4ARSA

Hafnia alvei phytase apo form
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
411
structure length
407
Chain Sequence
b'TAPAGFQLERVVILSRHGVRAPTKMTQTMRDVTPHQWPEWPVKLGYITPRGEHLISLMGGFYRERFQQQGLLPKDNCPTPDAVYVWADVDQRTRKTGEAFLAGLAPQCDLAIHHQQNTQQADPLFHPVKAGICSMDKSQVHAAVEKQAGTPIETLNQRYQASLALMSSVLDFPKSPYCQQHNCDFSQAMPSRLAINDDGNKVALEGAVGLASTLAEIFLLEHAQGMPKVAWGNIHTEQQWNSLLKLHNAQFDLMSRTPYIAKHNGTPLLQTIAHALGSNITSRPLPDISPDNKILFIAGHDTNIANISGMLGMTWTLPGQPDNTPPGGALVFERWVDNAGKPYVSVNMVYQTLAQLHDQAPLTLQHPAGSVRLNIPGCSDQTPDGYCPLSTFSRLVSHSVEPACQLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTIDINE ACID PHOSPHATASE
molecule tags Hydrolase
source organism Hafnia alvei
publication title Degradation of Phytate by the 6-Phytase from Hafnia Alvei: A Combined Structural and Solution Study.
pubmed doi rcsb
total genus 137
structure length 407
sequence length 411
ec nomenclature ec 3.1.3.26: 4-phytase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arsA01
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 4arsA02
2DWOA 2P2YA 5AJXA 2P78A 3C7TA 3GP3A 2BIFA 4PGMA 1BQ3A 1YFKA 2P9ZA 1QFXA 3K4PA 2P2ZA 3DCYA 3DB1A 1SK9A 2YN0A 5AJVB 1QHFA 5CX4A 5HTKA 1ND5A 1H2EA 3IT3A 2P77A 3EZNA 4HBZA 1XQ9A 2H52A 3D4IA 4QIHA 5AK0A 4ODIA 3FJYA 2QNIA 1C81A 5HR5A 2A6PA 4ARSA 3NFYA 4GPZA 1DKMA 2PA0A 3LNTA 1CVIA 1V7QA 2H4XA 1YJXA 1T8PA 1E58A 2EKBA 4MA4A 5CU7A 1ND6A 2OWEA 3E9DA 3NTLA 2YN2A 4TSRA 1SKAA 2EKZA 4IJ6A 1UJBA 2H4ZA 4PZAA 3GP5A 2HHJA 3PGMA 4EO9A 2EOAA 2H0QA 1H2FA 1QWOA 3BIFA 4D4LA 2P79A 4JOBA 1FBTA 2WNIA 4D4KA 2ENWA 1DKNA 2I1VB 3D6AA 4AROA 1V37A 2GFIA 2RFLA 3FDZB 5PGMA 1DKQA 4JODA 2P6OA 2ENUA 3E9CA 1IHPA 4IJ5A 5AJYA 1DKLA 4E3WA 1BIFA 3FDZA 4EMBA 1RPTA 4ARUA 4FDTA 1TIPA 5AJZA 2HPAA 3OI7A 2P75A 1DKOA 2AXNA 4ARVA 1FZTA 2WNHA 3ZHCA 2HIAA 1NT4A 1SK8A 3QPWA 3IT0A 2WU0A 1C80A 2OWDA 3HJGA 2P6MA 1UJCA 3MBKA 3QPUA 3GW8A 3LG2A 3LL4A 3D8HA 1SKBA 4JOCA 4D4MA 5CDHA 2F90A 4FDUA 3EOZA 1E59A 3QPVA 2P9YA 3F2IA 4PZ9A 2P9FA 3KKKA 2P30A 3IT2A 1DKPA 1RPAA 5AJWA 3IT1A 3E9EA 4GPIB 3MXOA 4D4JA 3O0TA 1EBBA 1BQ4A 1RIIA 1K6MA 3R7AA 2A9JA 2DWPA 2IKQA 3K4QA 3F3KA 1C7ZA
chains in the Genus database with same CATH superfamily
1TPZA 1D9XA 1MT3A 2WE7A 3RUPA 3EODA 2OCPA 3BGDA 3ZE0B 4PTYA 2WIJA 3S3TA 1EP9A 2HJHA 4CKZA 2QAGC 4WJLA 3T7RA 4CT4B 1PGNA 3T7IA 1F2TB 2D4AA 2AJBA 1NVDA 5SYMA 4K6GA 2B6NA 2HX1A 4LYGA 3BBPA 4B4VA 5ALEA 3WDLA 2WAAA 4N0EA 4ZZ0A 5AKIA 2QD1A 2PGAA 2Y1CA 3L8EA 4NK5A 5DW0A 2NU8B 2PBZA 3A37A 1JYSA 2J5RA 2G40A 3ILSA 3LI2A 1SQ0A 4PR0A 3WWYA 2ISSD 2R25B 2D54A 2AZXA 2D7CA 2GJ4A 3GUYA 4M0CA 1NV8A 4EJFA 4QLBA 4OGWA 5CHYA 1N25A 4ID3A 3AERA 3BE6A 3G17A 4R1UA 3UJHA 4HS9A 5JI3E 3NHKA 2C2BA 2Z4RA 3PK0A 3Q7SA 2XUFA 4PXYA 4FJ0A 3W8RA 3DJFA 3E9DA 3QQ5A 4C08A 2WSIA 3R9WA 1ZAKA 1SHJA 1IJFA 1F2UA 1FFDA 1QRAA 1ZL2A 3BH0A 4JC4A 5GTDA 4P86A 3IUMA 3HJFA 3BK7A 4TN1A 5JV5A 2J07A 5HPYB 4FFMA 1V2GA 2F43A 3LC2O 5A7GA 3LQ4A 1ZBDA 4LRSB 4M9SA 2IZ0A 3ZHVA 2B99A 1M10A 2FOIA 2QTCA 3V33A 3C39A 2EW2A 2H7YA 3EFBA 5D3QA 4WGFA 3IX7A 3LWNA 4XGQA 5JCJA 4AMUA 2ZJ3A 2A9VA 4S05A 4QDKA 4R16A 3M3DA 4WZAE 2BBTA 3MCZA 1TFRA 5K8UA 4M46A 2A1UA 3STWA 1GGHA 3R41A 3UANA 1NJ8A 1XK7A 2FWPA 2Z43A 2ZBRA 4HH4A 4WXYB 3WMFA 4XIYA 3SFTA 4YDRA 4UHDA 3BIOA 1GSHA 1JPVA 2OK7A 4R01A 3G2OA 3KUKA 4IGKA 2FSPA 3GLHB 1FJGB 5LP6C 1WQ4A 2WMYA 4ZRDA 1EUDA 1XTJA 3L8CA 3RIMA 3ZC3A 4ER7A 4CF6A 1NLZA 1NVEA 1C1HA 4KQHA 2VC2B 3ZLTA 1QIDA 2UV8A 4ZDWA 1SOVA 3AM1A 1PJ2A 1KYTA 1Z3CA 1KGDA 5G02A 4A27A 6LDHA 3GZJA 5L4SA 2Z3VA 2XUPA 2DH5A 2CNKA 4O4HF 5EKTA 3SBEA 2CLHB 1JXOA 2HRBA 3AQIA 3TI9A 2J9RA 1F8UA 3LG2A 4GP6A 3TBHA 3SR0A 1TC1A 4V0SA 2RK6A 4BVBA 1PUJA 1OBFO 3BERA 3GI1A 1YFJA 2BFEA 4EWLA 2FPGA 5KCMA 1BVUA 4J3JA 1ZUNB 4WXMA 4XEHA 3RS9A 3QXCA 2H57A 1W4ZA 4Q9HA 4DEYA 3NIGB 4QAJA 1SU6A 3ELDA 4WNIA 1EFUA 1ZH2A 3C3WA 3EXFA 2QRNA 5FRDA 1QDEA 2XOXA 4DV1B 2WA2A 1QIEA 3C3DA 3N6VA 4HWSA 3C43A 4IH1A 1X7YA 2VT6A 2VXBA 1NVWQ 2JA1A 4JASB 4RNCA 2OXRA 2QX6A 1DG9A 4PNPA 4URYR 4WKPA 1GILA 3VBCA 4L8YA 2FK8A 3WQRA 4BNKA 5SYNA 1BU8A 3B1JA 3GAAA 2B0CA 2C77A 2XMQA 3BMCA 4KR3A 2QZ9A 4FUTA 4QUKA 4X3OA 1RAAA 1PR3A 1NI4A 2P9ZA 1CZOA 3DLPX 1SUFA 4RVGA 1TW2A 2I4IA 5BVGA 3TTXA 4N54A 3IIEA 1ST2A 1LK7A 3CEJA 3FFWA 2X0DA 1KK0A 1VECA 4EMTA 1QPGA 5LMCA 2G82A 1JRLA 1XN1A 3E48A 5KNCH 2H17A 1KOFA 3JQAA 3V8RA 1W87A 3IDFA 4MRAA 2TMKA 4FUQA 4MVCA 4FFNA 3PXBA 4LYFA 5TT0A 2FDCA 1JHRA 3I76A 4HTFB 4CM1A 1UK7A 4GE0A 1SCAA 4RMHA 3RC2A 3P96A 3UFXA 5H9VA 1SHLA 4FEYA 3RNLA 1FDWA 1UPFA 5KIAA 2OCGA 1MRNA 1IVSA 3T3HA 6NULA 4L0MA 4QDTA 1PR9A 1UFKA 4Y2HA 4GKJB 1O87A 3IAM6 2HWXA 4M8IA 1P31A 2AOTB 2QL7A 2ZIZA 4NU5A 4REMA 3SC2A 4BRZA 3FBGA 3TI7A 3G0HA 1EWQA 5C37A 5FJJA 1TRKA 1NP3A 3QFRA 4ZQHA 3M6MD 2WD8A 4MUXA 4RL4A 4LCJA 4GX1A 1OLSA 1K7SN 5D7BA 2OFXA 2GM9A 3JYQA 1ZD2P 2R751 4R81A 1EP3B 2AQIA 1TKRA 3OWXA 3MWEA 1BROA 5M5BA 4O2BF 2E4YA 4Y2TA 5BW6B 5J59A 421PA 4C7KA 1SBNE 1I4TD 4UCXA 4ENUA 2DUMA 3L8MA 1K7EB 2R6DA 4LWQA 5CFMA 3TF5A 3K8QA 1YHYA 2GQ0A 3RVJA 4WIAA 4IR7A 1ULHA 2VP6A 3LPCA 4IEEA 5HIMA 5CM2Z 3TSYA 2PXCA 5A71A 3WGIA 3EAQA 2IPLA 2VP5A 2FW8A 4DRYA 2ZULA 4EABA 5HHTA 3GLGB 4OFZA 1Y8QB 1OKKD 2XYVA 1W19A 1NHWA 2JLYA 1Q3KA 5GJCA 6REQA 4BLQA 3TOXA 5F9HA 1SZPA 4QXPA 1X6VA 1AQUA 2VSNA 1SRQA 1Z12A 1VL2A 2YR0A 3IURA 1LV7A 2IL1A 1ORHA 2OEPA 1KVRA 1T10A 3FETA 3UN1A 5F98A 3GAFA 1P1BA 4N6GA 3K92A 4KW7A 2QLTA 2XTZA 3GL9A 1F9AA 3UPDA 4YRRA 3C3CA 1WCYA 5C1BA 1QM5A 3H97A 2G1UA 2PGJA 3FUUA 3GRFA 2WPDD 1OWNA 4O1MA 2IUYA 4DMMA 4ZICA 5CEFA 3DEAA 2VT7A 3VYVA 1EDEA 5L3QB 2GZSA 3M89A 2AL7A 2F67A 1U90A 3DXFA 1MIOB 2OESA 1WB9A 1DKPA 1K8RA 2GK7A 1NWCA 3KUCA 1X7WB 2P5TB 3Q0EA 4JLSA 5EXTA 3OCCA 3TEJA 1I2ZA 4K1LA 3H2KA 2P8SA 1O95C 3UAGA 1BVRA 1NN5A 1E1LA 1IK6A 3O8QA 4GOOD 3QE9Y 4PRZA 1HMPA 1RJEA 2W2KB 3GPBA 1KDRA 3VVCA 4H7EA 1ENYA 3T3DA 3DOCA 5C8YB 1I6KA 3U4CA 2HU2A 1I01A 4MS1B 4UEQA 5F5NA 1CUHA 1QS0A 1EFLA 2G0NA 2ONKA 1NX9A 3G5MA 4WA7A 1YR2A 3RVSA 3FTPA 4UEOA 2EL7A 1D6MA 2GH1A 3AU9A 5KJ6A 1QYDA 1ZYUA 2GPBA 1H9BA 4M8NE 4QSMA 3DR3A 4TTPA 3ZNOA 2QTGA 4BTLA 4C76A 4GMGA 4DDVA 3OC0A 3S2FA 3MWKA 3QKIA 3E81A 1YA8A 2C3YA 3NV7A 3TNFA 3JD0A 4D79A 1UMBB 3KLBA 1O6ZA 3Q3HA 2IE8A 3OZAA 2EKDA 1MRZA 3ROXA 3V1MA 5AI0A 3ZGOA 4A23A 5LP1A 3DTTA 2GD1O 3RROA 2R8XA 4ETWA 1HNXB 4JGBA 4RS3A 3WGHA 3ZJYA 3I6BA 1NI5A 1PJBA 3CF2A 5EZYB 1PJ4A 3VJMA 4FFSA 5J2TF 3U7JA 4EEKA 3JVUA 4IDHA 5L3VA 1FRVA 4JROA 1Y4SA 3THXB 3BRWA 1WTAA 1UINA 2CBXA 2J0UB 3PLNA 4RM2A 2V7PA 4OQQA 2XWJI 4AECA 2IVFA 1VFPA 1E1DA 3C3BA 4HDAA 1L8OA 4RFVA 1L7AA 2WM3A 4UAGA 1I6LA 3EGDB 3U26A 3D7KA 4D8UA 2D74A 1FLVA 3WGTA 4TM8A 4YUVA 2FEXA 3ZU6A 3FIJA 2FPSA 3JZDA 4MK4A 5DHPA 4EG0A 5I4KA 1J0DA 3HXOA 1DX6A 1G2PA 1NL3A 2B8TA 2V7UA 4GLLA 4KIUA 3U31A 1F4VA 2Q0HA 4AIIA 3FOEC 1ULBA 2AZMA 4PRLA 4LRXA 4AJIA 1FBTA 1KHTA 4K9DA 1DEXA 4PS1A 3KXIA 3SF8A 3DMTA 3IKMB 3JAKB 1G0NA 5AOVA 5KC8A 2C4VA 2PKEA 5DM70 2H4HA 1BFUA 1T9BA 2X1MA 2X0IA 3DLIA 3KDAA 4L78A 4UUOA 5JBNA 2ZVJA 4B45A 1WZUA 3BEDA 3GGDA 1JKJB 4KITB 3SS7X 4TTIA 3A1CA 4DV0B 4INAA 3DG9A 1DIBA 1DQZA 5CFPA 4MPDA 3KJZA 5G1PA 4WOKA 2Q46A 1GKLA 1Q0ZA 5FFNA 4LI3X 3DB2A 1XZIA 2C2YA 4DJJA 1NY5A 1KSFX 4BFZA 2B4RO 1CR0A 2OV6A 4RESA 2WJ4A 1EP2B 3CH7A 2JFYA 3HJNA 3E4CA 2RHLA 2N0SA 2ESRA 3DM9B 3ESRA 4E22A 5A4KA 4Q6WA 4CM3A 4Q4HB 1ODCA 5HKBA 1F2DA 3P8ZA 5FPKA 3MD0A 1Y3CE 1RXYA 2AG0A 2XGMA 4Y1RA 1ITZA 4I1PA 2I5PO 3UWOA 3ZXSA 2FFRA 3VDMA 3MAAC 1U94A 2X0EA 3AIOA 1AHHA 1JAXA 1G8AA 2POCA 5BMVF 1ID8A 2EL9A 5I5EA 1E5XA 3EDQA 2XJ4A 2BGGA 4EY5A 2J85A 3FCOA 3NTVA 1XQYA 2HEGA 2Z4SA 4G1VA 3CIFA 3N8NA 3GJ0A 3FROA 3BYZA 4ROSA 4U0JA 4AAYA 3B60A 2GA9A 3LLUA 3OX1A 2IWRA 3OZTA 8GPBA 5D51S 3D2AA 4X44A 4TUYB 3PGKA 3VYSB 4I0WB 3FCXA 4Z8YA 1QGUB 1D0SA 3BTVA 3JZIA 1R8XA 5K0EA 3NXSA 4WLFA 1LBEA 1E2MA 5FTMA 4CQMB 2W6JD 2WTEA 2RHWA 2IELA 4D25A 1JNXX 5E1BA 5IVIA 3B3FA 2FMFA 2XZTA 2AJ8A 3PHCA 1UWCA 4JFRA 4QUDA 5I7SA 1BEEA 1VQ1A 3A32A 3EBLA 3HKBB 4Z0TA 3TZEA 1HURA 5HBRA 5KOIA 2Q0XA 1OGIA 1N3IA 1OWPA 3CX8A 3LCCA 4BB5A 1V71A 4B3IA 4O5AA 3LOUA 2W90A 4HN2A 1A9OA 3ANTA 3W2GA 4ZYXA 1LI4A 2GUGA 4BN0A 1VJ5A 2JVIA 4URWR 4HZUA 4CL0A 1DBIA 1NDQA 3O2JA 3EISA 1XCOA 3IOCA 4RGQA 1Y6JA 1TVKB 2AD1A 1T9GR 2O7NA 1U1FA 1D0IA 2HMTA 1QS0B 1T2EA 4EW1A 1J33A 4J2OA 3Q85A 1AKWA 3FDFA 3W79A 4GICA 2FRXA 2HXSA 1O96A 1G9SA 1IFXA 2B3TA 2F1KA 4JMPA 4TTTS 1AHIA 4D57A 1KYWA 4Q4JB 1DMSA 3CZMA 3I42A 2VWGA 2AJDA 2EWWA 1DAPA 4RTJA 1TUBA 2PZMA 2CXOA 2WFZA 3N9IA 4FOPA 4R9RA 3AESB 4M9RA 1YJBA 4ZJZA 2GJ8A 1MQSA 5I6DA 1NJ6A 3R2JA 1NRIA 2OECA 4IIJA 4LHZA 4ND2A 4NMHA 5HS6A 5BMVA 4BNHA 3R77A 3FHJA 2I76A 2O07A 4TQ9A 2EFDB 3DH0A 1WZ2A 3V8VA 1OB2A 4E1VA 3V4FA 1SCUA 3OQIB 3G8DA 1L5HB 4HYEA 1IJKA 3FUTA 2IHUA 3VTAA 1REQA 3GU3A 4M1OA 1NHGA 4MIOA 4DZRA 4F1JA 2BN4A 2QRKA 2IPNA 6CHYA 2V6IA 4EYOA 1T0JB 4R1OA 3SXUA 2QR5A 2FWJA 3E9CA 2FGKA 4TYPA 4X61A 2RJOA 2OLKA 4XIGS 5HGJA 3DMGA 2UZ1B 2EQBA 2XXJA 3PITA 4JOSA 4LRTB 2OSBA 3STHA 3M2PA 3HVIA 4H15A 5CT9A 5AI8A 5ESWA 4UHFA 4XPZA 1JEEA 1RRMA 3MMXA 3H6GA 4X8MA 1OVGA 1N77A 3LY5A 2GZDA 2DKNA 1MABB 4U2BA 3RC7A 4DWWA 1KAQA 1JKJA 1XFDA 2OCKA 1MFZA 2UZ3A 1P0QA 4INPA 3STUA 1V45E 2ZJ1A 3C6QA 4LHSA 4O4JA 4HZGA 4BO3A 3LVQE 3GEBA 2CDAA 2QD4A 3GVHA 5IAEA 3ZWCA 1KFJB 1QO9A 1LF5A 3GDFA 3KCNA 2GLUA 2QRVB 5DM0A 5LLSA 1WDMA 5F4BA 4DZTA 1RLUA 4YAUA 2IDKA 3K1ZA 4IIXA 3GLIB 2G5GX 2ZJ0A 4O4IA 3TPFA 2OXCA 1PNVA 1Q17A 2VP4A 3FDXA 4G5QA 1WW3A 2IU6A 2WJIA 4O4IF 4MNTA 3SICE 1VL6A 2BKEA 2WKSA 4G01B 4I81A 5CURA 4DIDA 2WMOB 5CB4B 1NF2A 2P9FA 4JDPA 3L1HA 3KUXA 3OICA 5CHEA 2JHCA 3A4NA 4ND8A 2QX7A 3G2HA 3NRBA 1U9ZA 1X1TA 1ECGA 1NM5A 2HO4A 4PAOA 4C88A 1RSZA 4WN9B 1J42A 4BGUA 4CCYB 3QU5A 4A3SA 1UFQA 3L7AA 3RG8A 3ZVLA 1B73A 1OOEA 4Q03A 1IXYA 2C7OA 4QFMA 5ED4A 1AGRA 2X0KA 4IH4A 4UDNA 1DRUA 1XOIA 2DQ4A 4I50B 3NDJA 5AOAA 4L72A 4EA8A 1RQXA 3RBVA 5JZOA 1RBQA 3F9RA 4JU9A 3S1AB 3HO8A 5ALNA 2GI4A 4HKTA 4BVFA 1EX1A 4AZ0B 2CB0A 1FMLA 5JSZB 3GBPA 4P81A 1IN1A 5CTJA 5CVDA 1UZUA 4J90A 5AM1A 3PICA 4FXOA 4YAWA 1QCCA 1XFAA 2EDCA 3VJRA 4DXHA 1RTKA 2CDCA 4G56A 1R8JA 3HO6A 4HFNA 3OJLA 4UUAA 3PNKA 1MQAA 1ZLYA 3DBHB 2WG1A 4IHJA 5BUSA 2QUKA 4U7FA 5DYYA 2HQSA 2NZ2A 4QOJA 2R8OA 2I3BA 3I9JA 1KI7A 2HLDD 2I6QA 1JG2A 1KFBB 3PT5A 2O2YA 4GM1A 4MCHA 4MUGA 1SUAA 1BN7A 2AZ4A 4Q15A 2FUG6 2XF8A 1DARA 2H2AA 2WB4A 5KU7A 4LFAB 3ZIDA 3DVQX 4KQEA 3KHKA 2YNMA 1SBTA 1HDXA 2AOVA 5D6NA 3VR5A 4BNJA 2R47A 2R00A 4JI4B 4ZO4A 1P4JA 2XZDA 2OYCA 4WK4B 2RH8A 1EIZA 1MG5A 2XZPA 4K1XA 2ZUCA 2X2EA 4Q39A 3ZWOA 4BX0A 1ULTA 4YT4A 1I8TA 1DNPA 3GP8A 2F62A 5EIEA 4IOMA 5K8LA 5WRFA 5AW0A 2JI6A 1GUZA 3EQ7A 4MRVA 1PN3A 4ZVPA 4JWKA 3I0MA 1NRWA 3CLTD 3KJQA 4KPUA 1ONOA 2Q7DA 2AFIE 5JLJA 1L9KA 2HRDA 1M1YE 2E87A 1OUMA 3I2YX 4HFMA 3UB2A 5CA1B 4M55A 1HZJA 2GEBA 3UMVA 1KA9H 5B5SA 2J8ZA 1VC2A 4ITUA 1A04A 3DHNA 2OCLA 3GNQA 3SVTA 3EFEA 3ZN2A 4QDJA 1IHPA 3KT6A 4LZNA 4ARZA 1HSZA 2CLFB 1UM9B 2PSSA 5C7OO 3V97A 5IWAB 1MW8X 5E3IA 2AK3A 3PFKA 1U8ZA 2VFAA 3AHCA 2WLSA 3O2SB 3OX3A 4IOJA 4EJMA 3LPMA 5LBIA 1FNSA 2E1PA 1HKHA 3IE0A 1OYVA 1HF3A 2BT4A 2GAFA 2HA5A 3NC1C 4MVJE 2CHVA 4YCMA 4YRPA 4MUIA 2XPCA 2UYYA 3IQIX 2F1JA 3FKSD 3QVTA 4YECA 5K51A 1J2JA 1QZUA 5JAZA 1YDEA 5EHQA 4UE2A 1XV5A 3WGLA 4A26A 4CF5A 2AMVA 1SKYB 3BDAA 1C2YA 3A04A 1Y4AE 3FXAA 3WYAA 2H4YA 4RH0A 4OQ4A 3WLHA 6Q21A 1QLWA 1KI2A 1S1CA 3DCIA 4GGOA 5I9BA 1A8UA 2EFCB 1ESMA 4P8RA 3SIWA 1SU4A 1TEXA 4PZ9A 1KO1A 4JJGA 4PSKA 3V4OA 3A9WA 3WLNA 1AO3A 2JAOA 2RGEA 4Q3DA 1V7CA 2HBYA 5JQGF 1E7YA 3JQQA 3KQSA 3NAMA 4I5IA 4XYMA 4GPIB 2PBLA 4CDNA 4JI3B 3SKYA 3USCS 1EFRA 2R6ZA 3UT0A 1ZRNA 2DHRA 1HC7A 2D6FA 221PA 2X0NA 3K5WA 1KR5A 3DMNA 2IEZA 4US2R 1B1CA 2BELA 3NUGA 3PJFA 3IQXA 3LLVA 3B20A 3BL6A 4IXTA 4BVKA 4IRMA 4J6EA 3CW8X 4ASUA 1VPWA 2IHJA 4L50A 4WE3A 1Y34E 3RHZA 2JAWA 2E4AA 2XUQA 2I65A 3D43A 2D1SA 1LUAA 2O0JA 2W71A 2X6QA 4C04A 2ZFUA 4UOEA 2Y1LA 3ELWA 3EWSA 2VAXA 3QV2A 4IFEA 4LOKA 4P58A 4Z4HA 3WOVA 1V9SA 5C8ZA 1DEAA 1E1YA 3MJRA 2PUTA 4HUJA 5CDTA 4BP9A 4HAIA 1NPYA 4GQBA 3O84A 2XOEA 3GHHA 4TMTA 1GGKA 4IO0A 1PNOA 1IZYA 1BU5A 1P91A 1U2QA 4OXKA 4QVGA 5EQTA 2HF7A 1H0KA 5KOJB 1JX6A 5DNCA 3ZH9B 1KK1A 1P9NA 3IO3A 2PFKA 4EUKA 1W5TA 4G89A 1DZIA 5EOVA 2OWEA 5IN5A 1QF9A 1L5KA 4MJ3A 2IGTA 2Z3WA 4XUGB 1BW9B 2GF9A 1ULAA 5D5HA 1O95D 2ZI3A 3PR2B 3KQMA 1RQLA 1KH2A 1ZIOA 2OHFA 2ZJBA 1HE3A 1TCCA 1LPMA 2X8AA 4CMAA 1P5HA 3H3XA 5FYDA 1CUAA 2G1KA 3OZWA 4MWTA 4W99A 4YP5A 1LC3A 2O2EA 4QDZA 1SXJB 1X1RA 4L4SA 4X20B 5ILOA 1EAMA 4DUYB 1CEQA 4OK6A 2ZAYA 1L3CA 3TQIA 1JTEA 2C8KA 2BMFA 2DHEA 3RFFA 5JNTA 1Q16A 3NIDB 2H4FA 5JSUA 3SIRA 1QYVA 1L4UA 1GTMA 5DTEA 5JLAA 3T1QA 2YV5A 3WIVA 1J97A 4BIMA 4X9XA 4BQSA 1N2GA 2NTVA 1UANA 3PZRA 4DABA 3CM0A 3WGUA 3C7AA 2D0OB 1I2MA 1Y7PA 2K4MA 4KL8S 2I2FA 1IEVA 3I04M 2WFLA 1B8OA 1BMDA 2Q9AA 1ZKDA 1Z2DA 3L7YA 1D5WA 1ILWA 1OWOA 2CDBA 4MR9A 3V7FA 4GECA 4NG4A 1KY3A 3R7DA 4CFSA 4KZKA 4D5GA 5DSTA 3HE3A 1J0EA 4EKDA 1SQ5A 5AW2A 3NEYA 1JW9B 1ZJ6A 2R7AA 3P19A 4FOOA 4D42A 2ZPAA 1UAGA 1WKCA 2N47A 3IEVA 2OP1A 3VMMA 1N2CE 2NSLA 3FY4A 3G5AA 3CVUA 3BA6A 2G9NA 4KQJA 2A2ZA 2J4DA 3D0OA 3EGDA 1QPZA 2QTFA 4AXXA 4B6FA 2NYRA 1M5UA 4DMGA 3QLUC 2XA2A 2GEDA 4UCFA 1YZUA 4DIFA 3BCRA 4Z4QA 1P77A 2FPLA 4XSGA 1YQ9A 4BWGA 1OIVA 3OLCX 1Z3IX 4JX9A 1JKIA 5I4IA 2NVUA 3DAOA 4MUEA 1CQJA 1T5OA 1GM5A 4E5NA 4H7IA 1BKDR 1I80A 3N3AC 1JFFB 3OJEA 1JSRA 1Y5IA 4E08A 4HQLA 5AQ1A 3KPJA 1IB0A 3V6LA 3M81A 4PQEA 4BZXA 4KWCA 1TYZA 1CHNA 2ICAA 1SQGA 2RIPA 3O4JA 3K9CA 3OFJA 1L9XA 2E4UA 2WTBA 4RORA 4YC7A 4D02A 1KARA 3RLIA 3RRFA 5K01A 3KKMA 3GPIA 4U2FA 5EMMA 2H4JA 1Z6TA 3S1SA 2GZ2A 2JAQA 3VKUA 1NW3A 4ZO6A 3C41J 1SVIA 4O02B 3RS3A 2YWEA 3KAKA 1UJ6A 3TLJA 4QLOA 1EXWA 1OZAA 5TVGA 3A1TA 4OI0A 2PDAA 4BB0A 4A6XA 4Q4AB 1G8GA 5IAOA 2FQYA 4DLKA 3JATB 2WI8A 1WEKA 5KYWA 5A4JA 1TADA 1COWD 4R7TA 5HE9A 2IS4A 4MEBA 1L6IA 4JL5A 4HOYA 4I1SA 3I05A 4KVFA 4Q3LA 4DC0A 4O4HA 5CA1F 3NI2A 3Q6IA 4LJ6A 3V9AA 4HD8A 3ZY2A 3ICWA 5JYCA 1C0EA 4G8JA 4TQGA 1JIJA 3IQWA 1N8TA 4Q19A 1U9JA 3GQBB 1LH0A 4CE6A 3D31A 1Y9JA 4CTJA 3NAZA 2R68A 5BO5A 1JHQA 3BIXA 3CC8A 4FD3A 2Y92A 2J3JA 3EW7A 2XKKA 2VJAA 3ZY6A 3QEOA 2M6RA 1G9XA 4XJVA 1HKUA 3T3PB 5LYJB 4FT2A 2XB6A 3BTUA 3EIXA 4HAWA 4C4PA 1ZR4A 1XZBA 1PV2A 4UTZA 3ADBA 3KQNA 1OI2A 1KL7A 4K9KA 2J3DA 2OBYA 3COZA 4LMRA 3UOWA 4A03A 1EJ6A 2H59A 2H85A 5H59A 4BFTA 4CL2A 1QV7A 1Z5ZA 3HRIA 4RLFA 1QU3A 2YV4A 4RF3A 4WXPA 5GINE 1W25A 3TVTA 4OLBA 2DMRA 1YUBA 1TO6A 5DO9A 3AHGA 1O54A 3LUCA 1LTQA 1AK2A 4JQSA 4RJJA 4D8YA 1B26A 3BAFA 3H8JA 4R2XA 3ZWWA 5B7GA 3O91A 1BFKA 1G17A 3RC1A 3HM9A 1SC9A 3CPEA 4UHHA 4NBKA 4X20A 3ZV6A 2WEKA 4YUZA 1MX9A 2K2QB 1IK4A 2NUPA 4UJ3A 4F1KA 2VH5R 3UK6A 1CDOA 3UG7A 2HIGA 3KDSE 3Q11A 2NOAA 1FQKA 2NW6A 1Q2XA 1D4ZA 2NACA 3A14A 5A7HA 2CC2A 3T9DA 4E51A 5BQXA 3E8SA 3AZQA 4NS4A 4AJNA 1MPTA 2DQKA 1GTSA 4QOFA 4UPVA 4M76B 4Y2QA 3WGZA 2AA3A 3F3YA 3K53A 3RUEA 3V3KA 1U0JA 1S02A 2ZIUB 1RAFA 3IEPA 5BXQC 4JJZA 1R9GA 2V55B 3MUOA 1DFHA 3D6NB 3QW2A 2QYTA 2JLUA 1LNSA 4AF6A 1C1DB 3AB3A 4NJOA 3USZA 2CMHA 4HDSB 5ALQA 2NPOA 4B2YA 2OGTA 4RA6B 5JDIC 3Q3JB 1OZ0A 1PEKE 1P2GA 2I2XB 2JGLA 3ETCA 2CHFA 2YVQA 2HRZA 3MJEA 4RV5A 1VMKA 4YBZA 2PX0A 3RAJA 2QG4A 4S1TA 4LMBA 3EYAA 3IT2A 3RYTC 1U3TA 3AVQA 2IDZA 3DC7A 3EFHA 3R3ZA 3BGVA 1IY1A 5F33A 5LZ2A 3M3PA 3UGKA 3K0BA 2Q2WA 5TGZA 3BORA 4MDFA 2ZWIA 2J45A 4M89A 4MQ6A 3KQOA 4PIVA 3F90A 4EI9A 3GOHA 3KR9A 2L17A 2R6R1 2J08A 5DDIP 4JV5B 1CX9B 1V5GA 2BFPA 3ASUA 3F9IA 1EESA 2Y6UA 5EJ2A 1DRVA 1EEHA 1H05A 3AKCA 1C3OA 2FWBA 3EPRA 3HEAA 1H3FA 3GJ3A 4OYRA 3OMWA 1WHSB 4G9EA 3PDUA 3CVWA 2A5GA 1BE8A 2FKNA 1UIRA 2WHXA 3DP9A 4Q6BA 5T64A 1MDBA 5E6SB 4H6VA 2MWMA 1CUBA 4MVJG 5F4ZA 4PW0A 3GAMA 2D2FA 3F1LA 4OY3A 3MJFA 1ND5A 4N0PA 2XX3A 1GVNB 1E7WA 1XTTA 2HF9A 4LC1A 4Q82A 2X40A 5FL3A 2UAGA 4O4JB 4XD2A 5REQA 1UK6A 2GTPA 1YRAA 1CJUC 1DIGA 3HK2A 5K3FB 1JILA 1JIUA 1O0BA 2EAUA 1E2LA 2QLJA 1FFEA 3DPIA 1UMDB 2P0EA 3B1XA 2I6SA 2NIPA 1CBUA 1M0WA 2PFGA 5IG2A 4LMAA 2B8NA 2HYDA 3MOGA 3NBFA 1JHAA 2VBCA 4PCUA 1HDCA 4QUAA 2ADFA 1GDHA 3ZI0A 4YRNA 3CVXA 3RAFC 4LUCA 4O6VA 1JHPA 1W1UA 1DIHA 1NXWA 3EGOA 1EFPA 1MJHA 3R5SA 2X8LA 4E07A 2C2MA 1L5OA 4BP3A 4YYZA 4Y6PA 4AZSA 3N6RA 1RYEA 2GPJA 1AQLA 3KZOA 4TTJA 3CVYA 1BE0A 5ELLA 5G3YA 4D4LA 2BHRA 3HBFA 4DSTA 5FH9A 4HPJB 2G5PA 1KYVA 4OAOA 4XTCS 1G3IA 2R66A 1VMEA 1SGWA 2PBFA 4WNAA 4JSTA 1BSVA 2DY0A 4KOEC 2P65A 4I3FA 3UHAA 1JDZA 2BLLA 4Z3DA 3UKJA 1ZMRA 3KJEA 4JT2A 1J21A 1RM3A 3UBMA 1FTSA 2IXAA 4ACAA 2YZ2A 4XVHA 3VHRA 1E5LA 3CMMA 3VR3D 1OFIA 4EKIA 1K92A 2XB9A 4HEQA 4NL4H 5F73A 2PGXA 3LV8A 3FUCA 3MMPA 3ZK7A 4MUYA 3WL3A 1H2HA 3P2YA 3F47A 5BRJA 2HFKA 2Z98A 5DF1A 2A4KA 4JBNA 2A9FA 5DWVA 1DTWA 2YYYA 3MTBA 4Q3CA 3CQ9A 4HUTA 5KO2A 2ZE8A 3EG9B 1G1MA 2IE0A 1ZCZA 3HBMA 5AQEA 1L4GA 1Q50A 3QLEA 2HJWA 1KDVA 3G2LA 1SXGA 3B7WA 2JI7A 2P2NA 3U09A 3ZY4A 3OJWA 1PFKA 2EQAA 1FTGA 5BNFA 2Y0CA 1U8EA 1KXJA 4RMJA 1A7AA 2FSUA 4O0MA 1E2UA 1QQ5A 3CZPA 5C8YA 3RB8A 5HVNA 5EIOA 4P84A 5L9AA 4DWVA 1ZQ9A 2ACVA 1C9KA 2QZ4A 2GNOA 2QUBA 2GEVA 2JCYA 2XA1A 3AV3A 5FEMA 3HP7A 5L3SB 3U13A 1V3VA 2F2TA 1LD3A 1UK9A 1ZW6A 2ERCA 3OPNA 4HB3A 3KKKA 3EXAA 1U5BB 4W63A 2DBZA 4OUDB 2P30A 4GI5A 3X1XA 3HJBA 3A26A 2WIKA 3TDKA 2A14A 3NM4A 3VZBA 3U56A 3SIXA 3Q1KA 1AX9A 3JW8A 3ROKA 3EA0A 4PNZA 1C7QA 2JBAB 2E2WA 2IHBA 1LJLA 1WVGA 1U6IA 1GZSA 2Z0MA 3UAZA 3VKVA 3UICA 2JK0A 1TAGA 4HNSA 1NC1A 2XGSA 3U9SA 1ZEJA 2IK8A 3GVCA 4EDFA 1B8NA 1RZ3A 3AY3A 4TPKA 4BNDA 3ITEA 1L8AA 1A3CA 1I9GA 2XVAA 1UDRA 2AC4A 3AEQA 4J1TA 4R0NA 4G37A 3ROEA 5FUQA 3IVMA 4A2CA 1B15A 4GE3A 1HG1A 4QUBA 2ZZNA 1JR6A 3RF6A 1OILA 4WCFA 1AA9A 1GNVA 2KMLA 2XGOA 4W5JA 1N6IA 3VV3A 1C1XA 4NFYA 5SZKB 3OFKA 4F5ZA 4LNUB 1GL3A 4LHEA 1N0IA 4FXPA 4UAUA 3T1HB 1U0OC 2HRQA 1AKTA 2W4QA 4MUJA 3FMOB 3IA2A 3LQ2A 2XR1A 3QJYA 4LV8B 1ADCA 4FYJA 4TWAA 4XKJA 3D0KA 2PXAA 4BU0A 3KR2A 4G5YA 1JAZA 4PZPA 4TV8F 4DY6A 4O4LA 3SX0A 1QHSA 2PMWB 2VO1A 2ZWOA 1JWAB 4EZEA 3LY8A 1XF1A 2OGZA 4AUEA 2BR4A 5CB0A 5HK9A 1WD7A 1WO8A 2G71A 3Q3GE 1IG3A 4Y2VA 2PLRA 1DCTA 1MB3A 2FZVA 4X65B 1P45A 3CUUA 4UZSA 3IELA 2NYAA 4KYIB 4YRZA 2IFTA 1R16A 2AYZA 4U7HA 1JG6A 4HAOA 3RKRA 1PWXA 4PPGA 1G5IA 1N6HA 1ZISA 3BCHA 4FJ1A 4KI7A 4MRNA 1DGQA 5C5DA 3MRSA 4HNRA 5JY1A 3F74A 1A1SA 4L5CA 5F2KA 2C0CA 1M5RA 3RS2A 5HF8A 5BQOA 3VPFA 1U9CA 3CLUD 3VYRB 4L8LA 2W2TA 2C8JA 4KGVA 3VPAA 3WS7A 5E1MA 1GA6A 4AUKA 4EPTA 2JDIA 2QK4A 2QM3A 3Q3VA 5HMLA 4AMYA 4Z4GA 3W8EA 3RSFA 1WCV1 1NASA 4I8DA 3N0VA 2AQ8A 1XTPA 1YJAA 2YWFA 3BFKA 4MCIA 4WAUA 5HE8A 3ANYB 3CVJA 2NU9B 1I6WA 4XQ0A 4KH1A 5BOSA 1VIDA 3RWOA 5A0VA 1YKSA 3K9WA 1SVNA 1N2SA 2MR6A 3DPSA 9ABPA 1EBUA 3AEKB 1RKBA 4LNHA 2ZJAA 3FKJA 2O3UA 1IBLB 3EIHA 3OM9A 1M2VA 4M98A 5BQPA 3KALA 2VL7A 2Y1KA 4IX9A 4V24A 1P8AA 3NYQA 2X22A 1XJ0A 2PRJA 4Y6LA 3GIWA 4EG4A 3RTBA 3JQ9A 2IP4A 5TF4A 2WV7A 3LMKA 4QBTA 3GFVA 4TWBA 4CHTA 1HZZC 1M2WA 4X24A 4YEDA 4CQLB 4BMPB 3LL7A 4O3MA 3HWWA 1Z36A 1JI3A 4OMUA 4U6SA 1KJJA 4QTYA 1JHVA 2C9DA 4U63A 2NO9A 1EJ2A 1JEDA 3GH3A 2JAUA 4QTUB 4RH3A 1W47A 2VRWA 1EFCA 4XB6B 5J4VA 2RARA 5FL7A 5ICMA 2KE5A 2P5YA 3W5DA 3BFJA 5BVHB 2G4CA 1KERA 4Z86A 2XDAA 1J9GA 1WSDA 3B6EA 1PS9A 4JBLA 3BXPA 4D56A 5IJAA 1ZCBA 4GM4A 3Q7TA 1ESDA 2ZSJA 3L2OB 2YJNA 4KQ1A 2FHPA 4WJKB 3BJRA 4GSKA 3TJMA 2OPBA 3DFIA 1BOOA 2M32A 3QNWA 1CUJA 1QX3A 2CFTA 1E9SA 4OHFA 2ZREA 3DWIA 4AJKA 2F9MA 3GA5A 4G97A 1U5BA 1JKMA 4N18A 5A5EA 3E0QA 3M6UA 4MIYA 5EVJA 5K0JA 2IYNA 4HX9A 2PXXA 1U2SA 4KAJA 1J06A 1K75A 3PUXA 4C0LA 1NYRA 2ZBGA 1VMAA 3MTJA 3DGFC 5CNKA 5EWLA 4LPSA 3RVLA 3PE6A 3OM1A 3T99A 1B16A 3KDPA 3HL0A 1RAGA 4DYHA 3B9PA 2JATA 2QV7A 2V6JA 3BVPA 3PQ8A 4JEUA 3GJQA 3H5IA 4HDCA 2FSVC 5DCYA 2V7WA 2FCAA 3SP1A 3T6KA 4GDMA 1NTRA 1VRWA 2CLLB 5JPDA 1E3WB 2O9JA 3O4IA 1NW7A 3L1VA 4K26A 4RVUA 5BMVB 1T24A 2H3EA 4G0YA 1J8DA 1EPUA 1MLDA 4PGFA 3NUZA 3X2FA 2WKPA 2WZBA 1H2RS 3LUBA 2OMEA 3CV3A 1Y6QA 4EHNA 2ILTA 1HXHA 3CYFA 5T7BA 1TF2A 2D7JA 4YJKA 1HH4A 1SKYE 2FN9A 1C1XB 4RQUA 3WYFA 1UOQA 4MUHA 5HILA 3QVGB 4Q1BA 3I8XA 3GARA 4JLKA 3I9V6 4PPYA 1RRKA 5TNXA 4C3ZA 3AP2A 3NNSA 1PFGA 1Y5MA 3DCNA 1AV7A 4AMBA 4DXAA 1F7UA 1SG9A 2DPHA 2X15A 1RHKA 3PNLA 2P4HX 2TMYA 4EQ6A 1BHO1 1D9ZA 1YR9A 5FUXA 5JCOA 1KQNA 2O8BA 5AVXA 4PO3X 4CV3A 2QU7A 3FOBA 1YMVA 2AOTA 4E5KA 1BC5A 1V47A 3UBTA 1SKQA 2I99A 4MWEA 4BVHA 1U28A 3G5TA 4Q7KA 4IMIB 2VT3A 3ITKA 1IE3A 4WEOA 1PF7E 1DX9A 1YZ3A 1RAEA 3EOBI 3C3KA 3PVCA 9GPBA 1TQDA 4U9UA 1XP8A 4ONEA 2PV0A 4L2IB 3K1AA 2ENUA 1XAJA 1ZVVA 1S4MA 2ECPA 3E03A 1E4EA 2Y0EA 3H5VA 3GLHE 3WSWA 4G26A 2OD7A 2D1TA 3V6MA 4QQNA 3KZXA 4MTCA 3Q2KA 3Q3CA 2Z56A 4G5RA 4MOWA 3VXKA 4LVUA 1F0KA 2WYHA 3OZFA 5JUWA 3C5HA 4BZPA 1NTOA 1SUIA 3JTEA 4NULA 4ZVKA 4ZIRB 1W35A 1LXCA 3NDIA 2PG3A 4MVWA 2GHRA 1T29A 1X8JA 1N5RA 3NHPA 4D0GA 2PX2A 4E2WA 1QH0A 1BDMA 2R84A 1AGPA 2DPLA 4S1VA 3I3SR 3Q9SA 1V3QE 1KYYA 3OSUA 4EY6A 3DAHA 1M2GA 3EMVA 1FTYA 2RHBA 3O94A 1BDBA 1XZNA 3N2NA 2XWPA 1ZH4A 3QX8A 4KIFA 5T67A 5TR9A 3ZVNA 1KVUA 4MEJA 3WFIA 3RDPA 2ZYSA 1QHIA 5JADA 3RS7A 3TLGB 1CY8A 1D2NA 1UBKS 2FZGA 3WRXC 1ZNZA 1Q19A 1ZI8A 3FCEA 3RRNA 3ZD7A 1XIVA 4FEGA 4GPD1 2C7GA 1JEJA 2DWQA 3HVUA 3OU2A 1DOZA 1UBOS 5HDQA 2EATA 3SI7A 5BWMA 3WICA 2QMHA 2GX6A 5A3VA 1GRCA 3RIHA 3A2NA 4LRWA 2H5IA 1TZ2A 3NCHA 1CUUA 3H18A 4FS3A 4CF4A 5MDHA 3ZWAA 3CRVA 3DDSA 1DZ3A 4LZJA 2OYRA 5CVEA 3LSYA 2VXCA 3BHMA 3TXXA 4AS2A 1EZ1A 1QAMA 3HJHA 3STXA 5DISB 3EPHA 3X43A 3QU7A 3QZUA 3L3BA 3C97A 2MMGA 1U2RA 4YUWA 3EEYA 3WL5A 2HA3A 3AOEA 4R8VA 5K8VA 4IIFA 4LSWA 2VWQA 3DQPA 2OVBA 4K87A 4NEHB 4P2GA 2A7QA 4DMCA 1P73A 1VE3A 1Y8AA 3AFNA 3GGCA 1GG5A 1XNHA 3H2YA 3NAQA 1Y7LA 4M0MA 4QHSA 5B7NA 1SU7A 2R79A 1LFDB 3I2HA 1OMOA 2JW5A 3OWHA 4AP5A 4NCXA 2JFVA 3AIIA 4RTKA 1S4QA 2PS0A 3KVRA 3A9TA 1KXZA 4D9EA 1BA2A 3PHBE 1BS9A 2IYFA 2RAPA 3F1KA 2GPYA 1J5EB 3K6SA 3P97A 3UT6A 4DLUA 3MVEA 4GSYA 4IUBS 1FSPA 4RZXA 4RZQA 2BDTA 4QG7A 5AO9A 3A6EA 3SY8A 4C7OA 2UXCB 5GONB 3NMUF 4POAA 3ZW7A 5FF9A 3LUHA 3GUHA 3B70A 1UJ2A 4YJ3A 1J5PA 2XRZA 2OV2A 2YXEA 2HK6A 2H4ZA 2WPNA 2A67A 3ED5A 3GD7A 4JLPA 2ZSFA 4O2AA 4I4IA 2GAAA 3P9QA 3CLKA 5DCLA 3U7IA 4ZOAA 1DRKA 4QODA 4KLCA 4PHTA 4P3PA 1B2RA 3CLRC 3NVKI 5A5GA 4ALJA 5KYGA 1P3DA 3WGJA 1GYRA 2PCLA 4N03A 4MWDA 5K20A 1U0RA 2B4QA 3T7AA 1W36B 2XHZA 3DJYA 4D6XA 5DN9A 5D00A 5BWOA 4N82A 1ZWKA 4NBNA 5K0CA 3N75A 1C3OB 1BCRA 1Q0HA 3V7NA 4F4DA 4JI5B 3CZAA 3D3EA 4QUHA 5A5DA 2BEUA 2W6QA 2XE6A 2GCGA 3ZNQA 3SKXA 4ED9A 3HACA 2C82A 3CLSD 2FPGB 1CP2A 3DE0X 4TLAA 4R1LA 4BLRA 2BGJA 4E15A 4EVQA 5T57A 2IU0A 1TM3E 4NQZA 5P8WA 4R2LA 1AKEA 4MMZB 2NP6A 1U0HC 1G5TA 4EI2A 2WD7A 3H9BA 3WAKA 3KEMA 1NUQA 3PFFA 1I5RA 4D92A 1CQZA 4CU2A 4RMNA 2FLKA 4XSVA 5DLEA 1GGNA 1T91A 3G2NA 2XECA 4QE3A 1CUIA 3NTXA 4PAWA 4A16A 2JVJA 4Q7MB 3TGPA 2EEZA 4W5RA 2HQOA 3DULA 1XDGA 3JARA 2AS0A 3LUAA 5HBGA 3C85A 4OX9B 1U2ZA 1TT7A 1T8UA 1VB5A 2XQIA 3LUDA 1V6CA 3N53A 4B6RA 4Q9AA 1P7VA 2ZPUA 4YCLA 2VYQA 4AULA 2BTEA 4FKBA 2PU5A 4G41A 3D8SA 5DYTA 1TPYA 4D99A 3G5LA 1H8EA 3PQ2A 4BLSA 5J4LA 4V2UA 3JYNA 4V3BA 5ADHA 1S3FA 3AEYA 3NHMA 2IEIA 4GLJA 5ALYA 4RKFA 3ZEIA 5EIXA 4J76A 4EYGA 3JVDA 4HMQA 2JLBA 1SWVA 1A9YA 5FV4A 1TA9A 1MGPA 3A3OA 3DZHA 1KRXA 3W78A 1L7BA 1D2HA 2D2XA 2D13A 1JBKA 1A4XA 5IARA 3FWZA 2VAMA 4MJ7A 5CW2A 1JQ3A 4PGMA 3WWPA 1M72A 5J58A 4KPYA 1MO2A 1A9QA 1JR2A 3F97A 4KLAA 2AKAB 2WU4A 4NYJR 5A9SA 3I72A 4WH0A 3UJ9A 2XKBA 3BB1A 3ON5A 1W4CA 4BO4A 4C9BA 3P20A 5THKA 1XRQA 4MUBA 2BI7A 1FP7A 3TNDA 2EIHA 2B6HA 5G3ZA 4CDRA 2ZRBA 3Q6MA 4Q1FA 4FCWA 1PK8A 3FGPA 2VPIA 4RHEA 2E89A 4CMEA 1P4HA 3IDZA 1GKKA 3IVGA 2X8JB 4OHOA 1TLTA 1OWLA 2VPYA 3HDTA 3QELB 3LNCA 4RHXA 2FJ0A 2SKDA 3KXLA 3WNDA 4V39A 4R8SA 1W48A 1Z4OA 2HNKA 4GPTA 2XMZA 4X1KB 4AZWA 4F4JA 2CT8A 2BM8A 4O33A 5FNZA 1EZ4A 2RB4A 4L08A 5T4EA 1AVTA 2AZDA 1QNFA 2Q4EA 5COQA 2XT0A 3HS3A 4Q1VA 4B2LA 3ZLVA 4AX4A 3KLPX 2VDRB 3TXYA 1A5SB 1XDUA 4C1NA 5JFOA 2VOJA 4JYPA 2IHZA 2YXPX 2NO6A 1BMQA 3BFVA 4BRUA 3GFPA 2GZ3A 3MLAA 3MW8A 3BMOA 2DLCX 2JASA 1SCNE 1M83A 2YJ3A 3I6YA 4X8HA 5BQ3A 2ZJZA 1JHMA 1EQUA 5AVVA 3MFYA 3QFFA 4MIEA 4C6SA 4KJZA 2FVXA 2HU5A 2QL5A 2YOHA 3R5XA 4Q02A 4A15A 2GRUA 2VXYA 4LWZA 2ZJ4A 3VZDA 2HJSA 4TMWA 4C4OA 4B44A 4UW9A 4JMLA 4ARUA 1QIMA 2EARA 4PIPA 3WGGA 5A5FA 621PA 1Z0FA 3IOEA 1X9HA 2GVNA 3RIEA 1XYVA 2ZR8A 4O08A 1T8YA 1YGYA 1E60A 3G85A 1NXXA 2XWQA 5DEOA 2AUTA 4ZAFA 4B73A 4CLEA 3ROTA 1UBNA 4I55A 1ACJA 5C34B 4ZOBA 2A59A 1DXOA 1I1HA 5G4LA 2OY0A 4I4LA 3T35A 4ND7A 1KMNA 4LGVA 4G84A 4QYTA 1JSCA 1A96A 3ZE9A 2P9TA 1MTOA 2NP7A 3EZGA 3PX3A 4KXUA 4XX0A 5D5QA 3RT9A 5JO0A 2ZJFA 3AC0A 3A9RA 3WKBA 2H5JA 2OBLA 2PGOA 3DOUA 1FX0B 3ETJA 3GNLA 4KYTA 3HSYA 4QQ8A 3GCZA 4QBKA 1W46A 3OEEA 2C2WA 2ZWVA 2YWXA 1EWKA 2O0KA 1ORWA 3ECCA 3C87A 1RHRA 1SOWA 2RAUA 3KKOA 4HEA1 4NF2A 5G0TA 2X0RA 2IV7A 3SBDA 4CEHA 1E6LA 3E9ZA 3B8EA 3MYYA 2GGSA 3QXSA 5FPTA 4MV5A 4E11A 2V7GA 1NLMA 2EZ9A 2FH5B 3TKYA 1J5XA 4KR7A 1BQ4A 1KQFA 3VAZA 2QRLA 1DC3A 2XDQB 1FP6A 2XNDA 1ZJ4A 2CE2X 4RCZA 5F9MA 1XRJA 3PDJA 1XRMA 3WZMA 5JNRA 4QPZA 4V0ME 1XMQB 1Z7YA 4YV1A 1KKMA 2I80A 3F3KA 2MMCA 4X00A 1PR6A 2YICA 2YXBA 4JQCA 4JN6B 1Z39A 2LGJA 2IIBA 2ZUVA 3QE3A 3QP9A 2JI9A 5IEBA 1M66A 2J0SA 1UDXA 3ZWDA 4YTEA 1FS5A 1Z4LA 2R4QA 3C3EA 3K2QA 4OHYA 3I3OA 4F9EA 3HLTA 4HJXA 3F73A 5AKXA 3ZG6A 5JNUA 5E4YA 4FYHA 1O97C 2GN1A 5HTKA 3K9FC 2XKAA 4RV4A 3DDZX 4R1TA 2IXTA 3C0KA 1FDIA 4NEGA 3VTFA 2NZYA 4QOGA 1LPPA 1RC0A 1WY7A 4CZ2A 4F86A 3PX7A 2VVTA 1QTQA 5JAMA 1TU4A 3SFVA 4KHPB 2C4WA 3V42A 2GUWA 1G20B 1VG9B 3LQKA 3DEHA 1CF2O 3GXBA 4QO7A 4KQ6A 3GUVA 2G5CA 2C97A 5K03A 2PMEA 2PUCA 2JZCA 2OGSA 1NXPA 3H5NA 3GWZA 4NBVA 5KKCA 1Z8DA 1AS3A 4HDQB 4C07A 1EQ2A 1RMTA 3V2HA 1BOFA 3VKHA 1DO2A 1Y89A 3X1MA 2VBIA 4FYPA 4HG2A 1WF3A 2YJGA 4EL0A 4DTCA 3E9YA 3OZRA 5CLQA 5CITA 1NA5A 2CJPA 2AJLI 3SBOA 2FMHA 2HZBA 2XTAA 1SB8A 3DAPA 1U8FO 3HCCA 1OVMA 5JDCA 2BGTA 3WLKX 2W83A 4UMDA 4BNGA 1Q83A 1K98A 4Z53A 3A3PA 4Q3AA 2C5GA 1JLKA 1JA9A 3TD6A 1JKXA 3H04A 4FYMA 3L8ZA 3R3SA 3ZCUA 4CLDA 1ZAYA 3TW4A 4PG5A 4WOCA 3IUSA 4Q9JA 1OV4A 4D9CA 3I1YA 3KEQA 3C74A 2YV3A 2H1WA 2PUJA 4X3PA 2I71A 1FLAA 2JH3A 2RI6A 3EVAA 4AJEA 4PC2A 3BMOB 2H0AA 3WVNA 3U7FB 2XCTB 4ZZ1A 4J2TA 3CX7A 5EZYA 3LP8A 3PUJA 2B1IA 2XNKA 2WKQA 3V48A 4P3NA 4URUR 1PO7A 2IV3A 3BGOS 1K4YA 2R6GA 4K05A 5IZCA 3VR2D 3Q8LA 3UB4A 5K0ZA 3P52A 1E63A 1Z0SA 1RACA 2FSHA 1XXHA 1NXTA 2J3HA 2Q21A 1JI0A 3H9QA 3OE4A 4EB8A 3UPUA 4HQKA 4X41A 1RJ9A 2GZMA 4A0GA 4CQMA 3CNQS 3TIXB 1TF7A 1DFGA 1VYVA 3EZ9A 5EWMB 1D3AA 2I33A 3G0GA 3OAAD 4MVJP 4D4MA 5JPCA 4UTOA 5LA6F 4CW7A 1SG0A 3FMFA 3UQYS 2PKYX 1JA0A 2DG2A 4KZPA 3OEYA 2VHEA 3O5AA 1VCIA 2HA6A 2O1SA 4NZNA 2IZ6A 1D1QA 4LI0A 2PUHA 4IP0A 4G4GA 1RQNA 1Z4JA 2IOHA 4RW0A 4BLUA 2O8BB 3IP5A 4GDFA 2CW5A 2X5NA 2JK1A 2NVWA 2RI1A 3AB7A 3RC9A 3CS3A 4MPRA 4RF4A 3HYSA 1E1KA 3PXGA 1GEEA 3S5JA 5EP3A 5BV8A 5IS2A 3TW0A 3A4LA 3LW8A 1JEAA 1JLLB 3DOIA 1M34B 4ZEVA 3N5CA 3O92A 5BMOA 1RIIA 1Z7BA 3BC1A 1J24A 4OKNA 3EZ2A 4R5HA 5B4UA 1ORIA 3L46A 1M2NA 1QIIA 5DNDA 2DRIA 1NUTA 1K7XB 1KI8A 1ONBA 3K1AB 3NWPA 5E0KB 4L6IA 3M9WA 1CZRA 5JAQA 1BDHA 3OKFA 3GP3A 3F6CA 3GLFB 5HA5A 5ALRA 4UKDA 4WZ6A 2P6RA 3QNUA 1H4SA 1FMCA 3HY6A 1B3BA 1TYCA 4NBSA 3I9NA 3GFRA 4JXXA 3OQOA 3GT4A 4F2PA 4RENA 4XTRA 1EVIA 2FMIA 1EA7A 1GZVA 5LQAA 4PFSA 5CX4A 1M6VA 5AM0A 2D5CA 5ARCA 1A4IA 1E4OA 2D8MA 1KS2A 1Q44A 4YJ2F 1SOUA 2QTWB 2HXYA 3AP1A 3CW2A 3O9MA 3QUCA 4CWAA 1TQ4A 5LKAA 2AGVA 3OX4A 1XNQB 3MS4A 2BJWA 2UYOA 4I4CA 4D45A 2XYPA 5DGHA 3BQMB 1USGA 3LCRA 4OYHA 4U9HS 1R66A 5H1YA 3B6JA 1W8DA 2V7QD 3GJ5A 4EF6A 2DFPA 3ACCA 4U8HA 2W0MA 4MV7A 5JSKA 1SY7A 5C4IA 5I7FA 2ZQZA 4IS2A 16PKA 4R5MA 3O83A 4RZ2A 2C99A 5DLPA 1I3NA 1EAYA 1G5FA 1N8NA 2O57A 4NH4A 1P80A 2WIFA 4L28A 4BFYA 2PS1A 3CRRA 2IW3A 4JJFA 4YCCA 3QTTA 1AUPA 4BGDA 1DELA 4GZLA 4YRLA 4ZPJA 3K70D 3H65A 1P7YA 9LDTA 1YZFA 3HUUA 2VRCD 4LOLA 1PG0A 1U9IC 2CMGA 1FUYB 2Q4BA 3FWKA 2KS6A 4MKFA 4BRSA 1B43A 3RVMA 2JFPA 3A9SA 2QBYA 2ZVQX 1MA3A 5CXSA 1KRHA 5ENVA 3VH2A 1JT9A 3NLLA 3HQ4O 3U62A 4YJ2B 5JWRA 3KQHA 2M1ZA 1GZHB 2N3ZA 2W2NA 3R09A 5HKAA 3DO6A 2JHAA 1G21A 3VOAA 3EFOA 1RPTA 3DKKA 2G76A 3AUAA 4RSGA 1EFKA 5KDDA 1W52X 3E22B 2YWBA 2YMPA 2NSJA 2WHYA 1QHHB 3R3XA 4MV4A 3ZCRA 1TGVA 3PEWA 3PFGA 2X1LA 4E14A 2W6OA 2QORA 4YBRA 5HUQA 2B2CA 1ZM9A 1F6DA 3FNQA 1Y7HA 1Z2EA 2JGMA 3GLVA 2OXFA 1XCPA 1HEIA 1SVOA 1YRYE 3LL4A 3VJKA 1R4NA 3R24A 2WVGA 5ED0A 4QU9A 2W6ID 5BVGB 2J09A 2W42A 1NVTA 3C7KA 2UUOA 3KVYA 3OQVA 3WG9A 2ECQA 2ZRKA 3ZHYA 5SZHB 4Q4CA 2PAAA 1J8FA 1WMDA 2AD5A 1JHDA 1UAYA 2QE6A 3FOAA 3G68A 2P2DA 3FPCA 4N5NA 4QUGA 3ZY3A 4DA9A 5K4HA 5IT9A 5K3DA 1IATA 2GYUA 3DFZA 2Q3BA 4YJHA 4PG8A 3PCTA 3N74A 1C0LA 3PWTA 1TM1E 2ISQA 4E2ZA 2AX4A 1ISRA 1CDDA 2QN9A 1Y1QA 3UFXB 2GS9A 4OQXA 4YLEA 4EA9A 3ZV7A 4EFMA 4D1YA 3KKPA 4W5HA 1E61A 4P4TA 2GAIA 4GZMA 3LT1A 4ZQCB 3E61A 4KNWA 4C43A 2REXB 4OLHA 4NXMB 2O8FA 4LHVA 4W8GA 1MO3A 4X7PA 4XM0A 3I9V1 1QIJA 3COYA 4WGGA 1AD2A 2J3KA 3WYEA 5I7EA 3IO5A 1U63A 1JFFA 2C4KA 3L4BA 1X8XA 5F1PA 5JEDA 3AEUA 2RKBA 2YJZA 4E88A 1WSWA 4ES6A 3IJPA 4NHEA 4ERNA 4F5YA 2C2XA 2QW0X 3B9RA 3OCXA 2MTBA 3P2JA 3NBMA 1NMYA 2PO7A 1KMIY 4EZBA 4YALA 5G41A 3GVIA 3H2JA 1GGFA 4KXXA 3VYTB 3QKUA 4M21A 1P7PA 1UZLA 3H8SA 4EW2A 3D4IA 4XX1A 2ZATA 1K2WA 2MYPA 3MWEB 4XOIA 5LNK6 1C81A 2IOYA 3OLVA 1SHZA 1TZKA 1DCFA 1MZVA 3IEUA 5DTQA 3MAJA 1MO5A 1Z38A 2F3PA 3ESYA 2OOSA 3RLFA 3TR6A 4ALLA 3QGMA 5I5GA 4Z7OB 2QSUA 2R7NA 2V4ZA 2ZYHA 1RZRD 4A9AA 2GBPA 1NT2A 4NCHA 4K40A 3L0IB 3CNLA 3AL3A 4TS4A 2R8PA 2V4UA 3WLRA 4QZVA 1A77A 2ZP1A 4XE5A 5L40A 1ST3A 1X7HA 2R6HA 2VUTA 1UJBA 3KOXA 3P2OA 3A6JA 2J9ZB 2GDZA 5EIAA 2ZU6A 3G2QA 4BL5A 1N7HA 1U0LA 4FM9A 3GQBA 2H0QA 2WC1A 1O9HA 2XDWA 4K28A 5HQTA 2P2LA 3QOWA 3TMKA 2YQ4A 5L51A 3OD5A 4XWGA 2WJHA 4UAVA 1RADA 1VE7A 2V97A 1CJSA 1QLJA 3HWSA 4MQ5A 1U7OA 1NBIA 3VZRA 1VPVA 2YV1A 2RFLA 3OFSA 3PG5A 5AVRA 1RYBA 4G81A 2J7PA 5BWNA 3R7WB 2W5UA 3W8FA 4WK6A 1LSOA 1ULUA 1V26A 1XZ8A 2V0NA 2WINI 4IEIA 2JJMA 1M54A 1YH3A 2YHSA 4N9QA 4ZQEA 2Y1GA 3FWPA 4XZ3A 2QI9F 4EPXA 4KAXA 4TXMA 5JMOA 3PLAE 2YXDA 3BMXA 1GDDA 4NX2A 1M7HA 4F4IA 4B3TB 3IEIA 3IHKA 5CLIA 4L0QA 1M7BA 4L76A 1S89A 2VPXA 1PK7A 4MV3A 1U8CB 4NYMQ 4AS3A 3ZVMA 4Y2RA 3NNDA 1DKRA 3U4QA 1WV0A 2X9NA 3GNSA 3N2ZB 1P72A 1P2BA 2WYOA 3ZDRA 3T7SA 5DMXA 4DMLA 3L0ZA 4M0FA 1UPBA 2KW5A 3U39A 4IJKA 1P2UA 2PT9A 3UO8B 3FCCA 1DAHA 4BU1A 4JT4A 3PPVA 2DPYA 3F7NA 1RQRA 2SECE 3QI2A 4PLPA 5HWSA 1NLYA 1X2BA 3A3NA 1GSAA 1D5CA 1YK1A 4LDJA 4KPUB 5AXAA 4WD3A 4YH1A 5EWLB 4NBWA 3NXKA 1VHJA 5K0LA 2NU6B 4EK9A 2HW8A 2PEYA 3MWDA 3T9FA 4C0XA 3AL2A 2KYRA 4KDRA 1OI7A 1QVWA 1QOQB 3CZCA 3H8VA 2JGIA 3JD1A 4W9RA 1CTQA 2P9JA 2C58A 2G77B 4PICA 5EHIA 1G4UR 3OZCA 3QTBA 3IDSA 3IT1A 4HDSA 2Q6TA 3CXRA 2HHCA 4I7EA 1QZ3A 1JE0A 3RU3A 4YQFA 2GVDC 1R0ZA 3OF2A 3EXEA 1DJMA 1GU0A 1OX5A 1JMYA 3HGQA 3J81k 1Z45A 4I9FA 1C50A 1F48A 3GJ8A 3T7KA 4F6RB 4DJFC 2JLQA 1DQRA 2QN2A 2XNCA 4AFNA 2C9ZA 1W0JA 2KLBA 1VZ2A 2RGGA 5SY4A 2GD0A 4I36A 4PTLA 5TQ2A 3VC7A 1T1IA 4AF7A 3I2FA 3NJ4A 3RUIA 3NQ41 1EFHA 3U1VA 1O6CA 5AESA 4JA0A 5AP9A 4EHFA 3DTVB 1XHEA 1RXEA 4BMZA 2ZB3A 1JALA 1M1YA 5H7XA 4LGYA 2QG9A 1W2WB 1FSGA 1USKA 1F06A 1GKYA 1VJRA 4ARAA 2ISCA 2AN5A 2F1HA 3R3UA 4LSMA 1NXVA 3CURA 4MKGA 4JY7A 4QICA 4U6QA 4DLPA 4P4UA 6ABPA 1A0OA 1U2EA 1HUQA 1OROA 1TZCA 5JVDF 2A9PA 1O0SA 4FIDA 4A2PA 5FOUA 5E2AA 1YJXA 5K3BA 5C7YA 1CDEA 4FWIB 5DI3A 1N5JA 4OCZA 3H83A 5JYEA 1TYAE 1CIVA 1GCGA 2B82A 3HUTA 3VVBA 1RLMA 1RM4A 3IAHA 3PPIA 3RTAA 1RHJA 5I48A 2Q5JA 4RGVA 2AHOA 3O2QB 1NF9A 3OUZA 5IHPA 5BR8B 3ESXA 1FQJA 3LLMA 3RO7A 3WLOA 4L9AA 1KEKA 1LBQA 1GJRA 3PWZA 3SE7A 4Q00A 1PSDA 3FSGA 1IZ9A 1RP1A 3QBJA 3U3ZA 3ZE2B 5EFZA 1Z25A 1W0KD 2HJVA 3DHWC 3LFHA 5IABA 3WJ2A 3RT1A 1MGOA 3CRNA 4Y8VA 3W3AH 1XMVA 2XHEA 4UHBA 4KXFB 5EVCA 1C8BA 4D2IA 1A7KA 1HT0A 5H68A 5J47A 4A82A 3HLYA 3LWDA 3FFXA 4ENSA 2VIIA 1G0OA 5EPEA 2BTQA 3L07A 4FKMA 3OPYI 1CRLA 3KV1A 2ON6A 5AI6A 3M5PA 3TR5A 4J1QA 4EG7A 2D0IA 4TKUB 3TMYA 1UODA 3R3HA 5FOQA 3OIVA 2A7XA 4IXMA 2GBLC 4B7ZA 4BN5A 2PSHA 4IUYA 2SICE 4NJEA 4G1EB 1OX6A 1YS9A 4LJKA 4J43A 1GZ4A 1PL0A 3R9XB 3D54D 3RREA 1K8ZB 1MAHA 4KEAA 3UJCA 2O8DB 2W2PA 2LR0A 4JJ7A 2O4UX 1T6XA 4Y7CA 2A5LA 5BW5A 1HDEA 2WUFA 3E70C 1BWPA 1JR3E 4NNOA 1QOZA 4L4ZA 3WYBA 1E79A 4XCVA 4UHEA 3DKPA 2FRDC 3FJOA 2C5BA 4DARA 2WE8A 4TTAA 1JU3A 3LC7O 1W1IA 3L77A 5ERYA 3ETHA 2Y77A 4Y9RA 1SCBA 1YTLA 3L43A 3FI9A 3WLTA 5DNYB 2B0JA 1PJLA 2PMBA 2PVSA 3ZJ5A 4RKWA 1TZBA 1IH8A 3A1EA 4R2KA 3DLCA 3GT7A 3UPTA 1U0GA 3WWCA 3H2BA 4NH0A 3R40A 3KYDB 4HX2A 2ERXA 3EXFB 4QXAA 1JJVA 5IC6A 3R6TA 4H1TA 4H59A 3GVPA 1QRSA 3PUZA 5IJ0B 1T8WA 3R5KA 4X84A 3W5HA 4Z54A 5ICSA 5L3SA 3MXOA 1LK0A 3OCVA 3T0GA 1VJ0A 4MRRA 5F77A 5BNIA 5BYAA 4MMYB 1ZNQO 1P1CA 3WWDA 1CYEA 4Q4JA 3DQZA 5LJIA 1XA3A 2QLMA 1BZYA 1GIAA 1MX3A 1NX6A 3EDOA 4G09A 4HMPA 4I1YA 4OVKA 4AKEA 4F0JA 3L4JA 4BP8A 5BQFA 4PGGA 3ILYA 3SSNA 3GLGA 2CUTA 2H9YA 2AX3A 5ESRA 4CM4B 5EHNA 5GONA 1SIWA 5BN4A 4B9AA 3NBYC 2W6PA 1JMKC 2TMGA 4ZEOA 1THGA 1UIMA 3NS7A 4JX8A 4HRYA 1T1GA 3X3HA 4ACBA 2RH5A 4WXEA 2WICA 3K0CA 3NBKA 4UASA 1TTTA 4AS1A 4C4YA 4EEZA 3HMQA 4BPBA 1RYYA 5HNKA 4U5QA 2LWIA 1XXHB 1NU6A 1B0ZA 2EWMA 5ICGA 1C7FA 4FYVA 3ZGNA 3EGCA 3AI1A 5FUBA 1Y1SA 3QM1A 4ZI2A 2QRZA 1OKKA 4LOHA 1J1IA 2ZJYA 2BRUC 1JFLA 4YRDA 5EXDA 3VM6A 2AEJA 5J2TB 1B8VA 5JU6A 5AHKA 1FMTA 3GRCA 1BNCA 2PRSA 4HGNA 2FXIA 4GRAA 3SHVA 1JEYA 1XTVA 1RC1A 1X7GA 2Q29A 3Q3IA 2XYGA 5EE3A 1QC5B 3H17A 1K1EA 4Y98A 1WX1A 4IHQA 1YTUA 1OU4A 3MTIA 5JJBA 2F3SA 1Z15A 4KBGA 4PRYA 1M34A 4XJXA 2N1BA 2PWAA 4HDRA 3OY7A 3HDJA 4TL6A 4FU0A 3RVPA 1VA4A 3A36A 2DT8A 5ALJA 1VLQA 2GFIA 4DMFA 2PR7A 1PV1A 2XMPA 3A11A 1QJ4A 1V9CA 2FE1A 1G8MA 1E9DA 4GW3A 1Z0ZA 3BULA 4CCAA 4R69A 1V4VA 1VA5A 1I32A 1VHTA 4F2GA 3EJWA 5MN6A 3OPQA 1S2LA 5LPNA 4JC8A 4KBYA 2YIVX 2PRZA 4LCBA 4AX8A 1GNSA 1VHDA 3NHZA 1RWKA 3R23A 1RXCA 4W7IA 3U1BA 4KXNA 3N7AA 3RCBA 3ESCA 3I12A 2IH5A 3OOJA 3TZCA 4U6NA 2BFBB 3N28A 4PPQA 1QOPB 4QOHA 4MKZA 3G82C 1M6YA 1NBWB 4ZU1X 3IT0A 1U2GA 4RHFA 4YRMA 2GXAA 1MNAA 5D5PA 4MICA 2A3NA 1MAVA 4XQ9A 4IHAA 4RJTA 1YDGA 2BP7A 4B80A 2HA7A 2PZ8A 4URZR 3BWXA 1QYWA 3C16C 5C8VA 1EE2A 2VT2A 1SVKA 3DL7A 2GF2A 4HAZA 1VG8A 5ITZB 1V1JA 4IIDA 4S04A 3ZI4A 2LCQA 4OREX 5L3QA 1KO5A 2FPUA 3K0HA 3FMVA 3KXDA 3K70C 1USUA 4XSHA 4RTLA 1SKUA 1XZEA 2IEAA 3L1KA 2G8LA 2XXAB 3VNQA 2I6GA 2NXCA 4KR6A 3MT0A 4FEAA 4XGNA 2I8LA 4P4LA 4LW8A 1GUFA 3UJAA 5I9NA 2OBMA 1P75A 2CK3A 1IBKB 1RR6A 4YWJA 5CDFA 4YT8A 3ZDZB 4R51A 4OGLA 4G0UA 1HGXA 1HLDA 5JZVA 3ENWA 3KG2A 2FFJA 1E1QD 1QB8A 5ALGA 1ZN9A 1PJTA 1LX6A 1UMDA 4HS4A 1C7ZA 3LXXA 1QO7A 4WDQA 2PWPA 3N8KA 1G5RA 4KIJA 4RE5A 5AJXA 3UAVA 1U3DA 4AO8A 1TL7C 4P92A 4MKXA 4M99A 2JGAA 3MYRA 2C7RA 1G41A 2W2LD 1QONA 3ZS8A 3G8AA 1W4AA 4RIGA 2OCBA 1RI4A 5AI4A 2QHXA 1ZH0A 3MJ4A 2DWUA 2P6PA 3UHOA 3U3JA 1QHHA 1STOA 4DBVO 1QHFA 3LT4A 3WQBA 4D9NA 2XITA 4YAJA 1QG6A 3H11A 1DP4A 4Z1OA 1IM5A 1GKIA 3H13A 3MT9A 4J2HA 2HY7A 3GJ4A 4JJKA 1TUGA 2CMDA 2QX9A 2P67A 2XI4A 4QTXA 4C05A 1UPCA 4JT9A 4Q47A 4MYUA 5BSMA 3V1LA 2NADA 3ZDAA 1B0AA 4JHLA 3NRJA 3D6UA 4NDNE 1A9ZA 2JGDB 1H66A 2ZSKA 3B51X 3AZPA 3HRHA 3K1YA 4FQ7A 4U7GA 3U0BA 1U0TA 3L6OO 1HO3A 4C2BA 3BDIA 1EE1A 3H2HA 5FFMA 4D3ZA 1SVUA 4LISA 1TI7A 4UBIA 2FRVA 2OE2A 4QNNA 2R1TB 1DO0A 1NQXA 1Y4ZA 4R1MA 3CNHA 2LV8A 3UAWA 1GV0A 2KB0A 2PIDA 3TUJC 2C03A 1B4DA 5FTNA 4YJHB 2GPTA 2CEKA 3OY2A 3OPYB 1QZXA 2REQA 1L7VC 3I2IA 1M75A 2O3JA 5HUHA 2GO1A 2CYBA 3RFUA 1E8NA 1F8GA 3SF8B 5KKAA 3DE2X 1RJWA 2EFGA 3HJUA 4B17A 5A2QA 2FW1A 1EK1A 3QY0A 3B6KA 3E7PA 3PDIA 1GTG1 4LQDA 5CW1A 3HV0A 5E6SA 4C0QC 4CFZA 4E12A 3M1IA 3PEYA 5LB4A 4E7PA 2H2DA 2O14A 2GCPA 2PL3A 5T8KC 4ON9A 2WWYA 3QBDA 1MFPA 4FBLA 1S8FA 1VSBA 1ZOOA 2D1QA 4MV6A 5B6JA 1XP5A 3MGAA 5HIJA 5KWVA 1NPDA 4V03A 3UVEA 1WQ3A 1VSVA 1U7UA 1PFUA 1TTQB 1OBVA 3CPJB 1ESNA 1S5PA 1VHQA 2Z57A 3RJZA 1KKUA 3SVZA 2VHUA 1RZUA 1IN5A 4DNQA 5C5IA 4FDTA 4X93A 5MGBA 3PXAA 4N7BA 5A1TA 4FCCA 4PYNA 2BHNA 1C9MA 4HDNA 2ZITA 3CRZA 2GCOB 3M6FA 2PZEA 2HA0A 3WGVA 1ISIA 1L4HA 1JIXA 1RI5A 3GFBA 3LCVB 3LA6A 2DHQA 4NYIQ 4PCVA 2KM1A 3NJ8A 4J03A 3Q4GA 4L51A 3ITDA 4H08A 5AKLA 5FA6A 5IVDA 2QGNA 4M3NA 1BTOA 4N0DA 3TINA 4TT8A 4AICA 3WSTA 1XU4A 3HMKA 4HWKA 4CXMA 2W7TA 3SQLA 1NYTA 1S8AA 2AMLA 3M6AA 2YDYA 1M9NA 2WWTA 2YIDA 4JJIA 3BRWD 1BCSA 5BV0A 4BYMA 5DCUA 1IHDA 1U5AA 1YIAA 2WOJA 3L0PA 3VUFA 2FP4A 3A25A 4AMGA 3KVOA 1P33A 2WYWA 3LYUA 4DYDA 4HN9A 3V8MA 7MHTA 2EP7A 4LJYA 3W7BA 3Q88A 1KJIA 1GHTA 2YDXA 1QR6A 2YWHA 3JASB 4FYIA 5JAHA 3E0XA 4IAOA 3TUIC 2AT1A 4JENA 4ZYUA 4PNHA 1CNEA 2EJUA 4RDIA 2IYEA 3JQ7A 1QV6A 1IPHA 4EYEA 4BZZA 4UUNA 3PF8A 4G5XA 3BMQA 1ISHA 1F0YA 3O0TA 4FHGA 3WFZA 4ZCSA 5DTRA 3DVAB 3MBOA 3HXLA 3BZUA 2W4MA 4M53A 3DZCA 1W9MA 1O8CA 3W3ZB 4J16C 2OT3B 2Q1TA 3B36A 4FFBA 3ZWQA 3FLBA 1GLNA 3HADA 3HVJA 5ECDA 4ANFA 4I6GA 4B3RB 3U3KA 2QKYA 4L3VA 3GGSA 5SZIA 3VPSA 4TRJA 2CVPA 2DPMA 2DQYA 4NABA 1T3ZA 2XYHA 3G0IA 5J4KA 3ABOB 7AT1A 5IRCD 3TQSA 2Z1NA 1N5OX 2X6RA 4QUIA 1FDOA 4LVNA 3RU7A 1H6BA 2E1RA 3L0CA 5K3OA 1XLUA 1GQ2A 3BJZA 3R8FA 3WHPA 1G2QA 2C4UA 4RDHA 3M6VA 1DADA 3OOYA 4DNPA 2ZJOA 4HNGA 4I46A 4QO8A 4B7CA 4Q7EA 1OWMA 3OUTA 2GILA 3HPRA 3Q7RA 3FJYA 3QOFA 2VTBA 4KC0A 1S3SA 3GLRA 3RTCA 1UP7A 3KT8A 2VQ3A 2I7DA 3FTCA 3SNKA 2JD1A 2CLEB 3H7AA 1QCYA 1Y3BE 1E3TA 1NW8A 3D3NA 1QYRA 2XNSA 4XLLA 1WAMA 1E58A 3FN4A 1YQUA 2P4QA 1X7ZA 5T6MA 1M34E 3BOSA 1SM4A 3HKEB 2OV3A 3M70A 1FLNA 2F7SA 1XRNA 5DPMA 3SVLA 2Z2IA 4RJ2A 4RY2A 2JFHA 4GPEA 4IIJB 3K15A 3LY9A 1N6NA 2FSVA 4J4BA 2OHIA 4JD5A 1YD7A 5CVTA 4C7OB 1ELOA 2ZKLA 3OT1B 4RQTA 4EGSA 4EFKA 4INJA 3IUPA 2VUHB 1LVGA 3CF4G 2D8AA 5B3LA 1KZ6A 4DQXA 5HIAA 1EH5A 3I6IA 1IYZA 1M1XB 3GQVA 2I6XA 2EU8A 3FDZB 3JPYA 2ZUWA 5KYVA 1K5HA 2PX4A 3IDOA 1L4FA 3A1UA 4YVFA 5FUWA 2HK7A 1E4VA 1UKAA 1UKVY 1HX7A 2H18A 3QEMA 4HWTA 4DA6A 2B5OA 3A1FA 3O7MA 1L1FA 3DBHA 3OOEA 5DOVA 3R7SA 4BIIA 4GI3A 1O08A 4FNMA 4XVRA 4LFCB 2VATA 4KPEC 3GN1A 5ETJA 3CHYA 1DWUA 2BSXA 5EZ5A 5ALXA 1R50A 5KSWB 2CV1A 1T4DA 4N3NA 1EXNA 4EO4A 5D1NA 5FHRA 1IBMB 1XC7A 3CFYA 4CM9D 3TIGA 1GEGA 2OBBA 2PUVA 4OI2A 4UM5A 4X1YB 1T5IA 4ZYLA 1UXGA 1PEYA 3AJRA 2BE9A 2GKGA 2RHCA 2XVYA 4HUQA 4IX1A 4TTSA 4WUTA 1PZEA 3K16A 4ZCLA 3GOQA 3CNOA 3JQ9C 3HZOA 1GAEO 3QV1A 1E2IA 2P8JA 1IDOA 4ADSG 4XOUA 4F96A 4G0ZA 5LQMA 3KB1A 4EHLA 2H00A 3T5PA 1UQTA 4L0DA 4I3HA 3KP1A 2XCRB 3AETB 3IYLW 5DLQC 3CNNA 3S8MA 1YRHA 4ALNA 4NZOA 1AXGA 1FRNA 1OIWA 1N2CB 2LNDA 5CK5A 2XKJE 2ODQA 5AJWA 3EARA 3F7MA 3BXHA 2KBEA 3B5IA 3KTDA 3PHIA 5KQLA 4LOJA 1CVLA 4RAOA 2NTJA 1AO0A 1ZLXA 3MIIA 1FQOA 1DC5A 1YL6A 4D9KA 3K8YA 1SD1A 4GUAA 2NUAA 5AHWA 4EFNA 3OM0A 1C1YA 5DBGA 2WTMA 4ZJUA 1T2DA 3TQTA 4J4HA 2BKXA 4LJ8A 5LUAA 1A9XB 3M4ZA 4S0XA 5JHHB 1ODFA 1XCJA 1DQYA 2H2GA 5F51A 2ZAIA 3KTAA 4W1QA 4XDYA 3WMRA 5EN4A 1QFXA 3IIJA 1W7AA 1AQYA 4L5IA 4IYJA 1WQ1R 3VU9A 3OF3A 1ARZA 2V9PA 1N6KA 3WP1B 4QGSA 1QFYA 5AM4A 1JLRA 1NIPA 4HFRA 3E7FA 5AJVB 5J5VA 1UFOA 4KPFC 2W70A 4BVAA 4LV6A 3D3QA 1QHXA 3EXG2 3IPAA 3IT3A 1X74A 3IMCA 4MS4A 5AVWA 1FSFA 1SXHA 3NV9A 2BGLA 1L1EA 2H1CA 2HA4A 3PC8A 1M74A 4C4TA 4BX3A 1O9GA 5C4MA 2MSNA 3LJKA 1W0CA 4GEGA 4DLVA 3WGMA 4WKGA 3NHBA 2A84A 1PBTA 2AXEA 2VKTA 3OPMA 4FOLA 1T3HA 2G7MC 4LJ5A 1SRRA 5CP8A 3SMVA 4BEJA 4LX8A 4IZIA 1JE1A 1EWRA 1CR6A 1QBGA 3AU8A 4UATA 1RWWA 4DA8A 4IFBA 2YYSA 4CMGA 3ICOA 2W2KA 2QMQA 1U8YA 1GT6A 3EBOA 1BG6A 4C0BA 2ATCA 3GRAA 5ER9A 3ZQ6A 4RD3A 5IF3A 3MNFA 3O6VA 3NP7A 4LDZA 2AHRA 1LDNA 3NETA 4ZOLA 3ZXXA 4OJNA 1PJCA 1KVTA 5A3RA 4PCLA 3MGCA 4BJHB 4YMHA 2OILA 4AW9A 1H22A 5CLFA 4F11A 5CIQA 5KTYA 2C9MA 1UBCA 1GTZA 2GF0A 4UBLA 1P5RA 2SNIE 2F3UA 1X7ZB 1Z8HA 4RTRA 1V25A 4AY3A 1ZD3A 2IYAA 5L4LA 3KJNA 2EC5A 4RELA 1CB0A 3W5IA 2DHCA 2AR7A 2IT1A 2CJYA 3R6DA 5EJIA 5LFAA 9MHTA 4K3UA 3LIIA 4WI1A 1D4FA 4JU8A 4TV9A 5KTRA 3JX9A 3PTZA 2FETA 2OQRA 2IIPA 4F9GA 4NXNB 1YQGA 1GU1A 2P3QA 4BE9A 2HC9A 2QTNA 1D7OA 2PD4A 2W6IA 2X7JA 4DNOA 3CCCA 1X80A 5AKGA 5AM2A 4D97A 1R27A 3DTNA 1KFEB 2FPIB 3SQOA 1UEXC 2E5WA 3GGOA 5BP7A 3LCJA 3MTAA 1Z0JA 3DHVA 3HXPA 1NUUA 4WKBA 5ALIA 3MINB 5KTNA 2BSQA 2RH4A 1A50B 1LA2A 4UAJA 4JP1A 4NZMA 1COZA 3VSAA 3DV0B 3QPWA 3CXUA 4XYBA 3SR4A 3C3AA 3MC1A 4KE9A 1FUUA 2TECE 4WESA 3VR4A 4EQ6B 2RHTA 3FCUB 3QE4A 3K0FB 2FN8A 1HFJA 1Z29A 4H6XA 4LJ7A 4M1YA 4R1PA 5D84A 5DYIA 5F1YA 1PR0A 4QELA 1ORRA 5IT4A 3D3KA 4N47A 3K05A 1MO6A 2GPWA 1VLZA 2OO5C 1I36A 3FA2A 4BNMA 2H4WA 1AF7A 3N8DA 4OI4A 3N07A 3I9LA 4P22A 1NFFA 3UW1A 4HUQB 4MAAA 2OAEA 3FPGA 3VU3A 1Z5NA 2DX7A 1QGOA 4HGYA 4XIFA 4N12A 2I2WA 4N7RA 3ZU4A 2O05A 1FXUA 2Z1DA 3VGJA 3ZE1B 4KIWA 3ANLA 4MPJA 1QSGA 1PX0A 3D3JA 2PJDA 2O7SA 3NH6A 2MYTA 2IW1A 1JDJA 2NUBA 4OJQA 3I01M 3HU3A 4PBTA 4CDMA 4ZVTA 2CVOA 4DLLA 1DXQA 2BKUA 1CQIB 1OD6A 2QF7A 1P0FA 1R0RE 2CXNA 2JIOA 2XUAA 5A62A 1K08A 4ARCA 4UMFA 3A6PC 5FI5A 3TW6A 3WWOA 2GM5A 1PQWA 2JFWA 3BXFA 4ZEMA 5ECYA 1MJGM 2R7MA 3PIIA 2P9EA 1Y1KE 3S44A 3ZX4A 1FVHA 2UVDA 1JNYA 2NYUA 1E66A 2WKWA 2VP2A 2XVMA 3E7DA 1Q0TA 1S2NA 4FKZA 4EG3A 4B4OA 4LBZA 4A1FA 2R8RA 1XL0A 1BA3A 1XEWX 3LBIA 4N5MA 4PBRA 1SEVA 2F3RA 4EA7A 2JNWA 1TJ4A 5JASA 3A6GA 2BM9A 1EDZA 2I2DA 2ID9A 3KUDA 3L6RA 4MI6A 3QRWA 3AP3A 5DYWA 3UMJA 2HTEA 1EGMB 2YMQA 2PA0A 4C21A 3DEKA 4EH1A 4CPDA 3C4VA 2I4OA 3ZWKA 3EASA 1D2MA 3QHPA 4KXMA 4QBIA 5EXPA 2FF7A 3GBVA 5A4MS 2DPGA 4G5SA 5AK3A 4EJ2A 2WIBA 5D3KA 1KZHA 3HZHA 1ZSNA 4GWGA 3OIDA 2HB6A 2APJA 4IJ6A 2RHGB 3E3OA 1CW2B 1H8HD 5AYVA 3HXKA 1PCXA 1RLTA 3HN6A 3VYUB 2F8MA 1XEAA 2E18A 2EYUA 2I9PA 1E18A 1SXJA 2QP9X 4WERA 4Z3KA 3TLBA 2BLNA 4MVJA 3OCUA 2I1VB 4G0MA 2XUKA 2VHCA 3QYAA 2QJRA 4BE7B 4MARA 3HJTA 5H70A 1J07A 2D0PB 4NE7A 1AZSC 2GVZC 3ND9A 4BX8A 3K9GA 2HADA 2QMEA