3A27A

Crystal structure of m. jannaschii tyw2 in complex with adomet
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
219
Chain Sequence
KYQKIGDVVIVCKAILLYTHVKILYGKETETIHKEYGCLFKLDVAKIMWSQGNIEERKRMAFISNENEVVVDMFAGIGYFTIPLAKYSKPKLVYAIEKNPTAYHYLCENIKLNKLNNVIPILADNRDVELKDVADRVIMGYVHKTHKFLDKTFEFLKDRGVIHYHETVAEKIMYERPIERLKFYAEKNGYKLIDYEVRKIKKYAPGVWHVVVDAKFERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein MJ1557
publication title Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 71
structure length 219
sequence length 246
ec nomenclature ec 2.5.1.114: tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a27A00
1XDZA 1X19A 4PYLA 3C3PA 3DR5A 3EVEA 4C03A 4MWZA 1EIZA 1TPYA 2G1PA 4XUDA 5ICEA 3P9CA 3FYDA 5CVDA 2CMGA 1YUBA 3G5LA 3ER9A 3SGLA 5FWDA 2CMHA 3LCCA 2PX8A 3Q7EA 5HIIA 3GRZA 5DTMA 4RTQA 1F38A 3VC2A 1H1DA 3BZBA 3DOUA 1JQDA 3DUWA 1YFJA 4MIKA 5K03A 1N2XA 2YVLA 4E2ZA 2AN5A 3HCDA 2EFJA 3OU6A 4RTKA 5DRYA 3ELDA 3EEYA 4ZTBA 2AS0A 2EG5A 1I9GA 2ZFUA 3KR2A 3UJ9A 3VSEA 3MHTA 4HTFB 3M70A 3LHDA 1I1NA 3CJQA 2ZZKA 3MTEA 3DLCA 1DUSA 1QAOA 2F8LA 5E9JA 3X0DA 4GBED 1RI3A 2G71A 2PSSA 1PRYA 5ERGB 5CD1A 2IH5A 1N7IA 3G2PA 3T7SA 3KQMA 1V39A 3OFJA 5DTQA 3S68A 3UJ7A 1X1DA 5GINE 4RTSA 5LSAA 3R24A 4EQZA 4CKBA 3I5UA 3LBYA 3BKXA 3HA3A 2WA2A 5DXAA 2IIPA 3M33A 3FTEA 1FP2A 3NTVA 2P40A 2EJTA 5E8JA 2GLUA 2P7HA 3FYCA 1L3BA 3DMHA 2BR3A 3CGGA 5CVUA 5LQJA 3KQQA 4CWAA 3NDJA 2P8JA 3PT9A 4AZSA 4CTKA 4E2YA 1FBNA 4GOND 3G5TA 1YFLA 2NYUA 5KVAA 3PFHA 4QTTB 2I7CA 2PWYA 1AQJA 3OFKA 2QYOA 5BP7A 5KS2A 1P39A 3E7PA 3NWEA 4E32A 3GGDA 4EK9A 4PYJA 3NW9A 3BKWA 1EJ0A 4LWOA 2NNWB 3NMUF 2UYHA 3KHKA 4U7TB 3MAGA 3O7WA 5GP1A 4DCMA 2JHAA 2ZZNA 2G70A 1VQ1A 2A14A 1R8YA 1ZGJA 4BP1A 5DM1A 5DTRA 5K05A 4XUCA 3G89A 1X1CA 3LCVB 2EJUA 5FTWA 3UJDA 3ID6C 5T64A 5U4XA 2H00A 3THRA 3NJRA 2HMYB 3NVMB 5EZQA 4A6EA 2HV9A 4R8RA 3GRYA 1QAMA 4QQNA 5EKXA 3FPJA 2YQZA 5BW4A 1JSZA 3KQWA 4DCGA 3BWCA 4YUZA 4PNEA 3LCUA 3I9FA 2NXCA 4PIPA 4F84A 1G6Q1 4B17A 1EQAA 5C0OE 4YV1A 2C7PA 3D2LA 1JTEA 5EQJB 3TPZA 3EEOA 3CC8A 1IM8A 2PBFA 1IY9A 3EVDA 3EGEA 3EVFA 4KW7A 1P91A 3P9KA 4YUYA 3LECA 1O9HA 2AOUB 2C7OA 4PINA 2IPXA 4R6WA 4UOEA 3CBGA 3SSNA 3G2OA 4DKJA 4ISCA 5DX0A 3EVAA 3BGDA 3EGIA 4P7GA 4YUXA 2NXNA 3A4TA 1Y8CA 5K09A 5K0EA 4IWNA 4X1OA 4DQ0A 2NP7A 3DLIA 1EJ6A 5EOVA 1WZNA 2VZ9A 5HIKA 3T0IA 3BT7A 1X1AA 2NXEA 3VYWA 2PKWA 3IEIA 4XCXA 4FR0A 2OXTA 4RVFA 3NDIA 2ZVJA 2VS1A 2PWPA 3EVGA 5K0BA 5E1BA 4GOMD 2DPMA 1RJEA 3HCCA 2BZGA 4M38A 5GOZA 1EAMA 1KXZA 3P71T 4LWPA 1JG4A 2ZBRA 3GRVA 3UJBA 1NW6A 4C04A 1XDUA 1YF3A 4F85A 5P8WA 3GNLA 5DSXA 2PJDA 3DXXA 5DXJA 2PXCA 4CKCA 3JWGA 1M0EA 5G02A 4K6MA 2JJQA 1G38A 1XCJA 3FPHA 1DCTA 4U7PB 2HNKA 1QANA 3M6UA 3P2KA 2ZULA 4RTRA 1NBHA 1ZKDA 1HMYA 1KPHA 4FZVA 5FHQA 5DM4A 2ZCJA 2BH2A 2E5WA 2ZIEA 1RJDA 2OB1A 3RODA 2I9KA 3TM4A 1P1BA 1L9KA 2UYOA 3ELYA 3GJYA 5K0LA 5HZMA 3EVZA 1KPIA 2I62A 3AXTA 3TQSA 3IYLW 4OBXA 1YB2A 3RW9A 1WXXA 3FUXA 3FTCA 3V8VA 3PB3A 4FT2A 4PWYA 1SKMA 3ELUA 1UWVA 5CUQA 5BXYA 3GXOA 4PYNA 1INLA 4RYLA 3A26A 1VBFA 2AOTB 4KDRA 3HVHA 5KQRA 3MCTA 5EMMA 2GAFA 2NXJA 3ANXA 4PIMA 5EHGA 3I58A 4X61A 5FA5A 5IKMA 3HTXA 1RI1A 3EGVA 5E9QA 4MHTA 1Z3CA 1VE3A 3FTFA 1NV8A 3BGVA 3I53A 2PX5A 5D1HA 5EMLA 5EVJA 3LDUA 4L7VA 3A7EA 2R3SA 4DM3A 1WG8A 3KR9A 2HR1A 3HCBA 4RTPA 3G2MA 3K6RA 5EMJA 3VC1A 1FP1D 3C6KA 3BUSA 2IP2A 1D2HA 2OPBA 1XJ5A 4HTFA 2AN4A 4YV2A 2BR4A 2VP3A 3PFGA 1XTPA 4X63A 3B89A 3FTDA 3JWHA 5CM2Z 4C07A 3MGGA 4QVKA 5E9WA 2O06A 5FUBA 4RTLA 1JR4A 3GO4A 1YZHA 3M4XA 2VDWA 4E2WA 3PLAE 4CTJA 5DM2A 2PT6A 3HCEA 1G55A 4P58A 3GDHA 2LD4A 2EX4A 2HWKA 3P97A 1L3IA 2UYQA 2IGTA 3R0QA 5DM0A 1G60A 3UJCA 3HNRA 4MTLA 4PCLA 5C9ZA 1IXKA 3C0KA 5HIMA 3FZGA 4PYMA 3H2BA 4E33A 4AUKA 3B5IA 1ZGAA 3GCZA 3DTNA 3FPEA 3JWIA 2PT9A 4AZWA 3HA7A 2BM8A 1TW3A 2P41A 2AVDA 4PYKA 5HILA 2AOVA 5ICCA 2ORED 4YMHA 3DULA 1X1BA 4RV9A 1AF7A 4DA4A 1NW7A 5EEGA 3AJDA 5DSTA 3NWBA 1VP9A 3LDGA 3QV2A 4ATNA 1R00A 4AZVA 2OY0A 2WA1A 5T6BA 5EPEA 2GB4A 3KR0A 5ICFA 5IH3A 3BXOA 4H0NA 2QRVB 4HH4A 1VL5A 5B1SA 3LKZA 3R3HA 4HSGA 5FA8A 1BC5A 2XVMA 3MTIA 3PX2A 4GOLD 3SVZA 4OQEA 3BWYA 3ELWA 4OA8A 3ME5A 5E2BA 5LQCA 3SSMA 4R6XA 2C7RA 1NW8A 4OX9Y 1D2CA 3G2QA 3CJRA 4Z2YA 1TW2A 5LQNA 5CVEA 3CCFA 5CCBA 3U81A 4ER6A 3KPJA 4KVZA 1R74A 2ZBQA 4YV0A 2Z6AA 5T67A 4V0QA 4FGZA 3IHTA 4GEKA 2IBTA 1G8AA 5KYGA 2N47A 5DT2A 4EKGA 1U2ZA 2H11A 4XUEA 3DMFA 3DP7A 3E8SA 5HFJA 2OYRA 3RIEA 2QM3A 5GIPE 2O07A 2AOUA 4GF5A 1RI2A 5GM1A 1JTFA 3QOXA 3EPPA 4RTNA 2YR0A 4ER7A 1L3CA 4RTJA 2Q41A 4C06A 1SVUA 2B78A 3LDFA 3OZSA 4LG1A 2JG3A 4WVLA 3FUTA 4RX1A 2CL5A 5DWQA 2OBFA 1QYRA 3G88A 3OE4A 5K0NA 1RI4A 1KYZA 3ORHA 1NT2A 5H02A 3GIWA 2IH4A 3O31A 3P2IA 2FK7A 2PV0A 5K0GA 5DX1A 3FRIA 3UWPA 4BLVA 4A6DA 3G8AA 3JWJA 3M6XA 5F2NA 2UYCA 2ZZMA 5FQNA 4JXJA 1Q0SA 1KIAA 1EG2A 3LX6A 1L1EA 2ZIGA 3R6TA 2PX2A 5FADA 1VP3A 5JUWA 3DH0A 3UBTA 2QE6A 1BHJA 3B7PA 2YUIA 3OE5A 5BW5A 4RTMA 1OR8A 1T43A 4MQ4A 4NECA 2GPYA 5CVJA 5F2OA 4KWCA 2OZVA 1I4WA 1DL5A 3SM3A 4V0RA 3T7RA 3CJTA 4E30A 5EKUA 2BM9A 1F3LA 4GC5A 1P1CA 3PS9A 5EIFA 3UJ8A 1KYWA 3K0BA 3CKKA 3BWMA 4ER5A 3KU1A 5LQRA 4QVGA 3HM2A 4M36A 1MJFA 1HNNA 3G8BA 3KPWA 3SX0A 2IDJA 2ZWAA 4HGZA 1KP9A 2O0LA 1BKYA 1N7JA 1RI5A 4RVGA 2CWWA 1WXWA 4P7JA 4PYOA 1JG1A 2GS9A 2ONYA 2PXAA 5HIJA 4YMGA 4BP3A 7MHTA 3TM5A 2I6GA 4Y2HA 2YXDA 5F2KA 5K0CA 5K0JA 2UZ4A 2AOWA 1ZHFA 2WK1A 5GIOE 1D2GA 1NBIA 5EZSA 5E1MA 2PGXA 3P9NA 1ORIA 2P3LA 1SUSA 2IDKA 4O29A 2AOTA 4F86A 5ICGA 4Y30A 2OO3A 2K4MA 3FUUA 3HCAA 3HCFA 2P35A 4LECA 2ONZA 4HGYA 4RVDA 4KIGA 2FHPA 2ZSUA 3M6WA 5E1OA 4DZRA 4EVIA 1WY7A 3BGIA 1MHTA 4PYIA 4RSRA 1KPGA 3EVCA 1XCLA 4QPNA 3LPMA 3B3GA 3DMGA 3WSTA 3EMDA 3MCZA 2AVNA 1SG9A 3M6VA 1G8SA 4GOOD 4PYQA 3SSOA 2VDUE 4PCAA 2PY6A 1NW3A 3TR6A 4IKPA 3GRRA 4P7FA 1M6EX 3HA5A 3OZRA 5DPMA 3KQVA 3E05A 4KDCA 4HRAA 1JQEA 3OZTA 4WXHA 1QAQA 2O57A 4HG2A 1XVAA 2IFTA 2YX1A 3FPFA 2ZTHA 5KQSA 1ORHA 4C4AA 1O9GA 1UFKA 3FUVA 4FT4A 2P3QA 3LL7A 1JG2A 1FPQA 4CXMA 2IH2A 2ZBPA 3AXSA 3KQPA 3P8ZA 2GA9A 3A7DA 2ZW9A 3KQTA 5HOQA 4PGGA 3KQOA 3QOWA 5E8RA 4IV8A 4C08A 3L8DA 4QDJA 5FHRA 5C1IA 4E70A 4RTOA 5K8VA 3PTAA 3AY0A 3OU7A 1O54A 5LQAA 3MB5A 1RJGA 1UIRA 4FSDA 3HEMA 2P1DA 2FK8A 4EMSA 2PLWA 4X60A 1VLMA 2G8NA 5EC8A 5EIWA 3TMAA 3ERCA 3UJ6A 2JHPA 2XBMA 1R18A 2PVCA 4IV0A 1VIDA 4OBWA 2B25A 3CVOA 4EKIA 3UFBA 2QY6A 4E2XA 1SQFA 1ZQ9A 3EVBA 5GWXA 1AV6A 3UZUA 4BLUA 3P2EA 5FCDA 1XXLA 5HEKA 4FSXA 2Y1WA 3TRKA 4M7RA 2FRXA 1M6YA 3F4KA 3TFWA 2QRVA 3TKYA 3TOSA 4OQDA 3FRHA 2CKDA 2XVAA 1R6AA 2HTEA 2YXLA 2ZWVA 3DXYA 2P7IA 1JG3A 3KQSA 3TLJA 5EGSA 2FPOA 2AOXA 2H1RA 5CCXA 4ER3A 1NKVA 3Q87B 3LGAA 3MERA 2ZLBA 1B42A 2JH9A 3OCJA 4AZTA 2XYRA 3O4FA 2NP6A 3KPUA 4M37A 4ER0A 2PX4A 3KQYA 4KRGA 1RJFA 3TKAA 4E31A 2JH8A 3REOA 2YTZA 2FCAA 4FP9A 5EHIA 2AR0A 5EEHA 4DMGA 1AQIA 5E2AA 3P9IA 2OKCA 2XYVA 3KR1A 3B3FA 4FS8A 1NW5A 4GC9A 4DF3A 5K01A 5LQUA 4RWZA 3V97A 3HP7A 3KPYA 8MHTA 1VPTA 2IBSA 1ZG3A 5DLYA 3A27A 3PVCA 5LR6A 3AWIA 4QQKA 4QTUB 3UA4A 3OU2A 3R9XB 4QPPA 2ADMA 4AX8A 3DXZA 1PJZA 3SR4A 3KPVA 9MHTA 2BR5A 5EG5A 2C7QA 3LSTA 3KKZA 4OA5A 3GU3A 4R05A 2B2CA 4YUVA 5CIYA 3C3YA 3UJAA 1FJXA 3SXJA 10MHA 1JSXA 3GRUA 3MQ2A 3PX3A 2ESRA 5JR3A 5GM2A 3B3JA 1SQGA 4BY9E 2V7EA 2PXXA 4P7KA 5FWAA 3HVJA 1WS6A 2GH1A 1XDSA 3SMQA 4CKEA 1JQ3A 1SUIA 2ERCA 2G72A 4PONA 2B3TA 3BWBA 4HC4A 4PGHA 1NV9A 4C05A 3LKDA 1YZ3A 5LQKA 2O05A 5EMKA 3THSA 4R8SA 2JHCA 3A25A 1BOOA 3I64A 5D1NA 5FULA 5DX8A 4RVHA 2OB2A 2KW5A 3C6MA 2VDVE 1Q0TA 2AZTA 1QZZA 2Z6UA 2B9EA 3UA3A 3HVIA 3LBFA 3FUWA 4QDKA 2V74B 1NE2A 2Y1XA 4KIFA 5DRTA 1R8XA 1KR5A 4GUAA 4X41A 3EMBA 4BLWA 3G7UA 2Z6QA 5CVVA 5M5BA 3ER8A 2YXEA 3HVKA 2FYTA 2P3OA 2AN3A 3FPGA 3E23A 3GWZA 3OPNA 5MHTA 1KHHA 3NVKI 4YUWA 3IV6A 5FQOA 5K0FA 4GQBA 3T7TA 4G56A 2ZIFA 2R6ZA 5E1DA 2XYQA 2DULA 4POOA
chains in the Genus database with same CATH superfamily
2ZQYA 2HLDA 3GLGA 3JYHA 1N1GA 4RJKA 2XTMA 3A05A 3ENQA 1O77A 2PTHA 4NS1A 1PVDA 2PLAA 1QPGA 2N42A 3UNXA 5FLYA 3QVVA 2BKUA 4RADA 4DRXA 1W581 4EYOA 2AX4A 1QQ5A 1QFJA 1TM3E 5BT8A 3OIDA 1QRUA 1OU4A 3FJOA 3DUWA 3PFCA 4DN6A 1YK0A 2CLFB 2V3WA 1ZFNA 2C3YA 2G9RA 3KEFA 1QP4A 2YV3A 1JHOA 3QFTA 3WGZA 4D3XA 1EFPB 3I04M 3K0CC 4M0LA 1VIAA 1OTXA 4OMUA 4RMNA 5FL7A 1KI1A 2WV9A 2EG5A 3QITA 3U4IA 1OAAA 3QLEA 4W9NA 4LNUB 5EJGA 3T52A 3UH1A 1SXGA 3LHDA 2D1TA 2FEWB 3U48A 5HWSA 4DC9A 3JRNA 1WUKS 3FCSB 1G3IA 2ZZKA 4I0WB 3V9AA 1O95A 5BMOA 2QMUA 1ZN7A 1J8DA 4LTNA 3HB0A 5IZ4A 3KSMA 3H4IA 3EDYA 1N7IA 4GI2A 3VR4D 4CMIB 4XTRA 1X1DA 3ZZNA 4MDEA 1ODCA 2EU8A 1S8NA 5JJLA 4QLOA 2ENUA 3EH2A 5EWMB 5FORA 1IXSB 1U28C 2DTEA 1LLDA 2OC9A 2Q5EA 3OFSA 4L75A 2OA0A 1G9XA 3V6LA 3WQRA 2QLMA 2QLNA 3HH8A 4H7KA 5CT5A 1GVNB 2CB9A 2LTAA 2XB8A 2I4IA 4RKQA 2FSHA 2JD2A 3ROQA 5JVDF 3O8RA 1RKVA 2WT4A 3CFYA 2GCPA 2A78A 5JXJA 3CEMA 4MUHA 3ZQ6A 3HV0A 3N2LA 1M2JA 1CS0B 3LCMA 3VHXA 3JQ7B 2B0CA 3OFKA 5AJYA 3VVMA 2GPTA 3ECSA 2OBLA 1X7WB 4F60A 3WADA 1ZH6A 3OCUA 4IXDA 1FDUA 4MUJA 2NNWB 4D4JA 3CKLA 3MAGA 3O7WA 2PUTA 1WIWA 2JHAA 1DWUA 1W6RA 2XMPA 4MV6A 1VB3A 4W5TA 1YDHA 4WZBE 3NHMA 4WBSA 4HNAB 1UR5A 1T3TA 3QU4A 1W4AA 3PCRB 5B37A 4AVYA 4GRIA 4J9UE 1GLGA 2B94A 1VL2A 4LC1A 1ETUA 2QTMA 2V6BA 2VCHA 4IIGA 2XE8A 5T64A 2B1JA 1K7FB 1O94D 4KVAA 4BNHA 4TS4A 2BFNA 3M81A 4ZZ3A 3LUCA 1MQAA 3CLTC 2WSBA 3BJMA 2WU0A 5L4SA 2IP1A 1HDRA 2QSJA 1D2NA 4CG1A 3FGOA 3RD5A 2ZBUA 1QIEA 2WVGA 2TMGA 1EWVA 1V9CA 3PUJA 3C6YA 3F73A 3SQMA 4BO2A 1I4DD 5D3MB 1EQAA 1PX2A 1A5AB 1D6JA 1A8IA 2HMWA 1EUZA 3BB1A 4N82A 2FSPA 1FP7A 3KDPA 5KMGA 2I55A 4B82A 3S2UA 3RASA 2HBRA 4HMOA 4AJPA 2IPXA 5LYYA 1L4GA 2Z5GA 5LQMA 2VK8A 1NAHA 2P1ZA 3EOZA 4K9NA 1FTQA 4ZK6A 3UH0A 1B14A 3ZWPA 2I2CA 3DPIA 3H99A 3MBKA 3W9UA 1RS0A 2Z1MA 4JBLA 2IQ5A 5ELMA 4IX9A 3U4AA 3F3KA 1GZDA 5HDQA 3EQ8A 4KRYA 3OP4A 1WMFA 1USGA 4LCBA 4C9BA 1GG2A 2BCEA 2VBFA 2CVQA 2QL7A 1X2BA 4NV3A 1ECBA 4J3NA 2GBIA 1M2KA 4J75A 1S02A 3GRVA 4O4IF 5H1YA 5ECDA 4GRAA 4F85A 1A96A 3IGFA 1KDVA 2NUPA 4Y6OA 4K7JA 1HT0A 3D8BA 4FZ5A 3MFYA 2JAQA 3PUXA 1GZSA 1WHTA 1NNEA 1OZ0A 4F3KA 3A6JA 3QBDA 5DM4A 4XVCA 4X7PA 4FGJA 4F4FA 1AF4A 1H0KA 1O96A 3LO5A 2I8CA 2MSLA 4Y0VA 3ZY5A 2Q2VA 5IFKA 1FXSA 4N0QA 2HSEA 2FZ4A 3DYBA 3I2FA 3Q3IA 2GKOA 3AXTA 1LFDB 3PLRA 1EFDN 1UJ2A 1EX9A 2H7CA 2X4LA 5CPBA 5FTMA 3DOFA 3FUXA 3NNSA 3AMVA 2CBZA 3NC0C 2AXPA 1F12A 1MFZA 2GN6A 4FT2A 5B3JC 4O4JB 1IN6A 5F73A 3S5JA 2VJCA 2ZPTX 4MPPA 3LU1A 4YFVA 1GL6A 5YASA 1FW8A 5FOWA 2LPMA 3HCPA 1N6PA 2R7AA 3ANXA 4RETA 3DT9A 5AKHA 1L1QA 2VDRB 3EWSA 4NYJQ 4E88A 3OC6A 1ZD9A 4C0SA 4YEDA 3U5TA 2YWCA 3ADCA 2JAWA 2E85A 4AXXA 5H9WA 4ARBA 1SVSA 5CNMA 1N3BA 3E61A 4TN1A 1V37A 3HYSA 3EGDB 2C2GA 1WCXA 3KAJA 3UMFA 3DAYA 3WGUA 4X45A 1N6OA 4PR3A 3A3PA 3JVVA 4RPKA 1PG0A 1S8FA 3AQ4A 4MHOA 2OCGA 2WIDA 1PGNA 1TYEB 2L19A 3IPXA 3C74A 4GMFA 2Y3IA 4UEKA 1K97A 1HEIA 3OTGA 4NAUA 1AGYA 4ZOQI 4YREA 4B9EA 4EEZA 3RU2A 4OREX 4WCFA 4X1IA 1KOGA 1ID1A 1NXTA 2XXBA 4TM7A 2CKMA 1GNTA 4Y9DA 4BVLA 3TFQA 1ZD1A 4E2WA 1LUAA 4YYZA 3PLAE 1MTZA 5B3AA 1CDZA 4P5DA 3HSKA 4U9IS 3SD7A 4CLEA 3Q6MA 4J3FA 2HWKA 4YRKA 3EPJA 4OUDA 1VIYA 3D7MA 2IGTA 3NTUA 3OEYA 4J03A 1RXWA 4F93B 3IHLA 4FDAA 1M2VB 1ZMRA 3Q5DA 5CGZA 4ZOLF 2C04A 3QIAA 1HUQA 2ZVDA 5HS6A 2UUBB 1U94A 1AA9A 3ELBA 1W5FA 1O08A 1JYFA 1Z6QA 1R0WA 2Q3EA 2DVMA 3RS0A 3MG9A 4GMDA 1UZNA 4ML3A 4RABA 4DLAA 3L7BA 2DFDA 4DW8A 4E4YA 4B3GA 2DBZA 2JHFA 3UGQA 5LNK6 1QB7A 3CR3C 4BKMA 3B3AA 3N7TA 5HSGA 3J81A 2INGX 2QZ9A 2W48A 4LY0A 3KKQA 2JEZA 2CCGA 2WICA 3E22B 5DHUA 1OFUA 5GGYA 2ZUFA 5IM4A 2WWXA 5ALWA 2VK1A 2CL0X 1MB3A 1XN1A 5AVVA 1G21A 4XDHA 1JEAA 2XITA 4B6PA 1WO8A 1Z6AA 2GN4A 1P7WA 4NTZA 4BTEA 5KNDH 2GN2A 1ZZGA 3MS4A 4DBZA 3T3OA 5J47A 1R2QA 1N2OA 2FMUA 1ZHHA 4J94A 4NV0A 1HE2A 4QGGA 5LMNB 3FUCA 4EQ6A 4L3WA 2V59A 3UUFA 3IE1A 5E38A 3I34X 2UXCB 1EE9A 3ME5A 3PE4A 2CF5A 3ZDZB 4BP8A 4D97A 4DG5A 3B82A 3TZCA 2OCPA 1E0KA 3ZXSA 1BNCA 3TQIA 3RSHA 2AE1A 2WBLC 2VYFA 3OT4A 5C51B 5CXXA 3GDWA 3TW8B 3U81A 4ER6A 4D9BA 1Y8QA 2DUMA 4KVZA 4QTXA 4URUR 4DXAA 4AQDA 1NVDA 4DT1B 2WDZA 3ETEA 2Z6AA 1GLNA 1U8YA 4EDFA 3JALB 4KQXA 2IA5A 3BK1A 4G5RA 2HSWA 5I6DA 1OUMA 3D2CA 3O73A 1SCQA 3AOEC 1JDTA 1L7QA 1NI3A 1U1CA 4KLRA 4U7HA 4N7RA 2B8WA 2H5JA 2O07A 1XTSA 3H1TA 4JJ7A 4J1SA 4UXJA 5ALIA 1M3SA 1RIFA 3P45A 4D4LA 3ZWCA 4D92A 4J0CA 4AFNA 1OXUA 4I81A 5CH3A 3AKEA 3GDFA 2YN4A 3V46A 2XGMA 2CL5A 1FRNA 2WD8A 4NULA 4BTLA 1II0A 1RXUA 2KYRA 4TL9A 3GIWA 5HNKA 1AK2A 1V25A 4FFLA 3ZJVA 3LQFA 3VZPA 1P9LA 5KX5F 5DDIP 4HZUA 5JO9A 5E7MA 4NBVA 4F2PA 3KZVA 2J09A 3NJ4A 1SXIA 2ZRPA 3V4VB 1SQSA 4JVOA 4DLPA 4Z4GA 4QLBA 4HNRA 3V4FA 5LZ4A 1BHJA 5DLDA 4O2AB 1RWOA 4NECA 1GQQA 3HNOA 2AUMA 1WU8A 4LUCA 1WCWA 4BZWA 4MS1A 2Q1YA 4K46A 5INTA 1HRKA 4OHXA 1N2ZA 1L4NA 2YMMA 3KU4A 1K7YA 3RS5A 1LRLA 3UAGA 3W1EA 5AVXA 1NBMA 1ONOA 2I3ZA 4MKGA 4BNVA 5CA0F 1F2UA 3G82C 2BF7A 1BU5A 1T3HA 1WU7A 3G8BA 1CUZA 1F8FA 4ETIA 4ENRA 1Y5IA 4FMCF 1NN3A 2BBSA 1FSZA 2CWWA 4PC7A 3QENA 3RLIA 1QYXA 2XWQA 3D3WA 3H4MA 4CCAA 4OLJA 2Z4RA 2FMIA 1T10A 3BXHA 3P4YA 3PTLA 4BVFA 1YU9A 1NBIA 3ADKA 2AZ4A 4UZFA 5FO1A 1ULSA 3WRYA 5D51S 2FPIA 1KQNA 3BK7A 4B3SB 3K0FA 4FK8A 4YRQA 3HWRA 5ICGA 3PNSA 4X3PA 2IDZA 2K4MA 3DLHA 3ZLBA 3ORFA 4XFKA 1I30A 1LLUA 2LE0A 4KX5A 3H11B 2OCXA 4GVPA 1UBSB 2WMNB 2YDYA 3KJGA 1TMGE 3DONA 4DRZA 1JQ5A 2J85A 2R8XA 1BDIA 1OZAA 2IZ0A 3E9MA 5D7BA 3T9CA 5CXSA 3T9FA 1KY4A 1OFTA 4QPNA 4PV7A 2D62A 1JJ7A 3VJLA 5EHQA 3FVRA 2PL5A 3TBFA 1B00A 5B1DA 3DGFC 3WHKA 1FBTA 2QI9F 3ZGLA 1LPMA 1NW3A 2DWCA 2JEOA 3NBFA 5HUJA 3QXSA 3WK4A 4B32A 3R8FA 3E05A 2D8AA 3S7TA 2JJ1A 2YICA 2VF4X 4J2HA 4W6ZA 3Q88A 1O1YA 4HG2A 3UWDA 1O8BA 4L5JA 1AQYA 4BN4A 3DNFA 4EF4A 1UPAA 3EOAI 1DXHA 3E03A 3K31A 2DB3A 3OEEA 1K6JA 3EIEA 4XFJA 5K3OA 2WHEA 4Q9LA 1CUJA 4A2QA 1N7HA 3H8SA 4PGGA 1L6IA 5DYGA 3OQNA 1XCGB 1TOAA 2FWIA 3GXBA 3MWGA 4TPKA 1KDZA 5JBNA 5JD4A 4RTOA 1Y9DA 4F5ZA 3NFYA 1O97C 2YVKA 2P1DA 3JU3A 4F3NA 2ZBVA 4EHKA 4YAOA 1QQBA 4J76A 3W7VA 1A95A 1D1PA 1DELA 2D7CA 2DG2A 4G36A 5D6OA 2EF0A 2VAXA 5JCJA 2ZYGA 3FWZA 4IV0A 4AMVA 5CYGA 3FDIA 4GZMA 3UFBA 3QLUC 4TZ0A 4K9RA 1PJRA 1BMFA 2O3QA 3DFUA 5I9BA 4Z0PA 3OT1A 2P2ZA 3EVBA 4KXYA 4UUQA 2YINC 4N3AA 2JKZA 3FIUA 2FZLA 2I3AA 1Z17A 5CHEA 3BJIC 1LX7A 3DOHA 2HRRA 4V0KA 2WF5A 4C1BA 4GGOA 4RY8A 3A04A 2G1JA 2XQJA 3FWHA 4G25A 1QTNA 2WPNA 3TNYA 3K53A 2YJNA 3PT9A 1XZJA 1C5KA 1DI0A 4ER5A 1H05A 4PX2A 3IUSA 4ER3A 4AU1A 1WLSA 2FPRA 1PV4A 3KTAA 4BPBA 2P9CA 4IHJB 4M1ZA 5A62A 4YECA 2NP6A 2IYRA 1PTJC 1GUZA 2XTAA 1OGJA 1O4VA 3BZUA 1HEYA 1DAMA 4KIJA 1SR8A 4KR2A 3TI9A 5EHIA 1CVRA 4HMPA 3K16A 2PH7A 1G4AE 5DIFA 4DMGA 4Q6WA 5EGNA 5FB3A 3LUJA 3TSYA 2HO5A 2XYVA 2XB6A 3ZJ5A 3ACBA 1IJBA 1YB1A 3X1KA 1E1MA 2C57A 2PGNA 4UATA 4DF3A 5ALSA 1LGYA 1OMOA 4FWIB 1DHTA 3U26A 1LTKA 1RAFA 2C9MA 3MJRA 1EQUA 2Q99A 3SXPA 4L76A 4QPPA 3WWDA 3BE8A 4HLNA 4Q19A 1WW8A 4JA2A 5AUQA 4RJTA 3TAUA 2C7QA 4LJSA 2YNMD 3IBGA 2IV3A 2P2YA 3I01A 2E1PA 2PQ0A 2XZOA 1C29B 1XFDA 1XZDA 3RYCA 4D9EA 3BE5A 3IDAA 5D84A 1KI6B 3K1AB 2G77B 1E3DA 3HQ4O 3IS3A 3PVSA 3AX6A 1SUIA 4ZP1A 4CKEA 5B5SA 1JBEA 2EHJA 4YP5A 2HBYA 1TUGA 2Y0BA 1Q95A 1HURA 1YIDA 1C3OA 2Z2KA 4U2DA 3U31A 5AVYA 1W0JD 4GRDA 1GZ4A 2DZDA 1DBIA 4ZT5A 3T3PB 2I5PO 1GL9B 2I9PA 3GRKA 3OOWA 5H4GA 5JXGA 1X80B 4Y6SA 1J0CA 3PYMA 2HRZA 1BYUA 3MMXA 4KIFA 5ILQA 4KJZA 5LA6A 2ZRIA 3HUDA 3S2GA 3WLQA 3I3OA 2VHTA 2AMFA 1LF0A 1AKYA 3DNMA 3MIIA 3E5NA 2I4TA 1N8KA 4X93A 5EJ2A 5F9MA 1IYZA 2AWOA 2ZETA 1A2QA 1S9HA 1XELA 2RH5A 4BLWA 1ZCZA 2ZRGA 4TXMA 1WF3A 2J59A 2WM8A 2YXEA 3HVKA 3WLKX 4DA8A 2IELA 3IUYA 3ZDFA 4E5MA 2VQFB 1EUDA 4NG4A 1AB6A 2ZB3A 4IXTA 4OL0A 5CA1A 3M2TA 3QU2A 3GLQA 3C7DB 3E7WA 4Z9FA 5IC5A 1JBQA 3D6HA 5E3JA 1LPAB 1HQDA 2QN2A 4JMPA 4I3HA 3ZX5A 4CM4B 4F6RB 4XWOA 5DNYB 1L5NA 3S0JA 4HEQA 5TQ2A 1ADFA 2NYVA 4XLTA 4TLEA 5ALYA 1UDBA 4M89A 3C3KA 3FIJA 2IXGA 3WGOA 1YUBA 3Q9NA 2H8GA 2WHXA 5D5HA 5FJJA 2Q9CA 4URXR 2JAPA 3KHTA 3M34A 1YS9A 1KRXA 3LPNA 1M6WA 1YL7A 1MGPA 2E6UX 3D6TB 4AN0A 3K72B 2FB9A 4V2UA 1F7VA 1JQDA 1F0NA 3EGXA 3CLRD 1LKZA 2IUEA 4W8OA 1Z5OA 1P74A 2RG1A 4CCYA 4PG8A 3H2YA 4YXWD 3JW8A 3MMPA 1UPTA 4B73A 4EG4A 4A4DA 3HJGA 2WP0A 2WUVA 1GG5A 3OHPA 3T1NA 4AN1A 4FB4A 3IVMA 2V3VA 3NBKA 2FPGB 4RHCA 3CWZA 4J7UA 2QG6A 2OCIA 2DF8A 2PNFA 3CJQA 1YRBA 1KQ3A 2OECA 5AK3A 5FKJA 5C4GB 5ADWA 1F1JA 1CIPA 1YIOA 3EA0A 4DMLA 5E9JA 3D59A 2VDWB 5HS4A 4FFBA 1U98A 4BN5A 1R5NA 3EXEA 2FOLA 4GPZA 4RHTA 4UM5A 3EIQA 1JKMA 3S68A 4ADSG 2OVBA 2NMVA 2O8CB 2JNWA 4P0QB 1QJ4A 2OAGA 4TRMA 4C4TA 1VLZA 3H5IA 3NCHA 1C80A 1KF0A 2R4QA 4FOSA 1KJYA 1SBNE 1FP2A 2XD4A 3O1JC 4QXRA 2EJTA 1O5TA 1K5GA 2ZJBA 4IJVA 1P1HA 3DMHA 4S3MA 3HJBA 4EJFA 4IHAA 4YT5A 3HACA 4IGFA 4CWAA 1V9LA 4JOQA 3HHPA 1Z28A 2GM5A 3KUKA 1GYQA 1CXZA 4A2PA 5LB2A 5AI9A 1GAJA 3LYAA 4QD3A 4KLNA 2V9CA 1W25A 3GAMA 1FLAA 1NE7A 2AW5A 2C5SA 2QYOA 3DO6A 4OY3A 5FOTA 1VA4A 4E32A 5J9FA 1PSWA 1V3VA 1N75A 2OAP1 4M9RA 2M6KA 3UFXB 4ZN6A 5DE3A 3CEHA 3NUQA 2OC4A 3KVRA 5TJ9A 2P2NA 3ZW7A 1I94B 3QPBA 2G4VA 2OHHA 2X8WA 3FMGA 3QFFA 5DEIA 2A14A 2BJWA 2HJVA 3I42A 1R8YA 1ZINA 2J9XB 3EFOB 3IFSA 3JZDA 4I8IA 1JDJA 2DH5A 2R5WA 5FTNA 2QU7A 1VL0A 3G89A 4HDNB 1X8JA 4OIFA 1TYAE 3G9UA 4LZZA 1TCCA 3G49A 2O8DA 2YRXA 2D8MA 3H9EO 1ICIA 3KZNA 4B0PA 3ILXA 2B21A 2BGGA 3AP3A 4QM6A 1ZQ1A 5JSUA 2P6OA 1JLLB 1ZNWA 4FHZA 3HKBA 3HBMA 3I9FA 3HABA 1G6Q1 1TZMA 2CW5A 5C0OE 2YHUA 3D2LA 4YY3B 5AW2A 3HB1A 2W0MA 5CVCA 1P7YA 1Z18A 3D8TA 3M82A 4EG3A 2QV7A 5K8IA 4MGEA 2WWVD 4O4HA 1NHWA 1Y1QA 3UMMA 3DBIA 3HGTA 4H1UA 2WPDA 4IMPA 3TL3A 4CW7A 3I6MA 4YMLA 1VLQA 1KEVA 4P7GA 1XIVA 2RKOA 4JHXA 1EVZA 5T8KA 5EJ8A 5K0EA 4JB8A 4FYWA 5D8DA 2HLPA 3M5PA 4R68A 5HIKA 3ZI4A 1MHPA 3PDIB 1KGSA 1DIRA 3CX6A 3DF9A 1W0KD 4B6GA 3GX1A 4ZYWA 1K8YB 5ERXA 3EVGA 2D5IA 4GOMD 3H3FA 3R74A 3RO7A 4M38A 5GGXA 1CR1A 4CM9D 4MUKA 2G06A 1JG4A 2DPGA 4OTZA 4Z4IA 2V4ZA 3CM0A 3GYGA 3L7MA 3L82B 2FI1A 3PWTA 3QU5A 3WGVA 4E03A 3EA4A 2RKBA 3AIKA 3MNFA 4NENA 1DCTA 3B1XA 1JVNA 3ZD8A 4BNWA 3I72A 5EIBD 2NWQA 3NGXA 4U1RA 3DHEA 3GWGA 1SVNA 4D02A 3RS7A 2JZNA 2WB2A 5ALHA 1V3QE 1ZLYA 4YGXB 1SB9A 2DHQA 4GPEA 2SECE 4KFUA 4RULA 3R5JA 3ELYA 4QFDA 4JLOA 1P0CA 1K6MA 4R2XA 4WK4B 2ATEA 2YV1A 1IXZA 1A8UA 4FLMA 5JR3A 4KPEC 2ZUBA 3HYLA 3WZ2A 4MR9A 1TUBA 1A69A 1F3OA 1Z38A 2I33A 3KYIB 4G01B 4WESA 3DJFA 1SKAA 3JSAA 4FOLA 3Q41A 5DCYA 3RC9A 4LYYA 4KQ9A 2VQSA 3ILYA 4RA9A 5G1NA 4O8CA 3QBVA 2YW2A 5KWVA 4N0PA 1IEXA 1UUFA 2QMYA 4BLSA 4X61A 2SKCA 1KSFX 2QVLA 3H6KA 4UBIA 4ZQFA 5KBYA 3AR4A 5BQOA 1OB2A 4N6NA 4HYQA 1V3TA 1V26A 1Q1NA 2GDZA 5EVJA 3ZHSA 1QYDA 1LQ2A 2H52A 1S01A 3IUNA 4JLVA 1H93A 4HL6A 4XQCA 2J0QA 1E0AA 3LY7A 3KR9A 2HR1A 4KQCA 4RTPA 4CLRA 1BW9A 1M10A 3O74A 2HWUA 4BB6A 1R6XA 4LJKA 1T1SA 1CIVA 3LX4A 2ZI4A 2X77A 3WFJA 1DJQA 4U8HA 2WJIA 5B1IA 4GXQA 1V95A 3ZKAA 4E09A 5CB4A 2XRZA 3PTZA 2EJCA 3QEJA 1T1EA 3LXMA 1GZHB 4ZCRA 3T35A 3SFVA 1R6VA 3R5FA 4ZTUB 4GZ5A 4GSYA 3V2HA 4RSHA 1TA9A 3GEHA 4LZLA 3VGJA 3QJYA 4MVJE 4D3YA 1T6NA 4ALMA 4MQ5A 2EW1A 1Q14A 1MRNA 1SU8A 1VBKA 2WSLA 4YRCA 1EP3B 5KJFA 1H0SA 3CCCA 3HNRA 3NYRA 1WQ4A 4XDZA 5FWXA 3N7AA 3HWX1 4N47A 3ZCQA 5C9ZA 2FMXA 1TMKA 1X7ZA 2ZTUA 5FBHA 2Z98A 4K6HA 4TQ9A 2E6KA 5IASA 4R3UC 1TU4A 4TMTA 3STVA 5BQ5A 2G7MC 3MJDA 1MC5A 1OYVA 3OF3A 1SUWA 3DFMA 3O8CA 2RE8A 4ZMRA 2EEZA 1YDWA 3KSAC 2MIIA 2NZ2A 1XYGA 3L8HA 1MO5A 2WTUA 3RHFA 1AKWA 1EWQA 2AV6A 2EOAA 4HXEB 3X1JA 3NWBA 1ACJA 4AC9A 3ZOZA 1V1MB 4EIWA 5IPFA 4JXZA 4NCIA 5KNCA 1G5TA 1DWQA 5L7WA 1OBVA 2VKTA 3Q5EA 4JL6A 4U5QA 2GCGA 3MGKA 3MS7A 3EQ9A 5E4TA 1T4CB 1KZYC 2I4MA 2A0UA 3CUYA 3SVZA 1JKIA 1NKSA 3PP8A 3WP1B 3IEUA 2WINI 2Y68A 5I8ZA 4DCCA 5IUNC 1E6WA 5LIPA 4OJKA 2D5CA 2OHXA 1IY1A 3ZE6A 4PLFA 2VXCA 1WEKA 3O3NB 4HSEA 4NK4A 1EDEA 3G2QA 4QBTA 4Z2YA 3LPLA 4IDBA 4MCIA 4RFVA 4BFVA 2Y1KA 4P8RA 5KSPA 1W4LA 3RWBA 1E4EA 2I6UA 1Y81A 3BCRA 3M1YA 5FFMA 4ZIRB 3WNBA 1ZI8A 4KQGA 4CIBA 5BWLA 3TB4A 4INPA 2WC1A 3PDCA 4CMEA 2AQKA 5B2FA 3UAOA 1PFGA 1KNXA 3VH4A 2JLVA 1G8MA 2HGZA 4MEBA 4XUEA 3WMGA 1PWEA 4U0JA 3KKLA 4WI1A 5ALOA 4RTJA 2V7QD 4G0QA 1GJRA 1I10A 1BD3A 4GS5A 4BMSA 3OZSA 1TO2E 1WKBA 3P0RA 3EYAA 2C94A 3OF5A 4RJ2A 1CD5A 1CF2O 2XF2A 3RS8A 2R87A 1FK8A 1V45E 1OHHA 2O50A 4M55A 3ORHA 4YJHA 1MW8X 4M7PA 2BFEA 4TSRA 3O4JA 3QMPA 2J5RA 3F1LA 4ARIA 5ALJA 3GBPA 1FS4A 2WJZB 3FRIA 4N3GA 2I6QA 4MI9A 3M1AA 3TAXA 3GT4A 1MCZA 3LF2A 4WAUA 4XM2A 1UJBA 2AJLI 4WK0B 3RCBA 3AKZA 4GOKA 2I4OA 4EKYA 1PF7E 4ZA2A 1T43A 3CT6A 1WSBA 3FSGD 4TRRA 3WY9A 3TLBA 2OZVA 4XPIB 5C7IO 4HDRB 4MA0A 3VV2A 5AUPB 2OV1A 4DCNA 2X1LA 3CKKA 4Q3EA 3WISA 3BJEA 1EP9A 3EIFA 1C50A 1T2CA 1CFJA 2D74A 1BCSA 1ST3A 1EI9A 2FPSA 3KDSE 3TOZA 3GEBA 4QNMA 3UW3A 3VOAA 3ICEA 2WWHA 4HGZA 3IR6A 1OLXA 2AJ8A 1ML3A 1P6UA 1NWCA 3LQ4A 4DUGA 3J80A 2X0JA 4KE9A 3HLYA 1ZO8A 2G28A 2BFDA 3D6VA 1XLTC 5K0JA 4TTIA 5GIOE 1D2GA 3ZY4A 1KMQA 1BWQA 2JB9A 3PC7A 1XMVA 1A4IA 2O1XA 1GM5A 4O29A 4XM0A 1U5BA 2P30A 3BFJA 4HLDA 4XVHA 1D8AA 2O8BA 3U3JA 3NBQA 4C0XA 4JODA 1XDBA 1KJNA 2H18A 3DL0A 4MK4A 2J6CA 3H9BA 3ZNNA 4DRXB 2AMYA 1WY7A 1RC8A 2GEFA 5HRCA 2R5FA 4N3CA 1Z0KA 3HFJA 1E9RA 1HDEA 1YS1X 4JVLA 4OQLA 1RWBA 3VTZA 1DG1G 4OKIA 1WV1A 3U0VA 3BCSA 1V11A 3QBJA 2IPNA 4PNPA 1EWTA 2J8ZA 3B38A 3KV3O 4KQ6A 4PSAA 4E94A 3I37X 2VJDA 3IQZA 2Z08A 2FZ5A 2PY6A 1CX9B 1LPOA 2A3RA 2C82A 4IKPA 2ZTLA 2GZ1A 3AR8A 3F47A 2JC3A 2WDPA 3DDHA 3MGBA 4WRRA 1ZSNA 2Z43A 4OMFG 1CSEE 1JR3D 3GR6A 4TS3A 4C0QC 4B31A 4CDRA 2E7ZA 4FFWA 3FPFA 3UB4A 2I1WA 1BWRA 1SFRA 2WE7A 1P62B 4MMYB 3ICCA 4A73A 1A9QA 1XRMA 3OLXA 4M9SA 1W47A 5CW1A 1IHYA 4NOKA 4B9AA 2ZBPA 2Q8QA 4PZLA 1DMRA 2GA9A 3B78A 4Y7DA 3ECAA 2DTXA 3PF9A 1UT6A 5E8RA 2JHGA 3KSRA 2X23A 3PLNA 3NDPA 1D9XA 4IEEA 2X41A 3K96A 3BCHA 4PZYA 1RCTE 3UF0A 1V8DA 2DWPA 3ROEA 3SHFA 2GXUA 4EAQA 3ZGZA 2VXOA 3IKVA 4Z1MD 4QGAA 5IJ0A 1N2EA 2WR8A 3R7BA 4EJ6A 1OU0A 3FYHA 4XCVA 1C7IA 2YIMA 4UVDA 1K3TA 4KTVE 1U8AA 3KG2A 4W9NC 2PVCA 1ECCA 1VIDA 4M22A 3ZQJA 2IODA 2Q0SA 3CVOA 4JI4B 3VHXB 3VYVA 1H0RA 2QBYA 1SELA 1ULBA 4NKRA 4QEKA 1SQFA 2X8BA 3ESZA 1O95C 4TUYA 5DGCA 1AV6A 5CRIA 4FBMA 2YJGA 2QNBA 2QD2A 1C8VB 2X0IA 3HB9A 4EY4A 5FAKA 4C2BA 5L3VA 3KYDA 4L28A 4OQMA 5KHOC 2OBXA 2FFHA 4JZYA 1BMDA 1OIVA 3CPSA 2WFZA 4YBZA 3QUAA 2HREA 1V8PA 5F9HA 3UN1A 3TR5A 3KQSA 2AI3A 4EG1A 4YMGA 3DXYA 1JG3A 1E3WA 5CK5A 2H1RA 5ALUA 3W06A 3WXMA 3QHAA 4FIZA 4EB8A 3LGAA 3WLEA 1OYOA 2KLBA 2IEGA 2ZRQA 3L05A 3MERA 5TX7A 1GTL1 5JJBA 3REGA 2PFGA 5K99A 1H2WA 2ZT8A 4FU0A 3KPUA 4CKWA 1QKKA 1HG0A 1YKGA 3AB7A 4PSDA 4II7A 4DIDA 4JDPA 1NQUA 2WF9A 4FGSA 3REOA 1ZW6A 2QR5A 3LBIA 3UXHA 2C8LA 1POXA 1U4SA 2AR0A 3H86A 3H97A 4URVR 3HZHA 4U6NA 3ROKA 1BCRA 1JJBA 4KFSA 4QICA 1CDEA 2IHBA 1T2EA 3TG8A 3OM8A 5KMGB 1PZNA 3U7IA 5A3QA 2APJA 4I4TA 4GP7A 4AJ1A 2WIJA 2ONCA 4B3BA 1FQOA 1NJ8A 1JLRA 3KZ1E 3HGMA 1VE9A 3EXG2 2K5UA 3P26A 5GZ1A 3MTAA 2RHGB 3CNEA 3KZXA 5TF4A 4B0OA 4RK7A 2PMDA 3WGGA 3ZUGA 2IZOA 1IUOA 3L0ZA 2JZOA 1FJXA 2VSYA 1QQAA 5IKEA 4GI5A 3TBKA 1J0AA 1PL6A 1T1IA 3D5QA 2HXGA 5CT9A 2OQVA 4EW6A 4W82A 2H85A 5SYMA 4DDHA 5JXIA 1R27A 1SC3A 1NVMB 4AF8A 2Q49A 1CZRA 1R3UA 1W4BA 5I7VA 1VYTA 5IZCA 1ZM4A 3OETA 2AQ8A 2IW3A 1ZJWA 5ELXA 3B6EA 4KOEC 2OAEA 2OB2A 2E4VA 2NUPB 4FQ8A 4K2AA 3GCDA 1E1RA 4UQPA 5F5NA 3MJCA 4FVTA 1WHTB 1O0CA 3QFHA 1JHXA 2IE8A 3IAM1 1L4LA 3PXXA 1NBAA 1O96B 2XYPA 1WXDA 2FWMX 1T9ZA 3D31A 5DRTA 5TJHA 3U2QA 5J40A 1FYEA 4GUAA 4U2KA 4UQLA 1RRGA 1T3ZA 2B35A 4MAMA 1DZ3A 4DCJA 5M5BA 1IULA 2DSNA 3H5AA 2WAAA 3ZLUA 2CNWA 4J1NA 2Q3HA 1RLJA 3ZZUA 4XQ9A 5JCJD 1U0TA 5FOXA 1XLUA 3NVKI 1T5DX 1Z2OX 4EHIA 4F8JA 1GRRA 1UBJS 1YE5A 2R6ZA 4NYMR 5JNUA 3K0KA 1RVV1 4OG2A 2P9HA 3BFVA 1LFAA 2PUJA 4GECA 5JECA 2PUBA 3GVPA 1L8XA 5CIWA 1JPJA 2A86A 2C84A 4TS1A 2HQOA 4ASUA 2XOKA 2W58A 2KSQA 3MWLA 4FFOA 1M0WA 3ER9A 1ZL2A 5DI3A 1T8SA 3Q7EA 1EDBA 1ZK1A 1XF1A 4MUEA 2IHJA 2GWHA 5DNWA 4ND7A 1PJBA 1XLVA 1ZLXA 2QRHA 4RTQA 2QTNA 1FDIA 4Q00A 1KQOA 4MIKA 1E6MA 2AN5A 2IDMA 1RJ9A 4HLUA 4QC2A 1E2IA 4QWWA 3NWPA 1NVBA 2WVAA 3VPFA 2I99A 3DZBA 1JQKA 1J0EA 3ROPA 1XHFA 1I1NA 1KFJB 4QRDA 4WCFB 5BN3A 1EE1A 1ZWKA 3ON5A 4X1IB 1YA6A 4OX9B 4LDZA 3OP1A 3CA8A 5H3CA 3DL7A 3NHUA 4QOHA 2I2WA 3G2PA 1IJFA 3CEPB 3V00A 5GINE 4OUDB 4H35A 4IICA 4L5YA 5IW8A 4JXKA 4WFKA 1XRLA 2GD1O 4ISBA 1OXXK 1HKUA 2VHVA 5EXDA 5EE3A 1SVIA 2QMQA 1UBHS 2RGGA 3OWOA 1D1TA 4JBXA 3BHIA 1CQJB 1NOIA 1PJLA 3GBVA 4IOLA 1S3GA 4I50F 1YUNA 2J31A 1ACLA 4K28A 4YRJA 3CGGA 1VCIA 2BBWA 1M5UA 3Q2KA 1X9IA 4FW9A 1NC1A 3TRFA 2X8AA 1VG8A 2C7VA 1VCNA 1OD6A 4TKZA 4LHYA 3QLVA 5I4CA 2NO0A 5ESDA 5I7UA 3N74A 2IYFA 3V8QA 2QQ0A 2PDAA 3ZDDA 5JFTA 1A72A 1GRVA 4WY2A 3SU8A 1T5BA 1ZYUA 2X9LA 3HI4A 1TO1E 1YR9A 4PXAA 2FNAA 4WCFC 3RYFA 3ZV3A 4PYJA 2H4XA 1NP6A 1G21B 1NXVA 3N3AC 3NW9A 5EE5B 1W1UA 1Z47A 3WWCA 4KIUA 1WZ2A 4NCJA 2VWHA 3C14C 1J06A 4BO0A 2O19A 3W3AH 7REQA 3MJTA 4ZDJA 1IM5A 1X7HA 3KOWA 1ZGJA 3LUGA 1GKLA 1AQUA 1LSJA 4INOA 5DM1A 2RK6A 3GVIA 1IHOA 1ULZA 3FFTA 4NHOA 5DGXA 1S2IA 3LCVB 3DL4A 1VMAA 1L4HA 4IXMA 5U4XA 1A8HA 1ODKA 5C32A 5CX4A 5EZQA 5LN1A 1KDTA 4D9MA 5AW5A 1TKAA 2GUGA 2ORYA 2AFIA 1Z5PA 1NXPA 5CLJA 4BMPB 5JWOA 5C52B 4L78A 4U7DA 2QTWB 3NM5A 4PQYA 1E2GA 1TKBA 4QSMA 1MLDA 1SCKA 2C2HA 4JS0A 3KXIA 3PF8A 4BVBA 1JFRA 3B5JA 1VYHA 3KD2A 5JPIA 3T06B 4BOYA 2FZKA 2OG1A 3W6OA 3EN0A 4PINA 2ZPUA 1NJ2A 3PENA 3RUFA 1YZLA 2RHCA 2D5AA 4FCWA 1N36B 5ILGA 3R9XA 4MYDA 5EJ5A 3HDVA 2H4HA 5KVSA 1ZOLA 2XHZA 1ZU4A 2F17A 2XA1A 4DR5B 4B4KA 3CX8A 1XZEA 3DC2A 4J4BA 1J0DA 1X86B 1Z4KA 3PUIA 1WZNA 4WWHA 2EV9A 1CRLA 2PH3A 1YJAA 3S1AA 2BDEA 2OXTA 3SHWA 3U49A 1G7SA 3NEPX 4Z0NA 3U9LA 4I5GA 4HZUB 1XL0A 5E1BA 2W4QA 3OJWA 1ISSA 2DPMA 2Y71A 4AMZA 2XIQA 3L0BA 1SBZA 1Y5NA 3WL3A 5KU1A 2PANA 3QF4A 4RY2A 3PWKA 2KE5A 3D6UA 3DKPA 5P8WA 1W1WA 3DXXA 2REBA 3E15A 3L8GA 3O3OB 4WOKA 4XLLA 3CF0A 3KS9A 4M49A 4MS1B 3TLXA 1LNQA 1QG4A 1C1YA 4OK5A 1I6MA 2R1VA 4RTRA 3HR4A 5AVSA 3DWFA 4YI5A 4R40A 1VG0B 4WJZA 1MV5A 5B7NA 4EJ2A 1WDTA 5K0LA 1PYGA 4YAJA 2PRKA 3WV5A 3GLKA 2QT9A 3RHSA 3LHSA 2RAUA 3WYCA 3GFGA 3QLTA 1H9AA 1VHDA 2G17A 2JIPA 3JAKA 1KIMA 4NMHA 2C2YA 3SIPA 3U62A 1LLQA 2FPIB 5DEOA 4L0QA 2PSDA 5KU7A 2CNNA 4BBPA 1OWNA 1UMKA 2O5CA 4BQRA 3MTQA 1PT9A 4A0FA 1WDKA 5E9QA 1PI3A 2XT0A 2YWBA 4JIMA 4D3SA 3R0ZA 3OE7A 1TK2A 4S35A 3Q0TA 2X3FA 4B45A 3WYBA 5LP1A 3BGVA 3HYNA 3WYDA 1G4HA 2R6AA 2XGGA 3F9RA 5LYJA 1SULA 3LDUA 4E5SA 2W4MA 1YMVA 3A7EA 1WPRA 4HH3C 2BYTA 1QQ6A 4L07A 2G5TA 4QYSA 3NX4A 2QQFA 4FGWA 5KZMB 4C3UA 4HWGA 3D6AA 1C30B 1FU4A 2GHTA 1LWNA 4IGEA 1V43A 2ZSJA 1VPVA 2BKVA 2JI9A 3C6KA 4FZJA 3F5QA 3NQ41 2PNJA 2EWMA 3IPAA 3NT4A 9LDBA 1Z83A 5IM5A 2TSYB 3PJEA 1J25A 4PICA 4U9HS 2BR4A 1NY5A 1CNEA 2EYUA 3I2YX 4H15A 4Q6BA 1MB2A 5KYYA 1E9FA 1YU6A 4P7BA 3ZNQA 4DMKA 4BGVA 1ZRNA 1WRBA 1JR4A 2D5BA 4LOJA 3O0DA 5IAJA 5ESRA 1XNHA 4DR4B 3WKEA 3E8XA 3WL7A 4WOCA 2XMBA 4QGFA 5AUNB 2O1SA 3A1UA 1G60A 1JDBB 1P2GA 621PA 2QTRA 2D0PB 3M2PA 1SBHA 3UAYA 4IILA 2WQ6A 4DCTA 3SVLA 3ITNA 4E3ZA 1OFUX 4KR9A 4WNCA 2IEIA 3GFPA 4JP3A 1D4OA 1FZQA 1SO8A 2ZYDA 4IEFB 2BLLA 1MOQA 4XYGA 3QE9Y 1GRCA 1RXIA 3ZK9A 4I2NA 2GAOA 4JJFA 1M33A 4ZVUA 1D6NA 3DZKA 4IZIA 3ES9A 4C5AA 3ADDA 3OT1B 4YRGA 4RZUA 2Y9MB 1GU0A 3WZLA 1GN9A 2OLEA 1QVWA 4INZA 2DFLA 2YRFA 2C88A 3K1YA 4Q1VA 4XQ0A 1E89A 3ZEAA 4UREA 3U0BA 4OFXA 1LXCA 2NV2B 3KLNA 3AHEA 3VO9A 4RJJA 2YCBA 1JDBC 1ZK4A 3OM9A 5DTEA 2BM0A 3IESA 1ZK2A 4CDNA 1WPXA 2V7GA 2Q8PA 2ZJAA 1ADBA 3KTAB 2J3KA 4TYQA 2CD9A 1ID8A 1YC5A 3FLEA 4EGQA 5HE8A 5KTTA 3M5CA 2M1XA 4KSBA 1SKYB 1XMPA 3GT7A 4FWBA 2FSIA 4Q7MB 3RAEC 3KJXA 2ODAA 3O1HB 4EUHA 1XZFA 1M1NA 1SY7A 3HJTA 1ZS9A 3DF7A 2ZAIA 3DFIA 3RRFA 1ZEJA 3IHTA 4JN6B 4RK4A 3SJZA 2M6RA 3BQNB 4BVKA 1I2ZA 1OQAA 1IHUA 2IXTA 5KJEA 5B7GA 4CL3A 2JKVA 4FFNA 2QM3A 3CIOA 4QDXA 3TXXA 2OORA 2IYPA 3ZWQA 2OFXA 1UC8A 4XEHA 4QUEA 5U9CA 2G82A 4NFHA 2HCTA 3FCCA 1J8MF 5JZSA 3E3NA 4UKDA 2JFWA 3IAS1 4KFTA 4KGDA 2QTTA 4MVJI 3DTTA 4Q4LA 5BR8B 3A6EA 1UP4A 4JYPA 2VHWA 3LBHA 4IJKA 3O31A 1QIFA 2V7BA 4CKEB 2ZROA 5IBCA 1B6RA 4BLVA 1U7ZA 4CG3A 2ZB7A 4RA6A 4FEYA 3M6XA 3UYKA 3OPYA 4HB4A 3RSGA 3OG9A 5BVHB 3KB2A 4GD3Q 1C3OB 1M2FA 1E5QA 4TVOA 3VUFA 5JH7A 1UBNA 3FOFC 4WIAA 4WX2B 2POQX 3WFIA 2A7QA 5JUWA 2WYUA 2D0DA 1TI7A 4OD0A 2PKQO 5IJWA 1EK5A 4FEAA 4JENA 1T2DA 2DFNA 3O4RA 3GN1A 4OQXA 5FDFA 1QO9A 1YZUA 5KTSA 1L7OA 2X86A 2HV8A 1UMDB 2Q0XA 3CZAA 3LXXA 4R01A 6REQA 1C7RA 2EL9A 1KMHA 4UNNA 5EKUA 3WMWA 4DBVO 5LA6B 3BK2A 1D2EA 3PS9A 2IY8A 5EIFA 2IPLA 1K8ZB 4REOA 3ZS8A 4AWAA 1FB5A 1XZQA 2V7VA 4WMLA 2CV2A 4B6SA 2IOHA 3MJEA 1WB9A 3ZIAD 1GDDA 3CUWA 1PU2A 5LP6A 1CJUC 1RYFA 5JCZA 1EBUA 1S0UA 5DCWA 2ID8A 2FA9A 1WDMA 3NTOA 1VIMA 2B4AA 2JFFA 1FE8A 1EUDB 3D3JA 4HRYA 2PZEA 1EE2A 4XRRA 1QB8A 1Z6GA 4KE7A 4TQAA 3ZE1B 5E3HA 5CA1B 5IH7A 2UZ4A 1BEUB 1ZHFA 2NZJA 2QTFA 1HTBA 2H5EA 3CRQA 3Q1KA 1E3IA 3KVNA 3O92A 1L9XA 2GFIA 4ROTA 3B8HA 3DL2A 2JEYA 2B1RA 5AXDA 5TQ2B 3N70A 4I9GA 3FZYA 4GYJA 2WKRA 4R5HA 2H1IA 1YR3A 2ILTA 4I1RA 4ZYTA 2CB0A 4HB2A 5LIRA 1C9EA 2BMFA 1JG6A 1H65A 4H3HB 1Y7TA 3KBOA 4E3WA 1XTVA 4FZRA 5H81A 4UBOA 2M6LA 3ZBTA 2CY0A 4V02A 4P5EA 3PD0A 4AG3A 1FTWA 4PYQA 1Z75A 2A8YA 1KAOA 2JL1A 4K9LA 3A1TA 1CZKA 4YK7A 1LEHA 3KNZA 4CCYB 5CFOA 2Q50A 1KMMA 3SJ7A 3ZJ4A 4TMWA 5EIXA 1EAYA 3NGLA 4UHHA 5COBA 1JKFA 3CLHA 4FFVA 2IX3A 3GRRA 1CW2B 4EARA 1BXRA 4DCSA 4JBYA 4Z5XA 1AHNA 5F3RA 3Q3HA 1G19A 1XZCA 3CG4A 1AN0A 3TGLA 5EXTA 4FFBB 5JH7F 1K5DA 3EXEB 1S5PA 1Z5VA 3PFIA 4OH1A 1KAGA 2VUTA 3PEFA 1AO0A 3A2KA 2FLWA 2KLHA 1FS6A 1HE8B 1R9GA 3AKCA 3BMNB 4F5EA 1Y3CE 3P8ZA 3EH1A 5CYFA 1P29A 3FAKA 3KQTA 4LQCA 1H8EA 3JWEA 1H22A 2ZTSA 3KQOA 4ZU3A 4LQLA 2B7LA 1I33A 3X1XA 1NP7A 1U1IA 4ABYA 1I0ZA 4M7WA 1P4JA 4U3JA 1PEKE 1P7PA 1VLVA 4DRYA 1OI3A 4OQZA 3X1MA 1BDMA 4LHVA 3VAZA 1VLMA 2Y93A 5JNVA 3WL5A 3B1VA 2JCBA 2PFKA 4F1WA 1PUJA 1W4RA 1Q17A 2IYTA 4U02A 5BN5A 5GWXA 3R7DA 2AXQA 2HB6A 4ARVA 1HKHA 1T1GA 2HOQA 5HUQA 3T1YB 3L3BA 4IDDA 5D7NA 2WF6A 2PEYA 4N7BA 4Z9BA 5AJXA 3BOSA 1ZVKA 2HPAA 3HJAA 5GTDA 4WXRA 4DLRA 3T9BA 2IWRA 4CYMA 1LA2A 2HDHA 1QO0D 4PC6A 1GEEA 4C7MA 1QIHA 1H3NA 4B1FA 5AXCA 1QP0A 3DVSX 3NWOA 2OGTA 3VNUA 3C2QA 4I9FA 3QVJA 4V0ME 1EM6A 2YFKA 4FW8A 4L9WA 1KI3A 3HDGA 4G2TA 2PUWA 4R1MA 2VCYA 2XUZA 4OHUA 1BX3A 4X85A 3AEUB 3HRIA 4MEAA 5COQA 3VUEA 4E31A 1GIAA 1TF7A 1YJCA 2YTZA 4PZ0A 3HKBB 3BVPA 1K7XB 4JKIA 2A0YA 4EI8A 4UHEA 1XU4A 1N6HA 3K09A 1BDJA 1VZ3A 2Y05A 2PMKA 1KOFA 4U7FA 2FR1A 4MIEA 1ESNA 4UFNA 3R3XA 4Y1RB 3JD0A 3UCEA 5A5DA 1R9NA 2YS7A 2ZT5A 3EFEA 4Q1FA 3SP1A 5AWFC 4O4HB 1JJVA 3A27A 5CW2A 1EH5A 1U7OA 1Z0AA 4JQOA 2ZS7A 4RV4A 2FG7C 4LCEA 4QTUB 4Z9YA 5KDLA 1BE6A 4TL6A 4PLVA 1TGVA 3RKRA 5EG5A 1DBRA 4CF5A 5CIYA 2PGAA 2QX8A 3D8UA 3VNAA 3S99A 4ESEA 3IAXA 4LZOA 2X5OA 4R8LA 4JI1B 1R9MA 1CUUA 4ERNA 2R96A 5FUWA 4PM4A 2HY7A 4D8YA 4QPZA 4PONA 3L7NA 3IT3A 4A92A 1JLKA 1ZJ4A 2EEPA 3EC2A 4GGMX 2NQ8A 3R7SA 1SXJD 2HFKA 4X90A 5KPJA 1UKEA 3VC3A 1Z4NA 3I64A 5EZYA 2CLOB 2XCRB 3VKHA 3ZHBA 1FQKA 3G0CA 3WB0A 1U0HC 2YWDA 5CT6A 5MFPA 1GDTA 5BV7A 3P2YA 3VR4A 1GFZA 1UBGA 2HZ7A 4QT0A 5AK5A 4A3SA 1ZOSA 1W46A 1ONSA 3OJOA 2HRBA 2OMKA 1NU6A 5T8KC 4EG0A 8AT1A 5KNBA 3IURA 3VAYA 4WV3A 2BZ1A 5AXBA 1ISIA 2WHQA 1IZZA 1IUPA 3KCNA 4RM2A 1DPGA 2XUFA 4MR9B 1TUBB 3DWIA 5HQ3A 4EG5A 4WESB 3D1VA 2WU1A 3DLTA 4KO8A 1J39A 1JU4A 2IHYA 4R7ZA 4UFPA 3IIEA 4UTRA 2R1ZA 2IYXA 3HE3A 4MVCA 2PX0A 4PPQA 1O2DA 1U02A 4RA9B 3T7TA 1DE0A 1K89A 1GILA 5FNVB 2ZZMA 3AB8A 4FONA 3STWA 1OWOA 2H2DA 2IS6A 1E64A 5F7JA 3TPCA 1IRIA 3VOBA 2QD3A 3PSAA 3NOOA 3QV1A 4BRZA 4MGIR 4PX3A 1TVKA 3GVXA 5TQ0B 2ACWA 1D4ZA 4YCBA 3OO0A 4HDAA 4Z3KA 4PQFA 3SNKA 2H29A 4GLLA 4UNPA 3CEAA 5D01A 3HXOA 2OK7A 1TM5E 2G9VA 3DOUA 4G0UA 3LLUA 1PQPA 2C42A 4YC7A 1O4WA 2MMGA 1SU6A 3CBQA 1BW9B 4CLRB 1IZ0A 4F71A 2LCFA 3OU6A 4NMXB 4X8MA 3RIYA 2DETA 1RAGA 3EEYA 4ZTBA 2C4UA 2N0SA 1JT2A 1JDUA 4Q3AA 5DHTA 4CKXA 3AGQA 3PYLA 4MKIA 5CB4B 4D0LB 2JFGA 1IBCA 2WJ3A 5AJZA 2VTEA 3MTEA 1UL1X 2C31A 3AVQA 1QAOA 1F8YA 1PRYA 2WAXA 1AMNA 2ZIXA 3L6OO 4HDKB 1LBQA 1WNFA 1H8HA 1AS2A 1G5RA 5HFNA 4QZVA 3TQOA 1I7SB 3WAGA 2YBDA 3EWIA 1Z25A 3A6HA 3FBTA 5FWXB 2OOKA 3IP3A 3TRDA 1UT5A 1ZMTA 3DS8A 3EZGA 3SEZA 1H2FA 4TKVA 5DP2A 1Y4UA 1EP2B 2AW3A 1GNPA 1KXJA 1UZAA 2VH2A 5ALXA 4N39A 2FW6A 4XYEA 4BUJA 4KN8A 1NAIA 1LS6A 1PWYE 2HT1A 4CTKA 5SYNA 4E2YA 2EKPA 4GOND 4LWZA 3K71B 4TXJA 2JKYA 2Q0HA 4MW2A 3C1OA 4F2GA 3PGVA 4YR7A 3C1UA 4DIUA 2EZ9A 2P2DA 1JPUA 5BP7A 1V7PC 1KE1A 3E58A 3LRTA 4AUNA 5HDBB 3WL6A 4GPTA 1P7CA 4FE3A 2QUIA 1M8PA 1UZMA 4FPXA 4CQMB 4MW5A 3WGHA 3GGJA 3OKPA 1VQ1A 2X0EA 4E08A 3WLOA 1PGPA 1RRCA 4G26A 1MENA 1QNFA 2YQ5A 3B6MA 3L8EA 3NATA 3SYNA 1Z0FA 4BP1A 5HJEA 3AL0C 3NHFA 2PMBA 4LXGA 5DF1A 4ZAVA 3QW4B 1ZMOA 4LE1A 3C45A 2VRWA 2P67A 2H00A 3FX2A 4G97A 3DVQX 1V5GA 4QX6A 4RNDB 4DJJA 3ZTWA 1Q1QA 3D7NA 4I1UA 1WNTA 3GRYA 1E4EB 1PLJA 4OVKA 3Q7RA 2GGSA 1YR7A 3V7NA 4JWTA 3KQWA 4K05A 5EWJB 1FXWA 2W43A 2PLFA 3L4SO 5JCXA 3E9RA 4P86A 1DNPA 4CEIB 4B17A 2WTXA 5F1YA 5EQJB 3RSLA 2DH6A 5KYKA 1ZITA 1IM8A 1BE1A 4OQNA 1EVYA 2ZT7A 2QTBA 1XTTA 1T5OA 1W8IA 2O1WA 2ORIA 2GHQA 3EPRA 3LECA 3NNDA 4HNSA 4R2JA 3ZD9A 4IIUA 1KBZA 4PC2A 4WBNF 2H07A 1A9OA 1G6OA 3VH1A 1IBMB 3OJCA 4BEVA 3OHSX 4M21A 5K09A 3LTNC 4YJHB 1QV6A 2BFEB 4LV6A 3OTHA 1G6KA 3NKFA 4QGSA 2MJLA 1OH8A 6PFKA 1UK6A 3L0CA 3GMSA 1Z36A 1NWHA 4CHGA 4EPVA 4F4DA 1IIRA 2E4XA 3N2GA 4DV5B 3JYPA 3KWLA 4CMEC 3TH5A 4ZYLA 3H2GA 5BMVF 1R4NB 3K2BA 1YS7A 2ZBRA 1E2UA 3JVUA 3DBRA 4UHFA 4W99A 4NVRA 2ZWMA 1O89A 1XHEA 2VR1A 2ICAA 3D7LA 3GNLA 2IGBA 1USKA 2QMZA 3JX9A 3PIRA 3Q6IA 4G89A 3WNZA 2AXEA 4WH0A 2DMRA 1R8QA 4TYNA 1M0EA 3FPKA 1WMSA 2C61A 3BRQA 1Z56C 3BZWA 2O20A 4YO8A 1H42A 3EFBA 7ADHA 1R8SA 3WNQA 4F46A 4HNUA 1GFWA 5JLJA 1BCSB 2JVIA 1V4NA 2OZEA 2WYIA 3L7IA 3O82A 3SX2A 4DBLC 5FOQA 4HVAA 1NVTA 2OFWA 1VTKA 1ADJA 4M0MA 4YJ2F 4YT2A 2IEYA 2G5GX 3UJHA 4GKBA 4DLLA 3WR5A 1YB2A 1GZUA 4M0UA 4BB5A 4F9FA 5KNDD 2QN3A 5IAOA 5KTNA 2BFDB 2ZXUA 1FCJA 4Q48A 1JA9A 1TYDE 2RJ3A 4PWYA 2CV0A 3OTOB 1OLOA 3HA2A 4MWTA 5BXYA 2FPWA 2Y0EA 1U5BB 3E9DA 4IIJF 3TMYA 2O8BB 5HKBA 4MW4A 2ES4A 2BMAA 1XMQB 4PIMA 3VR1A 3KEOA 1I4TD 4RO0A 1XFAA 4EI9A 4IZOA 4LJLA 4G5HA 5TPWA 5HYVA 3EGVA 1TXGA 1WVMA 2AT1A 3DLAA 4NBRA 1PKXA 2QVZX 3IMKA 4C6SA 5SZJA 4MO9A 4PG4A 3C97A 2XUPA 3SZLA 1QK5A 4D45A 4QDOA 2V5VA 2Q4OA 2PVSA 3PNKA 3T99A 3TE7A 5K6RA 1V11B 3TQFA 2DTDA 3ONEA 1BHSA 4FFSA 1E9DA 3LWZA 1ADYA 1QH8A 2WWFA 3G0HA 8LDHA 1Y6FA 1T9DA 4HKTA 3NVDA 4G9BA 1TJ5A 1UKCA 1HOTA 1P1KA 2ZQ5A 5AKYA 2WJVA 1FMLA 1XJ5A 2GJSA 3GDGA 2ZAMA 1EK2A 4UJ5A 4X7MA 3UT6A 4D1YA 1XTPA 3EAGA 4DM7A 1J42A 1QMGA 1NXOA 1JIUA 2QLTA 3MGGA 1HNZB 1K66A 1XBTA 4JP5A 2VYND 3X44A 5FUBA 5ALVA 3G5AA 2R8YA 5IVHA 4AK9A 4C87A 2IJGX 3D5EA 2CVFA 2HSJA 4JI8B 4D8VA 3UK1A 2UYYA 2W83A 2ZE5A 3T1VA 2ZWPA 1Q2XA 1B41A 2B99A 3L8ZA 4Q4HA 3GZTB 3ZK8A 3SZ3A 2CHUA 3ZBQA 1DS6A 3FVVA 3VNBA 3FZGA 5AHOA 3H2BA 4E33A 7YASA 4ZZIA 1F5SA 5FX2A 4L72A 2C8VA 3MOIA 1JU9A 4HQ6A 3RI3A 4CBVA 4JYZA 5IJ0B 3H9CA 4MVJG 4ZRNA 3W8EA 1QIJA 4AULA 3FCUB 3FTQA 1I0IA 3DO5A 4EG8A 1BX0A 3JD4A 1DP4A 4G9EA 2P1RA 2QNIA 2VSNA 2XNDD 2Q07A 1ORWA 3LE8A 4FYVA 5FL3A 2QBYB 5EUQB 2GKSA 3PGKA 3W5UA 5I4BA 4I8DA 4TUYB 1FQJA 1NW7A 4IUBS 3T0GA 1F4PA 4PVCA 1YIAA 1QLHA 3FMOB 1XA3A 2CYBA 3B2NA 2FGKA 2VHJA 3HU3A 3KYDB 4G67A 4H7EA 4O5AA 1OH7A 3K05A 2C59A 1XTBA 4HH4A 2AIRA 3TEJA 3MLAA 4GUDA 2AK2A 1TQ8A 1E3WB 5GZ6A 3T1OA 5A6VA 3TEMA 1Q50A 3LXUX 5FYQA 1E2FA 3LK6A 1X1SA 1NY6A 2IC5A 3I9NA 2PGLA 4OX9Y 4BIMA 2XGJA 1M7BA 5KUTA 3W2IA 1IUKA 3FA2A 3FNEA 1T8WA 4D6YA 1L8LA 3MJHA 4RKYA 2PCJA 3BRWA 2BEJA 4YLGA 1O58A 2Z8ZA 1T6YA 4NJOA 1R74A 4KCGA 1SK8A 3HUFA 3T1QA 4ESOA 1I3LA 2ODQA 1QP8A 1U7XA 4TMVA 1W9MA 5C5CA 3I3SR 3QFSA 5A4JA 3CH6A 3BULA 4GSKA 3WMFA 5HR5A 2DY0A 3H2IA 4I4TB 1LDNA 3SEFA 3JWPA 5B57C 1CRWG 2AKYA 3TZ6A 1ZGBA 4GF5A 4MWOA 3PA6A 2QGZA 1JTFA 2O14A 4CQJA 2C5EA 3CLUD 3WIVA 2NZVG 2ZUVA 4R2MA 4EO7A 1YQXA 4NC9A 1CJVC 1Y34E 3VFDA 3VKFA 1AH2A 2G09A 4DC1A 3QY0A 4EAAA 2AHOA 3G88A 2PLRA 2J7PD 3LC2O 4Q1AA 4RF2A 2QX9A 2C4NA 3PDUA 1PZXA 4KYIB 4UFOA 5F5XA 4F9GA 2E4ZA 1R1DA 1I9CA 2NVBA 2J5KA 3BMQB 1SKBA 3R7AA 1RFGE 2PV0A 2H7XA 2NXWA 5JAUA 1ILEA 3EHDA 4CL8A 2Q4BA 1G20A 1DBSA 3AV3A 3OF2A 1U0LA 4PFJA 5THQA 2GYWA 5IKPA 4H27A 2QGFA 4LZPA 4B2PA 3LDAA 2XCQA 3GRCA 5HF6A 3EQ7A 4K88A 1SUAA 1RAAA 3QHQA 3RBVA 2CLKB 1SIBE 4A8HA 2UZ3A 1X38A 2B5WA 2XSZA 1OR8A 5C81A 2GPYA 3U40A 4KWCA 3OQOA 4V0MA 5EWLA 1C3LA 2A4KA 4COKA 4FJ0A 5DK4A 1S3FA 1Z0SA 4Y6LA 2C8JA 3UJ8A 4E07A 5KTMA 4RUKA 2WSSD 4ZVQA 5EJMA 3ZCXA 5E95A 4Y2SA 4E1BA 3A4NA 5TT1A 1DEHA 1YA4A 1IL0A 2FHSA 4MWCA 4I55A 1OLSA 2WTMA 3GT3A 4N5HX 3PX7A 2B20A 3EULA 1N2GA 1E2QA 1Q20A 5DBOA 5L40A 4OHPA 4PFKA 4BFWA 3AVXA 1U2EA 2BEVA 4ZEVA 3EDQA 3LNTA 1PL0A 5F2KA 5G0TA 2HI0A 2BDUA 4ENUA 1IVYA 1JIVA 3FWPA 4KXNA 4O2BA 4NJMA 3W8DA 5IZCC 3WAKA 3I9JA 2GD6A 5DU2A 2QAIA 4PAQA 5SV2A 1X92A 1JQLB 1P3Y1 4IQ0A 4RVDA 1BKDR 1T6BY 2VBGA 3PV0A 1K9VF 5F4BA 4CM1A 3QQ5A 1GR0A 5DI3B 4C0JA 3HM9A 5JNSA 1W7AA 4HS9A 3BREA 1P73A 5DN6D 3LJKA 4QJ3A 4KXVA 3RWOA 1QRTA 3DO8A 3ZDQA 2HA7A 2H4WA 3E3AA 4GLOA 3M6VA 1G8SA 1NJ6A 2RK4A 1RJ9B 1Z8HA 4DV2B 4UE3S 3IC5A 3TIFA 3OE1A 4AZ0A 1CB0A 2G0NA 2ZCUA 1GVHA 3K9BA 4FBGA 1M73E 3ZGNA 3HA5A 3SS9X 5JJ5A 4AKIA 5LPNA 9ABPA 2ZGVA 1QV9A 1D0IA 1H6CA 1VJTA 2P0AA 2VVTA 3ACCA 4RACA 5BN3B 1UXJA 1XVAA 2GTHA 1E20A 2ZT6A 4BX2A 3U17A 1X77A 1JFFA 5K3FA 4AJIA 3FOWA 2WHRA 1V47A 3OIFA 1Z6ZA 3OIYA 2Q2OA 1E3SA 2B6HA 1JG2A 4L8WB 4EKDA 1ZSYA 2IH2A 4GVXA 4LHEA 4PXYA 1T9BA 4FQ5A 3QPUA 1TCVA 5KVVA 3F96A 4IV8A 4EUNA 1JP7A 4D96A 1I7QB 1RAIA 1ULUA 4KXWA 2IYLD 3AI7A 2J6BA 3IDFA 4QDJA 4PLHA 4W63A 3ZDXB 4IHQA 4YP0A 1RJGA 4C88A 2GILA 2VAWA 4G1CA 4QTZA 4EW3A 3KTOA 1IEWA 5J59A 4UAJA 3RQIA 3V34A 1V6SA 1PWXA 1ZR2A 3AG6A 1JW9B 2G1AA 1BN7A 4MWGA 4W1PA 3O8OA 5E6SA 1E2MA 5JSQA 2C0QA 3RYFB 3I09A 3MBOA 4FR5A 4NEQA 5EZ5A 3C7TA 1E8MA 1Q1AA 4NE7A 3NFRA 1EGMB 2JFPA 1XXLA 4UMVA 3S28A 1XPUA 1E32A 1G17A 1RHRA 1WSWA 1MMFB 1PNVA 2B4YA 4E6EA 4P2GA 4Y6GB 4AKHA 4BQPA 3OJ0A 3PUVA 1MEEA 4RD6A 3TS1A 7REQB 1ZAYA 2XVAA 3BFPA 4PSUA 3TD2A 1IBLB 4XWKA 4IJ6A 5EGSA 2ZJFA 2DUUA 1Z2AA 4LBVA 2XTNA 2JH9A 2HMVA 2JH3A 1N2HA 1DINA 4JLJA 4A16A 2HKIA 1Z74A 2AFIB 3FGZA 1ZJZA 5LXTF 4AB1A 3HVRA 3L0YA 1E9BA 1ESZA 3QLVC 5LDHA 1BA3A 4TVSA 4OK6A 1T5IA 3GLHB 4AJ2A 1YRWA 4WK2B 4RLSA 4BO1A 5E2AA 3LHKA 4G1UC 2KB0A 3DT6A 4J0IA 4O4JF 3DEZA 4UUOA 1VXRA 5BNFA 1JB1A 4B71A 4MQFA 3LBNA 3OQJA 4Q9HA 3F7TA 1C3EA 2HXSA 1CJSA 2QN9A 3FMVA 4JJEA 4NIMA 3ZGYA 3DP9A 1W2WB 3R9XB 1B1CA 1PJZA 2AF3C 3QNWA 3LSTA 4LIPD 1SC4A 4YUVA 1EIWA 3K8ZA 2EVWX 4QYIA 3GRUA 5EJ7A 1VZ2A 4L4UA 3S1AB 6Q21A 3KSBC 5KYNA 2GJ8A 2P9JA 3MIZA 1H1LA 5LP6F 4L0DA 4PPNA 5F7OA 3NDBB 1TJPB 3CE9A 1UXIA 4A8JA 3ZZTA 4BNYA 2WIGA 1P3JA 1EG7A 3F5MA 1EKXA 2C5LA 4PGHA 4QULA 3HADA 3NUGA 2WKQA 4PC1A 3UJ3X 2P5TB 4WKNA 1A5ZA 1Y1SA 1YD7A 1T2AA 3G2JA 1KH3A 5C8YF 4RDIA 3AHIA 1GQ2A 4Q1CA 3OT5A 2L0XA 3P9PA 3ZR4B 5CBKA 4UU8A 5KVCA 2R1VB 4FNGA 5KOJA 2SCUA 1Z5WA 1BGWA 1E2BA 3F9IA 4DUYB 2SNIE 3ANSA 2BLNA 3JQ6A 4JI6B 4NONA 4COOA 3GZJA 1GGNA 2EBWA 1UKVY 1FC0A 3L5KA 1UDRA 5LKAA 5ELLA 5AKXA 2FQXA 2YIVX 3ETNA 4QXAA 1X8LA 1RHQA 2CFIA 2GAIA 2WJYA 4IGKA 1T2NA 1H3EA 2FYTA 3U7EB 2DC1A 2FR8A 4M1WA 4US0R 4F2WA 5MHTA 3JAKB 1NVGA 3ABOB 4MPJA 5EJ9A 4RL4A 2YL2A 2AZXA 3NAGA 5ALDA 1L4BA 2QUHA 3QE4A 4N49A 2JARA 4QQFA 4TV9F 3ORRA 4BGUA 2JLUA 3QKUA 1VJ1A 1KVQA 4X44A 5JSHA 4UCWA 3CLSD 2E0IA 5IBRA 3CZ9A 2CYAA 5A5FA 4C03A 3UMGA 3MYRA 3M3PA 4IYRA 4IZHA 2O3JA 3A9TA 4PLZA 3CPJB 2XB4A 4L2IA 1B8UA 1X0VA 5L6LB 3CF6R 3TLCA 4IINA 5LYJB 2ZSEA 1SKQA 1GQFA 1ONNA 4O5OA 1XCMA 4ZQBA 2PUCA 4KFCA 4OI1A 3WL8A 1U11A 3DDUA 3WHIA 3PXGA 1A50B 1WSDA 2C92A 2GEKA 1AS0A 4UOZA 4CR8A 1QCZA 2ZFUA 2WJ6A 3UTCA 5KWIA 1CCWA 3M70A 3H05A 3PQ3A 4E5YA 4KIWA 4B8YA 3W5DA 3WKDA 1TK9A 2YYAA 1D04A 3P96A 5KKAA 4OI2A 4N18A 5E9AA 3RRYA 4XRGA 1OY1A 4EHHA 1Q7EA 4MV5A 1XPOA 5GJCA 3B6JA 1WX1A 2JF0A 4I3GA 4MICA 3OQ1A 3F74A 4NQRA 4Q4AB 4U9UA 4UHJA 5EFZA 3UK0A 1DX9A 4KL8S 1DFHA 2KS6A 1SEPA 2OENG 4IFIA 5LSAA 4K87A 1X1TA 1BEEA 2A88A 4ZJUA 3IV9A 1R15A 3MLBA 3M33A 4MQEB 3ZU5A 4LZWA 1ZOIA 1PP4A 2NZ8A 1Z7EA 2JD0A 3I9LA 3SBOA 1BSVA 3GOHA 1S96A 5FBQB 3TZHA 1DXQA 3KQQA 4DSTA 3KYJB 1RXEA 1KETA 1W35A 4F97A 5IDWA 4MKRA 1YFLA 4ME6A 3L18A 3SZUA 3WLMA 1RHUA 4MGHA 1ZNYA 1LLFA 3RTAA 2Q28A 3RREA 1WAMA 4OYRA 3GIDA 1J1UA 3WJ1A 1Z34A 3NORA 2TMYA 2GJAA 4GKAA 2DUWA 3DEAA 1XK6A 2BFFA 5K51A 2JIZD 1B6SA 2X1MA 4DAOA 1C3XA 1OBHA 1PV2A 1Q22A 4PCUA 4V39A 3ZWMA 1E4OA 1YS4A 2WG2A 3A3KA 2O48X 4OQFA 3T4EA 1HYQA 3V80A 5K05A 2H1CA 1X1CA 3QXCA 2QJWA 2OGSA 3UPUA 4TV8B 1DXOA 2XQGA 5F9FA 5IBPA 2GF0A 1WD7A 5EJIA 4QO8A 3C24A 1QAMA 3A70A 5ULLA 1M1NB 3I92A 1NDQA 3SKVA 4YUZA 1KOJA 1ORTA 2JIOA 2C2XA 2NXCA 4R1PA 4YV1A 3OWHA 5HMMA 5C31A 2QJOA 2VG8A 1S3SA 1ZESA 2R1UA 3I04A 5H5JA 5J5AA 4IRUB 1IY0A 1T8TA 4YUYA 5BQXA 3RVDA 3EZ6A 4RQUA 1ISMA 1TMYA 1HG1A 4M2LA 1U8ZA 1P45A 2DFVA 5C3UA 3NPAA 1L5FA 4LRXA 3WIDA 3RRZA 1BHO1 3R6WA 4ZYXA 1Y8CA 2Q6VA 2R6HA 3K20A 2VRCD 4XB1A 3PC8A 4KPUA 4DG9A 1JEYA 1SU7A 3C87A 4LHXA 2W42A 1UAGA 2VC2B 3MT7A 2OCLA 3BT7A 1UK8A 2CXOA 2NXEA 3ISJA 1URPA 3HY6A 2ASEA 4CLOA 4YCMA 1UFOA 2R5NA 4KI7A 3KB6A 3EDCA 4KO4S 3OPYB 4RA6B 3SQNA 5K0BA 2D2FA 4OLBA 1OJLA 4N5DA 4MNTA 2JDIA 1KK0A 3AFOA 3RIHA 1Q1EA 3PITA 1FUEA 5IEBA 3ACDA 1CT9A 4KC0A 2MT9A 1IVNA 2AMVA 2JBWA 3LVBA 3BWEA 4NOMA