3RJ9A

Structure of alcohol dehydrogenase from drosophila lebanonesis t114v mutant complexed with nad+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
b'MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNVTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title An intact eight-membered water chain in drosophilid alcohol dehydrogenases is essential for optimal enzyme activity.
pubmed doi rcsb
source organism Scaptodrosophila lebanonensis
molecule tags Oxidoreductase
total genus 96
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rj9A00
1OZAA 3KEQA 1VJ0A 3RFTA 1UP7A 1X1TA 1KOLA 1HXHA 3RD5A 2VZ9A 3ZU2A 1ZJZA 3E6AA 1XYGA 4CMEA 2V7PA 4AG3A 2GF2A 2GNAA 1J5PA 1QKIA 1IHYA 2C7VA 2CF5A 1BHSA 4W99A 3WXBA 7MDHA 3INGA 2BMAA 1F17A 2BFPA 3DTYA 4NR0A 5TNXA 3I9NA 4RDHA 4QECA 3HE3A 4MVJF 1EQ2A 1EVJA 4AJ2A 3AOEA 3C24A 4W6ZA 5ADHA 4BNNA 4HFJA 1U7TA 4HWKA 4Y98A 2VOJA 3KVOA 4H15A 2BH9A 3GY0A 4TZTA 1K5HA 2NWQA 4XQCA 5JCJA 4XQ9A 4AJLA 3S2IA 1U2DA 3NX4A 3JTMA 3LF1A 4DBVO 1H0KA 1ULUA 1NVMB 1WDKA 4U0JA 4GX1A 1W8DA 3GA0A 2PK3A 2RH8A 1YONA 1UXIA 2O4CA 1UP4A 2Y1EA 4WJZA 1PR3A 3HDJA 4OOFA 5K9ZA 4OSOA 1U5CA 2YQ5A 2Q46A 1H6AA 3F5SA 4UUMA 4BHTA 2WE7A 2CDAA 3L9WA 5EQDA 4S1VA 4E31A 3K8ZA 5GZ3A 2W8ZA 5AQ1A 1N1GA 2NTNA 3LVFO 3N7UA 4RJTA 4LSMA 2VCYA 1NVTA 3JQBC 5DT9A 3ZI0A 3ETDA 1QYDA 4R54A 2JAHA 5CG2A 4CODB 4R9SA 1E77A 4ONEA 3BZUA 5TLSA 3I5MA 2PH5A 4JP3A 2GASA 3MJVA 3PYMA 2H1SA 5GY7A 3WOHA 4BO6A 3R3SA 3WSVA 4GLLA 2FPPA 2I99A 4H3VA 1N7HA 4EJ6A 4IJWA 1IUKA 4M86A 3M2TA 3RQSA 1WZEA 1BSVA 4HFMA 2AW5A 2B4RO 1SB9A 2X0IA 4KQXA 4R3NA 2CNBA 4Q9NA 4CM5A 4BNXA 1T1SA 1YO6A 3C7AA 4I5DA 1DIAA 2YHIA 4BNTA 3C85A 4OYRA 3CZRA 4BNKA 1NASA 2YV1A 3JD1A 3TPCA 2IZZA 4CL8A 4CM4A 3WB9A 1BXKA 1DJNA 3GG9A 3IMFA 4HUJA 3HDQA 1PQPA 2YHIB 3DTTA 3VZPA 1H6CA 1H9BA 4AFNA 4KQWA 3GVPA 1K2WA 3OBBA 3I4CA 4YT8A 3QVSA 3RCBA 2Q50A 1Q7BA 1LXCA 5ICMA 4CM4B 2J5QA 1IULA 2GGSA 3JQ9C 4WLNA 1EVIA 4IZHA 1X7HA 3SC4A 4DLBA 3ZWMA 1EVYA 2WD7A 3PTZA 4ALIA 2C54A 3DZBA 3RUCA 4IDAA 3AI2A 2V6FA 4XB2A 3ONFA 1BVRA 1GAEO 1H9AA 4OKIA 1WWKA 3VDQA 4J90A 3SEFA 1ENZA 1YDWA 2VHWA 1F8FA 1DRVA 2IZ1A 2WD7B 2IYOA 4NQZA 1W6UA 5CHEA 1ID1A 5IN5A 3RAJA 4IDGA 5KVSA 3RFVA 4BKRA 2I65A 1YBAA 3OEYA 2VT3A 3T7EA 2PNFA 4JQCA 1I5RA 4A5OA 1SB8A 2JHFA 2EKLA 3ZHZA 2X0RA 3IC5A 4YXFA 3HUDA 1PZHA 5A9TA 2XOXA 4BO9A 4P4GA 2QX7A 4J7CA 3H65A 2W2KA 2OZPA 1OMOA 2EG9A 1T1RA 2ZB4A 5TGDA 3W6UA 1NAIA 1B8VA 1QLJA 5THKA 1UH5A 3ITKA 1V9LA 1N92A 4AJIA 3D4PA 4BNGA 1IE3A 4DXHA 1M67A 3S2FA 4ALNA 4W7HA 5CDUA 4NZ9A 5I9NA 4I9HA 4FC6A 4AJ4A 2BELA 3M1AA 1R16A 4IQ8A 5HBRA 1ZMTA 4PG8A 6ADHA 3GRPA 3SJUA 1PGNA 3JQ9A 2ZYGA 5JC1A 3UGKA 1RM3A 2CUKA 2C7GA 2C5EA 4JJIA 2GO1A 3TZCA 5L45A 1HT0A 4Q3AA 1JKFA 3Q6IA 5AXDA 5MGBA 4YQZA 1I3NA 1U3WA 2JCYA 1UZLA 4Z0PA 3VVCA 3WFJA 3LSYA 1FJHA 1BGVA 1UUFA 2PD6A 2ZCVA 4MIOA 3WIEA 4ZU3A 4DYVA 4CLRA 3VPXA 1U5AA 4WE3A 1SEPA 3JQCA 4Z9FA 4XGIA 4B79A 4BGEA 1X14A 1UAYA 2EP5A 4I5FA 1QORA 4BNUA 2PY6A 5G0TA 5B4TA 4M1QA 1WPQA 3TFOA 3BHIA 4Q3DA 5JAMA 3ENKA 4CLRB 3HDHA 5BNFA 3QWHA 3TDKA 2QYTA 1LLDA 1K6JA 4HBGA 3PQFA 4PGFA 4DVJA 3P2OA 3D3WB 3AM4A 1H6DA 1DIBA 3MOIA 2H9IA 1MB4A 2PTGA 3OICA 1RPNA 3GC6A 1EFLA 1NTOA 3E5RA 3TZ6A 4NK5A 3GGGA 1PJBA 3MJCA 2WYUA 5TSDA 3LT4A 1E6WA 4IIUA 3GK3A 4M55A 2RCYA 4EJMA 5JO0A 1EZ4A 3PHGA 3CINA 3GLQA 5ILGA 3WWYA 4XIYA 3FD8A 3TL2A 1PZGA 3EVTA 1U7HA 3C1OA 3TOXA 4BOYA 1ZK1A 1OI7A 4B4WA 2O2SA 3OA2A 4TWRA 5COBA 5JDIA 4QO7A 1E1LA 1P45A 2WDZA 4F45A 3LC2O 4S3MA 5G4KA 4BMSA 3E5MA 1EQUA 2GERA 3PGJA 4CJXA 1LQUA 5CDYA 1P1FA 1U8FO 1HDCA 4XGNA 4IUYA 4R01A 1PEDA 3B1KA 4D43A 3H3FA 3N58A 4UUPA 2GN9A 5G4KB 3G49A 2GRAA 1XWFA 2GLXA 3NRCA 3WIDA 3KSDO 3IAHA 5IAAA 1A27A 1VKOA 1AHIA 3F5QA 3UAGA 4CMGA 3HSKA 1AE1A 2CDBA 3GEMA 3HWRA 3RROA 3GZ4A 4GBJA 4B4VA 2PFGA 2WTBA 2D59A 2NTVA 4NPCA 3F9IA 1M75A 1ENOA 3H2SA 3QWAA 2OOSA 3ETGA 4WCFA 3WGYA 4CMIA 4EUFA 4JGBA 2VRCA 1VJ1A 3FF4A 1GEEA 2BGMA 4HP8A 5GZ1A 1F8GA 1I32A 2PKQP 3CXRA 1PL8A 3KRTA 4D7AA 4MVJI 4FCCA 2VN8A 4XJSA 1ML3A 4Z9XA 1DAPA 4J16A 4FN4A 1FDSA 1I3KA 2Q4EA 3WBFA 4ZQGA 5A5FA 4J91A 3V5NA 1PS8A 4GMFA 1V35A 4ZQFA 3IP3A 1IPEA 5F5LA 2V6BA 3DZKA 2VWHA 2OBNA 1LX6A 1I0ZA 1PJ2A 4IXWA 3L6EA 3HNPA 1NQOA 2EKQA 3C7DB 5KVCA 1YVEI 5AXCA 2X0NA 1NFRA 3D4NA 4IJVA 2Q2QA 1SOVA 3O03A 1KC1A 1KVTA 3SBOA 3ANNA 3AUAA 1TEHA 4NFHA 1N2SA 1VJTA 1YL6A 4D41A 1U3TA 1TLTA 4JBGA 3O8QB 1F12A 4BNFA 2IZ0A 2PZMA 1BG6A 1RM0A 4E2XA 2PLAA 4R16A 4RQTA 4ZJUA 1P77A 3MTGA 2JL1A 4UVHA 5L7YA 3KSZO 3C1TA 1QXSA 5DCYA 1LSUA 4MVJG 1VM6A 3W6ZA 1GQQA 4XA8A 3QVWA 3S1LA 4MKXA 2XF8A 1N8KA 3IP1A 4ZN6A 1XDWA 4AJOA 3BMOA 1C0IA 2GN6A 2PKQO 4OMUA 4BGVA 5FEUA 1VPDA 2IRWA 4J1TA 3ROKA 4MP8A 4DIBA 2VT2A 4CLOA 3VOSA 4J2OA 1FDTA 3ZHXA 2HJSA 1BRMA 1LNQA 3VZRA 3QE3A 4J9VA 3RASA 4E5KA 4DRYA 3RKUA 3BMOB 2JFHA 1B3RA 5F5NA 2O3RA 3W8DA 5JAQA 4DQUA 1LBEA 2OXIA 3QVTA 3KO8A 5DCUA 4PLCA 2D8AA 3FCOA 3G17A 2VTDA 1Z45A 4LISA 3NAQA 2Q2WA 1BDMA 2I6TA 2GPTA 1GYPA 4E5NA 1ONPA 2HMUA 2UUPA 3P19A 2Y67A 2YY7A 3EC7A 3ZW8A 3GNQA 4XRGA 1ZCJA 5EJ2A 1JN0A 4UEKA 4PVCA 1CWUA 2VZ8A 5EMHA 2GCGA 3PXXA 2XPCA 4F3YA 1VSVA 1PSDA 4QO8A 3T7CA 3T4EA 5KNLA 3QP9A 5TT1A 4EJ0A 4RDIA 1Y8RA 1PZFA 4IJKA 1EFKA 1ZEJA 1WNTA 4NBVA 4B3JA 4J2HA 3U9LA 3FHLA 3NT4A 3Q2IA 4FOOA 1SZJG 1E1MA 8ADHA 5KJCA 5L7TA 2VRCD 3JV7A 4XKJA 4YACA 5DOZA 1Y8RB 3MJEA 2DBZA 5IDQA 4BO2A 3HG7A 5I8ZA 5FF9A 1E5QA 2W2LA 1ZW1A 3FTNA 4J1QA 3GMDA 5L40A 5I7EA 1Q7CA 5JNLA 1VLLA 1FDUA 3OIGA 5HTOA 4XYLA 5CPBA 1W0CA 3I23A 3PI7A 3PDJA 4K6CA 4FPXA 1U9JA 3KB6A 1GUFA 1NM5A 4M54A 3QY9A 1E0DA 3NTOA 3C3XA 2Q45A 4UUNA 3A1NA 5DNAA 1FK8A 2VZ0A 3KZVA 1IY8A 2WD8A 4PRLA 3S8MA 2G5CA 3Q2KA 2ET6A 4ZQHA 3RC2A 4IBOA 3PHIA 1YRLA 4L76A 4W7IA 1PJCA 2WM3A 3LDHA 1T25A 2FRDA 3ZWOA 1NQTA 2P5YA 3DBRA 1NR1A 4LMPA 3WNQA 2WMDA 4J0EA 5ILOA 4U8GA 2VYNA 4E5YA 1BTOA 1NHWA 3IKTA 3GN1A 3INTA 4DIFA 2GR9A 3KEOA 4I08A 2JCXA 3PWKA 1BW9A 3ZHYA 1ISFA 4ALKA 2HMSA 3DBRB 1GD1O 3ROPA 4W4TA 3ZV4A 1NWHA 2HRZA 5THQA 3WR5A 4IINA 3JQFA 3VH4A 1ZMOA 1ZSNA 1GYRA 2XAAA 1E5LA 2HAEA 4F6CA 1YQDA 3L77A 4ALLA 1SAYA 4MVJP 4OKNA 2E82A 3FNGA 4CV3A 4EEXA 3F46A 1V3VA 2EWMA 4LCEA 3DOCA 4BL5A 4OQZA 3RWBA 1A9ZA 3JCZA 2CMDA 4RQUA 4AJPA 4B3IA 1XKQA 1I3LA 4CR8A 4L75A 2R00C 1ZFNA 4RVFA 3UOGA 1R4MA 1SMKA 1YL5A 3WTCA 4KDFA 2W4QA 2YQ4A 4J9UE 2DTDA 2UVDA 4Y6SA 1F0YA 4L0QA 4IDBA 3JQ7A 3TZKA 1XEAA 2AE2A 1HDZA 3VH1A 1R4MB 4D0RA 4DC1A 2NQ8A 4CR6A 3JD4A 3JYNA 5CDGA 3I52A 1ONNA 3BTOA 3PRJA 2NU7A 1BMDA 2VHZA 2GZ2A 3IS3A 4E30A 4K6FA 3JYPA 3JQ7B 1PX0A 3WWZA 2CZCA 1A4IA 5I9MA 3DHYA 4AJNA 5IZ4A 4N18A 2ZIZA 3V2GA 4YRBA 5C7IO 2YYYA 1DIGA 1KS9A 3ANMA 1JVSA 4Q3CA 1DEHA 8LDHA 4ND3A 2BD0A 5CPFA 4OHUA 1MC5A 1U1IA 3TFQA 1RKXA 1Z7BA 5BSEA 4ALJA 3HN7A 3GFGA 3EZLA 4O5OA 4CMBA 3SC6A 5U9CA 1H2BA 2G1UA 4IQGA 1YQGA 1VE9A 2EJWA 4BS9A 4J4BA 1UXKA 2DQ4A 2Y93A 1JU9A 4IS3A 4WNIA 4CV1A 3VKUA 3AUSA 4CMEC 3OETA 3W1VA 2QHXA 3QA9A 3JYOA 5BNTA 3LT1A 3DQPA 3O26A 4NFYA 4D3FA 4DLAA 5IJZA 1S6YA 3LT0A 3R0IA 1HDXA 4FD3A 3SVTA 4PG6A 1O0SA 4BO5A 3WYBA 3ZU3A 1YGYA 1ISMA 1D1SA 3EK2A 3H8VA 2I66A 4LMRA 3H4VA 3NGXA 3UCEA 4XZ3A 2WYVA 3AOEC 5FI3A 4PN3A 4BUCA 1D1TA 4P22A 1XHLA 4A03A 3AOGA 4O59O 2EP7A 5IN4A 1I36A 2DUWA 1NR7A 1UZMA 1MXHA 1KVUA 2O3JA 5TJ9A 4I9UA 1N1EA 1LSJA 2FZWA 4G81A 1LA2A 2EEZA 2Y68A 5ER9A 5A4DA 1A4UA 2Q1TA 3ZH2A 3PPIA 4FW8A 5JMPA 4CMCA 1YQXA 1WDMA 3PFFA 3OIDA 1O94A 4P38A 4K26A 1R0LA 1IZ0A 3PIDA 1V3UA 1YH3A 2HK7A 4QXMA 4ZICA 3G0OA 1KERA 2G76A 2AMFA 2ZTVA 3GNTA 3MJSA 1YBMA 1ZXLA 4JP2A 1NVGA 5JS6A 1HTBA 3IL2A 1W73A 2X9GA 3B20A 3MJTA 5DP1A 4B3HA 1YOVA 3NDJA 2Y05A 3AFNA 4RORA 3NEPX 3GH3A 3B6ZA 3I83A 1H94A 2DLDA 2B83A 2H6EA 5TJHA 1GCOA 3PLRA 3D7LA 4TMFA 4J49A 1MP0A 3OMLA 3DMTA 3NT2A 1VC2A 3H9UA 2Y1DA 3WLEA 2HJRA 3HB5X 3I9OA 2P68A 2OUIA 2ZK7A 3UHAA 2ZTMA 2D2IA 2CFCA 4D79A 1GL3A 4MVJM 5KKAA 5JAIA 3AJRA 3PHLA 2NQTA 2X22A 1VRWA 1Q2XA 3RJ9A 4BKOA 2O3TA 2RAFA 3JQ6A 5COQA 3TL3A 2BLLA 2AQIA 2IEDA 2ZATA 4GKVA 5EIOA 3GEGA 3FBTA 3WJAA 2O23A 1U28A 5JXWA 2Y1CA 1A72A 4WEOA 3M1LA 4CLDA 5JPIA 3PFWO 4GSLA 1ZEMA 2C82A 2BF7A 4BO4A 1R37A 2HK9A 4MO2A 4PLZA 4DLLA 1D3AA 1LRLA 1ZZEA 1QMGA 2B5VA 3QWFA 2O3UA 1GUYA 2YFHA 3ADPA 1PQUA 5A02A 1A5ZA 2CVOA 2Y1FA 1U8XX 2W90A 5KCZA 3ZZNA 3UCFA 4KUGA 1P1IA 3KUXA 1AUPA 3RJ5A 4HV4A 1QYCA 1YB5A 3QSGA 3GHHA 4HNHA 2CD9A 3DC2A 3RI3A 3GDFA 1KEVA 4WECA 2QG4A 4KTVE 2ZB8A 1Z6ZA 3WICA 1OOEA 1TT5A 1UXGA 4A2CA 3HFSA 1GCUA 1HE5A 2LDBA 3AUTA 2AG8A 3RIHA 4WOJA 1XCBA 1TT5B 3PEFA 3ROQA 4XDYA 1DFIA 3GGPA 3HADA 1QYXA 3WLFA 3TN7A 1I2CA 3AY3A 1X0XA 3GOHA 3HHPA 5T57A 4CM6A 3GDGA 4E13A 3FI9A 3H2ZA 4O6VA 1MFZA 1CETA 3PVZA 3GFBA 3OJFA 3VHRA 2YV2A 3SXPA 4RF3A 2E6UX 4MVJH 1J49A 3B1FA 1JQBA 3FWZA 4RVHA 4J1NA 5BT9A 1NPDA 2IODA 3TQHA 4G5HA 4BKUA 4QFDA 1LJ8A 4R41A 5DF1A 3G1TA 5CEJA 2OHXA 4TRRA 2Y0CA 1HZJA 1SO8A 4NNJA 4ND5A 5DCWA 3AM5A 3GAZA 3K31A 1K6IA 3PYXA 4TROA 4B4OA 4D45A 4IY1A 4TZKA 5JLAA 4CV0A 2PD4A 2XXBA 3FN4A 4AJJA 3BYZA 1YBVA 1P1JA 4H7PA 1ZXBA 3RUIA 2ZKLA 3GVHA 2VWGA 3DAGA 4FBGA 2ZYAA 3DZJA 2A4KA 2IXAA 3ZWPA 2FWMX 4N7RA 3HZZA 4E12A 2X9VA 2QRJA 4JBIA 4HFRA 4R1NA 4BKPA 5EINA 3BMQA 1NHGA 1NP3A 1DJQA 1HF3A 4PG5A 4CLXA 3X2EA 3WYCA 3BMCA 3I9LA 4WLOA 4AVYA 5BR7A 4R3WA 2NACA 3Q9NA 4U6SA 4XCVA 2X0JA 2RBEA 2PKRA 3HN2A 3BMQB 4J6FA 1X13A 5JCJD 5KTKA 1D8AA 3P7MA 1HETA 2DTXA 4NK4A 1WXDA 1J6UA 2NU9A 3IIEA 3ICPA 1C1DA 2DU8A 3BMCB 5DBGA 3NDRA 4R51A 1DFHA 4D44A 4HADA 5L9AA 4E33A 1V3TA 3L6DA 1KVRA 4BGUA 5JC8A 2FPIA 2PD3A 4DQVA 1YE3A 4F46A 1C1DB 3ZNNA 4CM8A 2LDXA 2NLOA 1UR5A 4EUEA 1ZSYA 4B4UA 4CM1A 2BI7A 4UVGA 5EERA 1GYQA 5H82A 3OEWA 2PA3A 1UP6A 1MG5A 2W2KB 2WSBA 3E8XA 1CYDA 1WAMA 4WLFA 4CM8B 3NDIA 4FJ0A 5G2OA 3LT2A 2AEMA 4GX0A 4AL4A 2FOIA 4L9RA 4OGWA 4WKGA 4LN1A 1I3MA 5JDIC 2Y0EA 4AJ1A 4E2WA 1P1KA 2UUOA 4FFNA 3DBVO 3PP8A 1ISHA 4R1UA 3OECA 2JAPA 4YCAA 1KEPA 3LYLA 3PQDA 5B4UA 4K28A 1XU7A 1UZNA 4IXTA 2VHVA 2A35A 1GQ2A 3E48A 2JHGA 1CEQA 3RUFA 5FFFA 3SX2A 3L9XA 2I9PA 1NFQA 3ZWWA 4GWKA 3VDRA 5KVVA 1PIWA 4QFCA 1P31A 2CDCA 3F6YA 5CAEA 3PJFA 3ZN2A 2EHDA 2F00A 5DBFA 1X15A 3I6QA 4ZGWA 4CQLA 4WCFC 2FN7A 1EK5A 2HKIA 3O38A 1K3TA 2AE1A 3GR6A 1WMAA 4EEZA 1AXEA 5I9LA 3UKOA 1JA9A 1VI2A 3EMKA 4BIIA 4ZD6A 5BNIA 4FQ8A 4OXNA 1PZEA 1DHTA 1E7YA 4OH1A 1LLUA 4Z3KA 3HFGA 2G82A 4GL4A 2NSDA 3COSA 3ZDFA 3MWEB 5A9RA 4HKTA 4Z3DA 4BKQA 4OL9A 3CSDA 3KHUA 4BV8A 3SLGA 4J4HA 3N74A 1JWAB 1Y7TA 4YEDA 1WP4A 1FMCA 1MV8A 4BMNA 2YV3A 4RZIA 3KOUA 1D4FA 1KETA 3PGXA 3I6IA 5L95A 3VPSA 1J0XO 4NH4A 5U1PA 4FIZA 1HL3A 4G65A 1NAHA 1QP8A 3DZGA 4YAKA 2C59A 1B26A 1L7EA 3IJPA 4AICA 3CPSA 1JLLA 3S2GA 3F47A 1HE3A 3CIFA 4NI5A 1HDGO 2B5WA 1Y5MA 4L8VA 1JKIA 4OOEA 4TVOA 5C3MA 4A27A 1LRKA 1MC4A 1PL7A 1UJMA 2GN8A 2NUAA 3LQFA 4HY3A 4RVUA 4A0SA 1RJWA 1WMBA 2HLPA 3MTJA 5ITWA 3CKYA 4IS2A 3G79A 3RC7A 2J5KA 1VL6A 2Q4BA 3ZWBA 1Y9AA 2BFAA 4RPGA 4EGFA 1O6ZA 4AJEA 4BNMA 3JQGA 4I9NA 4YTEA 4MOWA 3WJ7A 3FNEA 1EMDA 4RF5A 4BO1A 3RUDA 4WCFB 4BNYA 4CMIB 1C3VA 1E92A 4TRJA 4TSKA 3PK0A 1I33A 1CDOA 3JQGB 4CL3A 2PR2A 5ENVA 4OSPA 5JW6A 1HKUA 3GQVA 4ILKA 3RU7A 4IJUA 2AXQA 2NNLD 1E6UA 1ISIA 1I2ZA 2YJZA 4B8WA 4CM7A 2DUUA 1RM5A 3VPGA 4O63O 4YT5A 5KJ6A 2H5LA 5C5IA 1DC5A 1E7QA 2Q2VA 3FNFA 3WGOA 1DBVO 2POQX 1PS9A 3WGZA 4YPOA 1DHRA 4JXKA 2I3GA 1SOWA 2D5AA 4QT0A 3JQAA 1Z74A 4KDEA 2FZEA 2J3IA 2OL4A 2PWZA 1NXQA 4WCDA 2FR1A 4L4RA 2NADA 3JD3A 5MDHA 1P3DA 1SEVA 4PZCA 3GF4A 1YB4A 3FTPA 4OJNA 1CQJA 4FGWA 4KWHA 3MJ4A 4N5LA 2BFOA 3GNSA 4LCJA 4NBUA 3RBXA 5DDIP 4IQ0A 1BXZA 1G0NA 1GQYA 1HYHA 3QIVA 3ZNOA 4PLVA 3ASUA 3BTVA 3GZNA 3KBOA 2JFGA 2AQ8A 1E7MA 2HUNA 2VUUA 3RC9A 1ZJYA 1S7CA 2AG5A 1DLIA 1GUZA 4ND1A 2V6GA 4FR5A 1M2WA 3GHYA 4DIOA 1QSGA 3OJLA 3DFUA 1Z75A 3NTQA 4NIMA 3GZNB 4Y6RA 1V0JA 4UVIA 5EL0A 3E03A 3CMCO 3NTRA 1IL0A 4PFJA 2RH4A 4FOSA 4CLOB 1Y9EA 2B35A 1LDBA 1GZ3A 3FBGA 2GSDA 1DPGA 3ZU5A 3CH6A 3ZWAA 3HJAA 2DFVA 3H6KA 1PJSA 1YWGO 2HO5A 4L74A 3K92A 4YWJA 4A26A 1OBFO 3C7CB 3DBHA 4XQEA 4YRAA 3IUSA 5KVQA 2BHLA 1P0FA 3JQFC 3ZNPA 4E5MA 1MXFA 3GN2A 1LUAA 5HM8A 3DBHB 1DRUA 1TA4A 1ZIDA 2DBRA 3QLJA 1KEWA 1DAOA 4GPD1 3M2PA 1Q0HA 3ZV5A 2ZB3A 4CMHA 4WLEA 3QVOA 3V1YA 1LDNA 1PWZA 1ZO8A 2DC1A 1E3EA 2Q1UA 4GQAA 3ORFA 1KEUA 1R4NA 4DWVA 3LLVA 5ENDA 1I10A 5F1OA 3DZIA 1U3VA 3H5NA 1P9LA 2B0JA 1Q1NA 1LDEA 3KETA 4FS3A 4ZQBA 5K6AA 3MOGA 1HE4A 4BNLA 4JJGA 2E49A 3WGIA 3W4JA 1PJLA 5JYDA 1I30A 4EW6A 1DIHA 4BNVA 3JQDA 3DWFA 4QQRA 5IXYA 1DLJA 3DAPA 2FR8A 1Q0LA 2B4QA 2VWPA 3ZWVA 4JK3A 4B7XA 3ZNQA 3H9JA 2FR0A 5F21A 5JY1A 3KXDA 1DIRA 4YJFA 1YJQA 3VC7A 4MINA 3UXYA 3MCVA 3CE6A 2PV7A 4OIMA 2RIRA 3PLNA 5ER6A 3C8MA 3E9QA 1RYDA 4BO7A 3RUHA 4PIVA 3DFZA 4WLUA 4IGFA 4MVJE 4RO0A 4NBWA 4EYEA 4UEOA 3K73O 1Z7EA 2FP4A 4D0SA 4ND2A 1GFSA 3NJ4A 4U6QA 2VQ3A 4GX5A 3U3XA 4IMRA 4YJDA 1MG0A 3A4VA 4RVGA 1BWSA 2JD2A 1BW9B 2PGJA 3D4OA 3BHMA 2P4HX 5KJ1A 3G1UA 3VTFA 4CMKA 2VHYA 2C2XA 3PWSA 4CM9A 1EDOA 2D3TA 1AHHA 5C37A 3LZ6A 5TRTA 5F1PA 4JBHA 3ONEA 4JJFA 1LLCA 1TI7A 2PGLA 3WQRA 2W98A 3VKVA 1Y5RA 1GZ6A 1O5IA 3VPFA 2FSSA 1PL6A 3I9MA 4Y6PA 1NWCA 4N5NA 2O2YA 1NQ5A 1LC0A 1OAAA 1GZ4A 4BV9A 3R6DA 5DULA 4CV2A 4JX8A 4YB8A 5T8KA 1TXGA 4I8XA 5T67A 3U49A 4DPLA 3JYLA 1BXGA 4PLFA 2Y66A 3FPLA 4MDHA 1GPJA 1PGPA 5L53A 1CJCA 2C0CA 1Y1PA 2B4TO 3TJRA 4W9NA 3W8FA 1C14A 1G1AA 4WPGA 1XQ1A 3WGTA 4ZHSA 3QVXA 3V1UA 4KOAA 2HK8A 3A28A 1T2CA 2I76A 1A7KA 1BXGB 3RBZA 4E6PA 2EJVA 3LU1A 3WGQA 2O50A 2FY8A 3U4IA 4IDEA 1LSSA 3EVNA 4QTZA 3D5QA 2ZTUA 4GVXA 2YDXA 4BVAA 1GR0A 1ARZA 2QRLA 2GYYA 5G4LA 2FPGA 1E7WA 4AJHA 4IGEA 1QV7A 3V8BA 3ST7A 1KC3A 2W2LD 3KYDA 1LDYA 3Q11A 1QYWA 4B7CA 2X58A 4P4NA 5LCXA 1JWBB 1M6WA 4ZQEA 1WZIA 3DMTC 3W4KA 2ZTLA 4B7UA 4DQXA 1T2AA 3L4BA 3ULKA 3KYDB 5IZCA 3CEAA 4E2YA 3PHHA 4HNGA 4AJKA 1P1HA 1UXJA 2O3SA 2OP1A 1AGNA 2DAPA 2XXJA 3OH8A 3EYWA 5JFOA 5JYEA 1EBUA 2C07A 2ILTA 1LQTA 2OBYA 2WWRA 4E5PA 2JFFA 4YJGA 1C0KA 3RU9A 2B36A 3ZWYA 1UXHA 1X0VA 2VNSA 4BQRA 3LF2A 4FFLA 5U4QA 4CUKA 4LVUA 2NU8A 4GAEA 1EEHA 2PGDA 4BNIA 2VYND 4UAGA 4YAGA 4YJGB 3FSRA 1ISGA 4XR9A 3OQ1A 4MP6A 1RM4A 1NX6A 3TF5A 5I7VA 2IDZA 5JY6A 2O4UX 2P5UA 5FI5A 1EDZA 4XJTA 3WMWA 3BAZA 4TVBA 1C0PA 3WQSB 4XQGA 2ZCUA 3EGOA 4R5MA 2X23A 4PLYA 3DEYX 3ON5A 2E48A 3L0DA 5JE8A 3JYQA 3AWDA 3UW3A 5F1KA 4J1SA 1HDRA 1YKFA 1QLHA 5A06A 1UAGA 3I9KA 2A94A 2YDYA 2NM0A 3F3SA 3GMSA 5IDWA 1EVZA 3GUCA 4A7PA 2HMVA 1L7DA 4IM7A 3WFIA 1XGKA 3DOOA 5HA5A 4U5QA 1QV6A 1ZK0A 2I5PO 3NYWA 3UVEA 3D5TA 1YOVB 4MP3A 4ROSA 4MJLA 2G17A 3LLSA 3WGGA 4EBFA 1Z73A 2DBVO 5LC1A 5IFLA 5A03A 4M87A 4E3ZA 3FPCA 3U09A 3EZYA 4PG7A 2G0TA 3WG9A 2WEKA 4Y8VA 3RBVA 1FXSA 4Y67A 3F4LA 4DTIA 4LVCA 3OJ0A 2RHRA 4LRSB 3OF2A 1FF9A 2EKPA 4PLWA 1M66A 4JIGA 4RPLA 4BB5A 1AXGA 4NMHA 1YL7A 5IDYA 3M6IA 2P2SA 3PZRA 4R4JA 1HWYA 4H16A 3GPDG 5DBIA 3RKRA 3NKLA 3GVIA 3ICCA 1R0KA 3DR3A 2V65A 4DYDA 5JDCA 2JCVA 3D3EA 2JD0A 3ONDA 1IZ9A 3L4SO 3DL2A 2OFPA 2YHUA 1KY5A 4JNKA 4J3FA 1QRRA 4X54A 2IYPA 1CIVA 2X5KO 1VL8A 2HMTA 5I7SA 2DPHA 1B3BA 3QRWA 1T4BA 4GGPA 5G0SA 5IXSA 3AI1A 2HCTA 1N5DA 2Q99A 1A7AA 5BSGA 1MGOA 1LTHR 4M8SA 1JAYA 1E6EA 3BXXA 3IUPA 2GD1O 4RVDA 1R0SA 3DONA 5DZSA 1GDHA 5FYDA 4INAA 4QEDA 4RZHA 5AXAA 4RCVA 3KSUA 3KM0A 1KBZA 2QZZA 3F1LA 1PJ3A 3ROMA 1U4OA 2Z1MA 1VSUA 3V2UA 1NYTA 1GTMA 3U62A 3UUWA 3VH3A 3WSWA 4CLEA 1WVGA 1PTJA 1Y8QA 4MIYA 2D5CA 5B37A 4DC0A 4XDZA 5HS6A 1ZK3A 3TNLA 3NV9A 2YUTA 3JD0A 3ZCXA 2HRBA 3NJ8A 1ZBQA 3NGLA 1B8PA 1Q0QA 2VOEA 3Q0EA 3RUAA 1U3UA 1Y8QB 2SCUA 2Q1WA 3PJDA 4B8ZA 1U2GA 4XEHA 2B37A 4C4OA 4O0LA 3OQ6A 4TKMA 3I9JA 5BSFA 4DPKA 4RPJA 3Q9UA 4DPMA 2WJPA 4R1TA 1M76A 3AY6A 4I5EA 5TF4A 1C1XA 1I2BA 5DP2A 5LDHA 1Q7GA 4N5MA 3TWOA 5KWEA 3DOJA 2GUGA 4ND4A 4R9RA 2ZQYA 1E3JA 4XWYA 1C1XB 1ZSVA 3AFMA 4NJOA 1O8CA 3AU8A 1ZVMA 3WTBA 3DB2A 4IIVA 3TSCA 4W82A 3ZV3A 4PCVA 1CERA 4NJMA 3WDSA 2X7HA 5LDGA 5ES3A 4Y9DA 2UYYA 2DFDA 2UV8A 2FHSA 5TC4A 1WDLA 2DBQA 1HSOA 3BHJA 3RUEA 4MKRA 5CEEA 4MPDA 4K1LA 1T26A 4NJMB 3LC7O 4WEQA 1B8UA 2HMWA 1DB3A 4OO3A 3ZW9A 1ENPA 3VZQA 1T4DA 3QWIA 3UFXA 1E3LA 1ZNQO 2NTJA 3GRKA 4IDDA 5ICSA 1XQ6A 1PWXA 5CP8A 4WLVA 9LDTA 4FJ2A 2F1KA 2P4QA 2GZ1A 3ZWCA 1GV1A 2P9CA 4NBRA 1SBYA 2DTEA 4F6LA 1Z82A 4ZA2A 4J4TA 4BO0A 4II3A 1DRWA 1DO8A 3F1KA 1OFGA 1T2FA 4R5HA 4XYEA 1YDEA 3KV3O 5L3ZA 5AOVA 4HXYA 4XB1A 5A04A 2A9FA 4NHEA 1C0LA 5JSFA 2O3QA 4UUOA 3E1KA 4D3SA 5KOIA 5A1TA 1NQAO 3K96A 4MVJA 5L51A 4RV9A 4LGVA 1U4SA 4XRRA 3K2EA 5A9SA 1BDBA 1JKJA 3EHEA 3OM9A 1MLDA 4XD2A 5EESA 4Z0HO 3JQBA 1JW9B 4ALMA 2BRUA 2D0IA 4FSHA 1CF2O 5CEFA 1PGQA 3PYLA 3O4RA 4ESOA 1PR9A 1EUZA 1ZUD1 5DN9A 1P1RA 5A9SB 1KYQA 2HQ1A 3KYCA 5TIIA 3AUUA 1GY8A 4ITUA 1JVBA 3U4HA 1B15A 4M49A 2JKVA 2EW2A 2VNAA 3A14A 4ZRNA 4EUHA 1ULSA 3GAFA 1ONOA 2PZJA 3DBLA 4QUKA 4LK3A 3KYCB 5C7LO 4Q3BA 2CVQA 4DL9A 3AY7A 3OJEA 3ZV6A 3E9NA 2D4AA 1N9GA 3QV1A 5T64A 3DBLB 1I8TA 4I1IA 4KMSA 4Z0TA 5HS4A 1XSEA 4PLPA 4HFNA 4MIEA 2PH3A 4GSKA 3I3OA 4YT4A 3FWNA 1HLPA 5H81A 1SPXA 5H83A 3GG2A 4R1SA 2Z5LA 5I8WA 2ZQZA 1N9GB 2O7QA 3TZQA 1WLYA 2Q3EA 4XYBA 5B1YA 3DHNA 3QHAA 2EGHA 2Y1OA 2V6MA 4E4YA 2WE8A 4HX5A 4YAEA 3P5SA 1JAXA 3D64A 2A92A 2YZ7A 3UICA 3L07A 2P9EA 4G2NA 4YQYA 2IXBA 3HDYA 2NVWA 4PLTA 2EW8A 4EITA 2OMEA 1G0OA 4PZEA 1IOLA 3LC1O 3A9WA 1MUUA 2AEJA 3E18A 3QJ5A 2CVZA 2QQ5A 2OP0A 4JN6B 3BMNA 4DA9A 1HRDA 2QIOA 3B70A 1O95A 2ZYDA 3FR8A 1PJTA 2I67A 2P91A 1KIFA 1CQIA 3U4DA 4CQLB 1B16A 4D46A 5KJFA 4Z9YA 2X86A 5KKCA 1LU9A 2X9NA 4NFSA 1HYEA 3BMNB 3L6OO 3D3WA 2BI8A 3FNHA 1DC6A 3ZGYA 3DMYA 3U4CA 2VYVA 5IF3A 4QSMA 4DMMA 1E3IA 2GDZA 1DC4A 1H6BA 2DT5A 1EE2A 3GPIA 4WK6A 5GZ6A 2AQHA 1HSZA 1RYEA 2VTEA 3IKVA 4DMLA 4DGSA 2YFQA 1HDYA 1IHXA 2I3AA 3CZMA 2PZLA 4BB6A 4NU6A 1ADFA 2EF1A 4CMJA 1HDOA 2E37A 2QW8A 3OP4A 5JO9A 1YJ8A 3LK7A 4MVJD 1H5QA 1UDBA 3WGHA 1R12A 4OXYA 3S2EA 4BNWA 1W4ZA 4A73A 3OQBA 1I01A 4CUJA 5FWNA 1E1KA 1TB4A 4BO3A 3F4BA 3AM3A 3GUYA 2C5AA 3OA0A 1EE9A 4GI2A 4UULA 4URFA 3UF0A 3OIFA 1ZK4A 3VVBA 1X7GA 2X1HA 3E82A 1VKNA 5IG2A 1B2LA 4RF2A 1HYGA 2R6JA 4Z6KA 4CR7A 1DC3A 3CUKA 5I7FA 2H63A 3K6JA 4CQMA 4N54A 4GH5A 3ZHBA 1HEUA 2QYSA 2X5OA 4FDAA 5T6BA 3Q1LA 1LEHA 6LDHA 4D3DA 3T4XA 5A3JA 3ABIA 3ENNA 2ZJ1A 1EUDA 4LSWA 3UN1A 4RLSA 4CQMB 2DM6A 5BSHA 5K0ZA 4XYGA 5TT0A 5B4VA 7ADHA 2YW9A 4TKLA 3PIIA 4UVEA 2C29D 4E21A 1ZK2A 3G3EA 1LDGA 2CY0A 1I24A 1LI4A 1NFFA 2Z1NA 3D1LA 4KWIA 5CG1A 4JCOA 4RGBA 3SLKA 3STHA 1B7GO 5A5EA 4OQYA 3RSHA 3PQEA 2UAGA 4FFMA 4TRNA 3ZWNA 4D42A 1P33A 3D0OA 3EW7A 1P74A 1O9BA 1E7SA 4PG4A 4TQGA 1ZKMA 2PZKA 3K2BA 1XA0A 2BGKA 2HDHA 1XR3A 3ZWXA 4I5GA 1T2EA 4TRMA 1T24A 1GEGA 4FFRA 4YDRA 2TMGA 2J3HA 4EDFA 2JD1A 3H5RA 1K0UA 4LW8A 3JSAA 3TOZA 5KIAA 4YVFA 3W8EA 5JBIA 1X7DA 3IOYA 2Q49A 2AHRA 1OC2A 3NT5A 5T5QA 1V6AA 1XG5A 2GN4A 2X5JO 2IEBA 3WYEA 1PQWA 1HLDA 1DFGA 2VHXA 3JQAB 1A71A 3PDUA 1XLTA 3WBBA 2X4GA 4ZVVA 5TQVA 5HRUA 1PGOA 4EI2A 4YAIA 5ITVA 3HB4X 3IJRA 4C7KA 2BKAA 5IDXA 5K6AC 1IPFA 3O8QA 4EZBA 1M6HA 1E3WA 1KVQA 2VRBA 1VL0A 3WX0A 5EN4A 2J5RA 3DZFA 1MX3A 2VYVD 3EDMA 3JD2A 3H9GA 1NPTO 5C7OO 4GLOA 5L4SA 1TVEA 2NVUA 4DBZA 2RHCA 4L4SA 4UREA 3KYBA 1E3WB 4IDCA 3R1IA 5TS3A 2B69A 2IE0A 2J3JA 4WUVA 3AW9A 4RPKA 4RLHA 1YXMA 4FFOA 2X6TA 1O89A 4A10A 1LLQA 4ZRMA 2E4AA 2NVUB 3RFXA 4QX6A 3VPHA 1XU9A 1SCUA 4YT2A 1G6KA 3UCXA 4CPDA 1N7GA 1BVUA 5A05A 4KUEA 2QRKA 1DOHA 3S55A 4CUZA 3DZHA 2FMUA 1ENYA 3K30A 3O9ZA 5JCXA 1HE2A 1TT7A 2DVMA 5AYVA 3V2HA 3DAFA 3TZHA 4KTTE 3MZ0A 5TX7A 1LSOA 5JAZA 2DKNA 4LRTB 4PLHA 1EBFA 3U0BA 4CQMD 3CMMA 3PHJA 2WYWA 2C2YA 4E32A 1WW8A 4BNZA 1Y81A 3A06A 4BNHA 4XR4A 1J4AA 1CRWG 1GPDG 3AI3A 3QWBA 3TRIA 4NDNE 4IDFA 2JJYA 4M89A 4XIJA 4YAJA 1R4NB 1E3SA 4J7UA 3I4FA 1JTVA 2BFMA 4GKBA 2VWQA 5T8KC 3GVCA 4J43A 2TMDA 4L73A 4P8RA 2D1YA 3R3JA 2P9GA 2X8LA 4W9NC 2Y0DA 2O7SA 3W4IA 1IYZA 5AVOA 4E0BA 5B12A 1QG6A 3OJOA 4JLWA 3JQAD 5COAA 4RVSA 4FGSA 4WGGA 4XGKA 3KLMX 2ZB7A 1NBOA 3H9EO 5BQFA 5GMOA 2AEFA 4YR9A 1GU7A 2J8ZA 1PJQA 4KP7A 5G0VA 3H7AA 4YJFB 4PLGA 3UH1A 3WNVA 2NU6A 3DHEA 3VAZA 4IMPA 3C1AA 1R6DA 3QQPA 3KTDA 1ADGA 1DXYA 1AN9A 3L4BC 4Q39A 4OM8A 5IZCC 1H2HA 4L4XA 1X1EA 4GX2A 1FDVA 1NPYA 3NUGA 3OSUA 4Q3EA 1RWBA 1P0CA 5EPOA 4BGIA 1E1NA 1F06A 1LRJA 1P44A 4BQPA 3ASVA 4FC7A 1XELA 4PZDA 4O1MA 3WQQA 4BNJA 5EQFA 4RL6A 5F3RA 2J3KA 3EY4A 5L7WA 4J0FA 3B1JA 3HQ4O 3INRA 1QYVA 2HU2A 2O48X 3V1TC 1DSSG 3K5PA 2EIHA 2VUTA 4WASA 1PS0A 1A9YA 2OGUA 4PVDA 1F14A 3RVDA 4R68A 4YRDA 3CTMA 3GGOA 5G0UA 1ADBA 3ZU4A 3AU9A 1MA0A 3IDSA 3GVXA 4XYMA 3BIOA 4MKZA 1ZH8A 3P2YA 1GADO 3OHSX 4XX0A 4ID9A 2EGGA 4PRKA 9LDBA 5L4NA 3MWDB 4GWGA 1E7RA 3DXFA 2Q1SA 4NG5A 3RC1A 3PZBA 1MFPA 4U0KA 2GZ3A 2HSDA 4UVDA 4R69A 1HZZA 2UDPA 1EK6A 3FRJA 3KLPX 5G0WA 4GGOA 3QW2A 1K6XA 1XIVA 3X2FA 4CM3A 1IB6A 1QR6A 5HWSA 1T2DA 3H5AA 3VH2A 4II2A 4IPTA 1NNUA 4K9DA 3DDNA 2Y99A 5CFZA 4WOKA 2Y1GA 1ISJA 1LC3A 5A3VA 2EXXA 3VZSA 4WNCA 3OFSA 4OAQA 3AK4A 1K89A 3Q3CA 1V8BA 3H3JA 3I1JA 4IZIA 2Z95A 1Y6JA 3JQ8A 4OXKA 1H93A 2CF6A 2FSVA 4E2ZA 3GT0A 3MEQA 1GV0A 1R66A 4Q3NA 4YYZA 5JDCC 1LDMA 5CDSA 4DUPA 4JROA 4UEJA 4BMVA 5CDTA 4KZPA 2J6IA 3JQ8B 3PJGA 2EERA 1ADCA 1JDJA 3VTZA 1KY4A 1OC4A 3DO5A 5L4LA 4DREA 4P4LA 4GVLA 1FDWA 4CMAA 3E9MA 1PJ4A 1EUCA 2OORA 3H9QA 2R00A 3WS7A 4YJHA 1D7OA 3PJEA 2R2GA 1YS4A 2QZ9A 3GDOA 4YBZA 1B0AA 1ORRA 1KVSA 2AA3A 3BTUA 3FR7A 3WMXA 4U7WA 2EV9A 1PGJA 4FB5A 1YB1A 4KUHA 3PWZA 3GEDA 3JQEA 4CM9D 2NVBA 4YJHB 1R15A 4C7JA 4CLHA 3ITDA 5DOVA 4NBTA 4FJ1A 4BO8A 2AQKA 3IQDB 4YA6A 3U5TA 2NV6A 2DPGA 2VUSA 4RF4A 3ADOA 3ETEA 5KJEA 1DDOA 3BTSA 5J23A 5AXBA 2ZJ0A 1B14A 1UDAA 3SJ7A 1SC6A 3EUWA 4RPHA 2OO5A 3BA1A 1L1FA 4J7XA 5JMWA 4FFPA 4GMGA 2C20A 1PU2A 2CSUA 1SNYA 2BGLA 3EAGA 3K9QO 1UDCA 3ANLA 4NU5A
chains in the Genus database with same CATH superfamily
2X9LA 3JVEA 2P7HA 3CJRA 5DHQA 5ALRA 1FMTA 4G8JA 1NNSA 2XA9A 5EVJA 4JGIA 4UJ3A 2I2AA 2JIZD 5CA1A 2JKZA 4CMEA 1NOKA 4DT1A 4F8JA 3FTFA 2ERYA 2EG5A 3KQWA 2JJ1D 4G0XA 4GXNA 4AG3A 1JQ5A 2EZ4A 3WK8A 3V4LA 1OV6A 2GNAA 5K09A 1J5PA 2Y4NA 3IAEA 4ZPXA 5C4MA 2AUMA 1OLXA 3AR7A 3CLKA 1IJBA 1BHSA 1BU8A 3WXBA 5AJHA 1G1MA 2GEBA 5ALNA 4AUMA 2BMAA 2BFPA 5HIMA 3DTYA 4JYPA 3T5CA 5E6SA 2XUGA 3CGWA 3KJGA 4FLMA 4H0NA 1DMSA 4NJEA 3MRSA 2IFTA 2H4JA 3C8HA 1G2OA 1JT2A 2HHCA 2QX4A 3HE3A 3IIMA 4WCVA 4XIGS 5C31A 3RYIB 3C24A 3RQIA 4BAZA 1OI4A 3IQHX 4LNHA 1U7TA 4HWKA 4QGGA 4OA5A 1CRPA 4L1KA 2IXDA 1SUFA 4Y98A 5AM5A 4AZ0A 4O2RA 5C32A 1V41E 5D6OA 2XDYA 2JJQA 4KQ1A 3TUZC 1JB1A 3NW9A 4IF6A 4DMRA 2DR2A 1XJQA 3G2HA 4G0UA 2C9CA 3R3HA 4BMOB 1GVHA 2UZAA 3PDIB 3PDHA 1QIHA 5JCJA 3NEYA 1CULC 1F3LA 4F85A 5CTAA 4AJLA 2XGJA 5BN4B 1L5NA 1IPHA 3GPBA 1NU8A 2EFCB 4GLBA 3CRRA 5JSYA 3UXEA 5CA0B 2CLCX 4E15A 3E27A 5JPCA 1WDKA 3ILVA 5CT5A 1GSIA 4NOJA 3C4VA 3E9ZA 4YO8A 4Y7DA 2QQFA 3ZDXB 1SBCA 3BCRA 5KNDH 4JVNA 4KO4S 1PR3A 3KUDA 4IO0A 4WKPA 4L07A 2XI4A 4TV8B 4ND7A 1TZMA 1A98A 3UK2A 4AF6A 1U1FA 1WV1A 4D8WA 3AXTA 4OSOA 1U5CA 3PLAE 4TXJA 4UM8B 3F5SA 1Z0ZA 2B8TA 3GJTA 4UUMA 3WK6A 3DBOB 5HGXA 2NXEA 2ZS9A 3K5WA 4WL0A 3NQ41 2W8ZA 3VSAA 2NTNA 4RJTA 1JE1A 1YUBA 1UOQA 4JSTA 1RAIA 2BFNA 1V2GA 2VRWA 3ELWA 2BFBA 4UATA 3KCNA 5DT9A 4CHGA 3LA8A 2JI6A 3DOEA 3WHPA 4NWIA 2ORYA 3KTOA 5CG2A 2PS0A 2QUKA 4ONEA 1GIAA 3ANXA 2G9VA 2NSYA 3I5MA 1Q7RA 4A8JB 1G18A 5FA5A 4EYSA 2IS6A 2H1SA 1HDEA 3GT7A 5GY7A 3BE5A 1CZLA 3P1JA 4MMYB 2H1IA 3C70A 4AF7A 5K99A 5H7XA 1TYZA 2IU0A 5ADVA 1WA5A 4WBNA 2UXBB 1Z6QA 2ATEA 4GSYA 2CLEB 3SQLA 3KQOA 2WV9A 4M86A 5HW0A 3KXPA 2B4RO 4DJJA 1SB9A 4KXUA 3GJXC 1TD1A 4R3NA 2FPPB 1WW3A 1KZ9A 2CNBA 2VR1A 3INYA 4JC4A 1HUQA 1T1SA 3GOQA 5ECGC 4H31A 4HDKB 1NULA 1KSGA 4A16A 4UTRA 2YHIA 3F78A 4BNTA 5KHOC 5AJXA 2REOA 3ENZA 4OX9B 1UINA 3IHKA 3VR6D 2WU3A 2PBFA 3M1YA 1AS2A 3EXEB 2WWVD 5F9FA 4X66B 2C57A 1TMGE 4CM4A 4CKYA 1DJNA 5TEWA 5TQJA 1DKNA 4MWDA 2LD4A 1PQPA 2O0JA 4M98A 2IZ7A 4B6PA 4MK4A 4N03A 4AFNA 2ZU0C 1P5ZB 3GBSA 3GVPA 3OBBA 4PGMA 3M3DA 3I4CA 4GPEA 2PXCA 4BFCA 5BQ3A 3T9FA 1DT3A 3LBFA 1OPRA 5SZKB 4AO7A 2J5QA 1IULA 4HS9A 4JKYA 5IKEA 1IOZA 4QHTA 3RS9A 2HSWA 3UGTA 2FPMA 4AW9A 3W5BA 1Y6GA 2I91A 4KE7A 4M4SA 3REOA 3SVZA 2IUTA 3K09C 5BRNA 2E4UA 2WD7A 4B4DA 4ZJZA 1M7HA 2C54A 5E4JA 2VTBA 3RUCA 2CXQA 2WMNB 3CPEA 4CTJA 4ZZIA 3VFDA 4XB2A 1GAEO 1H9AA 3QLVC 1WWKA 4KAAA 4EFDA 1I7SB 4J90A 1II8B 1ENZA 1YDWA 5D85A 5FV4A 4RKRA 1DRVA 1U3CA 1XROA 1JHXA 2IYYA 1E3MA 1QFSA 4E1VA 2XLCA 3QK7A 4NQZA 1A96A 1W6UA 1ZUHA 2HY7A 5CYOA 3DLBA 4K0KB 2V9PA 3MMXA 3F3MA 3LVQE 2I65A 5BSKA 3K0CC 3AVUA 3BH7A 1QH8A 3T7EA 4JQCA 4RBNA 3A05A 4AMYA 1I5RA 2OENG 2EQAA 1OI2A 1SB8A 1YBFA 1NXSA 3LD9A 1S3IA 2JHFA 3MGCA 2BEWB 2C88A 2O20A 2CKDA 3EJ6A 3GGDA 4YS6A 3ZHZA 1GTL1 1J1UA 3E22B 3I2IA 3KEMA 1PV1A 1NXPA 1PZHA 2JHPA 4BVFA 1IUOA 1WS6A 2VKQA 2W93A 4DBLC 2FPOA 2AN3A 1FQOA 3MGGA 4PFKA 5IKPA 1JFVA 2EHJA 2C3UA 3GRVA 2EG9A 4TL6A 3FZNA 3T9BA 1T1RA 1C3LA 3G13A 1JZTA 1ZGBA 1V9LA 1JHPA 5HQJA 3NHKA 4AJIA 5LQJA 1IXKA 1UBJS 3S2FA 5FWXB 1Z38A 4BWYA 3MQ2A 1M2NA 1RRPA 3DP9A 5I9NA 3VR5H 4ZI3A 3T41A 3HY6A 2F62A 2ZFUA 4DWWA 3BS4A 2HGZA 2J3EA 1IVNA 3DEFA 3M1AA 2C98A 2OYCA 1X8XA 5DNCA 4QU0A 1SU7A 2IY9A 1PGNA 3JQ9A 2ZYGA 5M7EA 4UUAA 1DL5A 2G8LA 3UGKA 5ESDA 4BCCA 1VZ2A 1RM3A 2F3SA 5CXQA 1C7QA 3TZCA 1EP1B 1TTHA 1JHOA 5E9JA 5ITZA 1E3DA 4S04A 4UHBA 5FOSA 4H18A 2ZWAA 3OZWA 3TW8A 1YA6A 1UZLA 1U0SY 4I9FA 1UC9A 2WT8A 3LPAA 2QBYB 3KQUA 3C3BA 1PEAA 1YS1X 1UUFA 1TYAE 2ZCVA 4ZDIA 1TM7E 2YWBA 2O2EA 1CFZA 4ZODA 4CLRA 2QXTA 4QTTB 4Z9BA 1KFJB 2H07A 1X14A 2P2ZA 3EIEA 1IBKB 4FZRA 1LI5A 1KOJA 3CX8A 4I5FA 1EJ6A 2GESA 3ZGVA 3OE7A 3A6FA 2ZZKA 4M1QA 4W8HA 3TFOA 3IAUA 3DE0X 4Q3DA 2AS0A 1LPAB 2IYZA 3C74A 3FOAA 4X61A 3D3JA 4HSEA 2N1MA 3QWHA 5BNFA 4C06A 2WZQA 3MWKA 2QYTA 5DASA 5J2TF 3VJRA 1P9NA 1AC5A 4DVJA 3BSWA 4RFSB 2R8XA 3TI9A 4DM4A 1JAIA 1H6DA 2DKOA 1DIBA 3PPXA 4PHFA 3I2HA 4Y0NA 4A6XA 3DFFA 4AY6A 3ZGXA 2PX4A 1L5ZA 5K8LA 2P9ZA 2P8SA 4L22A 2R7MA 3IBYA 3GC6A 2LNDA 1R6BX 1EFLA 1NTOA 3E5RA 3N86A 3TZ6A 3BQNB 2WYUA 5DRYA 4C7OA 1DTWB 1E6WA 2XUZA 1GGKA 3N8KA 3D9QX 3GK3A 3AUYA 3E3LA 1Z16A 1XMXA 3ZZ1A 4BLRA 1MB9A 4KRGA 3P4XA 4R8VA 2ABWA 1EZ4A 3BH6A 3PHGA 4B3BA 4CWAA 2H4FA 1EK0A 2UVQA 3CINA 3DCJA 3A1VA 4LPKA 1W35A 4X3PA 4EUNA 4LJRA 3UJ6A 4IGKA 1YRQA 5L3QB 1PDWA 1U7HA 3F8SA 5CLGA 2QRQA 1G19A 1U2SA 2ROQA 3L1JA 2ZI6A 1B1AA 2ODAA 3OA2A 1WO8A 5EMJA 4QO7A 3FUWA 3IDFA 1RBMA 3CLSD 4GDMA 3TVDA 3UT5B 4BXOA 5IJXA 3AILA 3E5MA 1EQUA 1UBMS 2IHZA 2IPAB 3PGJA 1GLVA 4G5GA 2DWQA 2O0LA 1DKQA 3L84A 4CJXA 2GAIA 1BC5A 1PR4A 1RYFA 4O4JA 4R01A 4QM7A 5LB2A 4AAYA 4D43A 3I2YX 3W7AA 1OASA 1ZGCA 2GN9A 5G4KB 4RPCA 2DX7A 4ETIA 3NP9A 1QHXA 3ZXIA 1MRZA 1XWFA 3K9CA 1K5GA 2B7LA 3WIDA 3KSDO 3IAHA 2GCNA 2OYRA 1SXQA 1A27A 2WFAA 4BLSA 1Z4NA 2G1AA 4CFZA 1AHIA 3R5FA 1YJBA 3HGMA 2XKBA 3SFVA 3HBLA 4KN9S 3RIEA 3V1NA 4KCGA 3IFSA 2J5XA 4JKIA 3RROA 4GBJA 3C5WP 2PU5A 1Q17A 2B1GA 4NPCA 3S8EA 1ENOA 2PBLA 3K70D 4EUFA 2JGFA 3C3PA 3GEIA 3OEHA 3Q4GA 4JGBA 2YN2A 1E2IA 1GEEA 3FF4A 3JPYA 3WMRA 1F8GA 3SKVA 3ZLJA 2ETXA 2JFBA 1I4TD 2H57A 3CXRA 3ZDDA 3GRRA 3KRTA 4D4KA 4PIMA 4HEA1 4I1RA 4XJSA 5JADA 3LL4A 1BA2A 4IDOA 5EGSA 3UWMA 1OZGA 4FN4A 2BKXA 1RMYA 3LCJA 5BPFA 3FZGA 2VT7A 5F77A 1XRLA 1YZKA 4FYYA 4ZVOA 3TIVA 3WBFA 3R09A 1J0CA 2R7KA 3V34A 5DTJA 1NDQA 2FX2A 5A5FA 2ZROA 4Q4CA 3GB9A 4ZV7A 3AHHA 1UWCA 4ZQFA 4AS3A 3C0KA 3D7MA 1O95D 3FUVA 2VHJA 3R3UA 5F2EA 3AIOA 2IEGA 3HNPA 4Q21A 2EKQA 3OHMA 4PX5A 3R9KA 5AXCA 3SBDA 3AHIA 5CXXA 5KVCA 2PFKA 1BZYA 2X0NA 3OLQA 3PXEA 5CGQB 2AOXA 2OK7A 2YFYA 3K0KA 4DLNA 4NE7A 2J4CA 4PO3X 1XLUA 4F6RA 1Z47A 2R4UA 4O4LB 4JOCA 3VU1A 4DCJA 3HO1A 1KFBB 1KDYA 2EKBA 3F4KA 1KC1A 2C00A 2CNLA 1KVTA 3ML1A 2R7LA 1E9SA 1PAUA 1RFLA 2FAXA 4W1PA 4E7PA 1A7JA 5DHAA 4EP1A 1UMBA 1GJRA 2JA1A 1N2SA 1VJTA 1MV5A 3OQMA 2ZI7A 3V4SA 3BL8A 3BXZA 3SKXA 3IX7A 1Z4MA 5IVDA 4BNFA 2PZMA 4JLJA 1X9IA 2KQUA 3D6NB 2PLAA 4IXNA 4ZJUA 2QM0A 6AT1A 2I4LA 2XBMA 1T8YA 3EG5A 2JL1A 4UVHA 5FAKA 3NS7A 3D4BA 2MCFA 1D6MA 3C1TA 2NV0A 4MVJG 4IIHA 4AP6A 3UJBA 1GARA 4XA8A 2QX8A 2P3SA 2DCUA 4ILEA 3UMMA 1QF6A 2BMDA 2ACEA 4M2LA 4KE6A 2J0EA 1LW7A 2QU7A 1GGFA 3KAJA 1G6OA 3CPHA 3MBOA 2XT9A 3RIGA 4AC9A 2BPOA 4B5LA 2WG0A 4FFBB 2K5UA 4L8FA 5JCPA 5FEUA 5KWVA 1VPDA 1ODFA 1JEYB 4GRAA 1JSCA 4MP8A 4B3CA 4CLOA 3AL0C 3VOSA 4YWHA 621PA 1EP3B 2F8MA 3ZHXA 3VZRA 3QE3A 3VU0A 4CEIB 3RASA 1MQAA 4F7DA 4EY7A 4PAMA 4HLQB 5KYKA 3W8DA 5JAQA 1UQTA 3OPMA 1LBEA 6NULA 1TM1E 4LZJA 5CM8B 1DBPA 2EX4A 3CQ9A 2D8AA 5BPHA 4K6GA 3G17A 3OOSA 1GAWA 4LWOA 4HB4A 4YY3B 2VQFB 3RYHA 1BDMA 4TN1A 3U0VA 2FJPA 1ONPA 5HF6A 5ALXA 4G1UC 3EQ6A 1K27A 4E5UA 4XRGA 1ZCJA 3A1UA 1V47A 3NFYA 3PHCA 4JODA 2Q9UA 2VZ8A 4HZGA 3QBDA 1ESEA 3HXPA 1PSDA 4JP1A 5JFGA 3T4EA 2XYRA 3H5TA 4RDIA 3WA6A 4IJKA 3LQKA 4ZXFA 1EFKA 2QL7A 2CDNA 2QW0X 2ZG6A 1L5VA 1WHTB 1HFJA 4MZDA 2LVBA 5AESA 3PUIA 5E7JA 3N87A 2BOVA 3KAKA 4MUHA 5LQDA 3H6HA 1LNSA 2ZUVA 3EASA 3LECA 3OEHD 3QUCA 4QDOA 4YACA 8ADHA 5KJCA 5DOZA 4BVLA 1Y8RB 5HJ5A 1KMNA 1T35A 3MJEA 3G0HA 3HG7A 5EIWA 4RK5A 2HIHA 5BOSA 4MGHA 5D6NA 1WXXA 1MJGA 4EPYA 1ZW1A 3BJEA 4M1TA 4EY8A 3VKGA 1S89A 2GN0A 5KNBA 1VLHA 5JNLA 4LI3X 4E1BA 4G25A 5M29A 4XYLA 1R4AA 1Q6YA 1TYCA 5JXJA 4PNHA 5HOEA 1Y4DE 2ODWA 1HZZC 1TJ4A 1R74A 3VAAA 2Q45A 2HR1A 3OCVA 4WH0A 1FS6A 2E4VA 2XUIA 2VZ0A 3BWYA 3D8NA 4S1WA 4Y1RB 4O1HA 4K6HA 3T9CA 4O2LA 3Q2KA 1Z0FA 1JQAA 2PQ6A 3N2KB 4I81A 3DLHA 3VJMA 3VDXA 1QNFA 4QDTA 2EOAA 3HDVA 3PHIA 2XZOA 4AIRA 3TUIC 2XX3A 2LTAA 4BDSA 3O4HA 3LE8A 4Y3UA 4QBTA 3ZWOA 2P5YA 1IXYA 1SBQA 4C3VA 1U7WA 2ZYIA 4J0EA 2IU4A 2VYNA 2PKCA 4MS4B 2I1WA 3MRXA 1S4MA 4U2DA 3P52A 1NHWA 3IKTA 3QKIA 4DIFA 4OUDB 3NOXA 2C5GA 2GBPA 3KEOA 4AQ7A 3MA0A 4ALKA 1BW9A 1JZQA 4ZCSA 2P40A 4F12A 4QPDA 1Q91A 1YUNA 3HTXA 1NWHA 4GZ3A 3WR5A 4IINA 3NR2A 2WBLC 2WYIA 4R2MA 4JJ4A 1ZMOA 4NYIQ 5F4BA 4RSHA 2XAAA 3CBGA 3CISA 5LM3A 2HAEA 4ALLA 4DNPA 5EJ5A 2G5GX 2XCLA 3FNGA 1B6GA 2J85A 2EWMA 4PZPA 3L7AA 5BSUA 5FTWA 3KS9A 3RWBA 4GPBA 5JS7A 3THWB 4ODIA 2CMDA 1SKQA 1Z56C 2FF7A 5CT9A 4C4RA 1XKQA 3CLRD 4JXXA 4CCSA 1V1RB 4L75A 4BP9A 1TKAA 1YS2X 2R00C 3L7OA 2M6LA 2WK1A 3L18A 3M82A 2ASEA 2XDWA 1B0PA 4RVFA 3P9YA 2A9VA 1HFWA 5K0GA 4M9QA 3NIFB 2W4QA 1XRJA 3BD8A 3JRWA 2UVDA 3HU3A 3NASA 4L0QA 3ICOA 3X3HA 5LZ5A 3V48A 4IDBA 1ZOLA 3TZKA 3MG9A 3F2VA 4EZIA 3UJNA 3VH1A 5L6LB 1IATA 2NQ8A 3DKRA 3E05A 1H65A 3I52A 3Q3EA 1ONNA 3TZBA 3RAFC 2NUPA 4I46A 5IPFA 1EAYA 2GZ2A 3WWZA 3JQ7B 4P6VF 2CZCA 1NURA 4CCYA 1D5WA 4MRAA 3DHYA 4AJNA 3U19A 4FCWA 3NAGA 4C4AA 4JHLA 1XQVA 1TUIA 4UE6A 2OO5C 1DIGA 1KS9A 3ANMA 3CR3C 2ANBA 1KKLA 2NTYC 4Q3CA 4WK2B 5JWHA 4A91A 4IJQA 2AWNA 3I09A 4JS0A 2WIDA 3B78A 3QEMB 4Y30A 4ENWA 2E5FA 1Z7BA 3AB8A 3QYFA 5CMLA 4MX8A 4HWTA 4O5OA 1WSWA 2E7ZA 3SC6A 1IQUA 3QFSA 5DLYA 1IUPA 3TE7A 4YYEA 5U9CA 1H2BA 1T6YA 1YQGA 3L49A 5KOHA 4KO8A 3MT9A 2Y93A 1JU9A 1O6BA 2D3WA 4GG1A 2XKKA 4KNVA 2W8BB 3UPUA 3RE1A 2A9RA 5CLFA 3JYOA 3LT1A 4D3FA 4KVZA 2NZJA 3O3NB 4DLAA 3SIPA 2GVDC 2ONYA 3OTHA 4XM0A 1U6IA 3EQ8A 2WUEA 3R0IA 3QUAA 3RGGA 5IJZA 4QU5A 3HYSA 2B25A 4YMSA 3RTEA 1UBEA 3NTUA 1PEYA 1YGYA 4O4HA 4MRMA 3HU5A 3H17A 4LTNA 3OZBA 1XV5A 4XZ3A 3EZ6A 1DZ3A 1G2IA 3L0SA 5FI3A 4DDUA 1VCMA 3QXSA 2F4VB 3IAXA 2WKPA 3HA2A 4AM8A 3GFSA 3WP0A 4P0QB 4FXOA 4O2AA 3TG2A 3COWA 4XQ0A 3ZWKA 5IJWA 1QH1A 3OCWA 3UENA 2FUKA 1I36A 1L8OA 4YHBA 1FUUA 1HNNA 1T9GS 5E3JA 3TD2A 1EUCB 4N0MA 4M7OA 2VJOA 3V1KA 3ZU6A 1C9DB 1KVUA 4W5HA 2KLHA 2XE4A 5EUBA 2UUAB 2ZREA 4V3BA 1KPGA 1XZLA 3EG9A 2AZMA 2EEZA 3ZZMA 1U2DC 5A4DA 2Q1TA 1WE2A 1KJIA 1PQYA 3EIXA 4LVNA 4XPIB 4YLGA 4WERA 5JMPA 4CMCA 4Y2UA 4OHXA 2HO4A 4Q9HA 1O94A 4G1VA 1S8FA 1GNRA 5I47A 3KVRA 3PCTA 3L04A 1WBBA 5AW5A 1R0LA 3PIDA 4QXMA 1V3UA 1YH3A 3AESA 3DDUA 4Y6GB 1PW5A 1ZH4A 1NUQA 1UOPA 3D3QA 1T0BA 1AF4A 1ZXLA 4YJKA 4H3SA 5AK5A 1YHNA 2CWWA 1G8YA 2VDOB 3O1IC 1FSFA 1J33A 2VDPB 3KZKA 3MJTA 2GJSA 4UXJA 4X1KB 1NJ1A 3CRNA 4B3HA 1I5EA 1YR6A 4D4JA 2Y05A 5LXTA 5LNK1 3ZJVA 3N2GB 1P2UA 3HSSA 5HKLA 4BWVA 1OBVA 3EA0A 2F8LA 5THXA 3RTDA 1M34E 1A8PA 3R9IA 3G8CA 1H94A 1KKUA 1M74A 4CNQA 2H1LA 2JGMA 3O95A 2ZDHA 3D7LA 4UQPA 1ZBDA 2F1IA 1GTVA 2YCBA 1MP0A 4J49A 4TMFA 1QHGA 2FRXA 3DMTA 4RV5A 3TRHA 1PFGA 3H9UA 1VJGA 4OIFA 2HJRA 1V5FA 3QLTA 1OCEA 4JVLA 2ZU6A 4CIBA 1IFXA 2G5PA 1XVAA 1GGVA 1GL3A 4XTCS 3ZHCA 3CLVA 4KBGA 5JAIA 1LBQA 4X20B 1FQKA 1L4FA 2B98A 2GTHA 1VRWA 3TPZA 5J1SB 2LGJA 4P3PA 4BKOA 3B89A 3A1CA 2IEDA 3DD5A 1SK8A 3IPCA 3JW8A 3WJAA 1QGUA 3P9SA 3HEAA 1EFCA 3NATA 2ZTHA 4C7KA 4LFAB 4EGJA 1A72A 2X2FA 2Y6VA 2VT6A 4HB2A 4OI0A 1V43A 5FDFA 4DUGD 4YCBA 4EW3A 5AKGA 1LV7A 4YCDA 1T5IA 5DRTA 4GSLA 5IUJC 2R2AA 3ZJTA 1KEEB 1OYVA 1R37A 4WNAB 1XRMA 3WHKA 4PLZA 5B4VA 1UFOA 1T5TA 3M5WA 4P0PB 4Q1CA 3TEJA 3E84A 1ZZEA 3USCS 1N7IA 4AY5A 3QWFA 4IUDS 3R6LA 4QWMA 3TLEA 1GUYA 2YFHA 4TYMA 4RHYA 1G16A 4FZ3A 4WFIA 3D4LA 3FHJA 1U8XX 2CXTA 2W90A 3PA8A 3W5SA 5KCZA 2P2GA 3OE4A 3UCFA 3KUXA 1WMDA 2P2CA 2RCNA 3DO8A 3FUCA 2H29A 1UEIA 4MXDA 1YB5A 1FX0A 4HV4A 1YI1A 3R5XA 1CUVA 4HNHA 3RSCA 3GDFA 1E1DA 2F1HA 4WECA 1X8KA 4NPHA 4ZOQI 1FFCA 3BA6A 3OCZA 4NOMA 3D6TB 2CLMB 3ILYA 3WICA 3LHKA 1QCCA 3ZBQA 5LIRA 1UXGA 5HK8A 4Y2TA 1X8JA 4D96A 3JASA 1X1AA 4KK3A 4P84A 4TMZA 2HFKA 5C4GB 1XMJA 1U5BB 2Q7OE 1KZ4A 4RJIA 1VCHA 3LT5A 5B1IA 1PN3A 4PO1A 1TT5B 2Q3FA 3MK31 2Y92A 3GGPA 3HADA 1QYXA 4FX5A 5F78A 2O2IA 3QMMA 4EEKA 1RJGA 2LCIA 2OV8A 3HHPA 5T57A 4F2PA 5FUMA 4RK7A 5H68A 5C80A 2PSHA 4ZGBA 4ZYWA 5EJ4A 4MVXA 3G2PA 4RJ2A 4WVFA 3H2ZA 2XKAA 4JX9A 3BM5A 1L4YA 2VSQA 1CETA 3DWGA 3N9IA 3PVZA 4U7GA 5K3DA 1XF1A 2AYZA 1XCGB 4BJ5A 3GBPA 1ST2A 3IPYA 2QYOA 2GA8A 2VJDA 2ZJ7A 5M2QA 4MUBA 3E3AA 2E6UX 4KFTA 4MVJH 1J49A 4P4SB 5L7TA 4BKUA 4QFDA 2GM4A 1GAQA 5JVDA 1NXOA 1LJ8A 1XJ5A 4R41A 3G1TA 4A8HA 3O31A 2A9KA 4J0CA 4MV4A 4NC9A 4P7KA 5DXAA 5TPZD 4NNJA 3GV0A 4BVGA 1DI0A 2QZPA 5DCWA 5AH0A 4EUKA 2VFAA 1BFUA 1OX5A 3ED1A 3KOYA 4RY2A 4E70A 3FN4A 5FPSA 2PL3A 3VNAA 1SU8A 2D2FA 1JG2A 2QAGB 2Y71A 1Y98A 4KDCA 3RUIA 1D4OA 2CDRA 2P0AA 3GYBA 4E3WA 1X2BA 2VBCA 2ZKLA 3HMKA 4JVMA 4W5JA 2BAGA 2BC9A 2YH2A 5EXEA 5EHQA 4ZMBA 4QOIA 2RK6A 1U4NA 1ISRA 4MCAA 3HZZA 4JQYA 4E12A 2P9QA 2X9VA 4JBIA 4XOIA 1E66A 2Q21A 4QUGA 4R1NA 4QBIA 1DE0A 5KYWB 1ICIA 1BN6A 4OU5A 1NP3A 2XVZA 3DMNA 2P7IA 4BV2A 5KTPA 2GKOA 4LXYA 4PHHA 4R84A 5DHFA 2QAJA 5BR7A 6PFKA 3FOEC 2JVKA 4C2AA 3EJWA 1GU1A 1CZKA 4HGOA 4MRRA 4QUBA 2GNPA 4U6SA 1XKLA 3L0OA 5J2UA 2X0KA 3HN2A 3LHDA 3BMQB 1FYWA 5KTKA 2ZE8A 5B3KA 3P7MA 1MC1A 1YD7A 5JQGF 2BONA 4C7XA 2V4UA 4QZVA 4LF8B 1J6UA 3IIEA 1CDDA 1KO7A 3ICPA 3NDRA 2BZ0A 3LY7A 4QL3A 5ALIA 1B1CA 1A9PA 3EEIA 4BKMA 2PE5A 4R51A 5IXJA 2HU5A 2C1XA 1AQYA 1DFHA 4LDJA 1J1IA 1RSZA 2BSXA 1HNWB 1CR6A 1YIOA 3L6DA 4BGUA 3Q9LA 5JS2A 2ZE6A 4F46A 1C1DB 1SUIA 4XW2A 1P5JA 2LDXA 2GCIA 4EUEA 1ZSYA 5K0JA 2ZYWX 4H9GA 3AONB 1GNLA 2AUTA 4Q4JA 2QIPA 3HACA 2ZIVB 2PA3A 2W2KB 4Q48A 4G4JA 2BJHA 3AEXA 3TW0A 2VHCA 4G56A 4DDTA 2AEMA 1XPUA 4LZAA 1TU3A 2FOIA 1T9DA 3EVBA 2CK3D 3ILSA 2W6IA 3TEFA 5BV2P 5KO2A 4IF4A 4FMCF 2PEZA 2J07A 2GH1A 2Y0EA 1P62B 3K6RA 3TD6A 4AJ1A 1MJHA 5E7QA 1Q1QA 4E2WA 2JEYA 3QI2A 3U80A 2FMIA 3PP8A 3DAHA 2I55A 5IMSA 2CGEA 2IUFA 3A8TA 4FDMA 2FZCA 2EX1A 3LYLA 3ZWQA 5IHPA 1UK6A 3LTEA 4OU4A 5AP9A 1BWPA 5G1OA 5DSZA 5B4UA 2ZJ3A 2LP4Y 1W59A 3GA5A 2P9YA 4PS1A 2ZUSA 5DN6A 1F9AA 3NANA 4TKVA 2F3UA 3E48A 1QJ4A 4PW0A 5B1HA 3DH0A 3U3ZA 1CEQA 2Q2OA 4YCLA 2HHLA 2FI1A 3A0RB 2I9PA 3BRCA 1NFQA 1G66A 1ZGAA 2CC2A 5B5SA 3PGVA 4WT7A 5EJAA 4RETA 5J63A 1I7LA 3AF5A 1P31A 3F6YA 2FLKA 4QFCA 3PJFA 2EHDA 5AW0A 5KBYA 1GG5A 5DBFA 1K98A 1E6KA 1X15A 3A25A 3M5DA 3PE4A 1OB5A 1RLJA 3PXAA 1A50B 2PUEA 1VBMA 2ST1A 3BB1A 4M8IA 1Y89A 4RZSA 1U9IC 3EFOA 2XMSA 4EEZA 1AXEA 3E2PA 3DDHA 2JS7A 1JG6A 2XMRA 3UTDA 3QM1A 2I8LA 4BIIA 4FQ8A 1ABEA 3VHXB 1KQNA 1LLUA 4FT4A 4JA0A 4Z3KA 3RVSA 2H2FA 3HFGA 3AR6A 1C8VB 4BASA 4YRTA 1I4LD 1TPZA 3IV6A 3GLKA 3A4IA 1X7ZB 3QLUC 3GUVA 3U7QA 1KSFX 2H7XA 4LJKA 4GUDA 4BKQA 2ZITA 5I45A 4G4SP 3CSDA 3ZUPA 1ZMXA 1NKTA 3EOZA 3KTFA 1JWAB 3N74A 4PC7A 1WP4A 1FMCA 3O7WA 4C4XA 5EUMA 3D6AA 3KOUA 1XP5A 1D4FA 1E0SA 3I6IA 2JFVA 4PWZA 3QSYA 4NS1A 4WVLA 2ZE7A 5AUPB 4LDNA 2HJGA 1HL3A 4Q7KA 2OXCA 2QAIA 3AP1A 3ER8A 3LCUA 3ZDYB 5JU6A 2MMGA 3B1VA 4AK9A 2MDTA 1N6IA 1L7EA 1XTKA 1ZM9A 3IJPA 1L2TA 1X9GA 2R8EA 3S2GA 3PI6A 4HDMA 2OM2A 2JDIA 2FZKA 1I9CA 1NI4B 3M70A 3NNDA 1TEVA 4D26A 2PLNA 2B5WA 4BFXA 1E9EA 1Z08A 2D1RA 2JEZA 3AIKA 1O9HA 4LYDA 1FMJA 1S4QA 4E4TA 4L2IB 3NHFA 5AKIA 3KJZA 2PYZA 2NUAA 3HKEB 2FK8A 3LQFA 4YJ2B 2YZ2A 1T6BY 2BEVB 2Q62A 1J09A 2XMGA 4HZUB 3SK0A 3MT0A 5FFNA 1H42A 4YRSA 4GPIB 3ESRA 4D81A 1WY7A 3H1PA 4OMFG 4GM0A 4QSHA 3FSJX 1QG2A 1RQGA 3MLAA 2WLTA 3I0MA 3VR2A 3ZY2A 4AJEA 4BNMA 4I9NA 3AUKA 1M34B 5JQWA 4MOWA 2NZYA 4C1NA 3EPLA 4GO1A 1EMDA 4HXGA 3DAOA 2RB5A 3RARA 3H2GA 3M6VA 4HR7A 1GNPA 3ACDA 4MA0A 3AL2A 1MX1A 2ZRDA 2AI3A 4G4SO 3V55A 1CDOA 4W7SA 4MYCA 5ICFA 3DYBA 4CL3A 3IEXA 3FNBA 3L46A 4FE4A 4LJ5A 3A1DA 4WN9B 4ILKA 1S2GA 4H77A 4OFBA 3LXXA 2YRFA 2H1HA 3QE2A 4CM7A 3LHSA 3B3GA 4ACBA 5EMMA 4O63O 3N7TA 4NBSA 1R1DA 1IU9A 1N5LA 4DEXA 5EZSA 4BX8A 4WESB 3OKAA 5C5IA 4O08A 1XLVA 4YAWA 4CKBB 2Q2VA 2CE2X 4H6VA 5LJIA 5DNVA 1T15A 3Q7IA 4TUYB 4BMXA 5JY1A 2HPAA 1RE0A 4JXKA 4WDRA 4YRQA 4CU2A 3PNLA 3MW8A 3UJDA 3T7RA 3DE2X 3E1GA 1KY3A 4XVUA 2PWZA 3S0JA 1NXQA 2HXYA 4D4MA 2FR1A 1THTA 3R3XA 3V7FA 2Q6VA 1VDMA 1WUHS 2OBLA 2QLMA 1OW3B 1T34A 2VHEA 1SEVA 3JD3A 4MA4A 2V7WA 3CY6A 4MV6A 2ZRCA 1YB4A 3FTPA 4N12A 1BMQA 1Q1EA 3MJ4A 4NICA 4N5LA 1K4KA 3KFLA 3FUTA 3NHAA 4BVBA 1NY5A 2ID9A 3RBXA 1ST3A 3CNOA 1A5BB 4FGKA 3EAFA 4Y2JA 3ZNOA 4GEKA 3B6MA 3PNPA 1SZPA 1JEDA 4UBJA 4UAVA 3ASUA 3GZNA 1FYFA 4YP1A 4YP6A 4JI6B 1RMTA 4ZARA 2JFGA 1NUAA 1JQDA 4FONA 1XC7A 3DE6X 1AD2A 2HUNA 3BRSA 4OI2A 4ENTA 1OVGA 1DLIA 4WLOA 4QRHA 3H0CA 2O5EA 4DIOA 2BTQB 1JF8A 3PUHA 1I7NA 1YQEA 3LRTA 2A9PA 3OJLA 2XDQB 1U3GA 1Z75A 4XM2A 1F6DA 4YMWA 4Y6RA 4I1OA 1RXCA 1V0JA 4BFZA 2W2OA 5EL0A 5EZ6B 1FSSA 4DDVA 4A0QA 3U3DA 2FQYA 3ESXA 3A4NA 2VDWB 4UASA 3JWPA 4ZC1A 4FVTA 4Z0NA 3G2MA 2PRIA 5E4YA 1TCVA 1VB5A 2CB9A 1DPGA 3G8BA 2ZSKA 2CD7A 4MQ4A 2Q6KA 4C88A 3ADBA 1VG1A 4L74A 1L5FA 2QT0A 3K92A 2D8MA 4YWJA 5DI3A 3RNOA 2JDID 2BKLA 3DBHA 3GT4A 4YRAA 2PL9A 1R8YA 4QUEA 5KVQA 4JEMA 4I50A 3SJCA 3UAXA 1OD6A 3JQFC 2WWIA 3QVUA 2GZRA 4DMHA 1GTZA 1M1NB 3G5AA 1ECCA 1BH6A 1ISSA 4FDUA 1RQPA 2O5VA 4GYKA 4ISBA 3P27A 2OEPA 3ZY4A 2ZP1A 5IWCA 1LPNA 3GRAA 3ZD9A 5AVVA 5ALLA 1IB0A 1KEWA 3SXUB 1Q0HA 2ZB3A 2C3MA 2R86A 1D2EA 3NM6B 1TPYA 4NEQA 2YJ5A 3H1AA 2A0FA 2Q1UA 4RQAA 3CG0A 4OJKA 3OHPA 5TVGA 3ORFA 1R4NA 2ZW9A 4IIFA 5CUQA 3REFA 1NY6A 3O2QB 1KAOA 2NMVA 1D07A 1JEEA 1GZDA 3IO3A 4FX2A 5F1OA 1N2OA 1U3VA 1BS2A 3KEFA 2WD9A 5GWXA 2QZSA 2J1LA 2IP1A 1HLFA 1QLWA 1Q1NA 3KETA 3QLEA 1XTIA 1MIOA 4CHTA 2H85A 2XNDA 1HE4A 4C78A 5K6AA 2O54A 1P72A 2P6NA 3HB1A 4MMZB 1KSJA 3IBSA 1YZ3A 5IXYA 3GJZA 2DQYA 1OX4A 2WU8A 3M3HA 3EDYA 4J0QA 3U4QB 3ZG6A 5LYJB 2FR8A 4GXRA 3VU8A 1MJFA 1Q0LA 2N1BA 3RRMA 4HLUA 5BR8B 2FSHA 2P2YA 4MJ3A 1TC2A 3ZNQA 2FWJA 2VZLA 3H9JA 1QCYA 4MICA 4RCZA 3VO1A 4ARVA 5CFLA 1NVDA 2PUTA 4O4IF 3NMUF 1DIRA 3TJMA 2IA5A 4DEVA 4FMDF 3ODGA 4OXRA 2V59A 4PPNA 5G3ZA 2W2PA 3UMFA 5EJ6A 2DXIA 3G6KA 4OIMA 2XUPA 4TXHA 3HYLA 3ITEA 2YWCA 4PZYA 1J23A 4H3KB 3U81A 3NUQA 2QY6A 1YJXA 3QFRA 3RUHA 1I1QB 1I4DD 4BO7A 5GJBA 4PIVA 2CT8A 1RABA 3Q1KA 1D6NA 3I3SR 4EHIA 4WLUA 4C6TA 1IN5A 4DR4B 4IGFA 3AQIA 4FSDA 1CY4A 2FSFA 1SQSA 521PA 4UEOA 3VO8A 4HVLA 1FP2A 3K73O 5CW2A 4JY7A 2P9HA 3W2EA 4ZQCB 4I55B 5LWHA 5E9AA 2DMRA 4Y9SA 3AEUA 3M0EA 1J00A 2JD2A 3QEKA 1BHJA 2PGJA 4D57A 3IT2A 5FHQA 3NH6A 3G1UA 4KKVA 3WRYC 3SE7A 3EW9A 2GJKA 2FP4B 1AHHA 5C37A 4LOLA 1P7WA 4QUDA 4PXSA 5F1PA 1F6BA 4M1SA 1FFDA 1LF0A 2OESA 2PGLA 3FUXA 4D97A 1YRBA 1I2DA 1TO1E 2HGSA 3TIXB 4WHMA 1IN7A 2GZMA 2RI0A 2IS2A 2G4CA 1Q2UA 3CH5A 3QKRA 1DAMA 5LDDC 1K97A 4HXEB 2AOTA 4IIXA 1RKQA 1CY2A 3IBGA 4NEHB 5CFOA 3Q5GA 5EWMB 3DM5A 2CFTA 5BWNA 2W37A 4JX8A 4ZYLA 5TXGA 3U49A 3LUFA 4CN9A 4LJSA 2XMZA 3RJMA 1Z06A 2ORVA 1PFQA 5LQRA 2IZOA 1NMYA 3KQNA 1PGPA 5L53A 1R6XA 3H8WA 1Y1PA 3W8FA 6YASA 4ZIRB 4WPGA 1XQ1A 4JC5A 3CX6A 3F6PA 3VZCA 3QVXA 5DYNA 3RIMA 1ZJ6A 4B71A 4EYKA 4UNSA 1MT0A 4IFTA 4UTPA 2J0UA 1T2CA 1Q57A 1D2RA 2EJVA 3H83A 3LU1A 2NU7B 4DCUA 4ZJYA 2O50A 3U4IA 4IDEA 5HEKA 3AJAA 4GOOD 1KI2A 3RREA 2C8KA 2ZTUA 1MQ9A 2RJOA 2VCEA 1LI7A 2W6JA 1JNXX 4GUAA 5SZHB 1DWOA 1XRNA 4F86A 5FPYA 1N3YA 1GR0A 1ARZA 2QRLA 3D6VA 2GYYA 5EIBC 4Z2YA 4AJHA 1SKUA 3EXIB 3HCWA 4HQ6A 3ENQA 4MWGA 4IGEA 3VOTA 1QV7A 3L1IA 1N5KA 1ZY2A 4URYR 3V8BA 2PUCA 1WOYA 4QYXA 1L3CA 2W2LD 1LFDB 1VECA 2IYFA 3IRUA 3KYDA 4B45A 1SXJD 5EFZA 2G07A 4CKCB 1ZITA 4G2TA 5GINE 2NX2A 4MYSA 3H75A 1JPVA 2ZTLA 1EX1A 2R9VA 4B7UA 5EUQB 3TCXB 1RC1A 1T2AA 4L85A 2GM3A 3N28A 4RZQA 3LCRA 3ULKA 5GQSA 3CEAA 2VJAA 1FYVA 5LOVA 3ICEA 1YU6A 1ZGZA 4HNGA 2WM8A 4OAPA 4Z86A 2QTFA 4Q02A 3DV0B 2O3SA 4JI5B 1QQBA 5M04A 4J03A 2FSPA 4LXUA 3DEHA 2XA2A 4IRMA 1YFZA 5FIUA 3O4JA 3LW8A 3MB5A 2WWRA 2F3QA 3OQIB 2DUMA 1FBNA 1XI2A 2P65A 3HK2A 2L69A 3O8NA 3KOZA 1AHPA 3AYXB 1U28C 1U7DA 3DOFA 2YN4A 5HFAA 3OEED 4I66A 3ZHTA 3I12A 3O92A 2GBLA 3HI6A 3V4PB 1LCIA 4D25A 4BNIA 4OI4A 1DUIA 3C3WA 4WZZA 4YJGB 1Y1TA 4GXQA 5JI2E 3AINA 3OQ1A 1NX6A 3TF5A 2I7DA 2YCLA 1S02A 1WDWB 1PL0A 2CCKA 4TVBA 1C0PA 2Y9MB 4G4IA 4UTXA 4RTLA 2ZCUA 3STYA 1AN0A 3RK1A 3OTGA