA 1CQPA 2GXSA 2IYSA 3IO5A 4OXRA 1QGUA 5BURA 3WL7A 4F3CA 4FT2A 2KS6A 2XZOA 1XCJA 1ZUNB 4JLKA 1CR2A 1BFKA 3V97A 5KCZA 1OTXA 1CUBA 4BO9A 3NW9A 2DKOA 5KAMA 1FMFA 3DMTC 3OZBA 4N9WA 4X5OA 4RKWA 3UANA 2OV2A 3W5SA 4H1TA 4D9JA 1MG0A 4JL6A 4YJKA 4HN9A 1JG7A 3FCYA 4O1MA 1HLFA 2I6SA 1LSOA 2WZBA 1UP6A 5TMDA 3SOPA 3ZY6A 2FU5C 3MBKA 4X1KA 5K0NA 5IFLA 2HA7A 1XXHB 2HBQA 3KHKA 3OCUA 4CPDA 3ZWDA 4URXR 5DP1A 3F5SA 3T5DA 5JFGA 4HZUA 3RVLA 2JHFA 4E1AA 2QRJA 4J3NA 2ODNA 2FCAA 4D0NA 1BS9A 2CSUA 1MZVA 4W5QA 3G9UA 2H2DA 2Y67A 4HGZA 1BS1A 1QIIA 2E4VA 1XNJA 1TUGA 1BAPA 3Q5EA 1RFGE 3B3QA 3OEED 4UUOA 5HKLA 3HXTA 1K89A 3UMGA 1ISJA 1P0IA 3MUFA 4KRGA 1NU6A 3D4IA 2BOVA 2FX5A 4BGEA 1KH1A 2O2IA 5AJYA 3NI2A 2C78A 1ZJZA 3DLTA 4EHJA 1FNBA 2FJUA 1BX1A 3L1IA 2I33A 4JBWA 5JS2A 1FFCA 2WDPA 3BGOS 3IP6A 1BRMA 2WSYB 4YN3A 5I01A 2NZWA 2YFKA 1QZUA 5KCMA 6GPBA 2CDBA 4OSPA 2H16A 1YV9A 1JBEA 2CKDA 3V3TA 4HYTA 4D97A 4Z4CA 2PVSA 3EBOA 4N5IX 4Q5IA 4X65B 2NQ2C 3IT2A 4HPXB 3AHIA 2B78A 4PWZA 4PZYA 1DP4A 1LLQA 4TXLA 1VPTA 3OJEA 1XOIA 3T3GA 4ZICA 1DU4A 2QSYA 1PAUA 1U8AA 3RNLA 3MB8A 5F2EA 2HSEA 3N2NA 1GUBA 1NXQA 5D7BA 1KBZA 2GN6A 2YWJA 1AG9A 1JHAA 4FYWA 5IBPA 5HJ7A 5L53A 2ZYAA 3NC0C 4F8JA 2OO5C 1YOVA 4QBKA 1UMBA 4Q01A 5BSWA 1MPTA 1THZA 1FFBA 2Q7XA 5DLEA 4TSRA 4TLLB 3QTBA 5DIZA 5AKGA 3CE6A 3EPPA 3QMVA 3SWWA 1W36D 4O3MA 1IEQA 1DBIA 1XDBA 1PZXA 2GB4A 1DS6A 2GBCA 3C70A 3DV2A 3IPAA 3PQDA 4MV9A 3RRJA 3I9V1 5LMNB 2WJZB 1T8SA 4TV8F 1VLVA 1RCTE 2H52A 4OHZA 1ZPDA 2I2CA 3U0VA 1CZKA 5AW5A 2YYZA 3C3WA 4BO4A 1CXZA 2HPZA 4EWLA 2GZ2A 2H1WA 1I33A 2XT0A 1NF8A 3UJNA 2A67A 2YN2A 9ATCA 1XCOA 4OUDA 4DSTA 4JBXA 4WECA 4EF4A 1OH5A 1BA2A 4MUYA 4YB8A 3HJHA 1V6SA 2OENG 1QBKC 1UEJA 4IR7A 4Z9BA 2P9HA 1FSSA 5KYTA 2CMGA 4OTZA 1PR4A 3UF0A 3W5CA 2XI4A 2DTDA 3H97A 2AC7A 1CY4A 2YN4A 4Q03A 3FUUA 3L8MA 5DSTA 4IYJA 1TVMA 1A3CA 3SIPA 5F9HA 1LNZA 3B6MA 4IG4A 2ZRMA 3HLKA 4LI3X 3AC0A 1NC1A 5KKAA 3VZPA 2GK3A 2PKYX 4IIFA 4GKJB 4KDCA 3ZDQA 3AFOA 3KXLA 3MT0A 1MA0A 2UUAB 4F5YA 2M9MA 2OC9A 2LRHA 3ZHUA 1CYEA 4LAFA 4KKVA 1HDYA 5EYPA 1XVAA 5HVNA 1G7RA 3B70A 3WKCA 1JFFB 2VSNA 5AHXA 4O4IA 5KMGA 4K0RA 3C7DB 5G1PA 1OLXB 3CCBA 2XOEA 4IOJA 3B5JA 3F0TA 1G4HA 1LWOA 5CA1F 1EHCA 4ZT2A 2C5BA 2YWRA 2O2DA 4IF6A 4D9EA 2I1VB 3O3NB 2CJXA 1JLRA 4LGVA 2I87A 1HOTA 4V0KA 5HQ3A 2W98A 5JXWA 3G6WA 2QTVA 5BMVA 1P0PA 3LT2A 5CW1A 5T8KA 2C4UA 2NQ8A 2XWQA 3D1VA 4YAJA 2VPWA 5B3JC 5C5EA 4UKDA 2GCOA 1DXYA 4FDVA 5HK9A 4U7HA 3RANA 4HLUA 4MLPA 5JAHA 1M2KA 4ZYVA 1NVDA 2CLCX 2ZI4A 1L9XA 4Q0MA 3ZDAA 2BD0A 4LJ9A 1P5RA 3QKSA 1J1UA 1LRLA 3N6RA 1N2EA 3IP1A 1W46A 1JAXA 5JIBA 1D0IA 2WSSA 4FBGA 4XUGB 4MAAA 4R3NA 3OZAA 3PD0A 3FOBA 1ULTA 4OHRA 1QZTA 1PQYA 3TSZA 3OICA 3J81A 3IPLA 1TEHA 2Z6AA 1FTSA 1L4HA 3HC7A 3IP3A 5CM8B 1EM8B 1WMSA 1IZ7A 3C43A 1T6BY 4RDCA 5DOVA 2NUPB 2HK8A 4X1YA 3THOA 2PL5A 3AEYA 1JAZA 1GPMA 2H5LA 3KOMA 4Z5XA 4Y2PA 3FM9A 3I2GA 2LIVA 4PSKA 3H5WA 1SR8A 4YP6A 1XHEA 3BOSA 1I10A 2JCYA 3GMDA 4J07A 1S7CA 3DM9B 3G7SA 2I71A 4UVEA 1KPGA 4KCGA 3O91A 2Z2JA 5LLSA 4HR7A 4RW0A 4D92A 3CEHA 3DWEX 5EHIA 1PEKE 4JA2A 3AWDA 3LCUA 5C80A 4YJDA 1I0IA 5HE9A 3CRNA 1NBMA 1Y7HA 1MDBA 3ECAA 1PSWA 3L7AA 3QK7A 4GX0A 4QOGA 4X61A 5CFQA 1YZ3A 4F04A 3L0YA 4YDRA 3EDYA 1ZN7A 3CV3A 4BX9A 1HE1C 2OUKA 2AMFA 4RMJA 3AMVA 4B2LA 3LHIA 4FFOA 3B48A 3FFWA 1DINA 4KX3A 4NPHA 5BNIA 3EVEA 1PFYA 3V33A 3UMVA 1ORIA 4TQGA 1T13A 3EXHA 3B7WA 2CUZA 1DRKA 5A9RA 4RGVA 2E4WA 3G8CA 2X0DA 4EB3A 1NV9A 1SIUA 4FD3A 2XTJA 2H1CA 2JS7A 5G0TA 1W88A 4RABA 4EYKA 4HZGA 1DLIA 2ZJ2A 3HG7A 4A10A 1M6VB 5IJZA 2CJWA 4C6TB 3NB0A 2VZ0A 4RK1A 5TJ9A 1FP4B 2NPIA 3PPXA 2BJVA 1QS0B 3BWBA 4D8UA 4GXNA 2AJ8A 1QAOA 2FAXA 2HBRA 1WM1A 2A4KA 3UMJA 1SU7A 4YUWA 1E2NA 1PWXA 4U2FA 5CT8A 5MF6A 5CD9A 1P81A 1NF3A 2E3JA 4RHTA 4M8IA 5ADUS 4BP1A 3C74A 4FLFA 1ZZEA 4UASA 4HNTA 1RPAA 1MEOA 3I61A 1DAOA 5IW8A 5J59A 3GPIA 1O08A 2AN9A 2VDKB 5AK5A 3WRYC 1NZJA 4JP5A 4HQNA 1LV8A 1GGJA 3LBNA 3X1ZA 3LHSA 2H06A 3ZS9A 1FW6A 3IXMA 3ZYZA 2ARKA 3SZMA 2Z83A 3DTVB 3O3OB 3ZY3A 4C6RA 3O2NA 3AYZB 1GHTA 2UZ1B 1F2UB 1PT9A 4WK0B 1GEGA 4OFBA 1H69A 4ZVLA 4LV5B 1LFAA 2P35A 1E8DA 2PBRA 3UMRA 5H02A 2AFIA 4GZ6A 4D42A 1YUNA 3G2OA 3GRFA 5ITZB 3TL6A 4CLOB 5LQCA 4UD6A 4PZ0A 5JC1A 5LD2B 3IR6A 1S9HA 2RCYA 4MUXA 2VZEA 2QX7A 4J03A 4LQLA 4DCUA 1N78A 5EPUA 2CBXA 1WW3A 1Z16A 1ATIA 4IIVA 5CG1A 4AQYB 2YZ2A 2QE7D 2BDEA 4HH1A 3R4VA 4FJ2A 3V4FA 1JFTA 1OTYA 3QMWA 1HORA 4CF4A 3ZIAA 1S96A 1Z15A 3D3WA 1GZ7A 4F9FA 2ZYWX 4DEYA 2BEVB 4Z4QA 2OFOA 2VBFA 3AP2A 4KQGA 5ALSA 5AJVB 1S02A 1QZXA 3S2EA 3R5HA 3P9PA 2J41A 3IGFA 4JHXA 4A3SA 4RTPA 4TUYA 4OV6B 1GQSA 4V0RA 3CKMA 1M0SA 5EJ4A 3ECSA 2AJBA 4C0KA 1Y8AA 2JBHA 2PKEA 4EB8A 3ZZ0A 1SC6A 3JZIA 1OB5A 1DKLA 4AIIA 3DZBA 5FWYB 2DRIA 1TYEB 2ZYSA 2OD2A 4KLCA 221PA 3NWOA 4ETIA 2PO5A 5CVEA 4IV5A 2GZSA 3V4OA 1U98A 3N2YA 3E35A 1TD1A 3DDHA 3FYCA 1I80A 1KK1A 4XUDA 4DWJA 4TWBA 3MRXA 4LUCA 1ZX1A 2VSOA 2D2FA 4AWAA 4JOQA 4US2R 4KK3A 4DMGA 1YZVA 5CFZA 4WGFA 2VK2A 3HEAA 3C5VA 1U80A 1UC5B 3BRWA 2JPDA 3P9YA 4MV4A 5IT0A 4HYEA 3QP9A 4Q3DA 2KI5A 3H9GA 3ZHRA 5E6RB 4GDFA 1WD7A 2DGDA 2VNKA 1RRGA 1G7CA 3EXG2 4NCNA 5T3YA 2Y68A 4ZN6A 4B35A 1QO0D 3UEOA 4DXAA 2KQUA 4KNWA 3UOGA 4HUJA 3AK4A 5BNWA 4ZVTA 1KEVA 3SS7X 3CF4A 1A2QA 5JZOA 1JXOA 3ZGNA 1I5EA 4JJGA 4H15A 1HFWA 2G36A 4NCJA 3B6JA 1RJEA 3IUJA 4KYTA 4RENA 1P7ZA 2Q6TA 4TYQA 5DI3B 1OX4A 1T8YA 5FHRA 4WOPA 4D9IA 4YUZA 3H2KA 5H3CA 2ON6A 2AXQA 2MSDB 4RK0A 1QU2A 2E6KA 1OYOA 1SU8A 1WUIS 5DM2A 1T15A 1U28C 2QRLA 3CLUC 3D81A 2ZLBA 3F4KA 1FSFA 5FULA 3T1OA 3EHDA 1QZZA 5JXHA 3DEKA 2FR8C 1XZMA 1JRLA 2EJVA 4JKYA 3A36A 1R6BX 1L8LA 2R6ZA 3ABRB 4J9UE 4U7TB 5D3ZA 4BVEA 3EGXA 1Q1ZA 4D6PA 2C2XA 3U3XA 4PC7A 5B5SA 4V2UA 4YTEA 2CEAA 2BFNA 4OVKA 3WYBA 4EATA 3LBFA 3OECA 4DDTA 1S8OA 4EPRA 2DLCX 2WWTA 2ZCVA 3ETGA 3TINA 1TEXA 1XYYA 2QYSA 5E4YA 4W8GA 3DDZX 4U2GA 2HA6A 4YMGA 4OMFG 1MABB 1N7IA 1V7QA 4G24A 4MP3A 4NSNA 5LVAA 5BV2P 1FFXA 1L1RA 1TK3A 2TECE 3ETCA 2HRCA 1ZI6A 4QJIA 3URMA 5B30A 4MI6A 4G1FA 1XRJA 3D8UA 2PD4A 1AKQA 3ZWNA 2QXYA 2TMDA 1BEUB 2MMCA 1E2UA 1GKIA 3FCCA 4IGKA 4E51A 1A5BB 4BEBA 2R7KA 2VUTA 1O94A 1BOFA 4Y3UA 4FMDF 4DRXA 5HYVA 4ZK2A 4NBKA 1R88A 1M2JA 5BNZA 3VPGA 4R1LA 4RAOA 3B53X 1XUOA 5ALMA 2REBA 3G89A 2A6PA 1T1SA 1U3TA 1JG4A 1O3YA 1ESMA 1UINA 3ZBQA 5A9SA 4ALKA 2A3NA 4PAGA 2GZMA 1MO3A 2ZXUA 4ZZIA 5JFOA 2P78A 4ZEWA 1UCFA 4BNVA 5J4HA 1DEXA 1P1IA 1RAIA 3I23A 2RARA 3IAXA 5AKHA 3VR4H 4QDKA 2I7VA 3V2HA 2XMZA 4OK5A 4BQNA 3UUEA 1E1QA 3SQXA 3IAS1 3PK0A 3PP8A 1BMDA 1SXJB 2ATEA 1K92A 1JQ5A 3E18A 3EAFA 3M70A 4ZOEA 2FW9A 4EI8A 1USWA 2RGWA 1GKYA 2GEDA 4AX8A 2QVBA 3P0RA 4ZCRA 2G7MC 3O4RA 2G0TA 1KY5A 5JAIA 1QFZA 5IM4A 2PWZA 3EUEA 3ORRA 4JT4A 3EFOB 3WSTA 4ZMBA 4NBSA 1LTKA 2G83A 1Y9ZA 4YAWA 3WNQA 4FYHA 4OQFA 4YO8A 3CLSD 4EPVA 3IAAA 3N2KA 2Z9CA 3GBSA 1A9TA 1HG0A 2V3VA 3PUHA 3FZYA 5BWOA 3ABQB 4PN7A 1GUDA 4YRLA 4RIEA 3RYIB 3KQNA 1A4RA 1UMDA 4MW9A 1Q0LA 1WVGA 1H3NA 2AOUA 4A7PA 4Y7DA 3O1HB 1SHKA 3OIDA 1L5GB 4C0LA 1Z7GA 3TH5A 2XMSA 4G8JA 2BRUA 4U7JA 4BVHA 1XZQA 4DNXA 3BXPA 2ZBFA 1ZBDA 1DX6A 3A6JA 2GZAA 4IINA 3GLHA 1V37A 1R5OA 1BS2A 1TKAA 2NO6A 4QUJA 2HBYA 2X4IA 3QIAA 4FR2A 3SX0A 2LP4Y 5BN3A 5GZ1A 1GPKA 2PUHA 3OEHD 2RHJA 3DMYA 3DMRA 3N05A 5HXAA 1JXMA 1P80A 2ID7A 4LJSA 1T5SA 3SZGA 1ZH0A 3U9TA 1GAQA 2BBWA 5CNIA 5HILA 1XTVA 4IXTA 1VI2A 1QRTA 1CD5A 1O96A 2JBWA 3OZFA 4EMSA 3HU1A 2DHQA 4I1IA 3FA2A 4CDMA 1AQUA 4YRBA 5JDCC 2FPGB 4F3KA 3PFHA 3MJDA 4AS3A 5EZYF 4MKHA 3R7DA 1L3IA 4MW7A 4KQCA 3RK1A 5CB4F 1JIVA 4LGMA 4TYYA 4LNUB 1E3WB 3E61A 2HF7A 2SICE 5FBKA 2ZBEA 1RWPA 5AXDA 4ETNA 1L8XA 5DO9A 2H5IA 4PYRA 3GEIA 3KSMA 2PZLA 1BYIA 2NW6A 1VOTA 3RIGA 1QH1A 4B17A 1V71A 3F49S 2PLRA 3CE9A 4OHWA 3IAHA 3ROPA 2Z2IA 3OCXA 2QRPA 4KE8A 3D3NA 4XGIA 4B3CA 3CBGA 1NQXA 3G2LA 4M8LA 2BGNA 2WUFA 4YMWA 4JB2A 1KS2A 3QEMA 3F4LA 4NDNE 3WK8A 2VTEA 4JIMA 3U16A 1PVOA 1XAHA 4Z1MD 2QN1A 2FTKE 4HDSB 4LDAA 3EVDA 5D1NA 1HQCA 2R0QC 3T9AA 1L4NA 1SVMA 3SKYA 8ADHA 4OYLA 2XLCA 3QBVA 2AC2A 1F2TA 2GFQA 2BBTA 3L4SO 4W5JA 3RV3A 5LU8A 2FPIA 2FG5A 4K86A 4ZA2A 1M2EA 3CNEA 4AO6A 3HU5A 1IQ0A 1YVUA 3JQFA 1GSOA 3UWDA 1YBMA 3PHJA 4ARUA 5DXJA 4PGFA 3E7DA 4S35A 5EXTA 5J23A 4EMBA 3OC6A 2CLIB 2G70A 4ZPXA 2VO1A 2AHOA 1V8FA 4I3HA 2RGGA 3GFRA 4A23A 1YI0A 2XQVA 2E87A 3BMNB 4HRYA 4RHCA 4LRUA 3N1UA 4P38A 3E9RA 3T7DA 4ZGGA 3NORA 2P5YA 2PSDA 3K0BA 1EG2A 1G7SA 1UJ6A 3LAWA 5EHNA 4YUVA 1FIUA 1KAOA 2QZ4A 1II9A 1PBNA 2HWYA 4DV5B 3UT5A 5B3AA 4B4DA 2I4NA 1WX1A 2Q8NA 4Z0PA 3C3PA 4HH0A 3KU4A 1LPBB 1XCLA 2DR0A 2FW1A 4H59A 1XVIA 2I54A 1ND6A 3FOWA 5FCDA 2GF2A 2M6RA 1FY2A 3IEXA 4UBNA 2GEKA 5AKEA 4N47A 1TGVA 3ZU6A 2HRRA 2W6ZA 3PFBA 3UIEA 4BAUA 4D3DA 4M0PA 2BLLA 4KU4A 3SE0A 5TEWA 4J0DA 4BNTA 5A4JA 2OCKA 5D6OA 2QD5A 3H04A 3WGNA 5FWXA 4IIEA 4CM7A 1Z8DA 4IDCA 3SFVA 2ID8A 2JF0A 2LW7A 2W6JD 4KAAA 4OFXA 4K9NA 5SZJA 3ZH9B 4CLRA 1H1DA 3LFHA 3AHDA 1V5EA 1KVQA 4RC9A 1K6IA 1WPXA 2C61A 1CUIA 3MT9A 1YHZA 4YJ2B 5DYGA 2Q4RA 3N2EA 4BU1A 3T3EA 2PUCA 1T3TA 2OG1A 4DRYA 1SXQA 4TSFA 1PNOA 2P5UA 3N8KA 4HH3C 4I0WB 2RG7A 4IVRA 3AY0A 4J3JA 4MQFB 2GETA 5BUSA 1NVVR 2GWRA 4JLVA 4ZT3A 2X9VA 3DQPA 3HL4A 3F9IA 2JK0A 3K9FC 3JYLA 3LPCA 4HSGA 4F2PA 1FSGA 4MYCA 3UATA 1ZU4A 4G5OA 4KTVE 4O1IA 1NXOA 1J2JA 2FFRA 3RG8A 4DXHA 4H1HA 3UT6A 3VNRA 1DC5A 1Y5RA 3OLQA 4XUEA 4YP5A 1NM5C 4D26A 2H4WA 2AE1A 2YJ6A 4PSVA 5CLIA 3TNLA 1TT7A 4U2BA 2WWHA 1T2AA 2JCXA 3NDPA 3HXPA 1YQGA 3W7VA 3WLKX 4AB1A 5I5EA 3G59A 5JAQA 3AESB 2AN5A 1E7RA 3SJCA 2CMKA 5B64A 3ITEA 1RSZA 1DO8A 1Z82A 1UQTA 1ISPA 1Z6TA 3C5EA 4PHTA 4Y2GA 5IYZF 3I9LA 4KQEA 1NMZA 3H2ZA 4YT2A 2Z58A 2F8TA 1EK0A 3BC1A 2ZIWB 1DHRA 4HDRA 2QRZA 4PS0A 1YUBA 3DJYA 4E5SA 1F8YA 3Q6NA 2GAIA 3OPMA 1CQXA 4AJ1A 3E9MA 1NBHA 3H4IA 3VVMA 4GLOA 1I6WA 2R47A 3OZWA 1O7JA 4L5CA 2GVNA 4E46A 1Z38A 3F7MA 3THSA 4LF7B 4WW0A 2EWWA 3RKSA 1KNQA 1VJRA 2WHRA 3HKCB 3PXGA 4J49A 2AYZA 4RA6A 3FZQA 2IHNA 1FX0A 1U7OA 3KE9A 2FGJA 3GCDA 4ME6A 3EGOA 4F6LA 3AR6A 4D9GA 1AHNA 4N5DA 4JI1B 1X14A 2P4UA 3JAKA 1E59A 3P9NA 3MM4A 3VAZA 3ZZNA 1XO1A 3KQHA 2CV1A 1BX0A 4DG9A 4DCMA 3D2CA 1AIPA 4NX2A 5KNBA 1YZNA 3A3NA 1EGHA 3HR7A 2YC4C 1J49A 4LTNA 1P3Y1 4KXVA 1W5EA 5IBRA 5AKIA 1RMQA 4MQMA 4EEKA 1FQJA 5FR2A 2IS4A 2B1GA 5K0CA 4LGYA 3VO1A 1VCIA 5FPKA 1HKUA 4PXYA 4FEAA 1E79A 5KX5A 3BE8A 4GSYA 3DR3A 4QOIA 1HQYE 4OXIA 4BO5A 2DULA 3O03A 1FW8A 2QP3A 3FE2A 3GN2A 4OGGA 3Q7SA 2WPNA 4JAVC 3W6ZA 2IXFA 3H5LA 2WYIA 3GRVA 4I3GA 1IZZA 1ZD3A 1YTLA 3O4FA 1ISSA 1RW4A 2UZ4A 2J3LA 5IDXA 3HCFA 4DV4B 2VCEA 3P9ZA 4GMKA 4PAWA 1U6JA 1W4RA 4L8FA 1L9KA 3RSOA 4CHTA 2JJ2A 2FWNA 2Z95A 3WNBA 3F8SA 4BZXA 4AKIA 3OA0A 3U3OA 4ZT4A 3E9YA 1KI6B 2LPMA 5HGJA 1OT5A 3QQ5A 4Y2XA 1W52X 4AY3A 5TQVA 1WTAA 4HF7A 2MT9A 5MHTA 4D43A 5C5IA 1LSUA 1AT1A 2P2GA 4CTMA 2WHEA 3N0TA 2PMEA 1XVLA 3SBDA 2IYTA 2PJRA 1PS9A 3UWMA 2FE4A 1Z13A 2XJ4A 4MAMA 4LYAA 5CFOA 1GZSA 1QIFA 1IE3A 3N8GA 4RJIA 2XNKA 4J4BA 3Q0EA 2JJ8A 4AZSA 3VYVA 5JYEA 1Y9AA 1V16A 2PL1A 2Y1FA 2PKWA 2CC2A 2GD0A 4YCJA 5D3QA 1MO2A 4YP1A 5T4FA 2VJPA 3W1EA 2SCUB 3L79A 5EHZA 2Q3FA 1BDHA 4JEIA 5ALUA 2WOJA 4I66A 5TX7A 1MJFA 2EJBA 3RTBA 3ZWAA 1NRIA 3A6FA 2O2JA 3SNKA 3HBLA 5H82A 5DPMA 2EJWA 2Q2QA 2ODTX 3DTTA 1UWKA 3IUNA 3PR3A 2B0CA 2ET6A 1GG8A 2I4TA 1DMSA 1NATA 2JJMA 2QAGC 3FRIA 4OREX 4EFDA 5KOHB 3MRVA 4BZPA 1IBLB 1BQ4A 4AUMA 3OSUA 3EFHA 2H92A 3CZ5A 2IYXA 4MSUA 4NBWA 4MI3A 1ZGZA 1RPNA 4L74A 5LM3A 1IZ9A 1RWVA 2KSQA 3DTYA 3MGBA 3AEQB 1E6LA 2QMQA 1SHJA 1U8YA 3GD5A 1I4OA 5I48A 5JJLA 3DZJA 5IKPA 4PC6A 2PUVA 3FUTA 1FFAA 3TR5A 3BIOA 3UC5A 2O8DB 3K8ZA 1NJ5A 5A5DA 4UUQA 1L5LA 5BSVA 2ZRQA 1AXEA 1GG2A 1KJNA 3GO4A 3NC1C 5HZKA 1XP5A 2BFDA 3U6KA 3HMKA 1J39A 2R4UA 3AHCA 3IJRA 4JJ6A 5BOSA 4QIHA 4EHBA 2VSFA 2QR2A 2QN2A 2B8WA 5ULLA 1EFDN 4HNSA 1LFDB 1C7QA 3OFSA 3GFSA 3O2JA 1M73E 1RJDA 4EDFA 4FR0A 5BW4A 1B6SA 2ZVQX 2P9EA 3EF1A 2OL4A 2EL9A 1PE0A 1U2DA 4L9WA 2PNJA 1NRXA 4BKRA 1TM4E 1XZPA 3K16A 5AFSA 5CFLA 1R0LA 1ZMRA 2FSVA 2WIBA 2W2LD 2PVPA 3UW1A 1DRWA 1UP4A 4ZALA 2QZJA 1C7IA 4DLVA 1VQ1A 4PFJA 1PVDA 2N9UA 4TLBA