4JHXA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
336
structure length
336
Chain Sequence
NAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine carbamoyltransferase
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus
molecule tags Transferase
total genus 133
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jhxA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jhxA02
1JS1X 2EF0A 4JFRA 1EZZA 4FYYA 4KGVA 4EP1A 4E2FA 4AT1A 1RAFA 5ILQA 3R7FA 3D7SA 3M5CA 2I6UA 4IV5A 4FYWA 5G1PA 4A8PA 1TUGA 3M4NA 3R7LA 1ZA1A 4AM8A 1C9YA 3Q98A 1ACMA 1DUVG 3KZMA 2IPOA 3KZNA 1Q95A 4H31A 3LXMA 1OTHA 3L06A 3L05A 2QG9A 2FZGA 4NF2A 2G7MC 4OH7A 3L02A 2HSEA 4KWTA 7AT1A 3R7DA 1TU0A 2FG7C 3M5DA 1F1BA 1AT1A 2ATCA 3SDSA 3UPDA 8ATCA 5G1NA 1I5OA 1PVVA 2YFKA 2FZCA 1VLVA 1RADA 3L04A 3KZKA 1TTHA 3GRFA 5G1OA 1ZA2A 1RAAA 4KGXA 2H3EA 8AT1A 1R0BA 2BE7A 4KGZA 1RAIA 1RACA 2W37A 3E2PA 2P2GA 2FZKA 9ATCA 3AT1A 4JQOA 3TXXA 2QGFA 3NPMA 1EKXA 1FVOA 4FYXA 4F04A 1RAEA 4A8TA 1RABA 4WTOA 5AT1A 1RAHA 1SKUA 3KZCA 1FB5A 1ML4A 1D09A 1EP9A 4KH1A 1RAGA 2OTCA 3CSUA 4EKNB 1DXHA 1NBEA 4F2GA 1AKMA 1R0CA 3GD5A 4KH0A 3MPUA 3KZOA 2AT1A 2A0FA 4ANFA 3M4JA 1XJWA 1ORTA 4A8HA 1A1SA 2AIRA 2FG6C 4BJHB 4FYVA 1PG5A 2RGWA 3D6NB 2BE9A 4JHXA 6AT1A 4AMUA 3TPFA
chains in the Genus database with same CATH superfamily
1EFVA 1BNCA 1WABA 1KYXA 2XYPA 2ZRKA 4NHOA 2AUMA 4CMGA 4DJ5X 4ZAVA 2R3SA 1MJ5A 1LF0A 3KEGA 4FDUA 3OQOA 1Z39A 1IWBB 3O75A 3H8WA 4PNEA 4JLVA 2B7CA 3FN4A 1KU0A 1MAWA 1QVVA 3HJFA 2H18A 2ZDHA 2WU4A 3AJ9A 5CRIA 5CH5A 4EMBA 5LB4A 1JVSA 1ZS9A 1VI5A 1G64A 4R1QA 1YC2A 4L57A 2HMAA 3O8QB 5AVZA 3A2KA 1XKXA 4RV4A 1D2GA 1D7AA 1PW5A 2ZJBA 3E22A 4Q3LA 5DCLA 5AKYA 3V8NA 4IIEA 4DDKA 5K0JA 5LP6C 5KYUB 3PUWA 4MCIA 5DASA 2CL0X 3COWA 3DVLA 1T0HB 2IEYA 3IERA 4CM8B 5IHPA 4EATA 1GGHA 3L05A 3H4TA 1CW2B 1YR8A 2VA9A 2VQDA 3JV7A 4X84A 1SWVA 4B5LA 2DWOA 4ZO6A 4BMCA 3HXQA 5EUCA 1JHDA 1XHFA 2H9IA 1DVRA 1G4UR 3PWTA 2AG1A 2RHWA 1FRZA 3ONVA 2FEPA 4JR0A 1X9GA 2YS7A 2XUIA 3MWLA 3N74A 3PGLA 4BZPA 4IJMA 4WL0A 5EE5B 4O3MA 5C81A 3R3YA 3L1HA 3BOSA 1VPWA 1L7PA 2VYVD 3RIHA 3K6RA 2NADA 2R97A 3UHOA 2A88A 3PXAA 4NESA 1CPYA 3E7DA 4G65A 3UG7A 1A88A 4IRXA 2JHPA 4RLSA 1NXOA 4OVKA 4ZIRB 1LDEA 4P7KA 3I8XA 4GL4A 1HDCA 1UMCB 4GPD1 2PFGA 3CJTA 4L08A 3RFTA 2I62A 1JU3A 5LQUA 3B2QA 5CT6A 2BY4A 4PONA 1Z7WA 1EH5A 2YN0A 3C5CA 3DHYA 4MVWA 5IN5A 3Q3IA 1G2QA 1N25A 1KE1A 2FDRA 5JFGA 5GIOE 4RXTA 5H3LA 2PXHA 5CW2A 3LRPA 2WKSA 3UJDA 3GUUA 3LMKA 3OOWA 5LJIA 4QBTA 4HGPA 3KOWA 3WI7A 2QENA 3F9RA 4FM9A 1D03A 3WJ1A 2HYIC 4PHHA 1S0UA 3AIMA 5JNLA 3RVKA 1J97A 2H63A 4RZQA 5FA8A 1NW8A 2QX7A 3LKZA 3L7NA 3UHAA 3AUJB 3CS3A 3AONB 3PQ8A 4QYSA 1L7VC 1IXRC 2HSGA 5EZYB 1SFRA 5LB2A 4OXRA 3M6VA 3R6LA 2C5GA 2W6QA 4X00A 5ERGB 1CP2A 3K73O 3GMTA 1BU8A 3ESXA 1QGAA 3ZU4A 2YNMA 1YKFA 4N8SA 1ZOOA 2OTCA 3SKXA 3WA6A 2YVUA 1DRKA 2WVAA 5JXWA 1A97A 5EWMA 3RRNA 3G7NA 3VR2A 3CX3A 3DAHA 1RYEA 4C3VA 3X1ZA 3G8CA 2BFMA 2J09A 3QYFA 4D8TA 4K26A 1SO8A 1X1DA 2FR1A 1IHUA 3P52A 2E6KA 1NMXA 3M8KA 1MIHA 1MPXA 1UMDB 2BFOA 2BKXA 2HRQA 2AOUB 2OILA 5C18A 3GRKA 4FBMA 2WPDD 4ZYVA 2WTUA 1FMLA 4FGWA 1VDMA 4IJKA 2IEZA 4WCFC 1Q17A 2OHXA 4R2LA 1RJWA 4H4DA 3WMFA 4QODA 1VG1A 3ZGLA 2OB2A 4ZMRA 1U9IC 2WM8A 2HW8A 2C88A 2PCJA 1N6IA 2HMTA 1ZH4A 3IEIA 4I1VA 2NVWA 3NM5A 4LXIA 3LKBA 1P44A 4TT3D 1E3JA 1NPYA 1TZKA 4G01B 3ZHSA 3MS4A 1RKXA 2F67A 2WHRA 4FYKA 5DTJA 3N6XA 2EKBA 4ZGBA 4XWWA 1JFLA 1KJJA 4TYYA 3KTDA 1RC1A 4U7PB 3ZGYA 6CHYA 5DK6A 2OZLB 5FORA 5A0VA 1CNMA 3HB4X 3HXKA 4TTPA 5EHQA 4CBVA 5A4FS 1P5RA 4KB5A 2Z6UA 2O7SA 1O3YA 2JHAA 4DMGA 2HRCA 1A7JA 4UUQA 1QO9A 1JSRA 3PJEA 3ZQ6A 4EUSA 5I7HA 3M1YA 3AERB 3UA4A 5AUNB 5HTKA 3WVNA 1V8DA 5IWCA 1QOZA 1ODLA 1ECCA 4I9UA 1HT0A 5G53C 2R1UA 4IYJA 2V5AA 3LXMA 5AKEA 3O4HA 3O47A 1QIHA 4Z8XA 4AQ7A 3DO5A 4W1SA 1MA0A 5KI6A 1EFVB 2W90A 5F3RA 4JB2A 1M2WA 3QLJA 3T9AA 5LP6A 2XTNA 3TB6A 4DIEA 5IH7A 5HG0A 4PZLA 9ABPA 3KB8A 4CT0A 1SAYA 4YCCA 3X2SA 2ASEA 4KJXA 4KIJA 1IDOA 2PFKA 4EHNA 2J3KA 1JAHA 4PAGA 2B2XA 1KEKA 2I1LA 2AD5A 1VL2A 1HO3A 2OCAA 2QTLA 1JEYA 4YUYA 3ETGA 2H11A 4KE9A 4F93B 3L6RA 5CX1B 3IR6A 3ORHA 3HFSA 1JKMA 2NNWB 3QU4A 3I37X 2AHOA 3H9CA 5IC6A 1NBIA 5EVJA 2I91A 3D3QA 3GLVA 5G0TA 3TRFA 1ISGA 3K9BA 1R8JA 4WOJA 3KBOA 4DUPA 4IZIA 4P92A 2KBFA 3F7OA 4NBTA 3QX9A 4LCJA 1LK0A 4H7KA 2Q5IA 3DOFA 3CPEA 1E1QD 4LHYA 2OLKA 4UVDA 5DWQA 5C8XA 2FZVA 1TNDA 2FEMA 1OZAA 4RORA 5DNVA 3IUQA 1XYGA 2JH8A 1ZC4A 3DOJA 3FGZA 1GL6A 1ZK3A 3GA5A 5IEBA 5BRAA 4O4JF 5AVJA 4L4SA 2DOKA 2HDOA 3ZBTA 3FYCA 3OIWA 1SQ0A 2X9NA 3O3MB 3ERCA 3EC1A 3KDSE 5B30A 2FZWA 1VMKA 3VNAA 1U2GC 4CG0A 5IPFA 2ZR0A 3AOEA 2V7VA 2COUA 5DMXA 1PDOA 1FNSA 1VGQA 4U00A 5GONB 3IUYA 4AXBA 1ODSA 1SC1A 3KZCA 3DPSA 3ZW7A 4NH0A 1Y5RA 3IOBA 5A5GA 2XE6A 3U3XA 2CXPA 3INTA 1KQNA 3LWDA 1Q1NA 4II3A 3P8ZA 4B35A 5K0SA 3K9CA 4NV3A 3H13A 4RC9A 5LQRA 1JDTA 1MZVA 4OSPA 3OM0A 4ZEVA 3PXEA 3TL2A 2QXUA 3U49A 2VRCA 1MOSA 1FXWF 2V7XA 3R3WA 4FYIA 5EKUA 5J9FA 3V1LA 4YDSA 3ICWA 4A3SA 3GJQA 2F3SA 2NVBA 4PSUA 4B3RB 4Y0VA 1PQWA 1W25A 5EIWA 3K5PA 2ZB7A 4WRRA 1F20A 4ZWNA 2X8LA 3VZQA 1IQUA 5CB4F 5J4VA 3OA2A 3NBZC 1G7CA 5IK2D 4RD6A 4JT8A 4RAOA 2GT1A 3M9LA 3PUJA 3K1ZA 2F1KA 1VL8A 3PCXA 4JA0A 4MP6A 1HLGA 4I2NA 1KZ4A 2ONZA 3UMJA 5CEJA 2RC5A 2HDWA 1K8QA 2XDYA 3O5AA 4WCFA 4XUCA 2ZRFA 4XWOA 4ZRMA 1RWKA 2FKNA 1S3GA 3Q3JB 1NF3A 3PXXA 3L46A 3KR9A 5HMLA 3D6TB 5EWMB 4DIFA 1HEIA 3VFDA 2IYLD 1T0JB 1K89A 1OREA 5CT8A 4OHUA 3S0JA 4P4UA 1JB1A 1QX3A 1R0SA 3BULA 4O6VA 5BV2P 3GLIA 4EHBA 4W7IA 1J1ZA 2O2YA 2C2ZA 2PKEA 4MCJA 5LMZA 4FX2A 2RI6A 1LB1B 1GU1A 3ASZA 4CIXA 1Y80A 5GMOA 1E2KA 4AJ2A 2RSLA 1S8NA 1ACMA 1TMOA 4D4JA 1K7SN 2J3HA 3EARA 3FFAA 4GRDA 1CDDA 1ZBDA 3RYFA 1L1RA 4FGZA 5KYWB 4C4YA 2HK6A 5E7MA 1U2RA 3M89A 5I7VA 1LGYA 1A04A 2PVCA 4KU4A 1NFQA 4HAXA 2VPYA 4MWTA 3FM9A 4FN4A 3I2IA 4ND6A 1G6OA 3VBCA 1SC3A 1TVEA 5CPFA 1EI9A 3ZWQA 1RWVA 1EAMA 5ISMA 1J6UA 3H9QA 5BO5A 2NPFA 1ZL2A 4N54A 3IVGA 4IGFA 3SDSA 1TAUA 4RWZA 4TVKA 1SVWA 2ERYA 1F0KA 3TNYA 3W9BA 4B4UA 2VWGA 4E14A 1Z15A 2EFGA 1S9HA 1W19A 2VXBA 3B78A 3GJYA 4Q0MA 2Z3VA 4NY1A 5K0CA 3WJAA 2BZ1A 5FNVB 3H97A 3IBYA 4P82A 3BB3A 4X45A 1E9CA 4FVTA 1YRHA 2XA9A 1GZ4A 4XASA 5DXFA 5I51A 5ELXA 1TMKA 1EK0A 1CCWA 4HUTA 1E9AA 3QA3E 2PT5A 5A6VA 5HPYB 1E4YA 4L4UA 5LP6B 2VQ3A 3QVKA 3AP1A 4KRGA 2RB5A 3KVYA 2O1WA 4WOPA 1HLPA 4L8FA 1YS4A 4NENB 2W37A 1EEHA 4KI0A 3OX1A 1N7GA 1NKSA 4PNHA 5EIAA 1NC3A 2JFHA 5EXPA 1L3CA 4CKCB 2BFPA 1TO2E 3NV7A 2WA1A 5EHZA 1JEYB 2H57A 2UYYA 1L7MA 2QXTA 1KSGA 1TQDA 3UCFA 1FFAA 4HX2A 1JTFA 3UK6A 5JAUA 5JJ5A 1JMYA 5D5HA 3C2QA 3NOVA 3W6UA 1ZLYA 1X92A 5K8IA 4HUQA 4QUAA 2HUNA 1N6HA 1FC0A 3D8RA 3IEPA 1EFTA 2G07A 4EDHA 3FBGA 1KJNA 2HC9A 1QP4A 4J0QA 3OCWA 1C9NA 5FOVA 4EPYA 4F4JA 1IG0A 2C7RA 1QH8B 2FW1A 4RS3A 1GNSA 1WY7A 3FMGA 5J43A 4A0GA 1USIA 4S04A 3JQGA 3Q10A 1V6AA 5HE9A 3NBKA 4JBXA 421PA 1V5IA 1XZHA 3H99A 3G23A 3GFPA 2Q5OA 3EW9A 4HTFA 5CH8A 2EBUA 5G4LA 1PZGA 2AMFA 4F71A 4F86A 4LSGA 5KQLA 2JVIA 1TM2A 2PS0A 1LTKA 2WF8A 3L41A 5GADl 4IQ8A 4PG7A 4UVHA 4G0UA 3TS1A 1KE2A 1SQFA 1SOUA 1XHLA 1WA5A 4KPUB 1GZ7A 4K6OA 3A0UA 3VDNB 5BSTA 1VIAA 2EZ9A 4F6CA 4ESHA 3UB3A 1YB1A 4ZJUA 3A1CA 2N46A 1M74A 2C94A 2Q9CA 3TL6A 1J8FA 4AIRA 2QI9C 4CM7A 5IMSA 3HDHA 3Q40A 1P6QA 5KJ6A 1JMVA 2VF7A 3EJ6A 2TS1A 1RS0A 4DZRA 1TK2A 4NEGA 3KLOA 3IV7A 5I48A 1ZG3A 2PT9A 3ZGXA 2QBYB 2QNRA 3KJHA 4M8IA 4IG4A 4ALJA 1W47A 5FTNA 2VPPA 2PR7A 4Y1EA 3GMIA 3RV4A 1DELA 2FRXA 2NTJA 2XUJA 4M0KA 4B74A 3E0QA 2A1IA 2AJDA 2EJCA 3RRYA 4LQDA 2HRRA 3H1AA 1QQAA 3B82A 4QOGA 4BMDA 3EVTA 2EXXA 4HN2A 4WCFB 2XQKA 3WLHA 4BP3A 3LYLA 5KNCH 3LPNA 4D6YA 3ZJTA 3ZCQA 2AUNA 1QJ4A 2ZPAA 3HWSA 3LTNC 4WLVA 3GT7A 3LAWA 1BMFA 4F56A 1E92A 1WDTA 2CKDA 3DE5X 3LQ2A 4REOA 1WU7A 8OHMA 4EKGA 1JH8A 3GNTA 3UTDA 2IX3A 4YDHB 3GLIB 3BE5A 5LDGA 1LEHA 4CEJB 1UOQA 5JD4A 2A8YA 5BVHA 3JATA 3ROGA 1JLKA 2BBTA 1TQ6A 1DIGA 3T7SA 5J3JA 3CA8A 3VPDA 4C7JA 2J5KA 2QUHA 3HCWA 4O4HF 2F17A 4PAOA 1P17A 3R5JA 3SLRA 3ZKWA 2GEVA 3PQ6A 5E1DA 1HFKA 5CX4A 4MUGA 2CNWA 1XVIA 3GGCA 3VR1A 4C88A 4OJQA 1PZFA 1Z4OA 2KB0A 4OPMA 4BN4A 5JAZA 3P0RA 3GEMA 3KKPA 2FWRA 3P71T 1WU8A 1V11A 3DBVO 4R6WA 3SJUA 1CR0A 1IZ0A 3UVEA 2O2EA 2YXLA 2BR5A 4GYWA 3EFHA 3O4JA 5EYPA 2PUDA 1VP3A 2Q4RA 4GNRA 3G59A 3DFFA 1UXKA 1WF3A 3R44A 4ND7A 2QGFA 3C6ZA 2AKAB 5FO0A 1VPEA 4L9AA 2OSBA 5KQSA 2KYRA 1H0RA 4JJ7A 1PAUA 2YUIA 1GGKA 1CHNA 4FEGA 4GSYA 4LISA 4DW8A 2C4WA 2RKBA 3NW9A 2QNBA 4MQUA 3SC2A 4EVQA 1T1RA 1B43A 2YX1A 4ZZIA 4Y6RA 1IIRA 2VDQB 3BL5A 3G9QA 2DLDA 4QG7A 1J9GA 1V5WA 1YMQA 1F12A 2QM3A 3GFQA 1DIOB 1CRWG 3I8SA 5TT0A 3ZX5A 4F4CA 4B3SB 1FUYB 1Q7EA 1EVLA 1JPNA 1PWZA 3L7DA 2XKAA 2WU1A 3L0YA 3C48A 3ENNA 2VIIA 3PXCX 5G0WA 1YA6A 3WYDA 4EGFA 2J07A 4LTMA 4I1PA 1HYHA 1KAOA 3O1HB 3EIEA 3EB9A 5I9SA 4V0KA 3C70A 5KTPA 1KWKA 5DWDA 3OZTA 2YMLA 3GJ8A 4YQEA 3A4LA 1KI2A 2WT4A 4N3BA 1DBWA 2DJIA 2VWHA 4KLCA 5TJHA 1UWVA 3KR0A 1RLJA 1NJ2A 3ZIDA 2QORA 3F46A 3O4FA 3OLYA 4I6JA 3LQYA 3PI7A 1K86A 4WASA 1D07A 2ZBFA 3EZ6A 4BY9E 1C1DB 2Q3MA 1GCUA 2CHFA 2H1SA 1ZGHA 3D4LA 3ZHYA 5B2ZA 4DWOA 4NZPA 3L6CA 1ORIA 4G8DA 2XE4A 1M83A 1FL9A 2IDJA 3HZZA 4P54A 5JMTA 4AQDA 3W3AA 1ISHA 2ENWA 3T7AA 3THSA 1HDYA 4XM1A 2FG5A 6PFKA 4QQFA 5G2OA 1K0UA 3HPRA 4NE7A 4XVRA 1I1HA 3MK31 3LPDA 4EGCB 2AG5A 3JQGB 1XRJA 3OX3A 1JQJC 5IUKC 1GQQA 5DK4A 2GFHA 3ENZA 4GX0A 1GV0A 3ESCA 4G1VA 4JUIA 4YUAA 4MCAA 4HTFB 3JZAA 2BI8A 3FRIA 1E1DA 4DCJA 4DPKA 4OKSA 3RUCA 4QJ5A 4BNUA 1AQLA 2I99A 4R7ZA 3AJAA 3A58B 2B7LA 4LDNA 3Q85A 5TMBA 4H31A 3L06A 1LSOA 2B1IA 5AUQA 1BN6A 1II8A 5IN4A 4CRWB 1U7XA 1Y1TA 2H9AA 2NV2B 2IHNA 3CWQA 2HK8A 5JATA 3TLCA 4DBVO 4DC0A 1HG1A 2GBCA 4HRYA 2XV1A 2BZSA 2B8NA 1DCTA 1EM8A 2IUSA 1ZNWA 3FBWA 3W2IA 1AIPA 3E8SA 1J0AA 1XTUA 4WK2B 4QVGA 1YB2A 4GHWA 1QHFA 3T1NA 1E96A 3FY4A 3W5UA 3H05A 1YHNA 3NHKA 3C5WP 1JI3A 3D6AA 3CCBA 1I32A 1NFRA 3Q7EA 5CFQA 3MMXA 3VX4A 1P7YA 1Z0UA 3OPMA 4C0BA 5IFKA 4KNWA 1CZOA 3IHKA 3NB0A 3EUAA 3KYDA 1Z5VA 4UZSA 2B20A 5TPWB 3SF8B 4B6QA 2JLZA 1YONA 3ORSA 3C6QA 3OP1A 3U9LA 2Z4SA 2Y66A 3VUEA 2XYVA 1UJBA 2PH3A 4JT9A 3R0VA 4D99A 2I9KA 2I80A 1N2HA 1U7UA 5JLJA 1FE8A 4KLRA 4M21A 1XJCA 3DW1X 4KN8A 4OATA 3VGJA 2DHRA 1GG5A 4KWCA 4Q5IA 3RTGA 4CUJA 3TQSA 1GTG1 3ZWOA 5BWCA 1DBVO 2V7QA 3AY3A 4N0DA 1EKXA 1ECJA 3TAUA 5J23A 3OMLA 4LF4B 1QS0A 4GDFA 3F5MA 3WWYA 4BLQA 5EIBD 4PVDA 1FFEA 4WGGA 2XMGA 2GM3A 3D6MA 5I8ZA 4GT1A 1NVTA 3T9EA 2RK4A 2QN7A 1QHHB 5ESDA 1QH1A 1V11B 2JBHA 3IQEA 3ASYA 4KN6A 1WUYA 1OXBB 4QBIA 3A70A 3WBFA 4FZJA 5EIEA 1Q0TA 2PX6A 3FYHA 2YJNA 1YOVA 2Y0CA 3JYOA 4EITA 4LC9A 1I14A 1KZ1A 1E1NA 3CE6A 1AUVA 5EIHA 4O4IB 1INLA 2IV7A 3RO7A 5AI0A 2A4KA 2XGSA 3PYLA 2Z2ZA 4N48A 5L3VA 1SVIA 1UC5B 3TTUA 3SC2B 2WABA 1QPZA 2C5HA 1MGPA 4I9NA 3E27A 3OMXA 2NO7A 2MMCA 4K87A 4NOJA 5BQOA 4EF6A 3I6QA 2J3DA 1GDDA 4N3NA 3ET4A 1HGXA 1NKVA 4YRTA 2WG0A 1NQOA 2I1VB 4EL5A 1BGVA 2MSCB 2O9JA 4ZTBA 1ZUNA 3EEQA 5H02A 3U62A 1ZD8A 5JQWA 1SBZA 3H84A 4GFDA 3AHHA 3JS5A 5HCIA 1SVKA 4ZEXA 4NBLA 4JU9A 2W4QA 1WXIA 1Z8DA 2ZI4A 4FJ2A 1YKSA 1JT9A 4MYTA 4PYRA 1T43A 2CXXA 3ZS9A 4POOA 3LGAA 2FK8A 4FYWA 1ULTA 2DPGA 4ZXPA 2JCBA 1MC4A 4TKMA 4L6IA 1TJ4A 3C3EA 3NFRA 3KWFA 2AXPA 1QZUA 4BO7A 1IZYA 1CUDA 3AUKA 2AS0A 3NWJA 5B1YA 3G1UA 2R7LA 1J33A 3KWMA 4JSRA 3BHMA 1IJEA 3IALA 1U02A 4NCKA 2ESRA 4OYRA 1A71A 4PRKA 3U7RA 1IHPA 5ALQA 1P81A 2HA7A 2NSLA 3JQAD 5AI6A 5ALGA 3FPGA 1G7TA 2OK7A 1SRRA 3RM3A 3EXAA 2QMOA 3ZY3A 3WLOA 2NU7A 4NTZA 4NZNA 4RHTA 1M0TA 4UBMA 3PP8A 4N1AA 1SD5A 3B3AA 1JDUA 2V9ZA 2VZ9A 3PWZA 4IQGA 1OB5A 4ATNA 2Z2IA 5EGNA 4DV2B 1Q84A 3QLTA 1X42A 4OQQA 3ADBA 3IAAA 3EIHA 2WR8A 5EP4A 2GXUA 1FTNA 2AE2A 3UF0A 1IZ8A 2AJTA 1F51E 3FOAA 5F1OA 4AF6A 1Q3KA 1YRLA 3E58A 4JKOA 1C9MA 2XCOA 1GP2A 3VU8A 1ACLA 2UUPA 1ADYA 2C2BA 2H2GA 4LXHA 3QUBA 4BVAA 2AFVA 3N2KA 2L42A 3V1TC 3R5XA 3OICA 3QF7A 3B1ZA 4IVNA 4YPFA 3HB5X 3TQQA 1JJ7A 1T1SA 1XTVA 1XYYA 4KO2S 1DG3A 2VDKB 5E9WA 5D7NA 1Y1RA 2CKMA 2Y6VA 3KPVA 4M9RA 3ZH2A 3LC2O 2OGZA 2IVFA 4FWIB 5HUHA 2YN2A 4RK1A 1G291 1NFFA 3ICPA 4KW7A 3IBCA 3HZOA 3UAOA 1NW6A 1H3FA 2QTWB 3EH1A 4OX9B 3LO5A 3Q8MA 1KFBB 4MTCA 3MWDB 4KDCA 1KO1A 5JMOA 2JGRA 5J4KA 5KOJA 4JEMA 4ZQEA 3FOBA 1CUHA 3EVGA 1GXSA 4D8UA 4PXYA 2X40A 4BN5A 1LNSA 4GGPA 4CLXA 4OJKA 4W9RA 2ZBUA 4XDYA 5CMLA 1R4AA 5B7QA 4IDAA 4CFSA 5D85A 1QQBA 3DO8A 2ETXA 3DOIA 3FLMA 1XU4A 2XHZA 5JEDA 2HJ9A 2XAUA 1SKQA 2D1RA 3A9WA 4EPWA 1NVXQ 1RWNA 4YLGA 4BBAA 1D1TA 1NUHA 5EKXA 4A1FA 4JUCA 2B0CA 3QG5A 3S2GA 2FSIA 1NXPA 1ISIA 1FSGA 4JJEA 3L01A 4AROA 2NG1A 2WV7A 4G4IA 5JIBA 2DPMA 3QLVC 4M1EA 5CA0A 5LMNB 1SXJA 2PH5A 3M4JA 3N2LA 3M6FA 1RTTA 2BCEA 4ZVUA 2CMFA 3MINA 3EGWA 1VXRA 3NDPA 4HGOA 4WIAA 2D7CA 2RGNC 1TMYA 2AIRA 1M1NB 4BE4A 4K9MA 5B58C 3L1KA 4NABA 2D0DA 4P33A 5EMKA 4H16A 1XKTA 5GPBA 1YQQA 4LBVA 4PAWA 4HEQA 3IKMB 4S1VA 3VV3A 3DEYX 2C3OA 2ST1A 2P5SA 3CVXA 1UEIA 3L7IA 3A05A 4Q05A 1HQCA 4CIBA 3ETLA 4G8JA 4GGOA 4N12A 1PT8A 1YOVB 1B8OA 4QDZA 5H4HA 1BHSA 3CKMA 5LA6B 1FUUA 4A16A 3ZQ4A 1RHQA 4I14A 1I9CA 3IC5A 1JIQA 2RB4A 4RE5A 3OOSA 5DNUA 1R5OA 5DSZA 4ZC1A 3RIGA 1GY8A 4ARZB 2VP9A 3MAGA 4YJ2A 1ZGGA 1ZCZA 1I2BA 3EXG1 3K0AA 4ETMA 2R7NA 1FU7A 4KLAA 3JR3A 2FOIA 4NK4A 2IGBA 3PDWA 4RJKA 1FP6A 4G0XA 3G17A 3ET5A 4PYKA 1JLSA 4UTRA 1OI7A 1PLKA 3STUA 2XTAA 2V45A 2D3WA 2C4KA 1IVSA 2VYND 3D5QA 5B3AA 3QOFA 3U6KA 1YIAA 2PMBA 3DEHA 2GJ8A 5BWMA 1K7FB 1E9FA 1PWHA 3K4HA 4ZQBA 3ZV7A 2X3UA 1GAJA 2FU5C 1XIVA 3C3WA 3OI7A 3PZRA 1LZKA 3QEAZ 3ZTYA 2HSEA 1ZUNB 4HZUA 4PX9A 5EA2A 3IL2A 3MOIA 1Z2AA 4LV8B 1QE5A 1P19A 1TU0A 1YSCA 1WHTA 1ZUWA 3PNBA 3B9RA 4OIFA 3WWPA 3NWBA 5C5IA 1IEVA 2ZIZA 1UJNA 4ZCQA 4E1BA 2R6DA 1IAQA 1U8EA 2FMHA 2QTCA 3CLSC 5F51A 5E3JA 4BC0A 5BMVF 1G59A 1SPXA 4GEKA 2Z9CA 2FPPB 3E2MA 1NUSA 3DGFC 1B6GA 5FULA 5DHUA 1TQ2A 1ZD3A 2VEDA 5AW1A 3N7TA 2NU6A 4D9KA 2SCUB 4TZKA 5IF3A 2EKDA 3U3OA 4BXOB 2G9VA 2RGCA 1I3LA 4N0MA 1G9TA 1WHSA 2N9UA 1RJDA 4HVLA 3QFSA 3K72B 4HEA6 1KS9A 1WQ3A 4H7IA 4MV6A 5CURA 1CR4A 4AP9A 1CUXA 1JGTA 2Z8YA 1ZW6A 2H0AA 3B9BA 4LECA 4BQNA 2P0EA 1XTQA 1JKIA 1CQIA 2WDPA 5D86A 2FZKA 3GXBA 4IIVA 5A3RA 2GX6A 1Z26A 5AM3A 4PR3A 1N0HA 1XL0A 3JARA 1VPLA 3NAMA 4IIXA 3C1AA 4FLMA 1BWRA 3FMFA 5GZ6A 5EY5B 4GI7A 3ZEIA 1BX1A 2P2CA 2Q5HA 5FBVB 4C78A 4U7DA 3LRXA 2BHSA 3H2KA 4Y2RA 3PFHA 4B0PA 1Z45A 2W2QA 1E6WA 1I0LA 2P1ZA 2JFVA 2P1RA 3KDAA 4D3DA 4V0OA 4IZ6A 3SI7A 1SBTA 3HKCA 3IDOA 4P4TA 4ZZ2A 1R50A 2X0JA 4AULA 4E21A 5JNTA 1JIKA 3OT1B 1EB9A 2RHHA 3PA6A 4JITA 1V95A 1H8EA 5BV7A 3JVDA 4A6EA 4Q1VA 1P5FA 3O1LA 5TQJA 2FSGA 3IAM6 3WQBA 3T3DA 4PRZA 1NIPA 2AZMA 2ZSFA 5I5GA 4ZFNA 2A30A 4ZK2A 4A8HA 2BFBA 4L6CA 2BFNA 4G0PA 5DB4A 3HYRA 3QLVA 5F9MA 3WLQA 4XX0A 3H42B 3NDJA 3CG4A 3LZ6A 3H9BA 2EZUA 1IN5A 2OKCA 4MB6A 3KE8A 3TR0A 4HNTA 2QRLA 3BD9A 3N7UA 3P9PA 4HWRA 2UUBB 1P7ZA 4FONA 2BH2A 1GGNA 1A7KA 3R5KA 4MYDA 3A7DA 1DAHA 3BDAA 2F9MA 2NIPA 3NOQA 5KOYA 3Q7RA 4EG7A 2WJ6A 3ROMA 4BX2A 3S8EA 3TFOA 5CNKA 2HA0A 3VBEA 4TRJA 2ZJ8A 3OQBA 2ZSIA 1KJWA 3W5SA 5JJCA 1YB7A 4M88A 5C4IA 4KK3A 3R9WA 1N6OA 1P2FA 2WIKA 3PD1A 1L4LA 1SBYA 1YBAA 1MFZA 4M9UA 2CHUA 5ALJA 3REOA 4YJGB 4R6XA 1S9DA 2JGDB 2QE7A 4QECA 2K2WA 2WYWA 4H3KB 4XXHA 5EHXA 5LMCA 5INTA 1X39A 5HF9A 1V8ZA 2FUNB 3H6GA 4KO1S 2IUYA 3X44A 1VG9B 2IYUA 3OIDA 2EC5A 2PSHA 2HLDD 4CTMA 3M5PA 2W6JD 1GRRA 5LXTA 1Z0IA 4KN9S 4HWTA 2C3MA 2H9YA 1PS0A 5LFAA 4WMLA 3P9CA 4C43A 3BD7A 4RD4A 2ZYGA 3OP4A 3GAMA 5EUBA 5AW2A 3U16A 2GZ2A 4TXLA 3CNEA 3DMTC 3SU8A 5A2QA 2C7PA 4TT8A 1YJXA 1H2ZA 1IBRA 3CPSA 5FKJA 4MQ4A 1EJ6A 2ATEA 3NUZA 3ESZA 3CMCO 2NLOA 1GCIA 2Q8PA 2FXVA 2VJPA 2RAPA 3L04A 1Q15A 3QFCA 3DONA 5ALPA 1L1FA 2ID4A 4BMXA 1XI2A 1SMKA 1N5MA 2WIGA 2PZGA 4EO7A 4DDUA 3C7AA 2P4QA 3PDIA 4ZQCB 4PLTA 1FBTA 2ZUBA 4HZUB 1LRJA 3HVIA 4ZVMA 3OSZA 3GRUA 1CUCA 4WXMA 3FTEA 4QQ8A 1MNQA 3DEJA 5HIJA 3HYLA 3EY9A 5ICMA 4RV9A 4AZVA 3BZBA 4JQOA 3BRSA 1M6HA 4D9JA 1GDTA 5GZ1A 1Y34E 4RVOA 3QWBA 1T24A 1YZKA 3BWCA 3WZLA 3B2NA 3IT3A 4G56A 1SOVA 3UMBA 4F2WA 1JHPA 2ZRMA 2NU6B 3GLGE 1X1SA 3C5HA 1A2OA 1GR1A 4KAAA 5CLHA 3DCIA 4PRLA 3FMVA 3GHHA 4JVOA 4YRPA 2JIZD 4KZKA 2MSLA 2ZB4A 3UK2A 2IIBA 2O1EA 3QBDA 5I47A 3S5UA 1PNQA 1IIBA 1TLTA 2ODTX 2UZ1A 4NMWA 4LGYA 3TOZA 3UENA 3O8CA 4K3UA 3N8HA 3QWAA 2ZTVA 5F7OA 4K6MA 2BZGA 2ZZMA 3LFHA 4EHJA 3C85A 2FE1A 2JJ2A 4XSHA 5NLLA 4QC2A 2AI1A 1BS9A 2RGDA 3C74A 3QPCA 3JARB 3JYPA 2PRZA 4GZLA 4ANFA 4D9NA 2O8BB 3A4IA 4KC0A 3A1NA 5BOSA 3ND8A 5HP4A 2W7TA 1UR5A 1FTSA 1YVEI 1MJNA 3E2IA 4AX8A 1SCDA 1YDFA 2QT1A 4BJHB 1A2BA 3MCVA 4QYWA 5HQ3A 2C58A 1TVCA 2AD1A 5AICA 4F6RB 2RCNA 5L3SA 2XMDA 5E2AA 3STTA 4RMGA 1PQYA 5LYJF 2KPOA 2QV7A 2XIQA 1JR3E 3HKCB 2VR1A 3FTPA 4K6GA 4Q12A 1W5TA 1I33A 1PWXA 3KB2A 3O8OB 3S40A 1K2VN 3U1VA 5IJXA 3G9UA 1FW6A 4KRFA 4QOHA 3F7TA 4J49A 4FE7A 1DX6A 1KXJA 2DWQA 3O2QB 1F7VA 3OECA 4XTCS 4JWTA 4MVJA 5EJ5A 3EIQA 3VRHA 1J20A 2Q5JA 4CKBB 5KNDA 1EXNA 4UNPA 3O7MA 3MNFA 3HC7A 3TZBA 1HI9A 3F1LA 1KYQA 3LHFA 3IOEA 4CM3A 1MJHA 3SYKA 4ZCPA 1ZJ5A 2BFBB 3FYDA 1ZD4A 2DPXA 4PU0A 5CIYA 4NYJR 5LD2C 1XZFA 4YECA 2WB2A 1LUAA 3ZCTA 3KAKA 3NBUA 3U4DA 3ICOA 4R2XA 4LHWA 1KRWA 1O5TA 5CM8B 3K0HA 1M2GA 2WJVA 2VSNA 1NRWA 3P0JA 4OQDA 4WA7A 5GONF 2OOKA 3QTLA 5L6LB 2FQ1A 1DMRA 5ADWA 5ITSA 1Y1SA 3PFWO 3ROEA 2O19A 3NQ41 3R7DA 1KU6A 1HDOA 4YNBA 5M2QA 5AOAA 3RI3A 1GV1A 5IJ0B 2OBXA 3BCUA 4WXRA 2V3CC 2ADOA 2Q62A 1TW2A 4Z0TA 4I46A 4MWEA 3UEOA 3Q88A 4LI0A 1XD8A 3WYBA 2P68A 4WINA 3UJ8A 4JC4A 1ATZA 2M1ZA 1KI3A 3FPHA 1OE0A 5JJIA 4XARA 2BDEA 4BTLA 3PSAA 3PQCA 1SKMA 3ILHA 4OQ4A 3RG2A 3DTVD 5HIKA 1T6BY 3I9V6 1DIRA 3L5KA 2WYOA 5BQPA 2GD2A 1EGMB 4DR7B 4C07A 2PS9A 1CDOA 3A36A 4FT2A 3QKRB 2IYEA 3TKLA 2C9ZA 1CQXA 2YJZA 1CUAA 3PKIA 1YK1A 3UGKA 3V7WA 1V4NA 2QLLA 1OX4A 1ZN9A 3DUWA 1W29A 3GCWA 1Z8HA 2H2HA 2LRHA 2H4ZA 5THKA 2OAGA 2BTOA 3MYYA 1N2CA 4L5YA 4PS1A 1OVGA 4ERXA 1FFYA 3ONDA 4X8HA 2A1TS 3OCYA 4YCJA 5LQSA 1FRFS 1NP6A 3FKSD 2Z6QA 4FLEA 3SXJA 1A96A 3HI6A 1I4TD 1KI4A 2IHYA 3KWJA 2QZJA 4H6XA 2WHQA 4X7BA 3VZRA 1EUZA 2Z9BA 5P21A 2WF6A 5BN3B 2IV2X 2XGGA 2BP7B 4PW0A 3DDCA 2WWGA 4ZT3A 4A6PA 4HZGA 5C8YF 1UWKA 3KTFA 1IG3A 3ZUGA 1QIIA 2YWEA 1J8QA 2CVQA 4FPXA 1EWVA 3PDIB 2J45A 3MCTA 3R6WA 1ZRNA 2R6JA 1XGKA 3PA8A 4GMGA 3FMIA 3RS0A 3TNJA 4DMKA 4WY5A 2A7QA 1B0ZA 4LV5B 2V55B 3A1VA 1W73A 1DEXA 3OD1A 3GLRA 3MA0A 2VLIA 3IKVA 1TE2A 1QHYA 3BMXA 3G5UA 1QYIA 1YJCA 3NNNA 4NFLA 4BE9A 2CV2A 4QHSA 4JCCA 1W34A 2GAJA 2V7UA 2WSBA 3R20A 3T5AA 1J24A 3GQBB 4RZ2A 5ALNA 4NNJA 1HE1C 4DN6A 2FDCA 1Y5NA 2Q27A 4Y9RA 4PCVA 5FTJA 3SS9X 1QQ7A 3C1OA 3ABOB 3L8HA 3A27A 3GLHE 4LMBA 1JSXA 2YZMA 2IT1A 3K4QA 4FGSA 1CB0A 1NR7A 3BGVA 2MWMA 1SA0B 5FNVF 4OQZA 5IBPA 4CDRA 3QEBZ 2P5YA 3HDTA 4OL9A 3WP1B 1Y3FE 3P45A 2PXAA 1IBKB 5AXBA 2IFTA 4R1SA 4L5CA 4MGHA 1K6JA 4U02A 5HFNA 3IP3A 4JSTA 4MMXB 3TZEA 2GPSA 1VJDA 1W52X 3ID6C 4P93A 3DTYA 4GP9A 3X1XA 4CN9A 4DTCA 1PFUA 2F8SA 3EGXA 3PPXA 4FXOA 4DIUA 5M29A 1GT91 1TZBA 5BOSB 1Z82A 2D5IA 4D3XA 4LDJA 1JIVA 2QUJA 3HBFA 3QITA 3ZGVA 5GWXA 1UMKA 1K1EA 1DKQA 5HQ3B 3IMCA 3OCXA 1JP7A 5ELMA 1IEXA 4L85A 3MB8A 3KWLA 1AHHA 2BKEA 4B4WA 1KFKB 5K45A 2IOHA 3T7IA 3I5UA 1AMOA 5IVHA 1LPNA 3E9EA 2JGJA 3DPUA 4S0ZA 2BMVA 1B3BA 1RRFA 2FPSA 2X1MA 4Q3CA 4D3YA 1UEJA 3R8FA 4AY2A 2KS6A 2WTEA 4TWJA 2QXYA 1ENYA 2QQ0A 1YQXA 3KV3O 4WFJA 5JPIA 1YMUA 3ZHOA 5CVDA 2QM7A 4AKTA 3QKSB 2VK1A 3IP6A 4WOKA 1KYTA 2J3JA 2K7FA 2WAAA 2QZ9A 3BYZA 4PZEA 2E4VA 1S4MA 2HWKA 2YIJA 3GCGA 4MIYA 3E8MA 4QGSA 4R8KA 5ALXA 2IH5A 1BTOA 4MKGA 4OHZA 1Q22A 1T2AA 6NULA 3E9ZA 1NIJA 2XPCA 5CD9A 3NCTA 2Z0MA 2AFRA 1B1AA 2REXB 3GT4A 5EQTA 1NVBA 5FEMA 3DM9B 1JE0A 2APJA 2C5BA 3AZOA 2DBZA 4ZQIA 1WETA 1N9KA 1XZ8A 4NC9A 2JK1A 4NZMA 1JWBB 4I66A 3KLMX 4Z4GA 1DBQA 1IE3A 4S35A 1KTIA 2G17A 1LPSA 2QQEA 5JXJA 2XRYA 4V0NA 2A5FA 1X2EA 5WRFA 1CS4C 4YAUA 3HO1A 5ER6A 2X6QA 3Q3EA 4RJTA 2G3YA 3EMKA 4Z6KA 2GJ9A 5HWSA 4BQRA 4Q9AA 3HCNA 3I72A 2WOJA 1XMOB 3OESA 3RUAA 4B9AA 4L76A 1LSUA 2ZDQA 1R2QA 1B4DA 2LCIA 3N87A 4N6GA 1NA5A 1UBRS 2FQXA 4PE5B 1WSWA 4H2DA 1D6SA 1N75A 2VJMA 3V2HA 1V1RA 4KVGA 4RJIA 3TZHA 3VV2A 5KOHB 1FX0B 2AEFA 2SICE 1M5UA 4MITA 1Z4KA 3BXFA 2R8RA 2EBFX 3HKDA 1YFKA 4O2BA 2QG6A 2VI5A 3ITDA 4W5OA 1RQNA 4D0GA 3G5LA 4HAOA 2R5WA 4N5NA 3AIOA 2IC5A 2ZYVX 1NW4A 2OCXA 1H4VB 3E5MA 1E79D 1AKRA 2FN4A 2GJSA 2DEUA 4OU4A 4TVOA 5K3FA 3TXAA 3GRRA 3MZ0A 3VDMA 3CWCA 2YBDA 4P7BA 4Y2GA 4FOTA 1QG0A 3C3PA 4NJMA 4BTVA 1XCPA 3LHKA 4PINA 4IQ4A 1N78A 1C8BA 4KQ1A 1XEXA 2NO6A 4J4BA 3RJZA 3G1WA 4WJZA 4AKSA 2JD1A 4UNRA 3KSRA 4NV0A 5AVYA 1TW3A 2E7ZA 4FBGA 3MJSA 5CLJA 2NSHA 2ZEJA 3SE7A 5HM8A 2HA5A 3QE9Y 5J4YA 2GWRA 4AAYA 1G5PA 3MFYA 5CXQA 1KEEA 4RF3A 2IPNA 5EZQA 3TFQA 3RJ9A 1CG6A 3ZIAA 5AVOA 3CR7A 1WB9A 3QRWA 4I9FA 1AU9A 2GEUA 2B21A 3K1TA 1G0OA 3GLGB 4AKIA 4D7AA 5CBPA 4FOPA 3TSZA 2WAYA 1OLXA 2Y4OA 3MCZA 2R11A 4LVNA 2OG1A 1C9YA 2H31A 3NTXA 5BW6B 3HCDA 1RWWA 1Z06A 2AK2A 2JKVA 3GRCA 2IZZA 1CU1A 1R6DA 1KMIY 2MOKA 2ZRIA 2H0RA 1ETHA 3EUFA 3HV2A 4IX9A 4OI4A 4EZIA 5KTOA 1DX4A 2Z08A 2VK8A 3WFJA 2JW5A 3U3DA 3GJ6A 4GC9A 3I53A 1IMOA 3LQRA 1BA3A 5KKAA 1NU8A 5K5EA 4O1MA 5JZSA 1L9KA 1QP8A 4EUFA 1G8KA 1B0UA 3HFJA 4ZGGA 4D4MA 3ZC3A 1YS1X 4EJFA 1JJFA 1X9HA 1IY9A 3K0BA 3MSCA 1HZZC 4GMFA 2YHBA 3SHFA 5KYXB 2P7HA 3AOGA 2FN8A 3JRNA 4CKYA 4CLEA 4NXNB 2IBSA 4I1IA 1SVLA 4REQB 2EX4A 4B1FA 3AUUA 2I1WA 1Y3IA 1G9SA 1GFZA 3K2IA 1THGA 5JDIA 1UK9A 4H7HA 4XR9A 4QDUA 4JC8A 1EG7A 1JLLB 1PUIA 1WPRA 2EARA 1P4AA 3A9RA 3IP5A 3QTBA 5F52A 4E2ZA 3B8HA 4DLLA 3Q1KA 2GJKA 1UQTA 1YCFA 2FN7A 2QX4A 4XIIA 5HE8A 3QUAA 2DPHA 3BEOA 5LD2B 4ZVVA 4FGLA 1XHEA 4FD3A 1XMJA 3REFA 3ZJUA 1OTXA 4HL6A 3EDRA 1Y3AA 2N47A 1Q21A 2P4HX 4OXXA 3HJHA 5DNCA 1FPMA 4ECEA 4F9FA 1ISRA 5D87A 4BEJA 4HCJA 4KRXA 5IC5A 1UP4A 4AUKA 1LQUA 1V48A 1JIUA 2C4NA 3CINA 3CV3A 4TUYA 5CFZA 3R3XA 4NMMA 2IIPA 2EX1A 4RU1A 4UPEA 4R1TA 4YACA 1U8YA 2FFAA 1G6KA 3AEQB 3NTUA 3I6YA 1E3EA 1NDHA 3W6NA 1TCVA 3R9KA 1WZ2A 4GXNA 3MTEA 1GTMA 4MW2A 3WGUA 3U4HA 2BL4A 4QSHA 1T0BA 4MLDA 1YS6A 4JLOA 4UEQA 1KC1A 3IKJA 4EYSA 3QEJA 1QIMA 2XWBF 3UC5A 3I62A 4TS9A 1IM2A 1HV8A 2KLHA 4MZDA 2G04A 2CLOB 2XVAA 3MIZA 1W76A 4P35A 3G0HA 1H2RS 5LOVA 1L8XA 1NRIA 3CZ9A 4EX6A 4F4UA 4RTOA 3NHLA 5IJAA 1VL1A 2X9VA 1CUSA 4HS9A 4LVOA 4ARUA 5J4LA 5LIPA 4KR7A 2BKVA 2DKNA 4TWBA 4RETA 1D6MA 3C0KA 3MXOA 1VYVA 1I1OA 4BVLA 3NHYA 1QK5A 1GA6A 3BH6A 3PK0A 5K2OA 2HPAA 3ZHZA 1YU9A 2ZJ2A 3HHEA 3LBHA 2QW1A 1L8AA 4O2BB 2PGAA 4ZCTA 5C5CA 4UU8A 3OUZA 1UPCA 1FP1D 2XNHA 1I1NA 1S02A 2W0SA 3NHBA 2V59A 3TMAA 3EPKA 3H1TA 4FFVA 3QI2A 4D9GA 1J99A 4TSFA 3QU5A 1NN0A 1CZNA 2PV0A 3PG5A 4G4GA 4H4EA 1OWLA 5K3FB 3ZDQA 4W5RA 3PX3A 2ZSAA 1MLDA 3Q72A 2QUZA 2CV0A 2Q4EA 3TIFA 2HGSA 4G4SO 3F47A 4D9FA 3A9TA 2O6LA 1U8CB 4OLAA 1UK6A 4C14A 1XEXB 5CTAA 1TEXA 2I03A 2XJ9A 4RQTA 5DHSA 1G20A 3FTCA 3FZYA 1WUHS 3WOHA 1U7ZA 4YT8A 2W8BA 2V96A 3CNLA 4AK9A 3OJXA 3PHIA 2BBOA 1SHKA 4QGBA 4BGUA 1E0JA 1XVAA 1GSAA 3L0IB 1HDGO 2JD0A 2SHKA 4H7FA 4EB3A 3U44A 2NXEA 2WKQA 3FRHA 5A05A 1L5ZA 3KOYA 1FX1A 3N8KA 3GB9A 3UANA 3LYHA 1KVRA 3GLFE 3NHZA 3THWA 2O57A 1W1UA 4M54A 1MFPA 1V71A 3GWZA 3QF4A 3TZLA 2DXIA 4LF8B 1RQ7A 1V8PA 3T61A 1F5NA 1BH2A 3SFZA 3BA1A 1WEKA 2KX7A 2NN3C 5EUQB 3GLHB 3GGGA 1J2YA 1ESDA 2F1IA 4ZD6A 1DU4A 1EGQA 3UK1A 3ZE9A 1QVRA 1T10A 1ZVMA 5DTQA 3EOAI 3WO1A 2XSZA 1Z07A 1ONSA 5DHRA 2OL4A 5IJ9A 2CFIA 3FROA 3QVLA 4J7XA 4RESA 3CMMA 5ERYA 1EGAA 3SOZA 1MTZA 2IPXA 3BWMA 4K9OA 5LZ5A 3H2JA 1DAFA 4ND1A 2IS1A 4Q4AA 1QZ3A 4PVCA 2B5VA 2R65A 3P0FA 1I4EB 1UFRA 3LDHA 2JGMA 3OEHD 5LLDA 4LWZA 2AQKA 3ZD6A 3BMNA 1RI4A 1B15A 1UFKA 3CLKA 3RPEA 5HRUA 1HFJA 5ADVA 1E4EA 8ABPA 1SBIA 1EGVB 2OCLA 4QUBA 1TGYA 4YVFA 3WRVA 4ZV4A 1X3SA 3SX2A 1K8XB 2OBFA 4DXAA 2RONA 5AJTA 1CD5A 3V7FA 2C2HA 1O9HA 1J8VA 2QD3A 3B1FA 3ZYZA 1OFHA 2LKCA 3IP7A 2E55A 1NNSA 3GELA 4UUOA 4UTNA 4RADA 5I9IA 4EHAA 3TPZA 2R8OA 4RVUA 3M83A 4LFAB 1RZRA 3D59A 3OM1A 4II7A 2CVZA 1XMPA 3PR3A 2OORC 4RH3A 2ZAIA 4YO7A 2QGZA 2ADFA 1L4NA 2XH8A 1XZAA 4R1PA 2M98A 3CQ9A 2QRGA 4M6WB 5CJJA 5ALDA 2EW2A 3PYMA 4XZ3A 2JD2A 2C29D 5AVSA 4DDWA 2Y1WA 4JS0A 3PR2B 3EPLA 5EEHA 1UFVA 3OCZA 1E99A 1M1ZA 1AV6A 4U6SA 4I9GA 1ENOA 3QWHA 4DWWA 2E4XA 3D64A 1KYIA 3MCWA 4HWKA 4BLOA 5C7OO 4WLFA 2UYQA 1UZLA 7YASA 4FCVA 5IBCA 3AB3A 3LIIA 1EDZA 2QI9F 4FYVA 4IWXA 1VI6A 4TM7A 1Q1ZA 3T12A 3T5TA 3K6JA 1JNXX 1K7XB 2VLBA 2Q28A 3I9JA 4M9XA 4ZK6A 1J23A 2VDWA 4RJ2A 3OZVA 2EF0A 5KHLB 3OF3A 3CZQA 5SYNA 4OB6A 3AIIA 1C2TA 3QLEA 4BJ3A 1Q74A 4DHEA 1JE1A 1PFWA 4BB9A 4NBRA 4G23A 1DQNA 2BPOA 2JBAB 4ZCSA 3HJAA 3SXUA 1RYMA 2NUPB 4TWAA 2PSJA 1OYVA 3OWXA 4I55A 5FFNA 4N41A 1WWKA 4CF7A 2H4YA 3GRZA 1E5DA 3DHNA 5IM4A 2HOQA 1BEEA 1XTRA 5FUWA 3RFVA 4HQFA 4KKVA 3RVBA 1L5YA 3CCFA 1P31A 2XQGA 1F17A 4K9QA 1XNQB 4GMDA 3SIPA 1KZGB 1IOZA 1RWPA 3KOMA 4FCTA 1Z2PX 5EJ4A 5HUJA 1P1RA 3A1WA 3I5YA 3CVYA 4L8YA 3UMGA 2PKWA 1YQWA 2D2IA 5KNBH 3K70D 1PG2A 4OQXA 4QELA 4UDOA 1RLIA 3R3JA 4PZPA 3RIXA 2VSOA 5KAPA 2YL2A 1DIHA 4JJFA 2N0SA 1XF9A 2NUBA 3QG1A 1Q14A 3T3PB 4ND8A 4MSUA 3AFMA 4RK7A 2CEKA 1V45E 1CS0A 2O7QA 1ZR4A 4RIGA 3VHXB 3SWWA 2IY8A 4PLHA 4I9HA 4MJXA 3I0NA 3OZWA 5EJ2A 3X2EA 3G5TA 5J2UA 1G20B 3CTMA 4YHHB 2PWPA 3HSYA 2ZBPA 2O0KA 3SBEA 3LBNA 4BUJA 2V7WA 1AXGA 1K88A 3CBQA 3U44B 4LK2A 1U0TA 1A50B 5EJEA 1HFWA 2Q29A 4E31A 1FFDA 4KP7A 2XCSB 3DKIA 2OM2A 5JAQA 4AYWA 1D4AA 1BEUB 1M2EA 1PZXA 2A7XA 2FQYA 2JGFA 3LD9A 3O8LA 4JP8A 4RTKA 3RADC 4DYVA 4U7JA 1QR2A 1R4MA 4YXWA 3KHKA 2PWZA 4CNBA 4CVNA 1E3LA 1G42A 1V5FA 2IOFK 2XEXA 3EA0A 4GR9A 2PZLA 5FR2A 5LA6F 5HKKD 4TV8B 1G8YA 2ZU0C 3PNLA 5BORA 4IDOA 1B2RA 4Z0PA 1YQ9A 2Q3HA 4U3JB 4A10A 5A4IS 4EAQA 2EZ8A 4PLWA 2F1RA 1X7ZA 5T41A 4LHXA 4RK6A 2P0YA 3G6WA 1DC4A 2HQ1A 4Q19A 4UVEA 3V4ZA 3THXB 1SOWA 5CGZA 2PUCA 2DR0A 5G40A 2WSSA 4CCWA 1XPUA 5ICGA 4R1NA 3EHEA 2IHJA 4PZ9A 2OORA 1GAEO 2V7TA 2VAWA 3DD5A 3CRQA 3IB6A 1JEOA 4TLEA 1IHYA 4YO8A 3JWHA 1L5HA 3BMNB 3UQZA 4EX7A 2OP0A 4HRVA 3ZZNA 3G88A 1HTTA 3ROQA 5C1BA 1YH3A 4Y0NA 4MR9A 3LUHA 4HPXB 3U31A 3EDMA 3IDZA 4D41A 1TDJA 2CDCA 2IJGX 4E46A 2PS3A 4CJXA 3HCCA 3U19A 1RYZA 5D01A 3ZD9A 4J0HA 3IHLA 2OOSA 1E1KA 821PA 3SQNA 4JJ6A 3HR4A 3O94A 5JYDA 5GOZA 2PWYA 5JW6A 5CR9A 4M36A 2W9XA 1NWCA 3COPA 3T5GA 5A4DA 2EKLA 1H8HA 4DL9A 4GKAA 3TUIC 4BRZA 3AGQA 4EY8A 2YHSA 4URVR 2XYRA 3EXHC 1XK7A 4Z54A 2WJJA 3Q0EA 2JIBA 4HP8A 3TKAA 4LOIA 3IILA 3U2QA 4B43A 1J0DA 1Q11A 2RARA 3DDZX 3VR6A 4EARA 4MA0A 3F3MA 5CDFE 1CQJB 3Q4GA 4UQOA 2V6BA 3Q7SA 1L7RA 4RPJA 4EYOA 2F9FA 4MQ5A 2ZSJA 1QOPB 2GILA 2I2XB 4OGLA 3G0IA 2EDCA 2ZS9A 1N5IA 3T3NA 1CLUA 2Z3WA 1G8HA 2OCYC 4F5EA 3S8YA 4IOJA 2PMDA 1HDIA 3RRZA 4IOKA 2HQRA 3TYXA 3WDSA 2O8EA 1A5BB 3DQQA 1KMNA 3MN1A 5LVAA 4FGJA 4MRRA 4Q93A 1UZAA 1YZLA 5KNCD 1SQGA 3F6RA 3O8NA 4UM9D 2PJZA 1B74A 2XRFA 1V9CA 1G8GA 4YAGA 1N5DA 3K1AA 3M2TA 3MJDA 2WB4A 3ILYA 2BKUA 3N2GA 4KMRA 1LW6E 3SXUB 4QFCA 1E1LA 1XSEA 3PQDA 3EYAA 3SVZA 3QTTA 3ELYA 3SS8A 1OFUX 4QTUB 4F12A 2GCOA 2FOLA 2BI7A 2IHUA 3H86A 1SQ6A 3MOGA 1EDEA 3OU6A 2WFAA 3QVGB 5KINB 1GR0A 3O8DA 1RYDA 4QPZA 3WLEA 4UEWA 3RC7A 1M6YA 2Q5EA 4CQJA 2XVYA 3AESB 4HAYA 4NV1A 2Y2UA 1LBEA 4BQEA 4XTRA 5ANRB 1JXMA 2ZJZA 1OC2A 3EIWA 4AC9A 3TM4A 4UD2A 2GLXA 1RMYA 4I1RA 2IODA 1AURA 2A9RA 3EAFA 5DI3A 5L7YA 3S2EA 3O2NA 3S68A 1DLIA 2ZREA 3T7JA 4C9BA 4ZDKA 4E3WA 4RTRA 3VO2A 2QLNA 3WMWA 3NHRA 1LTQA 3OOHA 4WUTA 3B89A 3R0IA 4EKDA 1WVGA 1TFRA 4DLPA 2CWWA 2X4GA 1XTBA 3GFBA 4H9GA 4J9VA 3USES 2JFBA 2PO5A 2ZJYA 4LJ8A 3UV7A 1EGHA 3RVMA 3A6LA 2HRBA 5IS2A 1BWQA 3NP7A 3GLFB 5COBA 4LQCA 1H93A 2JEYA 2R25B 3N0WA 4BX8A 2IYOA 3IPYA 4NQRA 4D74A 1G17A 2GB4A 2V03A 5DISB 4AURA 2ZRGA 3TF5A 3AB7A 3Q9NA 2IS2A 2WJPA 1US8A 2RFLA 1K8ZB 3LOQA 4ML3A 4DWVA 1U2PA 3AFGA 4IIJF 4WCVA 4WXPA 1TRKA 3WGHA 1T6YA 4X54A 1ZDMA 1IHDA 1MB2A 4NAVA 3RE1A 4BO3A 4HB3A 4ZI7F 5JBIA 3IJ5A 1Y81A 1PJBA 3HXPA 1NNUA 1X7ZB 2E5FA 4P38A 1H6BA 1PJAA 1JPUA 2DFLA 3HJUA 1OBOA 3G8DA 1AVTA 4TKUA 2FGKA 2IRWA 3VAZA 2A9PA 4JVNA 1WF6A 3PJDA 2Q3BA 2Z1NA 4PV7A 2FTKE 3TEMA 3HYSA 3W6OA 1KZHA 3MJ4A 1HXHA 2ERCA 1H0HA 4EF5A 1QZTA 3SR0A 5CFOA 1LLCA 3A3YA 2IYWA 4UHEA 5TS3A 1LD3A 1YJAA 4O3FA 5IWAB 3OJFA 3IQDB 5KIAA 3GPLA 4B3IA 2CMHA 4AKEA 3M6UA 3OFJA 3OTWA 2O23A 2C77A 2G77B 2AEMA 1GITA 1JFVA 2QUBA 2R8XA 3KKMA 3QBJA 5D6NA 2O3RA 1LRKA 2HSDA 3GRVA 3NIGB 4LZZA 4WVLA 2I3BA 2WINI 2GLTA 2H07A 4HFJA 5AK6A 1HR0B 2Q7XA 1H2EA 2EFEB 1KARA 3ETJA 4FFPA 3SZ3A 4X1KA 4KREA 2IZOA 3PL5A 1LFDB 2XZLA 2GAOA 1RHJA 3BKXA 1A4UA 3K6KA 1P9RA 4FFRA 4L0QA 5ES3A 5KKCA 3EWIA 3GMDA 1NSFA 4TTQA 4AN0A 1D2NA 3SSAA 2O52A 1E69A 3DBOB 4Y7CA 5A6SA 1DFHA 1KDOA 3SFVA 3AFNA 1LBSA 4PX2A 4WN3A 1VQ1A 1FLNA 2WG1A 2Q1SA 1D2EA 2ROQA 4JIMA 4Q1AA 4K40A 4G25A 4ESEA 4OBWA 3P5BA 3UWOA 4HGYA 3DDOA 4GPEA 2BISA 3IUBA 4EA8A 2BHTA 5C3MA 2W2OA 1U0LA 1JDPA 4BKQA 1R7RA 4JB0A 3ZVNA 3L6OO 5E6UB 8MHTA 5LWQA 1FDVA 3OFSA 1KZ9A 4D8YA 4RTNA 2PPVA 4LYDA 1XLTC 2O8EB 4C87A 1V3TA 2Q21A 4L0CA 1C80A 3K1AB 1OLSA 1ONOA 2GHRA 2VUSA 3VNVA 1WUKS 2JH9A 3N2GB 2PJUA 1V16A 4YRAA 2C83A 2X2OA 2YV5A 1RRGA 3HGTA 2QTRA 4HDMA 4HDOB 4LE2A 5J1SB 4BQOA 2B36A 1LX6A 2FRVA 2VT3A 1T2DA 1UPTA 4KQKA 1CX9B 1UAAA 1GT6A 1YQTA 1BCRA 1QC5B 4W4TA 2GCOB 3GAZA 4WKCA 3TQOA 1DBSA 2VP4A 2X4DA 4HXYA 4JOCA 4FSHA 4NULA 4U1RA 3ZQUA 2BTQA 1QMGA 4V39A 3ZKAA 4ASUA 3C39A 3GO4A 3GDOA 5HFJA 2JDID 3G1TA 2E18A 3N8GA 1PF7E 3PUYA 3DMGA 5BP7A 4A2PA 1XKQA 3AUXA 3BE6A 4ILEA 4M1SA 3PNPA 3KJNA 3QA9A 1XG5A 3MQFA 4J1NA 1DCMA 2VHZA 4FINA 1FP7A 5CNJA 4BHTA 3ZXUB 1N2JA 1J25A 2OVFA 3A32A 3WKDA 2TYSB 4EKEA 5K09A 1R8YA 4E4YA 1R8XA 4IF6A 4XPIA 3RODA 5HMMA 2PGLA 3EG5A 3OE5A 2QQGA 4TV9A 4OHOA 3TD2A 4BO6A 1V8BA 2HO4A 3WV4A 4ZTUB 4BMZA 1ZKMA 2D5BA 4DMFA 2E85A 5H70A 4Y7DA 4EZEA 3WOVA 5B1HA 2FF5A 3SS7X 1XVLA 1ZSYA 3STHA 1V35A 3AF0A 1E9RA 1T5OA 2PH1A 2FF7A 1IM8A 4KJZA 4DTIA 1JKJA 4BNDA 1MU0A 1WRBA 4A8JC 1PR4A 2PO7A 1ZL0A 1F1JA 3Q2IA 4UTZA 1A77A 5JQGA 5T64A 3GG9A 4OLFA 3G0CA 2XA2A 1CRPA 4JMPA 2QUIA 2ODNA 1ZVKA 3G02A 4JSYA 5AHWA 3WYCA 5DYIA 4AF8A 3N2NA 1ZOPA 3V1MA 2O5CA 2ZUUA 4EPXA 4YRRA 3PL1A 2G1AA 1X19A 3HUUA 5SZKB 3P96A 3KTAA 4G1UC 5EJFA 4EQ6B 3ZXIA 1ARZA 2HJRA 1CEQA 2O3UA 4TX1A 3WQSB 9LDBA 1KJZA 1X1BA 2ORVA 3CZ5A 3OMWA 5IYZA 3LC0A 4CMIB 3HN6A 4W6ZA 2X5NA 3MGKA 1PGOA 1VLLA 1YZGA 3JQ6A 1UM9B 3TG8A 2XT9A 3ROTA 2HIMA 4UAGA 3PI6A 1J42A 4ZODA 2QZ4A 1F4PA 2YZNA 2R0QC 1XRPA 1A9XB 5DP2A 3OZGA 2AV6A 4RPGA 3OQVA 5J63A 4FNAA 4C5BA 4CM9A 3EXHB 3IPLA 3VSAA 1SEVA 4E2XA 1RBQA 2VJBA 1DB3A 2YZKA 4DV3B 2HH9A 2QRKA 4LVCA 1UPUA 1Z2DA 1TVMA 3W4KA 1R6TA 1BHJA 4F4HA 1A5ZA 1PRYA 2QNIA 2ZRAA 4X1KB 1VP9A 1PIWA 3AY6A 5LQDA 3A1FA 1V5GA 2Q0QA 4ITRC 3WYNA 4JK3A 2FCRA 2W2TA 1K3TA 1WNTA 2GRUA 1LDMA 3DLPX 5EWLA 3LDGA 1E4OA 5F9FA 4H77A 5A6SB 1D5CA 1YR9A 5E95A 4WSOA 3WGYA 5CB6A 1SJ9A 5FIUA 1BKSB 2DTXA 4DG5A 1K6XA 4MS3A 4WV3A 3U61B 1UFOA 1AKEA 1RHUA 4RK0A 1UMBA 4O8ZA 2GQ0A 1UT8A 1FRQA 2XT0A 3MRXA 3HVRA 4LXYA 4MS4B 4ZVNA 4QSMA 1SU8A 3UKJA 3UO8B 3ITNA 1IJKA 4P3NA 1B7GO 3IEMA 1T5DX 3PLRA 5BPFA 1Y42X 5FTKA 4BJ5A 4N18A 2IV3A 4FSXA 3TR6A 1EDOA 3QV2A 2WPDA 4A4DA 1V43A 5FPHA 3ANYB 3D0KA 5DGTA 3EIXA 1OLSB 2CFTA 1SHTX 3HS3A 4X6UA 4BZXA 4TTAA 3OY2A 3QKTA 2FMTA 4GR4A 3DG9A 4IHJA 3CURA 1B2LA 1UBJS 2NW6A 3KZXA 2JJ1A 4JOBA 1OILA 4TT3A 4E4TA 1W5SA 1SBHA 3O73A 1BWPA 3SEAA 2ZQYA 1FYXA 1HT2E 1BCRB 2ZJ0A 4KDFA 4DM7A 2HX1A 1DDIA 4HQNA 4LVUA 5HA5A 3OG9A 2GR9A 2I4RA 2QR2A 3E3OA 3PEEA 3ZLJA 5FUXA 4W1RA 4B8ZA 1DFIA 1V41E 5KSZA 4G09A 4PICA 1L5VA 4ZN6A 1IK6A 3O6VA 3L4BC 4TZ6A 2AVDA 3D7LA 5KTTA 3F78A 4L5JA 1KJQA 3BL8A 4BRWA 3DNPA 3ZV4A 3NVKI 3GEPA 2PN1A 3RS4A 1JDSA 5FUYA 3CGWA 1ECLA 2KBEA 4EY6A 2WJGA 4ETWA 3FB4A 3IVXA 5F5NA 3EZXA 4RAQA 1NM5C 1NQUA 3GVPA 4R31A 1VC2A 2D0IA 4F8YA 5LIRA 4XPIB 5ECDA 1GPH1 1NJ8A 1UBHS 4JDUA 4DLUA 2BZ0A 3PT5A 4MJLA 1PR3A 4JLNA 3ZWCA 5IF9A 4KFCA 2EQAA 3OVMA 5HIMA 2FSFA 3BJMA 3D54D 1C0IA 1C4KA 2DBYA 1YVPA 2AVNA 4IWYA 1XDSA 2YJ3A 2HR1A 1TYDE 1DE0A 1QYRA 4MROA 4WY2A 1ULZA 4X1YA 4BNDB 4M55A 4UDXX 4DCMA 1RM0A 3GFSA 2WUVA 2PKQO 1UK8A 5DLDA 2V0GA 3DCYA 4Q1EA 1QE3A 4H6VA 5JQGB 2PT6A 5TB5A 4M83A 1NU6A 4QJ3A 2YXNA 3W3ZB 2CXUA 3WY9A 3JAKB 1DKUA 3E3AA 2PGJA 4XAQA 4EG4A 4MV8A 5CEEA 1GD1O 4HH3C 4RCYA 3QMWA 1KEWA 1ZJ6A 4KMSA 3ESQA 1X7YA 4MVJI 4P7GA 5FBLB 3WHIA 1PX2A 1JR6A 2VQEB 1JMKC 3HP1A 4J6FA 3NTRA 1WPXA 2Z43A 3KTAB 4IXWA 4IZHA 5GM1A 4QAQA 2C7QA 2DAPA 2FEOA 4GPAA 1TKAA 3QMVA 2J4CA 4DDTA 2GTIA 4XIJA 3BJZA 2D06A 3RKUA 5IYZB 2PYZA 1KDVA 2GEJA 1NRXA 1X8XA 2ZYAA 1R66A 4UZEA 2D5CA 5T4EA 3SZOA 2B99A 3P5SA 3QJGA 4ZC8A 5ICEA 1M1XB 2ZIEA 3R5HA 1P61B 2CLFB 2I7CA 3NWOA 1NYRA 1QP7A 2WSIA 2B4QA 4L4XA 1FNBA 2NM0A 3H6HA 1TTPB 1RQRA 3QKUA 4E7PA 5FL7D 3CZRA 3DVAB 3IPAA 1S2NA 2WAXA 4IDCA 4WE3A 2X1VA 5F1PA 3PEWA 1P7CA 3DXXA 3E4CA 1PGJA 4YUZA 2N75A 4GX5A 3HYCA 1X8KA 2L19A 5JSQA 1Z12A 1PFKA 3H9JA 3K2BA 5E6SB 4WFQA 4YP0A 2A59A 3I0ZA 3O2SB 3NKVA 3OTQA 1NQWA 2QTGA 3CSUA 4IFIA 2WWTA 3C4QA 4HAUA 4YCMA 1E20A 2GVZC 4YRNA 3QPWA 1AHPA 1RI5A 5EWLB 4H3HB 4V03A 2HTEA 3LGSA 3TWOA 1WMBA 1WUTA 1J49A 1QQ6A 4GX1A 2JI6A 4I4TB 4N0QA 4XW2A 5IVDA 2B8JA 1A2QA 3R7BA 4A0FA 1WP9A 3BB4A 2EP8A 2GSWA 4MHSA 3UT0A 4MS3B 5KU1A 4JU8A 3SIRA 1DC5A 4KBYA 4ZVKA 3I2YX 1YFJA 2ARKA 4ZKDA 1UMBB 2EJBA 3WICA 2AEEA 2UVQA 1DS6A 2GYYA 3GROA 1RP7A 3R09A 3JYLA 1HNWB 3H2BA 2R62A 3ZU2A 4YRBA 4I1YA 3MEQA 1IQ0A 3MCUA 1L7QA 1TYEB 5JEEA 2ZCVA 4K05A 4V02A 2G72A 5DV9A 1B26A 1JAIA 2WT8A 3UJ6A 4PGHA 1XN4A 1Q1BA 3AETA 2DECA 5JUWA 3SY8A 1PCXA 2ZS8A 1JX6A 5DLEA 1QYXA 2NVUA 2RGBA 2RGUA 2X0IA 4CLRA 5JFOA 5DBOA 4WKNA 4J07A 4D57A 1Z63A 2L69A 4WXEA 7MHTA 1TIBA 3LM8A 2GHIA 4LFBB 4UFOA 1FNMA 1IPEA 1YHZA 1XZIA 2DHEA 3DVRX 2PRYA 2V4UA 4ZOBA 1YRAA 2HIAA 4KQGA 1NM5A 4AS3A 1LPOA 2IEGA 1F0YA 4M53A 4KYIB 1DUVG 1FLAA 1O6CA 2IPOA 2O8VA 2EJVA 3QMMA 5K05A 4CL0A 1FNDA 4DMMA 5KNLA 3EA4A 1QNFA 2XJ4A 1QXSA 3VC3A 1N2ZA 3UJBA 1JHUA 1A8UA 1B6RA 1ZSNA 1ZU4A 2VKQA 2Y6UA 3AH8A 4QUGA 4X1IB 4E6EA 4IDNA 5DHAA 2Z8YM 4KHPB 2I7TA 2ZUCA 4LYJA 2CMDA 4QT0A 5HKOA 1T6ZA 4M60A 5TGZA 2A0XA 4A8JB 4EJSA 3MW8A 5JU6A 1DJLA 5A5DA 1X1QA 2HXSA 1S2GA 3JRXA 4EYEA 2ZJ4A 4OGFA 3SMVA 4BNYA 2JAQA 2J48A 5JJLA 2Q49A 2WZQA 3CUVA 1Z08A 3OLQA 1UODA 3EK2A 3L7LA 2BEWB 1PN3A 1QBKC 3O93A 2JFWA 5JS7A 1P1FA 1I2MA 1LPBB 2WD7B 1OU0A 3LECA 2CLKB 2P2NA 4X1YB 4MVCA 5FOWA 4HPJB 3I9OA 5BRJA 5DM1A 1TTHA 1SXGA 4FHEA 1QBGA 2ES4A 2VJDA 2H3EA 2MYUA 1OQAA 4ZYWA 3ES9A 3G68A 3HA3A 2CLSA 2B8WA 3LUPA 3S28A 4YALA 1QIGA 1VHQA 1RCUA 3DQZA 3WIEA 4MAMA 3DEKA 2C9MA 3PQ2A 3W2TA 3WLAA 2DPYA 2VJOA 3EDOA 3LPMA 3ED1A 4C05A 4BV8A 1BFKA 2H4JA 3UCEA 5KREA 1TLLA 3SEZA 5JS2A 1JHMA 4JZYA 1JXQA 4A5OA 1X7DA 1X7YB 2VTBA 3DF7A 4FZVA 1Z37A 3N2EA 4D8VA 4LBYA 3NEJA 3CLRD 1R9MA 3EC2A 1W0KA 2R8PA 3DVSX 3O0DA 4ZYXA 2MINB 5AI4A 4WK0B 5B3LA 3H0EA 2FP3A 4I7EA 4J75A 3DE6X 2F6RA 4ZV9A 1UBLS 1R18A 3B2EA 1I6WA 4O2RA 4E3ZA 1UPAA 2YYYA 1Q92A 3KQLA 5D7BA 1FNNA 2EDAA 3E4DA 3BEDA 3PDJA 4DAOA 5I8PA 2D2XA 3K9LA 4DCCA 1SVMA 3NRCA 3RBXA 2JASA 1UDBA 2RBGA 3PX7A 3QXSA 1GILA 3RV3A 4CUKA 1C50A 3MMPA 1R0CA 4XDZA 4JUAA 2XB6A 3AR7A 1K6IA 1KY3A 1OIXA 1T0IA 1Y5MA 1WZNA 4LPKA 3OY7A 2FPMA 3CWZA 4G1BA 3TQRA 3O74A 5I3CA 4YA6A 5LR6A 4OXQA 1N5KA 4BP1A 1FDUA 2VNHA 2UYOA 1PFVA 4QULA 5G0SA 2LPMA 4JB8A 1UC8A 5AW0A 1MN6A 1KMCA 4OMCA 1BMQA 5KUTA 4MWCA 4AJLA 1W59A 3BA6A 3QBVA 4HGRA 1RXIA 1XR3A 4OGKA 3N58A 5FADA 3U81A 1E0SA 2F62A 3NORA 2CUZA 2XOEA 2DUJA 4LV6A 3ZCSA 2YXPX 4HDNA 2EGHA 2IYPA 3HP4A 3IUPA 3C3BA 1SUFA 3UMCA 1ECGA 1IUOA 3TX6A 4NH4A 2N1MA 3KSDO 3JQRA 3RGGA 3RVQA 3KUDA 2P90A 2Q5LA 1WV0A 3B7GA 5IH3A 3UYLA 2QRVA 1CFZA 1E1CA 1WCV1 4RPLA 3FWPA 4IGIA 2CYBA 3NJ4A 3BK1A 1I2AA 2ONJA 3L0OA 2ZVDA 3WB9A 3NANA 1N7IA 1IZZA 3HVUA 4Q1FA 1GCOA 1HKHA 1SXIA 4J91A 5E2BA 2OQRA 3WP0A 3B7PA 6LDHA 3K92A 4RKQA 3W5JA 2CL6X 3RU2A 4KSYA 2EERA 2JNWA 4CGYA 1JG4A 3H4VA 3NT2A 4ZO7A 3NEYA 3DT6A 4B4DA 1T8SA 3MWKA 4OTZA 2W6MA 4JNKA 3ZTTA 3E7XA 3C3DA 3M3PA 2W4MA 5AVRA 4N82A 1U8AA 2F8LA 2JKZA 2P2SA 5AW5A 1DCKA 4N3CA 3IRUA 1U6KA 1L6IA 3ORFA 4Q4HA 5JASA 1ESCA 1TT7A 4POAA 2SBTA 4E5KA 4FYHA 4F45A 1G16A 4FUTA 4BBJA 2QJTA 3P9RA 5JSYA 4DKXA 1EFDN 4PFQA 2HN9A 4BLTA 2J30A 1PL8A 2X5JO 4MQ6A 2WMDA 4F3YA 3U48A 5JVDA 1ADCA 1JVBA 2A33A 1NW5A 2X9GA 3VR3D 4AB1A 2O8NA 1G5QA 1N9GA 1DWPA 2PXCA 1N9ZA 3GUCA 3HMKA 5FOTA 3WGGA 5FI0B 4XD7D 5T3YA 2R1VA 2VRWA 5B4UA 3IHTA 5EIBC 3WADA 3A6PC 1DIAA 3VHRA 4WGFA 2VF8A 2GN1A 4R1LA 4B75A 2W2VA 4CU2A 2NP6A 4OU5A 5T6BA 2PUFA 4LMRA 1BE0A 5F1YA 2Z1DA 3DOEA 4Q4LA 5CHYA 3UCXA 1KQ3A 3WK7A 1Y8CA 2AN4A 2WJWA 1EK1A 2C04A 1K68A 3LA6A 2BM0A 3LLSA 4U2GA 3LLCA 4FHDA 3WL7A 4MWZA 2NTNA 2CUNA 2PGDA 3FNGA 4J3FA 4B5KA 5JCOC 4LZAA 3WKCA 2Z58A 4AJPA 5CLGA 1XXHA 4Y1GA 3G2IA 5ALZA 4YR7A 1U2ZA 3U7FB 1RAHA 3EFOB 3BORA 4HV4A 2B5WA 4IHAA 1O96A 3HVJA 1H2FA 2RHOA 5CIWA 4S2UA 3B5JA 2RAFA 3U0VA 4CDNA 4M1YA 3RVNA 5BR1A 2F4VB 4O0LA 2HXGA 3AU8A 3ZHTA 2ZIXA 1R9JA 2PXXA 3LUAA 4M89A 1VGVA 4C0QC 3FCYA 2QTVB 2XXAB 4JGIA 2GKSA 4L9SA 1P73A 1VCNA 1MTOA 2HU7A 4ZHQB 1A9SA 1V1MB 2XQFA 4X95A 3AC0A 3Q1LA 3JQ9C 1XPRA 5JO9A 4GQBA 4FQ8A 1RQXA 3W8DA 2F64A 5K4GA 4M9CA 4IJ6A 4KKXB 2A57A 2QRZA 4MINA 4OBBA 2QJOA 4W5WA 5CJ2A 3NYRA 4INZA 4ZRNA 4KYUA 4F92B 2BM8A 2ZYTX 1CUFA 2W22A 5FFMA 1U65A 4C29A 1D0IA 3A11A 3PEYA 1WSBA 2NQTA 4UXIA 3GVCA 2C20A 1LNZA 3MTGA 1WCYA 4JOSA 2QMEA 1F8UA 1P1CA 4D9BA 1SU7A 3QELB 1NV8A 4UTOA 1K6MA 3VR4D 4CGZA 1RLTA 1WZUA 3TJMA 4EPVA 4RSGA 3ILVA 4QDOA 4P0TA 5C46F 4NYJQ 6YASA 2N3ZA 3EH2A 4RK5A 2H4WA 2ZUDA 3SBOA 4FFSA 2FVXA 4UNIA 5EMJA 5ALVA 1DUSA 1K66A 3KUXA 4ZO8A 1LQTA 2DQ4A 2PBFA 3HQ4O 1K7EB 2BBWA 5L3QB 3CZAA 1P77A 1BFDA 2HJHA 5AHXA 4ZU6X 4YB8A 3WL3A 3VR5H 4RQAA 4TV8F 2AMYA 3OKAA 3W78A 1LPPA 5F3DA 4RZHA 3RSCA 4BBPA 5MN4A 4NF2A 4HDNB 2GA9A 3RSFA 4XB2A 2AMJA 4XB6B 4BUZA 1Z38A 1Z6ZA 3FTNA 2CXNA 2OFWA 4D25A 3R77A 4JC0A 1GZDA 1Y7PA 1ZGJA 2A1UA 3M82A 1U7OA 4C7VA 1BDHA 2O3SA 1YAHA 4IKOA 1T8WA 4TSRA 3IR7A 2RC6A 1CZHA 1E1CB 2NU9B 3SZRA 3TH5A 4E1VA 4Q39A 3D8UA 3JRWA 5EIXA 2O54A 1CIPA 3O92A 1U90A 4ZANA 3SX4A 2OO7A 5H59A 3TRIA 3QFRA 2Z6VA 1GA4A 5E1BA 2C97A 2O20A 3WLNA 2FE4A 4QJ4A 5IKMA 3IT2A 1P18A 4LGCA 4PF1A 4XEUA 1U11A 4HWOA 2RAVA 2AFIE 4YXFA 3IYLW 3BQMB 1XDWA 4ZQGA 5BV1A 3H5RA 4V2UA 1EUCA 4P6VF 3WGNA 4LBZA 1QRTA 1JALA 4NCJA 2B78A 3QH4A 2ZJ5A 4OYYA 2W6CX 4RJLA 1C14A 4FKMA 4W8GA 1GG9A 4Q4HB 3SQOA 4MDEA 1U0JA 1TZ2A 3U39A 1TXGA 2KWIA 4GH5A 4GO1A 4OQMA 3UMFA 4C6TB 3ADOA 1BG6A 3IMGA 3NBMA 3PUVA 1OF1A 4HMQA 3CF2A 2R9VA 4RHEA 1ADFA 2C5LA 5CLLA 2KLBA 5CCDA 4RTLA 1T9CA 2Q8QA 5I7OA 2NPIA 2RG1A 4LIPD 4CL3A 2WIDA 1NHGA 2ZUFA 1E2IA 1NGSA 1TJYA 8LDHA 1BYUA 1N9GB 1OYOA 1SKUA 1VKZA 3OC6A 4GLJA 4HAWA 4IJUA 4E09A 2FSHA 1YR7A 3GU3A 5B12A 2LZ0A 1TLFA 1R15A 3EYWA 1Z2OX 1LI4A 3BG5A 5ICFA 3KLNA 3V8QA 3E23A 1Q16A 1ZH0A 4FCWA 4JWKA 1SUSA 3QBTA 1IN4A 1FXSA 1GSOA 1GG8A 1V8OA 4CV0A 1O95D 1XAJA 5AW6A 1RWXA 1QFMA 1SURA 4ISCA 2WAMA 4KQCA 1NBME 1M54A 1TAHA 4AI6A 2WF9A 4W5HA 1X8JA 4HQLA 3L1VA 1Z22A 2IXGA 3ZVRA 2NSJA 1GPUA 5HOQA 1YZHA 4JOQA 2D1SA 4KVAA 1FFSA 2PUJA 3JQ9A 4DS3A 1Y6JA 3O7WA 3G13A 4CETA 4BNNA 1OLUA 4COKA 1R0ZA 1O96B 1SH7A 1G3UA 2QTMA 3BF7A 4YFVA 2DC1A 3UMSA 4CF3A 2ZR9A 4GE3A 1JS1X 2X8AA 1HT3A 1JJAA 1RQLA 2BV3A 3BIWA 1CHDA 1IXZA 1HYEA 2IHBA 1ZC3A 4QFDA 5DYYA 1CQPA 4XX1A 3V97A 3CLUD 1NUAA 1GU0A 3QNMA 4BDSA 1FS6A 1MJFA 3ZDDA 3UFXA 4DY6A 1TPYA 3RT7A 1KEUA 2RIPA 2H4XA 2UUCB 4WDQA 1AF4A 1DAOA 1KY5A 4RL4A 4ZAXA 1MG0A 1PG0A 2G70A 4LYHA 2VYCA 2PL3A 4MEJA 4NATA 1ESZA 2AG6A 2FMIA 1X38A 3BS4A 4GI3A 4WXYB 3HDQA 4I5EA 1AHIA 1YULA 1XD2B 1C3JA 3I6IA 5I8WA 3NBYC 6REQA 1QQ5A 1V3UA 5HIIA 5ES4B 1VE7A 3CUSA 3L02A 1Q19A 4MWSA 3RYHA 4B76A 3WA7A 4YS6A 3CB2A 2Y8EA 4JI1B 1N2EA 3RNLA 4ZI3A 1W9HA 4ITUA 3HM9A 5DGCA 3RQIA 4QWMA 1D1SA 1X1EA 1F4VA 1NSYA 2OB1A 1I94B 2XGJA 3OEED 1DWOA 3VI4B 3T9FA 1UP7A 2JIRA 4JL5A 1HE5A 3RAGA 1C81A 2FUKA 3AVTA 1FZTA 4IV0A 5JFTA 2QPOA 1JU9A 2WFLA 4DQLA 4MVJH 5L3RA 3GBSA 4R2WA 4TVBA 3C7CB 1FJGB 1BXGB 2WQ6A 3FPSA 3VXKA 1DPGA 3E18A 1XCJA 4MLPA 5FT9A 3BHJA 4O4JA 3R75A 5BSHA 5AVUA 1V26A 2B4RO 2CW5A 2Q3CA 1PJQA 2L18A 3BGWA 3KT8A 1QB7A 5LBTA 4ZOQI 1T4CA 3UAZA 1PSDA 3SZMA 2X6RA 3JU3A 1W46A 3LWNA 1AB6A 5IAAA 4YDQA 4QQNA 2PLNA 2GCPA 2PIDA 5AH0A 3EQZA 3GJZA 4PPQA 2PSSA 5BSKA 3E03A 2WHYA 3T5CA 3FCSB 3V8RA 2DBRA 1XTSA 5THQA 1PTKA 5HW0A 3P0EA 4F04A 3R9XA 1NI4A 2BEJA 1KMHB 4NJEA 4BNXA 3U1BA 1FCJA 3ZYCA 1GZUA 3C4VA 5K0FA 3CNQS 3OF2A 2DQZA 1T25A 5KYXA 4OHXA 1JG7A 1AC5A 4GBMA 3OZEA 1SN7A 2PZFA 1OFGA 2AJLI 3SR3A 3WLPA 3CUUA 3ODPA 4F2GA 2JHCA 1QGED 3TD9A 5CB4A 2JLXA 2HRZA 4ZAYA 5B6JA 1XZMA 4LJ5A 1G2IA 3AL3A 3CO5A 3Q6IA 4ENTA 5K8VA 1YUNA 2X8JA 3VDRA 3L7KA 3U7QB 1AK1A 1C0LA 4CV1A 1M72A 1Y4AE 4CIWA 4XYLA 4W63A 3U5ZB 2XT6A 3MGCA 2QSZA 2GXQA 1WVMA 2FRDA 2QRPA 3AEUB 1N3LA 4MV0A 3IODA 3IQXA 4H18A 4CQMA 5I7SA 2H8KA 4LRUA 4OK5A 3I2KA 4XOUA 4E03A 5LLSA 2XDAA 4IDFA 1NT4A 2QJWA 2WZDA 4F46A 1HT1E 1R6AA 4PSCA 3VO1A 1E5LA 4AICA 3I6MA 4X8OA 1EU1A 4AF7A 1JDZA 1HDXA 2IPMA 2IELA 1Q1GA 3PQEA 3QV1A 4KAJA 4DRXA 4DUZB 2JJ8A 3B3GA 1U3TA 1ZH8A 5TF4A 4B71A 3SQDA 4BPBA 1JR3D 1NTRA 3D3WB