3RJ9A

Structure of alcohol dehydrogenase from drosophila lebanonesis t114v mutant complexed with nad+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNVTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title An intact eight-membered water chain in drosophilid alcohol dehydrogenases is essential for optimal enzyme activity.
pubmed doi rcsb
source organism Scaptodrosophila lebanonensis
molecule tags Oxidoreductase
total genus 96
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rj9A00
3O8QA 1SEPA 4U8GA 2HRZA 1HEUA 4WLUA 4L73A 4D0SA 3WTCA 3UVEA 4EUFA 2P5YA 1I0ZA 1L1FA 1Z73A 1ZFNA 4YJFA 2RBEA 4FJ1A 1H6DA 2CF5A 4PLZA 1ONOA 1U8XX 3V1UA 3V1YA 4RQTA 3OJFA 3FBGA 1SEVA 4B4OA 5IDQA 3L6EA 4GLOA 2YYYA 4GL4A 1GD1O 2EP5A 4O63O 2FR1A 1LDEA 3NJ4A 4MPDA 1YQGA 2H63A 3UXYA 2W90A 4ZICA 1L7DA 4BV8A 2EIHA 3OQBA 4JP3A 1DC5A 3GEDA 5DBFA 1N1EA 1HT0A 5IXSA 3GG2A 3QE3A 1H5QA 1B3RA 3TDKA 3JQ7B 4BNUA 1X0VA 4OMUA 3WIEA 1C1XA 1SOWA 5IFLA 1TT5A 3ZN2A 1HLDA 1Z74A 4BNGA 3EK2A 2I76A 3JQ9A 4WUVA 1PJTA 2E37A 5JAQA 2VWHA 3LT4A 1Q7BA 1PR3A 1ZK0A 2G17A 5L53A 2HK7A 1UP7A 4GGPA 3TZHA 1GTMA 4HNGA 1R4MA 2E82A 3DZJA 1CIVA 1F12A 1PIWA 4ND1A 4BNWA 4YACA 2AA3A 1U7TA 4BVAA 4CQLA 4YT8A 4L4XA 1ISFA 1GPDG 3GPDG 1DDOA 3WYEA 4CUKA 4CV0A 3F1KA 3DOJA 1AHHA 3E48A 1NPYA 2TMGA 3W1VA 1E3LA 1ENYA 4YJGA 5T6BA 2NU6A 1LQUA 3RROA 1YOVB 4IMRA 3I83A 3VPGA 1CEQA 1Y5MA 3DZBA 1BW9B 1NFRA 4G5HA 3W4IA 2EXXA 3UOGA 1ONNA 4PLFA 5TS3A 1U28A 3I4FA 3PHGA 1LDNA 4Q3BA 2J3IA 5A03A 1H93A 8LDHA 4YT5A 5C7LO 3LVFO 4ZRMA 4BKUA 3RUHA 3PDJA 5KIAA 3DHEA 2AQ8A 1BXGA 6ADHA 1SPXA 2G76A 2POQX 2X0RA 3SBOA 3UCXA 5BSFA 4I9UA 4GX1A 2BMAA 4H7PA 4IS3A 5JSFA 3L4BA 1QV6A 4HFRA 4EZBA 1BSVA 1KIFA 1J0XO 3GVCA 4PVCA 3RC9A 3R6DA 1YKFA 4YCAA 1E0DA 4NBRA 1Q7CA 5JMWA 5G0UA 1UXGA 1HE4A 3PK0A 3F4BA 3MOGA 3WGQA 2AQHA 1PL7A 1FDSA 3Q2KA 3PZBA 1IULA 4Q3NA 3B1JA 1AE1A 4E0BA 2GN8A 4J16A 3TNLA 3ASVA 1E1NA 1EFLA 1R15A 1M6WA 4AJEA 2D4AA 5CEEA 3TF5A 4CMCA 1U4OA 4X54A 4L75A 1EK5A 4A27A 3WB9A 3WTBA 3KYCA 3NT4A 2X9GA 2JAPA 4B7XA 4Q3EA 4BKQA 1O6ZA 5G0VA 1I2ZA 5BNTA 4IDEA 5KWEA 1YXMA 2O7SA 3GY0A 4XKJA 1B7GO 2YY7A 3GUYA 1E3SA 1D1SA 1MXHA 1P0FA 1H0KA 2B83A 1DC4A 2QG4A 3ZU5A 3COSA 3ORFA 3ICCA 3FWNA 4XZ3A 3LC1O 4R4JA 3EHEA 4PRKA 4B7CA 4NG5A 1YDWA 3GRKA 4JJGA 4JCOA 4LN1A 1XSEA 1IPEA 2GCGA 2HO5A 4M86A 4ND5A 4WLNA 1JWAB 3RASA 1J5PA 3E1KA 2I67A 1QYDA 2D5AA 3TOXA 3IJPA 3WYBA 3JQFC 2QQ5A 2RAFA 3JQ7A 4TQGA 2Q4BA 4FR5A 5EESA 2VUUA 1MP0A 1WMAA 4ND3A 4FSHA 3RUEA 1PJSA 3JQBA 5FFFA 4RZHA 1KC1A 3QWAA 1EMDA 5ILOA 2BFMA 2H5LA 3U0BA 3NDIA 2PGDA 1E3JA 3K2EA 5CHEA 2CFCA 1ZMOA 2AQKA 3MTGA 2X5OA 2FRDA 3BMQA 3JD1A 3GFBA 1PX0A 5T57A 4MVJA 4C4OA 4NFYA 4P4GA 4J4BA 3VZQA 5THQA 1P0CA 1YOVA 1PTJA 2X0IA 1J49A 5CDUA 3JYLA 3ROMA 3G79A 1ID1A 1BW9A 1P1KA 1PZGA 2BGLA 5JXWA 3ANMA 1Q1NA 9LDTA 3B70A 4TWRA 1CJCA 1XELA 4PFJA 4JK3A 3LF1A 2VHXA 4YAEA 4YYZA 2GF2A 5I9LA 2D0IA 2O4CA 4HXYA 4XB2A 4CR7A 3OH8A 2W2LD 5IF3A 2UUOA 1OFGA 2VTEA 4O5OA 1A7KA 1HDOA 1PR9A 3VHRA 3WSWA 4F6LA 1LDYA 4GAEA 3G0OA 4IPTA 5BR7A 1U5AA 1W73A 1N7GA 4IIUA 4J7CA 1XQ1A 4HP8A 3DO5A 4NJMB 5EL0A 1MFPA 2Y1GA 3V2GA 2WTBA 1PS9A 4KZPA 2O3RA 4G65A 2VNAA 4CQMD 2GR9A 1YE3A 4ALMA 2I3GA 3FWZA 2EERA 1NTOA 1ZZEA 4OQYA 1E1LA 4OOEA 1GEEA 1X14A 2UAGA 2O2YA 4ZU3A 4EW6A 5F1OA 2FPGA 1H2BA 3D4NA 3S2GA 1UAYA 4DIOA 1PEDA 4ALKA 1U2GA 2BELA 1CRWG 1LDBA 1NWHA 2BI8A 3LC2O 5CDGA 1G0OA 2EW8A 4I08A 2Z1MA 4BO6A 1W6UA 1BVUA 1U2DA 5F5NA 1YH3A 1PU2A 4UUOA 1HXHA 1H6AA 2OOSA 1XR3A 3JYPA 4PG6A 4FC7A 4Y8VA 3ROPA 1I10A 2OFPA 2C54A 3BMCB 2R6JA 2HMSA 3GDOA 4K6FA 4NU5A 5DBGA 5JDIC 2CY0A 4IGEA 1GL3A 1NASA 3K8ZA 4YWJA 2WEKA 3BIOA 4RVFA 2Q99A 1T2FA 2ZQYA 3KHUA 4MVJG 3FCOA 3S8MA 2D5CA 3X2FA 2BKAA 3DZKA 3MWDB 4RQUA 3BMOB 4AJ4A 3NDJA 2A4KA 4ID9A 1VLLA 2Q1WA 1AHIA 3IC5A 4XR9A 3GVXA 4UUPA 5L51A 5F5LA 4WNCA 2H9IA 3D3EA 2DT5A 3UW3A 3WGHA 3RC1A 4RVHA 3BAZA 5I7EA 4E30A 1IHYA 5G0WA 1A5ZA 4RDHA 1PJBA 1EEHA 3UUWA 3RFVA 4CPDA 4YAIA 4RPJA 2CVOA 3CKYA 2GO1A 1T4DA 5A3JA 1EBFA 3DBVO 3A06A 1B8VA 3HSKA 3ZDFA 4DQVA 5B4TA 1WVGA 2OBYA 4GSKA 1LDMA 4E2ZA 1GCUA 1NR1A 5TT0A 2WM3A 5HWSA 1EVJA 1Q2XA 3K96A 4A5OA 3NUGA 4EYEA 2WJPA 1MV8A 4OH1A 1I36A 4HV4A 1YB5A 2YFHA 1PZEA 4GI2A 2P9EA 3RUFA 1GV1A 4RGBA 1M66A 3H9EO 2C07A 2DC1A 1PJQA 1X15A 1ZBQA 1ZJYA 5A06A 1NHGA 4PRLA 1YDEA 4LMPA 3GHYA 2PY6A 2P2SA 3ADPA 3JTMA 1LRKA 2HK9A 5AXAA 3VTFA 2ZYAA 1PGJA 3DMYA 2WD7B 3NEPX 4BB6A 2ZTMA 2FOIA 3KSDO 5HS4A 3OQ1A 2Y99A 2EEZA 2Y1DA 4LCEA 3B6ZA 3H5NA 3HNPA 1E6UA 3P7MA 3OEWA 4NJMA 4QX6A 5DP1A 4W6ZA 1X0XA 2RHRA 3VVCA 1EQUA 1O0SA 4TRMA 2OHXA 5JDCC 1DJNA 4UAGA 4XCVA 1F8GA 1DIAA 4OSOA 5EMHA 4F45A 1EVYA 3ZWCA 1DFIA 3T4EA 5BQFA 1PL8A 2VQ3A 4NQZA 3WQSB 3JD0A 3WDSA 1E3EA 4IDBA 4BNZA 3AY7A 1TB4A 2PKRA 3S55A 4IQ8A 4FJ0A 4BNYA 5KTKA 4R41A 1SAYA 3OA0A 4W7HA 3TFQA 1VL0A 1HDGO 2CVQA 1LRJA 5DCWA 3TQHA 3FD8A 3H7AA 2C82A 3QY9A 3QWBA 1IZ9A 4N18A 3DBLB 4PZCA 5TQVA 1LC0A 1T1SA 5JC1A 2JCXA 2C0CA 3H9UA 1GZ6A 4B3JA 3GGOA 5F1KA 5IAAA 3HB4X 3BMCA 3IJRA 4DPLA 1WP4A 3OJOA 1NQAO 4R1TA 4XYLA 4LVCA 5GZ1A 4YJHB 3GAZA 4CM7A 1MFZA 1ZO8A 3S2IA 1YB1A 1EQ2A 4BNJA 4N7RA 2R00C 1ZK2A 2X9VA 5ENDA 3RBXA 5HRUA 3CSDA 3EVNA 3VVBA 1HLPA 3KUXA 2VHWA 5JYEA 2X7HA 1ZK3A 1VSUA 1WPQA 4BNIA 4IY1A 4UVHA 3AFNA 3KV3O 4IJVA 1NP3A 4Z9XA 2UYYA 2HMWA 3K9QO 3C7CB 4DQXA 4TVOA 1H2HA 1ZW1A 1UDCA 1YWGO 3E8XA 1LRLA 2PH5A 1JVSA 5BNIA 3H9GA 4B3HA 3EY4A 1W8DA 2BH9A 2Z95A 3E9QA 3GGPA 1KEVA 4BIIA 4D3FA 4DLAA 4ZGWA 1F0YA 5C7OO 1HE3A 4XYMA 2FZEA 3JCZA 3WICA 2OO5A 3QV1A 4TKMA 3RFTA 2TMDA 3I9OA 4MP8A 4XGKA 4L4RA 3I6QA 3IS3A 4J0FA 1HL3A 5AYVA 5A5EA 4IMPA 1SCUA 2EKPA 4XB1A 1C0LA 4EUEA 3DBHB 2GD1O 2O4UX 1NQOA 2V7PA 3LT2A 4J1SA 1DPGA 4BNMA 4INAA 3P2YA 5COQA 3OIGA 1YBAA 3WLEA 3OA2A 3RIHA 1ISGA 1X7GA 5JLAA 2FR8A 4FJ2A 4CQMB 1Y1PA 4WLVA 2WD7A 4RJTA 3K92A 5DF1A 1O95A 3MJVA 5T5QA 3MEQA 4Q3DA 1DBVO 4J2OA 1LEHA 2R2GA 2EJVA 2IXBA 4M54A 2AMFA 2NTVA 4WOKA 4L8VA 3GDGA 1NQTA 1QYXA 3K31A 3RU7A 2C29D 1N7HA 1T2CA 2PD3A 1NNUA 1LSJA 3IOYA 1M6HA 3CZMA 3ON5A 1XEAA 2B69A 3DFZA 1A27A 1KVTA 1HWYA 2O3SA 1B14A 2VYNA 5JCXA 1NAIA 1GZ4A 4BV9A 4HWKA 4EBFA 1T4BA 3IAHA 2X0JA 3JQ9C 1D3AA 1UUFA 2B36A 3BYZA 1RM3A 3C24A 1QV7A 3UKOA 1XQ6A 3KRTA 2VTDA 4MIYA 1LDGA 3DBLA 4G2NA 3O38A 3KBOA 2IYOA 1Y81A 3KM0A 1QYVA 2O48X 3E18A 3DHNA 4P4LA 5G4KB 5TT1A 5TNXA 5EN4A 5GZ3A 3AM5A 3EZLA 1EE9A 1B8PA 5DNAA 5FI5A 4YJHA 4IBOA 3IMFA 4NZ9A 2VHVA 4AJPA 1B15A 3FR8A 3QIVA 2WYVA 4FS3A 4XWYA 1RYEA 1KY4A 1YJQA 3HDQA 3ROKA 1J6UA 5A9RA 1ULUA 4CM9D 1LNQA 4CLEA 2EKLA 2E4AA 2Q1TA 3DTTA 2C7VA 1GAEO 3PIDA 3WXBA 4CL3A 1DRWA 2HLPA 3F5QA 3ICPA 3PYMA 4II3A 3L4BC 4DBZA 4QTZA 2YHIB 4JNKA 5LC1A 3T4XA 3GNSA 3WQRA 2H6EA 1A9ZA 4DGSA 3EZYA 1U3VA 2BGKA 4CLXA 5K9ZA 1ADCA 1KC3A 3G17A 4JXKA 4BHTA 3C7DB 4O1MA 4MKXA 3QA9A 1C14A 1I30A 3E5RA 2O3JA 2CDBA 3AM4A 4ITUA 1M67A 4WLFA 1Y7TA 2W2LA 3KSUA 2EF1A 4U0JA 1C0IA 3I5MA 4ZN6A 1DAOA 1DC3A 2PLAA 3DOCA 3NTRA 4GX2A 1H6CA 3DBHA 4J1NA 1ZK4A 4TRNA 1QLHA 5CPBA 5EJ2A 4D45A 4KOAA 2G0TA 1YRLA 3QVWA 4B7UA 3C8MA 4PG4A 5HM8A 3ZWYA 5ITWA 5L7WA 3MJTA 1W0CA 1ZKMA 5I8ZA 4TZTA 1E1MA 2JL1A 4RF3A 5B37A 5JAMA 4FW8A 4J3FA 3H9JA 1YBMA 3RC2A 2EGHA 3L0DA 4E5KA 2NQ8A 2O2SA 2OUIA 4I5GA 3WWZA 2NU9A 5DDIP 1BMDA 4TVBA 5KVQA 4RVGA 4GKVA 2HUNA 2DLDA 2E49A 3VH1A 4TMFA 2ZKLA 2HJSA 1Z6ZA 3ST7A 1ENPA 2OMEA 3RKRA 3NT2A 2X5KO 4UEKA 2EW2A 1F06A 4OIMA 3RCBA 5ER9A 4CM5A 3DDNA 3F46A 3HG7A 4FOSA 2UV8A 3L4SO 3CXRA 3ONDA 3QLJA 5JO9A 4A7PA 5IDWA 1WXDA 1DO8A 4XX0A 1XDWA 4CMJA 4FFNA 1JW9B 1XHLA 4PLPA 5I9NA 4D0RA 1SBYA 4AJ2A 4JBIA 4E33A 4D41A 1ZH8A 4WJZA 4P22A 1VJ0A 3KYDB 2GRAA 2I9PA 4KWIA 5ER6A 3Q6IA 5G4KA 4L74A 2PFGA 1YL6A 2JD0A 4WLOA 3ZWMA 2P91A 4BO8A 1A4IA 3BHIA 2GNAA 3G1UA 3D0OA 3L6DA 5JCJA 2GSDA 3WFJA 4BO7A 3TZKA 4XYBA 2ILTA 2Y05A 3R1IA 1GYPA 5B12A 1U4SA 2GUGA 1NAHA 4W82A 5IN4A 2CF6A 4PLHA 4BO2A 3FTNA 3LC7O 1YL7A 5CDTA 5CP8A 4CMGA 1Q0QA 4ZRNA 5ADHA 4QO7A 5IN5A 1BVRA 2NQTA 1P1IA 2J8ZA 3AUTA 2ZB3A 4K9DA 3KLPX 4RORA 3B1FA 3QSGA 3WGYA 1HDYA 2JHFA 1DSSG 1R16A 2IZ0A 5TGDA 3QJ5A 3CIFA 4NK4A 1U8FO 4ALIA 4N5NA 3R0IA 3M1AA 3JQ8B 1Y8RB 1RM5A 3BZUA 1BXKA 2C2XA 2O3QA 2Q50A 2WE8A 1MG0A 2AEMA 2Z1NA 1LU9A 2O7QA 4L4SA 2CZCA 4W99A 4UUMA 3ZV3A 4BB5A 3GZ4A 3NKLA 3PJFA 2YHUA 3Q1LA 4GWKA 2VUSA 1VKNA 3LDHA 5DN9A 2NVBA 5L9AA 3H2SA 2X1HA 2EP7A 3C85A 3H9QA 1MLDA 2NUAA 2QRKA 4Y6RA 1P1RA 5TLSA 1AXEA 5JNLA 4YR9A 1PQUA 2HMTA 4YT2A 1I01A 2YV1A 4W9NA 2FZWA 1W4ZA 4OXNA 2DPHA 4RV9A 4DIFA 1ADBA 1ISMA 5C37A 3ZV4A 1A7AA 4ND4A 4R16A 3IIEA 3K5PA 3MJEA 4J49A 3JYOA 4XIJA 1ISIA 2C5EA 3CEAA 3GVHA 4XQGA 2HDHA 1I8TA 1WDMA 2QX7A 1FK8A 2XOXA 5FF9A 1DRUA 4GX5A 4B8ZA 3QVTA 2NU8A 1R0KA 3HHPA 3DXFA 5A9SB 1RM0A 4LK3A 2RHCA 4HY3A 4LISA 3STHA 2PD6A 2Y0EA 1TT7A 3CE6A 4CMEA 4B4VA 4K26A 1E77A 1R0LA 5AXDA 2IXAA 2YDYA 3QWFA 3VZPA 4I9HA 2EV9A 2Y66A 2VRCA 1U7HA 4YBZA 3ZH2A 4M8SA 5BSGA 4WPGA 5U9CA 3JQAB 5B4UA 4TRJA 1I3LA 1OC2A 3HJAA 3IQDB 1PQPA 2JAHA 2NTJA 4BO3A 3KYDA 1O5IA 3MJCA 3AUSA 4YVFA 5JYDA 2VYVD 3TZCA 3VPXA 2UUPA 2GN6A 2O23A 1K89A 4K1LA 4B4UA 4CLDA 1BRMA 4LGVA 1BDMA 3R3SA 5CFZA 1LSOA 4AJIA 1DC6A 1X13A 3AOEC 3DMTA 1LLQA 5G4LA 2WMDA 2ZB7A 3FTPA 2VRBA 4OAQA 5L4LA 2PGLA 3C3XA 3RJ9A 3HFSA 5B1YA 4I1IA 4R9RA 4E5NA 4FFOA 3ETDA 3INRA 1I32A 2Q46A 4WOJA 1X7DA 2OXIA 5L40A 3PQEA 3PHHA 3W4JA 3A1NA 4DREA 3HB5X 3GN1A 3TSCA 1L7EA 1Y6JA 4YB8A 3IL2A 4CMHA 2VWQA 2FPIA 4R1SA 3BTVA 2A35A 2VNSA 3IKVA 1YB4A 1Z82A 3T7CA 3W4KA 1KEWA 1EE2A 3WGGA 4D79A 2EJWA 2F1KA 4WKGA 5H83A 5TIIA 3JQ8A 3PI7A 1Y8RA 2P68A 3O4RA 2O3TA 4XIYA 2HJRA 1DXYA 4HX5A 4YAJA 3MTJA 4DRYA 2IEDA 4HKTA 1V8BA 4YJDA 1LA2A 2CVZA 3ZWAA 1CWUA 1XU7A 2ZTLA 3N58A 1IYZA 2NLOA 4Y67A 3M2PA 3CPSA 2OP1A 1KERA 4KQXA 3RU9A 5A3VA 2Y1EA 3ZHBA 1P1JA 3GRPA 2X58A 1PJ3A 4FIZA 3R3JA 3DL2A 4L76A 3UN1A 3DAFA 1Z7BA 2FN7A 1WW8A 4DIBA 4KUGA 4BNFA 4DQUA 4QXMA 4R68A 1YONA 4S1VA 3VZSA 5CEJA 3F3SA 3KZVA 1PWZA 2Y1CA 4LRSB 3ZU4A 4KDEA 2AQIA 2VWGA 4N5MA 5K6AA 4GX0A 4DC1A 3WBBA 3ZWWA 3RBVA 2RH8A 3SC4A 3EGOA 2Q3EA 1HE2A 4M87A 5G0SA 3DBRB 4A73A 5CAEA 2FWMX 5T64A 4NPCA 4IS2A 2HKIA 4BQRA 5A9SA 3RUAA 4CUJA 4E2YA 3I4CA 2F00A 1NFFA 1VI2A 3BTOA 1UZLA 2EKQA 5ES3A 4BGVA 3HN7A 4LCJA 5HS6A 1JDJA 1IB6A 2BI7A 1O8CA 1UXHA 3L77A 4J43A 1TLTA 4E2XA 4KWHA 1SMKA 2OP0A 4QO8A 3RVDA 3JQAA 3GA0A 1LC3A 1YL5A 1MC5A 4K28A 1JQBA 3SX2A 2FP4A 1N92A 1ZNQO 4JJIA 3FF4A 2I99A 5K0ZA 4YEDA 3LLSA 4UREA 4PG8A 3I9LA 5JY1A 3BHMA 3Q3CA 3OICA 2Y0CA 4H15A 5H81A 1JKIA 4AJ1A 3IUPA 1D8AA 1DEHA 2J3JA 2YW9A 2HRBA 1IHXA 3OQ6A 5G0TA 2OL4A 1TA4A 3A28A 3WS7A 4PZEA 1T25A 1T2DA 1JN0A 3HDYA 4RPKA 4MVJH 2V6MA 3WFIA 3GR6A 2GASA 4P4NA 1BHSA 4PGFA 3JD2A 3KXDA 3KYBA 1G0NA 2Q1UA 1KVUA 3B20A 1GQYA 1V9LA 4MVJP 3Q9UA 2FY8A 3P2OA 4BNNA 2CUKA 1CF2O 3GGGA 4R1NA 3CINA 2EWMA 1QR6A 2ZIZA 3WQQA 3QWHA 1HETA 2PWZA 4JIGA 2DTEA 1N1GA 1D4FA 4XD2A 5AOVA 5KKAA 1NX6A 2HMVA 5IZCC 1ENZA 3U4HA 2I5PO 4CMAA 2GGSA 1QKIA 3AY6A 4U6SA 4WGGA 2VZ0A 5L45A 5AXCA 1YBVA 1EVZA 2XAAA 1ZK1A 2QRLA 3LT1A 3ZCXA 3O26A 2DFDA 2YQ5A 4CV1A 1MC4A 4XQ9A 2BRUA 3MCVA 3PQFA 1HYHA 4XDZA 4J4TA 3WIDA 4U6QA 1S7CA 3JQDA 4RPHA 5U1PA 1ULSA 1B8UA 5I9MA 4UEOA 3U4DA 1QYCA 1EBUA 1DHTA 3D5QA 1GYRA 1R4NB 4M49A 1PS0A 1SC6A 2D3TA 1V0JA 4OSPA 4PLVA 1HTBA 4RVDA 4H3VA 3WBFA 3LF2A 2IDZA 2GZ1A 3FNHA 4CLOB 1GFSA 1CDOA 1T1RA 1WDKA 3TL2A 1HDCA 4W4TA 2B4TO 2DTXA 3DWFA 1GUZA 4EEZA 2PGJA 4C7KA 3H3FA 4PG7A 3RSHA 3KETA 1IPFA 3G1TA 4JP2A 5JY6A 3TRIA 3GVPA 4WEQA 4GLLA 3ABIA 3E03A 2EG9A 2RH4A 3BA1A 2WD8A 3HQ4O 5L7YA 3U49A 1ZMTA 4FPXA 4NNJA 3DBRA 3VPSA 3JD3A 1ISJA 4BO5A 1AGNA 3GPIA 4QFCA 3LQFA 1YQDA 2FR0A 1I33A 4NH4A 1JAYA 1KBZA 3ONEA 3SC6A 3VTZA 3WJAA 4JQCA 3WNVA 2B4RO 1F8FA 2AG5A 3C1OA 4J0EA 3E5MA 3NAQA 4RLHA 4Z0HO 1EDOA 3TZ6A 3U4CA 4CJXA 1LSSA 4DMMA 1WMBA 1R66A 1LLDA 3DZIA 4AJOA 2GDZA 4UEJA 4CV3A 2VWPA 3GUCA 2PV7A 3RD5A 5C7IO 2BFOA 4UVDA 1P1FA 3FRJA 2C5AA 3LSYA 3ZV6A 3S2FA 3DZGA 4B3IA 3F6YA 1B3BA 3MJSA 4RCVA 3TJRA 3W6UA 3GAFA 4AJNA 5I8WA 4RPGA 4XJTA 5KJ6A 1JLLA 3WYCA 4D3DA 1O9BA 4RL6A 4E12A 1QYWA 4CM3A 3DOOA 4GWGA 4YT4A 3I6IA 3DQPA 5ICMA 4URFA 2FPPA 4ZJUA 2I65A 2Z5LA 2AEJA 4ZQEA 1E92A 3BMOA 3U9LA 4LVUA 3D1LA 3VPFA 3U4IA 3DTYA 4E2WA 2JCVA 3HDJA 1FJHA 3I23A 2NVUB 3INGA 4XGNA 3RBZA 1E7RA 1SB9A 1DAPA 3NDRA 3ZWNA 4QECA 4F3YA 2HSDA 3DAGA 4CMBA 4GQAA 4J4HA 3X2EA 1ZJZA 4B8WA 4XRRA 3ZNPA 1LJ8A 2VCYA 3NX4A 4EDFA 3GVIA 4NK5A 4Y98A 3F5SA 2D2IA 1DLIA 2JJYA 1PGQA 4AFNA 4E6PA 5T8KA 2B37A 4CM6A 3O9ZA 1AN9A 1MB4A 1NVMB 2HQ1A 3A4VA 4RF4A 5EPOA 3ZGYA 1N5DA 3ANLA 1YO6A 5TX7A 3ZU3A 4EJ0A 5A4DA 1Y9AA 3K6JA 4MIEA 1V3TA 2NSDA 1HE5A 3WMWA 4NFHA 5H82A 4PLGA 4YQYA 4JBGA 4RPLA 1V3UA 1EUCA 1LLUA 4IQ0A 1R4NA 3TN7A 4R3WA 2QW8A 2PTGA 4GPD1 5GMOA 4CLOA 1ML3A 2YUTA 3H8VA 1A9YA 1U3UA 3UCFA 3MOIA 3OJ0A 5KVCA 2NVWA 5DZSA 5JAIA 4ALLA 3BXXA 2CDCA 2IE0A 1D1TA 2P9GA 3PYLA 5CG2A 4TSKA 3KSZO 3VC7A 2VT3A 3H4VA 5F3RA 2AXQA 2CNBA 1UH5A 1R37A 4MVJD 1SOVA 4LSMA 2PNFA 3GMSA 4XYEA 4WNIA 3NJ8A 3JYQA 3S1LA 2Q2QA 1DHRA 4J91A 2FHSA 4RF2A 1ZXLA 2Q2VA 1KOLA 3W8DA 2XF8A 1PGOA 4GVXA 3L6OO 4KMSA 4WASA 1B16A 3KVOA 3FPLA 4JGBA 1PGNA 1FDVA 4HBGA 2Q4EA 3NRCA 1LI4A 1JU9A 2VN8A 2D59A 4QEDA 4ZHSA 4YA6A 2HAEA 4QQRA 4PVDA 3PHLA 4A10A 4BKPA 3VH4A 4PZDA 1OOEA 4Y9DA 3LK7A 2HK8A 4KP7A 1WZIA 2ZJ0A 1MG5A 3PHIA 3RFXA 4CUZA 3ONFA 3GEMA 4IDAA 2AW5A 1EUZA 3H3JA 3PVZA 4JX8A 5MDHA 2IZ1A 4RO0A 2WDZA 1B2LA 4R51A 2DUUA 2DBVO 1H9BA 2DM6A 3IDSA 3V8BA 3ETGA 4O0LA 5CG1A 4Y6PA 4A0SA 2W8ZA 2JFHA 3CMCO 4WE3A 4ROSA 4CODB 1WLYA 1SNYA 1N2SA 4BL5A 2DBRA 3PEFA 4Q3CA 4XEHA 4G81A 3PZRA 4CM4B 1HRDA 4MKZA 4HFJA 2NVUA 1HYGA 3H2ZA 3TOZA 3TL3A 4W9NC 4DYDA 2DUWA 5T67A 3GC6A 3IP3A 3PLNA 2YQ4A 1CQIA 1DIGA 5FEUA 1SB8A 1UZMA 2NV6A 1UDBA 1UAGA 1C1XB 2Q45A 3OECA 4OOFA 3TZQA 3PDUA 1T2EA 1RYDA 2RIRA 4MDHA 5KKCA 3MJ4A 5EQDA 4UVEA 5JFOA 3RWBA 3H5RA 1NQ5A 3UAGA 3I9NA 3V5NA 2QZ9A 4Z3DA 2ZYGA 3FPCA 2GERA 5DP2A 3D64A 3Q11A 2NM0A 1KEUA 4NBUA 2X5JO 4XA8A 1NVTA 4XQEA 3ANNA 2PZMA 4UVIA 2D8AA 5LDHA 4FN4A 3WMXA 1ZCJA 4BKRA 4JLWA 5LCXA 1WNTA 3OBBA 3DFUA 4CQMA 1QORA 5COAA 4OGWA 3I52A 4RDIA 4ESOA 1U5CA 4FFPA 4S3MA 3FNGA 1PQWA 2PZLA 4IJWA 2ZYDA 3EVTA 5BNFA 4WCFB 3ZU2A 2GPTA 1AXGA 2WE7A 3CZRA 2LDBA 3AUUA 2JKVA 2C7GA 2BD0A 5CEFA 2SCUA 2AE2A 4TRRA 4U7WA 5KJEA 3DMTC 5J23A 3BTUA 1GQQA 4IXWA 3WGZA 2YDXA 1IZ0A 4A2CA 1BDBA 3NGXA 3RJ5A 1NBOA 4BO9A 4JROA 4GH5A 4YAGA 4YDRA 1Z75A 4DVJA 1EVIA 4WCDA 3TWOA 3MZ0A 4EUHA 4GMGA 5JE8A 5IZ4A 1IL0A 3KEOA 3VH2A 1C1DB 4KQWA 1DOHA 5DCYA 1V3VA 3K73O 4CV2A 3PWKA 3JQBC 3RUCA 3HE3A 3WOHA 4FC6A 7MDHA 2DVMA 3OEYA 4LW8A 4BNTA 1ZSVA 4GVLA 4IZHA 3W6ZA 4BMNA 3V1TC 1OMOA 4YXFA 3E82A 3ASUA 4CM1A 1EUDA 1GUFA 3PYXA 2VOEA 4J7UA 3TFOA 1T2AA 1QSGA 2QRJA 4XDYA 5L4NA 4EJMA 4DPKA 2D1YA 2B5WA 1XCBA 3ZI0A 3I1JA 5JS6A 5KJ1A 4BGUA 4JN6B 3KYCB 1G1AA 4DLLA 3BMNB 3KOUA 2WYWA 4MJLA 2I3AA 4OHUA 3NYWA 1HSZA 3QQPA 3P19A 1C0KA 4DA9A 1IY8A 1ZEMA 1Z7EA 3UCEA 3PGXA 3PJGA 5KCZA 1OAAA 4I5FA 4DTIA 1PJ2A 4YPOA 5EQFA 3PFFA 4L0QA 5HA5A 4CM4A 1M2WA 4AJKA 1MXFA 3WGTA 2C2YA 4PG5A 2YHIA 1X7HA 5A02A 1UP4A 3DR3A 1WDLA 4CR8A 1U3TA 3C1AA 3NTOA 3KTDA 4O6VA 3U3XA 1EDZA 1U1IA 5K6AC 3AM3A 2PH3A 1ZUD1 3ZNNA 3GN2A 1Y5RA 2QHXA 3WJ7A 4XR4A 1VRWA 1XWFA 3AW9A 3KEQA 1X1TA 3HZZA 4M1QA 4D43A 1GYQA 2GN4A 4FQ8A 5DBIA 1DB3A 3LYLA 4B4WA 1LBEA 4D42A 3CTMA 1VSVA 1EK6A 3KB6A 4O59O 4NDNE 2HMUA 1F14A 4N5LA 2Y93A 3NTQA 4PLTA 4UULA 3BMQB 1XGKA 1VKOA 2ET6A 1ISHA 2DFVA 2O50A 1J4AA 2AE1A 2Y0DA 3PJEA 1RPNA 3FN4A 5AXBA 2PD4A 3N74A 2CDAA 2DU8A 2AEFA 4ZD6A 4WCFA 2VUTA 4HUJA 3D5TA 4NU6A 1PJLA 1RJWA 2Y68A 4P38A 5A9TA 4HFNA 1GY8A 4I5EA 5DT9A 3EMKA 3D4PA 4OQZA 1YQXA 3PHJA 4D3SA 1KVRA 4UVGA 1Q0LA 1P1HA 1O89A 2JCYA 1HZJA 4IDGA 5IG2A 1LXCA 1ADFA 3UFXA 3JQGB 5MGBA 1K5HA 5ICSA 5I7SA 1ONPA 4DL9A 1C1DA 5BSHA 2ZCVA 1GQ2A 1I2BA 1P45A 3FBTA 1OBFO 1E6EA 4DPMA 5L4SA 3ZWBA 3PGJA 2IEBA 4OXKA 1NPDA 4RVSA 1JWBB 2AHRA 1NWCA 4KUHA 3RQSA 1PZHA 3GFGA 1K6IA 1JA9A 3T7EA 2VZ8A 1E7WA 2PZJA 4BMVA 1VL6A 2P9CA 1TXGA 2J5RA 3GMDA 2Q49A 2G1UA 2DQ4A 1WWKA 2JFGA 4BS9A 2W98A 3F9IA 3VZRA 1EZ4A 2WYUA 3OJLA 2Q2WA 3AWDA 1GEGA 1IE3A 3BMNA 2DPGA 3WSVA 5COBA 1LSUA 1NR7A 4NIMA 3E6AA 2X0NA 2NWQA 3DEYX 4WECA 4OO3A 3OSUA 2OGUA 4MP3A 1BGVA 4MO2A 3SLGA 2X8LA 4QUKA 2PA3A 4TKLA 2CSUA 4CMIB 4MOWA 2VYND 4MVJI 1CQJA 3CUKA 4Z0TA 2LDXA 4JBHA 5TRTA 1QMGA 4YRDA 5IJZA 4XJSA 3GLQA 3SLKA 1LX6A 2EGGA 1CERA 2A94A 2YV3A 3EYWA 1HF3A 1HYEA 2J3KA 4FGWA 1JVBA 3JD4A 4R5MA 4E21A 1ZSNA 2VHYA 3ZW9A 2A9FA 3E9MA 1GU7A 2OZPA 1Y9EA 3TPCA 4Q9NA 4C7JA 5F21A 2IYPA 3BHJA 5JC8A 3IUSA 1T24A 3DB2A 4ZVVA 1HDZA 4R5HA 3OF2A 4R9SA 2JHGA 4WEOA 2CD9A 2ZB8A 4LMRA 1I24A 4Q39A 3AI2A 3G49A 2X6TA 1PJCA 4MP6A 4Z0PA 4A26A 3ZWVA 4IJKA 1P74A 4TZKA 4U5QA 1I3MA 2B4QA 4E3ZA 4D7AA 1KS9A 4FBGA 3QVSA 1U3WA 3I9KA 1JTVA 2A92A 1GUYA 1QLJA 5DULA 3UGKA 4AJHA 1DIRA 1UP6A 3W8EA 4W7IA 1YJ8A 3ZHZA 1MUUA 1SO8A 2P4HX 1FMCA 1B26A 3IP1A 3GT0A 2X9NA 3LU1A 4EI2A 3L9XA 2ZTVA 4FFLA 4LRTB 4QSMA 3OP4A 3UF0A 4BGIA 4CL8A 4PLYA 1ADGA 2J5QA 3RI3A 3ROQA 1FDUA 3ENKA 3JQGA 3N7UA 1ENOA 2YFQA 5BSEA 3GOHA 3HWRA 2GYYA 3GK3A 3I9JA 5DOVA 2QIOA 4FDAA 3ZWOA 2WWRA 3DONA 1PZFA 1FDWA 3INTA 4JJFA 4HFMA 5BT9A 5U4QA 4DYVA 5L7TA 4J1TA 1E7QA 5KNLA 4FCCA 1JKJA 1E1KA 3CMMA 4PIVA 1P33A 1RM4A 3FI9A 3EUWA 4II2A 4E13A 3VH3A 4MVJE 2ZB4A 5T8KC 4CM9A 1JKFA 1XLTA 4GKBA 1E3IA 5KOIA 4DXHA 3RC7A 1E7MA 1QRRA 4EJ6A 3GZNB 3ADOA 2UVDA 3ITDA 3O03A 2PK3A 5A04A 4CM8B 4YTEA 1Q0HA 5GY7A 4ALJA 4BKOA 2IZZA 2C59A 4IM7A 4CLRB 4M55A 4MINA 5CDYA 4NBWA 4CMIA 3DC2A 3I3OA 2BLLA 1K3TA 4BNKA 4OJNA 4YQZA 3D3WB 3C7AA 1T26A 4KTTE 4EEXA 5B4VA 5KJFA 3OM9A 1BXZA 3VPHA 4R3NA 1R6DA 4CR6A 2ZTUA 2YV2A 3WR5A 4L9RA 1VC2A 4Q3AA 4HADA 4I9NA 5AVOA 3RUDA 2CMDA 4DMLA 5TJHA 2DBZA 3WGOA 4YAKA 1QG6A 4PLWA 3AI3A 3E9NA 4R1UA 4IGFA 1YVEI 1VJ1A 4YRBA 4KUEA 3PRJA 3OJEA 1MA0A 4IQGA 5JCJD 4IUYA 2V6FA 1WAMA 5FYDA 2X23A 4IXTA 2H1SA 4NHEA 3F4LA 1NFQA 2P5UA 3AJRA 1IUKA 2NU7A 2W2KB 4Y6SA 2HCTA 3H6KA 3QRWA 4BO0A 4BNLA 3L07A 4IDDA 1VL8A 6LDHA 2Y1FA 1R12A 1OI7A 5I7FA 3PPIA 3I9MA 4NFSA 5A5FA 3ENNA 3MWEB 4BNXA 3AOEA 4ND2A 4BO1A 4IINA 1YS4A 4ALNA 5JBIA 4RF5A 3AU9A 2DTDA 5EIOA 3JQFA 1GPJA 3AY3A 2GLXA 2B5VA 1G6KA 1ARZA 4I8XA 3NV9A 1KYQA 3ETEA 5FWNA 4MKRA 3AFMA 3ITKA 3P5SA 1NYTA 4PN3A 1HDRA 3SXPA 3UH1A 5CDSA 1PJ4A 4IDCA 3PFWO 2I66A 4E5PA 1UXJA 5IDYA 1NHWA 2BF7A 2I6TA 4I5DA 1UR5A 3PQDA 4UUNA 3VDRA 2DAPA 1DJQA 3HADA 3PJDA 1P31A 4E5YA 5THKA 4A03A 1CETA 3WG9A 1TI7A 3Q2IA 4GMFA 4R69A 1ORRA 1H9AA 2B35A 1Z45A 1VM6A 4ONEA 3RKUA 2C20A 3QVOA 3JQ6A 1K0UA 2J3HA 3K30A 3WLFA 2VHZA 3EW7A 1I5RA 1RKXA 1WZEA 4J2HA 4OL9A 4NMHA 1H94A 4RLSA 1QXSA 3H5AA 1O94A 3GZNA 1C0PA 1PSDA 1V35A 5ENVA 1DFGA 3OIFA 2VZ9A 4FFMA 4CM8A 5C3MA 3FHLA 4XGIA 1X1EA 1N8KA 5JW6A 3U09A 4CLRA 5FI3A 3VKUA 2ZCUA 5L95A 1E7SA 3HDHA 1I3KA 1DFHA 1OZAA 3VAZA 1NXQA 3AOGA 3DHYA 3PXXA 1E3WB 2Y1OA 4KDFA 1UJMA 3D3WA 3EAGA 4ZQGA 1ZIDA 3VDQA 1M75A 2OORA 2YJZA 2VRCD 1UXIA 3FNFA 3PIIA 3PWSA 4QFDA 4CMKA 4DUPA 2BGMA 4ZQFA 3CH6A 3WGIA 2J6IA 2E48A 5HTOA 4B79A 4Z6KA 1YGYA 1E5QA 1LQTA 3UICA 3ZWXA 3AU8A 1JAXA 4E32A 3V2UA 4FB5A 4BNHA 4PLCA 4AG3A 2G82A 1OC4A 1XG5A 4OM8A 3D7LA 4ZQBA 3JV7A 3NT5A 4BOYA 1NPTO 3C1TA 4NR0A 3M2TA 4Z9YA 3JSAA 4DC0A 4FOOA 3OMLA 1QP8A 4J90A 3AI1A 4ZA2A 3GQVA 4BUCA 2HU2A 3SEFA 5G2OA 1VJTA 2X22A 3GHHA 3AK4A 2VOJA 4IZIA 1KETA 4DLBA 1IOLA 1PWXA 1ZSYA 3QP9A 4F46A 1BG6A 4XRGA 1M76A 1XU9A 1XIVA 2W2KA 4FGSA 4Z9FA 1DLJA 2VT2A 2NTNA 3ZNOA 1VPDA 1C3VA 5IXYA 1FXSA 1E7YA 4E5MA 4HNHA 2O3UA 2AG8A 4OKIA 1PGPA 4BO4A 5JDIA 2JD1A 1K6XA 2BFPA 2JFFA 3V2HA 3ZZNA 1KY5A 5DOZA 3LZ6A 1Y8QB 4XYGA 3PP8A 1F17A 1I3NA 4E4YA 3Q9NA 2NADA 3KLMX 4D44A 2BHLA 4FFRA 4EITA 1VE9A 2DKNA 3L9WA 3OHSX 2E6UX 1H6BA 4NJOA 3F47A 4NBTA 5HBRA 3DAPA 4BQPA 1HSOA 2P4QA 1LLCA 4OXYA 3SJ7A 3GF4A 2DBQA 4MVJM 2V6GA 4NI5A 4DBVO 4WLEA 1UXKA 3Q0EA 2ZJ1A 1SZJG 5IZCA 1BTOA 1B0AA 2PKQP 1DRVA 3LT0A 4J9VA 4D46A 4GSLA 2VYVA 1GADO 3BTSA 4AICA 5ITVA 3PWZA 4F6CA 3VKVA 4WK6A 3JYNA 4AJLA 2WSBA 1LTHR 2IRWA 5F1PA 5JPIA 3ZNQA 5DCUA 2ZQZA 5JO0A 1GZ3A 5TJ9A 1LUAA 3QW2A 2GZ3A 5KVVA 1TEHA 1U9JA 1XYGA 3SJUA 1N9GB 1TVEA 2GZ2A 1R0SA 3ULKA 2B0JA 3WNQA 1P9LA 1GR0A 3HN2A 5TF4A 4RVUA 4P8RA 2X86A 2XPCA 4BGEA 4IIVA 2BFAA 5IDXA 2XXBA 2V65A 5EERA 3EC7A 1GCOA 1ZVMA 2QYTA 3O8QB 3FNEA 5C5IA 2FMUA 3A9WA 3GDFA 2ZATA 3A14A 1UZNA 4AL4A 1E3WA 3OETA 4YJFB 3KO8A 1NM5A 3GG9A 1AUPA 3GNTA 3GH3A 2IODA 2PZKA 4AJJA 3DZFA 3QHAA 4J7XA 5LDGA 3H65A 9LDBA 1HZZA 3JQAD 1ZEJA 1E6WA 5TC4A 5JDCA 4WCFC 1P77A 5KJCA 3PTZA 1BWSA 3ZWPA 1E5LA 2J5KA 1FF9A 4J6FA 1A71A 1XKQA 1CYDA 3D4OA 2QZZA 4EGFA 5JAZA 2UDPA 4R54A 4TROA 7ADHA 1TT5B 3JQCA 1MGOA 3HFGA 1GDHA 5ILGA 3GNQA 1ZXBA 1EFKA 1A72A 3W8FA 4BNVA 2Y67A 2X4GA 5A1TA 4CMEC 1K2WA 1P3DA 4CLHA 1DIBA 4GGOA 4OKNA 1R4MB 3S2EA 3NGLA 5KVSA 1Q7GA 5JMPA 1S6YA 4CQLB 4M89A 5I7VA 4N54A 2RCYA 3GEGA 1DIHA 3B1KA 4PCVA 3ZHYA 4YJGB 3EDMA 2XXJA 3QWIA 4QT0A 2FSSA 2V6BA 1V6AA 3OIDA 4K6CA 1GV0A 1UDAA 1Y8QA 1RWBA 4Z3KA 2G5CA 4BMSA 3HUDA 4H16A 3UHAA 3RUIA 1FDTA 2OBNA 2R00A 4J9UE 1KVQA 2W4QA 2NACA 1PL6A 1K6JA 4IDFA 3ZW8A 3U62A 4DWVA 3OFSA 1BXGB 2YZ7A 3LLVA 3M1LA 5L3ZA 4ILKA 1NVGA 3VOSA 5CPFA 3ZV5A 5AQ1A 2GN9A 1HKUA 2NNLD 2PR2A 3QVXA 3ZHXA 3JQEA 3IKTA 4J1QA 5GZ6A 1A4UA 4NBVA 4MIOA 1P44A 4KTVE 1KEPA 4E31A 8ADHA 3DZHA 1I2CA 3FR7A 5TSDA 2Q1SA 2ZK7A 4XQCA 3FSRA 3SVTA 2QYSA 3RAJA 1D7OA 4R01A 3PLRA 1HDXA 3G3EA 4IJUA 4OYRA 5EINA 3WX0A 4AVYA 1MX3A 1XA0A 1N9GA 4ZQHA 3U5TA 2PKQO 4RZIA 5A05A 2FSVA 3WWYA 1KVSA 3F1LA 3M6IA 4U0KA 2EHDA 1PS8A 4MVJF 4GBJA 3K2BA 4LSWA 4FD3A 2JD2A 3AUAA 4YRAA
chains in the Genus database with same CATH superfamily
1SEPA 3WWOA 1HEUA 5LMUB 4HQFA 2C9ZA 4D0SA 2GK6A 3H87A 3PQCA 1I0ZA 1ZFNA 1WOYA 2O6HA 5MN6A 4FJ1A 3T3HA 4Q7EA 3FOFC 1MJ5A 1SBHA 3SI7A 2E87A 1SEVA 4YO7A 3KT8A 1WHSA 2P7IA 2X5XA 2YYYA 4MITA 2EP5A 4O63O 1A8IA 4EB8A 4DG5A 1YQGA 1H23A 2QT9A 4I5IA 2YZ2A 2W90A 4ZICA 2HT6A 1EYZA 1L7DA 2Y4NA 3W0LB 3OQBA 4CU5A 2AFHA 4CIAA 1N1EA 4KBFA 5FAKA 1RI3A 2UYQA 4OG2A 5IXSA 3QE3A 1G8YA 1J09A 4KFRA 5LP6A 2OV8A 2Y4OA 4FYWA 1ORTA 3TDKA 4KVZA 3MCAA 1C8KA 4E7OA 4F2DA 3B2EA 1KGDA 1V2HE 2JLUA 2RMKA 2FRXA 2O0HA 3ZN2A 4AY3A 2KS6A 2V6JA 1ZH2A 3TK1A 2H1LA 4ZU6X 4N48A 1CJMA 2I76A 4DANA 4WUVA 1RBYA 1JLRA 4G63A 2E37A 2ZANA 4H1WA 2C04A 4EKGA 3S8YA 2BV3A 1DJPA 3TRHA 2G17A 3K6KA 1U81A 3OCWA 4WBSA 4X20A 3FCSB 4AX8A 3USES 4HNGA 1Z0KA 3HLYA 1G20B 1P6UA 1F12A 2N47A 1QGUA 3AKCA 4KGDA 5E38A 5H3HA 3G5TA 1F48A 1XQ9A 2CUZA 3UNXA 2HGSA 1BWRA 1VLJA 2ZTSA 1E1DA 4H4CA 2I9KA 3CB2A 3EEYA 3FMFA 1Q3KA 1SRRA 5F51A 1OB2A 2VQSA 4UCQA 2O19A 1ENYA 5DHRA 1EINA 1LQUA 4G56A 4IMRA 4I9FA 2QTMA 4UPVA 2PX5A 1BEZA 1J70A 2LD4A 5J4KA 4UQPA 3TGLA 1NG1A 1BW9B 1D4AA 1J0AA 1HLGA 2RHOA 3RGWS 4PLFA 3U13A 5IT0A 5TS3A 3K1TA 3I4FA 1XLTC 4B46A 1LDNA 2Y2VA 4GOJA 2NZUG 1H93A 5IEBA 2V96A 1A76A 2WMYA 3CSSA 4JC0A 4F8EA 4DDTA 5C7LO 4ZRMA 2ZDHA 4RMJA 4WCVA 1IN4A 1WUKS 2AQ8A 3ZIAA 2GF0A 6ADHA 5BSFA 5GONB 3MRTA 3SBOA 3W2FA 4RNDB 2JIDA 2AN1A 4I4NA 1G5HA 1QV6A 4M0UA 1X1BA 4EZBA 5ALTA 3G23A 5AKHA 2F1RA 4RIEA 5LA6F 4PVCA 3GVCA 4KFSA 3RC9A 3R6DA 5F3WB 2GBPA 4JP8A 1G7CA 5CLQA 2XOEA 1P2GA 3JPWA 4EI7A 4NBRA 1Z16A 2IU3A 5AESA 3BS4A 3R5HA 4A0HA 3A9CA 2HJVA 4QUJA 1FFCA 1NVVQ 2GTPA 3W8RA 1VMKA 2VHQA 2ZZKA 1EP9A 3WAKA 2Y76A 3Q2KA 2ERYA 3PZBA 4HXFB 4QODA 2QL5A 4G8CA 4E0BA 3IPCA 2GN8A 4D0GA 4JKOA 2NXWA 4RZ2A 3T7AA 1E1NA 2VDRB 4FB4A 4N7BA 1W88B 3JPYA 3RRMA 2JJ2A 1ATIA 3TF5A 4JLAA 5KU7A 1UAAA 3B1WA 1XMXA 2XMPA 4KXMA 2X9GA 1M0TA 4L1KA 1EQAA 4BVKA 3FVTA 4RE6A 3RHTA 3NUQA 3L4JA 5JS8A 4JNCA 1MENA 2ZT8A 2KI5A 4Y6LA 5KWEA 5EUMA 2ON6A 2WNHA 3Q10A 1L0BA 1N6NA 1RMQA 4Y6QA 1A2QA 2VS1A 1O2DA 3LQ1A 3RBAA 2BN4A 3FUXA 4LKRA 5H9WA 1CUEA 1L4HA 2QG4A 1X1RA 3ORFA 4EPXA 3DMHA 3KOOA 5FL7A 4J8PA 4B7CA 2OPHA 3UGJA 3FHOA 1BJRE 3IP8A 4MICA 1I3CA 3I28A 4ZODA 4YV2A 3WB1A 8OHMA 2JGIA 3MAJA 5A4KA 1QQBA 4ND5A 1IWOA 1X3LA 4MV6A 1JWAB 3RASA 1NT4A 3MRXA 1A8HA 2A0WA 1VIAA 2D5AA 1UBCA 2I67A 3E1KA 3IJPA 3LFHA 4KQEA 4YCDA 3TOXA 1Q0TA 1OX5A 3NW9A 4LYDA 4TQGA 3WLHA 4CEIB 3FVVA 3IOEA 2Q4BA 4FR5A 2JI6A 2VUUA 3FI0A 2ZRMA 3HEMA 4UBNA 3E27A 3B9PA 4AKTA 2VXCA 4TV8F 4UBIA 3UAXA 5J2UF 3L7AA 5D5QA 2D62A 2O1EA 3IT2A 4FSHA 4WI1A 3SZOA 5A4JA 5LLTA 2V1UA 4PG8A 2PIDA 1RHMA 3WA7A 3WV4A 4O2AF 3JY6A 1Y3BE 3U0BA 5A4MS 1E3JA 1TYAE 2PYDA 3Q2OA 4OFBA 1KQGA 4LYYA 4YMTA 3BMQA 2V7TA 1PX0A 2PMBA 1OBOA 2BFCA 5L3RA 4OFXA 1UK9A 5EUQB 1T2VA 3KR9A 4RZ3A 2HBQA 3SZMA 2FDCA 3TVTA 1S8FA 3DD1A 4AIRA 3IELA 1LZLA 2QUKA 2CBGA 3QNWA 1J06A 4H31A 5A5DA 2Q0SA 5EJ7A 1YTUA 3G79A 2H4HA 3P26A 3P0RA 3T5DA 2ZSHA 4FFSA 5KWIA 2OZKA 3QELA 4CKYA 1P1KA 3EPPA 1XNHA 3LJKA 3LZCA 5JXWA 5CGQB 5E7QA 2WIGA 3U56A 2J7PA 3EDRA 4I1YA 4P35A 2Q9CA 4PFJA 2OFFA 2WILA 3ACCA 3LF1A 1CUZA 1AMUA 5FWXA 4F9GA 4JI0B 5DN6D 2GF2A 2ZDGA 3LGXA 3MOSA 3DGEC 1N2JA 2D0IA 2QM7A 1CQPA 4Q9HA 5AKLA 1MN6A 2O4CA 3RYFB 3OKFA 4JKIA 4XB2A 3OH8A 4CR7A 2OD2A 5IF3A 2YWCA 3WIBA 4I66A 2VTEA 3KB1A 3LPNA 4O5OA 3IIKA 3K72B 1A7KA 4MW9A 4BRZA 3ZI4A 2VXYA 4LZLA 3VHRA 4LJKA 2EBUA 4GAEA 5AOAA 1QRTA 1U5AA 1W73A 5LR6A 2ZBRA 4DSTA 2WF9A 1XQ1A 3C16C 3MNFA 2NNWB 1YJ5A 3DO5A 4NJMB 1ORIA 1MFPA 3DJFA 5EL0A 3WMGA 2VA9A 1MW9X 3WLOA 3A9UA 1TTTA 4HB2A 4JT9A 5C31A 2G9UA 4G65A 4DN6A 1JJIA 1FXWA 2IYLD 4F91B 3LY7A 4ABYA 5LWHA 2ZYVX 4AUKA 1M2FA 3RJZA 5B5SA 2YWBA 1MEJA 3I9V6 3QMWA 4OQXA 4AKGA 1AXRA 4YAFA 1ZZEA 2AWOA 4B7AA 3FOEC 1DTEA 1SUEA 2VK2A 4IYJA 5K0TA 4OOEA 1GEEA 3FAKA 1YBHA 4ZU3A 4QWWA 3M34A 5GP1A 4ANFA 4CYMA 1P4SA 2I2FA 4Q9KA 2MSWA 4DR7B 2W0MA 1DAMA 4RHCA 4WY5A 1O57A 1Z56C 3WB0A 2J4DA 4DWJA 2W8BB 2J4CA 3KJZA 4NC9A 4ALKA 1CRWG 1VE5A 1NWHA 3TD9A 1OX4B 5CDGA 5SZIA 4JBNA 3MQ2A 3PRHA 5IC5A 1A2OA 3VHXB 4CGZA 2UXDB 5DGIA 4JT2A 4BO6A 3UA3A 4RSHA 4MUGA 5E0OA 2XXAB 3IV7A 1ESNA 3IBCA 5IKEA 4H1UA 2ZWOA 3L7OA 5JROA 4RTSA 1UK8A 3OLXA 4QDZA 1UKVY 2IUYA 3M0EA 4D99A 4UUOA 3RVPA 2OKCA 5KNCH 4RY9A 3ROPA 2BEKA 4AYTA 1H3NA 3BORA 4DLVA 1I10A 1VYVA 1F0PA 2R6JA 3QVMA 4KQCA 4ZCQA 1FQKA 5DTIA 3T5GA 2CY0A 5JDIC 1GL3A 1HC7A 1VB3A 1L5YA 2JHCA 2WM8A 3GRCA 3R23A 3GYBA 1KFJB 3R0XA 2C0QA 4XD7D 2CLOB 2NP6A 1LQ2A 3CONA 1M34E 1VIDA 1ZISA 3UXEA 4C4YA 2ZQYA 1NE2A 3RT9A 3CLHA 1V71A 4G0PA 2D5CA 3X2FA 3KQLA 5F98A 4CCYA 4RQUA 5CH5A 3CEJA 3PPWA 3NDJA 1VXRA 5ALSA 1AC5A 5TMDA 2ZEJA 1NG9A 1Y4DE 3EH2A 3I64A 4REQB 5IP5A 4KXLA 1KRHA 4K6KA 1I7LA 2GUWA 3QEKA 1NBEA 1KIMA 1R1DA 1RFLA 2DT5A 3RC1A 3RVOA 1OXSC 2B61A 1P62B 4RDHA 4N3CA 3LL4A 4KSBA 1VI6A 3VGPA 3H1AA 3RFVA 3OKAA 1XTIA 3UC9A 3FXAA 1T4DA 2PMFA 1VZ2A 3I1IA 5A3JA 3HSKA 5B4TA 4V0QA 4DQVA 2VLBA 1GZVA 4YASA 3SKVA 4TLAA 3K1ZA 1GCUA 4BLTA 2BFEA 4MCJA 2IPAB 1GN8A 2A5JA 5TT0A 4RA9A 4MRAA 3L40A 4QUBA 3NUGA 1I36A 2H06A 3IJ5A 5AFSA 4C0SA 4EPWA 1D2GA 3Q41A 4KBYA 3RUFA 4MEAA 5ALQA 1EXVA 2REOA 4BC0A 1Q6YA 5K3AA 1QAOA 3TCXB 2WJZB 4C7MA 1M66A 1FNBA 1C41A 2C07A 1SUFA 4GF5A 1L4UA 2CBXA 4LRYA 1ZBQA 1BOOA 1D07A 1Z39A 2DFNA 2IIVA 3O1IC 1DAKA 4E5SA 1YDEA 1JEYA 2ZULA 3GHYA 4E88A 2AI2A 1D9ZA 1DQSA 2OECA 1LRKA 1O9GA 1GL9B 3CW9A 4MEBA 3C6ZA 1ZD1A 3HO6A 5J1SB 4YMIA 1Q15A 5J2TB 1C8LA 2G5TA 3DMYA 2WD7B 3KLBA 1J21A 4KL8S 1FQJA 4LHSA 1IWBB 4BB6A 4RTNA 2PGNA 1VE1A 4IWNA 5HS4A 3MJHA 2EEZA 3RF7A 1G98A 3GLIA 3THXB 2PXCA 3B6ZA 2Q8QA 1E6UA 1FP6A 3HNPA 2WYIA 3OEWA 3PPXA 3II6X 4FLEA 1AGXA 3A31A 4QX6A 1CLEA 3OJCA 4ZHQA 3X44A 5C2JB 3WRWA 1HZZC 1ZC3A 4G0QA 1OH7A 1USWA 4OSOA 5HX7A 3G0GA 2C9BA 5BQFA 3HWWA 4LFAB 2W43A 1E3EA 3NIBA 3OQVA 2PSHA 1AKRA 1RLMA 2GDJA 1N77A 2CNNA 4BNYA 5KTKA 3R7DA 3ROFA 2WP8J 3FDZB 4HB4A 5HUHA 2H1IA 3S5JA 1SAYA 3FPFA 3QEBZ 5EXTA 2PXHA 4HT3B 3K9NA 1VCNA 3I1YA 1MEOA 2YYZA 3AIOA 3OF5A 4GNKA 1GCAA 1QFXA 1OVGA 2PUTA 4HJXA 4IH9A 3EXFB 1F2VA 4Z4GA 4OK3A 1TYZA 4FGKA 1B4DA 4XUCA 2AYYA 5FLXA 2NG1A 2C82A 3UM9A 3QWBA 1XLWA 2V7QD 3ASZA 3VPDA 3ZZMA 3WIVA 1A9PA 1NXWA 1TJPB 1UM9B 2PRYA 1MH1A 3DBLB 3QPBA 4X1YA 2HK6A 5GAJA 4DJFC 2AG1A 4E5VA 3UQZA 1K9VF 5JC1A 3KZ1E 2E89A 1SA0A 2JCXA 3H9UA 3EZFA 4N47A 3W9UA 4L2IA 3W34A 1FFGA 4KX3A 4WBXC 3GQBA 1MW8X 3DBIA 1Q0UA 1NDQA 2DBYA 2Q3MA 4NWIA 1WP4A 3QOYA 3AP2A 2L69A 1IFXA 4I4TA 5EFOA 4C2TA 3K9FC 4R1TA 5CVCA 4XYLA 5FYQA 1IBRA 4J94A 2DHDA 4U7HA 3X1DA 4QGGA 5I51A 1ZO8A 4ZZ0A 1JR4A 2PYIA 1U99A 3T3MB 3SQLA 4FYXA 2IX9A 5ENDA 1N0UA 4AROA 5C51B 3MWDA 4FGUA 3T5PA 1U8EA 3F5MA 1J99A 2NMVA 3WKBA 2X7HA 1J33A 1VSUA 2AXEA 2VPQA 1K8ZB 2WAOA 3I01M 3GLHA 4RH1A 4U2EA 4IY1A 5DH9A 2I4TA 2D1RA 1SXPA 3AFNA 3NM4A 4IJVA 3EXAA 2HNAA 4KK3A 4ZXFA 3CKKA 1HGXA 1WF3A 3HP1A 4UU0A 1O6CA 4CI0B 4DQXA 3DDHA 1J2RA 1PF7E 1ZW1A 3TKLA 2IPNA 2QSYA 4CF5A 5C35A 1E62A 1R6UA 4Q7QA 1IY2A 2PH5A 3VZCA 4RXTA 2CV2A 4IIJF 1SH7A 3EY4A 4WERA 4LJSA 4NMLA 5FWAA 2QNRA 3PSHA 3QGMA 3W5JA 4IQ4A 4EJSB 3O4GA 1VQ1A 4MGEA 4RW0A 3FJOA 4TYMA 3ELBA 3DDZX 3HXMA 1FUEA 2EJUA 2IYWA 4EGCB 1TCBA 1QOQB 3PF8A 1THMA 4ZVOA 1JHUA 2OO5A 2PRJA 2WUEA 3FG9A 2P41A 5FADA 4B76A 3OCXA 3I6QA 1G7TA 3LUDA 3IS3A 3VM6A 3DMPA 1WTAA 2BEVB 2I1QA 2JGNA 4EA9A 1HT1E 2Z5FA 1SCUA 3VX4A 2O2DA 4I55F 1AQLA 4J0DA 3L7BA 4M9SA 3DBHB 1N8TA 2B7BA 1Z25A 2FEKA 2V7PA 3B6KA 1CRQA 3LT2A 3LUBA 5B3AA 3ICVA 4NBNA 5COQA 4E4YA 3KJEA 3ORHA 1BCSA 2FR8A 2X3FA 2H8KA 4WLVA 3BN3A 3EGIA 4DAEA 4ZRDA 3B1VA 5LYYA 3JWEA 4IV0A 4ZYYA 1R6AA 3PC4A 1VE7A 1DBVO 4J2OA 1LEHA 1S2MA 3OAAD 4JLOA 4JLNA 3ZHQA 1SCDA 2MYPA 2ECKA 3GDGA 3RU7A 3IO5A 3K31A 1NXSA 1T2CA 3QU5A 4NENA 3AHIA 4UHHA 5C4IA 4W5TA 5FORA 1YMQA 4MYDA 1G5FA 1YVPA 5LD2C 1SRQA 2PL1A 3H5TA 4LGYA 1SXHA 1KVTA 1HWYA 2BR4A 3HR4A 3N6RA 3WWCA 2Q9AA 2Z4RA 1XL1A 3NQ41 4B3TB 1MDBA 4H9GA 2JI8A 4P3KA 1NAIA 3G9UA 4POAA 3CE9A 2DLCX 4EBFA 5L6LB 4QUDA 4FYMA 1XD2B 4WNAB 3SQDA 4M1EA 3EEFA 2Z2YA 4QXQA 1QV7A 3I53A 2A30A 3HCEA 4X6YA 3PUZA 2VTDA 4LNAA 3ZOZA 1LDGA 2YTZA 4G2NA 1Z5UA 1NI4B 2C2WA 3DPUA 1XZBA 3GT7A 4RYDA 4Y1RB 1R9GA 5TQ0A 2DR3A 3DHNA 4K46A 2QVCA 1GTSA 1JFRA 2VAXA 5G4KB 5TNXA 2OA0A 4DIMA 5JJKA 2NZJA 3KL2A 4B9AA 5BSRA 3AM5A 3KKMA 3K0CC 3GEIA 4FMBB 2XT6A 5EA2A 3I2YX 3B12A 1Q21A 4PZPA 5DNAA 5FI5A 4KH1A 2PRZA 3KIPA 4KLCA 4IBOA 1YV9A 2QMYA 4MKGA 4YJHA 3H11B 1FMTA 1M9NA 2Q3CA 5KSZA 3QIVA 4FS3A 1M6YA 1YR1A 4G5QA 1SHJA 2NOAA 4OQEA 3RVSA 4F0JA 3CNBA 1J6UA 2V55B 4V03A 3Q7EA 1UPAA 1ULUA 4QYWA 1O03A 1RR6A 2EKLA 1SD2A 1Y98A 4JBXA 4WOPA 2YZGA 3WZMA 2QLNA 4FILA 4IJ5A 3ONNA 4YUYA 4QJ3A 3ICPA 3PYMA 1MU0A 3LBAA 3L4BC 3UT0A 4QTZA 2OHHA 1Y3IA 1IZYA 4REOA 2BGWA 1RMYA 2I71A 3IUYA 2PWPA 3OEED 5AHXA 1A9ZA 3WQRA 3P0HA 4L5YA 1YGPA 3OLYA 2FUG1 3AHDA 2J9FA 1DBRA 1HT2E 4XDGA 5DYGA 3TSOA 3UJCA 5K9ZA 5F2EA 4DV2B 2VDVE 3OHPA 2FCRA 4BHTA 1KZ7B 4OLFA 4B71A 5TB5A 2A0XA 1MJGA 1P0IA 3QUTA 4O1MA 2O54A 4MKXA 1I30A 1IRIA 4G9EA 1UKZA 1YRQA 2CDBA 2X8JB 3COWA 4CTJA 4DMKA 1VG8A 2W6JA 2ZIWB 2AG6A 2W2LA 2HWXA 3VQTA 2A8YA 3RADC 3H2HA 1KKLA 5BYJA 3K20A 1GFIA 3EUAA 5A2QA 4X1IA 2NUTB 2BW0A 4HVTA 1DAOA 1P7WA 4YCBA 1H8HA 2AXNA 2ZIFA 3VHQA 5KTNA 2OCXA 3DOCA 3PT9A 1TQDA 4EQ6A 1EFPA 4TRNA 5CPBA 2AZ4A 3ORYA 4D45A 2NUAB 2G0TA 2ECQA 4R05A 2BE9A 5EKUA 3R3UA 4OVKA 2HSEA 3MJTA 1NVAA 1HV8A 5I8ZA 1FSSA 3ORQA 4RF3A 5AKGA 3EGWA 5B37A 2WB4A 4RQAA 4DG8A 1LD3A 1USIA 2PJDA 2XV1A 2YRXA 3L0DA 3T0GA 3TN7A 2O2SA 2R11A 3P0FA 4I5GA 4RA6B 2NU9A 5J43A 5BXYA 1BMDA 5KVQA 4RVGA 3T9AA 4OHYA 1VSTA 1X38A 4KR6A 1RD4A 5EXSA 2G88A 4LJ9A 4EFKA 3BF8A 2RBKA 2RK3A 3UUEA 2ZKLA 1XQYA 2QAIA 1S89A 2XOKD 4GR4A 1MABB 3G8DA 5EIWA 4DG9A 3ST7A 3NXKA 1YMUA 2VL7A 4M98A 4MQEA 3VR1A 3KTAB 1JNXX 3HVUA 3M33A 1D0SA 1Q57A 2HJHA 3CF0A 1KSFX 4D97A 1KYYA 1NY5A 3RCBA 1XVLA 4E5UA 3F46A 4P93A 4JUIA 3HG7A 4HAUA 2AKYA 2BZ0A 3H8JA 3UWSA 4P9NA 3MIZA 4A7PA 5GVSA 2KE5A 2QTVA 3U7RA 3TDNA 4C5CA 5EMKA 4MEJA 5A4FS 2DCMA 2PLRA 3MS4A 4MWSA 4CMJA 3WL7A 1DKNA 1JW9B 4BP8A 2FAXA 2Q5JA 3RSGA 5FNZA 1G2IA 1JSCA 4B7ZA 1QFMA 4AJ2A 1EWYA 4D0RA 4JBIA 1QK3A 1C4WA 2EFCB 4ZGGA 3QU4A 1VJ0A 2GAOA 1C9EA 2GRAA 4UEWA 2UVPB 3N0RA 4V0MA 4NE7A 3ILHA 3S2ZA 3SHTA 4DCGA 1F6BA 2E9SA 2JFUA 3WGLA 1YL6A 4ES6A 3ZWMA 1VLVA 3CRRA 2P91A 3BCRA 2DGDA 3T1OA 3Q7PA 3PUVA 4ZCTA 5K0GA 3VAAA 4MLZA 2FTKE 5CNJA 5BMVA 1ZJWA 1OZGA 4L02A 4U6NA 5CIQA 3D0OA 4AQDA 3WFJA 4QNMA 4BO7A 2HA5A 2PQ6A 3LUAA 4XYBA 4DLNA 3PFGA 5HDQA 2NO4A 2Y05A 1IAQA 4HEA1 1DXQA 1F2DA 5CLHA 1N2ZA 3AL2A 1P4JA 2O2HA 3C2QA 4E13A 4G24A 4XFJA 3H8WA 3K0EA 5B12A 1KYXA 1U4SA 2VP5A 1H4VB 2GUGA 1NAHA 3DYIA 3EXIB 4W82A 2OQVA 3UPTA 5GIOE 1G66A 1TMKA 2CF6A 4PLHA 5AI4A 3T1VA 3U9SA 2HNBA 3LBYA 4BO2A 4CN9A 3PXAA 5CP8A 4YHHB 3J80A 2R6AA 1O94D 2W42A 5CW1A 1QP4A 2FPSA 2R8RA 1XVUA 1BVRA 3GIWA 1P1IA 3AR5A 4U5XA 3FE2A 3AUTA 3LCMA 2ZB3A 1N5LA 5LZ4A 3KLPX 5KMGB 3B1FA 3DMFA 3K2QA 2JAWA 4ESHA 1L8LA 1LWOA 1X2EA 3TXAA 1EHIA 1NVVR 4YCLA 1R16A 4URXR 2DPMA 3IEUA 2JZOA 3CIFA 4NK4A 2WWGA 1OB5A 1FSFA 5LQNA 3R0IA 5ED0A 3M1AA 3RSSA 2XSZA 3BKXA 3JQ8B 4N6GA 4MV8A 3WLPA 1ND5A 1U8UA 3DMNA 1YASA 2NQ2C 2H0AA 4WBNA 1FDIA 2C2XA 2O3QA 2WE8A 2Z1NA 2BFDA 3JARA 2QB5A 3IEPA 4TV9B 4Q9IA 3E5NA 3U1TA 2YCBA 2G09A 2ZJ4A 1N5KA 2CZCA 1K88A 4EECA 2CT8A 3CX3A 1S3SA 2JGLA 1C29B 3GZ4A 3QHQA 4DE5A 3Q1LA 4MW4A 4PINA 1PHRA 3LTNC 3L93A 1M0SA 3ZE7A 2VUSA 4BNDB 5DN9A 5K7SA 4NY1A 1TJ4A 2EP7A 1DELA 3H9QA 4O2LA 1G9XA 4NYIQ 4TTTS 3DSRA 1U2GC 2CE7A 2Q0QA 2VP9A 4NH0A 4OFZA 5IRCD 1P1RA 5HKKD 1SGWA 1N7JA 1QHHA 5KOJA 2NT3A 4M1MA 5TLSA 3BRQA 1FTNA 4DKJA 4OHMA 2YV1A 3SVLA 1NF2A 2ZSAA 3T52A 4QD3A 5H3LA 1ADBA 4L0DA 5K0FA 1VECA 4Q82A 1IMJA 1YR9A 3QXHA 4IVNA 1QS0B 3AL0C 3MJEA 3AF2A 5LJLA 4PCUA 3REQA 4G0ZA 2OV1A 3V1NA 2LUOA 2V97A 4XQGA 2EFYA 4KQ1A 3HP7A 2WA2A 1LPMA 2CVFA 4LG1A 4P4TA 4DS3A 4M9CA 1L5ZA 4UJ3A 1VBNA 1UMBB 3GUHA 4B8ZA 1DRUA 1CLUA 4GX5A 5FBZA 4JI6B 1TAUA 3DXFA 4F4UA 1O5TA 3O94A 2JLCA 4ZALA 5DFAA 3BRWA 4FHZA 1RYYA 4HY3A 4GR5A 4BE4A 2PD6A 2P9TA 4LJRA 3VDMA 2J08A 4DEXA 5ARCA 2FEMA 2I7TA 3N8IA 4P1ZA 4PZAA 4S24A 3X1WA 1R0LA 5AXDA 4B4VA 2D7CA 3HBMA 4GO1A 2YDYA 2D74A 2GAJA 3EW9A 3A8TA 3I34X 1FFBA 3EWIA 2F3TA 5FBHA 1QTQA 5BN4B 2W70A 5BSGA 4MJ7A 4WPGA 3LUGA 4RX1A 4TWZA 3FCUB 3D02A 3IQDB 2JAHA 3ODGA 3VO1A 5LVAA 1O5IA 4ZEWA 5JYDA 3Q72A 4WZ6A 1TGVA 2A7XA 3AR6A 2OCKA 4P83A 2GWHA 1Q1ZA 2B6HA 2KJQA 3VPXA 5EIBC 3QBDA 4Q6WA 1P0PA 2AV6A 1E5VA 1X13A 2RG7A 5E9JA 3AOEC 3SXJA 4BC1A 4C76A 2P2ZA 3C97A 4A0RA 5G4LA 1U0JA 2CXTA 3CKLA 5LLDA 5LYJA 2FA9A 1OTXA 3BERA 4ATNA 2ZPTX 3FTPA 2QPTA 2QTCA 1A97A 2DWCA 2ASVA 2OBXA 1AQIA 2VRBA 3E2IA 3M6AA 5C1IA 1PNRA 3STUA 4OJMX 5B1YA 4I1IA 3T7SA 1IN1A 1JJFA 4TUYB 2Q46A 3AV3A 4BMCA 2EU8A 2O7RA 2OXIA 1H8ED 1MMFB 2V8OA 1RLOA 1Z2NX 4A6EA 3NHUA 2NZXA 4XM2A 1IG0A 4MYTA 1XC7A 1L3BA 1L7EA 1Y6JA 1EJ2A 4YB8A 5FPYA 2FPIA 3TLKA 3E23A 4R1SA 4KR0A 2XDAA 3WI7A 5ALOA 1DOZA 1Z28A 2E85A 3IKVA 4BQIA 4DM4A 3GIDA 4ZZIA 3C5CA 3HXLA 3R0VA 2EJWA 2IE8A 4WKGA 5TIIA 1C0EA 1COWA 3EDOA 3K9WA 3CURA 3PI7A 1Y8RA 2O3TA 2FGKA 2IU4A 4GHWA 4L08A 1FFAA 1HK7A 1YJCA 4YJDA 1A5AB 3TTWA 2CK3A 3MUNA 3FPKA 2Z2JA 4N0EA 4NBSA 4ZYWA 3WIOA 2ZTLA 3QW4B 3QEJA 2DYKA 1KU0A 3CPSA 1FUUA 2EGUA 5GINE 2XRZA 1KERA 5IYZB 3EPKA 3ZHBA 1VPEA 1YK0A 1E9FA 4BQNA 3T4PA 4KAJA 2ATXA 1FS4A 2NU7B 4Q4JB 1DX4A 1BXRA 1G4UR 1M1XB 1MOSA 2QPAA 3DL2A 3HKBA 3M83A 5GV7A 3F5FA 4FYJA 2DECA 4LV8B 4LRUA 5E4TA 5FDFA 3D7SA 2DB3A 3OE1A 1WUJS 4QXMA 3WZ2A 4R68A 1A7JA 3PFNA 2WJJA 3A04A 1G21B 3DVRX 4DLZA 2V0GA 3SOPA 3W9SA 4YV0A 3T3PB 1IY9A 4B6GA 2ZYHA 3OI7A 4EAAA 5K6AA 3IAAA 4GX0A 4KV7A 1MX1A 2P9HA 3RBVA 3ELDA 4WZBE 4C6TB 3SC4A 1M10A 1VTKA 3STWA 5TDHA 2O8DB 1NUAA 2I2CA 1IDOA 3QOWA 3J7AC 2CB9A 1DDGA 1XNJA 4BX2A 3CPJB 3FCXA 4PCLA 4KMMA 3RH0A 2FWMX 2Q2OA 2HMYB 3I72A 4L15A 4MUEA 4NPCA 5A9SA 2O8CA 1FRZA 2MHCA 2OZLA 1L5HB 3FOCA 1NFFA 3HJCA 3I4CA 3W2IA 4CUJA 4DXDA 3BTOA 3K15A 4UUAA 2EKQA 3ONVA 4B44A 1RKBA 4ZU1X 2H5IA 1F6DA 1R6BX 3ZR4B 1YDFA 2BI7A 1O8CA 3L77A 2QI9F 1ZLYA 2QN9A 4INPA 2D00A 3GA0A 3K5HA 2FH5B 4QOGA 1MC5A 2O2XA 1PJZA 1D0IA 4WK2B 1VLZA 1JQBA 1Q50A 1SC1A 3V48A 1ZNQO 4QG3A 4W5QA 5HP4A 1JT2A 2I99A 5K0ZA 4I14A 4LDAA 4Q1BA 3KS9A 4PX5A 3I9LA 1U6JA 4LHYA 2PT7A 4P3PA 4U2GA 3RSZA 5K3EA 4AJ1A 2Y0CA 3GCZA 4MB2A 2IS1A 2K5UA 3SHFA 2I6UA 1D8TA 3CZ5A 2C3PA 3DHWC 4RKRA 4IIYA 4X6XA 3CJRA 2HRBA 3C3YA 4CEHA 1S9DA 2R4TA 5LXTA 4PYIA 4RTMA 5AVZA 3GFPA 1EX6A 1TJ5A 3CZ9A 1JN0A 4X63A 4KHPB 3ZD8A 5I7HA 5IKMA 5J2TF 4KQHA 4J75A 4M1SA 1BHSA 4PGFA 3JD2A 4X1OA 4PWZA 2ZUUA 4MRNA 3NM6B 2MU1A 5JR3A 1GQYA 2FY8A 5EZQA 5JYCA 4OKSA 2O59A 3CLUC 3GGGA 1ULZA 3IUJA 1YZFA 4JMLA 3F4KA 2EWMA 3GEEA 1AK2A 1QR6A 1NJSA 1H2YA 2ZIZA 2YWFA 4FYIA 4JU8A 4NCIA 4PR0A 1FYXA 1PR2A 1N1GA 1D4FA 4TTQA 5K51A 3TKYA 1ENZA 1O95C 2EATA 2GFQA 4TM8A 3NKFA 2ISCA 3UFBA 2G5PA 3MTQA 4PR3A 2QVYX 3JVUA 4QUIA 5KNBA 3AY6A 3R9WA 3DMDA 2W6PA 1PLLA 3LUJA 1YBVA 1EVZA 2C2ZA 2WFZA 2X40A 4QTTB 4DXAA 4F86A 2HC9A 2A0FA 2VCHA 4B73A 3LT1A 3ZCXA 2GTHA 3C74A 4JC8A 2DFDA 2HA7A 1Z6GA 2YQ5A 3T5TA 5B7PA 2B4YA 2DUJA 3D0KA 1GNPA 3GLVA 3CX6A 1Z0FA 1MNQA 4L8FA 2KPOA 2BRUA 3MCVA 1HYHA 4MPRA 3WIDA 1S7CA 3LD9A 1OU0A 2XJ9A 1XRQA 4PW0A 1B8UA 5B3KA 3OCVA 1BE8A 1F5NA 1GIAA 1T4CB 1WV0A 4H08A 5AOBA 1W4CA 5I9MA 1EFVB 4DZTA 4LF5B 4FSXA 4EHJA 1QYCA 4Y9SA 1EBUA 1DHTA 3AXSA 1GYRA 1EUQA 3ZVMA 3CPHA 1SC6A 1V0JA 4HBZA 4WN3A 4H3VA 4IXNA 2HI0A 3QEMB 1QFSA 3LA6A 2WUFA 2P2YA 1RCTE 3MQFA 4LXHA 5ALYA 2W6MA 1WDKA 4EMUA 4HNVA 3SC2A 3L2OB 5MHTA 1A1SA 1KQOA 1CIPA 2DTXA 1Q91A 2G8NA 3KCQA 1LBTA 1A8UA 3Q3JB 2Z9BA 3IPXA 2G06A 3NU1A 1O1YA 4JP2A 4A82A 3GVPA 1SKMA 2V98A 1V1MB 4WEQA 5ECGC 1H4SA 2ETXA 2RH4A 3IA7A 3IX7A 5DTMA 2XBLA 3JAWB 4CIDA 5A7HA 1ZMTA 4NNJA 2GJKA 1F8XA 4QDXA 2PS0A 4GMDA 2JAOA 1AGNA 1QYRA 3ONEA 4U3JB 3D3KA 1X39A 3RRBA 1NMYA 1HH4A 4A8JB 2F8TA 2B4RO 1XO1A 3C1OA 2Q5HA 1NN3A 3U4CA 3E53A 2PKYX 4Z0HO 3TZ6A 3R4VA 4BE9A 5FQNA 3SF0A 5BYKA 4K6MA 4BASA 2YNMA 4D8UA 5HKOA 3VR2A 3WP1B 4NNPA 5CFPA 5CT4A 2QQGA 3GLGE 1NKTA 1XRPA 4KPUA 4RPCA 3T1HB 4UEJA 3CISA 2HRCA 4WVLA 1KI9A 1H05A 1P9OA 2D1TA 3HGTA 5DI3B 4UE2A 5B3JA 1TO1E 1YZ3A 4KGVA 2BFOA 1ZD5A 2KWIA 3LSYA 3S2FA 3WYAA 4B3IA 2EX1A 3F6YA 3JVVA 5REQB 3L8CA 3WGMA 5JVDA 4FMPA 3S8EA 2QTRA 3FAZA 4NMMA 4NBLA 2P3QA 5I8WA 1N0IA 1T29A 1SFRA 1U0TA 1N9ZA 4AP5A 4HXEB 4XJTA 3N87A 3CPEA 1WXIA 1ZJ5A 4G9BA 4QE3A 2WSSA 3SIPA 3QLEA 3KEGA 3L0CA 1JLLA 1JEQA 1R3UA 5HF9A 5KJ6A 4FLFA 1BNCA 2PT5A 5AUQA 2C2GA 1ZHFA 1ZI8A 3SN6A 4OQNA 3SEAA 2W00A 5ICMA 5ALZA 5K0EA 3DVLA 1GNRA 3GD5A 1L4BA 2I65A 1RZRD 4ZMBA 2VO1A 2RD2A 1VLQA 4QTXA 4PU0A 3UMRA 1MOZA 2MSCB 2CWWA 5LBIA 1TMGE 4CMEA 3AB3A 2W2QA 3RRYA 2I8LA 3INGA 3A3NA 3AHJA 1DAPA 3MMZA 3PGMA 1BU5A 5JLJA 1PK9A 2HSDA 4CMBA 2VP3A 3EFOB 3HMQA 1BWPA 2C94A 3E9YA 3OZTA 1ZJZA 1YZVA 1J7KA 2CN1A 4JQOA 4PAOA 3RVJA 1SQFA 4W5OA 1JX6A 3SMQA 3KE8A 3GVIA 4A2QA 4B6PA 4D9NA 1C8VB 4FDMA 4G1UC 1KYZA 3MK31 4ZVRA 1I51A 2JGRA 3A1FA 2B37A 5T8KA 4E6PA 3ZGYA 5FOSA 1NVMB 3A4VA 4ENPA 4RF4A 5B57C 4S1NA 1WBBA 2QG6A 2BM0A 1NVWQ 2AF3C 1YO6A 4ZVQA 2EDAA 2YXLA 4EQZA 3W1EA 1CY1A 4DBLE 5HKLA 1BHQ1 3M9LA 5KX5F 3K6JA 4BXOB 5JQWA 1HE5A 3WMWA 5CIWA 2W11A 5H82A 2OE2A 2CZGA 4YQYA 3I2GA 4H6WA 2XNCA 4JBGA 5CB8A 4IQ0A 1KJ8A 3I37X 3KPWA 1U1GA 4RACA 4U9HS 4GPD1 4MHSA 2KSQA 3P45A 4LV5B 1B23P 3O8LA 2NV2B 4UDXX 4X62B 3LDGA 4MK4A 4LE1A 3UCFA 5AICA 5KVCA 1KNQA 2C8LA 3PEWA 3LHIA 2CDCA 3CNNA 1QHSA 1CZHA 1DC8A 2BMEA 1XAIA 1T5SA 3KQHA 1VDZA 4BDTA 3B6JA 4TSKA 4X7BA 2CNBA 1R37A 2Q0HA 1RQLA 3EOBI 2NSYA 2XGMA 4QWMA 2PNFA 3TSZA 5LP1A 1P2SA 1GGEA 2DQZA 3GMSA 3NVMB 4IMIB 4J76A 4N3AA 4U7FA 4ZVNA 2SECE 1NMZA 2L2QA 4XJXA 4YRCA 4U9IS 1W35A 1AQJA 1TAGA 4RF2A 1ZXLA 4XE5A 2ANCA 2YN2A 4GVXA 4YGXB 2WUGA 3DAHA 3L6OO 1T8YA 1MIOB 1BH6A 3EDCA 3O3NB 4L9WA 1X6VA 5BVHA 4ISCA 4B74A 2C99A 1T2NA 2Q4EA 1ZUIA 1LI4A 3ESDA 4N76A 1JU9A 2QYHA 4DLRA 1A9OA 1IEWA 4ZHSA 3MILA 3N2GA 3G89A 4PXAA 5DXAA 2FWJA 1UK6A 4RENA 4QQRA 1VI5A 1WXEA 1CUUA 2I1WA 4DDVA 4PVDA 1E9BA 2GESA 4OU4A 1YI1A 3PHLA 3VOTA 4I1UA 4BKPA 1LZKA 2XYVA 2BMVA 3WJ2A 3F96A 3JVIA 4HB0A 1UCFA 2DQSA 2P65A 4JLPA 3N1UA 2HK8A 1YQUA 2ZJ0A 4CHTA 4V3BA 4DR3B 2IXEA 4KDCA 3RFXA 4D4JA 3IHLA 1UZUA 3S40A 2JFWA 3LQKA 1C9NA 1EUZA 1U0EA 5LBTA 3O47A 2CL6X 1A9RA 4KMRA 3R09A 5DGXA 5MDHA 3PXUA 3EVAA 2OCGA 4JOSA 3VSDA 2OD7A 1B2LA 5EHGA 3LQYA 4HLDA 3TLXA 3LCUA 2DBVO 4C01A 2DM6A 3TMYA 3V8BA 5LLSA 3ETGA 4OP3A 4A0SA 2JFHA 3I2JA 4WE3A 1PFWA 1KS2A 3CH5A 5IM5A 1IM2A 1WLYA 1UOOA 1SNYA 3AEZA 2ZUEA 1QRSA 4RE5A 4BL5A 4BQEA 4URYR 1AS2A 5AJTA 3PEFA 4UAJA 3E3AA 3PZRA 4G81A 1P0MA 3C6MA 4MS4A 5BW6B 4MKZA 4HFJA 4KITB 1GKUB 3H2ZA 3RC8A 3Q8MA 1XZNA 1O0BA 4GP9A 3FF1A 1H1DA 4DUGD 3VYSB 1BX3A 2C2HA 5JJ5A 3D31A 2EZTA 2YQ4A 1DIGA 1T15A 4JJZA 3ZBUA 1F0NA 3TLGA 3ZX5A 1UZMA 3H16A 2WQ7A 2GRJA 3UKJA 1PZXA 5GV8A 5A3QA 1G1MA 1UAGA 4NESA 2Q45A 5TY0A 1RADA 5JATA 4OOFA 3G68A 1LI5A 1EJ0A 2RIRA 3DDCA 1VHLA 4MDHA 4Z4IA 1DKQA 1DX6A 1BU8A 3SQWA 4XH9B 4WAUA 3QNUA 5LJIA 3H5RA 2J41A 1UEXC 2RHHA 5IDQA 2FW0A 4DADA 4YRTA 3EOZA 1EPUA 1U9IC 2PBLA 4BVBA 2ZRJA 1H2WA 3NHAA 2FUG6 2EW1A 1AM4D 2MMGA 2B78A 1A9TA 1PL0A 2GKSA 4RKYA 2X5JO 4XA8A 3AVVA 2IYQA 3PV0A 2VR1A 2EFDB 2H54A 3T5CA 2D8AA 5FBWB 4FN4A 1T5LA 1IEVA 3JASA 5EEGA 1OHHA 3WMXA 3N28A 5CA0A 2NXJA 5LCXA 3LCVB 3TQCA 1QORA 3HCWA 3I52A 3IV6A 2W2XA 2WPDA 2ID9A 1JIVA 2XGOA 1N0WA 4DM7A 2GPTA 1AXGA 1DVRA 5TQJA 1CRPA 1SC4A 2DH5A 2C96A 3L8HA 3P0JA 1UBMS 4KAAA 1WXXA