4ARSA

Hafnia alvei phytase apo form
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
411
structure length
407
Chain Sequence
b'TAPAGFQLERVVILSRHGVRAPTKMTQTMRDVTPHQWPEWPVKLGYITPRGEHLISLMGGFYRERFQQQGLLPKDNCPTPDAVYVWADVDQRTRKTGEAFLAGLAPQCDLAIHHQQNTQQADPLFHPVKAGICSMDKSQVHAAVEKQAGTPIETLNQRYQASLALMSSVLDFPKSPYCQQHNCDFSQAMPSRLAINDDGNKVALEGAVGLASTLAEIFLLEHAQGMPKVAWGNIHTEQQWNSLLKLHNAQFDLMSRTPYIAKHNGTPLLQTIAHALGSNITSRPLPDISPDNKILFIAGHDTNIANISGMLGMTWTLPGQPDNTPPGGALVFERWVDNAGKPYVSVNMVYQTLAQLHDQAPLTLQHPAGSVRLNIPGCSDQTPDGYCPLSTFSRLVSHSVEPACQLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTIDINE ACID PHOSPHATASE
publication title Degradation of Phytate by the 6-Phytase from Hafnia Alvei: A Combined Structural and Solution Study.
pubmed doi rcsb
source organism Hafnia alvei
molecule tags Hydrolase
total genus 137
structure length 407
sequence length 411
ec nomenclature ec 3.1.3.26: 4-phytase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arsA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arsA02
2PA0A 3GW8A 4D4LA 2EKZA 3EOZA 3GP3A 2IKQA 3FJYA 2YN2A 3R7AA 3GP5A 3HJGA 4AROA 2YN0A 1YJXA 1SKBA 1C81A 5AK0A 3LG2A 2AXNA 2P9YA 4TSRA 1C7ZA 4ARVA 3F3KA 1IHPA 1V37A 2P77A 2P6OA 5CX4A 2P9FA 1E59A 4ARUA 1QFXA 5AJXA 5AJZA 3K4PA 5CDHA 2EKBA 2P2YA 1RPTA 2A6PA 3D4IA 1DKNA 4FDTA 3D8HA 4PGMA 1ND5A 2H0QA 1TIPA 1RPAA 1SKAA 3NTLA 2P79A 2WU0A 3LNTA 2ENWA 3QPWA 4EMBA 1YFKA 4QIHA 3LL4A 1FZTA 4IJ6A 4JOBA 1BIFA 4FDUA 1DKPA 2BIFA 2P2ZA 3EZNA 1QWOA 4ODIA 2WNIA 1H2EA 4JODA 5CU7A 2GFIA 5PGMA 4E3WA 3O0TA 5HR5A 1BQ3A 3IT3A 2P6MA 4MA4A 1UJCA 3C7TA 3IT2A 1DKMA 2F90A 4PZ9A 1V7QA 3MXOA 2ENUA 1BQ4A 4D4KA 5HTKA 1H2FA 2I1VB 3IT1A 3DB1A 1SK9A 4IJ5A 4GPZA 3DCYA 3QPUA 4GPIB 1CVIA 2H4XA 3FDZA 2HIAA 1T8PA 2HHJA 1SK8A 1RIIA 1DKLA 1DKOA 2OWDA 1FBTA 3E9DA 4EO9A 1K6MA 3IT0A 4HBZA 1C80A 3FDZB 2P9ZA 1QHFA 2DWOA 3ZHCA 3D6AA 3KKKA 3PGMA 2H4ZA 2OWEA 5AJWA 1EBBA 3K4QA 3E9EA 2P75A 3MBKA 2P78A 3OI7A 3QPVA 4ARSA 2HPAA 3BIFA 1NT4A 4JOCA 2QNIA 3E9CA 4D4JA 4D4MA 2P30A 5AJYA 1E58A 1ND6A 2RFLA 1UJBA 2EOAA 3F2IA 4PZAA 2WNHA 1DKQA 2A9JA 2H52A 3NFYA 1XQ9A 2DWPA 5AJVB
chains in the Genus database with same CATH superfamily
3FE2A 3WXBA 4RVFA 1QSGA 4UE2A 2WIDA 3UO8B 2BFEA 1XZDA 1S7GA 1CQJB 4DLBA 5HTOA 2BD0A 2XB4A 4S3MA 2I6XA 1HNZB 4KPUA 1G2QA 4AROA 5F73A 2PT9A 2WF6A 2Y1WA 4GICA 3T15A 1WF3A 3T9BA 1M2OB 4XI9A 4HRAA 3JAMA 1U7UA 3N6XA 1TVMA 2REXB 3OZBA 5EP3A 4W4TA 4F4IA 4KU4A 4LJAA 3GPLA 2FPLA 3PX7A 2CDNA 1E3EA 1O8BA 2PAFA 4DCUA 2EJCA 3OEEA 3ZBUA 4NR0A 1H2WA 3PNMA 4M7RA 3WYNA 4G0OA 2EL7A 4BECA 1RBYA 1XQWA 2GO1A 4CKWA 4ZDWA 1E6KA 3NFRA 2I55A 4NK4A 3HZZA 4TTIA 4EF4A 4TTTS 2XXBA 3V7FA 3H5VA 1YJCA 1YRYE 2H06A 2DC1A 4GO1A 1R4MA 1Z38A 3DMGA 2C57A 3MINA 5LQSA 4YMWA 4ZZ2A 3WGQA 4B17A 1AGPA 5LCXA 1OXMA 5KYVA 5BWOA 1IN8A 1Q19A 1D2AA 2BIFA 2YS6A 4OGKA 2WZCA 2QRVA 3WRXA 3RIXA 1UK6A 4I50F 4MR8B 4JI3B 3T99A 4B3IA 1HDXA 4UFOA 3NX4A 3VC2A 5I9TA 1QHEA 2PRJA 2GPJA 3NAMA 4UUMA 3KKQA 4LOIA 1YVEI 1NQ5A 5EC8A 4JJEA 2ZCJA 4PLCA 2ECOA 5G1NA 4PSAA 3L06A 1ZI8A 1WXGA 1RVV1 1TJPB 2R3SA 2BN4A 5DSXA 1DAKA 3D9QX 3ZWBA 5K0JA 1NYTA 1VGRA 3ROQA 3QPUA 1ID1A 4KUEA 3SLGA 2ORIA 5CPFA 3RSCA 1HV8A 2X86A 1W6RA 1ECBA 2I4LA 5ERXA 4FD2A 1PCXA 3ICWA 1PGOA 8OHMA 4ALNA 2ZDGA 2JGIA 1AUPA 2WA1A 3G2HA 2PX5A 4QJ5A 3O3OB 4CQLB 2H9YA 3CMCO 3PT9A 4KDRA 3ANNA 4DS3A 2PKEA 3WHPA 3JQ6A 1VJDA 5L53A 2NU8A 4PCUA 2JHGA 5B1HA 4C43A 3EJ6A 2ZOSA 4QXAA 3U3JA 3IQIX 5FNVF 4CE6A 3MTAA 1G98A 4G4JA 4Q18A 3ZDAA 1ZK3A 2UUOA 1L5FA 4KBFA 1G4UR 3WKCA 3T35A 3DTYA 5LMZA 3HNRA 4H0NA 5AHWA 1XZFA 2VDMB 2LBPA 1ZCBA 3NPAA 2XDQA 1Z5PA 1YCFA 2BEUA 4NE9A 1EVYA 3KSMA 4TGLA 1SC6A 4MCJA 3SDBA 2F1OA 3CG4A 3FRJA 4JUFA 4F6LA 5K0BA 1E3TA 5DN6D 1JJIA 4N3CA 4UASA 1KJNA 2B1QA 3A7EA 2FGKA 3OPYB 3KZMA 4K1LA 4WACA 2W2PA 3NR2A 1OI3A 2AJBA 1L5NA 4CDNA 4D98A 1YB6A 2IZ0A 1OWPA 5DMXA 3G0HA 5JC8A 1LBEA 4RJJA 1XKTA 2GKGA 2RGDA 1MIOB 3EXHA 4IS2A 5AICA 1W2HA 5DTIA 2QE7D 3LC7O 4WE3A 3UNXA 3CIOA 4KBYA 3N8HA 3BL6A 4KPGA 5B1SA 2FPWA 1VFPA 2RGBA 4B76A 4ZEVA 4NZNA 2B5VA 1Q22A 3AFGA 3LY5A 5IJZA 1M5UA 1R5OA 1HT2E 2NO5A 4O2RA 1LS1A 4G5XA 4JBNA 3MQFA 3LLUA 4H4EA 1S89A 3OZFA 3TFQA 5JRZA 4JLNA 3V7UA 4J03A 4NX2A 3MT8A 2HV8A 5KHOC 3C3AA 3OLZA 1L7QA 2H5LA 3DE5X 3N8IA 4ZVPA 3ZH9B 5E6RA 4KQ9A 2H5IA 3M5DA 2Y76A 3HV0A 3W79A 4OQNA 1EZZA 2VCHA 1Z12A 5LD2C 2JKVA 4Q4CA 1XPUA 5JJIA 2ONZA 4BBPA 3GRYA 2BKXA 1RYEA 3HJCA 4QNRA 5BQ5A 4ZVUA 4B3RB 5EKXA 3QU2A 1YS7A 1PNVA 2IQIA 4OHFA 1JN0A 1SCJA 4L8VA 2ZAIA 1FK8A 1U0RA 4DMKA 4F9FA 4BLTA 1FP4A 1XXHB 3I9LA 4E5PA 2C4HA 2EAUA 1SIOA 2KX7A 3JSAA 5EJAA 5GQSA 3CO5A 1G6OA 2CHEA 3SVLA 1DRUA 3VPAA 2GJ4A 1Y4DE 2I7DA 1OZHA 3BH6A 2XTAA 2UZAA 1JWAB 5BSKA 5K6AA 5JSZA 1SWWA 1TD9A 4FDLA 4XDGA 1JBQA 1VSBA 4DIDA 4HLUA 1JZTA 1FSGA 4R6WA 4YC7A 2W2KB 1H4TA 1ZRHA 4G4SO 2NSLA 3L82B 5TF0A 3BMOA 4UBMA 3F2VA 4FNGA 1E1CB 1NL3A 1YB2A 3A4IA 4FIZA 5AM5A 5JECA 2B82A 1USUA 1VL5A 1W46A 2WTBA 3B70A 4MQ5A 1ODSA 3JAKA 2F62A 3KK0A 5F1OA 2WY2D 4R69A 3UG7A 3CH7A 1H22A 1U2EA 2G8NA 3D0QA 1VYTA 4DF3A 1QHIA 3KUCA 2BAGA 1XMSA 3EXEA 1EP3B 3N76A 4FFLA 2YJNA 4G1MB 4HLQB 2YXBA 2A0FA 3LJKA 4GRIA 1NVEA 5IYZB 5DYIA 1ZD4A 2W2NA 1VRCA 5GVRA 3VO1A 3DPIA 2PFSA 3VR1A 4V1CI 3WR5A 3EG9A 1VCOA 1Z5ZA 3KWLA 3QLTA 5AQEA 5LVAA 3HI4A 3EYAA 3P2OA 4QM6A 1A71A 5IZCA 1XZQA 1UKEA 3CZAA 1UF9A 2OP0A 3DDZX 5IFLA 5JZBA 3UQZA 2BI8A 2RIRA 2VBCA 4NL4H 4RFSB 1Q2UA 4AJEA 2WUFA 1ML3A 4H16A 1E7YA 3OBBA 3VR4H 1F12A 3GNQA 3OOYA 4LTDA 5DM70 1JTVA 4RJTA 4U5XA 1QZUA 1QH0A 4QAJA 4BS9A 4QGFA 1DC4A 3JQCA 2QNIA 5BN4B 1H42A 3K1AA 3QA9A 1M2NA 4K40A 5J1TB 3A1SA 4JBWA 2QZZA 4J0CA 4U7GA 2IHZA 5J40A 1XPRA 2BFCB 5BWNA 1OZGA 3ZEAA 1Y3FE 3OTIA 2NU9B 1JEJA 4JYAB 1C3OA 1ID8A 5F2NA 1OZAA 3H5OA 2Y67A 1GZ3A 2Y6UA 4QUJA 1DWQA 2P8JA 3B12A 1SPXA 4QKQA 4WK4B 4Y2RA 4QGBA 3C3XA 4K5QA 2V03A 4OD0A 3AUKA 5KYYB 5A9TA 3PXAA 4LSMA 3TRDA 1I94B 4B4WA 3AY7A 1P73A 5IVDA 3BILA 1KY2A 3PD0A 5E4JA 1CZLA 4G8CA 4DV2B 1UL1X 5CH8A 3BXPA 1BDJA 2IXGA 4H1TA 3C4QA 3RIMA 4MKRA 1M1YA 4DHWA 4RKRA 4AYWA 4HQNA 4B8WA 1BMFD 3UCEA 4CCAA 2C04A 4D5EA 5KS2A 3S99A 3F9RA 3FB4A 1Y4AE 4I1VA 3CIFA 3EFOA 3D64A 4LHXA 1CW2B 1VIVA 1FB5A 1PS8A 2I1WA 4IDNA 2RG1A 4PAOA 4UTXA 1RLTA 1JR3E 1X19A 2IE0A 3D3WA 1OYOA 3K5IA 2AZDA 1EEXB 1OVGA 5K0GA 3HR4A 1GL9B 1HRKA 1N5MA 2G1JA 4K46A 5CNJA 3T3PB 1CWUA 4B48A 5A2QA 10MHA 1ZDMA 2NVUB 4DSTA 2BISA 1UZMA 4DLXA 2CXSA 4BFXA 1FVFA 1NBHA 3K9NA 4JQSA 4QPCA 1FUIA 3P9KA 4G63A 4B3BA 4B9AA 2Q4EA 4CMEC 3NALA 5MN6A 4JUDX 5FOTA 1IAVA 2P69A 4AJIA 1VPLA 1T4GA 1THMA 1E2EA 2NT3A 1GR1A 3AX6A 3GO4A 3HH8A 1CY0A 4YY3B 2B20A 1A9PA 1EUZA 4LJKA 1J0EA 3UV6A 4PG8A 2IYUA 2F67A 3C3CA 4MDFA 4KW7A 4RA9B 1DTWA 1LBSA 2IEGA 5H70A 2OC4A 2VZLA 1W0JD 2YN4A 2WRZA 4DMCA 2AR0A 4YLEA 4MPPA 2HDWA 3U26A 1ZIYA 2Y92A 4CCYB 5IPFA 1E6LA 4O3MA 1OLOA 4GKKB 2WVHA 1SXJD 1UP4A 4FCCA 4QFCA 3WYEA 3EIEA 4U3JA 2WE8A 1JVNA 1RWQA 2G4LA 3DTTA 1ATIA 1T5LA 4BLPA 2OFPA 5FWYA 1BDBA 2PS3A 3EQZA 3IO5A 4MULA 4NV3A 4JMLA 1A69A 1CETA 1SKYE 1PJLA 2JAHA 1IEWA 2JI8A 4FSDA 4NYIR 5DHTA 3ZCUA 1E5LA 4I4TA 3W6ZA 1CF2O 4QBGB 1VPTA 5F7JA 3ZU2A 2C42A 3GFSA 4A27A 1PR3A 4TS9A 3IJEB 4XSHA 3SXJA 3TB4A 3WS7A 3CZQA 3THWA 1QE5A 3P9QA 2ESRA 1T4DA 1P7YA 1ZD8A 2GYYA 3D54D 4J0EA 5T4HA 1QZXA 4JQZA 4XX1A 1GTL1 1S8NA 4IZIA 1PSDA 1E9AA 1VMDA 2IOYA 2XUIA 3PNOA 4D9KA 1T6YA 2FW1A 4NHEA 1N8TA 5THQA 4NXMB 2W6PA 3H6HA 4FQ8A 4NK5A 4YP9A 2YASA 2AWNA 1AJEA 1ODLA 1WPQA 2XUPA 1OAAA 3EUAA 3GDFA 4DAEA 4UXIA 1N2CB 2XA1A 4U7DA 3UUGA 4KR7A 5A05A 1URPA 4DEXA 5IHPA 1UOEA 1YFZA 2DUUA 4BO7A 5KWJA 1R0SA 5JADA 1TM4E 3JWEA 1W49A 1M0SA 3K8ZA 3MWEA 4JJAA 5AVYA 4IP0A 2CNKA 2D0DA 3ZDEA 4DUGA 1TE2A 2O23A 5A1JA 4D4JA 1GTSA 2OV3A 2P30A 3O75A 4DJFC 1Q1NA 3BE8A 4DLYA 5IKOA 5BSHA 3BT7A 3DMNA 2X8LA 5KREA 1W75A 3LIPA 4C76A 1B76A 1ZICA 1TTPB 2HCTA 1C1XA 4YV1A 3G7SA 2ODTX 4RQAA 2NZUG 3F1LA 5DHQA 3F6YA 4IV5A 3UN1A 4RZHA 1WCWA 1FTYA 2JCXA 3ZCQA 4JN6B 1E9SA 3IUNA 2NXJA 3KB1A 3WSVA 1YB1A 1R5JA 2FN7A 1I8TA 1AF4A 1DJPA 3DDCA 3LCUA 5AKXA 5BYBA 5LXTB 3MB5A 1UMKA 5AK0A 1G8PA 2A92A 3IOBA 5F7XA 4LJSA 1BAPA 2OHOA 3D6NB 4EUEA 4ANFA 3CLTD 4LYDA 3D8UA 1E3QA 3LOPA 4L3VA 1L7VC 4RCZA 2WWVD 2SICE 5B55A 1PR6A 1VMAA 5TS3A 4Z49A 5CITA 3WMFA 3P2IA 4CDRA 4GLJA 4WVLA 3U6KA 2Y4OA 2H11A 4DV3B 2XDYA 4CEJA 5H0IA 4OVKA 1ZH4A 2YZ2A 3L92A 1XHFA 2QK4A 4YMHA 2ECQA 2Y9MB 1UPUA 5EZYF 1RPAA 3N2KA 3GZJA 2P79A 4NCXA 1TAGA 1I6MA 1NDUA 1MEJA 3DV0B 4N39A 3RS8A 4ASUD 5BV0A 4DT1A 1IHYA 3W77A 1ST2A 4A7PA 3Q4GA 1O89A 4ID9A 2JIOA 4DMLA 5BSEA 3RC8A 1QANA 5CW1A 3Q7SA 4DJ5X 2WVGA 4D8TA 4ZI2A 1G1AA 3R0XA 3R5XA 1Y98A 4MPJA 1VLVA 3B9RA 3O94A 2YJTD 4D9CA 4TS3A 3ITDA 5F1PA 4D43A 1Q15A 3LOQA 5AVTA 1J22A 4KN9S 3WBKA 3I1FA 3TUIC 3GA5A 2N0SA 5FKJA 3TTWA 5HVNA 1WCIB 3I6ZA 2X5NA 1P5RA 2E49A 4TV8B 5E4YA 3I32A 4Y1RB 4HT3B 1CDOA 3DCYA 4F7DA 1P3DA 3LCVB 1V8FA 1FF9A 1Q1AA 1U0SY 1WY7A 4FKZA 4IDEA 4CV3A 3OZGA 3QYFA 4N0DA 3BB1A 3BIXA 2E48A 4TVBA 3CR7A 4PVCA 1SJ9A 3TNYA 1VA4A 3ZZ0A 2RHTA 2A1UA 3LUKA 1Z6XA 2C95A 2Q29A 5FR2A 1QORA 4PZPA 2KW5A 2HQSA 4RA6B 4WN9B 4ROTA 3FMPB 4IWXA 4Z6KA 5LB4A 1KMHB 1Z5GA 4OSOA 5CVTA 2GARA 1M2VA 1UFVA 1K63A 1MQ8B 1OLSA 2NADA 1CZHA 2O8VA 2B61A 4PW0A 2JI9A 3WLLA 3RT1A 1G20B 3WV4A 4M98A 1QG2A 1Z5OA 4IJVA 4PAMA 1MJHA 3D0OA 1SAYA 1DIAA 5KOYA 1E18A 1I1NA 2FQWA 3QEMB 1ZUWA 4G3XA 4JLPA 5DHSA 4ZANA 1HL3A 3H87A 2OGWA 2B3DA 3GEHA 4L8LA 1IMOA 4I1UA 1X74A 4TZ0A 3A2NA 1BHQ1 4IKPA 2A9OA 2AJDA 1T3GA 2FPUA 5JHHB 4RIIA 4NFYA 3A6PC 2H1RA 1J8VA 4FOTA 3T41A 2EERA 3TLEA 1YU9A 2WKWA 2PBFA 3VZCA 2PUTA 4M9QA 2EP8A 5J2TB 4EW2A 1NXSA 5CA0A 3LI2A 3NH9A 3C24A 3DOJA 3A27A 1SKMA 2PH7A 3PYXA 4FS8A 1HKUA 4PZZA 4RXUA 5FPHA 3BA1A 5AHOA 5H83A 5TF4A 2FEWB 2O8DA 4PPGA 3V46A 1UC9A 2J7PA 2WJPA 2V0NA 4KMSA 2VBIA 1MAAA 2C3PA 3EPPA 4R5MA 1CNEA 1LBTA 1WHTA 3L04A 2HCFA 1Q1BA 2PGXA 1FU8A 1MAWA 2QM3A 4N18A 3L6UA 5CVJA 1E59A 1QGDA 1NSFA 4LKOA 5J2UF 3ND6A 1KDTA 3MMZA 4HX5A 4RZQA 1Z3CA 1OKKA 5JARA 1UDWA 2OENG 1D1SA 1OROA 1YVRA 2X1MA 2G5TA 3IQEA 1U0LA 5L3ZA 2IV7A 4EQ6B 4KWEA 4YV0A 3LBYA 5L7YA 1ABBA 4MKIA 2ZFUA 4F11A 1CE8A 4Z3DA 5MFPA 2IUSA 4HAVA 4J94A 3NDPA 3AFIA 4DNFA 4TTAA 1P1KA 2FQXA 1L7BA 2GN2A 2B36A 1P62B 2B78A 4GDMA 4H3KB 1T5BA 2JLVA 3BQNB 1D7OA 1Z33A 2H51A 3DKVA 4MQEB 1YK1A 2ZSFA 2ZYTX 1XLWA 3AR8A 3H5WA 1RQXA 2FEKA 4IJQA 1XLTC 3RJ5A 1KSHA 4IUBS 3NWJA 4L07A 5ENZA 3WP0A 1XVTA 2YL2A 3QXHA 2B21A 3E7WA 5ED0A 5H82A 4I14A 3UAZA 2GJKA 2DFNA 1UJCA 3DEZA 4AKEA 3CKMA 1A9RA 4YUXA 3G0BA 1XJWA 2IPLA 1PFWA 1FDUA 2PEYA 3KSBC 2JLBA 1EWKA 1WL8A 3HJUA 3I8SA 3E1GA 4ZHQF 4DCSA 3KTAA 2ZJ5A 3H8JA 4GC5A 3WLQA 1RP7A 1XTKA 1X15A 2X7JA 3DDWA 9GPBA 4GE3A 1MU0A 4X71A 4BO4A 4E03A 3QBDA 4R31A 1IVYA 4ZQEA 1KQPA 1BXRA 4MJLA 4XWWA 1P75A 1TGYA 3AU8A 4CMKA 3HC7A 5EJEA 3CLUD 1A5TA 2X14A 5AKYA 721PA 1FJXA 2HHJA 2IYVA 1DCTA 4P4UA 4P7GA 4HUTA 2C07A 3G0OA 3QWHA 4XM2A 3GB9A 1I0ZA 4P32A 3MMSA 4ZD6A 1KEZA 3K73O 1SG6A 1NR1A 3U4QA 3S2GA 4W8GA 4LA4A 1DEAA 1RZRA 5I7FA 1SU6A 2BEWB 5EA2A 1NLYA 3WQSB 1P9NA 1Q84A 2O8CA 4HXGA 3PPVA 5EUMA 1C4OA 1QHHB 5KYUA 5C7IO 1MQSA 5TVGA 3U40A 4GH5A 1ZM7A 1EHCA 3O8OB 4I9GA 4R84A 5BR7A 4HHEA 2FPPB 2C29D 2H0AA 1EDDA 1PL6A 2G40A 3KFVA 3VSCA 3VU1A 2WQZA 4I4IA 5ALDA 2PFGA 1XKXA 1JHQA 4EATA 3BWYA 4KITB 1GQFA 2PZLA 4V0OA 3ZYZA 1LI5A 1HTTA 1UKVY 4KX3A 4J7AA 2ILTA 2RFLA 4X8LA 5LN1A 3OFNA 4L22A 4ZT4A 4PPQA 2BKVA 3K1ZA 4Q16A 3ZC3A 4HI0E 4DIMA 4DLKA 4F6CA 2ZRJA 1RMTA 1US8A 3DW1X 3OJ0A 3TRKA 3H97A 4N8EA 2OOKA 2ZRHA 4L5YA 1C8BA 4B6RA 4YLYA 2VDWA 3VH3A 1FMFA 1PX2A 3CBQA 5F3WB 4CTMA 4WZAE 3BQ9A 3HJGA 3RHSA 2OEPA 2C0QA 5D5PA 3LO5A 2RARA 4JB3A 3VDMA 2F8SA 2CFRA 4EX6A 3TZQA 1PQPA 4IHQA 3BKWA 3VKWA 3FN4A 4I46A 2MIIA 1AC5A 2RGNA 2YXNA 2ZRDA 3D1LA 3U4IA 5CVVA 1YR9A 1AKWA 5GONB 4DLTA 1CERA 2J9XB 1MN6A 4ARUA 3F3SA 2W43A 2PGLA 1XMIA 1QBKC 2MYNA 4UOEA 3LYUA 3FLAA 1P77A 3VDRA 1VKJA 3ANTA 4EB6A 2I2WA 3HWX1 4ZVVA 2P6PA 1TC1A 2QYSA 2VO1A 2Q2NA 4GOMD 5DASA 1HRDA 5H3HA 5IARA 3WWYA 4AG3A 4NONA 5BUZA 1PLJA 1EVLA 1ULHA 1QU2A 4MNTA 3A3PA 3CX7A 3R9IA 1Z62A 4CMJA 4AUNA 3GLSA 1XAIA 2J9RA 3RWMB 4KHZA 3RUCA 3G59A 4OFZA 3MWLA 4P1ZA 3CKYA 4P4SA 5FX2A 1ZUIA 1CFJA 1XMVA 4WLUA 5TQVA 3ZLUA 4F5DA 2NG1A 3GZTB 3FAKA 3DBHB 5TQ2B 3MT7A 3UH1A 4NAUA 3RAFC 1SXQA 4LF8B 2QWXA 2PX3A 3ABOB 2DPMA 4K03A 1SBCA 3KJZA 4PHTA 4TRRA 2JIMA 2NTNA 3HP1A 4MA4A 1ADCA 4DLAA 5A02A 4KXUA 5FJIA 3VR4D 1LRLA 4GUAA 3OKCA 4C22A 5H9WA 5EJ8A 4LHSA 3RCBA 3DT6A 1MH1A 4PVDA 4OOFA 4OYLA 1F0NA 2DT5A 5IEJA 1Z2AA 1EFPA 1I2CA 1T2UA 3UAVA 4E33A 3KR0A 4RVUA 3I12A 2BP7B 3QRWA 4R71A 4JY7A 3GGJA 4C6SA 5ES3A 4U5QA 3EIUA 3I5MA 2JJMA 3OJFA 3WRVA 1M5TA 3C74A 2ISSD 2V1UA 2O2GA 3IIMA 1X8LA 2FWRA 2GA8A 2HZ7A 3UAGA 3BRSA 1K7CA 1T0IA 5DCUA 1RAHA 4DDVA 1RIIA 2LRHA 3U7QB 3EE6A 5FI0B 2HRRA 4BV3A 1X6VA 4LJ4A 2WQ7A 4I1YA 5CA1B 4DCGA 5DXAA 4QU0A 5K3OA 5IVKA 1FDWA 3KOZA 1QFJA 4DLNA 3HNOA 1U4NA 2ZW9A 2LTAA 3FHTA 3B3GA 1JR3D 1DAEA 2AT1A 2I6UA 4AZ0B 4ZOQI 3EAFA 3O1IC 3GCXA 4R8KA 3GPDG 3NVDA 3DL2A 3BXEA 2DFKB 4LYEA 3NBXX 3LL7A 1PR4A 1OGYA 1V35A 4G24A 4HNGA 4X63A 3TK1A 3ZD8A 5LLTA 2NSDA 2QG4A 1UZNA 1QRDA 5DSTA 3ZHOA 1P4RA 2CXXA 1ZGBA 2NZ8A 2AIRA 2GEVA 2JD2A 3WL4A 2VTEA 3GMDA 4G01B 2EL9A 3K96A 4PBSA 4BNIA 1I2BA 2MMGA 5HJ5A 1VIMA 2GS9A 5AD1A 4E1AA 5CDUA 4EYSA 4MB0A 1E64A 3NTQA 3ONFA 5ESDA 4ER6A 2PV0A 4M38A 3UV7A 1NUUA 2ONKA 3T12A 3T7IA 1UKCA 1ORRA 2A94A 1GPYA 2G82A 4UMVA 5CX1B 2ZSUA 4DW8A 4BMXA 1PD1A 3FPAA 4YXFA 3INGA 4EHLA 2XBLA 1YQEA 4FGWA 3ZBTA 4BQIA 4UOZA 3DAOA 1ZXXA 3Q9UA 1TJ4A 3W3AA 1KI3A 1RJEA 2QRQA 1NBOA 4N5MA 3TLAA 2OGUA 1KKMA 1FDRA 2VK2A 1OLXB 3V97A 5CDYA 5JH7B 5DE3A 3SZGA 1KOJA 4MUJA 2FWPA 2YVKA 5LD2B 4FW9A 2Y3IA 4C2TA 3ZIDA 1KI6A 2I6FA 3L0ZA 1LA2A 1MV5A 2D3WA 3SZ3A 4C0QC 5IVHA 3A10A 1O58A 2HUNA 2P91A 1H5UA 1PUJA 4JXJA 2RGEA 4QTTB 1LLUA 3M33A 5K03A 1ZSNA 4U2DA 4DBZA 4TWZA 5DRYA 3I04M 4P3YA 4PFQA 4QDUA 1EVQA 1I5OA 1EXNA 4MK4A 2FWAA 3TJRA 4FGZA 3ZWPA 2HH9A 4HB4A 3EPKA 1JDJA 3U4CA 3OX2A 4XUGB 2LGJA 3Q6MA 3EXAA 4HPJB 3PENA 4MKFA 1ZUD1 4ESEA 1E1QD 2QSJA 1WJGA 4GSLA 2I80A 1JLHA 1ZW6A 3M6IA 3IALA 3NVAA 5FO0A 2DPHA 4D3YA 1DTEA 2JEOA 4JODA 4I3FA 1YBVA 5I4BA 2VATA 2ZQZA 3BCSA 4XDZA 1FJ2A 2I87A 5JBQA 1GZ5A 2XIQA 5JQGA 3KQKA 3D7KA 4R68A 4XWTA 4R01A 1PHPA 4IO0A 1PEKE 1IY9A 2Q4TA 4JT9A 1B4DA 2AUMA 4ZZ3A 3TX2A 2J9FA 3G5TA 4CF3A 2EKQA 4X85A 2ET6A 5I9BA 3KVNA 3DVSX 4IDOA 2DGDA 4MO2A 4WOKA 3CFYA 1Y7HA 2PS1A 1WW8A 2X4LA 2RGRA 1B6SA 5CG2A 2YV5A 1S8AA 1JG3A 5A7GA 1GSHA 3SDSA 3OQVA 2Q2VA 4LV8B 4F0JA 4M76B 4MAFA 2IY8A 4DMHA 2AN9A 3T61A 3I2YX 5KSPA 3FH0A 4XVCA 5BOSB 5A4DA 5JOQA 3WWZA 1OHHD 4GOJA 1V5IA 4IM7A 2NU6A 2OZLB 3JD3A 3IUSA 3O90A 2VP0A 4EO9A 5F9FA 4JXXA 4UZSA 1PR5A 2IWHA 1LLCA 5SY9A 4Z1MD 3T54A 3QMWA 4D02A 4EENA 3N53A 3AEKB 3AVUA 4D74A 5F5LA 3I9OA 1XQ1A 4LJLA 1WVMA 4KOEC 1V25A 3SFVA 4C5CA 2BFAA 2WSIA 2G9ZA 5ECDA 2DQSA 3F6BX 2WUWE 2EKDA 2ZVQX 2A9QA 4H1VA 3F5MA 1JG4A 3F0TA 4QYIA 4MV1A 4QVIA 4FMCF 3U81A 1ORWA 2XCQA 5EE0A 4RVGA 1ZZGA 4WY8A 3UOAB 4KPUB 4RHCA 4EVSA 2Z4RA 3IUYA 1YA8A 1X92A 1YRLA 4IS3A 2OCDA 3K70D 2QT0A 2XJ4A 4URVR 4GM1A 5H3LA 3T1VA 3ZGYA 1F06A 1MP0A 3DZJA 3LW7A 1T9HA 3ZZMA 4LJYA 1UWKA 3LKZA 5TGDA 2NUAB 3OZIA 2W6ID 4TRJA 4RIGA 3ZTTA 3DWEX 4RXMA 3HBFA 4WLFA 1I7SB 2FNAA 1ECPA 4UU0A 4G0UA 4DV6B 3I34X 4XFJA 4WK6A 4TYQA 1HE8B 2MR6A 4KMMA 1JDVA 4MUBA 3R9XA 3TBHA 3PF9A 1O95A 1T2DA 1IXSB 1MORA 3LQ1A 4CKWB 1CR2A 1UUFA 2CD7A 2OZPA 1XDSA 4MGKR 1T9KA 4CF4A 1T4CB 4O4IF 4XD2A 4BYMA 2YWEA 2JLWA 1RYYA 4UTPA 4LDNA 2AFIE 2GAIA 1UCFA 2GM9A 2VJAA 2EATA 1ISPA 2H08A 3PDHA 4AY4A 2OBXA 5BT8A 3MINB 2AI2A 2DFDA 2LW7A 3I9JA 1VZ3A 2ZVJA 3DE0X 2YOGA 4XUEA 3I45A 4F21A 2VDLB 2WHXA 2YWCA 2Q3FA 3M81A 5GADl 2PZFA 1ZSVA 3FPFA 3OZSA 1GDTA 4IJKA 1ISJA 3LUBA 3CW9A 1E1YA 2WUVA 5LZ5A 3R20A 3N28A 4Z4QA 1FP1D 3EBOA 4EMBA 3RU3A 4YAOA 2XR1A 4YUZA 5JJKA 2QR5A 1U0OC 2CMGA 2W6OA 4XIJA 3IAXA 4JP2A 1C9YA 1PJAA 2ZP1A 4L3OA 3WLTA 3GJQA 3ZDCA 2J5RA 3B1ZA 2WSSD 2OAQ1 3LQFA 2YWGA 3Q2OA 3DMPA 2CLHB 1PG2A 3IQWA 2ZWAA 4FEAA 3I9KA 4JX8A 4D9JA 1TNDA 4CF7A 2JJ1D 1BVRA 2A9VA 3U6BA 1PEYA 1B1AA 3FNFA 3KZKA 3HDGA 1MDFA 3DGFC 5TJ9A 1ZQ9A 1MV8A 5KNCH 2V8BA 3FROA 3I2IA 4ZU3A 4ME6A 5KZMB 3U56A 3CZ5A 3W1VA 4CKCA 4ZT7A 3RVSA 4WLNA 1P80A 2GR9A 1JLRA 3C43A 1XRNA 3L05A 3D6FA 4XSGA 1F0KA 3DQQA 3PJRA 3OM8A 3HVJA 3ESYA 2JIZA 4TN5A 4EYEA 2NU8B 1G21A 5BW4A 3H42B 2XT6A 4N7JA 1TYCA 3GMTA 5E38A 1H6AA 2K87A 4MYSA 3U9TA 4F7WA 3ACDA 3W6UA 1UZUA 2OORC 1BJKA 2DHEA 2Z4SA 4ZVNA 1R0KA 1YJ5A 3W5DA 3TKLA 1NM5C 1A27A 1CVRA 5IM4F 2ID7A 1JHXA 4KBGA 4RIEA 5LP6A 2XDQB 4MARA 4MI6A 3RSLA 1E5DA 3UEOA 7REQA 4RMIA 4L74A 1FIUA 4R2XA 5FTJA 3NGMA 1DRKA 3A2LA 1A04A 1XZMA 1Y6RA 3D6MA 4L28A 4DDWA 2F3SA 3K9QO 4ES6A 4L85A 1BA3A 4E12A 2JIBA 1A8HA 5IAKA 5IRCD 3ZW8A 3AZPA 1RRPA 2O20A 1A4IA 1VE1A 3ADDA 1I0IA 3ZGNA 1NE2A 2FG5A 4XH9B 2IODA 2ZZNA 2EBFX 2G4CA 4H7KA 5DKFA 1JH8A 1I2DA 5I7AA 1PQWA 2C5AA 4FZ3A 3EVGA 5LDDC 5JMPA 1CZNA 1II8A 3C97A 4TT3D 1XDBA 4LXUA 1AZSC 2B9EA 4WQMA 4E6PA 4RCYA 3DKIA 3W05A 2AJ8A 1YUBA 1CRWG 4UKDA 4ZYZA 1UBTS 2GCEA 1Z13A 2PXCA 2IH4A 2V0GA 1BU8A 1P0PA 2WG1A 1L4BA 1BN6A 5EYPA 1C7EA 3GGOA 1JMYA 1UBMS 2XD9A 3E0QA 4DM7A 2WK1A 3GGSA 8AT1A 1TD1A 2VYCA 4P08A 3ZDRA 5I48A 1C2TA 2AC2A 2QW8A 1FP7A 4EUKA 3C3DA 1HNWB 2NU7A 5E6RB 5E9AA 5J9FA 1TUBB 3OP1A 4JKYA 2FOLA 2HU2A 1GUYA 2AF4C 2B25A 2V6BA 4FYKA 2EJWA 2AEMA 5BR4A 3U44A 1XRRA 1AKQA 2UUCB 3C41J 5EMNA 3BICA 2I4TA 2RB4A 3VR6D 4HXFB 5JZ9A 1W0KD 2X77A 2YVUA 3UXYA 3TE7A 4BVKA 3BGSA 3OCUA 3P32A 4L4UA 4Y2PA 2Z2XA 5E1MA 1ELOA 3G2MA 2RD2A 2O54A 5DX0A 2A4KA 1VSTA 3B2EA 4UHCA 4X7MA 4MGIR 3UMFA 1FJGB 2QTBA 3VI3B 3ZD7A 2PGDA 5DNCA 4NNPA 2J08A 4LK3A 1R6VA 3P94A 5DSZA 4D26A 1B42A 3NWOA 4RTRA 1N1EA 1WVIA 4H59A 1G5QA 2I3GA 2OAEA 2TRSB 2D13A 4QRHA 4P84A 4C4TA 4PSCA 1DT3A 5FWAA 3QWBA 3UOGA 4EFLA 2GPNA 5JSZB 1LZLA 3FA2A 5J3JA 1D6SA 2WT9A 3NDBB 5JAZA 1YZUA 2R44A 1BGWA 3PQEA 4I55F 1W1IA 4KODA 4M99A 2GKSA 3BMOB 1KDPA 2IEDA 1AURA 5EG5A 5ECGC 3HKEB 4AS2A 3JAKB 4XOIA 2OMEA 3QVVA 1BA2A 4QXOA 4X94A 5ENVA 3KSZO 4TQUS 2M6LA 1BHO1 4EPYA 3EXEB 1ORIA 1A7AA 3WXMA 4F4JA 1VJRA 4N3AA 4CPDA 3PWTA 1WP9A 5FL7A 2Q2QA 4WXYB 1V9SA 2F1JA 4RL6A 3ETDA 2L17A 1K89A 2ABWA 2OQ2A 3I72A 1XVVA 5TMPA 4RESA 3Q15C 2ZUUA 4PGHA 3E7XA 1YRAA 1ZNYA 4DC0A 2AV6A 1OPRA 2V7WA 1FP2A 4LZZA 1NFQA 4HRXA 4J16A 3HNPA 5HF8A 3BX1A 3H9JA 4F3TA 2DCUA 2WD7A 3ISTA 1RI4A 1E96A 2CEAA 1JX6A 3A1WA 1M2EA 4ZREA 5KKCA 3QM1A 3SYNA 3GIWA 5JYBA 3RT7A 2HLDA 4W99A 1XEFA 4M9SA 2CYCA 2VJOA 2BONA 3K1AB 3H04A 1F9EA 1M66A 4P4NA 3IQFA 2RHDA 4L6AA 1O87A 2XEDA 4PPFA 3BHJA 1BGVA 1MW8X 3W5UA 3HMKA 1DJQA 3PG5A 4PSUA 3JRWA 4IXWA 4XXHA 3JYOA 2QR3A 3PUVA 2AK3A 5JTUA 3DZ8A 4IZ6A 4W7IA 4P93A 1OBCA 1E2MA 1GUZA 3OCYA 1N2EA 3FB1A 4G37A 2HWKA 2PMWB 3LX8A 1VLJA 1N3IA 4DCPA 4IOJA 2WUEA 5DW0A 4JD5A 1RSZA 2HJRA 2QPLA 421PA 2JLAA 2NSYA 2B37A 4KN8A 4MW6A 3WHIA 1U5BA 3O7WA 3FNGA 5A3VA 2OFFA 2BGMA 2QUKA 4RY9A 1M1YB 4H3SA 1YAJA 1DX6A 3N74A 1VXOA 4IRMA 3I2HA 1KP9A 2XQKA 2GAFA 1NJFA 1TJNA 1WPXA 3I5AA 3U62A 3V3TA 3M1IA 4HC4A 3EFOB 4REMA 5FUVA 1Z25A 2OHJA 3CPSA 4XDYA 4YJ3F 1ODJA 3SQNA 2WINI 3D3WB 3MA0A 4FYJA 4H15A 1F0YA 5JWHA 5KTNA 1GT91 4I6JA 4ZDJA 5CXQA 2H1LA 2O07A 4KVGA 4Z2YA 4BQEA 3B78A 4EA8A 2QJTA 3H0KA 2R8PA 4ENSA 4IINA 2M6RA 1OXUA 2EVWX 1OY1A 3R3SA 3CLSC 4ER7A 1RC8A 4J2OA 3EC2A 4RD1A 3AHEA 5K3EA 5BNIA 3E03A 4BJ3A 4YJ2A 2FFBA 2VTBB 1O97C 1ADJA 2GRUA 3IA2A 3LDFA 3DJYA 1DTWB 4TQGA 1E2HA 2OY0A 3B82A 1XK6A 1R0LA 2ZCVA 5AXDA 5K4AA 4FHDA 3T34A 2JK1A 4A2WA 3CUTA 5HS6A 4ID3A 3D8RA 3OD1A 4BQQA 2EF0A 2G5PA 4H3VA 5FEUA 1C3EA 3HI6A 3CEHA 4UQOA 2OQIA 1XTPA 2MOKA 4XX0A 1O1YA 1T2EA 2VDJA 1OX6A 2HU8A 3L43A 4UEKA 3AM1A 1SIWA 3KXDA 3GFOA 1N9GA 1NY5A 3PU6A 3I76A 5K0TA 1OXTA 2VI5A 1T0JB 1JHOA 5JZVA 1OTXA 1RT9A 3EPRA 3PUIA 4KFUA 3X1YA 4DGQA 4GSKA 1OA0A 4WZ6A 1Z06A 2GBGA 1N6LA 5EMJA 4QBTA 4PNHA 5DNAA 3IDFA 4QHSA 1L5ZA 3DKRA 3W9UA 4L76A 2JFBA 4MUAA 4HV4A 1WABA 1KAOA 4CUZA 3I04A 3FGZA 3OEWA 2JGLA 1BE1A 3ABIA 3TW0A 3IEMA 3R5TA 1XX6A 4JYPA 4ACBA 1JHZA 5CD9A 1TRHA 2ZROA 3RVJA 3AW9A 2CHQA 2FP3A 2IVFA 3OZWA 3CNQS 2RGUA 3EZLA 4Y9DA 3IIJA 4BXOA 2WYUA 3ELWA 5DJ5A 4XTRA 2QTGA 3DNPA 3NTOA 1RS0A 2QLNA 3PX2A 3ECCA 4WBNF 3JR7A 1ZH8A 2DWOA 3D2BA 1JHYA 4O2AF 2DR2A 3FPHA 1KI9A 4C7OA 1MX9A 3W8NA 1JSRA 4MVJG 3MS4A 1PTJA 1I30A 2B1RA 1HDEA 1WKCA 2M6SA 5AHXA 1SVNA 5HQJA 1NMQA 2VDVE 3EWSA 1E92A 2CC2A 3PXEA 1C1XB 2JFNA 1FXSA 2VZ8A 3HJAA 2FQYA 5ARBA 5BRJA 3IV7A 3OHPA 4NULA 1YZVA 5EERA 4YN3A 4DRXB 2VEOA 3K5WA 4DV5B 4EGFA 4UPVA 2QTTA 3PJFA 2G1PA 3K0CC 1N32B 3KAQA 1Q0PA 1NLZA 2HPVA 4NBVA 5JMTA 1RDFA 2ZB3A 4MV5A 2DR3A 1SUBA 5DWVA 3E9NA 1G2PA 2BBWA 3H1GA 1ZKMA 2QMUA 2PO7A 4FVTA 2JH3A 1YONA 2ZAMA 5TIIA 2C7BA 2CXQA 2QLJA 3ZWQA 1FFBA 4YBRA 4PLPA 4ITVA 2R8EA 4CRWB 5F23A 2XDAA 1EVEA 1KO4A 2XTZA 1QS0B 3FSGA 4RK6A 1OIVA 3EWIA 2FEXA 3K9FC 4K0RA 2CMHA 4CEJB 2OC9A 5JNLA 4AN4A 1IM2A 3OX3A 4KIFA 4HRVA 3RB8A 4N01A 2P62A 4LI0A 1GOTA 3RAEC 2VXBA 4LJ5A 1MVOA 1YFJA 3SMVA 3HSSA 2ZE5A 3QF7A 4GYWA 1EHYA 3S55A 1NAHA 3DBVO 3DMYA 4DT1B 2OKGA 1D04A 1GSIA 2GNPA 4FR5A 3O03A 4C7MA 5J2UA 5G0SA 1DFIA 4Q39A 4Y6RA 5CBPB 1D9XA 1AY0A 1U5AA 2ZRNA 4RETA 4DTCA 5KVSA 5KNBH 2UXBB 1L5WA 4G1VA 2W9XA 1GA1A 3MUNA 4TRMA 1TCBA 4QVKA 2FR1A 5JDIA 1Z0ZA 4KQXA 2PDAA 1ZIOA 4EKEA 3B3JA 2I3DA 1TCCA 3DMHA 1E6WA 4FR2A 1YFKA 1SVIA 3JS5A 4HAUA 1WHSA 2ZT5A 3PHBE 2OO3A 4FMDF 3UICA 1E4OA 3HU1A 4GYKA 5BUCA 3I23A 2QBYA 3DHYA 5G3ZA 3RVKA 1B14A 4HLNA 4GX5A 2WU1A 3B52X 1C50A 4RIHA 3BDIA 1SOUA 1ESNA 4WY2A 4EB8A 2X40A 1H3EA 1UODA 4N6OA 3LHDA 2CZQA 3FTNA 2ATIA 1VA5A 4IAOA 1UAAA 2Q7OE 1RAFA 2LUOA 2R8XA 4PV7A 2E55A 3Q11A 2WTNA 2OT3B 4B6GA 3VI4B 3OICA 1T2VA 5JYCA 1T0BA 1ECCA 4NABA 1SWVA 2C8LA 4II7A 1EFVA 3KKEA 3ONNA 3ABZA 3LX5A 3FF1A 1V0JA 2Y1OA 4LTNA 3Q9SA 1ZU4A 1VPDA 2WJYA 1M2VB 1L5HA 3HHEA 1M0EA 2PKRA 1OLSB 2PLAA 4KV9A 521PA 1HYQA 2VZ9A 2BV3A 2Q0HA 2ZRMA 1XRMA 2WJJA 1YVUA 4N6GA 4BX2A 4KQEA 2R6ZA 2HDHA 3ZDQA 1ZNWA 2OVFA 1EB9A 1PJZA 2EIHA 2I1QA 3KQVA 4I4LA 2H2AA 1L8OA 2O52A 2PCLA 3CJTA 4BO2A 5JYEA 2J3DA 3H0EA 3TLGA 1YQ9A 4ZYLA 5K20A 2H4HA 2YNMD 3GX1A 5DT2A 2HDNB 1H6CA 2A5YB 2UZ1A 1OBHA 1K4MA 4V0KA 1W8DA 1N7IA 2JC3A 1QMGA 3AL3A 3O8CA 5B64A 3I1JA 5IJ9A 4U7PB 4CN8A 3K15A 5CA0B 3B9PA 4L75A 4HSEA 4NMWA 3VKFA 1L5SA 3KKMA 4EJSC 5I5EA 4D8XA 4R83A 1B0PA 3H6GA 1MAHA 2GZMA 1GZ6A 4GP7A 5K6AC 4N9WA 3TR5A 2PZMA 4TWBA 1PV2A 3C3MA 2O8DB 3BM5A 2VPQA 3IOMA 2GK7A 1U11A 3MWYW 1YUMA 5B30A 3A32A 3AILA 1EVJA 4JKOA 4CLRA 4ABTA 4BY9E 5TDHA 1VL1A 3RSGA 1GXSA 2QRKA 5IT4A 4EBBA 4MUFA 2H52A 2ZTSA 3FUTA 1F48A 3FGNA 4PHCA 4YJKA 1PTKA 4UM7A 2D0IA 2Q1YA 1JVSA 2WFZA 3VH2A 2WKSA 2C82A 4AG6A 3ETJA 3LSYA 1RMQA 3VR2D 2C9BA 4CIAA 2O57A 3GJYA 1DQPA 3EXG2 5B58C 4DV7B 3IAUA 1XEWY 1DIHA 4Q4HA 2GASA 1O96A 1ZD5A 3WLJA 3FTCA 2ZI9A 3JQGA 3NP7A 4H60A 4RJKA 1MIHA 2GJSA 4U1RA 1GV1A 3IOCA 1N0WA 2DYKA 4QLAA 2IEIA 3R7NA 3GDOA 1ECJA 4AXXA 3CLRC 1WSDA 3R7SA 1JLSA 2WAOA 3PNKA 3TQCA 1EP9A 2DWQA 3IDAA 3P2YA 4N40A 4Q6BA 4PGFA 4HB0A 4AW9A 1BKYA 3A3KA 5J4HA 4W1RA 4GYYA 2IDMA 4PGMA 3EJWA 3U3KA 2J6HA 2QTRA 2XSZD 3TBKA 3RSOA 1JQKA 1R3UA 4QHTA 4F4HA 2WM2A 1VCIA 4CHTA 1WXIA 2O1XA 3LNTA 3QU9A 4H7IA 1T8SA 2XGGA 4IJ6A 3KTAB 2R48A 3QU7A 3KOXA 1KE1A 5T57A 4TWRA 2VDOB 2KQUA 2OBNA 2JVJA 4BNDA 2IVZA 2QMYA 4QQRA 5A9SB 2P4UA 5HSGA 1KKUA 5CK5A 1BXRB 2Y99A 1FXWF 3MMNA 4Q3KA 2XWBF 3RUIA 2AX3A 4C14A 2XX3A 5B4VA 2TMYA 3PCXA 4IWYA 5BOVA 3WJ7A 1PDOA 4CT0A 1DKMA 3AB3A 4FJ1A 3ZE7A 4K0KB 1K6IA 4W7SA 2QDKA 4GI5A 3ENQA 3PA6A 1UBCA 1OU4A 3IPCA 2OHVA 5FFMA 3FPEA 1H8HA 3K09C 2UYHA 3G13A 2EW8A 3GFTA 3DR5A 3M5WA 2I1VB 2XITA 1L5GB 3U7IA 4X64B 3SJ7A 4Y0NA 3LKBA 2WTXA 2G5CA 5COBA 3EPJA 2ZXEA 2W6JD 3CC8A 5JJCA 2A3NA 3WMWA 4A26A 3IL2A 2VHYA 3G3EA 1I0LA 1PGQA 1IEVA 5EIHA 4GI2A 4BO3A 1TT5B 1UPTA 4F2WA 4QG3A 4FUQA 1C3JA 3KUDA 1JXMA 1ESCA 2WVJA 3C3YA 4FMPA 5DZSA 4BEWA 5KTPA 4B31A 1S0UA 4QO8A 5FUXA 1W87A 1JFVA 4GP9A 2GBFA 3NM5A 4K9KA 2VDNB 2VUIB 5G4KA 3SLRA 1ONSA 4LCJA 1JA1A 3V4ZA 2VK4A 1K8ZB 1FLNA 3HXOA 3UUEA 3JARB 4DHEA 3QLUC 2OG2A 1TECE 2O4CA 3G8AA 4UHDA 3C85A 1J2TA 3AIIA 3N39C 4QDXA 5ALQA 1X9IA 1US8B 3DTVB 2F9LA 5H80A 4RTJA 4W6ZA 1Y8RA 4J0IA 3HCWA 2OQRA 3HRKA 5F4BA 4Q3CA 1GRCA 5LQAA 3PHGA 5DX8A 1VMEA 2HPAA 5LQKA 4G0NA 2NAPA 4LZNA 2DQ4A 3DP9A 2VJBA 2JLXA 4XARA 1O6ZA 4Q93A 5JV5A 1SHUX 1UXIA 1VI2A 4OHBA 1MO5A 1JECA 2OUKA 121PA 3IS3A 3L1KA 2BBOA 3KSDO 3ROGA 5C5IA 1A2OA 1J25A 1XDDA 3RU2A 4FOOA 1BDMA 3EDOA 1NJ1A 3TSZA 4P5PA 5GGYA 4DLLA 4OQLA 4EHKA 4G5GA 1E99A 2C3MA 4OQXA 5JALA 3HBMA 4G26A 1LJUA 4BKOA 4FHFA 1P2DA 3A37A 5IVPA 5M2QA 1YMUA 3PLRA 1GNTA 1ZOLA 1CRZA 4HGQA 4OQ4A 3AGPA 3WNQA 4M0CA 4Y9SA 5JS8A 4P9NA 1QIIA 4CIWA 5ALOA 1EIWA 5KAMA 1E4EA 5AOBA 3KQQA 4RV4A 1AG9A 3BGOS 3V55A 3I2FA 2ASEA 5AJXA 2WWWA 4NBLA 1E79D 3CNLA 4BU0A 1UP6A 1D2MA 3B5EA 3WLMA 1G8GA 1R4AA 4NCNA 1I5RA 2ZBVA 2QI9F 4TWIA 1NXTA 3R5JA 1FPQA 1VE9A 1YZTA 4MTCA 3G0GA 3AUJB 5SY6A 5CDTA 4R1LA 3T1OA 4JUIA 2PUDA 4KXMA 2Y1LA 2PPLA 5LR6A 1A2QA 3U4MA 2I2DA 4LRSB 3RFXA 4DV1B 4QX6A 2IDJA 3QPBA 1BG6A 1ZUHA 1MENA 2WWFA 3HCNA 4ZAGA 4XWGA 3KUUA 1LWOA 2FCAA 5C1BA 1L7AA 1GQOA 1EFPB 1P7WA 2O2ZA 3DZCA 3PC4A 4LIPD 4N5HX 4PC3A 4FOSA 4YGYA 5ILQA 3S44A 4V1CA 3CNOA 3OZRA 1EWTA 3RVBA 1D0SA 3WL8A 1QAMA 1JEEA 1YH3A 3NYRA 1MJGM 1UBJS 3RSHA 3HB0A 1OW3B 3IUJA 3RK4A 4EABA 3RVPA 4CQMA 1BSVA 3FUWA 3QKUA 3NHMA 4P0QB 3LT2A 3NAZA 4LF5B 1H2XA 4AULA 1PZGA 2YJ6A 3RG2A 3LQ4A 1QV6A 4H35A 3NATA 4JOSA 5D87A 4YAGA 5KNDD 4POOA 4F4FA 3LTNC 2O2DA 2P2LA 4I8XA 5LA6B 3K9BA 3EXG1 1G1MA 1LBQA 3NTUA 4I6GA 1MNQA 2BGRA 2WUDA 3F78A 4A8JA 5E95A 3GWZA 5H16A 5J4KA 2O7QA 1Q11A 3AH8A 3R75A 1N9ZA 1E89A 1XXHE 3H2GA 3NBAA 3OU2A 4O0MA 4YRDA 3ZY5A 5A62A 1KXJA 1M74A 1SC4A 2PZAA 2HSDA 3G88A 5A03A 1YMQA 1TEHA 3JQ9A 2W4IA 3FRHA 4TQ9A 5K51A 4ZI3A 4INPA 1JDSA 4FYMA 4KRXA 4RVSA 3CMMA 4WUVA 1OX4A 4RYDA 4ERXA 3F73A 1W36D 5CB4B 5GOTA 2BCEA 1E1LA 2QU8A 3ES9A 4OX9Y 2V0CA 4MW4A 1AUVA 5D01A 1VB5A 2YMPA 3D3QA 2ZPTX 1Y9ZA 3BXOA 4V39A 2ICAA 3HB4X 4ML3A 2IOFA 4AUEA 1NVXQ 1RAAA 1CDEA 1N36B 5F5NA 1CQXA 3IAS6 3OU7A 4FMBB 4C4YA 5GM1A 1GIAA 4E6EA 1DAIA 4W5JA 3T9EA 4QRDA 2QRPA 1XN4A 1WS6A 2JK0A 3VR3A 2O8EA 2DY0A 4N54A 3G5UA 3KSUA 1JRLA 2NYUA 3RFVA 4YRTA 5KPJA 2PUEA 3HLKA 3JQDA 1TO1E 3BSYA 4MRVA 1GDHA 5JW6A 3LHSA 2GDJA 3FCAA 1FDTA 4FGJA 5K09A 1RKXA 2Q41A 2PSSA 5C8YA 2KBFA 3QKIA 4BNZA 3ZHYA 1OB5A 1DBPA 1KI6B 1Y37A 1TTTA 3C16C 4D96A 4CR6A 4D7AA 1AH2A 3OO1A 4ZU6X 3HABA 3B85A 3NH6A 1L8XA 4F6RA 2CNDA 3UWPA 1OXXK 2YRXA 3NIBA 2O2EA 3E5HA 1H6BA 4DILA 1AXRA 2N3ZA 2FYTA 4GVLA 1E8DA 4HDSB 2WUGA 4TSRA 2A5FA 4R0VA 4BEBA 4IV0A 2ZUSA 3NRCA 4LW8A 1JIJA 3GA0A 5C4GB 1YAHA 4GMXA 2JIDA 3O4GA 2D5LA 4ZYWA 2CLFB 3N05A 3RIHA 2R60A 3NHFA 4BVJA 4LYAA 4D8VA 3TBFA 4LRYA 1IM5A 1HH4A 4PG6A 2C5GA 3TD2A 3OJWA 1CEYA 4HTFA 1XMOB 3BB3A 3SWWA 3K9LA 4H9GA 3TEMA 4K9PA 3HO1A 2OP1A 2R6R1 1RHMA 3ORYA 4MS4A 3W34A 5CG1A 5P21A 2Z9DA 4M0KA 2QRZA 1DRVA 3GD7A 1EGAA 3AK4A 5LMCA 2QLMA 1GNQA 1RRMA 3T95A 4AUMA 1A82A 1Z0KA 2J9FB 4NBNA 4JELA 4E30A 5EZ5A 1F17A 2YMQA 3OKFA 4BVBA 4CF6A 3CVWA 1L4UA 1ZN9A 1H4QA 1DUVG 4BFTA 3CWCA 2FW8A 1VB3A 5IJXA 1TMOA 3O3CA 1YZHA 3GU3A 2QG6A 3FOEC 3PHHA 3HUEA 2O59A 1U3UA 2QSYA 5K2MA 3MHTA 3IEVA 3VR0A 4KH1A 4IVQA 4MWTA 2W58A 1JIIA 2ZIUB 4UZFA 3ZEIA 4AYTA 3QLVA 3HR8A 1PGJA 1TA0A 2FZWA 3R6GA 5ABPA 1WIWA 1EFCA 1EK2A 3ACCA 4OYHA 1R8SA 2NU6B 3F3YA 3O4VA 5L3QB 3EXHC 1W4LA 1CUZA 2VG8A 1T15A 4PLZA 3BXXA 2OFOA 1DCFA 1GARA 1L5YA 3HDHA 1TDJA 2P4QA 2Q4DA 4R1QA 3D4BA 4JBLA 1GKKA 4ZCMA 3HO8A 1OH6A 2RHCA 4WJZA 1UK9A 3PEWA 1YNSA 5C0OE 3HJNA 4ZRMA 4QYIB 5IM4A 2BGJA 2PD3A 5CNKA 2C9ZA 3GLQA 5HMLA 4RACA 5COAA 1Y6GA 3WE7A 3KPYA 1ZRMA 3LUCA 1SQ5A 4TVSA 2C5HA 5EPUA 2W98A 2OV8A 1I3CA 4WZAA 1U3VA 4LOJA 4JXZA 2W71A 3IJRA 4Z9BA 2O0MA 1PZMA 4C4SA 3EDMA 1R74A 1WZ2A 4Z8YA 3RLIA 3C87A 2IXAA 3N2GA 5TXGA 1QF6A 1L1EA 2B8TA 1DWUA 5KI6A 3UVEA 1GAWA 2QW1A 3BUSA 2FJUA 2WAAA 3KQTA 2YW2A 2G36A 4ESOA 3JD2A 3F9CA 5FPYA 4YAJA 1RJ9A 1WBDA 3AINA 3JRNA 2IIBA 3FNQA 1TIBA 4RK7A 3E9QA 3R9XB 1ADYA 4WAUA 1ISIA 4UVHA 1BFKA 2EGGA 2ZG6A 4G8BA 2QTHA 2AFVA 1JBEA 1Q0RA 1FFAA 2NPFA 3T4EA 4YREA 4X41A 3F71A 2PX4A 4JI5B 1CRLA 2RGWA 4PXSA 2JD1A 4CF5A 4NZYA 2CNNA 4JI8B 1PZEA 1ZP6A 2A57A 1Q17A 3PNBA 1TX4B 5DK4A 2XGJA 1G8AA 1QOPB 3GRAA 2OXFA 1IIBA 1N2CE 3SEQA 4MV9A 3ZV7A 1GRQA 2BM8A 4AJHA 1XVUA 4JYMA 1ACLA 2DTEA 2QGFA 3CQ9A 2AS0A 5F2KA 2YZKA 3UJDA 3AC0A 1FTGA 1N3YA 1I3OA 2F64A 3VSDA 3E8MA 1O94C 2I9KA 4TSFD 3NKLA 2ZE8A 2TMDA 3JQBC 3MTJA 3TNFA 1QTRA 3NORA 4MWCA 5EXPA 3HM9A 3RJMA 1P45A 3CGGA 3L6BA 3AETA 5HMMA 1HGXA 4NCAA 4GMKA 4HD8A 1LD3A 1QE3A 2Z9BA 3GBSA 3L9WA 1ZVVA 4HDRA 2XRFA 2W93A 3K30A 4KE6A 1U98A 5CRIA 3IV6A 1A7UA 5TVKA 1AUQA 3ROXA 4BNJA 2WYOA 1QK5A 4EX7A 3WRWA 2WG2A 2D7CA 5DK6A 5U4QA 2PM8A 4L02A 4D9NA 3EH1A 1R15A 5EESA 1B6TA 1P6XA 4CKCB 4KXLA 3OZDA 4DIKA 2CNBA 5ECYA 4CLEA 1LSUA 4HL6A 4FJ2A 4UMDA 4ZVMA 5LLSA 3QKWA 3W9YA 2V4ZA 3PUHA 4P3OA 1G21B 1DJMA 4Y6PA 4GAEA 3MJ4A 3UOWA 3GI1A 1UDBA 2P6NA 1EHIA 1SZPA 2YOHA 4IO1A 4X20A 2P7HA 3KEMA 4A23A 2BHNA 1NXVA 3B1FA 4MUEA 3DFMA 1XEXA 4OV6B 3X3HA 3W4IA 5MF6A 5LP6B 2JJ2A 3BWDD 8MHTA 1J97A 1B2LA 4DM4A 3AUTA 4IIVA 4Q1AA 3BDVA 3ZXYA 1F6BA 1QP8A 3T7DA 4E5NA 4B47A 4G97A 3BSSA 4ACAA 5FPQA 2OK8A 4GPEA 4E15A 3H6KA 1D4AA 3MJSA 2GAOA 4XCXA 5KTTA 2Z6UA 4OMUA 3QVXA 1XQ6A 2FUKA 2QD5A 3FDZA 1HE5A 5A0TA 1ZUNA 5AWFC 1OXVA 5EXDA 5EHNA 3LOUA 3TTUA 4XASA 1IATA 1QLWA 4AP5A 3TRIA 4P0TA 3KEOA 2X7HA 1T9CA 4GSYA 3WFIA 3DJFA 4DIFA 5BQFA 5D86A 1II8B 3GL9A 2YV2A 3W04A 2FRVA 2QM7A 2O3TA 1U02A 3QXGA 4MJXA 5HQ3A 5A1TA 1EUYA 1FQKA 3CUYA 2IXTA 1NYRA 1EBBA 4D2IA 2YCBA 1IJEA 1FUKA 4HMOA 2V5AA 2PX6A 5CJJA 1DC7A 3NHSA 4WCFB 1A8IA 3CPEA 4FGUA 5F5XA 3HBNA 2C9OA 1PK8A 4JB2A 2HCBA 3WLEA 1Q0LA 4EG5A 3ID6C 5A6VA 1BX3A 1N6OA 2NU7B 2QRLA 3B6MA 3HCAA 4XB2A 2O0KA 2FUG6 5D8DA 3STUA 4ND1A 5F33A 4NATA 1S01A 1T6NA 3D6TB 1IZ7A 1T5OA 3AHJA 3QFTA 3R0VA 1WSAA 3FJOA 3JQ8B 4NG5A 4O4LB 2XB8A 5CK4A 2ZTMA 3RRYA 3W8DA 4CM9D 1T13A 1ZHOA 1P81A 3MJVA 2LPMA 4CJXA 4KQ1A 2XCOA 5FEMA 3WAGA 2BHTA 2XYVA 4WLVA 1G20E 1YASA 4HVAA 1C4WA 2IUEA 2O5CA 1E6EA 3R5FA 1RRVA 2J6BA 2Y0PA 1TM3E 3KL4A 3KLBA 4GR5A 3I01M 3PRYA 3LGAA 4U00A 4DYHA 1E2PA 2Q8PA 4L72A 4YJFA 1FCJA 2P9YA 5FR1A 3W5VA 3L7CA 4JDUA 2QUZA 3D2CA 2O5EA 1V37A 2XCIA 4H7EA 3GVIA 2LWIA 2V7VA 2J3MA 3A0RB 1OBVA 1P4AA 1OLUA 1X1EA 3COPA 4OGGA 3SFZA 5KHLB 3L7IA 3GUCA 3WDSA 3WK8A 1AO3A 1NU6A 2BELA 3X1ZA 2HXSA 3DZFA 3DEKA 2HU5A 2WLTA 1OAKA 3FM9A 5TV2A 2VJKA 1OIXA 4BMZA 1IK6A 4ZZ0A 2H5EA 5KX5A 1T9GR 2A9FA 2WMYA 1I5EA 1NRIA 2G1UA 3DC7A 3IKMB 4YLGA 1KGDA 3L1HA 5I8ZA 3A6LA 4ZI7B 3R3ZA 2GERA 2QR2A 3MFQA 4CM4A 1WDWB 4ZAZA 4TYYA 3T9CA 2PZEA 3N0WA 3T52A 3GLGA 2PUVA 3KYDB 2ZXUA 2P2CA 4LRWA 5FI5A 2A30A 5TNXA 2GEKA 3CBGA 1B43A 2HA3A 2LZ0A 3V6LA 3FXAA 2QQFA 3GGGA 1ZM9A 1X87A 1S6YA 2L82A 3UJ3X 4YFYA 1ARZA 3PJDA 1IB6A 4DABA 221PA 4AKTA 1SU4A 3OTOB 2NUBA 2ATCA 5LBIA 4LY3A 3U49A 2DLCX 3DM9B 4LF6B 4HH3C 2E1RA 3R1IA 1WZCA 3W9SA 4HAYA 4C87A 3MCTA 4HQOA 3W2EA 3DEHA 2EGUA 4QDTA 2Q3HA 2W0MA 3PIDA 4JP1A 4NDNE 4UU7A 4M9ZA 4MQ6A 4XGKA 1YZKA 1RXYA 1VP9A 2W70A 4R05A 5IK2A 1RRKA 3JYPA 2FPGA 4P0PB 4MV4A 3IBFA 2ZIEA 5WRFA 3JWIA 3KZXA 5IYZF 3QXSA 3AI3A 5I7VA 2C7OA 2HYIC 3D8BA 5CTJA 2COKA 2CVPA 3JW8A 4Y9TA 2NACA 3IVGA 3SC3A 3H13A 1K3FA 4JLOA 1JA9A 4TROA 5K0FA 2QZPA 1J7KA 1BFDA 4X7BA 7AT1A 2ZZMA 1J5EB 1V41E 4OEHA 4FSXA 2LDBA 2P9ZA 4UAGA 1HLFA 4FTWA 3IMEA 3IQXA 1OWLA 1SUAA 1K88A 1GNPA 1E9VA 4KQCA 3ZHCA 4EG0A 4KO4S 1MMFB 1FDOA 3PDWA 4IOLA 1E1RD 3TQSA 3KYBA 4XJTA 3DOEA 1U5BB 4M0FA 3BQMB 5JSQA 5KMGB 5L4SA 4FC7A 3TEJA 1R00A 1OI4A 2VJQA 3QTTA 4GW3A 4R9SA 4QTYA 4DREA 2X8JA 4O4HA 2BZ0A 1SCUA 3R0QA 3S2UA 3ICPA 1GPUA 2AFHA 2O1WA 3CE6A 3VO8A 4EA9A 3C7KA 1A50B 4OUDA 2ZM6B 4IZHA 2HEGA 2VAWA 1IB0A 1P1RA 2Z3VA 2ZUWA 1S2OA 3L93A 5AYVA 3VDXA 3BMNA 1ZA2A 4LNAA 5HOEA 1U6JA 5AT1A 2WPDD 2JAOA 3L4BC 2N47A 4K8RB 2YZMA 4P80A 2VUTA 4V0RA 4B81A 1EDEA 5DNDA 3BIWA 4N65A 1KSJA 5KQLA 1QQAA 1U9ZA 1EX1A 1ZM2A 3CEAA 4WJKB 3T94A 5IAEA 2I2CA 2VF4X 4FFRA 4BMPB 4L0QA 1GLVA 2RMKA 1AS2A 2ZWPA 1WQ3A 1TYEB 2Y0BA 5JRJA 3VUFA 3OBIA 1VCNA 2WTEA 3H1FA 4M60A 4MLDA 4BNKA 5TPZA 5IN4A 2LR0A 2E9SA 3IIEA 4DCMA 1XJCA 3K0FA 1JHUA 3R44A 4JA2A 4YJ2B 5B3AA 4MXDA 4GKVA 4HQ0A 4I2NA 3RBXA 1H66A 5A7FA 2OHHA 2RAPA 3FNHA 4R6XA 4V0NA 3V4FA 3SNKA 4ARVA 4DDTA 3LK6A 3UUFA 1OYWA 2FZCA 4OB6A 4UUNA 4XVUA 3FF4A 3H1AA 4EHHA 4G56A 3Q7IA 5AM3A 4M37A 1KP2A 5ES4B 1KMIY 5CGZA 3THOA 4ZJYA 4G4SP 1ZKDA 2BGNA 2QUHA 2JZOA 3O8BA 3PFNA 4JOQA 1KY5A 4ER3A 1B23P 4XX0B 2VHWA 1XRSB 4BJ5A 4BFZA 1EB8A 1N9GB 1IQ0A 5KNCA 3UW3A 1XBTA 1Z47A 1QO7A 5J1SB 1GUFA 2EXXA 4Q24A 3RKSA 3GLIB 2C4NA 4RKQA 1VFNA 4HAOA 3SEFA 2HPZA 3J81A 3H3XA 3WZ2A 2QUJA 3LVRE 3QFRA 3GVXA 2PQMA 2XE6A 4LV5B 4TKVA 5D3MA 3HXMA 3W6NA 1PJ4A 5U9CA 2QXYA 1FRQA 1Z4JA 1IWPB 2OAP1 4QEKA 2PMKA 3ZNOA 3C5VA 3NYIA 4B33A 1Q12A 4X61A 1B3BA 3IP7A 5DULA 3KS9A 4MUNA 1GQYA 3PWSA 1QGED 1VHJA 1N8NA 2YZGA 3M4XA 5FPKA 1Z0AA 2RKWA 3DA8A 4HQLA 2H07A 1V16A 2CJWA 2V7QD 4MGYR 1VP3A 3QVUA 1KFEB 1V7QA 5NLLA 5K6RA 4BXOB 1L5QA 1SY7A 5KUTA 3LWZA 4RQBA 2C00A 3PGKA 4DBVO 1PYGA 4KJXA 3I3OA 3IT1A 1QGAA 3CN9A 2XOKA 4J49A 4QU8A 1DHRA 1NP6A 1LDGA 2EKLA 2G9UA 2R6FA 5IDYA 4C7OB 1A5ZA 5DN6A 1KJWA 4CQNA 5HZHA 1SVWA 3BMQB 5B4TA 3QG5A 1S02A 4MITA 1I7QB 1ORHA 5D7BA 3WB1A 2ZSIA 2X9NA 2J3EA 3ROPA 2P2NA 4FKBA 5BSWA 3WGZA 1Q6YA 3BZWA 1HG1A 1XJ0A 3L0BA 5FAXA 4ETWA 1XKQA 3E3OA 1WQ4A 2CB9A 2HD4A 1QHFA 1QV7A 1NBIA 2FSPA 5DN9A 3SGLA 3LUFA 3OPVA 1FRNA 3QBEA 4YTEA 5DX1A 4E46A 3K72B 2ETXA 3INRA 5C3UA 1C5KA 5HF6A 5TQ0A 4AQDA 2I78A 1LZKA 1R6BX 4B3XA 2HV9A 3O8DA 3X1JA 1N2ZA 4RO0A 1EUDA 1FOEB 1KDRA 3B1YA 3EIFA 2GJ8A 2W6ZA 3FWKA 3IPAA 3NOOA 1V11A 3GMIA 4LQ4A 1JQJC 3FHOA 3MOGA 2Q1TA 2NZYA 3SE7A 2Y9PB 4EO7A 5MN4A 4BO8A 5AK4A 4OJKA 3TQHA 5IULC 4OI1A 4FXPA 4MHTA 2G6BA 3C1OA 2IFTA 3QW2A 4Q1FA 3DMTA 3U7FB 1GG2A 1R0WA 2W5UA 3ED1A 1I14A 4Q01A 3ZNQA 1N92A 1JJBA 4TYNA 1YDEA 1CQPA 1Y3IA 1AHIA 1NNUA 3HXLA 2WNHA 1DC6A 2H63A 5LXTF 1Z17A 1AHHA 1FPMA 1KS9A 5AJVB 1NMYA 3O1LA 5AM1A 4BNYA 7REQB 5KAPA 3HJTA 5C51B 5ALWA 1LSJA 2Z1MA 3RM3A 1VJGA 1ZM3A 3MF4A 3SOPA 4GRAA 2G08A 2EFJA 2OGZA 4H6VA 2ANBA 4NCIA 2A58A 1LPMA 3BXFA 1VXRA 1V1MA 3O47A 3T7AA 4EY6A 1VBMA 4E2ZA 1WCYA 1RYBA 2DFVA 2QQEA 2ZCUA 2WWGA 5AH0A 1QYDA 3R7BA 4FCTA 4YRLA 3DO5A 2DWCA 2IGTA 4KYVA 3I3SR 3L84A 1TUEA 4FJ0A 2VH2A 4M7PA 4DA7A 2GVZC 5I9NA 1NW4A 1WHSB 1W5FA 1N6HA 3ZWWA 2HADA 4ZZ1A 4YUWA 1ZAYA 5AVWA 4ESHA 2ZRIA 4M1SA 3CY6A 3H9UA 2CL7X 2C5EA 1RM0A 2FSUA 3RSQA 3ZHXA 1YJBA 3EVEA 2A88A 4ZVSA 3WGKA 4GM0A 3WLHA 1ND5A 1UT5A 1RJGA 2CLMB 2PK3A 1GKYA 1W59A 1KK2A 1QDEA 4X9XA 4PRYA 1WDKA 2B98A 2OR3A 2G07A 2NUPA 4HXYA 2DPXA 4GF5A 1JIKA 4FI3F 4OHUA 1SKAA 1D1TA 1SOAA 2AUNA 1U2GA 2WU0A 2BFDB 3ELYA 3HCOA 4OXXA 3V1MA 2JIQA 3IVCA 5TS2A 2AD5A 3AWDA 2JAPA 3BHIA 2IZ6A 1O9GA 3L8YA 4HPWA 4YYEA 1H8EA 1ZIPA 3RYIA 1V3UA 1TM2A 1ZVQA 5JNUA 1WDTA 1PK9A 2OBMA 3JQAA 3OZAA 4Q02A 2QRGA 3EZNA 3AOEC 1QWOA 1WF6A 5JD4A 2A2ZA 1VBKA 2W83A 4KO8A 1ONOA 3KRTA 3OJLA 1L5HB 1AKNA 2QTNA 3NBMA 4IDQA 2IU4A 3KHTA 3FBTA 4YCCA 2O7RA 4F9EA 1PEAA 2JHFA 1AO0A 3L6OO 5JPCA 2IHVA 3IBSA 5EQFA 4RLFA 1DAPA 4PWZA 1JLLA 3UA4A 5HKKA 3GP8A 3GGPA 2QSUA 1L4NA 3STTA 3KQMA 2CYAA 4XOUA 3Q7RA 4ZXPA 3QPCA 3A11A 2V6IA 4ZI5A 2HT1A 3TLGB 1Y3HA 4A1FA 2CL0X 2DLDA 3TLKA 4UM5A 2Y1FA 1WXHA 2QDXA 1IMJA 5ESRA 1YRBA 4GI3A 4DLWA 1D7AA 1FQWA 1HA3A 1K2VN 1NOJA 1YBHA 2RGNC 3EMVA 4R9VA 4AS3A 1XE3A 3SX0A 2P7IA 1XV5A 1BGXT 2E0IA 1G3UA 3FVQA 3NJRA 4IQ4A 4JNKA 4HEA6 4PE5B 3TVTA 1WMSA 1WMFA 2V6JA 4PTLA 3HK2A 1DLIA 4ZC8A 3P5SA 2CXUA 4AM8A 1OTHA 3QI7A 1JWLA 4WGFA 1DG3A 3ST7A 1E8NA 2CL6X 2OVBA 3CINA 1NDHA 2C88A 4MR7B 1C0PA 3OE4A 3ZXXA 4RPJA 4B6QA 1JFTA 3VYUB 4E2WA 5EWMA 4AKHA 2IKSA 4ZJUA 3EARA 4DM3A 1PT8A 3OQIA 1N6IA 3PGXA 4M54A 3GVHA 3K5HA 3D8SA 4IQFA 5KC9A 5KYGA 4Y67A 1L3IA 3EF1A 5EZSA 4UAVA 1NVGA 1R6AA 1Z7YA 2AVNA 1Z5UA 3P7MA 4MLPA 1VIDA 5BSTA 2UYQA 2XLBA 5JCJA 3NDIA 2GOYA 1R6UA 4XAQA 1KIAA 4G1BA 1PLKA 1T0PA 3HB7A 4HVTA 5FPTA 1IWOA 4Q4HB 5TARA 1CS4C 4YQFA 1F2TA 1TK3A 1O96B 1F5SA 2PWAA 3FHCB 4I6EA 4QFDA 5FRDA 3ZQJA 1QMPA 3JQGB 3LY9A 3RR2A 5AUOB 3WFJA 4ZODA 1ZQ1A 1Z4PX 3KVYA 5HUJA 1SHZA 3GLRA 3JZMA 3ZJYA 2FMUA 4OQQA 1Z5WA 1FNCA 3EOZA 4TM8A 1DQSA 4KP7A 4BRZA 4R9UC 3BE6A 1CLUA 3K31A 4X6XA 1U2DA 4W5WA 4PSDA 4YGXB 3COJA 2O8BA 2QX8A 2ZJ0A 3H5IA 4AMUA 3FZNA 3PL5A 1P72A 1MX1A 1F51E 3B8HA 4HNSA 4HY3A 5CNIA 4RZSA 3U1VA 2YJ3A 4PG5A 3RIEA 4K7JA 4MYUA 4DUZB 1E3WA 1TEXA 1GPH1 1CIVA 1TM5E 5CT5A 2QLBA 2Z2ZA 4XWYA 1LY1A 1GZ7A 1VLLA 1M7GA 2WAXA 2ZBFA 1QCZA 2AXEA 3AY0A 2P0AA 1QDLB 3A7DA 3KT0A 1FFCA 4L73A 3Q5DA 5E2IA 2Q6VA 5GJCA 1T9GS 1ZGGA 1ESEA 2A6PA 2Q62A 3IE0A 2HC9A 4I9UA 4Y2SA 3V2IA 5FDFA 4BNDB 3BD9A 4YMLA 1AT1A 1GCUA 1XDUA 4AKIA 4P35A 4MMYB 3TYXA 1R50A 3L8FA 2FXIA 4GR9A 3LDAA 2ZM5A 1MNAA 4NP6A 2WHEA 1D6MA 1I6LA 2P3QA 4G36A 1X3LA 2GPSA 4IDAA 1IONA 1P6QA 3B7WA 3BMCB 3GT3A 4YIKA 5ENDA 4BIIA 2O2XA 3QG1A 1OC2A 4J8PA 4A0GA 4DB4A 2FRDA 3A1CA 1PFKA 3VO2A 1U9CA 2P2ZA 3IBTA 3CM0A 4G4GA 1LDMA 1S2MA 3I01A 2XUAA 4M1MA 5J5CA 1PF7E 4HH1A 3C3JA 2AKAB 3OE7D 3LUAA 4RS3A 1YZFA 1V71A 2JNWA 3AFOA 4MW2A 1CR6A 1JT9A 3A4TA 2HY7A 1P9WA 2FDRA 3IPYA 5FADA 5J58A 3PL1A 3M9XA 4UARA 3CVVA 4KXXA 2OV6A 4L0CA 2BHLA 3QFHA 3K53A 2IP1A 4HX9A 5IKMA 4H08A 5DYWA 2CD9A 4RJ2A 3UV3A 5G4KB 4B3FX 4Y6LA 2YKGA 2YICA 5ALNA 4P2BA 4KV7A 5DCYA 3M2PA 3LLVA 2V7TA 3T6KA 1KMQA 1HFJA 3QUBA 1CBUA 2P1ZA 4KGVA 1Y63A 2PEZA 3OSZA 3QWFA 1GV0A 3EASA 1RMYA 3UK1A 3T5AA 1PS0A 1KARA 1NW9B 3CCCA 3TFOA 1FFXB 2L42A 1LC3A 1Y8RB 2RHWA 3BAZA 2R1TA 3KHUA 2P2SA 4DA8A 4QQNA 3IVAA 3CPHA 1Y7TA 2FR0A 1Y0BA 3AZOA 4LJ9A 1EG2A 3HVUA 1NKVA 4BJHB 3LYHA 2H4FA 1PRYA 4K3UA 4OHOA 2OWEA 1JQAA 3VM6A 2IF0A 4MAAA 4G2TA 2Y6VA 4P6VF 5DNVA 1YCHA 4H7HA 1TFRA 3HXKA 3C8HA 3UXEA 3RARA 5A06A 1XK7A 3VH4A 5JCZA 3K4HA 4IOKA 1TAQA 3KOOA 2FE4A 3HZRA 2YRWA 5DEIA 2BMEA 4ESVA 2WYIA 2JAWA 3P8ZA 5FNZA 2BHRA 5ANRB 2BE7A 3MYRA 1GM5A 4Q6WA 2BSXA 3W6PA 4HGRA 4YRAA 3DMRA 2EZUA 4UU8A 1IOZA 5EFZA 1TU4A 2GDZA 1ZK4A 1E5VA 2JH9A 2O05A 4WADA 3L0CA 1U2TA 2ID4A 3MT0A 1E4EB 4ALLA 2DWPA 1RXVA 1KEPA 1RC1A 1IUKA 2GGSA 4OSPA 4AY2A 1GUAA 3FTQA 4ASUA 2OO5C 2EQBA 1TCVA 2PL3A 4LTMA 5KNBA 3T4PA 2I66A 2QRNA 4D6YA 2AG5A 5GONF 3BTVA 3O82A 4UUAA 2QTAA 4YCBA 4ZOLA 5D1HA 5HYVA 2ISCA 2ZREA 1LPBB 3DOCA 2PVCA 2FN8A 2ORWA 3C7AA 2NO6A 3M2TA 1XAJA 1IPEA 1K4KA 2QVGA 3W7VA 3RJTA 5KJFA 1TMGE 4PIPA 4RZXA 5EWJA 2NV0A 4JGBA 3WOHA 5ELMA 3STVA 1QFMA 2D06A 3TLJA 1CU1A 1I51A 3EQ6A 1N4AA 3T3EA 2VHXA 2RAFA 3H5NA 4HN2A 1CULC 5HIMA 1N0UA 2Q0QA 3CF2A 3UGKA 1IWBB 1DNPA 3HCPA 5B6IA 2C9DA 1Q7BA 4OP3A 2FSVC 2FN3A 5KKNB 1DP4A 3GHYA 2J5QA 5EXEA 3KQHA 4UBIA 3I0ZA 3UK6A 4J0FA 3DBOB 4HN4B 4CQMB 5KQSA 3OIYA 1II9A 3ZLBA 4Q48A 1Y6FA 1C7IA 3IQGX 2JLCA 2JGFA 3WL6A 1S2NA 1X1AA 1YIOA 4J7CA 3BWCA 2XKBA 1BN7A 3Q7TA 4INZA 4IUDS 3KBBA 4U7FA 3MJFA 4AI6A 1Z0IA 5AK5A 3HVKA 2EW2A 5BV7A 2XF8A 4NEGA 4LBWA 1SO8A 4OBBA 1SHJA 3CLHA 3DLIA 1KPIA 4A8JB 1RM5A 1NXQA 3PLNA 4J4HA 4W9NA 2V9PA 3PVSA 4I5FA 5KOHA 1OX5A 3AUFA 3IEXA 4OM8A 4R51A 4D9IA 2PZ8A 1T0UA 4RC9A 2D1QA 3ZHVA 2VQFB 2RC5A 1RBQA 3KUXA 3KOWA 4YUAA 2J59A 4OTZA 4I3HA 4X1OA 2PLNA 3I1YA 1G6KA 5G1OA 1O5IA 3OFSA 3EGCA 4NPCA 3SZOA 1ETHA 3MXOA 4DOMA 2FY8A 5KO2A 4FT2A 1GZVA 2JI6A 4R5HA 4JBXA 1N8SA 1OX4B 1YSCA 3T9FA 2WYVA 1O95C 3AKEA 1JAIA 3K0AA 4Q9JA 1W4RA 1JU9A 3BC1A 4S0XA 3F8WA 2QGZA 1M8KA 4O29A 1OT5A 5HGXA 1QHGA 5FYDA 5CA1F 3UWOA 3ZVRA 2MWMA 3DUWA 2QN9A 1JP7A 3JY6A 4DQXA 4DWVA 2DB3A 3WGUA 2GCNA 2OB2A 4RFVA 4UHFA 2HRQA 1KVUA 4NBUA 1G5HA 2O8EB 2FFQA 1PP4A 5G53C 4G0ZA 2ZWVA 4DCOA 5C8VA 3GROA 4C20A 2J4FA 1U8AA 5HFAA 4LF9B 2VNSA 3RDPA 4JS0A 2LCQA 5CIQA 4ZAYA 2ZIAA 1HE2A 5ARDA 1DV2A 1OF1A 1XYYA 1YGPA 5C8YB 3LT5A 4XUCA 4AWAA 1SVSA 5FBWB 1MO3A 2HA0A 3HJHA 2JGJA 2O50A 4RVCA 2AGVA 3UKJA 4ZCTA 3QU5A 3I62A 2UUBB 1L7NA 3G7UA 3SZMA 3QGMA 1NX9A 1XJQA 3G23A 3CEPB 3H5RA 3CRNA 2REQA 3OE5A 5DGXA 4QPJC 3X0DA 3EVBA 2JCGA 1JW9B 2OTCA 4E94A 3EIOA 3L0PA 1CQJA 3LBIA 4UMEA 1U3WA 4Q3EA 1K92A 5K0LA 3SHOA 4EJ0A 1M1UA 2Q8QA 1NKSA 4YAWA 1LCIA 1Q20A 5K7SA 5JH7F 1M72A 3TM5A 3TAHA 2RK4A 3LF2A 3QPDA 1M2OA 1HX7A 2OD9A 1JTFA 1XEAA 4XQEA 3VGPA 3HJBA 1UM8A 3SC2A 5IC4A 5CM9C 1DEHA 4MWZA 2WJAA 4HTFB 4KC0A 2VRCD 2X9LA 1Z2PX 4L4RA 4BGUA 5F64A 1EFRA 4B73A 4QYMA 3JZFA 4MS4B 2QX6A 3VO9A 3NHJA 3LF1A 5LQCA 2HSZA 1C0LA 2CLDX 4OLHA 4J7UA 3NEJA 3VNBA 1SXJC 3QKTA 1E7WA 2X2FA 4ER5A 4QBKA 3VYRB 1ZRSA 4WCVA 4K6MA 5LL6P 2JD0A 3RS2A 3CZPA 3NHYA 3ZUPA 3I2GA 1M1YE 4IDHA 2FZVA 2I6QA 4B43A 4X65B 3V2UA 3LLSA 4EB0A 1ACJA 3NDJA 4MP6A 4G1UC 4BNHA 1GU0A 1VLMA 2IXFA 1XHLA 2QNBA 4PGAA 3SICE 3AF1A 4JHLA 4EYGA 4KN6A 1Z8FA 1MCZA 3D4PA 1VRVA 4MR8A 4V0SA 1WXWA 2ZR0A 3NM6B 4ZALA 1TQ8A 3WDKA 1AKUA 1G38A 1DKUA 1Q1GA 2ZVDA 2NGRA 2M32A 2H1OA 2ADOA 3JYLA 3RADC 3BGIA 4OHXA 4CGYA 1CQIA 4GGPA 2CFOA 2QD4A 3QVKA 1T9AA 4HWOA 3DF7A 3LFTA 4JIMA 1DRJA 4WHMA 5K3DA 4QPZA 2GLTA 3VNVA 2XCUA 4P36A 2J46A 4HJXA 4NFHA 1P2SA 2DP4E 2B34A 1TEZA 5COQA 2FPMA 1UT6A 2AEFA 2FZLA 3E1SA 2ZYIA 3VHQA 3VR5H 3AKDA 1Q16A 3ONEA 1ZS9A 4YAEA 3RS7A 3Q41A 2V97A 3NG1A 1SBHA 4DR2B 2M98A 5DT9A 2B5WA 4I36A 2X0EA 1U7DA 1K9VF 5CDGA 4L4YA 4L5JA 4GEKA 2C2XA 2P4SA 2QUIA 3G6KA 3M6FA 4U2KA 2UXDB 3TLZA 2AK2A 2O3UA 3MLEA 2ZE6A 2O48X 3LWDA 3DQPA 4KIJA 1RABA 1A2BA 1KEKA 2C7QA 2AH5A 3INNA 3V42A 4DA6A 4EP1A 2J0UB 4MWDA 2I5PO 3F7TA 5UKDA 4MJ3A 4V2UA 2BFPA 5B37A 5SYMA 1YZQA 4D0GA 1CP3A 4Z3KA 4DV0B 3AVQA 3FUCA 2JLUA 5AJWA 4KSBA 2W2QA 3PC2A 1N57A 4JSRA 3MWJA 2XZPA 3CLTC 4HG2A 3DL7A