4U2KA

X-ray structure uridine phosphorylase from vibrio cholerae in complex with anticancer compound at 2.13 a resolution
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
251
structure length
245
Chain Sequence
KTVFHLGVTEADLNGATLAIIPGDPARVQKIAELMDNPVFLASHREYTVYRAELDGQSVVVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHVNVGDMIVTTGSVRLDGASLHFAPMEFPAVPDFDVATAMKAAAQESGATVHMGVTASSDTFYPGQERYDTFTGRVVRRFQGSMKEWQDMGVLNFEMESATLLTMCASSGLKAGCVAGVIINRTQATLKETEARSIKVVVEAARKMLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title X-ray structure uridine phosphorylase from Vibrio cholerae in complex with new anticancer compound at 1.17 A resolution
rcsb
source organism Vibrio cholerae
molecule tags Transferase
total genus 85
structure length 245
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2014-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4u2kA00
4DA8A 3DDOA 4TTIA 3UAYA 3DF9A 1Y1RA 2HSWA 1C3XA 2OECA 1SJ9A 4G8JA 3EEIA 1PR4A 1LV8A 1PWYE 3DPSA 4D9HA 1VHWA 4BMXA 3LA8A 1Y1QA 4M3NA 1SD2A 1OTYA 1Y1TA 2QSUA 1FXUA 4I2VA 4OY3A 4L5CA 3NM4A 1RYZA 4E1VA 1PKEA 5KB3A 1ZOSA 1A9RA 1T0UA 1RXSA 3PNSA 1V41E 3KVRA 1VHJA 3BL6A 4M7WA 4WKPA 4OF4A 4KN5A 5F7JA 1RXUA 1Y1SA 1ZL2A 1ULBA 4DAEA 2AI1A 1Z39A 4QARA 4YMLA 1T8SA 3KVVA 5F78A 4TXHA 1TCUA 2Q7OE 4EARA 4OGKA 5CCDA 4LNAA 4DABA 1K27A 4GKAA 3F8WA 5F7XA 1NC3A 1Z33A 4TYMA 3P0FA 3K8OE 4H1TA 4GLFA 5CCEA 5EFOA 1V3QE 1Z5PA 5F73A 3INYA 3T94A 4TXMA 1T8WA 3MMSA 3UAWA 4OJTA 3UT6A 1U1DA 3EMVA 1G2OA 1TCVA 3K8QA 3NBQA 4F2PA 1OU4A 1LVUA 5IU6A 1VFNA 3FOWA 3KHSA 3U40A 1LX7A 1T8RA 1Z5NA 2GUWA 3OOHA 4R31A 1PR2A 1SD1A 3KU4A 4BMYA 3UAXA 1PR6A 1Z37A 4TTAA 3C74A 2BSXA 2A0XA 4TS3A 3D1VA 1JE1A 1A69A 1PR1A 1Y6RA 5B7QA 2HN9A 1A9TA 1OVGA 1PBNA 3DP9A 1Q1GA 1RCTE 4G41A 5IFKA 4M1EA 4WKOA 2OC9A 3FNQA 4D8VA 4OGLA 1JDVA 2A0WA 1PW7A 1Z34A 4D98A 5CXQA 4YNBA 3MB8A 4K6OA 2A0YA 4IP0A 1A9OA 1I80A 1YRYE 5EUBA 5B7PA 4WKBA 4X24A 1Z36A 2AI3A 1ECPA 3O4VA 3KVYA 3OOEA 4OEHA 4QAQA 1YR3A 3UAZA 2AI2A 1YQUA 1K9SA 3P0EA 1PR0A 4DANA 1OTXA 4DA6A 3QPBA 4TXJA 4NSNA 4U2KA 1V2HE 3NM6B 1V45E 5B7NA 1CB0A 1QE5A 4MCIA 3OZCA 4JOSA 1T8YA 4ECEA 1Z35A 2B94A 1JP7A 3ODGA 5C80A 3IOMA 4LDNA 1RFGE 1RR6A 3OCCA 1JDSA 5B7GA 3FB1A 5F7OA 1PR5A 5CYGA 1PK7A 2HRDA 1YBFA 4TXNA 1B8OA 2RJ3A 5EPUA 1VMKA 4DA0A 3ONVA 1ODLA 1M73E 2I8AA 1RXCA 2PGAA 3GB9A 3NM5A 3OZBA 4YJKA 5K1ZA 4JP5A 1RT9A 4BMZA 1ODJA 1U1EA 1PF7E 1JYSA 1U1GA 4L5YA 5I3CA 1N3IA 1NC1A 1YQQA 1PK9A 4BN0A 2QTGA 4UC0A 2OXFA 4QATA 3LGSA 4GLJA 1JE0A 3FUCA 2HWUA 4R2WA 3E9RA 3OF3A 5F7ZA 3TL6A 4NY1A 4QASA 5JPCA 4F2WA 2A8YA 1U1FA 1XE3A 4GMHA 1V48A 4FFSA 2QTTA 3SCZA 3PHBE 4EB8A 5ETJA 2I4TA 3FWPA 5F77A 5CYFA 3DJFA 5CXSA 3PNPA 4QEZA 4PR3A 4WKNA 3BGSA 3GGSA 4QFBA 1ULAA 1SQ6A 1CG6A 1JDTA 4R2XA 3EUFA 5DK6A 4D8YA 1JDZA 4LKRA 1ODIA 4WKCA 2XRFA 4RJ2A 1JDUA 4L5AA 1V4NA 4P54A 1OV6A 4DAOA 3E0QA 3OPVA 4DARA 2AC7A 3LBAA 4LZWA 1B8NA 2QPLA 4F1WA 3OZEA 2QDKA 1K3FA 1A9QA 3E9ZA 4MCHA 4YO8A 3BJEA 4F3KA 4LNHA 3PHCA 4TTJA 3EUEA 1Z38A 3FAZA 4NS1A 4TXLA 5F76A 4MARA 4L0MA 3ENZA 4TS9A 5FAKA 3O6VA 4PNPA 1NW4A 2ISCA 2ON6A 1RXYA 1Z5OA 4D8XA 1A9PA 4F3CA 1TGYA 2IQ5A 4L6IA 1OUMA 2P4SA 1WTAA 4JWTA 1ODKA 1RSZA 2H8GA 1A9SA 1Y6QA 3OZDA 3UAVA 2OC4A 3BSFA 4G89A 3KUKA 4DA7A 1JPVA 3IEXA 1TD1A 1U1CA 1TGVA
chains in the Genus database with same CATH superfamily
5IJZA 1MC5A 3EBLA 2B4AA 3O4FA 4UDOA 1F0YA 1XP8A 4TLCA 1K08A 1G9SA 1X1RA 1HSOA 3VHQA 3JR3A 2BUCA 3MRTA 4JAVC 3SFZA 2J0VA 3DDOA 2A14A 2FJPA 3ZNQA 4B7XA 4DY4A 2TMKA 3IUYA 2PS0A 3M3DA 4LWZA 3NIWA 1J20A 1P6QA 3JRXA 3OF5A 4M46A 5JS2A 2O5CA 3ZH9B 3VNVA 2G70A 4CUZA 2R7AA 4F7WA 3DMHA 4CLHA 5K01A 1DPFA 3EGDB 2RGAA 1N2SA 3R7WA 1PNQA 2GD1O 3IL2A 1T6YA 2ZUVA 4J16C 2XNKA 1ND6A 4BU1A 3HZZA 3WO1A 1IG3A 4BCDA 4LRUA 2OAP1 4I4NA 2B1IA 1FBTA 4Q1AA 1WO8A 3EISA 5HKAA 1EXVA 2MINB 2HX1A 4KMOA 3B1KA 4GMGA 2P69A 5I4CA 1FDWA 4NS4A 4P6VF 4AY5A 3A3YA 3O9MA 1UZLA 1DG3A 1BMFA 2REBA 3STYA 1H2WA 2BCEA 3D2BA 1K88A 4CKCA 5IP5A 1QIFA 3DMNA 3FR7A 4EJ0A 1O6FA 4CG1A 4MKZA 1PKEA 2C61A 1ZUHA 2W2QA 1PEYA 2J7PA 3ED5A 2H1IA 1TM7E 4HTFB 1XRRA 3E23A 4TKVB 3ZZ1A 4C0LA 4KJXA 4NZNA 2OO5A 3GELA 1ZK1A 4IIJA 4E5YA 3AXSA 3HZRA 3UJBA 4Z51A 4D4GA 1E7WA 3BE4A 1Z83A 4B7CA 3ZJ5A 1ZESA 5EP4A 2FTKE 4ZEOA 1S3IA 1JQEA 4RK6A 3I0NA 2RJOA 2FOLA 4P58A 1MJGM 1NBEA 1QP4A 3LUBA 4BQQA 3HWX1 1KSFX 2O8CA 1AUVA 2PWAA 1P29A 5H3CA 4OG2A 4MKFA 3T7IA 3LFUA 4JI4B 4DAEA 3T5BA 2DX7A 4KIJA 4CPDA 1WSBA 1Q17A 3QITA 1FYXA 4QARA 2XDWA 2YHUA 5TPWB 4AQDA 1EE9A 2X1MA 3AO0B 4JLPA 2GZRA 4QVGA 5EI5A 1TT5A 3ZW9A 1UWKA 5HM6A 5F78A 2DC1A 1SCNE 4QM7A 1I6LA 1WF3A 1Z06A 1T3SA 2YQZA 3DDHA 3EVNA 1H4SA 1AB6A 1Z07A 2A0FA 3BWVA 2CDCA 3F1KA 3FN4A 3QOWA 4RVHA 4BGDA 5LQNA 5JBIA 2X9QA 5CM2Z 4EEXA 1QH0A 4JJ4A 4GZMA 3B1ZA 4IFIA 4V0QA 3VR6H 3ZV5A 4POOA 3FUTA 3BRWA 3W8NA 2F00A 3BMCA 2D4HA 4BN5A 4TQUS 1G8GA 3PPWA 4WGFA 3TRDA 1E89A 2IITA 1DINA 3SNKA 3ZWPA 4BMCA 4DUYB 4R2JA 3C7CB 3GJ5A 3OKCA 5DT2A 3RNLA 3W9BA 4LF7B 2O3UA 4OTZA 2PS1A 2OHIA 3CLHA 5BOVA 2P1ZA 2FPGA 1F20A 1VE6A 3NAQA 2QNIA 1E2NA 1CJMA 1L8AA 4Q7MB 2EFDB 4CKWB 4JU9A 2A5FA 1TMYA 2NSDA 1AKQA 2LCIA 3DTVA 4KUGA 1N5DA 2OM6A 3UY4A 3THRA 3HXOA 3OD5A 2QHXA 1GU1A 5LNK6 1V4VA 4NULA 1BXRA 2XE6A 4W5OA 3W7VA 3IKTA 1L4YA 3C1UA 2XBMA 3VZRA 1V5EA 1XCOA 1SAYA 2Q46A 1UWLA 3DE4X 5ADWA 4B40A 2IXTA 1E59A 2G06A 2B2XA 1VKJA 2D0PB 4LQCA 2UYYA 5DM4A 4L75A 2DFVA 4Y1FA 2GPBA 3KQOA 5TQ2A 1JG4A 1KKLA 4DRZA 1ZN7A 4S05A 4R0NA 1D1TA 4ZVUA 1FUYB 2AR7A 3EVGA 5C4IA 2EOAA 4BIIA 2BI7A 2PT9A 2VXCA 1FNSA 2JFZA 1NP3A 3FNRA 2JI7A 3K6RA 3NR2A 5A9TA 5A7FA 4MV5A 3H1BA 3K2QA 1A2BA 2I3ZA 3ZE0B 3UWSA 1RQ7A 4U7DA 1EWRA 2XGSA 3SZRA 3FPBA 5A2GA 1D2GA 1DTSA 3BJMA 3A1SA 2X3YA 1E5VA 3E3MA 3LY9A 4OGFA 1EZZA 1HR0B 3W8FA 2PUGA 1U2DA 2ZPUA 1PJ4A 2VYCA 5KWVA 5KS2A 3T3NA 1A4UA 3TRFA 2Q3EA 4Z1MD 2O3TA 1ZJWA 3BQNB 3DNFA 3NYIA 3NAMA 3AZPA 5CIQA 3LM8A 4TTAA 4UHDA 4H27A 3AL0C 4ZKEA 5CB0A 4JUBA 1VIYA 2IE0A 2DT8A 1VXRA 4TS3A 4JIMA 3RGWS 1BJRE 4FYMA 3O7WA 5IN4A 3MRXA 1U2GC 2DQSA 2X4IA 2GKOA 2RGWA 3DVSX 4MR9B 3DAGA 1DJLA 3X1JA 2HBRA 4UE3S 4W8OA 4PO1A 5EKXA 2DB3A 1BXKA 4XJXA 2GBPA 5HUQA 4CTKA 1E20A 1Z6ZA 3A28A 4UVEA 4YRKA 5FV7A 4Z9YA 4IBOA 4OUDB 3I83A 5GP1A 4F4FA 1T4MA 1XOIA 1JZQA 1XQWA 3BCSA 4HQOA 4WOCA 1HV8A 2UVPA 2EP7A 3OT1A 4B79A 3EMKA 5GWXA 4QSHA 3WJAA 4HDOB 2R5NA 3T1YB 2ZRDA 3QFFA 4JJKA 4KQ6A 1HNWB 2DHRA 4G41A 1FIUA 1I8TA 1KOFA 1IZ9A 1W87A 3PFNA 4X60A 3TINA 3GLFA 2D2FA 1KDYA 2PGNA 3G23A 4TROA 2SECE 3ETGA 1ZJ5A 1MA3A 3H3XA 1DFGA 4Y9RA 4G5XA 4TTVA 1VE1A 5EXSA 4NICA 4LXYA 1NMXA 1ZPDA 1AX9A 4MR7B 4BPBA 1CT9A 3G0DA 5C7OO 3W4JA 5CFLA 4FJ1A 3DE0X 4P3XA 3JYOA 2XNDA 1NRIA 5C35A 3CJRA 1SBHA 1RBZA 3MB8A 3RQSA 2XD4A 3DM9B 5G2OA 3G2HA 3LCJA 2EATA 3W2FA 2H08A 3CNOA 1Q1EA 4EUKA 5LDHA 3MW8A 1IK4A 2B6HA 4MKGA 3WL8A 4HS4A 4WADA 4HGQA 3SIRA 2HPHA 3VGPA 2F9LA 5AJVB 2IUSA 4BWGA 3F67A 3FTPA 1Q16A 2IZOA 2K4MA 3DH0A 3HDJA 5FPTA 4YT8A 1PG5A 5C8ZA 4HMQA 3GGOA 1QP0A 4MB6A 1PGOA 1ODSA 3H7AA 2OBLA 5DMHA 2H51A 4QAQA 5EMMA 5C5CA 5JATA 2IS2A 3O93A 1SCJA 3DOEA 4H6VA 4J3NA 4EVIA 3S68A 3VHXA 2P75A 2WJ3A 2H17A 1J39A 1F2DA 5IUKC 4MGHA 1NI4A 2CT8A 3P9NA 5JH7A 1UEJA 2WICA 3LWDA 1WUIS 3T0FA 3G9QA 2E55A 3K0AB 4HDQB 5I9IA 4YO7A 4GECA 4F86A 3LY7A 4ND2A 3WISA 3GDOA 3LWNA 3N0TA 2JJ1D 3MT8A 4ZVOA 4EUNA 3OHSX 1XNHA 2V97A 3MLBA 3SE7A 1QYDA 3SKYA 4B1FA 2PLFA 2C1EA 3HB7A 3LUJA 1IQ0A 2OCXA 3IKLA 3RBXA 4IIYA 3OLWA 1FDRA 3DS8A 1EFRA 2XQFA 5JMOA 3I1YA 5EQTA 5DNEA 1YCHA 3ZWOA 4LZNA 3E18A 1ZW6A 2ASEA 5GV7A 2ZJ5A 1VP9A 3N6RA 3E9EA 2Y0PA 5CGZA 4R9UC 3MJVA 3T5TA 3VOSA 4U9HS 1OR8A 2QE7D 3EH1A 2AE1A 4XWAA 1G5RA 2AUNA 4QT0A 1VHLA 5CT6A 2J3KA 4PX2A 2JVIA 3RFFA 3A6LA 3NKLA 1QRTA 4MRNA 4IGFA 2OD2A 3L6BA 1AKYA 1GZSA 3B85A 3E05A 1RJDA 4PANA 4ZC8A 1C81A 5CYGA 3TPFA 3K1AB 1BO6A 5FOVA 2WQZA 5BV2P 3OX4A 2AHRA 1XBTA 4Q05A 5DK4A 2BTOA 2HA6A 1Q1AA 3T3HA 2RJ3A 1KH1A 3I2FA 4TV8B 3KOMA 5CD9A 4AAYA 4MVJG 1D4OA 4U6QA 2DTDA 2OUKA 4OHWA 2PX6A 3L1HA 1RXCA 4CFYA 2P77A 1YZGA 4A1OA 2F1JA 5LLSA 4AP9A 5B6JA 5K3OA 1RWNA 3T3OA 3ZU5A 2IY9A 1PLJA 1SULA 2GM5A 1KH3A 2IC5A 2Q27A 3LKVA 4G56A 1OYVA 4PZ9A 5TV2A 1ZIPA 3MWDB 4AYXA 2ZIUB 1XHLA 4MNTA 3QEBZ 3Q0EA 1L0BA 4MVJP 5AVTA 1K66A 1CY6A 1L8LA 1MX1A 2R8EA 2VXBA 3LVQE 1L3IA 4FBGA 4QUJA 4RQAA 3VQTA 4HV4A 1SCKA 2YXPX 2CDNA 4JJ6A 2D1QA 3K4QA 3I9OA 4JLVA 4BBPA 4CCYA 4QRIA 3EQ9A 2CMGA 1HYQA 2HDOA 3AEZA 4C3VA 4S24A 3BK1A 2V7EA 3WBBA 1T25A 1B0UA 3SX0A 4D9KA 4UBLA 1TFRA 1QIMA 3KKPA 5AIBA 5KMGB 3D7LA 3R40A 3OLQA 4QDXA 1QRRA 4U2DA 5K0GA 1KL7A 1R4AA 4N5MA 2OBYA 4KR0A 4R9SA 4Q3AA 3TCKA 4C22A 2Z3VA 4JLWA 3G2NA 3WDMA 5PGMA 3D6MA 1WB4A 1Q0TA 5FHQA 3NEPX 2MHCA 1Y37A 2BP7B 3U7EB 4BVBA 5LXTA 1ZXBA 4LCEA 5GPBA 1JE0A 3RUFA 5JYDA 3T7JA 2JC3A 4EG1A 5BVHB 1KAGA 1UK6A 2HV9A 4H59A 4I7EA 4INZA 1XC7A 2CMFA 2C03A 3KDPA 3T35A 3BDIA 3KQNA 5BN4A 5M34A 3KAJA 3L05A 1EFPB 2ZYUX 5F7ZA 1KJNA 3HB5X 2OQVA 1I3CA 2DR0A 2KW5A 3AMVA 1ZAKA 3WIUA 1C9DB 1JILA 1R8YA 3KJNA 4QASA 3WK9A 4CM7A 4PZUA 2W8ZA 4ABTA 2QUAA 2QN6A 2QTRA 1IQPA 1B93A 2W6PA 3L7KA 2G67A 4I6JA 4NPHA 4BS9A 4B6PA 1X1BA 3CPSA 4PCVA 4DLBA 2Y99A 4P92A 4DJAA 4K9MA 1IZYA 1V48A 5DHAA 5CK4A 3A26A 4XIIA 3KIPA 5EXDA 2PUAA 4D25A 2PXAA 2YJNA 5SYMA 5EUMA 2IOQA 4QEDA 2B8JA 2PX0A 4Q19A 3TZ6A 4BP8A 3RI3A 3SIPA 3DEHA 5CXSA 3R7BA 2DLDA 4ND5A 3T95A 3JAKB 5C5DA 5F9FA 1KE2A 4URVR 4EG6A 4MAAA 2GM4A 4TPKA 5IC5A 4B7ZA 4IW3B 4IXWA 4BNDB 4HXFB 1O6CA 4JC4A 2WD8A 2G04A 5CVEA 4ZI7F 1W52X 1IHPA 3GJXC 4H17A 1NQWA 3UUWA 2WILA 3HFRA 2NP7A 1R16A 1G6OA 3A4TA 4QTTB 2WTBA 4MICA 2M32A 1I7NA 2OPBA 5CNKA 4FFMA 3D0QA 2C2YA 3IAM6 3IP5A 2QQGA 4BQIA 1FB5A 2GPSA 3EXEB 3R5FA 3UOGA 2Y92A 3BL8A 3F49S 3LLUA 2CMDA 5AOCA 3OVMA 1CPYA 2VZ0A 5L9AA 3QYAA 3NHPA 3BDVA 1J7KA 3PD0A 3JYQA 4X66B 2BY4A 3PWSA 4U7WA 2G28A 4GZ5A 1HF3A 1V4NA 3EW7A 1SCDA 3CF4A 4U5QA 1CUBA 1WUTA 4YRRA 5D3MB 4JVLA 4BMOB 3PKIA 3KUUA 4GOMD 1KMIY 1XRLA 1ZN2A 2E6UX 5IJ9B 4W7HA 4DV4B 1M0TA 1YL6A 2I4NA 7REQA 3KETA 3AINA 3JQPA 4HPJB 2FDXA 3BS4A 4JBIA 4QRDA 3WWPA 1M7BA 3PQ2A 4JJIA 5ALIA 5E4TA 4J4HA 3WB1A 1L8OA 2AZDA 2GPJA 2WU4A 1PVVA 3PJEA 4K6GA 3TDNA 1AURA 1EXNA 1FSGA 3CLKA 4ZOLA 3AHGA 3OO0A 3GUCA 2IV7A 3L6UA 4ARIA 1OIXA 2KBEA 3KZCA 3QPUA 5M3BA 3UHPA 1QYRA 2F3SA 2IEIA 3KEOA 4L8LA 4MDHA 2Q4BA 4R16A 3CNEA 4TTJA 4KTTE 1QGUB 1SR8A 5DB4A 3L6DA 3U2QA 2WFLA 3URMA 4BQFA 3AR7A 2REXB 3DAHA 4LGYA 1FTYA 2H2DA 1X8LA 3RGGA 2X22A 2J09A 4MGEA 2CDAA 5B4UA 1WLYA 4YQZA 3TTVA 3ZHYA 1AMUA 3GEPA 3A2LA 4TS9A 2PDAA 2FG6C 4CGYA 3DEIA 2GOYA 1NRXA 5AO9A 4KFCA 1WXGA 2JB9A 4DPLA 3CW9A 2NYRA 3QVMA 4FS3A 2VDNB 3EA0A 4EYEA 2IT1A 2O23A 1D6SA 2Q6OA 2I3BA 4G24A 1HDOA 1EZ4A 2IF2A 4U2CA 4DCSA 3KJIA 1FVOA 3GPDG 1M34A 3PE4A 5T41A 2ZYRA 2FPUA 4L50A 5FAXA 5BN1A 2DMRA 4BNFA 3IC5A 3ESYA 2VCYA 2FPLA 3QIAA 4D3YA 1QTQA 1FFAA 1WDLA 4TQGA 3L8MA 1COWD 2W8BA 1SCQA 3HCDA 3OA2A 3MILA 4V1CB 3PLAE 4ND3A 1YQ9A 3H1PA 4AJKA 2J46A 1UL1X 1XKTA 3BE5A 4A3SA 5A9RA 2IRWA 3EVDA 3ON5A 4E31A 4B3IA 1UJMA 2LPMA 4TRMA 4NV1A 4ER3A 4ZEXA 1HYHA 3TJRA 5I7EA 4QTYA 1B3BA 3K6SB 5AVVA 4I55B 4XCXA 2VF7A 4CEJB 5BWCA 3L1IA 3TUZC 3ME5A 1NF9A 1QIEA 2NTEA 3QXSA 4FSDA 5KU7A 4X00A 5L4SA 1GV0A 1U8UA 1FYFA 4CRWB 4N54A 1IM2A 4ZD6A 4EMTA 2HIAA 3U3ZA 5IDXA 4US2R 5DYGA 4J07A 3RHSA 3L0PA 2NU8B 2QAGA 1FCJA 4II7A 1XN1A 3DCYA 3NLLA 1FC0A 4IIDA 4L16A 4LVOA 3KPWA 5BRNA 2C0CA 3WL6A 1Z74A 3RSGA 5I48A 3OP1A 3RIEA 1GVNB 1CY8A 721PA 4DTIA 2HLDA 2QIPA 1MC8A 3VR0A 3IDFA 1Z8NA 3ZLVA 4NFHA 4C30A 1UM8A 2RHCA 5ICMA 3MOGA 1VL8A 3VR4H 1LJ8A 2ZVDA 1MVLA 4TL8A 1S3FA 3TMAA 3G02A 1NF2A 2BR4A 4NH0A 3A3OA 3ZGOA 2Z8YM 1EAMA 1OYOA 4FZRA 3MN1A 3ZXXA 2R6CA 1NNI1 1RJ9A 3F5DA 3I58A 2DFKB 3U0BA 5FPSA 5ARDA 3KXIA 1I6WA 3M0EA 4LYJA 4GPIB 2HCRA 3R6TA 2ZR9A 5TQ0A 2BSQA 2ACVA 2QVGA 1SQ5A 4PZ0A 4I1OA 4F5DA 1COWA 4LNUB 2AMVA 3NKVA 4U0JA 1K7FB 1DWQA 1SA0B 1VRVA 4MO2A 4I1VA 3K15A 1HEYA 4QA9A 4DQDA 3H87A 3OJLA 4AN4A 2FRDC 5DM70 1I7DA 1Y3HA 4NARA 1YS1X 3KVRA 3MJEA 3Q4GA 5LP6A 2JCBA 4QJIA 1GPWB 1E1NA 4OF4A 5HTKA 3DO5A 3UT5B 5B55A 4NE9A 3PC2A 1RXUA 2BKXA 3QSGA 4FI3C 3NANA 2G9ZA 4BVKA 1CEQA 3UIEA 4CV1A 4BKMA 4CKZA 4EGQA 1E94E 4D82A 3FPKA 1XL0A 5G4KA 1G4UR 2II6A 4HFNA 3R9KA 4NJEB 2LDXA 1R0BA 2RGYA 4ZCPA 3NHZA 4QYTA 1P1CA 3CG4A 2X6QA 4B9EA 3AJAA 3WGUA 2BBTA 5H59A 3F5MA 2D3TA 4L5JA 5FBWB 2P30A 4DXAA 1L5LA 5KNCA 1C1XB 1ZISA 3VAYA 4CUKA 1KP2A 1LLUA 1LX6A 4GR9A 2NO9A 2FI1A 1IEXA 4OGKA 4IDNA 3IP9A 2DP4E 3TSOA 5DTJA 5E6RA 3VDQA 4U5XA 4FCVA 3SI7A 4ENVA 2ASVA 2F55A 2YOFA 3PENA 4WNIA 2X8LA 1UKCA 1BMTA 4AG6A 3EWIA 4BV2A 1W6RA 1KMHB 1WNFA 2IP4A 3DWFA 4MUJA 5DBFA 4IXDA 4OKSA 4XD7A 3S8EA 1YVUA 4IH1A 3VKWA 3AGQA 4IKEA 1TCCA 5IFLA 4HLCA 1ACMA 3KALA 3SEQA 1Q14A 1EFHA 4AU1A 4ZMBA 5HKBA 3RUPA 3FYCA 3R0QA 3KT8A 1YKSA 2DBZA 3SD7A 3VR6A 4PNZA 4GGPA 4U9UA 1X94A 1MHPA 4C88A 4E30A 1UXIA 5FI1B 3VO9A 2OYCA 5BN3A 1KI7A 3WLKX 1YKGA 3EXIA 4YUXA 3MMSA 1F4VA 3MAJA 3LC2O 1G1AA 4FYWA 1CETA 3CISA 1UUFA 4XR4A 4B0PA 4C21A 3IPXA 4FDMA 1UPTA 5KSYA 1HFKA 1X7YA 4BKRA 1SM4A 4KXLA 4URWR 1OCEA 4U4AA 5E9WA 2V7PA 4G0NA 3ZY6A 4DBLE 3AERA 5CFZA 3DYVA 4QYWA 1DMSA 4E2WA 3F9IA 1SFRA 5J4LA 3OFKA 3SKVA 3TIFA 4LV8B 1UEXC 4RKWA 1XRSB 2H4JA 3JZIA 2J3IA 1T15A 3P0HA 1HDXA 4G65A 1UBNA 1VFNA 5J2TF 1A9XB 1FRQA 1C7FA 2GMWA 3G0BA 3SXUA 2XVAA 1EK0A 1ZCFA 2V6MA 4ERNA 4XIFA 5IG2A 4IOMA 1WKBA 1ODCA 2CYAA 3LPNA 2G08A 1BEEA 1CEEA 4ZGGA 5HW0A 4BMYA 1FFCA 2VJPA 2JVKA 1LSSA 4P8RA 4BLTA 1UINA 4GX0A 1Z22A 1E3IA 1NXWA 5CK5A 1R5NA 4QG3A 4TS4A 2PNFA 1ONPA 5JTUA 2RDMA 4IGEA 2EXXA 1T10A 4JGIA 2CYBA 3EZ9A 5JFGA 2GVNA 3TPCA 4YAUA 1YFJA 1O94C 5I45A 2QAIA 4EO4A 1O4VA 2AG5A 2G63A 3QUSA 1CJBA 3UYKA 2PWPA 3GCGA 5AKKA 4C7KA 3TRKA 3V7UA 4KQEA 5DP1A 3RRNA 3C3XA 4HNQA 2VUUA 3W2IA 3EB9A 4C03A 2A59A 1OVGA 2HSGA 1XR3A 1J06A 3MRVA 1O97C 5LFAA 4MW4A 1BROA 3D0KA 3UOAB 1HRDA 3SXJA 5GZ3A 4J1QA 4F5EA 1J1IA 4CLRA 1ISIA 1C7JA 1XA3A 1ZRNA 2GXUA 3EOBI 1LGYA 1YQTA 3G1WA 4H7JA 2WU8A 4D74A 4YYEA 4OXQA 4DCVA 3QUAA 4KQ9A 5GONB 2CL5A 4MRSA 3W9YA 4BO0A 3PU6A 1RI5A 3F90A 4UCQA 4WKOA 1C9JA 2QPAA 4W4TA 4W1QA 3GRYA 5E9QA 2OCAA 3GI1A 1QZTA 3DEYX 3BL5A 5AI4A 5KDDA 1K4MA 1W46A 2REQB 2VR1A 1JDVA 2A0WA 1DMRA 4TL6A 1PW7A 1STOA 2L0XA 3M5CA 4ML3A 5FBRB 2FV8A 1XAIA 3T52A 3TXAA 4AL4A 5K0ZA 1TUGA 2VJNA 4Q9HA 3TOXA 3P0IA 4K6OA 4POAA 3ANTA 2W4QA 3W6PA 2ZPAA 1WCV1 3C8MA 1RHQA 3DB2A 4P4UA 2B5WA 1P60A 3DMPA 1VJCA 3M8KA 2D62A 2VTKA 3GLIB 2ZJ1A 5K0BA 2EJWA 4IM7A 1WEKA 5A1TA 1RKXA 3K9FC 3DBHA 1E2DA 4FMBB 4O2BF 5FUBA 4O4HB 2A5LA 1DUIA 3ZQKA 3KVYA 2J41A 4H1VA 5A02A 2J0SA 5ITVA 4WW0A 4EI8A 1PTJC 4F9EA 1EBBA 4RBNA 1V43A 3IO5A 3BHMA 3U6BA 2HK9A 4HB3A 4AUNA 4DLNA 2AI2A 3OZAA 2WQ7A 4AT1A 3E3NA 1UZUA 3II6X 2QTVB 4WY2A 4JVNA 4DDMA 1XEWX 3RIHA 3WGVA 3AB3A 1OWOA 2ZBPA 4IO0A 5F2NA 3FUWA 3IPAA 1T0PA 3DOIA 3QXXA 1HUQA 1X38A 4H7DA 4MKHA 5J63A 2ABWA 5B2EA 3OQNA 1JFTA 3DPUA 4PBRA 1JIQA 1ZGBA 4EKDA 3AM3A 1RI3A 4XUEA 4LTDA 1JFLA 2VUSA 3QLVC 5HOQA 5JSQA 4O29A 3QLEA 1IUPA 2FUG6 3CCBA 4DIOA 2B4YA 1KK3A 1KDZA 5A4MS 2ATVA 4FE7A 4YH1A 3TNJA 3E7XA 1EYZA 1W1IA 3CUUA 2B94A 2O0KA 4A4DA 4DUPA 1OV4A 2CUKA 3UHFA 3R5KA 3EPHA 2ZUBA 5F1KA 1XTTA 3K1YA 4MDFA 1NVXQ 1YAHA 3AUTA 1EQ2A 1P0QA 1GY8A 2IHKA 3MTDA 5MGBA 3ZD7A 1RFGE 4R2MA 5B1SA 2FMIA 1GRNA 2YFKA 4Y2VA 4CR6A 1R6UA 3LX4A 1Z6PA 1NVVQ 1MG5A 2PD4A 2ODPA 5JMTA 4CKEA 1TUBA 1VL6A 2VHVA 2I67A 2P3SA 2QROA 2UZ1B 2YCLA 1CLUA 3E7WA 3O90A 4FWBA 4OXIA 5BWOA 5F2EA 1CJSA 3A11A 3OX1A 3PUHA 2VWQA 2C4HA 5IVIA 2VNHA 4Y6QA 1OXSC 3B8EA 1I4DD 3QBDA 3TIIA 2FR1A 4O4LA 4FYHA 3FTFA 2C5BA 4JI0B 3FMOB 3GRPA 3GLUA 1IL0A 1KJWA 1YA4A 1QZ3A 1SHJA 3TB6A 3F47A 2NACA 5FPYA 3PUVA 3P9KA 5EE1A 1ZCZA 1OLXA 2ZCUA 1BVRA 1NAHA 1M2JA 1RYBA 4H60A 4CG3A 3A8TA 4WBNB 4XWWA 3ZVKA 3GZ4A 3DFMA 3EASA 2JH8A 3LFHA 3ANMA 4M1MA 2L19A 2BF4A 2GHTA 3I6IA 3FSJX 4XB6B 4RZXA 3TBHA 4LQ4A 3FTCA 2HIHA 1CR1A 3C5WP 4YFVA 1FTSA 4UJ5A 2ZEJA 4P98A 5I8ZA 3MCTA 3NTVA 3HYSA 1VJ5A 2DTXA 3CUYA 3WRYC 4JC5A 1NXPA 3JALA 3RS7A 3AVXA 3VYTB 1CJTC 5CW2A 2FMTA 1JJFA 1SXJB 3SLRA 1T5LA 1CRWG 1MPXA 2OO7A 2SCUB 3EXFA 4M8NE 1FRZA 2H85A 4B4UA 1ITZA 1WULS 3VVMA 5I7OA 2VP9A 1GHTA 1WKCA 4WOKA 2N3ZA 4HAWA 2KLBA 3QWBA 1GTJ1 1FTWA 4HZUA 4S1VA 5CT4A 1QDUA 3RBVA 3UMFA 4BN0A 2A1UB 4W9RA 2ORIA 3AUSA 3ENVA 3DW1X 1ESNA 5EJIA 3ORFA 1PIWA 1ZH4A 2VLIA 2QV0A 3ZWWA 1E2FA 4GVPA 1XJ0A 1P2BA 2VDPB 2XMQA 1N2ZA 3LIIA 3VR5A 2BHRA 1ZSVA 4ESOA 5DNWA 4E7PA 4DXDA 1B1CA 3JY6A 3KP1A 1BOFA 1U5CA 2JLSA 4ICIA 3N0WA 4PPYA 1M72A 2B0JA 1E66A 1SB9A 4AUKA 1L9XA 2HL6A 4L27A 3L8ZA 3O8BA 5H83A 1NL3A 1G21B 1U0OC 2A35A 2OVFA 3A70A 3OIWA 5EHIA 1ISMA 5TGTA 3WGMA 4L3OA 1NY5A 4CNBA 1U0BB 3NMUF 4TMZA 3RVSA 4EJSA 4QM6A 2QW8A 4MQFA 4WFIA 1U94A 3D54D 3B6MA 3KSDO 1X7XB 3LZCA 1RI4A 2AG8A 3ONNA 1E7MA 1HT3A 1EGAA 1LSOA 3D8RA 1FFXA 4LZLA 4OHPA 4S0XA 4U02A 4Z7JA 3CLSC 5AVSA 1YS9A 3R9XB 1OW3B 3SCZA 2AQKA 3ETJA 3C85A 3VA7A 3PHBE 5ELMA 1NQOA 2QY6A 4A0HA 1FFHA 3HBJA 4IQGA 1GFWA 4J1NA 3B89A 5AOVA 2AN4A 2PQMA 3ZCVA 3W5VA 4R98A 3CFYA 3B1XA 3LECA 5DI3B 4W1PA 3ET4A 5IW8A 2YJGA 3D4IA 2QK4A 3L79A 4PXYA 3ELWA 1VLQA 1O0BA 4DA9A 4AXXA 2QVCA 1V3VA 3PGXA 4OHXA 2F9FA 4ALMA 3GZNB 3JARA 4TLAA 3TNLA 3TW8A 3HGTA 3SR4A 4RHFA 4XDYA 5DK6A 5FWXB 3ZV6A 3H9BA 1H6DA 4RTLA 4F21A 3DOFA 2SKDA 2QVLA 4IZOA 3TTSA 4LG1A 1J8YF 3QVVA 1F9EA 2QX9A 4Q4JA 1MB2A 3VPCA 3U5TA 5DSTA 1EP3B 4CJXA 1HE1C 2FRXA 2H2WA 4I1YA 4Y2YA 2Z58A 4E5PA 4F8JA 1D2RA 4BDTA 2PBZA 1F2VA 1GTMA 5ECWA 1B2RA 5TQJA 1LUAA 2AYZA 1NJ1A 4KI7A 1N6KA 3PDJA 2F62A 3P4UA 3SIXA 5JAMA 5LMCA 1OV6A 3WB2A 4CM5A 4QQKA 2X7JA 1T1IA 3TOCA 4P5PA 3OJWA 3PRJA 1PWEA 1DRVA 3ADDA 1VL2A 1YRWA 3FCXA 2IP2A 4GICA 1PT7A 4PLZA 5KQPA 7ABPA 2QQEA 1C3VA 3TSAA 2P65A 3CPHA 3A25A 2PRZA 4CTJA 1ISGA 4F1WA 2P62A 3PLNA 4FOOA 4KPUB 2A9PA 4HRVA 4UQPA 1N1MA 2MSLA 1GQOA 1LZKA 4FFBB 5DDIP 4E5KA 1AOXA 1ONSA 1WV0A 3L0ZA 1XDWA 3P9IA 1G8HA 1GZ5A 1IMOA 2Q1YA 3CA8A 1ZUWA 4F3KA 3GP5A 2O6HA 1BXZA 2QN8A 1I51A 3NCTA 2E82A 3E5NA 2WTNA 1ORRA 5BYJA 5EWMB 4MV8A 5JS6A 1VL1A 1VPLA 2FGKA 3JVEA 4JA2A 4I9GA 2Q5QA 1NG9A 1XZIA 1FVHA 1PNVA 3C8ZA 4Q1CA 4QGAA 4UVIA 3PHGA 3IEKA 5EP1A 2EW2A 5E8JA 5G4LA 4Z4IA 1E2BA 1PG0A 2GJ8A 1V1JA 3BILA 1YB1A 2RHWA 5JDCA 3VSCA 2XW6A 3X1DA 4XVUA 2YV2A 1LU9A 2X3UA 4XXHA 5KSPA 1LRLA 2XDQB 4REQA 1GQSA 4EMUA 2H18A 5EJMA 4YR9A 3ZGZA 1TD9A 2X8JB 3OO1A 1MIOA 2XEXA 4C4RA 4W63A 2UZ0A 5M5BA 1KO8A 4L6IA 3TD6A 4R0MA 4OHMA 3FLEA 3K4HA 1T5OA 3UPDA 3V42A 2DFTA 4D0SA 5JOQA 5AUOB 2LCFA 4H16A 4UTRA 3UK2A 1EVIA 1BDIA 1UFVA 3G0CA 1PJAA 5BWNA 3PEVA 1EM8B 5CT5A 5FL3A 3G89A 1ZOOA 4YMVA 3ZHQA 3KHUA 3VRHA 4ON9A 1CCWA 1E9DA 2AZTA 2J5QA 4HS9A 4N03A 3MUOA 4WFJA 5KJEA 4ZEVA 2GCOA 1U2ZA 4EHDA 5JZMA 4PLCA 4DA7A 3HPQA 3RYHA 4JJAA 4DUGA 4GSYA 3DKPA 3QVGB 3VR4D 4EF4A 1JRLA 1AY0A 4GDMA 1WR8A 3QG1A 3SYLA 1GPKA 1Z18A 5E8RA 5EJ7A 2HCFA 3V32A 2ZRHA 1WW2A 2AXQA 2C58A 3M6IA 3W2EA 5BW5A 4N6NA 5JQGB 2FEMA 2B4RO 1LS6A 4LOJA 1DIHA 3GFTA 4JI5B 4GR4A 1J97A 1P7YA 2I34A 4D0LB 1TLLA 1TZCA 2RHLA 2HSWA 3PFIA 5T4HA 5LDDC 1RACA 4DR6B 2MYTA 3AF6A 2WSLA 3HKBA 3TXXA 1ZKMA 4ZYTA 4ZCLA 4G8JA 1NLMA 5ADHA 3T3IA 2BFFA 1C4KA 1S4QA 3EEIA 3I45A 4QYSA 4X6UA 2XOEA 3KLNA 4BV8A 1TJ5A 5DWVA 2WD9A 1WBDA 1Q21A 4R81A 1JG3A 3O0TA 4HK4A 3I9V1 5E6RB 4RK0A 4YP7A 5AXAA 1AO0A 2NZYA 3QK7A 1ZITA 4KL8S 2ZT6A 3TVDA 5LN1A 4P38A 4DPKA 1FXUA 4NOJA 4WUTA 1H9BA 3HB9A 4JXKA 2DVMA 3PHJA 5U1PA 3UCXA 3NBXX 1V71A 3DM5A 4XJSA 1M0SA 3WYCA 5DGIA 3P19A 2HW8A 3FOFC 1H3FA 1QPGA 4B34A 4CMEC 3OF2A 1JHDA 4DWWA 6ADHA 2W2PA 3BGVA 4M8IA 5IH7A 5K6AA 1RYNA 1G60A 1E2IA 3U7GA 1NFQA 5KB3A 1JF8A 3G85A 5CDFE 5J3JA 2AJLI 3K9HA 4IRUB 4NKRA 4Q93A 5JSZA 4NIMA 2Y1FA 3KB2A 4CT5A 2O8DA 1B8PA 1UP4A 2AK3A 2DFNA 2HRQA 3PXUA 2QTCA 5E7MA 5E9JA 1NX6A 2RH5A 2YDXA 1M2WA 5EJGA 5I9LA 1HORA 2QY9A 5DGTA 3WYEA 2FGJA 2RHTA 4TMKA 1U65A 4N3AA 2K87A 1SWWA 3HJAA 1NVKA 5L3VA 1D2EA 1XMSA 3AONB 1RZRD 1A0OA 4MA5A 5KHLB 3BDAA 4JDPA 3NNDA 1LSUA 4MQLA 1Y5MA 4CTMA 2P41A 4AS2A 1Y4SA 1H5UA 1M5TA 3EJ6A 5FR2A 3WIEA 2HJVA 5GVSA 3PE3A 3P0RA 4C14A 1IATA 2WFAA 4QFDA 1A27A 4DIKA 1X3LA 3AJDA 1HDEA 3EMBA 2XWPA 3B2QA 2GYYA 3I05A 3JZMA 4ZC1A 4X1IB 4E6EA 1Z47A 3C6MA 1MDFA 3RUCA 3I2HA 3TBKA 2NU6A 3ZWQA 3H4IA 2Q4OA 1L1RA 4V0NA 2A3NA 4W5RA 1VSQA 4X7MA 2QUHA 3EZ6A 5EUQB 1H2HA 2KHZA 4YWHA 4FS8A 2XB6A 1C9EA 3M7IA 3U3KA 5F7XA 3FPHA 1G3MA 1JAIA 4QUDA 4RL6A 3CF4G 5A0VA 4MITA 3WL3A 4KAXA 5EMLA 3P0FA 4D3XA 1TK3A 4H7EA 1XKQA 2CLMB 4H1TA 4XVQA 1T1GA 3BGWA 2FETA 3SEAA 3LWZA 3ZV3A 5C8YB 2H0QA 1Y80A 5CH3A 3AIMA 3JU3A 3X1ZA 2VJKA 5JJCA 1D3AA 1YRLA 4PZCA 3I8OA 1V3QE 4CQLB 3GL9A 4GM1A 1Q0PA 4PE5B 3WLHA 4F9TA 2DPLA 2ACWA 2XCTB 3A6JA 3TUJC 4M1QA 5E7JA 2PKRA 1YB5A 5E9AA 4F72A 3EXHB 4ZO8A 1GU0A 4R41A 1UBSB 1RI1A 1GZ4A 4RGBA 2R6AA 4DM3A 1XEXB 3DV2A 3LO5A 4OQMA 4DIMA 4D9FA 2J59A 3ILYA 1FFSA 2UKDA 4LJ7A 2Q49A 1FS6A 4WCFB 1G8SA 2ERXA 4I19A 3VVBA 4B2YA 4YIHA 1D8TA 5I51A 2Y68A 3G5UA 1IZ0A 1DJNA 2FFQA 4R1NA 1JFFA 1CKEA 2BGUA 2YHIB 3AHIA 4V0SA 5CLHA 5B12A 3ZHUA 3LX6A 4Q66C 4BB6A 1D4FA 2BN4A 3EGOA 4WGGA 2H2FA 4P7FA 4F06A 4WXYB 4DNQA 4FHGA 5C7LO 4TYNA 4TKUB 4Y9SA 2ID8A 5DHTA 3VR2A 4MS1A 2QUBA 5GQSA 1WDTA 2Z4SA 3AZOA 1GCOA 3DB1A 4HUQA 4IUYA 4JQYA 4JNCA 1TQHA 1GSOA 1YT5A 5CIWA 3WKCA 2W37A 3OZGA 2WKQA 4MHOA 3HZHA 1LA2A 4MUMA 2L42A 4XYMA 1PR2A 1XDUA 1PSDA 2IUTA 2XHEA 3LU1A 1YKFA 2A1TR 3V48A 3S1SA 3AY3A 4JD5A 4LEIA 5F5LA 3H0EA 1X9HA 5IVHA 3M6UA 4AJLA 4RVNA 1R27A 2UYGA 4RHTA 5IM4F 2IK8A 1Q15A 2YDYA 4HDRB 3ENKA 2V74B 1L5SA 5JWRA 3IDSA 1A8UA 4RDCA 4Z3OA 2XBUA 3LLVA 3AKYA 4Q7LA 4DR3B 2C2BA 3NI2A 5F33A 3FPAA 3F74A 4UHKA 5EESA 1OB5A 1G20A 2G5GX 3GT4A 3GC6A 1H2YA 2DQYA 4II3A 4EHFA 3W06A 1NVWQ 1XTZA 1VDZA 4HGYA 4HC4A 5K4GA 1N5LA 1A1SA 3AW8A 1II8A 1RAEA 2ZI9A 2NADA 2NZUG 4O2RA 2PPVA 4Y0NA 2XLCA 3ICWA 4IF4A 2W6ID 1EQAA 1HZZC 1E6MA 1Z12A 3LBFA 4JENA 1UFKA 4N7RA 5D5HA 3UXHA 2YKGA 1AF7A 3MFYA 2OGWA 1J25A 1WQ4A 3AOEC 4KNYA 5THXA 5KWJA 2PZAA 1IPFA 4HQFA 2AFHE 4RA6B 3FFBA 1GD1O 2ODNA 2J9RA 4TRNA 1TO1E 4RTKA 1ZVMA 1U8FO 1AG9A 1VPVA 1X92A 3MGGA 1M83A 2XWSA 3UT0A 3PVZA 3NTXA 5LYJF 4I4IA 5HF9A 4YUYA 2E21A 3I1IA 3QP9A 2R65A 5JWOA 2KLHA 3ZCQA 2F3UA 3MSXA 5JI3E 3LDFA 2GXAA 4YMUA 4AFNA 2G8NA 4YREA 4ETIA 4CL2A 5KTTA 1XMOB 1N3BA 2ZYHA 1A5BB 4G4SP 4KCGA 2WV9A 4L51A 4KNWA 5EUBA 3N86A 1YE5A 1LW6E 4OMDA 4RSRA 4FEGA 4ZAWA 5BT8A 2R2AA 2VO1A 3GDWA 4P53A 1XWWA 2OV1A 3AJRA 1E9AA 3IA2A 4C0QC 4RZUA 1MDBA 4NE7A 5KTMA 4MQBA 4GBGA 1TAGA 2GYVA 3NXSA 5T6BA 4Z54A 3RC8A 4AKGA 3OOEA 4GRDA 3TTYA 4NXMB 1WSDA 5KX5A 1KJZA 1B3RA 3COYA 4WVFA 5IEJA 1YQUA 3Q3VA 4URHA 1QHHA 2NUPA 4X84A 1FMCA 1WD5A 1ZUNA 2QD2A 2GCGA 3B5IA 4H35A 5DTMA 3FSGA 4M8KA 5B64A 1JHYA 2XVZA 2E9SA 1HOXA 2GQ0A 3EGXB 1C1HA 2Y4NA 1L9KA 3QPBA 1HEIA 1E7SA 1TVEA 3Q87B 2LIVA 4WCDA 2V3CC 1SBIA 4KQWA 1TKBA 3SBEA 1RIIA 3GH3A 1E3WB 3H1FA 3LXRA 2Q6LA 1J8FA 2H7YA 1M1YE 2I1LA 4G5HA 3TNFA 3E53A 2VZ8A 4F85A 3R4CA 1Y63A 4HATA 2RI1A 4JJ8A 3OZCA 5MN6A 2I3AA 2GEBA 1FNNA 3E8SA 3M5PA 1KHTA 4NAHA 4KRXA 5EHNA 3HYCA 3KWLA 3H4VA 4H3HB 2UUBB 1HOTA 3G49A 1UC9A 1Y7LA 4IOJA 5D5PA 4Z9BA 4RGVA 2ZYDA 3P2IA 1H22A 5JEDA 2AFIA 1R8JA 2IDZA 2Q2VA 1SK9A 1O87A 2O6LA 4EAQA 1RLTA 3RFVA 4YJ2A 2BMJA 4QQNA 3BMNA 2V6FA 4CIAA 1M0WA 2H9IA 1YRAA 3MAAC 4Q1VA 3WNBA 3W78A 5IUNC 2ZZNA 2JBAA 3WHIA 2YRFA 4K87A 5KREA 1E1CB 5T4EA 2CXNA 2RARA 3HUFA 3GV0A 3WLEA 3DLBA 3GA7A 1MC4A 2DUUA 3IUJA 3BMQA 2ZJ2A 4H3VA 4QHTA 1Y9EA 1CLEA 1AN0A 3U80A 3GJ6A 1FLDA 4CG2A 4QJ3A 1QV6A 3P7MA 1M1NA 3KXDA 1R00A 1P17A 2RIRA 5EPUA 3N5KA 1JXQA 4DLVA 4BV3A 5JT1A 1EDEA 2J3QA 2H5IA 4TWRA 3REQA 2O59A 1XA0A 3BD8A 4DZZA 5DKFA 3W05A 1T29A 3ASYA 2YX1A 4YHBA 1KC3A 1NUQA 4CQMB 1X86B 3HU2A 3R0JA 4JP5A 3ZXYA 5FNVF 3K92A 2P3OA 3FOBA 1K98A 4KBYA 3FVWA 4NEHB 1MJHA 4H7IA 1ZH8A 2Y0CA 1JYSA 1OFTA 1US8B 1OTHA 2HY7A 3GLGB 3TKLA 2ZUEA 2FSSA 1K1EA 4WCFC 4HUJA 1IU9A 3RRMA 2VRCA 1WPQA 1MQAA 3GJSA 3Q85A 5LXTF 3O8RA 3WADA 2O7VA 4N7MA 1U98A 1QTRA 2YIJA 4FVTA 1ENYA 4CMBA 4JLUA 2PHZA 2WHYA 4RABA 4F4CA 2E0IA 1OFIA 1Z4JA 4P34A 1H2BA 3WNCA 3E2MA 1D0IA 3QXJA 1JXMA 5C8VA 4FFWA 3PC8C 4B71A 1J9ZA 1JHAA 3QBEA 5ANRB 1P4JA 4BU0A 4EFNA 5C52B 1TPZA 2R6JA 4EMBA 2ARKA 4IV8A 5KWSA 4B3RB 2XXBA 2QA5A 2WVAA 5G3YA 2I33A 4PRZA 1T24A 2HWUA 4LRQA 1G98A 1UJNA 2WUWE 1ULTA 2BCGY 1NVAA 2LP4Y 3KYDA 1B42A 1QQTA 4G1UC 5AHXA 1APBA 3EY4A 1RE1A 4YJHB 4NY1A 1CS0B 3NIGB 3TRIA 1MGPA 5G0SA 3S2IA 1PJSA 1HSZA 3PPVA 2O8BA 4E5UA 1E1KA 1MRSA 3BSWA 4GP7A 1EX1A 3BCHA 5HRUA 5EGSA 2FRVA 3CJTA 3MRSA 3QPAA 3V4VB 1UK9A 3LGAA 1M74A 1OZFA 3V8QA 2O4CA 3HR7A 2EWWA 1NRWA 2MT9A 2ZYIA 3HQ4O 5E3IA 2Q6VA 3KZ1E 1PZFA 4I1IA 4TX1A 1NBIA 4I50F 1GT6A 5KYXB 1ESZA 1I3NA 2OO3A 2ZSDA 3RAFC 3MGBA 1CDOA 1UJ6A 3DJFA 3P94A 4GQBA 1K7YA 1XQ6A 3U4CA 2PR2A 4ZICA 3PNPA 1XXHE 4N7BA 3MGKA 4NZYA 2ZBEA 4PNHA 1DS6A 5HG0A 5FI3A 2EL7A 3QKRB 3LX8A 2OPHA 3VYSB 4BFLA 3I39X 5AICA 5FUMA 4UUNA 1ABEA 3A6HA 2XEDA 1DI0A 1CUUA 5BWLA 2Q5EA 3KPJA 4S1NA 4UKDA 3FWNA 3QKWA 2VTVA 3QELB 4MWEA 2DAPA 3ZGXA 4JJFA 2N1MA 5EJ8A 1P44A 1WCWA 3P26A 4XGKA 4DLLA 3K5WA 5LPNA 2QVXX 1AQJA 2IL1A 3OQPA 2P3LA 2RAVA 4G4JA 4I9UA 3TQOA 1RRFA 4QXQA 1L8XA 1DELA 4G4IA 1Q7BA 4M9ZA 4ZI3A 1FX1A 3K0HA 4TTQA 3OE7D 1GFZA 4P80A 4Y2RA 2LE0A 2O2IA 4WKCA 2JZCA 3I6ZA 2IIVA 3P97A 4HAOA 4KMRA 4NOKA 4OBBA 4YRCA 4DN6A 1SBYA 5J2TB 3IEMA 3DQPA 3DHVA 2MOKA 4OK5A 2GFQA 4J16A 1ZHOA 3GFFA 1N7JA 4IDHA 2JIQA 4HLUC 4IDPA 5DV9A 2B8EA 3CWZA 2VTEA 4PIVA 3GZJA 2VPIA 4LFAB 1DBRA 4MQ4A 1YR2A 4I4TB 5T3UA 1DL5A 2GZMA 3F9CA 3V1KA 1MXHA 3I30X 2X7HA 3FVTA 4LJLA 4FFDA 3AF0A 3VV2A 1B8NA 4MA0A 4ANFA 2BZGA 3QY9A 4D8WA 4ESHA 1NJ5A 1Q84A 3K0CA 1B00A 1YB6A 3RDPA 1VXOA 4DQXA 2E87A 2VH2A 4BO4A 3TZEA 3BAZA 1Z0IA 5DHRA 5FI0B 5JZBA 1ATZA 1PR9A 5AM4A 3DNMA 2X40A 2PV0A 4ADSG 4N5IX 2A33A 3KTDA 4WA8A 3H19A 2HR1A 2FSPA 2BLLA 3JQDA 4JC8A 1MOPA 2Y6VA 1IY0A 3LUGA 1KE1A 5KJFA 1G7CA 3PT5A 4TYYA 3CX3A 4ZPJA 3I12A 4X1YB 3TVTA 5KTNA 3D3QA 1O6GA 1TF5A 1N5RA 4EKIA 1L4BA 3LYAA 3N58A 1AQLA 3RKUA 2QJWA 2E37A 3I0MA 2VWGA 1KMMA 4P7JA 1NJSA 3ZIAD 2K2WA 3PVCA 5HF8A 4NH4A 3HXTA 3T7SA 5GTDA 2HNBA 1J2RA 1G0NA 1A8SA 1P7WA 2ZSFA 4UBIA 4OI1A 4TT3A 3DUFA 5DTEA 2W6NA 5ALQA 1GRQA 1IB6A 2ZLBA 3OLVA 4BFYA 4Z99A 1PZGA 2G36A 3P45A 4PIPA 2J9ZB 4RPCA 3S8YA 2PY6A 5FFMA 2WY2D 3KRTA 5JNRA 2AJBA 2F67A 1A9SA 1FP7A 3Q8XB 1R37A 2GD2A 3TI7A 3VC7A 2G71A 2IOHA 2AD1A 5JJ5A 3BWCA 3EPJA 3QH4A 2I29A 2D6FA 1QP8A 3W2GA 5CB8A 2F90A 1RRGA 1PT5A 4G07A 1P31A 3ZGYA 3P9PA 3LT5A 4F6CA 5LLDA 1XZKA 5EEHA 1KI2A 4EHAA 5JC8A 3ZKWB 4O2BB 4JVOA 4PYRA 4AN1A 1T36B 1YAJA 3TCNA 1P0IA 2VWHA 2A0UA 1CQJA 2RJNA 1NONA 2PLAA 5E4YA 3HH8A 3ETDA 1ADYA 1OB2A 4BO3A 1KYXA 3EGWA 1P61B 3UH0A 4BNLA 1I4WA 1XTIA 1GG8A 3FWKA 3OQBA 3I73A 4B3XA 1PTKA 5C5EA 1ELOA 3OQOA 4CM3A 1DBPA 4DIUA 1T4DA 2D8AA 4BX2A 3SZLA 1IDOA 2HJGA 3MT7A 1FA9A 4KVGA 2WE7A 4PO3X 2Z5GA 4PPNA 3KKLA 2ESRA 1PJ8A 2NAPA 3I6YA 4LZAA 4M38A 4CV0A 5K3DA 2HADA 1YUMA 2UDPA 1ZS9A 1C14A 1D7OA 2QRPA 2OCPA 5CURA 1JSCA 4EPWA 5A9SA 3H9JA 3I28A 2X8WA 4YMWA 1Z16A 3PBKA 1YZTA 3T7EA 4DT1A 2XQKA 2R68A 1GIAA 3CURA 3MJHA 1Y9ZA 3IIEA 3OLYA 1XLWA 3CR8A 4M88A 4CDMA 3BH0A 3GD7A 3L0CA 4M21A 3N75A 4PC3A 4MLCA 1NASA 2P1RA 5KOYA 1NTRA 4UUMA 5J2UF 2XODA 1XNGA 3IA7A 2A9OA 3ZDZB 4B8WA 3CEMA 2GN8A 3L77A 1TMOA 3GARA 4O59O 3HDHA 3NGXA 4UFOA 5CNMA 5DCWA 3UFXA 4FYIA 3JQGB 3PQ7A 1W88A 4HN4B 4IMJB 2D0IA 2IZZA 3ENNA 3QFSA 4LI0A 4C3ZA 1JLLA 1DQPA 3HRKA 4PGAA 3ROMA 4JP3A 4IINA 1U3GA 1CP3A 1OQAA 4ZYWA 1KK1A 2R6DA 3W1VA 4D9EA 3MJ4A 3W5CA 2BYTA 5D86A 1Y1SA 1ZNWA 2DETA 1YDHA 3IKJA 4LFCB 1YQGA 5JLAA 4DMUB 3UFBA 3GCWA 4GX1A 1KORA 2EFEB 2ISSD 1U2GA 2PM8A 3I42A 4FHCA 5L7YA 1XDGA 1DC5A 4DLAA 1JFVA 3H6HA 3KVVA 3PRKE 1ISRA 1FK8A 2B1QA 5K4AA 4WY5A 1MO3A 4EQ6B 2JDIA 4PHHA 4P08A 5IJWA 4CLOB 3KDAA 3MUFA 1T91A 4NZPA 1I5EA 5A4KA 2RMKA 2FSIA 1FJXA 5HQTA 4GFDA 4TMFA 2WDPA 3AVYA 3CUKA 1RBMA 4LNAA 2C9ZA 4W9MC 4IKPA 3HNPA 2DCUA 5D3QA 3S81A 1D5CA 1JJ7A 2H4HA 2QG9A 1VCOA 4ZO6A 1AHPA 5DZSA 4GMKA 2WMNB 1N3YA 1T2NA 1G5QA 1V8DA 2GAOA 4BNNA 1U6KA 2QG4A 4WK4B 3IPCA 1LF0A 4AJOA 3QWHA 3SEFA 1UPCA 4C78A 4CQJA 4LWOA 4DRXA 1E1YA 1O9HA 4BRZA 1TO2E 3A7EA 4TV9A 3DCNA 5FP0A 1QQ5A 1ZXXA 3N0XA 4D9GA 1Z2DA 3AP2A 1BXGB 3K05A 4PLFA 4DG5A 4ZARA 3ZCTA 3QX8A 2FEOA 2X41A 1GYPA 4MV9A 1NRJB 1GGFA 1VA5A 2GA9A 1M7HA 3H65A 4PWZA 4W82A 1I13A 2EGHA 1U9ZA 3VPGA 4C29A 3MK31 1NYQA 3PFFA 2MINA 3AJEA 1DBVO 3PXAA 1TTTA 4AZ0A 1XVVA 4LXQA 4MUBA 2NVUB 1I0IA 2ES4A 2DFPA 2DR3A 4WUVA 2XHZA 2H1SA 3D31A 2BMVA 1ZBQA 4YRQA 1S7CA 1GFSA 3O8OB 3ZDDA 4QKQA 3G5MA 4JX8A 3UG7A 3VU8A 3PDUA 2PS9A 3FUUA 3NHBA 2CD9A 4FYYA 2ETVA 4MINA 3ZVRA 3D3WA 3MHTA 1MB9A 1N5KA 2SICE 3PUKA 2BE9A 3QEOA 4TKVA 2IU6A 1EVEA 3RW9A 2FKAA 4YMSA 1E3JA 2HHJA 1H2XA 1JJIA 1KBOA 1VGRA 2O1SA 2RK4A 1IQRA 3G6WA 3NV9A 4IQ8A 5P21A 1AUQA 3ROZA 3WDSA 4A26A 3TMYA 2L18A 4XKJA 2XCIA 1GGNA 2ZJ0A 3PUIA 4Z0HO 1G8PA 1SVUA 1Z5UA 1D6NA 3AR2A 3GWZA 2HT6A 3C6QA 3GPIA 3SICE 6YASA 2VQEB 2WJ4A 5DM1A 3A6GA 2VJOA 4WXRA 4X20A 3F98A 5FB3A 2YWXA 2J33A 3MIIA 3T7DA 2MR6A 2D8MA 3VU0A 1JBQA 4AMZA 5JH7F 1RCFA 2JASA 4OXKA 4B09A 2PE5A 1Z2EA 3GGPA 3QQ5A 3AM1A 1T1JA 3MJTA 1WS6A 4D99A 5TPWA 1D2NA 2AOUB 4QPNA 3FE2A 1KJJA 3OM8A 1NQ5A 2QLFA 1JBEA 1T9AA 1VKZA 3O03A 3WOHA 3MWEA 1GAQA 4TVOA 4OLJA 2M1ZA 2YJTD 2Q9CA 4BWFB 3WBKA 1Z15A 3RTGA 3JR7A 4PSDA 1C30B 3DHWC 5F3RA 2FZWA 3BCRA 4OAOA 2ZP1A 4GEKA 4TRJA 2ZM5A 2JD0A 2EYQA 2MIIA 4ZO7A 1T1RA 5K0JA 4NENB 1A72A 2XDYA 4MUXA 4CM8B 5CB4B 3CZ9A 3Q8KA 3L07A 3EUWA 2GZHA 1QZZA 3RODA 1YS6A 3OAAD 1OZHA 3RG2A 3DBRA 2O7QA 5DIZA 3LHFA 3WWCA 3TI9A 1CUCA 4QRHA 3DAPA 2XYGA 2AQ8A 1H6CA 5FRDA 4D8VA 1CQIB 4QPZA 4AMGA 3PUWA 1ABFA 1XCGB 1ZD4A 3SDZA 2YN2A 4JLOA 3W0LB 1XZQA 4F93B 1EWQA 2BTEA 2AX4A 1XQ1A 2ZSBA 3CVYA 2XNHA 2Z08A 3P8ZA 3R6LA 4EPRA 2DLCX 2DUMA 4HAUA 5LC1A 4J03A 3ACDA 3PR2B 2C5EA 2QG6A 4JNKA 2KMLA 1Y3BE 3BOSA 4MV3A 3TO5A 4QGHA 3PNOA 2A0YA 3B5JA 2XT9A 1N75A 1OH6A 1OWMA 4JL5A 3ZOKA 3CC8A 3UMYA 1I80A 1QRSA 5FF9A 4ZWNA 3QFRA 2CHUA 3MYRA 4ALLA 5LZ2A 3TLBA 4CU5A 1AM4D 3ZNNA 3LL7A 1P2UA 1ZIOA 3DP7A 1DAHA 3I6BA 4GXNA 5DIFA 4CEIA 4OYRA 1WOYA 1GA6A 2WU1A 4ZEWA 3LQ1A 3H16A 5CA0A 3ROEA 5I9SA 1GLNA 2Q9AA 4K3UA 3HL0A 2IWHA 2Q9BA 3DWGA 4MMXB 3DKVA 4X7PA 3TTTA 2UVQA 3ZHBA 5ITZB 2G40A 5CHYA 2FPIB 2H0RA 2DECA 3A27A 2OBNA 3UJPA 4B3DA 5KYUB 4S04A 1WXDA 4AO8A 4DA6A 1FY2A 1RWMA 2RHHA 4YXWD 4QBFA 1ZQ1A 2WC1A 4NP6A 3C15C 2WU0A 4TTTS 1SU6A 2XE4A 4ENQA 2ONZA 2XXAA 4EP1A 1CR0A 2C2OA 1R6VA 2PGIA 3Q10A 1N0WA 4HAVA 1G8YA 4M1TA 5A3VA 4DWOA 2X4GA 3QEJA 1A77A 1QE5A 3GFRA 4YCLA 4WY8A 1JEAA 1TAQA 4ZRMA 2ZRLA 4Y0VA 3IP7A 2R1ZA 5EKSA 1KI6A 5JO0A 1BCRA 1CF9A 1JP7A 2FEWB 1A7AA 3KUCA 3ODGA 4FGLA 4N1AA 1N25A 3H42B 3L4EA 1U80A 4O4LF 5SICE 2O06A 3AUXA 2HDHA 4LHZA 1EUYA 5KDLA 2YY5A 4V39A 4H18A 3ZCPA 2I6FA 3PUJA 1EBUA 3RUDA 3OCCA 1XF9A 4LWPA 2Y1GA 1Y6FA 2CXPA 4GPZA 4DGSA 1IHXA 5KJ6A 2ZIXA 5FXMA 4AMYA 1Z28A 5HFAA 4H0CA 2XMBA 2D5CA 5F7OA 2P2CA 7GPBA 1X70A 4X0EA 4YX9A 1HT2E 4OK6A 4OSEA 1RM4A 2QI9C 1Z13A 1PV2A 3GVHA 4HQ6A 8ADHA 1JKJA 2H1OA 1ZUIA 1P2DA 4GX2A 4NHOA 3TTUA 4CKCB 1N4AA 3NU1A 3VKFA 3AQ4A 4MEAA 2JI4A 4BAUA 4YMTA 3ONVA 2C4UA 2HCTA 4PS0A 3ZZMA 4N82A 1KRXA 1KZGB 3ULKA 4HKTA 1BS1A 3PGKA 2V7BA 2DLNA 2ORVA 3M3PA 4IIJB 5AD1A 4BNIA 4RTQA 1NU8A 2AYYA 3GMDA 4J1TC 4Y2GA 3RAEC 2C54A 2C3PA 3MCWA 2ACEA 4L9RA 4TWZA 2H4YA 5HK8A 2PPLA 4HOYA 1OLOA 5GZ1A 2YVAA 4OQXA 4DRYA 2BELA 1XMVA 3M1IA 1U2RA 2PR7A 2VHUA 4ZRDA 1X1CA 1SKQA 4CW7A 2JJ8A 2C5SA 4YJ3B 3WXBA 1N7IA 2LR0A 2J5BA 1WY7A 2O8CB 2OHHA 2JJ2D 4RGQA 4ENPA 3KJEA 1NZDA 1SCUA 4Q21A 4JN6B 1ZEMA 4Q3OA 1XSEA 2EG5A 1RAFA 2AW5A 2QPTA 3KXKA 4EF5A 2O19A 3GUZA 1TT5B 2ZVJA 3DE1X 1BHJA 4UM5A 5BT9A 2IS6A 4GHWA 4KE7A 4U7TB 1CRLA 2AG6A 4Q01A 5B1IA 1KMNA 1E77A 3LGSA 1R3UA 3WQSB 2MDTA 3JYNA 2XECA 2Z3WA 1YC2A 3VH2A 2YZKA 2GEUA 2YNMD 2G1PA 1Q19A 2J4CA 4JLSA 4DQKA 3X0DA 5DBIA 1IWBB 3OFND 5EN4A 3BMCB 4U63A 3G5AA 2EP5A 3RU7A 1UAGA 4LXHA 1FLAA 3HO1A 2PZ8A 3O1IC 4LYAA 3STVA 1NMQA 1UBJS 2D1YA 4ZCQA 2IS4A 5AK0A 3DFZA 4ER7A 5JPCA 4F2WA 2HLNA 2A8YA 2FPGB 1V26A 4Q4DA 3TOZA 4D57A 2V7UA 3DE2X 1XE3A 3E9NA 1UBCA 3VPAA 1YNSA 5IUJC 3A1UA 1Z2OX 2RGNC 5DE3A 3HM2A 3OTIA 2CNWA 1Y3CE 3UKDA 1GL9B 5KYGA 1LTKA 3DTVB 4MWSA 3TLXA 3OQ6A 3Q9SA 2J6BA 4L8FA 3V5NA 4KJZA 3D5QA 4NCAA 5HE9A 3H84A 1BXRB 3NKFA 1ZM7A 5F52A 1QHEA 1WPGA 4LDQA 2RK6A 3RS2A 4DV0B 1DX9A 1O95D 3FWPA 3OIUA 5AW3A 3ZDBA 3SYTA 5I7FA 1G6Q1 4A0SA 1T9HA 4ZREA 2O2SA 3K9QO 3KE8A 5DX0A 4YPVA 4G84A 3IB3A 3T5GA 4UUQA 4EZEA 5D7BA 4X64B 5AJUA 1Z7EA 1E9SA 2ZI6A 1PD1A 2QMYA 4QPCA 3M6XA 4FUQA 5TQ2B 1EUQA 4W1RA 4Q4LA 3N2LA 5ALMA 1CY0A 1EWVA 1PJLA 3H5TA 3L4SO 2X0JA 1U3FA 5DPMA 2GHRA 3F71A 3HTXA 4TSRA 2XQVA 3OE5A 5L6MB 3GOQA 2PFGA 3G2PA 1H05A 3SF0A 3TL2A 2UV8A 4ENTA 1ECCA 4XCVA 3PF8A 4C3OB 4MRPA 3I5MA 3RROA 1T5HX 2EEPA 3DL7A 2I78A 3GG2A 3VZQA 4L8VA 5CFPA 1F4PA 4DPMA 1J0EA 2EDCA 1LPOA 1PS9A 5JVDF 2C04A 2WAXA 3B3FA 4G8CA 4CR8A 2GTHA 3DMGA 4BVGA 1QIHA 1R5OA 2FFJA 1F5SA 1KI8A 3D7RA 3PR3A 2IYTA 5HHTA 4OJKA 1BA2A 2BF7A 1RJEA 3DXXA 2UYQA 5ED4A 3DQQA 2YWJA 4ZQHA 5TIIA 1OPXA 3ZJTA 1NHGA 1FU8A 2JGRA 3T8YA 1AZTA 4Q7EA 2HU5A 2XKBA 5FEUA 3ANXA 5HF5A 2IYYA 5JAIA 3ZQ6A 2JFOA 3DYBA 4PONA 1THGA 2Z0MA 2CK3D 2OGZA 2VF2A 1J8MF 3PXCX 4LZZA 1XZHA 2CLEB 2R96A 1A97A 1ML4A 4W7IA 2P40A 1Z3IX 4YALA 2QD5A 3KXPA 2J4DA 2XF2A 1DQZA 3RHZA 1W5EA 1C7IA 2UVPB 3ZI7A 5BSWA 3IE1A 3PL1A 3D3EA 4EGFA 3N53A 1OBFO 2PLNA 2ID9A 4MVWA 4OQ4A 3TH5A 1B76A 3EH2A 1E1RA 1G38A 4NMLA 4REMA 3RJ5A 1MXFA 1Q22A 3GLFB 3VMMA 2DY1A 1XU4A 4O1IA 2FRDA 3N76A 4IUBS 4C4XA 4ZZ3A 2PVSA 3KWJA 5FUQA 1YGPA 1J7JA 2WTXA 3DZGA 3HCEA 2Z6QA 1TL7C 4HVTA 4XAQA 4ZYVA 5FBVB 2ON6A 1MQ9A 1BTOA 4N8EA 1FU7A 1AZSC 3PX2A 3ZWKA 2FA9A 3KZMA 1Q57A 5KQRA 2VAVA 4OHVA 5DF1A 1A2QA 4JYCA 3X2SA 4URZR 1H2AS 2OORA 2WM3A 2W43A 2PKYX 2WWRA 3AK4A 3LOQA 3NV7A 4TUYF 4DDWA 2PCJA 1OT5A 4JWTA 3ZJ4A 3JZDA 1FNBA 1JLHA 1HO3A 1A5ZA 1Z29A 1RHRA 2AVNA 2QL9A 1O8CA 3H9EO 1Y6QA 4XPIA 1YUNA 1L5OA 1YIAA 1PDOA 1M8GA 2E85A 2XCQA 1OY1A 1U04A 3PHIA 4J7CA 2E5FA 2PO5A 3DL0A 1IHUA 3L1UA 1A04A 2GD0A 1DTWA 2ZRQA 3QXCA 4OU4A 3PZRA 3OETA 4G89A 3U4GA 5ES3A 2VDQB 1NI4B 1P5HA 2Z6VA 3LPLA 1GAEO 5L3RA 2JCSA 2C9OA 5FD8A 1XTSA 4YRPA 5IT0A 3UK0A 5EHGA 3EXEA 4P7GA 4BBAA 4FB5A 2ZWOA 5CJPA 2Q5FA 2X86A 2EBUA 4B4VA 2JHPA 3JWPA 5F9MA 4BL5A 1TYZA 2RCYA 1P7PA 3KEFA 3Q7IA 5I6DA 1Q6ZA 2NPIA 3NBFA 2IELA 4CI9A 2AT1A 4OB8A 2RE8A 2BM1A 5CA1F 2EJUA 1QRUA 4L0CA 2NVOA 3ZXUB 2PFSA 4G67A 4QNRA 3UICA 2RH8A 2QLNA 1J6UA 1WXEA 1Y1RA 1A9ZA 2DY0A 2AOTA 3N87A 4RUKA 4EM6A 4F8YA 5CXXA 5LU9A 1VI2A 3VNSA 4ENSA 2UZ3A 3FPEA 4Z3KA 9LDTA 3I62A 4H7KA 3W04A 3IUNA 1FXSA 3JQBA 4LX8A 4R8MA 1YD7A 1O97D 3JW8A 2ENUA 4JI3B 3LLCA 3DPSA 5CRIA 5FWYA 2RKWA 2VHCA 1NV9A 3HI4A 2HLPA 2N47A 1G5IA 2ZBDA 3O83A 1Y1TA 3QG5A 2R6HA 3KVOA 3ZWXA 5IJ0B 3E2IA 4RZ2A 1JPJA 1DXYA 1PEKE 4TL7A 3WWOA 4AJ4A 4UOEA 2EKLA 5EJ6A 2H57A 5EGNA 5K0NA 3HSYA 3IAXA 1VG0B 2P9TA 4IDEA 1ZIDA 2PSJA 1J42A 2VS1A 3DT8A 4ND6A 5FO0A 3VYVA 5ALXA 5FTMA 3WV4A 5K0FA 3EVTA 1KS2A 2I4LA 1M7GA 4GD3Q 2N75A 4A03A 5TB5A 5TJ9A 2WT4A 3Q98A 2K6GA 3DGFC 3LK7A 5ADVA 1U7OA 4JFAA 1UM9A 4BV9A 3EIHA 4LDRA 2OUIA 4ENWA 1DTEA 2O8NA 3GUHA 2V96A 2WMDA 1XP5A 2FX2A 4G36A 4R05A 1P3Y1 5GINE 4C7MA 2ATXA 1FRFS 3I52A 3FRIA 3I2GA 1KQPA 5EEGA 1J2UA 3IT2A 4YLGA 5HP4A 4XRRA 5DU2A 2FN4A 3UM9A 1FL9A 1ZL2A 3CRNA 3DEZA 1O94A 3R3UA 4XQGA 2FG5A 5K0CA 2XSZD 2H1HA 2IQIA 4EUHA 2PXCA 4OQDA 4QNNA 4V3BA 4WK0B 2QLTA 1JXAA 1U8XX 3QNUA 3R20A 3UHJA 4CCYB 1ZI8A 4ZDWA 4D4LA 1PSWA 4XGQA 1T8SA 1LLDA 5J59A 3RUIA 3BJZA 3C2QA 5C51B 1XAJA 2QL6A 4QOGA 2IHTA 4B6GA 1UOPA 2PT5A 3OWOA 3NS7A 2CUTA 2QTBA 4RH0A 5T67A 1MW8X 1HTTA 4ZP1A 5G1NA 2YZ2A 2CEKA 4HZGA 2WM2A 1UPUA 1YIOA 3G0IA 1QG0A 4P35A 1Z17A 3L82B 3KQVA 1JPNA 2GM3A 3K6SA 1X14A 1TA4A 3EF3A 3ASZA 1DVRA 1QFMA 1UOEA 2XOXA 3IDAA 3NJRA 3BIFA 4LTNA 2PCLA 4TTRA 5TMBA 2P2DA 2OTCA 1XF1A 3MWLA 3DF7A 4RVOA 2ZSIA 4G0ZA 1IULA 3VX4A 3WGYA 4BQOA 1BU8A 3IO3A 2E4YA 1ZFNA 1GL6A 5BN4B 2C4TA 3EEOA 1W1UA 3V4SA 5CCEA 4NVRA 1OA0A 2E4ZA 4HRAA 4JBXA 3UMGA 3UMSA 1RWOA 4I4CA 4KIUA 2C84A 1QE3A 3DE3X 3EGIA 4QGBA 3IVXA 4XOUA 4C20A 4EGCB 4EG8A 4LFBB 5CLFA 1V25A 5F73A 4FW9A 1H5NA 1W6UA 3BFKA 4C01A 5G0TA 5BPHA 3T94A 2ZULA 2PUEA 5L3QA 4MV0A 2W83A 1PWZA 1DXQA 1CUZA 1KAHA 2NVBA 3KD3A 4RY2A 1ENZA 2CV1A 3A1TA 2A9KA 3UBTA 1IIRA 1XTUA 3LGXA 3NRBA 4L22A 1PTJA 1FW6A 4QAJA 2ADMA 3OCXA 4LV6A 1U0SY 5KYWA 2WF9A 1RCUA 4DDUA 1WCIA 2Q5JA 4AJHA 1W4BA 3HLKA 1KSJA 5AJTA 1ZW1A 4I81A 4ER0A 2XMDA 1JUDA 4KB5A 4UHFA 4E4RA 1KZ7B 5DN9A 4C0KA 1LVUA 3FMGA 1H4TA 4LY3A 3V8BA 2A4MA 2CLIB 1VLVA 1RLMA 3DDWA 4Y30A 1PFYA 4L95C 4H7PA 5ICFA 2PS3A 1SXHA 2NUAA 3L7NA 3QLVA 5CM8B 5EMNA 3LP8A 3ZHZA 5BMVA 3N74A 2PZLA 5E95A 4M0FA 4UVHA 5BUCA 1EUZA 5F23A 4IV5A 3R3WA 1ZVJA 2D2XA 1Z0KA 2PKQP 2WTAA 2ZKLA 3NG1A 5LOVA 1K8ZB 1DEXA 1I30A 3WMWA 2MYPA 1VA4A 2GO1A 3MS7A 4PS1A 3VO1A 4ZZIA 2AK2A 3NDPA 4Q7JB 4BNHA 1C80A 2ZFUA 4PZAA 4JP1A 3L1KA 1XVUA 2Y1LA 2Z9CA 4PLYA 2QRKA 2FE1A 3W90A 1A69A 4B7UA 1O6ZA 2RBKA 3V6MA 1E8MA 3DWIA 3SJZA 1MIHA 1BN6A 2IYZA 2QU7A 7REQB 2EZTA 2BFBA 3K5PA 3LIPA 4RVUA 2X3FA 3GUVA 1E2GA 5CFOA 5KU1A 2ZETA 3P9CA 4K6CA 4BCBA 4AUMA 2HMTA 3WQRA 1KBQA 3STHA 4F46A 3G68A 3A9WA 5YASA 4ZOLB 1ZMTA 4MDEA 1QYVA 2TYSB 3PPYA 1ZK3A 1E3SA 1N0VC 1KARA 3CX4A 3ID6C 3MJFA 2VNSA 2XRMA 3L43A 4GGOA 4JH0A 4MQEA 5HE8A 4HGNA 5TMPA 1G8MA 1XZLA 4AZ3A 4C4ZA 2WFLB 4P33A 1JFSA 1R64A 2M2IA 3BAFA 3GFOA 3QU7A 4M9CA 3ZDQA 3CLSD 1EZ1A 4PW0A 5EP2A 1YL5A 2G6BA 4IEFB 1PG2A 1XTRA 4C0SA 4GDFA 3SLGA 4YJGA 4AI6A 3CVJA 5A06A 4UMVA 2JLXA 4G09A 3K0SA 2WWGA 3WRYA 1MD9A 5KX5F 1O89A 4L5BA 2Q5OA 1LQTA 5H9VA 3GRRA 4N9QA 4WWHA 1JEQA 1A9OA 3EGCA 4Q15A 5HGJA 4RTRA 2OOSA 3C8UA 3TG8A 3Q5DA 4RK4A 4BQSA 3LQQA 1R0KA 3LE8A 3KJHA 3GNTA 1M34B 2J48A 4B81A 5AI0A 3F7NA 4BLOA 2OEPA 3V34A 4Y0AA 3ETLA 3OJ0A 2QENA 1KYVA 2CFRA 5IASA 3CNLA 1LK5A 3F4LA 3ZQUA 4XFJA 4AIRA 1T9ZA 4XIGS 4KZKA 7ADHA 4HQ0A 5IARA 4LGVA 2PVCA 1EKXA 1U99A 3DUWA 4FYXA 2C8JA 2HRRA 1HQYE 3E27A 2W8BB 1OF1A 2VLBA 3ROXA 1T2DA 1W5FA 1P1KA 1TT7A 4R1QA 2YVUA 3QX3A 3ZWMA 1L7DA 5FNZA 1FLVA 1S8NA 1PX2A 4XOIA 3N7AA 1IEQA 2VVTA 4QNMA 5H81A 3BK7A 4RLFA 1W0KD 5IULC 2P90A 1HQDA 3DW3X 4MVJM 3TZHA 2CE2X 2ZPTX 1Z35A 4LSGA 4Q4CA 3IP3A 3SR0A 1OT3A 1TLFA 2X8AA 1VLZA 1F0KA 3WYBA 2IYQA 3EFBA 1FQWA 2H2HA 3EVZA 4IUDS 5K8TA 1L4GA 1PJ2A 1ZAYA 2HJWA 3MOSA 4JS0A 4JB2A 4L8YA 5AW6A 4B8YA 3IRUA 1DO8A 3GLIE 2QAGB 5KTSA 2V4UA 2XXJA 3O95A 3B36A 3PDWA 3GEMA 1SXQA 3DLTA 3LK6A 1WNTA 1OWLA 4B4DA 3K6KA 2E3JA 4PRKA 1TEZA 3B9PA 1RAAA 2DJ5A 3KJXA 3JYPA 4O8ZA 5HR5A 4B35A 5AWFC 5JBNA 4ENUA 3PVSA 2XVXA 4H1HA 2HK8A 3ZXSA 1LBHA 3H1EA 4DLZA 1TMKA 1RJ9B 1RI2A 4TLEA 1I24A 1OFGA 3CM0A 2HNKA 1E5QA 1UXGA 2JFHA 2HDWA 4MH0R 4MRAA 3WTBA 5TQ0B 4QBKA 5BSKA 4DA0A 5JDIC 1O9GA 5JTTA 1M73E 3RSFA 4HWSA 3CH7A 3BA1A 4WLUA 4OXXA 1QK4A 2MJLA 1JA0A 3PT9A 3GJQA 3AI1A 3CXUA 3K94A 3PLRA 4IL5A 1Z75A 4N0MA 5H02A 3U3DA 1OGIA 1I9CA 2X14A 2VP4A 1U1EA 3GHYA 4LXUA 2NU9B 1H94A 4I8XA 2W2NA 4BMDA 1YBMA 2H16A 1PK8A 2ZVPX 3H18A 1N32B 3B51X 1GDDA 3D3JA 5LA6F 1JLMA 2MSWA 1XRMA 4FDLA 4V1CI 5E3JA 1JB1A 5HCIA 3C43A 3O9ZA 2Q1XA 5MHTA 4BWVA 1JSRA 3M6AA 3OIGA 2R4QA 3EDQA 4NL4H 1Q7EA 4OBWA 3EHEA 4UTPA 3Q3JB 4MJ7A 1J8QA 1OREA 4RQBA 1CE8A 4B6EA 1JDBC 5SZHB 4D0GA 1SC6A 3KM0A 3T7KA 1PT6A 3ZE7A 2BC9A 3SKXA 1QDEA 3K5IA 1JVNA 5A5VA 2Y1XA 2ZCVA 4IMRA 1HYBA 1C0EA 4I5EA 3IXQA 4KE6A 3DT9A 1VJDA 5TC4A 2OAGA 1SXJD 4R01A 1GR1A 1M6EX 2OKGA 4A82A 2EGUA 2QYHA 3ZPXA 1HE5A 2FFRA 3LXXA 3IODA 3M2PA 2XYPA 3NW9A 4PCAA 3ILHA 4FFPA 4U6SA 4PYIA 4CMGA 1HMPA 3G7NA 3K71B 3EYWA 4KAJA 2COUA 3IJPA 1YR6A 3FHJA 2P5YA 5AKEA 4I66A 4E46A 2ONKA 2RGCA 2QYTA 2GPWA 1XX6A 5E6SA 1OC4A 2DHQA 1V16A 2DUWA 5BN3B 2QTTA 4HEA1 2GEVA 1J56A 3ROKA 1SXJE 3C16C 4EB8A 1YZKA 1THTA 3I8XA 3WJ1A 3IEVA 3KX2A 3RANA 3IAS1 3ZD9A 3OPYA 2MYNA 4KOAA 5ALNA 4RZQA 2WSSD 2YMPA 3MS4A 4RNCA 3KO8A 4LX0A 2XLBA 3HB4X 3IXLA 3AERB 3GGSA 3P2JA 5D85A 5TF4A 5B4TA 5BR7A 4WBNA 4MVYA 3D5TA 4OKNA 3TSCA 1FDTA 4HH1A 5C1OA 1C7RA 2OXRA 1QMPA 1X77A 2OM2A 2WYWA 1W48A 2YZGA 1TZ2A 3E1KA 3HDGA 3JWEA 4G0XA 4HSEA 5CDFA 1NG1A 1QH8A 3HGQA 1CG6A 3ZR4B 1ZP6A 2PYDA 1W85A 1SRRA 1XZDA 3DL2A 4EABA 3SXUB 3S8MA 4Y18A 3VSBA 3H2YA 4ACAA 4MYCA 3HG7A 4Q1FA 1AXRA 1U3WA 3LTNC 3UB4A 1AB5A 5F64A 3EDYA 3W8DA 1G21E 3SHWA 2W2XA 4C6TA 1T0BA 5BNWA 1JQ3A 3AYZB 4QWMA 4RPJA 4DZTA 1DCMA 5ALUA 2JS7A 3VISA 4RJIA 1ZMOA 3WGQA 2VCHA 2AMLA 3C3PA 3SHQA 5B30A 3WIVA 1DJOA 3ICEA 1FUEA 1TIBA 2A9QA 5I4IA 1N9KA 3ONWA 1YZHA 3IQGX 4D3DA 2P0EA 1M6YA 4QEKA 1GAJA 1M33A 3H97A 3GGJA 1XJWA 5LD2B 1IVYA 1R0LA 2QRVA 1Z8HA 4TS1A 2JA1A 3OEHA 4RK7A 5KTRA 2BH2A 2NUBA 1JHXA 5JAPA 2Y0EA 3WRVA 4OQQA 2C82A 1T43A 4CMEA 1DCFA 1OAAA 1MH9A 1A4XA 1X6VA 3KOYA 4AZVA 4EBBA 3E9ZA 1YJXA 4MCHA 3ACBA 2WWFA 4CLRB 3UAGA 2WSSA 4JROA 3SFVA 2YXNA 2CXRA 4G9EA 3HKEA 3HACA 1Q0LA 2Z95A 3MWFA 3HABA 4LISA 4FFNA 2ZZKA 3D6TB 3FGNA 4DXHA 1X7XA 3QVJA 1D03A 4EZBA 3I5AA 1G59A 5EZYA 1QG6A 1T1EA 1XG5A 5K51A 2JFGA 3IUPA 3PWTA 1EMDA 2RC6A 4MB2A 5AI5A 3OE4A 2ZJ6A 4E2XA 4HGOA 4EW6A 2NTJA 4QBHA 4DWVA 1OWNA 2QD4A 2XCOA 3EPLA 2BFNA 1XPJA 2DRIA 3KZVA 4PNPA 4Q3EA 5TPZD 5TS2A 4EY8A 1Z5OA 2QAGC 1BNCA 4F4JA 4M9UA 2P5UA 3LF1A 3UNXA 5ALJA 5HIKA 2AKAB 4DLXA 2OESA 3L49A 2C9CA 1YQXA 3U3OA 2CHQA 3LOUA 3KB6A 2VP2A 3E22A 4INPA 4RLHA 1ODKA 2MR5A 3DBHB 2IV2X 1BW9A 4UNIA 4A8JC 3LXUX 1H3NA 4MI1A 4N49A 1YO6A 3P9YA 1UC4B 4K46A 4MCAA 1HNZB 3V3KA 4X7BA 3CXRA 1QF7A 3LBIA 5B4VA 1GLVA 1L5QA 1P19A 3BD9A 4FT2A 2LWIA 2QU8A 1JR3D 3NFYA 4MLPA 2Z5FA 2VH1A