3A27A

Crystal structure of m. jannaschii tyw2 in complex with adomet
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
219
Chain Sequence
KYQKIGDVVIVCKAILLYTHVKILYGKETETIHKEYGCLFKLDVAKIMWSQGNIEERKRMAFISNENEVVVDMFAGIGYFTIPLAKYSKPKLVYAIEKNPTAYHYLCENIKLNKLNNVIPILADNRDVELKDVADRVIMGYVHKTHKFLDKTFEFLKDRGVIHYHETVAEKIMYERPIERLKFYAEKNGYKLIDYEVRKIKKYAPGVWHVVVDAKFERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1557
publication title Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 71
structure length 219
sequence length 246
ec nomenclature ec 2.5.1.114: tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a27A00
3PVCA 2YXDA 1JTFA 4DKJA 4PINA 5EHIA 3GRUA 2B25A 3OZRA 5LQNA 1KPGA 2CKDA 1PRYA 1X1AA 3CVOA 3AJDA 4HSGA 5EZSA 2XYQA 3MTIA 3TM4A 1G6Q1 2O0LA 2UYCA 3AWIA 3IHTA 4AZTA 1B42A 3O4FA 5EMKA 3TR6A 3LECA 3M6VA 3BT7A 3EMBA 5CVJA 3TM5A 1JG2A 1KP9A 4P7FA 2P1DA 1FP1D 3HNRA 3KPUA 3PX3A 3P71T 5K01A 1YZ3A 4YV0A 2YXLA 3P9NA 4OQEA 4YUYA 2YVLA 3KPVA 3LKDA 3SX0A 4M7RA 4YUZA 1NW5A 5ERGB 1T43A 1H1DA 2AOUA 3OE5A 3CJTA 5GM2A 3P97A 3G2PA 3FTEA 3LKZA 4OBXA 5DWQA 2YUIA 4KRGA 3NTVA 3KQWA 5LR6A 2O05A 1EJ6A 5EGSA 4EVIA 3C6MA 1R8XA 4OQDA 3X0DA 5HIIA 4E2ZA 3KQSA 5JUWA 1O9GA 1KPIA 4HGYA 4ER6A 4RTKA 5FQNA 3DUWA 1M6EX 1NBIA 2H00A 2ZSUA 3KQTA 5DRTA 1NW7A 1TW2A 5DRYA 4LECA 5GIPE 3FRHA 2GAFA 3UFBA 1UWVA 4GOOD 3B5IA 2AOWA 1N7JA 5GWXA 3SSMA 2P35A 3G8BA 3G7UA 3B3GA 5LQRA 3CKKA 2NNWB 5DM2A 5G02A 1G55A 4KWCA 1VLMA 2WK1A 3UJ6A 8MHTA 1O9HA 4AZSA 2IP2A 2PX8A 1M0EA 3C3YA 3EVDA 5E1OA 1DCTA 2ZZNA 3KR0A 1JG3A 1UIRA 1FBNA 4Y2HA 4CKCA 3DXYA 3BUSA 5T6BA 3P8ZA 3UJ8A 4AZVA 2P3LA 2UYHA 4QVGA 2GA9A 3EVBA 4FP9A 3M6XA 4E31A 5EMMA 2O07A 2ZZKA 1INLA 3I53A 2PY6A 4YMGA 3TOSA 1ZKDA 5M5BA 4YV1A 3HP7A 3HCCA 1ZQ9A 2ORED 3BGVA 1SVUA 2ZWVA 3UWPA 4BY9E 5K09A 4X61A 5FHRA 2PX2A 5EZQA 5DTRA 1EIZA 2AVDA 1NV9A 2JJQA 4QQKA 5HILA 4R8RA 4E2WA 5F2NA 5KQRA 1G8SA 3ORHA 2EFJA 5CCBA 2H11A 2BH2A 3IV6A 2IIPA 2C7PA 3FPJA 4CXMA 7MHTA 3G2QA 3LCVB 5CCXA 3EPPA 1WZNA 1P39A 2XVMA 5EMJA 5HFJA 4E2XA 2ZVJA 5BP7A 2QYOA 3FYCA 2ZW9A 4WXHA 3HCAA 3HA7A 3NMUF 1NBHA 1QAQA 3DLCA 5GP1A 3GDHA 3GRZA 3Q87B 4IV8A 4PYNA 5LQAA 5CUQA 1XTPA 2ZULA 5ICEA 5FADA 2VZ9A 1L1EA 2HMYB 4HG2A 1FP2A 4GUAA 3UJAA 4E32A 5CD1A 2IH2A 3PFGA 3HVKA 5EKUA 2B9EA 2BM8A 2JG3A 1BOOA 4HRAA 3FPGA 2NXEA 3UJBA 1JSXA 3WSTA 3G2OA 3R0QA 4KIFA 3KPJA 1VPTA 1P1BA 2G8NA 3TKYA 5IKMA 4F86A 3SMQA 3KQQA 4ZTBA 3ELDA 3DMHA 3GGDA 4P7GA 3M70A 4O29A 1X1BA 3GXOA 4IV0A 5EMLA 5FULA 4AZWA 1V39A 5KQSA 1R18A 1I4WA 3DP7A 4ATNA 3DXZA 2PWYA 2FK8A 1X1CA 3PX2A 4ER7A 2PKWA 3Q7EA 5FTWA 2G1PA 1NKVA 3BWYA 3KQMA 1L3BA 3BKWA 3I5UA 3MERA 4DA4A 2C7RA 2AN4A 4GF5A 4PWYA 5EHGA 4EKGA 2QRVA 2ZBQA 3K6RA 3P2EA 5K0BA 1D2CA 3F4KA 1HMYA 2AOTB 2JHAA 4RTJA 4HH4A 2VS1A 5DM1A 5FQOA 4CKBA 2C7QA 2P7IA 5E8JA 5DSXA 4KVZA 4E2YA 3OZTA 3LDGA 5BW5A 5CVDA 1D2GA 1X19A 3K0BA 2LD4A 3DMFA 4XUCA 1R00A 3MB5A 2BR3A 2BZGA 2VP3A 3A25A 5BXYA 1RJGA 5CVVA 3P9KA 2P7HA 3PS9A 2I7CA 4PONA 3NVMB 4PGHA 5DLYA 5C1IA 2IBTA 3PLAE 5HEKA 3OFJA 3SSNA 3OU2A 3VC2A 1RI3A 2ZCJA 4R6XA 3M6UA 2JH8A 3R6TA 1QAMA 2PXAA 1JTEA 4DQ0A 2PXCA 4L7VA 1BKYA 1L3IA 4LWPA 1IXKA 4RV9A 3UJ7A 4DCMA 5GIOE 2IDKA 4HGZA 2Q41A 3DH0A 3RODA 2NP6A 1XXLA 2G71A 1RI5A 3ELUA 5GINE 1WXXA 2CMHA 4MQ4A 3ELYA 3EVEA 1I1NA 2OKCA 3NDJA 4RSRA 4FT2A 2P3OA 1VIDA 5C0OE 1EAMA 2OXTA 3B3FA 4EK9A 1KYWA 4KDRA 4Y30A 4V0QA 4IKPA 4OBWA 3TPZA 4PIPA 4M37A 4GQBA 2I62A 2IPXA 2OB1A 3MQ2A 4QPNA 2GPYA 4XUDA 1EG2A 3TMAA 3PTAA 1YUBA 3PB3A 3R9XB 5E2BA 4YUWA 3CBGA 3HEMA 10MHA 2IH5A 3O31A 2V7EA 3MGGA 5DT2A 5LQUA 5DTMA 3HA5A 4R8SA 4RVHA 3R3HA 3L8DA 3LHDA 4Z2YA 4M38A 3G89A 1KHHA 3EVGA 1KXZA 3R24A 1R6AA 2OZVA 2KW5A 2XYRA 1ZG3A 2PT9A 3TRKA 3BWMA 2NXCA 5E9JA 3VC1A 4ER5A 2AN5A 2V74B 2WA2A 5FUBA 5K03A 4OA8A 2ZIFA 3A7DA 9MHTA 3C0KA 2Y1WA 1WS6A 4BLVA 1XDZA 5HIMA 1JR4A 1VP3A 3AY0A 5EKXA 3EGEA 3UZUA 3DR5A 3E7PA 2O57A 3NWEA 3QOWA 4KW7A 2OO3A 3MCZA 4X63A 5B1SA 3V97A 3V8VA 4AUKA 3EEOA 1R74A 2ZWAA 3TKAA 2ZIEA 2UYOA 4QVKA 4C06A 4RWZA 4DMGA 5CM2Z 5DXJA 1HNNA 1MJFA 1KPHA 4MIKA 4YV2A 1YF3A 3C3PA 3HM2A 2JHPA 3EVZA 4NECA 4PYLA 4DM3A 3AXSA 1X1DA 3I58A 5K0CA 2PX4A 4ISCA 2EJUA 3NW9A 5DX8A 2DPMA 4BLUA 4DF3A 3KR2A 4C4AA 2R3SA 4KIGA 3FRIA 4FR0A 4X1OA 1VE3A 3OU7A 3KU1A 4GOND 4HTFB 1L3CA 4P7JA 4KDCA 5E9WA 5T64A 4C05A 5K8VA 1KR5A 2PXXA 1AQIA 2OBFA 2YX1A 3NDIA 4GEKA 3REOA 1YFJA 2GB4A 5JR3A 2ZZMA 1G38A 3LBFA 2H1RA 5EQJB 4A6EA 2UYQA 3AXTA 3E05A 3GNLA 3P2IA 1YZHA 2QY6A 5DM0A 2BR5A 2GLUA 1XDUA 5K0LA 2HWKA 4PYOA 5D1NA 2IBSA 4CKEA 3HCEA 5E1DA 1D2HA 1Q0TA 4IWNA 3GU3A 1RI1A 4OA5A 3CCFA 2FK7A 1KIAA 2ZLBA 3G5TA 3KQPA 1U2ZA 4PCLA 3GRYA 3C6KA 5EIWA 3SR4A 4PCAA 1YFLA 3KKZA 3S68A 2OB2A 3G88A 3LDFA 2K4MA 4RYLA 3JWJA 1Z3CA 1F3LA 2PBFA 2OY0A 4HC4A 2ONZA 4PNEA 1ZGAA 3DULA 3VSEA 3FUVA 3MCTA 3OPNA 4R05A 1P91A 2PJDA 3JWIA 3CJQA 4CWAA 2Z6AA 3E23A 2GH1A 2O06A 3GJYA 1TPYA 2AOUB 3CC8A 2FHPA 4RTMA 3LGAA 5KVAA 5KYGA 1R8YA 1QAOA 5LQKA 2AVNA 3B89A 3NWBA 4E33A 3KR1A 5EEGA 3QOXA 2OYRA 4RTPA 1SUSA 3RW9A 1ORIA 2PSSA 1QZZA 2EG5A 4RX1A 5EEHA 1RJFA 3UJ9A 5LQJA 2NP7A 1JSZA 4PYQA 4RTNA 3KPWA 1NW6A 3EMDA 3B3JA 1VP9A 3G8AA 2JHCA 3HVHA 3HCFA 4WVLA 5EIFA 1JG4A 3BKXA 3FUWA 2A14A 3UJCA 4QTUB 1QANA 2HR1A 2XVAA 3JWGA 3LPMA 4BP3A 5HOQA 4P7KA 1WG8A 2YXEA 1FPQA 2FPOA 3G5LA 3T0IA 4BP1A 4DCGA 4FS8A 4RVFA 5DM4A 1IY9A 3LCCA 2AZTA 3NVKI 1RI2A 3ER9A 2ESRA 3IYLW 5H02A 1NE2A 4LWOA 3E8SA 1N2XA 2HV9A 4EMSA 1I9GA 3FUUA 5BW4A 1RJDA 5K0GA 2HNKA 4PYMA 5HIKA 1SKMA 2Z6UA 4DZRA 2AOVA 2EX4A 3PT9A 3FTFA 3LCUA 2ADMA 4GOLD 5FWAA 2WA1A 1WY7A 3LL7A 4FGZA 2FCAA 3BZBA 3UA3A 2QM3A 2OPBA 2ZBRA 5C9ZA 2YR0A 5E2AA 5EC8A 5GOZA 3FYDA 3FPFA 2XYVA 3MHTA 5KS2A 2PWPA 2CMGA 4PYJA 4M36A 3P9IA 4MWZA 4EKIA 4RTSA 1MHTA 4GC5A 4JXJA 5E8RA 4R6WA 2B2CA 2PGXA 2IGTA 3P2KA 3EVCA 1NT2A 4RTQA 3OU6A 2BR4A 4C07A 2Y1XA 2NXJA 4GBED 5T67A 1DL5A 5EPEA 3DLIA 3SSOA 3TLJA 1UFKA 3U81A 3EVAA 2C7OA 2HTEA 2PX5A 2AS0A 1ZHFA 2AOXA 3BWBA 1XVAA 2F8LA 3FPEA 2AOTA 3H2BA 2IH4A 2ZIGA 3FTCA 3SGLA 2ZTHA 1JQDA 4PYIA 2ZFUA 1WXWA 3QV2A 4FSDA 3I64A 4G56A 3KQOA 3HTXA 4YUXA 3O7WA 4P58A 1Q0SA 3HA3A 3HVIA 2NXNA 1O54A 3BXOA 3DOUA 3I9FA 3KQYA 5DTQA 1BHJA 1M6YA 4RVGA 5FA5A 4X60A 3DXXA 5F2OA 2Z6QA 2VDVE 1KYZA 4GC9A 3M4XA 5K0EA 3GWZA 3D2LA 1P1CA 2DULA 1NW3A 1OR8A 3LSTA 3EEYA 2UZ4A 1IM8A 3MAGA 1SQFA 5ICCA 3M33A 1SUIA 4FZVA 1XCLA 1XDSA 1EQAA 5FWDA 3LX6A 1XJ5A 1QYRA 2IFTA 5EVJA 4C03A 4QDKA 4V0RA 4U7PB 2QRVB 2IDJA 2BM9A 3T7SA 3UBTA 4PIMA 2XBMA 4FSXA 4QQNA 2P3QA 3BGDA 3FPHA 4GOMD 4K6MA 2G70A 1RI4A 3GO4A 4YMHA 3VYWA 2N47A 1JQ3A 5IH3A 3M6WA 3TQSA 2NYUA 4C04A 5LQCA 3IEIA 2AR0A 2B3TA 2PLWA 3BGIA 3HVJA 5CVEA 5DPMA 2CWWA 3PFHA 2G72A 5P8WA 2I6GA 5E1MA 2ERCA 4U7TB 2CL5A 4PGGA 3LBYA 3ERCA 5GM1A 2R6ZA 4MTLA 4BLWA 3EGIA 3UJDA 3ANXA 3B7PA 3JWHA 2B78A 5CVUA 1VL5A 2QE6A 1N7IA 5E9QA 3SVZA 4POOA 1JG1A 1ZGJA 3ELWA 4A6DA 2P8JA 1RJEA 5ICGA 3CGGA 1AV6A 5K0NA 5D1HA 3BWCA 3CJRA 1NW8A 3G2MA 3GCZA 1DUSA 2FYTA 3HCDA 4LG1A 5E1BA 5HIJA 3RIEA 3T7TA 4B17A 4F84A 2GS9A 3EGVA 5K0JA 4YUVA 3SXJA 4ER3A 4H0NA 4UOEA 4F85A 4FT4A 3KR9A 3FTDA 3KHKA 1SQGA 3UA4A 3MTEA 4AX8A 4XCXA 2EJTA 4PYKA 3T7RA 3TFWA 1FJXA 2ONYA 4RTOA 3DTNA 5HZMA 1EJ0A 1JQEA 1BC5A 3DMGA 3OFKA 1AF7A 5DX1A 5EOVA 2YQZA 2JH9A 3FZGA 3GIWA 2FRXA 2PVCA 3OZSA 4MHTA 2P40A 5DSTA 1G60A 1G8AA 3NJRA 4CTKA 4X41A 1AQJA 5MHTA 5F2KA 1PJZA 2E5WA 3THRA 4OX9Y 3HCBA 3OE4A 3A7EA 3GRRA 3EVFA 5K05A 5CIYA 2P41A 3SM3A 4E30A 4XUEA 4QPPA 1Y8CA 3ER8A 1TW3A 2AN3A 2VDUE 3THSA 1YB2A 5FCDA 2PV0A 4EQZA 4RTLA 5LSAA 1F38A 3FUXA 4CTJA 3GRVA 1ORHA 1SG9A 5FA8A 4QDJA 3FUTA 1VBFA 1VQ1A 1XCJA 2YTZA 4QTTB 4ER0A 2ZBPA 5EG5A 3ME5A 2I9KA 3KPYA 5DX0A 1NV8A 2PT6A 4E70A 5DXAA 4HTFA 5ICFA 2VDWA 3A4TA 3A26A 3ID6C 4RTRA 3LDUA 4RVDA 3P9CA 5U4XA 4C08A 5K0FA 5FHQA 3OCJA 1L9KA 3A27A 3KQVA
chains in the Genus database with same CATH superfamily
4PZDA 2D0IA 4RSGA 4IVPA 3DV0A 2QP4A 1VSUA 5K3SA 3U13A 2B25A 1XRRA 1KSHA 1N5LA 4KBFA 4XKJA 1R9GA 3SHWA 1J1ZA 1AO3A 1JJFA 3TM4A 1KU6A 1IN7A 1HURA 1QYVA 3RAFC 4EW6A 4KGDA 4KPEC 1YS4A 1Y4UA 5TQJA 5B6JA 1ONPA 3GJRA 2FQQA 4AZTA 4EJSB 1JLMA 1JU9A 2XE8A 3LECA 4YO8A 3H1EA 5HX7A 4PY2A 5H1YA 1R7RA 2B99A 3ZWDA 4N41A 2P1DA 3TX6A 4F6LA 1EFKA 3H4VA 2VBCA 4DIDA 1YDFA 2X9VA 3H6KA 5KJEA 1XZLA 3CUYA 3RC9A 2YW9A 2MTBA 3WRXA 1H1DA 1PKXA 3CJTA 2GN0A 4MVJH 3FTEA 2IP1A 4EMBA 2O50A 2CDBA 4JP8A 1LD3A 1OGYA 5A5EA 3NM4A 4NK5A 2PUBA 3A11A 2WUEA 3IR7A 3JSAA 3JQAB 1OGIA 5DP1A 1FZTA 3ZYCA 3IPRA 4REMA 4LI0A 3VOSA 5B58C 4G8CA 1RWQA 5FUMA 1M1NB 3JQDA 4XYLA 1KFKB 1UWVA 2XDWA 3RU9A 3HDTA 4DLYA 5KOJA 1BXRB 3ANSA 4U6QA 2V6IA 2FPWA 2M9MA 4G1MB 4P92A 3G2IA 5JECA 2R47A 4M49A 1DKNA 3QITA 4TT8A 1A2BA 2XTZA 1M0EA 3UWPA 3W5IA 4J0HA 4N8EA 5JJIA 2MR6A 3NKLA 2YC4C 1MRZA 3NI2A 2ZZNA 2CDRA 3KUKA 5KTYA 2DKFA 4MCIA 3CEAA 1PV2A 1JP7A 2A9PA 3G1UA 4IQ4A 2ODNA 3EF3A 4JT2A 2I2XB 4XM2A 5AOBA 4Z0TA 2QD4A 7ABPA 1YGPA 2GO7A 2ORYA 2P9HA 4RKRA 4C1BA 1ETUA 1I0IA 4DIFA 5BUCA 2CE7A 3DHWC 3OWXA 5CG2A 4MRMA 5M2QA 1U2EA 3HP7A 1Z88A 1ZQ9A 5CGQB 5HBGA 5H80A 3UJ3X 2XZTA 1W30A 3QTTA 3MUNA 5LXTA 3FETA 4UPEA 3CX4A 2FB9A 2FUG1 3EWAA 4G5SA 2R25B 1G3RA 4ZQFA 1N6KA 1VMEA 3JQFA 2C78A 1RXUA 2IIPA 2X8LA 1L5VA 3O4GA 2XMGA 3HUFA 3SIWA 5B4VA 3EPPA 1BVYF 3LRPA 4Y6PA 2R6JA 3Q3VA 5JMWA 5JVDF 4JU9A 4Q9DA 4EPTA 1U0JA 1A4XA 3L1JA 3MJRA 5IF9A 3OQNA 2WM9B 3K4QA 1G4UR 4AQDA 4EFDA 3BRCA 2QTBA 2VK8A 2XUKA 4HDNB 5GP1A 3ZU4A 1TLFA 4FS3A 4L5YA 1PWXA 4IH9A 3A2LA 3WLKX 1VGQA 4HG2A 4R4JA 5CFLA 1NF8A 5CD1A 3AI2A 1SHZA 4IXTA 4BLPA 3DLBA 1HFEL 4KPUA 1P4HA 1GZHB 2B4QA 4KE7A 2EBUA 1GLVA 5C46F 3N39C 1S01A 5I4BA 4OX9B 1HKHA 2MSWA 1BXGA 1WSBA 2PUWA 3AQIA 5HXAA 1MH9A 2XODA 2VEOA 3ZDDA 1NMQA 4JQSA 3AVWA 2B37A 4S1WA 4GFDA 3V34A 4BTLA 5IT5A 4QFCA 2CDAA 1RLJA 1VGVA 2JCBA 2YYSA 1FC0A 3GMDA 4I81A 2G6TA 4UAGA 2VP5A 1HR0B 1LSUA 1CV2A 2Z04A 4HK4A 2A0FA 3KAJA 3KQMA 4DRYA 1U8FO 1NOJA 3FBGA 4MLCA 5BQPA 3UMYA 3KDSE 2XRZA 1DQRA 4J4TA 3ZH9B 3ZS9A 3JYPA 2CLDX 2X19A 1H23A 2JF0A 3O6VA 4KXVA 3WGQA 4ZI7B 3LBNA 1I3CA 3WK4A 1V25A 5IJ0B 1TO2E 3GGSA 3MCUA 4YAJA 3S44A 1E18A 1KFJB 3G9QA 4Q05A 4BO2A 3RYCB 3QBDA 3UAYA 4BFUA 3K0BA 2QD3A 2Z3ZA 3HYCA 4GYKA 4XGQA 1Z06A 5K3AA 1E5QA 4FUTA 4DTIA 1UANA 5KSPA 1SC9A 2ILVA 5T41A 2PKYX 2LCQA 4MROA 1ZGHA 2LP4Y 1IUNA 1SRQA 3L7AA 3WLNA 3W6UA 5BYAA 1BSVA 4QUEA 1ZMBA 3F46A 4L3WA 5CXXA 1KRXA 1EUQA 2B7LA 4Z4CA 4DQ0A 3VU0A 1C7QA 3B6KA 3UJ7A 2RJNA 2E55A 2Q41A 3K9GA 1BDMA 1QH1B 3DH0A 1Y6GA 1SBQA 2JHFA 4O6VA 3ELUA 2IYLD 1XPRA 1DFHA 2OKCA 4QIHA 2EBWA 1MORA 2ZYSA 3JQ8B 3H18A 4FT2A 4J49A 4E5DA 3AVYA 2QX9A 1QRSA 1IJBA 3VGJA 4EK9A 1KYWA 1ODKA 2PU7A 4B82A 4IKPA 1UAGA 2XJ9A 4N7MA 2GZSA 4F2WA 4D3FA 1YQGA 2BI8A 3EAQA 3ICWA 3W4IA 3VTZA 1LI7A 2NU7A 3W79A 1BMDA 5E2BA 3CBGA 4OMDA 1W1UA 4MMZB 1SHKA 3L7CA 3NAMA 4K9LA 2DF8A 4HLDA 2FFRA 3AU8A 4YMWA 1IRXA 3C24A 2CXQA 4GXQA 4O2LA 5C5IA 3EIOA 2VI5A 1KHHA 2AH5A 3D8UA 2MINA 5KNCH 2VYVA 3ICVA 4HTAA 5KYXB 3Q0TA 1KFCB 2IOQA 3B1XA 4EY7A 5E6RB 5IC5A 3WX0A 4MVCA 4EF4A 4EG6A 4RLQA 1H6AA 2Q3MA 1I1HA 1JDNA 3E9DA 4S35A 4D82A 4H0CA 2WA2A 4NDZA 3A4MA 1DDGA 1ZH8A 3E7WA 4NE9A 3UMMA 1HDCA 1E8MA 2FQWA 5GZ6A 1FLVA 4FLFA 4Q7QA 5L40A 1DHTA 1JIXA 2WG2A 4Q15A 1U28C 1UT5A 2F1JA 3KSBC 3R5JA 3UFXA 1PBNA 2CCKA 1USUA 2EZ4A 2J9YB 3OMWA 2ZIEA 2PZEA 1LBTA 4J0QA 3AVOA 5DXJA 2PIAA 1E5XA 5EXSA 4BWFB 3Q3JB 3P9YA 4OAOA 5SY9A 3EVZA 1RFGE 3I58A 3KJGA 5JH7A 2QUKA 1IXRC 2CXUA 3CLHA 2G80A 3W7VA 1V6AA 1MGOA 1XZHA 1VE3A 4TLDA 1EFDN 2C9DA 1OTXA 1UJ2A 5HQ3A 3QYAA 1T25A 5D5PA 4OVKA 5KZMB 3REOA 3FOFC 3OE7D 1Z0ZA 4RIGA 5DOVA 2LIPA 4ZO4A 4NFYA 2WF6A 1LH0A 2BAGA 3GUVA 3NOOA 3OI7A 4MQFB 5EINA 3UQZA 1W85B 1ZD3A 4GVPA 3SZRA 2I4IA 2OD2A 2PG3A 2NX2A 1SO8A 2QT9A 1A82A 3OSZA 3GEIA 3IPYA 3LNTA 4BZQA 5HCIA 3GU3A 4K5QA 5HDQA 1I24A 3AI1A 4OA5A 4JYMA 2JLUA 1TCVA 3JYHA 1KIAA 1U4NA 3PTZA 4KWEA 1Z38A 3T3DA 4LJ4A 4CM8B 4E4YA 1FJHA 1R3DA 2GAAA 3C4JA 1Q3HA 3FBWA 4Z9AA 2QIPA 3LZDA 4K2AA 4E94A 3GZNA 3H6HA 2F1HA 5DLPA 4H0FA 4K81B 1TOAA 1DPGA 4IFTA 5D3KA 2JI8A 3R7WA 2XUZA 3S2GA 4HWGA 1M7GA 4RGQA 1P2BA 5EE0A 3JWIA 1UMBB 4JGIA 2F48A 3I1IA 3IAM6 1IBMB 2DFTA 1CYDA 2HBQA 1TXGA 2OK7A 1QYDA 5K8UA 5D3QA 1NAIA 2NTYC 5JNLA 3EGCA 2EHDA 3HB9A 2NWQA 1W1WA 1J4AA 1Z4NA 1R8YA 2LKCA 2O1EA 3HPRA 4YB8A 4LE1A 3U37A 3GK3A 4MKFA 1F2VA 3AHFA 5IYZA 1ECCA 5GONF 1DAKA 2XUFA 3RNOA 4DN6A 3RADC 4I9FA 2EBFX 1DXHA 3RW9A 2X5NA 3W2IA 3PIRA 3A3NA 2PSSA 1QZZA 4GR9A 2J4CA 3ITKA 5EEHA 5I9TA 3W5UA 2FWPA 3L0YA 3TLYA 4EHHA 4Z1OA 4ZMBA 2ETXA 1MDFA 1NVVQ 2YJ4A 3E03A 3G8AA 3U17A 1SXQA 1N3YA 3EGXA 3MN1A 1FXSA 3BM5A 5CEFA 4QNMA 3F73A 4RA9B 4M7PA 1K8RA 1U7HA 4HGOA 2N9UA 3E22A 4BP3A 2DPHA 1WMEA 4I1UA 4LJYA 4RACA 5DVZA 3ANMA 3TG2A 1VCMA 4N7JA 821PA 2NACA 4D8UA 1JKJB 2EATA 3E61A 4Y2VA 2XUGA 1UM8A 3S70A 1AX9A 3IP1A 5DEIA 5JY6A 5LDDC 1I1OA 1O95D 2HJWA 5I4CA 4B9AA 3A1SA 4QHTA 5CW2A 4HN9A 4B8ZA 4EMSA 1VLLA 3P5SA 3ZQUA 1KRHA 1NBME 1CVIA 2I5PO 4PYMA 4FFRA 3NYIA 3T8YA 1G0OA 4NAUA 1JYSA 4EEZA 2E1PA 3FTFA 2QZSA 1JAIA 2VIIA 3PUIA 2PN1A 5PNTA 4DV7B 4JZYA 3UA3A 5IAAA 4QUIA 3KVNA 5AHWA 2EAUA 1U2GA 3W3AH 1N3LA 2P27A 3GEPA 3T1TA 1U1IA 4JQCA 1I4DD 3ETNA 1XEWY 2PMKA 4RL4A 5ALUA 5KYWA 4XWOA 1GNVA 5DB4A 1TJPB 4RK6A 3RS2A 2R7MA 5JS6A 3PRJA 1NI5A 5ICSA 4YPVA 2Q0XA 4KZPA 4B3GA 1IUKA 1M66A 3R6GA 1V6SA 4UM5A 3I73A 5ECDA 4C0LA 1WUTA 3AV3A 1D2EA 3BD8A 3TLJA 2I1VB 2CJXA 4F6CA 2PH7A 4UMVA 1UBCA 5F1OA 4BNIA 1I7PA 5A02A 1XVAA 4MO2A 3H2BA 2JLZA 2E5LB 1UBFA 2BDTA 3ELBA 5B1DA 3DQZA 1BCSA 2FRDA 1HYGA 2J6IA 3QMWA 1JQDA 2AFIB 1A7UA 3KAPA 4YRDA 1NN5A 4MQLA 3NVAA 3H1AA 4XM0A 3WRVA 1U7TA 1TZMA 4C7XA 4TV9F 2C9OA 2CLEB 3AR7A 4AX8A 3A6ZA 5F98A 3M1IA 2WBLC 4BO9A 4TT3D 4PC6A 1QXSA 1X7HA 1JGTA 2XMBA 4J0FA 3SR0A 2OO5C 1OR8A 2JJ8A 3LSTA 1MEOA 3EZLA 3H2YA 1UZNA 2COKA 2P62A 2QJFA 2X8AA 1RAIA 1D8AA 4TXMA 3AEYA 4DWWA 1Q7RA 4N9QA 1GXSB 1OFUA 3UBTA 2PFKA 1EM8B 1ZSVA 3JQPA 2WF7A 1JAXA 4Z0PA 1TUIA 2Y4NA 2AJBA 1EUCB 1GILA 3C8MA 5DHUA 1JQ3A 3B5EA 3M6WA 3UJPA 5KTRA 2O54A 1QHYA 3TZBA 2B3TA 4WY2A 1SCNE 2PLWA 2QM8A 2RK6A 3NEPX 1QYCA 4G24A 4WINA 1ZOIA 4MITA 3PGVA 1FW8A 1T0IA 2TMDA 1GAWA 4MUAA 1SOUA 2BMDA 2PBZA 2QTZA 5J23A 5GJBA 1NXOA 1V6CA 1BROA 3ANXA 2L82A 2O0HA 3MBOA 2EWMA 1CNFA 4AJLA 3GP5A 4MICA 2RGAA 4KLNA 4PN7A 3R0JA 2P8JA 4AWAA 1PGNA 4BGDA 3E18A 2VP4A 3RIXA 3JRNA 4HJXA 3MM4A 3PICA 2A86A 1NQWA 2P75A 1JALA 3L8HA 1AN0A 3B9RA 1UQRA 2AC7A 2Y3IA 2DCMA 3V46A 4UBNA 3MWLA 1X7ZA 1PJ2A 3HG7A 3M89A 2PMDA 4OUDA 4R2IA 4E5PA 2QY9A 1PS9A 4AI6A 1C14A 4KXFB 1Q20A 3PHCA 4FDMA 4PW0A 2YWXA 4F3RA 1PL7A 4J7XA 3MGKA 5EQDA 4JSYA 1JQEA 1RXWA 3LLSA 4CI9A 4C7VA 1YWGO 2IA5A 1LCIA 1J21A 2FRXA 4F4JA 1YKGA 5A3RA 2RHBA 3TN7A 1Y8RB 3CUWA 3JAWB 2A59A 1HE2A 2HWWA 1JR3D 5IJXA 4FZJA 1WQ1R 2HSZA 3THRA 3GI1A 1EUDB 3VR5D 2GN4A 3W6ZA 2TYSB 1TFRA 4MV1A 3OCXA 5K0TA 2FUKA 1KDRA 4II7A 3ZLBA 2IYVA 3G2LA 4XGIA 5ECYA 1EDOA 2DY0A 4ALIA 4E30A 1W5FA 1Y8CA 1TW3A 2ABWA 3IUYA 3QHAA 4GBJA 5F1YA 5FCDA 3QQ5A 1GZVA 1QE3A 3AFGA 5IJ9A 1BMFA 1QGUB 3RS3A 4D81A 2X23A 1UZLA 3PHHA 3ZGYA 1VJTA 1PNTA 3FMVA 5KC8A 1M2WA 2HXYA 4XD2A 4CTNA 1E1RA 2P6OA 2AX3A 2G3YA 3BB4A 3K8YA 3OCYA 4RJIA 3MSXA 1GSAA 5M34A 1KYTA 3ANNA 3Q7IA 3R3UA 3F8TA 5IT4A 5A3QA 2JGDB 3OO0A 3QVKA 1Y6QA 1Y1TA 3AJ8A 4RMHA 2PH1A 2FEOA 2NV2B 3KD3A 1SJ9A 2ZIVB 3TDKA 2R68A 3ZY2A 3HN7A 1JRLA 4PINA 3LF2A 1MPXA 2ECQA 1JYFA 1MX5A 1U3UA 2EVWX 2WKWA 5DASA 2DBZA 4YMSA 3A2MA 2Q6OA 5BNTA 1R0KA 3V4LA 3AJDA 4DV3B 2PLRA 3EDRA 4GX2A 1C29B 2O0LA 1MU0A 3WADA 2WU3A 1KO8A 2XNSA 1JN0A 4ES6A 1N75A 2B8EA 3HE3A 5IWAB 2D5CA 3O4FA 3ZV7A 1O94D 1CDDA 3IAAA 4CM4A 1FNMA 2NYRA 3OETA 3TM5A 3U4HA 3CUTA 5TX7A 2YDYA 2X9GA 1Z4IA 3KPUA 2HLNA 2EKZA 1PYOA 3BMQB 2I6XA 5FTLA 3ADBA 3UGKA 3OPMA 3WA7A 4FC7A 2QRUA 4NAHA 3T99A 1ZA2A 2XDYA 3I0MA 3OE5A 2PKQP 2YOGA 1LJLA 3WB2A 4CUKA 2B2NA 1YGYA 1BDJA 5LDHA 3EMVA 4XWYA 1B1AA 1T4CB 3F8SA 1XKXA 3D4LA 4OPMA 4JVSB 4ZI5A 4BWGA 2I3GA 4PVCA 2G6BA 5J4LA 5LU9A 4B6JA 1CULC 3NHJA 4YJ3A 5IX8A 4ZHQF 3S3TA 4BRUA 4I4TA 1JKMA 4UZEA 4DLXA 1JFVA 3KZNA 3ZNPA 5JJCA 4XGNA 4JB2A 4KACA 1NRWA 3HDVA 2AOWA 4L4RA 3BB3A 2P35A 3VYUB 1WXIA 3MMNA 4MV8A 4FR5A 3FIUA 4OHYA 3S1AB 3IEPA 3L5OA 4RUKA 4GKJB 3BXGA 4DA9A 2Q1WA 1W96A 3CH6A 3PNPA 1TQ8A 5FBVB 4Q3DA 5DHAA 9ABPA 4V0SA 3KB2A 1WSDA 4M0MA 4P5DA 1W46A 2GUWA 2RHWA 2B2XA 2BJHA 3DXYA 2R7LA 5I5GA 1V1MA 2P3LA 2X2EA 4OKSA 1W25A 3IB3A 2OKGA 3EVBA 3HMKA 4QJ4A 4WK2B 3HKDB 4LJRA 3CZPA 4DIMA 1AH2A 1KMHA 2PV7A 1ILEA 1NR5A 2I7XA 4AMGA 2Y1GA 4X61A 5IJ9B 3F6YA 2C84A 3P0JA 4OQMA 2P5UA 3CUVA 4BU0A 3GLKA 1JIIA 3HC7A 2IWRA 1FRVA 5AK5A 5ALYA 4PX2A 3ETDA 2ZYHA 2G04A 3KUDA 3QWAA 1N7HA 4IVNA 4BZZA 4B9EA 1LVHA 3OESA 2F43B 3R20A 1WZNA 3ZWQA 1US8A 2YNMD 3FSGD 1TU3A 1Y1RA 1C41A 2MYPA 2GD6A 4PG6A 1ZFNA 2H2HA 3MD0A 3T4UA 2H1FA 1GAJA 3AGQA 3P32A 3IR6A 2C83A 4IYRA 1PZGA 3FMFA 4LTDA 4ZICA 4FFBA 3RSLA 1ZU4A 4KHPB 1NQXA 3BXEA 2H85A 3H4IA 3ISJA 3LC7O 3HPQA 5ICEA 2BHNA 3FCCA 4KR2A 3NLLA 4QJBA 4CV3A 1IBRA 2HMAA 2X2FA 3PFGA 3VYSB 5K4HA 1R4MA 4EQ6B 1PGOA 1O94A 1S6YA 3FNEA 2JFUA 3ZJTA 5EZYF 2RI0A 3TI9A 2FJPA 1I51A 1A2KC 1UQTA 4HB4A 3B70A 1L8AA 6ADHA 1DBVO 4EGCB 3QE3A 3T5DA 2E18A 3CLTD 3DMHA 2RGNA 3E58A 5ENDA 4A0SA 1X1BA 3GXOA 4MV4A 1U8AA 2IODA 2Z0MA 1R18A 3BH6A 5DWVA 1VJ5A 3AM1A 2W8ZA 2ARKA 2YN2A 1NJ2A 2A5LA 3AR9A 3DP7A 4AG3A 1GUAA 3U5TA 4DCJA 3VRHA 1T9BA 4LXIA 1SUWA 2G1PA 3S2FA 2P6PA 3AO0B 3E9RA 1L3BA 4E5KA 1ISHA 5BR1A 1XHLA 2BGUA 2QUBA 3CEJA 1E32A 2ZTLA 1XVUA 1F8GA 1F8FA 1M0TA 3MJSA 1H69A 4JLBA 4TZ0A 2XYHA 2UZ0A 4P33A 4RHCA 1UEXC 3KEOA 5I51A 3BMNA 1I7SB 5K3CA 4ESEA 1K7SN 4HADA 2G88A 1CY7A 5JAMA 3KZXA 1B76A 1HKUA 2PZGA 1OYOA 3MBKA 4O2RA 3VOAA 5BW5A 2DUJA 3LHSA 5EJ8A 2C5FA 2D59A 2P2ZA 3GWGA 4JL6A 3GPLA 1AKQA 2FSSA 4ZAYA 3M7IA 4ZO8A 3WGTA 3H42B 1PZXA 3GPIA 1RBQA 3C97A 2M98A 3GJ5A 4G01B 3OZAA 4OHBA 4YRNA 3AHEA 3BK7A 2OP1A 3FF4A 2BW0A 5JVDB 2JCXA 5JCXA 2CLKB 2R00A 2ZCJA 3TTVA 4KTVE 1XG5A 4X3OA 1U1CA 3AX6A 1JQLB 1TQHA 3K05A 4BFTA 1J49A 2O3QA 4HGQA 3U6KA 1F4LA 1Y48E 3LUGA 3RWOA 2NO0A 1KEPA 4ACAA 3QVGA 1JMKC 3GXBA 3ROPA 1LPPA 1T0BA 2G71A 3JVUA 2NU9B 2ID9A 1PFGA 4MQ4A 1NPYA 3F74A 3OLQA 5E2IA 3IDFA 3M1YA 2C5SA 3C87A 1QH8A 1YO6A 1DCTA 4M9UA 2II6A 3N0VA 3NP7A 3LP5A 3DZBA 3IQHX 3QW4B 4DSUA 4EFKA 2E1RA 3CPEA 3WLHA 4XJVA 1WSAA 1FTWA 1Y0BA 2FUEA 2X4GA 3COSA 3B36A 3PB3A 4QDTA 4PX9A 4W8GA 4ZCRA 4WNAA 1FRNA 1N6HA 1UF9A 1BOFA 3MGGA 1C3JA 3Q40A 3R0ZA 5G40A 4CM7A 2WJ4A 1WMAA 1CVLA 4RIFA 3W6OA 3RPEA 1S1CA 2HJ9A 3P9ZA 1EP9A 1JPVA 4FFBB 1QZUA 4K03A 3SK0A 3OFSA 1CY2A 4N5DA 2JJ2A 2R8RA 2JGAA 3ROQA 5B7PA 1LVGA 5IFKA 1YIDA 5HUQA 1EB8A 4R98A 3O73A 3IPAA 5EQFA 3JALA 5BN5B 3EXHA 5DNWA 5HR5A 1FZQA 3NANA 3D7RA 5FUBA 2XCRB 3CRW1 3I1FA 1PI3A 1PJCA 4IH4A 3QUTA 4OHPA 2YFHA 4PTYA 5CH8A 4DBVO 4F3CA 1ZR2A 4FXPA 4B35A 2A0WA 3ZCVA 3C3XA 5EUCA 4MB0A 2RHJA 3OQOA 1O2DA 3AY0A 5C1PA 3UZUA 5CDGA 3L8CA 1XXHE 4LCBA 5B1SA 3JR7A 1W1IA 3IQDB 3T7KA 1RYDA 3TLXA 2ZIAA 2PWZA 3GBVA 2ENUA 3MS4A 4MO9A 4OCZA 1LV7A 4QSMA 4YBRA 5EFOA 5TS2A 3VPFA 3HJGA 1U0FA 3C3BA 1UK9A 5F2EA 1QVRA 2CFCA 1P0PA 3IKVA 3L4SO 4G1FA 3OQIA 1MP0A 1T8WA 3AXSA 5JASA 1TA0A 3UV7A 1F7UA 3NGLA 1ZWLA 2PZKA 2D5IA 1FUIA 2WUGA 5BW6B 5C3UA 5JADA 1ISMA 3KU1A 3KOYA 4JBWA 2HPVA 2BKXA 2CJWB 2QRGA 4EO9A 1G16A 5CAEB 2CXTA 2D2IA 3UT5A 4KFRA 1R15A 4MUFA 4DFDA 2QS9A 1BU5A 1K5HA 5C51B 4DXAA 4HVAA 3JPWA 3SQLA 2D5AA 4GIBA 2OORC 3CF6R 3MT8A 2QRJA 5ENZA 2IBSA 2OV6A 4HAYA 3WIOA 4DJDC 3VJMA 3R41A 4KR0A 4WKOA 1KMNA 2PUTA 2BFPA 2PH5A 4ZZ3A 2OR3A 3BFPA 3VTKA 3K0CC 2H52A 2ZJAA 2JVJA 1P73A 1BJTA 5AM0A 3MA0A 5DF1A 4GPZA 1ZA1A 2VDLB 3KUUA 1TT5B 4BHTA 2GHIA 5A6SA 3G88A 4M6WA 3X1ZA 1N5JA 3OX3A 4ZYWA 1NLMA 3BXZA 1JDSA 2IQIA 1KH1A 4WKBA 1X39A 1MAVA 5JO9A 4YAEA 3OPNA 1EX9A 1P91A 1NIPA 3OEHA 4Y67A 4OAQA 4YS6A 4UUNA 3ZW9A 1UP7A 1FJGB 2AOUB 3BVPA 2P5TB 4AY3A 5DN6D 3D6JA 4IS2A 2F3QA 2GF0A 3TD6A 3MWDA 2I3AA 4EVRA 2PUCA 3NWBA 4AC9A 2NYVA 3UQYS 3VZPA 1KQOA 3OD5A 1JLLA 4JUBA 1UP4A 1T36A 3D1VA 4BQIA 2ZRJA 3R40A 2YMPA 2WVHA 4MGYR 1BE1A 1X7GA 5B3KA 4MVXA 4ZT5A 2IGBA 5BSEA 4CF3A 4GU5A 1OFHA 3ZX4A 3B78A 1GAQA 1CR1A 3AT1A 3CPHA 4F4UA 1FYEA 1S8OA 1KI6B 4RETA 1ZI8A 5CVCA 1N4AA 2FTKE 1NMSA 5YASA 3U3MA 4BZWA 3IDQA 2J3QA 1SCBA 3DOIA 4W6ZA 4EX6A 2VJLA 3G5LA 4OKIA 3WWDA 3DE6X 2C88A 3AILA 1A97A 1SBIA 2WHRA 4KREA 1SELA 1N2EA 1WVGA 4EG7A 1JSLA 3GN1A 1H2FA 1TZBA 2C2OA 3LQFA 2UZ1A 2IHNA 1X7DA 3AFHA 4O4HF 5CYPA 3WJ1A 3QKSB 1N2XA 1ZJJA 2GHQA 3FUUA 1X13A 3WDKA 5K0GA 4FFLA 3ICEA 4YCJA 4DWOA 3D8NA 4EI8A 5DO9A 1JDBB 2PZJA 1J06A 1XRPA 2IYWA 2P4HX 2QD2A 3O2SB 3ZEAA 3TKLA 2CW5A 4DCTA 4OUKX 2PKQO 2YCBA 1W5AA 2WVJA 1UEIA 4H16A 4MV0A 1QFSA 1GA6A 3UW1A 4K9NA 3UWKA 1IWOA 1Q7BA 1J2TA 1FCJA 3C3CA 3H3FA 3I9OA 4G86A 3K96A 5G2OA 1WMFA 2CL0X 3IXQA 3CU5A 3FYDA 4REQA 1MDBA 4OLHA 1YQTA 1OUMA 2XCSB 3RC8A 3EGDA 4R2JA 4MGHA 1JQAA 3VO1A 1QZXA 1N5DA 2C4WA 2B2CA 6REQB 4CNBA 4FILA 1Q7CA 5E9AA 1XMVA 4ZODA 4RTQA 3WRXC 3ZNOA 3LUKA 5T67A 5F9MA 5GONB 1V4NA 3U81A 3GDOA 1XFDA 2DT5A 4QXMA 2OAGA 4X8HA 2F8LA 1CLEA 1D1PA 2GRAA 4HY3A 3HBNA 1DMSA 1MPTA 1BX0A 4B85A 4QAQA 2ZFUA 3IA2A 5EMHA 1JPJA 3WTBA 1H4QA 3AG6A 3HTXA 3AFOA 3MELA 4FEYA 4JEHA 5HK8A 3U3KA 2IU4A 1HX7A 2ZIUB 1B6SA 1O7JA 2JD2A 1XZGA 2XD9A 3MRXA 4U6NA 1VCOA 2Q3FA 4BKQA 4GBMA 1IU9A 1R9MA 4OGKA 4XYGA 4A5OA 1N8KA 1RYNA 2NM0A 4OQ4A 1NW3A 3S8MA 4YRJA 5A3JA 2VTKA 1C8VB 2TRSB 2WI8A 3JATB 2VHQA 1V7ZA 3AZQA 3LX6A 1QYRA 4ZN6A 4IOKA 4WK0B 4B2IA 5K3OA 2OAQ1 3ER6A 1UXHA 3OO1A 2J07A 4GOMD 3TBKA 3CNEA 4TKVA 2G70A 2GYWA 3PKIA 3GO4A 4RCYA 3VYWA 3A6HA 3WG9A 2FN3A 1PYGA 1N0WA 1RXIA 3O3OB 3L6DA 3CNLA 3QF7A 1JG6A 1VL2A 3TK1A 2RG7A 3WY9A 4GD3Q 4WK6A 5JFTA 3C1TA 2HRQA 4UDNA 2AN1A 2WJJA 2V9ZA 4XPIA 3JQ7B 1VL5A 2HF9A 3JQFC 5FPKA 3TRDA 1E3JA 2PBRA 3KCNA 1WUJS 3DC7A 2I76A 4Y6SA 1VRVA 5D1HA 1P19A 4DQDA 4LG1A 2BCJQ 2W4QA 3OJEA 1FYVA 3T7TA 4G1EB 4AD8A 5BMOA 1MKYA 4DSTA 3VBCA 4MR8B 4UOEA 4F85A 1AHHA 3LX8A 1T1JA 4JH0A 4O5OA 1GPBA 2E3JA 1ID1A 1PT9A 3TFWA 3A3KA 3NHFA 1T1EA 4QTXA 4TWIA 4DMKA 4DJFC 2BFAA 3PJDA 2IUTA 3DTVD 1O96B 5DX1A 3C5VA 1DJOA 4OHKA 1V47A 2HWUA 2I4MA 1KI8A 4TV9B 2XXAA 5E3IA 1NVUQ 2ZT8A 3KETA 1J1IA 4IX1A 3KOOA 4M9CA 4RD4A 2Z2XA 1LBQA 1FFXA 3U4IA 4OX9Y 5I7RA 5HF6A 2HEIA 4C76A 3LO8A 4MW6A 5IEBA 3W3ZB 1ST2A 2A5DA 4LE0A 4ZAGA 3ER8A 3WGLA 4Z1MA 3H8VA 4EQZA 4PG4A 2UDPA 1OZGA 3ESQA 5D3ZA 1QX3A 4B5LA 2Q2QA 1F38A 4QLOA 1MAAA 5B6IA 1F3OA 2W2LA 3OIWA 3SBXA 1MOSA 3FI9A 1TZCA 2P5YA 4OHMA 1Z15A 1W88B 3REFA 3AOEA 3K71B 1TM3E 3V55A 2H2WA 3GLFE 4XWKA 1DZIA 2RKWA 1XQ6A 4H77A 3WFJA 1OXVA 5ICFA 1ZC4A 3LAWA 5BSRA 4EUHA 4W99A 2ZSAA 5JFOA 1Z83A 1ZGCA 3HXMA 4XRRA 4YRZA 4ZCPA 2ORWA 3ZX5A 4Q4AA 4BNVA 4GKVA 4WBNF 1VPWA 3D2BA 3N59A 4LDPA 1FU4A 5AVJA 4YRCA 3IAXA 1KK3A 2YWFA 3I9V6 3O1HB 4IICA 3KP1A 1FOEB 4Q19A 2WJAA 3OZRA 4JUDX 1P29A 3IJEB 3K94A 1SA0B 5EWJA 1TE2A 1RIFA 1XZQA 3NPMA 4HDKA 2R2GA 2WILA 2XYQA 1AUQA 5G3YA 3ZBUA 1QGED 2PEYA 3KT3A 4AW9A 2UVPB 2X7HA 3CW9A 3N2EA 4EW3A 2FZLA 2NO4A 3M6VA 1NU6A 4CT0A 5D7NA 5BW8A 2XOKA 1JKFA 5LP6A 4Q3NA 1FNDA 3VR2A 3HXOA 5DWDA 2B83A 4LC9A 2JARA 2WMYA 4II2A 1NLFA 5EHQA 1QIHA 3WK7A 8GPBA 4RULA 3L7OA 3PJEA 4GZ5A 2Y1FA 4Q3LA 5GM2A 4IIYA 1HE5A 3Q12A 4NHEA 5BR7A 3CLUD 4P0TA 2XTJA 2EV9A 2YZKA 1EDDA 2Z5GA 4XIFA 4RGYA 1KTVA 4EVIA 2V65A 3O38A 4PO9A 1J99A 5A4JA 5L3QB 3L8MA 1UFVA 1U9ZA 5IW8A 1OT3A 1OVMA 2D2VA 1KMMA 3DD1A 4HX2A 3ZIAD 1N2ZA 1QF9A 4CLRB 2F7SA 4CKXA 1B93A 5I9IA 3UFBA 3TW8B 1HH4A 2WMOB 4AWBA 1GUFA 3G0DA 3HWX1 3C98A 2AD5A 3BJZA 3NKVA 3D4PA 2CEKA 5BSKA 2JLWA 3IAFA 3LA6A 3QIVA 3W9YA 3G1TA 2WK1A 1VB5A 3B6EA 1V11A 5AVKA 1DARA 1CFJA 3B9BA 5TJ9A 5EI5A 2QOEA 2XXAB 4AO6A 3VH2A 1XL1A 3P0EA 3AV0B 3ZJVA 4QM6A 3TGWA 4AMVA 2KWIA 3HY6A 3NCHA 4K0RA 5A9SA 4R31A 3UK2A 5FIUA 4BFVA 4MVJP 4UVGA 4KXNA 3M6XA 1C1XA 3Q0IA 3DUFB 2QAIA 1E79A 1A9ZA 1IJEA 2ZSEA 3LBHA 1HV8A 3KDPA 4MR7A 2AI3A 3NATA 4QJIA 3TOSA 1XCPA 1LQ2A 2ORED 3WB9A 3A6JA 1Q7EA 2VP2A 5B3JA 1NQ5A 2JI4A 4GRDA 3B8HA 1UFRA 4R8RA 5EJIA 3KJFA 1G8SA 2E82A 2VSXA 3N2ZB 3Q7QA 2H29A 5AK4A 1GZ5A 4CQMA 3LT5A 3GEBA 1XNQB 1SXGA 5DEOA 4CIBA 1QG2A 2CBZA 2QMQA 3EQ9A 3I2KA 4EB0A 1VRCA 1YIOA 2H16A 2QVCA 3HXKA 2HIGA 4QOEA 4YRKA 3FNRA 2G1JA 3D81A 3FDZB 5BP7A 1S0UA 4XVHA 4CV2A 2VZEA 2JFOA 1DEHA 3F3SA 2PS0A 1KEEB 4EAAA 1VM6A 2A94A 4WW0A 1T4MA 3L7JA 4IV8A 4W1RA 3ND9A 2P0AA 3WIVA 1V3VA 1DTWA 4DCSA 2B1IA 3LPLA 1R0LA 2H06A 4P5EA 3PWKA 2WT9A 5DI3A 4BB5A 5CFOA 1EDEA 2B9EA 4L74A 4F5WA 3SG0A 2Y1LA 1BOOA 1UT6A 3FCSB 4UPDA 3RC1A 5F33A 4RZ2A 1QWOA 3KKLA 4UBIA 4BNXA 5KWIA 4U5XA 4GR4A 1C3LA 1Z2AA 2EFDB 2HSGA 2I2BA 3A10A 2LUOA 2WU4A 1I4EB 3ITDA 4LDNA 2QG4A 4PZCA 3CURA 4R8KA 1N6RA 1PR3A 4C6RA 4D4IA 4ENPA 4Q48A 5G1NA 4N9WA 4JKYA 2H4ZA 2PKWA 4ED9A 1NKVA 2MT9A 4KQEA 4PZ9A 3SM9A 1A8UA 1TTQB 1UC5B 2LE0A 3QPCA 2PUDA 3AKCA 2JI9A 2M1ZA 2FQ1A 4E2FA 2E21A 4HWTA 1L6RA 4WCFA 2AOTB 2O8DB 3THXB 5FPTA 4YCDA 3CTPA 1GL6A 5FBHA 1NX6A 1YQXA 3M6LA 5AVYA 1K7CA 2GYVA 3LXRA 5E8JA 2Q7XA 3C4VA 3CF4G 4ND6A 5DSXA 3FCYA 4DIEA 2XY4A 5BSUA 2CXRA 2G1UA 3ENKA 5KJFA 3DMFA 4PLVA 1R00A 4ESOA 2W70A 1XF9A 2XIJA 2AJTA 3BXFA 4Y2TA 1M34E 3QX9A 2DR2A 4OFXA 4F4HA 4JR1A 4PONA 5K3FA 2PZLA 1C1HA 1P18A 3AW8A 3K6SA 1FS4A 2BZSA 1IPHA 3DZHA 3PDCA 1KJ8A 1ISFA 2B69A 2O8VA 4X95A 3H3XA 1TVEA 1ZVMA 3KZOA 5DSZA 5F21A 3TTSA 4IDOA 3ILSA 4I1SA 4IZIA 4ND3A 4OYYA 4L7VA 4UXIA 4RNDB 4RV9A 5A0FA 3RAPR 5KJ1A 2J3JA 4K6HA 3MXTA 2IDKA 2Q4RA 5A9SB 3K0EA 1H8EA 4E5UA 3TXYA 3DZKA 1NC1A 3LQ4A 4J0EA 1WW3A 2X9NA 3K2BA 1TUBA 2BEUA 3NIFB 3OLWA 1GNPA 3EVEA 2C5BA 4HXGA 4V0OA 1P0MA 3CWCA 5EZYB 1AZWA 1IY1A 1ML4A 4C89A 2XZDA 2FETA 1AKEA 2RARA 4BX0A 3Q3EA 1JEAA 1X38A 1JHQA 4G07A 2KE5A 4NV3A 4KI7A 3TMAA 1PV1A 3M4NA 2G1AA 2FZCA 1W5TA 1VKRA 4TTPA 3V9PA 1XRJA 3CRQA 3LV8A 3N7UA 1JLKA 2CK3A 1U1DA 1WABA 2A9OA 3K73O 3R9WA 1S2MA 5AKYA 4C0XA 3KT8A 1USVA 4XFJA 4BL5A 1I7LA 3VKWA 1W76A 2NUBA 4KQFA 2IP4A 3G89A 4M38A 3MCVA 3KQUA 1DAHA 3U7QA 3EVGA 5A4MS 1R2QA 5LD2B 2OZVA 2G77B 1DINA 3RUCA 1P7PA 2H4FA 2CFTA 5FYQA 1CUEA 1G63A 1L6IA 2BZ0A 4AWXA 1PK8A 2FRDC 4UMDA 4C0WA 3H9BA 5K03A 4R1UA 2D1YA 2BGLA 5E7IA 5T4EA 4OQLA 3BIFA 4G97A 4ZGGA 1JSCA 2R6CA 1MB3A 4O02B 5J58A 2DPLA 3MEQA 3GVHA 1JJBA 3KL4A 3T3EA 4G4SO 3V2UA 1VP3A 2M6LA 1I32A 5DLEA 5B2ZA 1Y6RA 3E7PA 3NGXA 5CXSA 5DIZA 3VZQA 4Z7QB 3V4PB 5BYKA 3MFQA 4FI3C 5G41A 3EEOA 4A15A 3ZQ6A 2R6R1 2BIFA 5LB4A 3TKAA 3C7KA 4NBWA 2W6OA 4MI9A 1USIA 3TF5A 2W2MA 4ND5A 2O8FB 3UMVA 1PWZA 2ODQA 5JTUA 1KYQA 1YAJA 6GPBA 1XCGB 3JD2A 3KZ1E 1UL1X 1PQUA 4ISCA 3KK0A 2XTNA 4TROA 2DPMA 4DBLE 3KR2A 4CMCA 3SSAA 1IY2A 2NVUA 4BJHB 3QLJA 1W34A 4KXMA 4ZMRA 2KSQA 4QT0A 5M29A 4ITRC 4YRPA 4BO6A 4MPPA 4CMEA 3A9TA 2MSEB 1ST3A 3KHTA 1J0XO 4U7GA 2A1IA 2ZSIA 2UZIR 5REQB 1WBDA 3I39X 4R1NA 1SVWA 4GDFA 4N76A 1UMDB 1N0IA 4L0CA 1DCFA 4OQZA 2RHGB 1Z4LA 4IO1A 5B4UA 2M6SA 1VE5A 1VB3A 5K3FB 4U3JA 3MWJA 3BC1A 5K99A 3H0KA 2G5TA 4NQRA 1ODSA 3E0QA 3WICA 1M6NA 4TL6A 2OHXA 5EIOA 5GM1A 2XCQA 3HV2A 4OREX 4PCLA 4RM2A 3GHYA 3C6KA 1YFLA 1WZ2A 4XQ0A 2OB2A 2WP8J 2J0SA 1M1YB 1XTQA 2VXYA 3N0TA 3STHA 3B12A 5FL7D 1ISGA 1YVRA 4IEEA 1FSZA 4BQSA 1Y9EA 2BEUB 1ZUIA 4GR5A 1TI7A 2AFVA 2WF5A 3L82B 1IMJA 3ADOA 3ZHYA 1DOZA 2PQ6A 3D7KA 4PFQA 5D5HA 5KPJA 2O06A 1OIWA 1BA3A 2QG6A 3IIJA 1ZONA 3CC8A 2QU7A 3CMMA 1OREA 1TTTA 2JIQA 1NXTA 1QC5A 1EWKA 1DTEA 1MABB 4FDUA 1EEHA 2FR1A 5G4KA 5HCUA 5LQKA 2ZRKA 1ZM2A 4BP8A 3G8DA 1RYYA 4ZVSA 3OOWA 2OT3B 2XWBF 1SXJB 4TMFA 4W9NA 4EZEA 1ZD8A 3WNBA 4A23A 5KJ6A 1FU8A 3UJ9A 1L4UA 3G17A 1EHIA 4MYUA 4PYQA 1UIMA 4XFKA 1DO0A 1I80A 2W2QA 3G0IA 3PPIA 1XP5A 1VP9A 1XD9A 1NBMA 3BCSA 4Q6WA 4RZHA 5ALLA 3W8RA 5IVHA 5J1TB 1JG4A 1UWLA 1GTJ1 1TMGE 1T5SA 2Z4TA 1MHPA 1ZJ5A 3B52X 1YJQA 2ZRIA 2Z8YM 4P7KA 1GTG1 1TU4A 1WG8A 1R5NA 2C04A 1L4FA 3PD7A 4Z8XA 4CLHA 4G5YA 2VF7A 2WFMA 4PLHA 3DWIA 1H3EA 3C7TA 5JSZA 1PJRA 1IY9A 2NAFA 4C7MA 1KJWA 5H3HA 2R85A 5AW7A 1RI2A 2X40A 2UXDB 5K3DA 3ITNA 4JLSA 1C9EA 2F6RA 1FVFA 2HNKA 4L57A 1OAOC 4LDQA 4U63A 4R5HA 4XWGA 5ALSA 3QQPA 1L5WA 4HMQA 5F5NA 4DA8A 1QRUA 2O2SA 3TRFA 4R1PA 2ZJ7A 4OXRA 2SKDA 4R83A 5PGMA 1HORA 1WHTA 1PL8A 1TYDE 5KJCA 2C5AA 3OT1A 5B5SA 2PUGA 3EEFA 1RRKA 3I6ZA 3QPWA 1CF4A 4YJGA 2NQ2C 4E08A 3P19A 5GOZA 1RQGA 2VT7A 1WIWA 1UBOS 2XDQB 5ILOA 1C2TA 4O3FA 4MJLA 1P2SA 3PHIA 1T1RA 4N18A 4YJFA 3DSRA 2XMZA 3IKLA 1YE5A 2JL1A 2ZETA 3RK1A 3RIYA 1XKTA 2W6NA 2OCBA 3BAFA 4JJ6A 2C2KA 2XEXA 4YRQA 4QRIA 5G0TA 1OB5A 3HBJA 4C4SA 2BGGA 3A6FA 3H0EA 2OGTA 4G9EA 2NZ2A 2PR2A 2YJ6A 3G5MA 4YQEA 2QHXA 1WUIS 2CD9A 5FEMA 2QORA 5TLSA 2AS0A 4LQ4A 2COUA 1XNJA 3GQBB 4HZUB 3BG5A 1PR9A 3JQ6A 4S12A 2AFRA 4NENB 1RKUA 3MMXA 4KLAA 4IFEA 4F2HA 4P4NA 3GLIA 4KRFA 1VDMA 1QG0A 1JDJA 3FVWA 1VGRA 2DQZA 4XFDA 1O54A 3DOUA 1S8AA 2HK7A 3HZZA 3I2IA 1HDOA 1KBQA 3GVXA 3KHSA 3DXXA 1JJVA 4MIOA 5ALXA 4ZI3A 4PTZA 3KC2A 2H07A 3H8JA 1TAQA 4JUAA 5SZKB 3WIBA 3L0OA 1YZNA 3MAGA 4ZJUA 1AU9A 3G7NA 4B09A 3L6EA 2O5CA 1XCLA 1PEDA 2IFTA 4K87A 4XSGA 4O4HB 1Q17A 4A73A 3ACBA 2AQIA 1OX4B 3DE2X 3AIMA 2JIRA 2BM9A 3DBLB 3N86A 4JVLA 4RAOA 4XIGS 4F45A 1E1MA 4F5DA 5K6AA 3KE8A 4UM9B 3S7TA 3D7SA 2Q0HA 1QDEA 1ORRA 4KWHA 2NZYA 2C7OA 4I4IA 2HN9A 2OMKA 3AUFA 4BVKA 3WL8A 4V3BA 4WZAB 1TQ6A 2CYAA 4XD7D 3VM6A 1ZXLA 2WIBA 4X64B 2Y76A 4CDNA 3P4YA 1PG0A 4QU8A 5I7UA 5KO2A 4K8OA 4P80A 1CRZA 2J4DA 1Z16A 1RAGA 2GNPA 2QSYA 3KV1A 1J2UA 4CR8A 3PGMA 1QRRA 2A58A 3R9XA 5K1ZA 3BWCA 2GEVA 2JEYA 4TN5A 3U3XA 4ISBA 2VKTA 4YAUA 5C53B 4OBEA 2BPOA 1R3UA 4EAQA 4ER3A 1FUYB 1ZH4A 1K98A 3GFGA 2X14A 3BB1A 1D9ZA 4K9OA 2QUZA 1REQB 4PS0A 4BX9A 3ROZA 1F12A 2WWIA 3BRWA 4D6PA 3UA4A 2AZXA 5FTJA 2EQAA 4PAOA 4BOYA 1HEYA 2ZE8A 1OAKA 3EQ2A 4HWRA 5AT1A 3WLFA 4RTOA 1GTSA 1BC5A 4MV6A 2NSLA 4PNHA 1AF7A 3A6GA 3RGGA 2HT1A 1KY3A 4TTSA 1O94C 1P2DA 2RMKA 3MGBA 2VF4X 2A7QA 2RH4A 1FTQA 2PWAA 2QV0A 4IYJA 3E9MA 4OGLA 3ZDRA 2UUCB 1PJZA 2CVOA 2DH6A 3GMTA 4MV9A 3NC1C 1VDZA 4I5GA 3F3YA 2FWAA 5AUPB 2QT0A 3AHHA 3T1QA 2RGNC 1BH6A 1T9GR 2CMDA 5K8CA 3RVKA 1NSYA 3BMCA 4RH0A 1UK6A 3PCRB 5K6TA 2VDUE 2PD4A 2Q4OA 4DQUA 1YB2A 3GW8A 3H75A 3STWA 4NYIQ 4WZBE 2O4CA 4O4JA 1ORHA 3RBXA 2ZITA 3RYHA 3M4ZA 4D8VA 3FUTA 1CJCA 4QGAA 4F92B 3ZHCA 5KOIA 2C4TA 4F2DA 3T4EA 4OO3A 1KGDA 3ME5A 1LFDB 3VR4D 1QVWA 3ZGZA 4GPBA 2WM2A 3QA3E 5A04A 1PF7E 4BN4A 2BE9A 3U9LA 4RJTA 5I01A 3PQ5A 1XVVA 2H2GA 1WP9A 1G21E 4D79A 1OKKA 3OTOB 3KWFA 4RHEA 3VYTB 2XGSA 1BHO1 3MW8A 5LMZA 5IH7A 2BUCA 2CKDA 4M1SA 3CVVA 1JA9A 2R00C 3ACDA 1IHUA 1G6Q1 4LDJA 3I92A 1FNBA 2L2QA 3NAGA 3WRWA 3H1TA 1UP6A 3QWFA 1BVHA 3QBVA 5AR1A 3PVZA 5DBEX 1J2EA 1QOZA 3GLGE 3VR1A 1Q0QA 4E5NA 1KIFA 4WJKB 5JEDA 1Z12A 1WV1A 1JQ5A 3D6TB 1KZYC 3MB8A 3CE6A 2FPUA 2Q9CA 5A9TA 1E3QA 3ESZA 2XGJA 1IN6A 2HOQA 3VA7A 2ZM5A 5AVSA 2XUPA 3HKBA 3P97A 4IGEA 2YHBA 4AKEA 3G2PA 3VSBA 3HXPA 1YNOA 3EAFA 4TKUA 1YZYA 1VG0B 4MLPA 1N57A 3SKYA 1P4AA 1D2NA 3C6MA 1HE4A 1Y1KE 4XXHA 3X1JA 4CUZA 3M0EA 2IT1A 5IVPA 3HB1A 4W5WA 2YFQA 4BJ6A 1XCMA 4GMHA 4UKDA 3FKSA 4JI2B 1TEXA 4DLTA 4GOOD 1Z22A 3B5IA 1U7WA 4P31A 2HW8A 2PGLA 1A77A 1ZP6A 4MUGA 2MYTA 5THQA 3FNHA 1Z5ZA 3T3IA 2VTBA 4MVWA 1F5SA 2GM5A 3DBIA 1C9KA 1QO0A 5FUWA 4EGSA 1L4HA 2W6IA 4UCQA 4WGFA 4XLZA 4CF5A 5IJWA 1O9HA 2WSBA 3EXHC 3I9KA 3FY4A 4MVJG 1F9EA 1ZD2P 4RPJA 3T7IA 2QG9A 4CIXA 3KOWA 4DQVA 1CYEA 1P3JA 4XOUA 1O57A 2YDXA 4IQGA 4LYEA 4ESHA 2FW6A 4HQFA 4WBNB 4JX9A 3ZR4B 4EELA 4FFVA 4IILA 2OBNA 4LZNA 2NU8A 3KJHA 4AS2A 1PZFA 4DLZA 2HRDA 4L0DA 5JBNA 5JNSA 1LPAB 5CFNA 1INLA 1YVDA 4GWKA 2JI6A 5HJ2A 3VKHA 3EDOA 1KMQA 1UZUA 3Q88A 2I4TA 3U16A 4WLFA 1THGA 3M5PA 1YI1A 2VJPA 3REQA 3N7TA 4TLEA 5EERA 3RTAA 1TLTA 5IAEA 3PUYA 5EIAA 2RCNA 2OQ2A 4O4JB 3QENA 2B8NA 4QQKA 3D1JA 1ZRNA 2GNOA 3JQQA 4QU9A 3ETEA 1NU8A 2D4AA 3KJQA 3N9IA 4OYHA 3F7MA 2IYPA 5TT1A 5IDQA 2L69A 1RLTA 1JWAB 1PN3A 2FMHA 2DEUA 4TRJA 4XUGB 3QKRB 2V7VA 3LLCA 1Q0RA 2H18A 3WC4A 1SRRA 2WWHA 3FYCA 1SB8A 1V5FA 3HCAA 5HUHA 3DTTA 3V2IA 3V3TA 1VBMA 4GQIA 3COJA 1VIAA 3H2ZA 2V7XA 2IUSA 3IVAA 1DIOB 3EWNA 1JHZA 2XCUA 4IAOA 4Q1FA 1T6XA 4EATA 3HGTA 4DREA 2AXEA 3FHCB 1O6ZA 4EI9A 3L9WA 3AF6A 2H1OA 1A7JA 2C95A 2PKXA 4I8DA 5AJYA 3FSEA 2ZYAA 3ZLJA 3EW9A 1EJ2A 1E3WA 2OL4A 3TVDA 4WDQA 1T5TA 1GKYA 1DI0A 1QGDA 2BEJA 3R0QA 2J6HA 3KPJA 3KT6A 1N2CB 4RABA 5DMHA 5HFNA 2I65A 4D2IA 4JBHA 1YK0A 3E7DA 1G7SA 4XDHA 3DLTA 5HRCA 3L0SA 5AKIA 4ZZ0A 2XGGA 4PHGA 4MP3A 3C43A 3OX1A 1CQIA 4ASUD 2IF2A 1AKTA 4PVDA 2XCLA 4NEQA 3MINA 4KNYA 2BKVA 2BH9A 4FLEA 4R2MA 1QOQB 3AF3A 3NFRA 4PAQA 4BFWA 2GZ1A 3JD0A 3NEYA 2D1TA 4LZWA 4QFDA 4HNGA 5CT9A 3A6EA 2X3YA 1XA3A 3QX3A 4ZAFA 5J2UA 3DWEX 1K6EA 1O8CA 2B8WA 3OA0A 3C39A 1OD6A 2ZJ8A 1ZGBA 1JHOA 1Q1QA 4TWAA 5DGHA 2CSUA 5ED0A 4WMLA 3LHKA 4M8SA 3OM8A 1T1SA 1VRWA 2XZLA 5AXCA 1NYTA 5CVDA 3VI4B 2C82A 3L93A 3SF8A 5KYVA 1NI4B 4XSHA 2BR3A 3A25A 3DGEC 4KWTA 5KYUA 2Q2VA 1E0SA 3OICA 2VTVA 4ZAZA 4IWYA 1E4EA 4JLWA 2VTBB 2F3PA 2NPFA 2NO7A 1E4YA 3CRVA 4GMGA 2NG1A 4LXTA 2ANBA 1F2TA 2QD1A 1Z4PX 1B6GA 5KYYA 3DFZA 4NBLA 4PQGA 4RORA 4D42A 2CVQA 1MRSA 1NDHA 4EHBA 2J5KA 2NU6B 2XT9A 3AIKA 3TQIA 3ILVA 3KKPA 1JHPA 2NP6A 4Q37A 5AW5A 2B0JA 3N2GB 4FJ2A 1J90A 3V32A 2CNKA 5JS2A 4WLVA 1OBOA 2KHZA 5T3YA 1I1NA 4Z53A 2WHPB 5AI9A 3QOFA 2XQKA 4URVR 1SWVA 3KTAA 2XGMA 5CU7A 4JLDA 5CXQA 1I8TA 4PIPA 1C8LA 6YASA 1H42A 2P1ZA 2VDMB 2Q1UA 3Q9UA 2IUUA 5JD4A 1B23P 2JIMA 3OKPA 5CXUA 1VMKA 4QXQA 4ZYVA 4X3PA 3HLYA 1TO6A 3UK1A 1U90A 3TQTA 1P0FA 2XBLA 5BV0A 4JELA 4OQPA 5LLTA 4JODA 4LC0A 2W2XA 1IB0A 2WV7A 3F67A 3FPKA 5SZHB 2J6CA 1RYFA 5TQ2A 4UHEA 3WLQA 5DTMA 2PA0A 5LQUA 4NYMR 4PGFA 3K0FA 3R3HA 3SICE 2X86A 3K1AA 2ACEA 4Z2YA 2YICA 4MVJI 4FZ3A 5CT5A 4BMSA 4L8GA 1J9GA 3MGCA 3DOOA 3O3NB 5DZSA 3ZLUA 2LBPA 2R11A 4TQAA 1E2KA 1N0HA 1ZO8A 2CVPA 2NXCA 3LWNA 3G82C 4FE4A 4HWPA 2GZMA 1L5NA 1MG0A 2XCIA 4NX2A 5CNJA 3QU2A 3V4OA 5KMGA 4M9ZA 3A70A 3CB4A 3A7DA 5KNDA 4B7XA 1XGKA 1MVLA 4AJNA 3E9YA 2CFOA 4I9HA 1C3OA 4E3WA 1ES9A 4GO1A 2VKQA 4PSAA 1GN9A 1AKYA 3RSOA 1U9IA 2GR9A 3UXEA 3WGJA 3PDHA 1RYBA 3W5CA 4A10A 3P9SA 3PE3A 4FQ8A 3D3NA 1LSJA 1KOLA 1NVMB 3KSZO 3T0FA 4BNMA 4W5RA 2QTGA 3INGA 2QF7A 4PLTA 1DLJA 2V4ZA 4JOQA 4E5MA 2PUAA 1J33A 1U0OC 3U31A 1J09A 3C3PA 1XRMA 4I4CA 1FRQA 1KFEB 3IUBA 5IKEA 5JMPA 1SZDA 1IZ7A 1UOOA 3I05A 4OXXA 5JZSA 4UHHA 2PMBA 4CF4A 4C4AA 1OH5A 1GGEA 5CDSA 2WWXA 2QJRA 5BWMA 5FRDA 2JGIA 2PSHA 1L3CA 2C8KA 4JBYA 4UZSA 4CDMA 1Y1PA 3MTAA 3SJAA 4C0SA 1U4OA 1TZKA 2TSYB 5JR3A 1KVSA 4XGRA 4PSUA 1G38A 2C2XA 3RUIA 1PTKA 2OGWA 3SX4A 1WP4A 2IS2A 4LHEA 2H0QA 3DE5X 3GVPA 1DX4A 3QFHA 4CHTA 1CC1S 5D7BA 3E05A 3ORYA 4TMWA 4Q24A 1K9VF 1KQPA 2HRCA 1T9KA 5K0LA 4DA4A 1XCBA 3EUWA 2VT2A 4CKEA 4Z49A 3O4JA 1YV9A 3TMKA 1N9GB 3GP8A 5F5LA 1M2FA 1M6HA 1ENPA 1RM5A 2CMFA 1GT6A 2Y0EA 3LMKA 4IV5A 3H11B 1PJLA 1WOYA 2HPZA 4NBKA 4RK4A 3LDFA 3T9DA 3X43A 4RYLA 4DRXB 3X2EA 1FU7A 1P4RA 3F7OA 3WR5A 6NULA 3M4YA 1DKUA 3WV4A 1UJMA 3N6VA 3EBLA 2NVWA 5ITSA 1KKUA 4GVXA 2O19A 1C9YA 1V1RA 1VSVA 2FHPA 4HMPA 2EKLA 5H4HA 1BYUA 5KYGA 5KWJA 2AVNA 4YVFA 3B89A 2C9ZA 2M1XA 3C1AA 2O5RA 4DA0A 3Q6IA 1QZ3A 2DPGA 2IUYA 2QNIA 3KLOA 1CJTC 1AT1A 1W29A 3G8YA 4D5EA 1SUSA 3FYTA 2QPLA 2D5LA 2RGCA 2ZWPA 3E5HA 3F5FA 1TEVA 1AZTA 4FBLA 3A1DA 4B45A 4NNPA 4Z4IA 3G8CA 1OZFA 3PGXA 3UYLA 3TZCA 1XXHB 4E21A 2XXBA 4Y0NA 5BWBA 4X85A 2JKVA 3UJCA 4CR7A 2HR1A 4XDZA 3I76A 4EUKA 3C6BA 1S4MA 3AOEC 3Q1LA 1GSHA 1VYVA 3T0IA 9LDTA 4HD8A 1G64A 4FHEA 4JVNA 4EITA 5A3VA 3T95A 4BKUA 3GQVA 2D74A 2GEJA 2R4QA 1CS0A 1IH8A 1PQYA 2VTEA 1IAQA 5BPFA 4ZEVA 1Q22A 2P9QA 2ZRBA 1C3OB 4JGGA 1NE2A 4KXUA 4QXPA 4UCXA 3CB2A 5TPWB 4M1WA 1YL6A 1GGHA 1QPBA 3UBMA 2B21A 4ZAWA 2SBTA 3LCUA 3NTQA 4JUIA 4OD0A 4K2HA 1WW2A 5A4IS 5GGXA 4A36A 3U19A 1BO6A 1NF3A 2J9FA 3CT6A 3NIGB 2LZ0A 2YR0A 3FLBA 4I66A 4JNKA 5F9HA 4A8PA 3PA6A 2GPWA 1FP6A 5CX1A 4Q9IA 4ZT4A 4OXIA 4KXWA 1QFMA 2ZWIA 2A8YA 3WAGA 3A58B 1SOWA 4BIMA 1APBA 2YCLA 2IY7A 4RTSA 4K1XA 4X97A 4WOJA 2H63A 5GQSA 5LP6C 3P27A 1MVNA 4C2BA 2GASA 3KD2A 4EHLA 3MNFA 4CHGA 1EE1A 2VPTA 1ULSA 2RHCA 3HLTA 3CNBA 3HXLA 1EZZA 3ONDA 4ZRDA 3TSYA 1LK0A 4GBED 3ZXUB 2R1VB 2Z8XA 4QBTA 5ICMA 1D2RA 1RXYA 3HRKA 2VHWA 2PX5A 3FPEA 1X80B 3BWBA 4FE3A 3AR3A 2EP8A 2G17A 3FDFA 3SGLA 3UM9A 3PPVA 4ROTA 1YA4A 3ZW8A 4LDRA 5EYPB 2D2FA 3ZXYA 2C8LA 4GX0A 1KC1A 3HVIA 1E2GA 2P79A 3SOPA 1II8B 1PJAA 1YI0A 2GEBA 2QYHA 2RJOA 4YA6A 2GPJA 4ZAXA 4FCTA 3SLKA 4Z9FA 3UB3A 1VI6A 2CGEA 3VHXA 4GC9A 5CLJA 5JQGF 1E9FA 3MTJA 3D2LA 1Z8FA 2BFDA 3ZVLA 1LPOA 1Z18A 4BNHA 2V3CC 4A0FA 1SBCA 4PLCA 2B4YA 2RKOA 1GY8A 2PU5A 2XUQA 4QDKA 2HLDD 4QHSA 4K9DA 3AL2A 4KO4S 4TS3A 2XBMA 3ACCA 2EP5A 2A9QA 4GI5A 2P3QA 3FPHA 4Y6QA 2YWHA 5LA6A 4B47A 1SUCA 2VBIA 1W4CA 1IOWA 2P9JA 3OFVA 1JDZA 4B7ZA 1CUBA 4DAEA 1NUTA 1PV4A 2MMCA 1U0LA 2DFPA 1PHPA 5P8WA 2Q5IA 2CWWA 2QVZX 3JD3A 2CL5A 1EK0A 2WB2A 3RJ9A 5B3JC 1G6KA 1W0KA 2R6ZA 3PI6A 3L84A 2XNDA 2VSYA 5IC4A 2X22A 2ZUSA 1DKMA 3WTCA 3AINA 1PUXA 3QBTA 3ELWA 5AD1A 1AV6A 2FMXA 1MH1A 4HS4A 5SZJA 2RHDA 1QUFA 3RRBA 4ZIRA 3L92A 1EK6A 2F9MA 1ADCA 3B1ZA 2YZ2A 1K97A 2CNLA 4RD2A 3NHPA 3ASVA 1M5RA 2A5JA 2ZYUX 1PVVA 2Q9UA 4TLCA 3VKVA 4XM1A 4AF6A 4MAFA 3O03A 5DYIA 3OEEA 3BFVA 2QX4A 3QUSA 4LGVA 5KNBH 2ZQYA 1FA9A 3F6SA 2RFLA 3KWJA 3WFZA 4EG8A 4EYEA 5J9FA 7REQB 4BXOB 1UPTA 4RZSA 1MUUA 4DG8A 2DHEA 1RTTA 3AYZB 1WNFA 3DTNA 3K4PA 3LY7A 4R5MA 4FONA 3TZEA 4ETWA 2O2JA 3L7NA 4FDTA 1UJNA 1XU4A 2WWFA 3IOYA 4Q5IA 2QR3A 5GPBA 3ZZ0A 4FYJA 5AW6A 5BT8A 3DEHA 5F4BA 2ETVA 3MJHA 3NJRA 4FWBA 1IPFA 3OOYA 4X41A 2IV7A 1E0AA 3BCRA 1PEYA 1YC5A 5FWXB 1XVIA 2BEWB 3MYYA 4E88A 2PUFA 1YS2X 5CIYA 1PK7A 4RIHA 2LNDA 1N1DA 4H7IA 1H3NA 4UCWA 1U0NA 4X8LA 4QJ3A 1J6UA 1EFCA 1RAAA 1J70A 3SDBA 1NQVA 4M60A 3ISTA 3CLUC 1CP2A 3E84A 1RXEA 4XX0B 4BQRA 5IM4A 2BKLA 1IQPA 4YCCA 4YP5A 3RFFA 1CB7A 4R54A 4CU2A 4R1OA 1C3XA 5LNK6 4QDJA 1ISPA 4KAXA 2H08A 3MLAA 2PUVA 4PAGA 4BX8A 4F04A 5K8TA 3OZDA 4GP6A 4WCFC 4Q0MA 4ZOCA 3EFHA 5LYJA 2I9KA 1KZGB 3KPYA 2J0UA 3ZWNA 2JATA 4BP1A 4F8YA 3WLLA 4OHRA 4A0QA 3IIEA 1MB9A 4TUYB 3BMOA 4GDMA 1RP1A 2P65A 3N87A 1R0ZA 4OKNA 3WB1A 1FMFA 3UTDA 4JKOA 5JSQA 5U4XA 3TLGA 3C6XA 2DHCA 5JWRA 1TMOA 1IMOA 1JMVA 1BCRB 4LNUB 4P7BA 1RXSA 5CT4A 3UGTA 4TVSA 4MOWA 1K08A 4OY3A 1MXHA 4IHQA 2K5UA 2ZCVA 3N28A 5CBPB 4C7OB 2DOKA 4WLEA 3ZW7A 3H7AA 4DR1B 3IL2A 3IHTA 1Q11A 3EG9A 4TYMA 4Z2AA 2O2HA 3RBZA 5GV7A 5LA6B 1A9YA 5FOTA 5LBUA 3FNQA 2RAUA 1KP9A 1VMAA 221PA 4AN4A 4O2AF 4IOJA 4DABA 4ZC1A 4YUYA 1ZUNB 4DDHA 5KPDA 3QI7A 2X0KA 4HHEA 3VH4A 5KVQA 1RKQA 1NW5A 2XMSA 4YCSA 3R77A 3FWNA 2F9FA 3BL8A 1J8MF 3MWYW 1LF0A 4YI5A 4C0BA 4CKWA 2AGVA 2P67A 4NU5A 4DMCA 3LY9A 2ODAA 3KQWA 4HLNA 1N77A 1GZ3A 1KI4A 4I4NA 1MTZA 4I9GA 4R9NA 4X24A 4F6RB 2CF6A 3KQSA 1P44A 1NMZA 1KPIA 1Y3CE 1T1IA 1YR2A 3W7AA 3RR2A 1BWRA 1HDEA 1V9SA 3ETLA 3KQTA 5DRYA 1UPCA 3SXUB 4LECA 2ADFA 5GZ3A 4Y6LA 1NTRA 2WAOA 4QNNA 4HPWA 5AIBA 4EI7A 2WM8A 3MJVA 2CNBA 3G8BA 2CCJA 4OBBA 4RF3A 5B30A 4Z4QA 1Z68A 2FSIA 2IIVA 1UDBA 3G9XA 3MRTA 1CE8A 3GPCA 1G8GA 4PSDA 3BE6A 4I8IA 1P72A 3VPGA 2DSTA 4AKGA 2HRZA 4WUTA 5C8VA 4GW3A 1NYLA 4DB4A 1UM9A 3GLFB 4Q6BA 4ZYUA 1CERA 4UBJA 3LWZA 3V7UA 1OZHA 2D54A 4L4UA 4BX2A 3L04A 4NNOA 1NVDA 1WF6A 4FP9A 4Y18A 4A1OA 2IOHA 5EMMA 4CMIA 5J2TB 3SR3A 1PR2A 2PMFA 4ZOEA 1VCNA 2H2AA 3FYHA 4ZU6X 1G3MA 1ZKDA 5AHOA 5ETJA 3RSZA 2ZJ5A 4FHCA 3PGA1 2X8BA 1LC3A 3ZXSA 1UPXA 1NT4A 2CD7A 2ZWVA 3L1UA 4K9RA 3FPAA 1WCYA 1H4SA 3AEUA 1ZS9A 1Z75A 1EIZA 1NJ6A 2QVYX 5EVCA 3ORHA 1D0VA 2BH2A 1JW9B 3COZA 4QDXA 3IRVA 4B3DA 1G5RA 4KQWA 1GPAA 4EHIA 2J4FA 2J0UB 5HKBA 1XTIA 3DOJA 2R60A 3F71A 1TJ3A 2H7YA 3R7NA 4AMUA 4J3FA 4OJTA 4E22A 1O5IA 4CMEC 4FJ1A 3BMOB 1PVOA 3HQ4O 1FDUA 4FINA 4A1FA 4QODA 1L8XA 2Z2KA 4I9UA 3UOWA 1H2XA 4BS9A 4HGPA 1XTPA 3SYMA 1WUHS 3QX7A 2WM3A 1J23A 1KY4A 1Y89A 2C5LA 3D6FA 3R5KA 3C5CA 1FP4A 2A57A 2YMLA 3GEHA 3HVKA 3LUDA 4W8OA 4B0OA 4BLSA 1A5BB 3QI2A 4FN5A 4DV4B 3FPGA 2BGNA 1PGJA 1TAGA 5EKSA 2WKQA 4J1TA 4XQCA 3TXXA 2OWEA 1K8QA 6ABPA 2XMCA 2F1KA 1SQ6A 5CJ2A 3KQQA 2NVBA 4L8WB 3O2JA 2L17A 3ELDA 1UBUS 1HXHA 3ENZA 4FYXA 4F38A 4IV0A 4MVJE 2Z9CA 1OBVA 2BSAA 4RMIA 1CHNA 4IGFA 4EW1A 3RTDA 5C7OO 3DV9A 3R2JA 4PAWA 4Q3CA 3ZCXA 2VLIA 3NO4A 1M34A 3FAZA 3O4VA 3DPSA 1JB9A 3D6AA 1OXXK 1QUEA 3OECA 2V7GA 3PQ3A 4UVIA 1ZM4A 3LOUA 2V5VA 4BQQA 5IG2A 3P2EA 4N0MA 4MEBA 3MT7A 3HGMA 4RA6B 3USZA 4B6PA 5C8YF 4FDVA 5ESWA 4EFNA 1FE8A 1A8HA 3ROTA 2VS1A 4CKBA 3FJOA 4W9NC 3QIAA 2C7QA 4UTXA 4YP1A 4RBNA 2Z30A 3NAZA 1I6WA 1UPAA 3VR5H 3ZCUA 3VZDA 1G5PA 3OX2A 1NRJB 2ZTUA 3EE6A 3W2GA 2X1VA 1PWYE 3IGFA 4OM7A 2EU8A 3M49A 3GLHA 1RJGA 3E4DA 5G53C 4I14A 5CLLA 1FMLA 1H2RS 1GPH1 1NLZA 2DJ5A 3BWEA 2RIPA 3IULA 4O2BF 4P86A 2VDNB 1UEJA 2VJYA 3SSNA 2FOIA 3A28A 1TRKA 4IW3B 1T5HX 3KFVA 4A6XA 3ZDYB 2VQ6A 5ERXA 1G5FA 4W7HA 2AF3C 4D45A 3U4GA 3P20A 3VSAA 5FUXA 2BFFA 2Q5OA 1A9OA 3P5BA 4ID9A 4DJ5X 3I6MA 2GXSA 4F3TA 2QIOA 4P83A 3EA5A 3ZU6A 2VZLA 4NAVA 2GN9A 2IYEA 1Y6FA 1T2AA 2OOKA 5B3LA 5DTJA 1ZGGA 4NZZA 3GA0A 3H0CA 3SLGA 1MGPA 4PPNA 5EA2A 3DOCA 1G4AE 5ES3A 1FFDA 2PMEA 1CK4A 1G9TA 3BCUA 3F6CA 3A14A 1R6UA 2VHVA 4YJKA 4DNXA 2X6RA 1QMGA 4R9VA 2HU8A 3FNGA 5WRFA 4DLKA 4YWHA 4FU0A 3UYKA 1H9CA 3KQKA 2RAPA 3INRA 4JNCA 1E2IA 1AXGA 3NBKA 2WD7B 1EGAA 4HV4A 2QA5A 2V7EA 3I5MA 2ZYGA 2BMEA 4BMYA 5KX5F 2C96A 1D6MA 4AJ1A 1HYHA 1P80A 2NO5A 4RD0A 3R0VA 4N6OA 1A4IA 1KXZA 4NY1A 3BJRA 4H27A 4UTNA 3U56A 4TWBA 4IM7A 1C0PA 1WY5A 1D9XA 2QE7D 2C7BA