3RJ9A

Structure of alcohol dehydrogenase from drosophila lebanonesis t114v mutant complexed with nad+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNVTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
publication title An intact eight-membered water chain in drosophilid alcohol dehydrogenases is essential for optimal enzyme activity.
pubmed doi rcsb
source organism Scaptodrosophila lebanonensis
total genus 96
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rj9A00
1B26A 1ZMTA 4ND3A 2AW5A 4DBVO 1XCBA 5JXWA 3LQFA 5G4KB 1SAYA 2OL4A 2NTNA 4CM1A 2ZK7A 2X4GA 5EMHA 1W6UA 5THKA 2DBRA 1QYVA 5A5EA 2CNBA 3FTNA 2D0IA 5EINA 2HMVA 4R1UA 3GNQA 1Q7BA 3NUGA 3B1FA 5H81A 3NTQA 5DZSA 2FWMX 3GDOA 5AQ1A 1LDNA 1BRMA 3KYDA 1TA4A 3E18A 4RQUA 4CR7A 4BO0A 4E2YA 1IOLA 3GHYA 2J6IA 3RUAA 4F3YA 3PHHA 3DBRA 1UZMA 5C7LO 1E7MA 1R4NB 5IDWA 2YV2A 4FOOA 4FC7A 1VM6A 4B7UA 4CM3A 1NPTO 5ICMA 2QHXA 1YOVA 4BMVA 3ICPA 3UXYA 3WBBA 3QWIA 3NDJA 1ARZA 2NVUA 5DT9A 3GMSA 4MIYA 2D59A 3DWFA 2Q3EA 3I6QA 3KLPX 4CQMA 4IXTA 1H6AA 4DMMA 3GAFA 1CEQA 3BTVA 2Y0CA 4NHEA 1Q2XA 3TZKA 4PVDA 2IZ1A 3C1OA 3GZ4A 5JMWA 2EKLA 4XDZA 1N1EA 3DHEA 4N5NA 4L4RA 3VPXA 1UXJA 4XYLA 1EE9A 3B70A 3DOOA 1KOLA 2GYYA 1ZXLA 3K2BA 4CM4B 5JNLA 1LC0A 1SO8A 5COQA 5EQFA 3WLFA 1PGNA 1ISFA 1PWZA 1A9YA 1H2BA 3NT5A 4XQEA 4J1SA 3LYLA 4TVBA 4RDIA 4CLRA 3ABIA 1QMGA 1B3BA 3STHA 1ID1A 1M6WA 2AQIA 3AM3A 4IDFA 1QG6A 1ZK2A 3DBLA 4YJFA 3H2ZA 4HP8A 2OXIA 1U7HA 1FDWA 4OO3A 2P9GA 3LT0A 3WG9A 4BNJA 2UVDA 4KQWA 2X22A 4K26A 2ZYDA 2HAEA 3DXFA 3JYPA 1GEGA 4R9RA 4UVEA 3B1JA 3GK3A 1ISIA 5JAQA 1IY8A 5CPBA 4PLFA 7MDHA 1DIRA 4K1LA 2OO5A 2PKRA 3ZNNA 1WWKA 1X1EA 1UDCA 4UUNA 2V6GA 1LA2A 2C2YA 2ZQYA 3L07A 1TVEA 3ZV3A 1HE3A 1Y5MA 1LC3A 4YJGB 3GG9A 1NAIA 4A0SA 1M67A 4D45A 2VZ0A 1YONA 3OMLA 4J7CA 5A9TA 1CJCA 4DVJA 3IAHA 1PU2A 2Q2VA 1D1TA 1LRJA 1E6UA 1PJ4A 3MOIA 3OEYA 3GN2A 1YDWA 2Q46A 4WLFA 1KEWA 3ZV5A 3QP9A 3K96A 2AQ8A 5KKCA 4PLCA 3UCEA 1OFGA 4Y9DA 1L7EA 4G81A 3D5QA 4RO0A 1XLTA 5I9MA 4CL3A 2I67A 3TRIA 3ORFA 1JDJA 2OOSA 3GPDG 3P2OA 1LDBA 2GRAA 4R51A 2EJVA 1RJWA 4WK6A 3NKLA 2QIOA 1DFHA 1KIFA 4MKXA 3NGLA 2BD0A 3JQ8A 2EERA 3LLVA 4CPDA 1M2WA 3HUDA 1FMCA 1Q0QA 1SCUA 1ZVMA 2V6MA 3WTBA 4RLHA 4E5NA 2G0TA 1KEVA 4QFCA 3ZGYA 4KUEA 4YCAA 3W8DA 4PRKA 1H6DA 4QXMA 3DZIA 1U8XX 2P2SA 4XRGA 1YH3A 3TOZA 2IRWA 3M2PA 4FFPA 4JJGA 2Y1EA 5I8WA 2HQ1A 2FZEA 3QWFA 1OZAA 5LC1A 1N5DA 1XGKA 1NNUA 1O6ZA 1U5CA 3I83A 1H5QA 3TDKA 4A27A 2Y99A 4BO5A 1GYRA 1X7GA 1PZHA 4LCEA 5EERA 1Y6JA 4GX1A 3PK0A 4R41A 2QYSA 5TGDA 4J91A 2FRDA 4IQ8A 4KDEA 2RH8A 3QE3A 3N58A 4MVJH 2EP7A 4JGBA 4Q3BA 5HRUA 4L74A 1WDMA 3B20A 3BYZA 1F8GA 3AM4A 1R37A 1Q7GA 2B4QA 4RDHA 3TPCA 2NV6A 4Z6KA 5CG2A 3WDSA 4ID9A 4YQZA 1DXYA 4BNUA 2P4QA 1DEHA 1K6JA 4R4JA 2NU8A 4D42A 4YT2A 1RYDA 4RCVA 5A1TA 1C1XA 3WJ7A 3P2YA 5F5NA 1ENPA 5JMPA 3CMMA 1M76A 3PVZA 2YY7A 1ZSNA 4LSMA 5KVSA 4W7HA 3HADA 2CF6A 2J3IA 2J5QA 1DLJA 5JAIA 4NBWA 2GZ1A 3AY3A 4P8RA 1UJMA 3RIHA 1GCUA 3IDSA 2ZTMA 3F1LA 3NT2A 1T2AA 1WW8A 5DBFA 4ALNA 1IUKA 5CDSA 3OJFA 4J7XA 2NNLD 3KSUA 3WR5A 1SB9A 4EUEA 2W2KB 5BR7A 2AG5A 3ONFA 3BMQA 3GVCA 1PQWA 3H9EO 3D3WB 4DIFA 3GC6A 2PD6A 4II2A 3K30A 1X0VA 3CEAA 3QWHA 4OAQA 3RUEA 1G1AA 2P5YA 1HRDA 4BL5A 5CDYA 2EGGA 2GF2A 1KVSA 3O8QB 1LUAA 1PS8A 4BNLA 3RUFA 1NASA 1RM4A 2GN9A 3JYQA 3TL2A 3F5QA 3VOSA 2PZJA 5CEJA 4FFLA 5K0ZA 1NFRA 3HE3A 4BNIA 3ETDA 3CPSA 1X13A 5L7WA 1OI7A 1DAPA 1HZJA 1EFLA 1OC2A 2CDBA 4L76A 1XDWA 2DBVO 3RI3A 3DL2A 1BSVA 5FYDA 2WMDA 1K0UA 3ENKA 4YAKA 4F6LA 3VPHA 3AU8A 5TT1A 2V6BA 2YDXA 3N7UA 2DPHA 3E5MA 1J5PA 1PTJA 1VSVA 1SB8A 1LLDA 2P9CA 3AUAA 5GZ3A 5DDIP 4KDFA 4MP6A 2VHXA 5JSFA 3NEPX 3E9MA 2EXXA 2H1SA 1GAEO 1YB1A 4JIGA 5CP8A 5KVVA 4KTVE 2Y1GA 4DRYA 3WYEA 4WNCA 4CM9A 5TLSA 4R1TA 4BNHA 3JTMA 4Z9FA 5KVCA 1BW9B 3UGKA 4G2NA 4WLOA 4H15A 4XZ3A 3HB5X 4C4OA 1JA9A 1J49A 3HFGA 3OFSA 5T8KC 4A5OA 1T25A 1B0AA 1EE2A 4PZCA 4DWVA 4BO9A 4EYEA 2FR0A 4IGFA 1LJ8A 4O6VA 3IJRA 2O2SA 4CMIA 2XOXA 3QY9A 3ZWMA 1PJBA 4L8VA 3LC2O 4BGVA 2JHFA 2RAFA 3SX2A 2DPGA 1UXGA 1I3KA 4MVJI 3PJFA 4FBGA 4DPMA 3NX4A 3WICA 1GQ2A 1O9BA 3VKVA 2PV7A 5ENVA 5T6BA 4HBGA 3AW9A 2FPPA 1ZIDA 5T8KA 2OP0A 1VJ0A 2WDZA 2RHRA 4NZ9A 4NBRA 2X0NA 1GQYA 4E13A 3T7CA 4XCVA 2VUUA 3H3FA 1EQ2A 1EDZA 1WXDA 4BNYA 3PQDA 3ETGA 3MJTA 4GI2A 5KJEA 1DIHA 3FF4A 2J8ZA 1ADFA 1ZFNA 4HFNA 3TNLA 4K6CA 3F1KA 5T5QA 2XXBA 1U3TA 4PCVA 3I9LA 2PK3A 4J43A 1QYXA 4I1IA 5EJ2A 4KQXA 5FWNA 1OOEA 1PJSA 5LCXA 3E03A 2IZZA 4CV1A 1BXGA 2FR8A 4YAIA 4MIEA 5EQDA 4BNZA 3B6ZA 3GRPA 3U4CA 2ZCVA 3ROKA 4CMAA 1D8AA 3JQ7B 4NBTA 3RC2A 3VZSA 3ZCXA 3GVPA 4MKZA 4EBFA 2X6TA 4TWRA 1U8FO 3WXBA 2X7HA 3TF5A 4TRJA 2GSDA 3VTZA 4NJMA 5TX7A 3Q3CA 1CYDA 3KXDA 1HDXA 4NIMA 3GVXA 1DRUA 2RIRA 3CXRA 3FHLA 3ADOA 1YQDA 3JQCA 1BVRA 3U4HA 4IDDA 2X5KO 5DNAA 4R5HA 1HE5A 7ADHA 3PWKA 3JYLA 4I9NA 4YTEA 3MJSA 3BAZA 5CDTA 5EL0A 5JS6A 3HWRA 4YQYA 1KC3A 2LDXA 1QYWA 2TMDA 3H5RA 4G5HA 3CZRA 5G4KA 4UUMA 1A4IA 3DMYA 4PG7A 4RV9A 5F1KA 3IP1A 2AXQA 2H5LA 2BGMA 3GRKA 1RM3A 3ASUA 3ZH2A 4AJ2A 4INAA 4XX0A 1DRVA 3CE6A 2GGSA 5CDGA 2I3GA 4HFMA 5THQA 4IZHA 3JQDA 3FR8A 1DIAA 1DIBA 2OP1A 1E1NA 2DVMA 2UUPA 3OICA 3I1JA 4J90A 4MO2A 5A3JA 1Z7EA 3C24A 1P45A 1HT0A 1C3VA 2EKQA 2BI8A 3TZCA 1J4AA 1FDTA 3UAGA 1R4NA 1GU7A 2H6EA 3QVWA 3TOXA 1B8VA 4WE3A 5DBIA 1B8UA 1I01A 4XWYA 3UW3A 1JAXA 4CMBA 1I8TA 3WNVA 1Y8RA 1CQJA 5A02A 1UAGA 4JK3A 4J2HA 1B14A 1U2GA 3LSYA 5B37A 1Y9EA 1NM5A 4HXYA 5FI5A 3WGOA 5AOVA 2RCYA 4IMRA 4J9UE 2D5AA 1S6YA 2Y0DA 4ALMA 4OL9A 1PL8A 3WFJA 1B15A 4RL6A 4JXKA 1FDUA 4YACA 2W2LA 1OBFO 3IKVA 4BKUA 2V6FA 3L9XA 4HY3A 1E92A 5EIOA 2X23A 4CODB 2ZYAA 4DMLA 4CR8A 4W82A 2OMEA 4MINA 4YRAA 4DYDA 4E5KA 4CM4A 4YAGA 5K6AC 1DC4A 3GF4A 4GKVA 3UFXA 1NX6A 3A4VA 4ZGWA 2X58A 4BO4A 3VDQA 3WGHA 1VKOA 1TLTA 2O3JA 4M54A 1UH5A 3GN1A 3BHMA 4B8ZA 4YJDA 1CQIA 5TQVA 4KWHA 4NI5A 1NVTA 1TEHA 3AM5A 4PLVA 3D4OA 4Z0HO 5JYDA 2X5OA 3H9QA 4ALKA 4E2XA 3RFXA 2PWZA 5IXYA 5A3VA 1GUFA 4R9SA 5I7VA 5H83A 1KY4A 5K6AA 1EUZA 2G1UA 5JAZA 4FFRA 5BNTA 3OJOA 4R3NA 1UDBA 4XIYA 5AXCA 4TROA 2JCXA 2QYTA 4QO8A 2IODA 4RGBA 3DONA 2QZ9A 3KO8A 4Z9XA 4IY1A 1Y5RA 5GY7A 5JCJA 2C59A 1ADGA 1PL6A 2AE1A 4UUPA 1T26A 2Y67A 1FDSA 3U3XA 4YJGA 3C1AA 3ST7A 4CQLA 3VVBA 1LDMA 3DZBA 4BB6A 3WWYA 3RASA 1LSOA 3BHJA 2HJRA 3S8MA 4Y98A 4ND2A 3I9OA 1XKQA 4PN3A 2X86A 4MVJD 5TC4A 4UAGA 1LDGA 5F1OA 1JVSA 1B2LA 1F14A 2VWHA 3AWDA 1LXCA 4C7JA 4R1SA 2NADA 3DR3A 5A9SB 1OC4A 3FN4A 2AE2A 4WJZA 4FS3A 1UZNA 2VTEA 2DTXA 4FPXA 1XEAA 3VPGA 3F4BA 4GLOA 1SEVA 4XD2A 4YDRA 4E5PA 4FOSA 3ENNA 4E5YA 4YYZA 2DBZA 3HSKA 3QVXA 4PLYA 4CV0A 4J2OA 3JCZA 3C3XA 4KMSA 1N92A 4IIUA 1LQTA 4CMGA 3CSDA 4OOEA 4IDEA 3DZJA 1DDOA 3FBGA 3HG7A 3Q1LA 1LBEA 2A94A 3I3OA 1KY5A 1EVIA 1X7DA 1W8DA 2IXBA 1BDBA 2JD0A 4FFMA 4I08A 4WCDA 5DOZA 5F21A 5A9RA 2VNSA 4XYBA 2WWRA 2YFQA 1DSSG 2BRUA 3KEQA 3Q2IA 1KS9A 4WLVA 1KVRA 4XQCA 2O4CA 3I4CA 1HZZA 1YO6A 2AHRA 2NVBA 2E6UX 4IM7A 1XR3A 2V65A 1XU7A 5IZ4A 3X2EA 3I9JA 1LDEA 4DQUA 3E5RA 2A9FA 4PGFA 2OBNA 1EUDA 2CVZA 2ZATA 4OQZA 3DAPA 4XRRA 3SJUA 3L77A 4IPTA 3WMWA 2UUOA 1A7AA 1WVGA 3TZ6A 4BVAA 1AHIA 3SJ7A 1HDOA 3IS3A 3ZU5A 3QVSA 3WYBA 3GOHA 3IQDB 1M6HA 5JAMA 4BQPA 3GEGA 1H2HA 2PKQP 3DFUA 3ZWWA 4LMRA 3NJ4A 3KZVA 4I9HA 1LEHA 2PD3A 2C82A 1T24A 1EBFA 1A71A 4B4VA 5IG2A 4FJ0A 4N7RA 5FI3A 1QKIA 3DAFA 4TMFA 4W9NC 4A26A 1PX0A 1XHLA 1GR0A 1CIVA 2DT5A 4WASA 2B37A 2NUAA 4A03A 4UVIA 5L7TA 3MWDB 4GMGA 4PVCA 4KWIA 5J23A 2WD8A 1RWBA 3V2HA 2W2KA 2BFAA 4XGIA 3PYMA 3PHIA 5BSGA 5IZCC 1ISHA 3D3WA 4ONEA 1N7HA 1B8PA 1CRWG 3BMOB 3F4LA 4XB2A 3Q11A 4LRSB 5AXBA 5CFZA 2VNAA 2X1HA 4Z3KA 4HKTA 4Y8VA 5HA5A 1KBZA 3T7EA 4MVJA 4W9NA 4NFYA 1D4FA 1JQBA 3LT1A 4BO2A 3F47A 2PGLA 3DBVO 3INRA 3OA0A 5GZ6A 3SXPA 1EVJA 4NJOA 4ZQEA 1A27A 4NH4A 2ZTUA 3OBBA 3AI3A 4CUKA 3M1LA 2BHLA 5DN9A 2ILTA 3D5TA 3LU1A 4RPHA 4LN1A 5TJ9A 3WQQA 2JD2A 4K9DA 5IZCA 4XYMA 1MG0A 1E3JA 2JCVA 5IXSA 1ORRA 3NDIA 2HK8A 2W8ZA 3V5NA 2J5KA 4Y6PA 1V3VA 1IZ9A 4FIZA 2GPTA 2Q50A 4GAEA 2AG8A 3CUKA 3S2GA 1QV7A 3AY7A 4XGNA 2I66A 3LF2A 4UREA 4Q3CA 1QSGA 3BMNB 2AQHA 1E3SA 1K6IA 4CLXA 3G49A 1R0KA 2YQ5A 2Y68A 5T67A 1GY8A 3ZV4A 4D43A 2PGJA 2R00C 5TIIA 4RVSA 3A14A 3UF0A 3ANMA 1LU9A 1I36A 2CDCA 3HDHA 4U6SA 1BW9A 2OORA 4H16A 4M49A 5KKAA 5K9ZA 3ZI0A 4J1TA 1VC2A 2BMAA 3JQGB 5JCXA 1E7SA 3NRCA 4BO7A 4IDBA 3WFIA 5IJZA 4QO7A 4O59O 3ZHXA 2UDPA 3RC9A 1NHGA 1FJHA 2DUUA 1D3AA 2Z1MA 4DGSA 1Y7TA 3H2SA 1C0KA 2F00A 1JU9A 1LI4A 4GSLA 3MWEB 5KTKA 1PJ2A 2R00A 3HFSA 2GASA 1M66A 1YGYA 1JLLA 1KETA 3GEDA 1YQXA 2VWPA 3MJ4A 4J49A 3BMCA 4A73A 4Z9YA 4UVHA 3MTGA 4F45A 3I9NA 3D3EA 4ND5A 3GG2A 2B4TO 3IP3A 4QFDA 4D3SA 2DC1A 4AJKA 3ROQA 2NACA 2D5CA 2VRCD 4YAJA 5B4UA 3ETEA 3H9UA 3INGA 4OM8A 1P1RA 2VWQA 2YZ7A 3PJEA 3DZFA 3IUPA 3L6OO 4NNJA 5EPOA 1PIWA 3FPCA 2DAPA 3W6ZA 2CVQA 3JD1A 3QA9A 3R0IA 5I9LA 3KYCA 3CKYA 1PR3A 4CM6A 1ZBQA 1Z73A 4PG8A 1E6EA 4A2CA 1V3TA 1AN9A 1RPNA 3JYNA 4D46A 3WSVA 2VYND 4IIVA 2AA3A 3KBOA 1PZFA 4CR6A 1Q1NA 3V1YA 3PP8A 2RBEA 1I10A 1W0CA 1O8CA 2NM0A 2NU9A 1BXKA 3AUUA 1G0OA 2VQ3A 2E82A 4AJNA 4XIJA 2AQKA 3IIEA 1HYEA 3LZ6A 4IMPA 4MOWA 9LDBA 2Y1FA 1ZJYA 3RKRA 3UHAA 1ZSVA 3JQ7A 1W4ZA 4BUCA 3QWBA 1GTMA 1MG5A 1ML3A 1EZ4A 3RBVA 1U5AA 2JL1A 3QQPA 3DQPA 4JQCA 3X2FA 4BGIA 5JDIC 1TT5A 3JQ9A 2XAAA 1K5HA 3I4FA 3PIIA 2EG9A 4CM7A 2SCUA 2Q49A 2UV8A 4PLHA 3JYOA 4YPOA 5LDGA 4DA9A 3C1TA 4E4YA 4B3HA 4J3FA 1XWFA 4GQAA 4BNFA 8ADHA 5A06A 5CAEA 3DHNA 1E7YA 1LTHR 1TB4A 4MP3A 4QUKA 1Z74A 1C0PA 2YYYA 3ITKA 4MVJG 3FNGA 1EEHA 1MA0A 3EVTA 1DJNA 2O50A 1P9LA 2FMUA 1MLDA 2EW2A 5JDIA 1Q0LA 3FR7A 1HDZA 2BGLA 2J3HA 3PHGA 4IJUA 1T1SA 4WEOA 1DIGA 4E32A 4YJHB 2NTJA 3UH1A 1H0KA 2GN4A 1U1IA 2WE7A 3L0DA 3PRJA 5TF4A 4Z0PA 1V9LA 2ZTVA 1NPDA 1I2CA 3GT0A 3W8EA 4CUJA 1ZK4A 3C7CB 4FFNA 4NK4A 1E1LA 1I32A 3WYCA 4JROA 4ILKA 3H5AA 3K31A 1T2DA 3EW7A 3QIVA 3SBOA 3VH4A 1NVMB 1H6CA 3RKUA 3QJ5A 1EVZA 1YJQA 3VTFA 5LDHA 3GH3A 3W4JA 1CDOA 3LF1A 5MDHA 5JY6A 3RUIA 4NU6A 1D7OA 4PG5A 1DC5A 3ZWNA 1YVEI 2VRCA 2XXJA 4DXHA 3NDRA 3HB4X 4DLAA 3TFQA 4XJTA 5BNFA 3ROPA 2X9NA 3OQ1A 3JQAB 3ZWOA 2ZCUA 4NFHA 3KYDB 1NR1A 1DB3A 3TZHA 4BNXA 2UYYA 4YT4A 1LLCA 5L53A 2I99A 2VRBA 3HDYA 2YV1A 1ZEJA 5KJFA 3IOYA 3L6EA 1AUPA 2VYNA 6ADHA 1TXGA 1EK6A 4WECA 4YB8A 3U49A 2C5AA 1YOVB 4QECA 4YBZA 1EDOA 1LDYA 5IN5A 3LT4A 4GMFA 3FNFA 4IJVA 1HXHA 2C5EA 4CLEA 3KETA 3WGZA 4WUVA 3WQSB 5ENDA 1XA0A 2ZJ0A 4J0FA 4WLEA 1JW9B 4CMEA 4AJ1A 2XF8A 3PYLA 3GLQA 4ALIA 1J6UA 1VL8A 3K8ZA 2OGUA 2VHWA 5TJHA 2C7GA 3ROMA 1IPEA 1Z45A 3AUSA 4M8SA 2GERA 4D0RA 3PXXA 1HKUA 1P0FA 1E7WA 1SOVA 1Y8QB 1K2WA 2WYWA 1ONPA 3PZBA 1N9GB 1WAMA 2DU8A 1I33A 1NWHA 1GADO 1RM0A 2GDZA 2B5WA 3LT2A 4CJXA 1I24A 3PGJA 3O38A 4ZICA 1V0JA 1YB4A 1KVQA 2HLPA 1YXMA 3QVOA 2VHYA 3OJ0A 3LK7A 3RFVA 3RSHA 5JYEA 4D44A 1DAOA 4HV4A 4Z3DA 4BNGA 1NQOA 1I30A 3RUCA 3S2FA 4BO3A 1HTBA 5L51A 4NR0A 4HFJA 4OH1A 2HKIA 2EHDA 1O94A 4L75A 3RU9A 1L1FA 4LMPA 3V8BA 1SOWA 4NBUA 5COAA 5B12A 1NP3A 1GZ3A 3Q2KA 2O7QA 4WCFB 1PWXA 1PGJA 1OAAA 2BFMA 2JAPA 3NGXA 4Y6SA 2YW9A 2A4KA 3KVOA 4AJEA 4A10A 4WEQA 3GPIA 5A9SA 4OXNA 3TN7A 4D0SA 3RC1A 1H93A 4M87A 3FWNA 3U4IA 4O1MA 2GR9A 2EGHA 1Y81A 1GV0A 6LDHA 1DLIA 3EC7A 2PA3A 3NJ8A 2VT3A 3H5NA 1YS4A 4FCCA 3IC5A 1SPXA 3OA2A 4K6FA 3U4DA 5COBA 1GZ4A 3EYWA 1KEPA 3GEMA 2EF1A 1PS9A 3QLJA 4LSWA 4P4LA 4UEJA 5FFFA 5JFOA 3DOJA 3F5SA 5A4DA 1C14A 3FBTA 3RU7A 4D7AA 3BA1A 1U4SA 4O63O 3DDNA 5HWSA 2ZB4A 5AVOA 1H94A 1ISMA 1P33A 1P77A 2HUNA 5JC1A 3H7AA 3PDJA 5L95A 3AY6A 2WM3A 4IINA 3VC7A 4R69A 4PZDA 1HSZA 1YJ8A 4P4GA 2O4UX 3TFOA 2ZKLA 5BSEA 1MC5A 4ALLA 1IYZA 2VUTA 1DC3A 1EMDA 4U6QA 3HDJA 1F0YA 4U0JA 3FSRA 4J4BA 4L4XA 1D1SA 1ISJA 1NFFA 3GHHA 1KERA 2VCYA 4WOJA 3OP4A 1ZEMA 4R16A 2IZ0A 4OMUA 1SNYA 3V2GA 1R4MB 3DTYA 1I2BA 5I7SA 4Q39A 3C7DB 3LLSA 2OFPA 1PSDA 4ZRNA 1QLHA 3PLNA 1J0XO 4XYGA 3V1UA 4BNNA 5GMOA 4ZRMA 4DBZA 4R68A 1XU9A 4FQ8A 2OZPA 4RLSA 1ZSYA 4FGWA 4IQGA 3KLMX 4CV3A 3GAZA 4L73A 1JVBA 2WYVA 5G4LA 1T4DA 2UAGA 4ZQHA 5I7FA 3AU9A 4UVGA 2B83A 2X9VA 3T4XA 4M89A 5JW6A 3QSGA 2I6TA 1XQ1A 4BO1A 4EJ0A 1IHYA 1UP7A 3FRJA 4J1QA 4JBGA 5G0UA 5TT0A 3UVEA 4OYRA 3DB2A 3ULKA 1E6WA 4LVCA 4PG6A 5L4NA 3MJCA 4OSOA 3I23A 4OOFA 1MFPA 1GUZA 1P1HA 3L4BA 5KJ1A 4LK3A 4GH5A 2NTVA 4GKBA 4RF3A 2P68A 3F3SA 2Y1DA 1VRWA 1WDLA 3VZQA 1ZZEA 2G76A 1P1KA 4Q3AA 1GEEA 2CY0A 3ASVA 4OQYA 3GVHA 2HK9A 2I3AA 5I7EA 4RPGA 1ENZA 3ANLA 3PIDA 1P31A 3LDHA 4DL9A 2PZKA 2EWMA 4WOKA 3PJDA 4EGFA 3COSA 3M6IA 4PLZA 1DFIA 3NTOA 4HNGA 4IJWA 2QW8A 1W73A 5ER6A 3ZU2A 4DREA 4QQRA 3ZU3A 2HRZA 1VI2A 1S7CA 2D8AA 4OGWA 4RPLA 5MGBA 1ADBA 3VH2A 3JQEA 1EUCA 3BMNA 1F12A 1E7RA 2QRJA 4RPJA 1DOHA 4YT8A 3OQ6A 3I52A 3WNQA 3GZNB 4GX2A 4ZQFA 1MX3A 3OQBA 2WD7B 3A06A 3WX0A 4BB5A 4TVOA 5CG1A 5HS4A 4HWKA 2ZB7A 3U09A 2H63A 4MP8A 4CMJA 3I9MA 1ZJZA 1MV8A 2B5VA 2NU6A 3ZNOA 3JQGA 1AHHA 2GCGA 2ZB8A 2P91A 2YDYA 4TRMA 5DULA 5B1YA 2Y1OA 5CDUA 4UUOA 2HMWA 2DFDA 3A9WA 8LDHA 2I5PO 3L6DA 3QWAA 1VL0A 3EGOA 2WYUA 1HSOA 1FK8A 1IB6A 1RM5A 2FSSA 5HBRA 3VH1A 2DBQA 3VPFA 1B7GO 1QORA 1Y1PA 1WNTA 2NQTA 1KC1A 3K73O 1VSUA 2NSDA 3RC7A 1YWGO 3W8FA 1U3UA 3ZHBA 1HLPA 1T4BA 4BGUA 4R54A 1YRLA 3MCVA 4IDGA 3CH6A 2O23A 3VH3A 4TRRA 1MC4A 3ADPA 1SBYA 1TT7A 2HDHA 2YHIB 3EUWA 2CFCA 4RQTA 3JV7A 3WIDA 2ET6A 1HLDA 4BNKA 4QT0A 5IN4A 4J9VA 2JJYA 1GD1O 4XYEA 2CF5A 3RJ9A 2IDZA 2D4AA 1V3UA 1ZH8A 4MKRA 4XJSA 5CEEA 2E37A 2Y66A 3S55A 5L7YA 2VYVD 3JQAD 4CLDA 4PIVA 3E48A 4CMIB 1CF2O 1NR7A 2EJWA 1P3DA 3MJVA 3DZGA 1I3MA 1N2SA 2JD1A 2HU2A 1XG5A 3JD4A 3U9LA 2FPIA 4I9UA 3PPIA 1X1TA 4E2WA 1E7QA 2AEFA 2G17A 2AEJA 2X0IA 3ZNPA 2WJPA 4ZVVA 3DMTC 3KB6A 3JQ6A 4C7KA 3EMKA 4KZPA 4EEXA 3D7LA 2PTGA 3LVFO 5AXDA 1EK5A 4N5MA 1GDHA 1Q0HA 3OF2A 2GO1A 3RJ5A 2GZ2A 1LNQA 2PY6A 4AG3A 4DLBA 4HX5A 4YRBA 5IDQA 3K5PA 1WP4A 2E4AA 4TKLA 1BVUA 1LX6A 4D41A 3NYWA 2JKVA 3NT4A 2HSDA 1N7GA 4NQZA 2DKNA 2VT2A 1E0DA 2YFHA 3DMTA 1NQAO 2FHSA 3G79A 2IEBA 1M75A 1LRLA 1E3WB 3FD8A 4Q3NA 4ZQBA 4U8GA 1KYQA 2DUWA 5CEFA 1U2DA 5KJCA 3CMCO 3K2EA 4PLWA 1YDEA 1E3EA 3AJRA 4B8WA 2O48X 3GDFA 4JX8A 3P19A 2JCYA 1I3NA 3DTTA 3R1IA 1UXIA 4W4TA 5EN4A 4ZJUA 2D1YA 2Q1TA 2O3TA 4D3DA 1HEUA 1VL6A 4QEDA 3W6UA 4YJHA 2BI7A 1JAYA 3VHRA 4W99A 1PJQA 1U4OA 3ANNA 4WGGA 4XA8A 3VPSA 1R66A 5L40A 1NHWA 3VVCA 1VPDA 2DM6A 4NJMB 1VLLA 5T64A 1CERA 1HE2A 1P1IA 1XYGA 2YQ4A 3EK2A 4S3MA 4B3IA 4FJ1A 3I5MA 1R6DA 4J4TA 5DBGA 4ZHSA 4ND4A 1NVGA 2Q1UA 3IKTA 3PHLA 4XQGA 4CMCA 5FEUA 3ONDA 2NWQA 3PEFA 3BTSA 4IXWA 5DCWA 2Q45A 1BDMA 4RF2A 4UEKA 1WLYA 4CMKA 1AXEA 5BSFA 3GGOA 2IXAA 2W98A 3DC2A 1GPJA 1QV6A 2A92A 4TZTA 4BNTA 3GFGA 4BMSA 4FJ2A 3FWZA 5HM8A 3JD3A 3ZW9A 3JD2A 2NVWA 3H3JA 1WZEA 2CSUA 5TRTA 3GR6A 2C20A 5A04A 1WZIA 3O8QA 5DCUA 4GBJA 4BHTA 3AI2A 4GGPA 1NFQA 2VYVA 5KIAA 3JQAA 1WDKA 3ZWAA 2W4QA 3MJEA 1E1KA 5JO9A 4CMHA 3V2UA 2VUSA 1YL7A 4N54A 1QRRA 2BH9A 2EW8A 3OJLA 4AJLA 1A9ZA 5JPIA 3UUWA 3Q6IA 3HNPA 4J7UA 3ZHYA 1ZO8A 3A1NA 4JP2A 1ZXBA 3S1LA 1DJQA 1PL7A 2RH4A 1NWCA 1SEPA 3OSUA 2HJSA 2C54A 2C29D 4O0LA 1Y8RB 4RJTA 2YJZA 4R01A 4GX5A 5DOVA 1LSJA 1Z7BA 4HFRA 2DTEA 4II3A 3G1TA 4J1NA 4OXKA 2GZ3A 5JBIA 1HDYA 3OEWA 5CHEA 5HS6A 2BGKA 3WGGA 4KTTE 3MTJA 9LDTA 1UDAA 1RKXA 4LISA 3TWOA 3RBXA 4GX0A 3EY4A 3TZQA 4YWJA 3CZMA 4ZU3A 1HF3A 4AJHA 5JO0A 4I5EA 2YUTA 4J0EA 3VZRA 3PWZA 1Y8QA 1JWAB 2DQ4A 3QV1A 4R5MA 3KUXA 5KOIA 4BNMA 1N9GA 1R15A 1C1DB 1H6BA 1T2FA 1I0ZA 2D3TA 3S2IA 1R0SA 1YE3A 4IBOA 4WCFC 5TSDA 3WSWA 5AXAA 1HL3A 1L7DA 2X0JA 3PZRA 4TQGA 1PJTA 3FI9A 2FP4A 2O3RA 5C5IA 4CLOB 1P0CA 4IJKA 3TJRA 3WGQA 5L4SA 4H7PA 1K3TA 4RVFA 2W90A 1IHXA 3ICCA 1N8KA 4IDCA 4YR9A 4DQXA 1VKNA 3DBHB 1WMBA 3ZWVA 2VZ8A 3GFBA 3O26A 1OMOA 4Y67A 4DC1A 1NTOA 1JKFA 2PNFA 4PLTA 1GPDG 5G0VA 4RPKA 4WCFA 4CM8B 1MUUA 4NBVA 3KEOA 3G17A 4IZIA 1ZK3A 3H9JA 4J4HA 5JC8A 4XEHA 4E5MA 3LC7O 4FR5A 1XELA 1P44A 1YBAA 2EIHA 2HK7A 1P1JA 2WEKA 2ZIZA 3EHEA 4MVJE 4OSPA 2BF7A 4QSMA 4BV8A 2GUGA 4BS9A 1UXKA 4B4UA 4DYVA 3AOGA 4CQLB 3E8XA 4OIMA 3JQ9C 2Q2QA 2Q99A 4GL4A 2B35A 1Z75A 3S2EA 2G82A 3AFMA 4DPKA 1JKIA 1EBUA 1RYEA 1YKFA 3U62A 4Q3DA 2PZLA 1BTOA 1ADCA 2PFGA 4RORA 1C0LA 4A7PA 1PJLA 2GD1O 3EAGA 3GY0A 2D2IA 4R1NA 4FB5A 5HTOA 1X14A 4LVUA 4CM5A 3WGIA 1E3LA 4FN4A 4U5QA 5GZ1A 1V8BA 3ZWYA 4DTIA 1LLQA 3PLRA 1BHSA 4UEOA 4HNHA 1JKJA 1B3RA 4NU5A 1SMKA 2FN7A 2C7VA 2FZWA 2O3QA 3AFNA 1G6KA 1R16A 3AK4A 3R6DA 4GVXA 3W1VA 1DFGA 4DUPA 3GUCA 4GVLA 3GQVA 4Z0TA 3WBFA 3F6YA 4HUJA 4JJFA 3ZWXA 5F1PA 1R12A 3NV9A 4E0BA 1GL3A 1T2CA 5G2OA 3SC4A 4AJPA 2OHXA 5L45A 3KRTA 1FDVA 2CMDA 1BGVA 2GNAA 2PR2A 4I8XA 2WSBA 3FNEA 4PG4A 4Q9NA 4BNWA 1R0LA 1ULUA 5C7OO 3RUHA 1HYGA 4URFA 5JE8A 5IF3A 1LSUA 5IDXA 5ILOA 2Z1NA 4D79A 1R4MA 3EDMA 3G0OA 3D4PA 3HQ4O 4BO6A 4DLLA 1ULSA 3OM9A 1VE9A 1AE1A 3H8VA 3UN1A 1MGOA 4GLLA 4CM9D 4W7IA 2BFOA 1MB4A 1NPYA 3IL2A 2VHZA 3D64A 2EEZA 1XQ6A 3WIEA 1A5ZA 3RFTA 4BGEA 3FNHA 1C0IA 3U0BA 1AGNA 4NFSA 2TMGA 4RZIA 3RVDA 1PJ3A 3EZYA 1GZ6A 4MVJF 1UP4A 4PFJA 4U0KA 2P5UA 4YXFA 1WPQA 2GN8A 3SVTA 2QRKA 5JLAA 4CL8A 4Q3EA 5ILGA 1H9BA 3PWSA 4E33A 3MOGA 4XB1A 1KVUA 4BKRA 4U7WA 3WGYA 5ADHA 1YBVA 3RD5A 1HDCA 4DIBA 4NG5A 3K92A 4K28A 1PEDA 3F9IA 3U5TA 5KJ6A 5ITVA 1XIVA 2C0CA 3DFZA 5U4QA 1IZ0A 3O4RA 2G5CA 2X5JO 1U3WA 2AMFA 4BQRA 1O0SA 5KVQA 1ZNQO 3ZZNA 3NTRA 5FF9A 5G0SA 1WMAA 5I8ZA 2HMTA 4RVDA 1U9JA 4GGOA 3MZ0A 5A5FA 4AJ4A 1P1FA 4P22A 2VN8A 1GCOA 1FF9A 4HADA 4M55A 1IL0A 1VJ1A 1BWSA 1I2ZA 4CMEC 5ES3A 3DBRB 2PH3A 4X54A 1DC6A 4FGSA 3PQFA 4E12A 3PFFA 1U28A 3WQRA 4EJ6A 4EW6A 3O9ZA 4JBHA 1X7HA 2VTDA 4DC0A 3DZHA 4CV2A 5G0WA 4F6CA 2BELA 1QYCA 2HMUA 2NLOA 4GWGA 4EJMA 1EQUA 3DOCA 2O3UA 4YEDA 4NDNE 4QTZA 2NVUB 4DIOA 3KSZO 2I76A 1LQUA 4MVJM 5C3MA 3GZNA 2WD7A 4CQMB 4BKQA 4BMNA 3OIDA 3JQFC 2Z5LA 4TSKA 3UOGA 1U3VA 4FD3A 4BIIA 4BOYA 4E21A 3EVNA 2JFGA 3INTA 4ND1A 3ZN2A 4BKPA 1UAYA 5CPFA 3ZHZA 4N5LA 3BHIA 3K6JA 3PDUA 1IPFA 1Y9AA 2NU7A 2Q1WA 2V7PA 1YL6A 1BG6A 1O95A 4FFOA 4B7XA 1NAHA 1GV1A 2O7SA 1UXHA 4WPGA 3PQEA 3DZKA 1NQ5A 4YVFA 2Y0EA 3KSDO 4MJLA 4MDHA 4XQ9A 1AXGA 5KCZA 2EP5A 3JQFA 3AI1A 4CLRB 5JY1A 1E5LA 3DHYA 3DAGA 4E30A 1PJCA 2A35A 2Y05A 2IYPA 3CIFA 1HYHA 3E9QA 1UR5A 4RF4A 5DCYA 1X15A 1B16A 2YHIA 3DBLB 1MP0A 3GNTA 1FXSA 3JSAA 1O5IA 2ZTLA 3PGXA 4YJFB 3Q9UA 5BNIA 5ER9A 2X9GA 4AL4A 3NAQA 1PQUA 4R3WA 2Q4EA 1GYPA 4I5FA 3B1KA 2EV9A 3R3JA 4P4NA 3TSCA 1BXZA 4OKIA 1PGQA 3HZZA 3P7MA 3QVTA 4ZD6A 1SZJG 2IE0A 1PGPA 3WWZA 1F17A 3GNSA 3O03A 2IEDA 3KYBA 3OECA 2CVOA 1JWBB 2CUKA 4Y6RA 5H82A 4GWKA 1QYDA 3H9GA 1NYTA 3VAZA 5IFLA 3H6KA 4WLNA 3BMCB 4ZA2A 4FDAA 1X0XA 3Q0EA 4JP3A 2PD4A 3RWBA 3L9WA 3BIOA 5B4TA 2VHVA 3T4EA 2FPGA 1PZEA 2GLXA 1MFZA 1DHRA 5KNLA 3WMXA 5BT9A 5TNXA 5ICSA 1GYQA 1NXQA 1EFKA 2F1KA 4OJNA 1A4UA 1LSSA 1Q7CA 3PJGA 3WJAA 5A03A 4F46A 3KYCB 3K9QO 1Z82A 2H9IA 3HN7A 2X0RA 3RAJA 1GFSA 2W2LD 1SC6A 2Z95A 2DFVA 3WB9A 2ZJ1A 5L9AA 2QX7A 4JNKA 1E3WA 3SC6A 4BKOA 3JQ8B 2Y1CA 4ZN6A 4YA6A 3WOHA 3C85A 3PFWO 2VWGA 2OBYA 4EDFA 2QG4A 4RZHA 1HETA 3WGTA 2HMSA 3ONEA 3D0OA 5ITWA 2J3KA 4W6ZA 2GN6A 2ZYGA 1ZCJA 4E6PA 1CWUA 4ROSA 3PI7A 1N1GA 5L4LA 4E2ZA 1QLJA 2PLAA 2XPCA 4TKMA 3UCFA 2I65A 1DBVO 3GGGA 3KV3O 1TT5B 3DEYX 2B0JA 3JD0A 4B4WA 1YBMA 3BTUA 5AYVA 1BMDA 3L4SO 4B4OA 3OETA 1K6XA 2QQ5A 2BKAA 5T57A 1TI7A 4OXYA 1MXFA 3GDGA 4L9RA 3KM0A 3ON5A 3L4BC 1K89A 3RQSA 2CDAA 4J6FA 5BSHA 5DP1A 1NBOA 3PHJA 4BO8A 4PRLA 4B79A 2Q4BA 2DTDA 2VOJA 5JCJD 3E6AA 1Z6ZA 4XDYA 3WTCA 3GA0A 2HCTA 2RHCA 1UUFA 1E77A 5F5LA 2E49A 4OKNA 2WTBA 3R3SA 5DF1A 1DPGA 2BLLA 2QZZA 4E3ZA 1C1XB 3FPLA 3WS7A 4BV9A 4MPDA 1ZMOA 3BMOA 2HO5A 5EESA 3M1AA 4EITA 4IGEA 4L0QA 1PQPA 3PYXA 4M1QA 1NQTA 2NQ8A 3AOEC 4JJIA 4KOAA 4N18A 4KP7A 3IMFA 3BXXA 2PH5A 4AICA 3PTZA 1JN0A 3F46A 2R2GA 3RROA 1DHTA 3TQHA 4NMHA 4IQ0A 2Q2WA 3E9NA 3OJEA 4O5OA 3QRWA 3GUYA 4RVGA 3SLGA 4AFNA 3CINA 4D3FA 3LC1O 3VKUA 4ZQGA 3BMQB 1I3LA 4AVYA 4CUZA 4RVUA 2I9PA 2J5RA 4ESOA 3AOEA 2PZMA 4H3VA 5F3RA 2ZQZA 3GGPA 2POQX 3ZV6A 2OUIA 4NK5A 4QX6A 2PGDA 4CLHA 4JBIA 4XKJA 2B69A 3RUDA 3HHPA 2FR1A 3N74A 3G3EA 3W4KA 2R6JA 3E82A 2QRLA 4AJOA 1E3IA 1GQQA 4XR9A 1KVTA 3KTDA 3TL3A 4UULA 3EZLA 2LDBA 3Q9NA 4EZBA 3HN2A 4EUFA 1C1DA 1ZW1A 4FC6A 1EVYA 1ZUD1 5JDCC 1A72A 1PGOA 4NPCA 3ZW8A 2Q1SA 4TZKA 4YT5A 3RBZA 1ONOA 2JAHA 3UICA 4BNVA 5C37A 3SLKA 4FSHA 3GVIA 2VZ9A 2FY8A 1P74A 4KUHA 3KOUA 3VDRA 4CLOA 3DO5A 1IE3A 3FCOA 5C7IO 5U1PA 1A7KA 5KWEA 1QXSA 3D4NA 1ZK0A 2P4HX 4LW8A 1H9AA 1QP8A 2JFFA 2Y93A 4LRTB 1U7TA 1XSEA 2IYOA 3DBHA 3H65A 4YAEA 1YB5A 3ITDA 5JDCA 3E1KA 3BTOA 3KHUA 4AJIA 1KEUA 2YV3A 3OIGA 3UCXA 1HWYA 4CM8A 4EUHA 1DO8A 5A05A 1ENYA 1HDRA 2WE8A 3V1TC 1PS0A 4GSKA 3AUTA 3G1UA 2ZB3A 4UVDA 2BFPA 3ZU4A 3JQBC 3HDQA 1ZKMA 2O3SA 3MEQA 1T2EA 4PZEA 5DP2A 2PKQO 3I9KA 3ZWCA 1UP6A 1HDGO 4FW8A 2CD9A 1GUYA 3OIFA 4RF5A 4LCJA 4EEZA 4WNIA 1F06A 4B7CA 2YHUA 4YRDA 3GMDA 3IJPA 4IDAA 3HJAA 3D1LA 2FOIA 4TRNA 4S1VA 4I5DA 3VZPA 1ISGA 1PR9A 3JQBA 4CQMD 1F8FA 4EI2A 1O89A 3BZUA 4L4SA 4WKGA 3ZWBA 1HE4A 2JHGA 4M86A 5BQFA 1QR6A 3C7AA 1ZK1A 3QW2A 4I5GA 3SEFA 3M2TA 2FSVA 2J3JA 3OH8A 4OHUA 4LGVA 4RVHA 3H4VA 4GPD1 3I6IA 3RCBA 1E5QA 4JLWA 4JCOA 4KUGA 2HRBA 4WLUA 4MIOA 4ITUA 1LRKA 5G0TA 2VOEA 3A28A 2C07A 1BXGB 3ZNQA 3QHAA 1CETA 3C8MA 4JN6B 1V35A 5U9CA 5B4VA 5I9NA 3UKOA 3ZDFA 5IDYA 4DPLA 1YQGA 4XGKA 1YL5A 2O2YA 4G65A 4E31A 1VJTA 1PZGA 1ONNA 1V6AA 1IULA 3IUSA 1ENOA 1I5RA 4PLGA 5IAAA 2P9EA 2E48A 2JFHA 4J16A 2B4RO 4IS2A 2AEMA 2C2XA 2DLDA 4XR4A 3ZWPA 3WLEA 2X8LA 2CZCA 4IUYA 2B36A 1E1MA 4DQVA 1G0NA 4B3JA 4P38A 1MXHA 4PLPA 3OHSX 3CTMA 2EKPA 5L3ZA 3W4IA 4AJJA 3P5SA 1UZLA 4ALJA 1DRWA 5TS3A 3FTPA 1JTVA 1T1RA 4MVJP 4IS3A 1LLUA
chains in the Genus database with same CATH superfamily
1KYXA 3EIUA 1FUUA 5C0OE 4LXTA 2SHKA 2WJJA 4NS1A 5K7SA 1XCBA 3VPDA 5JXWA 1ABEA 3LQFA 5G4KB 2XV1A 3R0ZA 2IXFA 4UQOA 1BHQ1 2NTNA 2ZK7A 4N1AA 3R7FA 3WGMA 1W6UA 3QKWA 4UU7A 2R4UA 1XWWA 3M3DA 5CTAA 5EINA 3A27A 3OIUA 1GSOA 4F92B 5LQRA 4R1UA 1JIIA 4DY4A 4XX0B 3GFPA 1MJGM 3PDIB 2C2OA 2Q28A 1TLFA 3HLTA 1AA9A 3NTQA 1OAKA 3EZ6A 3C15C 3FVWA 3RS7A 4CBVA 3WKBA 4L72A 1LDNA 3ZHRA 2YL2A 5FR1A 3NPMA 1TA4A 3E18A 3U3JA 1R4ZA 1NIJA 3D5EA 4J8PA 4J0KA 4ES6A 3TIIA 4ZI2A 1CIJA 1Y1QA 1J0CA 1ZBDA 3GHYA 5B3JC 3RUAA 1K63A 2IYNA 1Y6GA 3PHHA 3DBRA 1KXZA 4DMGA 1IRXA 4MK4A 1JECA 1O6FA 4LPSA 1HGXA 4P2BA 1ATIA 4KDRA 6REQB 4HGZA 2YV2A 4PTLA 4UMFA 4BVHA 2ASVA 1FLDA 2Y4NA 1I0IA 4TVSA 1PJZA 2QHXA 4GYJA 1SD1A 2V0GA 1GLVA 3DA8A 1O5OA 1DMSA 4M37A 4HRAA 1J25A 4WUTA 5GOZA 5KOHA 5ECDA 4F3RA 1PV4A 1MTOA 1YQTA 1Z8FA 3OPYI 3CX3A 5DBHX 3V7WA 4HT3B 2R6AA 5LWHA 2Q3EA 1R0YA 3KLPX 5ALSA 4IXTA 3R5HA 5DW0A 5J5AA 1CEQA 4CQMA 4LYAA 1H66A 3TZKA 4PVDA 4U8HA 3C1OA 5JMWA 3ILVA 3TKYA 4XDZA 1Z5PA 4F60A 4RV4A 3IODA 4OBEA 4C5AA 1YZUA 3RBAA 1RKVA 4EG1A 2C4VA 4L50A 7GPBA 1HH4A 2R0QC 3DOOA 2IW1A 2VVTA 4LPKA 4Q47A 3P27A 1KOLA 1U5BA 3ETCA 3SYTA 2GYYA 2I4NA 3IB3A 3K2BA 1CZHA 1IDN1 1LC0A 5COQA 5KNBD 1Z2OX 3GEIA 3TINA 3EVFA 3UFXB 2YRXA 3AR3A 3ASYA 2XB6A 3OKCA 2FFAA 5HCIA 4DZZA 5BRAA 4DV2B 1AIPA 1YVPA 4Z7NB 1Z5WA 4F2DA 1XJWA 2WWGA 4LVNA 4NZPA 5E1MA 4XQEA 4J1SA 4LGMA 4D0NA 4RTQA 3V4VB 4TVBA 3IOMA 2PKYX 1Y1RA 4KOEC 4C05A 1QMGA 1B3BA 2AQIA 3AM3A 1L3BA 1WOYA 3MJHA 1QG6A 4XI9A 3QFHA 1Q1ZA 4YJFA 3H2ZA 4MEBA 3VC1A 1U7HA 2Z8ZA 3N2NA 1FDWA 1DU4A 2OXEA 2IELA 3LC0A 1YT5A 3JAKB 3IDQA 4K0RA 4KE7A 4R1MA 2P9GA 3EQ6A 3GLUA 5AUQA 3LT0A 3OZVA 3SQMA 3VR6H 3IP6A 4KQWA 1WDTA 1CNFA 2BW0A 4G07A 3TH5A 4DAEA 5CB4A 3MUOA 4WW0A 2ZYDA 3BQ9A 3LMKA 1AB6A 4OQ4A 4R9RA 1ISIA 1J2YA 1IH8A 2JRLA 4LTMA 2V7QA 4G24A 1RI1A 2VHJA 3LOPA 1KH3A 1FNNA 1ZITA 2OO5A 1I80A 3JASA 5CK4A 5EE0A 5AJWA 1X74A 2E85A 3ZLUA 1X1EA 1UDCA 1YQWA 4UZEA 4AKIA 2J09A 1G16A 4ZMRA 5CD1A 3D6UA 1TVEA 1HE3A 5BYAA 4LZOA 4LZLA 1Y5MA 5K4GA 2Q8PA 3DB1A 1TKBA 3O4FA 4B43A 2PH7A 3T99A 1A69A 1K4MA 3CRVA 4ZVNA 4DLXA 4OHVA 1EFVB 1VJGA 1XZKA 2R25B 3PNPA 4MPPA 5B1HA 5HP4A 3ICQB 3OFNA 3OMLA 3Q15C 2OLJA 4EF6A 4GKKB 2XMGA 3DOUA 3D7MA 1BWPA 1RBQA 2HCRA 4HAUA 5L3QA 2WQ7A 2GLTA 3FPHA 3DO6A 3OEYA 4QARA 5D7NA 1KHHA 4WLFA 1A8PA 3AUKA 1KEWA 1W0JD 2R5WA 1YJXA 2AI3A 3TX2A 3UCEA 3DTNA 5EWJB 1YASA 3X1DA 4AF6A 2I67A 3FLAA 3ORFA 5K0FA 5EYPB 1NG1A 2WILA 2OOSA 3T5TA 2F7SA 1AMNA 4LDAA 4KO8A 5F52A 1TYZA 4Y6OA 3ZDEA 4CETA 5IJWA 4FX5A 3WO1A 1T0IA 2Y3IA 5AOAA 1CUUA 3GCWA 4WK6A 2NSLA 3NKLA 3IPRA 1XPJA 4HMOA 1U0JA 2IPAB 1KIFA 2XT6A 1TYAE 4JC8A 1D6JA 5FQNA 1MO4A 1T10A 1ZVMA 3O4IA 2V6MA 3WTBA 5KINB 2HA2A 5SICE 3RS8A 2G0TA 4FNOA 1K5PA 1DADA 2BFBB 3COVA 3DLAA 4KUEA 4YCAA 3FDZA 1H6DA 4QXMA 1SUFA 2AK3A 3M5CA 2C4NA 2P2SA 3M4YA 2NXJA 2CDNA 2IGBA 1VZ2A 2RHDA 3QUAA 3TOZA 5JH7B 2QZPA 3SOPA 4N3GA 5J4VA 1T8UA 3CNBA 3JARB 3PFIA 1UBMS 2EQAA 3G2NA 4KQKA 4UBOA 4IFTA 2ACVA 3DE2X 4PHFA 2W42A 1TIBA 4IWXA 2IDMA 4PSAA 3UMBA 5B7NA 3ODPA 1OZAA 3MJDA 3T12A 5LLTA 1MU0A 3NU1A 1EFRD 3NBXX 3R7DA 3BWMA 1KAHA 1JL3A 1SC3A 3L1IA 4N7BA 4FSDA 3RS5A 3OQVA 4MWSA 3GLIA 1X7GA 1PZHA 4LCEA 5EERA 1PT6A 3PHBE 4R41A 2QYSA 4JI6B 4EA8A 1IB0A 5CHYA 3U4QB 4IQ8A 4KDEA 2RH8A 3WK9A 3ICOA 3NKVA 2PZEA 3N58A 2O5EA 2H2FA 3LX4A 4M0UA 4PR0A 5L3VA 5KU7A 2ADFA 2WVGA 2ZZKA 4MPRA 1FFSA 3P45A 5E4TA 4ZYVA 3BYZA 5ALXA 4Q4JA 2VR1A 5M7EA 1KARA 4IUCS 2P2YA 4ODIA 1KF0A 3HA3A 1Z06A 4I4LA 3FYUA 4JLVA 3WDSA 4YQZA 5E6SA 4BNUA 3GPLA 2C0PA 1IIRA 1I4EB 3OCZA 1DEHA 1TLLA 5JNUA 1WMEA 1A7JA 1HBJA 2FEPA 3ONNA 4CTNA 1DX6A 1C1XA 5ADUS 3P2YA 4HQKA 1X94A 5HIJA 1ENPA 2FN8A 2WIFA 4UTRA 1JIQA 1U80A 1DS6A 4FEYA 4OGLA 1R5OA 221PA 2PXCA 3PVZA 4G4JA 1CUIA 1JBEA 4R8LA 1SVSA 2PWPA 4B82A 2BHSA 2VJLA 5KVSA 3G9ZA 5BSKA 4CKCB 4DDKA 4X44A 3T5CA 1DQYA 3PQCA 4AWXA 2Q6IA 1PJ8A 6PFKA 3AY3A 4P8RA 2ZJZA 4QDKA 3T3EA 2OZEA 3DEJA 5EGSA 3L06A 3USES 4UDYX 3GD7A 1TU0A 2QRPA 5FNZA 3NT2A 4E5UA 1ST3A 4S1WA 1V4VA 5DBFA 4NYJQ 2PAAA 1IUKA 3B12A 1SU6A 4PC6A 3OJFA 1JMKC 4RVCA 4DIEA 2NNLD 4TV9A 1OV4A 1BMTA 5DB4A 1RJFA 2A5DA 3KSUA 4JKOA 1EWYA 2GD0A 3ONVA 3WR5A 1JQ5A 1XZJA 1U2ZA 2AG5A 2HIAA 4P3NA 3BMQA 3GVCA 4L16A 3RYIB 2GCIA 3H9EO 2GS9A 2ID4A 4TS4A 2PD6A 4II2A 3K30A 3T7RA 1TMOA 4OAQA 4Y2TA 3ZW7A 1G1AA 3QA3E 1IQUA 1HRDA 3KJEA 2EGGA 5CDYA 2GHRA 1J5EB 1Y1KE 3O8QB 4ZOAA 3R0VA 3UMGA 4K2AA 1CUXA 3CW2A 1T1EA 1TOAA 4B3CA 1IPHA 3QEBZ 2WT8A 3HACA 4ZYWA 3ZOKA 3IR6A 5KHLB 3TL2A 4F38A 5D51S 1N2OA 3ML1A 5FO1A 2G8LA 5K0ZA 4C4TA 1MT0A 1NFRA 1Z83A 1FMFA 2Q2NA 3O9MA 1L7MA 2H4YA 5IAKA 2FUNB 5FD8A 3WK8A 3WXMA 1NF8A 1DXOA 3ETJA 3UYKA 4HPJB 1W5TA 3MCUA 4EW1A 2CDBA 2N75A 1XDWA 3GFQA 4L76A 4X1KA 3PD1A 5FYDA 1V37A 3MINB 4B17A 4ENQA 2BCEA 2HF9A 3T8YA 3OQMA 4M1WA 5TT1A 2YDXA 3IDZA 2AD1A 2IOHA 3TI7A 3N7UA 1BE6A 1CW2B 2DPHA 4N8DA 1RC1A 1GAXA 1MDFA 3L49A 4HDKB 1TVCA 2ID7A 2P9CA 1E4EA 2AXNA 2Z58A 4GR5A 5DDIP 1T3LA 4N5HX 3A6JA 4MP6A 1EP1B 2VHXA 1W1WA 3B8HA 3L5OA 4P36A 4Q3KA 5JSFA 4HDNA 2H1SA 4AP6A 4O4IF 2W0SA 1YB1A 3DDCA 3OZ7A 4HWGA 3W2HA 3DEHA 4A36A 4W5NA 1A9PA 1LBIA 5CP8A 2FVYA 3KL2A 4KXMA 2XITA 5AVQA 1QIMA 4CM9A 3E81A 5ED0A 2L0XA 3BB4A 3JTMA 3PCTA 3QX9A 4JLAA 5KVCA 3E4DA 1ZD4A 3H19A 4Q7EA 3WB0A 4ARUA 4WLOA 1BU5A 4CKXA 2P3OA 1RWQA 4UXJA 2FRXA 3S8YA 2WPNA 3RVSA 1US8B 1AQIA 2RH5A 4FE3A 4DR4B 1JA9A 1J49A 5HILA 5E8JA 1V45E 3THXA 1N2CE 3O8DA 1UKCA 3NASA 1KQ3A 5BWMA 1VLQA 1B0AA 1FLAA 4A8PA 1J1UA 1M2EA 3LY9A 1V8OA 4K03A 4TLLB 4A8JA 3N07A 4PC2A 5FO0A 1QTIA 2AJDA 3IJRA 3QPAA 1R5BA 4OJYA 3ZWMA 1GUBA 1QH8A 1AO3A 2QEQA 4L8VA 5GWXA 1Z18A 2XYRA 5IJAA 2QAGB 2IQ5A 3OCJA 3FPJA 1THTA 1T8RA 5FL3A 4KXWA 2WFAA 1E0SA 1JLLB 1G7SA 4MV4A 3LSTA 4F84A 1TQDA 1Z35A 1TL7C 4O4HB 5AI6A 3TTTA 5CJ2A 4FBGA 1J0BA 1WJGA 3N6RA 2A3NA 2FG6C 2WAAA 1P6UA 2V5VA 3NX4A 2AH5A 2HU5A 1UJ4A 4FXPA 5T6BA 2AOTA 1FVOA 3AH8A 4ZVTA 4YMUA 2FX5A 2C5HA 1ZIDA 5T8KA 1IJEA 2ZPUA 3RAPR 3FSGA 3N05A 4NL4H 4B6SA 2LWIA 3VU3A 1FJGB 4NZ9A 1ECPA 4NBRA 3UG6A 1K7YA 1NSFA 5BT8A 4MQEA 3V33A 3ICVA 1OXKB 1RJDA 4PAOA 5JJCA 4TWZA 4HNSA 3H3FA 4FHEA 1KP9A 1GN9A 4R05A 5DK6A 1XJQA 2NO1A 4D9NA 3QU7A 5LZ4A 2NP6A 3KVNA 3VKFA 1PWEA 3BEDA 1NVVQ 5LP6A 2QD2A 2B61A 1M2HA 1ADFA 1VG9B 2IUTA 2J8ZA 4Z86A 5C32A 5FLKA 3WYGA 2C61A 5FWDA 3F1KA 3FPSA 2XXBA 2DFLA 1ZOIA 1U3TA 3KQQA 2YMPA 2EBFX 2FX3A 5MFPA 4F5EA 5DNYB 4QJ5A 4M0MA 5FULA 4MITA 5LA6A 1G21E 5KVAA 2BWJA 2O5VA 1RJGA 3HDGA 5LCXA 3U2QA 3E03A 1J2JA 1JA0A 1V95A 4CV1A 3ZD8A 1S9HA 3KTAA 4MIEA 4BNZA 3RC8A 1TM3E 1KSGA 3GRPA 2WU4A 3LHIA 4GEKA 4YGXB 2WTNA 4BNDB 2YXBA 1M1NB 1USVA 1Z36A 2ZBUA 2QOEA 2BCGY 3HEAA 4ATNA 4FKBA 3IPCA 2AK2A 2Z4SA 1KRWA 2WLTA 2I33A 2PYDA 3VZSA 2CNNA 4EBFA 1LBHA 2QMQA 1SBCA 3THYB 1QKJA 1U8FO 2D13A 3VGJA 2X7HA 5M29A 3TF5A 4HQNA 4WERA 1RE1A 2SCUB 1CYDA 3KXDA 2EKZA 3LUBA 2A0YA 3OUUA 4CXMA 2CXNA 1DRUA 2O5CA 2XBLA 3CXRA 1AK1A 3ADOA 1YQDA 4ZCTA 3D6VA 1N2XA 2WICA 1YE5A 2X5KO 3DZ8A 4HNAA 3PWKA 3FTFA 4BRZA 3ZTWA 4YTEA 4LVOA 3GBVA 5FTJA 1E2HA 2Y92A 4YQYA 4R31A 3G88A 4LE1A 5A6SB 1LPAB 5BSTA 3THWA 2GH1A 1P0IA 4GI3A 1DNPA 4UAVA 4DCMA 3ROFA 1GGFA 1EGMB 3DMYA 4U2DA 4D8WA 3IP1A 1IUOA 4PWZA 4Q1AA 3SC2A 3W6PA 3C3DA 3P32A 3KT3A 3PGLA 2AIRA 3EQ9A 3QNMA 3ZH2A 3J80A 1SHJA 1PV1A 4ZTZB 1RE0A 5LJLA 4P4SB 3CE6A 3ORQA 4N7MA 2ZSEA 3ANSA 4PPYA 1G7TA 3JQDA 4WN9B 4HAOA 3S2ZA 4AX8A 1BQ4A 1HA3A 4AX4A 4HO1X 2AN5A 1E1NA 1SUPA 1QQ6A 4YV2A 2XUKA 5CA1A 2WJAA 3OJXA 2VQSA 1G4UR 3NI2A 3QUTA 3N8IA 3D81A 2MT9A 2ABWA 3C3JA 1HT0A 3TZCA 2BI8A 4UE3S 2HPZA 1KO4A 5FBHA 5E6UA 2XWPA 3ZC3A 1R4NA 1YDFA 1DG9A 1E79A 1WMSA 2WJ3A 3B3GA 3CUWA 3TOXA 1B8VA 1WCIB 4WE3A 4CTJA 3B3JA 3TLMA 1H2AS 3GJ3A 4M1YA 1KNXA 4ETMA 4DR7B 2B78A 1JAXA 1OE0A 3M6VA 4UW9A 2FMTA 3G8CA 1CQJA 1W19A 2NXWA 2B8JA 3A9CA 3HYCA 4KLRA 3V8QA 3PEUA 4JK3A 1U2GA 3LSYA 5LD2C 2V1XA 3KKMA 5SV2A 5LQNA 2GXQA 4B40A 1PEYA 2IEYA 2D5AA 2ZS9A 2Y0DA 3HSSA 2P8JA 3HU1A 1G20A 3I92A 4HGOA 3TQIA 2ZFUA 4E08A 4RL6A 1Z25A 4LFAB 4P0PB 1FDUA 2VA8A 1KIMA 4JASB 3RYCA 2MMGA 1OBFO 1RLUA 3IKVA 3KFVA 2XXAB 1D6SA 2ZYAA 4QDZA 1E0AA 4NP6A 4W82A 4BMZA 4QUEA 2WM2A 3HSYA 3RIMA 4BMCA 5KYGA 4ZDKA 3DL4A 2D5BA 2VXYA 1RIIA 4CM4A 3GF4A 3GLVA 2QTAA 4OUKX 2HPAA 4B5LA 3R09A 4IDQA 1U8CB 4UM9B 4BO4A 5K0EA 2XQIA 2Y8EA 4RAQA 3VA7A 1AZTA 1RQXA 4JJKA 1JR2A 2LR0A 3M9XA 2G1AA 2FEWB 4ASUA 3EA0A 3GN1A 1M83A 2PV0A 4TT3D 2F8TA 2QRUA 4X3PA 1N78A 1QGOA 3BJIC 3PIRA 2DWUA 1D7AA 4KWHA 4C6SA 1WHSA 4WBXC 4O4LF 3P9XA 1YJAA 3H9QA 4ALKA 3BC1A 2QI9F 2M1ZA 3G2MA 3AHDA 3N8NA 4QGHA 3PXBA 3USZA 2V3VA 4B9EA 1ZM4A 3L0PA 1F8UA 2HFKA 2ATCA 3DQZA 4BMOB 2QKYA 4X66B 4FONA 1R18A 3TW8B 2GA9A 2LIVA 2OZVA 1JDUA 2XD9A 5JAZA 1Z07A 5FPHA 1II8B 2G9QA 2X41A 3MNFA 5DLEA 3LPLA 1MQSA 2EHJA 4FZVA 3S40A 4XIYA 3W90A 2CLFB 4TROA 2JCXA 1U1FA 5GP1A 4UHEA 1JE0A 4XD7A 4TUYB 1KFCB 2CE7A 4UTXA 3N2GA 1BS9A 3DEFA 3ZCRA 1KEKA 1Y5RA 5GY7A 5JCJA 3IEPA 3UMSA 1PL6A 2AE1A 3O8NA 4AQ7A 1BC5A 1T26A 1FDSA 3OOSA 1JDSA 3MWYW 2JARA 4CQLA 4IFEA 4DDMA 3TBKA 3M4NA 5HSGA 3D6NB 4W9MC 3DZBA 4KVZA 4TXNA 1HE1C 3LE8A 3QVUA 2IU4A 1LSOA 5JQWA 4HK4A 3KQNA 3NC4A 1NONA 2GJ9A 5FA8A 3I9OA 4ISCA 3BGVA 4B6FA 3CONA 3LXMA 3NBZC 3QJYA 3T94A 2OXTA 3W3ZB 4PN3A 3SXUB 1T5SA 3HCCA 1E9EA 1KORA 1H4TA 5BW6B 1RWPA 4F7DA 5G1PA 1IK6A 4BEBA 3GI1A 5FPTA 1LXCA 2EWWA 5BWNA 2WUGA 3BJEA 4IDNA 2FSUA 1USUA 1E1DA 1Q12A 2IKQA 3THRA 2HIHA 3Q8XB 1EZ1A 2VJMA 3DAOA 3STXA 2QIPA 4CCSA 5A9SB 2AE2A 1HFKA 4JKYA 2OHFA 4CEIA 2GFHA 2DTXA 4FPXA 2CHEA 1D4ZA 1RKBA 1XEAA 4RMIA 1XROA 1U8ZA 2EFHB 2QMZA 3HY3A 3PC6A 1XJ0A 1N3LA 5JZSA 2PNJA 4X6XA 3AG5A 5TMDA 2HYDA 2IYZA 1NBEA 1RFLA 2C78A 3IA2A 1L0BA 2BEJA 1AKQA 2ZYTX 4IF4A 1GLGA 1LQTA 4IIUA 1E60A 3CSDA 1JS1X 3PCXA 1V16B 3OAAD 2AZTA 4F04A 2ZB2A 4IDEA 3OX4A 2J0UB 5GGXA 3M3PA 1NI5A 2ONZA 4DR6B 2A94A 5FX2A 4UDXX 2ZU0C 4JP8A 1PTKA 1X7DA 4EDHA 3KDSE 1PVVA 2ZRJA 4FFMA 3S70A 5A9RA 6ABPA 1NDQA 2PKWA 1HG1A 5FH9A 1XMIA 1AG9A 3DKRA 2BRUA 1QP4A 3D7RA 3NAGA 4MUGA 4PFSA 3BGWA 3NXKA 3CF0A 3HDTA 3QKSA 4YRQA 1RABA 1YO6A 3SSNA 5AKGA 4FYMA 2XWSA 5KC9A 3D54D 1BH6A 3MB8A 5AVUA 2C8VA 3E5RA 5K3CA 5EZ6B 4GDMA 4XWAA 1KZ7B 2OT3B 1DVRA 1WETA 2MU1A 1Z16A 5EUCA 3AF1A 3P0RA 1FUKA 5C52B 2E2WA 3TZ6A 4FE4A 2CFOA 1KMHB 1NF3A 1AHIA 4BVAA 3TYXA 3SZGA 3HJRA 3IS3A 1E9RA 2PDAA 4G84A 2XCLA 2YWGA 1F48A 4BU0A 1JGTA 1KYIA 2VPXA 4RL4A 3STYA 2QYHA 2VP9A 3ZVLA 2RB5A 3DG9A 4NSNA 5EQJB 4JQYA 4EELA 2QRVB 5D3KA 3TG8A 5HIIA 5FBVB 5J58A 4RGYA 1LEHA 1CR6A 4GOXA 2PD3A 2G9RA 1GTVA 3GRFA 4Q7KA 3B1ZA 4PS0A 3VYTB 2NPOA 5AKLA 3N87A 4N7RA 4BX8A 2JFBA 3FF1A 3DAFA 4TTRA 5D5PA 3I32A 4A26A 1PX0A 1XHLA 5BUZA 5D2CA 1WSDA 3CN9A 4GOMD 5CNIA 5H70A 4F0JA 1LV8A 5FL7A 3QNWA 3TEFA 2LRHA 2O2HA 4FMBB 4MKHA 3VBCA 3GGCA 3MWDB 4GMGA 1PUXA 4GBMA 3WWDA 2JLYA 5E9JA 3IT1A 1BHJA 2QTBA 2GKGA 5HGJA 5DX1A 2PO5A 1JHMA 1RWBA 2QPTA 1JHOA 1A0OA 4XGIA 2ODEA 2YZKA 1N4AA 3PICA 5B5SA 1N33B 4V2IA 1CRWG 2W48A 1OBHA 3F4LA 2W8BA 3Q7RA 2QRQA 1SVMA 4Q9AA 1VXOA 4LRSB 4Y2UA 5G41A 5JAUA 5IS2A 1M8GA 3MPOA 1U7DA 4NCBA 4LECA 2CMKA 1GG9A 3F6RA 4Y8VA 3A4TA 4PIMA 4W9NA 3HR7A 3T5GA 2MDTA 2UUCB 1ATZA 3INRA 2FWJA 3M9WA 1NF9A 5GZ6A 2CL5A 3LQRA 1PK7A 1JHXA 5FOVA 2IE8A 3CB4A 4JQOA 4L95C 4NH4A 5IM5A 4PANA 5TQJA 4CUKA 3M1LA 4ZTUB 2X15A 4DRXA 1Q92A 4R9UC 2VAMA 4ZODA 4YJ2B 2FUKA 4V0KA 1Z5VA 1E3JA 2WI8A 4YXWD 5AK0A 3HZOA 3UJ8A 2XYHA 1YAJA 1WW2A 2OORC 2XMBA 3R6GA 4V0MA 2AG6A 3DS8A 3VU9A 4J1TC 4CTMA 1V3VA 4BWGA 3PNSA 1QO9A 4KSYA 3VZDA 2AG8A 1JPVA 4OFWA 3NTLA 2OK8A 5KYUA 3ZCTA 3NWBA 4XGNA 1QOZA 4UREA 4J0IA 3QQ5A 2AQHA 1E3SA 1ZVVA 4ARZB 3NEAA 1LPSA 4P7KA 4WJLA 3VOBA 5FRDA 2IS6A 2YQ5A 2HJWA 1MGPA 2Y68A 4IIXA 3SJBA 4D43A 4GOJA 1GRQA 2X42A 3V7FA 5TIIA 1FIUA 3UF0A 1ZJ4A 1SGWA 5B57C 1LU9A 1I36A 4U6SA 1J2RA 1A4XA 1IXRC 1TM2A 3H13A 3WNCA 2CL0X 4QWMA 5JARA 5DHRA 2ZPTX 3V6LA 3JQGB 4YYEA 3NHUA 1XQYA 2AI2A 4XXHA 3NRCA 2R9VA 2W58A 2M1XA 1BYIA 2XOEA 4IDBA 5IJZA 4TYNA 5KYVA 5KWIA 5CBPA 1DRJA 2UDPA 4IMJB 2W6CX 4HQLA 1Y7TA 4C0SA 3PNQA 1DWOA 4FMDB 5C34B 1KBQA 2F00A 3E9RA 1RWOA 2W4MA 2YNMD 1ZI9A 4DJFC 4AURA 4G0OA 1FUEA 1QRAA 2JIRA 3A3KA 3LA8A 4B6OA 3A4YA 2PBFA 3WLQA 2HA0A 4R9VA 3GEDA 4ZOCA 1QGZA 2WWHA 4C4XA 4FXOA 1WCV1 2YJGA 3A9RA 1KPIA 2YN0A 1G6HA 5AQEA 3BK1A 3QLVA 4DLZA 4C4YA 5IT5A 1H69A 1JPNA 2YWXA 2PN1A 2N9UA 3D3EA 1VKJA 2CN1A 3TMAA 3ABQB 3U3OA 1QZZA 4AJKA 4D3SA 1QDLB 4ZOLB 1XTPA 3VHXA 2CW5A 2WV7A 4B3XA 2VRCD 3IOEA 4YAJA 3FYSA 3INGA 1ZR4A 3G0CA 1XTUA 1Y1SA 3UWPA 3V7NA 1DOZA 3BUSA 3GPCA 1EXMA 3KWJA 4NNJA 4TQ9A 3FPCA 3W6ZA 1LBQA 2OXCA 2X19A 1ZD1A 3HA5A 3NIWA 5HGXA 2QN2A 5I9LA 2QM0A 3KYCA 1IEVA 3A32A 4CM6A 2C03A 1T15A 1Z63A 2XIJA 2OFOA 3ND8A 4PG8A 1E6EA 3UB3A 1AN9A 1DZ3A 2GKSA 4A2WA 4EY6A 4EYSA 1EFPB 4Q7LA 3FCYA 3WSVA 1XALA 4MO9A 4ICIA 4XLZA 1AM4D 2YIVX 4FYPA 3V1YA 3T15A 4EI7A 5KYYA 1XPUA 1CT9A 1VKZA 1KJ8A 2RBEA 3DR5A 3B36A 1FRZA 2H1CA 2NM0A 4EUNA 3DTVA 3KR2A 1F60A 4QA9A 1G0OA 1XDUA 2O6LA 3LLMA 3TRJA 4AJNA 4P53A 3IIEA 2FJ0A 1HYEA 4IIJB 3OE4A 4IMPA 5GPBA 2MIIA 1IBSA 1ZSVA 3FOEC 1QH0A 1FW8A 3FCEA 4PW0A 1QHEA 3AR5A 4GC9A 1DP4A 1GTMA 4X61A 4YRJA 3U3ZA 2H2HA 4BEVA 2ZOSA 1FYDA 2C1EA 1MTZA 4JQCA 3DQPA 3A26A 3LP8A 1TT5A 3FUWA 3G9QA 1KKMA 1K5HA 1ZGBA 5T4HA 4NNOA 3KS9A 4HEA6 4YQFA 1QAOA 3GRZA 3TLZA 1XXHA 2UV8A 2H9YA 4HAIA 5HJ2A 1YQUA 5LDGA 5JV5A 1A9XB 1YS6A 2QVLA 4E4YA 3JVVA 3P4YA 4G0PA 2BDTA 1QONA 3FHTA 4KHPB 3DHWC 4GLJA 3F9CA 1HX7A 1VIAA 4EF4A 5CAEA 1QHXA 3JRNA 3B60A 3LNCA 5B7GA 4QUKA 1Z74A 4PGMA 1C0PA 2XMRA 3UAOA 3FNGA 4G4IA 4JDPA 3VV2A 2QSJA 2XUHA 4YMSA 1YFKA 1S0UA 2O50A 2G04A 3G2HA 4RIGA 3IESA 3CE9A 1XKLA 1D4AA 3P20A 1JHDA 3PHGA 4IJUA 4UNSA 4ZEOA 1SHZA 4YDHB 2QAJA 4MI3A 1AUQA 4S04A 1L5HB 1DX9A 1KKLA 4DB4A 1GSAA 4IJ6A 2RHTA 4MDEA 4GFDA 4QBKA 1VGQA 2ODNA 2VK8A 2HPHA 2ZBRA 1H0KA 2PL9A 4OHOA 4M9QA 1DQRA 4ZVKA 1NURA 1T2VA 1AGPA 3PRJA 2QA5A 5JNVA 2X3FA 1P5JA 4FFBA 4HAXA 3ZD9A 1RLTA 2GT1A 5KYTA 1GNTA 4OMDA 1N6NA 1AZLA 2WWIA 5IAOA 2GZDA 2AX4A 1EGAA 1IEXA 3Q3GE 4LWZA 3W8EA 4CUJA 4MLPA 3C7CB 3C8UA 1DGQA 1CEYA 1TMKA 1LBTA 2WUDA 2CLHB 3CG4A 2PRJA 3OQJA 4NESA 4Y30A 4BMXA 2IFTA 4Q9JA 3K31A 3E3NA 2D74A 1Q7RA 2CBXA 1T2DA 2WZQA 5E7JA 1QLWA 2CYBA 2YN4A 2ACKA 4K9SA 4UE2A 3T3HA 1QCYA 3M33A 4JAVC 3W8RA 1N0VC 4E5DA 1NVMB 4FHFA 3PLAE 1H6CA 3I2YX 3QJ5A 5L3SB 1EVZA 2PUWA 4L08A 3MAAC 4CL2A 1KBOA 5LDHA 1T35A 2H4HA 1CDOA 3OJCA 3LF1A 2GPBA 5KYXB 3L43A 3CR3C 1CY0A 3EUEA 1AH2A 1JEEA 3ZWNA 4MB6A 2I62A 3OX1A 4DXHA 4RQBA 2VBCA 3RSZA 2D7JA 3CVYA 3T06B 5G40A 5K0GA 3ROPA 3OG9A 1QQ7A 4X6YA 1DB3A 3IXQA 5JJKA 1VI6A 2UYYA 1XMSA 5DFAA 5F64A 3OZSA 2EBWA 4DSUA 4YT4A 1POWA 3AB7A 2I99A 2JNWA 2HHJA 3PEYA 3HDYA 2F43B 2AJCA 5KJFA 3QE0A 3H9BA 2XTNA 3QMVA 1RRPA 2J1LA 3IQFA 3L6EA 4HGNA 4JOQA 4NTZA 3ERCA 5LP1A 3FLBA 5SZIA 1U04A 1WSAA 2QU8A 3STUA 1R0BA 5GV8A 3QY0A 2FEMA 3EGIA 1BWRA 3O91A 1NKSA 3SMVA 1EDOA 3GLIE 3EIQA 5KOHB 1KQGA 4F12A 3WZLA 3MIZA 1L7RA 4PCUA 4BFCA 6CHYA 5AW8A 3ZEAA 5CA0F 5DISB 1JJIA 3GJRA 4CIVA 4F4IA 3WGZA 3W6NA 4NAHA 1GZ7A 1DAKA 1CUGA 1RQNA 1XA0A 2EL9A 2VSNA 1NVAA 4WLEA 4YIHA 5KBYA 2AHOA 1ABBA 1ZHHA 4JLJA 3GLQA 4O25A 5ALTA 4DJ5X 2JGDA 1V8DA 1ZG3A 4AWAA 4NXMB 2C0QA 1ZWKA 5EJ9A 1CDEA 1WB9A 4JI7B 1IXKA 1YZKA 3VX4A 2NUTB 4UJ3A 4IVRA 1M8PA 1IPEA 2B9VA 2P11A 3IT0A 2GERA 4IDHA 3K0FA 1U5BB 4HB2A 4C7BA 3ZU6A 1HKUA 3H8JA 5KX5B 1PG2A 1Y8QB 2B25A 4EG3A 1K2WA 3UATA 1ONPA 2O2XA 2XUPA 3PFHA 2DU8A 2IZ7A 1Q1AA 4FYJA 4LKRA 4CVNA 3LT2A 3P9KA 2PEYA 2HXYA 1QH9A 5DEOA 4ZICA 1V0JA 3QOYA 1JPJA 2YWJA 1TAUA 1KVQA 1YXMA 4G37A 1NI3A 4GM1A 1DCFA 2VHYA 3C3WA 3WB2A 4ZK6A 5DNUA 1T29A 4WCVA 5KOJA 2WYHA 3O95A 3RSHA 5DGHA 2GK4A 2P2NA 1T9GR 2FGJA 2HF7A 1DAOA 4MX8A 1NQOA 2NQ2C 4CHTA 1NE7A 3EC1A 4RZ2A 3RUCA 3WLRA 3WQHA 3QZUA 1JSLA 2GFIA 2QLJA 2QUHA 1EK2A 1P39A 2QQFA 1B00A 2G71A 2OD2A 2O7VA 3CM0A 1DKUA 2HKIA 4UCWA 1L5GB 3SFTA 1WQ3A 4C4AA 1EA5A 1Q77A 4LJ4A 1S4MA 3TDNA 4ZMBA 4EJSA 3TX6A 4QWWA 1NP3A 3AFGA 2O7QA 1PWXA 1PGJA 1NY6A 1YGPA 2OCDA 4G0ZA 2JAPA 4A23A 1JAZA 4AJEA 1NVFA 3SBXA 4DEYA 1CLUA 4XOIA 3ZIAD 1YCDA 4A10A 2QB5A 3GPIA 3QGMA 3RIXA 2Y9PB 3R0XA 4M1TA 3GP8A 1EJBA 1AS3A 1H93A 3I0ZA 1L4FA 2GETA 3ZUGA 2DETA 3HP7A 3U4IA 2JZOA 2VF4X 1CHNA 4L5CA 4O1MA 4RD1A 5FLYA 2FZ4A 4KVGA 1WSWA 2J9YB 1EHCA 1Y81A 1XA3A 3JS5A 2CVPA 1Q0PA 3T38A 2WQ6A 4RZSA 3IC5A 3MMXA 1HUQA 3H2GA 4V3BA 1X7WA 4PFQA 2B1IA 3KJQA 1KMCA 1GZ4A 3EYWA 3QX7A 4GUAA 2CV0A 1Z4JA 4UXHA 2ZU6A 3DOJA 1U3GA 2GPYA 5A4DA 3F3MA 1VA4A 1S89A 3EWAA 3IQHX 2GRJA 1U4SA 4H6VA 3RS4A 5KQSA 5BR1A 5AVXA 1U8AA 2CMFA 1P29A 3ILXA 3I9FA 1FYXA 1Z6AA 1UM9A 2O20A 2G1JA 2OC4A 1FOEB 1ZQ1A 1UMCA 1WM1A 2ESRA 3FMGA 4RETA 4HMPA 9GPBA 5L95A 4IINA 5K3BA 5BMVB 4CIDA 3O0DA 2E89A 4TL6A 1NTRA 4HDMA 1HSZA 2HSJA 3ECCA 1YJ8A 2EJUA 4KBFA 5BV8A 3FAKA 1JHZA 5LMUB 4HAWA 4ALLA 1ZY2A 3CZPA 3INNA 3AGQA 4WN3A 4KMMA 4YRFA 3GLSA 1GJRA 1T8TA 2G4CA 4LV6A 4PN7A 1GM5A 5J2TA 2DERA 3R2JA 1LH0A 3O2QB 2GF9A 4EUSA 1ISJA 2IHBA 3DPIA 2C8JA 1E2IA 3GHHA 4KJZA 4QPPA 3ZH9B 3DYBA 7REQA 1SJ9A 1QX3A 1ZEMA 3E0QA 1ZNWA 3TMKA 1Q19A 2IZ0A 1G60A 4NKRA 5AJHA 3TL6A 4MV1A 2XSZA 3GAAA 1Z2NX 3DTYA 3MYYA 1V1RB 1EDEA 2EL7A 4GR9A 4DDWA 5B7PA 1KDOA 1QLHA 3CVXA 3PLNA 3V1UA 3LTEA 1MQAA 2QLLA 3LIPA 4BNNA 4DBZA 3IMEA 4R68A 4EABA 1E6CA 4XLLA 1TGYA 1XU9A 5AFSA 5F7ZA 3LCCA 5ESXA 5FT9A 3TSZA 3KZXA 2WIAA 4L73A 2RGYA 3M4JA 3OZUA 2CNWD 4MW5A 2OAEA 4Q4JB 4NBKA 4C0KA 5G4LA 3UHJA 1NRIA 1T4DA 5I7FA 3ABRB 3AU9A 1JQJC 1SG0A 3QENA 4UVGA 2VF2A 3AZOA 3WIBA 5E6SB 3FTCA 5FPPA 4YMLA 2I91A 2PT6A 3UVEA 4ZARA 2A9RA 3GUUA 4OYRA 2JLRA 3W1EA 2YXEA 3FE2A 3AJAA 1K86A 2HHAA 4QU5A 4HEJA 3HU2A 4DCCA 4IO1A 4OAPA 2ZUUA 1QO0A 3OE5A 3FI0A 3KKZA 5HR5A 3I23A 2Z2XA 4NYJR 1MFPA 1OA0A 1P1HA 3QLTA 4WD3A 1YSCA 2QROA 1B1AA 2NTVA 2QJOA 4GH5A 4Y2YA 4GE0A 5IARA 2P68A 2J0EA 2Y1DA 3F3SA 4EGCB 2PS1A 2PUDA 3SC3A 1SVKA 2OTCA 1CZOA 2BEWB 3ICEA 3ASVA 4XM1A 3FMPB 2FEOA 4KRYA 3SYRA 3T3OA 3GVHA 1QMPA 2XI4A 3K0EA 5IHXA 4KN5A 4Z99A 3HB0A 3NALA 3E2MA 1YC5A 1KZGB 1P31A 3ISVA 3A31A 4AZSA 1I5OA 4I6EA 2EWMA 1NYRA 2QN9A 3FB4A 4BLUA 1SXHA 2NO7A 4PLZA 2VO1A 3VR1A 3ZU2A 1W73A 3DFIA 1TF2A 5JROA 4W5TA 2SBTA 3MS4A 4ZV9A 4U7FA 2N0SA 3NGMA 1Z26A 3ETNA 4OF4A 4OEHA 2XTJA 3B2NA 2I29A 3EXHB 3A1SA 4HH4A 1V5IA 1ZGHA 2AVDA 5KUTA 3D6MA 2DX7A 2AR7A 4R2MA 4RPJA 1RW4A 1V8PA 1XA4A 2P2DA 4QDOA 4GYYA 4DHWA 5CFPA 2Q6TA 4HTFA 1H2WA 5AKHA 4B7ZA 1BMFD 4WESB 4ERXA 5JBNA 4QOIA 5TQ2B 2IS4A 1RIFA 1XCOA 2ZS8A 3A06A 3LECA 4GECA 3BE5A 4F1KA 5HS4A 4HWKA 4KACA 3O4GA 1DOAA 2AS0A 1LTKA 2ONKA 1GNRA 5A5VA 5AW0A 2NU6A 4TRMA 2GCGA 2GPSA 3HJBA 2AL7A 4N40A 1KWKA 5GJWC 3L0OA 4HS4A 2NSYA 4Q15A 4X1KB 1AKWA 3VNVA 1OR8A 2Q5IA 3BCUA 3L6DA 4UHCA 3WK5A 2NU7B 4V0QA 3BCSA 4X7PA 3L7BA 5AW6A 5JVDA 1I4WA 1TA9A 4TS3A 4C4RA 1YA6A 2V5AA 1C1HA 2H31A 2WYUA 1FK8A 1IB6A 2MINA 4IOLA 3B48A 4MQLA 3O6VA 3PUKA 5HBRA 3VH1A 1TUBB 3BORA 5TS2A 1Y1PA 3K32A 2NQTA 2PUEA 1V7QA 3K73O 2NSDA 1F6BA 1FU8A 3ZKAA 4XUCA 4ZI3A 4KPYA 2BE7A 1U3UA 4HDNB 3MXTA 1BCRB 4PSVA 4MGIR 4D99A 2ES4A 3IE0A 3AR4A 3OU2A 1ILWA 1TU4A 3VH3A 1GCAA 4TRRA 4BP9A 5IUNC 1SBYA 2AW3A 2YHIB 4Z2AA 4RQTA 2WT9A 4TWAA 3JV7A 2ET6A 1NI4B 3H2YA 4J9VA 2JJYA 1GD1O 2C2MA 3R5FA 2NXEA 2Q4DA 3FKSD 4ZKEA 3ZDDA 1VPEA 3EA5A 4ZVMA 1Y7PA 3VJMA 3ZCSA 4MKRA 3OD5A 3RSOA 5JJBA 3VO1A 3RSFA 4RXTA 1E6MA 2Y66A 3IMKA 2HQOA 5CIQA 5HE8A 2F1JA 3VV3A 4A8JB 3OKPA 3JQAD 2C1ZA 2UVQA 3MRSA 3QTTA 4O4JA 4Y1GA 4ZZ2A 4CLDA 1NW3A 4JCCA 4XOUA 2CFSA 1KP3A 1NR7A 3U26A 3F0TA 4P34A 1IVNA 3O74A 5EIWA 2ATVA