4JHXA

Crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
336
structure length
336
Chain Sequence
NAMAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIALIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGRMYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHSQGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELVAACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVALMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLEVTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ornithine carbamoyltransferase
publication title Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
rcsb
source organism Vibrio vulnificus
total genus 133
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jhxA01
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4jhxA02
1AT1A 4A8HA 1JS1X 3R7LA 3UPDA 5G1PA 1RABA 1AKMA 3D7SA 3R7FA 4AM8A 3TXXA 4KGXA 3M5CA 5G1NA 5G1OA 2IPOA 1RADA 1PVVA 4ANFA 9ATCA 1PG5A 1RAIA 6AT1A 4KGZA 1ZA1A 4OH7A 4AMUA 4F2GA 4EKNB 1EZZA 1VLVA 4WTOA 3AT1A 2OTCA 1TUGA 1ZA2A 2FZKA 1RACA 2P2GA 4KWTA 3D6NB 2I6UA 3KZCA 3M4JA 1F1BA 5AT1A 3L06A 2A0FA 5ILQA 4JHXA 1RAHA 2ATCA 1FVOA 1DXHA 1C9YA 4JQOA 4IV5A 8AT1A 3LXMA 1A1SA 4KH1A 1D09A 2QGFA 2W37A 3M5DA 2G7MC 1ML4A 2QG9A 1FB5A 1EKXA 1RAEA 2FG7C 4KH0A 2AIRA 3KZMA 2BE7A 3KZKA 3KZNA 4KGVA 7AT1A 1EP9A 1TTHA 1TU0A 3KZOA 2RGWA 4A8TA 4FYYA 1RAGA 1ACMA 3CSUA 1Q95A 3NPMA 1SKUA 4NF2A 2FZCA 3E2PA 4FYVA 3L05A 4FYXA 2EF0A 3GRFA 8ATCA 1XJWA 3M4NA 3L02A 4EP1A 4A8PA 3TPFA 1R0BA 2HSEA 1ORTA 1I5OA 4JFRA 3Q98A 3GD5A 4BJHB 2YFKA 1RAAA 3MPUA 2FZGA 3L04A 1DUVG 4FYWA 2BE9A 1R0CA 4F04A 2FG6C 2AT1A 3R7DA 1OTHA 4AT1A 2H3EA 1NBEA 3SDSA 4H31A 1RAFA 4E2FA
chains in the Genus database with same CATH superfamily
1AJEA 1M1UA 2Q5JA 1M9NA 5D7BA 1OZGA 3D6VA 2ZOSA 1YRBA 5EWMB 2AGVA 3RFFA 4RK4A 1Y7LA 2QMZA 3DBHB 3P20A 5EWMA 1HNWB 5E7QA 4YYZA 3HA5A 2ANCA 1KFKB 3SS7X 4ZAWA 5JNSA 1RJEA 3OEYA 3DBHA 2YV3A 3IH5A 3T1NA 4B31A 2PGDA 1FXWF 4ODIA 2WVJA 1VXOA 2YJ6A 1JMVA 2DSNA 3UM9A 3RCBA 3AUYA 1AMUA 1P33A 3Q10A 2VHXA 3OE5A 1NSTA 3WYFA 4BXOB 2B1RA 3UBMA 4GMHA 1UJBA 2F64A 3VA7A 2RCNA 4ZD6A 1T5HX 4AF7A 5BN1A 5IKEA 4QVIA 1Q74A 1XJQA 2OZKA 4WOPA 1WAMA 1DEXA 1I2BA 1LC3A 3V7WA 4OATA 4DCGA 4I1YA 1K2VN 1MO6A 1L5ZA 3WAGA 1E92A 3E8XA 4PTLA 3FDIA 5C1DA 5LZ9A 3PR2B 4R9VA 4EVIA 2VF8A 1UCFA 4KN8A 5JJBA 4WBSA 4X3OA 4C88A 1B41A 4US0R 5EWLA 2PZKA 3NDJA 1E6UA 4YMTA 1QHFA 1EIZA 1ELOA 3LLSA 1U7PA 3MT9A 3O8QA 4JLKA 1DWQA 3LUKA 1ZY2A 4KXLA 1U0NA 2WD9A 3WWDA 5IZCC 2KBFA 4EY3A 1U8UA 3O4IA 3LCVB 4KFUA 3GA5A 3P0IA 4B35A 3HVRA 4EZEA 3F9CA 1Z16A 2C4HA 2QGNA 2C4TA 2NSJA 2ZB8A 4G5GA 3UWMA 1WXGA 4XAQA 2Q46A 4KEAA 4UFOA 1ZN8A 1Y8ZA 5F51A 4MS3B 1NRWA 2WRZA 3QFFA 5DISB 2WJJA 2C9CA 3ZDEA 2R8ZA 3HTXA 2WPDA 2VJAA 4EW3A 7AT1A 1OXUA 2O05A 3EZ6A 3L6EA 3OFVA 3TIXB 2UYGA 1FVFA 3HSYA 2QWXA 1PJQA 4K9NA 4L74A 4A8TA 2CF6A 2D0IA 4UU7A 1EGAA 2JLZA 3O91A 3B38A 3V4PB 1E3LA 3WNDA 3IE1A 1HE8B 1IOLA 2G4CA 4J2TA 1N34B 5HTKA 3G79A 3ZCTA 1A8QA 3AIOA 4P4GA 5JECA 8ATCA 1SXJC 2EW2A 1T34A 3PICA 3AUAA 3VOBA 5GONB 3EEYA 1A7JA 2GZDA 1JQEA 1CQZA 5FOTA 3KAKA 1U9YA 1E0JA 4HADA 3L7OA 1PTJA 2B98A 1RJ9A 1E1QD 1NKSA 1QF9A 2GKOA 2XNDD 2C29D 5C3UA 5CIYA 4Y6PA 4GUDA 4W8HA 3JAKA 5AK3A 3KOXA 3WWEA 4EFKA 2FZGA 2CJWA 2B20A 3K6KA 3AOGA 3HWSA 2P3SA 2Q2WA 2FCAA 2C7PA 3TTWA 2QRPA 4RJLA 4IZHA 1UXGA 4KFTA 4BQNA 4INPA 2CV2A 4KREA 3OT5A 5ED4A 4B73A 3RUEA 1QR6A 3HS3A 4OB6A 4B3IA 2WWIA 4OQ4A 4GNRA 2J3EA 2O1EA 5F3WB 3CNEA 2XD4A 4X1IA 3ZV3A 1CWUA 2ZETA 4LKRA 4CTJA 1PE0A 2ZZNA 1D4OA 2CXNA 5I7AA 4HAZA 1MTOA 1E7SA 3EVEA 2RD2A 2HIAA 1IJEA 4G0UA 4UUOA 4DA0A 4RXMA 2PLFA 3AVTA 3O8BA 4AIRA 4PCLA 3NDBB 3OQBA 1T8TA 3AM3A 4R5HA 4YXFA 1OPRA 1C0PA 4C7BA 2J30A 3QVTA 1A4XA 3NBFA 3ZCRA 3I6IA 3WS7A 1MH1A 3SHQA 4UE2A 3OQJA 1PS8A 5K0NA 1IY9A 1CQIB 1OZAA 2WSLA 4FYIA 2AC2A 3OFKA 4YLYA 1YQDA 4AS3A 4YK7A 4DG8A 3D6UA 2WVAA 3F6SA 4YT2A 2NW6A 3SEZA 1BDIA 5KHLB 2ZAGA 2YZMA 2ORED 1Q0UA 3JYLA 4MZDA 3W5IA 2HSWA 4MLCA 3GEBA 4YTEA 4GR5A 4FI3F 2AK2A 3UJ8A 3HQ4O 4I36A 2EWMA 3KJHA 1U81A 3HPQA 4LCEA 5EPOA 3GGSA 4ZK2A 2B6HA 4V39A 4CRWB 2IHNA 1PJSA 4F7DA 3BGOS 2PX0A 1BGVA 5KTRA 3MHPA 4S1WA 2OYCA 1JPJA 4CM5A 5LC1A 4CLEA 2E5LB 1G8YA 4GWGA 4R6WA 1JTVA 2FCRA 1I3NA 1UDWA 3WJAA 1DC8A 3EVCA 3IP9A 4W1PA 5F2EA 4D7AA 3D1LA 3MWDB 4B76A 3PPYA 4ZDKA 5JD5A 4FZ3A 2QG4A 3AY6A 3ASYA 2VDPB 4DC0A 2WG0A 1U2TA 2PGJA 3GEGA 5EVCA 2XRYA 2AJDA 5KS2A 1VLQA 2Q4EA 4PCVA 5JRZA 2BGRA 3M5DA 3LT1A 3PGVA 3ICWA 4FZVA 2JG3A 2EZ9A 4ZJYA 4ARZB 3V4VB 4ATNA 4BX9A 1C4XA 4P84A 3KZNA 5FL7D 1Z63A 5KOJA 3QKSB 4YJ3F 3IEUA 5IUNC 1JHVA 2COKA 4QEKA 3RIXA 1JW9B 4EOGA 1WMAA 3EAQA 1ZVKA 1AUXA 2QX8A 4MCAA 4UDOA 2V8OA 1JJ7A 2P79A 3PA6A 3BTOA 2RMKA 3K35A 3PIRA 2YN4A 4P7GA 5D85A 5TS3A 5D00A 4F96A 1Y1LA 3P9QA 1KDVA 2O57A 4LFBB 2ZPTX 2ZE5A 5AO9A 2PWBA 2FW1A 4H27A 5A4DA 1I30A 3QLUA 4UUQA 4Q1BA 3CZPA 3OKFA 4U5QA 1L0BA 2HJVA 4JXXA 1G6OA 1A0OA 2F17A 3HFJA 4EG6A 3IT1A 2XNCA 1XQVA 5AVUA 4Z2AA 4HLDA 4AZ0B 5HQJA 1JWBB 3V1NA 3FKJA 4M6WB 4BQPA 3W7VA 3EFBA 3RHSA 4EJ6A 3AF2A 4ZMSA 1LLUA 4MWDA 1NDHA 2Y1DA 3N05A 4WDRA 2WHYA 4YMHA 4J8PA 2N1BA 5JG7A 3KSZO 4CDGA 4LFCB 4PNZA 1A8HA 4NXMB 1OR8A 1M76A 4JR0A 4IWYA 3SHOA 1Q0TA 2R6GA 3NWPA 3R23A 4JB2A 5K20A 4QT0A 3THWB 3EJ6A 1SC6A 2DFVA 2EBUA 2NU9A 1SCAA 3T15A 4F97A 3CINA 3IT3A 4B4WA 2WSSA 3AFIA 3M2PA 2C99A 4PSVA 3KZVA 1XN1A 2IWRA 2OSBA 2VLBA 1AA6A 1JQLB 1XTKA 2IYVA 5THXA 2BFNA 3B78A 3QX9A 1ZU5A 3TIIA 4ETMA 1T3SA 3G59A 2IEGA 2WBLC 2RGGA 2ZSDA 1R15A 4E94A 5J2UF 2QI9F 1ANKA 2GN0A 2WJWA 1VYTA 2X3YA 3W3AA 4XWYA 5DO9A 1FS6A 1L5QA 4K9DA 4Z0PA 1R0KA 2HQRA 4N9QA 4MWGA 3PNKA 2OPBA 1SC1A 2IX9A 4B33A 5CRIA 5GZ3A 2WB4A 1DAHA 3O8OB 2VQEB 4WY5A 2H5IA 4B3HA 2WIAA 2JFXA 3JQGA 4BNDB 3AHCA 4CKEA 4PO9A 3UBTA 4RK6A 4DADA 3L6BA 3BZBA 2I9KA 3HN7A 4TGLA 1T4MA 3AYXB 4R1SA 2HK7A 4YHBA 3BEOA 4PRYA 3WTBA 4B84A 4RJTA 3CVXA 2PAFA 1NY6A 3UMFA 2HSZA 3MRXA 1PG5A 2WZQA 1KBOA 2Q8QA 3HCRA 1ZA1A 4AY5A 1V11B 4H6WA 2VXYA 4GQAA 2HLPA 2JIZD 4HNVA 1Z5ZA 2QYTA 1J8YF 1FNBA 2WSMA 4PX5A 1SXJE 2XCTB 2AKAB 3NWBA 1BYUA 1PT6A 2CD7A 5HCUA 1LLFA 5IM4F 1Y5LA 3AG6A 4BRUA 1MORA 2IHVA 3QWBA 4MINA 4YCLA 4H17A 1SKYE 2FPLA 2GUWA 2LD4A 2ZT5A 4PLWA 4PVCA 2ORVA 4PS0A 3BC1A 1RAHA 1W87A 2ZCUA 1AVTA 4KACA 4Y0AA 4ZP1A 1LBSA 3IULA 2LCFA 3ZCSA 3C3YA 3DAGA 4PHTA 2B7LA 2JBWA 1R6TA 2PLRA 3GLUA 2O8EB 1ZMRA 2W37A 5ALWA 3QW2A 1HMPA 2FEOA 3AX6A 4KE9A 5ER6A 3QVMA 5BN4B 5LXTF 3KSUA 2JHCA 2O8EA 5F73A 4A92A 2WJVA 3A9VA 4OL0A 1I94B 1QTIA 1QORA 4N01A 5AK0A 3DKVA 4J07A 5IBCA 1HM5A 1II0A 2OHXA 3A1DA 3WHIA 4BTLA 1Z6ZA 1VHQA 1E2MA 2V4ZA 4F71A 1RKUA 2WTEA 4M36A 1E3EA 1K86A 4K6CA 3Q3IA 2JBAB 4MVJG 3IEVA 5DJ5A 2AG0A 1Z07A 2WD8A 3TL6A 1TECE 4CN8A 2JBAA 2CHEA 5EKUA 4AWAA 2JARA 1H2YA 4KQ6A 3EGOA 3K1TA 3OTWA 4K6HA 3LXRA 3MBOA 4M86A 4HOYA 4NE7A 4NYJR 2WOOA 3MGGA 4RMGA 4Z2YA 1FXSA 3KAPA 4NE2A 2YHIA 1U0RA 3Q41A 3TEJA 4PGMA 4LJ4A 3IAFA 1VZ3A 2AHRA 2GCPA 1IB0A 1HFWA 4LVNA 2SKCA 1PZHA 4OHWA 1ZBQA 5CURA 1NF2A 5AI0A 3VPDA 4OQFA 4QSMA 3ER9A 1ZFNA 4P4UA 3K92A 4PZLA 2OO5C 2A8YA 4A4DA 1GNRA 5HUHA 1UBTS 1LV8A 4KO3S 2K4MA 1MX1A 2IGBA 3ZWDA 4R81A 2O14A 2QX4A 2YRFA 3P9RA 3T3HA 4GPZA 1HT0A 1QIMA 1UZMA 2QTLA 4AUEA 2DHEA 2GPBA 4MB6A 4QM6A 1IZ0A 4BVGA 2BVNA 3EUAA 4FFLA 4MQ5A 2QU8A 3ROXA 2FWJA 2R62A 1SZCA 1MOSA 3UK2A 3UTDA 4TLDA 4BX0A 1WZIA 4PQYA 2BDTA 3EC1A 3LDGA 4BHTA 3HDYA 1N2GA 1ZJ5A 5KVQA 2GA8A 1XKTA 2J3JA 1V35A 4E70A 2DWCA 3RDPA 4YI5A 3T5MA 3V5NA 3Q9UA 4ZZ1A 1JDTA 2AFIA 4Q03A 3LJKA 1FUUA 4DSUA 3TGPA 1O94D 4PC2A 5BSHA 3SC2B 4TRNA 1G291 1Y6FA 3UJHA 4BP3A 1EAMA 2D1SA 1QHXA 2QY6A 1DWPA 3CFYA 3SC2A 3ZVMA 2QTNA 1LRLA 2Q99A 3NVKI 3M6WA 1RLUA 2ODQA 2V03A 2R96A 3PD1A 4X9XA 1A1VA 4BVFA 3ENVA 4E31A 3D7SA 1MOQA 1WMEA 4IRMA 1NI5A 1VP3A 2DPYA 3U4IA 4KAJA 1IXSB 3PHLA 3RB8A 4A5SA 1OIVA 2KI5A 4YCDA 4HC4A 3WRXA 2OD2A 4ND5A 1JR4A 2CXOA 2Q3HA 3EK2A 3KQTA 3URKA 3WQBA 4A2PA 3AR7A 5FOQA 3ZUPA 4IRXA 2X22A 3LWZA 3I8XA 2IYXA 2HSDA 2I3GA 1E6CA 1PZXA 5K8TA 2WM8A 1WDWB 4CJXA 2C04A 4LISA 2XWQA 3BFPA 4F6CA 4DEYA 2P7IA 1V39A 1UBFA 4WKOA 4CMJA 1I7PA 2PUGA 3PWTA 1N6KA 3K9LA 3FUWA 3LYHA 3PGJA 4OCZA 2OCPA 1H5UA 1WOYA 4LZWA 4FSDA 4UXJA 4TYWA 4XR9A 1OGJA 2AJ8A 1PGOA 1ULUA 1ZZEA 2K2QB 4KLZA 1Q1NA 3RWOA 5I5EA 4NKRA 1MRNA 3O4FA 1ZCAA 2OA0A 3WWCA 3H5VA 2E3JA 2QUAA 5L40A 5EHIA 1MJ5A 2JJ2D 1C4OA 1B7GO 2DPMA 2BGIA 3ZXXA 5REQB 1PSWA 4YVFA 2A1IA 1JWAB 3EY4A 3OQVA 4O0LA 3MOSA 16PKA 4L02A 5REQA 5EERA 2W6MA 1PT5A 1GN8A 1XVLA 2VF4X 1DTEA 3LQQA 3VYUB 5JI3E 5KSZA 3U44A 1T29A 2EWVA 2D0DA 1SIUA 5CFMA 5D5PA 4F3NA 1L5MA 4NVRA 4L9RA 4I66A 4OREX 4KIUA 3PUJA 4HMPA 3H4VA 2A1UA 2C83A 2B6NA 3JD4A 4HTFB 2WWTA 1NBOA 3D3KA 3KB6A 2FSGA 4XI9A 1TDJA 4HTFA 1NVKA 3MYYA 2EEPA 2FPIB 3GOHA 4DMRA 3CN7A 4KR2A 4NYMQ 3VYTB 1YOBA 3EEBA 2J48A 4ER7A 2FPIA 2FN9A 3JWHA 3NHYA 2JGFA 3ESDA 3GHYA 4RX1A 3G1WA 1WQ4A 4TLMB 1AHNA 1MABB 2WVHA 3MYRA 1C7EA 1VJTA 2FSPA 2WTAA 5A5VA 4ZO9A 3NT5A 4D4JA 5EYPB 1E6MA 4OGLA 3WK7A 1BIFA 1T5SA 1N75A 4GC5A 2NQ2C 3U4QB 5EYPA 3QPAA 4QPNA 5J2UB 2X0DA 5J4HA 2GK3A 1JA1A 4E2ZA 3ZOKA 5EMLA 3L46A 3ASVA 1TZJA 2I6XA 3SQMA 2J87A 2AH5A 2WU4A 3K73O 3K2BA 4FYWA 4MMZB 2HQ1A 1N3IA 3CUVA 4KCGA 1FYVA 4TV9B 5LLSA 1YMQA 2ZZMA 2V8BA 3UG6A 5EE3A 1ZXXA 2NAPA 3OEWA 3PXXA 5IK2D 1TFUA 2AYXA 1UIMA 3QFRA 4LSWA 3IEXA 5AW5A 3L1JA 2PUFA 2GDZA 1BE6A 1Z4QA 9MHTA 1N57A 4UVEA 5JSUA 3D6FA 2D5CA 3JR3A 2Q5IA 4O63O 1KVRA 2QYHA 3EXHA 3Q3HA 3LHKA 4Q9KA 4G1BA 5E9AA 3W9SA 1KVSA 4BYMA 1YUMA 4NV3A 2TRSB 4KVGA 4PXSA 3B3QA 5A6SB 5A9SA 1FVHA 3CT6A 4L08A 2WD7B 1KH2A 1T6BY 3TKAA 3CW8X 3LQFA 4C6HA 2IHYA 3GJ8A 3TS1A 3AJDA 1U1DA 3LYAA 2DPXA 4N4AA 4C30A 2A7QA 5BUZA 3COWA 3KHUA 4NV1A 4QZVA 4GPEA 3S81A 1WMSA 3PQFA 4OB8A 2A7XA 2ZVDA 4Y2GA 2Q1WA 1OYYA 1RADA 4HBZA 1ZOLA 2GSDA 2RH4A 3O2JA 2Q41A 4TKZA 3MHTA 3RT1A 1LW7A 1NKTA 2O6LA 2VHZA 5CEEA 4KR3A 1ID1A 2XMBA 2VNJA 4CQLB 2BFCB 2IXAA 2YYAA 4FI3C 4NCIA 4YRRA 3AT1A 1EK6A 1PK7A 3RYCA 2P4QA 4QHTA 2XCOA 4QTZA 4ND6A 3IBGA 1X1SA 5EZYF 2GOYA 1TRKA 2IHUA 4F5EA 1MJNA 1A88A 2X4IA 2D2VA 3LDHA 5EXPA 4D4MA 4EYOA 2ZRBA 1KDOA 2DKFA 3BORA 4G0NA 2D5IA 3UO8B 3WGHA 1R9GA 1ZK4A 1PFQA 1NNLA 3LGXA 2XMGA 4MPTA 4FR0A 2ZU0C 4RANA 4LNAA 2XLCA 3NYRA 3E7XA 5BYAA 4OMUA 3RK4A 2GBLC 1Q5PA 3IKJA 2OMKA 3BDVA 4OH1A 4YUXA 2VNKA 5B1HA 5DHTA 5I6DA 1DKLA 1JFLA 3L01A 3UTCA 1ULTA 1ZESA 1AKQA 5FTLA 1LTHR 4PLFA 2HD4A 4Q4CA 4II3A 3QITA 2KMLA 4WVFA 1SU8A 4X97A 3GROA 2B94A 4DUPA 1FDOA 3I76A 1M10A 2P27A 2P2DA 4LQCA 3EF1A 2P6OA 5G0WA 2J09A 4E13A 5C46F 2E37A 3RKSA 1P39A 3SU8A 4QVKA 1DOHA 1Z62A 3B89A 3TLAA 1OTXA 1UC4B 4CV3A 1ZKDA 2SNIE 3OQMA 1MVLA 5T5QA 1C3JA 2GX6A 3BRWD 5IAOA 3KHKA 2R9VA 3OU6A 4FYXA 1QP4A 4GD3Q 1T5LA 3A1WA 1ZBDA 3IMGA 1LDBA 5FA8A 1NC3A 4NZNA 1GTG1 3ANNA 1TYBE 3V7UA 3GLIE 2H9IA 3BIOA 5EUBA 1F2UB 1K92A 2O52A 3L7YA 3UAWA 4C0JA 4TKMA 4GZ5A 4ZI7A 1OQAA 1UZUA 2VFAA 1PL6A 3BB4A 3RSSA 1TTQB 3TRIA 1XROA 3K16A 2Y1CA 3SX0A 2VPIA 1Q50A 1CY6A 1FMJA 4L72A 3IKVA 3M89A 4TTJA 1RE1A 1VDZA 1RLOA 4ZCIA 4X6UA 2AN5A 1M2OA 4AB1A 2FRDC 4GI5A 4GU5A 1QF7A 2VPWA 4HI0E 4YBZA 4RK0A 5B4TA 1VIVA 2IEBA 1PK9A 4JBLA 3LKZA 2JLUA 3QYFA 4E5DA 2ZTUA 3OX4A 3KTAB 2YDXA 5CGQB 1NVTA 4C03A 3NTVA 3W2EA 3FCEA 4Q7JB 1PQYA 1NM5A 2IYSA 1YMUA 4K3UA 4UU8A 5A7HA 3RNOA 4DJEC 3P9SA 3EEIA 3D64A 3LT4A 4LUCA 3WZMA 1ND6A 3ST7A 2FB9A 1NONA 4S35A 2QI9C 3ERCA 2E1RA 1TL7C 3RRFA 2C57A 2EZ8A 2ZI6A 4U2GA 3VO2A 2RGBA 4Y30A 4DZTA 1VSVA 2YQZA 1W49A 2P4EA 3BL5A 3JAWA 1RABA 4MPJA 3E2IA 2B2XA 2Q7OE 5B3JC 4PS1A 5KPJA 4JWKA 4YAWA 2ZJ4A 3VO8A 3VNQA 4L2IB 2EL9A 1DEKA 1E1MA 5K3CA 4DJFC 1WPGA 4QQ8A 5TARA 4H0CA 1YVPA 2PLNA 2TS1A 4DCPA 4J7UA 4URYR 2DU8A 3S70A 4DFDA 2EKDA 1YKGA 1JT2A 1S8OA 2ZYGA 3FYHA 4G3XA 5HUJA 1L7BA 3P2MA 1PFKA 3TZQA 3RR2A 4R4JA 3EIUA 1G20A 2ZRHA 3GP3A 2CWWA 4F9GA 3PDIB 1DJQA 4CM3A 1BDBA 2Z56A 5LQUA 2OV2A 3DJYA 4F1WA 3ZLJA 4QL3A 3A11A 1XRMA 3DAHA 3HKEB 3OZFA 4TL8A 2I54A 1KAHA 4EJFA 3QK7A 2H4HA 1PJZA 5GMOA 2JLYA 4FMCB 5AW9A 1XTBA 4MVCA 2WT9A 1SOUA 1QCZA 2BY4A 4ND4A 4X7MA 1G41A 3ZWNA 4G56A 5I7FA 3JQ9C 1FPQA 5ECWA 1J49A 1MEEA 1VCMA 2B9EA 4YV7A 3HM9A 3ZGZA 2QQFA 3JQFA 1M34B 5KOYA 3R5HA 3GEIA 2B37A 2JJ1D 1T9HA 3RANA 1M34A 1OJ7A 4BWFB 2XMQA 3I62A 5EIFA 3UICA 3I2IA 2UUOA 3OO1A 3C3MA 3I52A 1DFIA 4P08A 7GPBA 4D9FA 2JH8A 5GZ6A 1A2BA 1RYMA 3QWFA 5BQFA 3CSUA 3KJNA 4RH1A 1QYVA 2FEPA 3O31A 3OFJA 2PUAA 2HSJA 2BHSA 2J08A 3D1JA 1JHRA 2HYIC 2H0AA 3HJTA 3OTIA 3OPYI 4TLCA 3DD5A 3TRKA 4ZVVA 3LX5A 3OM9A 4LF4B 1YJCA 2OB1A 4HYYA 4JU8A 3K20A 2EX1A 1CVRA 1EZ4A 1U65A 1VCHA 2C59A 3LSYA 3VZPA 3ZS9A 1WNFA 2H1SA 1SUPA 1JG2A 2V4MA 3NP9A 3LIIA 5B1IA 4D6PA 4GYWA 1DAEA 2D0OB 2QMUA 2AMJA 1K6MA 1DBQA 1X7YB 3B2QA 4R98A 2IP4A 2JIRA 4YJGB 1KL7A 2NT3A 1E2UA 2PTHA 3DKIA 4Q4DA 4S05A 2UYCA 1SIWA 2V7EA 1JSCA 1EFPA 4MRAA 1HURA 2F90A 5ALSA 1M7HA 4BJ1A 1G4HA 2FEWB 1IHYA 2X6QA 1HETA 3L7LA 3QBVA 2UYYA 5ENDA 1UPXA 3PQEA 5COQA 3RJTA 2R5NA 3DYIA 1BJKA 4S2UA 4ZVNA 5DE3A 1DKPA 1CD5A 2WNHA 1FOEB 4IQGA 4Q3OA 5CH8A 4QYSA 4RPJA 4MQEB 4B6GA 2V3CC 2I91A 3ZDFA 1JXAA 1Q16A 3KKMA 2NYRA 4MKRA 1CZHA 2DUNA 2R00A 3K0FB 4R2MA 1OWOA 4Y2HA 1KVTA 4KAXA 5IVDA 3H7AA 4GM1A 3EDOA 2IYAA 4EYKA 1CNEA 1RRVA 1E1RA 1HL3A 3GQBB 5JJCA 2VP3A 3RYHB 4PY2A 3MUNA 1M6YA 1RLMA 3QBTA 1FTWA 1WEKA 1I01A 1M67A 1RWNA 2ZJ5A 1STOA 3C16C 3R7SA 3RYHA 4A0RA 3D4BA 3B7GA 3MD9A 4DNXA 1P7YA 4EFDA 2PUHA 3CNHA 4LCBA 2J46A 4OJQA 4KE7A 4YP0A 4CUZA 3RYFB 1XNHA 2PHZA 1KMCA 1D1PA 4NJEA 3O4VA 4XSHA 3EXIA 4UZEA 3V34A 4JP5A 5KVVA 4OQMA 4JJIA 4M9RA 3ZPXA 1RPZA 3C7DB 1W88B 3B1XA 4I5IA 3ET4A 4WL0A 4OH7A 3RLFA 5FWDA 3WJ1A 1AGYA 1QO7A 2W6ZA 4RS4A 3FFAA 4BEVA 1QIKA 1Y3AA 2Q3LA 3ETEA 4IFTA 1WBDA 1QNFA 1SHJA 3T7KA 5C32A 2ADMA 2ECOA 2HHCA 3B12A 2IV3A 1MEJA 1Z0SA 2C58A 3QKRA 1PT9A 4XLLA 3TSYA 1T0HB 3GXOA 5BVGB 5K3EA 4HN2A 3SYLA 4BGDA 1GAJA 1VIDA 4XVCA 4U2KA 1FRVA 4Q9AA 5TEWA 2Q9BA 1MPXA 2WKRA 4FK8A 1SAYA 4QDXA 2ZGVA 1JKXA 1LI4A 3C97A 3CZ4A 4YACA 1AGNA 2JLQA 1VI2A 3E8SA 5DHFA 1JXOA 1W5SA 1JVBA 2J3DA 2ZVJA 3CTMA 3P0FA 1DB3A 4EB6B 2YWFA 3IUJA 2C9DA 3SNHA 4FB5A 4B5KA 1DC3A 1EVYA 4WJZA 4IJKA 4LX8A 5E7MA 1XQ1A 4N3NA 1KYZA 4RLSA 4AMYA 1EP9A 2VC2B 4F4UA 5DHPA 1UKYA 1GU0A 2XQVA 1B6SA 4JT4A 4ENSA 5F4BA 1VZ2A 2PNFA 2H2DA 3NDPA 2HREA 1OA0A 1XRPA 3K32A 1CP2A 3ZWVA 4LBWA 1JKMA 5LJLA 4BV2A 4XX0A 4EDHA 4RGVA 1X94A 4URUR 1T43A 1ZAYA 1JPUA 1KP2A 1MT3A 4IKEA 2SBTA 4NC9A 5BR8B 4IUYA 2EFHB 3MNFA 5KCZA 4PZCA 3WO1A 2AZMA 1EFHA 2GN2A 3S3TA 2QN3A 1U8XX 1GKUB 3EOZA 4ZQCB 1SQGA 3PI6A 2REOA 1J5XA 1HLFA 1LVUA 1R0BA 2VDOB 3GVHA 5AI9A 3MLBA 3TUJC 5C7YA 2PT6A 2QP9X 3DCJA 4H35A 1B0AA 3KOOA 1B8OA 1YL7A 2QD3A 4HN9A 4MA4A 5CT9A 5COAA 3KYIB 4D6YA 1XOIA 3G5MA 5JNUA 1W48A 3W6UA 1UC8A 2Q2NA 2WF7A 2MHCA 3R20A 1YS7A 1B16A 2JH3A 1P4SA 1I2ZA 4J49A 4QLAA 3FNQA 1DUVG 2QVXX 2HGZA 5FYQA 3F6EX 4RPGA 3UYLA 1LA2A 1WLYA 2FPXA 3W1EA 1KJ8A 5EXSA 3WYBA 2X8AA 1IWOA 3A1TA 1S8NA 3KSAC 3FOEC 4PSDA 3GFVA 3HL0A 1CJBA 5ALGA 3GGJA 1U7ZA 3TBFA 2ZI3A 3FFBA 3HY4A 1T13A 3LOPA 3NS7A 2IHZA 4RIEA 2C8KA 5IVIA 1GKLA 5LN1A 2PA0A 1A72A 2X0FA 2Z8ZA 1PKXA 1SBZA 5ALRA 1WJGA 3TLJA 4D42A 2UXDB 4YQYA 4GOJA 4CM9D 4MW2A 3EWNA 3H1TA 3M6FA 3N8DA 2IS2A 1FP4B 4LRYA 4TWZA 3JD0A 3PGXA 4WAUA 4D8WA 3U7GA 4KSCA 1R8QA 2HMWA 1U9CA 5G02A 3DGFC 5THQA 4IV0A 4N3GA 4TWBA 4TXLA 4A0QA 5IYZF 5LWHA 1WW8A 3BIXA 3TB4A 2HHAA 1UPAA 1JXMA 3DO6A 1Y81A 3NIGB 3NLLA 4LPSA 4C3OB 1BS2A 3DQQA 3LG2A 2FXVA 3AHHA 3VSEA 4ZZIA 5JYDA 4RD6A 1DX9A 4J0IA 1K3UB 3OOSA 3H0KA 4A73A 5FQOA 3L7DA 2XZPA 1KKMA 2EWWA 1SVKA 2FF5A 2JVIA 2NPFA 2EGHA 4BNHA 4UD2A 2G63A 2FPMA 5JS8A 4PHGA 3UUFA 4L76A 1S0UA 4NOJA 5TVKA 1OSNA 3HZZA 2UYOA 3QGMA 1G7SA 1HKHA 1JYSA 3EUFA 4WIAA 4AECA 3DKRA 1MO2A 1TIBA 1XAIA 5ESWA 1XG5A 1Z29A 1V3VA 3SCZA 2LKDA 5BUQA 3R9WA 4QBIA 1JVNA 2ATCA 1KOFA 4BEJA 2BI7A 1HY3A 3EIOA 3OM1A 2NXWA 3GDFA 4ZT3A 3RQIA 5GZ1A 1B93A 3EIQA 5SYNA 3EXEA 1U11A 2O20A 2P7HA 3B6EA 3K8OE 2VYQA 3NHLA 1R6DA 3NAZA 2Z1NA 2JAUA 4G81A 4G5YA 1UOOA 2WILA 2G1PA 4BX3A 4GWLA 1ZN2A 3EAGA 4JZYA 3IMFA 2MYNA 5IAAA 4QM7A 1ZRSA 3FPGA 1C5KA 5IJ0B 3VR6A 1N2CE 3A9TA 3H0EA 3FMFA 1J97A 4CF7A 1RWVA 3LC1O 3V3KA 1QG2A 3G8DA 4C5BA 4TUYF 2FZCA 3CRNA 2H1LA 2WINI 1CQPA 3PNPA 3TNLA 3QVVA 3GNLA 2RAUA 1PW5A 4B6EA 3KQUA 3MZ0A 3UUWA 3DL0A 4DAEA 2Z57A 4DWOA 4GPIB 5JDCA 5KC8A 4AZSA 2OB2A 3FPLA 3LH5A 4DMFA 4TV8F 3N0TA 1QLWA 5BOVA 1NW9B 1L1RA 1ZD2P 1DAKA 1ZM4A 2RAFA 3WMWA 4CR7A 4CIVA 2JIQA 3BD6A 5KSYA 3JQCA 1XQWA 3ZWOA 4C4OA 3NIDB 3SBEA 2VTDA 2VJNA 3OOYA 4H6PA 3PQ2A 4UBOA 5J5VA 4JBXA 1XLVA 1SMKA 4D9GA 1ZH2A 1BN6A 2GFQA 2GPWA 4DQ0A 3ZWMA 1HDZA 3VHXA 1NN5A 4UCXA 4W7SA 5BMVF 5JUWA 3FOAA 1NN1A 2L42A 1XJCA 3V8VA 1R0CA 2CE2X 3CEAA 4IIJF 5FNVF 2P2SA 5EJFA 4R7ZA 3F9RA 1HI9A 4IDEA 2IBSA 5IVPA 2IXFA 2GYYA 5KTYA 3HP1A 2HMSA 3ICOA 1I0ZA 1O4VA 1H5QA 2G9UA 4RSMA 5JXWA 3II6X 1H5NA 1VPVA 1DEHA 2WIJA 1WXWA 1EFCA 3K4QA 4MGIR 1VSQA 5F52A 1Q3HA 4W82A 2V4UA 3WZ2A 5DIFA 2YWDA 3HWRA 1FCJA 3JWEA 1NT2A 2HC9A 4NJMA 4EK9A 4QTTB 3CUUA 1TA9A 5K0GA 3ACBA 4X90A 3FRHA 2D2XA 3DKPA 1E3DA 3P1JA 5BR1A 1XTVA 1W4BA 1ITZA 3A4IA 1JHXA 1YHZA 3GVXA 4RADA 3PGMA 5T57A 1LBEA 3EPPA 4NDNE 4J0DA 3UB2A 4EAAA 1IK6A 1L5FA 2OXTA 4GMFA 3R6LA 2A9FA 3EULA 1WKCA 1K6JA 2BGUA 3LCJA 1MO5A 4G65A 4WNAA 5HFAA 3AB3A 1BJTA 1OCEA 5CDYA 4PF1A 1LPMA 4HFNA 5A0TA 2HCTA 4J4TA 3ZC3A 2AYZA 3CUEF 3MWJA 3D6MA 3E1KA 1FTNA 1XTTA 1AKVA 4ZMRA 2D2EA 3I9JA 3QOXA 4QXPA 4ZCPA 5BQXA 5JHGB 1EWVA 5GIOE 2CVZA 3MWFA 5FV4A 3W1WA 1KIFA 3T5TA 2HJWA 2CFRA 2IXDA 4C06A 2WB2A 4UHJA 4GBGA 2QVZX 3IOYA 4OA5A 4L8YA 3VAAA 2ARKA 3DXXA 2IZOA 3EZFA 3C43A 3FNBA 4PYRA 2EG9A 4R7GA 5IWAB 1NBHA 1XF9A 2QN6A 1C9NA 3VNRA 1IEQA 1MW8X 2BI8A 2QR5A 2BR5A 2JI6A 1EWYA 4WLVA 5CPFA 2BH2A 1M83A 1P0IA 2BMWA 3NJ4A 2PVSA 1Z4IA 4CDMA 2J0EA 1SQ5A 2J0UB 2OE2A 4S1TA 4AF8A 4QULA 2YOFA 1CUGA 1T0JB 3PUWA 2IYFA 3UT5B 2XWBF 4XDGA 1XQ9A 1Z2NX 2WYHA 3G0GA 3HCWA 4XB1A 1ZOSA 3QU5A 3PA8A 1IH8A 4RV5A 3PUHA 1D9ZA 4IHKA 4UBIA 3WWZA 5K8JB 4L5JA 1AK9A 4NYJQ 5LSAA 4J7AA 2AVNA 1YL6A 2W6NA 2JAXA 4HS9A 5CA1A 3FSGD 1DHRA 1HK7A 3FSRA 3ONNA 2AEMA 1VLZA 1OY1A 4RD3A 4RFVA 3WQSB 2NO5A 3KT8A 2JFGA 4E2YA 4CKBB 1PR0A 3N2KA 3OPYA 4M22A 2YZGA 3OC0A 5HKBA 2PPLA 1FE8A 4CKBA 3OM0A 4I1IA 1XE3A 5JLAA 3Q15C 3SC3A 4IDNA 3SF8B 4JEHA 1TM4E 3SF8A 1NBIA 4FSXA 1GQ2A 5BY2A 4AJ2A 1EE9A 2OCLA 4RK1A 1GFIA 4PHFA 2QP4A 2HWWA 2W2OA 3N8GA 1Y82A 1NSYA 1X9IA 1XDBA 3A1UA 3KKQA 3L84A 3OA0A 4O0MA 5AI6A 3ZQJA 1NMYA 4X61A 3AVXA 2I1VB 3NRCA 4N48A 4E09A 1JEDA 2XJ4A 2ZTLA 3F8SA 3TTVA 4DR3B 3ZHOA 3KAQA 1ISHA 3T3DA 3HC7A 4MVYA 1SJ9A 1NP6A 1F8UA 1YNOA 1FFSA 3E70C 4EI2A 3ZJ5A 1KNXA 1MMFB 1KE1A 2M6KA 2GRUA 2OQRA 2P8SA 3A2LA 3LKVA 2BZ1A 2JJ8A 1ZSVA 1W0CA 2A0YA 3RQSA 4ER3A 1D7OA 4O2BB 3FGOA 2HXGA 3KEGA 3OKPA 4R1MA 5JD3A 3U4CA 3TZKA 4CCWA 2P9HA 1GCIA 1MNQA 1Q0ZA 1UWVA 2DR0A 2TSYB 3BJZA 1KYWA 2BRUC 4FNAA 4YI3A 5AVVA 3PIIA 1NVBA 3P52A 3OX2A 1C0LA 1VA4A 5KVAA 5TQ0B 3QVLA 1UQRA 5HYVA 1BW9B 3A6JA 3AEQB 3LUGA 4PSCA 4WA7A 5CK5A 4H18A 4V0QA 1IOVA 2GF9A 1HDIA 2VSNA 3O73A 2G4VA 5A5GA 5ED0A 4OU4A 1D4AA 1WX1A 1F0YA 3AOEA 3P0HA 5DX8A 3CPEA 4RWEA 3FBGA 3H0CA 5TXGA 3B1KA 4C7OA 1A4UA 4FE3A 4QLBA 3FSEA 2NZJA 1NBWB 4DAOA 4C6RA 1Q1BA 2XCIA 2C54A 1IPFA 3GELA 4TTPA 2BMDA 3OKAA 5FX2A 5IN4A 1JJAA 4UDXX 1O94C 3D3JA 4LY0A 3TEFA 1ZUWA 5F9FA 2Y05A 3AR3A 3CEJA 4N6OA 4X94A 3WQRA 3IPAA 4AP6A 1NF9A 2XUGA 4JLNA 1NI3A 4BIMA 3WLQA 1J8DA 1F14A 1ONOA 1YHYA 1U8YA 2CXSA 2Q7XA 1ZNZA 3E9CA 3PX7A 2E1PA 2IDZA 2RAVA 1YKSA 4IVPA 2EZ4A 2Z8YM 4EQZA 5H7XA 4RCYA 4JBYA 5P21A 3BA1A 4ER5A 3TLGB 4TUYB 5ALDA 1OVGA 2IEIA 3WFIA 2HT1A 3HXMA 2ANBA 3OCWA 3TLGA 1E79A 3FOFC 2BMEA 4K3VA 4WEOA 4E5MA 2BCGY 1ISFA 2XT9A 1SCBA 4MKIA 2FH5B 1X92A 5C34B 3LS2A 1G66A 4DJTA 2XQGA 4BFYA 721PA 2EERA 4TTAA 3STTA 3CUTA 1QQAA 4BATA 3GH1A 2R68A 1KY3A 4R5MA 4UHBA 3MJFA 3SI7A 3IR5A 3DOHA 3O1HB 4QJIA 5JBQA 4G5SA 5B2ZA 1QDUA 4K6MA 2PG3A 4N7JA 4REOA 1YOVB 3ELYA 1TCVA 2QPLA 1GGEA 2UZ1B 4NULA 4NZPA 4QYMA 1JFVA 4RIGA 3TW8B 3ZJ4A 2QJRA 3DJFA 3RKRA 4B4DA 4J1SA 1NNI1 1YOVA 1YVDA 2R7KA 4D9IA 3C45A 4LWZA 4OHFA 3CKMA 4ENQA 1JQBA 2BBSA 2AOWA 3OIUA 1OX5A 1GNQA 3G49A 3R6GA 4IIJB 4RFSA 5IKOA 4EEKA 4CYMA 1AHHA 4RDIA 4UAGA 1XJWA 4IHAA 2BKEA 1QLHA 2D4HA 3CLVA 4ISBA 1WL8A 4MAMA 1JI0A 4RF4A 4M0UA 3GLGB 1AC5A 3F5FA 1GRRA 1R0XA 4R2JA 4JLAA 2GDJA 3TDKA 3LFUA 4OMCA 5JQGA 5EZSA 2YKGA 3VR5H 4HKTA 4BZWA 1KKLA 2CLHB 1RXYA 4RA6A 3U3ZA 5IMSA 1EP1B 3GJ5A 1C7ZA 3PX2A 5GTDA 1KP3A 4PPQA 4UQOA 1XTIA 2FSUA 3NGMA 4YT5A 2NOAA 4XGNA 4K9RA 1GN9A 1RI3A 1W4AA 2P78A 5CU7A 3WP1B 3C85A 3FFWA 1OH6A 2X0EA 4Y8VA 3TDMA 3BCHA 3NOQA 3NFYA 3ADPA 3VH3A 1UBEA 2X2FA 4BVBA 4FZRA 4R1OA 4C2AA 3CSSA 1O58A 3C7KA 1SXJB 2P3QA 2CL7X 2YBDA 2VHJA 1FJ2A 3IV9A 8ABPA 1SXJA 3FAKA 1PQWA 1V6AA 4RD2A 3RU9A 3SS8A 4J1TC 4B7ZA 2IIQA 1SKYB 5K8IA 1RZUA 3DXFA 2ZQYA 1S2OA 5LBUA 4EELA 3M3PA 2Q5LA 3UPDA 4JFAA 2F1RA 3ZNPA 5FLEX 4MGYR 2VCYA 4QAQA 1RHJA 3DE1X 3C5VA 1ZH4A 1DADA 3OC6A 1AF4A 5FPSA 5IW8A 5I47A 3ABRB 1R5OA 1QHNA 4M1YA 3UHJA 2Y0PA 3CMMA 5LA6A 3K70D 1BVYF 4JXZA 1YZGA 2X1LA 2Q7DA 2FRVA 1OXVA 3K6JA 5IAGA 1RI1A 3N5KA 4KX5A 1SUIA 3UB4A 1Q0HA 2OM6A 3QBDA 1T8RA 3MK31 3W8DA 4ZT4A 5LD2C 1DXYA 1NQ5A 3IVXA 1FNMA 3N2GA 4ZC8A 2AVDA 2H29A 1IY8A 1W46A 2W8BB 3CF2A 4FXPA 1MC8A 2WWGA 3LLVA 1UJCA 3SHTA 1E9RA 2B34A 2C7BA 2PR2A 2EYQA 3UQYS 4RETA 3BPSA 3ROKA 2FJPA 2NZYA 1J2TA 2NO0A 1JYEA 1GZSA 2QP3A 2R8XA 3F4LA 4IVRA 5AK5A 3VAYA 1YA6A 3ZJTA 3A6PC 3HGMA 1SWWA 1TIPA 2CJFA 3AWIA 3O03A 4FNMA 4DV1B 1Y37A 2ATVA 3K0CA 4ZU1X 4LOLA 4JBGA 3VU9A 4E33A 5AI8A 5JCZA 2FQWA 2NTEA 1N3YA 1HFEL 3ADOA 3H6KA 4JC4A 3L8ZA 2L82A 2VBFA 3SJBA 2VJPA 4PFJA 1GU1A 2VHCA 4LRWA 5BV8A 3EVFA 4ZIRA 3QKWA 1W9MA 1T8PA 1U28C 2C5FA 2E18A 1EPUA 1A4RA 3COPA 4BAUA 1E60A 3EYWA 1NVVR 2YWHA 3F1LA 2D3TA 3BHNA 4YAOA 5LYJF 1YF3A 2P6MA 1XBTA 4TLEA 1G42A 1FA9A 4MYUA 4X8MA 2BTQB 3BG5A 3LWBA 4N49A 3RD5A 4C4ZA 2ZT6A 4AAYA 1JLRA 4LJAA 3EGIA 1U0OC 2BTQA 4PNPA 1PJRA 4X6LA 3PJGA 3RFTA 3GZNB 2PL1A 3KSDO 4IV8A 2NNWB 4MJ3A 4Q12A 1ZO8A 5HUQA 4ZQGA 3K31A 5C5IA 2VQ6A 1HE2A 2D8MA 5ENZA 3IV6A 4S0ZA 3U7JA 1NP7A 2JHGA 5KYUB 2CLSA 1ESZA 4NHEA 2ZE8A 4YCBA 1EBBA 1SR8A 3PWSA 1Z7YA 2ZBQA 5KYUA 2ZAMA 4C01A 5HCIA 3IQHX 4INAA 3QYAA 4MRPA 4FGZA 4YAGA 3IMCA 1ZVVA 4Q3NA 3BJMA 5JHHB 2VWQA 4N0EA 3RYTC 1USKA 2X9VA 2QTCA 3JPYA 4YQEA 4HQFA 2X1VA 3VGJA 4MYSA 4BNMA 1VB3A 2ZRAA 1M6VA 3BE6A 2J41A 3JARB 4MW7A 1NR7A 3NJRA 2VUTA 5D3KA 3G5TA 1BA3A 5IP5A 1NAIA 1Y5RA 1S2DA 1VHJA 1RM3A 3I6BA 1ZK0A 2PMDA 1IN1A 5ALEA 3B7PA 5D2CA 3IQGX 1N6IA 4BNNA 2BEWB 4QYIB 3GB9A 4ZVQA 3AY3A 4HT3B 4KITB 3GEPA 3KR9A 3MJCA 1XRRA 4HB4A 5IBQA 3SR0A 1WXHA 2UXCB 4QYIA 5DX1A 5AUQA 3TZBA 3HB1A 4DMHA 4IDPA 2X8WA 2AOVA 4URZR 4URXR 3EEFA 5E8RA 4C0HA 1NNEA 3JSXA 4E6PA 3PD0A 4CW7A 3FUXA 5KNBH 4WLFA 3L5KA 1D5WA 5C1OA 2REQB 4GZLA 1IU9A 3EVAA 4BKMA 4GLBA 1A8SA 1Z6YA 4JC0A 2IWHA 5B55A 1KYTA 1Y5MA 3TOCA 2X7XA 2REQA 3C1TA 3U7FB 4EHJA 4B3SB 3OQIB 4YRLA 1KI6A 4FHDA 4YA6A 3C3JA 3OQIA 5LNK6 4OXYA 1DPFA 2XUKA 3KOWA 1TOAA 2WV9A 1E5TA 2PMEA 2F55A 2Z2ZA 3E8MA 2ODTX 4B71A 1T1EA 2PH3A 2LGJA 3IFSA 1XTSA 4NPAA 1W4RA 3V97A 3O92A 5KB3A 1KRHA 2OGUA 1NE7A 3V48A 3IRUA 3WSWA 5C7IO 2A5DA 2G9QA 2Q27A 3GMSA 4K9SA 1Y4SA 3EDCA 2GN1A 2P2GA 2ZYUX 1WP9A 1G19A 3H86A 1ES9A 3PF9A 4EGQA 3BK7A 5HHTA 1Q21A 2VK2A 4FN4A 2WR8A 3RJ5A 4XGIA 3TNYA 2I6QA 4YLEA 4ENPA 2ET6A 1XCBA 3KTFA 3JRXA 4JHXA 1G4AE 1SA0B 3O1IC 3Q8XB 4HLCA 3WL6A 3I04M 3PF8A 5BNIA 1H85A 2AMYA 3WX0A 4AZWA 5JCXA 3C39A 4Z4QA 1LDGA 3DZCA 4S1PA 2EJTA 4AKTA 4CI9A 3RVQA 4LQDA 4N8SA 2HF8A 3O75A 1JIVA 5TX7A 4QOIA 4ZGWA 4L6CA 1XVAA 4M46A 1QLJA 4YP1A 4C3UA 1XPJA 4MQMA 4HXFB 3WLEA 1UADA 1O6GA 1NYRA 5AKXA 2R4UA 2FA9A 5FDFA 3KSMA 3L1VA 4FGJA 4FW9A 3RAGA 1OFIA 2R97A 4ZVKA 3UQZA 1W0KA 4AIIA 2VK8A 5CB0A 2WAYA 4D3SA 1KFCB 3NBAA 3J80A 3T7AA 4RHXA 5HG0A 4K03A 1VFPA 3W7AA 1E4EA 1T3HA 2C7VA 3HCDA 1O5TA 4LGCA 5BSMA 4YAIA 3IVGA 4HGNA 2FMXA 1RIFA 3NVAA 2QMOA 4J0FA 4A6XA 3KEOA 2J1LA 2VK4A 4EG0A 1YE3A 3GOQA 4XB6B 1CLUA 3HXLA 3JQAB 4LQLA 4MO9A 1FDVA 1AV6A 2XGSA 4P5DA 4UHHA 3MCWA 2YWXA 2QLNA 2CLLB 2RKBA 3CISA 4X93A 4CG0A 4EY6A 2ZIUB 1X7XB 4R41A 4X1OA 2I65A 3D0QA 2VYCA 1WUJS 3IBYA 1PEKE 3TIFA 1FJGB 1X7XA 3AHFA 4Y9TA 1JU9A 1RD4A 4XTRA 1BXRB 1HOTA 1NJ5A 3IGFA 1GZHB 1R50A 2IF0A 3G0CA 5DTRA 1XHEA 2CLMB 3AV0B 3HGTA 3MPUA 3OZIA 2FEAA 2JEYA 5MF6A 2F9LA 3O84A 2C5BA 4PLHA 4KLAA 3TJRA 4F0JA 5IANA 2QD2A 3AO0B 1JAYA 2GUGA 3DR3A 2E4YA 1TUBA 2DC1A 2XRMA 1FFEA 1U5AA 3CJTA 4NL4H 1QV9A 1VCIA 3MUFA 3IXLA 1TADA 3CF0A 5FPHA 3R0ZA 5EIBD 2Z2IA 3COYA 5DX0A 4R69A 3NTRA 1SPBS 4X1YB 1O95D 3W2GA 1JG6A 1ADFA 2X40A 2ZR7A 2RHWA 3BJEA 2WQZA 1FTGA 3M6XA 4GXQA 4B9AA 4DNPA 5CYFA 5BO5A 5TR9A 3GLFE 1JS1X 4O2AB 4J03A 2OO5A 4X44A 5F7ZA 3QRWA 3E5HA 1SC9A 1VGRA 1UFKA 2ZIXA 2EGGA 4KIJA 5SY9A 4JMPA 3T1OA 2ZJYA 5BPHA 1F3OA 4EM6A 4UOZA 3L8FA 2PY6A 2F8SA 3MMSA 3ZG6A 4U2FA 1UBSB 2VK1A 4IOLA 1W581 1OA1A 5DYNA 2BKUA 3QNMA 4Q15A 2ZANA 1WF6A 2R8RA 2E5FA 1UH5A 3GRVA 4TT3D 4M0EA 5JPCA 1KK2A 1YTLA 1QX4A 2CVOA 1CB0A 2GH1A 3AHEA 3OE1A 3QUBA 3NKVA 4H3HB 4WBNF 2PWAA 4ZYXA 4X66B 1IZ9A 1WQ1R 3UT0A 1GV0A 1H23A 1OT5A 3DL2A 4RQUA 1GUYA 3R9XA 3KB2A 5LP6F 3MELA 2A59A 2DTXA 1VE9A 3LDAA 4OO3A 5ARCA 1M74A 2MMGA 3GUYA 3QBJA 5AT1A 1NVGA 5FB3A 1KFJB 3FJ1A 4OHCA 3M49A 4MO2A 5FAKA 3QVSA 4Z54A 1OILA 4DQLA 4ROTA 2Z4RA 3CH4B 3EB9A 4AQYB 3LUJA 5LZ4A 5J5CA 1TTPB 3T3NA 4EUSA 2PZLA 2PLWA 4OFXA 4D0NA 1VBMA 3GLIA 3DAPA 2XVMA 3I5MA 1W36D 2EJBA 4AYXA 1WCIA 1UBOS 1JFFA 1Q1QA 4Q7QA 1ZI6A 1FXWA 3DE3X 1K9VF 4L0MA 4NMHA 2HA6A 3RWBA 3U3KA 1RQ2A 4JLMA 1YBMA 3D1VA 4XLZA 4ZALA 3VKGA 1PFUA 4MKFA 2HWKA 2XMPA 4MQ4A 2C8LA 4QPZA 5C5CA 3TSWA 2B0JA 1SU7A 2QTAA 2B35A 4EMUA 2WY2D 1NHWA 3TMAA 1Y9AA 2QN1A 3O26A 1M2JA 2IW3A 4NCKA 4RK7A 4XIGS 5ECGC 5JPDA 3FCCA 2I78A 4F06A 1KSHA 3BREA 4UTOA 1MJHA 4K5QA 1TQ6A 2G9RA 1OH7A 5CD9A 1P2VA 4OQYA 1CRLA 1RQNA 5D5HA 5LL6P 2DQ4A 3MWYW 2RJNA 4NG5A 4DCOA 3UAYA 1KDTA 5BUSA 4ZCTA 1U02A 3CPJB 1CEYA 5I3ZA 5DNYB 1X8KA 2VDJA 5IEBA 3Q7EA 2QJTA 3FKSD 4GOMD 4B9EA 3IP1A 1HO3A 1F8FA 1LDNA 3QE4A 4OHVA 4WBXC 3AH8A 3TQFA 4JLWA 4DC1A 5JJKA 4IP0A 4Z1MD 3ITEA 3D6TB 3BBPA 1LH0A 2LTAA 4MYRA 4F04A 2QJWA 4URHA 5BOSB 2R2AA 3G9ZA 2JB9A 1CIJA 3C98A 4IO1A 4K28A 3VR3D 2LZ0A 3OX3A 3QTTA 4WMLA 2DP4E 2W58A 5CAEB 3O8NA 4AC9A 4DILA 4XTCS 3P7MA 3MGBA 2YUTA 4YR9A 2YWBA 4BRSA 4CBVA 3U49A 1O3YA 5CAEA 1NMZA 4C6TA 1QIJA 4XSGA 3FLAA 4BFSA 1E1LA 4M9QA 3O8CA 4P8RA 2O06A 3GAZA 4Q05A 5AVKA 2CDNA 3TN7A 2WZCA 2FUG6 4MV0A 2Y68A 1FFDA 3NYIA 5D1NA 3LUPA 1P1IA 1VSTA 1WU8A 4MARA 4WFKA 1ZMXA 5TNXA 3UWDA 4KRGA 1FLDA 4EJ0A 1NZFA 2WEKA 4YXWA 2PZGA 4ZT2A 2ZSFA 4ZHQF 2VNSA 4DR2B 3NATA 4UM8B 3NHMA 3Q0IA 2EW8A 2WJ6A 1OFTA 3UXHA 4D56A 1KI1A 1KI9A 3ROMA 3AEUB 1JIIA 3D43A 4I50F 1BCSA 4M3NA 3KFXA 4ESOA 2ZQ5A 3IV7A 4GECA 1G60A 8OHMA 2ZXEA 1P1BA 3VISA 4X7PA 4B4OA 3JASB 3SVLA 3I23A 1JU3A 2CC2A 2I33A 2O2EA 1FS4A 2YJTD 3EODA 4EI7A 4RZIA 1USIA 4UMDA 1E2IA 5A03A 4ZYUA 2B82A 1Y89A 3D6NB 3KZCA 1HTBA 3Q3GE 1V1MB 1ZLYA 1F1JA 4L07A 1H2EA 2H7YA 4TWIA 5A3JA 3TGWA 2QRNA 1P1HA 5ALJA 2ZRMA 3C6YA 1S01A 1G5FA 1NFQA 1X2EA 1ZSNA 1TFRA 3LUBA 3ZHZA 3THYA 3R5JA 3F67A 4LSMA 3OWXA 4CKZA 2BOVA 1NUTA 1Z4JA 1OYOA 2I3ZA 2C3OA 3WLRA 1ML4A 2QG9A 1DKRA 1Q14A 1OFHA 4JQSA 1A8PA 1I4DD 2OCAA 2QW8A 2ZR9A 3U13A 3PDHA 3V42A 1P5HA 3OHMA 2ZT7A 3DBOB 4ND8B 1HQKA 1IPEA 2VJCA 3G2MA 1D1SA 4MVJP 2QL9A 2X9GA 3LP5A 2BKXA 1H6AA 4XR4A 4BYGA 2ZPUA 4BGEA 3MCAA 3FG9A 4TMZA 4DR5B 1LZKA 2B99A 1ABBA 3H75A 3GRRA 3DDZX 3JWJA 2NO4A 1ZUHA 5I9MA 1EFKA 1D6NA 4QYWA 3ZVNA 4OI0A 3IPXA 3V3TA 4QU9A 2MTBA 1E1KA 1IFXA 1WHSB 3QMMA 4GQIA 4J3FA 5E4JA 1JPVA 3HL4A 5DHAA 2BM9A 4FD2A 4P5EA 3UNXA 1RHRA 3IUEA 5EESA 4DQUA 3INGA 2OP0A 1X80B 3AXSA 4DW8A 1RDFA 3JVDA 1AN0A 3KXDA 5ADVA 4KMRA 3E0XA 1PZEA 2GJSA 3R0IA 4L9SA 4KXWA 4BMXA 2A30A 3BXOA 4GT1A 2N9UA 2Z5VA 3QU4A 4MRVA 4QBKA 2GBLA 3S5JA 4D9KA 5EUCA 3D0KA 1PR1A 2Z3WA 4ITUA 1EVZA 4F5WA 1N2XA 3I3OA 4FEEA 1UIRA 1JAHA 4BMCA 2G17A 2SHKA 1UM8A 2GK4A 3OLQA 1HDXA 4GVLA 3TVTA 1XZMA 3CRVA 1HQCA 4JZKA 1N9ZA 3ESBA 3OQ1A 1Z28A 1XYGA 2R66A 5LZ5A 4M21A 1VBKA 5HQ3B 5LQCA 3EA5A 1K4YA 4YT8A 3BWYA 4EUFA 1P74A 2ASEA 5J47A 3CEPB 1H8HD 5BSVA 2Q9UA 5GADl 3PPXA 3ZNNA 2GEVA 2PR7A 4U3JB 1KI7A 3JCZA 1WNTA 4UBJA 4BTVA 3RREA 3RK1A 4JXKA 5K4AA 2A9JA 3E0QA 2F59A 3DKKA 5F77A 2B5OA 4FIZA 2WWFA 1R4MA 1DUIA 2A0XA 5G4LA 5JDIC 1CRPA 3L6UA 5BR7A 3U0BA 2HLDA 1MAAA 1DE0A 3G88A 4DC9A 4K9KA 1Z73A 4ZQFA 3WK6A 3EC2A 2GRJA 2B4TO 4I9NA 2FMTA 4LVUA 4NIMA 4YONB 3SK0A 1K5DA 1VJ0A 4M9ZA 3HBNA 2C82A 3DM5A 5E9JA 1C3VA 3LCUA 4WZBE 2JKZA 3AWDA 1UOQA 1H6BA 5TLSA 4KNYA 3W6NA 3BH0A 3V8MA 5A4KA 2OPHA 4FNOA 4QHYA 5TC4A 4DMCA 4B3BA 3CEHA 3IJ5A 1OFUX 2HDWA 1WCV1 5TT1A 2FRDA 3SM3A 2AI3A 2H52A 1MX3A 4L7QA 2FLKA 1WKBA 2ZI4A 3CWCA 1NVEA 4M1TA 4PICA 4RQAA 5HS6A 2JGDA 4ZCLA 5KSOA 3NT2A 4MTLA 2H0RA 1T9CA 4BB0A 5B1YA 5B1EA 5KNCH 2ZB3A 1V7QA 4AX8A 1VG1A 2F8LA 4TMYA 4IJVA 1T0BA 2NZXA 4PG5A 4YRZA 1XRQA 2P9TA 1N6OA 1Z06A 5C8ZA 1H05A 1NPDA 2J32A 1I2CA 3OT1B 4P86A 4BDSA 4BEWA 5CB4B 4AJEA 1FDRA 5M34A 1D0IA 2F1KA 1Q19A 5EXEA 3VMMA 3EVNA 3OT1A 5KZMB 2A0FA 4F4HA 3SZGA 2JCXA 1XZ8A 1PLLA 2IS6A 1N2ZA 1YE8A 5H68A 2W2LA 1XZJA 4AJIA 1BD4A 4X5OA 3AVUA 4UQLA 3E9DA 5B3JA 2YXDA 4U2DA 3VAZA 3RUPA 1LWOA 1N2IA 2OV1A 3KEQA 3ZHUA 5A02A 3TZCA 3FTCA 5F78A 1KWKA 2CMDA 2XBUA 5EXXA 5FBWB 4BV9A 5FI5A 4NCXA 4KODA 2ZYHA 2VYNA 1SVIA 3A05A 1KVUA 2EDCA 2H1FA 2HBRA 3CKYA 3QE3A 3ZCVA 5DNDA 1QXSA 4OSPA 4XD2A 3EE6A 1DPGA 3SZLA 1L1QA 3BF7A 4MW0A 4QODA 3I30X 4C05A 3UKDA 2ZAYA 4HNRA 1QANA 1A76A 1TMGE 2DWUA 4MJLA 2A5FA 3GA0A 1TEVA 3OPXA 4AQDA 2R4TA 5A1JA 2HJGA 2Z08A 1RHKA 3M70A 1XZLA 1A5AB 1LLCA 1B3RA 1W5TA 1C81A 1DAFA 2OAEA 3MJEA 4GOOD 1L4YA 5DULA 3RVOA 2IRWA 3CVOA 3CWZA 5I7RA 4UNRA 1BE8A 3PHJA 3PYXA 1D8AA 1KEWA 1V7CA 2XYRA 3DFMA 3G7NA 3MMPA 4UTXA 2K87A 1MV5A 3VNSA 5HOEA 2XWSA 4MR9B 2NMVA 1UKVY 4RHFA 2O2JA 4L4SA 3W1VA 3JQ9A 1P81A 3MTIA 3ZU2A 2C3PA 1HT1E 4UCWA 3EFOB 1SVMA 1YR8A 1KEUA 5LXTA 1WXXA 3GRAA 2QVBA 1W85A 3OEED 3ZCPA 1W5AA 2Z09A 4G84A 4O4IF 1QTNA 3EFOA 1GYRA 3CUWA 2BF4A 3DVSX 3WDMA 4E1BA 2QHXA 3ZGXA 2G9ZA 1R6VA 1GZVA 3R7NA 3DO8A 5HDQA 2GEKA 2WNIA 1OB5A 2P5YA 3C3XA 4AT1A 1YS2X 4B75A 2PL3A 2RH5A 5TB5A 4ZHQB 5EJ7A 5CFNA 3SFTA 1PCXA 2IDMA 1O9HA 4HQNA 4Q5IA 4PYJA 1MX5A 2IXGA 3LUHA 4AY3A 1CS4C 1RYYA 4MV8A 4MS4B 2R6FA 4TXNA 2J4FA 4G5OA 4Y2QA 2NQ8A 5A7FA 4F91B 1MQ8B 2BHLA 1LBTA 1N0UA 2EKBA 3BRSA 3L41A 4MH0R 4NMWA 4V3CA 2BKLA 2A33A 3RO7A 4RV4A 3S8MA 3SC4A 3ETJA 3A2MA 5KREA 2WIGA 3AKZA 4BE9A 1S4MA 2B2NA 5EXDA 1DAGA 4XVHA 2IXBA 1P9NA 2Q1XA 3IPRA 3U56A 2PMKA 4UHFA 5FBHA 5GV7A 2IY8A 3JQ6A 4BKUA 4ESEA 5CDGA 1P0PA 3T7TA 2BJVA 3H2IA 5TF0A 2JFNA 3WADA 4KIWA 4HWSA 1X42A 4O2RA 3HK2A 3AESB 2VUSA 5H70A 4C9BA 1RKBA 1EZZA 1KO5A 3EZXA 2G72A 3AESA 5C31A 3C3PA 3F4BA 3EQ9A 5K8VA 1CVIA 1FS5A 4ZEVA 5LP6C 1N2CA 1HRKA 4JK3A 4RZ3A 3KJZA 2F43B 5GIPE 1NJ6A 2GNAA 2YJ3A 1OI2A 5LMZA 4XUEA 5BSEA 3A1CA 1T4CA 2Z5FA 1IXYA 4E5VA 2HPHA 1WTAA 3ANSA 4KQHA 3JALB 1YU9A 4JQOA 4R8RA 4WFQA 2G80A 4Q93A 1JDBB 5HF5A 2PUBA 3NBZC 4CMIB 5AOVA 2XSZA 4YGYA 1DQPA 2IV7A 3DF7A 1JXQA 2IXTA 4WXHA 4FLEA 1PS0A 2FN4A 1KIMA 1K7SN 2B4RO 3EZ7A 3WLKX 2Y99A 2BT4A 2C4VA 1I9CA 2DBQA 2Z98A 1SKAA 4BWYA 3CTPA 5IH7A 3D0RA 5TPWA 5CB8A 3NALA 1WV0A 5KYXB 4ZTUB 4UUMA 2WJZB 1BNCA 2R6AA 3RFCA 3HWX1 1E3MA 1HBJA 3CLHA 5KYXA 4FMDF 4B34A 3FYCA 4TYNA 5A0VA 4G9BA 1XPOA 1TJ3A 5EJ4A 1HEUA 1JI3A 4KPUB 1ONBA 4WNYA 5SY4A 1TQHA 1GITA 3DAFA 4KPUA 4LMAA 3TM4A 2WM3A 4L8FA 5DMXA 2OLEA 3GRFA 3L2OB 1MVNA 3N0XA 3PHGA 2FSHA 4D0SA 4AKIA 1NXQA 3IELA 5HEKA 1E62A 2BEUB 4MVJH 2FWRA 2PGAA 3NH6A 4OMFG 4ZT5A 1AQUA 3OQNA 1P0QA 1XZKA 5IT4A 4PZ9A 4LXQA 3LHFA 4YBRA 1CQJA 4ZAXA 1VGVA 4K05A 1OXTA 1OXXK 3SJUA 3KBBA 3QSYA 1EFRA 3CEMA 5CJJA 1Y63A 2ZBFA 3EZLA 3GGOA 4EJSB 1QONA 4MR8B 1QUEA 2QD1A 1SD2A 4M9XA 3ZEIA 1V1RB 1E2BA 2VAXA 1XRNA 4MR8A 3QV2A 4HD8A 3DAOA 1S8AA 1Y7IA 3TO5A 4ZO6A 4NS4A 1NBEA 1YZLA 4OFBA 4KO8A 3MQ4A 4H77A 4JGBA 4Q1EA 2VP0A 3CQ9A 3VVCA 3VUEA 3W9BA 1UXJA 5HKKD 4RIIA 2QRMA 2QORA 1PNOA 3FH0A 1J07A 5CLJA 1SHLA 4H0NA 4LYGA 2HUPA 5JJIA 1K7YA 2XQFA 1X38A 2WT4A 4B4UA 4O25A 3DLPX 4FFBA 4J75A 5F23A 4ZXPA 1Q77A 1YVRA 2QRUA 1Y8QA 2A94A 3N3AC 3RV4A 5DNWA 5G4KA 3WL7A 4TVBA 3D6HA 3HJCA 4L5BA 1XZQA 1FXUA 3HN2A 1IOWA 3PPIA 5M3BA 3SQLA 1X3LA 4OHBA 3ZHQA 1CPYA 3FTPA 3U61B 4MV4A 1QO0A 5K3FB 3Q2OA 3BFVA 5LLTA 2NO6A 4M8IA 4FPXA 2JZOA 1JEJA 1EVKA 1KY4A 4H7FA 5CPBA 2B4KA 3AETB 1XR3A 4EEZA 4TRRA 3X1MA 2YJZA 1USUA 4GP9A 5CXSA 3VI3B 2K7FA 4DLWA 1M2FA 1CNMA 1GA1A 1JZQA 1HG0A 1X8JA 1YQ9A 3MFYA 4Q3KA 5JRDS 3DNFA 2HO5A 2WJ3A 3ME5A 4L3WA 5KHAA 4B44A 4ENVA 4N7BA 2E4WA 2VJKA 4R9UC 4B2YA 1Y1TA 3FRIA 3H9EO 3G5AA 4NECA 2O07A 4GYKA 1WDKA 2ZBRA 2PQMA 3R5FA 4U7FA 2OGSA 3SP1A 3UHFA 3CBGA 1YK0A 2O0HA 3NBXX 5CVUA 1P19A 1QKIA 3RAPR 1I8TA 1UBGA 2MU1A 1E1QA 3FXAA 1IJFA 1PZGA 3OTOB 4ZRDA 1PF7E 3OVMA 3K70C 3DEHA 3NP7A 1EBUA 1IXRC 1E1NA 5BSKA 2V6BA 2Z6QA 2IYUA 1QWOA 5GJVC 3CZRA 4KZKA 3KZMA 4DUYB 2PYDA 5H8WA 3W5CA 3EMVA 3CV3A 2NZ2A 3N0VA 1RLJA 3ZV5A 4LHSA 5JSKA 5E7IA 4BO9A 1KYQA 3FVVA 4KGVA 5A0FA 3A9WA 4KMOA 4AROA 2FPWA 2EBFX 2LIVA 3TTSA 2HH9A 3QPDA 1NVVQ 3FR8A 4WNIA 3ZDYB 3TBKA 3GJ7A 3K96A 2HCFA 2ST1A 1WB9A 1V0JA 1JDPA 2XA2A 3UENA 2SKEA 2Q4RA 5GQSA 3WYGA 7REQA 3PDJA 5CHYA 1F48A 1HDYA 3LBIA 1Q1GA 1TYCA 4LMBA 3O2NA 4UM9B 4ILKA 1UFVA 3ZE8A 4GLFA 2J9XB 3BSSA 3ENZA 2LDBA 4YAJA 5DM70 4NQRA 3VH2A 1LKZA 3F8TA 3CUSA 3IIJA 2V1XA 4I4LA 1SD1A 4O4LB 4ABYA 4M7RA 4JI2B 2EHJA 2JRLA 3ZOZA 4WUTA 3U9SA 2QLLA 4FWBA 4O4LA 1J7JA 3NC1C 4LZOA 4EG3A 3LOQA 2AMFA 2AC7A 1P0MA 3FLEA 2QRJA 3VJKA 2OBNA 3N6VA 5AIBA 4WESA 5KYNA 1XEWY 3OECA 4GUAA 1OV4A 3DULA 3IERA 1SWVA 1P9OA 2D59A 3CRMA 4G63A 3RRXA 2QTZA 4IQ8A 2H4YA 3JQPA 3K2EA 5AW1A 2H1RA 3FZNA 3DFIA 2JFWA 1ZUD1 4HPWA 3FDZA 5TSDA 4ARSA 2HHHB 3IJPA 1R10A 2WUFA 3IOEA 4GBED 3CX7A 4RD0A 3CJRA 3EMBA 2I67A 2VDRB 3KD2A 5HNKA 3WFZA 5HK9A 1FLAA 4AJ9A 3PUIA 1B4DA 4ARIA 2Z2KA 2D0PB 3DTVB 2GYUA 3K0SA 4K81B 3M1YA 3AVVA 2A86A 1T5TA 3GG9A 1UK8A 1C0KA 4TZ0A 6CHYA 3DTVA 5CT6A 4V1CI 1V8PA 3V4SA 1EB8A 3BDIA 2FPGB 5FTMA 1EXDA 3NV9A 3AY0A 3ETLA 3RS5A 4LHYA 4GQBA 1G3RA 4RVFA 5FL7A 2NU8A 4XGQA 3PFFA 5BW4A 3T5AA 2QRLA 1MG0A 3K6SB 4B48A 2J4CA 2E4VA 3KUUA 1ZN7A 3BFJA 3KUXA 1QH8B 5J59A 4OLAA 1ULZA 3FI0A 2QLFA 3OQHA 1UZLA 3ZX4A 1FMCA 4HWGA 1WABA 4KNVA 3G2PA 1NJ1A 2I6FA 2PXHA 1UPFA 1DTWB 1NW5A 3A1FA 3EN0A 4E4YA 3C5CA 4I9UA 3Q0EA 1TM7E 2Y1OA 5GINE 1M1NB 4A7PA 4CT5A 4CTKA 1DTWA 1U5CA 3IQXA 3W5BA 2J5XA 2CLDX 2HHLA 1GY8A 4I14A 3IAEA 1M75A 5DHQA 4BZZA 4D4LA 4F6RB 1XU4A 5T3YA 5EJEA 3EIWA 1QRRA 1XD2A 5FI1B 1EUDA 1J6UA 2Z8YA 3MCTA 4ITVA 4KBFA 4EKGA 4F6RA 1ONSA 5C4GB 4UJ3A 3BE4A 1WEHA 3REQA 1QZZA 2QPAA 3PGLA 5DYYA 3AUSA 3VHLB 1Z5WA 4TTIA 3IQEA 1EMDA 1C8BA 1P73A 1YCFA 3AEZA 1E99A 3G3EA 2EFCB 4MGZR 2WJPA 4MQFA 4Q9JA 1VI6A 2E49A 4YMGA 3EQ6A 2I9PA 2J5KA 3A3NA 3GLTA 1BO6A 3PPVA 4HN4B 4RSHA 3MMXA 1GAEO 1MB2A 3ITNA 5FNZA 1HDGO 1PG2A 1HQYE 5IBPA 3SIRA 3KJFA 4OBBA 4UUPA 4ER6A 3L1UA 4DLVA 4LN1A 4KBYA 3HFSA 5DCLA 3G9QA 4R0MA 1NU6A 3STWA 3EW9A 4BP1A 2A3NA 4X1KA 4D9MA 2C5AA 2IP2A 3ASUA 2X9QA 4KKXB 5LPNA 3FPSA 1TM2A 5AKHA 3BMQB 2GXAA 2PUVA 1H3EA 1ECGA 4XH9B 1T36B 3R8CA 1KAQA 2Z1DA 1M72A 1O96A 2R8YA 4F3TA 5FWXB 4RY9A 5BOSA 2QPTA 1D2CA 4K9MA 2JEOA 1WDTA 3LMKA 1GRNA 2E0IA 4URVR 4X3CA 1ODCA 4MQ6A 3QHPA 4NMLA 2OO7A 2OXFA 2GCOA 2I3BA 1ARZA 4QGBA 1HTWA 3ANYB 4XPIB 3E53A 2RE8A 2VUIB 1TYDE 3LX6A 4ML3A 4XW2A 1TM3E 5BSUA 4BQEA 4GF5A 4I1PA 4H1TA 4HYEA 4RK5A 4X41A 2C1XA 3TSAA 3W2HA 3ZKWB 3L0DA 2J3HA 5DYGA 4BFVA 1U2EA 1M7GA 2CCKA 3LUDA 3Q9LA 1SGWA 4LDZA 3U3JA 5HK8A 4WOJA 4FTWA 1N92A 3BK2A 1AZWA 2PXCA 4KQFA 1G9TA 4WY2A 2O3JA 4OQDA 4BO0A 5L3ZA 2JIZA 3LUCA 2RH8A 3IX7A 4ZOCA 5K1ZA 3ZGNA 3MT7A 2X0JA 5IWCA 4NCAA 2P6UA 3GGCA 1N4AA 2A4KA 4BEBA 1P7CA 3WLFA 4DDUA 1NLYA 4ZEMA 5EJIA 1DBWA 1A2KC 2IQIA 4LYHA 2VS1A 1D2GA 2Z6AA 2QYOA 3C5EA 4QO7A 5FTWA 1L7EA 2UVDA 1NJSA 3ZJUA 2H4ZA 3K0AA 4D25A 1V2HE 4ZC1A 4GMDA 1YNSA 1ST2A 3EDRA 5BWOA 1NUQA 2NLOA 3X3HA 2RHMA 2FN3A 1MB9A 4PU0A 3T34A 1I1OA 2MSEB 3DZBA 2GEFA 5ITZB 5E38A 2PKCA 3D3EA 4IJQA 1F2DA 1DBIA 4RH3A 4FU0A 4AUMA 1U2QA 2IELA 4Z51A 5LWQA 1NPTO 2XIJA 4NH4A 2O54A 4BMNA 4M83A 4EB8A 2MT9A 3FY4A 5BVHA 1ZJ4A 1NASA 2VEDA 3AC0A 2JPDA 4ZOQI 4AO7A 2CW5A 1GGNA 3AZOA 2AOTA 1SBQA 5EIBC 2YHBA 4WCFC 3B9QA 3MTAA 3N8HA 3CZMA 5ELMA 1SVWA 1O95C 3RIYA 1PUJA 3BQMB 2FZKA 2GMWA 1GLNA 2X8JA 4PLGA 4QGSA 2ZAOA 1KK0A 3E22A 4J76A 2P11A 4HH3C 5C35A 1XCMA 4JJ7A 1JHPA 4MP3A 4A2CA 5FWYB 1OB2A 3GT7A 1DJLA 2OGWA 3P9PA 1E2FA 2IJGX 4LRQA 4YS6A 5FI0B 4AZVA 1FUIA 4Y9SA 5CLFA 4ED9A 1N33B 1A9PA 4OK3A 3WE7A 2BKAA 2PRZA 4U7WA 1NIPA 3RTEA 3R9KA 1R2QA 3EOBI 4Y0VA 2AOXA 2HZBA 4R1LA 3WI7A 1DZIA 1OX6A 1UT5A 3DPSA 3SMQA 1ZMTA 3MBKA 2YZ7A 1U8AA 2HEIA 1V5IA 4G26A 1LK0A 4TMWA 3VR2D 3N0WA 4HH4A 4OJYA 5A3VA 4QWMA 3NHWA 1J22A 1GHTA 3VZBA 3H5TA 4F1KA 1DUSA 4R40A 2XMZA 4MWZA 2FGJA 4NU0A 4OYRA 4ONEA 3D3NA 2JGEA 4IS3A 4F6LA 2WQ6A 1N5OX 3G5UA 4MA0A 3NBYC 4PNEA 2EJCA 2NTVA 3O0DA 4FQ5A 2Y1WA 1W9HA 5B3AA 5B7QA 3A25A 3AI2A 4Z49A 4PIVA 4XGKA 3MRSA 4LJKA 1KMHA 1TCAA 3TSOA 1P0CA 2I80A 3UB3A 2J0VA 4H3SA 3ZBQA 1XQYA 2NACA 2PN1A 4DVJA 3N53A 1E96A 1W1IA 4GM4A 4C1BA 3M1AA 3P4UA 3SHFA 1U0HC 3RK0A 2WM2A 3I28A 3GCZA 4MUXA 1NI4B 3G13A 2NXNA 4UZFA 1W36C 1RWOA 1FLVA 3GP5A 4GSYA 5AVYA 3EF0A 2AG6A 4G5HA 5IXYA 3COZA 5IXJA 1VIMA 3C4JA 4PPYA 2GZ3A 2Q6TA 3KYCA 5HM6A 1L7DA 3AEKB 1LLQA 1XVVA 5KNDH 2I6TA 1URPA 2YN0A 1PNVA 5M7EA 1JR3D 4WX2B 1PI3A 1XF1A 2GWHA 2R5WA 4X24A 3KJQA 5B53A 3AEKA 1M0TA 3V2UA 3VJRA 3O95A 4GMGA 4JB8A 4YQZA 4HPJB 4HF7A 1QQBA 1I0IA 1RIIA 1RPAA 4M1ZA 8GPBA 2GKGA 1L5OA 2IY9A 4KJXA 2Q5EA 3H1AA 1K8QA 2QB5A 1DIBA 3OIYA 3QNWA 4LX0A 3UJDA 4IGKA 1IM2A 2YCLA 1H0RA 3H7IA 5DNCA 3EVTA 4LOAA 3QX3A 1QK5A 4RNCA 1UKAA 1GADO 4LW8A 4CFYA 1KS9A 2JJ2A 4MIKA 1Z5GA 5DBOA 4PIPA 3EG9A 3Q1LA 1J00A 4GKAA 2CL6X 1LNZA 2C94A 2F00A 3ID6C 2R7NA 4H08A 5WRFA 1ZOIA 2Q4OA 3BXHA 4YDSA 4EHDA 1W73A 3V7NA 2EQAA 4NATA 1E9EA 1LNQA 4A8JB 1TTTA 2H5LA 2CFIA 1JIQA 4CM1A 1V7PC 1Y1RA 4C29A 1HE5A 1QCCA 4ACAA 4A8JA 5HKOA 2VR1A 2XH8A 3EXAA 2X23A 2CYCA 3GZJA 2N75A 3I4CA 3CIFA 3JQBC 5TT0A 4C07A 5L8VA 2HU7A 4DR7B 2G9VA 3ZVRA 2RI1A 3SHWA 2BF7A 3KQLA 2MIIA 3K5PA 1GT91 2F3PA 1S96A 1KH3A 4PXYA 4UVDA 4KLRA 4PGHA 2Y1KA 4XJSA 4HGQA 4LJ9A 3F3YA 4LYAA 1L4HA 1FX0B 2I3AA 2XITA 3DMRA 2DUWA 3W5UA 2CNNA 4N0PA 2Q0QA 2JLCA 2PJUA 3ZN2A 5EFOA 2NSDA 1W7AA 4YCAA 4Y9RA 4BGVA 4LV5B 2VDVE 3FPHA 2WYOA 3SGLA 3HYTA 3I04A 4HVLA 5SICE 4FCCA 3BHMA 4ZTBA 4J1TA 1K27A 4O4HF 3TUIC 1MZPA 5FUYA 5EINA 3BTVA 4LDAA 1UP6A 2BSXA 4PZEA 2BDEA 3PEFA 1ZN9A 2DHDA 4D3ZA 5KX5F 1L3CA 2Z9CA 3MFQA 5PGMA 4E3ZA 4RCZA 4UEQA 2DUJA 2GVNA 2I2XB 4NAHA 2P5UA 1MJFA 3ICVA 2D4AA 5ERYA 3RARA 3TRHA 4B09A 2HLNA 1IXZA 3LUAA 5IK2A 5DM1A 2QSZA 1IRXA 4KE8A 5LD2B 1DKQA 3R3ZA 1QGUA 3V2GA 4D5EA 2ZM5A 3BMXA 4LHZA 3IQIX 2I1LA 4U4AA 3I1FA 3AU9A 3U9LA 4JROA 3ZVLA 3NIBA 4F2PA 4GR4A 1XEAA 5H4HA 2JD0A 2Q29A 4OKIA 4TKVA 4GO1A 3QJ5A 4FYYA 3SVTA 4CMBA 2OQ2A 2R6DA 1JMYA 2FPKA 4C4SA 5FT9A 4ALIA 2WA2A 2XCLA 4AZTA 3KR0A 2V6GA 3V1MA 3NKFA 5JASA 1P1KA 4NU6A 3QLJA 3VC2A 3W77A 4UBMA 3K71B 4MAFA 2EGUA 4OB7A 4ZO4A 2OQVA 3LBAA 3VR5D 1Z38A 1R0ZA 1HDOA 4ZZ0A 3GFPA 2RKWA 1U0BB 1WDMA 2AV6A 3H18A 1ECBA 5IAJA 1WVGA 4G24A 3WIVA 1W47A 1QAQA 2V55B 3R40A 1J99A 2ZBPA 3GLFB 1UOPA 4U7DA 2RGUA 3GLFA 1F60A 4DY6A 4PBTA 3WGYA 5F7OA 2J6IA 5T41A 5LQRA 4NK5A 3KJEA 1QGED 1FQWA 1RI4A 2MJLA 3R5XA 5B7GA 5FBVB 1U28A 2QRQA 4TTQA 2IE8A 3A7DA 2JD1A 4NZ9A 3A4TA 3T4UA 2NZVG 3X1JA 1JJVA 1TRHA 1LPPA 1ZRHA 2CNLA 3QXCA 5ERXA 1CYEA 1LPAB 2AF3C 2W4QA 1GG9A 2WIBA 3AR9A 3GN1A 3GUZA 4QUDA 4QREA 4X63A 3ZDDA 1B23P 3GUVA 1UMBB 4KO4S 4PZZA 4P82A 1DFGA 1R9NA 3V00A 3GPLA 3OUUA 4KQJA 4B80A 1HXHA 3STHA 3QXHA 2K2WA 1LVHA 1L3BA 4F3KA 4XZ3A 2FPUA 1GU7A 1R1DA 4V1CA 3SZ3A 3EGXA 3S8EA 1O87A 2P0EA 1IK4A 4NCJA 1NW4A 3WQHA 5JYCA 3KVOA 4S24A 2F7SA 5B4VA 3T61A 3TLCA 2JZCA 2V6MA 4F9FA 2JFOA 1NX6A 4QRHA 1SZPA 4WGGA 2AA3A 2AJCA 2FYTA 5EJGA 5BYKA 3IOCA 2IPOA 4OXIA 4RDHA 5JYEA 5HZHA 4C2UA 1CEEA 1IEXA 2IH2A 5BMVA 5BNWA 9ATCA 1JE0A 3B85A 4F21A 2B5WA 3JD1A 2OZPA 3KM0A 4HRAA 1VOTA 2R1UA 2OO3A 3WNVA 3BRWA 2VN8A 1JLHA 3F97A 5CFZA 2W0SA 3PHBE 3MAJA 4N0MA 3IDSA 1EUZA 1R8JA 2N1MA 5JR3A 4JI7B 4FOTA 4YUZA 2JHPA 3QEBZ 3BMOB 3C0KA 3RHFA 2WSYB 4HDAA 4WLOA 3RGWS 1IJKA 1XP8A 2IYRA 1CUCA 2XMDA 2XAUA 3AFHA 2VYVD 2VZ8A 4DSAA 5L6MB 3J7AC 1DG1G 3GT3A 2WKQA 3NH9A 4ECAA 4WXRA 4X64B 3B8HA 3HLTA 4O3MA 1DXHA 3RUFA 1W2WB 1JNYA 1MC1A 1DJNA 3AL2A 1VHWA 1NMXA 4Q16A 4Q9IA 1GPUA 1TJ5A 5BR4A 1KF0A 1PNQA 1IBMB 4WCVA 4LS3A 4G5FA 4LCJA 4XWGA 1THMA 1PL7A 3LA8A 4V0LA 1P45A 1ZDMA 1QTQA 4D02A 3PEVA 4YMIA 1AK1A 3GPBA 4G8JA 1DVRA 1ST3A 2GN8A 5C8VA 4GNKA 3UH1A 1OBOA 3FGZA 3T5BA 1TT5A 2VG8A 3IA2A 1RMQA 2XWPA 5E0KB 1Y3BE 1JFRA 3Q7IA 2RIPA 3LL7A 3WKDA 4M49A 1DXOA 4D8YA 4MKXA 2IBTA 4TVSA 3R3HA 1RWKA 5BN5A 2FW6A 4R1NA 2PIAA 1VPTA 3KFVA 4DIKA 1Y3DE 4GS5A 2DPHA 1PR4A 1E1CA 5DP1A 5K2OA 1NNSA 1FYWA 4XYEA 1LVGA 3TQIA 2ZM6B 1QE0A 1RRPA 4J6FA 5HCNA 1XZIA 4K46A 1IVSA 1T8WA 3UHPA 4TMVA 4Y2PA 1MW9X 5BNZA 2IV2X 2FUCA 3BTUA 2ONZA 3ROTA 2OKGA 4RJ2A 2IE0A 4UM5A 2Z3VA 4KLNA 5A5DA 4J3NA 3QV1A 5DGTA 1E1DA 4RTOA 2GHIA 5JAHA 2O8DA 3FYUC 5KQPA 1TA0A 3BQNB 3DR5A 4J7XA 5FOXA 1NOKA 2LKCA 1RYNA 2XGMA 3MB5A 4JT8A 1SK9A 4P7FA 2CHVA 3WAJA 2Q3CA