3RJ9A

Structure of alcohol dehydrogenase from drosophila lebanonesis t114v mutant complexed with nad+
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNVTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An intact eight-membered water chain in drosophilid alcohol dehydrogenases is essential for optimal enzyme activity.
pubmed doi rcsb
source organism Scaptodrosophila lebanonensis
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase
total genus 96
structure length 254
sequence length 254
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2011-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3rj9A00
4N5MA 5JMPA 2E48A 2AEFA 1LSSA 3MZ0A 3TOZA 4J4BA 2PKRA 5B4VA 4B7CA 4ZJUA 4D41A 1ZSYA 1PJCA 2BGMA 3WIEA 4IJUA 3FCOA 4OL9A 4IQ0A 4I1IA 1RM0A 3U49A 1EVYA 3ZGYA 2Y67A 3NDJA 1GQYA 3KOUA 4NNJA 2JL1A 1AUPA 3HN2A 3WS7A 1IYZA 3D7LA 1ORRA 4E5MA 2FSVA 4J2HA 3RC7A 2E82A 4J1QA 3ZU2A 3GAZA 2VTDA 4CMEC 4WE3A 2XOXA 2E4AA 2RIRA 2YW9A 3R3SA 1BVRA 2VYNA 4PLFA 1R37A 1IL0A 3DOCA 4JXKA 4BVAA 3VH4A 3ONEA 4HFNA 3JQ9C 3DBLB 3VC7A 5JC8A 3DHEA 1Z7BA 3GHYA 3LT4A 3MJVA 5I9MA 1E0DA 4ZGWA 3PP8A 3OICA 1P74A 3O8QB 3IKVA 3B1JA 3EVTA 4UVHA 2O7SA 3BHJA 2I3AA 4ID9A 3L6DA 1E7MA 3L4SO 4G65A 3RC9A 1PSDA 3PYLA 5IAAA 3CUKA 1I3MA 3NKLA 2Q1SA 1Z7EA 2YHIA 1JVBA 4OIMA 3SJUA 5CDSA 1CWUA 4W4TA 1YOVA 4ND5A 4FGWA 1E92A 3WLEA 1VJTA 3WQQA 2DFDA 3FNEA 1KVTA 3EY4A 4GPD1 2Q3EA 3ZHXA 3N7UA 1R0KA 4TRJA 3MJ4A 4A26A 3E48A 1QYWA 3JQAB 3I3OA 4R01A 4BNIA 3D5QA 5G0SA 3ZWBA 3KM0A 2ZB7A 5CFZA 2EWMA 5MDHA 2RAFA 2X0JA 2AE2A 2J5KA 2WYUA 3WMXA 1XHLA 2WDZA 2QX7A 4E5PA 3COSA 2O3UA 2Z1MA 2TMDA 5TGDA 1D4FA 1T2DA 1LI4A 5L4SA 4LGVA 4NBWA 3RFVA 2HUNA 5A3VA 4PG4A 1U2DA 5CAEA 1PWXA 2B4RO 3X2EA 2Y66A 3VTZA 5LDGA 1I8TA 5IJZA 4D42A 2DBZA 1YL5A 1PTJA 2GD1O 3K2BA 3UAGA 3JQGB 1XKQA 3D3WA 4RVHA 4BNXA 2P2SA 3T7EA 4XEHA 4RO0A 5ILGA 1P0FA 4UAGA 5DULA 1U3UA 2UV8A 1QSGA 1GV1A 4L73A 5JSFA 2CUKA 3GFGA 4J3FA 4RDIA 2A4KA 2Q4EA 5JFOA 4Q3DA 2CDBA 1W0CA 1L7EA 4BO8A 4HWKA 1Q0QA 1J6UA 5EMHA 3K2EA 4RVDA 1F14A 1F17A 3PQFA 4XB2A 4IIUA 2YFQA 2B5WA 5BSGA 3UCEA 2VWHA 5AQ1A 2XPCA 3PLRA 5KVCA 4K6CA 3AM5A 5BT9A 2IYOA 4IBOA 4OM8A 1NXQA 4MVJA 2OMEA 1H0KA 2QRJA 1E1KA 4N7RA 1ZBQA 1HYEA 1IY8A 2VOEA 3OH8A 3VZRA 4IDCA 2PK3A 3H8VA 1UXHA 2BHLA 3SBOA 1WNTA 3CTMA 4GKVA 2OBNA 2GO1A 4K6FA 4XB1A 3JQFC 1UZNA 1N1EA 3TZHA 4BNUA 3AK4A 1FDSA 6LDHA 2ZB4A 3ICPA 5JNLA 1R4MA 1DC5A 2VUUA 3VDRA 1LUAA 1UXKA 3VAZA 4QO8A 1UP6A 2BLLA 5TLSA 3RASA 3FNGA 1VRWA 5B37A 4TVOA 3PFWO 3AUUA 4R1TA 1P1IA 3WLFA 1VI2A 4MIYA 4J7UA 1G1AA 4RPGA 4KZPA 3FBTA 5DDIP 1AGNA 1IHYA 1M75A 2B36A 4CMJA 2EXXA 3MTGA 4A7PA 4E6PA 1L1FA 3ZZNA 1PX0A 3IP1A 2VRCD 1XCBA 4K28A 3RVDA 1YB1A 5BSEA 4EI2A 3NAQA 1VC2A 2GYYA 3AW9A 1HDZA 1AE1A 4HY3A 1LDYA 2V7PA 3WDSA 4YAIA 1NR7A 1NNUA 3ZWYA 2VWQA 2OO5A 1O6ZA 2O3SA 3OJOA 3VKUA 1E3WB 1PJ3A 1XG5A 1HZJA 1ZK1A 2UUPA 3QVTA 2NSDA 4FFMA 2PWZA 2YQ4A 3LSYA 1K6IA 3U0BA 3VH1A 3GPDG 2Y93A 2EERA 1ZK4A 3ANNA 3DOOA 3VHRA 4YAKA 3DTYA 1P1KA 5I8ZA 2NLOA 1CIVA 2JFFA 4Z0TA 2A35A 4JROA 1ZK2A 4PFJA 1HTBA 1PJSA 3TZCA 5B4TA 2G5CA 3HDHA 5A02A 4UUMA 3CSDA 2AXQA 2UVDA 3ZWPA 2X23A 1KERA 4MIEA 4BO5A 1AHIA 1MX3A 2DM6A 5DBFA 1NWHA 4WLNA 3ZDFA 3MJEA 4E0BA 2C7GA 1HKUA 3BZUA 1DC3A 4N54A 2NQ8A 2NM0A 2G1UA 4U6SA 4C4OA 5IZCC 4W9NC 4RL6A 3LZ6A 5DN9A 5EINA 2C7VA 4OSOA 5G0WA 4XGNA 3UH1A 3TDKA 2W4QA 2D3TA 1A9ZA 1E7WA 3Q2KA 3NEPX 2B69A 2JFGA 3NX4A 2J3KA 2YQ5A 5KNLA 1GPJA 3C3XA 4IDGA 4XKJA 3FWNA 4BO7A 4RZIA 4J1SA 5KJCA 3SVTA 1UH5A 1ISFA 5F5LA 3H6KA 1A71A 1HE2A 3KYDA 5KJFA 4L74A 4Y6PA 3OEWA 3EMKA 1GPDG 2H6EA 3E9MA 4E2ZA 4M89A 3LC1O 1IHXA 5TJ9A 5L7TA 4CR8A 1X13A 4XJTA 1ZFNA 1G6KA 1MC5A 3PIDA 3V1YA 2J3HA 3G0OA 4FSHA 4Q3CA 5EERA 2C2YA 3DMTC 3ZH2A 1T2EA 3D3WB 2Q2WA 4KOAA 3WSVA 3JCZA 1DRUA 1DO8A 4AJNA 1K6XA 1NFQA 3P7MA 4AJKA 3E6AA 4CMHA 3LT1A 3M2PA 3A14A 3OIDA 4BMNA 3QVSA 3I9KA 3L4BC 3AOEA 4UEOA 2Y1CA 2HRZA 2PD4A 3V2HA 1I3NA 3RUIA 1H6DA 3UFXA 1Z45A 4WUVA 4E33A 3OM9A 1W4ZA 5U9CA 3DBLA 3A06A 4GL4A 1FDUA 4G2NA 3TPCA 3UGKA 4R1NA 5ICMA 1RM4A 4Z9YA 5A9TA 4BNKA 1GEEA 5CEJA 2AQ8A 3D64A 1HSOA 4Q3NA 2PLAA 5C7OO 2PTGA 2G82A 3EHEA 3F5SA 1LEHA 5TT1A 4CLHA 4DQVA 4LSMA 1QV7A 2XXJA 4EBFA 1GZ6A 5K6AA 1MV8A 1C3VA 3GN1A 1GYPA 3GVCA 2Y68A 2A94A 3VDQA 3NTQA 3PLNA 5F5NA 3SJ7A 5ENDA 3W6ZA 2DPGA 1YOVB 1VL8A 3AUTA 4AJIA 1T1RA 2VWPA 3O03A 5FF9A 2PR2A 1PJQA 3OQ1A 2P9EA 2ZTVA 2X58A 1I3KA 2PFGA 4OSPA 2P9GA 1R6DA 1ZIDA 5FEUA 1PZEA 3GC6A 2VRBA 3PXXA 5JCJD 4L4RA 4P22A 1U1IA 2AHRA 4MP3A 4WPGA 5BQFA 8ADHA 1U8FO 2VZ0A 4F6CA 4W99A 1P31A 2FMUA 4MIOA 1HDOA 2AQHA 2CVZA 1EDZA 1UXJA 4IQ8A 3BTOA 2F1KA 1GYRA 1KIFA 1GD1O 4GX2A 3RSHA 2NWQA 4ND3A 3RQSA 2HJSA 1TT7A 4R9RA 4L8VA 4A0SA 1TT5B 4TZTA 3ROMA 1YONA 2ZQYA 1X7HA 2DUUA 2HK9A 4MKXA 3GNQA 1RYDA 4IZIA 4NJOA 3M1LA 3JQGA 5K0ZA 2V6MA 3I9MA 4YCAA 3DO5A 1B7GO 4R68A 1BW9A 4CM8B 1DIBA 2AMFA 1VKNA 4EEXA 3I6QA 2V6BA 1SOVA 5H83A 3C24A 4BV8A 5L40A 4HNGA 1DAOA 2D5CA 4LRTB 4Q3EA 1E3LA 2HO5A 1Y8RA 1KS9A 2NU9A 1ZEJA 1B14A 3OSUA 2DTXA 5CEEA 1B26A 3QWBA 4EGFA 1NM5A 4BO0A 3NTRA 4GVXA 4I9HA 2EEZA 1FDWA 2WSBA 1E7YA 3O8QA 3K92A 3K8ZA 5B1YA 2PY6A 1SOWA 1FK8A 1DRWA 4BS9A 4JQCA 4FQ8A 4B7XA 5KIAA 1PJBA 3AOGA 1LX6A 3DOJA 2NUAA 1C14A 1HZZA 3N74A 3O26A 3S55A 4YEDA 1LU9A 1M66A 1U3WA 5BSFA 2O4CA 4CLRA 4IDAA 5L7YA 3U3XA 3HDJA 3PZBA 2LDXA 4BNTA 1ENPA 3AOEC 4AJJA 5JC1A 4E21A 2Z95A 1EFKA 3G79A 3JQ7B 4UULA 5CPFA 4YRDA 1T26A 1AN9A 1HXHA 4INAA 4GX0A 3BTUA 4DLLA 4FDAA 4WEOA 1D3AA 3OMLA 2BMAA 1E77A 2YDYA 4OHUA 4H7PA 4UVDA 3FBGA 1O94A 2PNFA 2IZ1A 3KO8A 3PHHA 4BO9A 5I8WA 5JO0A 4D0SA 3QVOA 4JIGA 2X8LA 1NBOA 2W98A 2CVQA 1NHGA 2HKIA 3DZIA 3NYWA 1IB6A 2W2LD 1C0LA 1VJ1A 3DXFA 3PHLA 4LVUA 4IGEA 1ZJYA 3ZN2A 1HRDA 4BO2A 5CDYA 1YJQA 3RUHA 3FPLA 3P19A 4TVBA 1N92A 1XR3A 1ZXLA 3IKTA 4JNKA 3U4CA 7MDHA 2OBYA 2O23A 4OO3A 4GX5A 2DUWA 4AFNA 1X0VA 4BNVA 2EV9A 4WLOA 2AEJA 2JCYA 4U6QA 4C7KA 4RPHA 4W6ZA 2J5QA 2YV1A 4D3DA 2R00C 3KTDA 2H9IA 4Y8VA 1PZFA 2AG8A 3ANLA 2R2GA 4J16A 5IF3A 4WJZA 3DBHA 4BKQA 4M1QA 4CM9A 3LC2O 2ZYAA 1BVUA 1ZO8A 3NTOA 2JCXA 4J1NA 2DBVO 3C85A 4HP8A 2NTNA 1LSJA 3QRWA 2IEDA 3BMQB 4QT0A 5COAA 3EGOA 2GRAA 2J6IA 4HX5A 3V2GA 7ADHA 4NJMA 4OQYA 2PGJA 4CM4B 1DC6A 1BSVA 1E5LA 3G3EA 3UF0A 3DHNA 1LBEA 4QX6A 1M67A 2VT3A 4CM7A 1YJ8A 1BDMA 3QIVA 1JWBB 4UUPA 4DPMA 3GNSA 1O5IA 3D5TA 2G0TA 4NBRA 5TIIA 3GVPA 1I10A 2CF6A 1ARZA 4DLAA 1JAXA 4Y98A 1HDCA 1P1FA 1MP0A 1TA4A 2VNAA 5JDCA 2OGUA 4PVCA 1LC3A 2EG9A 3V5NA 4YB8A 3WB9A 2J5RA 3CZRA 3QWIA 3I9NA 1WPQA 1ADBA 2X22A 4J9UE 3LF1A 1MLDA 3JD4A 4AL4A 1QYXA 4CLDA 4YRBA 5DBGA 1YRLA 1Y5MA 4XYEA 1S7CA 3HUDA 1C1XA 1A27A 2Q4BA 4IDEA 5I7EA 1I30A 4R3NA 5EQDA 3CMMA 1M2WA 3W6UA 4B3JA 4CLRB 4RZHA 1DIAA 3WFIA 1YBAA 2RH4A 1N1GA 1ZUD1 4DWVA 1WWKA 4I5GA 1PS0A 1ISIA 1SC6A 4MVJM 1J49A 5FWNA 1AXGA 2IODA 1TEHA 3ONDA 3OJEA 4NK4A 1ZH8A 1DFGA 1R4NB 1UDBA 5AYVA 5IFLA 1VL0A 4B3HA 4OJNA 2QYTA 2HRBA 2AW5A 4NMHA 2SCUA 3FNHA 3DZBA 4D7AA 5HTOA 1X15A 5ADHA 1ZXBA 3R0IA 5IN4A 1R16A 1DEHA 4WNIA 2Q1WA 4YJDA 1F06A 3RUAA 1KVQA 1U7TA 3QVWA 1K89A 1UZLA 1HL3A 1F12A 3QA9A 4URFA 4YJHA 2BGKA 5ILOA 4TKLA 2ZCUA 1KVRA 1P44A 2NACA 4F46A 3GVXA 1H9AA 3ZHYA 3AWDA 4DLBA 5JAMA 2IZ0A 3C1TA 4IPTA 3PFFA 3MCVA 1HEUA 3NDIA 1WZEA 3JYPA 2AG5A 1OC2A 4U0KA 1E1LA 2HMWA 5AXCA 2GN6A 3ITDA 4L4XA 4CPDA 4AJ4A 2JFHA 1NFFA 2VUTA 2XXBA 4MVJG 4ZQFA 1HYGA 2E49A 2H5LA 1P45A 4RCVA 4BNYA 3K31A 5A9RA 3WTCA 1PEDA 4R16A 3JQ7A 4L9RA 2A92A 2C07A 2QRKA 3GDGA 4ZD6A 3MTJA 2PGDA 5JY6A 3PYMA 5TF4A 2PH3A 1C0PA 2TMGA 4HADA 4J6FA 2P5UA 5JMWA 1QMGA 1F8FA 2G17A 2QYSA 4CMEA 4E13A 1ISHA 4LCJA 4MVJE 4E3ZA 4FIZA 4CUZA 1CQJA 4MKRA 4CV2A 4JK3A 1I2CA 5FFFA 2R6JA 2FZWA 3VPGA 4GKBA 3GGPA 3S1LA 4ROSA 1DSSG 3NDRA 5JCJA 5B12A 3OHSX 4E5KA 4PIVA 2O3JA 3CKYA 5IDWA 4ND2A 1YXMA 1BXKA 1ZK0A 3CIFA 3FF4A 4BNGA 5IN5A 2NVWA 4CMKA 4YAGA 3ABIA 1N9GA 3DL2A 1E3IA 3G17A 2ZTUA 2DVMA 2WEKA 3IP3A 1A5ZA 4GSLA 4XCVA 2ZB3A 3M1AA 1VPDA 1BW9B 2C82A 2Y05A 1CDOA 3GGOA 4GLOA 2FPGA 2WD7A 3ZW8A 1ZK3A 1LNQA 3JQDA 1RKXA 4AVYA 4YRAA 2GCGA 1JU9A 3PDUA 4OOFA 1Y8RB 1GQQA 4I5FA 3U4IA 4Q39A 3Q11A 2PV7A 4DQXA 4CL8A 3S2IA 2Y1EA 1DJQA 4FFOA 3P2OA 3K30A 4ESOA 3I4FA 1ZMTA 4II2A 1GDHA 3VPSA 1MC4A 3FN4A 3ENNA 4IS3A 4CQMB 1SMKA 4E5YA 1SZJG 3I9JA 4W7IA 3ZWOA 1UR5A 1UAYA 4R51A 3GEGA 3AU9A 1ZMOA 5CDTA 4WK6A 3GQVA 3L6OO 4IZHA 3PGJA 1PS8A 2IYPA 1U4OA 3K6JA 1ZJZA 4LMPA 4NU6A 1I24A 1LRJA 5A4DA 1SBYA 4MP8A 2ET6A 2FP4A 3NT4A 9LDTA 5G2OA 2H1SA 4FBGA 3GT0A 4BGVA 4NFYA 4ND1A 5JS6A 2QHXA 1DOHA 3JQCA 3FNFA 1PR3A 4FW8A 4A27A 1CETA 3TL2A 3IC5A 1PL8A 3BYZA 1R15A 4HKTA 4AJLA 1NWCA 2D0IA 1YDWA 4YYZA 4FFRA 4M8SA 3BXXA 1QLJA 1WP4A 2YHUA 4RPJA 2CF5A 4DXHA 1U2GA 3VZPA 4OKNA 3OJLA 3VPHA 4GWGA 3QVXA 3GUCA 5IXSA 2WTBA 3RBZA 4PG7A 1YB5A 1Z74A 2UDPA 3KETA 4R54A 2DQ4A 4LRSB 4J91A 2DAPA 3C1OA 3PQEA 5COQA 5JAZA 1Q2XA 1EBUA 1Q7CA 2C54A 3QLJA 4AJ2A 5AOVA 3HADA 4CM1A 1EVIA 3TQHA 5GY7A 1QP8A 3WOHA 3W4IA 2JJYA 2FPIA 2IEBA 4CQLA 2NV6A 2PA3A 4CUJA 1LLUA 1YH3A 4RVGA 5J23A 3RI3A 1GU7A 2VCYA 5DCYA 4Q9NA 1IZ9A 1MG0A 4OXKA 4OQZA 3GMSA 3VVCA 1V6AA 5HA5A 3W4KA 4FJ2A 2I3GA 4RQUA 4OOEA 5L9AA 4PCVA 1PGOA 4F6LA 3QWHA 3ZNNA 1LQTA 1I32A 2DKNA 1CF2O 4FR5A 3LF2A 2DBQA 4PLVA 4M87A 5GMOA 2Y1GA 3L0DA 3OP4A 2D8AA 3WYCA 5T5QA 1NVTA 5HS6A 4BKPA 2O3RA 3PWKA 1DFHA 3LU1A 1I5RA 1R0SA 3QY9A 3I52A 4HNHA 2EW8A 4L0QA 3F6YA 1HETA 3W8DA 5JYEA 3I9OA 4NR0A 4LVCA 4MVJD 4DMMA 5BNTA 1XWFA 3AFNA 3QQPA 4CM3A 2HJRA 2JHGA 4XX0A 1XIVA 1LLCA 3RFTA 3CPSA 3QWFA 1OAAA 1GZ4A 1ID1A 4ZHSA 4EEZA 3UCXA 4RVFA 4DIOA 4GGPA 2ZCVA 1ZZEA 2HK8A 4K26A 4CV3A 3WGIA 4MKZA 3ZU4A 4D43A 4JBIA 1B15A 4QEDA 3JSAA 4WGGA 3GDFA 1NVGA 4BNWA 3GHHA 1OC4A 3BIOA 3LK7A 4ZN6A 5ITVA 4A2CA 2X9GA 1U5CA 2GR9A 3ROQA 3PWSA 1XDWA 4FD3A 4TWRA 5JO9A 2QQ5A 1R4MB 2X7HA 5IZCA 2CDAA 2HK7A 1U3TA 3E9QA 1KY5A 3IS3A 5JE8A 1YKFA 1EVJA 5KOIA 3DMTA 1Q1NA 4YACA 2CFCA 3EVNA 1LDGA 2IRWA 3NUGA 4BNJA 1T4DA 4FC7A 1GZ3A 2VHXA 3RBVA 2AQKA 1EUZA 5AXAA 4TRNA 3ZCXA 4P8RA 5DP2A 1EK5A 2CDCA 3JQAD 4HFRA 2P4QA 1VE9A 1Y7TA 3AFMA 1WVGA 3E1KA 2GZ2A 4DA9A 2X1HA 4RF2A 4ALJA 4GBJA 3H4VA 3GEMA 2NVUB 3WGTA 3ORFA 1DC4A 1EK6A 5T67A 1EZ4A 4M54A 1D1SA 3UXYA 1LDNA 2H63A 3DDNA 3JYQA 3U4HA 4J2OA 1FDTA 4PN3A 2Y1DA 5GZ6A 2JD1A 1ULSA 4KUHA 2DPHA 4XYLA 3B70A 1OMOA 4Y6SA 3W1VA 3QWAA 1I0ZA 4P4NA 4NFHA 1MGOA 4TQGA 3ASUA 4WOJA 2Q2VA 4XDYA 4E2YA 3ZWXA 5JDIC 2EKPA 2Q50A 4MO2A 4S3MA 4EJ0A 4R1UA 1M6WA 4WECA 1GCOA 2P91A 2XAAA 4GVLA 4KUEA 1DIGA 3IAHA 1LTHR 3WJ7A 5MGBA 3ADOA 4CM5A 4FJ0A 5A05A 2HCTA 5DOZA 1Y9EA 1G0OA 4JX8A 5G0TA 3A1NA 3BMNA 1SNYA 4NIMA 3KVOA 1P3DA 4JP2A 4XYGA 3M6IA 4YWJA 2FY8A 1XELA 4ILKA 4XQCA 4GH5A 5T8KA 4PLGA 3KSDO 4PVDA 3JV7A 3VTFA 2C29D 2C20A 4CL3A 1J4AA 3WGQA 4J9VA 8LDHA 5A5FA 4RPKA 3LC7O 1NAHA 2I6TA 1VL6A 1OOEA 5K6AC 2FR1A 1E7SA 5CPBA 3IL2A 3GOHA 5F1OA 1JKFA 3ZU3A 5A9SA 4O6VA 1WDMA 1DAPA 4GQAA 1NQAO 3D0OA 1H5QA 1EE9A 1M76A 3WXBA 4FJ1A 4R69A 1VKOA 1ISGA 2HMVA 3H2ZA 2OORA 1BWSA 3TRIA 1JVSA 1C0KA 2FR8A 2YFHA 1JN0A 4AJEA 1QRRA 2GGSA 1V9LA 5AXBA 1E5QA 4MJLA 2X0RA 4IJVA 1UXGA 4XIJA 4XRRA 1UDCA 1HDXA 4WLEA 4EYEA 3EAGA 3Q0EA 1MFPA 3TF5A 4PLCA 5IDQA 1T1SA 3H5AA 3F47A 1TT5A 3HE3A 3PJGA 5TC4A 2WMDA 4DREA 4FFNA 4TSKA 4WASA 4CQMA 5A04A 1H6BA 2Z1NA 3C7DB 4KWIA 3ZNPA 1NTOA 3EUWA 5U1PA 3HN7A 3T4XA 2EJWA 1JA9A 1A4UA 3NT5A 4G81A 4J0FA 2D1YA 4WCDA 1PZHA 2DT5A 4PG6A 5BSHA 2CZCA 2JHFA 5F3RA 1NQ5A 2Y99A 3PHIA 5FI3A 1DLJA 2OXIA 2BFMA 3IUSA 3PRJA 1HWYA 3F9IA 3VVBA 4QECA 2VYND 2Z5LA 3BMCB 4E32A 1IPFA 1CQIA 3GAFA 3BHMA 3WR5A 3HJAA 3TZ6A 1YVEI 3JQBC 4KQXA 1QG6A 3GR6A 1YB4A 1T2CA 1U7HA 1XGKA 1DLIA 4CM9D 3RJ5A 3WQSB 2HMSA 4JBHA 4YQYA 5T6BA 3DBRB 2IXAA 4CMIB 1Y6JA 2O3TA 1CRWG 4D46A 5GZ3A 2P4HX 1EQ2A 3TFOA 1UUFA 5IDXA 5LDHA 4HUJA 4KMSA 1LDBA 3AM3A 4LMRA 3KEQA 4WKGA 3NGXA 3FI9A 1QYVA 1I36A 4FCCA 1EUDA 4PLPA 4IY1A 2EJVA 1ZSNA 2C5EA 2ZJ0A 1C1DA 1P77A 1UDAA 5KJEA 2IXBA 1YDEA 3FTNA 4YAJA 3UICA 1T24A 3ZWAA 3GZNA 3DEYX 3UUWA 4IXTA 5DF1A 1WDKA 4LK3A 2GZ3A 4RPLA 5L4LA 4CR7A 3E03A 1PGPA 1XYGA 1ZSVA 3RAJA 3JD0A 2HMUA 2VHVA 4TKMA 3H9QA 4FFLA 4ZQEA 4YTEA 3LLVA 5TT0A 3RKUA 5CHEA 2FWMX 2O3QA 3FWZA 1DJNA 3PTZA 2OFPA 3HNPA 4D3FA 2GN9A 4IMPA 2HQ1A 4UEJA 1NASA 3LQFA 4L76A 4DBZA 4TZKA 5G4KB 1WMAA 4YJGB 2IZZA 2OL4A 1KETA 2YJZA 1V8BA 3MJTA 4MP6A 2G76A 1ONNA 3VPFA 1E6EA 1A7AA 1S6YA 2D59A 4Z6KA 1AHHA 1OBFO 3JQ9A 2Q1UA 4QXMA 2EP5A 3P5SA 3SX2A 2GERA 4XGIA 4MINA 1PJTA 3LVFO 5IDYA 2AEMA 4TRRA 2IE0A 3PJDA 2R00A 2RH8A 3UW3A 1I01A 3GVIA 3PVZA 5CG2A 4DBVO 4UEKA 2VUSA 1YQGA 2JKVA 2YZ7A 3KZVA 4M86A 3BTVA 2AE1A 4LCEA 4NBVA 1MXHA 2WYWA 4E31A 3BA1A 3IMFA 3WWYA 3N58A 4XYBA 5T57A 1YL6A 2GLXA 3ETDA 3GRKA 3U5TA 3SC4A 5DBIA 2BH9A 1EQUA 1O0SA 3WGOA 4BO3A 1U3VA 3T4EA 2WE8A 4P4GA 1H94A 3ZHBA 2Y0EA 1Q0HA 4LN1A 2O2YA 1GY8A 4DPKA 5KWEA 1HE5A 2F00A 3BMOB 4IDBA 1Y9AA 4GI2A 4H16A 4RVUA 4X54A 5KKAA 4CM6A 2VZ9A 1V3VA 1XEAA 4UUOA 3I5MA 4YJHB 3ROKA 2GDZA 4RDHA 4FB5A 2BRUA 3H9UA 3MOGA 3AY6A 1Y8QA 1EEHA 4MDHA 1NX6A 4WCFB 3E5RA 3ZV5A 3D4PA 4OAQA 3WBBA 2QRLA 4FOOA 4R41A 3JQBA 3LYLA 2OOSA 3CZMA 5CG1A 3RCBA 5AXDA 4KTTE 1ADGA 2YY7A 3GMDA 4BB6A 1KYQA 3ADPA 4UVIA 3L6EA 4R5HA 4GLLA 4CLOB 2OP0A 2CNBA 1IOLA 2FR0A 4XQGA 4YT8A 5JY1A 2EW2A 3HZZA 3RWBA 2VHWA 3DC2A 3RU7A 2NQTA 4P4LA 3HWRA 3OEYA 1BGVA 3AUSA 3KHUA 3SXPA 3B1FA 4Q3BA 4XD2A 3C1AA 4Y67A 4XA8A 3R6DA 1U8XX 5I7SA 2PD6A 5JBIA 1HYHA 4EJMA 2O50A 5DCWA 1LC0A 3TNLA 4CV0A 5CDGA 4WLUA 4DIFA 2EIHA 2ZTLA 4A10A 1LDEA 2EGGA 3A4VA 3F3SA 3JQ6A 3ON5A 1PQUA 4J4TA 3JQ8B 1V35A 3TN7A 1MB4A 1YE3A 2QZ9A 3H3JA 4J0EA 1E6WA 4NH4A 2VWGA 4B7UA 3GA0A 4NPCA 3Q9UA 4R3WA 1T2AA 2DU8A 2YV3A 3UOGA 1DHRA 4XR4A 3KYDB 3RFXA 1N9GB 3VOSA 5U4QA 2DBRA 3OA0A 2GZ1A 4IMRA 3KYBA 2PD3A 4JCOA 1HDGO 3NJ4A 2GNAA 4DGSA 3EZYA 4E5NA 4NI5A 3R3JA 4KP7A 3JQFA 1JQBA 1U4SA 5C7LO 2ZYGA 2QW8A 3JD2A 3IJRA 2Q46A 5T64A 3DBRA 4WLVA 1EDOA 3NT2A 1XQ1A 1H6AA 4BQPA 4XWYA 4KDFA 3C8MA 4XZ3A 1Z82A 4B8WA 1KVUA 3INTA 4CODB 3IUPA 1NHWA 3ICCA 3VKVA 4CUKA 3QV1A 3ZWVA 2BFPA 4XR9A 2PZMA 4FN4A 1SB9A 5ER9A 1VJ0A 4CM8A 3ZNOA 3IDSA 5HWSA 1ENZA 3W8FA 5TS3A 4R1SA 3Q1LA 3QP9A 4GAEA 3L07A 2RCYA 5TNXA 4B4WA 1NPYA 2BI7A 3WTBA 1N5DA 3KUXA 2ZJ1A 3INRA 3PWZA 3ENKA 5EPOA 3S2GA 4J49A 2E37A 3QJ5A 1EBFA 1JKJA 3ZV6A 2GF2A 3QW2A 1PL7A 4OXNA 1PGJA 2QIOA 4QO7A 3K5PA 2HMTA 3X2FA 3BAZA 3PEFA 1N7HA 4NHEA 4HXYA 3SC6A 4OMUA 2OUIA 4CR6A 4DMLA 2XF8A 4YT4A 1FMCA 2C2XA 5I9NA 4JGBA 3KYCB 4NZ9A 4N5LA 1LLQA 2B35A 3S8MA 1O8CA 3AI2A 2RBEA 5THQA 4D0RA 1BDBA 1R66A 5H82A 3HB5X 4NU5A 1EFLA 2HLPA 1JTVA 3GNTA 4DIBA 4WCFA 2I9PA 2B0JA 3KSZO 1B8VA 1FXSA 4FGSA 3RUEA 4B4UA 5DT9A 4DC1A 1H2HA 3WMWA 2RHCA 4BO6A 1JW9B 3G49A 2ZYDA 2X0IA 3WFJA 3TFQA 5JW6A 3ZWWA 3F5QA 3F46A 4CQLB 2FPPA 1HDRA 3U62A 4DC0A 4DUPA 3RKRA 4GMFA 4CM4A 4W9NA 1GFSA 1YGYA 2ZATA 4J7XA 1PZGA 2HDHA 1KEWA 4C7JA 3U4DA 3MJSA 3D1LA 2YHIB 3K73O 3V8BA 3FHLA 4I08A 3F4BA 4E12A 3LT0A 4QQRA 4E2WA 2HAEA 1DDOA 2WWRA 2FSSA 5CDUA 3LLSA 3RUDA 1P9LA 4IDDA 2W2KB 3I9LA 3JQ8A 1GADO 2POQX 3MWDB 2QZZA 2UYYA 1WZIA 2I65A 3ZV3A 4J1TA 5TJHA 3ASVA 1X7GA 1PGQA 2ZKLA 2PZKA 5L45A 4FS3A 1Y8QB 1SO8A 4ZA2A 1Q0LA 3UHAA 3DZFA 5FI5A 4BGEA 2B4TO 4G5HA 4U7WA 1JLLA 4F3YA 1G0NA 5HRUA 1W8DA 5KKCA 2YUTA 1GR0A 2X0NA 4W7HA 4YQZA 1PJ4A 1B8PA 1D7OA 4Z3DA 2V65A 2D5AA 3TJRA 1E7QA 4KWHA 1O9BA 2I99A 2CSUA 1MG5A 3PJEA 4QFDA 3WGZA 3DR3A 2WJPA 4GMGA 4JJFA 3UVEA 4NK5A 1KEPA 2J3IA 4IUYA 3L4BA 2Q1TA 1EMDA 1ZEMA 4JJIA 1F8GA 1K6JA 3WGGA 4BGIA 4L4SA 1UP7A 2B37A 5DNAA 2WD7B 4A5OA 4ONEA 4WOKA 1V3TA 4Z0HO 2FN7A 3PI7A 4B3IA 4Z3KA 4DTIA 3GK3A 2W8ZA 1DIRA 1TVEA 1BMDA 3F1LA 3Q3CA 1MFZA 3EZLA 3PDJA 4ZU3A 3DHYA 5KVVA 3PZRA 2HU2A 2PZJA 2ZIZA 4NG5A 3PQDA 3WBFA 3TL3A 1P0CA 2BFAA 4NDNE 4TRMA 4F45A 4AJ1A 1ISJA 1SEPA 1IPEA 4IQGA 3ONFA 1O89A 1XU9A 1HE3A 1MXFA 3C7CB 5IXYA 1CJCA 1N7GA 1PS9A 9LDBA 3WNVA 1E3JA 2EKQA 4H3VA 2X5OA 3ST7A 1WW8A 2PKQP 5JCXA 3W4JA 2X4GA 2FRDA 3HFGA 4I5DA 1PWZA 4J7CA 3WJAA 4ZRMA 2D4AA 1NAIA 1NP3A 1T4BA 3TOXA 4I5EA 4B8ZA 1P1HA 3GFBA 2PGLA 1WXDA 2GN4A 3NRCA 5JAQA 3AI1A 3WYEA 4R4JA 2A9FA 1ISMA 1WAMA 5C5IA 3H5RA 3GRPA 4QUKA 1DPGA 5BR7A 5JAIA 3DFUA 3PIIA 4CMCA 1MA0A 3DWFA 3IOYA 5DCUA 5KVQA 5LC1A 4BKRA 4CLXA 4BQRA 1GAEO 1XU7A 1IZ0A 4FPXA 4XIYA 2ZQZA 1X0XA 3INGA 4M49A 1HF3A 1LLDA 3V1UA 3KEOA 2GASA 3GLQA 4EUHA 5L95A 4MVJF 1FF9A 2DFVA 4KQWA 2UUOA 4EW6A 1IUKA 1UAGA 5I9LA 3RJ9A 4WEQA 1B16A 1NFRA 4BV9A 4NJMB 1IE3A 5ITWA 3Q2IA 1K3TA 5JLAA 2Q49A 5KVSA 5JPIA 1TB4A 2BKAA 1T25A 1MUUA 4CLOA 2VRCA 2EGHA 1K2WA 3BHIA 1HSZA 3K96A 1J0XO 1PU2A 2DTEA 5A06A 5JXWA 2BFOA 3WGYA 1GTMA 3WG9A 4W82A 3DAGA 1X7DA 4BMVA 5B4UA 1ULUA 3GZ4A 3DFZA 4CV1A 3WYBA 2PZLA 1KC3A 2NTVA 4RF4A 4PZCA 4JBGA 3AY7A 1DB3A 1EE2A 3IQDB 2NVBA 1GV0A 3GF4A 3HSKA 2CVOA 4MPDA 1LSOA 4MVJI 2EP7A 4EUFA 5L53A 3GVHA 3E5MA 1F0YA 4IINA 1E7RA 2VTEA 4BL5A 1P1JA 4MVJP 1PL6A 2BGLA 3OECA 1RPNA 5JDIA 1T2FA 1SAYA 3DBVO 2VZ8A 2PH5A 1CYDA 3D4NA 3RU9A 2VHYA 1ENOA 1R0LA 4R9SA 2V6GA 3KRTA 1H9BA 3ITKA 3OJ0A 1YO6A 4O5OA 1YWGO 2NNLD 4TROA 1ADFA 2OHXA 4BKOA 1DHTA 4L75A 1PGNA 1LDMA 4D3SA 1KEUA 1NQOA 1D8AA 4J4HA 2Q99A 1Q7BA 3H65A 4PLYA 2ZB8A 1DRVA 2FOIA 1A72A 1P33A 2NU7A 2O48X 1TXGA 4BNFA 2FHSA 1ENYA 1Y1PA 3DB2A 5BNFA 4PLZA 1LA2A 2YYYA 1DFIA 5G4LA 2D2IA 4IIVA 1KOLA 2NTJA 4II3A 1WLYA 3LDHA 2OP1A 4D79A 1X1EA 4FFPA 1PQPA 4RF5A 3U9LA 1I2ZA 3RUCA 4DVJA 4EITA 3H7AA 3RUFA 3DAPA 3EK2A 1U28A 3KLMX 3K9QO 1UZMA 4O59O 4O1MA 3A9WA 2ZK7A 1ZW1A 4H15A 4OKIA 4BUCA 4K1LA 5L4NA 3DZHA 3FTPA 1HE4A 1RWBA 1IULA 2I5PO 3FRJA 3E9NA 1DXYA 1KEVA 3BMCA 4OH1A 3ZV4A 4EJ6A 1PIWA 2CD9A 4PZEA 2DTDA 4CMBA 4IJWA 5AVOA 2ILTA 3NJ8A 4WLFA 5EL0A 5A1TA 3ULKA 4YXFA 4JN6B 3H5NA 3Q6IA 4ITUA 3GDOA 4XQEA 4YA6A 1D1TA 1C1DB 5ER6A 5DOVA 3CMCO 4QTZA 4ZVVA 5TX7A 2J3JA 1XLTA 2AA3A 3TZKA 2BI8A 2NVUA 3MJCA 3TZQA 2BD0A 1LQUA 1Y81A 4IDFA 6ADHA 1BRMA 3JQAA 4B4OA 4D45A 4FC6A 1SEVA 5I7VA 1A4IA 1UP4A 2I76A 4P38A 4IM7A 2X9VA 3PYXA 4JP3A 3PHGA 5HS4A 3WX0A 4Y9DA 1H2BA 1NPTO 4DPLA 1KVSA 4A03A 2PKQO 4MVJH 2X6TA 5G0UA 1WMBA 3CXRA 3BMQA 1E3WA 3ZU5A 4N18A 3HQ4O 4YVFA 4ALLA 2AQIA 2C5AA 4R5MA 3QE3A 3ZWNA 4CMAA 1ONOA 3E8XA 1LRKA 4GWKA 4RVSA 5A03A 3RD5A 4O63O 2JAHA 5EJ2A 3BMNB 4PG8A 1V3UA 3WNQA 4PLWA 4YPOA 1RM5A 1DIHA 2P5YA 3ZWCA 2RHRA 1Z75A 3ETGA 4LISA 4XQ9A 3PPIA 3ZW9A 1Y5RA 5G0VA 3FPCA 3ROPA 4CMIA 5BNIA 4AICA 1E1MA 5JYDA 2O4UX 4PG5A 2Y1FA 4ZQGA 3H9JA 3OJFA 4BO4A 4O0LA 5A9SB 4ND4A 3JYNA 5KCZA 1I2BA 1FJHA 3AY3A 1BXGB 3HB4X 2P9CA 1Z6ZA 4ZQHA 3GUYA 3QHAA 3DBHB 3ZHZA 3V2UA 3G1TA 5H81A 1PQWA 3FR8A 1YBVA 2C0CA 1HDYA 2W2LA 5GZ1A 1XSEA 4PRLA 3ANMA 1E3SA 2OZPA 3H9EO 1R12A 1QYDA 5COBA 3WICA 2VNSA 1OFGA 1HLPA 5LCXA 1B8UA 3OA2A 4IXWA 3FR7A 4RF3A 5HM8A 5A5EA 3H2SA 1HLDA 1OZAA 1B2LA 1X1TA 3B20A 3VZQA 3I1JA 4YBZA 2YV2A 3GPIA 1P1RA 2BELA 1V0JA 2GPTA 4NQZA 3WSWA 1ZCJA 2NU8A 4HBGA 3GG9A 5CP8A 1U5AA 4ALNA 2GUGA 2VN8A 2B83A 5L7WA 4JJGA 2E6UX 2VT2A 3MEQA 4BB5A 3SLKA 2GN8A 1TI7A 3V1TC 1JWAB 4NFSA 3SEFA 1H93A 2B4QA 3DTTA 3HHPA 5ENVA 4UREA 3OIGA 1LXCA 3O9ZA 4DRYA 3VZSA 1LRLA 3UKOA 4AG3A 1CEQA 4AJHA 3I23A 4DL9A 2DC1A 3JQEA 1ML3A 3RC2A 3NGLA 3H3FA 2X5JO 1CERA 1ZVMA 4BNZA 1YQXA 2V6FA 4RGBA 5F21A 3OETA 3O38A 4HFJA 1SB8A 2W90A 5HBRA 3T7CA 1YL7A 1I33A 1UJMA 3KBOA 3QSGA 3VH3A 2VOJA 1HT0A 2I67A 2Y0CA 2X5KO 4ZQBA 4E2XA 3JYOA 1UXIA 1VLLA 2Q45A 4KUGA 3DMYA 1GCUA 4K9DA 2B5VA 3MOIA 4NBTA 2WE7A 5CEFA 3PGXA 3JTMA 3PJFA 3PK0A 5C37A 3WWZA 1J5PA 3GG2A 4BMSA 3L9XA 1R4NA 1N8KA 3TWOA 4E4YA 3DZJA 2CY0A 1B0AA 1E1NA 4ALIA 1ONPA 3GEDA 4BKUA 3Q9NA 4EUEA 1JAYA 2NADA 4PGFA 3MWEB 3RBXA 1M6HA 3IJPA 3S2FA 1K0UA 3HG7A 2W2KA 3F4LA 3D3EA 1X14A 5IG2A 4PLHA 1YBMA 3UN1A 1GUYA 3P2YA 1E6UA 1LSUA 4AJPA 1H6CA 4EDFA 3BTSA 3E18A 4UUNA 4B4VA 3AI3A 1FDVA 3FSRA 3G1UA 5A3JA 1NQTA 4DYVA 4UVEA 3W8EA 3AUAA 3WQRA 1RJWA 2YDXA 1KBZA 1DBVO 4Z9XA 5G4KA 4BNLA 3H9GA 1RYEA 1QYCA 5IZ4A 1PJLA 3AJRA 5K9ZA 1W6UA 4GGOA 2DLDA 4E30A 5L51A 1GL3A 4OYRA 5EIOA 4WNCA 3D4OA 3OF2A 3LT2A 1YS4A 3SLGA 2EHDA 1O95A 4I9UA 3VH2A 3L9WA 1VSVA 2JAPA 1E3EA 3KYCA 2WYVA 3GY0A 4HFMA 1GEGA 2P68A 3DQPA 1XA0A 1PJ2A 4NBUA 5L3ZA 4BNHA 3M2TA 4J43A 1A7KA 1U9JA 2Y1OA 3DZGA 4OXYA 1N2SA 4DQUA 4GX1A 1LJ8A 3EDMA 3HDQA 4D44A 4BOYA 4BGUA 4U5QA 5F1PA 1QORA 1C1XB 4XGKA 1NYTA 4S1VA 4RORA 1VSUA 4I9NA 1XQ6A 3B6ZA 4I8XA 3OFSA 1BHSA 1BXZA 5T8KC 3ZWMA 4YR9A 5F1KA 3STHA 4KDEA 4Y6RA 4EZBA 4YJFA 4CJXA 4XYMA 4BNNA 2CMDA 4QFCA 3BMOA 2JCVA 1EVZA 3DZKA 4OGWA 3UCFA 3FD8A 2WD8A 2I66A 4AJOA 3F1KA 5FYDA 3E82A 1AXEA 2Q2QA 3ZI0A 3KXDA 2WM3A 3GZNB 1W73A 4ALKA 1QR6A 1WDLA 3HDYA 4LSWA 1QLHA 3NV9A 3IIEA 4JLWA 4KTVE 4QSMA 1ZNQO 3GN2A 3I6IA 4RLHA 2JD2A 2O2SA 1Z73A 1JDJA 3CH6A 4A73A 5DP1A 2QG4A 1RM3A 2JD0A 5TQVA 5DZSA 3I4CA 4RJTA 1Q7GA 2X9NA 3GGGA 1QKIA 2HSDA 1QXSA 2NU6A 5TSDA 1GYQA 1B3BA 1TLTA 5EESA 4XRGA 1C0IA 4YDRA 4BIIA 1KY4A 3JD3A 4ZICA 4MOWA 4UVGA 4YJFB 2FZEA 3EC7A 3AM4A 3DONA 5EQFA 5THKA 3TSCA 3CE6A 5C3MA 3PHJA 5JDCC 4YT2A 4U0JA 3DAFA 5ICSA 4U8GA 3S2EA 4BHTA 1JKIA 3OQBA 3GH3A 3L77A 4LW8A 1GQ2A 3KV3O 1YQDA 3JD1A 5I7FA 3ZNQA 2VHZA 1BG6A 1SCUA 3EW7A 4PZDA 4DYDA 2VYVA 1SPXA 4M55A 4YT5A 4CMGA 3I83A 3RIHA 5KTKA 2X86A 4CQMD 4B79A 1NR1A 3OQ6A 1VM6A 4J90A 3KSUA 1ZKMA 4YAEA 3HFSA 1ADCA 5KJ1A 2VQ3A 1EUCA 2UAGA 2VYVD 4ALMA 4BO1A 3CEAA 1KC1A 4CLEA 4PLTA 3KB6A 2Y0DA 2EKLA 1BTOA 1L7DA 5C7IO 2GSDA 3ETEA 4Q3AA 4RQTA 4IJKA 3R1IA 4WCFC 1B3RA 3EYWA 3U09A 2BF7A 1GUZA 1NPDA 5KJ6A 3VPXA 4XDZA 4ZRNA 4XJSA 3B1KA 4N5NA 2J8ZA 3OBBA 3C7AA 4RV9A 2IDZA 2EF1A 1K5HA 3O4RA 4IS2A 5TRTA 5EN4A 2LDBA 4HV4A 3WGHA 4TMFA 4FOSA 3JYLA 4IGFA 2O7QA 2ZTMA 4YJGA 4Z0PA 4GSKA 3CINA 4BNMA 3A28A 1BXGA 1QV6A 1OI7A 2C59A 4Z9FA 5ES3A 3WIDA 3KLPX 1I3LA 4PRKA 3OIFA 1NVMB 3RC1A 3RROA 1PR9A 3AU8A 1A9YA 4RLSA 1GUFA
chains in the Genus database with same CATH superfamily
4CU5A 2WW8A 2VPXA 3DE2X 3U4GA 1NVXQ 3D54D 4N41A 4C7BA 2DZDA 2R66A 4OB8A 4TV9F 5ARDA 3U80A 4IW3B 2ZREA 3NUQA 2BGMA 4O4IF 4RHEA 3W5JA 3A6PC 4ABYA 3FCOA 2AFHE 2BV3A 3PQ5A 4J6EA 1BNCA 2HUPA 3HP7A 3OIUA 3IEVA 1GFIA 4QL3A 1XTKA 1W4RA 2QA5A 1Q1BA 1VMAA 1GKYA 2FN4A 3KOUA 1NSFA 4M0EA 3E9ZA 4NNJA 5CIQA 3BILA 1OWMA 3EZGA 2J3MA 4L02A 5H7XA 5J63A 4D4JA 3D7LA 4KKVA 1H0RA 2NSHA 4RS3A 4LXTA 3AF2A 4PHTA 2PUBA 4DV4B 2QR2A 4L4ZA 2CL5A 2EDAA 3EDQA 1X7YA 4UXJA 3VMMA 2XCRB 4CMEC 1UBMS 1IMJA 2CXTA 2I1VB 3A7EA 2XOXA 3CNBA 5IH3A 2E4AA 4Q6BA 3F6CA 4JA0A 2YW9A 4MUKA 4C87A 4EYOA 3VHXA 2MDTA 2VI5A 4P84A 1R37A 3W79A 5LNK6 3RHFA 3H1TA 3VH4A 3ONEA 1FFGA 1E1CA 3Q3EA 3JQ9C 5CX1A 5JC8A 4Y2HA 1Z7BA 2FN9A 4PGMA 4R9NA 5TXGA 5K3SA 1O4WA 3QVVA 1E0DA 2ZR0A 4BMPB 2FGJA 1STOA 3EBPA 4OQPA 4ZGWA 1N6RA 1U0RA 3IKVA 4B85A 3D31A 2Z2XA 3B1JA 3C97A 3HPRA 3M0EA 5JI3E 1RWKA 1HNZB 4F4CA 2JLCA 5K0BA 4Q4AA 5ITSA 1DI0A 4G65A 5SY9A 4DZTA 5AICA 2H52A 4CEIB 1PSDA 2E4UA 3PVCA 4MI3A 4MUJA 3CUKA 3NKLA 5DMHA 2WMOB 1FLNA 1FU4A 1Z7EA 2LPMA 2Q1SA 3BXHA 1HC7A 1UFRA 2G3YA 4JA2A 4ZAXA 1LS6A 1JMVA 3O90A 1YOVA 2B2CA 2P7IA 4FN5A 4FGWA 1SKYB 3ZZUA 4AECA 4YK7A 5F52A 4REQA 3G8YA 4PCLA 1NVKA 1Z68A 3N8NA 1QH1A 2AR9A 3T9DA 2DFDA 4GM0A 2HWYA 3CKLA 1QIMA 1MAHA 2R44A 3FNEA 3K71B 2VH1A 1IMOA 4MUFA 3N7UA 1R0KA 4TRJA 4DR3B 3VDMA 3BCRA 2HWWA 3JQAB 4QGFA 1GTVA 2R87A 4OGGA 1LVGA 4R01A 4O2AA 1PFVA 4OVKA 5CFZA 4EVRA 2EWMA 1YR9A 4JQYA 5F4ZA 1JQLB 3LBFA 3UWMA 5TMPA 3TOVA 2QE7A 3WL5A 2XI4A 2J5KA 3Q7SA 4D8TA 5AUNB 5FUMA 4J3NA 4M8NE 4HG2A 5EFOA 5TMDA 5ITZA 3BCSA 1WJGA 2X7XA 3EQ2A 1DMSA 3MLAA 3NHSA 2UZIR 3TBKA 1OLXA 2CJXA 4XM1A 5H9VA 3U1VA 5EE1A 1T2DA 2ZIEA 1G5FA 5CH5A 1HQKA 1L5SA 4DLSA 2WV9A 2HBRA 1K3UB 3THWB 5CAEA 2JGRA 4F6CA 2RE8A 4DR1B 4Z4EA 3R5KA 1RNLA 4PO3X 3X2EA 3VTZA 1AK9A 4G5GA 4D42A 1N2XA 1YL5A 1PTJA 1ZCAA 3JQGB 3D3WA 1JT2A 4RVHA 4BNXA 2P2SA 1PJ8A 2QPAA 2VA9A 3OLQA 4KQ1A 4XEHA 5ABPA 1P0FA 4UAGA 4OXIA 3RV4A 1U3UA 5DYWA 4QYWA 1OU0A 3BFJA 2UV8A 5AM5A 5F35A 5LQMA 1GUBA 1EWYA 3CT4A 3F7NA 4L73A 4UHFA 5JSUA 1OE0A 2CUKA 2RAVA 3GFGA 4TKUA 5JSFA 2IU4A 4LZJA 5JFOA 4IFTA 4R3UC 4B2PA 5JHHB 4DKXA 1QO7A 3EH1A 4OQQA 4Q3DA 4MYRA 3SHOA 2VAPA 5DBOA 2QD2A 3QVKA 4JU8A 4C4XA 4D56A 1Q0QA 1ODIA 1F14A 3IA2A 1JR4A 3K9FC 5HUHA 2V7BA 4GRAA 1QDLB 2B5WA 3NHUA 3M6MD 5AQ1A 5D6NA 3VHXB 5D7NA 4FFWA 1Z5GA 5KVCA 3LT5A 3MLEA 3E0XA 2PDAA 2XA1A 5BT9A 2IYOA 2RJ3A 4MARA 5EJGA 2ZRHA 3LWNA 5AQEA 1RI5A 5DNCA 4YMLA 1U9IC 1DTWA 1ACLA 2PZGA 1NMQA 4JB2A 1HYEA 4OG2A 1E4EB 3CZAA 3OH8A 1OH6A 2ECQA 2WJ4A 3IPCA 3PEVA 1NNEA 2BHLA 4UXIA 1WNTA 3CTMA 1GM5A 3K72B 4EAAA 2FQQA 5JZSA 3WISA 2Q3MA 2EZ4A 1QTNA 3NRBA 4FZVA 5SYMA 3UJAA 1P29A 2LCFA 4K6FA 4XB1A 1QH8B 3BFKA 3SKXA 3BA6A 1UZUA 4QG7A 1MDBA 4L5BA 1OLSA 4WFJA 4ZVUA 2CK3D 3ICPA 4B0PA 5ISMA 5CTJA 1J22A 1JPUA 4WKPA 3R0VA 4ENVA 2JZNA 5LIRA 1O8BA 1XK6A 4GI5A 3U13A 1UP6A 5T3YA 3LH5A 4TLLB 1XXLA 1FDOA 4TVOA 2UU9B 4U3JA 1Q0UA 1L4MA 5IK2A 1P1IA 1AKMA 3G7SA 3H13A 1YTUA 4A8JA 4MIYA 4WV3A 1AMNA 2RC5A 1ESEA 2RGDA 4J7UA 4DSTA 4MR7A 1G1AA 4AK9A 1XNQB 4JR0A 4MQUA 5DDIP 4ADSG 1IHYA 1DT5A 1KMMA 1M75A 3H19A 4MTLA 2EBWA 2B36A 5FULA 3LPMA 2CMGA 4LHVA 2PXAA 1L1FA 1OIWA 1UJ5A 3TW8A 3ZZNA 1PX0A 4DT1B 3G0HA 2LBPA 2NZ8A 4ZJZA 3O4IA 3TEJA 1X86B 2FUG1 4EI2A 2EC5A 5JLJA 1M1YE 2GYYA 1HYBA 1NTRA 1XRPA 5GGXA 2V9CA 1J9ZA 5KX5A 4RLQA 1LDYA 3QX9A 2OLJA 2W22A 5CUQA 4N3AA 2YIJA 3W2HA 4YAIA 2EU8A 1DQRA 2OO5A 2NT3A 1O6ZA 3OJOA 5KVAA 3ILSA 2JGIA 1XG5A 2ZSDA 4OFZA 2UUPA 4ETMA 4WOBA 4LC9A 3IOBA 1KO7A 4FFMA 2PWZA 2WKPA 2YQ4A 5CB6A 1L4UA 5HJEA 4YJ2A 1CUZA 1PLKA 2Q1YA 3NHMA 3UANA 3U61B 1G8HA 1K4MA 1R5NA 2Y93A 1ZK4A 3AFIA 3DOOA 2YZ2A 3VHRA 2P6PA 3DTYA 4M1EA 4RA9A 5I8ZA 3ZXSA 4PX5A 4GWLA 4PFJA 4KI7A 1HTBA 4F9FA 3KQSA 3CNNA 4L9WA 2A5DA 2FZVA 3GP3A 4XSHA 3SZRA 3HDHA 3A36A 3IFSA 5HCUA 4CDRA 2O8CA 1F4LA 1TF5A 1YDHA 3IPXA 1JZSA 1KERA 2WIFA 4O08A 3LNCA 3FGZA 5YASA 5CDHA 1VLVA 2DM6A 2V3WA 3GOQA 4BV2A 1DNPA 1DAIA 1Q11A 3MJEA 1W1UA 2FZGA 2C7GA 3CW8X 3RHZA 1CUIA 2ODQA 2ZULA 3EPPA 4EQ6B 3F9RA 2WQ6A 3C5EA 4YRRA 5LXTB 2FZ4A 5LN1A 1JG7A 2EBUA 3FTEA 1EWRA 3LZ6A 2YJ6A 3EEYA 1XCJA 1KDTA 4RHTA 2PMDA 4IIXA 5G0WA 2XZLA 1M8JA 2TRSB 1A5AB 5BYBA 2ZTSA 3HWWA 4K6MA 4Q7LA 3TDKA 2ZR9A 1A9ZA 1E7WA 3Q2KA 1B00A 1CNEA 3BD7A 4I55A 3UMRA 5AVXA 2WVJA 5IJ9B 2IHYA 1ZIPA 1QJ4A 4KLAA 4KFSA 3R5HA 5EVCA 3DMRA 2A9VA 2GLUA 5BXQC 2ADMA 3FDXA 1U9CA 4IDGA 1O6BA 3IPYA 3OO1A 1GZ5A 4I6EA 3SKVA 1AO3A 4BO7A 4R71A 4F84A 3AVVA 2Q2OA 2HIHA 4RZIA 1L4FA 4X84A 3AF5A 2RMKA 4ZAGA 4ZREA 2YYAA 4J0GA 1C30B 4E7OA 4INOA 2F1JA 2HNKA 3CO0S 3L05A 1MW8X 1LK0A 3OEWA 4FFSA 3RAPR 2H6EA 3WLAA 4AZVA 4JLNA 3MRVA 3Q8KA 3FKSA 5L7TA 1XRSB 1Q0TA 2V45A 3D7NA 3P2KA 1JSXA 5D87A 4UDXX 3KT3A 3G2KA 1OAOC 1U0BB 1PT7A 3E9DA 1MC5A 3WMRA 3V1YA 1MNQA 1UZAA 2RI6A 3EWNA 4GXQA 4J0HA 2CEKA 4YASA 4UUAA 2ACKA 2UZ3A 1PFUA 1T9ZA 3GWGA 1D8TA 4Q3CA 4C29A 5KSZA 3GUZA 1OLSB 1JIIA 3CLRC 3ZH2A 1ZGGA 4D0GA 3KFVA 3D3WB 2B21A 5CGQB 4BWFB 1DRUA 4DV3B 2XTZA 1AGXA 4ZALA 9GPBA 2VF5X 3OQHA 2AL7A 2ORIA 4MPPA 5ALUA 2GF9A 1QO9A 3K8YA 1JHXA 1M0EA 1WIWA 4G0QA 1IN7A 1WMSA 3QVSA 3ZD8A 5TDHA 4YUZA 1J2JA 2P2DA 3L4BC 1UBTS 3H1BA 4UEOA 1CZUA 1FUIA 1ZM2A 2Q0XA 4KR9A 1C4KA 2RFLA 3KTAB 2PUHA 2JVJA 2QVZX 2PXHA 3SC2A 3SZMA 2PZBA 4E33A 2PSEA 3BGWA 2FJ0A 5CFMA 3ER8A 2VKQA 3DBLA 3A06A 4GL4A 1FDUA 4G2NA 3SYLA 3TRJA 2R8YA 3OAAA 1KAMA 2Q3HA 3AQIA 3QU4A 3QGMA 2DUJA 3ANTA 4LDPA 5ICMA 4HAOA 5CT4A 4K9NA 3SYKA 4BNKA 1PP4A 2IYNA 3ELYA 2IYAA 4JQZA 5C7OO 1HFKA 1QC5B 2R8PA 1LEHA 4L3VA 5EUQB 5TT1A 4LSMA 5JEDA 4KBYA 5KC9A 3L93A 5AW9A 5AW8A 5KX5B 5E7JA 2OESA 4MTCA 2GK6A 1MV8A 1A77A 4IVPA 4RMGA 2NTEA 4UMFA 1NP7A 1GYPA 4DLUA 4DV2B 4U2CA 2R6CA 3TRDA 3B82A 3SJ7A 1FCJA 1R7RA 4QPNA 1EX7A 5ENDA 3FMPB 4E5UA 5L3SB 4NBLA 2I3DA 1Y9ZA 5C81A 1YOVB 1N0UA 1VL8A 3WO1A 3AUTA 5A0FA 1PK7A 1T1RA 2KBEA 2QTMA 2QR5A 4LJ6A 5BWCA 5LQKA 2PR2A 2XMGA 1SQGA 2QT0A 2P9EA 2NQ2C 2OBBA 2XCIA 1DKUA 2PFGA 2X58A 2ZTVA 1SN7A 5FEUA 2PH7A 3GC6A 2C9MA 5DTIA 1KK2A 5IJXA 1D4ZA 5EMLA 1BVYF 4KIWA 1NYLA 2AJBA 2PX5A 3H4MA 3PNPA 4ASUD 5JECA 3W7AA 1GPKA 3UMCA 2O06A 1I9GA 2NSLA 2Q28A 3CONA 1U1IA 3LPLA 3NGMA 2D1QA 1U8FO 1POXA 2AG6A 3UGTA 3OP1A 4BE7B 1Z3IX 3TG2A 1A5SB 4QTTB 4BRZA 3PGKA 2CVZA 1UXJA 4IQ8A 1NATA 4EPRA 1ZUHA 4IILA 1E9FA 5FOVA 5CAEB 3HVIA 3HZOA 4GM4A 5D2CA 3EB9A 2IYRA 3M4YA 4HEA1 4R9RA 4L8VA 1EIZA 5AT1A 5CG2A 1SA0B 2VJQA 2QTTA 3GB9A 4AY5A 4DBLC 4HWSA 3ROMA 4FFBB 4AB1A 4NYMQ 1YONA 2ZQYA 3DDSA 4MKXA 4E2FA 4H1TA 4LNUB 4LE2A 3NHJA 3QZUA 3OMWA 2VEDA 4MW1A 2IU0A 3KQWA 4QXAA 3ZDEA 3AETA 2RB4A 1ZINA 1ZVKA 2JZCA 5E1BA 3RGWS 3H2HA 5AVRA 3RHSA 5FH9A 3V6MA 1FSPA 3FFBA 1XWIA 3LL7A 1BW9A 4CM8B 5EI5A 1WBDA 1AGPA 1TM7E 3CLUD 4L5YA 2VC2B 3MQ2A 1VKNA 2CB0A 4XIFA 2V6BA 1SOVA 3RC8A 5H83A 3EDRA 1U9ZA 2J9YB 1EUCB 3CUYA 3P27A 2XCQA 4LRTB 4OHKA 4YROA 2JI6A 4Q3EA 3QY0A 1O94D 4RNCA 4GKAA 5T6MA 1ZEJA 2QTNA 2YJNA 4C0JA 3I8XA 1DDGA 1GTSA 4BN4A 3WRYA 4EGFA 5DI9A 3KQUA 2F3PA 1N5OX 4I9HA 3RS8A 4PAOA 1DCKA 3U48A 4BX3A 1H3NA 3O8QA 4MUIA 5LZ7A 5LP1A 4DSZA 1SOWA 2Q1XA 1ZNZA 1ZX1A 2IIBA 3R8FA 4C30A 1YZNA 3IV6A 3I4LA 4B35A 1LX6A 2OGWA 3C6QA 4HMQA 2NUAA 1FNBA 1VE7A 4PQYA 3HBJA 2M6SA 5JI2E 1Y5NA 1DX6A 1DJLA 2LWIA 3O26A 5FNVB 2P75A 3N8GA 3LDFA 3RWMB 2PWYA 4C9BA 3SJZA 4DY6A 1CS0B 3F7TA 3GLVA 1RPAA 3R9XB 2FSFA 4Y7CA 4JT2A 2Z04A 4CLRA 2C9CA 3U3XA 3T5AA 3NHWA 1BGWA 1ENPA 5B7PA 1JR3D 2Z95A 5CRIA 1M10A 4Z2YA 2OV2A 3G79A 3JQ7B 1UT6A 3EXG2 3I01A 1O5OA 3A4YA 5HILA 4INAA 4GX0A 5AVWA 4JYZA 3BTUA 3OMLA 1O87A 4UZEA 2BMAA 1TW3A 1E77A 2QD1A 4H7PA 4BQSA 4N5HX 3FBGA 2BTOA 4F92B 4PZPA 1EFPA 4LJ9A 2B0CA 4JIGA 1YIDA 2BEKA 2IW3A 4F6RB 2P27A 3TD9A 1G4AE 3DZIA 2CL7X 5K5EA 1JBKA 1VJ1A 4KJXA 4UMVA 1MEJA 2FMTA 2IJGX 4TXLA 4ND8A 1QVAA 1IWPB 4BO2A 2WHPA 4IRXA 1YJQA 3HY6A 3JZDA 4XPIA 3EIWA 1KGSA 4Q82A 3IKTA 3PI6A 3WMGA 2O23A 2OBYA 1U8YA 2QG6A 4PBTA 4GX5A 5IAAA 3BS4A 1AQIA 1MAUA 4BNVA 4JUDX 5KTNA 4MEAA 2JCYA 1J20A 4Q4AB 5HIMA 3SBDA 2KX7A 2IP4A 2R2AA 4DWOA 4A6PA 5KQSA 1E2LA 4W6ZA 3NFRA 1LFDB 3GU3A 3EF3A 1Y6GA 2QROA 4D3DA 2J7KA 3ZZTA 2H9IA 4EI7A 1EX6A 2IHVA 4UNSA 1PZFA 4US0R 1JECA 4HOYA 1Z5WA 5IF3A 5AM1A 4PC7A 2O2CA 4A9AA 3SR0A 2J5BA 3JWIA 4M1QA 1C7JA 4BAZA 1RFLA 4YUXA 1RWWA 1G8FA 4HS9A 4F6RA 821PA 2OZVA 1V6SA 1QX3A 1V16A 4MLZA 2MTBA 5BSVA 2JCXA 3L6BA 4TYWA 2DBVO 1W29A 4YUWA 3TCKA 2I7DA 1JDTA 5H0IA 2FW7A 3TD6A 3FMVA 3LPAA 3QRWA 3Q41A 1MBZA 5DHPA 4KDCA 3HS3A 5AJTA 3RRNA 4GRDA 3KZNA 4PYQA 3B13B 1E4YA 5DGIA 4CF5A 5KU7A 1CNMA 3DEHA 4O4IA 4JZKA 4BZQA 1JJFA 1YF3A 1BX1A 4I9FA 4EL5A 3UMMA 1XPUA 1P4AA 3G3EA 2LGJA 5HF6A 5KYKA 1NDHA 1M67A 1U2QA 1GPUA 3L0YA 4HDNA 4BFTA 4CM7A 1SQFA 5FUXA 4GXRA 5DM1A 3GW8A 3DUFA 5ALHA 4C1BA 1RSZA 4JEMA 4QIHA 4KRGA 2CSXA 4I99A 3O84A 3GNSA 3ZCVA 5CCXA 3GRUA 1G6OA 5D86A 3IX7A 4DA7A 4NBRA 3EDCA 1RR6A 1ZH4A 4JJAA 1DQSA 2CYBA 1DP4A 1EB9A 3UK2A 3GJ6A 1JEQB 4L5JA 2GEVA 1YQTA 1JAXA 3H87A 3CR7A 4NONA 3WOVA 2B1RA 3CJTA 4C2TA 4TZ0A 1CE8A 1HDCA 1P1FA 2J30A 2Q3JA 2ZUVA 3AB7A 4PVCA 1Y9DA 5C5EA 4HC4A 4UEWA 3WYAA 1FFSA 4ZGBA 2PCJA 3D7RA 4KHZA 4BXOB 3I9NA 1BD3A 2GRJA 1ADBA 3C16C 2QD5A 1ONSA 1DG1G 4AL4A 2X8BA 1ZM4A 4NV3A 5DBGA 4ZK6A 2UXCB 1OXKB 4EHHA 4DIEA 4ZI2A 1PCXA 1H4QA 2Q4BA 1MO2A 2XYQA 3DYBA 3SYRA 1I30A 3ZJUA 1PVDA 3MWKA 4RZXA 3RTGA 1M2WA 3WI7A 3OJXA 3O9MA 4BJ6A 1P2DA 3BE8A 4AZ0B 1YBAA 1KJQA 1M7BA 2RI1A 5AKKA 5JHGB 5KKNB 4JP8A 2VJDA 2YASA 1QOZA 1JRLA 3B1VA 4LI0A 3OFNA 4LRYA 1WWKA 1ZXXA 3FGOA 1MX1A 1R0CA 4I2VA 4X3CA 4ETWA 2OENG 2I8AA 4P5PA 3I39X 2X9QA 1X1SA 3BQNB 1TEHA 3ONDA 1JSCA 2GK3A 4EBBA 1NYQA 2D4HA 1KRWA 1JEJA 1ZG3A 4NOMA 4P3XA 3SZ3A 1UDBA 2ZIUB 1XHFA 1UOOA 2QW1A 1XQVA 3AJAA 4B3HA 4OJNA 1TM2A 4Q1EA 2JK1A 2HRBA 2ERCA 1N5LA 2SCUA 3DZBA 4RY9A 4ZI5A 1DAGA 4ZKEA 2FA9A 5CR9A 1D4AA 5ADHA 2BEWB 3NHAA 2VA8A 3J81A 5K3DA 3WVNA 4YV0A 4EMTA 1M33A 1PV4A 3RC3A 4XUCA 4Q4HA 1N6PA 1U7TA 3QVWA 3RUAA 2NO1A 2HDNB 2PL9A 4URFA 5I4BA 5ILOA 5ERXA 4YAUA 3QEBZ 3M6AA 2ZR8A 1P44A 4P1ZA 4HNVA 4DV6B 5DTRA 4CM4B 1MF7A 4ODIA 4F46A 5IWAB 4HXGA 4ZEWA 2AC2A 3QTTA 4CXMA 4KPEC 1AZLA 1ZNXA 1OFHA 3C1TA 4IPTA 2WUDA 2YWBA 3L01A 5BURA 3LHKA 3MWLA 1NURA 3A3KA 3NDIA 4BVLA 5C53B 4NS4A 1XNGA 3JYPA 4U0KA 5DTJA 1DC8A 2BR3A 2XMQA 4N47A 3ITDA 1J97A 1MC8A 4ZQFA 2W6QA 4NXNB 3F5MA 2E49A 3KKPA 1P45A 4RCVA 4OP1A 3IT1A 2OQ2A 4ZAWA 3W6PA 3C5CA 4ZDWA 3GDGA 4ML3A 2NMVA 1ZISA 5JWHA 3C48A 2PGDA 3T3DA 5IT9A 5F2NA 2DE0X 3ANXA 3N6RA 2PH3A 1FXWF 4NC9A 1XZJA 1WHSA 4Y1EA 3B36A 1EFPB 4CEHB 4LCJA 4MVJE 2Z58A 4QLBA 5FFFA 2FWJA 2R6JA 2FZWA 1Z28A 3QE9Y 4YMVA 5EJ4A 1RJ9B 1TX4B 3OQJA 4IIJF 4KN5A 4WNAB 2LV8A 1Z07A 3NDRA 4K7JA 3X3HA 3UYLA 3OZAA 5B12A 2M32A 4I4NA 4MYDA 4ACAA 3HY4A 3EVBA 2ZU0C 1LVUA 1QQ5A 2Z1DA 3CKYA 2Y4OA 3PL1A 3RNLA 1NLZA 2ZAYA 4LX0A 3FZQA 2DFPA 1IJKA 1QS0B 1UM9A 3LBIA 2R47A 1L7VC 2HV9A 2YKGA 1MOQA 3AV0B 5ALOA 1KZ4A 1UK8A 4TS9A 2XVAA 3GARA 2CHEA 2RGBA 4GSLA 4XCVA 4X5OA 4B2LA 2ZB3A 3I53A 4YGYA 4K5QA 1IUPA 3E58A 2PS9A 5DPMA 3GGOA 4GLOA 3RG8A 1A04A 3DJFA 3EPHA 2PE5A 2QU8A 4I1SA 3T1HB 1CFZA 2QM0A 5EEHA 4CKWA 2FUCA 4AVYA 4YRAA 2FMFA 2RHDA 1H2YA 4R0MA 1JU9A 3PDUA 4OOFA 4WN9B 1QGUB 1Y8RB 2R4TA 5D3ZA 3I42A 1SUSA 4MRMB 1K7SN 3U4IA 4Q03A 1GG8A 4EKDA 1EIWA 1LQ2A 5CFNA 5GIOE 3ORHA 3R4CA 3K35A 4DQXA 5KNDA 2Y1EA 2CNWD 3B9PA 1U7ZA 1G6Q1 2YXDA 4MRSA 2XCUA 3THWA 3OCVA 2PQMA 3BGSA 1SBHA 1TCVA 4O4HA 3KQMA 4D5EA 1VL2A 3DDOA 1M7HA 4ESOA 1ILWA 2ZJOA 3NOOA 1WCWA 5F12A 1E5VA 5CD9A 5FUWA 3EMBA 3VPSA 3FN4A 4KN9S 4CQMB 1SMKA 3M4XA 5J59A 1SZJG 2ZE8A 1W44A 1UBEA 1WXWA 4HX2A 4GR5A 5K1ZA 3ZV7A 4R51A 3JVUA 1KTVA 4RKRA 2AMYA 5REQB 1ORTA 4F7WA 1G59A 2W71A 5CDTA 4XASA 1GT6A 1H66A 1NY5A 2RHHA 3D5EA 4D81A 4P32A 2IYPA 1FL9A 3V7NA 2XKBA 5ADWA 5HM6A 2GZHA 1BFKA 3BWMA 1KI8A 3MM4A 4I1RA 4NU6A 2YWXA 3ESCA 3EPRA 3OZEA 4FU0A 5CM9C 1SCJA 3M6VA 1QIGA 5EWLA 4EQZA 4B3GA 1L4LA 3EUAA 1CQZA 1T9CA 2A14A 1JQ5A 1J39A 2ZJ4A 1W59A 2IFTA 3PR2B 4FBGA 1ITZA 4NFYA 4CCAA 4E94A 4YRIA 3V4RA 1VXRA 4KFRA 1D9XA 4O3MA 1RXSA 4A27A 1X9HA 4QDJA 2LXNA 1P4HA 1JSRA 2VPTA 2GD0A 3FRIA 3H5OA 3K0FB 3PQ3A 3TL2A 1GDDA 3CG0A 4AKIA 1CUVA 1Z35A 1B1AA 4AJLA 2JGJA 5DTMA 1EM8A 3B52X 1X7ZA 2QUKA 4OFWA 1NUAA 1D03A 3UC5A 1WP4A 2OC9A 1P72A 2YHUA 2CF5A 3N7TA 3OZRA 4RPJA 4DSUA 3FNQA 4DXHA 3OJLA 3OZTA 3HCPA 4RZ3A 3VJMA 1EXDA 3QVXA 3G8DA 1GAXA 1XD8A 3VPAA 4QNNA 4OQEA 5IJ0B 1YB5A 2JGLA 1S8FA 3OT4A 1RWVA 1XZAA 1TMYA 2UDPA 4HN9A 2IUUA 3OG9A 4DRXB 3KXLA 4R54A 1L5QA 2DQ4A 1OY1A 4I4TB 3C1OA 1FP6A 1A9XB 1Q2XA 3JVIA 1A2KC 4KLCA 4OBBA 4RETA 5COQA 5JAZA 1TVCA 3ONNA 5JSYA 1DXQA 1LI7A 2HRCA 1CVLA 3OWHA 2ECPA 4I4TF 3TQHA 4F3RA 5GY7A 4CG2A 2FPSA 2FPIA 1UMDA 4D9JA 5LOVF 5ESWA 2PA3A 4Z5XA 3AVUA 4BMYA 2B3DA 1I7QB 3RI3A 1GU7A 5J23A 1V37A 3OT1A 1WUKS 1IZ9A 3REFA 1ZS9A 4UNRA 1MG0A 1UBOS 2Q8NA 2VP5A 1V6AA 3B85A 5KQPA 3TLCA 1SKMA 1FSZA 1CRZA 4UJ5A 5HA5A 2FSPA 2XUQA 1L7RA 2OG2A 5DLEA 1PGOA 3SU8A 1GRCA 3REGA 5ECGC 1F5SA 4LI3X 4NH0A 1FZTA 4RLFA 1CF2O 4KFUA 1AGYA 1YJ5A 3K05A 4OQXA 3VBCA 1M6YA 4LDRA 3L0DA 5E6RA 4J2TA 2D8AA 1PYGA 1LPNA 5JD5A 2LCIA 2X8WA 5T5QA 3OZBA 1YR1A 3UOWA 2Z2KA 4H1VA 1JHVA 4WA8A 2OMKA 4NENB 1I5RA 1E0KA 2NV2B 2ZWOA 5IC5A 2J3DA 3R75A 1QUFA 1T5OA 3YASA 4P08A 1L5ZA 3FB1A 4RESA 4CU2A 4EATA 4HNHA 5ELLA 3JVDA 2H07A 3PGMA 4RSGA 4ISBA 4HNUA 4G36A 5CVUA 5DO9A 1T8SA 1WULS 1Y3DE 5JYEA 3I9OA 3TTTA 2WTEA 2Y1LA 3VAYA 3VR6H 4EHKA 4DMMA 3WA7A 1W2HA 4DCJA 5BNTA 1TK2A 3QQPA 2VJNA 4ACBA 2C83A 1T0HB 2B92A 1Q7RA 2L42A 1RJEA 5ICCA 3HCFA 3RFTA 3DE0X 3CPSA 3T9CA 5KOJB 1UBRS 1Q12A 3X1ZA 2P30A 1GZ4A 1ID1A 4ZHSA 1T35A 1Z6XA 3BREA 2QRVA 3B12A 2HK8A 2D13A 2DWCA 4TMZA 1MW9X 5C7YA 3EGDA 4WZBB 4JIMA 3WGIA 4MKZA 5GQSA 2GK4A 5FPYA 1C3EA 3TNFA 4DAEA 3B6EA 5BYAA 4MWOA 3H2IA 3TQCA 2R4UA 3L7DA 4D43A 3C5HA 3E9RA 1CR4A 3JSAA 1KH3A 3IPAA 4WGGA 1NVGA 4BNWA 2J6CA 4URUR 3GT7A 1Y5IA 1Z3CA 4AROA 2PANA 5L3QA 2D06A 1BHJA 1P6XA 3SE0A 3B51X 5B7GA 1T6XA 3ROQA 1V5GA 2JS7A 2PX6A 2HZ7A 1XDWA 4FD3A 4TWRA 5BOSA 3FMFA 2AOXA 3W78A 4D96A 2YCLA 1NDQA 2X1MA 3OZIA 4PX9A 4RY8A 3ZJ5A 4V0MA 3E9QA 3IS3A 4QOJA 1M5UA 2B2XA 1YKFA 1EVJA 1G5TA 5JE8A 1G20E 1VB5A 2F1RA 3DMTA 4B2IA 5KOIA 3C2QA 4NEGA 3GMIA 3W5AA 3VNUA 1C2TA 3HNRA 3HVHA 4ZCQA 4F8EA 3ADCA 1XNRB 3H5IA 3DLAA 3KPUA 1ZAYA 2ORED 1PR1A 1GZ3A 2VHXA 3SF8B 5AXAA 3ZCXA 4BRUA 5CA1F 1NUQA 1ZU4A 4G84A 3I05A 2W93A 1YJBA 2A1TS 4EX7A 1EAMA 1RKVA 3BRCA 4P8RA 1VG0B 4WGFA 2ODEA 4QASA 3GGCA 2CKDA 2QKYA 1ZU5A 1Y7TA 3O2SB 2ZSHA 1OZFA 3IULA 3K9LA 3E1KA 3ZX5A 5JJ5A 1XEWX 4RF2A 3H5WA 4MA0A 1NI4B 4E7PA 5EIBD 4ZAVA 1EK6A 3OPYA 5T67A 1PUIA 4M54A 1FBTA 4YUVA 2XQVA 3UXYA 1IWBB 5BVHB 3UA4A 3Q8MA 2D7DA 2H63A 4GPIB 1OT3A 1WF6A 3JYQA 1FDTA 3W0LB 5C80A 3M1YA 1ZESA 4LNAA 1S2NA 5EKDA 4Z1OA 4KUHA 3OEED 3HL0A 2FW0A 4J0CA 3W1VA 3KE9A 2BZGA 4P4NA 4RK0A 4F2WA 2QY9A 1DBPA 3K09C 1XJ5A 3IODA 3ASUA 5FO1A 4Q7EA 4XDYA 4LZPA 3ZWXA 1JQJC 2QVBA 3AF0A 4R2JA 5LZ8A 1EHIA 1M6WA 4XFDA 1WW2A 4H3KB 5EHXA 3RAGA 3IIMA 5HJ7A 1LTHR 3WJ7A 5MGBA 2DEUA 5B1HA 1D0IA 3CM0A 4M8KA 5I4CA 1JVNA 3QENA 2QGFA 1Y9EA 1J2UA 4D9GA 4DR7B 1M72A 5L3VA 3QW4B 4YRNA 4NIMA 3D4IA 4ZV9A 1P3DA 1CJUC 1F48A 3QK7A 1OLXB 3AR2A 2V5AA 3WYFA 1ZQ1A 2GHRA 3M6IA 3TKAA 2PIAA 1E0AA 2Q5CA 2ZYIA 2QD4A 1OWPA 4HQLA 4IZ6A 4DWJA 5F3WB 3KSDO 4AZ0A 1VG1A 4PPQA 3JV7A 3VTFA 1EAYA 3X1KA 2C20A 2VSFA 1J4AA 3WB1A 4J9VA 3WKDA 3KB8A 5A5FA 4KYUA 3MG9A 2BZ1A 2PRZA 3IQZA 2IF2A 1QG2A 4YQEA 5K3BA 5K6AC 1PUJA 1E7SA 5E4FA 4OL0A 1R74A 1PLLA 3U7GA 1NX9A 1JKFA 3SOPA 5A9SA 5ALQA 3BH6A 2IPMA 1DAPA 3SZUA 1QYIA 3G9TA 2GTHA 3D0OA 4NQRA 2RB5A 4MVXA 1H5QA 1M76A 3PGA1 3WXBA 2YY5A 2V9PA 1O4VA 3G2MA 3EVEA 3HJNA 1WHTB 2VK8A 1EDBA 1DKQA 5DYIA 2KM1A 1U0SY 1DUIA 2FR8A 3PXEA 1JN0A 5JATA 5FBQB 1UAAA 2X0RA 4QXPA 5KYWB 3R3VA 3VXKA 2WWVD 5BNZA 3DH0A 1U8UA 2FKAA 1R8JA 4HN2A 4V0OA 4JZYA 2JLUA 3EX7C 1UWKA 1LNSA 1MFPA 3TF5A 1ZOIA 1KI4A 1VECA 4OJKA 4PLCA 3JR3A 4LECA 5IDQA 1FLDA 1KHHA 1TU3A 1IEQA 4R2WA 2BFDB 4FFNA 4GC5A 4HDRA 3RARA 3RVQA 1NMXA 1NULA 2OSBA 1NBIA 2R85A 3ND5A 3Q3IA 4JL8A 4B3RB 1U31A 1CD5A 1HLFA 2JJ1D 2FAXA 2RAPA 4KWIA 4JEUA 3EUWA 5U1PA 3PC6A 3PC3A 3EPLA 1QIKA 4ZTZB 1J0DA 2D1YA 2C3MA 3BWBA 4ZEXA 1N2CB 1F0PA 4PG6A 1P5FA 3IERA 3N2YA 4F72A 4X7BA 1XPJA 2CZCA 2Q3CA 1HMYA 1SIUA 2ZI3A 2Y99A 1I9CA 1ISRA 3KPYA 4Z86A 5EXEA 1CULC 4EA7A 1DLJA 1IAVA 3DVAB 2OXIA 1BCRA 3BXPA 3GFSA 3SD7A 1VCIA 2VP6A 2WZCA 3PRJA 4C4ZA 2GM4A 4AN4A 5K0EA 3DHWC 4TV8A 2H17A 4H7KA 3RIMA 1FP2A 1KKMA 5DI3B 3SQLA 1XD9A 3GEBA 2ZT8A 3R3YA 4KN8A 5DHSA 1SUIA 3GAFA 5MFPA 5JZVA 3DW1X 2PGAA 1GGKA 1DO0A 1WCYA 1WU8A 2PMCA 2ZRJA 4NESA 1QQBA 3MGAA 4CE6A 5IW8A 3AIKA 3SNKA 4CM9D 5BVGA 4R2LA 5IVHA 4F9TA 3WQSB 1OAKA 4JBHA 2I22A 3EQZA 3K0AB 4BZPA 4CMIB 2C7QA 2OG1A 4WI1A 1CRWG 2DR0A 5EUCA 2P4HX 4Q9KA 4EPVA 2WSIA 5IASA 1PX2A 5IDXA 5LDHA 3WRXA 1QTRA 4H27A 4XWWA 2YXNA 3AM3A 3CZ5A 3QI2A 3KEQA 4KMSA 3EGWA 4WKGA 5KYUB 3NGXA 3FI9A 4F5DA 4I81A 1MJNA 2FMXA 3NM6B 4OYHA 3WP0A 1ZN7A 3IDQA 1SD1A 5KYXB 1WXXA 3OWOA 5AOCA 2D5BA 2Q07A 5BN4B 5KJEA 4WZAE 3FTNA 1YDEA 1AIPA 1T24A 3UK6A 1OXXK 3GLIE 2FMIA 3GCZA 5DF1A 4E22A 1WDKA 3O47A 1QLWA 3V80A 2ZM6B 3EC1A 4RPLA 4KIUA 3NC1C 3E03A 4KNVA 1FRVA 1XYGA 2F17A 2PO7A 1L5MA 2FPRA 1CY1A 3VC1A 5KQGA 3T7IA 2VHVA 4EBFA 4ZQEA 5DXJA 2ZRPA 1YVRA 3HDTA 1MCZA 2ZRQA 3FWZA 5KNBA 1PEAA 5HCNA 2H4ZA 3B6JA 3KZ1E 3QVGA 3MC1A 4B09A 2GN9A 3NUZA 1ECGA 2HQ1A 1NASA 4UEJA 4HJRA 4S2UA 4YAWA 3UHJA 5G4KB 2D62A 4UCQA 4DBZA 2FK7A 4GQIA 3ILHA 1A76A 3OCZA 2P6OA 5KHLB 3R6GA 1OQAA 3AEUB 5AJXA 4E1VA 2DECA 3MJTA 2WPDA 1GNSA 3U9SA 3O3CA 1SXJD 1EM6A 4QZVA 2A9OA 2XE6A 2ANBA 2ASEA 3TGWA 3IP9A 5ADVA 1X1BA 3ODPA 4PAQA 4V0LA 2OAGA 5AKHA 3ZK7A 2EP5A 4WBXC 3SX2A 1J07A 4XGIA 3CCCA 3OQNA 3U4QA 1J2YA 3QA3E 2V59A 1N25A 2ZBPA 3LA8A 2H2WA 5EZYA 2AEMA 3SPXA 3DE5X 4TRRA 4BQFA 1Q2UA 4Y7DA 1C4WA 4HH1A 2RH8A 1Q50A 1U8TA 2JIBA 3UW3A 1XMVA 1I01A 1THMA 2FPWA 1TCUA 3MCTA 3GVIA 4X41A 2HT6A 3PVZA 3SSNA 4M99A 3WXMA 1LK5A 3DTVB 4LZZA 4BFLA 4UU8A 1Z25A 2XV1A 2VUSA 4Y6LA 5HKLA 4PPFA 3PX2A 4QUDA 3URKA 1JJBA 4JR1A 1UJCA 3CSSA 1A82A 5HFAA 5BUCA 1LS1A 1NT4A 2F90A 4RA6A 4WRRA 1MRNA 4E31A 1CHNA 3Q9LA 2MSKA 3N58A 1E96A 3NHRA 3OZSA 4XYBA 1P5ZB 2GLXA 2H9AA 2WUGA 3QVLA 3MT7A 4S0XA 3U5TA 1SWWA 4WTOA 1OI4A 2EEPA 2NOAA 4HGNA 3UHFA 4QQNA 5IM5A 1YC5A 2GPWA 4P4GA 5AD1A 2Q0SA 3OZGA 1GY8A 1WMFA 1OYYA 1KZYC 4H16A 4F7DA 5KKAA 5I3ZA 2QDKA 1MA3A 3DEFA 3I8OA 2VZ9A 5LUBA 4PC6A 3G0DA 4G9BA 3TQRA 4AUEA 5K8IA 3VNVA 3AKCA 3NOXA 3I5MA 5AWFC 1A5TA 3ABSB 4YJHB 3LX4A 3ROKA 4FB5A 3N75A 3X1MA 3IOMA 2NUPB 3MRXA 3WSTA 1YAJA 2XWJI 4HXFB 4H60A 1Y8QA 2VBCA 1JQEA 3UWDA 1NX6A 1WQ4A 4TL7A 3COPA 5EJAA 4TSFD 4PXSA 5CD1A 2ZZNA 3F74A 4FOOA 3BEOA 2QX9A 4ZVMA 4BVBA 4QGHA 2QUBA 5CG1A 3WRWA 1T9GR 1YMQA 1ADGA 2FH5B 3HXTA 4JXJA 1G38A 1IDOA 2YY7A 4D8VA 3V3TA 3BWDD 3TSZA 3VO8A 3ZDAA 4QYSA 2FN8A 3B8HA 4TT3D 4CLOB 1PQYA 1MJ5A 1V5FA 2OM6A 5TPWB 5JY1A 3HZZA 5JYCA 2CLEB 1TPYA 4TS3A 3RU7A 1UKVY 2NQTA 3HA7A 1FQWA 4BKMA 4ZHQA 4KAFA 3TR5A 5F9FA 2Q6LA 3AUSA 2Y9PB 1HTWA 5FUBA 4ZMSA 1H0SA 2RIPA 3SM9A 5CFLA 4UTOA 5AVYA 3C87A 3R6DA 4B5LA 1GLGA 3R40A 4KQHA 5JBIA 3M6UA 4KLNA 2TMKA 3W3ZB 4QOGA 3GUHA 4WLUA 2XT9A 1N0WA 3JWGA 2W70A 2YX1A 1ES9A 1KBQA 4M46A 3IE0A 4A10A 1ZUNA 3JQ6A 1PQUA 2G9QA 3K6SB 4UAJA 5FP0A 1A8PA 3Q5GA 3I04M 3ZHRA 4EHDA 1MB4A 1IONA 3TQSA 1IM5A 3TIVA 3H3JA 4J0EA 1E6WA 3G68A 2VWGA 4ZARA 4DCSA 3GA0A 4NPCA 2P9TA 2DU8A 2E87A 1A4RA 1NKTA 3NIDB 4OGLA 5K51A 3EXAA 3UOGA 1U80A 4GDMA 2PPLA 1N9GB 4RDCA 1CQIB 4GECA </