3RJ9A

Structure of alcohol dehydrogenase from drosophila lebanonesis t114v mutant complexed with nad+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNVTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An intact eight-membered water chain in drosophilid alcohol dehydrogenases is essential for optimal enzyme activity.
pubmed doi rcsb
source organism Scaptodrosophila lebanonensis
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
total genus 96
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rj9A00
4PRLA 2J6IA 4WNIA 1SOWA 1E6UA 3GFBA 4MVJI 5DOVA 1VSUA 2NU8A 3O9ZA 1RM4A 3CH6A 4PLWA 1E77A 3ZWNA 5B4VA 3GNSA 5T64A 4EW6A 4DLBA 1XLTA 1R4NA 4QUKA 5DBFA 4TRRA 2VTDA 3QVTA 1QYWA 3VAZA 2Y68A 1GD1O 3WTCA 1Y6JA 1PL8A 1O6ZA 3B1JA 4H7PA 1I3LA 1Q0QA 2RH4A 2HAEA 3E5MA 5U9CA 2CVOA 4U0JA 5JXWA 4K1LA 2YY7A 2Y1CA 4A7PA 3GMSA 3PFFA 1W0CA 2GGSA 2Q99A 1YB1A 2O3SA 3CINA 4I9NA 4BVAA 3DBRA 3ZU2A 2C82A 1U28A 1ZH8A 4EEZA 1ZSNA 1ZK3A 3NEPX 1B2LA 5IN5A 3VPFA 4A5OA 1EUCA 5BSFA 2A35A 4PLPA 1PWZA 4E5MA 4S3MA 3FNEA 3BA1A 2NTJA 4I08A 4QTZA 4BGVA 2SCUA 4N7RA 1LSOA 4CM8A 4PFJA 5L3ZA 2PKQO 1JLLA 3DAFA 3QSGA 1NYTA 3OQ6A 4JBIA 1FXSA 1YE3A 2C5EA 3F5QA 1H6BA 7MDHA 3ANLA 4HP8A 3FWZA 5BQFA 1KC3A 3TL3A 4WE3A 5TRTA 5KJ1A 3BYZA 4PLVA 3C3XA 3PWZA 3ZHZA 1E1MA 1Y8QB 1WVGA 2DAPA 2J3IA 2X9GA 2GZ2A 3ZWWA 4NFHA 1E7YA 1ADCA 1QG6A 1TEHA 4Z6KA 1FDVA 3IP3A 3NGLA 5IZCA 3DBHB 2F1KA 3EYWA 4CM6A 3U09A 5A5FA 2Y1FA 1GY8A 2J8ZA 2HSDA 3CTMA 2JJYA 3DQPA 4GH5A 4GVXA 3C7DB 3OJLA 5ENVA 1ML3A 3INRA 1GPDG 3UKOA 2YV2A 1ULUA 3W6ZA 4DIOA 4P4GA 4B7UA 4XGKA 3OIGA 3NV9A 4CL3A 3QWHA 4KQWA 4GLOA 1K3TA 2VYVD 1SEPA 1KIFA 2GRAA 3I9NA 2RHCA 1BXGA 1Z73A 1E3SA 3P5SA 3H3FA 4KTVE 2Y0DA 4BS9A 2GASA 2FOIA 3JQBC 2RAFA 4JBGA 4CLOB 4R1TA 4KMSA 2UDPA 2FY8A 3QA9A 3GPIA 4L9RA 2YDYA 3T4EA 4BNWA 2DPGA 4XRRA 1CWUA 3I6QA 4MVJP 2IZ0A 1GQQA 1WXDA 3CZMA 4QECA 5CDUA 3K2EA 1CRWG 5CPBA 2PK3A 3WGIA 4YQYA 1DXYA 3VTZA 1EMDA 2HKIA 4XQCA 3RJ9A 3E9MA 2XAAA 3HADA 4DIBA 1NFRA 3AM3A 4PG8A 3W4IA 1ENOA 4WOKA 1P45A 4R01A 3A4VA 4DBZA 1YQGA 3RKRA 2E82A 3ZHBA 4Q9NA 1TT7A 2YQ5A 3I4FA 4L75A 3ZWCA 1ARZA 5BSHA 4S1VA 2AQIA 3KRTA 2B37A 2D4AA 1ADBA 1ENZA 1A72A 1IE3A 2V65A 3ZWBA 1RJWA 3WBFA 5A5EA 1UP6A 3ULKA 1LDBA 3UUWA 4GLLA 4JK3A 3PDJA 2PH3A 3HG7A 4D0RA 4ND1A 2X5JO 2A9FA 3PWSA 3F47A 3F1KA 5KIAA 4NBTA 1GZ3A 3ZWXA 3W6UA 2Q49A 2J5QA 4OMUA 1C1XB 3N74A 4WLOA 1RKXA 5KVVA 1GL3A 5DT9A 1HKUA 2O3JA 2YQ4A 2QRLA 2D59A 5IDYA 1B26A 2NQTA 3OJEA 4OKNA 1SCUA 4ND4A 4WCFC 5L95A 3FN4A 2G17A 3OEWA 2QZZA 1Q0LA 1FDUA 4CV2A 3LC2O 4F46A 4UULA 4TRJA 3WYEA 1VLLA 4CUKA 2DFVA 1V3UA 1JDJA 3E18A 4OH1A 3PQEA 1U4SA 2E49A 1EVIA 2VOEA 5EMHA 1CIVA 1LDNA 3SJUA 2I3AA 2EV9A 1X15A 2NNLD 3L0DA 4RPKA 4DYVA 1UDBA 2BELA 3GVXA 2Q46A 5EN4A 3UCXA 5TIIA 2ZTVA 2O23A 2PKRA 1GPJA 4UVIA 4BIIA 4IDEA 2VHYA 3QVXA 4CMJA 3D64A 4E2WA 1DBVO 1IULA 4PLZA 3UH1A 2VHZA 3VPXA 4XYLA 4UEOA 4TVOA 3QVOA 3L4BA 2JFHA 2Y1DA 3O26A 1QXSA 3JQ7A 1DB3A 1YJQA 1UUFA 3GN2A 1A71A 4AG3A 1YVEI 4GGOA 5DN9A 1WLYA 1JAXA 1HDCA 2VHXA 4RDIA 1HDRA 8ADHA 1EVYA 4A10A 5IDWA 5B37A 2QYSA 2GN4A 1BMDA 1BRMA 1NNUA 3VPSA 5IFLA 1KVRA 5IG2A 5DF1A 1O0SA 2Z1NA 4WEQA 1PL6A 4JBHA 1LSJA 3FNGA 2EJWA 4E13A 2FWMX 3TZKA 2Q4BA 4L8VA 1P1FA 1OFGA 1HZJA 2IYPA 3L07A 1D1TA 4RCVA 1NX6A 2NVUB 3V1YA 2IE0A 3HWRA 3QWAA 2HMTA 3GC6A 3BHJA 1CYDA 4G65A 1GZ4A 3ZW9A 4BKOA 1O8CA 4DUPA 2QZ9A 2VT2A 4DIFA 3PZRA 5JLAA 3AOEC 1VPDA 1X7DA 3B20A 3AWDA 4YRBA 3AI1A 1T2EA 2WD7A 1B0AA 1RM3A 2R00A 3G0OA 5JAIA 3WGQA 5CHEA 2W8ZA 3KO8A 2VRCA 2HK8A 4UVDA 3O8QB 1LSUA 4LK3A 4D7AA 4YA6A 1LJ8A 1MGOA 3JCZA 1I8TA 2W2KA 3T7EA 5TJ9A 2PKQP 2Y1GA 4NMHA 1HE5A 4I5EA 4RVFA 3D4PA 3WNQA 1HDGO 4NJMB 3RBZA 1UAYA 3U4DA 2GF2A 2AG5A 5CEJA 4XR9A 1AE1A 4JCOA 4PG6A 3DBLB 1KVUA 1E7WA 1E92A 4PCVA 4ZVVA 1NR7A 4IY1A 1VJTA 5KKCA 1U3TA 1I5RA 2QIOA 3E03A 5AXAA 3MJTA 4B4UA 2WYUA 4DLAA 4KZPA 3V1TC 2Y93A 3LT0A 3U0BA 1VKOA 1C0PA 4FCCA 1ZK0A 4OOEA 1M66A 4E3ZA 3GZNA 2DFDA 1E7SA 3NT4A 4DGSA 5A1TA 1YL7A 4R5HA 2YHIA 2W2LA 3F6YA 4NK5A 3ZU4A 5COBA 1E5LA 2WD8A 5CG2A 3X2FA 1HDZA 3LK7A 4OXNA 2VT3A 1PZHA 3JQ8B 4G5HA 2V7PA 4DC0A 3AY6A 3WX0A 3MOGA 2GD1O 2GERA 1CEQA 3S2FA 1IUKA 5T8KC 3Q1LA 2FSVA 2ZTMA 5G0UA 2NU6A 3I83A 4CR8A 4NU5A 2AA3A 3UVEA 4E2XA 3WJAA 1R0LA 1QYCA 2FZEA 3DBLA 3LT2A 4NBWA 2E48A 3VDRA 3K9QO 5L4LA 3W8FA 4D43A 4B8WA 3MJSA 4BB6A 2Y99A 3GUCA 1PGQA 2O7QA 4GI2A 2H1SA 4PG5A 2IDZA 1VE9A 1C0IA 1J6UA 3Q11A 4P4NA 4RQTA 3E1KA 1K89A 2DT5A 1WAMA 1IPFA 1H0KA 3INGA 4B8ZA 4CJXA 5JDIC 4M54A 3O8QA 3ZHXA 3RUEA 1J49A 3OA0A 3IKVA 4NBVA 2DBQA 1Y9AA 4IJKA 3NRCA 1PU2A 3LU1A 1YDWA 2ZJ0A 2WD7B 4I9HA 3ZZNA 4CMBA 3ANNA 4D46A 4LN1A 3ANMA 4D44A 3K73O 3A06A 3GG9A 3KEOA 4IQGA 1QR6A 3DOOA 5K6AA 1X13A 3OF2A 3TQHA 4ZHSA 4GKBA 4G81A 4Q3AA 2W90A 1I3KA 4MKXA 4ND3A 4CLOA 2VWGA 4NHEA 4MDHA 2TMDA 2VUUA 2C07A 5BNIA 3WIEA 5JAZA 4L0QA 4OIMA 3JQEA 3H5NA 1QYDA 3PHLA 4CQMA 2GNAA 4AL4A 4JN6B 2YHUA 1Z75A 4FOSA 5IN4A 3ZWYA 1E0DA 4C4OA 5I8WA 4NBRA 1WDLA 4RVSA 1NAHA 4NBUA 1P1KA 3LYLA 3TJRA 3BTVA 4ITUA 3D5TA 3SLKA 4JLWA 3Q9UA 1ZK2A 5I9NA 3WQQA 1MC5A 3LDHA 1S6YA 3S55A 2I76A 1LX6A 3ITKA 1EK5A 3G3EA 5HRUA 1Y8QA 2HRZA 1EQUA 5A9TA 3ZV5A 3BMNB 3IIEA 4BNGA 4FW8A 3ZI0A 1N7HA 5KKAA 4OJNA 3BTUA 3GDFA 3RFTA 3FF4A 4DQUA 2NQ8A 1JWAB 1WMBA 1PJ3A 2FPGA 3RCBA 4YAIA 3K5PA 5KVQA 3TPCA 3DO5A 1V35A 3LSYA 1HE4A 1OZAA 1ONPA 2UVDA 3IMFA 2Y0CA 2HJRA 1UXGA 3RAJA 4AJ4A 3KXDA 1D3AA 3F4LA 4MP3A 2OGUA 4LSWA 3G49A 3T7CA 2A92A 5JY1A 1HWYA 4GWGA 3RU9A 2NVWA 4OSPA 1QYVA 3WS7A 2PTGA 1BVUA 4JIGA 5T6BA 3D5QA 2LDBA 1QSGA 1NVTA 3I1JA 1WWKA 1JAYA 2DPHA 2VZ9A 4TKMA 4WUVA 3EZYA 2O4UX 3PJFA 3BMCA 1TVEA 5CAEA 4NH4A 3DZHA 1DRUA 1EQ2A 3GVHA 1IB6A 3UGKA 2V6FA 2JHGA 4J0FA 3RASA 4TZKA 4BNVA 1PQWA 2AG8A 4O63O 1W4ZA 2C2XA 4BMNA 3KLMX 4EDFA 4E4YA 1Y1PA 1XG5A 1HXHA 1YQXA 3FR7A 3CXRA 3HQ4O 3WQSB 3LF2A 1KEVA 4KUGA 4DPMA 3PK0A 1YOVA 5EJ2A 2Y1EA 3OJ0A 4H15A 2OBYA 2VYNA 4IQ0A 4BGIA 1ISMA 2OP1A 4AJKA 5L7TA 4YRDA 1KEPA 1E7RA 5G4LA 4RVUA 1PJQA 3B1FA 3KUXA 3ZV3A 2NTNA 3FRJA 4RQUA 3PJDA 2AXQA 1LDMA 3JQDA 4FFOA 3DMTA 3HSKA 1EUZA 1QV7A 1PX0A 1HLPA 3G17A 4RVDA 3KSDO 4RORA 2OBNA 4IS2A 1P3DA 2HQ1A 3AOEA 3UOGA 3E6AA 3M1AA 3RJ5A 4QFCA 3JD2A 1ADFA 4PVCA 3EMKA 2Z1MA 3KYBA 3R0IA 1PGOA 2AE1A 2UV8A 4JQCA 3QWIA 3PYMA 4NNJA 1IPEA 4EUFA 4ZQEA 1A4UA 1M76A 2WM3A 3K96A 4OYRA 4DC1A 5FI5A 4RPJA 1NQOA 5A02A 1DHRA 3RSHA 1MXHA 4U6SA 1PJTA 3ZHYA 2JCYA 3NJ8A 4FB5A 4Q3BA 3VTFA 1TLTA 2P2SA 1Q0HA 3HB5X 4YCAA 1H6AA 1LLDA 4RVHA 4F3YA 4LMRA 4RGBA 1V0JA 5TGDA 2GO1A 4ZQFA 3WLEA 4CUJA 1GR0A 3V2UA 5FEUA 5DP1A 4OO3A 5JE8A 3HDQA 3H9UA 2CF5A 4DXHA 3PDUA 4H3VA 1LQUA 2RHRA 3MCVA 4L74A 4U0KA 2DTDA 3OM9A 2NU7A 4TQGA 3KTDA 5KJEA 2OUIA 2UAGA 3MOIA 3ENNA 4N5NA 3PHHA 1V6AA 4IMRA 3IJPA 4E21A 4RF4A 1TA4A 1V3VA 4CR7A 1KERA 4E6PA 1ISFA 2C5AA 3I23A 1YOVB 3QP9A 2NM0A 3LQFA 2XOXA 4O5OA 3JQ9C 3A14A 4CLXA 4J1QA 3JD0A 5TF4A 4B7XA 4BO3A 5C5IA 1P1HA 4WLVA 1XGKA 4GSKA 4EUHA 1T4DA 4WCFB 1Y5RA 3IQDB 2YZ7A 1RM0A 3H5AA 4IZHA 4Q3EA 3GFGA 1JKJA 1ADGA 1ZW1A 1MFPA 3GAFA 3HDHA 1F14A 5ILGA 1TI7A 2P91A 4D79A 2EEZA 2VWPA 4ZA2A 1EE2A 3GT0A 3K2BA 1PSDA 4J16A 1DIGA 3R3JA 3DAGA 1OC2A 1BXKA 3TL2A 4BO1A 4EEXA 1MP0A 3BMCB 3BTOA 5G4KA 3C1TA 1ISGA 2HU2A 3PJGA 1OMOA 1YWGO 3DBRB 5BT9A 1E6EA 4FJ1A 4RPLA 4D3FA 3MJCA 4GX5A 4BNMA 1Y8RA 3ASUA 5DCWA 2I67A 4CUZA 2OL4A 3GZ4A 5H83A 2P68A 3HNPA 2B35A 3RUCA 3I9LA 4LISA 1E3LA 4LRSB 3I6IA 1F8GA 4WASA 1ID1A 1DRWA 4MVJH 1SEVA 4DPLA 3TSCA 3QW2A 4J0EA 4IDCA 3W8EA 3DTYA 4N54A 3IUSA 2AEMA 1HDXA 2D1YA 1GV1A 2H5LA 3R3SA 2D3TA 3AJRA 4LSMA 1GU7A 3FBTA 4O0LA 5C7LO 4QT0A 1D8AA 1LC3A 3I9OA 2X0RA 3JYQA 1K0UA 2X1HA 1NPDA 4YAJA 1I32A 2HCTA 4EBFA 3ZGYA 4CV1A 4YDRA 1ISJA 3EW7A 4UUMA 3KB6A 4RPHA 2E37A 3EAGA 5DNAA 3AFMA 2NWQA 3WFIA 2P9GA 1ZFNA 4XR4A 4YJGA 4YB8A 2DBRA 4B79A 4E12A 4LCJA 3VH3A 2XF8A 3SBOA 3TDKA 3SXPA 4HBGA 3EGOA 3PHJA 2P5UA 4K9DA 4PLGA 3JYLA 1PZEA 3JQAA 3EY4A 5JDCA 3C8MA 4YPOA 1YQDA 2WEKA 1ONOA 2I6TA 5LCXA 2BI7A 5U1PA 3RQSA 3HN7A 4J9UE 1DEHA 3OQ1A 1NM5A 1FDWA 1F12A 4Z9XA 2AW5A 3JQ9A 4IPTA 3ZCXA 2Q1SA 1MUUA 4FR5A 4II3A 1Y9EA 1TT5A 3BMOA 5EINA 3OIFA 4YT4A 3G79A 1WP4A 3L4BC 2CDAA 1IHYA 1UAGA 3AI2A 1IY8A 4BNTA 3WIDA 2J3JA 4J4BA 5GZ6A 5T57A 3GGOA 3NGXA 3WWZA 1QMGA 4B4OA 5EIOA 1DIHA 4OQZA 3U3XA 1WW8A 1HRDA 5CDYA 5TLSA 4ID9A 1BG6A 1E5QA 1P33A 2QRJA 1DO8A 2QQ5A 1ZEMA 4NIMA 2PZMA 5JCJD 3MTGA 2EP5A 4P8RA 1R16A 2NVBA 3OSUA 5TT1A 2I65A 4AJOA 1OC4A 4CM9A 4I1IA 5LC1A 4QFDA 1EDOA 4GPD1 1YB5A 3WDSA 2Q2WA 1G6KA 2I5PO 1VI2A 4CMIB 1PIWA 4LW8A 2WSBA 3SX2A 3ZV6A 4CM4B 4PLFA 1T1RA 3FD8A 4BO6A 1KVQA 4H16A 2OXIA 5I7SA 4OQYA 1LLUA 3E48A 3ETDA 2PD6A 3BMOB 2EERA 2PR2A 4ONEA 1UXIA 1HSOA 4CV3A 1K6JA 4OXKA 4PG7A 3RU7A 2OOSA 3JTMA 2QG4A 3IL2A 3WBBA 2YHIB 2R00C 1B8VA 1EDZA 3WGHA 1UR5A 2IXBA 1PTJA 2WYWA 5A3JA 4IZIA 4CR6A 4HXYA 5L4SA 1QP8A 3JYOA 1H6CA 1P44A 1E3IA 5CDSA 2WTBA 3ZDFA 1I01A 2GN9A 4E31A 1O95A 1OI7A 4RZHA 3S1LA 4CODB 2BI8A 2CDBA 2NV6A 2X5KO 3MJ4A 2Q50A 3VOSA 5L40A 2DVMA 3RUIA 3ZW8A 1NFFA 1UP4A 4NZ9A 4CLHA 4XA8A 4BO0A 3MTJA 1PQPA 4TSKA 1B7GO 4GMFA 1YS4A 3GZNB 3JQAB 4JNKA 4IMPA 5DCUA 5JO0A 3D3WB 4ZQGA 5BNFA 1DRVA 1ZBQA 4QSMA 4YAEA 5A4DA 5TJHA 1BHSA 4QXMA 3VVBA 1YXMA 1T2CA 2NU9A 4B4VA 4YACA 3ZNNA 5T5QA 4BO7A 3VKUA 5JMWA 4HADA 4DREA 1E3WA 3A1NA 3L6OO 1TXGA 2X58A 3V2GA 4IS3A 4NFSA 1A27A 2B4QA 3D0OA 3NJ4A 3UFXA 1P1IA 2ZTUA 3FI9A 1PL7A 3HDYA 1ZXLA 5FYDA 1HF3A 3DZIA 1NVMB 5DP2A 3ZV4A 3K6JA 4DQVA 1WDKA 5T8KA 4HX5A 3PXXA 1JKIA 4FFRA 1XELA 1L7EA 3TZQA 3WWYA 4LMPA 5AXDA 3WSVA 1O9BA 3WQRA 1N9GA 2P4QA 5ICMA 3UW3A 1UJMA 3PHIA 1XR3A 3ZWPA 2GZ1A 4J7XA 4XJSA 2GZ3A 1PS8A 1FK8A 3VH1A 2VZ0A 4GKVA 4OHUA 4XCVA 4EJ0A 5A06A 2RCYA 3KYCA 2X4GA 3PVZA 1GUYA 3KHUA 5KCZA 1QKIA 4NPCA 4IJUA 1T25A 2AE2A 1N7GA 2W98A 3DWFA 2VHWA 4OAQA 2X9NA 4WLUA 4Y67A 5DOZA 3DTTA 3GPDG 5EL0A 3JV7A 1P77A 2CF6A 3KYCB 4WJZA 2YJZA 3VZSA 4KOAA 1DFGA 3OIDA 2BRUA 4BGEA 1FF9A 3TFQA 3E82A 4BGUA 4E32A 4WK6A 5I7EA 3GK3A 5C3MA 3LC7O 2HJSA 3CZRA 3DZJA 1IYZA 1PGJA 1XQ6A 2VYVA 4GX2A 4D0SA 3LLSA 4QO7A 1G0NA 4A27A 4KUEA 2PGJA 5EERA 4FJ2A 4GMGA 2VTEA 4D3DA 1DSSG 2YFHA 2VWHA 1PGNA 4JP3A 2GN8A 1DJNA 4FS3A 2X0NA 3U9LA 4Y6RA 2DBVO 2VQ3A 2ZK7A 2ZKLA 5GZ1A 2B4TO 3PQDA 3AY3A 4G2NA 2OO5A 1T26A 4FBGA 3RUDA 3E9NA 4TRMA 1U2DA 4B3IA 1P0CA 2EIHA 4AJIA 2A94A 4DRYA 2J5RA 5I9MA 2HMUA 4CMEC 5FWNA 1I2ZA 4IGEA 4DLLA 2DTEA 1JKFA 1V3TA 4MIEA 2G0TA 4DYDA 1UXKA 3F9IA 2B5VA 4INAA 4XEHA 3GUYA 2VYND 3ETGA 3FR8A 3EVNA 4XD2A 5A3VA 2WDZA 3IC5A 1LDGA 3PRJA 5ES3A 5MGBA 3ICPA 5BNTA 4CLDA 3ROPA 2WWRA 1AN9A 2BLLA 5CDGA 2X8LA 1Y81A 3BTSA 1E1KA 1PR9A 3ZWVA 4J1SA 5G0SA 4YAKA 5IXYA 4CV0A 2GSDA 3EHEA 1KEWA 1MG5A 3Q2IA 1VL6A 1B14A 3UCEA 1Z7EA 1IHXA 3O4RA 4CQMD 3NYWA 1I2CA 1YGYA 4YT8A 3E5RA 5TQVA 9LDBA 2BGLA 1DLIA 3BHIA 3GRKA 4BNLA 4ZQBA 2RH8A 4HNHA 2GN6A 3O38A 3JQBA 3CPSA 1V8BA 2YDXA 4TROA 2E6UX 4WCFA 4XB1A 3AUUA 4GWKA 4W82A 1UDCA 3RFXA 5CEEA 5ILOA 3TNLA 2X0IA 5HTOA 1CETA 3V1UA 2DUUA 2FPPA 1SZJG 4GSLA 4CLEA 4FIZA 3WGOA 1FMCA 1RM5A 5L45A 2ZYDA 2F00A 4ZN6A 4RF5A 3C7AA 2JFGA 2WMDA 1MG0A 2PZKA 3G1UA 2NTVA 1YKFA 1SB8A 2ZQZA 4UUOA 1LLCA 2RIRA 3QLJA 3CEAA 1NP3A 2X9VA 3DR3A 4J2OA 4XDYA 1NHGA 2CNBA 1GEGA 4R68A 1ZVMA 3GVIA 2O50A 3FPLA 1CJCA 3EC7A 4N5MA 5B4UA 5KVCA 4JJGA 3H9EO 4OGWA 1A4IA 4WECA 2WE7A 4E5NA 4HY3A 1KBZA 2HMSA 2B69A 4E2ZA 2HDHA 2NSDA 1B3BA 4B3JA 3TOZA 2JFFA 4YT2A 3WOHA 3H65A 2PGLA 1FDSA 1LA2A 3NTOA 5CPFA 1T4BA 1J4AA 1UDAA 4W7IA 4FPXA 4XYBA 3GEMA 2I99A 4Y9DA 4YWJA 2Y67A 5AOVA 4YT5A 1Q7GA 2EWMA 2IEBA 4AJPA 4E5YA 2HO5A 3HN2A 1XWFA 1I2BA 4BQRA 4LGVA 3IP1A 1KETA 3ICCA 4XYMA 4YYZA 4J43A 4BKPA 1YBAA 2BF7A 2CFCA 3ZWOA 5I9LA 4GVLA 5A04A 1DC6A 3PWKA 2CZCA 1GYPA 3WFJA 1NQAO 1SPXA 2VUTA 4BO2A 3CSDA 3GDOA 1EEHA 5JDIA 1F8FA 4EJMA 1D4FA 3C85A 4R9SA 3C7CB 4IIUA 4RPGA 3GA0A 1DIBA 1BVRA 5KJ6A 2B5WA 1Z74A 3GVPA 1X7GA 4XQGA 3TF5A 4UREA 1Y7TA 3H6KA 4D42A 4GX1A 3AW9A 3O03A 1DOHA 4R51A 4A0SA 4ALKA 2Y1OA 4BO8A 4FC6A 1M6WA 1W73A 3Q9NA 3UCFA 4K26A 4BNUA 4CM8B 3HUDA 4YEDA 3IDSA 3NAQA 2ILTA 3S2GA 4DBVO 5JSFA 2P9EA 3BZUA 4IBOA 5IZ4A 4BNHA 1R0KA 2BGKA 4YXFA 1H9BA 1LSSA 3VH2A 3VDQA 4YRAA 1U5CA 1RYDA 1Z7BA 2Z5LA 1I30A 3U4IA 1LC0A 3L9WA 5A9SB 1OAAA 4CLRA 4M8SA 4YJFB 1HDOA 1V9LA 1ORRA 2D8AA 3SLGA 4BKQA 4ZRMA 1NXQA 4D45A 1U8FO 2CDCA 1YJ8A 1PJLA 4ZJUA 1D1SA 4Q3DA 1EUDA 4C7JA 5KJCA 1NAIA 3V5NA 3MZ0A 4MVJA 4R3NA 4PLHA 3EK2A 2XXJA 2JD1A 2Y66A 2VNSA 4AJ1A 3NT5A 2P4HX 3AY7A 4UUPA 3TRIA 4PG4A 4CMAA 4PN3A 1EFKA 4Q39A 1Q2XA 1GYQA 3GG2A 2HK9A 5ADHA 4UEKA 3ABIA 1WMAA 3PLNA 4J7UA 1VL8A 4BV9A 4WLEA 2JHFA 4WLFA 4URFA 4IXTA 1DAOA 1ZXBA 4R9RA 4CQLB 1DLJA 2X22A 4K28A 5K0ZA 3NX4A 3EZLA 1HL3A 1R66A 1E1LA 1K6IA 1B16A 2EGGA 2EW2A 4EJ6A 2PY6A 2Z95A 1MC4A 2D5CA 4L73A 3TWOA 1DC3A 4XRGA 2JCVA 5ENDA 5I7FA 3VH4A 4WKGA 3JQFA 2C7GA 3PGJA 1O89A 5JCJA 2GPTA 1WZEA 2RBEA 2D5AA 3JYPA 3AK4A 2YFQA 2G1UA 4KWHA 5LDGA 4WNCA 5F3RA 4ALJA 1U2GA 5CP8A 2H9IA 3PYXA 5DBIA 1RYEA 3VHRA 1ZCJA 1HE3A 1ULSA 5IDQA 1C1DA 3DXFA 3PQFA 1I24A 2VNAA 3I3OA 1KY5A 1LRKA 1U5AA 3DHYA 4WGGA 4CMHA 3QY9A 3GHYA 1UZNA 4Z0HO 1LRLA 2PNFA 4KDFA 4QO8A 4ALLA 4BNKA 1BDBA 4I9UA 3WJ7A 1VL0A 1SC6A 3W4KA 3H3JA 3AUTA 5TS3A 2O3TA 4IXWA 1YB4A 2AEJA 2Q1UA 2G82A 3A28A 3BMQB 1VRWA 3GGPA 2IYOA 1WDMA 3KOUA 1DIRA 2DQ4A 4NJMA 3PYLA 4YJDA 5F5LA 4Z0PA 4AJJA 2QRKA 3CUKA 4O1MA 4AICA 5KWEA 3JD1A 3WMWA 4ZQHA 3P7MA 3B6ZA 1L7DA 2GLXA 3F3SA 4XZ3A 1R15A 3AU8A 4FSHA 4L4SA 3ZN2A 3AOGA 1WNTA 1U3VA 4BMVA 2Y0EA 3P2YA 5H81A 4Y98A 1BDMA 1BSVA 3C24A 4J2HA 4NDNE 3RROA 1HYGA 4PLYA 5K9ZA 5U4QA 2O48X 4XJTA 4MPDA 5JO9A 5DDIP 3VVCA 3GF4A 3GQVA 2C20A 2HUNA 3KETA 1ZKMA 3GLQA 1H6DA 3OBBA 5CDTA 1EFLA 2PA3A 3PI7A 4Y8VA 5L53A 5B4TA 1JQBA 5KTKA 4ESOA 1GV0A 2I3GA 4XWYA 4E30A 3LLVA 5L4NA 2ZIZA 1PJSA 2ZATA 3V2HA 4DWVA 1XU7A 3E9QA 4AJ2A 5JY6A 1BW9A 2O4CA 1NASA 3PJEA 5TX7A 4J6FA 2Q2QA 1R4MA 2GUGA 2AMFA 1N92A 2AHRA 2PH5A 2DM6A 4FFMA 3F4BA 5HBRA 1CQIA 3GVCA 1I36A 3H7AA 5HM8A 2EGHA 2X6TA 4RF2A 4CMIA 1H2BA 3DEYX 4CM7A 4IGFA 3R1IA 1M67A 5CG1A 1E6WA 3ONEA 2HRBA 4PZEA 4IQ8A 4OOFA 4PLTA 3U4HA 4AJLA 4IIVA 1R0SA 1YH3A 4PVDA 1DC4A 5F1OA 4W9NC 4ND2A 2JAHA 4MVJG 1I3MA 5A05A 5KOIA 2J5KA 3FPCA 3OH8A 1MB4A 1H9AA 3IJRA 4IDGA 5KVSA 2C0CA 4YVFA 3GRPA 6LDHA 3D3WA 4BV8A 4I5DA 4KTTE 5BSGA 1B8UA 1C1DB 4CM9D 4IINA 2Q1WA 4XQEA 5DBGA 4DQXA 1MA0A 1T2AA 4MVJD 3LVFO 3NDJA 2OHXA 4EGFA 4II2A 4N5LA 4MKZA 3ZU3A 2UUOA 2UYYA 2FR8A 4L4RA 1H93A 3WGGA 3FWNA 1JU9A 1ISIA 2BFPA 1IZ9A 3KYDA 2O2SA 4WEOA 4OKIA 4W4TA 1ZEJA 1ZMOA 2EJVA 2IZZA 3B1KA 3IOYA 2NUAA 3GNQA 4ALNA 3ASVA 1MV8A 1LRJA 3E8XA 3LT4A 4BOYA 4OSOA 3OJOA 4TKLA 2V6GA 3U4CA 3NDIA 3UN1A 3DMYA 1LLQA 4ZGWA 2I66A 1P9LA 2CY0A 3PP8A 3M2PA 2FP4A 1PGPA 4FDAA 4ZICA 2ET6A 4CQLA 1HEUA 1ONNA 4RV9A 5HS6A 1GFSA 4GGPA 4UUNA 4D3SA 4J49A 2UUPA 5J23A 2GR9A 1U7HA 3R6DA 2FMUA 4AJHA 4M1QA 4TRNA 3M6IA 1U8XX 1P31A 4J3FA 3BHMA 2R6JA 3HFSA 4JJFA 1P1RA 1NBOA 2I9PA 4RDHA 3KSZO 2IEDA 2FR1A 5T67A 3P19A 4IJVA 3RKUA 1SAYA 1TB4A 4F6CA 4F45A 1NR1A 3Q2KA 1E3WB 4OM8A 3GAZA 4Z9FA 1U7TA 4K6CA 4U5QA 3TZCA 4R16A 1B15A 5JFOA 4NQZA 1C0KA 1LQTA 1R4MB 3BIOA 3EUWA 2J3KA 4P22A 3DONA 5KJFA 3KLPX 1J5PA 4BKRA 3I9JA 3VPGA 3I5MA 4J7CA 5F1KA 4YJFA 3NTRA 4DMLA 4MVJM 1CDOA 5JDCC 5TT0A 4PRKA 4BO5A 1DAPA 1DFHA 3ROQA 1ZK1A 4I5GA 3SJ7A 5FFFA 4IDDA 3QHAA 5AYVA 2ZYGA 4JJIA 2FR0A 4XYGA 1BWSA 4LCEA 3WMXA 3ADPA 3ITDA 2AQKA 1ZO8A 4RVGA 3FTNA 5JMPA 1DFIA 4BNNA 4OL9A 3FBGA 4X54A 2ZCUA 3MEQA 2JL1A 4NI5A 3KVOA 2P9CA 1NTOA 4MO2A 3VKVA 4NU6A 2HK7A 1XYGA 3AU9A 3GY0A 3I4CA 4RZIA 3S8MA 1KY4A 3WXBA 1YBMA 5L9AA 3RI3A 3GR6A 2JCXA 1HETA 2CD9A 1KOLA 4LVCA 3DBVO 3HJAA 3IS3A 2AQ8A 3AFNA 5A03A 3L9XA 1IZ0A 4M86A 1T1SA 3C1AA 3MWDB 4HKTA 4A2CA 1DJQA 1VJ1A 1QRRA 4Y6PA 1ZMTA 3RVDA 4BO9A 2G76A 2GDZA 4Z3KA 2BFOA 3BMQA 5A9RA 3RC2A 3LZ6A 3QWFA 4KDEA 5GZ3A 3N58A 4YQZA 1GQYA 2W2KB 1QV6A 4RLHA 5ER9A 4AJEA 5HS4A 1GDHA 3LT1A 3RFVA 2C7VA 3OFSA 2PFGA 3LF1A 4N18A 4O6VA 2BGMA 2PZJA 3ROMA 4U7WA 2ZB7A 5L7WA 1X7HA 2O3RA 2QYTA 4P38A 2VN8A 2CMDA 1XHLA 1O5IA 3H9JA 5AXCA 4FD3A 1K6XA 3DC2A 4CLRB 5C7OO 1GQ2A 3RC1A 4I8XA 3F5SA 4FFPA 2IODA 3CMCO 4ZU3A 1U4OA 2Q4EA 2DU8A 1Z82A 3FNHA 1HYEA 3QQPA 2WE8A 1LDYA 4R5MA 4XGNA 3RBVA 4J90A 4BNXA 2QW8A 2EXXA 4ILKA 5IZCC 5DZSA 4U8GA 2BD0A 1FDTA 2OZPA 2ZQYA 5DCYA 5DULA 1YDEA 4RL6A 1J0XO 4MINA 4J4HA 4L4XA 5BSEA 3AM4A 5G4KB 2W2LD 2A4KA 2BFAA 3SEFA 3TN7A 4KUHA 5COQA 3RUHA 3ON5A 3WTBA 3FTPA 3ADOA 3PIIA 5L7YA 1X1EA 4DMMA 4JROA 1SNYA 4XIYA 2ZCVA 4PLCA 3HZZA 5C7IO 1UP7A 4IDAA 1MLDA 3V8BA 2GCGA 4B3HA 1E1NA 4CM1A 3DBHA 4B4WA 2PD4A 4XDZA 4EYEA 5JAQA 1LUAA 5IDXA 3BMNA 1NQ5A 1NQTA 2DLDA 4E0BA 3QRWA 4RO0A 3GMDA 1ZJYA 5FF9A 1XDWA 1AHHA 4JGBA 4RF3A 1GYRA 2X86A 3L6DA 4R1SA 3ZWMA 3ZWAA 2H63A 4UVHA 3QJ5A 1N2SA 2O3UA 1NVGA 5ICSA 3KYDB 4CMCA 4ZD6A 5EPOA 3CMMA 5GY7A 2E4AA 4FC7A 3EDMA 3ZH2A 4FGSA 2YV1A 5A9SA 1GCOA 1YL6A 4GAEA 1E3EA 3WGTA 4BNFA 4J9VA 3RC9A 1ZIDA 1JVBA 1MXFA 3X2EA 1S7CA 1EK6A 4A03A 3VC7A 4E2YA 4CL8A 2CSUA 5LDHA 1N9GB 1Y8RB 3Q3CA 3RC7A 3ONFA 5BR7A 5CEFA 5I8ZA 3S2EA 5EQDA 4CM3A 4R4JA 4E5KA 5KNLA 2HMWA 1LDEA 3KZVA 5TNXA 4CM5A 2QX7A 1HSZA 3OA2A 1LNQA 3S2IA 4EI2A 2B4RO 2Q1TA 5G0WA 3I9MA 3WGZA 3CIFA 4M49A 1C0LA 1P74A 4PZDA 3PTZA 3FCOA 1FJHA 4NR0A 3WNVA 3ZU5A 4E5PA 4DA9A 1R4NB 1PJ2A 2X0JA 3WG9A 4UAGA 4NFYA 5G2OA 2VWQA 2DTXA 2GYYA 1O94A 1BXZA 1HZZA 6ADHA 1A7AA 2ZB4A 1P0FA 3D4NA 1AUPA 2O2YA 3RUAA 2YYYA 4KQXA 5AXBA 1DHTA 1CERA 3DOCA 5MDHA 1B8PA 5ITVA 1AGNA 1K2WA 4BO4A 2ZTLA 4BNIA 3DOJA 3QIVA 3PGXA 1XCBA 4XQ9A 1SO8A 1GCUA 1HE2A 1X14A 3KM0A 4CMEA 5JAMA 4HFNA 1YO6A 3UICA 4BUCA 4MOWA 3IUPA 1NWHA 5JYDA 1M75A 3H2SA 4FGWA 3MJVA 4ND5A 1JA9A 4FFLA 1IL0A 4MP6A 5COAA 4A26A 4HUJA 3ST7A 3NUGA 1IOLA 1N5DA 3ZNPA 4DTIA 3JQ8A 3CKYA 2DBZA 3PFWO 5L51A 2EKLA 2EKQA 2X23A 4NJOA 5JS6A 3AM5A 4IM7A 1NPTO 2IZ1A 3K8ZA 1R6DA 3OETA 1XKQA 4YTEA 3NDRA 3AUSA 1ZNQO 3OP4A 4PZCA 4AVYA 3ZNQA 4DVJA 3DAPA 2FHSA 4CMGA 3VZRA 3JQ6A 5IF3A 1Y5MA 3CE6A 1F06A 2J3HA 1A9ZA 3KSUA 3OJFA 1H5QA 3GGGA 3PIDA 4FJ0A 1G1AA 1GADO 3ROKA 1XIVA 1T24A 3DZGA 4LVUA 1VKNA 1W6UA 1PJ4A 4PIVA 3ORFA 1GAEO 2B83A 3DHEA 1PQUA 4M89A 3U62A 3PLRA 3JQCA 1KYQA 5ER6A 1Z45A 3RD5A 1KC1A 1SB9A 3KBOA 3HDJA 1YRLA 3COSA 3DHNA 4FQ8A 3H2ZA 1QLHA 2DUWA 3OHSX 3HFGA 5FI3A 2FSSA 2YUTA 1ENYA 3DFZA 4HFMA 4YJHB 1JN0A 3WLFA 3BXXA 3ENKA 1GZ6A 3EVTA 1F0YA 4L76A 5HA5A 1AXEA 3U49A 2PWZA 2PD3A 3H9GA 3INTA 8LDHA 4U6QA 1UXHA 1W8DA 1GEEA 2BHLA 3K30A 1H2HA 1HT0A 2G5CA 2V6MA 4BB5A 1OOEA 1QORA 4Z3DA 4WCDA 4EZBA 2EKPA 2IRWA 2FRDA 4R3WA 1N8KA 4GQAA 4XGIA 4EITA 4K6FA 3M1LA 1Q7BA 3TZ6A 3UF0A 4FOOA 2AQHA 4DPKA 5TC4A 1ENPA 4M55A 2BMAA 4W9NA 1E7MA 2HMVA 3GOHA 3PEFA 2PLAA 4UEJA 2YW9A 1EVZA 2VHVA 1BTOA 4M87A 3I52A 4FN4A 3Q0EA 2WJPA 5AQ1A 9LDTA 5THQA 1PS0A 2VCYA 1JVSA 2C2YA 3HE3A 1EBUA 1GUFA 2XXBA 3H9QA 3K92A 4AJNA 3W4JA 4JXKA 4CM4A 1P1JA 3RWBA 5JW6A 4MJLA 1GTMA 4FFNA 4J4TA 4MVJE 2BH9A 2OFPA 3K31A 1HDYA 2P5YA 2JD0A 2LDXA 1L1FA 1R12A 1XQ1A 3PHGA 1CQJA 2CUKA 3KEQA 1JTVA 3JQ7B 4TZTA 5JYEA 1LU9A 1QYXA 1PZFA 2JAPA 3GNTA 4CPDA 5JC1A 3OMLA 4LRTB 1KVSA 1YL5A 2CVZA 1OBFO 1U1IA 4HFRA 1RPNA 5IAAA 3WGYA 2B0JA 4Z9YA 1Q1NA 3RUFA 2OORA 2EP7A 3WYBA 1AXGA 2AEFA 4R69A 2ZB3A 3GEDA 1WZIA 4IDBA 2VOJA 5JCXA 3W1VA 3UXYA 1F17A 2X5OA 1I0ZA 1QLJA 4MVJF 1UZMA 2EF1A 5EESA 1HTBA 1NWCA 2TMGA 1T2DA 3L6EA 1A9YA 3NTQA 3OECA 1DIAA 1M2WA 2FPIA 1A7KA 3W8DA 5JBIA 2JKVA 4MKRA 3HHPA 4YAGA 2QHXA 2NACA 4PGFA 5F5NA 3VPHA 3JSAA 5IXSA 4TWRA 1UZLA 2EW8A 3OICA 5B1YA 3JQGA 1PR3A 1UXJA 3H8VA 3SVTA 4XB2A 1PS9A 4QEDA 3IAHA 4CQMB 1SBYA 3JQGB 2XPCA 1LBEA 1LXCA 3FNFA 1X0XA 1I3NA 3KV3O 1B3RA 2OMEA 4WLNA 4XX0A 5GMOA 3RIHA 4RLSA 4J1NA 4D41A 1I33A 1M6HA 2IXAA 2X7HA 3PZBA 3OQBA 2BFMA 1YBVA 1WPQA 2Q3EA 3DZBA 2OP0A 3QE3A 4MIOA 1PEDA 2PZLA 3DFUA 4UVGA 3WYCA 2H6EA 3D7LA 3M2TA 3QVWA 3L4SO 1YONA 3PPIA 2D2IA 4I5FA 2C54A 4ZRNA 1EZ4A 1KVTA 4J1TA 4BNJA 1U3UA 4J91A 1MX3A 1LI4A 4DL9A 4YJHA 4BKUA 4W99A 4IDFA 5HWSA 4MP8A 2VUSA 3H4VA 2ZYAA 4BQPA 5ITWA 1E3JA 2B36A 1NPYA 4JP2A 3TOXA 2DC1A 4R41A 4TMFA 1BW9B 3JD4A 1CF2O 3TFOA 2NLOA 1XU9A 3DL2A 1XEAA 1DC5A 1DDOA 1ZSYA 3C1OA 3ONDA 1LTHR 4C7KA 3U5TA 3I9KA 4QQRA 4HNGA 4RJTA 1I10A 2C59A 3A9WA 1PZGA 3UAGA 3GDGA 2D0IA 1HYHA 4MIYA 2VRCD 3DZKA 3STHA 1E7QA 4NG5A 2HLPA 3JQFC 4KWIA 3SC6A 4R1UA 3Q6IA 3P2OA 4GX0A 3JQAD 2ZJ1A 4ROSA 1VSVA 3FHLA 2VRBA 1BXGB 5AVOA 2NADA 3QVSA 4OXYA 3MWEB 1DPGA 3GHHA 4E33A 1C14A 5I7VA 1N1EA 3D1LA 2ZB8A 1U3WA 5K6AC 4GBJA 4JX8A 5G0VA 4HV4A 2YV3A 3D3EA 3TZHA 4XIJA 3GN1A 4YJGB 1ISHA 2JD2A 3D4OA 5JC8A 3DZFA 5G0TA 2W4QA 4XYEA 4BL5A 4EUEA 1BGVA 1JW9B 3H5RA 4F6LA 3ETEA 2PV7A 1ZUD1 1XA0A 7ADHA 1KEUA 5H82A 2FZWA 1SOVA 3BAZA 4IUYA 4IJWA 5B12A 4KP7A 2Y05A 3RBXA 2BKAA 1MFZA 3DDNA 4UVEA 3VZPA 1A5ZA 4CMKA 4BNYA 1C3VA 5C37A 5JNLA 1AHIA 1EE9A 3WICA 3WB9A 1H94A 3IKTA 5IJZA 1PJCA 4W7HA 1JWBB 3QWBA 2Q45A 4HWKA 1X1TA 1KS9A 3VZQA 2Q2VA 5THKA 1EVJA 1ZSVA 3T4XA 3N7UA 1VM6A 3DB2A 5JPIA 1HLDA 2O3QA 4Q3NA 1ZJZA 3MJEA 3NT2A 3F1LA 3WSWA 1U9JA 2DKNA 2C29D 3JD3A 1TT5B 2O7SA 1PWXA 1SMKA 4Y6SA 4ALIA 2CVQA 5F1PA 2V6BA 2PGDA 3FSRA 4Q3CA 1VJ0A 1GUZA 4BNZA 3HB4X 1ZK4A 5CFZA 2NVUA 3NKLA 3OEYA 4YR9A 3L77A 4O59O 4WPGA 5TSDA 1UH5A 4QX6A 1Z6ZA 1RWBA 3DMTC 3QV1A 3F46A 4AFNA 3JYNA 1N1GA 5F21A 1D7OA 4WOJA 1G0OA 2EHDA 3WR5A 4GL4A 4A73A 4R54A 3AUAA 1VC2A 4BMSA 3LC1O 1C1XA 1Q7CA 4B7CA 2R2GA 2WYVA 4R1NA 3SC4A 2POQX 3B70A 3UHAA 4W6ZA 3GH3A 1X0VA 1XSEA 3G1TA 4TVBA 1R37A 1EBFA 1NHWA 1PJBA 4ALMA 4P4LA 4BHTA 1NFQA 1ZZEA 5EQFA 4YBZA 1K5HA 1T2FA 1LEHA 4XKJA 4Z0TA 3ZNOA 2VZ8A 4NK4A 3GEGA 3AI3A 2EG9A 2FN7A 4HFJA
chains in the Genus database with same CATH superfamily
4X65B 3CLHA 3I04A 1SOWA 1K98A 5D5HA 1E6UA 3AC0A 3I28A 5J2TB 2I7CA 3EG9B 1VSUA 3HL0A 2NU8A 3O9ZA 4EA9A 2BH2A 1RM4A 1W87A 3D43A 16PKA 3ZWNA 2EU8A 4BE4A 2MSCB 3FGZA 1MT3A 5A1JA 3GCZA 4RMNA 2ZJ2A 1KYIA 3QIAA 3SBDA 5FLYA 1MR3F 2VTDA 1G98A 3F7NA 3FFXA 4QRDA 2R4QA 5DHSA 3RYCA 3U9SA 3PNPA 3VU9A 1QHXA 3EWSA 3NEYA 4YBRA 1OXSC 1PL8A 1O6ZA 1EA5A 1USUA 2VJOA 2NO0A 1WW3A 1G8FA 2DHEA 3L06A 4H7PA 5P21A 5K6TA 5IPFA 1O94C 3E5MA 4HAZA 3OFVA 3WRWA 2PCJA 3CZQA 4K1LA 1Q11A 1U5BB 3OQJA 1XEWX 2D5LA 1CKEA 2MTBA 2AUNA 2FHPA 2J41A 3GMSA 3P0RA 3KFXA 3AG6A 3UV3A 3PEWA 3OTOB 3QVMA 2NYVA 1Z2CA 2ZE6A 4KMRA 3ZGZA 5JAHA 2IHNA 1ZD1A 1X80A 3EVFA 1XTJA 3ZU2A 3RTEA 5DIFA 1U28A 1G21E 2GZSA 3FPEA 4V0ME 4Z4FA 1ZK3A 5SZKB 5CFOA 1CUIA 1E4OA 2IVFA 3NEPX 2GHQA 4OHOA 4UXIA 5BVGB 5JRZA 1EDEA 3NDPA 2D3WA 1G19A 4RKEA 4GRIA 1EWRA 3MHPA 1C3OA 1LPNA 2QN8A 3N2EA 2DXIA 1FZTA 3JZMA 1L8AA 4NEHB 3LKDA 1RKBA 4BGVA 5B30A 2QK4A 2JBHA 4EUSA 1QIKA 2NTYC 2PKQO 1JLLA 3INNA 2KHZA 4CF3A 3EQ2A 1H6BA 4IOMA 5B6IA 5B1YA 2XUGA 5BV8A 5IJ0B 3KKZA 4HP8A 3TL3A 4WE3A 4A36A 4KI7A 5A6SB 1NN1A 3BYZA 3EIXA 5CGQB 3PWZA 3G5LA 1QHIA 4RZQA 1UBJS 1WM1A 4QARA 4MI1A 4YV7A 5HPYB 4EVSA 2OSVA 1EWYA 2W5UA 4LCBA 4NFHA 1LJUA 1LBTA 3I2FA 4OU5A 3IP3A 2ZUCA 4ANFA 3EYWA 2R8EA 4CG2A 2AFHB 3C3YA 2C0PA 4JYPA 3U09A 4AAYA 4FHGA 4OP3A 1YZ3A 3QUAA 1LVHA 1G5PA 3CTMA 2GEVA 4EYGA 3DOHA 4FZVA 2JJYA 3RNLA 4GH5A 4DWWA 3C7DB 3OJLA 2JBAA 4V0SA 4FWTA 2JIZA 3INRA 3TEJA 1GPDG 4L08A 3UKOA 1KK0A 2EJTA 3DAHA 2V7XA 1SVSA 4P4GA 3UT0A 4LRYA 3TECE 3SZ3A 1KXZA 2GARA 3K6SA 4BFLA 1FBNA 1DXQA 1RMTA 3CBQA 2H7XA 2KMLA 2O8NA 3CUUA 3FFWA 4GLOA 5ICFA 3WL8A 2P3LA 3EFOB 3FWKA 1MAAA 1MEJA 3TEMA 5L3SB 2YJTD 721PA 1BXGA 1Z73A 1ZVKA 3QPAA 4L9SA 4CQNA 3P5SA 4BS9A 1CRZA 1FYEA 3OOYA 5LZ2A 2FOIA 2VQDA 2RAFA 1SOAA 4JDUA 2R66A 5LLTA 1VJRA 3D6MA 1QRDA 4EB6A 2UDPA 1CE8B 3T95A 3TMAA 5CDHA 3QA9A 4M22A 4DSTA 3GPIA 1NUAA 3IEUA 3PUYA 1EXDA 2YDYA 5E1MA 4A9AA 2WFLB 1HYQA 1OH6A 4XRRA 4O2BF 1CWUA 4JJZA 2ZZNA 1HEIA 3IV7A 5HZHA 3E27A 2IZ0A 4NESA 3FTFA 6REQA 2DQKA 2H1RA 3QTTA 1WSAA 5EJ5A 4OH7A 4QECA 1TU3A 3BB3A 1M7BA 2XMGA 4TVKA 3O75A 4MITA 5KC8A 1TZJA 3D3QA 3OIUA 4Q4LA 2JVJA 3GYGA 4YQYA 3UNXA 4NBNA 5K99A 3SZOA 1RXSA 4H7HA 1N78A 1R7RA 5HE9A 5HUJA 4WOKA 2R25B 3ACCA 3M33A 2TMKA 4WGFA 5BN4A 3A4VA 5EJ7A 4DBZA 4Q24A 1KQPA 4GOKA 3ZHBA 5CNKA 4L75A 5JH7A 4LNHA 1Z0IA 2JJ1D 2Q5EA 2H8GA 2B37A 2OC9A 3PC8A 1QB7A 1ADBA 1ENZA 3AR9A 3JAWA 1QZTA 2H06A 5IFKA 5AI5A 3ZWBA 1RJWA 1UBFA 4RA6B 3ROFA 5EZQA 3WBFA 1W0JD 2O5CA 1BS2A 1KO1A 2FG6C 1A9TA 3MM4A 1T3GA 1V7ZA 3PDJA 4QVGA 4R1QA 4ZAZA 5KHAA 1XB2A 2PLRA 2TYSB 3BAFA 2XGMA 2AD1A 2X5JO 4ND1A 4Q18A 4QFMA 1RACA 4OB7A 4DY4A 4BY9E 2RKBA 1T3LA 2ZETA 2W2MA 4CNBA 5HFAA 4TV9A 4OMUA 3SQNA 4U7FA 2CZGA 3P96A 5KNBH 3JALA 2FPXA 5CLIA 2ZUDA 3BE5A 4O29A 2OD9A 4UFPA 3L7YA 5DT9A 3EWIA 3FSJX 1RHUA 2VDPB 4G4JA 4ARVA 1NUQA 1B26A 4ZODA 2NQTA 4KWTA 3KLNA 1BDHA 5L95A 3O1LA 2EL9A 4UTZA 3O92A 4YP0A 4M1SA 1FDUA 1YS9A 2RHJA 1P3Y1 4F46A 4TRJA 1NNI1 2DFVA 2WP0A 5DNDA 3GDWA 1JDJA 2OT3B 4YHBA 4CEJA 4Q9AA 3GT3A 4JAVC 2P65A 3GLHE 1A9OA 4FEYA 4C05A 1R0ZA 2QMZA 2I3AA 2EV9A 3L0DA 5AJXA 4ZYXA 2XMCA 4YCLA 2B94A 5ICEA 4Q37A 3KEFA 2HR1A 4DYVA 4BC0A 5JVDF 1OFHA 1TRHA 4LZPA 1DELA 1Z36A 2G06A 2Q9CA 1ZIPA 2Q46A 2ZITA 3KOMA 5KMGB 5TIIA 1VFNA 1PFGA 2G28A 2ZTVA 4PSUA 4F4DA 3ODPA 2DLCX 1QZUA 1JFRA 1QIFA 4IDHA 3UUGA 5B57C 1SGWA 1W94A 3TXYA 1FTQA 1LB1B 1FTNA 1WA5A 2E1RA 4GBMA 1E1RA 3K1JA 1DBVO 2BGIA 3UH1A 2VHZA 3A6HA 2FDXA 2QR2A 4A16A 5ECGC 821PA 3PD0A 4UEOA 5CGZA 4ZO8A 3GIDA 3L4BA 1NXOA 1LLFA 3RSLA 1QXSA 3FJ1A 2C2GA 5AH0A 1KI6B 3JQ7A 3CVXA 3NAZA 3QX9A 1UUFA 2ZT8A 3LX5A 4LJ7A 5JJIA 1L4MA 4AG3A 4CDMA 4WVFA 2W70A 1SRRA 3ZE2B 1JAXA 1HDCA 3M1YA 2IHKA 2IBMA 3I0NA 1HDRA 1XJ0A 2QMOA 2YIMA 3F5FA 3L1HA 2G3YA 4O08A 3UWSA 4R40A 4DEXA 2V5UA 5FOXA 4ZEMA 1E18A 3AV3A 1I14A 4OFXA 4MCAA 3NHAA 3OLWA 4X1KA 1BMDA 3HB7A 5KYYB 4RTPA 4RFSB 3VJKA 4TVSA 5KKNB 2R6CA 2J4FA 4TYMA 3EEBA 3VYVA 5JSZA 3WRXC 4WEQA 3MLBA 5HKBA 4QOIA 4MW1A 4MCJA 3RV4A 3BIXA 2IFTA 4K7JA 3LUFA 1RABA 1O08A 1DT3A 1E2LA 3L07A 3P9NA 4RCVA 3KKEA 3HWRA 1QPGA 3QWAA 4KQ1A 5JADA 4YCCA 1C3JA 2X40A 3CYFA 2AEEA 3BHJA 3UHFA 1CYDA 1XFAA 3HHEA 4DZTA 2YRXA 4C0BA 4LJ8A 4YX9A 4F4CA 4CGYA 4DIFA 2LBPA 4EATA 1T36A 2HCBA 2GLUA 5JLAA 4JWKA 4FB4A 2OD2A 1QF6A 3B20A 1COWD 1ZUNB 5EUQB 4YRBA 2G09A 2QPTA 1T2EA 3ZHOA 2XXAB 1DTWA 3BF8A 2RHGB 5MHTA 4FLFA 2QM8A 1NX9A 4AROA 1H4VB 3I05A 2R00A 3CA8A 3LG2A 3WGQA 3N2KA 3TFWA 1ORHA 2PZEA 3REFA 2VRCA 4TTPA 4AG6A 3W79A 1Y82A 2ERCA 4UVDA 1CJUC 3PXBA 4LK3A 4QFBA 4MAAA 3GFOA 2OO7A 3L7BA 5AMXA 4REQB 4IXDA 2VIIA 3PLAE 3FKQA 3EPRA 3K1YA 3FB4A 2PKQP 2Y1GA 3T7EA 1HE5A 2R97A 3BRWD 3PQ2A 4H1VA 2QQGA 3K1ZA 2A1UA 3BIJA 1M6YA 2ZE8A 1FW8A 5CEJA 4ENSA 4FQ5A 4XR9A 2EEPA 4NEQA 4JCOA 1TO6A 2ZJ6A 4INJA 1PNRA 3AESA 1ZW6A 3P9IA 1TW3A 4BVHA 2P3OA 3Q88A 3DXZA 2JGNA 1TJ5A 3E03A 3IP6A 2KBFA 4B4UA 3MJTA 5LFAA 3S8YA 3K70C 5H3LA 1TKBA 3L0OA 5LVAA 1VKOA 2GO7A 4UC0A 4H4EA 1NYLA 4P92A 3WAKA 4GOJA 1I94B 3VYSB 1D6MA 4X44A 4EW3A 1WY7A 1MAHA 1SCUB 4HDMB 2H7CA 3T6KA 1U8AA 3IKJA 1YDMA 2JCSA 1F48A 1UBOS 1U2RA 3M1IA 1R5BA 5LJIA 1XAIA 2D6FA 2YHIA 3ZU4A 4MUGA 1DG9A 1SBHA 1ULBA 2ZIFA 3CHYA 4WX2B 5COBA 1D7AA 2WD8A 3V4LA 1HDZA 3LK7A 4D9BA 3SR4A 1BJKA 1PZHA 3DEFA 2XE8A 3RF7A 4DC0A 1HORA 2P9ZA 4JFRA 2WIAA 4OQXA 3MOGA 4RS3A 4XGQA 3A6FA 4PWYA 1ODJA 2GERA 4B46A 3AB8A 5G0UA 2NU6A 2F6RA 1Q21A 2FFQA 3HDGA 5HIJA 4CR8A 4DR4B 1FYDA 1JU3A 1L7AA 5KO2A 4RELA 3A04A 4RKYA 4RX1A 1R0LA 3F73A 4LK2A 3DBLA 3A9VA 1E2IA 2BJWA 1SU4A 3VDRA 1VYTA 5TQJA 3U56A 4EYSA 3ADBA 2CLLB 2JLSA 4EY8A 3STTA 5I4IA 1GUAA 3GUCA 3HVUA 4PG5A 2BISA 1XTQA 2HA7A 1CUYA 3TRDA 3RRXA 3ANSA 3B1YA 3RYIB 1RKUA 4JS0A 2F8SA 3NHUA 1GQOA 4CJXA 2Z2YA 1IPFA 4LNUA 4PYQA 3O8QA 1M2KA 2VLIA 2V0CA 1N0WA 1NMEA 3RUEA 1PJRA 3S4YA 1ZD3A 5C51B 1O7JA 2ZU6A 4E5SA 4IJKA 2VP9A 2J3LA 1Y1SA 3BXPA 5A6VA 3NRCA 1PU2A 5JNRA 4O1HA 3G9QA 3L01A 5JZBA 2WD7B 2PUAA 4CMBA 4J0IA 2GXAA 3NH6A 1SQFA 3K73O 1AJEA 1AG9A 3GG9A 2QL7A 3CUSA 3HLTA 1NLYA 5KX5F 2P8SA 4IQGA 3T4UA 5K6AA 4H0NA 4GKBA 1XA3A 1EUDB 1GU1A 1I3KA 1IH8A 3E8SA 2V1XA 3AEYA 3IB6A 4NHEA 5AI9A 1MOSA 3A1WA 1V1MB 2PUEA 1ZNXA 1H2RS 2W11A 2QVYX 2ZRKA 3H4MA 4OIMA 3GRUA 2P9JA 3JQEA 5GWXA 2FFRA 4XWGA 5AI4A 3R77A 3PHLA 3TGWA 2GNAA 4AL4A 4JN6B 2QPAA 5A0VA 2FXIA 2YHUA 1X77A 3M82A 4C4OA 4MICA 4BBJA 3WHKA 4MCHA 3P0IA 3PWTA 4JZYA 3OD1A 4WZBB 5C1PA 2IHUA 1P1KA 2OCGA 3BCUA 4Y2RA 1L5HB 3TJRA 2ANBA 1T5BA 3D5TA 3TKYA 1VSBA 2QVGA 4JX9A 3GIWA 1OH8A 1MQ8B 2IW1A 1UMKA 3D3JA 3WLHA 3SICE 1M1YE 3CQ9A 3ND8A 1FS4A 2ZT7A 4QOGA 3S55A 4YLGA 1Z2OX 1M2OA 3ZJVA 1LX6A 3ITKA 2P9QA 5I4KA 1EYZA 1G8PA 2R5NA 4RE5A 1RXUA 4UBOA 5HRUA 1ZJWA 1EP3B 1Y6QA 4NS1A 2HRZA 1ZR4A 1IHOA 3ZV5A 4YRQA 3BMNB 2D0PB 1BCSB 1VCNA 1QWSA 4C3OB 1T34A 4BNGA 4FW8A 1QGUB 3F6PA 1M1YB 1MH9A 1TCCA 1XQXA 2PLNA 3IHTA 4NATA 3RFTA 1ZONA 1KZ6A 1W8IA 3A2NA 3FF4A 4GG1A 5I7RA 4QHSA 2F55A 2J4DA 4DQUA 1MVLA 2NQ8A 2YXBA 1WMBA 1GFIA 1AUXA 1G6OA 3OZVA 4JBLA 3RCBA 4EHKA 1SXQA 3E2PA 4KDRA 1XRLA 2NNWB 4ICIA 4FKBA 4UCQA 3L05A 4WFQA 4YDHB 3EODA 4C3VA 4EI9A 3PKZA 3CLUC 1S96A 1XD2A 1XDDA 3HEAA 1OZAA 3BSWA 4DLZA 2Y0CA 3K9HA 3C48A 2CUNA 3KALA 2GJSA 4LXYA 4HVLA 4DMRA 3MSXA 1ZQ9A 2G5PA 4C6TA 1D3AA 4L8YA 4UQPA 2H2DA 3K9GA 2PKEA 2FETA 3VR5A 3T7CA 4GWGA 3RU9A 2JGKA 4CQJA 4K0RA 1N6OA 3R41A 1IJFA 1TQ2A 2X2EA 2UVPA 4HSGA 5T6BA 4A2QA 2GD2A 4OP1A 2Y92A 3A10A 2YBDA 5E4TA 3ITEA 2JZCA 4H35A 1UJBA 2QX6A 5DNCA 1BN7A 1QHGA 2A3NA 2I7DA 5ULLA 2QTGA 2FYTA 5EUBA 5CAEA 2BZGA 1W49A 4MYHA 5DYYA 1JMKC 1DRUA 1E79A 3B60A 4YI5A 5ADWA 2P30A 5I47A 1KEEA 1IB6A 5F76A 4MV8A 4URYR 2V6FA 1Q0RA 2W4MA 1U4NA 1IOVA 1OW3B 1IVYA 4L8FA 1FUYB 1X6VA 2WJ3A 3O5AA 4BFZA 1NJSA 3RSOA 4IMIB 2AG8A 2RCNA 5KPJA 3CKMA 5EYPB 1J7JA 1E9FA 2W93A 4B3TB 4QUJA 2CZQA 2XNSA 1A4RA 2FN8A 1E2QA 2BMVA 2H11A 1HXHA 2NO5A 5JCZA 4HUQA 1D4OA 3CXRA 1K86A 4WKNA 3LF2A 5JXIA 3JASA 4JASB 3UBMA 2Y9MB 1YOVA 4KXLA 2JLAA 4RZUA 1OX6A 3OJ0A 4QBIA 3B3JA 1OFVA 3FOCA 5D7BA 3ZQJA 1JEOA 4IQ0A 4LS3A 4BGIA 2R8ZA 4XWTA 4ZCSA 5HQ3B 5LP6A 2VSFA 1AKYA 1JB1A 1XZKA 4FUQA 4ZJYA 5G4LA 3FSGA 3OQOA 3R8FA 1XDZA 3KUXA 1A3CA 3HM2A 3ZVMA 4RQUA 3WHIA 3PX2A 3ZE7A 3HWSA 5K20A 1UKAA 2AMVA 2DJIA 2YBEA 2WZDA 4JC4A 1SHUX 4LDNA 3HSKA 5K0LA 1AC5A 3F74A 4REMA 1QV7A 4CEIB 2OWDA 2QUZA 3PVCA 5KSWB 2QBYA 3FROA 1P60A 3RJTA 5SYNA 1MO4A 4IS2A 4PAGA 5J43A 2HJ9A 3GFTA 4TL9A 3TLGA 2MDTA 2O14A 3E6AA 4PTLA 3RJ5A 1KAQA 5AOCA 5TY0A 1QQ7A 1II8B 1BHO1 1CF4A 4EFDA 1ADFA 4V1CI 1OYVA 4PVCA 3H1TA 3B6MA 3QXSA 4AZ3B 1L2TA 3IE1A 2JLVA 2ISQA 3BXGA 1RYBA 3IESA 1TAGA 5HIKA 2AE1A 4IP0A 2UV8A 4JQCA 3QWIA 4PXYA 4PW0A 2L17A 3FLAA 2BEWB 4C7XA 2QD3A 1WNFA 1M76A 2L69A 1WKBA 2I7XA 3CPHA 4P32A 4BE7B 2EAUA 5KTSA 1E3QA 2QS9A 2W22A 4P35A 3N0TA 1NQOA 1P9NA 1DHRA 1US8A 4OHZA 3RSHA 1JF8A 4S2UA 3ZHYA 5IU6A 4G26A 3NJ8A 3UGQA 5L6MB 1J25A 1GNVA 4Q3BA 3PGA1 2ECPA 4Q9JA 1SK9A 1TLTA 3BEDA 3HB5X 1QRUA 2R1VB 4YCAA 5KYVA 3DGEC 3WA6A 2X8JA 4RGBA 1V0JA 4G25A 4G3XA 4CUJA 3V2UA 3NC0C 3NI2A 1EAYA 1RZVA 4EQ6B 5I7WA 5JE8A 1AHNA 2D5IA 3RRMA 3PPXA 3WLAA 4YK7A 3PCXA 1OIWA 1OI3A 3EGCA 4EF4A 1D4AA 4U0KA 4RXMA 5FWDA 4C4XA 1IZ8A 2WKPA 1P19A 1X8XA 4QE3A 3HR8A 2V6JA 1OPXA 3IFSA 3KTDA 5FOUA 3SDBA 5FBVB 1YRAA 4DV3B 5FWYA 2QDXA 5EJ6A 4PTYA 4RD1A 4ZI3A 4CR7A 4Y1RB 1WBDA 3NDBB 1H8HD 1AA9A 4OBXA 3DM5A 4FP9A 3I73A 4QGGA 3TW6A 2XOXA 4HAWA 2R5WA 3TQFA 1Y0BA 3GJXC 1LX7A 1P1HA 2CLFB 2ZWPA 3JQQA 3PEEA 4WLVA 4BO3A 1YTUA 4GSKA 1I9CA 1G5HA 3AHJA 4M7PA 4YH1A 5F77A 3W34A 3E9DA 4IZHA 2GBGA 1BQ4A 1RJFA 2MSNA 3O8OB 3TM4A 3W7VA 3P0HA 4CIXA 1J21A 1OXKB 1CYEA 5JNSA 4QBTA 1IVSA 5ILGA 1TI7A 4D79A 3IVXA 3K0FB 1FU8A 1S2GA 4QHTA 2PMBA 5LP6F 3K2BA 2P77A 5LYJF 1QFYA 3R3JA 3DAGA 1OC2A 3KE9A 3LSTA 1BXKA 3M4ZA 3LPLA 1KE1A 3TL2A 3CNNA 3V7YA 4JR1A 2GKGA 2C9DA 3C1TA 1ISGA 4I1YA 5G4KA 5HZKA 2JZOA 2QSZA 2ZYRA 3HABA 3KZXA 2Z6AA 4FJ1A 1YZTA 2WMOB 3M9WA 3R5FA 4D3FA 3NVAA 1UFRA 1ZI8A 3B3GA 2P79A 3EXFB 2R6AA 3RS3A 3LOUA 2VEDA 2I67A 4CUZA 4WN3A 3DE1X 3FNBA 1F5SA 2JH3A 2OL4A 3PUXA 4JSRA 4OQNA 5H83A 1S3FA 2B35A 1HTWA 4ALIA 3SOZA 5K45A 1H1LA 2A2ZA 3WAGA 1UFVA 3CG4A 3NW9A 4BU1A 4Z4CA 3FFTA 2GI4A 4QOFA 1DRWA 4LECA 4C4RA 3HKBB 1L4FA 3CCCA 3T3IA 4AQYB 1ODSA 2C0QA 3OPYB 1BD4A 3QPDA 5JRDS 1UFQA 1HFEL 2LWIA 4N65A 2CNLA 2H00A 4QGBA 1KYTA 2OY0A 2K2WA 3IUEA 5HKKA 3QXGA 1QH8B 4RJLA 2NMVA 2D3TA 1C9KA 2IX3A 2B6NA 1CEEA 1GU7A 3FBTA 3MGAA 5C7LO 4QT0A 3ZDZB 4RD2A 2DR0A 2EL7A 5SY4A 1ZMBA 3TL6A 1T6ZA 1Q1AA 1Z2NX 2ANCA 3OESA 2W0MA 4HRXA 3O0TA 2QZSA 1X38A 1OT3A 4WXEA 1SXJB 4NPAA 2G77B 2FK8A 2KLHA 3O93A 5FADA 3DNPA 5JG7A 2GYVA 3OTGA 3P2KA 1DWQA 2YJ3A 1ISJA 3GLRA 5AHKA 1EZZA 3EAGA 3FYHA 3VYTB 4DDUA 2P9GA 4HN9A 4J75A 4HZGA 2PWYA 4JSTA 1P0PA 1ZFNA 4XR4A 3KT0A 4YJGA 2LZ0A 1N1DA 4LCJA 3VH3A 4W8OA 1YASA 4TL8A 3OE7D 2FPMA 2C4TA 3EGOA 3PHJA 2P5UA 3DLHA 3VHXB 4MV4A 6ABPA 4N0MA 2WW8A 2FQYA 3PCRB 1YQDA 1QVZA 2I6TA 2Q4OA 2IK8A 2WEKA 3QLTA 3AB3A 1MB3A 1YMUA 4BN4A 5K03A 5KTMA 2IE8A 1FJXA 2FPSA 4ZREA 3CZ5A 1HK7A 2PUWA 4KWCA 1TECE 4JXXA 1TGYA 1HFJA 3L7DA 2QT9A 4Z9XA 3I4LA 2AW5A 4NARA 2CUZA 2ZI7A 3JQ9A 2I4NA 5AHRA 5C34B 3OQNA 2V7GA 5SICE 1RAEA 2J3DA 3N86A 4KPEC 4FR5A 4II3A 1Y9EA 1SA0A 1Z5ZA 4PC7A 1N6KA 5C8XA 3ZY6A 3QEAZ 4R1PA 4IH9A 3OIFA 3TNJA 3G79A 5GGXA 3ZXUB 2J0QA 1MX9A 3UM9A 2CDAA 2ZKIA 3CWQA 4Y2YA 4CT5A 5B6JA 5JRJA 1IY8A 3K5HA 5FQNA 3WQHA 4X6YA 3ILXA 3BDAA 1OIXA 1ZR2A 1P61B 4KO4S 3HY6A 2VDNB 2IWHA 4XX1A 3IRVA 3LQ1A 2X1LA 1DWOA 4E11A 4HAUA 1DIHA 1YI1A 3OY7A 4J76A 4NCNA 4G4SO 2CYCA 1U1DA 1HRDA 2XB9A 4N1AA 3WP1B 1CDZA 4KXWA 1TJYA 5E2IA 4AUMA 2H0RA 1MD9A 1E6MA 2BEVA 3OTIA 4OHRA 2NO7A 4UNIA 4BJ3A 4K03A 1HG0A 1AN0A 2FUG1 5LBIA 2DERA 4ZOLB 1DEAA 1ODKA 1N2CE 3HYLA 3TCXB 2MT9A 2Q6IA 3FMVA 4WKBA 4C22A 1ECCA 1VIVA 4CRWB 5JCJD 1N33B 4N49A 1XWWA 4BLTA 4IIEA 2FUG6 2XVAA 2JVIA 3MS7A 1P2GA 3NYRA 5DT2A 5LC1A 1XEWY 5HJEA 1MRSA 2PSEA 2GCOA 4QFDA 3WDSA 3R9WA 2ZDHA 4TXMA 1G6KA 3FOBA 5K0BA 3DMHA 5HGXA 3RDPA 4CMIB 4WOBA 1RT9A 1NRWA 1RCFA 3F6SA 3W77A 3WLJA 1A9XA 4HPWA 4PLFA 5DGCA 2C31A 5CNIA 1NOKA 4NU8X 2OXIA 5IHPA 3GAAA 1LLUA 3E48A 3G8YA 2EERA 3QOFA 2EOAA 3N2LA 5EWLB 1U04A 5LNK6 4MVWA 1LNZA 1ZLYA 2ZBQA 3BHNA 3PUJA 2OOSA 4JT8A 2YWEA 4XLTA 4KAXA 1K97A 4LF7B 1DT5A 1PT9A 1REQB 3CRVA 4XJXA 1B8VA 1OREA 1EDZA 5DYWA 3RWMB 3U3KA 3LDFA 4DLXA 3UO8B 2OZLB 8ABPA 2NXJA 5A3JA 3QEMB 1AS3A 3ES9A 4NMMA 5EPEA 4EYOA 4LJYA 3I0ZA 5EP4A 3UMCA 1XTBA 5TXGA 4C89A 1L4HA 1P44A 4QJ3A 4LBYA 4MWTA 5DHPA 5KWSA 3TIFA 4RACA 3NRBA 3T06B 5JNUA 2X8AA 4HGZA 4OXIA 3SXUB 1L8QA 1OHHA 1UBTS 3S1LA 3NEJA 3MWLA 4HRVA 3E9RA 4CODB 2DUNA 2NV6A 4YN3A 3IAM1 4P5EA 4S0ZA 1OZHA 1KZ1A 4ZZ2A 1NFFA 2ZYIA 3JWJA 5ERGB 1I3CA 5IH3A 4AB1A 4E94A 4NZ9A 5FWAA 5H70A 3QXCA 5DRYA 3W2FA 3EYAA 2HY7A 2M6RA 3MTJA 4KXQA 4GMFA 3O8DA 1BC5A 4Q1AA 1YDHA 2GKOA 5JH7F 3CNOA 2C7QA 5DCUA 3UYLA 2Z5GA 3D3WB 1BJRE 4ZQGA 4DABA 5BURA 5JO0A 1LPAB 1NF3A 5A4DA 4I6GA 2PUGA 3V55A 1GVHA 3IR5A 1DXOA 4KQ6A 2AC4A 3WZ2A 4WN9A 3ZCRA 4E7OA 2SCUB 4JEMA 1NDQA 3CVOA 4ZCLA 4BO7A 3C4JA 3EVGA 2FMHA 3A1NA 3NPAA 1QGAA 3GELA 5K2MA 1JSXA 5AVKA 5HXAA 1KQGA 1FX0B 2EDAA 3F8SA 1UPCA 3UFXA 2G9VA 1XRMA 4HQ0A 2GJ8A 2VH2A 4P81A 5FYDA 3V4FA 2XCUA 1HF3A 3W9SA 1E1CA 2WJIA 3ECAA 4PNEA 4FU0A 3E1GA 3ZV4A 3K70B 4DQVA 1WDKA 4EECA 4B2YA 1C7RA 3QJYA 4HX5A 1F51E 3M49A 1L7EA 1OGIA 1YBHA 2AJTA 4LMPA 2CFSA 4INOA 3HU2A 4CL0A 5AXDA 1O9BA 3LUDA 2IF2A 3ZHRA 4X71A 3U3MA 5ADUS 5ICMA 2EBFX 4LPSA 3LK6A 3F6CA 3PE3A 3NS7A 4UNQA 5K8LA 3K1AA 4COKA 4NZPA 1T4GA 4FHZA 1IWOA 2A0KA 4IRXA 5G3ZA 3ZWPA 2ZS8A 2PJRA 4IUBS 1NVVR 4IIXA 3GU3A 4UATA 4Q1CA 2VZ0A 2I8LA 2VBCA 3AFOA 2CJYA 2EFYA 5A06A 4U5XA 2C57A 4ZU6X 3P0EA 4NYJR 3I30X 3PVZA 3UMFA 3KHUA 4MQ6A 3QU9A 4NVRA 4R81A 1J0BA 4XCXA 1WSDA 1KI3A 3U7QB 3U4AA 2AE2A 2W98A 4BZQA 5BSVA 3KR0A 1V5FA 4LDAA 1P77A 3FETA 2AVDA 2O5RA 2Q6TA 3VZSA 1V48A 1MJFA 2WF7A 4L72A 3JZFA 3D7SA 4HGPA 4BGEA 3O7WA 3OPMA 4B7ZA 5FORA 2WAYA 4Z53A 2LCFA 1Z6YA 3PR2B 4DADA 3LC7O 1X7YB 2RKWA 3JAKA 4N01A 1IWBB 1PGJA 1XQ6A 1C5KA 1SG9A 2FEAA 2GEBA 3RSSA 2DZDA 4QO7A 5GPBA 3TTXA 4B2PA 4ENRA 4Z54A 1H8EA 3X2SA 4KUEA 2ZAOA 3CX3A 3I8OA 2PFSA 5GOTA 1BYIA 1RNLA 2XITA 2OHIA 4DLRA 4JP3A 3PENA 3AL3A 3CUTA 3P0JA 3TGPA 4JJ7A 1YCFA 2QUAA 3EN0A 1OILA 2PQ6A 4KLCA 5U4XA 2VQ3A 2WIKA 2ZKLA 4J0KA 2B4TO 4W7SA 5GZ1A 5ETJA 3H11B 4G2NA 2OHHA 1RBMA 1HQYE 3W2EA 3RYFA 1V1RB 4B3IA 1YQQA 1QH9A 2N0SA 4FZRA 2EIHA 2A94A 1KMIY 3PUKA 1OQAA 5H9VA 1ZC4A 2WUFA 1IN7A 5EMMA 5HF5A 4TTSA 5D01A 4EUNA 4ZYYA 1R00A 4E46A 2OG1A 1V3TA 1Z6PA 5FX2A 1OFUA 1DRJA 4YJ2A 1E20A 4UBLA 1Z4LA 3EVAA 4INAA 1NIPA 4RMHA 4X7MA 3FLEA 2VYND 3GUYA 1HURA 3IXQA 4XD2A 1NJ2A 1RTTA 1QU2A 2NYUA 1BS1A 4UBKA 3PF9A 2WDZA 2GZHA 3KKOA 4ROTA 3ICPA 2XWQA 3QV2A 4HLDA 5E9QA 1JJ7A 2C4NA 4TXHA 4IOKA 5CDGA 5JSHA 3B51X 3ZY2A 2DQZA 3GJTA 5G0SA 1JPJA 1VG1A 1NW6A 5IXYA 3TLMA 2C9OA 2LTAA 3NXKA 5BYJA 2RI6A 1VRVA 2OGWA 3OG9A 4HOYA 4CNQA 2L0XA 4R7ZA 1I3OA 2Q29A 2Y9PB 3RHFA 1WHTA 2HPVA 5LZ7A 4WY8A 5B1IA 2ZVDA 4Y3UA 5JUWA 3QKTA 3W7AA 1UWCA 2RFLA 4NV1A 4BFVA 1ZCBA 4IWNA 1JHYA 1EM6A 1SIBE 2A9RA 4CDGA 5JECA 1O0BA 1TQ4A 2C4WA 5J63A 1ORDA 4R0VA 5G3YA 4UU8A 4DBLC 1L3IA 1QKJA 4QTYA 1BA3A 2HDWA 3HKEB 4MA4A 4W5NA 1BWQA 2YDXA 3MD0A 4W82A 1E4VA 3GJ4A 3U7RA 1E0AA 2X0IA 4OA5A 1MB2A 2P6NA 4ZVPA 1YSCA 2PJUA 3H2HA 2DUUA 3A6EA 3O7MA 3Q7QA 4IEEA 2BCGY 4RD0A 4YRTA 1TM3E 5C8ZA 3L46A 4B0PA 4KKVA 3C7KA 2YICA 3O73A 2ZYDA 2F00A 5LZ8A 5ALPA 2O20A 2JFGA 1X80B 1Q6ZA 2WMDA 5EAIA 1LW6E 1YKFA 4DSNA 4V39A 6NULA 4FNOA 2C97A 3CEAA 1NP3A 4J2OA 5JZVA 2JIRA 5K01A 1N77A 4GP9A 2WKWA 4Q02A 4Y1EA 3G85A 2MSWA 3GDHA 4XVQA 1KRXA 2O50A 5B4UA 5IBCA 1L1EA 3I2JA 4ARAA 2Q27A 1BMFA 4QRIA 3WGVA 1DKUA 1A4IA 1KNQA 5K05A 1CR0A 3AGQA 2FKAA 1O5OA 2PIAA 1L8OA 5ALQA 5BQXA 4XIGS 3A4YA 2AS0A 4JU8A 1B3BA 4UCFA 2PS0A 2JFFA 3WE7A 1ONSA 3H65A 5IYZF 1NTRA 5EIAA 5F35A 3NTOA 3ZWDA 1T4BA 1UJNA 4TWIA 1UDAA 1XJ5A 5KNCD 2JIQA 1ZYUA 2QIPA 2WHEA 3OQPA 4W7IA 3U31A 5CXXA 3CLKA 4DCVA 2PSFA 2V3CC 1PV1A 2RAVA 4IKEA 3DA8A 2IYLD 1DJOA 2IEBA 3GXBA 4RADA 3HN2A 3P5BA 5F2KA 4E5YA 5BV7A 3MBIA 1ZGBA 3SGLA 1Z35A 1FDIA 2EJCA 1XZJA 4C21A 1NJ6A 3DLCA 1T1EA 2VP5A 2CFCA 3ZWOA 4CXMA 4GVLA 2VRWA 4QYWA 1GSOA 3UANA 1U7OA 3SYRA 1X9IA 1GRVA 3PNSA 1NQAO 4U2BA 1BKYA 5DU2A 2VUTA 1QRAA 3EGWA 4G1MB 4XM2A 4BO2A 3SVLA 1M8GA 4PO3X 1A5BB 4CIDA 1D03A 1U02A 5JDIA 3HBAA 4ARZA 3G0GA 1D2EA 2OCIA 3O3CA 3SQOA 5I01A 1M9NA 3EJ6A 1XJWA 2QRVA 1NXVA 3BE8A 3WNCA 2XNCA 3U61B 1DIBA 2HPAA 3JAKB 4MUHA 4ZXPA 3F0TA 1Z74A 3ABSB 1JPVA 1X7GA 3D6HA 4F9EA 3TF5A 4O25A 1DL5A 3MQ4A 3TQQA 3FZEA 3H6KA 4MLZA 1DJMA 1OSNA 4FGZA 4PHHA 3HDVA 4OAPA 2QTMA 4A0SA 2IPXA 3DOFA 3A31A 4FC6A 4LBVA 4B3RB 4LDQA 4G0UA 4CCYA 4DN6A 1NBEA 3CU5A 3HUDA 2MU1A 2ILTA 4PIMA 3S2GA 1ETHA 4ZI7B 2BVNA 1TX4B 5IZ4A 5IP5A 3K0AB 1IBLB 2ZULA 3OC0A 1H9BA 2JW5A 4ZPJA 4HX9A 1UWKA 4YRAA 4ZVRA 4C0LA 4CLRA 2QD2A 1OAAA 4PHCA 4M8SA 4RUKA 2QV0A 1V9LA 1DNPA 2D8AA 2XZTA 3JQRA 3E70C 3QVVA 4ZRMA 1WVMA 4HGYA 4ZJUA 2XECA 3MCZA 4KB5A 4G67A 1NAIA 3V5NA 4FHCA 5GJVC 3RVOA 2VXOA 2GBPA 4WH0A 2KBEA 2JD1A 2VNSA 4AZTA 1Q3KA 1NQWA 3P9SA 1VZ3A 2WHXA 3NT5A 4G5YA 1PD1A 5IWAB 1WZCA 1ZRSA 2XOEA 3TNDA 4D4LA 5FAKA 1H3NA 3PDWA 4D97A 3LVBA 2QRMA 5KSPA 2FMIA 5DVZA 1AH2A 3GG2A 4P4UA 4X94A 4EY6A 1HLFA 3AEQB 1I6LA 2O2HA 1WMAA 1J8FA 1G21A 3AIMA 4BV9A 4WLFA 3U16A 3W5BA 4R9RA 5K0ZA 3NEAA 3LGXA 1BNCA 1U3GA 2MHCA 3OZDA 4Q21A 2R9VA 2AW3A 4DUGD 4EI8A 4ZK2A 3RC3A 1DTSA 1KARA 1OLOA 2EW2A 2H08A 4UJ5A 3WK4A 1CQWA 1QP0A 2IS2A 2VSQA 1RCUA 1XZLA 2E4UA 1DC3A 3B7GA 1NLUA 1YIDA 4NABA 5ENDA 1O96A 5I3CA 4HGNA 3WADA 3VZBA 1I4TD 3E5HA 3HCOA 5EWMB 1ZIYA 2M9MA 2UZ0A 5JCJA 2GPTA 4JYAB 3TOSA 3G7UA 1XZCA 2RBEA 2FN9A 4JMLA 5G02A 4HMOA 2CLDX 2GFIA 1DEOA 5LDGA 3UAYA 5G1PA 4Z86A 2H9IA 3PYXA 1QYIA 1F38A 2ZVJA 5DBIA 1RYEA 5BN5A 4RIIA 1HE3A 1ULSA 4KR0A 4R9UC 3RS9A 1C1DA 3BQ9A 3MYRA 2VNAA 4L5JA 5DM2A 5JQGB 3I3OA 3E8MA 1LRKA 3LM8A 3HU3A 1ULZA 1KOFA 2PS3A 4IF6A 2PNFA 1J8DA 2IEZA 3QPCA 4MLDA 3RG8A 4BNKA 1XPOA 1TK2A 4V38A 4I9UA 1Y9DA 1L6IA 1EX1A 4YGYA 3M34A 2ZUFA 2P2ZA 1PG5A 2H57A 4MVYA 5JCOC 2PZAA 5JROA 2GOYA 3HLKA 1X94A 5TS3A 1E0SA 1VIYA 2FQQA 2O3TA 1YB4A 3FCUB 2FZGA 4HJXA 4IXWA 2AEJA 4JT2A 4JUFA 4ZAGA 2M6LA 1JFFB 3ZDRA 3E0XA 3A28A 5LA6F 3GGPA 3NIWA 2IYOA 2I1VB 1DIRA 1SH7A 2P2YA 3KOUA 3PYLA 4NJMA 5E6UA 2XDAA 5HOQA 4AJJA 4RJ2A 2GZMA 2UXDB 3VKFA 3BFKA 3KJHA 2ZOSA 3PL5A 4ZDJA 2Y27A 1JMYA 4MW9A 4UFNA 3BERA 3JD1A 2O1WA 3WMWA 4ZQHA 5M2QA 4ODIA 4PQFA 4XFJA 4E5UA 1YRWA 2ZYUX 4U39A 3AU8A 4UAUA 4L4SA 3AOGA 4TMXA 1U9CA 1IY9A 2ZR9A 3ZBQA 3LOPA 3AVVA 2ST1A 4H2DA 2J9FA 3N76A 5JXHA 4CN8A 2GUWA 1HYGA 2JJ8A 2ZJZA 3A37A 1WHTB 4HDNA 3WLRA 1YUNA 4F04A 5FPYA 2E6KA 3VNVA 3EIUA 3T3DA 2ASEA 2XYGA 4UFOA 4RTOA 1NBMA 1OAOA 3K72B 3UY4A 2BHSA 1KEKA 2BFDB 3R3ZA 2C20A 2ZIGA 3KETA 5F9HA 2D2XA 3OBBA 2P6PA 3ESBA 4GMKA 2PA3A 1ZHFA 3PI7A 4K9NA 1KBOA 1JQBA 1O57A 2V58A 4Y8VA 5KTKA 1QQBA 1QZ3A 2RDMA 4ESOA 3EF0A 3PJRA 2EARA 2CCGA 3I42A 2XEDA 4KQKA 1YCDA 4KRXA 2HIGA 1ST2A 5FPHA 2VDKB 4ME6A 2A9VA 3EUFA 1XU7A 2O05A 3GLFA 3IAEA 3V7FA 4BZXA 4HGRA 4C0HA 5JY6A 4G4IA 3PJEA 3ZG6A 4UXHA 1V43A 1R4MA 2AMFA 2PH5A 3MINA 5TC4A 2VTVA 3A1DA 5HBRA 1CQIA 3GVCA 1Z13A 3TJMA 1QFJA 1AKTA 2A5JA 5KDOA 5HM8A 3FMGA 5JYBA 2X6TA 4RF2A 1F20A 1WXFA 4Q4JB 4P7BA 1SUIA 2W00A 3O31A 4OSEA 5HOEA 1JZSA 3PUZA 1NQVA 4EGSA 4F9FA 4UZSA 4N0PA 4EIWA 2HRBA 4PLTA 2I7VA 1MRZA 4MCIA 5AKZA </