3A27A

Crystal structure of m. jannaschii tyw2 in complex with adomet
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
246
structure length
219
Chain Sequence
KYQKIGDVVIVCKAILLYTHVKILYGKETETIHKEYGCLFKLDVAKIMWSQGNIEERKRMAFISNENEVVVDMFAGIGYFTIPLAKYSKPKLVYAIEKNPTAYHYLCENIKLNKLNNVIPILADNRDVELKDVADRVIMGYVHKTHKFLDKTFEFLKDRGVIHYHETVAEKIMYERPIERLKFYAEKNGYKLIDYEVRKIKKYAPGVWHVVVDAKFERI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ1557
total genus 71
structure length 219
sequence length 246
ec nomenclature ec 2.5.1.114: tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase.
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02475 Met_10 Met-10+ like-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3a27A00
4V0RA 1ORIA 3TKAA 1MHTA 2ZCJA 4NECA 2YXLA 4LECA 4QVGA 1VP9A 2JH9A 3CKKA 1JR4A 4P7JA 4KDRA 3FPGA 1NW3A 3DULA 2AN4A 2PV0A 5CM2Z 2ZIFA 3EGEA 4C08A 4HGZA 5CD1A 3I58A 3I53A 5E9QA 3WSTA 2BR3A 4PINA 3MQ2A 3GRUA 3BT7A 3EVGA 3P9IA 3NDJA 3REOA 4LG1A 3MAGA 3U81A 4E70A 4RTNA 5DSTA 5F2KA 1M6EX 4KDCA 3VC1A 1Q0SA 5T6BA 1M6YA 5DM4A 3OZRA 1JG3A 2G71A 1IM8A 5DXAA 3UWPA 2NP7A 1R00A 3HVIA 2FK8A 3HA5A 4QPPA 2BR4A 3EVFA 2YUIA 2FPOA 3CJTA 1KXZA 3GO4A 3GXOA 4HGYA 2PJDA 5LQAA 2AOUB 3LDUA 4PIPA 5C9ZA 1DCTA 2AOUA 4CTKA 3DP7A 5IKMA 5K8VA 1TW2A 4KWCA 2BH2A 4PGHA 3S68A 4QVKA 2UYCA 3HVJA 1JG1A 1R18A 1JG2A 3A7DA 2ZBPA 2XYRA 5DM0A 4E2WA 2AR0A 2PSSA 2PT6A 3KPYA 3C6KA 3KQPA 2IGTA 3FZGA 1QYRA 2NXNA 5EZQA 2AN5A 5EVJA 3HCEA 1NV8A 1T43A 1XTPA 3KU1A 2ZZKA 1SQFA 4M7RA 4RVDA 2ONYA 4V0QA 5EZSA 4AZVA 4E2YA 4PIMA 1WZNA 1XCJA 1WXWA 3DH0A 4AZSA 4F84A 2YR0A 1R8XA 1NW6A 3TR6A 3P9CA 4IV0A 3KQVA 4DA4A 1OR8A 4HTFA 3UJ9A 5E2AA 5FWAA 2O05A 1YF3A 1RJEA 3C3YA 4QDJA 1JTFA 2AOVA 2ZFUA 5FQNA 2IH2A 3SVZA 1ZGJA 3DLCA 3SXJA 2XYQA 3UFBA 2EJTA 3TLJA 1XXLA 3M6VA 4DQ0A 3IEIA 1XDUA 5U4XA 3TM4A 1FP2A 5K0NA 4X63A 1JSZA 4HC4A 5DT2A 1X19A 2NYUA 1BKYA 2EFJA 3B89A 4ER0A 1VQ1A 2IPXA 2JG3A 2P1DA 3P97A 5H02A 1I1NA 3OE4A 3E8SA 3FUTA 1RI3A 4P58A 3PTAA 1N2XA 3I9FA 3AXTA 1EAMA 2ZW9A 3SR4A 4DCGA 3PS9A 3ELUA 3FPEA 5EMLA 4BLWA 3FTDA 1NW7A 3JWJA 4R6XA 5CIYA 3ER8A 1M0EA 3C0KA 4YUWA 2PY6A 2C7PA 3H2BA 3TQSA 3UBTA 3A27A 5ERGB 4GOND 2OY0A 1KHHA 3X0DA 1G38A 2BR5A 1KPHA 2V74B 2ZZNA 1D2GA 2OBFA 4X41A 3CVOA 2I6GA 1O9GA 2PVCA 3QOXA 3KR1A 3R9XB 4CKCA 2HR1A 4BLVA 3F4KA 1YB2A 2P40A 2PWYA 5DM2A 5JR3A 3GRRA 1NW8A 3HCFA 3HVKA 1RI2A 3SMQA 4A6DA 1L1EA 5EHIA 1KP9A 1FJXA 2JHAA 4QTTB 3ER9A 1NKVA 1SVUA 1BC5A 4FZVA 2F8LA 2IFTA 2OB1A 4PYJA 2AOWA 5HIMA 4AUKA 5DSXA 4FSDA 4KRGA 3GWZA 5D1HA 1NT2A 1KPIA 3GGDA 5HFJA 2OO3A 3BKXA 5E8JA 3KPJA 4CTJA 3FPJA 3UJ6A 4PYKA 3O31A 3KQTA 4PYIA 3P9KA 1RJGA 4MHTA 4RTKA 2IBSA 4DKJA 5BXYA 3P9NA 4ISCA 2G8NA 2ZIEA 3KPWA 1Z3CA 5T67A 3UA3A 2WA2A 3FUUA 2NNWB 4KIGA 5KYGA 4P7KA 3SSMA 4R8RA 5K0FA 1WY7A 5KQRA 1N7JA 2UYOA 4RTJA 1JSXA 1JQDA 2EG5A 3KQQA 4MIKA 3TRKA 1Q0TA 2XBMA 3HM2A 2B25A 3UZUA 3NMUF 3A4TA 5E1DA 4KW7A 1RI5A 1ZG3A 4PYNA 5ICEA 3ORHA 2FRXA 2GH1A 3BUSA 3P2IA 4GOMD 1TW3A 3B3JA 3MCTA 3O4FA 3RODA 3V97A 3JWGA 1RI4A 1KR5A 5P8WA 3MCZA 4U7PB 4ER3A 4LWOA 4X61A 5K05A 2PX4A 3TMAA 3R0QA 3CBGA 1EQAA 3LKDA 3GRZA 4E33A 3OFKA 2CWWA 2OPBA 2ZBRA 1UFKA 4YUVA 5CVEA 5FQOA 2QRVA 5E1OA 1XJ5A 3R6TA 1X1AA 2QRVB 5GOZA 5HOQA 4BP3A 3EVAA 5CVUA 4HTFB 5GIOE 2ZLBA 5GINE 2AOTA 4YV2A 3FTFA 3ERCA 4PCLA 5EHGA 5BW4A 2JHPA 5DX1A 2ZTHA 4ER7A 3BWMA 1ORHA 1X1CA 5M5BA 4DMGA 4DF3A 2G70A 3QOWA 1FP1D 4RTPA 4G56A 1ZHFA 2PX5A 2PXAA 3EGIA 5EOVA 3SGLA 4C04A 2NP6A 3FRHA 4CKBA 4QDKA 1KPGA 3CGGA 3LBFA 3KQYA 4C07A 1B42A 4BP1A 4FGZA 3THSA 2VS1A 5ICCA 5DX8A 2PBFA 1EJ6A 2NXEA 1P1BA 5FA8A 4CKEA 3P8ZA 1V39A 5DRTA 5KQSA 5K01A 1QAQA 4IWNA 4RTOA 4A6EA 3G8AA 3B3GA 4XCXA 3MTIA 3E05A 3GCZA 5F2OA 4YV0A 1IXKA 2P7HA 5E2BA 5KS2A 3RIEA 3EVCA 3LCUA 4OQEA 5EPEA 3B3FA 2AZTA 2NXCA 2P3OA 3ELWA 2FYTA 3A25A 2ZVJA 4PWYA 3HCCA 2P3QA 4PYMA 3PLAE 2IP2A 2H1RA 3FPHA 4GOOD 3A26A 4CWAA 4GBED 3OPNA 2OYRA 1YFLA 1SKMA 2FHPA 3ANXA 3JWHA 3LL7A 4ER6A 1RJFA 2N47A 4H0NA 4R6WA 5EMMA 3EVZA 3NJRA 5DLYA 4RTSA 3ELYA 3BXOA 3FRIA 5CVVA 1AF7A 3JWIA 1D2HA 3FUXA 2O06A 5G02A 1DUSA 4FSXA 2UYHA 2BM8A 3G5TA 2A14A 2AS0A 4POOA 5HZMA 1G8SA 2H11A 1VP3A 2ORED 3FYCA 3G8BA 3GJYA 5DXJA 4M37A 4DCMA 4ER5A 4OBWA 1XVAA 1NBIA 3K6RA 2PXXA 4FP9A 4YUZA 5LQKA 1KYZA 3TKYA 1G60A 4Y30A 10MHA 2PWPA 1L3CA 2XVMA 2YVLA 4MQ4A 2V7EA 5EIWA 1NW5A 1BOOA 2PKWA 2HNKA 2QYOA 2XVAA 3FUVA 3G89A 1R6AA 3HVHA 3KQOA 3OZSA 4C4AA 5C1IA 4XUDA 5CVDA 2GPYA 4PYQA 5EEGA 3VYWA 2G1PA 3IV6A 2IH5A 3MERA 1FPQA 5T64A 4EVIA 2ERCA 1XCLA 3BKWA 2I62A 4R05A 4BLUA 3Q7EA 3O7WA 3R3HA 4EKGA 1SG9A 3M4XA 5K0CA 2AVNA 2UYQA 5LQJA 3KQSA 1KIAA 3I5UA 2O07A 1ZGAA 3AY0A 4GF5A 1SQGA 3UJDA 1AQJA 4KVZA 1R74A 2P41A 3KR0A 4GQBA 2GB4A 2Z6AA 5DTQA 3GDHA 5C0OE 2Q41A 3CJRA 3D2LA 5MHTA 3BWCA 4EK9A 2Z6UA 4YMGA 3LDGA 3V8VA 2VZ9A 3BWBA 2ZWAA 3VC2A 3DR5A 2FCAA 3A7EA 2AN3A 4WVLA 5B1SA 5EC8A 4CXMA 2Y1XA 3DLIA 5FA5A 2GAFA 3DOUA 5IH3A 4C05A 4P7GA 3EVBA 2CMGA 3M70A 3OZTA 4PGGA 5DRYA 5D1NA 5K09A 2VP3A 3KQMA 1P39A 4GEKA 2KW5A 5F2NA 4XUEA 3IYLW 3NWBA 3OU7A 3RW9A 2OXTA 4AZWA 3G2PA 4X60A 2BM9A 5K0BA 3T0IA 1EG2A 2ZWVA 3BGDA 3G2MA 2GS9A 4P7FA 1BHJA 2HV9A 3E7PA 3P2EA 2PT9A 3DMFA 4QPNA 1YZ3A 4RWZA 3TOSA 4C03A 3EEOA 8MHTA 1AQIA 4X1OA 3BWYA 4M38A 3AWIA 3SSOA 1SUSA 2DULA 1ZQ9A 7MHTA 3LBYA 2ZIGA 4RTLA 2H00A 2PGXA 3LX6A 3NTVA 1WXXA 2OB2A 2ZSUA 3ME5A 3PX2A 3PVCA 5LQUA 5HIIA 5EGSA 3BZBA 4GC9A 1IY9A 2PLWA 1XDZA 3K0BA 4RTQA 2OKCA 5K03A 4RV9A 3PFHA 3Q87B 4RVFA 2AVDA 1JQ3A 4OX9Y 4RVHA 3FYDA 5FTWA 5K0JA 2IH4A 3FPFA 3T7TA 2YXDA 3FUWA 3G7UA 5FULA 3AJDA 4IKPA 3FTEA 3E23A 1RI1A 1F3LA 2B3TA 4K6MA 3B7PA 3MB5A 5LQCA 2JH8A 2Y1WA 3G88A 4O29A 5FCDA 4E30A 3DXYA 2O57A 3KHKA 3DTNA 1NV9A 1JTEA 1G6Q1 3KPUA 3FTCA 4RYLA 4E2ZA 2O0LA 4RX1A 1O9HA 5E1MA 1DL5A 1JG4A 3LSTA 1HMYA 3M6UA 4Y2HA 2VDWA 2R3SA 4RTRA 3EVDA 9MHTA 1ZKDA 3OU2A 5EKUA 3NVMB 5EMKA 3SSNA 1H1DA 5FHRA 3G2OA 4F85A 4C06A 2DPMA 4PYOA 4YMHA 1L3IA 2CL5A 4HSGA 5FHQA 4RVGA 3UJBA 5JUWA 1WS6A 3UJ8A 2YXEA 2ESRA 3HEMA 1VIDA 2VDVE 2HTEA 2OZVA 3HA7A 1I4WA 2AOTB 4FS8A 1UIRA 4DZRA 3OE5A 3DXZA 5DTMA 5EIFA 4Z2YA 3DMGA 3HCAA 1HNNA 1PJZA 4FR0A 3KR2A 2IBTA 1QANA 3MHTA 5EKXA 5DM1A 5CCBA 2R6ZA 3LPMA 3HP7A 4OA8A 3UJ7A 3GU3A 1VPTA 3TFWA 5GIPE 2YTZA 2HWKA 3B5IA 4RSRA 3EVEA 5FADA 3EMBA 4HG2A 4EKIA 2JJQA 4OBXA 1WG8A 3EGVA 3T7RA 2I9KA 2PX2A 2CKDA 3GIWA 3GRYA 5EQJB 4OA5A 3CCFA 3ID6C 3AXSA 5BW5A 2NXJA 4HRAA 2FK7A 1SUIA 2WK1A 1O54A 1JQEA 3IHTA 1QAOA 3KPVA 4AZTA 1RJDA 2VDUE 3DMHA 4M36A 3UA4A 4EMSA 5KVAA 2CMHA 2P35A 2ZULA 2LD4A 3PT9A 4DM3A 4YUYA 3HA3A 3KKZA 5K0GA 3KQWA 4E2XA 5HEKA 3PFGA 2EX4A 1G55A 1G8AA 3G2QA 3NDIA 4XUCA 3EPPA 4GUAA 1FBNA 5HIJA 2B78A 3CC8A 5BP7A 3HNRA 3OCJA 5EMJA 3BGVA 3DUWA 3UJCA 2P7IA 1AV6A 4LWPA 4R8SA 4U7TB 1NBHA 1X1DA 2UZ4A 2ZZMA 4PNEA 3C6MA 3TPZA 2PX8A 5ICFA 5K0EA 5LR6A 4EQZA 1UWVA 2IIPA 3CJQA 1Y8CA 3LHDA 2IDJA 2K4MA 4IV8A 1U2ZA 1TPYA 4F86A 3EEYA 5EG5A 3GNLA 3SX0A 3HCDA 2GLUA 3C3PA 3T7SA 1X1BA 4YV1A 3LCCA 1VLMA 3M6XA 3LCVB 5CVJA 4ZTBA 3G5LA 5CCXA 1EIZA 1F38A 5FWDA 5LSAA 5DWQA 3HTXA 2ZBQA 3M33A 5GP1A 3NVKI 5GM1A 3L8DA 4UOEA 4L7VA 4WXHA 4PYLA 2YX1A 5K0LA 4HH4A 1QAMA 3HCBA 2GA9A 3LKZA 4OQDA 2B9EA 1YFJA 4RTMA 1N7IA 5E9WA 5CUQA 4JXJA 3M6WA 5EEHA 4KIFA 3OU6A 2QM3A 5FUBA 4GC5A 3P2KA 5ICGA 4B17A 1MJFA 1L9KA 5LQNA 3BGIA 3TM5A 2ADMA 3PX3A 2P3LA 4QQNA 5E8RA 3DXXA 4FT4A 3VSEA 1P91A 3EMDA 3MGGA 1VL5A 2BZGA 2E5WA 2WA1A 3QV2A 5DTRA 2HMYB 2C7RA 5HIKA 1PRYA 1YZHA 2JHCA 3I64A 2QE6A 3OFJA 2XYVA 5E1BA 3R24A 5GWXA 1YUBA 2AOXA 4MWZA 2G72A 2C7OA 4AX8A 4PONA 3KR9A 4QTUB 1QZZA 1EJ0A 5DPMA 1INLA 5DX0A 3LDFA 3THRA 4YUXA 2ONZA 5E9JA 3MTEA 4ATNA 1P1CA 3LECA 5GM2A 3SM3A 1VE3A 5LQRA 2C7QA 4PCAA 3GRVA 1VBFA 2P8JA 4MTLA 3NWEA 1KYWA 2YQZA 2IDKA 1NE2A 1D2CA 1I9GA 4E32A 3NW9A 4BY9E 4FT2A 1L3BA 4GOLD 2B2CA 4QQKA 5HILA 2QY6A 3PB3A 4E31A 2Z6QA 3ELDA 2PXCA 2I7CA 1R8YA 3LGAA 3P71T 3UJAA 2EJUA 1XDSA
chains in the Genus database with same CATH superfamily
2QRGA 3JAWA 1G6KA 1DWOA 3C15C 4H4CA 3DPIA 4B45A 1PGJA 2FPGB 4F92B 5MGNA 3OOWA 2ZCJA 2PMKA 3DAGA 2XOXA 2CMDA 1T9KA 4QVGA 3IEPA 4P7JA 2JLSA 4D02A 1QLHA 3OFNA 4KDRA 1L6IA 5LLDA 4H7JA 2J0QA 4W5OA 4RJLA 2WF6A 4I50B 2FR1A 4XVUA 5KWEA 1PU2A 4RGQA 3AZQA 5KYUA 3CE6A 2Q6VA 4XXHA 2H52A 3SDZA 4LG1A 1TYCA 1ODSA 3KT0A 3ZEAA 1ACMA 3B1WA 1Q0SA 3FGZA 5T6BA 1PL6A 2B2NA 3WOHA 5DISB 2JFHA 4FGSA 2G71A 4KH1A 5I48A 4AKGA 1V8DA 3ILHA 4JA2A 3HVIA 3P9RA 4JFRA 4EJMA 2RHGB 3I73A 3QZUA 4XDZA 1V71A 4L5JA 3QX8A 4TKUA 3BMNB 1MABA 2EBUA 1XD2A 3UK0A 5JH7A 4LKOA 2O23A 1M7BA 2C04A 1SA0A 2KB0A 4K6CA 5CXXA 3R9KA 3TNYA 5CFQA 1HSOA 1TK2A 2BJHA 3FETA 1L4KA 1ONPA 3ED5A 4KWCA 1J97A 4LX8A 4YROA 5FTMA 1I1HA 5I7SA 3S68A 2YJTD 4TQGA 4F1KA 2Y27A 3HVJA 3TBHA 3U4GA 4BMVA 5ISMA 2ZBPA 1KF0A 5C3MA 4EG7A 3CY6A 3WDMA 2X9QA 1PFGA 1NJ5A 1AKTA 1CD5A 3C6KA 3TJRA 4JYZA 3CUKA 3HK2A 3VKWA 3EB9A 3HCEA 4O4JB 2RI1A 3GJZA 2WY2D 3S29A 4L15A 3WK4A 4RESA 1KZYC 3QVOA 5LU8A 3S8EA 5C7OO 2ZT8A 4LOJA 5JSYA 2Y1OA 2J0VA 3IAM1 3K4PA 3KUUA 4UNNA 3WOVA 4C4TA 3I23A 4DQUA 5TX7A 4UM7A 3GN2A 1O6ZA 2C4HA 3C3YA 2IZOA 5FQNA 3OQJA 2OFFA 1FFCA 4W6QA 4AC9A 2IH2A 1GXSA 3SXJA 4KAJA 3D2CA 1D5WA 5KIAA 3D59A 1LBSA 4HGOA 3DKRA 5KNBH 4N9WA 1C4WA 1R6UA 4ENPA 1YVEI 4HC4A 1LF0A 2PQ2A 3GEDA 2MJLA 3KB8A 4O0MA 4W7SA 2JG3A 4YYEA 4ZT5A 1DO2A 2ZYAA 2VTVA 3MEQA 4MKHA 2XNSA 2WU3A 3RYIA 4QOSA 5J9FA 2OORC 1ICEA 1E6KA 4IX9A 3T5TA 4AO8A 4HV4A 3FOEC 3OZEA 2CV1A 1IZYA 2V6FA 3HE3A 1Y1KE 3F46A 1LVUA 2JFVA 3ZEIA 4E5KA 1S1MA 1G41A 1K06A 1TA4A 3RJMA 5AK5A 4J2OA 1L7XA 1JNYA 13PKA 2I2XB 4ZDWA 2BFCA 2OBFA 3R3JA 4JKYA 3C97A 4ENTA 2JFZA 4GI1A 5C4IA 1L4MA 2NU6B 4IINA 2PR7A 1MMFB 5L53A 1UZLA 5KOHB 3MTJA 2IX3A 4MGIR 1RI2A 2Z1NA 1XAHA 2JLVA 3DJFA 4IIEA 3IMEA 4LHXA 1KP9A 1I33A 1XEFA 2ZR0A 4D0GA 4JB0A 4IHJB 4EGCB 1CJKC 1KAGA 2PGDA 1LDBA 2O14A 4EP1A 5D1HA 5JJIA 3DWGA 1BE6A 4BQPA 3GZNB 4I81A 1IPHA 1U3GA 3F7NA 1YR1A 4RF2A 1JR2A 4NOMA 1TUGA 1GPJA 5FBHA 5KCMA 4B43A 2NM0A 4PO9A 3UXHA 4ECEA 5FPHA 3ZU2A 1N6HA 1CLUA 4P6VF 1X0XA 1XOIA 2BGNA 3PC6A 3B5JA 4NCKA 4GP9A 3WNVA 4R83A 3WMGA 2ZSDA 1EG7A 3C4QA 4OHBA 1GN8A 1T26A 3UYKA 4CCSA 3QVVA 4RTJA 3ICEA 4HK4A 3ESCA 2OENG 1VL2A 3NOQA 4MIKA 4EB3A 2B25A 5TDHA 1MVNA 4Z49A 3LUBA 5E1DA 4KXLA 2QEQA 3GFQA 2EHJA 2A5LA 3C8UA 5TLSA 1GRRA 1XSEA 3PQ6A 3R0XA 4R1UA 4US1R 1C7EA 4BATA 1WB6A 3FWKA 4OL0A 3I52A 3CR7A 1EZ4A 4Z54A 5JCJD 1IN7A 2FQ1A 5JNVA 1M34A 1XKXA 4DR4B 4EUEA 2B98A 2WWHA 1A7JA 5LWQA 1CR6A 5IJ0B 3OPMA 2QLFA 2P6UA 4ZVUA 1EGVB 1ZD8A 1RAHA 3C6YA 4MMYB 1CUAA 1ULTA 4U39A 3MUEA 3LBIA 5CVEA 5AW4A 5LM3A 3W5CA 3W7AA 4WZAB 2Y0EA 3ROEA 3ENWA 1FFGA 3AHJA 3E5NA 4R81A 4MUFA 5GIOE 2PUGA 4G0UA 3H7IA 5KZMB 2JAWA 3NWOA 1M5UA 4MW1A 3R7DA 4E7OA 4KQJA 1CZOA 2W4IA 2XMRA 5IBPA 4UJ3A 4HYQA 2AA3A 3BGWA 2HQOA 1BN6A 4J29A 1G5RA 4JJAA 3JD3A 4P7BA 5EE5B 3AI1A 4G1BA 1ECCA 1RM4A 1H2FA 1MO4A 4EF4A 1K89A 1E3EA 2IRWA 1GLNA 2WUFA 4UVDA 3RIGA 1UMDA 3GJQA 3ZCSA 2POCA 3VVLA 1LB1B 2WT9A 2I29A 4D45A 2GNPA 4NMXB 1NVMB 2I0FA 2IHTA 4LTNA 3G8AA 3P20A 4DIUA 2IUFA 3Q8KA 1SXPA 1WHTB 4XWGA 1GZ3A 4N47A 3UKOA 3ZTTA 1NXPA 4WACA 5BSEA 1CNMA 4JJKA 1MAAA 1TKCA 4IO1A 1UODA 5KSOA 1DDGA 2CDNA 2NXCA 3D6HA 3VYVA 4QGSA 1N6PA 2FYTA 1U2TA 3BWEA 3HUEA 1C9KA 5JG7A 3PLAE 1PAUA 2HK7A 2FPIB 2LPMA 3L8CA 5JJBA 2E6UX 2FPIA 3EC1A 3LT0A 2WU0A 4I4TA 1G7SA 2Y3IA 1OW3B 2HUNA 2YHIA 1JPJA 2OYRA 3D3KA 4P2BA 3LL7A 3RHTA 2P9ZA 1J8QA 1I3OA 3KDSE 1ICIA 1V9CA 1XCMA 3KOMA 2I2DA 1MOSA 2WU1A 2YMLA 4LZJA 1RKQA 3OCZA 4MS4A 4CPDA 1JHPA 2QS9A 2A8YA 4OSEA 4BVFA 4BRSA 1KYTA 1W47A 2ASEA 4CF5A 1ML3A 4U9UA 1QUEA 1W4BA 1MDBA 4BP8A 1D0IA 4NDNE 3VHXA 3IDOA 3G0CA 4EG8A 4NP6A 1V6AA 3ND9A 4IG9A 3DTVD 1YS9A 5SZJA 5G41A 2A58A 3THOA 5LQKA 2GAJA 1A76A 4Y30A 1OWOA 1Y6ZA 2IZZA 4KE6A 2XZLA 2V7EA 3UMSA 1D2RA 4CEJB 2XYPA 1XZKA 3ZNOA 4NDZA 2AXNA 2DX7A 2HNKA 3LX5A 3P0JA 4X9XA 1CF4A 3V7WA 2IJGX 3DE4X 2CVOA 1GQYA 4FWTA 1DU4A 5LB4A 3H1BA 4PYQA 2IH5A 4GLOA 4CV3A 4GZ5A 4B3GA 4L28A 4OP2A 2IZ5A 3A2NA 1Q3KA 2I67A 4EO9A 4EUSA 1MPTA 1BQ3A 2CXSA 2EC5A 1TF2A 2FA9A 4I19A 4KVZA 3ZDEA 4DR7B 4M1KA 3KR0A 4HLDA 1X9GA 2L17A 5HCNA 4MVXA 5EQFA 3RTEA 3T5CA 3GA7A 4N40A 2ZBGA 1SIUA 5IN5A 3WL6A 3N3AC 1LVHA 1RZUA 3HLKA 1P77A 4HFMA 2MR6A 2R97A 3VH1A 3OKCA 3TFOA 1IHXA 4OXXA 1EX6A 1I01A 1RM5A 1CIPA 2PTHA 4ZYLA 4CXMA 1H2HA 5B3JA 3ED1A 1A1VA 1U3UA 1CYDA 1DXYA 3L7CA 1N2HA 3TS1A 3FUCA 3VTAA 4EVQA 3IA7A 1II8A 4UFOA 4HS9A 2OZLB 4N4AA 3S40A 3CH4B 4TRMA 3I8OA 2BM1A 3R6LA 1G3MA 2GRUA 2XLCA 1GQFA 1YTLA 3SKXA 1Z0FA 4MWSA 3TOSA 1K0FA 1U0RA 3IO3A 4RGBA 3HZZA 2SECE 4F04A 3CO0S 3S8MA 3I2GA 5HFAA 3B1FA 3ZE2B 4FHZA 3RSCA 1FK8A 1O5OA 2ZANA 5D5QA 5DGDA 4ZJPA 5CBPB 5L3SA 1USUA 2UVQA 2PGLA 1A5TA 3LX6A 4XVQA 1K3TA 2NO0A 1WXXA 3GLSA 4RPKA 3ZWMA 3T41A 2X7HA 2ONKA 1ZI6A 2ECPA 3F6PA 4IZ6A 4WH0A 3ZI4A 2O2HA 4WEQA 4RTQA 2YWHA 3KWLA 3S1AB 4GZ3A 4RV9A 3D6JA 3DZBA 3ETGA 1A88A 4NH0A 4QOJA 1X2BA 4AZ0B 2IYZA 4YRCA 3IAS1 5CK4A 2YHAA 3M2TA 4RKYA 3ROKA 3N76A 3UGKA 3UV3A 3HUUA 1E4EB 2P9GA 1Z0KA 5TS2A 4RHCA 4FJ0A 4DKXA 4BKUA 3FUWA 1NDHA 3AEXA 3U1BA 4F93B 5C2JB 3FWNA 2PKXA 1XCPA 3NFRA 1E0JA 4Y98A 5CITA 1M1YE 1WKVA 1LS6A 1JZSA 2JFGA 4HQLA 3A4LA 4GMKA 2Q8PA 4O29A 1XXHE 3WP0A 1B1CA 4ZRDA 4CG1A 1PQWA 3FTCA 5DHSA 2VJQA 2J31A 3F6SA 1IG3A 5B1IA 5TJHA 1JS1X 1U8AA 2RHBA 4ZPJA 5H68A 3LP8A 4ND8B 1FBTA 4ZWNA 4ZGWA 1T3TA 3MHPA 3LQQA 1NUUA 4GS5A 2M6KA 2YXBA 2QGNA 4X1IA 3MTBA 1EE2A 1JFFA 2AUTA 2P3SA 1K3UB 1M2OA 3ORSA 1REQA 5EKUA 2X0FA 1D9XA 1QLWA 1SBZA 1UQTA 5C31A 3O1LA 1QB8A 1T2CA 2BKEA 2IEDA 2QUHA 3A14A 2G80A 4FHGA 1KZ4A 1KH3A 2UUOA 3HEMA 3D4LA 4XOIA 2RH8A 1KETA 2B5VA 4YIHA 4D9NA 5E3HA 1CRWG 4R2HA 1SCIA 3D2BA 5TGDA 3ZDQA 5IXYA 4B4UA 4YASA 3WIBA 1NBAA 4QGHA 4ZVVA 1H8ED 2RC6A 3I0NA 1PNOA 3LX4A 4H2DA 4DIBA 3S8YA 5SZIA 221PA 1OX5A 3C7TA 3KKKA 3MN1A 4MUGA 1B8VA 3SC2A 4FEEA 2HTFA 5J5AA 1BE1A 1QXSA 3MBKA 1PDOA 1P0MA 2H59A 3EVEA 4OHUA 5LA6B 3EMBA 3U3DA 4EKIA 3U5TA 5K3DA 3AW8A 1JAYA 4AUMA 2PX2A 1QHGA 1FFDA 3ZNNA 1E2HA 4OA5A 1R8QA 3CCFA 1AXEA 1SC1A 1T36B 1JDVA 1T9CA 1QIKA 3A6EA 1U2SA 2RCNA 3T38A 3BB4A 2G0NA 2IUUA 1C1YA 5FFMA 2VDUE 2PLRA 2CVZA 2Z57A 1YB5A 2M98A 2IXFA 5B57C 4NQZA 4TTRA 4MMXB 2GAOA 3SZRA 1KMHB 4CCYA 2QQEA 5AOVA 3KL2A 1G55A 3IUEA 4FFDA 3RO7A 3ZBPA 4BWGA 3VKFA 1V5EA 2AQHA 4XM1A 4LHWA 2VRBA 5ALNA 1MEEA 5EIAA 2A92A 1HORA 1Z63A 5ALGA 1MW9X 3L6CA 2LVBA 1G2IA 3SZOA 4U6NA 5JALA 2QZPA 1AT1A 1NOJA 1UEIA 1BROA 2O54A 4NMMA 1EVZA 2HL6A 4DPKA 4GGOA 1QFXA 1Q11A 4NFLA 4QJ4A 4WBNA 4W5RA 1L5ZA 3MXOA 1L5WA 2Y1EA 4JMPA 4YN3A 2XNJA 5IABA 4DYDA 3PXUA 3LCCA 1R0WA 2CYBA 3GJ6A 1QYWA 5CCXA 1XXHB 4ZHSA 4BB5A 1EWQA 3DJYA 3WGLA 2ZBQA 1W9MA 1S3SA 3WGYA 3OIDA 2WKQA 4KX5A 2G28A 1JA9A 5DHAA 2PSDA 5FDFA 3PPXA 4OXQA 5TIIA 4RYDA 2YX1A 4HH4A 4OGWA 2FSSA 3ONEA 1BYIA 4NBRA 1QIIA 2H63A 1JW9B 1YZFA 2GM9A 3RC1A 1UM8A 2FQXA 3C43A 5FWXA 1E1NA 3NH9A 3F7TA 5FUBA 2HPHA 2JDID 2ZE5A 1NR7A 1MIOA 3UY4A 3DMYA 4WNAA 2HGZA 4B7UA 1Q7RA 1HQYE 1R0KA 1KQFA 1B7GO 3RSFA 1F2UA 1B8NA 1U0TA 4YRTA 1WPGA 4CLDA 3ESRA 3TLAA 1CZNA 1YKSA 3ZD8A 3K9CA 1P18A 3LYLA 1FNDA 1JWAB 2FDRA 1XMVA 2G1UA 1GU7A 1HT1E 4JBIA 4WOCA 4WXPA 4CUKA 6REQB 2YKGA 4MCJA 2IXEA 2NZ8A 2EAUA 4GL4A 3QITA 2HJWA 1X1TA 5JAPA 3KUXA 5DPMA 2OP0A 3DSRA 1F8UA 5BWOA 1PO7A 4QOIA 5HRAA 4Y2VA 1YB4A 4A7PA 1ZGHA 1P1CA 3GP5A 3SM3A 1GO2A 4IIJA 1LBHA 3PFNA 4CLHA 3LPCA 1BHSA 4XVCA 3FSRA 1NU8A 2ZYIA 1EFVA 1KYWA 3KYCB 4HDAA 3SJZA 1A8HA 4EECA 1PEYA 1XP5A 1Z9BA 4TYNA 4PNPA 4AP5A 1Y7LA 4OHRA 3KAPA 1AO0A 2VNIA 3DYBA 1FDRA 5J1TB 5J23A 5M3BA 1OX6A 1C0IA 1OFTA 4NXMB 4G84A 1XDSA 1Y98A 2VCEA 2P8SA 1OA0A 4PC7A 4V0RA 1Z8NA 2VF5X 3DZGA 3GHHA 5ESXA 5E2IA 3S2EA 3SDSA 1GA4A 3U7JA 4YAWA 5JRDS 1JJIA 4H17A 2A5GA 2DQZA 3HB0A 4M22A 5JNLA 4ZTUB 3CKKA 2DHCA 1IAQA 4CL2A 3VM6A 1JJAA 4RLHA 1YBMA 5EJ8A 1X92A 2PO7A 4INZA 2OHVA 1JVBA 1VM6A 5EPOA 4Q3AA 4GZMA 3N6XA 1FJHA 3C8ZA 1SKMA 1MW8X 4BPRA 2ZEJA 1HXHA 2YJZA 2JK1A 3M4JA 4WXRA 3UKDA 2XMCA 4IOLA 3R7BA 3WLIA 1M6YA 2ZRQA 1X74A 4X97A 4XB6B 2Y8EA 4CFSA 3TD9A 1WSBA 1XTZA 4G5XA 4LSGA 3KJEA 4F8EA 3EVFA 3PXCX 3CJTA 1NDUA 3I8SA 3DLAA 3NAQA 3B6MA 3HYTA 1C1XB 2YMPA 3AM5A 1P5RA 3OESA 1ECLA 3VDMA 4GPD1 3W5AA 5A7FA 1BHQ1 2P4EA 4FCCA 3LC1O 1PK7A 1MNAA 1OH5A 2P65A 1Z35A 1V6SA 2J9GA 3H11B 2E4YA 3R20A 5I8ZA 1Z26A 3C5CA 5FTKA 4WHMA 1UH5A 4E09A 2V3CC 3RS7A 1GILA 1SQ0A 2GMWA 5CURA 2B4AA 1OUMA 1GA6A 1Z25A 2F3TA 1TZCA 4O4IF 3WXBA 1BXGA 2XH8A 1NSYA 3WFIA 4HTAA 4C4OA 2Y0PA 4M60A 4BNKA 1CHNA 1NYLA 4PRLA 1OX4B 1YQEA 2O2JA 3WK8A 4M98A 4QDJA 4TTJA 3T1NA 1V5WA 3GNTA 1GPLA 3VH3A 4JXKA 2VYCA 2QX7A 4LGYA 1LPOA 4L5BA 4C2UA 4MWDA 3AF2A 1EDOA 3D5TA 5JSZB 4I1SA 2I99A 5L4SA 5U4XA 3TM4A 1FP2A 5SY6A 5LJIA 1W6UA 2Y9PB 3LP5A 2ACVA 3PGKA 3EIUA 5EE1A 3BC1A 2EL9A 2LIPA 2WVJA 3AUXA 3N5CA 5AD1A 2CZCA 4Z1MA 3DLTA 4YR9A 1SBYA 1XHEA 1E5QA 3I9FA 5I9NA 2FZKA 1VPDA 3DPSA 1SIOA 1G8FA 1ULBA 2CLCX 3BHNA 3RYIB 1M0EA 1Z22A 1PQ4A 2PD4A 4NG5A 1DOZA 2XQGA 3FTDA 4B2YA 4NEQA 1X7HA 3CT6A 3UTCA 3B1VA 3WL4A 5JXWA 3CSDA 1RDFA 3LOPA 4UVHA 3TQSA 4S04A 4G2TA 6LDHA 2BUAA 4G9EA 1GJRA 3FVRA 4Q6WA 1DX9A 4D26A 4ZJUA 1V8FA 1T3GA 4BZXA 2A6PA 3F1KA 3RVKA 1TM5E 4AKHA 2PVCA 2C2OA 3AU8A 4ZU1X 1E4YA 1Q7BA 4CKCA 2HR1A 2NUAA 2V5VA 2FI1A 2GZRA 2VJBA 1W2HA 3F4KA 2H1HA 3CVJA 4H35A 4MGHA 4AWBA 4E5SA 1B0AA 1GAQA 2P40A 3GGPA 4QYIA 1IUKA 2H2AA 2PS3A 2O8CA 3MYRA 1ZW1A 1RD4A 4MI1A 5BSVA 4BNTA 3OOYA 3RRMA 4YA6A 5A3QA 1CBUA 4RE5A 2A7XA 2JLBA 4H1UA 4PZ9A 1YJQA 4CEHA 1BGVA 1KEZA 5A4IS 4E46A 1YE3A 4E1BA 4LFAB 2YASA 1WCYA 3EQ6A 5CX1B 4ZVKA 4F1WA 1KJ9A 3P9KA 2VJOA 4KI7A 5FI3A 1MR3F 4B2LA 1E1QA 1TUBB 1ZSVA 5CNIA 3KT3A 4IDHA 1TUBA 4Z9YA 5T67A 2PU7A 2GEKA 2W9XA 1S2LA 4P7KA 5BN4B 5EIBD 4E3ZA 1I51A 2D6FA 1PJSA 2YC2C 4NZOA 3NMUF 5LC1A 5JECA 5DNDA 4HZIA 3UUGA 4GH5A 3HGQA 2NYVA 2A1IA 4GZ6A 1EFPA 1TM7E 2FLVA 2J09A 4FX5A 4QG3A 3SBOA 1W8IA 2PFGA 4LDJA 3BFPA 4AUNA 1C4XA 3SLKA 4B81A 4BGUA 1T9AA 2DHDA 4U7PB 3U56A 2C5LA 2BSQA 1KQOA 2NV6A 2P2NA 1T4MA 4X61A 1RHJA 4OHFA 1XEAA 2YCBA 5BOVA 3EQ2A 1VKHA 4R1LA 2W70A 3V1TC 2IYSA 4C30A 4LWZA 4HN4B 1U3FA 2AUMA 5B2EA 4M1TA 3OFSA 4WADA 1LJ8A 3N2YA 3A1CA 2YXPX 4U9HS 2WFLA 2HA2A 2OYCA 5KAMA 4B3CA 1X1AA 5HOQA 2YY5A 1KO8A 3J80A 3GJ7A 4PGFA 3EWSA 3KZOA 3F2VA 1AXRA 1G20E 3ZLJA 4X44A 2DLNA 1TQ4A 3I0ZA 5IU6A 1CRQA 4AIRA 1VJ0A 1J9GA 1UOOA 3CF4G 4C76A 4CETA 3AVWA 3ZPXA 1MT3A 4JVNA 4JI5B 1YJXA 2XVZA 3DV0B 3QE2A 1C3XA 4C04A 4D9IA 3CRNA 3I1FA 2H4ZA 1VLHA 4LQCA 5AI0A 3I3SR 5DLEA 2UUCB 1Y5LA 2QBYB 2JASA 3KQYA 5AVJA 1YJBA 3DYIA 5I4KA 3A36A 4GI7A 4ZICA 4P38A 4ZK6A 4D4LA 3EA4A 3AEQB 5HR5A 2UKDA 4CKEA 3IDQA 3L8YA 3UK1A 1KJNA 4RTOA 5ALDA 1DKQA 5F1YA 2QV0A 2OSVA 2JAXA 5IX8A 5IAGA 1EIWA 4PZEA 2OK7A 1L5LA 4JLBA 4FFSA 1IAVA 2X9LA 3EYAA 3ES9A 1WPQA 1Y3BE 3GXBA 5EY5B 3E9QA 4XVRA 1C9DB 4DEVA 3UWSA 4DJ5X 3LT5A 4WERA 3FB1A 2PKQO 1Z4PX 1ULAA 3D8UA 3W1WA 3WYFA 2OLJA 1Z33A 2R6DA 3P52A 5CAEB 1RRKA 2CEAA 2P3OA 1TCAA 3WGQA 2ZR9A 4C43A 3GG9A 1UBJS 3K8QA 3NRCA 3LW8A 3QF4A 4MJXA 2P3QA 4P2GA 4XSGA 3STTA 4ZCTA 4B75A 3FXAA 4WN9B 1WZCA 1MVOA 1IONA 2WU4A 4LQ4A 1CZHA 4OQNA 3UB4A 5C8XA 4XWWA 5DHFA 2WT8A 4JLPA 3IL2A 1NJSA 4I5DA 3EZ6A 2RH4A 1AU9A 5EXEA 1YKFA 2QB5A 2E6KA 2Z6VA 4XIJA 4YRMA 5C5IA 2YHBA 4J0IA 3GVIA 2GFIA 3OQPA 2KHZA 1ML4A 5BNWA 3OOSA 3ANSA 3G2NA 1O08A 4U3JB 3MINA 5JFTA 5CDUA 2D0IA 2OM2A 5DXJA 1GIAA 4V0OA 4OBWA 1HE3A 2HQBA 4CKZA 1S4QA 2ZSJA 4B6JA 1NVAA 3M1LA 1UMBB 1XDWA 1CJVC 3UMYA 1PLJA 1CKEA 4MIOA 5D5HA 5ALRA 2IE0A 3HZHA 5E0KB 2ZWIA 3ESAA 3KQOA 3FOFC 1ODLA 2IXGA 3E3LA 3E4CA 1JFRA 1LI7A 2AV6A 1CUCA 4DRZA 2VJNA 3PF9A 5IYZF 1HI9A 5T64A 2HHJA 4EKGA 2EP8A 4BN4A 4INPA 2R44A 2DBYA 5TE9A 2YWEA 4LGMA 2FF7A 5T7BA 2D59A 2UYQA 3DMDA 4UE3S 3ZDYB 4HJRA 2IVFA 3T5AA 3DM5A 4YX9A 5CDGA 4AN1A 5JZ9A 4D4KA 2O2CA 2FMIA 1NQVA 1M9NA 1D9ZA 4MA5A 2DJIA 4HBGA 4LRTB 4B3SB 2F4NA 2GYYA 2Y0BA 1CUEA 4OMDA 4G0WA 4JQSA 1SOUA 1XLTC 4I50F 3CX7A 1SU7A 3PE6A 4LZPA 2PTGA 3DR5A 1J0BA 1A4RA 2W2LD 3AM4A 3E27A 5TV2A 4M0MA 1GFWA 4ZD6A 1I36A 3DLIA 1ACLA 2C7GA 5BSRA 4YJGA 1H1LA 2MSWA 3V4RA 2K7ZA 3GYBA 3OMLA 2G63A 3IT1A 4O5OA 3RQIA 5BSGA 4POAA 3AR5A 2A78A 2ACKA 4TTPA 1ORRA 1FDWA 5E38A 3A4MA 2V0CA 4U7WA 3TZHA 1LTHR 1UKYA 3KJNA 2BM9A 4P08A 1RM3A 4FCTA 2ZWVA 3G2MA 2XHEA 1W4RA 2QRUA 1PJBA 4YBRA 4BV2A 2Q62A 1X7YA 3O4RA 4R84A 3E82A 5ALIA 3C14C 5B7QA 5ADHA 1AB5A 3DBLA 3EZ7A 1VHTA 1JYSA 3ZKWB 1SUSA 4BQOA 2P0YA 3GLHB 4URUR 5CB4F 5KUTA 4CF4A 2FPGA 2PQ0A 4QU9A 1QS0A 3OAAA 1UFQA 3OUZA 1QS0B 2C5SA 2RJ3A 1Z88A 3VPXA 1MDFA 2V9PA 2XQKA 3HY3A 4MLZA 1UZMA 4R2JA 3SLGA 3W4IA 5IZCC 3RYCB 2QV7A 4GRDA 3H2SA 5ED4A 2YVQA 3PNYA 3H2HA 3EFBA 4GPAA 1CE8B 5HM6A 1EESA 5AM5A 4AKTA 1J70A 1G98A 1PLLA 1Y7HA 2H4FA 2WFAA 2EP5A 3IHWA 3NHRA 2N46A 4GHWA 1RWOA 2Y93A 2WWRA 1KVQA 3BK2A 1KDZA 3AG5A 5EL0A 3T7TA 5AVVA 3ZHQA 4OG2A 4IHAA 3ODPA 2YH2A 2F8SA 1QIFA 3OZCA 5AR1A 1IMJA 3V46A 1VA4A 2BGMA 2C8JA 3DEJA 4DAOA 1RI1A 2FQQA 2C58A 3E5MA 3I2KA 3LLSA 4I7EA 4JCCA 4AP9A 5IUKC 4BTVA 5KX5F 3GLFB 1KDVA 3I1IA 2X7JA 1D09A 3BJZA 4E30A 1IJFA 3EUWA 3TG2A 4JWTA 1G6Q1 4YPOA 2X1HA 3ABRB 5ADWA 4RX1A 1JIVA 3AR9A 5D3ZA 5E4YA 2VHTA 4O2BA 4QAQA 2AD1A 4FIZA 5JMTA 4S0XA 2R8RA 3QVUA 3EVDA 1UZAA 3LMKA 3CQ9A 3VSCA 1J49A 2I3GA 9MHTA 3MTQA 3OC0A 3SQOA 3W05A 2ZE8A 3I6ZA 4LZWA 1SG0A 1H1DA 4CMEA 4NYIR 3AM3A 4AK9A 1VJGA 4C22A 4ONEA 3HDYA 2JIPA 4J9UE 4LC9A 1IXZA 2BDEA 3NYRA 3VNSA 3KSAC 3L41A 3HA7A 2OZVA 4G0ZA 2NVUB 4DZRA 2JIOA 3V4PB 1TEZA 3HDGA 1EK5A 1PR5A 2HCTA 3MJFA 2AMVA 4HCJA 5TQVA 1XRNA 3O8BA 1F0NA 1JXMA 2DFTA 2Q5HA 1P0CA 3KR2A 3KS9A 4KVGA 4QEKA 2VPPA 4X95A 3ITDA 2OK8A 5LNK6 1ZWLA 5AI9A 3L04A 2P9QA 3OWXA 2HOQA 4Z9FA 2WJZB 4M7OA 2GX6A 5KCZA 2XA9A 2BTEA 2B6NA 1VJCA 3M5PA 5FLXA 4B6QA 4WZ6A 3BN3A 3QEAZ 1W36D 4G2NA 3IQWA 1IBMB 4CQLA 2PUCA 1Z45A 3MFYA 2VP9A 2AX3A 3NOOA 3VNAA 2IS4A 3LHFA 2CLSA 1N6RA 1K4MA 5IHPA 5IMSA 1JSLA 4IZHA 1R50A 4RHUA 4YCDA 1U9IC 5J2TA 1WD5A 3GJ8A 3HJRA 4EMTA 1KFBB 2ZSFA 4DLZA 3RS4A 3UV6A 2A5FA 3KKZA 4IXNA 4DIDA 1GGVA 1RTTA 2OWDA 8AT1A 5INTA 1CRZA 2H1CA 3S1SA 4YC7A 1OZFA 1RYEA 3QG5A 3OQ1A 4MZXA 3R7LA 4X8MA 3ZHZA 2YJNA 1IUPA 4KV7A 2JBHA 3AEKA 2H9IA 4PPQA 1ZAYA 2EVWX 4FPXA 4BB6A 2JLXA 4QBIA 2GXQA 1H2RS 4AQYB 4JI0B 1M7GA 2GSWA 3OLXA 2HPAA 4TWRA 4MR7A 4HI0E 3A6PC 2ZJ8A 4KYIB 3QI2A 5C8VA 4EX7A 1T9GR 2WSSA 1ZCFA 3HXTA 2DMRA 3TSZA 1TVEA 1VRWA 4EHHA 5CVJA 3UO8B 4HEJA 2NZUG 4WOJA 5D3QA 2FMKA 2LR0A 1PGNA 3B3AA 5JPCA 3KKNA 4JR1A 1IOLA 5GM1A 1RFGE 5KHOC 3Q3CA 2VHYA 4DRXA 4O59O 5JD4A 2PUAA 1I13A 5EYPB 2C3OA 2I4IA 1QYIA 2ZJYA 3EG9A 2YJ6A 1LKZA 2KLHA 1BCRA 1C1DA 4GLFA 1BX1A 1VRVA 2XTZA 4QUGA 4X1KA 3T5BA 3MK31 1A69A 4DEYA 2FW8A 3N1UA 3RS9A 1Q0ZA 5KJFA 3IAM6 5B64A 4YRDA 1HX7A 4OH7A 4X1YA 1FFHA 1MIOB 1MA3A 3EYWA 5CFPA 4BNXA 4WLNA 3NBMA 3OT4A 2G67A 1DC8A 2F43B 2H4XA 5CJJA 2WICA 3OEHD 1CFZA 3KHUA 2IWRA 4B3TB 2IHJA 2CXUA 1SU4A 2AOXA 2HAEA 3F4BA 3Q7SA 4L85A 5EP1A 3H5VA 4M1WA 4YUXA 3LBHA 2ILVA 4PO8A 5GM2A 3E9ZA 3EWNA 2Q1YA 5BNIA 2M6SA 2OXCA 3OD5A 5D3MA 4YWJA 5CA1F 3NHBA 1S7CA 2XXBA 5JXHA 2BEWB 3WYCA 4GMGA 3FYUC 4NLLA 1Z8FA 3AOEA 1E5TA 1F9EA 2B2CA 3C7CB 4HGNA 5IC5A 4PWZA 5IK2A 4F3CA 1WLYA 2Z6QA 4N01A 3PJDA 1AM4D 4L4ZA 1IZ7A 1L5MA 2MIIA 4C2AA 3UANA 3D2LA 4BBJA 3RAEC 1ONOA 1XJQA 3JQPA 1JRLA 4R01A 4RK7A 4EY6A 5KSZA 1XNGA 1OTHA 1W4LA 1NVEA 3W2GA 4DLWA 4BOYA 4FMCB 5EJ9A 1U6KA 4TMVA 3ZW7A 3VSDA 4JL6A 4TLDA 3BGSA 3DVSX 4KXXA 3RF6A 5F23A 5MN4A 4KRFA 1TLFA 1ODJA 3TZQA 2WWFA 2Z2IA 3IFSA 4TSRA 1IQUA 2BR3A 4LA4A 1SUFA 4PLVA 5FUVA 5KNDH 1JFLA 4LYDA 5JEEA 2JI4A 2HJSA 4E70A 5HUQA 1A9PA 1T0IA 4KDCA 1CEEA 1WUJS 2DBVO 2V9CA 5FO0A 3RK1A 1M3SA 1Z7BA 3ZUPA 4Q9NA 4N49A 8ADHA 5KO2A 3K9NA 4MHSA 2C9BA 2ZWMA 5AKJA 3D3NA 5EUQB 1UP6A 5ALTA 3PQEA 5KAPA 4M9CA 4NBSA 4B71A 5JISA 1YRHA 1SHJA 2D5CA 2YN4A 2IYEA 5JADA 3Q3IA 1D1TA 1N2JA 4UUBA 4X0EA 2YOHA 3I5XA 4DJAA 3DMTC 1ZVKA 1ZR4A 3CTPA 2CCGA 3FMGA 2I78A 1WQ1R 2QGFA 1VC2A 5D00A 2OC4A 1P2BA 3HPRA 2RBEA 5FV7A 2GZ3A 5EZQA 3JVIA 3OTIA 2EFDB 1EGQA 1NLMA 3QEBZ 1UJ2A 4EWLA 4LVOA 3H05A 2V65A 1P5JA 4F84A 2OQIA 3L6DA 4HB0A 3TR6A 4IS3A 3H13A 4QSMA 4ROSA 1OIVA 1XQ1A 3U6BA 4YK7A 2CNNA 2HU2A 2EKLA 5SYMA 5IC6A 3K5WA 1JHOA 2HRDA 4BAZA 1YS7A 3K32A 1E98A 1IN4A 3HZRA 2YDYA 3QEMA 3S99A 3T3GA 2QRJA 1EDBA 3V8NA 5JS8A 2WIDA 2QT1A 1F4VA 4YYZA 2EIHA 2V3VA 1FTSA 1XEXA 2ZJ1A 1V96A 3H8JA 4XM2A 2X0EA 4FMBB 1LQUA 3O21A 5B7GA 2ID8A 1JI3A 4FHFA 2XZDA 1Y3AA 1IJEA 2YN2A 1SELA 3ZHVA 2ZWOA 4KBYA 5LP6B 2FFRA 4G0NA 4G24A 3TZBA 3RUFA 2PS9A 4WJZA 5CB8A 1HDEA 3S4YA 3AEUB 1FDIA 1GZDA 1Q6ZA 3UHFA 2ACWA 1XZMA 2ZW9A 2AE1A 5JCOC 2WJYA 2YFYA 1Y7IA 5K2MA 3GLRA 5IBQA 3BH7A 4JBLA 4RVNA 1F8FA 3GVHA 4R6XA 3FM9A 1IJKA 2QMYA 3C8HA 4FGLA 5TS3A 3VMFA 1RKXA 2CBZA 3NBAA 4BNWA 1PF7E 3CWQA 5BOSB 3L40A 1RKUA 2GTIA 4Y6PA 2W2PA 2XMZA 1AN9A 2WHEA 2HUPA 1OXBB 1XVLA 2E4XA 3CRVA 4YGXB 2O3QA 3FZNA 3A10A 3CVOA 1O6BA 1QF6A 5A0TA 3PQDA 1P19A 4ZXFA 4LMBA 4TT3D 3E1KA 4MVJI 3O91A 2RHTA 1SA0B 1YK1A 3M4YA 4Z1OA 2Z1MA 3ABOB 4EB0A 2FZVA 4RVUA 5A6SA 3MF4A 1FMFA 4GE3A 1NLYA 4B73A 4EY8A 3E9DA 3LRXA 1SG6A 1XZEA 3D54D 3AUFA 4ZQCB 1QOQB 3MWLA 3H11A 4GGPA 3GWZA 4HX5A 2W8BA 4LOAA 4CLRB 3RHFA 1AMUA 1GNPA 5AW6A 3C41J 1XA4A 3KPJA 4FCWA 1HNZB 1TADA 3O31A 1CK4A 2H08A 2J45A 1FMJA 1JQAA 3HFRA 1ZK4A 2A0YA 2ZYTX 4M4SA 1Z8HA 2R8YA 3SJCA 5DLPA 1RZRA 1ZMTA 2ZIEA 2X0NA 3E9CA 4Z0PA 5TSDA 4KIGA 2ZS8A 2WABA 3QLVA 1MO3A 3JVDA 4NAUA 4R8RA 4Y1RA 4CMEC 1N7JA 3IP1A 4I4TB 4EHNA 3QW4B 1JSXA 1GZVA 3H5OA 5DKFA 1KMMA 1PVDA 3OZAA 1CF2O 1T25A 5CG1A 4D3DA 3U44B 2FSVA 5B12A 1AKQA 2DUJA 3TOXA 1ZG3A 2ZPTX 2JVIA 4PYNA 4MS4B 5KTTA 3LQRA 2RK3A 3IS3A 3NEPX 1FDOA 1TO2E 4CN8A 3G6WA 4ALLA 1L5FA 2J33A 5IJAA 3RV4A 3ZHXA 4AZ3B 4HBZA 5JFOA 4KGXA 1ZONA 2ZKIA 4RY8A 1VXRA 1K66A 4XQ9A 1OREA 4RETA 1X7ZB 1X7XA 1YBFA 5L6MB 3IUYA 2B4YA 4HN9A 2WYUA 1OXSC 4RFSB 4RIFA 1J5XA 4RH1A 2G3YA 5DN6A 3V32A 3ZGOA 4LBWA 2AFRA 6CHYA 1H4SA 1OZ0A 1KORA 3OFVA 3H6KA 1OSNA 4DBLE 4TWAA 2WM3A 1QHFA 3IPYA 3TJMA 5KKNB 1H3EA 1XPUA 1D4ZA 1OFVA 3DAHA 3PUWA 2O8CB 4P1ZA 4RMHA 3GLIA 5ECWA 3WYGA 2RGUA 2QN7A 1MAUA 4IEEA 1JZTA 4KB5A 4ZI5A 4ZOQI 5LJLA 1ZU4A 3M1YA 2PJZA 5A4JA 3TWOA 2ET6A 4TWBA 3UHJA 1GP2A 5KKCA 3O8NA 2OHHA 3GAFA 1W6RA 1G64A 1B42A 2IOYA 3RT1A 3OZXA 1HYHA 3L84A 3LFUA 1DXHA 1USVA 1XTJA 4OD0A 3WMXA 4G5QA 4BNGA 3NHSA 3AEQA 1YKGA 1X2EA 1R9NA 1KO5A 1MO2A 2PSHA 4L75A 4DC0A 5H16A 2BMJA 2AQKA 3N0TA 4BMZA 1RKBA 4LN1A 3U6KA 3PHJA 2OE2A 4DNOA 2TYSB 1B23P 2JIBA 5CX1A 3ZLUA 5CNMA 5KS2A 4OQEA 5A0FA 2EQBA 3T3MB 4LK3A 3EFOB 2M2IA 4CTMA 1QH1A 4O1IA 4J3FA 4MW2A 2XCLA 4OHWA 2VAMA 3U48A 4K0KB 4GBGA 1QU2A 2ICAA 4KFTA 2J4CA 3GLGE 4QXAA 4ZQEA 1OB2A 4RM3A 3C39A 3TQQA 3U5ZB 1AO3A 4C89A 3IAXA 5DYGA 4NZYA 4OLJA 1N75A 5EZ6B 3KLMX 5AXCA 4WFQA 5LPNA 2V7WA 1NVTA 1GQ2A 3NHWA 1Z0IA 4HB2A 4WOKA 2VPTA 2A88A 3COJA 2DY1A 1GG2A 5B2FA 4PHTA 5HZMA 1BAPA 3EF0A 1SFRA 1MZVA 1XMXA 3T7IA 1LI4A 3GLHE 4ER5A 3URMA 1IHUA 4BFXA 4JYBA 3WR5A 4WLOA 2C2HA 3LZCA 1KA9H 1P4GA 4HADA 3KE8A 3LA8A 3ZLVA 5EE3A 3D1LA 1TD1A 2QNBA 1BVHA 1D1QA 4CGYA 2CB0A 4FQ8A 4UUQA 1J1ZA 1CT9A 3OZSA 3Q7TA 1RPZA 1W59A 3H9GA 3NHYA 3P1JA 2E1RA 1J99A 2ZWPA 3PUIA 2CVQA 2IF0A 3Q0EA 3BKWA 4Z6KA 1U3VA 3R3HA 4DBZA 1A27A 4FW8A 1VMEA 3CGWA 4BQRA 1I6WA 5BMOA 2UZ1A 2AVNA 3HADA 4ARZB 3KQSA 4JVLA 1P6QA 4ARZA 2Z2XA 3LY8A 1UK8A 3JSXA 1WMSA 1L7EA 4WOBA 3GGCA 3TYXA 3VAZA 3VMMA 5CLFA 2XZTA 2OFPA 4R4JA 5A4AA 1R74A 2VVTA 4QICA 7REQA 5FAXA 1VJ1A 1U0FA 4PPFA 2EQ5A 4YONB 4CDMA 4X1IB 2I71A 5DGTA 4EK9A 2R8EA 4KQ9A 4F72A 1KI6A 2QZSA 4HX2A 1M7HA 5DT9A 1GGMA 1T8SA 3A7EA 1QVRA 5AJUA 2ZQYA 1MC8A 2FUKA 2RGWA 5HGJA 1O7JA 5CT6A 3WNBA 5A5FA 1P1FA 3DOUA 3LPLA 3CMMA 2R8ZA 3VJRA 4JMLA 1DLIA 2IU4A 3IP7A 3M70A 4LRXA 3W7BA 5CAEA 1DHTA 2IEIA 1CV2A 1JKJB 5D1NA 4RY0A 3VOAA 4ZVMA 1IL0A 3IQFA 3KNZA 4UE2A 5A71A 1JHRA 1OVMA 4MPJA 5K0BA 4FLFA 5ED0A 2ZB7A 2V6IA 5HM8A 1ZH4A 3OM9A 4NBKA 4RXMA 4NABA 4P7FA 4WKGA 5FO1A 5F4BA 5LA6F 2PT9A 4P33A 2DFLA 2CJXA 4I8IA 1C3OB 3S3TA 1M2VA 3P9PA 2ZJ5A 3W5VA 4BZZA 1VHWA 3DBLB 3USZA 1XZDA 2PX3A 5JCZA 4G9GA 1KJWA 1LRKA 1NI3A 1XE3A 1JXAA 2P77A 2QL9A 1SVLA 5TRTA 4ND4A 4JC8A 2H7XA 1UJMA 3FDZA 1KTIA 3HVUA 4MDEA 4NONA 4OU4A 2GKOA 3MSXA 3QWFA 4QRDA 1IH8A 4HSEA 3N2IA 4MUMA 4PX9A 1WSWA 3MGKA 1K6XA 3IPAA 4QFMA 4C4SA 1PR3A 1WR8A 4S2UA 2J3EA 2CE7A 1A9SA 3NO4A 5IDYA 2AFVA 4XEHA 5T8KA 5FULA 2ZJBA 4ZO8A 4YP7A 3E23A 4JBWA 3AJ8A 1F3LA 3QVLA 3X44A 2PKEA 1JV2B 2PZEA 3T4XA 1M8PA 1B3BA 4B0OA 1QX4A 1Q14A 1KAOA 1RJWA 1X7WB 2NTYC 3A4VA 3CPEA 3DFMA 4XWAA 1FDSA 2C4UA 4KWTA 4IDAA 1DZIA 1O9HA 5CG2A 2J87A 1KDRA 2IU3A 4C0KA 1PL7A 1WY5A 2X6RA 3LYUA 4O2BB 3RK0A 3L4KA 3IC5A 3C4JA 4YMLA 2XUGA 1QVAA 3K6KA 3AESB 4AXBA 4DDTA 1E2UA 4PLYA 4YMHA 2C92A 4QDOA 2OBMA 5LZ7A 4NMWA 3F6EX 2ODNA 1R4AA 2DY0A 2VO1A 3FGOA 1Y7PA 5JNWA 2B30A 2YXEA 4A0QA 4BO5A 2VDVE 3BL8A 4WA8A 1XIVA 2GESA 3R0JA 4Q16A 2AOTB 4FS8A 4M76B 3VO1A 1N1MA 1Y3HA 1Y42X 4Z2YA 1UBMS 1UBTS 5EJ5A 1WTAA 4KO2S 1ULZA 1DCKA 1C0KA 1MJHA 1M0SA 3WLEA 3BMCA 3HFGA 1GPYA 1ZGBA 5F73A 1RVDA 4XRGA 3WQSB 3KIPA 4KHZA 4LCBA 4ME6A 2BHTA 4PN3A 5FB3A 1S0UA 4ZI7A 1IVNA 1OPRA 3OIWA 3NIFB 3S28A 4D4MA 1ZS9A 5JZSA 1Q7GA 2AJ8A 3IDSA 3JATA 4EFDA 2FZ5A 4OBXA 2XE4A 1X0VA 2MMGA 3AEYA 3FZYA 4MRNA 4NJOA 4X91A 2H1WA 4CCWA 5BURA 7MDHA 2X0JA 4BO3A 3AI7A 1ZM7A 3D2AA 3NBUA 4WXYB 2OMEA 4BKRA 4JT8A 5DASA 3IHTA 3U19A 2ZXUA 1VI6A 2XUHA 4AZTA 3AY3A 1Q1BA 1YD7A 3DQPA 1RABA 3WNZA 2OFOA 3NVAA 4MULA 2PSEA 3CUSA 1VPVA 3TEFA 5JC8A 2FRDA 3KOXA 5AJWA 4J0GA 3USCS 3EIQA 4GMDA 2XQFA 4L74A 4LAFA 3WICA 4BRZA 1HUQA 1SD1A 1HE2A 4AS1A 4XPZA 2B78A 2ZS7A 1G5IA 1OJ7A 4LOLA 4MA0A 1DKUA 5DWVA 5FUXA 3UUFA 4RANA 3DUWA 3GMDA 1E3MA 1EM8B 3C3DA 1I2BA 1NBHA 3SYKA 1CIJA 1BTOA 1X1DA 1Z15A 2ZZMA 4L4XA 1KKLA 2HC9A 3P5BA 2WUDA 3ADPA 5DLQC 2CF5A 5ICFA 4RDXA 2BISA 3CN7A 5AOAA 1Y8CA 2I3ZA 4DMUB 2JGIA 3ZJ4A 1T6NA 3FHOA 1J6UA 2O8FA 1S2NA 3TCXB 3FW1A 4Q47A 2SHKA 1HOTA 1VA5A 1VTKA 2NWQA 4DGQA 1L6RA 2KYRA 1EIZA 4EYQA 1E2PA 1XLTA 2FWMX 2B34A 1CY1A 1FS4A 2B2XA 3L18A 4MROA 4DLNA 4P32A 5IAEA 1KQNA 3VYRB 3L2OB 1KI1A 3EC7A 4ZOAA 3WFZA 4IICA 1I7NA 2GYUA 5A5DA 1D2MA 5K0LA 3LPNA 4BNFA 4D6PA 1W1WA 3HCBA 3QU5A 1GVNB 2B9EA 1NVVQ 4IJKA 4TMXA 1FDVA 4UBMA 3S2UA 5F9MA 5IDWA 2YFQA 3C6QA 1CYEA 3K8YA 1RS0A 1D0VA 2GBPA 3Q8WA 1RWMA 4NBTA 3KYJB 5JJCA 4CR7A 3EY9A 1RYYA 4XEUA 2HBZA 3MJDA 1MJFA 3IBTA 3LT2A 1L9KA 3IE0A 3EUEA 3L43A 4ZCLA 3W8FA 3FNHA 2WTUA 4LF6B 1QV9A 2P9BA 2J6BA 4BFLA 3E9RA 4Y2SA 5B2ZA 4F4HA 2BUBA 1YV9A 2ARKA 4D74A 1GCUA 1B8UA 3E7DA 3QV2A 4YTEA 3GROA 1FX0B 4URVR 4DJEC 5AM2A 1VE7A 2XYVA 2C42A 1MFZA 2ZXFA 1YUBA 3ICVA 4IMPA 1I9CA 4MIEA 3N2LA 4MWZA 4ZOBA 4R1OA 4PONA 5I5GA 3EGOA 3HU1A 4A73A 1AHIA 1EJ0A 1S02A 1QH0A 3LDFA 1LNQA 3V9PA 3OT5A 1XTQA 3EDOA 3I04A 4N7RA 4Q3CA 5H7XA 3WWCA 2K5UA 3N6RA 4S24A 5I01A 4B6EA 5I7EA 3SJAA 4KLCA 4G4JA 1VBFA 3FMFA 3IQIX 1E7QA 1KO1A 1R3UA 4UFNA 1Z06A 3PCXA 1BXRB 1A5BB 5FBRB 1BXRA 4BJ5A 5D6OA 1JILA 1HQDA 1ID1A 1QO9A 3GAAA 4HLQB 1H9AA 1KI7A 2RAVA 1EXDA 1H5NA 2HA0A 2NTNA 1GAJA 1RLIA 1VKRA 1Z5OA 2JGFA 3MZ0A 3PENA 4UW9A 4Z0NA 1NASA 3UJAA 4OL9A 1ORIA 2IHVA 2QG4A 3JQ9C 4CFZA 1JIJA 2D2VA 3VYTB 2Q8QA 4L2IB 4NECA 4KR0A 1MNQA 3G5UA 2QRQA 2AFIB 3KJIA 3RS5A 4M9ZA 5KNDA 5DBHX 5AWFC 4D82A 3C6XA 4WRRA 1CJSA 1IN1A 3WSTA 4MKRA 5BQFA 3ZIUA 4NHOA 3SXPA 4OGGA 3CFYA 2WKSA 2Z8XA 4YRJA 1OYOA 4HWSA 4DLSA 5JZBA 2F3SA 1M6VA 2G4CA 1JDPA 3I3OA 3LHKA 1JQBA 2BFFB 1QHYA 3MWEA 2EKQA 2PANA 5IYZB 1Z2EA 1N2CB 1R00A 4NHEA 4L1KA 1EVEA 1PLKA 2PUBA 1L8OA 3OA2A 5H3LA 4IIDA 2RJNA 4CIWA 5BWNA 4P86A 5F77A 4BZPA 1E64A 1MV8A 3LYHA 1C50A 3RRNA 4DDWA 5HSGA 1RWPA 1BVYF 1EEXB 3RRYA 5K8VA 2QYTA 1RAAA 2F3PA 1XX6A 2X13A 4IDQA 2P4SA 2FDXA 2XYRA 1JR3E 1WXIA 3KX2A 3VPFA 4F5YA 3HJBA 5K5EA 1QJCA 1E9FA 1O2DA 2QPOA 4KH0A 2W2VA 1SBNE 3OO0A 3TTVA 2BMEA 2F2TA 1KJZA 2C78A 4YS6A 3N0RA 4F5WA 2ONYA 5I7VA 3WO0A 1CUJA 2BOVA 1O0BA 1KWKA 1Z6XA 2VHXA 4BDTA 5FBQB 1PJRA 1PYOA 1G5TA 1UAYA 3L0ZA 3P9CA 3P0HA 4DA4A 5BV7A 5BT9A 4AXXA 2OCPA 3KAKA 1S9DA 3AYZB 3H5TA 2DECA 2CHVA 3UCXA 3H1EA 3W6NA 1U0JA 3FNGA 1ZHOA 3FLBA 5AH0A 4R8LA 5BSTA 1S6YA 1SHUX 2Y77A 3KVNA 3NBZC 1J25A 2DQSA 1RQLA 3TIVA 1QJ4A 4HNSA 3HZOA 4C0SA 2P67A 4INOA 2Y1FA 4L72A 3RROA 3QF7A 3TFQA 4C01A 1X19A 1VCMA 3CUWA 3LJKA 4PSCA 3RYFA 1VQ1A 1QIHA 2CFTA 4C20A 3IUBA 4NEGA 2O7RA 2R1TA 4GE0A 5KPDA 2Q6TA 1RI3A 2RE8A 5EXTA 4H6VA 1Y8RA 2WPNA 4OU5A 3L1UA 4DBLC 1P81A 1XN4A 4BGDA 1XZPA 1NW7A 4H1HA 1KSFX 3F90A 1FJGB 1R0BA 2FKAA 2ZUWA 3E22B 3GLTA 1EFRA 1FRFS 2X0IA 3UFXA 2DM6A 1DJLA 3GEEA 4HEA6 2ZIUB 5H9WA 4AAYA 1XU7A 2C5BA 2G0TA 3FD8A 5CHYA 3BF8A 4YCMA 4ZYYA 4IDGA 1PWXA 1CRPA 1D2GA 1NYRA 1MP0A 3CB4A 4MI9A 2D62A 3HQ4O 4X41A 2V0GA 4O3FA 5GOTA 4R1NA 3KR1A 1C7RA 4UU8A 5JOQA 3ZU3A 3QE4A 2GWRA 1YB2A 1SXJC 2OO5C 4LXQA 4MRMA 5FOVA 5DM2A 1UADA 4HH3C 1W5SA 4PICA 4B4KA 4EQ6A 3ZVMA 4QEDA 1YL6A 3LFTA 3K5HA 3MMXA 4JXXA 4IHJA 1JFSA 4U7FA 3UK7A 1N2CE 1NHWA 4HQ6A 2Z2KA 4L73A 4UAUA 5HIMA 3IP5A 4FSDA 5HGXA 2V59A 1BGXT 1JEDA 1SCBA 1W7AA 4OXNA 4OI1A 1DKNA 3LKVA 3RYCA 1H2YA 1MAWA 2ZITA 2V03A 4PC6A 4PYIA 3E1GA 3GT3A 4GYWA 5HF9A 3W9BA 5CFNA 1Y9DA 4DR2B 2DF8A 3C70A 5DI9A 1FS6A 1VCNA 1HC7A 1JBEA 2DWQA 3O8QA 4JH0A 4WJKB 1F12A 4L9RA 1K86A 3I09A 1CY4A 4AY4A 1Y80A 2OT3B 4R41A 1A4XA 5DWDA 3EC2A 5AW8A 4HNUA 1DCMA 3PHCA 3UZUA 3FIJA 4PSUA 1KBOA 1TMOA 4KW7A 2VSOA 3FSGA 2XMSA 1GR1A 3L6BA 4EEZA 3JQBC 3S2ZA 4NOJA 2GH1A 1WZIA 3K31A 3NJ4A 5JI3E 4HQNA 5KTRA 3ZDAA 3Q3HA 1PR4A 1RI4A 2H1SA 1C41A 1XTBA 1KR5A 2YZKA 3IIMA 4PLHA 4QHSA 5L3RA 3LUAA 4D6XA 1JAXA 4Q15A 1XU4A 2WD8A 2W43A 4ITRC 2J1LA 2C7BA 4FVTA 5ECYA 1WW8A 3K0CC 3EEBA 3KG2A 5BN5A 5BN5B 1WEKA 3QM1A 4HQOA 5G40A 1SXIA 3U3MA 2ENUA 1Z73A 1DX6A 2FFQA 1ULUA 1JIQA 2R0QC 1C29B 4YMTA 4EG6A 4KAFA 3FHCB 5C53B 2O4UX 2R68A 3F9IA 3O8OA 1DEAA 1KFCB 1YQQA 1ZZGA 3GOQA 3PD7A 4G1EB 3R9IA 4D9GA 4OYHA 2YV4A 2OGWA 4PPNA 3SR0A 4ZIRA 4UNIA 3NHMA 4JWKA 1E5XA 4W1QA 4RK6A 5BQPA 1Q3TA 3NONA 1XCOA 2JI9A 3PQ3A 1CVLA 2FW7A 3QPWA 2NP6A 1UKCA 1O89A 4RHYA 4LE2A 5HF6A 3TX6A 3DT6A 4I3FA 4H4DA 5HQ3B 2ZIXA 4CIXA 4EAQA 4R51A 1I7QB 1XCBA 1Q84A 3LXRA 1UMDB 4XI9A 4DYVA 5ICCA 2NSLA 3ESDA 2VSXA 4EGFA 1H22A 2HJ9A 1IDN1 4IUBS 1SKQA 3I9KA 2O8DB 1NURA 5IJWA 2XE6A 1YNOA 3QJGA 1FXUA 3PGMA 4G81A 4FMDF 1B73A 2XDQA 4M1ZA 4QXPA 5BSMA 3RIEA 3VR3D 3W6OA 3G23A 4UNQA 3OQOA 3NVDA 3H9UA 3MG9A 1FP6A 1MBZA 4IF6A 5HS6A 3U49A 4PYMA 4G25A 2RI0A 2BWJA 2H1RA 3AUTA 3FPHA 4C7KA 2AEEA 3WJ7A 2Y4NA 4M8NE 3WQBA 3J7TA 3BWDD 1KVSA 4GKBA 1T6BY 5I8PA 1LQ2A 1YQXA 5DE3A 5EMMA 4L0CA 3EVZA 1RYMA 2P79A 3IMCA 5IKEA 1AV7A 1Z0DA 3FRIA 4LYFA 4BFWA 1AF7A 2QSZA 1THZA 4CBVA 3FUXA 1UT8A 5FBKA 1RE0A 5B30A 3VNQA 1JWLA 2NTVA 3G5TA 1YHYA 4DSZA 4WGGA 2KQUA 2Z3ZA 1JP7A 5AVWA 3HABA 3RIYA 3G8BA 3L7BA 3R8CA 3GJ0A 3HFSA 3NB0A 4K6OA 2Z4SA 3TLEA 4ZDJA 3WTBA 2PXXA 1PG5A 2LCFA 1G60A 3UHPA 1R5NA 1ADBA 2P5TB 2N0SA 3I05A 1PE0A 5ALUA 4WKOA 5EIWA 4OEHA 3ZE1B 4TXLA 2XVAA 2OCIA 3FUVA 3LTNC 3CLRD 1K8ZB 3UOGA 1C0LA 1ES9A 4ZZ2A 5C1IA 4MS3A 3LH5A 3AB3A 4LJSA 4B35A 5KX5B 4ZTZB 5DCWA 4KREA 4J1NA 1OC4A 3ORFA 4PZCA 4RIHA 5AW0A 4RD6A 4LVUA 3GW8A 1NVVR 1EFDN 1H8EA 2WIJA 2PGIA 1Z7GA 3M4XA 2QI9C 1MGOA 2BEKA 3O3CA 4EIWA 5IJ9A 5ALSA 2ISQA 3I5UA 3NCHA 5HZKA 5HCIA 1AQUA 2RGRA 4DIFA 4PG8A 1EWYA 1IE3A 4JL5A 2HJVA 2YWFA 3AZPA 3B1XA 2IHUA 3GDHA 1LSOA 1IU9A 1WBJB 3F0TA 1F1BA 2J9ZB 2NZVG 3C45A 4ND1A 4TTVA 5J2UA 4ND7A 1HFJA 5FNVB 4BJHB 2WJIA 3KXKA 4O4LA 3R7AA 3PE3A 4MQFB 2ECQA 4N0PA 4CL8A 1VRCA 5T4HA 1HWYA 1ZPDA 1WF3A 3EVBA 4GOKA 1PL8A 4H7PA 4R40A 5IC4A 1Z28A 4RZQA 4Q05A 3OUTA 1NG9A 4DLRA 3MMZA 4FCVA 2YWGA 1Z5PA 1R4MA 4BCBA 9ABPA 4HNTA 4LSWA 4LYEA 2GBGA 4D8VA 1L5OA 1G17A 4JC4A 3PTLA 3U3JA 3USES 2QQFA 4JYCA 3T35A 1W52X 1GFZA 1Y1PA 2BHRA 2EWWA 2P9JA 4L02A 5K8IA 2ZYHA 2BFEB 3I12A 2JHFA 4Q4LA 3TW8A 4MV5A 3GLKA 3SWWA 3TW8B 2H00A 3W1EA 1LDYA 2PAAA 1T5TA 5B6JA 5AKGA 1PFVA 4Q6BA 1NXQA 3THXB 2D54A 4FDUA 3UWKA 5KWJA 1IN6A 5HHTA 1DAGA 1HY3A 3D1VA 1E4OA 3PFHA 1QKKA 1DS6A 2OHGA 1IEVA 3EAQA 1JPVA 1JQ3A 1KEUA 1SB9A 5UKDA 2WSBA 3WKBA 4YT4A 5A4FS 2DERA 1E4EA 1XZFA 2HF7A 2A33A 2OCGA 3U3OA 4AF8A 4C4YA 3SYMA 4NQRA 2UV8A 1MC5A 3IERA 4IKPA 2IYWA 1DAFA 4KFRA 1U7UA 2W58A 1ISRA 5C4MA 3MUNA 4UEWA 2D13A 3MB5A 3M3PA 1RIIA 1Y0BA 2CD9A 3GQVA 4CLOB 2O0HA 2FSHA 4YH1A 1NUPA 1X39A 3TQHA 1CY7A 1FL9A 1UPBA 2XAUA 2DFNA 4MW9A 2J9RA 4LYJA 4P4UA 4DCJA 3PQFA 4PCVA 3FA2A 4URZR 4B9AA 2A5DA 2PU5A 1HFKA 1XZJA 1X80B 2H4JA 3V8EA 3LSYA 5TPWB 1EJ2A 1P0PA 2HHLA 3L01A 5FX2A 2ZCVA 1WTCA 4N41A 2Q4RA 3HXMA 4B6GA 2VQFB 1U98A 2FW9A 4TXNA 5I7HA 5DTJA 1EKXA 3KEGA 1WS6A 4X7PA 2I34A 2I5PO 2WYHA 4MUNA 4PCUA 5A6SB 2A7QA 2ZRFA 2VAVA 3DXZA 3JWEA 1NE7A 1XLVA 1C1DB 1BCRB 2X4GA 2Z9DA 4Y2XA 3NJ8A 5CRIA 2YWJA 2YFHA 5FNZA 4QJ3A 1E69A 3OJCA 4IHQA 2ANCA 2DR3A 4DSAA 5K3EA 1FRZA 1PKEA 4EOGA 3BTOA 4J1TA 1V95A 2WAAA 4IOJA 4LBYA 2AZDA 2QRPA 4TQUS 2QT9A 3T4UA 3CH5A 2YVKA 3DKVA 4IS2A 4MDHA 1V7QA 2WM8A 4GGMX 1TQ6A 2I2CA 2OG2A 1P75A 4GI2A 4RK5A 5FKJA 4F3KA 2XE8A 4BVLA 1KBZA 2ZRNA 2FP4A 2R5NA 2X8JB 4HXFB 4JROA 3WLFA 4C0HA 4RULA 3R8FA 1O57A 4FILA 5EXPA 3LUCA 3NT2A 3INYA 4E51A 4M36A 1HQKA 2OBYA 3GLFE 3D8RA 4ZKDA 1OHHD 4ZYTA 1A97A 5KU7A 4C0QC 4UCFA 1EFTA 2X40A 3IUNA 4ND5A 1L1QA 4BEWA 4Y6LA 3WWYA 3OEWA 3VR4A 2QTWB 4TSFD 3B6EA 2Q4EA 2JZOA 1AK2A 4GYKA 3ODGA 3FTQA 1H4VB 5HIJA 4CDNA 2CB9A 4JNKA 1E6CA 3I83A 1C9JA 3HNRA 3EBPA 4P82A 1NN3A 1UJ4A 2QY9A 5HE8A 3GFGA 4RD4A 1MC1A 4U7TB 2I3DA 2E4VA 4R8SA 3UFXB 4BFZA 3K6SB 2V7VA 3C2QA 4KQ6A 4M49A 3RC2A 1U2PA 1R6DA 1VG0B 3NIBA 5LMCA 4XYLA 3EW9A 3O2SB 4RH0A 1TGVA 1P1RA 5EP2A 2MSKA 2VTBA 1SXJE 1CQWA 3AR6A 5ALJA 4GDFA 5EG5A 4IFIA 4L95C 3SBDA 2GLUA 1THGA 3RIHA 3TN7A 1TVMA 5LD2C 2PWBA 3TMKA 2BFDA 4D4IA 2C82A 2QE7D 5DCUA 1IZZA 2YRWA 1KDYA 3C3WA 4LMPA 2BVNA 3NVKI 2PEZA 5AKKA 1KGSA 1MB2A 4ON9A 2RH9B 1N8SA 3T52A 3AF4A 4RU1A 2J3LA 2W6JD 2Z3VA 2IXBA 1NBMD 2EJCA 4EBFA 3T12A 3MA0A 3E5HA 1LBIA 4RV5A 5CLGA 3U13A 2V45A 3FF4A 2IY9A 3PGLA 3UV7A 2OLKA 4BMSA 2B94A 4P5EA 2DRIA 1ZSYA 2PLNA 5K3CA 3SYRA 3U44A 2P9CA 4MVWA 1BFDA 1EINA 4E6EA 4LMAA 3CLUD 2ZDHA 5J58A 3TM5A 1FNSA 3OZGA 1AKEA 1W5FA 1ZOOA 3RVOA 4UD6A 1TCUA 1Y6RA 1I5RA 1TPZA 2R4TA 3DXXA 1P7VA 3JVVA 1M73E 3QSGA 2Q5OA 5BVGB 3IPCA 3QUQA 1BN7A 4GP6A 4KFUA 2PT5A 5EWJB 3FCAA 1Y1RA 2PN1A 1KQ3A 1S89A 3BSFA 4K40A 5AHWA 1FY2A 5ARCA 2A9FA 3QJYA 2QA5A 4ZYVA 3BFXA 3A8TA 1VJ5A 4U2FA 3BOSA 2V7PA 1FJ2A 1QK4A 1JUDA 4JBNA 1SWWA 2BMDA 4W5QA 3NTRA 3OSZA 1Z56C 1TKAA 2FFJA 1FUYB 5HWSA 3IR7A 5ICMA 4DJFC 3R6WA 4O8ZA 3GZ4A 4KFSA 4U63A 2C97A 1ZOPA 4E31A 3QKTA 2R4UA 4RA9B 4L4UA 3QH4A 2G7MC 4M89A 4UAGA 4JIMA 2HRCA 5LP6A 3K09C 3OG9A 2EJUA 2Q0HA 2Q28A 3RTCA 3GJRA 3W8DA 1H69A 3L0CA 1EB9A 1GFIA 3NHUA 3UJNA 1AHNA 4LRUA 4G5GA 2XUIA 2F1JA 4RIGA 4MW4A 3WSWA 1GM5A 4CNBA 1VSUA 1J7JA 1PR9A 1MJGM 5ICSA 3D7LA 2AN4A 2D3WA 3FZQA 3OE7A 1XTVA 3MLEA 2PKCA 3RBAA 4B9EA 4E94A 3F74A 3F6YA 3E3OA 3FRJA 3H9CA 1DAKA 3I9OA 3QKWA 4PINA 5BV2P 2DYKA 2YJ5A 4WMLA 4PZYA 4DJJA 4ILKA 3QGMA 5DSTA 3IUPA 3PLRA 2B6HA 2B8JA 1ZOIA 2Q4OA 5AHOA 3EQ8A 1Q0PA 3OSUA 4G63A 4B82A 3KTAA 3OIFA 2OESA 4IOMA 3LV8A 1ZNXA 2HBYA 3CLSC 5AIBA 4IIBA 1RW4A 4RPGA 1WB4A 1T4CA 1Q0RA 2C4NA 4HEA1 4XPIA 1POWA 4NDAA 3I76A 3R0VA 5C7LO 1MGPA 1Z16A 1BEZA 5ESDA 4G4SP 3NKLA 5F3DA 4DL9A 4U2EA 4AJLA 1PIWA 2PL3A 3K0AA 2VF2A 3UMBA 4AX4A 5LDDC 1IRIA 2NXNA 2PQ6A 1YI1A 3WYAA 5FI5A 5FOUA 5J4LA 4AWXA 2QTCA 1DKMA 3OZIA 1T0JB 1NJ8A 4A36A 1OWNA 1CHDA 3SQLA 1KY4A 1W5AA 3DH0A 4JUAA 4AJ1A 1MOQA 4I9GA 3FTPA 3NDBB 3HLTA 3WIUA 4BFYA 1XYGA 1AHPA 1GZUA 1KC3A 3FNIA 1JKFA 4KKXB 2EU8A 3CV3A 1JTFA 3W2TA 1FYEA 1L7VC 2XYQA 3HN2A 1U2RA 2IYLD 4B7AA 2Y1DA 1NNSA 2Q5IA 3LBNA 5F33A 5DMHA 521PA 4FE4A 1WW2A 3SZMA 4YHHB 2QM0A 1HYQA 4I1UA 3G17A 1Y9EA 2PKYX 4I9HA 3I39X 4C1NA 1MFPA 1ZO8A 3PRJA 3RYFB 1R5OA 4FOOA 5JIBA 5ALQA 4P98A 4YT5A 5K99A 1CB0A 3FUTA 4QFDA 3TOCA 3IVMA 5E4TA 4Z86A 6ADHA 1GNSA 2E85A 1SRRA 3RSQA 4EUFA 1L5NA 4R8MA 1V8OA 3L9WA 5A7HA 2DH6A 2NPIA 3W6UA 1LLFA 2LUOA 4PQFA 2EX0A 1ZMXA 2Z58A 3CRW1 1CQIA 4QOHA 1COWD 2XGSA 4FFWA 4AG6A 1V25A 4EM6A 2PBRA 4CTOA 2AT1A 4KUEA 1NI5A 2XWPA 4PC2A 3OY2A 1K5HA 1UBOS 2Q4TA 2BR5A 2DWPA 3FBGA 3D8HA 4BV9A 2CJWA 2RAPA 5DI3B 1MT0A 1OD6A 3KKOA 3NYQA 2JKZA 1U7HA 1IN8A 4TLBA 1C7ZA 4DNPA 5I7OA 3RE1A 1EHYA 3U16A 2NU6A 3K30A 3OCYA 3CVXA 1MB3A 2IQIA 3O0DA 1X86B 4ZKEA 4EHLA 5KSPA 2HLNA 2XUQA 1H85A 3DTTA 2Q3MA 2VH5R 4A6DA 4DOMA 2OA0A 4HNQA 4TZTA 1SVUA 2BAGA 4ND6A 2IFTA 1ZVJA 2DUWA 4BRUA 2AOWA 2CNOA 2BJVA 1VJRA 4BL5A 5IUJC 3CWCA 4KRGA 3ANTA 4P22A 5TQ0A 1DWUA 5HCUA 4YJ2A 2OBNA 2ZRMA 4RQAA 4DCVA 2PD6A 3CHYA 3OX2A 1HDOA 4K3UA 4A8TA 3KQTA 4KO8A 1VJTA 5A05A 4UPDA 3DZKA 3YASA 2EJBA 3IMKA 3O8RA 5BXYA 3BZUA 2G88A 2G8NA 1DARA 4ISCA 2OUKA 5BMVB 4D43A 4EFNA 1RYDA 1SC4A 1SCNE 1T35A 4YRAA 5JAHA 2DTDA 3SSMA 1PQYA 2LIVA 4Q4HB 3RLIA 1U0LA 2MINB 2BKXA 3FSJX 5A5VA 4UCXA 3EOBI 3KZNA 1UBLS 1YIAA 3A4TA 3H0KA 3G2LA 1FNBA 2JVKA 2W2XA 4ZZIA 2R6R1 1CU1A 3DP9A 1E66A 5EESA 3PNKA 4AJOA 1TW3A 4KVAA 2JAOA 5EJMA 2VCYA 4WK0B 4MVJP 4Y2PA 3JZFA 3ZJ5A 1GTL1 1JKMA 2FMFA 2GGSA 2QJRA 4YQYA 2Q46A 3T9FA 1AKYA 4EJ6A 1SVOA 4UBOA 1IATA 1E96A 2G7ZA 5A62A 3CBGA 2PUEA 1ESDA 1HL3A 1KOJA 2OCBA 2R6FA 1C9EA 3AILA 2GPAA 3JZIA 3KKLA 4GIBA 2CWWA 2GUGA 3DC7A 2ISSD 4GX2A 2WFLB 4IR7A 1TX4B 4WKCA 5EERA 4ZAGA 1TT5B 2QRVA 4JB2A 1BU8A 2WG1A 2FHSA 5E1OA 2O7VA 4GEGA 4MR8A 3ZH2A 1NYTA 1V16B 3EVAA 4G5YA 4A27A 5BR7A 1OH8A 3F6RA 4O63O 1VE9A 3ZVNA