4ARSA

Hafnia alvei phytase apo form
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
411
structure length
407
Chain Sequence
TAPAGFQLERVVILSRHGVRAPTKMTQTMRDVTPHQWPEWPVKLGYITPRGEHLISLMGGFYRERFQQQGLLPKDNCPTPDAVYVWADVDQRTRKTGEAFLAGLAPQCDLAIHHQQNTQQADPLFHPVKAGICSMDKSQVHAAVEKQAGTPIETLNQRYQASLALMSSVLDFPKSPYCQQHNCDFSQAMPSRLAINDDGNKVALEGAVGLASTLAEIFLLEHAQGMPKVAWGNIHTEQQWNSLLKLHNAQFDLMSRTPYIAKHNGTPLLQTIAHALGSNITSRPLPDISPDNKILFIAGHDTNIANISGMLGMTWTLPGQPDNTPPGGALVFERWVDNAGKPYVSVNMVYQTLAQLHDQAPLTLQHPAGSVRLNIPGCSDQTPDGYCPLSTFSRLVSHSVEPACQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HISTIDINE ACID PHOSPHATASE
publication title Degradation of Phytate by the 6-Phytase from Hafnia Alvei: A Combined Structural and Solution Study.
pubmed doi rcsb
source organism Hafnia alvei
total genus 137
structure length 407
sequence length 411
ec nomenclature ec 3.1.3.26: 4-phytase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arsA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arsA02
1V37A 3R7AA 1DKNA 1DKQA 1SK8A 2PA0A 2P79A 3FDZB 3OI7A 3LG2A 3QPUA 2A6PA 3IT0A 5PGMA 1FZTA 3D4IA 2P75A 3IT2A 1UJBA 2ENUA 4MA4A 2P2ZA 5HR5A 4HBZA 2OWDA 3PGMA 3D6AA 2H4XA 2ENWA 4TSRA 1BQ3A 3LNTA 2P77A 1ND5A 2P6MA 4IJ6A 3E9DA 1NT4A 2YN0A 2H52A 2P9FA 4E3WA 1DKMA 1K6MA 2P9ZA 3F3KA 3QPWA 5CX4A 1IHPA 2P9YA 1QHFA 2IKQA 2BIFA 2WNHA 3E9EA 2AXNA 1RPAA 1BQ4A 2P6OA 4EMBA 1H2EA 4IJ5A 4PGMA 2I1VB 2P30A 1QWOA 2GFIA 2EKZA 2P78A 3NTLA 5AJXA 2DWOA 1SKBA 3NFYA 4FDTA 2F90A 5AJVB 2QNIA 2A9JA 1BIFA 4PZ9A 2RFLA 3K4QA 4PZAA 1CVIA 1UJCA 3E9CA 1ND6A 3BIFA 4JOCA 3IT3A 4D4MA 1TIPA 3LL4A 1V7QA 5AJYA 5AK0A 2H4ZA 2YN2A 1DKPA 3D8HA 3GW8A 1FBTA 3K4PA 3QPVA 1E58A 5AJZA 4D4KA 3MXOA 4D4JA 4GPZA 3ZHCA 2WNIA 2P2YA 3GP3A 4EO9A 1RIIA 1SKAA 1YFKA 3MBKA 4D4LA 3IT1A 1C7ZA 4JODA 3HJGA 2DWPA 5HTKA 3EOZA 4ODIA 1SK9A 3KKKA 5CDHA 3DCYA 1T8PA 1EBBA 4QIHA 5CU7A 1C80A 4FDUA 3FDZA 2EOAA 1C81A 4JOBA 3C7TA 1XQ9A 2WU0A 4ARSA 3EZNA 5AJWA 2EKBA 3DB1A 1E59A 4ARVA 3FJYA 1DKOA 1QFXA 2HPAA 3F2IA 2HIAA 2H0QA 2HHJA 2OWEA 3O0TA 4AROA 3GP5A 4GPIB 1H2FA 4ARUA 1RPTA 1DKLA 1YJXA
chains in the Genus database with same CATH superfamily
4C0BA 1L5QA 1YV9A 2BGKA 3GVXA 1WU8A 3CR3C 4INAA 1OI7A 3CLRD 3BGSA 3CURA 1X92A 4HYEA 5HCUA 3RIMA 5CDFA 3WLRA 2ZJ8A 4A0FA 4I9NA 1SZPA 4RD3A 3FE2A 2KS6A 2R8BA 5DJ5A 3STVA 1RWKA 5HUJA 1FZTA 2QW1A 2VAVA 2P75A 2WE7A 4UATA 1OAAA 3F8SA 4HUQA 3KHUA 1DARA 4ZRDA 2IUUA 1GGNA 3EGCA 3CSSA 4UOQA 4IJ6A 4BV3A 3AL0C 1JH8A 1AGNA 5AW6A 2H52A 1TKBA 1JVNA 1IWPB 1CYDA 2Q0SA 3OAAD 2JIPA 2XCOA 5ALNA 4Z7OB 3A6EA 3DL7A 4U5QA 5FWNA 4CG3A 3RR2A 3U3OA 2DHQA 4FE7A 3I5MA 4D3DA 3K71B 4BXOA 4DCJA 4KUHA 5LVAA 3KUDA 4BYGA 1AZWA 2CDBA 4D96A 3WZMA 2C29D 5DBGA 3G9QA 4MLZA 1G291 4U6SA 4K1LA 2KMLA 2JK0A 3R75A 1LBSA 1SUSA 4JL8A 1DC5A 1GV1A 1JA0A 4QRHA 5LBTA 4L4UA 3U62A 4BRWA 3F9IA 3R3SA 4ENRA 4RA9B 3C3XA 3H5IA 4A26A 1KZ9A 3H4VA 4KAJA 2J32A 3D4OA 5CIQA 3NV7A 4LSMA 4FLMA 4OXXA 3UMGA 2GRUA 2WD7A 2A5JA 3RHSA 1X7YA 1EK6A 1UT5A 2COEA 4IVRA 4S1TA 1K1EA 4QQNA 4FFRA 4A82A 3KT0A 4L16A 1UJCA 1N5OX 5EGSA 3L7OA 2E4WA 3L06A 4XVUA 3CJTA 3LQRA 1JXAA 2Z2IA 1C1XA 2Q5HA 3KC2A 1RYZA 3OLZA 5JO0A 1MABB 5A7FA 3H9JA 2DKFA 4X94A 1K3UB 1WXHA 4RJTA 4EOGA 3UO8B 1N2SA 3ZY4A 4C3UA 1EX9A 5HHTA 3HK2A 5DULA 2P2YA 3W9YA 4AIRA 2NYAA 4OM7A 3D6UA 2JB9A 4PFKA 4Z9AA 4HOYA 2C0QA 5CA1B 2XQIA 1N9GA 1M1YE 3AG6A 3ED1A 5E7IA 3A4VA 1RWOA 1GZVA 4O4LB 1JFFA 4BNLA 2Y8EA 3P9YA 4YLYA 2PA3A 3N7TA 4XQ9A 1QRAA 1VLZA 1GGVA 3NPMA 4PZCA 3DYVA 4NY1A 3DDNA 1O89A 1RP7A 2F62A 3B70A 3MGKA 1OJLA 4N0QA 4YJ2F 5EIAA 3I52A 3VJMA 1J0DA 1FMTA 4BPRA 2FJUA 2WJWA 3NBUA 4ENSA 2QD4A 2XMBA 4RABA 1BW9A 2G88A 4DAEA 2OY0A 1BQEA 2G63A 4IOJA 5E4YA 4TLBA 4D4GA 1T6XA 2C8LA 2QTTA 3DB1A 5EFZA 2FPXA 5DBFA 4I8DA 2NO0A 3H13A 4MW9A 1MW8X 3GMDA 3RODA 1YRHA 2H1HA 2AK3A 2CL7X 2O3JA 3GVHA 5JD4A 3VI3B 3RIHA 1PVOA 1G38A 3R09A 3D8TA 4QGHA 3W06A 1QS0A 3AEZA 4F85A 3VNUA 2XVZA 3HKCB 3DTVD 2I6UA 3KELA 4N76A 1JNYA 2JJ2D 1OX6A 2VHZA 2FI1A 3V8RA 1EA7A 3G0IA 4B2IA 4ZYZA 2IH4A 3K73O 2Y0PA 3NBFA 1EFKA 2ZSJA 2ZWMA 3ZBPA 3SE7A 3LPLA 1A8SA 5AK5A 4XWGA 1JP7A 1ZHOA 3WDMA 1A04A 1N25A 2GTIA 3RLIA 1OXUA 4EVIA 1U8AA 3BJMA 2CHEA 3TD9A 4DLVA 1ORRA 2H2HA 4N8SA 1PL6A 3DE3X 3DV9A 2R2AA 1FQOA 4LTDA 4JLKA 4PONA 5LDGA 3L6CA 1RAHA 1AT1A 2YWXA 4RF3A 1K97A 5C1IA 1Q0TA 1SCNE 1KO8A 1E2QA 4HDMB 4EI8A 3I9JA 1ZNWA 1JFTA 4ARCA 2ODQA 5JHHB 3E15A 1L5OA 3JQAB 3KL2A 1SBYA 2B5OA 5REQA 4BGIA 1QP0A 1RYYA 2EWVA 1AGRA 4EELA 3G68A 1SRRA 3PUHA 4YRRA 3HCEA 3RS3A 3IJPA 2BHRA 3ITNA 5DBIA 2WAOA 2ZTHA 3KKMA 1DRUA 1KZHA 4B4OA 4DV4B 4A15A 5JJ5A 1II9A 3MRVA 2EJCA 2WT8A 3FTCA 4QRDA 3DM9B 1FNSA 3EDOA 1NP7A 3K9HA 2O2JA 2AJ8A 4JUBA 5HS6A 2EQAA 3SYKA 3ZBUA 4DN6A 4NEQA 2WQZA 2CY0A 2RSLA 4JASB 4MV0A 4DMRA 1SELA 3U19A 3OHPA 1DUIA 2HWUA 3T6KA 3E4CA 3ICEA 3H5TA 4M1KA 2V6IA 4I8XA 4MI3A 4PZLA 2G0TA 4O2RA 1UKYA 1CVIA 3ZD8A 4KITB 5LZ4A 2BH2A 3GRFA 4MLCA 4QOGA 4P34A 3D2LA 1DG9A 1VPDA 3COZA 1AK9A 4NU6A 2X1LA 4MV9A 5TQJA 5KKNB 3I5YA 1MQ9A 4PZPA 3RBZA 1IBMB 3NTQA 2A1UA 2XYPA 2VP5A 3DV0A 4HTAA 5G4KB 2WNIA 3H1EA 2QS9A 1AQNA 3L7JA 3DEZA 3ZLUA 2PKYX 3D7RA 3ZPXA 2A0XA 3N3AC 2GYYA 4NCBA 3DDCA 4DV6B 1M1ZA 1TM7E 3VTAA 2P69A 1NU6A 2OORC 4IQ8A 1XLTA 2H9IA 2I4MA 3FOWA 4X54A 2NT4A 1NVFA 4R9NA 5AQEA 3KKKA 1GITA 4A6EA 3LFTA 4P7BA 2VHEA 1Q22A 2B30A 3BULA 4LISA 4MRNA 3SQXA 4QPNA 1ZMRA 3KZXA 1RNLA 3BHNA 5JS2A 3ZHZA 3IBSA 5BO5A 4CN8A 3U09A 2YDYA 4ZOBA 1P2GA 1SC4A 4LHWA 1YC2A 4R41A 4F91B 3T5BA 1OB2A 1BX3A 4IP0A 1CCWA 1VE9A 2AQ8A 3H19A 4GQBA 3RAPR 3DOFA 1V8BA 2GTPA 1V5GA 1B6TA 2AG6A 2VF7A 1PJSA 1GUAA 2EFDB 4D8YA 3X3HA 1VFNA 3GGOA 1XYVA 3EMKA 1A5ZA 2CVQA 4FS3A 4FBMA 3WYDA 3L9WA 1YB4A 3BMOB 1JTVA 1TVEA 5DHUA 1JU3A 3PU6A 1DKUA 1JS1X 1U2DA 2Z98A 1RM5A 4C22A 5BVHB 3VMMA 4K0KB 1UMDA 1CUVA 2CNDA 2BRUA 4DA9A 2FU5C 4RKFA 2GILA 3MJDA 4OQLA 3GLUA 3KQWA 2PLAA 4LPSA 5E1MA 3PHLA 3CVXA 4DPMA 4IH1A 1DI0A 3WRXC 5CT4A 2LRHA 3DE7X 2YHIB 3CKKA 3MYYA 4RTOA 2DPXA 3IESA 2QG4A 3KFLA 1ZGZA 3ZZTA 4TYWA 2ATXA 1QIJA 1P5FA 1E69A 1SY7A 1ANKA 1E8NA 1JQKA 1KQOA 1PFKA 2K2WA 4MV1A 2NOAA 3L4BA 5EMKA 3T1TA 5JS1A 3LNTA 3QWFA 5BNWA 2Z8ZA 4IDBA 5FQNA 2JAOA 2Q4RA 3SHVA 4OMFG 3DLTA 5DO9A 5EJIA 4EVQA 3I45A 1L8LA 4LS3A 5BMOA 1O0CA 2F2TA 1RWMA 4TRRA 2JIMA 3DA8A 3LT1A 5I45A 2PKXA 3M4NA 1FVOA 3HBMA 4WXRA 1XRLA 2HFJA 3BORA 2DUWA 4R1LA 3GG2A 2GHRA 5CT9A 3GGCA 3UV3A 1Q7GA 1TO1E 4LQLA 3U4QB 1XTBA 1ZICA 1V3TA 3F74A 4NBTA 3W6ZA 4WY8A 1XP5A 2HSWA 5A3JA 4OUDB 2K2QB 3GV0A 3T9AA 1ECGA 4RULA 3A6KA 3PF9A 5LQUA 2ALJA 3MINB 4DLYA 1CQPA 4TN5A 3WIBA 2AGVA 3N9IA 4LVUA 3O2NA 1HNWB 3JZDA 1FFHA 2JGNA 3HJCA 3P2MA 5K3CA 2VA8A 2I9PA 3FDJA 5ALSA 2QHXA 4F4UA 5E4JA 4YX9A 1VJDA 2QMEA 4HS9A 4IX1A 4JOCA 2PFSA 3CRW1 3W2EA 2GASA 3LHIA 5ENDA 3VO2A 1GCIA 3ETJA 5I7WA 4KPEC 2XAAA 4GR5A 4F3YA 1C14A 1PAUA 2PV7A 4E21A 5HW0A 3SPXA 3TZHA 3X2SA 3OA2A 3W8EA 1U0JA 2H2FA 4PLFA 1U7OA 3IDOA 4PZZA 4TKUB 2CMKA 3R74A 4V1CA 1DFGA 4KODA 1US8B 1RBMA 1D2EA 2WK1A 2FXIA 4UDNA 4PYJA 4DRXA 5I9BA 4C6RA 4C05A 2BDTA 4HAXA 1KE1A 5HE9A 3ZCRA 2HMYB 1JKXA 1YZYA 3IDAA 3OPQA 3IGFA 1EAYA 2CJPA 1NN3A 3C8MA 3RG8A 3UMSA 2WUGA 2W6ZA 4ITRC 4WKGA 3QIVA 2A5DA 5JJCA 2K5UA 4J76A 2Y9MB 1UDXA 3H5AA 4D9CA 5LQMA 1ZUNA 3DBHB 1H93A 1OYYA 3QEMA 5FA8A 4RNCA 1BVRA 4C14A 2VZEA 2KI5A 3TCKA 5AJWA 1IJKA 2HZBA 3WSVA 1BN6A 4MZDA 3N0RA 2QORA 5EJGA 4IHJF 1JYFA 2I2BA 1YZNA 1PGPA 1FFEA 1ZU5A 2GK3A 3BX1A 1QC5A 4RTLA 3PR2B 2YVUA 2HD4A 2TSYB 4G8BA 1N3IA 3FA2A 5BR7A 1ECBA 5GVSA 5JALA 1CUJA 2P3SA 2P5YA 3TBHA 2WHQA 1S8FA 1SIOA 3ABZA 4LJLA 3P96A 4YAEA 1FK8A 3CV3A 2IYXA 2VPQA 1DKNA 3HVUA 3BFXA 1SMKA 1UMBA 2UZ3A 3JQ9C 1E6WA 1EWRA 2JGAA 1W5TA 2IITA 3DBOB 3OO1A 4OHXA 2VHYA 4XFDA 4UFNA 4ER7A 1VJTA 2QTBA 5JRJA 2K4MA 5SYMA 3E1KA 5IM4A 6AT1A 3A0RB 5GQSA 5H02A 1IVNA 4IL5A 2O3TA 1SB8A 4PICA 1PJBA 2F4VB 3T15A 1F8YA 2KHZA 3KV1A 1ZK2A 2C2HA 2O2YA 2YMLA 3TZKA 1ISGA 5HQTA 4Y9SA 3PC7A 2PXXA 4LQCA 3SIWA 2YXPX 3HJNA 3O9MA 5I5EA 3U7GA 5A5VA 1DOAA 2C4HA 2O4UX 1N3LA 2VP3A 1E5TA 2WNHA 4WLOA 121PA 1B93A 2PGNA 3H2SA 4HVCA 4CM3A 3R7BA 5TIIA 3QNUA 5DYWA 5EP2A 5K3OA 4JXXA 5BNFA 3PDIB 1IEQA 1XQWA 2AVNA 4NV0A 4A2PA 1JMKC 2DFPA 1HDOA 1TKCA 1X8KA 2F3PA 3G7NA 4FK8A 2YBDA 4GOND 4OJTA 1RMQA 3PD7A 3GLKA 3FGOA 4RTRA 5FOTA 2HY7A 1JXQA 2P41A 4KLAA 3MTIA 3GLIB 3G5AA 2E18A 4NLLA 2H29A 3IHKA 3K15A 2CXQA 3WMWA 4BP8A 5C4GB 1W4AA 1Z2AA 4UW9A 1BD3A 2YWCA 3L8CA 2CLFB 1BRTA 4W9RA 1E4VA 1VB3A 2YYSA 5BWLA 2BEVB 5AI4A 3MS4A 5BN5B 3F6RA 4OI2A 4ZZ1A 2AC7A 2GEDA 3QPBA 3PJFA 4DKXA 5A9SB 3BJZA 3DS8A 3TBFA 3QVXA 2WSBA 3ESZA 3BAFA 5KMGA 2C3OA 1J8YF 4RCVA 3HNPA 5CLIA 5K0LA 5EWMB 1R8QA 5ANRB 4X62B 1YTLA 1MXHA 4UUAA 2XRZA 2X9VA 3KVNA 2ONKA 4YQZA 4QDZA 4XX0B 3T1VA 4B44A 2CJWB 1V16A 1M7BA 1H9CA 3DTVB 3UCFA 3S99A 1J70A 2PH7A 2WU4A 3H1TA 4OK6A 5CT8A 1M1NA 3B2EA 1AKRA 1U7XA 3GPDG 2GD2A 4HWKA 4DARA 3PC2A 1U4NA 2V0CA 2X4LA 3GFSA 5KC8A 1E0SA 1U3VA 2OM6A 3IILA 4CLRA 3U4DA 1T25A 3EXEA 2E7ZA 1EJ0A 1PZFA 2EATA 1AS2A 3CN9A 1J56A 4R68A 3WLPA 5KQRA 1F2UA 3AP2A 2CL5A 1XA0A 3E22B 2ORIA 3WLEA 5GGYA 2YC4C 1XN1A 3RO7A 3BL6A 4ZVLA 1FDVA 4UMEA 5ITZB 1KEEA 2R6AA 1CBUA 4NS1A 4KO3S 2J0SA 5IVDA 2Q28A 5AM1A 1ACMA 3Q15C 1X94A 1BWSA 1I4OA 2PGJA 1EVKA 1GQYA 2A58A 4EUHA 4FI3F 4BASA 1GTJ1 1YWGO 3Q6NA 1CVRA 2Q6OA 1QR6A 1ZNXA 4R0VA 4RMGA 3C5HA 5ALGA 5DNYB 4L50A 3W5VA 3IMGA 1JKJA 3BH6A 2QW8A 5HXAA 2XMQA 4N3NA 2C98A 3OJXA 3TEMA 1Q7EA 4BFYA 4CRWB 4EZEA 4J0EA 3B52X 1V25A 3D3NA 1QPBA 1BWRA 1E6KA 1KTVA 2BMDA 3G2PA 1NBME 4CM4B 4DM3A 3HC7A 4GPD1 3QVSA 2I3ZA 3E1GA 1NZDA 4I8IA 1VBKA 2B1QA 3KYDB 3OFJA 2CLKB 2WZBA 3BWBA 4TQAA 4MB0A 10MHA 1FW6A 1NP6A 1XZEA 2YHBA 1X3SA 3F6PA 4OKIA 3S2UA 3UK0A 1B42A 1E1CB 1LI7A 4XSGA 4BO3A 1E3QA 1D4AA 1EX7A 3A1FA 4MA4A 1FL9A 5JPIA 4D0GA 4Y7CA 5K8TA 2PRJA 4K5QA 4RA9A 5KAPA 4XFKA 4P9NA 1P4SA 2ZUEA 3BKXA 5DM4A 1KA9H 3LUGA 4CIDA 2QTVB 1K2VN 1JW9B 4Q4AB 1Y7TA 2CLIB 4L22A 2PGDA 5E3HA 3PEWA 3T1NA 4KUEA 2BKAA 3RYHB 1Y3IA 2YJ3A 1RRCA 3BT7A 1IRIA 3FSGA 2JW5A 2ZEJA 1QIHA 3AFMA 1IY1A 4OXNA 4DRYA 3INYA 1SXJD 2XUDA 3P20A 1L4EA 2PDAA 4W8OA 3ONNA 4IIGA 4EMBA 1RAGA 1T0JB 2IWRA 4RTQA 5CB6A 3HDVA 1BMFD 1I13A 4NHEA 5HFJA 4AY4A 4I6JA 1YJAA 4YJ3B 1NWCA 1HDIA 1P80A 3RIYA 4AJOA 2H9YA 4CNBA 4PGHA 3KDSE 5FBLB 2DFNA 5CM2Z 1YQTA 2WF9A 3KYJB 4JI0B 2FLWA 1WM1A 1XC7A 3DE0X 2GK6A 1LSSA 1HXHA 2XTZA 2FFAA 4JB2A 3L79A 4DQUA 5IF3A 3O8BA 1K68A 3QH4A 2DJ5A 3AFNA 2Q5JA 2QYOA 1U2DC 2VEDA 1MX9A 4D9MA 5C1PA 1S8AA 3T5PA 2VJCA 3MLBA 2OBLA 5IKXA 1BDHA 1IE3A 2F9FA 3C6MA 3CCFA 4HAZA 4E13A 2OQ2A 4KE9A 1SUIA 1TQ4A 1ZX1A 5EHQA 3OZEA 2FG5A 3MAGA 1VPVA 2GYUA 4X00A 3TCXB 3WV5A 1HDZA 4CT0A 3EK2A 2VZ8A 4LE0A 2DH6A 4G2NA 1KU6A 4O4JB 1JAZA 3GEEA 2OYCA 2WV9A 2CZGA 4MMYB 5L95A 6ADHA 1MU0A 1TK2A 1W87A 1J5EB 4S1WA 5CDFE 3AFIA 5EEHA 4NDNE 1OV6A 4H1HA 4Q7EA 3OU2A 3G8AA 1RIIA 2DQZA 2DPGA 3ZCVA 2BTOA 4XJSA 2NPFA 4A4DA 1OZGA 1WB6A 1XTVA 4EMUA 5KNBA 1U8EA 1VYUA 1NKTA 5FLEX 3MWYW 5IC4A 1KJNA 1NXTA 1UXOA 1W1WA 1WUTA 4I1RA 4JLPA 3ESAA 1G3QA 2VWHA 2OSVA 4NAVA 4LJ7A 3KQHA 2R00A 3KYBA 1ZG3A 1JVBA 1SUAA 2GPWA 2WJ3A 3T1HB 3Q8KA 3JZAA 1OXTA 3HKCA 5KWSA 2OL4A 3AM4A 1W5AA 2ZE6A 4J1NA 4OAOA 1XZFA 1QVZA 4E12A 4EITA 4OJKA 2NNLD 4IKPA 1LDEA 4QBTA 2GPSA 5FL3A 3IUNA 3CZRA 1IVSA 3TF5A 2X3YA 4L5CA 3QBTA 3FRIA 5B5SA 3Q2OA 1ZL0A 2FPUA 3NHSA 2QYSA 3TB4A 1YVDA 3EGDA 4GUDA 4KL8S 4O8CA 5HKBA 4U7JA 4QLAA 1AZSC 3KOMA 1PT6A 1P7PA 1C3EA 1NSTA 4DUGA 4AJPA 2QENA 4FD3A 5BURA 3ORQA 4KIJA 4JCOA 4UU8A 3V4VB 4AG3A 2WC1A 3HCBA 3KTAB 2JJ8A 1AUVA 1Z0DA 1EB9A 4P33A 4PC2A 3SHWA 4AUMA 5HZKA 3L7LA 3W2FA 3EDMA 1ULHA 1HTWA 4OA5A 3M3DA 4XD7D 2R6JA 3PYMA 2AHOA 1YL5A 5ES3A 1B76A 3VJLA 4DANA 1ZESA 4Q48A 1DX9A 5BV7A 2J48A 1HH4A 5ALMA 4WBNF 3D3WA 2NUAA 1CUGA 3NEPX 3MHPA 2VT2A 3OJFA 3DW1X 4K05A 5GTDA 1XHFA 3RYTC 4F12A 1HQDA 5JADA 3DL0A 3GN1A 1B6GA 3IIKA 3URMA 4U7DA 2I9KA 4YAJA 4GYWA 4QD3A 5EQFA 4G81A 2QAGA 1EJBA 2PWAA 3BIWA 4OHFA 2RKWA 3DE4X 4U2KA 1YH3A 3AR7A 2BI8A 3R41A 4YREA 3A1VA 2QRQA 2JKYA 2FHPA 4FN5A 4R2HA 1KKMA 2F67A 1LJUA 5I7VA 1HY3A 4I5GA 1Z7GA 4M0UA 4OA8A 1UPFA 4IICA 5JZMA 3UJNA 3ZWCA 4LN1A 3E61A 5JEDA 4L2IB 3FRHA 1PD0A 1AQLA 1C4OA 1J4AA 3NOVA 3ONWA 4YAFA 5EIWA 4DQDA 1VLVA 2AMLA 1C8BA 3L02A 3TNYA 3IC5A 2WE8A 3QWHA 4OM8A 2HNKA 3OP4A 4Q7LA 4WLEA 3QF4B 2JFYA 4RK1A 4TTIA 1RMTA 3JZFA 4NPCA 4RVGA 5FWDA 3U4HA 4MLDA 1Q7CA 1Z0JA 3P0JA 3T7SA 4JC4A 2QL5A 2HLDA 5K51A 5DHRA 3PZBA 1WW3A 3T3HA 2F3RA 3SEAA 5KREA 2KQUA 1JB1A 1QG2A 3EVEA 3SEQA 3TQHA 2JGEA 2OGZA 2ZUUA 4MWZA 2W00A 3FLAA 1SQFA 2GEVA 2IEBA 4JVOA 3VPCA 3ZXUB 1W88B 1U3GA 3ZZ1A 1BVYF 3GRUA 3MK31 1OMOA 2XUKA 3X0DA 4U3JB 2LW7A 1PUJA 1I10A 4MEBA 4OPMA 4WNYA 3EXHC 1R4ZA 3LQ1A 5AOBA 3N8KA 3ZE1B 5LIRA 1NQWA 4HLQB 1QB7A 5I01A 3EGIA 2P35A 4HD8A 1OYOA 3REFA 5FPTA 3M5PA 2BONA 2QLBA 4PTZA 2OO3A 1ZK4A 3O6VA 1J0CA 2M9MA 1YT5A 1GCAA 1MPXA 3MWFA 3JQRA 3WNCA 3VYRB 4CM7A 4GQIA 5GAJA 1CIJA 5AR1A 3TOCA 4KQJA 5IWAB 1KFBB 4F72A 5BVHA 4Q19A 3SYNA 1ZD5A 1IY9A 2BH9A 3OJ0A 3QEKA 4OB8A 4H7KA 1RE0A 2W48A 4LSZA 4TLDA 2PNJA 5JC8A 1YR8A 3RTEA 2QVCA 3JX9A 2RCNA 2XMDA 3QM1A 4G0ZA 4UTVA 4H27A 1IDN1 1OHHD 1FTYA 3AXSA 3KKEA 4AM8A 1T8SA 4UTZA 1E9CA 2CVOA 5DN6D 4F11A 2YHIA 3O8CA 3LY9A 3VFDA 1MB3A 3FZQA 4FFOA 2ZJOA 1H8EA 3G2MA 4TL7A 3N59A 3ZHYA 2PX6A 4GQAA 1VOTA 4N5LA 1NLMA 4N5NA 2KE5A 5B1SA 1P4AA 2NZXA 3FUCA 3OPMA 4AN1A 3ZDDA 3LCJA 3U44B 1C8VB 3FPSA 3VVCA 1GHTA 4PG4A 4U7PB 4NOKA 5DTEA 4IYJA 5JASA 2R1ZA 4EDHA 2I6FA 2IP4A 9LDTA 1UP4A 2PUTA 1IY2A 3HU2A 4H16A 1YU9A 4W5WA 3UWDA 4JIGA 1IN1A 1GN8A 2BGTA 2YVQA 4OLHA 3SX2A 1TYDE 2ZSBA 1RCTE 3MCTA 4LYEA 2WKQA 4BCDA 4XOUA 1DJNA 5HF9A 4YIKA 3ETCA 1QHHB 3RUIA 3NTXA 3T9EA 5JNRA 4DEXA 4YDRA 5JBNA 4RA6A 1P8AA 4P3OA 3V4OA 3S7TA 5BSGA 3H9UA 2IJGX 5EVCA 1WO8A 3VZBA 3U4QA 3ZGZA 3DDHA 3ZHXA 1VHDA 4AW9A 1VG8A 4BCCA 4X7PA 1WZIA 4HQNA 3SDSA 3SMVA 1X80B 1WZCA 3MINA 2ZYDA 4YRFA 2E82A 4CHTA 4KI7A 1KJ8A 2BDEA 1E1RA 2I4RA 2WG1A 2FDRA 4GLJA 4JVLA 4R31A 4YQYA 4H4CA 4ZTUB 3U7EB 3T7CA 1FPQA 3GDFA 3C41J 3H17A 3USZA 4E14A 2GM9A 8MHTA 4GGPA 4I1YA 3AFGA 3B5JA 1WB4A 4BB5A 3OCCA 1SG6A 2R8PA 1N6LA 3DGFC 4Q66C 5DH9A 5I5GA 3HI6A 1XXHB 1RC1A 4DLBA 4S05A 3KUUA 2XUHA 2PUFA 5JAPA 3PPIA 5FQOA 2ETVA 4LYGA 2G1AA 4TYQA 1YA6A 3MWDB 3A7EA 3COPA 5EXSA 2PBFA 2AEMA 1ETHA 2EBUA 4R5HA 4TKUA 4V03A 4BB0A 2ZUVA 2B8WA 1DG1G 2YICA 4IFEA 2WF6A 5F4ZA 5G1NA 1US8A 4RENA 4LWPA 4R0NA 2ZUTA 3CLTD 3MT8A 4FE3A 4L73A 2NZ2A 4G0QA 5LBUA 3BB1A 3JVUA 1T2EA 2BE9A 2PT9A 3VU0A 3PKJA 3OBBA 3L0CA 5D87A 1K06A 3PJDA 1J0BA 3LPAA 4YMLA 2J30A 1MVNA 1ZRNA 1DAPA 4X7BA 4HF7A 4YGYA 3ME5A 2FSHA 1TKAA 2Y0CA 1JHRA 2PSEA 3HNRA 5IJZA 4ZKDA 5BYJA 1B0AA 3HACA 3KQQA 4ZT6A 1DMRA 3CF6R 3TZ6A 2ISSD 2I7CA 5C2JB 3ED5A 1MPTA 4HZGA 4UUMA 1SBNE 2GN6A 4GRAA 1MG0A 3T94A 5EOVA 4O4IF 1I14A 1L5SA 4OP1A 4RXTA 3UM9A 1HORA 3OAAA 1KIAA 1KEZA 2GBPA 1HEIA 4FSDA 2YS7A 2IYVA 4EF6A 2QA5A 1QE5A 3H04A 3I42A 4P4SA 4RBNA 2O57A 5J4LA 1L4YA 2WTEA 3LI2A 5ARCA 1WCIA 2CZQA 1FNDA 5FADA 1LPNA 4UREA 5J4HA 3BKWA 4AKIA 5KS2A 3PEVA 1C4WA 2MDTA 2OHVA 3A3KA 3R3VA 3ROQA 3A2LA 4J4TA 1T8PA 2GO7A 1EA5A 1F12A 1MO3A 4TMFA 5KC9A 4DE5A 1W0CA 4OAQA 2PM8A 3KJHA 3RVBA 3PE6A 4B31A 2EDCA 2HA2A 4OU5A 1P44A 1P75A 2Q5OA 4M38A 1UUFA 3VSEA 3WWPA 4GXTA 4WPGA 1USWA 2OECA 3E9QA 4EM6A 1Z36A 4P84A 5EUMA 2NZ8A 4U2CA 4MVJF 4ZAXA 3CUEF 3W7BA 5CUQA 2FSFA 2VN8A 1LK0A 1TNDA 2C1EA 3QSYA 3UJ6A 2GPYA 1DIOB 2LD4A 1DKLA 5AJTA 3UK6A 5AW0A 3EWIA 2GM4A 1S1MA 2XYHA 4IYRA 2CVHA 2X0DA 9LDBA 5LOVF 2Y1DA 2QSJA 3W3AH 1GQ2A 1SN7A 2ZTMA 3ZNOA 3P5SA 3GHYA 4O1IA 1IBCA 5EE9A 1AO0A 1K92A 1H3FA 1QVVA 3PDIA 3CRZA 2HMVA 3ROKA 1KTIA 4OXYA 4H3HB 1T1GA 2NXNA 4UHBA 4J3NA 3CH4B 1IBSA 2X86A 5D01A 1JALA 4FZ3A 5GPBA 4BWFB 4HX2A 1MH1A 4RF4A 4UUNA 2HPHA 4F8YA 3EIQA 3T3PB 1Y9AA 2HWKA 4DLSA 2GR9A 1VI6A 4G5HA 3QEBZ 1Z2PX 5E0KB 2LPMA 1ZMTA 3QBJA 4FC6A 2L18A 3DDSA 2QVGA 4FYJA 2JLXA 3Q4GA 2HA0A 2R00C 2WICA 1G8SA 1IZ0A 4R69A 4ZALA 3NIDB 1G5HA 4NQRA 1PQUA 3DMHA 1OIXA 3HO8A 1IONA 4RWEA 1Z45A 2BEVA 5BN5A 1DRJA 2WJJA 1B7GO 1YJCA 2CB0A 5BW8A 1HZJA 1SCJA 5ECDA 3UHJA 2IBMA 2YRXA 1NM5A 1L7DA 2B61A 2PZKA 3ZJVA 4YRZA 3G9UA 3MT0A 2BFMA 2BSAA 3ULKA 4P2BA 1W94A 4IIJF 4MDEA 1RCUA 2VYFA 3OFSA 4PYNA 1KFKB 1N2XA 4XX0A 3OTOB 2ZROA 4TTAA 4HX9A 1H2RS 2GCIA 4TXLA 2AMYA 3DTVA 1A98A 5HTOA 4BX2A 2JJ2A 2BZSA 3WICA 1APBA 4LX0A 1Y33E 1Z75A 1E5DA 2ZUBA 3HP1A 2QY9A 2B3TA 3O4JA 1P3Y1 3WR5A 4UPEA 3FI9A 2FZ5A 3N7AA 4ZCMA 2AW5A 2C77A 3LDHA 5BOVA 3WTCA 1GTZA 1FBTA 2QL6A 4Y8VA 4WJKB 4UULA 1F38A 1NVBA 1YR6A 3RRBA 5IHXA 4IO0A 4AJKA 1SH7A 2FFBA 1S2LA 1T8WA 1WNTA 3ONFA 4G63A 4B82A 1TVMA 1D0VA 1I3OA 1U8TA 4ZRNA 1L4NA 2JHFA 2H4WA 2OXRA 2YJZA 3ZKWB 4BZXA 2I33A 1Z9BA 1PFYA 4J9UE 4WCFB 4ZQCB 3UW3A 1O6FA 3RADC 1OY1A 2B36A 3OG9A 3T5CA 4NCAA 3ENVA 3KZOA 5E4TA 3NIBA 1H0SA 5BUSA 4KQFA 4XD2A 3BWXA 1O08A 2B1GA 2PX4A 4QU9A 2QDKA 4GZ6A 3LXMA 4NWIA 1ZHFA 3KYDA 1HNNA 5AXBA 2JFFA 2P4EA 2Y93A 2W8BB 3PX7A 1M6VB 4F04A 1GA6A 1C3LA 3IEUA 2DOKA 4L78A 2IBTA 1E1CA 1ISRA 2XNKA 4KIUA 4UVEA 3GQVA 5CLQA 4BQSA 4J8PA 1QFJA 2V59A 2XIJA 3G79A 2OHJA 4MUGA 4FM9A 4Z7JA 1YB6A 3F2IA 4U8HA 2N47A 4WXMA 4WL0A 2YWRA 3M7IA 1JE0A 2MR6A 1Y6RA 2ZRKA 5MGNA 5AVWA 3HADA 4X1OA 3WA7A 4BUZA 2C00A 1TA0A 3QUSA 4PX2A 3JQGA 3RYHA 4KVAA 1A8IA 4LBYA 4UBJA 1SOUA 4LJ6A 5ILOA 4BNIA 4IGEA 4EPRA 1Y34E 5DISB 2C9YA 2EFEB 1EH5A 4D6YA 4KLZA 3RBAA 1F6WA 2IOYA 1M2OB 3PQ5A 2PZBA 1WMAA 3A58B 4F71A 3QVWA 1KDRA 2IDZA 4C4OA 4HWTA 4Q82A 3ZGOA 1FZQA 5CCBA 4TWRA 4YJ3A 3PTZA 3ASVA 1R4AA 5DYGA 3OLCX 5KJ1A 1MO4A 4Y6PA 4BTLA 2Q8NA 3FUVA 4IDAA 1XWFA 4JLSA 4BX8A 1NBWB 5F2NA 4HJRA 5JAZA 2CSXA 1M2WA 2P77A 1JHVA 1Z7EA 4RTKA 3ZGNA 2POCA 3FYCA 1GKKA 4US0R 1SXGA 4NP6A 2PE5A 4XEHA 3TLGB 1HT3A 5KOHB 4ZIRA 1I32A 2QJRA 2AFHA 2FW9A 4YRTA 4P4GA 5AKKA 4DCNA 1W5BA 4MGIR 2PCJA 2YYYA 1EAMA 1ORVA 2QJOA 5A4KA 1JDUA 4ZU3A 2YASA 3WC4A 1JIQA 1G8YA 1IBRA 4NYIQ 1U6KA 2CHGA 3MJRA 3MOIA 3O82A 5A6SA 1IY8A 2Q9AA 4X1IA 4AI6A 5FOUA 1D8TA 1HC7A 2FZ4A 2HYIC 2RI6A 3FWHA 2GKGA 1NQOA 1QHNA 4G6ZA 3I53A 5TF0A 4EUEA 1JQ3A 5AJVB 1NVAA 1XSEA 2VQ3A 3BXHA 3V4RA 2XT0A 3D8BA 3LFHA 4ZI7F 3F90A 3B6IA 1ZNYA 3MAAC 2QD2A 1XVVA 3EGOA 1G0OA 4Q7JB 3LCCA 2XGJA 421PA 1I1QB 1SKYE 2IE0A 4BIIA 4Z53A 3O26A 3CW8X 3SQLA 3H2GA 3NOXA 2VOJA 3KR0A 3GEPA 1PNTA 1QJ4A 2GXSA 3L93A 5AIAA 5P8WA 2X8JA 3ZWKA 4XWWA 1M2FA 2BFNA 1GLNA 3V46A 5KHLB 5AYVA 3VYSB 6LDHA 1HQKA 1VCHA 3A25A 2QROA 2FX5A 3IIMA 2YL2A 4NYMQ 3Q8MA 4MUAA 1HL3A 1FQWA 2A0KA 3D0OA 3DAPA 3OIVA 1YU6A 2HMAA 4MW0A 5DNAA 3VKUA 5L4SA 5K0JA 2JLZA 4D9JA 5J2TB 1SZCA 2G4VA 3SIRA 3ZG6A 4QDKA 4RTPA 3KTAA 1CR2A 1NKSA 3FNRA 5YASA 4QWMA 3REQB 2CMFA 4OL0A 1Z6YA 3UC9A 2VO1A 3ANNA 1FCJA 3CT6A 4JNKA 4RJIA 4UFPA 5KVSA 1KYYA 3TUIC 4M1YA 5KYVA 3UKDA 3BS4A 2CLLB 4Z8XA 1NHGA 3GQBA 2KB0A 3SHTA 3SDZA 1G20B 3U60B 5CK4A 4BVEA 4GKJB 4CG2A 3KOUA 2QDXA 4R2LA 3E5RA 3B89A 3T7KA 3O8DA 4JU8A 5FO0A 5ICEA 1XT6A 2R3SA 3BYZA 1M8PA 1G21B 3CKMA 4OFXA 5I8WA 2C8KA 4J0KA 4P54A 4PANA 1COZA 1VL0A 5CT6A 5ENVA 3F6SA 1SCKA 2XHEA 3DB2A 3AI3A 1HOXA 3PUIA 2QSZA 3JYNA 2Q3DA 4P92A 1GR0A 5DTQA 3TCNA 3VGPA 5C34B 1UWKA 2IS6A 1TJ5A 3RSLA 1IH8A 2O2DA 2GN8A 1T4CA 4REMA 4B84A 1K6XA 2JEOA 3VDXA 1VHTA 3X1KA 2O8BB 2VT3A 2HCBA 1ZJ5A 1I4WA 3CHYA 3TI7A 3KV3O 4E46A 2X3FA 2DR0A 4L2IA 1T4GA 1G55A 4NZMA 4UE3S 4P53A 3DMGA 3ZZUA 1SUWA 3CCCA 1XZAA 3CO5A 1VKNA 2WFZA 3F67A 1WV1A 1CJSA 3A8TA 4BDSA 1DE0A 1JHQA 4KE8A 1VA5A 3MXTA 4R81A 4C0KA 2IX9A 2HJGA 2C5FA 4K28A 3I9V1 2VWPA 4EA6A 3VZPA 3P26A 2OSBA 3AKZA 1ODJA 1T2CA 3ECAA 1DAOA 1XTUA 3RJ9A 3U3JA 4JC8A 1AXRA 4GPEA 4NC9A 3RCBA 4DLNA 3IOEA 3ZDCA 5D5PA 5IYZA 5LA6B 3TJZA 1TAUA 1W88A 3NHFA 5GM1A 1PL7A 2Q2VA 3RYIB 2ZRBA 3IKMB 3PS9A 4U3JA 1XF9A 5LB4A 3GGJA 3C15C 1I3LA 1L3IA 5I7UA 2V54A 1TC2A 3GCZA 2EZTA 3NBAA 3ZI4A 1FU4A 4IGIA 1RQXA 3W5CA 3HXKA 4UXHA 5DYTA 4INZA 1QK5A 1U81A 3QX9A 1RM4A 2PX5A 4MUNA 4S3MA 3R6TA 3CRQA 2AJLI 2HMTA 1P1FA 2AA3A 1JHYA 3DNFA 1KIMA 2CYCA 3HWRA 2H2DA 3W1VA 4RTMA 3SOPA 4L15A 4NTZA 4EKNB 2I34A 2W4QA 1BIFA 1J2TA 2A4KA 3OBIA 4P1ZA 5E95A 2DQKA 3IIIA 3P45A 5A62A 1W0KD 3WWYA 3KUXA 2LVBA 4FGUA 4DHEA 5SV2A 3WP1B 5EQDA 4M7PA 1DC4A 5CH5A 4B3BA 1Y42X 1QKIA 3ZC3A 1OZHA 1YB1A 3D4NA 5JFGA 2AOWA 2XODA 2WIBA 5EKXA 5H7XA 3SLKA 4DQLA 2YN2A 1TFUA 3IXQA 2J4FA 4H59A 3B7WA 3ICCA 2RAPA 3T7JA 1AC5A 3ZDBA 4UD6A 3LYAA 3PQEA 1FDSA 1IDOA 3IDFA 4OQPA 5J59A 3HY6A 3TXAA 4ZGGA 3TLEA 1BVHA 2WILA 2JL1A 4E7PA 4F3CA 1N8NA 1YS2X 5JXWA 4X91A 3QLJA 3W5JA 4MW1A 4B76A 2OC9A 4BMYA 5IC6A 2VF8A 3BA1A 3KVYA 4CEIB 2QU7A 3BDAA 3JD0A 2J3IA 1X1SA 3EXG1 2IODA 2JDID 3W79A 4ARZB 5CXUA 3CEAA 2Z8YM 4FEAA 4IV0A 1GZSA 4UVGA 3SYMA 1FFXB 3LMKA 3H4TA 4HDOB 4V39A 3UB2A 4D8XA 4IFIA 1GARA 3G0HA 2I2AA 1JPNA 1Z2EA 2D4HA 2HA4A 5BR8B 3Q7TA 7YASA 2V96A 3ZNNA 5C3MA 3L6OO 1WETA 1RC8A 3PRYA 1YACA 4IG9A 4M0CA 5AUOB 1X80A 3N75A 2A9OA 1KI1A 4ND4A 3OC0A 3ETLA 3E8XA 5ADWA 3GLFA 1Y81A 3JZMA 4HAYA 1II8B 4LNAA 2A84A 4YRJA 5LD2B 3O0TA 3ZYCA 4XVCA 2BUCA 2OBMA 1AK2A 1Y89A 3WGNA 1VKHA 4I99A 3IS3A 5IXYA 2WVGA 1XV5A 4TT8A 4F97A 4DV1B 5K4AA 3TN7A 3HDQA 3M3HA 5DZSA 5CB4F 4BVKA 1RQRA 3R0JA 4WZZA 3CSUA 4B9EA 2PMWB 3AVUA 1C3VA 2IC5A 1P5JA 3D8NA 2GX6A 3EVAA 2O0JA 4HZUA 1IOWA 1E98A 2AXEA 2G04A 1YRBA 2E85A 3RUHA 3TDKA 4F1JA 1A4UA 2W2OA 3BHJA 3IEKA 3MWDA 3UKJA 1OA1A 2O48X 4BIMA 2JFHA 4CF6A 1IXYA 1K4YA 2F7SA 2ENUA 1N2ZA 4L4SA 2DGDA 1D9ZA 1ECPA 2G8LA 3G82C 4NBRA 4JBNA 1Q1GA 3RC3A 4EKIA 5C51B 3FBWA 1MGOA 1QM5A 4GE3A 1DIGA 3ACDA 5LMZA 5JUWA 1TU4A 2A88A 1F4PA 4Q21A 5D5HA 2XTAA 2ZRPA 3FAZA 1Z08A 3PL1A 3FTPA 3ZCSA 1MP0A 4EHJA 5MN6A 8ATCA 1A9OA 1RW4A 5E7QA 3R2JA 4M60A 1ISJA 1GFSA 4IEIA 1LDGA 4FZ5A 4I9FA 4M87A 4MJXA 2YZGA 4Q34A 1DEKA 3AUUA 3QWBA 4X97A 2QGZA 1X74A 3M1LA 4A27A 5C31A 2ZUFA 3V1MA 5DGIA 4ETNA 1TRKA 1Y5IA 2JFVA 1PEKE 1QH0A 2JEZA 2X23A 4HXEB 3R5HA 3EZXA 4BO5A 1AQ6A 1ZL2A 3ZE9A 4B8ZA 1I7PA 5IN4A 3TLYA 2B99A 3OF2A 1DO0A 2R6HA 4Z0NA 1NW5A 2C1XA 1X8LA 2CUTA 3WLSA 3HJUA 3E7FA 1DHRA 2PFKA 5IS2A 3UQZA 4ZQFA 3BILA 1VKJA 4MZXA 3ZXYA 1L9KA 2AIRA 2CVZA 2DUUA 1KGDA 5T8KA 2OD2A 2XLBA 2Z9BA 5AXDA 5EKTA 4ZAWA 4ZYUA 4NDZA 3DXZA 3GB9A 3I1YA 3CZ9A 4HNGA 4RV5A 1B2LA 3LWBA 3C1UA 1Z12A 5C8VA 3BD7A 4UMFA 4Z3OA 3MWKA 3ESBA 4FOSA 3ZU5A 3WRYC 5EJ8A 3LY8A 4UQOA 3O2QB 3QFFA 2GDZA 3UQYS 2CYBA 1DSSG 1Z7YA 3CVVA 1SXJA 4TSKA 1WSWA 5BT9A 5A2QA 4MULA 4BQNA 2GK4A 1BMFA 1JG6A 3EFOB 1X1RA 5A04A 2CLHB 1L4HA 2HBQA 3TLJA 1UP7A 3PDJA 3SM9A 5A5DA 1VE5A 4HZIA 2H7YA 4O0LA 3WQHA 3QPAA 4K81B 4NL4H 5DKFA 1T36B 3WOHA 1G6Q1 2Q1UA 3KQYA 2JFBA 3X1XA 1PEYA 1O97C 2QX7A 3UHPA 5BQXA 3GYGA 2WKPA 4CIBA 5JZOA 1Z8FA 4N41A 1BGWA 1G9TA 1FMCA 1NF8A 3EYAA 3PUJA 3O4VA 2ZUCA 4QTYA 5K4GA 3QEAZ 4Y18A 4WLUA 1N6KA 2JIZD 2Y0EA 3A05A 2C9DA 2QZPA 3HCDA 8GPBA 4FYXA 4CEJB 4F9FA 2C2OA 4HQFA 3LX6A 4FYPA 1YZUA 4H08A 4HMQA 4LJ8A 5K0GA 2RI0A 4HDNA 5EC8A 3ZEIA 5JAMA 2TRSB 4DYDA 1DEHA 1ZEMA 3E7PA 3AKCA 1VPWA 5LQSA 2NZWA 1YB5A 1F2TA 2Z30A 1I3KA 1ZFNA 1VTKA 4ZMSA 1NVEA 1OFIA 1WLSA 3FI0A 5ICSA 1NVWQ 4Z7NB 3E9ZA 4D97A 1C0EA 5ALUA 3QE3A 4O2BB 3AVOA 4LTNA 2ZATA 4N4AA 1P81A 1PTJC 4HPWA 3ZW8A 4MQEA 4CV1A 1IXRC 2BFCA 2I87A 3EBOA 5AKGA 4BKRA 1N32B 4DSUA 4KSCA 4UTRA 1BVUA 1A82A 2NVWA 3EPJA 4N0DA 4QO7A 4H4DA 3HB1A 5CFOA 2XT6A 4KH1A 4E5MA 1VE1A 2ZIFA 5F33A 4QU0A 4EVRA 3BD6A 4I9UA 3BJIC 5DTRA 5EJ5A 5KX5F 4LFAB 3PTLA 3WHKA 2VUSA 4ILEA 1WTAA 4WFQA 1Z34A 3PNYA 2FMFA 4XFJA 2V4MA 4JR2A 5JZBA 2YW9A 3DKVA 4A1OA 1NUAA 1Q0HA 1Y3AA 2RKOA 3PVZA 5AW4A 2JFXA 3JD3A 5BSHA 4KQ9A 4OVKA 3T7DA 1HTTA 4OU4A 1TW2A 4TRJA 3WMGA 1IUKA 4Y1EA 3TUZC 1JGTA 3MC1A 1GZ7A 1Z0SA 1DEXA 4RESA 2RGYA 2HB6A 5BPHA 1KAEA 1Z4PX 3J81k 1ZNQO 4XM0A 3IUQA 3ZKWA 4EEKA 1KK3A 1V71A 4XD7A 2DR3A 4WCFA 4BO2A 1CQXA 4PZ9A 2VTDA 5BOSA 4NYIR 4MP6A 2D0PB 3A0UA 4B3JA 3HMKA 5ICCA 3PV0A 4UHCA 3RYFA 4KZPA 3TQIA 1LGYA 1VLHA 1S8OA 1UZNA 5EZYA 4TV8F 4MUBA 3OT1B 4GMFA 5JMWA 2GBIA 1TIBA 2V3VA 4JJFA 4ZQIA 4GOOD 5LZ8A 2VSNA 3KEOA 1R0ZA 1TJ3A 4IJVA 4S1OA 3MJEA 2W8BA 2PUVA 5JU6A 1H4VB 1X9IA 4XRRA 2GM3A 3ZU3A 1HTBA 4ZO8A 2ZRFA 3FNBA 3JZIA 1K8RA 1XA4A 1V7PC 1F2VA 2R751 4YS6A 3EZYA 3U1TA 4PNPA 4EPTA 4J07A 2J85A 1MB4A 4R1QA 4RFLA 4DIKA 3GD5A 1B14A 2ZYVX 1TMKA 3OT5A 2H1IA 1SBTA 2QVBA 3CUVA 3DEIA 3ZI7A 3B8HA 4C03A 2WIKA 3I39X 4M37A 2CFTA 4DUPA 1G2QA 3GROA 3B9PA 4ZK2A 1NW8A 2XTNA 4KXVA 4NYMR 3EOBI 2YJ4A 5IAGA 3IULA 4XYMA 3ZTTA 1ZD2P 2FKAA 4LDAA 2ZJ6A 2G70A 2DPHA 4PX9A 2PS1A 1E89A 4HH1A 3A14A 1C7EA 3O4RA 1E2BA 3N6XA 1EFUA 4KC0A 1EB8A 3KZMA 1FVXA 1ZGJA 3MB8A 2C54A 3ODPA 4CVNA 3HXLA 4I9GA 4J03A 4ZV9A 1Y1KE 2FXVA 4FKZA 4OQFA 3SD7A 2REBA 2J9RA 4QAQA 5D8DA 3TLGA 3UJ9A 1XU7A 4X64B 3ITKA 1YKGA 3ILXA 2EZ9A 2FPGA 1BHO1 5FBVB 3DXFA 2EFHB 3T3MB 4CL3A 2PT5A 3QF7A 2WHEA 3ONDA 4M0PA 3S8EA 2BKLA 1FYFA 1OPXA 4MS3B 1YFLA 4FXOA 4LRQA 5EZSA 2PPVA 4JOQA 1NVMB 3EASA 2BEWB 1FS6A 1PS9A 3GFBA 3L0PA 3EIXA 3MTBA 2VEOA 4UBNA 4EW1A 1UC5B 3UUEA 5TVGA 1QP8A 2QR2A 4HO1X 4L74A 5DM1A 1GU7A 8ABPA 5EY5B 4KYVA 5EHXA 1OHHA 2W0SA 3HWWA 5DHSA 5FTJA 2VBFA 3JW8A 4CF4A 4CDRA 4ND7A 5DN6A 5A6SB 1CUZA 4IIDA 2PSHA 1GEEA 4WESB 3RSSA 5K2OA 3OQJA 3T7EA 2O2IA 3F3MA 2RMKA 5HK9A 3KYCB 3IAHA 4QSMA 3BGIA 5EMNA 4A0SA 2MINA 5DSTA 3WBKA 3PLRA 1YA4A 1HUQA 2FJPA 3RV4A 2XCQA 1PS8A 1A69A 1EWYA 2PX0A 2RE8A 1EIWA 3GJRA 2B83A 1IEVA 3OZ7A 1ZSNA 2ZJ2A 4TLCA 2BFFA 3EXAA 3Q1KA 4R2KA 5FV7A 2RHJA 1DO8A 3W8RA 3AM1A 1YI1A 2DH5A 1LQUA 2VCEA 3IPXA 4AUEA 1XALA 2ZIVB 3F6YA 2X15A 5JXIA 3TNLA 1HETA 4MUIA 4ZTZB 4PRLA 1GJRA 3HFJA 3HVKA 3RJTA 2BKVA 2Q6VA 3E81A 3ICQB 2GKOA 4OSOA 5JNWA 1A2QA 1IULA 3LC0A 2H4JA 1NVDA 3T38A 4EHLA 4YAKA 4ZIRB 9ATCA 1RCFA 1M0TA 1V8ZA 3EA5A 3F49S 4U2EA 4OHCA 3W9SA 2I3DA 4MOWA 2XOKD 1LBTA 3LYHA 1CJKC 3STWA 1WUYA 1WZ2A 1ID1A 4TYPA 4FW8A 3ZHSA 5BN1A 1WOYA 3L18A 2R8EA 4MWOA 3H5LA 4URZR 4C7VA 3KB1A 2I4NA 2EGGA 2QTCA 4H3SA 4XVQA 2JGRA 2L0XA 2RGWA 3K0CA 4OYHA 4Z9FA 1G21A 1TU3A 5DHTA 3WL8A 3ZD6A 2QLLA 1QONA 2XT9A 4YMWA 1MO6A 3CR8A 4HQ6A 4ZKEA 3B20A 1ZNZA 3HB0A 4TVOA 1IZ7A 1P0PA 3PITA 4M89A 4E6PA 3Q7EA 2QZ9A 3R20A 2VKQA 3PFFA 3NM5A 2Q4DA 4BS9A 4ETIA 5EXPA 2VXBA 3MRTA 2HF9A 1KMQA 2O8BA 4NK4A 4YQFA 1P5HA 5DLQC 5TLSA 3T4EA 1N2BA 4JFRA 4RX1A 3SBEA 2AFHE 2IEAA 3PWSA 2DFVA 3GT0A 4C7JA 3OIFA 1T0BA 2AVDA 2JIDA 4RXMA 3MHTA 1M2HA 5ED0A 4EFDA 3E58A 2BL4A 2VTEA 2YXBA 3EC2A 3K9CA 1ZN9A 4M1ZA 4ESOA 2CFRA 3AUXA 1MEJA 1AKTA 2DHDA 2GTHA 3S1SA 1E60A 1Q1QA 4P80A 4CLDA 4RO0A 1FX0A 4YAGA 1J90A 4R05A 2HKIA 4JYAB 5D3ZA 4UEWA 1BJKA 1JVSA 1T0IA 1ONBA 1NX9A 3DZBA 1CEYA 1XX6A 4U7FA 2BHSA 4J16A 4KAXA 5ABPA 3VX4A 4QHYA 2WSIA 4LHEA 3H0EA 3BXOA 3SGLA 3R9WA 3ES9A 4BGDA 2J3KA 1KZ6A 2Q5CA 3QELB 1L0BA 4FEYA 1NYQA 3R5XA 3I34X 1RJEA 2AQKA 1PJRA 1KEVA 3JSAA 1YZLA 2O8FB 1QHYA 2H7CA 2F43A 2R4UA 2XWQA 4A5OA 4AS2A 5C8XA 5AHRA 1RM3A 1S2GA 4MMZB 1QUFA 3H1FA 3H2YA 4RL4A 1GPJA 3RT1A 3OHMA 1OV4A 1P72A 4UNPA 1Z6ZA 1RXWA 2P6PA 2PCLA 3RRMA 1UJ6A 2ZYUX 4JLOA 1EVIA 1PSZA 1ZLYA 1XELA 4BE4A 1NBOA 2ZXUA 1Q92A 4UDYX 1GQRA 1ZI6A 4RPKA 3I05A 4JXZA 3DFZA 4QUEA 4YO7A 5E6UB 3L8HA 1W46A 2VWQA 3TAHA 1G5RA 1M2VA 4JYMA 4LXXA 3ZIUA 5ITSA 4J7UA 5DDIP 1EK2A 1ZD3A 3O1JC 1RRGA 3CNLA 4CM8B 4GWLA 4R2JA 2XE8A 4YMTA 1PNQA 2QRMA 4L0QA 4CGZA 1B16A 5DTIA 4CR8A 1PX0A 2DFTA 2CL6X 3GJQA 1T3TA 2EFYA 4TGLA 4ABTA 4QUGA 3DNMA 1PGOA 2WV7A 3RT9A 2R68A 2XCIA 1JHZA 4TX1A 4P3NA 4MO9A 5BV2P 1DGQA 3QW2A 4MYCA 3I2HA 4NAUA 4CEIA 3TIIA 5KUTA 4ARZA 5FPQA 5HWSA 2GRJA 2YHAA 3VTKA 4FEGA 4W1RA 3M83A 1SOVA 3EFBA 4CKCB 1MN6A 3I6MA 1OAKA 4YRSA 4LC1A 1N2CA 3K9LA 2GJ8A 4N7BA 3VUEA 4AL4A 1VXOA 4BU0A 1JWAB 2FNAA 1STOA 3IKJA 4M9UA 2JA1A 2OQVA 2D0OB 1A97A 1MJFA 3ILVA 4PC7A 2GBLC 4Q3AA 4C43A 2JLQA 3BB3A 3L7IA 3RK1A 2PWYA 3EQZA 2YOGA 4LA4A 5LYJF 1II8A 4YJGB 4Z7QB 2SNIE 3HYLA 1P91A 1G18A 2DWUA 3WMFA 4IAOA 5IJXA 4GNRA 1G4UR 2CCJA 1R8XA 4MWEA 2VPWA 4NX2A 1EK0A 1VDZA 2PUHA 4GPBA 4UOEA 3NAZA 2RJ3A 3R3YA 1MD9A 4HAUA 4DMMA 1LW6E 4F6LA 5LJIA 5AKLA 4YCNA 1P1KA 4XIJA 3HN7A 5A4JA 2D5LA 2IYTA 1ZP6A 5NLLA 1YE3A 2Y71A 3WGVA 2QZSA 3P71T 3TDNA 1KQFA 1XQ9A 2NO4A 2VDQB 1SG9A 1SVWA 3DWEX 1G3RA 4HNAB 4EQ6B 5CVTA 3UMVA 3H6KA 1YFJA 4AO6A 3WWEA 3JWHA 2R85A 3D02A 4QEKA 4AQDA 4NEGA 2WMOB 2W6OA 4EKEA 1EFAA 2H0QA 3AESA 4WCFC 3UWMA 1TCVA 5AKEA 3F46A 5CFNA 1VZ2A 1QTQA 3VH3A 5D85A 1TUGA 3D5TA 2AUNA 4IGKA 4JAVC 5B53A 3LVFO 3LZ6A 1EWQA 1HRDA 2QQGA 4C06A 4BB9A 1JI3A 2D62A 2H08A 4Q9IA 1CUSA 3QFRA 5CFRA 2C95A 1A9PA 1GVHA 1S2IA 1YE5A 4KR6A 1P0FA 3L0ZA 4IWXA 1ECLA 2QU8A 3FCEA 3VAAA 5HPYB 3GT4A 1E32A 3MCZA 4OBWA 2PUAA 3ZHUA 2ODPA 1A7KA 1UBHS 3VZSA 5AW9A 3Q9SA 1LPBB 1K89A 4KQMA 4A8PA 1O9HA 3W9BA 4ML3A 4G4SO 1MEEA 2PGLA 4DW8A 2AZMA 3DE1X 4BMDA 4Z2AA 4KX3A 3HGQA 3MTJA 1L3CA 3LGSA 2K7FA 1W75A 2YN0A 5C80A 1G5IA 2C2ZA 3DKIA 4UHHA 4TTPA 4ZFNA 1V4VA 3Q7QA 4DSZA 5A1JA 1V1RB 2QUJA 4OB7A 2PSFA 4L6AA 1RWXA 5G2OA 2UU9B 4JU9A 1NNUA 3C4QA 4XB2A 3PI6A 4MWDA 2I7TA 2PTHA 5DW0A 2CV1A 1YUNA 2NXJA 2OG1A 5K3FB 5EMMA 3D8SA 2BFDA 2D2VA 5KU7A 2CV2A 4D9NA 4QPDA 1C9NA 4Z0PA 1AF4A 1P2SA 5DHQA 3RJMA 1XZHA 1VE6A 2J0UB 1X39A 2X5NA 1EIZA 4MQFA 4PPNA 3NTLA 3L1JA 2BR3A 5CLJA 2QRUA 2AKAB 2OCGA 5DP1A 1KK2A 3PFKA 5FF9A 4Y2RA 2OV3A 3QY9A 3L05A 3UXMA 4H15A 1R3UA 1XD2A 1SQGA 1YZHA 1BYIA 2QMHA 4MRPA 4DWVA 5JXHA 2DMRA 5A9RA 3GJ6A 1AUXA 3QVUA 3GLFE 2EL7A 4IUCS 3HB9A 2NU8B 1R9NA 3W0LB 1CRWG 1DBRA 1O57A 1WQ1R 2CVFA 1GRRA 4V3BA 3EFOA 2WVHA 5LXTA 1CVLA 1TYCA 3H2IA 2GOYA 5KYWA 2DQSA 3E9CA 4MGHA 1FP4B 4UBKA 4B3XA 4DJTA 4W5NA 4NJEB 2O5EA 1JFRA 3L92A 3GJ8A 2H48A 1H2AS 1MXFA 2EKQA 3EHEA 2DBQA 1EYZA 3NC1C 3RKRA 1H0HA 4D4KA 5TY0A 2A57A 5A4AA 1H6BA 3EXFA 4GECA 3NHAA 4CW7A 4LECA 3UK7A 1Z22A 1HDXA 1ES9A 2NSYA 1RWQA 4KIWA 1NBHA 1IG0A 4PNHA 4NONA 4R8VA 1U9JA 1M8JA 4LMBA 5KYYA 2NTEA 2DZDA 5AI5A 4C04A 2PV0A 4BNFA 2JAPA 3OZIA 5LL6P 1TUEA 2GHIA 4OJNA 3P5BA 2NU9B 4JQSA 2JEYA 3WLHA 4CFYA 3T3GA 1JEOA 1BE6A 2R44A 2O5RA 2PBRA 3C7KA 5IAJA 2A7XA 4C7MA 4Z6KA 4FDUA 3JQBC 3GRRA 4EZIA 3L8YA 3KL4A 3GPLA 3QWIA 4QU5A 3LQFA 3MWEB 1E63A 3SS7X 4EKDA 1PNOA 4TWIA 2ZIZA 3FWYA 3V8PA 2A5FA 4JK3A 2VTVA 4Q3BA 4U7GA 5JCJD 1JIUA 3F6CA 1IEWA 1EGQA 3IJ5A 4G0MA 1CC1S 2ASEA 3TNJA 2QJFA 1XLUA 2XECA 4AB1A 5LP6F 3A9RA 1ZGGA 2YH2A 1XZLA 2CBGA 2ODTX 3USCS 4Q03A 4E5VA 5HZHA 5KQLA 5B6JA 2H0AA 5A02A 3C70A 3D6VA 5TF4A 3THOA 4BFLA 4ME6A 4FILA 1DCFA 4RZ3A 3I12A 4Q1CA 4QJBA 4XPIB 3RVLA 4HRAA 4EHDA 2PUDA 4MYTA 2XAUA 3STYA 4QZVA 2WP0A 4JA2A 5KBYA 3MWLA 3B2QA 1P7CA 1TM4E 1Z13A 4L8WB 2C5SA 2LNDA 2ST1A 2F1OA 3K0CC 2WYWA 3M6AA 2VR1A 2XADA 3L7YA 4WSOA 4LRUA 4ZVOA 3ZDYB 1ZDMA 4R0MA 4OLBA 2VHQA 2HDOA 2L19A 3NBYC 3O03A 4FJ0A 1SR8A 1G8HA 1YVEI 4K46A 2F48A 4IIEA 5DT9A 2XB9A 5AUQA 2EZ4A 5FI1B 3OQMA 1TAGA 2ZBEA 3C4VA 1NRXA 4L72A 4ZT7A 5LKRA 2IHNA 3EE6A 1HM5A 4P83A 5TB5A 3OTQA 5JRZA 1T3GA 4BLOA 1SXJE 5JVDF 1GV0A 2O7NA 1KBOA 3KJFA 4KPYA 1QO0D 2GEUA 3DL2A 2OUIA 2ZS8A 4ONEA 2PY6A 3EEYA 1GNSA 3GPIA 1OTXA 4S1PA 1XKTA 1TE2A 5DTJA 3T9CA 2WF8A 3CLTC 2EW2A 1YDFA 2X22A 4Q0MA 1UIMA 2ZREA 4PYMA 4YJ2B 4WWHA 5M7EA 1SUDA 2Q7XA 2IY8A 5ULLA 1FXWF 4AJ1A 4URWR 4BQOA 3IR5A 5F73A 2NP6A 4ZI2A 4CIXA 5CHEA 5ALQA 3I2IA 4PU0A 2VSXA 4C30A 2J9YB 3ENNA 3RC2A 4NCKA 4R2IA 4Z9YA 3HTXA 1TK9A 4KBGA 2OD7A 2HSDA 3A4IA 4RIEA 4MUYA 1XMPA 1WPXA 4P38A 3HVHA 2YXEA 2FDXA 1QH9A 1Z6PA 1FX1A 1NPYA 5JQGA 3C98A 1N6OA 2IDMA 3PNVA 1QPGA 4Q1FA 4RWZA 3RS8A 1F5NA 4YNBA 3ZWNA 3V1LA 4ND5A 5JD5A 3QE9Y 1YL7A 3SJZA 4KTVE 1WXXA 2ZFUA 4Q4HB 4EKYA 3O1LA 1FNNA 3C3DA 5LC1A 1WY5A 4LZZA 2VJMB 3RM3A 3ZVMA 1UJMA 1XAHA 2EYUA 3AF0A 1YFKA 4M6WB 1PL0A 4B3DA 1SAYA 4FGZA 1E2GA 1BHJA 1PGJA 2XMRA 3HJGA 5DWDA 5TR9A 1N8SA 1UINA 4PZYA 1U0RA 2V03A 4RW0A 1I0LA 1Q1NA 2WMYA 5B7PA 1HEUA 2B78A 4YALA 4F60A 4YXWD 3L8ZA 3P2JA 3IURA 3O1HB 1OWMA 4DJJA 5FH9A 3Q1LA 1ZVJA 5C46F 2AN3A 3KR2A 3UZUA 1BO6A 4JD5A 5KINB 1J7JA 3O3OB 5FCDA 1FU8A 3JWEA 2IUYA 4MS3A 4Z9BA 4CEHB 1Q17A 3RK4A 3PX3A 3LL7A 3FMOB 1PJTA 1RRMA 1UC8A 3HV0A 2BEWA 2FW7A 4G0VA 4MTLA 4JLJA 4KQ2A 1J23A 3MQ2A 4TS1A 4WZAB 5K8VA 4MI6A 1W6UA 1W0KA 2LBPA 1KBQA 3HA7A 2LIVA 3KCNA 1KYXA 3DBLB 4KZKA 5CDYA 1ISHA 3LC2O 3EISA 2HL6A 4LDPA 3TWOA 2ORYA 3NIFB 2KWIA 5A0TA 1XA3A 2R1VB 2OZVA 2ZBDA 1EX1A 2HMUA 4IDFA 3A3OA 4RQAA 2FZCA 1KU0A 5LYYA 4TKLA 1UT6A 4HRYA 4QU8A 4EGAA 1LBIA 1TF5A 2PO7A 1U0LA 1MOPA 2H7VA 2VUUA 3I1IA 3P9RA 4X8HA 3UB3A 1V3QE 1NR1A 1C5KA 1MORA 1RACA 4G9EA 4RETA 2ZZMA 1C4XA 1SIBE 1GTMA 2F1KA 2FPRA 3KB6A 3QXHA 1XBTA 5DX1A 3RTAA 4GZ3A 3VO9A 2EP7A 3N2KA 5EVJA 4MA0A 3ZBQA 4CLOA 3NORA 3FMFA 3IT2A 2NZJA 3B38A 5CNKA 2GNPA 1MJHA 4O63O 4C3ZA 4IDCA 3CX6A 4P4LA 4JL5A 1O4VA 2IQIA 2IVZA 4ESHA 4GP6A 1VYHA 2QT9A 3FWKA 5LD2C 3R0IA 1MVOA 1U2RA 3PT9A 4FNAA 5K2MA 3EQ2A 2JDIA 3VSCA 3DEFA 5IJ9A 1JAYA 4UCQA 3N0VA 4MKZA 1YA8A 2JD1A 2Y0BA 3AONB 4DR6B 2YZ2A 2Q29A 1YZVA 1LRLA 1ZO8A 4HEJA 1ZAKA 2EDAA 2QUBA 3KWMA 4MR7A 4CQNA 2OUKA 3WK9A 1YHZA 4XDYA 1N5JA 1DAEA 3OKFA 5E3IA 4IDPA 3AEQB 1H2EA 2B4QA 4W6ZA 1KQPA 2HADA 3FW1A 2W2NA 3RS4A 3C1TA 4ABYA 1MA0A 1SU7A 1C7QA 3FWNA 2GCOB 4I55F 1MFPA 3Q7RA 4GFDA 3T12A 1G1MA 2DAPA 5HJ2A 5EWJB 1NOJA 1VI2A 1NBEA 1RS0A 2R96A 1U9CA 2OBFA 3NHMA 4GP7A 4UPDA 4B47A 4BRUA 5MDHA 1UBUS 2X13A 1UCFA 4L5JA 4NK5A 4U0JA 4RHTA 1X8JA 2VVTA 2X42A 3PEFA 4GI3A 4GH5A 3UUGA 2F3QA 4EI9A 2VDMB 4UVHA 1U90A 1XEXB 2F1JA 1N5MA 4LJRA 2TECE 2WTBA 1GU1A 1A9TA 4EHIA 3KVRA 1UC9A 4AULA 3JV7A 1MC5A 3L5OA 4KLRA 4JVNA 4XUDA 3KXKA 4DDWA 2RK3A 2HJHA 3IP1A 3K4PA 3QPVA 5BUZA 3KALA 3NATA 3EGEA 4Y1FA 1F2DA 5HRAA 3VR5D 3V42A 4U2GA 1KL7A 13PKA 2GN0A 4D80A 3MWJA 2A0FA 1X14A 1TX4B 1V4BA 4KQ1A 1ESNA 1O8CA 3K09A 4RUKA 2WAYA 5ER9A 4G0PA 1ZCAA 3HQ4O 5EUCA 1Z4JA 4EHHA 4ZEOA 4ZAFA 3SOZA 2QI9F 2WPDD 2YIMA 5FI3A 3PNKA 3PNPA 2AQIA 5AM0A 3LDFA 5F4BA 4N47A 4WLVA 2I22A 4UUQA 4NFSA 2VOEA 1W85B 1JL3A 2GAOA 3R3UA 4CT4B 3ZKAA 1P2UA 3KHKA 4UNNA 1Y7PA 5JSKA 3ZV3A 4CM9D 3CVUA 2ZYAA 4A0GA 2GN4A 2YY5A 3C3YA 1RVV1 3HZRA 2UUAB 1GZUA 3AHCA 3BRWD 1G6KA 4NBKA 5K0BA 1D6SA 5L7YA 2C5AA 4NYJQ 3TLKA 1G5QA 3VR6H 4PNEA 3QELA 3HSYA 2V7WA 3FF4A 4ZYVA 3HU3A 4RXUA 1IK6A 2O8FA 221PA 1M2JA 2PKQP 1E1NA 1X0XA 4I5DA 4HUTA 3LKDA 4LJSA 3TJRA 4B2LA 1DBSA 3DWGA 2PL3A 1XCGB 1G6OA 3QE4A 4M1TA 4PR3A 3RS2A 4C1NA 3QXSA 1W47A 4QT0A 3TUJC 4GVXA 3EAGA 4FNOA 1TUBA 4R83A 4HQOA 1CJUC 1QVAA 1WMFA 2JJMA 2R66A 2AKEA 1TUIA 1F17A 1ZBDA 2VXCA 4HGYA 1C30A 1T34A 1U3TA 3CR7A 3NGMA 1PJCA 5HG0A 4H3VA 5KNCD 1DKQA 1K7EB 4JLUA 2XJ9A 1SXIA 1XROA 1PTKA 2IZ1A 1D2MA 3K2QA 4P4NA 4YP9A 5KEIA 3TFOA 3R5KA 4F84A 3PKIA 2QLTA 4YUZA 3BFVA 3CF4A 1X2EA 2QW0X 3O4GA 4AURA 4PQFA 4BAZA 4CM8A 5JAIA 1RDFA 4JJAA 4MQLA 4Q1DA 3NBKA 1CUDA 4Z2YA 4BVJA 4RKQA 1WDTA 3O47A 5FP0A 4ARAA 1BMTA 4W99A 1S3GA 5CTAA 1RJWA 1ZR2A 2QTHA 2SICE 4E5KA 1O95D 2ZM6B 1G21E 2D2XA 1SG0A 3JCZA 4MICA 3S68A 4EFMA 1EXDA 4BYMA 1DXHA 1QBKC 1WABA 1C3OA 3IP6A 4R6WA 4LGVA 4JXJA 2XKKA 3LW8A 1LS1A 1A95A 2HPVA 4FX2A 2P2LA 4BMZA 3J7TA 3IB3A 3SBDA 1X7XB 4C4PA 4OGFA 1USUA 2CLOB 1AB6A 2FR0A 3NT4A 2XKJE 4NDAA 2GVZC 2EV9A 3AQ4A 3MIZA 4C0HA 5IH7A 2QYHA 3MW8A 1UMKA 2I71A 4DFDA 2JIZA 2WFAA 5JI3E 3LUBA 3JVIA 3WNQA 1UM9B 3EG5A 3OICA 1J24A 1JJBA 3CPEA 3BE8A 5JJBA 2YXLA 2EKPA 4H7EA 4Q1BA 4JI5B 1WBDA 1NNSA 1ZS9A 2CDNA 1R6VA 2QLJA 4GSLA 4A3SA 1MIOA 4LI0A 3UYLA 4G0WA 4ARBA 2RFLA 4IHJB 4DA7A 1DQPA 2O2CA 3O74A 1HBJA 3OQBA 3THXB 5J2UA 3FTFA 3GBVA 1BE0A 1JKFA 1F0YA 4UHEA 3CS3A 2H11A 1V8DA 5CVCA 1I3MA 1ZIYA 1G16A 3RVJA 3C6YA 3LOQA 3JYQA 4BKQA 4LYDA 1UBNA 3G2OA 1FNMA 2DJIA 4GE0A 4R5MA 3S0JA 4GC5A 4E5DA 1Z0IA 3QBVA 3P2IA 2CHFA 2GLUA 4U8GA 4YJDA 2FH5B 1N2IA 1TKRA 2C2MA 2ECQA 2DCUA 3LCUA 1IATA 4K0RA 4QASA 1J8QA 4I19A 5EJAA 4EQ6A 1GNVA 5JYCA 2N75A 1YBAA 4RQBA 4B6JA 1L7NA 2Z2YA 4KV7A 1G5FA 1FA9A 4G67A 1PJ3A 3ECCA 3TZQA 3KQNA 1AHHA 5KO2A 1ZW6A 4AD8A 4C07A 3NASA 2GZ3A 2ACKA 1J2RA 3GFRA 3OEED 1QK3A 2QGFA 3DCYA 1U0TA 3ONEA 1ZU4A 1TVCA 2ONJA 1F8GA 4QGSA 5DBHX 3ILSA 3A31A 5JHGB 3EVTA 4QYMA 1KEUA 4MVCA 3T06B 2VQ6A 3ADPA 2NTVA 5MFPA 3AG5A 4G24A 4RVNA 1KIFA 3KT8A 1JUDA 3OCUA 1Q3KA 1V5EA 3PHGA 4BLTA 4XLLA 1CY6A 1G8PA 2J5RA 3LNCA 1L5HA 2H1CA 1N78A 1JJ7A 3PQ3A 3UJAA 2C5LA 4IHAA 2PZ8A 3ENZA 5KDDA 5EE3A 1T2VA 2ZQZA 1SD2A 1Y8QB 1RKBA 1OI2A 2QTLA 3UTCA 1NC1A 4RTJA 2QTMA 1QFSA 1Z5UA 2PXHA 3C74A 3H2KA 3CNOA 4IZOA 4DCCA 2PUWA 3P0HA 1RRPA 4L4RA 4Y30A 2AKYA 4LZNA 3M6WA 1IUNA 5FBKA 2I4IA 5K3FA 2BZGA 2VAXA 2WWXA 3KBOA 2W2XA 3HR7A 3NRJA 4NMLA 3TQSA 3V2IA 2G9RA 5IX8A 5KTTA 1YUMA 1YMVA 3HEMA 2J0UA 1C3JA 4NESA 3ZH2A 1G8KA 4MRMA 1J42A 4R4JA 3ZR4B 1P1BA 4H0CA 4Y2YA 1N2CE 1N6RA 4B4UA 3CTMA 3SJUA 1GNQA 1U5AA 2OOSA 3PCXA 1S6YA 1G63A 1Z29A 4DCUA 1WXEA 4DPKA 4WUVA 4C7BA 1D09A 3PDUA 3FN4A 2PIAA 1T4MA 1UBKS 1F0KA 2QRLA 5CPBA 5JNTA 1WMDA 2NU8A 2HXSA 3FX2A 3UAXA 2PQMA 4RACA 5E2BA 2NADA 5K3SA 4EK9A 2I2XB 3GDWA 4TM7A 2X4GA 3RU3A 5HM6A 1FP4A 5KOIA 4EFLA 4NJEA 2ZJZA 4I36A 1RKQA 4W7HA 4H6XA 1ZITA 4IQFA 2QBYB 2QEQA 1ML4A 2PUGA 2P9JA 4ZV4A 3AUSA 1VGVA 2UYYA 4QELA 2ZP1A 2BE7A 3JQEA 1U5CA 1OFHA 1SKBA 1U2GA 5CM8B 5AKJA 2G3YA 2R8XA 3WO1A 1FDTA 1EUZA 5GM2A 3EEBA 4IINA 4B46A 1XXLA 1YHYA 2VHJA 5I3CA 1RPNA 1DAIA 2YV3A 2GARA 3C43A 5DI9A 1H1TA 5TGTA 4EPYA 5C7LO 2DERA 3X2EA 1EFCA 1GR1A 1XZNA 4CM6A 4IJMA 2C4TA 2WKRA 2XF2A 1N33B 4BN4A 1E1QD 1K7FB 4TM8A 2OFPA 4U6NA 4UZSA 3BIFA 4O2AB 3ABRB 1SQ5A 4G1CA 2D7CA 2R8OA 1Z5WA 4IJKA 1ZSYA 5F7XA 5HRCA 3RS7A 5J40A 2FGJA 5AESA 1RPZA 1PDOA 2X2PA 3G88A 2D5AA 1NOIA 2M98A 1WR8A 3WL7A 4J2OA 4KR2A 1U3DA 3EH2A 1PV2A 2VYND 4YEDA 4D74A 2OGUA 1XTPA 3NLLA 4ZD6A 1RT9A 2ZSDA 3QVGB 6REQB 4DIMA 4O02B 1L5WA 3GZNB 1YS9A 1K86A 2P68A 2XOEA 4KO8A 1J2YA 4EL0A 1YD7A 2OCLA 1AURA 1E3IA 2PL5A 3BJEA 1L5FA 4CI0B 2I03A 2GVNA 5TPWB 4XPIA 5GJVC 1N0WA 4PVCA 5E7JA 4IFTA 5FTLA 4Y2XA 4DMUB 2BFWA 4DV2B 2JI6A 5SZHB 1WSDA 4OL9A 3LWNA 2ANBA 3OZSA 3VR5H 1HFKA 4JBWA 2MSLA 3FPBA 4MCIA 3ZWWA 5BYKA 4RYLA 2WJVA 4IR7A 3NZEA 3FJ1A 5D51S 4J3JA 1IWBB 3UPTA 4B17A 3AU9A 1J1ZA 3MCWA 3L0YA 2WIAA 2QB5A 3E5HA 5EIBD 4K9QA 2C9OA 1BCSB 3IPAA 1NA5A 2FN4A 3M6LA 1Q7BA 1CQJA 2I3AA 2NGRA 4FOOA 1TK3A 4LJKA 2XE6A 1IPEA 1ZR4A 2XOKA 2ZRMA 3GVCA 2AH5A 1XQ6A 4HNRA 1TRHA 4WKNA 3TW6A 2VAPA 4F5ZA 4DLTA 1OI4A 5TEVA 5AJZA 4B3RB 1CRZA 4CJXA 4EG3A 1XCMA 3GZJA 5CIYA 1RZ3A 5EJ4A 3GJ7A 1PR4A 3PT5A 1H4QA 1W49A 5KSPA 5CDTA 1U31A 5JG7A 2XF8A 4PS0A 5U4XA 4DSNA 2YV1A 1K5HA 1XFAA 3WYFA 1XO1A 4ZEXA 3U3RA 3NHYA 3IV9A 5AICA 2JLUA 3AIKA 5FR1A 2A9KA 3SC2B 3K09C 2Q7DA 2D8MA 3ZDFA 1U7ZA 2DSNA 4AP9A 4MKIA 4NKRA 3ZQJA 4QUAA 4US2R 3NWOA 1UK6A 1EVEA 1UQTA 2C0PA 2CXUA 3KKNA 1JSZA 1ZBQA 2AZ4A 1ZM3A 2X41A 3DFMA 2IOQA 4GI1A 4M46A 4ZEWA 5JE8A 4DZRA 2XYQA 3HJAA 3A1EA 1QZ3A 2CXOA 4PRYA 1EK1A 4JI1B 1ISMA 4TLEA 1KK1A 1OX4A 2TYSB 2YZNA 4XI9A 1WUIS 2IHUA 1C9DB 2JI4A 3BSFA 5I9TA 4BFCA 1Z33A 3M9WA 5KTYA 1V41E 3MEQA 1DLJA 1E5LA 2XGGA 3IUPA 3QA9A 4ZVQA 3RVKA 3EVBA 2AG8A 1M2KA 3EYWA 4KPFC 1BRMA 3U3ZA 4JYCA 2R4TA 2BM0A 4PLHA 4Q4HA 1VP9A 3GDOA 2X5XA 4FSHA 3PXUA 1NJ2A 2NYVA 5D00A 2VJMA 2AE1A 3KX2A 4DEVA 5JTTA 4JR0A 4KDEA 2ZBPA 1OXVA 3ZNQA 4N40A 2A9JA 1FTGA 3UAWA 1E9VA 3I28A 4PHFA 5D3MB 4EYSA 4MW5A 1U1GA 2A1TR 4MNTA 5HF8A 5A5EA 4HQLA 3GARA 3ZTWA 2ZI5A 4KRYA 1OLSB 3OZGA 4D02A 1DMSA 2WHPB 1Z0FA 4E7OA 3ABQB 3RVPA 4B9AA 4RS4A 1OLXB 3OY2A 4MW4A 2F1IA 1U8YA 2HRBA 2JCGA 4E3ZA 1CULC 1L7PA 1R5NA 3FDXA 1RWNA 2VYQA 3BF8A 1RWBA 1E3DA 3QTLA 1RQLA 1TQDA 2J9ZB 1GLGA 2Z3WA 4GZMA 5ALTA 1Z26A 2XI4A 3WYGA 5K99A 1J9GA 4I46A 4IRUB 1Y9JA 4FGJA 1IJFA 4WZAA 1USKA 3RFTA 5BNTA 4RTSA 1THZA 3KHSA 4GM0A 1TO6A 2C59A 2XMSA 2ZDGA 2CMHA 1N0VC 2FPIA 1IZYA 3VV2A 4DM7A 3LLCA 4EBBA 2V6GA 1PBNA 1QYCA 3HUEA 3LSYA 3GFGA 4L8FA 2IBSA 2IW1A 2D0DA 5F3RA 1LWNA 4MVYA 4NCJA 4BO0A 4DCVA 4BJHB 1SK9A 4BVGA 2PJRA 2QIPA 3AF5A 3MF4A 1NL3A 3GFQA 2J9GA 3L6DA 5HS4A 1E3MA 5ER6A 4KBYA 3DM5A 4TQ9A 1L4FA 3UT5A 3GJ0A 2HA6A 4JKOA 4WCVA 3VNQA 1OROA 1Z4KA 3Q8WA 3WNBA 2V7EA 4BLWA 5KQMA 4I9HA 5AK6A 3E2MA 3TQQA 1U28A 1SVSA 3AHDA 4E08A 4GT1A 1TQ2A 2ZVDA 1SVUA 2O9JA 3ABIA 3BJRA 2XYGA 5BQOA 4D6XA 2RGBA 3CLVA 3GGSA 3V4LA 3LX8A 4QOIA 2MTBA 4Q39A 2HGZA 1NURA 4NYJR 4D9EA 5KHOC 5K9ZA 2Q3MA 1NMZA 1NI4B 1Z38A 4RM3A 2JFNA 4Y98A 1QFYA 2FSVA 5M04A 3LDGA 2C4KA 3AEQA 1BS2A 1D2CA 2WABA 2H3HA 1KY4A 3BIXA 3WKEA 4HWSA 4V0LA 5CD9A 3IA2A 4PIMA 2ZCJA 2NUPB 1VBNA 4OFWA 2A2ZA 3AB3A 3KR9A 3NTUA 1VYVA 4AP6A 4CLXA 1Y4AE 1JN0A 1QTRA 1YGPA 1E5XA 1BU5A 4DMGA 2HF8A 4JJKA 2FGKA 3KSBC 3KNZA 5EXEA 1NQXA 1QWSA 3I9NA 4FYKA 5AQ1A 4QG3A 4Q05A 5D2CA 3Q11A 4KOAA 1XEXA 3A06A 1YJQA 4IDDA 1U0BB 3ZJUA 5DM0A 1J1IA 1O54A 4TV9A 1NMEA 2KSQA 3GC6A 4URVR 3Q88A 3N2GA 3DZ8A 4NBNA 4L28A 1A2BA 1MLDA 3W4JA 2L2QA 1KPHA 4RCYA 1Z2OX 3ZH9B 5L3QB 3MJVA 1VG1A 3O95A 1YBHA 3MJTA 2FN9A 5AXAA 5A0FA 1TC1A 2V1UA 3F71A 3G9TA 5BN4B 1LJ8A 1IHUA 1UBCA 1G2OA 2GNOA 1JQJC 2QNIA 5B3JA 5AD1A 1PV4A 1E9SA 1M6WA 1TEVA 3BOSA 4JEMA 4C78A 2YJ5A 3HKBA 3TMAA 3ADOA 2J5BA 2CJFA 3PENA 2VJAA 3PLNA 3KHTA 4Z1OA 1SVLA 2UXCB 1NJ6A 1P73A 4JQCA 4UDXX 5TQ2B 4DV7B 2VP6A 3REOA 2P3QA 1F51E 3IB6A 4B87A 5G4LA 4EJMA 5FPKA 2V1XA 1PWHA 1N92A 1AKMA 1TCUA 4LJ9A 1RTKA 4WNIA 5T6BA 1MX3A 3OC6A 2QM3A 1R5BA 4UXIA 3X43A 1ZH0A 1OT5A 1XQ1A 2Q8PA 2HUNA 4IDNA 2GHQA 3I1FA 4M1OA 1VP3A 2DBRA 2RK4A 3LKVA 4I08A 3DMTA 1RYDA 3K32A 3KSUA 4MUMA 2ZIUB 4EO9A 1Y3HA 4F8JA 1P0QA 4KFSA 2BKUA 3CX7A 3D6NB 5B7NA 3F8WA 3U37A 4D4LA 1DJPA 1NRIA 2XUPA 2IUFA 3Q10A 1ZM2A 2FZWA 2GMWA 2W6ID 1E4EB 2C2XA 1TZBA 4XIFA 4G0OA 2Y3IA 2OM2A 3WI7A 2AJDA 5CDHA 4D5EA 4V24A 3KZVA 4COOA 1TEHA 1XMOB 3LT2A 1NMSA 2JH3A 2PMFA 3DOHA 4KXUA 2B4TO 3A6JA 1G9SA 1EUDB 2HV8A 3RYIA 4GWGA 4I3GA 4D8VA 3W1WA 4C7OB 2FOLA 3HHPA 4DQVA 3V9AA 5FLXA 1ZM9A 4TLLB 3P9IA 2C8VA 4MH0R 3H9EO 4R54A 2KLBA 2YDXA 1UR5A 3G0BA 2V6FA 4MQ6A 5I9MA 3T0IA 2WZDA 4KQIA 1H23A 4IO1A 1A7AA 3VKWA 2J1LA 2HXYA 2PKCA 3PR3A