3RJ9A

Structure of alcohol dehydrogenase from drosophila lebanonesis t114v mutant complexed with nad+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNVTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An intact eight-membered water chain in drosophilid alcohol dehydrogenases is essential for optimal enzyme activity.
pubmed doi rcsb
source organism Scaptodrosophila lebanonensis
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
total genus 96
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rj9A00
3KYDB 2B5VA 1LLCA 1MP0A 2B69A 4AJOA 1FK8A 1HSZA 1U3TA 4JJGA 3V8BA 2I99A 5ADHA 2CDCA 5BNFA 1T1SA 3KEOA 5CEFA 3OJ0A 3ROPA 1PL6A 2YV3A 4HFMA 1EZ4A 5G4KB 1LXCA 4ND4A 3DMTA 1CJCA 4CMJA 2OO5A 2NLOA 1XR3A 3T4EA 1K6IA 2Y93A 3ZV4A 2Y0DA 4FR5A 4ZA2A 3PRJA 4LMRA 1NFQA 2I3AA 5C7OO 3JQ9A 5AOVA 4MKRA 5C5IA 3GVXA 1DDOA 3ZV3A 3UCXA 4F45A 3D3WB 4GL4A 4U8GA 2AE2A 3V1TC 1GU7A 1O6ZA 3CMCO 1HEUA 1RM5A 2XF8A 2VRBA 2VTEA 1VE9A 1H93A 3SX2A 1ZJYA 3ZWVA 4BKQA 2CZCA 2PGJA 1OI7A 2HK7A 3I1JA 4U7WA 2BFMA 4BOYA 4E2ZA 2HJSA 4IDFA 3C7AA 3PHLA 4LSWA 1JAYA 3ZWOA 1P1FA 2D5AA 5IFLA 3NTOA 1Z73A 5JMWA 1E3EA 3DFZA 4IDEA 1YB4A 1YXMA 4JLWA 4EJMA 4BNLA 1X1TA 2ZATA 5JPIA 1T2EA 4RF2A 2GCGA 4ALMA 3DBRB 3NRCA 4D0RA 2AE1A 3RC9A 3KUXA 1DIGA 3M6IA 3OA2A 4MJLA 3VTFA 3MJVA 1DB3A 4H3VA 4LRTB 1E3JA 2JCYA 1T2DA 1DAPA 2WYWA 4WNIA 1E3WA 4RQTA 4L8VA 4S1VA 1LDEA 4I5GA 1LEHA 1E3LA 4BGUA 2YQ5A 3QLJA 1R16A 3K9QO 5DOZA 3PZRA 1GAEO 1EDZA 1E77A 1PGNA 1B7GO 1P0FA 3FWNA 4FBGA 3I9KA 2OORA 1T24A 1BSVA 2V65A 4PLGA 4DIBA 1ZIDA 4JK3A 3MJTA 1N5DA 2CVZA 3D0OA 3UGKA 1MC4A 3UF0A 3I4FA 4J1QA 1QYWA 4M1QA 5THQA 3OECA 1U7HA 1X14A 1Y81A 2P4QA 5TSDA 3V2GA 2FSSA 3ENNA 2PD6A 3WX0A 4UEJA 3U4DA 2PGDA 4CV3A 2IRWA 5BT9A 1Q0HA 3PJEA 1FF9A 5CPFA 3E9QA 4LN1A 4CM8A 5B12A 1MFPA 1GTMA 4K28A 1CERA 4YXFA 4IJWA 3F4BA 3ANNA 3FNEA 3V1UA 1PJQA 4DPMA 3GQVA 2C5EA 1XHLA 3GNSA 4NI5A 5F1PA 3ROQA 1PX0A 3BMNA 4CLHA 1AXEA 1XQ6A 3R6DA 1ISHA 3I9LA 3TJRA 3QWBA 1ML3A 1PGPA 4QSMA 3OIFA 3F1KA 1BMDA 4NBVA 2NTVA 3AU8A 1NXQA 3PQDA 1I30A 4PVCA 1ZK0A 2A9FA 2VCYA 3WGGA 4EEZA 1E92A 2EKQA 2VYND 1O94A 2Y1EA 2H6EA 3EZYA 3P5SA 2EP7A 3GVIA 1DIAA 4J4TA 1ARZA 3F1LA 3RUHA 1P31A 3G1UA 4BKPA 4J90A 3OEWA 2GN9A 4DIOA 2JD2A 1N7GA 1OMOA 3DO5A 3E03A 4DTIA 5CDUA 1SCUA 1QV6A 2Q2WA 2GUGA 4W6ZA 4WLOA 2BI7A 2WEKA 4IGFA 4RDIA 2RAFA 5BNTA 1PGJA 4PG5A 3HN7A 3AWDA 3I9JA 3E5MA 3NYWA 4QFDA 1ZSNA 3EC7A 1I01A 4LRSB 4CV0A 3R0IA 4BNJA 5HTOA 4IZIA 4NBUA 1P1IA 3ZW8A 3TDKA 2RBEA 4GX1A 5JS6A 4WECA 3E1KA 3HJAA 3QRWA 3TOXA 1NHGA 2O3QA 4HADA 4QXMA 4BO8A 4FGWA 2NVWA 2C07A 4E21A 4NU5A 3C85A 4BMNA 1KVSA 1DHRA 2XXJA 3G0OA 5AVOA 3DL2A 3L6OO 4WOKA 3RU7A 3WIDA 3TZQA 1P0CA 3WJ7A 1W8DA 5EL0A 4D46A 5I8WA 4HX5A 4MIYA 4CMEC 3PXXA 2X22A 1CIVA 3O9ZA 1DO8A 3BHIA 4ZGWA 3TZHA 4WEOA 3WTCA 2HMSA 3ENKA 4N5NA 4B7UA 3CPSA 2HAEA 1IZ0A 1D3AA 1HZJA 5I9NA 3GDFA 2X23A 2X9GA 1OFGA 4TVOA 5ILGA 5A3JA 4Q3NA 1T2AA 3K5PA 5TF4A 1G0NA 4PLFA 3HQ4O 1HDOA 1U4OA 5ICMA 2GYYA 1B8PA 4MP8A 2YY7A 5DP2A 1ZK2A 4AJNA 2NSDA 2VN8A 4I5FA 4QO7A 1ENPA 2I67A 1Q7BA 3O8QA 2FZWA 4R9RA 2EW8A 4YQYA 5HS4A 1I8TA 4NBTA 3WGZA 5EJ2A 3R1IA 4CMIB 4OIMA 3WFJA 3WQRA 4FFNA 4PRLA 2J6IA 4Q3CA 3VH2A 4YACA 2ZK7A 3PJGA 4MVJF 5JLAA 4ILKA 1PS9A 1KVQA 5BNIA 1UAYA 4RPKA 3RJ9A 3DBHA 3I3OA 3QSGA 1ADCA 1O8CA 3D7LA 1Y8RB 4RJTA 2VZ8A 3WS7A 5IDWA 1NBOA 3OMLA 4C7JA 4YT8A 2QQ5A 2Z5LA 2W2KB 5JCXA 4II2A 3GZNB 1A9ZA 4EYEA 4PRKA 1YH3A 3U3XA 2X0IA 1YQDA 4ZICA 1FDSA 1RKXA 4BO0A 1KC3A 4CL3A 4FJ0A 3ITDA 1XQ1A 1LJ8A 3BHMA 4EDFA 4PG6A 4R41A 4ID9A 3FTPA 5KWEA 3W4IA 3F4LA 1QYXA 1JKFA 1T2CA 4W9NC 4XGNA 1KEUA 4P38A 3C3XA 3WQSB 3IIEA 2BLLA 5DBFA 1X7HA 3GGPA 1H6DA 1R0SA 3AI3A 1S7CA 3UN1A 1BTOA 1YE3A 2V6GA 3DMYA 3TN7A 3JYQA 3H6KA 4OXYA 2ILTA 2AW5A 4FIZA 3TZKA 3LC7O 2BD0A 4TVBA 3UAGA 2FPIA 1DLIA 1KVRA 1VI2A 1NQOA 4YRDA 2OMEA 3S1LA 4L75A 3ZNQA 1M67A 1DJNA 3IJRA 1VKOA 4OOFA 3BMOB 5BSFA 3JYOA 3NUGA 4CR8A 4EEXA 1X13A 2RCYA 4WCFA 5BQFA 1B3BA 1EVJA 3JQ6A 4J2HA 2GN6A 1EBUA 3SJ7A 3V5NA 4DIFA 2DQ4A 3NTRA 1ISJA 2AG8A 2UUOA 3EDMA 4JBGA 4EW6A 2GO1A 4P22A 4FFOA 2GGSA 1Z7EA 2IODA 1EMDA 1EQ2A 2X86A 4J6FA 1QRRA 4J7UA 2QW8A 4QECA 5G0SA 4UUMA 2CY0A 2Q1TA 1EFLA 3QE3A 2UAGA 2QYTA 4P4GA 3IUSA 4K6CA 1H6CA 3D5TA 3SLGA 4E12A 1VJ0A 2P4HX 3PLRA 3PYXA 4NZ9A 3E18A 3AI1A 3SC4A 1QYDA 2BELA 1Y8QB 2YHIB 4E2YA 3OP4A 1ISFA 4BO6A 1HSOA 4B8ZA 4E6PA 4Z0TA 4BMSA 2E82A 1N1GA 2JAPA 3BTSA 3NDRA 3PGJA 1JKIA 4J16A 3PLNA 2Q1WA 4E5MA 2J5KA 4F46A 1F12A 4HY3A 2A4KA 1UH5A 2GERA 2SCUA 3D4OA 3NJ8A 4KMSA 3KLMX 5KJEA 4YJFA 5F5LA 4GX0A 3C8MA 1LLQA 3K8ZA 3JQAA 2OBYA 3JQFA 4GWGA 4RVGA 5KJ6A 3EHEA 4CJXA 1C0LA 4BL5A 3OQ6A 1XG5A 5LC1A 2G5CA 4FW8A 1GUYA 2UYYA 4HKTA 3QW2A 5JYEA 4ZQBA 3OSUA 3OFSA 5A5FA 4GI2A 3H3JA 5FF9A 4WNCA 5HWSA 2O2YA 5ICSA 4ALNA 1PWXA 1EEHA 2PK3A 7ADHA 7MDHA 1I2BA 1RYDA 1JA9A 5A9SB 5CDTA 4C4OA 4YJGB 2X5OA 3CINA 4UUPA 4XCVA 1WWKA 4NFYA 1J4AA 3HUDA 4IS3A 3QWIA 3QWAA 2B0JA 3MTJA 3D4PA 3A28A 3IL2A 1HLDA 5JC1A 1E6WA 3OH8A 3PZBA 3U49A 4IBOA 5B37A 1GYQA 1VSUA 4AG3A 1ZH8A 4DQUA 3OJLA 4B3JA 4E2XA 4XIYA 4RPGA 3Q0EA 4QEDA 3QVSA 1HDYA 2AEJA 3WG9A 3PFFA 4CMHA 2AQHA 5ILOA 1SNYA 2E48A 4NBRA 1LDMA 1ZCJA 3DBVO 2FPPA 4IIUA 4Y9DA 2FR1A 4WUVA 5FI5A 2XAAA 1YJQA 3JQBC 1D1SA 1SZJG 1GDHA 1KS9A 1H94A 2ZQZA 4UAGA 1E7WA 4CV2A 2C59A 3EVTA 2AG5A 1R0LA 4ZN6A 3LU1A 2GF2A 1E3SA 3VVCA 4FGSA 4PG8A 4J4HA 3JD4A 2UVDA 3QY9A 4BO5A 2H63A 4I08A 2PFGA 2F1KA 4EUEA 1IHXA 5A4DA 1HE4A 1U3UA 3VC7A 2C5AA 3ETDA 3IJPA 2GNAA 2VHVA 1QG6A 2A94A 1O95A 1YB5A 4JBIA 4HNGA 4XZ3A 4BS9A 3P2YA 1CRWG 1MXFA 4RQUA 4J0EA 4JP2A 4L4XA 4YT4A 5L4LA 4UVHA 3QVTA 3DBLA 4CM1A 1ZK4A 4KTVE 3FTNA 1NQ5A 5F3RA 4N54A 4EUHA 1U5CA 3WMWA 4K26A 1ZBQA 2O3JA 4OSPA 2EF1A 4LW8A 4JNKA 2I5PO 1DRVA 5JO9A 3TF5A 3FRJA 3GN2A 1ZMOA 5F1OA 1TLTA 3H7AA 4H16A 1LSUA 4UVGA 4OQYA 1F14A 5EINA 1YL7A 5H82A 2CUKA 1VJTA 3I6IA 3JTMA 3RKUA 4R69A 3ANMA 4IQ0A 3ST7A 1A7AA 1J49A 1TT5A 4PLYA 4IJUA 3WBFA 3UXYA 4JP3A 3IP1A 5KNLA 1ZMTA 1YONA 5A05A 1M76A 3SVTA 1H5QA 4M89A 4AJJA 3NGLA 3BYZA 3DBHB 3A9WA 3PVZA 3ITKA 3DHEA 5A04A 5JY6A 3WSWA 3NJ4A 1K3TA 3EYWA 5CPBA 2DTXA 2DVMA 2OGUA 2R2GA 2Y68A 3W8FA 1NR1A 4ZQHA 2BGLA 3TFQA 1NHWA 3SJUA 4YRBA 1NP3A 5IZCC 2BFAA 4EUFA 2VYVA 1DEHA 1GYPA 4BO9A 4J49A 1TI7A 1NQAO 3VDRA 1GADO 3JQCA 3O8QB 4OO3A 3KETA 1LDBA 4KDFA 4NFSA 1G0OA 3COSA 1C0KA 5U9CA 4BNIA 1V8BA 4CM6A 4I1IA 1A7KA 1EK5A 2EJWA 1BDBA 4CQMA 3K31A 3ZWWA 3JQDA 1LDYA 1EE9A 2A35A 2GRAA 3AY3A 2JD0A 3GVHA 4NDNE 4BNFA 5JAMA 1JU9A 3GY0A 4QQRA 2EP5A 4NQZA 4LCEA 1DFIA 4A7PA 4DLLA 5B4UA 3ZU3A 4AICA 4IMRA 1B2LA 1SB9A 2O50A 2Z1MA 1U2GA 1WNTA 2OL4A 1PZFA 3PQEA 1KETA 3ZWMA 1M6WA 1WP4A 4CM8B 3U0BA 4A26A 1XU7A 4N5MA 3AOEC 2LDXA 1ISIA 2VWGA 4FSHA 4B4VA 2DFVA 3GG9A 4QUKA 3P2OA 1I0ZA 2D0IA 3JQAD 1DC4A 1Q1NA 4GSLA 4JQCA 2BH9A 1Y7TA 3BMNB 5L95A 1TVEA 3LF2A 1ZW1A 1YOVB 1WMAA 2PV7A 4GKBA 3K92A 5G0TA 4O63O 1BDMA 4NHEA 4BNTA 3L0DA 1WXDA 4Z9XA 2HLPA 2YW9A 2CF6A 4Z3KA 2VRCA 1SEPA 3UCFA 1AUPA 3WDSA 1N1EA 2FSVA 5H81A 1IUKA 5IDQA 3V1YA 1IYZA 5IJZA 1YVEI 4NU6A 2TMGA 3ZW9A 5JCJA 1E5LA 4R1NA 3F46A 4RVFA 4YYZA 1Z74A 2FWMX 4YT5A 4JGBA 2UV8A 3H5NA 1FMCA 3GH3A 2I3GA 1X7DA 3GVCA 5EIOA 4OXKA 3F47A 3PHJA 3HDQA 3DZHA 4CMGA 4CV1A 2DBZA 3B6ZA 4NK4A 3C1AA 1BXGB 4ZRNA 1L1FA 3TWOA 4OGWA 2DPHA 1FXSA 5T57A 1NFRA 5EN4A 3M2TA 4DVJA 3GDOA 1I24A 2WMDA 1CETA 3W8DA 4N18A 4R5HA 4BNMA 2Y0CA 2VYNA 3INRA 5DP1A 5KVCA 2ZIZA 1BG6A 2W90A 4P8RA 4D42A 1Y9AA 4RF4A 4MVJH 1UXIA 3NEPX 3ONFA 4DL9A 2O3SA 3EVNA 3L07A 5U4QA 2PH3A 3GF4A 2B37A 4YJFB 3WGOA 2YUTA 4LK3A 2IE0A 3H2ZA 1LNQA 3QWFA 1YKFA 4BNKA 1XSEA 2VRCD 2W8ZA 3PYMA 3S2EA 4ZU3A 4HP8A 1B8VA 4PVDA 4OOEA 4AJ2A 2VUUA 1FDUA 1SPXA 5I7EA 1MUUA 2E37A 1DHTA 1HT0A 4ND3A 3KYCB 3EK2A 1HYGA 4IMPA 3BTOA 3K73O 1KEVA 2YHUA 4G81A 5ER9A 3UUWA 1RWBA 4GKVA 2ZB7A 5AQ1A 2BKAA 3AJRA 4G5HA 4KUEA 3FNHA 5JMPA 1EBFA 1W4ZA 4Z0PA 1HDCA 3MOGA 1M66A 3BMCA 3PI7A 3ZI0A 4X54A 4XYLA 3MJEA 5FI3A 1SO8A 3B1JA 4HUJA 3DOJA 3I83A 3Q6IA 1PJ3A 1QP8A 3ETGA 4KP7A 2QRLA 3VPHA 1JQBA 4M49A 4CM4B 2W98A 1CQJA 3ABIA 5KVSA 3TRIA 5ITWA 1MXHA 2I76A 4R5MA 5ER6A 2D5CA 4NPCA 4XDYA 1PWZA 1DRWA 4NFHA 1BXKA 3D4NA 1LX6A 4MVJD 1ENZA 2AMFA 4O6VA 1M75A 3GPIA 2A92A 5DDIP 2QRKA 2HMTA 2C0CA 4WCFB 5KVVA 1NAIA 1U2DA 2NU9A 4TWRA 3Q1LA 1PJBA 3HSKA 4AJ4A 6LDHA 1AHIA 2FRDA 4WKGA 4GSKA 3RFVA 4G65A 3ZHBA 4LVUA 1PEDA 4RPLA 2IZ1A 4GQAA 3RC2A 3LDHA 4XA8A 4E0BA 3DFUA 2DUUA 2ZKLA 2PZJA 2AEMA 2DPGA 4M8SA 5DN9A 2VZ0A 5JFOA 3CIFA 3P7MA 1EK6A 1PZEA 1JAXA 4I9NA 1I10A 4FFRA 1DBVO 1RPNA 2R00A 2BGKA 2NQTA 4J2OA 4WLUA 3TL2A 4OMUA 1U9JA 2PGLA 1AGNA 3G49A 2YHIA 2HJRA 1IULA 5FEUA 1I2CA 1OOEA 1NAHA 4DC0A 3UFXA 4YJDA 5KJCA 3WB9A 1AN9A 2Q99A 4WJZA 1I33A 1HXHA 1NPTO 1JVSA 2PZMA 4YAGA 3FNFA 3JQ7B 1GZ3A 1DPGA 2VQ3A 2JL1A 4WCFC 2B4QA 4R54A 2O7SA 2X1HA 1LLDA 3FCOA 3NGXA 4IINA 4R51A 4MVJI 4K6FA 3DR3A 3FPLA 2JHFA 1E3WB 2Y66A 1Y5RA 1E7RA 2O2SA 3DZGA 1JN0A 3ZDFA 4DGSA 1T1RA 3WGHA 4II3A 1GPJA 3EW7A 4XKJA 3WICA 2EXXA 5I7VA 3S8MA 2FHSA 4CQMD 5TT0A 5DCWA 1LC3A 2IXAA 1H0KA 1HETA 4WK6A 2DU8A 1TXGA 4DWVA 2IZ0A 2B35A 1GV1A 3MJCA 3GMDA 3G3EA 3AW9A 5CP8A 1I3KA 2BMAA 5I9MA 5TC4A 3VVBA 3FBGA 3LQFA 3HNPA 3ZHYA 1KERA 5JBIA 3ADPA 3HN2A 1BVRA 1SEVA 3ANLA 1PJTA 3HFGA 1VSVA 3NT4A 1J0XO 4YCAA 4PCVA 4YJGA 1WPQA 2WYVA 4XRRA 3W8EA 4BNXA 4S3MA 2GDZA 3P19A 2JFGA 5I9LA 4KZPA 1SC6A 4KWHA 1JW9B 3S2GA 5FWNA 5IAAA 1XDWA 3Q9NA 4RVDA 1P3DA 3DOCA 5DT9A 3L4BA 1HDRA 2GLXA 2NACA 4ZRMA 5C7IO 3KSDO 1IE3A 4XEHA 3RUFA 3DEYX 2ZJ1A 2NU6A 4RL6A 4B3IA 3DZIA 4YTEA 3TQHA 3WMXA 3DTYA 5L53A 1E1NA 1ZZEA 1CEQA 5TGDA 1GPDG 3AUTA 3U4HA 1R4MB 3FPCA 4ALKA 2Z95A 3FI9A 4CUKA 3A1NA 4Z6KA 1DIRA 2OUIA 3ONEA 2BI8A 1NVGA 1HYHA 1HYEA 3NDIA 4XX0A 3RBVA 2OP1A 2DT5A 3W6UA 1MV8A 3KXDA 5TQVA 3AUUA 1HE3A 2HK8A 3Q3CA 4OSOA 1GCUA 1UP4A 3WIEA 3L9WA 1PZGA 4ESOA 1NWCA 2D3TA 3ZNNA 4WEQA 4B3HA 2VTDA 5G2OA 4UVEA 2WTBA 1DIHA 2Y0EA 2H5LA 1JWBB 1WDMA 3VKVA 2QRJA 4NJOA 4PLCA 4BB5A 1DLJA 2X58A 3E48A 3DC2A 3GZ4A 1DFHA 1LDGA 1A4IA 1K89A 5DCUA 2OXIA 3KV3O 1PJSA 4TZTA 5L4NA 4RF5A 2NM0A 2VWQA 3WNVA 3ZWCA 2IDZA 4NBWA 2HRBA 1C1XA 3W4KA 4RF3A 4DRYA 5J23A 1ZSVA 4DYDA 2Y1FA 4PG4A 3GA0A 4ND2A 2P2SA 4CLOA 3DDNA 4PLWA 1I3MA 1MA0A 1GZ4A 1X1EA 4FN4A 5JC8A 4RVHA 4AJ1A 1TB4A 3ON5A 3DAGA 3EY4A 1X7GA 3WR5A 4W7IA 3WYBA 5T6BA 4BNHA 1UP6A 3BMCB 1UAGA 3BMOA 3KSZO 2YJZA 3OETA 5EPOA 3MTGA 1A5ZA 1LU9A 1UDCA 2DBVO 1PL7A 4F6CA 1P44A 2EGGA 4YB8A 1PQWA 5DZSA 3DTTA 3RC1A 3VHRA 3ZU4A 4CLRA 1GR0A 2C20A 4DUPA 1VM6A 2FP4A 2Y1CA 1FDTA 2EKLA 5TJ9A 3GDGA 3ROMA 4XJTA 1XU9A 3STHA 2P5UA 4XQEA 5JYDA 1E5QA 3GGGA 1ZXLA 4KWIA 3ZGYA 4KTTE 4CLDA 4EITA 4OKNA 2R6JA 1CDOA 5CHEA 3IC5A 1SOVA 3RFTA 2OFPA 5L40A 4Y67A 2EHDA 3UCEA 4M87A 1ZUD1 2HMWA 5TRTA 1Q7GA 2YFHA 1UXJA 4M54A 5JAZA 1PR9A 3FNGA 5CEEA 3ADOA 4TZKA 1MB4A 3LK7A 3SXPA 1ZK3A 1R4NB 1E7YA 3AOEA 2PR2A 1H2HA 3GEDA 3DZKA 3GRKA 3U09A 1EFKA 3AM4A 4DLBA 1IPFA 5JDIA 3B1FA 3W4JA 1BW9B 1WZIA 4UVIA 4Q9NA 3H65A 3TFOA 2ZJ0A 1NPDA 1PQPA 2HMVA 1Q0QA 1G6KA 3PYLA 2NU8A 2IYOA 4E5PA 2XXBA 4IDBA 1G1AA 3OJOA 4DC1A 1BW9A 3MEQA 3RSHA 2ZCVA 3VZSA 4CMCA 3CH6A 6ADHA 3ZCXA 4I5EA 1V3VA 2E6UX 1QKIA 1NQTA 3EMKA 2G82A 3PP8A 1H9BA 1XGKA 4U0KA 1QLHA 3FHLA 5ES3A 3ZV6A 1PS0A 3GFBA 3H8VA 4JROA 4ZQGA 4NK5A 1N9GB 1OBFO 3F5QA 1CQIA 2GZ3A 1WLYA 4DQXA 1P33A 5IZCA 4Q3BA 2JKVA 3FN4A 2HRZA 1JWAB 1KEWA 4CM7A 1A9YA 4BV8A 3M2PA 1P1KA 3QIVA 5KJFA 4RVSA 5A9TA 1N9GA 2UDPA 2O3RA 1QYVA 4BNUA 3PFWO 4CLRB 4RLHA 3M1LA 4AL4A 4IGEA 4CUZA 1GFSA 2DBQA 4MKXA 3ZWXA 1EE2A 4U6SA 4AJEA 4E4YA 1XKQA 3BHJA 2D2IA 3PDJA 3SLKA 5BR7A 3H3FA 4J3FA 4HFRA 1ORRA 1OC4A 3L77A 4J9UE 1XLTA 1GY8A 3DBRA 4R3WA 2X9NA 3ONDA 1NFFA 1R66A 3A06A 4GLOA 3O38A 3ZU2A 1EVZA 2Y99A 1NR7A 3DAPA 1U28A 4BIIA 1PU2A 2XOXA 1D8AA 1E7SA 8LDHA 4PLTA 4L74A 1E3IA 1ZNQO 1H2BA 3K2EA 5TJHA 4GMGA 3V2HA 2ZB8A 3OEYA 1Y5MA 3GR6A 5A06A 5JXWA 2P9CA 5T64A 3HWRA 2HQ1A 3AI2A 4BQRA 4Z3DA 1YDWA 2CVOA 4BGEA 5IN4A 1LQTA 2EV9A 3QVOA 1BVUA 1I36A 3D5QA 4U6QA 2JD1A 1IL0A 3L9XA 4HXYA 3ZN2A 1IY8A 4XYMA 4RO0A 1SBYA 5BSEA 1KIFA 1T2FA 2GD1O 1K6XA 5JAIA 3I52A 4BO7A 2P9EA 1H6BA 4ZVVA 2JJYA 3U4IA 4MVJM 1VLLA 4TKMA 2CMDA 3BXXA 3MJSA 3E9MA 3JQBA 2B5WA 3OA0A 5L4SA 2C54A 1PSDA 4E5YA 1WDLA 1ZSYA 1UZNA 3B1KA 2F00A 5GZ1A 3RD5A 4XIJA 4FC7A 5ITVA 5L7WA 1TT5B 1ADBA 2ZB3A 2DLDA 3HDJA 2OP0A 3EUWA 4AJKA 3NX4A 1F8FA 5A9SA 4E5KA 1F06A 2Q1UA 4INAA 3QP9A 4B4OA 3D3WA 3JQ8B 2Y1DA 2J3JA 3LC1O 4Z9YA 4A0SA 3RROA 5IZ4A 2H1SA 3NT5A 2CSUA 3FSRA 3PWSA 4L9RA 5COBA 5EQDA 4KUGA 3AM5A 3OF2A 4CM5A 3DXFA 3DHNA 3SC6A 5IDXA 4J1TA 3VTZA 3RWBA 1SOWA 4EJ6A 4IPTA 1YO6A 3QVWA 1NYTA 2DTEA 2VHXA 3JSAA 3LSYA 4BNNA 5LDHA 3VPFA 2IXBA 4JJFA 4MVJA 1QR6A 5HS6A 5EERA 2ZYGA 2Y1GA 3JQ8A 3ZNPA 4L4RA 4OKIA 4UUOA 2VOEA 4WCDA 2GSDA 3RBXA 3BZUA 1B26A 1Q2XA 4IXTA 4YAJA 1RYEA 3IUPA 4WPGA 4TKLA 3DONA 3G79A 4MVJE 3HG7A 1HE2A 4CUJA 3I4CA 1GZ6A 2B4TO 1LI4A 2Y05A 3JV7A 3Q9UA 5IXSA 2ET6A 1OAAA 4GMFA 1CWUA 1PJCA 1W73A 3IKTA 2TMDA 1EQUA 2EKPA 3DWFA 1LRLA 4QX6A 2NNLD 2Y67A 3MWEB 1U4SA 2VHZA 9LDTA 3IS3A 3WJAA 1W6UA 2X0NA 2Q4EA 3AK4A 1PL8A 3I9NA 5DULA 4TRRA 2O23A 4HV4A 2WE7A 2C82A 3CXRA 3JQ7A 3N58A 4MP3A 4NJMA 3PIDA 4R1TA 1I3LA 3UH1A 2AXQA 3AOGA 4L73A 4D79A 1ADGA 1VC2A 1HDXA 3E8XA 4QTZA 4O59O 4XYEA 2CDAA 3NT2A 4ONEA 4XR4A 4Y6SA 1R6DA 1DOHA 2YZ7A 2AQ8A 2WD7B 3D1LA 2R00C 2NUAA 3OICA 1UXGA 4XRGA 1LBEA 4JIGA 4TQGA 4GPD1 4FPXA 3JYPA 1UZLA 2ZQYA 2V6FA 4JBHA 3LT0A 4PZEA 3RQSA 4I8XA 2NTJA 3ZNOA 5A02A 1UZMA 3LYLA 4CM9D 2NQ8A 1WMBA 2RH8A 3E9NA 3U9LA 4GVLA 4E33A 4N7RA 2PD3A 2FMUA 3PHHA 4IJVA 1UP7A 2E4AA 3PWZA 4OH1A 4D7AA 1BGVA 1YQGA 3CUKA 2Q2QA 4Q39A 1P9LA 3FR8A 1MLDA 4ALIA 1EDOA 1E6EA 3PDUA 4MVJP 4YEDA 4ALJA 3C24A 5C37A 2J5RA 4A03A 4W82A 3RUCA 3FBTA 3SBOA 4PLZA 3I9OA 4MIOA 1C0IA 5KOIA 1YBVA 5DBGA 4R1SA 5DCYA 1EUCA 3GFGA 5KJ1A 2W2KA 2BFOA 4WLNA 1KOLA 4IDAA 4M55A 5HA5A 3GG2A 4GBJA 1C1DA 2VOJA 1OC2A 2NWQA 2YFQA 1HRDA 4AJLA 3JQGB 4IQGA 1BXGA 1E1MA 3K30A 2FR0A 4FB5A 5A1TA 3CZMA 4XB1A 1ISGA 3ZU5A 1X0VA 4WASA 4A2CA 3LVFO 1AXGA 4BNZA 5JO0A 3ZV5A 1NNUA 4UUNA 2QG4A 1MG5A 2X9VA 2EGHA 4U0JA 4W7HA 2GZ1A 2DBRA 4TRMA 3OIDA 1K0UA 5AXDA 3PJDA 3GHHA 2AQKA 4E32A 4XGIA 4R9SA 4MPDA 1B0AA 1PJ4A 3WWYA 1F17A 3PGXA 1V9LA 2EG9A 1B3RA 3MJ4A 4PLVA 1GUFA 4DPKA 1B16A 4FFPA 1E6UA 3I6QA 2X0RA 3NV9A 2P91A 3G1TA 1P1HA 4F6LA 1P1JA 1R4NA 1PIWA 1IPEA 4BV9A 3GLQA 2ZYDA 4J91A 4E3ZA 5GY7A 3K96A 1HKUA 5DF1A 1VPDA 1QXSA 5FYDA 2HCTA 1X15A 3PHGA 4JCOA 4YA6A 4XD2A 3WQQA 1MFZA 3I23A 5ENVA 3GGOA 1BHSA 4J1SA 3LC2O 2PTGA 3O03A 2V6BA 4B7XA 2Q45A 9LDBA 5L9AA 3KTDA 1HLPA 5JY1A 2C2YA 2V7PA 1P45A 2YDXA 4DMMA 4EZBA 3E5RA 4OAQA 2O4CA 2X4GA 2FN7A 2ZYAA 4E30A 1HL3A 4AVYA 1LC0A 4RZHA 3VH1A 4WGGA 3Q2IA 4RDHA 4CM9A 4KQXA 1UDAA 2BF7A 3GMSA 4DXHA 4E5NA 5F5NA 5T67A 2NVUB 2QZZA 2W2LA 4CR7A 4Y8VA 3O4RA 4B79A 1N2SA 3WYCA 1QYCA 2WSBA 3GOHA 3ORFA 4HNHA 4CMKA 4NMHA 4IS2A 1U1IA 2AQIA 2EIHA 1QV7A 4B4UA 2EWMA 5CDSA 3DZJA 3N74A 4WOJA 1VL0A 5JDCC 4DPLA 2Q4BA 2FZEA 2HSDA 3Q2KA 4LISA 4RVUA 2IEBA 3H9UA 4BO4A 2PH5A 4JN6B 1E1KA 2X6TA 4WE3A 4CMEA 1IB6A 3PK0A 5ENDA 3RIHA 2Q49A 3RC7A 1N8KA 1KVUA 4URFA 4ZD6A 4D3FA 1S6YA 4MO2A 3TOZA 4O1MA 4PLPA 3BMQA 2QHXA 4FOOA 5G0VA 3EZLA 4XDZA 4MKZA 1E7MA 4YAKA 1FDVA 5T8KA 1Q7CA 1KY4A 1TA4A 1H9AA 5BSHA 2RHRA 1DC5A 4R16A 3GEGA 2QIOA 2V6MA 3CSDA 2Y1OA 1O0SA 1VRWA 3KZVA 3KLPX 1LA2A 4J4BA 2FR8A 4MIEA 5JW6A 5IF3A 5FFFA 1YOVA 3RVDA 4RLSA 3RUAA 2I6TA 5CDGA 2BGMA 3IAHA 3JD1A 1HDGO 3HB5X 4D0SA 3E6AA 4IIVA 2HUNA 2AHRA 3GAFA 3S2FA 2ZTLA 1LQUA 5G4KA 4OM8A 1PR3A 5EQFA 4J7CA 4BO1A 5JNLA 4LGVA 5TIIA 4YQZA 1W0CA 3D3EA 4MVJG 3PEFA 1Q0LA 2ZTVA 2DC1A 4IDCA 1QSGA 4L0QA 1AHHA 3CE6A 4KQWA 4I9UA 3OBBA 3LLSA 4UVDA 2WE8A 5A03A 2PZLA 1R37A 4PN3A 5COAA 2PZKA 1ENOA 2NVUA 3EAGA 3UKOA 4JXKA 3RI3A 1WZEA 2G1UA 4BNYA 3MOIA 4R01A 1J5PA 1KC1A 3DB2A 1KEPA 1Z7BA 1M2WA 1Y6JA 3VPSA 3A4VA 4LMPA 1A72A 1NVMB 5MDHA 1R0KA 2WD8A 3JQGA 3KRTA 2CF5A 2P5YA 2WYUA 2VHYA 2J8ZA 1GD1O 4MP6A 4ZQEA 4PZCA 3KSUA 2ZB4A 3VDQA 5KKCA 1WAMA 4EJ0A 4CODB 2VZ9A 4H7PA 3CZRA 4XJSA 4J0FA 1YL6A 4CM3A 4GAEA 3VZQA 3KO8A 2VUTA 3JD3A 5GMOA 1UDBA 1WDKA 1RM3A 4A10A 2C7VA 4BNWA 1RJWA 4FC6A 2HMUA 2BRUA 4I5DA 1C1XB 2FOIA 3F3SA 3VAZA 1XA0A 3OJFA 1V3UA 2DM6A 3VOSA 1YRLA 4P4NA 3HB4X 3TNLA 2RH4A 1P74A 5EMHA 1X0XA 1YBMA 1PGOA 3BTUA 3PJFA 1UUFA 2BHLA 3WOHA 2X8LA 1NVTA 3FD8A 4XYBA 1Z75A 1JLLA 1U3VA 1BRMA 4IZHA 4TSKA 4QFCA 3GT0A 1YJ8A 3ZWYA 4RZIA 3DBLB 1YB1A 4RV9A 4YT2A 1Y1PA 2RIRA 3MWDB 3ZWAA 3ASVA 3INGA 2YQ4A 3IDSA 4HFNA 1ZXBA 4IJKA 4UEKA 5C7LO 4TMFA 4BGIA 1XIVA 4B8WA 3RCBA 1B15A 2G76A 4ZHSA 1YL5A 1V35A 2B4RO 4FDAA 4XQ9A 3IP3A 1GEGA 1JVBA 4FD3A 1MG0A 4CLEA 3A14A 3EGOA 2WJPA 3UW3A 4KOAA 3GAZA 4RCVA 1I3NA 2O7QA 2X7HA 2DUWA 5GZ6A 3DAFA 2DFDA 5IN5A 1R15A 4GH5A 1P77A 3GPDG 3ZZNA 1GL3A 1Z6ZA 1ISMA 2VT2A 4KUHA 3ROKA 4EGFA 2QYSA 4BQPA 4U5QA 3D64A 5L45A 3KVOA 1LRKA 1RM0A 4XQCA 1D7OA 2IYPA 4D3DA 1V0JA 3G17A 1F8GA 1E0DA 3JQFC 3R3SA 3WNQA 4W99A 5DOVA 1I2ZA 4ND1A 2D1YA 4ALLA 3GN1A 1LLUA 1YQXA 1U7TA 1UXHA 3MZ0A 3GUYA 4GX5A 2I66A 3AUSA 3RASA 2EJVA 4OL9A 5JSFA 4AJHA 1SMKA 1T26A 3JD2A 2YDYA 4FCCA 4BGVA 3S2IA 2X0JA 4YAEA 1CF2O 2B83A 3GUCA 4FFLA 4W4TA 3T4XA 4BNGA 2EW2A 2W4QA 3OIGA 3H5AA 1HZZA 4IQ8A 3T7CA 1V6AA 1A27A 1DC6A 1DXYA 2Q2VA 3QV1A 5CG1A 4DQVA 3H2SA 3C1OA 3RUEA 5DNAA 4GGOA 4XYGA 1FJHA 2EEZA 3OQBA 5KIAA 2WWRA 2GR9A 4CMAA 3GVPA 1GQYA 3TL3A 3CMMA 1EUZA 3FF4A 3WLEA 3HDHA 2J5QA 3GC6A 3HHPA 5G4LA 3JD0A 3L6EA 3ICCA 4AJPA 1H6AA 1T4BA 3HDYA 2DTDA 4B4WA 2VWHA 3LT1A 2VHWA 1TEHA 1M6HA 4GLLA 2D59A 1LUAA 3QQPA 2VYVD 3GK3A 2Q50A 1Z82A 3W6ZA 2YV1A 3WTBA 5CDYA 2JCVA 2PNFA 3X2EA 3I9MA 1ZFNA 4WLFA 4YRAA 2LDBA 1EUDA 3NKLA 1R4MA 2AEFA 3NTQA 4DBVO 4CMIA 3JQEA 2HO5A 5F1KA 5CAEA 3UICA 4TRJA 4LSMA 1GYRA 5B1YA 2J3HA 1NX6A 2Q3EA 2H9IA 2W2LD 3PWKA 3TZ6A 3H9QA 1Y8QA 4IDGA 3KEQA 2CNBA 1C14A 2GN8A 4GWKA 5JE8A 1LTHR 2FPGA 5KVQA 2POQX 1LDNA 4HWKA 5AXBA 3DHYA 3UVEA 5AYVA 1O9BA 1A4UA 3RFXA 3QWHA 4OJNA 5AXCA 1GV0A 3WGYA 4R4JA 5K6AC 3KYBA 1BXZA 2C29D 3WGQA 4A27A 4EBFA 3IMFA 2I65A 3KYCA 3SEFA 3RAJA 4DREA 3N7UA 4Y98A 3RJ5A 4O0LA 3AU9A 1GCOA 2ZTMA 3VH3A 3JCZA 5A3VA 1VL6A 2IEDA 4GVXA 1IOLA 1K6JA 3Q11A 1HDZA 2PD4A 1ULUA 3WBBA 2Q1SA 4CL8A 1QLJA 1DJQA 3WWZA 4FJ1A 1ZO8A 2HDHA 3AY6A 3TSCA 1GQQA 4OQZA 2CFCA 1ONOA 4K9DA 3K6JA 3L4BC 3OHSX 4RORA 4CM4A 4DA9A 4LVCA 5L3ZA 3VKUA 1U8XX 4YJHA 4IY1A 4WLEA 3LZ6A 4CQLA 1DAOA 1IZ9A 4NNJA 2J3KA 2IZZA 5CG2A 1VKNA 1N7HA 4PLHA 1NM5A 2D4AA 1K5HA 3GNTA 1HE5A 2CD9A 3ULKA 3LF1A 3NDJA 1YDEA 1L7DA 2VNAA 3HE3A 3PQFA 1O5IA 1O89A 2VNSA 3NAQA 4HBGA 3VZRA 5B4TA 4BKRA 1EVIA 3KM0A 3BTVA 5MGBA 1T4DA 1TT7A 5T8KC 3C7CB 3ZWPA 1LSSA 3JYNA 2JHGA 2FY8A 1PJLA 4BNVA 4E13A 1YBAA 4Q3DA 4F3YA 2NADA 1DFGA 4C7KA 1PS8A 3KBOA 3C7DB 2GZ2A 4J1NA 2JFFA 1DC3A 4A5OA 1DIBA 3LLVA 3X2FA 4D41A 1ENYA 2Z1NA 1UXKA 5KCZA 3V2UA 3ZWNA 1YS4A 2GASA 5KKAA 4D3SA 3L4SO 4ITUA 5JDCA 2EERA 5JDIC 2QX7A 3GZNA 1JTVA 4L76A 4OXNA 3U4CA 2VUSA 2PA3A 4XQGA 4GGPA 5CEJA 4IDDA 3WXBA 1PZHA 4XB2A 2OHXA 2B36A 1NTOA 4UEOA 2OOSA 3H4VA 1Y9EA 4FQ8A 2PLAA 4R1UA 4Z0HO 4BUCA 4D45A 3H9GA 4UREA 2HK9A 1L7EA 5AXAA 5K9ZA 1F0YA 1SB8A 3QJ5A 1B14A 5H83A 3QA9A 4I9HA 4OHUA 5I7SA 3ETEA 1R12A 4MOWA 1Y8RA 3ZWBA 2JFHA 3HFSA 1D1TA 5I7FA 1KYQA 3CTMA 3TZCA 4ROSA 5F21A 2DKNA 3B70A 4CQMB 3C1TA 3OM9A 3AY7A 4ZQFA 1D4FA 4NH4A 3PTZA 1XWFA 3H9JA 1XEAA 1U3WA 4Q3EA 3TPCA 1YWGO 5A9RA 3UHAA 2NV6A 4BKOA 3IQDB 4JX8A 4CLXA 4FS3A 1ULSA 2NTNA 2VT3A 1LSJA 1LRJA 1XYGA 5T5QA 1J6UA 2PY6A 1JKJA 2X5JO 4OYRA 1ONPA 4CLOB 2JCXA 1PTJA 1HF3A 4AJIA 3HADA 3R3JA 4P4LA 3QVXA 4PFJA 3GHYA 5EESA 4ND5A 1WW8A 1E1LA 4BB6A 4DYVA 4J9VA 1ZVMA 4EI2A 2P68A 1NPYA 4YR9A 5HRUA 3S55A 2YV2A 5L7TA 5B4VA 1MC5A 1OZAA 4D43A 4FJ2A 3ICPA 2G17A 3H9EO 3BA1A 4XR9A 4DMLA 4R68A 3ASUA 4UULA 4NIMA 2PKQO 4PG7A 1HWYA 4JJIA 4IXWA 2O4UX 5I8ZA 1AE1A 1C1DB 2JAHA 4FOSA 1Z45A 1UR5A 1ZEMA 3ZHXA 5L7YA 1RM4A 3CEAA 4W9NA 3RBZA 5HM8A 4QT0A 2WDZA 1U8FO 2PKRA 1ZJZA 1QORA 2WM3A 4R3NA 1ZK1A 3H5RA 3OQ1A 3PIIA 1KVTA 4Q3AA 4AFNA 5KTKA 5JCJD 3CKYA 4XGKA 3BMQB 4RPJA 4J43A 1MX3A 3M1AA 3K2BA 4BHTA 3JQAB 2CVQA 2OZPA 1C3VA 3IOYA 3WSVA 4YAIA 3PHIA 2RHCA 2J3IA 3OJEA 3U5TA 1N92A 3AFMA 1ZEJA 1GUZA 5BSGA 3DZFA 2ZCUA 2YYYA 4BVAA 1VL8A 3DQPA 3HZZA 3IKVA 2GN4A 4XWYA 1ZKMA 4PZDA 5IDYA 5IG2A 1YGYA 1VJ1A 5TLSA 5L51A 4PGFA 2HU2A 4E31A 5LCXA 4K1LA 4NG5A 1ID1A 1QMGA 3MCVA 1WVGA 1PGQA 1KY5A 3RU9A 2GPTA 4J7XA 4O5OA 8ADHA 4HFJA 5HBRA 2C7GA 4NJMB 2O3TA 3KYDA 1SAYA 5K6AA 1NASA 1GQ2A 1ONNA 5G0UA 3WYEA 4KDEA 4MDHA 1KBZA 3F5SA 1I32A 5G0WA 4BO3A 5U1PA 4A73A 4CR6A 1XELA 4CQLB 4BKUA 3UOGA 2WD7A 1DSSG 3GNQA 4YJHB 3BIOA 3QHAA 1GEEA 5TS3A 4Z9FA 3LT2A 2E49A 1U5AA 4MINA 1UJMA 3RUDA 3AUAA 3WGTA 4B7CA 2NU7A 3U62A 3AFNA 5COQA 4E2WA 2UUPA 2XPCA 3JQ9C 4LCJA 3JYLA 4DBZA 3VPXA 4QO8A 4Y6RA 5TT1A 2HKIA 1BWSA 3KHUA 3BAZA 4DLAA 5JAQA 3AM3A 2PWZA 4G2NA 1NWHA 3KB6A 4CMBA 2VWPA 3I5MA 5IXYA 3DMTC 1PQUA 1JDJA 1K2WA 1LSOA 3RKRA 4NR0A 4GX2A 4TRNA 3F9IA 3VPGA 2DAPA 3KOUA 3PPIA 2P9GA 4RPHA 5DBIA 1E7QA 5TX7A 5K0ZA 1P1RA 2G0TA 3B20A 4FFMA 3ZH2A 1T25A 5C3MA 2O48X 3GEMA 3DOOA 4H15A 4PIVA 4YBZA 1B8UA 4BO2A 4Y6PA 4L4SA 1CYDA 4YWJA 1I5RA 1ADFA 1DRUA 1PJ2A 3T7EA 4WLVA 2ZTUA 4N5LA 4YDRA 5A5EA 2Q46A 2BFPA 4IM7A 3WFIA 2I9PA 3WGIA 1V3TA 3GRPA 4CPDA 3INTA 2PKQP 3WLFA 4D44A 5TNXA 1C0PA 3E82A 3O26A 5LDGA 3W1VA 1IHYA 4RGBA 3ZHZA 2QZ9A 3F6YA 4IUYA 1HTBA 2C2XA 2AA3A 1EVYA 4M86A 4YVFA 1XCBA 3DZBA 1FDWA 5GZ3A 2O3UA 2CDBA 3FR7A 3RUIA 1A71A 5THKA 3FWZA 3VH4A 1MGOA 4YPOA 3LT4A 3L6DA 4TROA 3VZPA 5CFZA 2NVBA 2X5KO 4BMVA 2OBNA 4ZJUA 2D8AA
chains in the Genus database with same CATH superfamily
2B5VA 1XL1A 4X8OA 1FK8A 1HSZA 5JROA 3UW1A 2AIRA 2BDUA 4ZYXA 3ZKAA 1GNTA 4RTNA 3EA5A 3JAWB 3GMTA 1SKBA 2OVBA 2E89A 4FHDA 4LZJA 3WA7A 2PSJA 1FMLA 4HFMA 4KBGA 3AERA 1Y9ZA 2Q5CA 4ZODA 4AY5A 4MJ3A 4PSUA 5G4KB 1LXCA 1VDZA 3A9TA 2RIPA 4P0QB 4CMJA 2JAWA 1XD8A 3GLVA 3H2GA 4ZGGA 4EGJA 2NU7B 2R1VA 1LB1B 4U2GA 1PR1A 3QPDA 4U2CA 4ZIRB 3K0CA 2XMCA 1VZ3A 2A3RA 2X0KA 2XSZD 3G88A 1G3UA 4WVLA 4QRDA 5KYXA 3H84A 2YH2A 3GGJA 1MX5A 4J0QA 5JNTA 3DT6A 3JQ9A 5AOVA 3ZOZA 4GC9A 5C5IA 3FLAA 2F8SA 1ESMA 1PUXA 3DWIA 3UCXA 1CS0B 4F45A 1MW9X 4GL4A 3ZUGA 4OEHA 1T8SA 2VNIA 3DHWC 2LVBA 4R2KA 1LZKA 1O6ZA 2MTBA 3JZFA 4NARA 2UZ1B 3LRXA 3UATA 2ZBQA 2AN1A 1RM5A 2DQKA 3DEKA 2NXWA 1JT9A 2V0NA 2RFLA 3DDSA 4OKSA 2CEKA 4QZVA 4YP1A 2HSJA 1E2EA 1Y5IA 1GGVA 2VTEA 3RHZA 3MWLA 3ZWVA 3NXSA 2PGJA 3I1JA 1OI7A 4U7WA 1TF2A 4KAXA 1OUMA 4MB2A 4R1OA 5HZHA 1TGYA 3G6WA 1F5SA 3C7AA 5I7UA 4P3NA 5ERXA 1J5EB 2BKUA 2VA9A 2BCJQ 1Z73A 5JMWA 2X8WA 3RU2A 5TGZA 1WP9A 1YXMA 4UBKA 1N3LA 3IDFA 1X1TA 4BNLA 1NX9A 4EJMA 5JPIA 3GJRA 3HN6A 2GCGA 4NFLA 5KSYA 2IVFA 2AE1A 1G4HA 2AXEA 3RODA 2I2FA 2UYQA 1BGXT 4MWEA 3VTFA 1OXVA 3UJ6A 1E63A 4WNIA 3TIVA 4BPRA 1DAPA 1UFRA 4LOLA 2JGDB 1O58A 4P53A 4DJ5X 4I5GA 5CNJA 1SU8A 4UAUA 1JH9A 1SJ9A 2A58A 2DMRA 2GETA 3T7TA 5I01A 3WSTA 2CXXA 2C2ZA 1GAEO 1EDZA 1U2ZA 1Z6PA 3X1DA 1F7VA 4IFEA 3FWNA 4K40A 1TM4E 1GL9B 4GT1A 4O2AB 4FEAA 4LYYA 3PTLA 5CDFA 1WQ1R 1T24A 5JUWA 1C2YA 2IIQA 1C1HA 2ZSJA 3FHOA 4HQLA 4X1IA 3ZCQA 2F3SA 3NHSA 3R0VA 3A25A 3PCXA 3JPWA 3NKVA 3UGKA 5LMNB 1EFTA 2JGNA 3BB3A 3UY4A 2OV8A 4E5SA 5JTUA 3OECA 4KN8A 1Y81A 2LKDA 4OG2A 1NLYA 1A4XA 2PU5A 3EH1A 4NOJA 4B9EA 5K6RA 3CSUA 2PD6A 3HPRA 4GGMX 5HPYB 3U4DA 4CV3A 3EVEA 1U6KA 1G8YA 1YS2X 4ATNA 3MTIA 3PJEA 4QNNA 2P2YA 4RWEA 1FF9A 3WHLA 3P9ZA 5CPFA 4KU4A 1MAUA 4PO8A 3E4DA 2HPHA 3WXMA 4AIIA 3WWCA 5B12A 3ZDDA 3I8SA 1GT6A 4LBWA 4CIXA 3FNEA 1XDGA 2HYIC 4DPMA 2QMZA 1KEEB 1K8XB 2NX2A 2WWIA 3HV2A 1AKUA 4BFSA 4I6EA 5ALRA 3KCQA 4P08A 2JI4A 4F11A 1PX0A 1SWVA 1BROA 3FGOA 3QI7A 3HCAA 2ECOA 2O5CA 4E5VA 1CUJA 1A5SB 2N42A 4HAVA 5SV2A 2IS6A 5GM1A 1KQPA 1YIDA 2NTVA 1NXQA 4CDMA 4QKQA 4JI2B 4PR3A 1XTZA 4LHWA 3WGGA 3WWEA 1E92A 2EKQA 2VYND 5HXAA 1MGPA 2H6EA 3H2YA 3KJZA 1HE8B 3P5SA 4GYWA 1YR2A 2OC4A 2G25A 2J4CA 1XLVA 4OU5A 4ER5A 4Z54A 1P31A 1J24A 2GTHA 3G1UA 4M46A 2BMDA 4NLLA 5B5SA 4OFZA 5JAUA 3DO5A 1OMOA 3Q6MA 1VJDA 1MHPA 3DR5A 2FG5A 2WBLC 1L6RA 1SCUA 1QV6A 3U17A 1M2NA 1ZHHA 4UU7A 3HABA 1HOXA 3QE9Y 2WEKA 4IGFA 3AP1A 4JR1A 4ODIA 4US0R 2DE0X 1XAIA 2CXQA 3GMIA 4FI3F 1UF9A 4PG5A 3WOVA 4JC5A 3NYWA 2ATEA 5BUZA 2RE8A 4QFDA 3AESA 1ZSNA 3DKKA 1I01A 3EC7A 5HTOA 4K6HA 4IZIA 3HKEA 2BMEA 1RC0A 1BHQ1 1P1IA 3NOOA 4NBUA 1ZJ6A 3TDKA 4WECA 3E1KA 1EGQA 3UWMA 1X94A 4HYYA 4JU9A 3QRWA 4WFKA 5B3JA 4CCSA 1JMVA 4LJ8A 1HFWA 1A88A 2O3QA 5K51A 4TS4A 2HSWA 2NVWA 1N1DA 1T1JA 2C07A 4OJQA 4YRQA 3P4XA 4E21A 5LQMA 1W1WA 4NU5A 3FZQA 3OPNA 4BMNA 3B1YA 3G0OA 3V3TA 5AVOA 4WNAA 1NRWA 2H31A 2CUZA 4XIGS 2P8SA 3DLCA 4ARCA 1P0CA 4X8MA 5LSAA 4HB0A 1DELA 3HUUA 3LGSA 4QBHA 2O8DA 2XB4A 5DXFA 1CIVA 2I55A 3FOCA 2YBDA 1K3UB 4U7JA 4QVIA 5E2IA 2EJBA 2XVAA 2QTNA 3D2AA 1HNWB 5HW0A 1WV1A 1VOTA 5IANA 4B7UA 3RAFC 3KR9A 2WAAA 3DNFA 4W8GA 4G4GA 1HZJA 2FEMA 4CF5A 3GDFA 1CLEA 2X23A 4D3ZA 3A9UA 4EY7A 3L5KA 1EA5A 1JEQB 1VLZA 4F7DA 5C18A 1GGKA 1ACJA 2PL3A 1SUFA 3A04A 4MSUA 4ZDIA 2V0GA 1U4OA 2I2AA 1AK2A 2I87A 1ZITA 3HCNA 4EO4A 1B8PA 2PBZA 2QTMA 2WWGA 2YMMA 2YY7A 2Z5VA 4K1XA 2FZGA 4GPIB 2VN8A 3P20A 2FF5A 4QO7A 4ZOAA 4EY6A 2RH9B 2I67A 1C9KA 1G2QA 1VFPA 5LU9A 4EATA 1K6MA 1Q50A 3VZBA 4C2UA 4A8TA 4YPFA 1XX6A 4E09A 5EWJB 4JFRA 4KL8S 2CV0A 4WCVA 2C9YA 5IJ0B 2Q9UA 1I8TA 2OLEA 1E79D 3R1IA 2TMYA 5EJ2A 4CMIB 4Z4HA 3V8RA 3QEMA 4V02A 1BC5A 1QQBA 1TLFA 3P9SA 2I54A 4FFNA 5IJAA 3MQ4A 3SYKA 3WFJA 2YV4A 2HQOA 3UMCA 2AK3A 3HFRA 4MVJF 2FE1A 4XVRA 5JLAA 4CKXA 1F7UA 1UZUA 3P1JA 1YNSA 1UAYA 4F7WA 2YJTD 4RPKA 5LIPA 1HMYA 3QSGA 3VKHA 2Q9AA 4LEIA 3QXXA 1WUHS 1Z4LA 2Q3JA 1FP6A 3AR3A 5FBWB 1GCAA 4HNQA 1TYEB 1KH3A 4GLJA 3G5UA 2D62A 2PCLA 5FUXA 2FN3A 4C7JA 5T4FA 3N70A 1Y82A 3UGTA 2XOKD 4DADA 4L8LA 4ON9A 1GJRA 1PNQA 2OV6A 1FFXB 1QZZA 2QAGC 3L7BA 4M9SA 1FOEB 1MB3A 3WKCA 2FXVA 2I22A 2X0IA 5DTEA 3FZGA 5IJWA 3OKFA 4PZAA 4LBZA 3TQQA 4ANFA 4ZICA 4ZK2A 2G07A 1DJLA 1DQZA 1TQ8A 2L17A 4ZARA 1KC3A 3IQXA 4F8EA 4WXRA 3TJZA 3CVYA 2O8FB 1DAFA 5FH9A 3RTAA 3BQ9A 3GW8A 3PUJA 4EMSA 2H7XA 4ID9A 3LWNA 1FYVA 2Z9CA 3QKIA 3I1IA 3W4IA 1DPFA 1XMPA 1AB5A 2Q6VA 3BGWA 3TTTA 2O59A 1T2CA 3M0EA 1GAJA 2OC9A 4Y6QA 4DF3A 1D2AA 5AI6A 4NNOA 3ZEAA 1V71A 3RVJA 3IIEA 3WQSB 2YS6A 4A0QA 1C41A 2JJMA 1F6WA 1USUA 1NVDA 3A1EA 1E6LA 3GGPA 3U7FB 1EG2A 1R0SA 4ZCRA 2XYVA 4LHEA 4D6PA 1BTOA 2G9NA 2XRYA 1SELA 3DMYA 1Z4NA 3PUKA 1V96A 2IOFK 3E2MA 3H6KA 3LFUA 1O6GA 2ID7A 3W7AA 2ILTA 2IUUA 3AEZA 3TZKA 1TU4A 3SNKA 3KC2A 3KJIA 3UB2A 3W5UA 5ITSA 3COPA 2FPIA 4I46A 4G0NA 2D00A 2Z4SA 4DGQA 4KQKA 5HNKA 1EVQA 2DHQA 2P6UA 3HP1A 1AKWA 1IVSA 3DYBA 5BN5B 2EZ4A 1C5KA 1EDBA 1XZNA 1R0XA 3AT1A 2FK8A 3BMOB 1S2DA 3MW8A 4HF7A 4Y30A 4ZAGA 4C1BA 5BSFA 3R76A 4B80A 1PHRA 4KQCA 4WCFA 1RSZA 4RYLA 3LUPA 4OCZA 5AW0A 3VI4B 4TZ6A 1RT9A 1EBUA 4QU5A 1IB0A 3V5NA 2DQ4A 2XWSA 4JBGA 1QWSA 3NM5A 2GO1A 3P96A 2PL1A 2VP9A 3AKEA 5H7XA 4P7GA 2BEWA 4FFOA 1J09A 1EQ2A 4TSRA 1JPVA 2HL6A 1L8XA 1P2TA 1OYWA 2QW8A 4QECA 3UJ3X 3W8RA 4B34A 4MGEA 3UPUA 1OIVA 1EFLA 5KNDD 2P9ZA 3NPMA 4JJKA 4RENA 3ASZA 2G5PA 5DGTA 5KX5F 1CUYA 2ZUCA 4K6CA 3QLUC 3SLGA 4E12A 1NBIA 1VJ0A 1LZLA 2EBHX 4ETNA 4RPCA 3KEFA 4JQOA 2MU1A 4ENTA 3VSAA 4AF7A 1HE1C 1L5OA 1Y6QA 1UBOS 1DADA 3NETA 1UZAA 2DKFA 3PLRA 4KO4S 3E18A 4L4ZA 1FX0A 1QYDA 5EPEA 2BELA 3LWDA 5H3LA 1R6TA 5EXXA 2YHIB 2BCGY 3VHQA 3G68A 1QGAA 4J8PA 2GHQA 4FSDA 3HI6A 3GZTB 5CIQA 4E6PA 8GPBA 4IH9A 1HYQA 4HATA 2AC7A 3SFVA 3FFBA 2XUHA 3NI2A 3PGJA 3NDRA 2UZAA 4J16A 4F46A 1XTTA 2J5KA 4B48A 1F9AA 2XR1A 3ILYA 2Q6KA 1ZG3A 4HY3A 5GGXA 1UH5A 2GERA 5DVZA 1SD1A 2O7VA 4HGOA 3TLMA 3E8SA 4B5LA 1RFGE 3H1GA 4QYSA 4DRZA 4JD5A 2ACKA 1LLQA 4OGKA 1NSYA 3KZMA 4LOAA 1XEXB 5EE5B 2OBYA 2TMKA 5E9JA 3ZCPA 3HM9A 1KO1A 3S70A 1BHO1 5KJ6A 3HZHA 1OHHA 2AFIA 1E2KA 2GCIA 1N8SA 521PA 1TQ6A 1GUYA 1A77A 3SC3A 3VV2A 4COKA 4ZQBA 3OFSA 2QEQA 3Q7QA 1I3CA 2QROA 3LVQE 2CZGA 5IJ9A 3QXHA 1X7ZA 2P1ZA 2G5TA 2O1WA 1CJSA 5BW4A 4IO0A 4CBVA 3ZUPA 4H3KB 3BH6A 1QO0D 2XQKA 4CLEA 3CLTD 2F8TA 3PA6A 3QOXA 1GTZA 3CSSA 1JA9A 1TK3A 2GDJA 3GQBA 2ODAA 4BEJA 5CDTA 4FYPA 4UUPA 3NLLA 1KI3A 4XCVA 4NFYA 4Y6OA 4N47A 1CY8A 2F62A 4MYHA 4AF6A 4IS3A 3ANYB 2CUNA 4IL5A 3QWIA 3QWAA 3GPBA 3MTJA 1YU6A 4QQFA 1R88A 5DHRA 4B6FA 1TYZA 2HHCA 2XGMA 5EIAA 5JNUA 1E6WA 1TO6A 3OH8A 3U16A 2GF0A 2PO5A 5I3ZA 3BCSA 3V7WA 2NP6A 2YN2A 1M6EX 1RBYA 5J1SB 3OJLA 4Y3UA 5CK4A 2DFNA 5SZHB 3TZLA 2ZRHA 4FLEA 5DEIA 3ONNA 2R6HA 4ZP1A 4N48A 3WFZA 1OV6A 2AZ4A 1L7RA 3CF6R 1RW4A 5CXUA 4RY2A 5HOQA 2ZIAA 2AX3A 4LWPA 3R6WA 4BVEA 2VCHA 1T6YA 3FLBA 3L1VA 3SXUA 4KREA 4Y7CA 3SJCA 2XB9A 2FPPA 2H0AA 3ND5A 5AH0A 3B3GA 2XAAA 4BMZA 3JQBC 3VM6A 4UASA 4G0VA 1FS4A 2JAUA 1YI0A 3RK4A 2ZS7A 1LX7A 4L15A 4AZ0B 1KS9A 3WGVA 1BE0A 1Z5GA 2RI0A 3TQOA 1E7WA 2ZRIA 1TJ3A 3BWCA 4B3BA 4UOEA 1G5QA 1XXHE 2ZUSA 3KKKA 4BQOA 1UBRS 3R9XB 4WHMA 4FGSA 5IMSA 3JD4A 1M34E 2X2PA 5IAGA 3L8DA 1UBKS 5CYPA 4CETA 1YBHA 2ZIVB 3T6KA 3DF7A 2YVAA 4I08A 4WZ6A 4EUEA 1CUAA 4BDTA 2BAGA 2NIPA 4BTEA 3HCWA 3L7CA 3F3MA 4V0OA 3SY8A 5A4DA 3VC7A 2HLNA 3HR4A 2V45A 3I8XA 2W4MA 1Z4IA 4S35A 3IJPA 3EA4A 5EP2A 4G1CA 3MQ2A 4KVFA 3VHXB 4AUNA 5IM4F 2E2WA 4LF5B 1KDTA 1RKQA 2WJ6A 4BS9A 5T7BA 4BXOB 1JNYA 1E5TA 3LYAA 4ZOEA 4L4XA 4ARBA 4QPCA 1VYVA 4MI3A 3CH4B 3JARB 5KYWA 2GZSA 2O0LA 1Y3HA 2COKA 3LI2A 3DBLA 5AWFC 5K45A 1H4QA 1NQ5A 1U5CA 4MYRA 4FI3C 4PSVA 2FE4A 2V5UA 4EK9A 1Q5PA 3AEKB 2EF1A 3ME5A 3GGSA 3E5NA 4IGAA 2OXTA 4JNKA 3T3HA 2B2XA 2FOLA 1SU7A 3FVRA 4C1NA 1F60A 4E88A 1NXPA 1A9RA 4ARIA 2CVHA 1CU1A 5LQCA 3GN2A 2NUPB 1M8FA 1T1GA 3HJNA 1E9BA 1TLTA 4P7JA 5F1OA 4D9MA 1KO5A 1TFUA 2A86A 2ZQ5A 4UVGA 5DSZA 2J6BA 2DFPA 2R7MA 1Q7EA 1F14A 3PQ4A 1Y1LA 1YL7A 1YQTA 1CQWA 3C5HA 4MWOA 5H82A 3NHYA 1VJTA 2GF9A 3ANMA 1M83A 2FEPA 3BKXA 3WLLA 4PYIA 3M7IA 3K70B 1V1JA 3G2IA 1I1OA 5K8UA 3BZBA 4JP3A 3UXYA 1W35A 4CIDA 5KNLA 1ZN2A 3HB1A 3SVTA 1H5QA 3C5CA 3OOHA 4M89A 3CUWA 3T41A 3SYRA 1BXRA 2XDQB 3GRCA 5AOBA 3A9WA 3PVZA 3ITKA 5JY6A 3ZXXA 5GM2A 1YZUA 3E9YA 1JUDA 3EYWA 4DW8A 1NG9A 1EUDB 3NATA 2ZYHA 2DVMA 1ZGAA 1EUYA 1LS1A 3W8FA 4NDAA 3A1WA 5C1BA 2QQFA 1L4BA 2VDWA 5KTRA 1GYPA 3L7OA 3O3MB 1UMCB 2YZKA 4RSGA 2G1PA 4EYGA 4LV5B 1II9A 5FL7D 1C3JA 3JQCA 4OO3A 1LDBA 3ZWKA 4F9FA 4CEHB 3RJZA 1NZFA 3OZAA 5I48A 1VSQA 2VJYA 3COSA 4ZCTA 1FYXA 2ES4A 2YWXA 4J03A 4BNIA 5U9CA 3FPBA 3F5DA 1A7KA 4I1IA 1KEKA 2ETVA 1EK5A 3AF4A 4UARA 3BXZA 5AKGA 3ZD8A 3GRVA 1Y3BE 3K31A 1H65A 2Z6VA 2IYQA 3B51X 4RAOA 4BEWA 2BDTA 3AY3A 5IUJC 2HWUA 3EGIA 3NV7A 4CKBA 2HTFA 5K8TA 1VG8A 1FSZA 1JU9A 1ZS9A 1D4ZA 3GY0A 5JAMA 1CZLA 2EP5A 2Q29A 3GJ7A 4NQZA 2MYPA 3N8DA 3R0XA 4XM0A 4A7PA 4DLLA 4IIGA 2ZR8A 1QRUA 1G4UR 2GEDA 5K5EA 5P21A 4BATA 1QH1A 1YHZA 2FEOA 2O50A 3LX5A 4ZOLA 3ZU6A 4E3WA 1WNTA 3RPEA 1IN1A 4JHLA 2GJAA 1T4CB 3IEXA 2BFFB 1WD5A 1KETA 1G63A 2C5LA 4HDCA 1WP4A 4CM8B 1U65A 3D2LA 2AKEA 1CG6A 1JFSA 5BRJA 4H3SA 3NHRA 1KO7A 3AOEC 3B1XA 3TIIA 1HTTA 1YE5A 3NFYA 3BQNB 2I80A 4QUKA 4B4VA 4JEMA 1QUFA 4MUIA 4P5DA 3O2NA 1DU4A 1E2PA 3MD0A 2D0IA 3JQAD 2FPMA 3SBXA 4INOA 3WRXC 1DC4A 3DO8A 3WVNA 2PAAA 3N7TA 1JEDA 1Y7TA 4YO7A 4BX0A 5KTTA 3DO6A 2RDMA 5FA5A 1KORA 1JI3A 1ZW1A 1JP7A 1WMAA 2F48A 3K92A 3JASB 5FPQA 4HD8A 2PZBA 4NHEA 4U4AA 4RK6A 1WXDA 1D2EA 2IYSA 3QA3E 4KNVA 2VRCA 1SEPA 2CLHB 4UBOA 2WU8A 3UCFA 3WDSA 1N1EA 2FSVA 3EBPA 1IUKA 2NGRA 3D59A 5IJZA 3QLVC 3EGEA 2CB0A 2GJ8A 3LHKA 4NU6A 3WDLA 3JALB 3A6GA 4DY6A 3BFKA 4UCXA 5JRZA 4IMJB 2AMVA 2V59A 3D0QA 3F46A 1C3XA 3LO8A 4LE1A 1HOTA 3ILSA 4YT5A 4RWZA 3OPMA 3H5NA 2A67A 4A1OA 2OA0A 3RH0A 2NO9A 2REQA 1FMCA 2FWRA 2H5EA 3GH3A 3Q98A 4JSTA 4K2AA 4RIHA 2I3GA 3FYHA 3D7KA 4Q47A 3A37A 5EIOA 5LYJF 3L05A 2VATA 3KTAB 3QU4A 4KVZA 3PHJA 3AFIA 1U8ZA 1UOOA 3AI7A 4AJKA 1IC6A 3HC7A 4LGCA 4CV1A 1SC9A 3B6ZA 5C8YA 1L1FA 3A4IA 2NT3A 2ZU6A 4OGWA 3TWOA 1FXSA 3GGDA 1KQFA 2EHJA 2B34A 1KYTA 4MHOA 3W8DA 2WMDA 4BNMA 1ZY2A 2E7ZA 5DASA 1QQ6A 1EE1A 1G3RA 1F2UA 3G0HA 2HQRA 2NT4A 2AMLA 5CNIA 3LPLA 1Q3HA 2MOKA 1PG2A 2ZJ2A 5J4KA 4V0SA 1UXIA 4DL9A 3IVRA 4YP0A 3R74A 1YUNA 4QUHA 4ROTA 3CVOA 5U4QA 1AK9A 4TGLA 4YJFB 4U2DA 2YUTA 4LK3A 5EJ7A 4FKMA 4GUAA 3UWDA 1LNQA 3QWFA 2YNMC 2YMLA 4B6JA 4MUHA 1YA8A 4PVDA 4G0WA 4KO8A 4AJ2A 2EFGA 3QVMA 1FDUA 3V8QA 3TRDA 1MUUA 2E37A 1HT0A 2EZ8A 2JNWA 3IV7A 3EK2A 1HYGA 3U7JA 3WYDA 5MFZA 3CX4A 1AQIA 3B6JA 1HO3A 1P61B 1W2WB 4GPEA 4TTQA 3OQNA 3L0IB 3AJRA 1ODKA 5BSMA 3P32A 2AOUA 1SHTX 2RKWA 1T8YA 3FNHA 1EBFA 3ZX4A 4Z0PA 4N1AA 3W06A 1FU7A 1THTA 1K5PA 3I8OA 3EUFA 5E3JA 5J4VA 2CLDX 2OO5C 4DLTA 1YA6A 4JKIA 1RYNA 3TNDA 4OHWA 2B8WA 3R3HA 4D4KA 3FWPA 4HUJA 3VYTB 1Z8NA 2QN6A 1GKIA 1P1BA 1QDEA 2HHAA 3I83A 1YMUA 3ICOA 1J2YA 2BBWA 1JQBA 3T1OA 2ZAIA 2NYUA 2IDKA 1CQJA 1QVWA 1XDZA 2R25B 3ABIA 4KPFC 2VJDA 3AH8A 3ZQJA 3TRIA 4R5MA 5A7GA 2A5JA 4JVOA 4YS6A 2ZIGA 5ER6A 4CXMA 2UYGA 5BOSB 3P9NA 1RRVA 2FKNA 3HR8A 3MS7A 4JVLA 4MVJD 4O6VA 2IEAA 1JBQA 2W37A 2BJHA 2HMTA 2WIBA 3ZVRA 2PJDA 3AJEA 4BECA 1U2DA 2I78A 3TQIA 2BP7A 3UJPA 3HSKA 5H9VA 2FN4A 3AETA 3DTVD 5IAEA 4KEAA 1KOFA 1QIHA 4C9BA 4N12A 3ZHBA 4AP5A 2AD1A 3RC2A 4LGYA 1E18A 2PM8A 3KHSA 3LDHA 5JH7A 4WNYA 4RD3A 3HXKA 2FPWA 5B36A 2PZJA 3RR2A 3HNOA 1M0TA 5D2CA 3W3AD 2VPZA 4EM6A 4K8OA 3LCJA 2PUDA 1EK6A 1ADJA 3DEJA 3S1AA 3QF4B 2CHFA 4BQEA 4EUSA 5LQRA 1UKVY 1A1SA 5FOQA 4NHOA 4WXMA 4K6OA 2QUAA 4AX4A 5M7EA 5EZYB 3IOMA 2AI3A 1PR4A 3L8CA 3DOIA 1I4TD 1U9JA 1U2RA 2PGLA 3I6YA 2ZVPX 3MWKA 3ZGVA 4R3UC 4C4AA 4DNOA 4P34A 1QANA 4IF4A 3E4CA 1YT5A 4IEEA 5HE8A 5EUBA 3UFXA 2IU6A 3HVJA 1AN9A 1B74A 1BYUA 1EFPB 2Q99A 2RC5A 2XUJA 2BE7A 1GPNA 2BUAA 4FCTA 3BE5A 1KOGA 5EMJA 1C1YA 1PFVA 2JRLA 2R5NA 3MWYW 1W7AA 2O8BA 2HU5A 2F43A 2P11A 3OT1A 5F9MA 4S2UA 1YVUA 1LLDA 4CFZA 4RKEA 1JFFA 4R51A 1N3IA 4EENA 4EGCB 2BM9A 1JEOA 3HU1A 2JHFA 4K6FA 4MR8B 2CLSA 1Y5RA 2Y66A 2MSDB 1E7RA 2RHTA 1TE2A 1JN0A 3HBLA 4PZZA 4R2WA 1QJCA 4QJIA 4OLHA 3WGHA 1AMNA 2GM4A 4XKJA 3NIBA 1M5TA 3DOFA 4QE3A 1EK2A 2H7VA 4H7JA 1D1PA 1C81A 2MR6A 2D2FA 1KDRA 1ZJJA 2IXAA 1DGQA 3S2YA 1DTSA 1P2FA 4WK6A 1TXGA 4DWVA 8ABPA 1IZZA 4KCGA 3FMFA 4FFVA 4WXYB 3TUJC 3ZY2A 5BR1A 3WRVA 4RTMA 2P9QA 3QPAA 2XDYA 1Y6ZA 5CP8A 2YXLA 1D2MA 5B7GA 1Q0ZA 3HNPA 4H2DA 1DQPA 1XZMA 2ZVQX 3MUFA 1PL0A 1XKTA 2UYCA 1EFCA 1QIKA 4M0LA 4D74A 3ADPA 4GO1A 3SZLA 5JBIA 1BVRA 3HFGA 3SZOA 2QGZA 4UU1A 1VSVA 3ZDQA 3NT4A 5BOSA 2IYYA 5CNMA 3AR8A 4RH0A 4YNBA 2WYVA 1JSCA 3CVUA 2COUA 3FE2A 4ZTBA 5JS1A 3G2PA 2VPWA 3P19A 2JFGA 4N7BA 4F38A 5I9LA 4KZPA 4NWIA 1JW9B 3FPKA 3S2GA 3Q9NA 4RTOA 3BXFA 2P2GA 4DG5A 5BSUA 3DOCA 3L4BA 3C48A 2GLXA 2NACA 1N77A 4QUDA 4GQBA 5LMUB 1RKVA 3EXEB 3ENVA 4QGAA 3ZS9A 3RUFA 5AVSA 1W5SA 2ZJ1A 3OCCA 3DZIA 3DCIA 3TQHA 3HA2A 3MS2A 1GN8A 1ZZEA 1CEQA 5CT8A 3AUTA 3OMXA 5TGDA 1R4MB 3U4HA 4C29A 4QLBA 1H3EA 1Y98A 5EJ5A 2N46A 2Z95A 1J8YF 1ODLA 3FI9A 4Z6KA 1DIRA 3QE4A 1ZM2A 2OUIA 3ONEA 1NVGA 1XTQA 1HYEA 2WV9A 2EGUA 4FGUA 2OP1A 4XX0A 5J2TA 2X3YA 3KJEA 4M0MA 5TQVA 1HE3A 2FW7A 3KKEA 1UJBA 1HRKA 2WABA 2HA5A 3RQIA 1J0AA 1T0JB 2YVKA 4G86A 4OY3A 5I7RA 4UDXX 1ZRSA 2H4JA 1QQTA 4HSEA 2D3TA 1MZPA 1UBJS 3D6MA 3EYAA 2YRXA 2PWAA 5ESXA 5JVDB 4JFAA 4DIKA 1SCUB 4Z4EA 2ZETA 2H4ZA 5JCOA 2AOTA 5G2OA 4UVEA 4G9BA 2WTBA 1JXOA 4N6OA 1S2IA 2WAOA 2Y0EA 4UUAA 4FMPA 2ORIA 1UJ2A 2J9FA 1ZJ5A 2QRJA 3L02A 2GYVA 5DM1A 3VKVA 2XAUA 1E89A 2OGWA 3NS7A 3PKZA 3NBKA 1U9CA 2M6RA 3DC2A 3PFCA 4G1UC 4MWDA 3OE7A 4KH1A 5DCUA 1K89A 2PVCA 3F5FA 5HJ5A 1PJSA 2NM0A 1KDPA 3AKCA 4DLWA 4NBWA 3PITA 4GICA 3EQ8A 4F04A 5KTPA 4UCFA 3KOWA 2WU1A 4KO1S 5IT4A 4ZWNA 3ER9A 1PV4A 1NXSA 2Y1FA 3KKQA 3C1UA 5F2NA 1IG3A 4ADSG 4LQLA 1SIBE 4CLOA 3DDNA 1I9GA 3NBAA 4YAUA 2DP4E 2XTMA 1MA0A 3EF1A 3VGJA 2QKYA 2Q0QA 1X1EA 1LFDB 3FKSA 4FN4A 1U4NA 1W5FA 1J90A 5LZ5A 5JC8A 4D8YA 3IIJA 1A8UA 1ZNZA 2CCJA 3EY4A 1NVVR 3RSZA 1X7GA 3BJZA 3IIMA 3ZHRA 4C0XA 4BZZA 2HXSA 6GPBA 1UP6A 1JTEA 3EVCA 4RCZA 2YJZA 3OETA 4R2IA 4ZOLB 3O1IC 2JLBA 3MTGA 4TYYA 2LNDA 5KZMB 3PC2A 1LU9A 3ESCA 3VR2D 4K9RA 4QULA 3HU5A 4KDCA 1ZH2A 3PG5A 2PFSA 5E0KB 4HXFB 3AGPA 4Q9DA 1E62A 3RC1A 4BBAA 3PEYA 2BIFA 1EG7A 3EDYA 1ZRHA 5JSKA 1WOMA 4EAAA 3W5DA 4MGYR 2BEVB 1FP4A 1VM6A 5IVHA 2EKLA 3N0RA 2AJCA 2NYAA 3O8OB 1N8NA 2VYFA 1E9FA 1UQRA 2VA8A 3TX2A 1PW5A 4LNHA 3ZGYA 5KWVA 2I8LA 4J0GA 1TF5A 3V3KA 1H1LB 1ESCA 3TR6A 3IC5A 1OLUB 1SOVA 4KDRA 4X71A 2V6IA 5FLYA 3UCEA 5K4GA 3L8FA 3IR5A 4ZT2A 2P9FA 1JLKA 1NXWA 2LIVA 4DV2B 2YFHA 2AC4A 3M9XA 5BWCA 5DM70 1EVEA 2W6JD 2Q7DA 1PR9A 3FNGA 1IUNA 3L04A 4BCCA 4ZZIA 1YI1A 1DT5A 1MB4A 1LNSA 1T6XA 3KZKA 2ZUVA 3PL5A 4KKXB 4M7RA 1L5WA 2PR2A 3QFCA 5TEVA 1GTVA 1AKEA 2GK3A 2PZFA 3MCAA 3CVVA 3LBNA 4R8RA 3U09A 2GT1A 1JR3D 1RYMA 1QG2A 5AOAA 3OPXA 3TBHA 4CDNA 1BW9B 3AIMA 1II0A 3OI7A 4UVIA 5G40A 4EG7A 1TW3A 4Z1OA 3MPOA 3H65A 2VXYA 3NHLA 2ZZNA 4FFBB 2HMVA 3SK0A 1NYQA 4L51A 4GRDA 3T0IA 3UT5A 3K70C 5JJKA 1XD9A 3OZFA 3R4CA 1RJEA 1Z0FA 4JA2A 4E5PA 3CWCA 4OUDB 3TTWA 4P4UA 4IDBA 3H11B 2IS1A 3K94A 4DC1A 1BW9A 3WLTA 2H07A 1SQSA 1TA9A 2ZCVA 4BB9A 5EE0A 2RGDA 1WHSA 2X2EA 1J39A 2VRWA 4K9MA 4Y2GA 4AW9A 1SRQA 3Q6NA 4YRLA 3CH6A 5EP4A 3RRNA 1YZTA 1C80A 4CMCA 1U90A 5BPHA 3ZCXA 3BE4A 4HTFB 2LBPA 4NZPA 4LQCA 1PNOA 4RHYA 3ZWDA 4V0ME 1SQ5A 2BFDB 3TAHA 3ZV6A 4JROA 4MA4A 1W88A 1XRSB 1N9GB 1OBFO 3F5QA 1CQIA 3TSWA 4GZLA 2OAGA 2QPLA 2W2NA 1GNSA 1V5GA 2ZRQA 3HI4A 5BQXA 5IZCA 3FN4A 2DHCA 3C45A 1DXQA 3NM4A 4IHJB 4V0MA 1J7JA 4CM7A 2FJPA 3M2PA 2W6MA 3IA7A 4MW2A 3OPYB 4GYYA 3E7DA 4KKVA 2A4MA 3CGWA 1N9GA 4WKNA 4QPZA 4BNUA 3L6RA 3KKPA 3AG6A 3W8NA 1QH9A 3ZTTA 4CCAA 5KTMA 5KU7A 3U44B 3GELA 4AL4A 4CUZA 1MTZA 3EQZA 2I29A 4AJEA 1TQ4A 1XKQA 3BHJA 3EGXA 4XGRA 4EKDA 3PDJA 5JSHA 3DGEC 3SLKA 1FFWA 5KB3A 4J3FA 3WGJA 4DC9A 1G16A 5JV5A 3S8YA 1ORRA 1IBSA 2HFJA 2WYIA 2XTZA 4G9GA 1XLTA 2ERYA 3KPYA 4K6KA 1M2VB 2PX8A 5EHZA 4C7OA 1FVXA 4L27A 1D0SA 1LK0A 1K98A 3A06A 3INNA 3GJ0A 3KB8A 2HNBA 3T5GA 1E3QA 1EVZA 2FPPB 5DI3A 2JIZD 2ZIXB 3A0RB 3PD0A 5FWDA 4ND6A 4BLOA 4H7DA 1C9JA 1E7SA 2Q07A 4RK1A 3ZE9A 5IPFA 3A1TA 4EHJA 1W34A 3REOA 3VHLB 3X1KA 1XPRA 3AG5A 2QBYA 3IQHX 3D7NA 2V7EA 5TMPA 2PS0A 3N2NA 4EQ6B 1EU1A 1RHJA 3M4ZA 2ZB8A 4BP9A 2FWIA 3OEYA 2WM8A 1FTSA 2WOJA 1YA4A 2VH5R 4C3VA 3IT1A 4WBXC 2NPFA 1OZGA 3HWRA 3M8KA 4BNDB 2NP7A 1K8ZB 5KYKA 5E2BA 3S4YA 1RKBA 1QAMA 2P3QA 1KJ8A 1TZBA 2JLRA 4G5XA 4LBYA 3ZS8A 2X3UA 1YASA 5KTSA 3SX4A 1X7ZB 4BAZA 3BN3A 2C03A 2X5NA 4D56A 4EQZA 5KTNA 1RR6A 1QO7A 3QVOA 1ICIA 1BVUA 3WYAA 2HHHB 4U6QA 3T61A 2JD1A 2JRCA 2H5JA 3UT0A 2ZCJA 1Q3KA 2QTFA 3MT8A 4FMCF 4RO0A 3IT0A 3T5AA 2J67A 3PXGA 5E9QA 4BRSA 1P1CA 1UT8A 1FMFA 4P1ZA 4MB6A 4C0LA 3OM0A 3L7NA 2P9EA 1H6BA 4ZVVA 3N3AC 4RFVA 3H1TA 2PSFA 3FVVA 1VLLA 4YUWA 3RS2A 2V8BA 4OQMA 3DNPA 3E9MA 3OF5A 4S1OA 2GK6A 5LM3A 1OPRA 4Q4CA 4F92B 3ODPA 4E5YA 1WDLA 3F90A 4NONA 3TIGA 2I6FA 1UZNA 2VDRB 4DN6A 1SXJE 4JGGA 4MA0A 3TDNA 1K8RA 2BFCB 2HRDA 3PFHA 3ZHTA 4ENVA 2X7XA 5L7WA 3KS9A 2QZPA 2ZB3A 1IEVA 2LE0A 4RVCA 5AW5A 3T1NA 5KOJB 2CZQA 3UAZA 2OP0A 4C6TA 4X1KA 3RS5A 3NR2A 4PNPA 1U04A 1F8FA 1OLOA 4JCCA 3GQBB 5FQNA 1XQXA 4EYOA 5AIBA 3ZGZA 2QY6A 3QP9A 1YQWA 1Z7GA 3AZPA 4B4OA 1XVUA 4IW3B 3PQ7A 1AZTA 3HSSA 1T5HX 1JR4A 3K1AA 4A0SA 1TIBA 3JWEA 4UATA 1T8UA 4H08A 1FFDA 1NOIA 5EQDA 2V7XA 5COBA 3FOEC 3WL6A 3AM5A 3OF2A 4CM5A 4D4IA 1UBGA 5AJVB 1SOWA 4DMGA 1P2SA 3ZW7A 2DTEA 2VHXA 4BNNA 3GEEA 4HDNB 4XCQA 1PR6A 3CF4G 1P80A 3KT3A 4ASUD 5EERA 1TMKA 3AB3A 2QT1A 3TKLA 3ZNPA 4IJ6A 3GLFB 3OLYA 2AT1A 3FHJA 2GPAA 4ARVA 3TCNA 1GPMA 1M1NA 1RYEA 2JLCA 6Q21A 4TKLA 3G79A 4IOKA 4TUYA 4QBIA 1AKYA 3I4CA 3CM0A 2PX4A 3FCXA 1WVMA 2Q3LA 4PQRA 3JV7A 4GP7A 1AGPA 3UMSA 1N0IA 4JUIA 2VPQA 1NF8A 3CUEF 1OAAA 5LLTA 1QRDA 4GMFA 1PJCA 2Y3IA 2EYQA 1VHWA 1H3FA 1AIPA 5MN5A 1WNFA 4XWGA 1LRLA 3HA5A 3LUDA 3TOVA 2AFHA 3R7WB 1KAEA 4MRMA 5D1HA 2XT9A 2BC9A 3T7SA 2Q4EA 2PTHA 5DULA 3OIWA 4W5HA 2BEKA 2A9KA 1KI1A 1VPVA 5LP6C 1PD1A 1MRNA 3RK0A 5FBRB 1FC0A 1X80B 2JJ2A 3PIDA 4NJMA 4PEVA 4RESA 3JWGA 3A3NA 3AOGA 3UH1A 3WAKA 4D79A 4V0LA 4I3GA 4JELA 3A9VA 3BCRA 1ADGA 4K9OA 1HDXA 2Y2VA 2Q5EA 3ANTA 4O59O 4QTZA 1TYDE 2Q2OA 3IMGA 4XR4A 4ONEA 5IYZB 1R6DA 1L4FA 2WTMA 1DOHA 2QSJA 2BT4A 2TS1A 3AHEA 3LCRA 5LN1A 3NXKA 3TOSA 1NTRA 2B4KA 4MK4A 4XRGA 2IKSA 1LBEA 3FAZA 1RQNA 1SKQA 4XH9B 5AVWA 1XXHA 1NVEA 3JYPA 2OCXA 3NHZA 1GTJ1 1AOXA 3EZ2A 4PX9A 5BYKA 1UZLA 4I9FA 4AMZA 5ERYA 4Y9RA 3RQSA 3LT0A 3ZNOA 3GPLA 2PS9A 2FLKA 2WAMA 1QF9A 4CM9D 1F38A 1TC1A 3JYHA 5CU7A 4B2YA 2ODPA 3IBFA 1S4QA 4U7FA 5ALKA 4DBLE 4CHGA 1HNNA 3N9IA 3EW9A 1GPWB 4PHFA 2XCOA 5LQNA 2JFVA 5K05A 2ZWMA 2BSAA 3PWZA 4OH1A 5LZ9A 1U0HC 3QVLA 1PAUA 5D86A 1VPWA 3CUKA 1M2OB 3R3UA 3IHWA 4ALJA 4YEDA 4EO7A 3C24A 4G3XA 4GBGA 1VYTA 4UNQA 4LC1A 3RUCA 4F84A 2C7RA 3TQSA 4FXPA 3I9OA 2Q3MA 1C0IA 5G1NA 5GTDA 2H11A 3GJ8A 3HJGA 1EUCA 2P4SA 4R1SA 5DCYA 4LYHA 2NXEA 4M55A 2VXOA 7ABPA 1C1DA 3O2JA 4MRPA 5KSOA 3CONA 1JDBC 2A9RA 2NWQA 2F8MA 5LA6A 2BZ1A 1HRDA 6AT1A 2SKCA 1BXGA 1RP1A 5IJ0A 2QRVA 3ZE2B 5MN6A 1KI9A 2HY7A 5DTQA 2BSQA 3LOUA 1MB9A 3R7BA 3SU8A 3TM5A 5GQSA 5BXQC 2O8BB 1X0VA 4ZPJA 2IYXA 2CMGA 2WDPA 3DE7X 3PNSA 3VNRA 1VIDA 2H3EA 2WTEA 4BNZA 5JO0A 2N47A 3WMFA 4X3CA 1ZKDA 4IO1A 4TSFA 4KE8A 4K6GA 4B85A 2DBRA 2I2BA 4EMBA 3NB0A 5BN3B 1GZ5A 1K0UA 1J2EA </