3RJ9A

Structure of alcohol dehydrogenase from drosophila lebanonesis t114v mutant complexed with nad+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNVTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol dehydrogenase
publication title An intact eight-membered water chain in drosophilid alcohol dehydrogenases is essential for optimal enzyme activity.
pubmed doi rcsb
source organism Scaptodrosophila lebanonensis
molecule tags Oxidoreductase
total genus 96
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rj9A00
2CUKA 5CEJA 1IPFA 2IEDA 4B3IA 1VE9A 3GGGA 4G81A 5DN9A 1UXKA 4J1TA 1LLDA 4BNUA 1AN9A 3UFXA 4J0FA 1QV7A 3MJ4A 3GFGA 4I5EA 4J49A 3RBVA 4PFJA 1E5QA 3ASUA 4Z6KA 1N1EA 2OUIA 1JKFA 4L4SA 1GQYA 1WNTA 1XU9A 3IL2A 1PJSA 3KYCB 3RUHA 5BNIA 4IDBA 1P33A 4JLWA 3DZFA 5DDIP 4E5MA 4P22A 4IMRA 3WFIA 2AQHA 1R4MB 3A06A 3GNSA 3PDUA 4NBUA 4YJHA 2VRCD 3I23A 4JGBA 5ITWA 3NTQA 3ZWPA 2VWPA 2I9PA 3AWDA 2PNFA 1P0FA 4WASA 1UUFA 3KM0A 4L75A 3AI3A 4MP6A 4XR9A 3PHLA 1DFIA 3ROQA 2ZK7A 4YT5A 1ULUA 2VWQA 1Z82A 3E1KA 1OI7A 4ID9A 1P1JA 4BB6A 3ZH2A 2HDHA 1YOVB 2ZIZA 3KYBA 2ZTVA 4GLLA 3C7AA 3RBXA 4CM8A 4EITA 5L51A 1DHRA 1HDOA 4NK5A 4RQUA 5GY7A 4UVIA 5CG2A 1ZK2A 2VOJA 1HZZA 2YHIB 3HB4X 3KRTA 2I66A 4O6VA 5F3RA 1PS9A 4ILKA 2E48A 2JL1A 3PP8A 5EPOA 3SJUA 3VZPA 2B5WA 3I9LA 5IN4A 4BNYA 4RVHA 4Y6PA 1I3NA 4LVUA 4GL4A 4L0QA 2IXBA 3EAGA 3K96A 3DL2A 1KVQA 4NG5A 4QFDA 4CM7A 1JWBB 1NVTA 3DZBA 1HETA 3C1OA 1NX6A 3KLMX 4E3ZA 1EVZA 3HADA 4HFJA 5DOVA 3FHLA 4H7PA 3GQVA 5FWNA 5AQ1A 2VN8A 3G17A 4CJXA 3H5AA 1FDWA 2XXBA 2I76A 3WTCA 3H9GA 4D0RA 2HRBA 4BGIA 4NBWA 3RD5A 3JQEA 4IJKA 5I7SA 2GERA 4F6CA 4N18A 3ETDA 4YT4A 1B8UA 3QVTA 2CVOA 3LC1O 1T2DA 2HQ1A 3E48A 5THQA 4E5PA 3H4VA 4NBRA 4E4YA 4EBFA 4CLXA 1OMOA 1O5IA 1ZH8A 5JY1A 4CMAA 2HLPA 1BWSA 3IP3A 4F45A 2WMDA 4M86A 1BTOA 4IUYA 1OC2A 2Q3EA 4AJ4A 1KVUA 2TMDA 4CPDA 2WD7A 1H2BA 2UV8A 4LISA 1ZK0A 4OAQA 2A35A 1C0KA 1MUUA 1LBEA 4U6QA 1O89A 1OZAA 5TGDA 3ZNNA 1ZUD1 1HYHA 2DBZA 4X54A 3QRWA 1BVRA 1NAIA 1Q7CA 3E9QA 4E2XA 2R00C 1EE9A 4FFRA 1PL7A 3DAFA 3RU7A 1EUDA 3NGLA 4WLOA 3JD1A 3OA2A 2IODA 3HDYA 5JMWA 2FZWA 1V9LA 5JMPA 2E37A 3LT0A 4GGOA 3Q0EA 1F12A 2NWQA 4BNIA 1IY8A 1X7DA 3JQAD 1HSOA 4NBVA 1R16A 3EVTA 4WCFC 3ZI0A 1XU7A 1WPQA 3MTJA 2W90A 1FF9A 4YTEA 3S2IA 4GX1A 3EHEA 4WCFB 5FI5A 1A71A 1PEDA 3S55A 3D7LA 5FEUA 3C1AA 3I6IA 4Z9XA 1LQUA 1RM0A 2PV7A 2Q4EA 3QVSA 3Q2KA 3EC7A 4P4LA 4RZIA 5GZ6A 3UAGA 4H15A 5EINA 4BNWA 2IZZA 1KBZA 3WGYA 1DFGA 4B79A 4CM4A 3TF5A 4J9VA 1IZ9A 3GNQA 2G17A 3JQAA 2Q1SA 1UP6A 1CQJA 3H65A 4UUOA 4RVSA 2NTVA 4ZGWA 1F14A 1MG5A 2YY7A 2JKVA 3AOGA 3JD3A 2RCYA 1U3VA 1QMGA 1GEEA 4FS3A 3H8VA 3LF2A 3WBFA 1PU2A 5TS3A 3GVIA 3PLRA 1V3VA 3DZHA 4E5KA 4YA6A 1HDRA 1P31A 4WGGA 5HWSA 1LEHA 1NWHA 1P77A 4ND2A 1NQTA 1NFRA 3Q3CA 5BNFA 5DZSA 1PZFA 1JQBA 1LDMA 4EJ6A 3KETA 2GN8A 3QP9A 5IAAA 4IGFA 4WLNA 3DZKA 1T25A 1P9LA 3Q2IA 5EESA 4ALKA 1M6WA 3G49A 5K6AA 1K6JA 4ITUA 3BMNB 3KXDA 5HRUA 1ONNA 4C7JA 3ZZNA 1EVJA 2POQX 1Z7BA 2W8ZA 2VOEA 2JCYA 3GEGA 3WOHA 1HYEA 4ROSA 4TZTA 4XB2A 4YAKA 1VJ1A 1GYRA 3E5RA 3HDQA 3KSUA 5JDCA 1E3WB 3GOHA 3OICA 5DP1A 2IZ0A 1HRDA 1U7HA 4PLVA 4E30A 3ZDFA 4TVBA 3QHAA 5DCWA 2RBEA 3WYEA 4J4BA 3NKLA 3MEQA 1KVRA 2JHFA 3BXXA 1PR9A 3QJ5A 4MVJD 3DOOA 3GDGA 2PKQP 4TRRA 4UEKA 5JC8A 1VL6A 3FD8A 3H9JA 2VZ8A 3I83A 2QW8A 3BHIA 4IINA 3DQPA 3GVHA 4J7UA 2CDAA 3F46A 4M1QA 1V3TA 4KWHA 3KEQA 3RFXA 2YV2A 1FDVA 1O95A 1LU9A 5AXBA 1VSUA 1HDZA 2P68A 4A7PA 2J3IA 1WMBA 2NQTA 2EG9A 2AG8A 3JSAA 3DTYA 4MVJA 3DHYA 3GMSA 3V2GA 2D4AA 5G0UA 3N7UA 4ZQFA 1YL7A 1YVEI 4XIYA 2P4HX 1R0SA 3I9MA 4RVGA 1E7SA 4MKRA 4NNJA 1MP0A 1SNYA 1UJMA 3HG7A 1O0SA 4MVJF 5EIOA 1IHXA 3BHMA 5C7OO 2AQIA 4BNJA 3ZWMA 1BG6A 4RJTA 1T1SA 5I7FA 3QVOA 4PG7A 4UUPA 4TWRA 4IDEA 1RKXA 2BI7A 1GADO 1XCBA 3RUCA 1ONOA 1Y9EA 1Q0LA 3TL3A 4BNTA 1EK6A 4J43A 4ZQHA 3JTMA 3S8MA 3FN4A 1MX3A 3VTFA 4XKJA 3JD4A 4P4GA 3GLQA 3MWDB 4AG3A 1KEUA 1ZKMA 3OJ0A 2DUUA 4RLHA 2X58A 4UVDA 3VDQA 4DYDA 1DC5A 5CPBA 3CIFA 2X7HA 3LT4A 4OSOA 1PZGA 3SBOA 3MJSA 4R16A 3VZSA 4IPTA 5BSEA 3UICA 2PD3A 1GQ2A 3BA1A 3KYCA 1M2WA 1E6UA 5U1PA 4JP3A 1NQ5A 1SZJG 4ZRMA 4DWVA 3U09A 2F00A 1DJNA 1LSSA 3SC4A 1HE5A 3H2ZA 1IL0A 3IUSA 4TROA 1EE2A 1JKIA 4Y9DA 1R4MA 2ZATA 3O8QB 4YJHB 5T6BA 5TT0A 4WUVA 4AJLA 5JO0A 4KQXA 2GUGA 2P9CA 2VYVD 3GN2A 3PQDA 4I5GA 3RCBA 3KTDA 3DB2A 4FJ2A 1V35A 4M87A 4DPKA 4B4VA 3Q6IA 4PLZA 5T67A 3F9IA 3S2EA 3STHA 1PJ3A 1BRMA 2FN7A 3NEPX 5A1TA 3TPCA 1YOVA 1NFFA 3GMDA 1I3LA 5FI3A 3ENNA 2VHVA 3UH1A 1C0IA 3FI9A 5HS6A 1FXSA 3N74A 3GK3A 2ZTUA 1GUYA 4R5HA 4FIZA 4BO1A 2VYVA 1HXHA 1Y8QB 3JQ8B 3SX2A 2YHIA 3PHJA 2V6GA 1Y9AA 1QLJA 2DPHA 3DZGA 3PJEA 4PG5A 2BH9A 1BSVA 4NK4A 4ZRNA 2AE2A 3WIDA 1UXHA 2C2YA 2PZMA 3UF0A 4E12A 2FSSA 3FNGA 3RROA 4IS2A 1ADFA 1YB4A 1U2GA 3ZCXA 1ENYA 1E3JA 1FMCA 1Q7GA 1GFSA 1HKUA 1R0LA 4D3SA 5JYEA 1XA0A 3TZHA 1D4FA 2VYND 1VKNA 4N54A 3NT4A 3GT0A 3OETA 2WSBA 2NU9A 1HDYA 3GVPA 3G3EA 1Q7BA 2WE7A 2IEBA 1RM5A 2C0CA 2OBYA 3RJ9A 4D44A 5JDIC 1JWAB 5JAMA 4CV2A 4R1TA 2JFFA 3CKYA 5F1KA 2HJRA 3DHEA 2VHZA 5B12A 1XDWA 1DIBA 3GEDA 3ONFA 1YBAA 2DPGA 4CM3A 4N5NA 2V6MA 2VYNA 2X0JA 5KJ6A 2BGMA 3LZ6A 4K26A 3ZV4A 4AJNA 2ZJ0A 4RVFA 2CY0A 2DC1A 4RPGA 1UR5A 1GY8A 4CMHA 4WLEA 5JW6A 2PK3A 1I24A 1GUZA 1K0UA 4Q3CA 3WIEA 2I65A 4D79A 5TJ9A 1YXMA 2NVUB 2RH4A 4A73A 4NHEA 1RYDA 5G0TA 3ZWVA 5KTKA 1YQDA 1HE4A 3NUGA 2OOSA 3VHRA 2PD4A 2ZB3A 3WX0A 4EYEA 3QLJA 2GPTA 4TZKA 5A5EA 3B70A 1ISJA 3JCZA 2ILTA 5GMOA 2Y0DA 3MOGA 3WLFA 1DRUA 3L07A 3B1JA 1GV1A 1B2LA 5B4VA 1KEWA 3V2UA 2Y0CA 3CZRA 4PN3A 4DGSA 4OXKA 4KDEA 1JDJA 4A03A 1Q0HA 3GG2A 4DBVO 4RVUA 1G1AA 3BMOA 3GHYA 5ENDA 3WNVA 2R00A 3QW2A 1F8GA 3WWYA 3CPSA 2JFGA 1B26A 3ANNA 4PG4A 4NBTA 3MOIA 5JCXA 2JD0A 1GZ3A 1UZLA 3NT2A 1ZFNA 1NQAO 3GZNB 1C3VA 2YUTA 1GCOA 1HSZA 1QYXA 1J0XO 4TMFA 2VHXA 4WCFA 4BNGA 3B6ZA 4JJIA 3I1JA 2DFDA 1UAYA 2O3JA 4MP8A 1A4UA 4HXYA 4EW6A 4RV9A 3MJEA 3CXRA 1XLTA 3WGGA 5AXCA 1LI4A 4KZPA 1ZVMA 4XEHA 3BMCB 3OBBA 4E33A 4WJZA 3RFVA 3L6OO 3SJ7A 4OIMA 2B5VA 2UUOA 4FFNA 4RL6A 2X1HA 4WNCA 2Z5LA 4BGEA 1ZJZA 4HV4A 5EERA 1HEUA 3O4RA 3GUCA 2V6FA 3VZRA 4ALMA 1DEHA 5T64A 2Q1UA 2PFGA 2HUNA 3H9UA 3RI3A 2CMDA 3ANLA 4DIOA 3KVOA 1Y6JA 4R41A 2CNBA 4BKQA 4FBGA 2JHGA 2OXIA 1LQTA 2IYPA 3NDJA 3NJ8A 4FN4A 3AJRA 4OGWA 4GX5A 1NASA 3F4BA 3G1UA 5FFFA 4J7XA 2YV1A 1P0CA 2QRLA 4LW8A 1G0NA 3D0OA 4CUJA 4YR9A 1ZSNA 3DC2A 4Q3EA 4YB8A 1Z6ZA 1PQWA 3Q9UA 4GSKA 3R3SA 5T5QA 5IXSA 4UVHA 2J8ZA 3K30A 3ZWNA 4BKRA 2VUTA 1QV6A 4BV9A 3PDJA 3WBBA 3H9QA 1EVYA 4WCDA 4D42A 3DFZA 1I2ZA 1JA9A 3W6UA 2CDBA 1SB9A 3EW7A 3IUPA 1ZO8A 2VNSA 1E3WA 4TRJA 3RQSA 4OKNA 3WWZA 1T26A 2EW8A 3PRJA 3BTVA 3U4CA 3WICA 4N5MA 3JYOA 4FR5A 4PLHA 2NVWA 3ZNQA 3VPGA 2F1KA 3G0OA 1NPYA 4TRMA 4EDFA 1JLLA 4PZEA 1X0VA 3WYBA 2VHYA 1T2CA 4U0KA 3GAZA 2GO1A 4KUHA 2A94A 1HE3A 9LDBA 4XIJA 2GRAA 4J3FA 4RO0A 1CETA 3U9LA 3KHUA 2AEJA 2B0JA 3L0DA 1IPEA 2UYYA 4BO4A 1NHWA 1LSJA 2EIHA 2EKQA 3IP1A 2G1UA 1CEQA 2A4KA 3O9ZA 3CMCO 3ZV3A 5L4LA 1VSVA 3D3EA 2W2LD 3ZU5A 4W6ZA 2Y1CA 1SEPA 4OL9A 3ADOA 3RUEA 1ADGA 1D1TA 2ZB8A 2W2KB 2H6EA 4MKXA 2ZB7A 3WQRA 2Z1MA 3RC2A 2RIRA 3RUIA 2E82A 4Y98A 1U5AA 5MDHA 1X1EA 1F17A 4QXMA 3HNPA 4XQEA 1Z75A 3M1LA 1L7EA 2DLDA 3EY4A 4HX5A 4ND4A 3EDMA 2BKAA 1Z45A 4NMHA 5A4DA 4CLOA 4I5FA 4DPMA 1ZCJA 2C59A 3OF2A 3UCEA 2NV6A 4EUHA 4PLPA 3ZV5A 1H94A 4E0BA 4TQGA 1U4SA 5ILOA 2J3HA 1GYQA 4ZJUA 4PVDA 3R3JA 4Q3AA 3PYLA 3ABIA 4U0JA 3VPXA 1WMAA 1MXFA 1E3LA 2HU2A 2CVQA 3PI7A 3PVZA 1B3RA 4K1LA 4W82A 2P2SA 3VAZA 3KBOA 3LYLA 2HK7A 3ZN2A 2I3AA 3NT5A 3IAHA 4YJFB 3W4KA 1ISFA 1XKQA 3NTOA 3AI1A 1E1LA 4B3JA 3LT2A 5C37A 2C29D 3GNTA 4YYZA 1P1HA 2Y66A 3L9XA 4QUKA 2DBQA 3VH2A 5A9RA 1NR7A 1GYPA 3CH6A 4BUCA 3O8QA 4YBZA 3C8MA 2WDZA 1S7CA 1H2HA 3UCXA 4AJPA 2HMTA 3I52A 5F21A 1XWFA 2PR2A 2HKIA 3WDSA 1RPNA 3MJVA 3NYWA 4OQYA 4IXWA 2ZQYA 3ZWXA 5L7TA 1NXQA 3CINA 2Y67A 2D2IA 3VKVA 3FNFA 1P45A 5IDWA 2BFPA 4OOEA 2ZTMA 5DT9A 5THKA 4TRNA 1DLJA 1B14A 1H5QA 1YBMA 4MIYA 4BNHA 5I9NA 1SC6A 4XR4A 5C5IA 3VPSA 3LDHA 1MXHA 4J1SA 3ZNPA 2WYWA 5DOZA 3K5PA 4WK6A 1P1IA 3EVNA 4TKMA 4YQZA 4CLDA 1VI2A 4E2YA 1LLQA 4ZD6A 2X22A 1CDOA 3CZMA 5C7IO 2EGHA 3ICPA 4J9UE 1Y8QA 3JQ8A 1Z73A 3DHNA 3AUUA 1H9AA 4RF2A 5TJHA 5I9MA 3TZCA 2NADA 1YQGA 2PH5A 3HN2A 2FRDA 2X6TA 3B1KA 4P38A 5TF4A 4CV1A 2WM3A 1LDBA 1V8BA 4WE3A 2O7QA 5B4TA 4BB5A 1UDAA 2X86A 2XPCA 3FR8A 1J6UA 1LTHR 4J4HA 1FDTA 2YFQA 1T1RA 3JQCA 3KUXA 2JD2A 4G65A 2JCXA 4H3VA 2DTXA 1IB6A 3C7CB 4ZU3A 3JQGB 1TT5A 4E2WA 1YWGO 1EBUA 4NFYA 4YAGA 3HDHA 4IS3A 5LC1A 3GEMA 5A05A 1OOEA 1CRWG 2BELA 1H6BA 2VTDA 2Z1NA 4PRKA 1LDYA 4DQUA 1S6YA 3EK2A 5JDIA 3UVEA 4IIVA 3FBGA 3GG9A 4IQ0A 3DBVO 4BQPA 1HDXA 2A92A 3CUKA 5KVCA 3IJPA 3CSDA 5H83A 4GGPA 4DYVA 4OQZA 1P1FA 2ZQZA 1EMDA 3F6YA 1SO8A 1Y1PA 4U6SA 1SPXA 5A02A 1Y8RA 3AK4A 1EQUA 3ZWYA 1NM5A 3MWEB 4YPOA 3PJGA 3KZVA 2EXXA 3WSVA 2JAPA 3RVDA 1ZK4A 2NVUA 1NPDA 5G2OA 3RC9A 2I5PO 2GLXA 4FFPA 4DREA 3RUDA 1R12A 1E7WA 4W7IA 5U9CA 3U5TA 2DT5A 4RF3A 2BFOA 4NFHA 4DQVA 3GVCA 2W98A 2BHLA 2LDBA 4L74A 4TVOA 3UKOA 4BNXA 4Y6SA 1E3SA 4Q3NA 4BO0A 2VNAA 1XR3A 3M2TA 3K6JA 4QFCA 4LSMA 3AOEC 3E5MA 5DCUA 3GDFA 4BHTA 1N7GA 4N7RA 4GVXA 5HBRA 3K92A 4WKGA 4BKUA 5TRTA 1DDOA 4UEOA 1B8VA 3QWBA 3BMOB 3DAPA 3I5MA 3O38A 4M89A 4XGIA 4DPLA 2FR8A 3KLPX 3FF4A 1I10A 2Y99A 5BT9A 3ENKA 2VCYA 2EGGA 1P1RA 1HWYA 2DTEA 5J23A 1I32A 1BW9A 3GZNA 1U1IA 3PTZA 3UUWA 4RLSA 3ZWOA 1NWCA 1ADBA 3GRKA 2GF2A 3D4OA 2FHSA 1B16A 4CQLA 1UH5A 5COQA 1E5LA 5KNLA 4FDAA 3WGQA 9LDTA 5CAEA 4B8WA 4ALJA 4UUNA 3FSRA 4GKBA 4BO5A 5KKCA 4PLYA 1E1NA 1Z74A 3GUYA 5G0VA 1B7GO 1N8KA 3TDKA 1P1KA 1F0YA 2O7SA 3BHJA 5EQDA 3BMCA 4XCVA 2QRKA 2PZLA 2FWMX 1GZ4A 2AG5A 2B4RO 4LVCA 3OIDA 2GSDA 5A3VA 2EWMA 4BMSA 3BZUA 1YJQA 1R37A 3TRIA 3ZWAA 2NU7A 3TZQA 1LC0A 3E18A 4NPCA 1TEHA 2PGJA 3PLNA 1H9BA 2LDXA 1HF3A 2AW5A 4IBOA 4XQ9A 3TQHA 5ITVA 5IF3A 1NQOA 1DIRA 1VJ0A 3NAQA 4BKOA 5CDUA 1BHSA 1XYGA 2V6BA 2FP4A 1K89A 3QVWA 4OOFA 7MDHA 2QZ9A 4IDFA 3LC7O 4AJ2A 4BNKA 2I3GA 1XHLA 1E3IA 3QQPA 1M76A 4II2A 3FR7A 3CE6A 2NNLD 4IDGA 1WDKA 1IHYA 2Z95A 4MJLA 3WGOA 1U3WA 3SVTA 1UXJA 4EUEA 2B4TO 5KVQA 3M1AA 3DZJA 3TN7A 5ER6A 4XYLA 4LCJA 4KP7A 3JD0A 1EUCA 1KY4A 4GMGA 4O1MA 3VDRA 2NLOA 1ZSVA 1ZEMA 2AE1A 2YDXA 3HJAA 3U3XA 1B3BA 2WYVA 3PZRA 4BGUA 1PJBA 5T57A 5HS4A 4DL9A 1GTMA 4CODB 4M8SA 4PLCA 3EGOA 5JAZA 3PIIA 2EJWA 5L9AA 1E6WA 5EQFA 2C82A 1JAYA 2JCVA 2NM0A 4FOSA 4BNMA 1D8AA 4XYBA 3OSUA 4J1QA 1AHHA 1DLIA 4CMEA 3A1NA 1VL8A 4WLVA 1PIWA 4FJ0A 3FBTA 4NR0A 1PJ2A 3E03A 4YAEA 1K2WA 4NU5A 3I9NA 2VT2A 2VUSA 1TT7A 3VZQA 4CLHA 1NBOA 3X2EA 5KJCA 1V6AA 2UDPA 3GN1A 4IY1A 4ZQBA 1A7KA 3PK0A 3DBHB 3P5SA 4LCEA 5EL0A 1I01A 5HA5A 2ZJ1A 2W2KA 3ZW8A 4OKIA 2G76A 2OL4A 3DTTA 4FB5A 4FQ8A 4II3A 4D41A 1ORRA 4PG8A 1PL6A 1XGKA 4OHUA 1NPTO 2PTGA 5IXYA 2Y93A 2FOIA 4R5MA 1ZK3A 2UAGA 1DPGA 2DAPA 3JYQA 4I08A 5MGBA 1OBFO 5H82A 2YV3A 3LSYA 1J4AA 4OSPA 4Z9FA 4CLOB 4W99A 1YONA 3GVXA 4YT2A 1PGNA 1E0DA 4AJIA 1H93A 3WS7A 3LLVA 2BMAA 5AXAA 3IDSA 4NH4A 5ES3A 3A14A 4DIFA 4HNHA 1GL3A 4M49A 1EFKA 2B35A 1ARZA 3RSHA 2ZKLA 3NX4A 4NJMB 5ER9A 5IFLA 1HDGO 3DMTA 2C2XA 4YJFA 5G0SA 1U2DA 2CF5A 3A9WA 2OP0A 4LK3A 2DQ4A 1TI7A 3FPCA 3M6IA 1FK8A 5AVOA 5BNTA 2IDZA 2OP1A 3ASVA 5L7WA 2Q99A 4EEZA 4CM1A 2YYYA 1Y5MA 1Z7EA 1DXYA 4RPJA 4RGBA 4WOJA 3GAFA 3MCVA 3PJDA 3HZZA 4IMPA 2GZ2A 4J2HA 1AUPA 4CMIA 2H5LA 5KJFA 3EZYA 3ZHBA 4BV8A 1Y5RA 2Y1FA 4P4NA 3JQBC 4RQTA 1KVSA 4O5OA 1NYTA 1PTJA 4AL4A 5HM8A 3V1YA 4WEOA 3PFFA 3GA0A 5BSFA 1T2AA 3Q9NA 4DIBA 4RPHA 4BOYA 1CJCA 3TZKA 1I3KA 4PLFA 4FJ1A 4NU6A 2GZ1A 3MJCA 4W9NA 5EMHA 3WQQA 1R4NB 5B37A 4OO3A 4WLFA 2PLAA 1M6HA 5KJEA 3RIHA 3OIFA 2AA3A 1EDOA 1KEVA 3AUAA 3WGHA 3SXPA 3I4CA 2R2GA 2XOXA 3H5NA 3L6EA 1U9JA 1QXSA 4HWKA 4HUJA 3HDJA 1U7TA 4BO7A 3DOJA 4RVDA 1SCUA 2P9EA 2DTDA 2O4CA 3JD2A 2GN4A 3NTRA 3OJOA 3PHHA 2VUUA 4AJOA 1K6XA 2IE0A 3F1LA 1JVBA 4ZQGA 1TT5B 2BRUA 2OGUA 3JQGA 4FSHA 4RF4A 4C4OA 3EYWA 3EMKA 2PKRA 1FDUA 1PSDA 2O3QA 4MVJI 4BO8A 1U8FO 5H81A 2UUPA 3F4LA 1MC5A 2ET6A 3WTBA 2PD6A 1E92A 4DXHA 1B0AA 5TSDA 3RWBA 1W6UA 3B1FA 3D5QA 4IQ8A 3WLEA 3W8EA 2YZ7A 1QRRA 3GFBA 1SB8A 1H6AA 3K9QO 2XF8A 4MOWA 4XRGA 1X0XA 2FR1A 1BXGB 1HE2A 1Y8RB 3QWHA 4GQAA 4I9NA 1R66A 1GPJA 1OC4A 3AU9A 5A04A 1A27A 4XRRA 3QE3A 2WJPA 2HAEA 3IQDB 4XGKA 5CDYA 5JO9A 1VLLA 3AY3A 1CYDA 3A28A 3JYPA 5JE8A 2GN6A 3PZBA 3P7MA 2NU8A 5I8WA 1DAPA 4A27A 5JBIA 1I36A 4ZA2A 1IOLA 5KCZA 2B83A 1ID1A 1HDCA 4IDAA 1T4BA 4D43A 3IKVA 4R1UA 5DBFA 3W4JA 4L4RA 4MKZA 4AJJA 3WFJA 3DXFA 4GI2A 2FPGA 3AOEA 4B7CA 2O48X 2GDZA 1ENPA 1VL0A 1MFZA 2X0NA 2R6JA 3DEYX 4F6LA 3D64A 2FMUA 4BS9A 5IZ4A 2OFPA 1YE3A 1I5RA 2EV9A 2J6IA 1GCUA 3IKTA 1BXKA 3COSA 4TSKA 2Q2WA 4BNNA 1PJQA 4M55A 3BMQA 3P2OA 4JQCA 3OECA 1BW9B 4RPKA 5CP8A 4BO2A 4CMKA 1SOVA 1YL5A 4LMPA 3RU9A 3T4EA 2D1YA 5JFOA 4CQLB 3O03A 1UAGA 4O0LA 3JQ9C 1PWZA 1ZMOA 1W8DA 4KOAA 3UN1A 4XWYA 1U3TA 4E13A 4Z0PA 4YRBA 1C0LA 1JKJA 2CSUA 4R54A 4DMLA 2Y0EA 4URFA 2TMGA 1HZJA 4D45A 2YJZA 4B7XA 3DFUA 1GQQA 3IC5A 4KUEA 1W4ZA 4D0SA 2P91A 3ZU4A 4ALNA 4R1SA 2Y1DA 2CD9A 3UOGA 1ZNQO 3OP4A 2HK9A 1FJHA 3GF4A 3PWSA 3ZV6A 2CF6A 3AFMA 2B37A 2O3SA 5JS6A 2Q50A 1QP8A 3KYDB 4UVEA 2H1SA 1TB4A 1X14A 1GR0A 3KB6A 3QVXA 4FGWA 5EJ2A 5CDTA 1A9ZA 3I3OA 1YH3A 4BNFA 1DB3A 2P9GA 4DRYA 2GD1O 2DBVO 3PJFA 3JV7A 4CQMB 1K5HA 5I9LA 1JW9B 1TA4A 2I99A 4Q3DA 2Y05A 4L8VA 4BL5A 5C7LO 5JYDA 2X8LA 2PY6A 4ZHSA 3PQEA 4YQYA 2Y1EA 4Z3DA 4CLEA 1MG0A 1Y81A 4CUZA 2UVDA 4GAEA 3OFSA 1O94A 4BIIA 3WMWA 4FGSA 3A4VA 3OQBA 3ZWCA 1JU9A 4CUKA 1DRWA 3ZNOA 1QKIA 3OEYA 2QQ5A 1M66A 4E32A 1DC4A 1AXEA 3L4SO 4B7UA 4PIVA 3U49A 2ZCUA 4HBGA 2YQ4A 2GNAA 4PGFA 3S1LA 3S2GA 2O3TA 1O9BA 3OEWA 3OQ1A 2BD0A 3DZIA 4R4JA 1I2CA 1UZMA 1YDWA 4IZIA 3PEFA 4BMVA 1GD1O 4U5QA 4HKTA 3U62A 4GWGA 3TL2A 3QIVA 3WQSB 4FFLA 3GZ4A 1VC2A 4CMEC 4PG6A 3U4IA 3ROKA 4S3MA 3QWFA 2Y1GA 2EF1A 3IOYA 3HFGA 1R0KA 1XIVA 2DUWA 3R0IA 5L3ZA 2XXJA 3ZHYA 3TWOA 2H63A 1EUZA 1J5PA 1EZ4A 3D4NA 4K6FA 4YDRA 5A5FA 1PR3A 2X0IA 1SAYA 2PA3A 1D7OA 3GHHA 4JCOA 4YXFA 2ZB4A 2BLLA 3FTNA 3IJRA 4CL3A 4CR7A 5CDSA 2C7VA 3DBHA 1X1TA 4CV3A 1C1DB 1DJQA 4GWKA 1N92A 1GPDG 1X7HA 4IQGA 2YDYA 1XQ6A 2RH8A 3AM4A 3F3SA 2C7GA 1RM3A 4XQCA 1DRVA 3E8XA 3ITDA 1PGOA 5TQVA 1YDEA 4DQXA 4EJMA 3ORFA 3P2YA 4RF5A 2WYUA 1ENOA 1JVSA 3B20A 3JQ7B 4JBIA 5L7YA 4AJEA 4NZ9A 3PIDA 2B36A 5DNAA 5T8KA 1UXGA 5FYDA 1E77A 1U5CA 2X0RA 2FY8A 5L95A 4AVYA 3UXYA 1EK5A 4WPGA 3KEOA 2RHRA 2H9IA 2JAHA 4YEDA 4BNVA 5IN5A 2J3KA 4ESOA 1CQIA 4OMUA 3PHGA 2NACA 3FWZA 4HP8A 3DMTC 1GDHA 1MGOA 1PJLA 4LSWA 3SEFA 2PWZA 4CV0A 5G0WA 2Q4BA 4NJMA 3AW9A 5AYVA 2G82A 2GASA 1IULA 3TJRA 5IDYA 1U28A 1UDBA 1UZNA 3QWIA 1N5DA 4Z0HO 1LNQA 1I30A 1N1GA 3WYCA 1W73A 3DR3A 3LVFO 4R01A 1AGNA 2BFAA 2DVMA 1IYZA 4BMNA 3AY6A 3FRJA 1DC3A 4MDHA 1VRWA 2WEKA 4C7KA 5IZCA 1W0CA 4EI2A 5L53A 2P5UA 2BFMA 4CMIB 3HWRA 3TNLA 4UEJA 4GX0A 2HK8A 4GLOA 1A9YA 2AEMA 3OA0A 3ONEA 4D46A 3UGKA 1KC3A 2E4AA 1E7RA 4O63O 4FW8A 3JQBA 3C7DB 1L1FA 4UUMA 4R3NA 4RDIA 2C5EA 3LLSA 5DBIA 3ON5A 4W9NC 3KV3O 1MFPA 3UCFA 3N58A 1LLCA 1DBVO 2FSVA 2X4GA 3GDOA 3FCOA 5L40A 1LRJA 4NJOA 1R4NA 1ISGA 1ZXLA 5LDGA 4EUFA 1Q2XA 1YL6A 4CM6A 4AICA 2E6UX 1P74A 3FWNA 3PGJA 1P44A 3V1UA 2WE8A 4DBZA 2PKQO 2FPIA 5TC4A 4A0SA 4IM7A 1A7AA 4Q39A 2D59A 1ZSYA 4ALIA 2Y1OA 1DSSG 1YGYA 2O50A 1M75A 4QX6A 2V7PA 1LDGA 1JAXA 1U8XX 4UAGA 2VRCA 3HHPA 3LF1A 4WLUA 1WLYA 3ETEA 5CDGA 4F3YA 1ML3A 2FPPA 3OJLA 1I0ZA 3C1TA 4PZCA 3Q1LA 4OXNA 1FDSA 4JJFA 3WG9A 2Q1TA 4INAA 1D3AA 3QSGA 4MVJH 1F8FA 2X9VA 3D5TA 3LT1A 3VKUA 2GYYA 5A9SB 2O23A 3AM5A 4Z0TA 1KY5A 3OQ6A 3KSDO 4XJTA 4IIUA 1DHTA 4W4TA 1KETA 3BTSA 4YJGB 4W7HA 1ENZA 6ADHA 1BXGA 1LXCA 4OXYA 2YQ5A 4IDCA 5A03A 3PPIA 4UREA 4CMGA 3AI2A 1GZ6A 5IDXA 4UVGA 4MIOA 1E3EA 1ZK1A 4R3WA 1QR6A 2QYSA 2B69A 3G1TA 4YAIA 2WTBA 3VVCA 3ZWWA 3WGIA 4I5DA 1YB1A 2X5OA 4QEDA 4YRDA 5CFZA 1PWXA 4DC1A 5LDHA 2ZYDA 3OMLA 4XDYA 3TOZA 1U3UA 5JPIA 1QSGA 1UXIA 3HE3A 1GEGA 3V1TC 5TIIA 2X9NA 3AM3A 3C85A 3GC6A 3W6ZA 4PLGA 1QORA 3WR5A 5KJ1A 4EZBA 1HLDA 3X2FA 3GR6A 3JQFA 4RPLA 4JK3A 4HFMA 3MJTA 1L7DA 3ZHZA 6LDHA 4E31A 2JFHA 3BMQB 4CM5A 4A5OA 1T2EA 4ONEA 4QO7A 1IE3A 3K2BA 3ICCA 1ISHA 4L76A 2G5CA 1EVIA 3H3FA 1LSOA 2Q2VA 1RYEA 2ZCVA 1D1SA 3GH3A 3JQ9A 3NDRA 4PZDA 1LDEA 3QY9A 1K3TA 2GZ3A 4L9RA 3RC1A 1HYGA 4HFRA 4R68A 1H6CA 3WJ7A 3DBRB 3JQDA 4J6FA 5ENVA 3BAZA 3ITKA 1ZXBA 3PWZA 4HNGA 4IXTA 3L9WA 4LRSB 5BQFA 4FFOA 1PZHA 1P3DA 4CQMD 3HFSA 5BSGA 1VM6A 3OIGA 4MINA 5CPFA 5G4KA 3K73O 1F06A 1NAHA 4PLTA 5K0ZA 4KUGA 2GGSA 5DBGA 2VRBA 3KYDA 3VOSA 1X15A 4I9HA 3DWFA 1E1MA 4Q3BA 4JNKA 2D3TA 5JC1A 5KOIA 3HUDA 5KVVA 3KOUA 3UHAA 1QYWA 4A2CA 4CQMA 1PX0A 2IXAA 2NTJA 3JYLA 2Q2QA 1NTOA 1E7QA 3ETGA 1PJCA 1ZZEA 1PGQA 3H6KA 1T24A 5DP2A 3AUSA 5B1YA 2AEFA 2D8AA 4IGEA 1LX6A 4D3FA 2Q1WA 2EKPA 3TFQA 4YAJA 4DMMA 5GZ1A 2Q49A 2BGKA 1N9GB 2IRWA 4NQZA 4QTZA 1SMKA 3QWAA 1WXDA 4JXKA 1E7MA 5DCYA 3WJAA 4TKLA 2O2YA 3PWKA 4PCVA 1CF2O 3ROMA 5CEFA 1H0KA 4YJDA 2GR9A 2VHWA 1C0PA 4BQRA 2HRZA 5L4SA 2GCGA 2YFHA 1MLDA 3L4BC 3E6AA 5U4QA 1CWUA 1XEAA 3WMXA 2ZTLA 1U4OA 1ZJYA 4KWIA 2I67A 5ICSA 3OHSX 1K6IA 4JN6B 2OHXA 4MP3A 3K31A 1HTBA 4YACA 3DDNA 4PVCA 4NFSA 1SEVA 4K9DA 3LK7A 3DO5A 4S1VA 3NDIA 4WEQA 5TLSA 3OH8A 5FF9A 2NVBA 2PZJA 4I9UA 1JTVA 2QX7A 3G79A 4YWJA 1ZW1A 4JIGA 4Q9NA 1DC6A 3VH1A 1AE1A 3R1IA 5TT1A 1KS9A 4PRLA 1KEPA 4GX2A 2EW2A 1C14A 4WECA 4LN1A 4DLBA 4J90A 1KIFA 1C1DA 4ALLA 5A06A 5F5NA 3H3JA 1LRKA 3IMFA 4K6CA 1C1XB 4O59O 1GAEO 2C07A 3PFWO 3V2HA 5JNLA 5ILGA 1O6ZA 5AOVA 5IJZA 3E9MA 3PYXA 5CEEA 3AU8A 1HLPA 5JY6A 4CR6A 5JAIA 1LRLA 5ICMA 4CLRB 5T8KC 1T2FA 3CEAA 3HQ4O 5GZ3A 5B4UA 3JQ7A 1ZIDA 2PH3A 4L4XA 4BO6A 4E2ZA 3I9JA 4J2OA 4FC6A 3ZWBA 1WP4A 3LC2O 2VZ9A 2AQ8A 4XJSA 1KVTA 4B3HA 1X7GA 4D7AA 1I2BA 2DU8A 1MC4A 1XELA 4BVAA 3RBZA 4A26A 5G4LA 3D3WA 4ZICA 1PGJA 1M67A 2FR0A 2OZPA 4GPD1 2D5CA 2OMEA 1JN0A 1DIGA 2AHRA 3S2FA 3L6DA 1QYVA 2DFVA 3ZU3A 1KOLA 4Y8VA 4XDZA 1YBVA 2PGDA 4B8ZA 3DBLA 3C3XA 1OFGA 3FPLA 2QZZA 2ZYAA 3IS3A 2CVZA 4B4UA 4E5NA 1PJTA 1IUKA 2P5YA 4OM8A 4XYMA 2J5QA 2W4QA 3TOXA 1TLTA 5IZCC 1WW8A 4RORA 2OORA 1YQXA 1R6DA 4BO3A 3O26A 4CMBA 2AQKA 4E21A 1NVMB 3F5QA 2I6TA 4HADA 4AFNA 1X13A 1XG5A 1N2SA 4R1NA 5KKAA 2D5AA 1MB4A 4XA8A 4GBJA 4MVJG 4MIEA 1UP7A 2AXQA 3I4FA 5L45A 3ROPA 2O3RA 3BTOA 4YRAA 2QYTA 5HTOA 1NFQA 4K28A 3VTZA 4MVJM 2EEZA 3GPIA 4YT8A 4B4WA 4FFMA 3VH3A 1RM4A 4GMFA 4RDHA 2BI8A 2GN9A 1CERA 5KIAA 1A72A 2A9FA 3BIOA 3NRCA 1A4IA 4JP2A 1LC3A 3PGXA 3T7EA 3VVBA 4DLLA 4LGVA 1NNUA 3NJ4A 5BSHA 2YW9A 4NI5A 3E9NA 1SBYA 3NV9A 4MVJE 3RJ5A 2BGLA 4WOKA 3EUWA 4AJHA 1NR1A 3RUAA 1MV8A 4AJKA 1YS4A 4CM8B 1WDMA 1WZIA 3FNHA 5JLAA 1EBFA 4CMJA 4XZ3A 2C20A 1LJ8A 3HN7A 4RZHA 3Q11A 4Y6RA 3WSWA 1XQ1A 2V65A 4R69A 1DIAA 4AJ1A 1EFLA 2HJSA 4R9SA 3VC7A 2NSDA 4BNLA 3AUTA 1Q1NA 3P19A 4MO2A 4UULA 2X23A 2O2SA 5A9SA 1LUAA 4A10A 4ND3A 1AHIA 5A3JA 2QHXA 4J1NA 3W1VA 1WWKA 2J5RA 2VWHA 2CZCA 2Q46A 1WZEA 1QLHA 4YJGA 4GVLA 4IJVA 3I9OA 1BXZA 2J3JA 4J16A 4KDFA 5F5LA 1GV0A 1DIHA 3BYZA 2HMUA 2SCUA 3C24A 4FPXA 1VJTA 1TVEA 3JQ6A 1ISIA 2NUAA 4FD3A 4XD2A 2PZKA 5C3MA 1QG6A 1EDZA 1LSUA 3AY7A 3TFOA 3WXBA 4LRTB 1KC1A 4I8XA 3U4DA 1HT0A 3RAJA 2YHUA 1VKOA 4GSLA 4P8RA 2NTNA 2XAAA 1BDMA 4QECA 3H2SA 4YVFA 3VPHA 1PQUA 3D4PA 3W4IA 3F47A 3PQFA 1R15A 3WB9A 4D3DA 2X5KO 3INRA 1KERA 1UDCA 4QSMA 3JYNA 4QT0A 2QG4A 5F1OA 3K8ZA 1RJWA 4EEXA 3JQFC 5IG2A 4M54A 1YO6A 4J4TA 1J49A 1ULSA 5F1PA 2DBRA 2AMFA 4OH1A 4JROA 4L73A 1DO8A 4N5LA 3I9KA 4XYEA 3M2PA 1B8PA 1O8CA 2HMWA 5IDQA 3HB5X 4PLWA 2WD7B 4EGFA 3GGPA 1PZEA 2HMVA 4HY3A 3SLGA 1BDBA 1HL3A 2C54A 2VWGA 5K9ZA 4WNIA 2OO5A 1E6EA 5CG1A 4EJ0A 1WAMA 2J5KA 2NU6A 1OAAA 3PYMA 4G5HA 3DMYA 4J0EA 4QO8A 3RUFA 4DA9A 3W8DA 3CTMA 4Z3KA 1UP4A 5JCJD 4CL8A 1DFHA 4U8GA 2O3UA 2Y68A 2EHDA 1G0OA 1H6DA 3DBRA 1NHGA 3FNEA 4G2NA 3T7CA 3GGOA 2EJVA 3KO8A 5I8ZA 4XX0A 5JXWA 4KTVE 4KMSA 4BGVA 1YKFA 1PJ4A 2PGLA 3H7AA 1ADCA 1B15A 1T4DA 1ZBQA 5G4KB 3UW3A 3H9EO 1E1KA 3TZ6A 1G6KA 4ND1A 2Q45A 2DM6A 4B4OA 4FCCA 4DTIA 4KTTE 2X5JO 5JSFA 5JCJA 5CHEA 4GKVA 4DVJA 4DC0A 2HCTA 3MZ0A 5AXDA 2FZEA 1PQPA 5DF1A 3INGA 3RKUA 1KYQA 1RWBA 3INTA 4CM4B 5EN4A 1AXGA 2WWRA 3H5RA 3MTGA 3JQAB 8LDHA 2QRJA 4E6PA 7ADHA 1CIVA 1DAOA 3LQFA 2DKNA 1EEHA 3WNQA 4CMCA 2CFCA 4QQRA 4FOOA 8ADHA 1EQ2A 4JX8A 4BO9A 3ANMA 1Y7TA 3KSZO 3OJFA 4Y67A 2ZYGA 3DAGA 1MA0A 3ONDA 4R9RA 4OYRA 4GH5A 4R51A 3ULKA 1VPDA 3I6QA 1I33A 3E82A 4U7WA 1N9GA 3OM9A 4E5YA 3SC6A 1TXGA 2VTEA 3ZHXA 5TX7A 4DUPA 5JAQA 2EERA 4DLAA 4CM9D 2G0TA 4XGNA 1V0JA 1ONPA 2P4QA 4NIMA 3U0BA 1YJ8A 5COBA 3ZW9A 5K6AC 2JD1A 3ST7A 3LU1A 3ZGYA 1I8TA 1BMDA 1NVGA 4IJUA 1DOHA 1PGPA 3W8FA 3L4BA 1QYCA 2X9GA 2IZ1A 5I7VA 4XB1A 2WD8A 3BMNA 3GRPA 3GY0A 4RCVA 5JDCC 3EZLA 1LDNA 1GU7A 1XSEA 4MVJP 4F46A 3IIEA 4BNZA 2IYOA 3DOCA 5DULA 4JJGA 3U4HA 3TSCA 5TNXA 1A5ZA 3VPFA 4CM9A 1ZMTA 3RFTA 2E49A 1QYDA 2EP7A 1E7YA 3QV1A 4H16A 3WGTA 3RC7A 2HSDA 4J91A 1BVUA 2VT3A 4FC7A 4HFNA 4XYGA 4Z9YA 2VZ0A 1PS0A 1SOWA 5LCXA 3SLKA 1BGVA 3K2EA 2EP5A 2C5AA 2QIOA 3PHIA 2VQ3A 1PS8A 4IJWA 4JBGA 2BF7A 1C1XA 4IZHA 3F1KA 4J7CA 2CDCA 4ZQEA 1NP3A 3HSKA 2RHCA 3V5NA 4CLRA 1GUFA 1PL8A 5ADHA 3L77A 3ZU2A 1IZ0A 1ZEJA 4CR8A 2HO5A 3NGXA 5L4NA 2JJYA 3OJEA 5A9TA 1LLUA 3VH4A 2RAFA 3ADPA 3RASA 2B4QA 2O4UX 4XQGA 4NDNE 5COAA 3RKRA 3D3WB 5KWEA 1YRLA 3T4XA 3FTPA 3QA9A 4ZN6A 5KVSA 3F5SA 1N7HA 3R6DA 2NQ8A 4ZVVA 4ND5A 1YB5A 4KQWA 2OBNA 2HMSA 3PXXA 1LA2A 1WVGA 4BKPA 3DONA 3BTUA 3GPDG 2W2LA 4LMRA 5BR7A 3DBLB 3WGZA 3V8BA 3CMMA 1ISMA 4IDDA 1V3UA 4OJNA 4JBHA 5I7EA 4MPDA 4YCAA 1WDLA 3D1LA 1Q0QA 1I3MA 2EKLA 3AFNA 4I1IA 2D0IA
chains in the Genus database with same CATH superfamily
5AI6A 5JJBA 1VE9A 5HDBB 5IANA 5IT5A 2EFEB 2G1KA 1MZPA 4J1TA 1CJTC 1XC7A 3SX4A 4BNUA 1B8NA 1DCTA 4X24A 4ED9A 3UFXA 3R75A 3MJ4A 4HH3C 3GFGA 2HSJA 3PD7A 4J49A 2C5SA 2JLVA 4NDAA 3V7YA 5JRDS 4L5AA 2R68A 2QVZX 2VYCA 3EOZA 3TG8A 3ZQ4A 4LX0A 4R0NA 2L69A 3OD1A 3IL2A 1Q21A 3RODA 4QOFA 1P5JA 1ND6A 1XPOA 1KZGB 1KQPA 3LCCA 1A9QA 2IPOA 1P2TA 4H6XA 4KO3S 4QUIA 5DDIP 4W9MC 3AEUA 2EQAA 3G02A 2Y1XA 4DTCA 2O20A 4G4JA 3QKWA 1EP9A 1IK4A 2BFDA 4QWMA 4XAQA 2A3RA 2HWXA 3A06A 3PUVA 5CVEA 4B17A 4ENUA 2VRCD 4G07A 5DHFA 4DRXA 4JLKA 1JJ7A 4IVNA 4ZT3A 3QVUA 3MCUA 4WASA 2PNFA 4LA4A 5F2KA 3R9KA 1H2FA 4TKUB 3AI3A 3NLLA 5K45A 5F3DA 5A0VA 2WFZA 1DFIA 1MPXA 2FEPA 1JE1A 1ULUA 2YWXA 2XDYA 3OE7D 4A6XA 5E1BA 1OI7A 3D3NA 3C3CA 4O4LF 3K0CA 1FP7A 4FKMA 2R1ZA 3NHUA 3KYBA 4GLLA 1GZUA 3RBXA 1PNTA 3ROZA 3QU9A 5GY7A 1BE0A 3AFGA 3D9QX 3ZXXA 2MSDB 2X15A 1YRWA 5TPZA 3VYRB 3MLBA 1GGHA 2I7TA 4AUKA 2ZRHA 3CURA 2I29A 3MMXA 5ELXA 5F3RA 4E1BA 1J42A 3EEQA 3EEOA 4ILKA 4WI1A 2JL1A 4B4KA 4NLLA 4EQ6A 5CX1A 2B5WA 4NABA 2QIPA 3VR3D 5IN4A 4BNYA 4KPEC 4ARCA 2Q3DA 3DYVA 1XMJA 3O8BA 1I6KA 4L0QA 1HBJA 5DYNA 1YIAA 3EAGA 2VDQB 1QH8B 3DL2A 1XRMA 4GWLA 4J16C 5D86A 3AIMA 2QM3A 4K0KB 1KL7A 1T3HA 2AVDA 4ZOCA 1K9VF 2PL9A 3PXAA 3P9RA 2NU9B 3VNBA 3ZYZA 2Z2KA 4QGFA 2ZJAA 5LJIA 3KLMX 3CGGA 3EMDA 3TBFA 2XE6A 1OFTA 3IKJA 2H8GA 1F2TB 4OHBA 2FMTA 2YW2A 4PHFA 1CY7A 5FWNA 3LI2A 1I7QB 3IV6A 1AF7A 4JEUA 5IF9A 3G17A 3L8MA 4YRTA 1W1UA 1E1QA 4QU5A 4ZVRA 3TIFA 3H9GA 3IEIA 4D0RA 2AF3C 2XMZA 2HRBA 3A1FA 3HJTA 1YA4A 4M1SA 2JGIA 1FNDA 2O5VA 3RYIB 4DV3B 4BGIA 3LQ2A 4CTKA 1Q15A 3NVKI 3K8OE 1G2OA 1USKA 4MS4A 4N18A 1M2KA 4F6CA 3GLGB 5ICCA 2O9JA 1QGUB 2CVOA 1FMFA 3VZCA 4X61A 3LLUA 3QUAA 5THQA 2HQ1A 2PJRA 2BISA 4CLXA 1W2WB 1OMOA 1ZH8A 3KV1A 4KR9A 2HLPA 3IP3A 1L5LA 1NSYA 3AQIA 5T3YA 1TU4A 2BEKA 2PT6A 3HFJA 1U6JA 2FSHA 2VBGA 1ODIA 3M6AA 2XNDA 2J9ZB 1ZK0A 1MPTA 2CL0X 2F8LA 2RGDA 2HRQA 4ZYVA 2WM2A 1YVPA 3RSSA 1U2RA 4BQEA 5K0TA 3VNAA 1G3QA 1OZAA 2G0NA 1U1GA 4BASA 1TCCA 1HYHA 2B7BA 2DBZA 2Z56A 3BRWD 4M1TA 3NOQA 4X54A 2R86A 5HF6A 3QFCA 3KQHA 1NLUA 4KXYA 3ROFA 1CUJA 1E2UA 4A91A 5FT9A 4C2AA 1EDBA 4EKIA 2K7FA 2GD0A 3E2PA 2RFLA 3JD1A 4JLDA 5JMWA 2FZWA 2HPAA 4YS6A 3LT0A 1KSJA 2PKEA 3E22A 4GGOA 1P60A 3Q0EA 3K16A 4X92A 4B3RB 4DSTA 2NWQA 1IY8A 4FFSA 1KO7A 1Z88A 2YCBA 4GX1A 4YROA 1E18A 1TZBA 2FVYA 3BRWA 1A71A 1QOZA 2ZT5A 4WDRA 1G21B 5G53C 2QLJA 3AHJA 5K2MA 3D7LA 3ZDXB 1C30B 4HTFB 4V38A 2WVJA 4YI3A 3V8PA 4D8XA 4E6EA 2VDKB 2MYNA 2PV7A 2Q4EA 3OZXA 3QVSA 1JHRA 2ZROA 4RZIA 2B82A 5EINA 4BNWA 3H84A 3R8FA 4X97A 3WGYA 1YVUA 2IYUA 4O4HF 4P9NA 5F73A 3RDPA 4CM4A 4E1AA 1Y3CE 1EFPA 1QHNA 2PZ8A 3R3UA 1RWKA 4I4IA 4Q5IA 4FGJA 4IUCS 1QYRA 3OCUA 1N6PA 1UINA 3H65A 3HI6A 2HBZA 4RVSA 4PBRA 4ZGWA 1XD2B 4K2HA 3IAS1 4JUAA 4UOQA 5DGTA 3HYLA 4GKAA 3R76A 2JKVA 4U7HA 3AOGA 1AKNA 3ILYA 3EBPA 3LX4A 3OCVA 2IIQA 2OBLA 3ESBA 1QMGA 4XUDA 3O94A 3SIWA 5EZYB 4PANA 5CLIA 2Q4RA 3IE2A 5AICA 1PU2A 3P9QA 1XA3A 4FCTA 3CRRA 1U2ZA 2WR8A 4JP5A 2I4OA 1N1DA 1QHEA 5P21A 3ZJ5A 5I9IA 1PZNA 2DMRA 1C3OA 2HMAA 4ND2A 5K3SA 3THXB 1NQTA 1DX6A 5DZSA 5IMSA 3GWGA 1UK6A 2D4HA 2G83A 3DULA 4EJ6A 2GBFA 4ENTA 1Y6GA 2JEOA 3B5IA 5DTQA 1K98A 4LI0A 1GVHA 4WLNA 1RQLA 4MLDA 4V2IA 1XQ9A 2GKOA 1UM9A 1KJZA 1WM1A 5EESA 3DFMA 2VSOA 3IYLW 4OHKA 4ITUA 4US1R 3CFYA 2O1SA 3GYBA 3LNCA 4O25A 5HRUA 3ZZNA 1IUNA 2POQX 1Z7BA 1DWQA 4BLTA 3GEGA 4LTNA 5LYJB 1BDJA 4JYAB 1HYEA 1M5TA 1S96A 1Y3FE 1XE3A 4PZAA 4ROSA 4TZTA 1VJ1A 3ANTA 3E5RA 3HDQA 4A8JC 2H06A 4ZEMA 4N65A 2BSXA 4F91B 4A8JB 3HRIA 1HRDA 3W9YA 3CNOA 1G8MA 4N39A 4KIWA 5JNTA 2FX5A 4TQUS 4J4BA 2G7MC 3KC2A 3IBCA 4FGLA 5FUYA 4G86A 3IRVA 2JAUA 3NZEA 3L8YA 4TM7A 5SYAA 3WHKA 4C03A 5CLQA 2XQJA 1V47A 1PX2A 2Z8YM 4ZAVA 5IKEA 5J59A 2ZUVA 1GSIA 4TYQA 2QW8A 3X1YA 5KNDH 3AEZA 1G98A 1Z6TA 4QJBA 2MINA 4KI0A 5A4KA 1KDVA 1TFUA 2HHHB 4KWHA 4JBWA 3KEQA 1I94B 2NG1A 2JJ8A 3LAWA 4LJSA 1QTRA 3KR1A 4YI5A 3TRKA 5KS2A 3HUTA 5KNCA 4ZODA 5AXBA 3QX9A 4C0HA 2IXFA 4BMDA 4IX9A 3B5JA 5F98A 4A7PA 5D5HA 4C0QC 6GPBA 4OYLA 1XEXB 2VSXA 3RYTC 1XRSB 4DFDA 4EX6A 5AKEA 3QX3A 2JW5A 5CURA 3NHFA 1P5ZB 2D4AA 2MDTA 1E4VA 1ZM3A 4OFBA 1FMJA 5DLEA 3KFLA 1M2VA 2OHHA 4ZCLA 5BQPA 1G20E 2BFEB 4XIYA 1KYVA 2AFRA 2QRZA 3DO6A 4XIIA 5J43A 3X0DA 4NNJA 2H7VA 1TO2E 3FYCA 5FV4A 3HCOA 1W0KA 2D2XA 4BNJA 2XT6A 5FPPA 2ERXA 5JRJA 1LS6A 4FX5A 4P3PA 5C5DA 3HBNA 5KHOC 4PG7A 5HBGA 1FC0A 3AV0B 2H29A 3H19A 3LY5A 2RJNA 4FKZA 4AJ9A 3TE7A 3RUCA 4EMTA 3NJRA 1JHVA 2OKGA 1I13A 4G25A 4GE0A 4XDHA 3ZQKA 1WVMA 3TL3A 1EK6A 3GPCA 4J43A 4ZQHA 4HUTA 3PUXA 3AVTA 3FN4A 3F3KA 4AUEA 4IKEA 4ODIA 4OLAA 3BSSA 3GLQA 4AG3A 1JI0A 1VXRA 3MERA 1O9HA 4FMBB 2DUUA 3SU8A 3UFXB 2BH2A 1DC5A 3DS8A 4LKOA 4KZKA 4AIRA 1OLSA 1NI4A 2X7HA 4U02A 1BXRA 4ZI7A 1M34E 3I2JA 2K7ZA 1V9SA 3SBOA 3PNPA 1WMDA 1KAHA 4C07A 3ENWA 4LYAA 4J0KA 2IHJA 2QPLA 3LKBA 5ALEA 1VZ3A 3IIIA 4O2BA 3JRWA 1CR2A 3L5OA 1Z83A 3LM8A 1E6UA 4ARSA 4EW3A 2HN9A 1R88A 2VSYA 1DJNA 3QA3E 2VXOA 5CLFA 2BFDB 2QV0A 1QZ3A 5TT0A 1JKIA 1TYDE 4BTEA 4WUVA 2BV3A 1MENA 4PC3A 4KQXA 3BIWA 4RW0A 4H2DA 4BFLA 3DVQX 1HE1C 3PQDA 8OHMA 3D7MA 3PX7A 3HC7A 3P0EA 4C7MA 4WXPA 4M87A 4KYTA 4DPKA 1C8LA 4C4PA 3T06B 3F9IA 1R00A 5A1TA 1J24A 5HHTA 3GB9A 1MC8A 1FTQA 3G8YA 4X3CA 4XOUA 2A2ZA 2C1ZA 4PNHA 5AO9A 2PSSA 4AKEA 3FZGA 3GROA 4NECA 4J0JA 2O0LA 2JI8A 3O8NA 4FU0A 5EJEA 5K8IA 1HTTA 1HXHA 4CKYA 1Y8QB 3JQ8B 3SX2A 1JLHA 2YHIA 3AF4A 2Z3ZA 3PHJA 2QUHA 2AOTB 2V6GA 2XGMA 2DPHA 3PJEA 4MUHA 4PG5A 4Q7KA 3HPRA 5CJPA 1BSVA 4NK4A 4ZRNA 3S2UA 3UMGA 4DT1A 3BFJA 1LLFA 3WIDA 1Z2AA 2G9VA 4C0BA 3O0DA 1KQNA 4E12A 1BA3A 1GSHA 1W5EA 2IW1A 3FNGA 2E55A 4IS2A 1ADFA 4B9EA 3TLYA 4JHXA 5CFMA 1Q7GA 3T5CA 1GFSA 2NN3C 3EW9A 1K4MA 2A9KA 3I8XA 4F06A 4ETMA 1SUWA 4MCJA 1ZH4A 1ZMBA 1XA0A 2GLTA 3K3PA 5EVJA 2VYND 1DUIA 3TDMA 2LCIA 4ME6A 2WSBA 5FI1B 4IZOA 3F8WA 4B2LA 3QXHA 1CZNA 4IWXA 1HDYA 1RCUA 1J39A 4AMBA 1V6SA 3R7BA 4WFJA 2RAVA 3U4QA 1RMYA 2I1WA 2OV6A 4CV2A 4EBBA 2HJRA 3DHEA 4HEA1 4AX4A 4S24A 1EEXB 4D6XA 1Q0RA 2HX1A 5AW2A 4CM3A 2VYNA 3LZ6A 3ZV4A 4AJNA 2W9XA 1KH2A 2ZJ0A 2IYYA 3EC1A 2Q07A 1GY8A 3FPSA 3HGMA 1PYOA 3HVUA 4GUDA 3NR2A 4WLEA 1PQ4A 5JW6A 1GUZA 1K0UA 2AXNA 2H2DA 3LHDA 4YCNA 3DVSX 3JARA 1DCKA 3PWTA 1NYLA 3KJHA 2EKZA 5EHQA 2NVUB 3WLIA 3ZLUA 4A73A 4NHEA 1RYDA 3CIOA 3E2MA 2YS7A 3T8YA 3L1HA 1HE4A 4DJJA 4MDYA 2EX4A 4EPXA 3NVDA 4ZZ1A 2P30A 4HMQA 3JPWA 5CK5A 1TAGA 1SG0A 2D6FA 5TB5A 3OCJA 3WX0A 3DT9A 3R3YA 1WW2A 3BEOA 4HPWA 3SZGA 2PT5A 4TZKA 5DU2A 3U1BA 2CLDX 1J0EA 1G6OA 3GFVA 3JCZA 2ILTA 1T43A 2IZ7A 1JKMA 4U2EA 4GOND 4Z7JA 2P3QA 4EAAA 2ZOSA 3ZXIA 2Q4TA 3MRVA 2OBXA 2OK8A 4EPRA 2NTYC 2Y0CA 4K6MA 4KVGA 3NBXX 1TF2A 4ZANA 1E66A 1AIPA 1RD4A 2CL7X 4OXKA 4CEHA 3HKEB 2R60A 4W1PA 2AXEA 3GG2A 3LL7A 3SKVA 3E9DA 3K70C 1G1AA 2XUHA 3BMOA 3QPVA 1QP7A 1UFRA 4CBVA 4EG8A 3K70B 1SBQA 3QKRA 2JFGA 1B26A 3GFOA 3KUKA 4JJZA 4V2UA 2AZDA 3MOIA 2CNNA 2QSYA 4IICA 4RL4A 2JD0A 3P20A 3UWMA 1UZLA 1CP2A 2VJLA 1FXWF 1C3VA 2I4TA 5GWXA 1AY0A 5C53B 1ABEA 4BEWA 2I78A 3BUSA 1EZ1A 5LBUA 2KB0A 3LD9A 4BNGA 3HP4A 4RTRA 3NXSA 4QOGA 1ZI9A 2ZRBA 3RO7A 2OY0A 1GPKA 1WVIA 5IKPA 4ITVA 3P8ZA 2OK7A 5KPDA 2YJTD 1ESMA 3LUBA 4EW6A 1ZA1A 3C3DA 2A6PA 2ZVPX 3NWPA 3WGGA 3CXRA 5L3VA 1I2AA 1N25A 3PTAA 4F1JA 4RJJA 4KZPA 4MA5A 1ZNYA 5HVNA 3OEHD 1RRPA 1TZMA 3OF5A 5CLLA 3L6OO 5EKDA 3RFVA 1KYYA 3SJ7A 1QGYA 4OIMA 4TXMA 3ZZ1A 2B5VA 4HV4A 2F17A 1F8UA 1P2FA 2M2IA 2WSSD 3IO5A 2VHCA 1ZMXA 3HVIA 4WNCA 5EERA 5EP4A 3S44A 2CUNA 4BMPB 2EQ5A 1V8OA 3DE0X 3RI3A 3H9UA 2F4NA 1S3FA 3W2IA 4DIOA 2QG9A 4R41A 1N2HA 2A1IA 2WIBA 1FU8A 1KOFA 2JHGA 3G0GA 2XECA 3D2BA 1LQTA 1TM3E 3A4TA 5ISMA 2GYUA 1G20B 2B4KA 4K46A 4RAOA 4KYIB 2CV2A 3BDIA 3AJRA 4OGWA 3OZRA 2JFWA 4GICA 1RJ9A 4GX5A 4Q34A 3THYB 3W3AD 2WSSA 4DJTA 2HW8A 1FX0B 2ESRA 2IYEA 2I1VB 2QRLA 1RLMA 2GCIA 2R1VA 1G0NA 3K20A 4L8GA 4YRPA 3WGUA 2G70A 2JLUA 2XDAA 4Q16A 1UQUA 1PKEA 1TTQB 2DY0A 2OSVA 3EE6A 1YA6A 4Q7LA 2XCTB 3WSTA 3ZWNA 1XHEA 2VUTA 1ZCFA 3IP8A 2OGSA 1E2IA 4DMGA 4JYBA 3PDJA 1YFKA 3JYHA 5IJAA 4KOEC 3TOVA 1A2KC 3WBBA 2XZLA 1VFNA 5EWJB 1ICIA 3FCUB 1N8NA 4D42A 3NIBA 1G8HA 4PGMA 2PYDA 3B8EA 1IY2A 1BWQA 4PN7A 2FB9A 3EW7A 5FL7D 2VNSA 1L8AA 2XUGA 1CUIA 2Q8PA 4ON9A 4TRJA 2BEWB 4GXTA 1ODTC 1OU4A 3D4IA 2L18A 1CLEA 2FEMA 3HCNA 1NA5A 4HQ0A 2EW8A 5DLQC 3RFUA 3WBJA 4RTQA 4L8FA 4N5MA 1L0BA 4X64B 1M34B 4EARA 1E79A 1D4AA 3OESA 4LZNA 4YH1A 1J21A 2R25B 1MAAA 4EDFA 1GSOA 1X0VA 2VHYA 2ZAIA 4FI3F 3C3WA 2XD4A 4MDFA 4KN9S 3HCFA 5F2EA 1HE3A 4AO7A 2OECA 5JJLA 2BFWA 2HV9A 1R1DA 2Q7DA 3USZA 2GRAA 4C7VA 5JD6A 2B0CA 3DOIA 4RO0A 1LBTA 4W8GA 5FL7A 3U9LA 1QNLA 2AEJA 2R97A 4RS4A 3ZH9B 3HHEA 1JYFA 3L0DA 2UYYA 3LOPA 4KRGA 4XIFA 3T54A 1C0EA 2EIHA 2IS4A 4L95C 3OTIA 1NBAA 2G1UA 2GNOA 4H31A 3FNQA 3ZE9A 3RRJA 3ZV3A 2X3UA 3CMCO 3FTQA 4RD4A 2BGJA 1Z5GA 2W2LD 4GOOD 4YJ3B 4W6ZA 1UMCB 1QIJA 4OL9A 4L4UA 3W6OA 1L8OA 3IXMA 1J09A 3ADOA 1M2VB 1WY7A 3ECSA 3EF1A 5ARBA 3OPMA 4KMMA 4DDUA 4RE5A 4I7EA 2ZB7A 3RWMB 4ARIA 2ZJ6A 4WKOA 3UMSA 4YRGA 3RC2A 4HNUA 3IR7A 2RIRA 4HNAA 1Z28A 3EVEA 1AC5A 3UV6A 1QHSA 1BS1A 2NXNA 3BIJA 4D4HA 5MDHA 1X1EA 3RJMA 5F9HA 2OZLA 2GA8A 5F51A 1F17A 5JZVA 4KNVA 5KC8A 1C3XA 2ZE7A 1OIXA 1GUDA 2OLEA 3G89A 2FETA 4X1YB 1Z45A 1PFGA 3T61A 4DCNA 2C7QA 5MN4A 1B8OA 2QTCA 5JATA 2EJTA 1ZCJA 3FLMA 4DABA 4DPMA 4YV7A 3LY8A 3J81k 3IBTA 3NBQA 5K0NA 3DOUA 4KLRA 3T7DA 3EWIA 4L6AA 3ZY5A 5H1YA 2Q4OA 1CEXA 2C1EA 1OLUA 5ILOA 4UKDA 2J3HA 2DQYA 1HORA 4EVRA 2PUVA 4PVDA 4Q3AA 1RCTE 2VO1A 4U0JA 2JLWA 2VXCA 1IXSB 1WMAA 3I04A 3TXAA 1NI4B 4LYDA 2AZTA 3PVZA 4W82A 2CJXA 4K1LA 1B3RA 1BXRB 3VV2A 3OIWA 4DIUA 2QMHA 5MN5A 3AKDA 2JAQA 3L2OB 1OZ0A 4YJFB 2VJNA 1ZKDA 2ZT8A 2QGNA 5I8PA 2XTJA 3Q7PA 4LCBA 5JPDA 3T9FA 1AA9A 4ZU1X 1UDWA 3V33A 4IEFB 2D00A 1E1LA 4B3JA 4OGLA 3EIOA 4HS9A 1P1HA 4XDGA 2Y66A 2HZBA 2JGLA 4QQFA 3M9LA 4ZHQF 2XY4A 3D3JA 1GYPA 1ICEA 1QFYA 4TMVA 3GYGA 3P9ZA 2ZVQX 2AMVA 4Q1FA 1S7CA 1H2HA 1K7FB 1CS0B 1PLKA 3UCXA 2HMTA 4AJPA 3U44A 4OLBA 5T3UA 4AUMA 1IWPB 1XWFA 3AX6A 1VTKA 3H17A 3MVEA 2ZQYA 5LXTF 3TBKA 2O19A 2AYZA 1TYCA 3L46A 3OX4A 4CEJA 2D2IA 1YNSA 1IBSA 1NUQA 2JLAA 2KHZA 3G8DA 4FZVA 4OOEA 4LBZA 4LQCA 4UUQA 4YBRA 5DT9A 3RK1A 1DLJA 1YBMA 1TIPA 1Q7EA 3EFOB 1OZHA 5IJ9B 2WDPA 3LDHA 4J1SA 2G08A 3GCGA 5AI0A 3RTEA 4CG1A 1XDSA 2JVKA 1F7VA 3FOCA 4TKMA 3HTXA 3DHWC 3KKEA 1MAHA 1L9XA 4KN5A 1C1HA 4MWSA 3N8HA 1QHHA 4CHGA 4EMUA 1N6HA 4TWJA 4N4AA 4X8LA 3W7AA 4DC9A 3T9DA 3F7NA 4HZGA 2JK0A 2PXCA 1YQGA 2RB4A 3HN2A 2FRDA 2WLSA 2X6TA 5JEEA 2WJYA 4CV1A 1LDBA 1UKBA 1AO3A 2O7QA 3KLOA 3MNFA 4QRHA 2HH9A 3PVCA 5T6MA 1ZMRA 4CMHA 4U7DA 2E7ZA 4FW9A 4GRAA 1X1SA 2GQ0A 5FPYA 2ZJFA 3W1WA 3IEMA 1T1RA 2BRUC 2VRNA 3CNEA 3QUTA 3KUDA 3QZUA 2JD2A 4HZUB 2JCXA 1BN7A 3I1FA 4GI3A 4S12A 1U1FA 4Y2RA 1IB6A 3ZXSA 3ZLJA 3C7CB 4B81A 1Q7RA 1WU8A 1X74A 1NRJB 3JQGB 1TT5A 1Z68A 4OTZA 4DLKA 2LTAA 1Z4LA 4DLZA 3LX8A 2C2HA 4IS3A 4HC4A 5LC1A 1EVQA 4JLPA 2YV4A 4TL8A 4UXIA 4WHMA 4BN4A 1T0HB 3NBFA 3THOA 3K9CA 4DHWA 2NUPA 1LDYA 1P0PA 4GMDA 4MQ6A 4Q21A 1TC1A 1KI8A 1UZUA 1S6YA 1X7WA 3EK2A 4C6TB 1XAGA 3GG9A 3JQQA 2H85A 1BFKA 4WW0A 1S9DA 2AX4A 4BQQA 3G8CA 5B3AA 3TD2A 4GGPA 2QTTA 2YXNA 3RS5A 4MJ3A 4CU5A 1KSHA 1I7LA 1Y7LA 1Y8RA 2WJ4A 3O91A 4AU1A 1NM5A 5NULA 2PWPA 4YPOA 1BHJA 4UPEA 5AVWA 1Z2OX 3WSVA 5I47A 3RVDA 1Z4KA 1ZK4A 4RTSA 4DR1B 1LK5A 2QYHA 3N0WA 3QELB 5G2OA 4D4IA 1T9ZA 2PXAA 1BJTA 3WRXA 4B3MB 2C92A 4B3FX 1SC9A 4CE6A 4QQ8A 4QBTA 1E0SA 1FRVA 2V0CA 2JBAA 5IUKC 3CW2A 5U9CA 1IOWA 3EGIA 2KBFA 3UK0A 1YI1A 3MTIA 3QLUA 4JUBA 4X20A 2BHLA 3C3EA 1VJRA 3NIDB 4Y6SA 3WNBA 1V7ZA 5IVKA 1OHHA 1M1NA 3P4XA 4R2HA 1TO6A 5E8JA 3WDLA 3F7TA 3M2TA 4N6OA 3KEGA 1DJLA 3FFTA 4LC0A 3H1EA 5CCEA 5FDFA 3GDFA 3I2YX 1UFKA 2FPGB 2I34A 5THXA 3DMPA 3S2YA 5AW5A 2GJ4A 3K92A 3KQQA 3C3AA 1A8PA 4KR3A 5ALWA 2QM8A 1R6UA 4OLFA 2ZBEA 4N3CA 1SD1A 1MVNA 3I45A 1B8VA 1XB2A 1EXMA 3QWBA 3BMOB 3I5MA 4K7JA 3NHJA 4M89A 2VPWA 3I4LA 4OK5A 4RFLA 4XGIA 5H59A 1NJGA 4BVBA 4DPLA 4Y2GA 2BI4A 1NR5A 1I10A 1Z0KA 3QKRB 3CNBA 4E51A 3MWKA 2VF8A 3LQYA 5BSRA 5IVHA 1KZ6A 2EGGA 3M49A 1GLGA 3VR6A 3WDKA 1I2MA 3WK6A 5J23A 3CBGA 3O74A 1BW9A 1DG9A 1U1IA 4P92A 4YYEA 3I01A 3GRKA 1CBUA 1B16A 3PUJA 2XH8A 2HTFA 3EIUA 3AKCA 4I50B 2M1ZA 5CAEA 4B8WA 4EO4A 1O57A 4UUNA 4EVIA 2AI2A 3WLSA 5B6PA 1KNQA 3TPFA 2VHUA 3CCCA 1B7GO 1L7PA 4G5YA 4ISCA 3TDKA 4RKEA 1DUVG 2EBHX 1KYIA 2PZAA 2PANA 1KWGA 2P1DA 2FWMX 2PZLA 1OX4B 1NLMA 1GZ4A 3DCIA 2AG5A 2W6CX 3N76A 2B4RO 4IDQA 5H4HA 3WLLA 3WWCA 4O3FA 3FVRA 3DL4A 2EWMA 2VT6A 4HBZA 5EP1A 3HKCA 2QT9A 1A7JA 1R37A 3OPXA 4E22A 2VLBA 2FGKA 3ISVA 2JLXA 5LWQA 1QHIA 4JFAA 4FUQA 1FNNA 5IYZF 2IDKA 3ZI7A 1O77A 3CF4G 1IEQA 2ZRGA 3Q3VA 2B1QA 2PGAA 5KDOA 4DR5B 1H9BA 5DM4A 1MX1A 3UB2A 4PAMA 4FT2A 3TQHA 3NAQA 1DIRA 1VJ0A 3BWVA 3A25A 1RJ9B 5NLLA 1XYGA 4B1FA 2V6BA 3QVWA 2ZJ2A 4D99A 4OOFA 5IKOA 2F64A 2FUEA 2QZ9A 1THMA 4BFZA 3LP5A 4AJ2A 4BNKA 3R7WB 3K71B 3IAUA 3P2JA 3QQPA 4DUZB 5A4JA 3EXFA 3L05A 1B73A 2YIMA 3GLRA 4II2A 1Z13A 2WJ6A 1LBHA 1FU4A 2NNLD 1WUJS 1U65A 4IDGA 3LYHA 3N70A 3ILVA 3HV0A 4ZGGA 2Z95A 4MGIR 1AURA 3HKBB 4I19A 2KW5A 1C41A 1KGSA 3G8AA 2Q5JA 2PJUA 4Q1EA 3M1AA 4OJQA 4YGYA 4COKA 1KI1A 3SK0A 2OB1A 2B98A 2WIJA 2Y6UA 3LYAA 4IG4A 4DAOA 4BX2A 1T91A 3TN7A 1RJDA 1ZD9A 2PAFA 5ARCA 4LCJA 4CN8A 3T1OA 2ZI5A 1T2VA 1EUCA 2WSIA 2ZBGA 4KIGA 1ZSVA 2EEPA 2WFAA 5AM5A 1ZGHA 2AE1A 3ZGZA 3EXAA 2NUBA 4IJ6A 3V7NA 1B3BA 5ICEA 3SZUA 5I9SA 2FEWB 1O95D 2WABA 3ETHA 3T1VA 5HIKA 1K5GA 1PJBA 4EENA 1RWXA 2X1LA 3M6VA 1U0LA 2G77B 5T57A 1H8HD 3WJ1A 4ZGBA 3JRNA 2RGGA 4DL9A 4PLCA 2C5BA 3ZK9A 3QUBA 5JAZA 4HPJB 3AIIA 3JVDA 5EQFA 2C4WA 1X7YA 3KL4A 1THGA 2P8SA 2NM0A 2PFKA 3RAPR 4LWOA 4CMEA 1JEDA 1N2EA 1C8KA 3LDGA 2AN9A 4WLVA 4M1WA 4PQEA 3L49A 4RTPA 1XN1A 3TK1A 4KWCA 3FBTA 2VBCA 1YFLA 4BWYA 4Z51A 3KD2A 4YAEA 1K2WA 5TPWB 4YO7A 3WO1A 3K0EA 5JS1A 4MI9A 3QMMA 1G4AE 1OY1A 5KJCA 4MV4A 2F90A 4QNNA 2MYTA 3GN1A 1VIYA 3EOAI 4IY1A 4KX5A 4ZQBA 2W70A 1A7KA 3GJ7A 1E4OA 1SXJA 1CIPA 1E9CA 2QV7A 5EL0A 3GP8A 1KZ7B 1Z47A 3F3YA 1UT8A 1UOEA 2ZUUA 4ND8B 4IGIA 1UEXC 1CY0A 3H2HA 1HI9A 5CXUA 4HNAB 1QK4A 4OKIA 5K4GA 3DTTA 4JKOA 1BFUA 3CPEA 3R2JA 4EY5A 4G8BA 1ORRA 4AO6A 1MO2A 1PL6A 5A5GA 1BEZA 4ZZ3A 1NPTO 5LQUA 3W5BA 1K1EA 2OZLB 3SHOA 1BX1A 4OQEA 1HT3A 1HY3A 1RWWA 3JAWB 1FRZA 1G8YA 1IEWA 2NX2A 1OTYA 1A0OA 4BQFA 5ITZA 4YK7A 2GHTA 1OBFO 1R8JA 3OLWA 1BS9A 1YONA 4YJKA 3W9BA 1PGNA 4YT2A 4N0PA 4BLSA 1E0DA 1X1CA 3L0SA 4HLCA 2OV8A 1KMNA 1DQZA 4KBGA 4N5DA 4NU8X 4RYDA 2Z9BA 5BYJA 1MAWA 2P1RA 3LLVA 5HUHA 4GD3Q 3IDSA 3A6GA 1WXIA 5DRTA 1IXKA 1ZONA 1B6SA 2HPZA 4NH4A 3O8RA 1CQIB 5AUPB 1C81A 3BILA 3F6SA 4N0EA 1Z5UA 2F3SA 1GA1A 4HNHA 1M54A 3ZGLA 1GL3A 4MVCA 4DLUA 2VJBA 1ARZA 2JGDA 2ZKLA 4ER0A 3LWZA 4HR7A 3A1UA 3EXIA 1SVNA 3IJEB 1MTZA 2ZI4A 3A2NA 2B94A 3DMTA 2PUDA 2O5RA 3BF7A 1TCUA 3MMSA 3X1XA 3N87A 2DJ5A 3A9WA 1DBIA 2OP0A 3N86A 2DQ4A 4LK3A 3FPCA 1GZDA 4HLUC 4V39A 4W5JA 5LLSA 1E64A 2XYHA 1ZNWA 3RVBA 4JWKA 2OP1A 5K3FA 5AKYA 2G88A 1K8YB 1QGDA 4JEHA 2IJGX 3T35A 1NJ2A 2FG7C 2OTCA 4RPJA 4OF4A 2E4XA 4WOJA 4X6UA 5AIBA 2GZ2A 1MB3A 4HNRA 3RVOA 4KWEA 5E3IA 3MXTA 3V4ZA 1AUPA 1S2DA 2WF6A 3V7WA 2C95A 4IDHA 1Y5RA 4P4NA 4PQYA 3C5EA 3M9WA 2WNHA 2NAPA 2PRSA 3UXMA 4RQTA 4O5OA 1IHDA 4CEJB 1SXJE 4FKBA 1P1BA 5H80A 3FPKA 3N53A 4DZRA 5CMLA 1T0UA 4RPHA 2Q2OA 4ZVLA 4O2AB 1N2ZA 3L0IB 4QNMA 4BOYA 4BX9A 1I3KA 4FJ1A 3PQ4A 4RTJA 2CXTA 1QAQA 1JZTA 4QEKA 1LJUA 1M6HA 3KAQA 2XXAA 3SZRA 4V1CA 5JRZA 1ISPA 2G36A 3RIHA 2WMNB 1A1VA 3I39X 1QHHB 1G8GA 3I4CA 2HB6A 3EUFA 4HYQA 4RNDB 3EVDA 1UQRA 4HWKA 4I36A 2FPIB 2WWXA 4NBSA 4BN5A 4Q03A 3BWYA 3FCXA 1XZIA 1SCUA 3NTXA 3PXDA 4RVDA 1NQXA 2DTDA 3H0EA 5K4HA 3JD2A 2GN4A 3ZJUA 3FZNA 3OJOA 3SS7X 2VDWA 1O03A 1DL5A 2NZXA 4AJOA 1WXWA 4KQKA 3CPHA 3OPYI 3E7DA 3NBYC 3KIPA 1CUSA 3NTVA 3K9NA 1JVBA 2LR0A 1ZAKA 3RSOA 2I1LA 4G85A 4YR7A 1AO0A 2C5LA 1IBMB 1JQJC 2Q62A 1TT5B 3AJAA 3D7RA 4BLPA 1SVKA 1XVTA 4RF4A 3AUYA 4MV5A 4C4OA 5BURA 4ZAZA 3UJ8A 1SKMA 1YTUA 1EE1A 2O3QA 1RXEA 3HVHA 2GJKA 3AONB 2OMKA 1QIMA 2QS9A 4GOLD 2H5JA 3AW8A 2MSLA 1DP4A 3N2ZB 4IIFA 4LYFA 1G38A 2Y6VA 1DMRA 3UIEA 1QVZA 4I1SA 1JSZA 1LI7A 1TGVA 4LDJA 2ENUA 4P7KA 5DNWA 2PD6A 4LYYA 3WWOA 1B0AA 4BP9A 3FTEA 2WY2D 2I2BA 1L4LA 3B1FA 3WLEA 4IQ8A 5DBEX 1CJVC 3F6RA 2YZ7A 3ZXYA 1CDZA 1ZJJA 3W5SA 1Z4IA 3J81A 2XF8A 3AUXA 1KI6A 3FCCA 2DX7A 1SCAA 1Y8RB 3ZLBA 1R9NA 2DQSA 3EYAA 4I9NA 4IRXA 1DKRA 2B30A 1R66A 2JGFA 3R7AA 1GPJA 3AU9A 5C35A 1G3IA 3I0MA 2YQZA 4XRRA 4TKVA 1SZDA 1GL9B 3OCXA 3R09A 4P7BA 3WRXC 4Z8XA 2B34A 1PCXA 3RJTA 1ZPDA 2DHQA 2NO1A 2P6NA 1VLVA 2H65A 3LPLA 5KNDA 1CYDA 3A28A 5JE8A 1KPHA 3CLTC 2GN6A 1JQLB 1WV1A 3JASA 3PZBA 3NNSA 1RBQA 3E81A 2OHJA 4G4IA 3UMFA 1XEWY 4IEIA 4YCMA 5DTMA 4U5XA 3ZGOA 1IOLA 7ABPA 3CH4B 3HDGA 3OEEA 1U80A 1B0ZA 4QHSA 5KSWB 4NOMA 4L4RA 4AJJA 4FNOA 1Q1AA 1R3UA 1TQDA 3WFJA 3PXUA 4YRFA 1YRQA 4F4HA 4IF4A 3IAS6 1ABBA 2O48X 2JH9A 4YRQA 5B2EA 2I22A 5JCOA 1RHUA 4KO1S 3UGQA 1E6MA 2GM3A 2J9RA 4G1MB 1DQRA 1RAIA 5E6SB 2LWIA 3IKTA 1GCUA 1NZDA 4I9GA 4TSKA 3SSOA 5ALZA 1W4BA 2W2QA 3SE0A 3GGCA 3H87A 5KCMA 1YA8A 4RPKA 1BW9B 4BO2A 2WJAA 4G0YA 3LUDA 2YINC 4EY4A 2GEKA 1YL5A 2XMRA 2JI9A 2XYRA 5A5DA 3UOWA 4D3XA 3JQ9C 2E5LB 1T10A 1XZNA 1O9GA 4MQ4A 4ENWA 1W8DA 4XWYA 5IM4A 5C1BA 2D1FA 4RD1A 2DUMA 3MWGA 1I1HA 4RHTA 4Z0PA 4E13A 4ESEA 4Y2TA 2Q27A 1PD1A 3L43A 3MUOA 4UBNA 1NTRA 2OCKA 3BL5A 4A82A 4G5RA 4URFA 4DMLA 5FUMA 5CA1A 621PA 3G1WA 5IW8A 4JLUA 4PF1A 3AHHA 2CBGA 2RHLA 3O3CA 2YJZA 5LU9A 3KKOA 5HJ7A 2GK7A 2Y8EA 3OKFA 5FADA 3DEFA 3HSSA 4IHJF 2I2DA 2C94A 5JJ5A 3ZU4A 1U1CA 1EDEA 1U1EA 2VDVE 2Y1DA 3C5CA 4L5YA 5KWSA 3OP4A 2HK9A 1FJHA 3DG9A 3PWSA 4Q3OA 4DIEA 2A30A 1RRCA 4H18A 3AFMA 1Z6AA 2ZZMA 2ACEA 2B37A 1W93A 2G06A 2Q50A 3OZ7A 5E4TA 1KYXA 4QBHA 1CUZA 2H1SA 4HQ6A 3ZJYA 1X14A 3UWKA 1REQA 4G0VA 5CDTA 3THWA 1EWYA 4TWAA 1A9ZA 3VO8A 2QTVB 4Q7EA 5JVDF 1CG6A 4K9NA 4MRPA 2QM7A 3LDUA 1NE2A 4CCYA 4DRYA 3I12A 1P9WA 2XGJA 1SZPA 3ONVA 4EM6A 2QM0A 3PJFA 3L8EA 1OZFA 2ZIXA 4CQMB 2IHTA 2ZULA 4DMFA 3L1JA 3Q85A 1AUQA 1TVKB 3QKUA 3GIWA 1O6GA 3DZ8A 5AW7A 1R18A 1JW9B 1G3RA 1OBCA 4BL5A 5C7LO 1E1RD 3ZHSA 5GJWC 2JFNA 4E70A 2IS1A 1Y3AA 1HM5A 1J56A 5JECA 2QRNA 1MG0A 3WP0A 4E09A 1UKAA 2G9RA 3CT4A 3NH9A 4GAEA 4GYJA 3ZY2A 4F8JA 3OQBA 5BW4A 5EHGA 5ECDA 1F2UB 3QI7A 1DEXA 4AWXA 5JAPA 4UOEA 2AKEA 1WETA 1NJ6A 4BZWA 3AKZA 4PIVA 2XYQA 5BXQC 3S2GA 5K0FA 2O3TA 2CV1A 5EJIA 2AMYA 2WQ6A 4CTOA 1QRTA 4A9AA 3D8SA 2FFHA 4LRYA 4IZIA 2I4IA 1DXOA 3RS0A 3U62A 4LNHA 4BUZA 3TL2A 1LFDB 3AFOA 3QIVA 1ZN7A 1X7YB 2I6FA 4CMEC 1RZRA 4PG6A 1QTNA 4L5BA 2YYAA 3I1IA 2G72A 2IL1A 2PRIA 3V9PA 2EF1A 3MS4A 3HFGA 1O6CA 1CNFA 3Q40A 3T4UA 1EUQA 2AS0A 5HILA 1Q16A 5BOSA 1EUZA 1MH9A 1EZ4A 4K6FA 4QUDA 5A5FA 1KYZA 4L78A 3B52X 1T36A 2PA3A 1SXJC 4HNTA 1SG9A 1FLVA 4ZVUA 3MG9A 2OESA 2ZB4A 4CL3A 4CR7A 1SXJB 3K35A 1KK0A 1DQYA 1X1TA 3CVXA 4BVLA 3GZJA 1ZH6A 5SZHB 5CNKA 1XT6A 1Z0UA 3LSTA 2D0PB 4C3OB 3AM4A 3F3SA 1XEFA 4MPPA 4PE5B 1DUSA 1DT3A 3RS2A 4YP6A 2C8KA 4ZOLF 1TF7A 1X2BA 1TCBA 1XJWA 5TQVA 2IHZA 3LX5A 4S1PA 3P2YA 4RF5A 2OGTA 1JVSA 4E15A 5ITZB 3LRPA 1IDN1 4ZKDA 4N47A 5F3WB 1E1CB 5FYDA 3P9XA 2C42A 3SWWA 1L5SA 4D6YA 3LP8A 5L95A 1JLMA 1L7MA 2QQEA 2CMFA 4ER5A 3U61B 3KEOA 5FNVA 4KEAA 2BL4A 2H9IA 1YR8A 1NF9A 5ESXA 4YEDA 3DLIA 1WB5A 2FZKA 2H4YA 3OJXA 4R1OA 4UU8A 4ASUD 4EUNA 5IN5A 1R8QA 5A71A 5LIRA 5EWLA 1N78A 4TXJA 1Q20A 1D0SA 1P2DA 1QH1A 1RXUA 1LPPA 3GCXA 3DMTC 4DE5A 1MGOA 2YN4A 4LSWA 5CXXA 5JAHA 1M7GA 1WUYA