2BELA

Structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
243
structure length
243
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
publication title The High Resolution Structures of Human, Murine and Guinea Pig 11-Beta-Hydroxysteroid Dehydrogenase Type 1 Reveal Critical Differences in Active Site Architecture
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 91
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2belA00
4PZEA 1IHXA 3IUPA 3VPSA 4MIEA 1U2GA 4YAKA 2JL1A 3GAZA 4UUPA 4CUJA 3WFIA 2WYWA 1ISHA 3PYXA 1V0JA 3N7UA 4AJ2A 4DQVA 1KVUA 3S2GA 1VM6A 5KCZA 2DM6A 3MOGA 4J43A 1MP0A 2JCXA 1WLYA 2CVQA 3BTUA 3INGA 4IDFA 4BNUA 2POQX 3BMCB 1PL6A 4I08A 5IDXA 4OYRA 3KYDA 3ZWOA 2CD9A 4RVHA 2PNFA 1E3LA 4Z9XA 3VVCA 4IDCA 3KEOA 2QHXA 2A9FA 3BHJA 3CH6A 4R9RA 5AVOA 3ZNQA 2VQ3A 1Z7EA 4UREA 5DULA 3TF5A 1T26A 4I5DA 3U62A 3INTA 2Q46A 5K9ZA 1T1SA 4NFHA 3MJTA 4DMLA 1DXYA 3JQ6A 1GYRA 1VPDA 2FSSA 2WD8A 3ZV4A 3IJPA 3DBLA 4D44A 4EGFA 4XRRA 1ENYA 1AXEA 1SOVA 3DZIA 1BG6A 4OKIA 2YV1A 3FNFA 2B83A 2QRLA 4F46A 3VZPA 2D2IA 5CEFA 4K28A 5JC1A 4DQUA 1YDEA 4JP2A 4AJ1A 3LU1A 4J7XA 4NDNE 4ALJA 3RBXA 4MVJE 2Q50A 1DIHA 1XSEA 3FPLA 1SEVA 3U09A 4HV4A 3ITKA 1EUDA 1T2FA 2PKRA 3WQSB 3FWNA 1B3RA 1LLQA 5T6BA 3GMSA 4DA9A 1H94A 1SNYA 4CMCA 5KNLA 1N9GB 4R16A 4WCFA 3TZKA 2IZZA 5T5QA 4ND4A 4E2YA 3JD4A 1R15A 2YDYA 1ZW1A 2W8ZA 3KO8A 1ZIDA 1JAXA 2HO5A 4GX0A 1M75A 1PGOA 4I5EA 2CF5A 2W2LA 1HDZA 4MKZA 4ND2A 4IJKA 3RWBA 3U49A 1Z73A 3GUCA 3WYCA 1PQUA 1WDMA 5CEJA 3PLNA 3GOHA 2VHYA 3L9WA 3MJEA 3JQ8B 3NTOA 4CQMB 4NIMA 4NI5A 5J23A 3C7CB 1OMOA 1R4MA 3G17A 4PGFA 2C29D 5AXBA 3JQFA 4RVFA 1ORRA 3FPCA 1LC3A 3LSYA 1PWXA 3WOHA 3ZWMA 3PYLA 5HRUA 1U4OA 4PRLA 4N7RA 1R4NB 3KLMX 1HTBA 1S6YA 3ANLA 5T8KA 1PJ2A 1ZSNA 3OHSX 5A04A 1X13A 1OI7A 2GR9A 4IZIA 1VL8A 2Y1OA 4ROSA 1A9ZA 3FNGA 1ZUD1 2VHXA 4K1LA 3PVZA 2D1YA 3PQEA 3ZWWA 3KTDA 4A2CA 3UW3A 5CG2A 2Q45A 1I10A 1O5IA 1P1IA 3SLKA 3D5QA 3H9JA 3ITDA 1A7AA 4M89A 1DIGA 5A5EA 1PGPA 2AQ8A 4WLEA 3AWDA 1HDYA 4IS3A 4FN4A 4D45A 1JU9A 2VHVA 5I8WA 4YRDA 5G0SA 4PLTA 3CZMA 3HE3A 1ZK1A 2YY7A 1QYWA 3M1AA 3O8QB 1H0KA 1GFSA 5DBIA 2BFAA 1JKFA 3PK0A 2PGDA 4MP3A 4ZQBA 1KEPA 5H81A 5A05A 1QXSA 4XGKA 5L9AA 2JAHA 3OBBA 3I9JA 3JQEA 1PSDA 1DC6A 1LDNA 2ZYAA 1DC3A 3B1FA 3EGOA 3JQAB 3NT5A 4Y67A 4YQYA 4BO6A 3IMFA 5A9SA 1BDBA 3PHGA 1YB5A 3EYWA 1DIBA 2EKQA 3OIFA 4WECA 3F46A 3BTVA 3W4IA 2EGGA 2ZCUA 3CKYA 5TGDA 1VKOA 3SX2A 2SCUA 5EESA 1WW8A 5IDWA 1XELA 2Y1CA 2PA3A 1GYPA 4KDEA 3PQFA 2NVUB 3H65A 3GGGA 4MVJA 4E33A 3FR8A 5EPOA 1NR7A 2BFPA 3E03A 3GG9A 3QVXA 4ZQEA 3AM5A 3PGXA 4J3FA 3ZWPA 4CQMA 4DXHA 1UUFA 4DGSA 1MXFA 3TJRA 3PWZA 1NVMB 4II2A 4BGVA 5B4TA 4L76A 3S2IA 3K6JA 4DTIA 4HXYA 2PGJA 1T2EA 3JD2A 4ND1A 1C1DB 3OJ0A 4OXNA 2XPCA 4AJIA 1N7HA 2HCTA 3IUSA 3I9KA 1PGNA 1R6DA 2VWQA 1K5HA 4CM4A 4FC6A 3FD8A 4XB2A 2VZ9A 4RPJA 5BQFA 1ZXBA 1TVEA 1Y9EA 3BMOB 4QTZA 5T64A 4CLDA 3G1UA 3L07A 1HE4A 3PDUA 3OJLA 3QVTA 4MDHA 3P7MA 4ALMA 1QRRA 1V3UA 3HB4X 4FFMA 1BTOA 2FMUA 3PRJA 4WNCA 3RAJA 4DPMA 3BTOA 2CDCA 4WLNA 5ES3A 1NVTA 2NSDA 3JD0A 3RUCA 1Y8QB 3TFQA 2P4QA 1YONA 1HYHA 3I6IA 1Z7BA 1H6CA 4MVJG 4URFA 5DBFA 3GEGA 4YXFA 4R1UA 2R2GA 1Y7TA 4AJHA 2WTBA 3W4KA 4GSLA 2BLLA 2X0RA 4J2HA 4NBRA 3ROQA 4XZ3A 4WLVA 4KMSA 1EQ2A 3L9XA 4CMIB 4PLWA 2GGSA 2PKQO 4QT0A 1YE3A 4GWGA 5JLAA 1WDKA 4D0RA 1ZK3A 3HUDA 3AOEA 3L77A 3MJSA 1A9YA 4J1SA 4D7AA 4ZGWA 2PLAA 4HADA 2DBVO 5TJHA 1LU9A 4LMPA 4DQXA 3GVCA 1GZ3A 3H3JA 3R3SA 3TOXA 3D3WA 1BSVA 1VRWA 4NK4A 1YVEI 3H9UA 4PZCA 3CE6A 1NPDA 2PTGA 1Y5RA 3EVNA 5IJZA 5JAZA 4ID9A 4WUVA 1PGJA 2CNBA 1QV6A 4NJMA 5B4UA 1FDSA 3U9LA 1NQTA 2D3TA 5DP1A 4I5GA 4ZICA 4KDFA 1EUZA 1E3IA 5KOIA 3PYMA 5CDUA 5EQDA 2I66A 1DOHA 1R66A 2NM0A 2Q49A 1KVQA 4NBUA 1XQ1A 3FCOA 3RIHA 3U4HA 5IF3A 5KJEA 5F1OA 1SB8A 1U7HA 2XOXA 1WMBA 4GMGA 4EEXA 4J2OA 4BKQA 2PH3A 2Q1UA 5DCUA 4U7WA 2JJYA 5IG2A 3MEQA 4JBHA 4UVDA 2WJPA 1JQBA 1C1DA 2NACA 1CETA 1E7SA 2GO1A 4JCOA 4TWRA 3KSDO 1HLDA 3ORFA 2ZK7A 3CUKA 1A4UA 2CY0A 5A4DA 3GQVA 2IXBA 3IP3A 4NG5A 2P5UA 1A4IA 2X58A 2HRBA 3FHLA 3JD3A 2P91A 2OFPA 4XJTA 1Y8RB 1A71A 3VTZA 4D41A 2W2KA 3CXRA 1X7DA 4IDEA 4DC1A 1FDVA 1JVBA 3FNHA 1LLDA 4OOFA 4XB1A 4FFLA 4KTTE 1PQWA 1YDWA 3VTFA 4AVYA 4IINA 4GGPA 5JS6A 1VSVA 2FN7A 5DF1A 5IZCC 3L6DA 2Y1FA 4PLZA 5HWSA 3HJAA 2PZLA 4BNVA 3KVOA 4TKLA 5TX7A 4CMKA 1LX6A 1M66A 1NVGA 4UUMA 4OKNA 4ITUA 1E7YA 1KBZA 1GR0A 2FR8A 1D4FA 3NAQA 1NP3A 3QE3A 4PVDA 3QJ5A 3ZWAA 4PLFA 4CM1A 5L7TA 4TQGA 3KUXA 1Q1NA 1L7EA 1A7KA 3I9MA 2O3UA 4HP8A 1FF9A 1HE2A 1HDGO 3DR3A 4ZQGA 3ZNNA 2BI8A 4XQCA 3DMTA 5IXYA 1MG0A 1ZK0A 1PJSA 3HADA 2YUTA 2B4QA 6ADHA 4M87A 1PJLA 5JO9A 3KSUA 2V6MA 4HFNA 3H5NA 3MWDB 3EDMA 3JQ7A 1M67A 2AQKA 4DIOA 3OEWA 2X86A 3L6OO 1ARZA 3S55A 1DRUA 1BWSA 2IEBA 4E3ZA 3ZWBA 5CAEA 1WP4A 2PZJA 1HDXA 4N5MA 5BSFA 3DQPA 1U8XX 2EHDA 3JSAA 3AUTA 1E3EA 2FHSA 3FBGA 2NVBA 4FS3A 5A3VA 1P1HA 2J3KA 3I9NA 3AOEC 3I6QA 4YB8A 1BW9A 4RGBA 5DBGA 4E30A 1GV0A 5A02A 5K6AA 3WGIA 2OGUA 2QYTA 3UAGA 2C7VA 3UOGA 1UP7A 2LDXA 4N5NA 4CMBA 3M1LA 2FZWA 3W6ZA 5IDQA 1X7GA 2GD1O 3D7LA 1DJNA 1F8FA 1O8CA 4IQGA 1QLJA 3MJVA 4DPKA 3QV1A 3BZUA 2D0IA 3GZNB 4FQ8A 4Q3NA 3JQGA 4Q39A 4EUHA 3MZ0A 2WEKA 1OOEA 4D79A 3GPDG 3BYZA 2FWMX 4N5LA 4RJTA 1N5DA 1UAGA 4JJFA 1OZAA 3KXDA 3V2UA 3SVTA 3RFTA 1NTOA 3P19A 3DBHA 2EGHA 3DOJA 3AUUA 9LDTA 4EJMA 1LDMA 1QSGA 5F5NA 2ZB7A 4CQMD 4IDDA 4UVHA 4CODB 2GERA 4AJNA 1NX6A 3BHMA 5L4LA 4WOJA 2BFOA 1EDZA 3I23A 4XD2A 4BKUA 1XIVA 5TNXA 4BNMA 1CDOA 1EUCA 3ABIA 1SPXA 3IOYA 3EK2A 4CR6A 5C5IA 5TJ9A 4AJJA 3DTYA 2RHRA 1V9LA 3H3FA 1ZK4A 4DC0A 2ILTA 4JN6B 4OGWA 1U3UA 9LDBA 2EP5A 2P2SA 2WE7A 4JROA 3PJFA 5F1PA 1J49A 3JV7A 1PIWA 2GYYA 3JQBA 1QV7A 4PLGA 4D46A 4KUEA 5DNAA 4LVUA 4IMRA 3WMWA 4AFNA 5IXSA 4IJUA 1H6DA 2ZTMA 4HNHA 4PIVA 1T2CA 4QO8A 2WYUA 1YH3A 2UVDA 3OJEA 3D4NA 1JWAB 1PZGA 5A9TA 3UFXA 5TF4A 1P0FA 1W4ZA 3IJRA 4G5HA 1Q0QA 1QLHA 2X9GA 2O4CA 4HY3A 4EZBA 4F6LA 5I7VA 1M6HA 1LDGA 4CQLA 3ASVA 2OP0A 1NFRA 1N92A 1MUUA 3GRPA 3RASA 5AQ1A 3U5TA 4TVBA 3W6UA 3RFVA 1Q7BA 4NQZA 1EBUA 2I9PA 4TVOA 1ISGA 5AXDA 2V6FA 5U1PA 4N18A 2FP4A 4YT5A 5BNFA 1Y1PA 1PJ4A 1TB4A 1QP8A 1Y6JA 4FGWA 1K6XA 2BKAA 2R6JA 1E1NA 2D5AA 3PIIA 1IPFA 1Y5MA 2ZTLA 5U4QA 2VN8A 3DMTC 3NEPX 5L3ZA 3KYDB 3Q9NA 5LC1A 3Q11A 6LDHA 5IN5A 3DFZA 2VZ0A 4UVIA 3ZH2A 2DQ4A 1DRVA 2HRZA 3IIEA 3TOZA 1NQOA 2X7HA 4MP6A 2W98A 2ZKLA 4H7PA 3A14A 3A9WA 1V35A 2E48A 5KVQA 1ZMTA 4H15A 4J90A 4LMRA 4TZKA 1H6BA 2FSVA 1B8UA 1J5PA 2Z1MA 2ZYGA 3GZ4A 1HZZA 2PY6A 2VUTA 1NXQA 1T4DA 1ZCJA 3DONA 1DIAA 4LRSB 5ILGA 3WX0A 1XCBA 4IIVA 3IAHA 4AJEA 4Z0HO 2O7QA 3JD1A 4ALIA 3BXXA 1MV8A 3VOSA 4CM9A 3Q3CA 3WICA 3B20A 3G1TA 4JIGA 2C59A 3KRTA 1HDCA 4Z3KA 1QKIA 4NU6A 3I5MA 4CM6A 4X54A 1YKFA 2NWQA 2RCYA 3BIOA 4FPXA 1VL0A 4R1NA 4W9NC 4YYZA 2OUIA 4CUKA 1MX3A 4ZHSA 4L75A 3Q6IA 1H9BA 2JFHA 3PTZA 1EMDA 1KYQA 4WASA 5DP2A 3ZU2A 3FTPA 1GAEO 2CMDA 5DOVA 4CL3A 2O2SA 4GWKA 4MINA 4AJKA 4D0SA 3NDJA 5B37A 2A92A 4B8WA 3QWFA 1SB9A 5HTOA 3RI3A 2UYYA 4XYGA 1YBMA 2F1KA 1DRWA 4CMAA 4OOEA 1EVJA 4ZA2A 4WCFB 1YL5A 4RVUA 4BS9A 2X1HA 4GX2A 2VWHA 3E8XA 4BL5A 2GPTA 1L7DA 3H4VA 5FYDA 4E31A 1U7TA 4R41A 4XGNA 4MPDA 3RKRA 3E48A 1FXSA 1KEUA 4WCDA 5GMOA 3NKLA 3RSHA 1EZ4A 3DDNA 3IS3A 5TRTA 4CM3A 1LQTA 4B7UA 3NDRA 4TRJA 4E5MA 2VYNA 4L4RA 1DJQA 3WIDA 2NTVA 2AHRA 4RF4A 2FOIA 4UVEA 2NU8A 1P0CA 3OQ6A 4R9SA 4I1IA 4JQCA 5EN4A 3RU9A 4MJLA 5I9LA 4IQ8A 1CYDA 3C85A 4LGVA 3QWIA 1R4MB 4BB5A 4BNJA 4J1NA 1X0XA 2YDXA 5I7FA 1B26A 1N7GA 5G4KA 1EE2A 1C1XB 2X0NA 2I3GA 1PS0A 3LT1A 1AHIA 3DBVO 4YPOA 2UUOA 1GZ6A 4IS2A 3QVWA 2V6GA 1LRLA 2EIHA 2QRKA 3LC1O 3LDHA 5AXCA 4J4TA 4HUJA 2YV3A 2X5KO 2UV8A 3K2EA 5FEUA 1GPJA 1MLDA 2HJSA 1ZNQO 2NU6A 5I8ZA 1H9AA 4EBFA 2Q2WA 1AN9A 1AE1A 3F1KA 3W8FA 5U9CA 2X23A 2QQ5A 3ZU4A 3H2ZA 4OXKA 4OHUA 2GDZA 2O3JA 2UDPA 3ETDA 4CV2A 1I30A 1EEHA 2QRJA 4MVJI 3A06A 1ZMOA 1DAOA 5DZSA 1GYQA 3UCEA 2VTEA 3DAFA 4YACA 3UCXA 5TT1A 1GU7A 1UDBA 3KV3O 3UKOA 2X5OA 2JCYA 1I0ZA 1VE9A 2Q1WA 3ZW8A 3FI9A 1YL6A 3VKUA 5ITVA 2DAPA 1E7RA 4IJVA 3QQPA 4E5PA 3QVSA 4BNTA 1EDOA 4PG5A 2BELA 4CLEA 3RFXA 3OETA 4PG7A 1ZFNA 4NU5A 2FR1A 2J8ZA 3ZN2A 5GZ6A 1TEHA 3C1OA 3BMQA 1LSSA 4IDAA 4YT2A 2GF2A 2QG4A 1VLLA 4RPKA 3JYLA 1PJQA 5A9SB 1BXGA 2GN9A 3D1LA 3DZKA 1B14A 2Y1GA 1C3VA 2PD3A 2JAPA 4QFCA 1GQQA 1TT5A 3T7CA 4WOKA 1YB4A 1EVIA 3WBFA 4XCVA 2E49A 3C24A 1GY8A 3UICA 5DCWA 2RH8A 2H63A 5KIAA 3LLSA 4UAGA 3GA0A 4YRAA 1P44A 1Q0LA 3GR6A 3QWHA 3ON5A 4ZVVA 4XR4A 3AY3A 2QYSA 1P74A 1QG6A 1E3WA 3AU8A 3W8EA 2WYVA 4Z0TA 5G0UA 2C5AA 3Q9UA 2I6TA 2HKIA 1XHLA 5TQVA 1NFFA 3VPXA 5TSDA 4E5KA 3PZBA 3AY6A 1F0YA 5IN4A 2FR0A 4GGOA 1ZSYA 4HFMA 5G4LA 4HFRA 2Q99A 1A5ZA 4JP3A 2IDZA 3AI1A 1C1XA 3E9QA 3P5SA 2YQ4A 4BVAA 1CRWG 4U8GA 1LA2A 3WGHA 4CM4B 4CMJA 3GEDA 1F12A 2P9CA 2NQ8A 1R0LA 4TKMA 2JKVA 4RQTA 4YRBA 2EERA 2VYVD 1UP4A 4Q3EA 1ADBA 1GV1A 1Q2XA 3O03A 1WZIA 1WVGA 1H2HA 2OMEA 3ST7A 3W1VA 4GVXA 3GDFA 3PJEA 2J3JA 3BA1A 4FJ0A 1B0AA 1E3JA 4GX5A 1DDOA 5CFZA 4WNIA 4AICA 1VL6A 2CZCA 3MCVA 5KWEA 1D1TA 2VRCA 1HWYA 3H9EO 3I3OA 4CLXA 2C82A 4IIUA 3HB5X 3K9QO 4LCJA 3AOGA 3ZU5A 1ZEMA 1KS9A 1MC5A 1WZEA 3FWZA 5GY7A 3MOIA 4FFRA 3FR7A 4KTVE 3F4BA 4TRNA 4LW8A 5JC8A 4QUKA 1FMCA 4RL6A 3WG9A 3WJAA 3PIDA 2PKQP 3B1JA 3ZU3A 1KIFA 4IBOA 2A35A 1HRDA 2CFCA 1I3KA 4GAEA 3T4EA 4A73A 3D3WB 4MO2A 3ZI0A 5EIOA 4CR8A 3RCBA 4Q3BA 1U1IA 3TZQA 1RM0A 4BQPA 5L4SA 2O23A 4FGSA 3IDSA 1KERA 1IUKA 2CSUA 2G5CA 2Y1EA 2HAEA 4RF2A 4RO0A 2V65A 1J4AA 3DBRA 4NJMB 2OHXA 4WKGA 3ENKA 1E92A 4YAGA 4AJOA 2GLXA 1XKQA 3PDJA 4GLLA 4CV1A 4KWIA 4R1SA 3PHHA 3V1UA 5G0TA 3DTTA 4EYEA 4M54A 1EK5A 1U3VA 4JBIA 2J5QA 2ZJ1A 1LDYA 4BNWA 3ZW9A 3EMKA 4TRRA 4J6FA 4PZDA 1DSSG 4OSOA 4FR5A 2NLOA 3AM4A 3TWOA 1PEDA 2GRAA 1UR5A 4H16A 2QZZA 4RPLA 1NHGA 4XQ9A 3RUFA 2O7SA 4WJZA 4IXTA 1E5LA 5C3MA 3KZVA 1X15A 2WSBA 2XXJA 1K6JA 5ENDA 3DC2A 3U4DA 1CERA 1IZ0A 3DO5A 4WCFC 3SLGA 2YQ5A 3WQRA 2O2YA 5FF9A 1S7CA 2E4AA 3NYWA 4R4JA 2W2KB 2AEMA 1PJBA 2HLPA 1P33A 3FNEA 1IY8A 1UXGA 4XGIA 3EUWA 5IFLA 1T2AA 3LC2O 3WYBA 2ZATA 3OQ1A 3C8MA 1UDCA 1GZ4A 3GNQA 3UN1A 2DT5A 3B70A 3O9ZA 4RORA 3WGYA 1DHRA 4R3NA 3DWFA 1GUYA 3ADPA 3RJ5A 4PG6A 3EHEA 1AGNA 1LLUA 3LVFO 4G2NA 3RKUA 1H5QA 3T7EA 2Z1NA 3HHPA 2DBRA 1SC6A 4W4TA 4Y98A 4FC7A 3RBZA 4PFJA 1W6UA 3UF0A 3JQFC 3D3EA 3DXFA 1HT0A 2JFGA 1YRLA 4FOOA 3CIFA 4IGFA 3M2TA 1ZVMA 4GLOA 4XWYA 5T8KC 1BRMA 1XEAA 4IZHA 4JGBA 5JMWA 4RVSA 2Y93A 1WXDA 3CEAA 3STHA 1JTVA 3ZWYA 5KJ6A 1XA0A 1E1LA 4J4HA 2JD1A 1HZJA 4U5QA 1I3MA 3QW2A 2VZ8A 5CDSA 1FDUA 2BH9A 2B4TO 2RH4A 1HL3A 1E7QA 4BO2A 1PZFA 4DBZA 5CDGA 3L4BA 4YJHA 2EXXA 4DWVA 2WD7A 3PHLA 4RZIA 3TNLA 3WGGA 1BXKA 3BMNA 1ZJYA 3JQ7B 3WFJA 3H2SA 4Z0PA 4BV9A 3Q2IA 2PD4A 2OXIA 4BKPA 4TRMA 4BO3A 5GZ1A 1ENPA 3VDRA 5A03A 2VNAA 1B16A 4RDIA 4YVFA 3E6AA 3Q1LA 2C54A 5F5LA 4BV8A 5L7WA 3EVTA 3FRJA 5F3RA 5I7SA 3LK7A 2JHGA 1R37A 3ICPA 3UXYA 2NU7A 1I33A 2FPIA 4MP8A 2HK9A 2HMTA 4TZTA 4CMGA 4WE3A 1BW9B 2JFFA 5JDCA 4BO5A 2BGKA 3WXBA 3WLFA 5EERA 4XA8A 4ALLA 1L1FA 1JWBB 1G0NA 4HBGA 4OL9A 2WWRA 1B2LA 1P31A 4BNXA 1HF3A 2R00A 4P38A 4NMHA 4H3VA 5H82A 2VRBA 4QQRA 1YL7A 3JQCA 3E82A 4J7CA 4FFOA 1SBYA 4BIIA 3HG7A 5FFFA 3SXPA 2BFMA 3SBOA 3GRKA 4CLOA 2DPHA 3JQGB 2G0TA 1E6UA 4ALNA 3RU7A 3COSA 4A26A 1NNUA 4FDAA 4F45A 5L40A 4I5FA 1NAIA 2GN6A 2W2LD 4CMEA 1UXJA 5JDIA 3OA2A 3ROKA 3UVEA 4XYLA 4HKTA 2AW5A 4B3HA 1ULSA 3DBHB 4WGGA 4KZPA 4Y6RA 1TXGA 3KETA 1X14A 2C07A 3QWAA 1MFPA 2GN4A 4KOAA 5A1TA 1YOVA 2E6UX 1VJTA 5AYVA 4A5OA 4KUHA 4S3MA 3GEMA 1KVRA 3GG2A 2C20A 2BGLA 2OP1A 4ALKA 1YGYA 4YAJA 3ZCXA 2GN8A 4K26A 4Q3CA 4Y8VA 4WLUA 3E5MA 3OF2A 1W73A 3ZWVA 3M6IA 3U3XA 1BXZA 5DT9A 1F06A 2HK8A 3ASUA 5KTKA 2FPPA 2HMSA 4MIYA 3ULKA 1CJCA 2ZB4A 5L7YA 2F00A 2CVZA 1EQUA 2TMGA 4MOWA 2VWPA 1D3AA 1C14A 5BT9A 1HEUA 4N54A 4KUGA 1GL3A 4A0SA 2D8AA 3K30A 3GHYA 3PXXA 2GUGA 4G81A 1LUAA 1U4SA 5KVSA 3SJUA 1HYGA 4HWKA 4MKRA 4XIJA 2Y0DA 3ROMA 4CQLB 5LCXA 5C7OO 1ONOA 4GL4A 3WNVA 3PWKA 4ZN6A 3CINA 1I36A 1I2BA 3OM9A 1DPGA 1M6WA 4IDBA 4PCVA 5KKAA 1ISIA 5THQA 2ZQYA 2ZCVA 4WK6A 3S1LA 4BKOA 4D42A 4MVJF 4BQRA 3GDOA 3GNTA 4YTEA 3VPFA 4XIYA 1CF2O 4XYBA 2B4RO 3NT2A 4NHEA 3NJ4A 4FOSA 4BO4A 4NK5A 2BRUA 4OIMA 3LT0A 3GFBA 5JO0A 3I83A 5CP8A 1Z74A 2J5RA 4FIZA 5JXWA 3UCFA 4BNLA 4E5NA 2DUWA 3L4SO 1E5QA 3RQSA 1E77A 3PJDA 3V5NA 1G1AA 3DB2A 4Z9FA 1KEVA 3DFUA 4JBGA 4NBWA 3VH2A 3D4OA 3TSCA 4MVJD 5JMPA 5TIIA 7ADHA 1WDLA 2XF8A 1VJ1A 3H8VA 5CDTA 1EE9A 1H93A 4AL4A 1LDBA 1NBOA 2X9VA 4L9RA 4RZHA 4R1TA 3HQ4O 2NV6A 1SAYA 2D59A 3S2FA 3P2OA 1SEPA 1OAAA 2I99A 4QFDA 3UUWA 3SEFA 2YJZA 4BNHA 1FJHA 3AU9A 3U4IA 1SCUA 1JA9A 3C1TA 3KB6A 4GI2A 3KEQA 1YBAA 2AEFA 4RVGA 3K8ZA 1JLLA 2B36A 3TL3A 3F3SA 5B12A 1W0CA 3WLEA 1WMAA 4AJLA 4DIFA 1DFIA 3GF4A 3NGLA 3RBVA 3ZHBA 4E32A 2EG9A 3ETEA 3NRCA 3PEFA 1PZHA 3GMDA 1K3TA 3FBTA 1J0XO 2IE0A 1E1KA 3H5AA 3H5RA 3INRA 4EJ6A 4OH1A 1E7MA 1O95A 3GN1A 3GAFA 4QX6A 3UHAA 1GDHA 5COBA 3RJ9A 1D7OA 2NNLD 2VWGA 3PJGA 4UUOA 3O4RA 4Y6SA 3QP9A 1EK6A 1NWHA 1VJ0A 1NR1A 1DC4A 3F9IA 3GH3A 1T2DA 4TSKA 1KOLA 3GVIA 3ZWCA 1Q7GA 2PFGA 4L74A 4BNGA 1BGVA 3AK4A 3NTQA 4W7IA 4YJGA 3KHUA 2VUSA 1FDTA 4TMFA 4BNNA 1PJCA 4J16A 1M2WA 4BMVA 5G4KB 1DC5A 4DMMA 4R51A 2OBNA 1MXHA 1XU9A 1IE3A 1N1EA 3BHIA 4PG4A 2I65A 1UXHA 3T4XA 4DIBA 2B37A 5JFOA 4E13A 3DEYX 4GMFA 3GT0A 4GBJA 1QR6A 1EVYA 1LRKA 1UAYA 4FJ1A 3E18A 2WE8A 4LSWA 4O6VA 5G0WA 3SJ7A 4YT8A 1ENZA 1P1KA 1B15A 4ZRNA 2FRDA 1JDJA 3GLQA 3QWBA 5A06A 3RUDA 1QYCA 1HSZA 1GQ2A 2ZQZA 2AA3A 1U28A 2CDAA 3AFNA 5JAQA 3L0DA 3UGKA 1ISJA 3S8MA 5ICSA 1W8DA 1PX0A 1YWGO 3IC5A 4L4SA 3B1KA 4QO7A 4UULA 5JCJA 5K6AC 2B35A 2Y1DA 3X2FA 1ONNA 1DAPA 1E6EA 3E9NA 1UZMA 4B4VA 2O4UX 4GH5A 4E4YA 2PK3A 2NUAA 3TPCA 4YJFA 4FB5A 2B69A 3V2HA 3CMMA 1E6WA 4CUZA 1I3NA 1PS8A 2FPGA 2Q3EA 3NUGA 2EV9A 1O0SA 2C2XA 2H9IA 1G0OA 4BNIA 4EW6A 3V8BA 4XQEA 5B4VA 3N58A 3U0BA 3WDSA 2HSDA 2CVOA 3F5QA 5T67A 3CTMA 3GVHA 3BMQB 3DMYA 4NR0A 2I5PO 2TMDA 1DLIA 1E0DA 4M1QA 1LDEA 4DUPA 3PFWO 5BR7A 4NPCA 1D1SA 3H6KA 4ZU3A 1BXGB 2OOSA 4B79A 2YHUA 1HE5A 4D3SA 2G1UA 3FF4A 4FFNA 4LRTB 4KQWA 3OP4A 4BO0A 5JYEA 2PWZA 3LQFA 4JX8A 3ZWXA 1TT5B 2YZ7A 1V8BA 1AUPA 1V3VA 1BMDA 3VAZA 3GHHA 4RF3A 3AUSA 2O3SA 4CLHA 4B8ZA 1I01A 1JKIA 2CF6A 2DTEA 1Y81A 2B0JA 1NPYA 1MGOA 1O9BA 4B7CA 1E3WB 2NTJA 1DHTA 4EEZA 3RUIA 3PQDA 5CEEA 2G76A 2QX7A 3ZNPA 1DB3A 5G2OA 1B8PA 1YB1A 4AJ4A 3Q0EA 2VHZA 2X0JA 3JQBC 3ZHXA 2BF7A 1LLCA 3VVBA 3O26A 3RUAA 5BNIA 3DZBA 1ZJZA 3VKVA 4KQXA 3G49A 1OC4A 4P4LA 1Z6ZA 3GUYA 3C7AA 4Z3DA 4AJPA 4D3FA 1O94A 2HU2A 2P9EA 1QYVA 2AQIA 1ZSVA 4M55A 4ND3A 1JN0A 1Z45A 3PPIA 2GSDA 4L4XA 4PLPA 1DBVO 1OBFO 4QECA 3ZV6A 3RC9A 3JYQA 2I3AA 2YHIA 1LSJA 1XDWA 3QVOA 2CDBA 4K6FA 1XGKA 1I3LA 1UXKA 4GKBA 3R3JA 3V1TC 1X1EA 2IRWA 3BAZA 1UDAA 4LVCA 3AI2A 1XWFA 3OJFA 1YQDA 3AI3A 4UEOA 1LBEA 1GADO 4FCCA 1QYXA 3OIDA 5I9MA 3WGOA 3I9LA 4YA6A 2C0CA 1GPDG 3DHEA 2NVWA 3GGOA 4YCAA 5JYDA 1UJMA 4DYVA 2ZB8A 3H9GA 1TA4A 4NH4A 2ZTUA 4CM7A 4ILKA 2J5KA 3PFFA 4QEDA 5ENVA 1IHYA 4NZ9A 5C37A 5DDIP 4XYEA 4RF5A 1U3TA 4DBVO 4BUCA 1ID1A 1YQXA 1MG5A 5DCYA 3VPGA 2A94A 3KSZO 4HFJA 3TDKA 2IXAA 2IYOA 3SC4A 3WBBA 3RC1A 4UEKA 3CMCO 5MDHA 3MWEB 1ADGA 1ADFA 1RPNA 4RLHA 3IP1A 1B3BA 5KVCA 4MVJM 4CM8A 4XRGA 3LYLA 3DBRB 4OXYA 3HDHA 5DOZA 2ZJ0A 5CPFA 3HDJA 3NDIA 1YBVA 2V7PA 4IDGA 4B3IA 1LXCA 2IYPA 4JJGA 1SOWA 3HZZA 3EZYA 3C7DB 4QXMA 2D4AA 1KVTA 3HFSA 3LT2A 1NQAO 4NBTA 3RD5A 3JTMA 3D64A 3N74A 4B4UA 2W90A 3V2GA 4CV3A 1IL0A 1YO6A 2XXBA 1EBFA 5JAIA 4CR7A 3QIVA 4M86A 1RM3A 2Y68A 2PD6A 2YFHA 1HE3A 3P2YA 1R12A 1PZEA 5TLSA 1QYDA 3C1AA 3LLVA 5F21A 5EQFA 5HBRA 3GFGA 1ZEJA 3L6EA 3KLPX 2VCYA 1U5CA 3MTJA 4M49A 1Z75A 4WPGA 1LC0A 2AQHA 1T24A 1UZLA 2D5CA 4FJ2A 2HUNA 4R54A 3IL2A 3RVDA 2VTDA 2Q4EA 3R1IA 3LZ6A 4RPGA 3OJOA 1SO8A 1T25A 2EKLA 3RC7A 4E5YA 1RM4A 3DAGA 4C7KA 5JY1A 1P9LA 5I7EA 3BMCA 4BHTA 3S2EA 2OORA 4P4NA 3DAPA 5ICMA 4PLCA 3ZHYA 1R16A 5C7IO 3K92A 1NWCA 1KEWA 3A28A 4BOYA 1P1RA 1Q7CA 1PGQA 4WLFA 1U2DA 2IODA 2ZIZA 5BSGA 4J9UE 2PZMA 4W7HA 3IKVA 4DRYA 1ADCA 3ONFA 4TROA 4W99A 2AG8A 5TT0A 4ZQHA 5JBIA 1P45A 5HM8A 2HMVA 1HLPA 3HN7A 1UH5A 5T57A 2BD0A 5CHEA 3OH8A 1ZXLA 5EMHA 2E82A 2ZTVA 4Z9YA 2JCVA 3WMXA 5KJCA 3ENNA 4IUYA 3HWRA 2A4KA 4XEHA 1P1JA 2DUUA 3VDQA 3RC2A 1I32A 5LDHA 1PL8A 2H6EA 4K6CA 2ZB3A 2Z5LA 3CPSA 3DZGA 2H5LA 3HFGA 4WEOA 1VSUA 4YJHB 4XR9A 1TLTA 2WD7B 3VC7A 2DFDA 5BSHA 3BMNB 1U3WA 1YJ8A 4CM9D 4E12A 4BGIA 1ZH8A 4INAA 4MVJH 1YQGA 1GUZA 1N9GA 1ML3A 1CIVA 2EJWA 1GD1O 2YYYA 1I24A 4HNGA 4Q9NA 4Y9DA 8ADHA 4YAEA 3QHAA 4PLHA 3PI7A 2Q1SA 5JCJD 3NT4A 4HX5A 5ILOA 4RPHA 2EW8A 3RUHA 3DL2A 3LF2A 5L95A 4LSMA 4IPTA 1EFKA 1KC3A 2P9GA 3K2BA 4IMPA 1VC2A 4GVLA 5IZCA 3EZLA 1JKJA 2QIOA 3WGTA 2WM3A 3JYNA 3KM0A 5IDYA 1F17A 3JQ8A 1UXIA 4II3A 4J91A 1BHSA 3WR5A 2YW9A 1Z82A 2B5VA 3HDYA 3OIGA 4XDYA 4CLOB 2JD2A 1CEQA 2DC1A 4P22A 4CM5A 1IB6A 1P3DA 3OA0A 2OL4A 4MVJP 1AHHA 1KC1A 5IZ4A 3ZZNA 4CL8A 1HXHA 2Y0CA 3JQDA 3DHNA 1LSOA 2VYND 3VH3A 5JAMA 1R4NA 2NTNA 3GPIA 4O59O 5JSFA 1VKNA 3JYOA 3NJ8A 4I8XA 4R01A 1U9JA 1HDOA 3EY4A 4ZJUA 2P68A 2IEDA 3F4LA 3GN2A 1RWBA 4UEJA 3WSVA 4AG3A 1YOVB 1ISMA 1U8FO 3DOOA 5C7LO 3AUAA 4WEQA 1RKXA 3IKTA 3GDGA 1A27A 4JXKA 1GEEA 2I67A 3PZRA 4IQ0A 4DREA 5I9NA 4I9HA 1MFZA 3PLRA 2X4GA 1PR9A 1IULA 2RIRA 3R6DA 2YFQA 1NAHA 3ANNA 3EW7A 3AFMA 1K6IA 2AE1A 4PVCA 2W4QA 4KP7A 1KY4A 5HS6A 3ZV3A 1PQPA 4DPLA 2EF1A 4BNYA 4EI2A 4A03A 1P77A 3CSDA 3QA9A 3GY0A 1I8TA 4J4BA 3WB9A 1GEGA 4BNZA 3DHYA 2VT3A 1DIRA 3HSKA 4DLLA 1KETA 1LQUA 4R68A 2RBEA 4GSKA 3OICA 4FSHA 1PTJA 4RVDA 4R5MA 4Q3DA 2O48X 3O8QA 1C0KA 3G0OA 8LDHA 5COQA 1EFLA 3F6YA 3GVPA 3I4CA 3ZDFA 5DN9A 4IJWA 4D3DA 1J6UA 1VI2A 2DLDA 1XQ6A 1YJQA 3F47A 1CQJA 2PV7A 2Y99A 3JQAA 3R0IA 3GGPA 3ONEA 3H7AA 1ZZEA 2B5WA 2OBYA 4RCVA 3TN7A 4E2XA 3VHRA 2X9NA 3ICCA 4OQYA 3NV9A 4I9UA 1N1GA 5CPBA 4ZRMA 4YBZA 3WGZA 4U6SA 2HMUA 5IAAA 4LISA 1Y9AA 2NADA 3KOUA 1LTHR 4GKVA 3W4JA 3RUEA 2NQTA 2V6BA 2NVUA 5AXAA 4F3YA 4Z6KA 1A72A 5FI5A 2J3IA 4S1VA 3TZCA 1QORA 3TFOA 3TZ6A 1HKUA 1DEHA 2VT2A 4O5OA 4JNKA 2J6IA 1LEHA 4CV0A 1MC4A 1XLTA 1DFHA 3FN4A 2HK7A 3GK3A 3A1NA 1K89A 4JLWA 4DL9A 4YR9A 3LF1A 1LSUA 2Q2QA 3OEYA 3ONDA 4U6QA 1MA0A 3WWZA 1IYZA 4Y6PA 2DPGA 1R0KA 3C3XA 1KY5A 1XG5A 2G17A 2Y67A 2FY8A 3D4PA 3BMOA 3VH4A 4CLRB 5F1KA 4C4OA 3BTSA 2UAGA 1GQYA 4C7JA 1P1FA 2O3RA 4LN1A 5JCXA 4L0QA 3ROPA 1Y8QA 4OQZA 4IM7A 4E21A 4XKJA 2BHLA 4U0KA 4U0JA 4B4OA 2JHFA 1D8AA 4JJIA 4J49A 2GZ2A 1FDWA 1HYEA 3GVXA 3WS7A 4WLOA 2AEJA 3WTBA 3H9QA 4XX0A 4B3JA 5JE8A 1I2ZA 3QSGA 1GTMA 2C2YA 1TI7A 5MGBA 4UVGA 4CMIA 5CG1A 3QLJA 1YS4A 1YXMA 2CUKA 1V3TA 1ENOA 2DTXA 3A4VA 4BGUA 2QZ9A 1WPQA 2HQ1A 1HSOA 4R3WA 3EC7A 4ESOA 3MJ4A 2IZ1A 1F8GA 1LJ8A 2VRCD 2PR2A 4IGEA 4YDRA 1PJ3A 4P8RA 4O63O 1U5AA 2DVMA 5COAA 3I4FA 2DBQA 1H2BA 2UUPA 4NJOA 4BO8A 3G3EA 1ZKMA 4DYDA 4E0BA 3OECA 3ZHZA 2P4HX 3WTCA 5G0VA 1RM5A 2X22A 1O6ZA 5JPIA 4XJSA 4FD3A 4DVJA 3OQBA 4LCEA 3WYEA 4P4GA 3FTNA 3ZNOA 3MJCA 4FW8A 1OC2A 3EAGA 1NFQA 3TQHA 1EVZA 1UP6A 3OMLA 3LC7O 5AOVA 3HNPA 4YJGB 3M2PA 3O38A 4J0EA 3JYPA 4J7UA 1O89A 4A10A 2E37A 4YAIA 2DFVA 2OZPA 4CJXA 3L4BC 4BNFA 3VH1A 4PG8A 4YQZA 3WNQA 2AMFA 4L73A 3GNSA 1E3SA 4W82A 2VHWA 2Q1TA 1RYEA 4R5HA 1T1RA 3HN2A 4OAQA 5L51A 4W9NA 1CQIA 1V6AA 2GASA 4ONEA 3ZGYA 4EITA 5L53A 1IOLA 1C0LA 3WGQA 3ANMA 3ADOA 5EL0A 4BGEA 1HETA 2Y66A 1N8KA 2JD0A 5BNTA 2EEZA 3E1KA 5EINA 1DFGA 5FWNA 3SC6A 4QSMA 5A3JA 4L8VA 1Q0HA 3NGXA 1NPTO 3K73O 4CLRA 1PWZA 1Y8RA 4ZQFA 7MDHA 2X8LA 1ZO8A 1NYTA 4RQUA 1K2WA 1N2SA 3K31A 1E1MA 5HA5A 4OJNA 2FZEA 3G79A 1WWKA 1JAYA 2WMDA 4J1TA 5JDCC 4XDZA 2BI7A 2Q4BA 1OFGA 3JQ9A 4PRKA 4CPDA 5ER6A 3KYCB 5B1YA 4OSPA 3LT4A 3TZHA 3IQDB 4YJFB 4BNKA 2HJRA 1C0PA 3F5SA 4E2WA 1LRJA 2R00C 2I76A 2EP7A 4NBVA 4FFPA 1CWUA 3DZHA 4F6CA 3AW9A 2VUUA 4K9DA 4GQAA 4RLSA 5ITWA 4PLYA 1JW9B 1X1TA 4XQGA 3VPHA 3W8DA 4E2ZA 4G65A 4BMSA 2BMAA 1WAMA 1R0SA 2PZKA 1IPEA 3FSRA 4CMEC 2HMWA 4J1QA 5JDIC 3X2EA 3ETGA 1PR3A 2HDHA 3DOCA 3PHJA 5TS3A 1NQ5A 4UUNA 4A27A 5KJFA 1F14A 1PU2A 2GNAA 4R69A 1DLJA 4W6ZA 2X0IA 4EUEA 4JK3A 4BO9A 1DO8A 1BDMA 2G82A 2AE2A 3PGJA 3V1YA 2AXQA 2QW8A 2RAFA 2NU9A 2O3TA 4LK3A 1RYDA 3WWYA 4PLVA 2VYVA 4YJDA 4E6PA 2GZ3A 2IZ0A 2X5JO 1JVSA 2P5YA 4O0LA 4DLAA 1M76A 3F1LA 4J9VA 2GZ1A 1H6AA 1LI4A 1BVRA 1ONPA 2Q2VA 1X0VA 2PGLA 2Z95A 3PWSA 4EUFA 5JNLA 5HS4A 1TT7A 5THKA 1T4BA 2BGMA 2O3QA 5A5FA 4OM8A 5KJ1A 3PHIA 2O50A 4NFYA 1SZJG 1I2CA 4A7PA 4NFSA 5BSEA 3AJRA 3I9OA 4D43A 5A9RA 5ER9A 4GPD1 1ISFA 1C0IA 1PL7A 3RROA 1NASA 2J3HA 4IY1A 3JCZA 4YWJA 1XR3A 1NM5A 2GCGA 2X6TA 3AY7A 4O1MA 3VZRA 3NTRA 2YHIB 1GCOA 4XYMA 3ZWNA 3UH1A 1WNTA 3TL2A 2Y0EA 3JQAD 3GZNA 1GCUA 3U4CA 1RJWA 3K5PA 4IXWA 3I52A 5LDGA 1LNQA 4EJ0A 3TRIA 1K0UA 2ZYDA 3B6ZA 1UZNA 5H83A 4DLBA 3VZSA 4ZD6A 2VOEA 1SMKA 4PN3A 1B8VA 3KYCA 4YEDA 4OO3A 3HDQA 1NHWA 1G6KA 2H1SA 4M8SA 1XYGA 5ADHA 4RDHA 1FK8A 3DBLB 3KYBA 4MKXA 5JY6A 3OFSA 3E9MA 3VZQA 2VOJA 3QY9A 1KVSA 2DBZA 4J0FA 4OMUA 2EKPA 2DKNA 3D0OA 3Q2KA 2XAAA 3E5RA 3DZFA 3K96A 2Y05A 1ULUA 2DTDA 2C5EA 3I1JA 4YT4A 1E7WA 3WIEA 4CM8B 3GC6A 4CMHA 4BB6A 2AG5A 4BMNA 5K0ZA 3DZJA 4BO7A 2EW2A 4I9NA 2LDBA 2PH5A 2C7GA 2WDZA 1HDRA 2DU8A 4KWHA 5EJ2A 5TC4A 3PP8A 5CDYA 5L45A 5GZ3A 1XU7A 5L4NA 2EWMA 3AM3A 5KKCA 3WQQA 3OSUA 4Q3AA 1I5RA 3D5TA 1GUFA 1X7HA 3JQ9C 4GX1A 4B7XA 1B7GO 5FI3A 3WSWA 3KBOA 4NNJA 4MIOA 1ZK2A 4FBGA 4ND5A 4EDFA 1IZ9A 3QRWA 5JW6A 2ET6A 1ZBQA 1AXGA 1MB4A 2RHCA 2VNSA 3CZRA 3NX4A 2YV2A 2OO5A 1PS9A 3WJ7A 4B4WA 2EJVA 5KVVA 3MTGA 1PJTA 3ZV5A 4BKRA 1BVUA 4BO1A 1QMGA 4RV9A
chains in the Genus database with same CATH superfamily
1Q5PA 2BFEB 1FX0B 3CVVA 4ZZIA 1RXVA 5BSWA 3A2MA 4MIEA 5GONA 3GAZA 1JDUA 1UQRA 4YMIA 3ZDBA 2YJ3A 3WYNA 1ISHA 4AJ2A 4DQVA 1Y80A 3DG9A 3OLYA 5AW5A 3S2GA 2VYCA 1L6IA 3TX6A 5IFKA 2HFJA 5IVIA 5LPNA 5HHTA 2XEXA 4J43A 1MP0A 5DWDA 1EGMB 5BWLA 5JS2A 4NARA 3O8CA 2CVQA 5T3YA 1R0ZA 4YUYA 2POQX 1GT91 3TQOA 5B6PA 1PL6A 1OASA 2R7KA 5IDXA 4OYRA 3PCTA 4R1PA 3RVQA 3WO1A 4N7MA 3DPUA 4TYMA 1UM8A 2UYOA 3G2LA 4RVHA 4UAUA 5G41A 1PWHA 2GUWA 2JAOA 4HN4B 4IDCA 3M5DA 1V3QE 4LNAA 4D98A 1SZPA 3H1FA 4R9RA 4N48A 1II8B 3ZJ5A 3FXAA 2HJ9A 4UREA 3SP1A 5DULA 3OPXA 3TF5A 1T26A 3CF6R 4PYOA 3EXHB 4B3TB 2Q46A 3CJTA 4EHAA 1T1SA 2IW1A 3HK2A 3O7MA 5JZBA 4HQOA 1ZVKA 2V96A 3G2HA 3H9BA 1CKEA 3JQ6A 2FSSA 3ACBA 5CYFA 3N8HA 3PL1A 2FRXA 3AERB 5AR1A 4MA5A 4D44A 5CIYA 4MCIA 3AEUB 4J16C 4IDPA 1IN7A 4MWGA 3R5KA 4UQPA 4DARA 2XTAA 1DBWA 1CJBA 4YQFA 4M8NE 3A3YA 1HE1C 1ZX1A 1QOQB 3VZPA 4FYMA 4K28A 4DWWA 2W6OA 3BD8A 3CLRC 5KC8A 5IMSA 1K66A 2P9TA 2A14A 3E1GA 3HEMA 1SQFA 3DM9B 1YS2X 4JP2A 1Y4SA 2I1QA 5BSUA 3GO4A 3WZMA 2PIDA 3ETNA 1MEEA 1XF9A 1J8FA 1I1OA 3S2UA 2WIDA 1CJKC 4JLOA 4Q01A 5EA2A 4ZI7F 1D2NA 3ILVA 2IDJA 2QTMA 3KB8A 1UMBB 1SEVA 4RE5A 1KGSA 3U09A 1GU0A 1NNSA 2A0YA 3MMXA 3P2EA 1WZNA 4CEIB 1B3RA 2CVHA 2Q41A 1DXHA 3BFXA 5IDVA 6ABPA 2DJIA 2ZRCA 5T6BA 1PF7E 3GMSA 3I2KA 4DA9A 4O2BB 2F9MA 1BJRE 3GEHA 1J8MF 5EMLA 1N9GB 2Q3LA 2BT4A 2GARA 3GYGA 5CA0B 3H2JA 4R16A 3EBPA 3TZKA 1J0BA 2YMPA 1V7CA 4CG0A 4ARIA 2XRYA 3CPHA 4DC9A 2QORA 1SUEA 1OPXA 1Q19A 5DLQC 1FQWA 4F0JA 1ZW1A 4UE3S 3IXMA 1JAXA 2A0KA 4C78A 5K3OA 5KNBA 4A15A 4K0RA 4ON9A 1EINA 4QM6A 3TSWA 3LPNA 2V45A 1R8JA 3MT9A 3I2JA 4IJKA 2QSJA 3I0MA 1VPVA 1WZUA 2IT1A 4LXUA 1U0GA 3CJRA 1ULTA 1USVA 2G4LA 2R1TA 2XZTA 2BCJQ 2XMCA 1OXBB 3KLNA 1L8AA 4XUEA 3L7DA 4GU5A 4OI4A 3OU7A 4QARA 3Q4GA 2IEGA 3O94A 2O52A 3F96A 3AESA 5J23A 5LQMA 4Q9DA 4DV6B 3C7CB 2QSZA 1AH2A 2EZ4A 4J0HA 5K4HA 1EXWA 2C57A 1N2XA 5I9IA 3BGOS 1S4QA 1D2CA 2C29D 1RC0A 2L0XA 1JP7A 1JQ3A 4LQ4A 4K6MA 2XHEA 3GRYA 3U3RA 1E2LA 1NVVQ 2OAP1 3NV7A 4NOLA 2XNHA 5KOJB 1X7YB 2OBBA 3ZWMA 1R6BX 3PYLA 2IIBA 4P81A 3HWSA 4XE5A 1L5YA 1BE0A 1MNQA 3KOZA 1AF7A 5AUNB 1ZSNA 3OHSX 4A23A 3FNQA 4C87A 3L8YA 2OLKA 4BVFA 3E1SA 5LXTB 1OI7A 4N5HX 1LS6A 2J5BA 10MHA 1PNOA 4I55F 3L92A 1C7RA 1JQAA 3CRW1 4OQDA 4P3PA 1MV5A 3USES 2HBRA 1KI6B 5JH7B 5JSZB 3FCXA 3KQLA 2EW1A 3KTDA 4OQFA 3ZCRA 2QVBA 3OAAD 2Q45A 3U4CA 1I10A 3UHOA 2EP8A 2O9JA 2WSMA 3D5QA 4WAUA 4F3NA 1BGWA 3H9JA 1NKSA 1OV4A 1A7AA 1Z6GA 2C00A 2GYWA 1OXSC 4Q9KA 4CDGA 1OR8A 3AR9A 3MUNA 2AQ8A 4RTLA 4WZAB 1QH1A 2PE5A 1O94C 3CLRD 1T9BA 1ZCZA 4OXRA 1JU9A 3LBFA 3HRKA 4R2MA 4K87A 1XRNA 2PKEA 1EFPA 1DXOA 3L0CA 1PSZA 1PO7A 1WIWA 2ZAMA 3HE3A 3B53X 4PLTA 3QUBA 4MB6A 1WB4A 5AOBA 3VVMA 1IJKA 4IZOA 3RYCB 3ZHSA 2IPNA 3OZXA 5KYUA 3TBFA 1H0KA 1GFSA 1QB8A 2IZ7A 2AB0A 1JKFA 2LXNA 3PK0A 5LDDC 1ZGGA 1T9ZA 4JYMA 4ZQBA 3TTWA 1QXSA 3B5JA 1HT2E 5CX1B 4DV0B 1QHYA 5GWXA 3KT8A 1U2ZA 2RMKA 2YOHA 2YN4A 4DB4A 3ZGZA 5JJCA 3TK1A 2JVJA 2ZYAA 1DC3A 1LPMA 3ZVLA 1CQJB 1DTWA 3EGOA 3HUUA 3PLAE 1WZCA 4PSVA 4HUQA 1MOSA 2WWGA 2D0DA 3ZGNA 4BO6A 2A58A 4F86A 5KTRA 1BDBA 3PHGA 3QVLA 1CY7A 3F7NA 4XLLA 3A0RB 1DIBA 3OIFA 3HGQA 1NYQA 4GZLA 2VDWA 4HI0E 1DPFA 3UQZA 3G13A 3UMVA 3ABOB 1Y6ZA 3ABRB 4FD2A 3MYRA 1AKQA 2Y1CA 2PA3A 2PV0A 3CF0A 3PQFA 2HA3A 3CIOA 1W85B 5DI3B 2Q5EA 2YRWA 1JHQA 3PG5A 4C04A 1NR7A 1GKLA 2BFPA 3ZWPA 1YZGA 1C7EA 2QN3A 1GSHA 1ZNXA 3AM5A 3N2GA 3PGXA 4JOCA 1C4XA 2ZT5A 1XPRA 3RRZA 5DLEA 4RETA 3TJRA 4DZTA 4UMEA 4JEMA 4DTIA 4Q24A 5P21A 2A57A 3JD2A 3LBIA 3OJ0A 3TEJA 4MHSA 4HQLA 2QGFA 5IT4A 1EB8A 2BFFA 2ZANA 5EFOA 2ACEA 2V3WA 3DLAA 1IEWA 3MGBA 3PCRB 3IUSA 2NXJA 4CHGA 1A2QA 1PGNA 1PSWA 2JCGA 4HLNA 4ZCSA 4DXDA 2X3UA 4WZBB 4KXWA 4LK2A 3FD8A 4NZZA 1RRFA 3GARA 3H05A 5CT9A 4YCSA 1RBMA 5T64A 2Y6VA 2AFVA 4J0QA 2DH5A 2XUOA 4Y1FA 1XMOB 2RBKA 5DTQA 1HE4A 3PDUA 2HPHA 2ZUWA 3QVTA 4F85A 4WXPA 3I32A 3P7MA 3EVFA 1V3UA 2N0SA 2Q3DA 2YN2A 3PWTA 4FFMA 3QKRA 1Q0TA 4DPMA 2AOTA 3CX3A 1KI2A 4WLNA 2O8CA 3R40A 1ORIA 5DT2A 3SDSA 3AJAA 2XGSA 1U1EA 3P2MA 4H3SA 1TMGE 2OYRA 2RAVA 4HZIA 4WD3A 1YONA 3T5MA 2A0XA 2Q5IA 2VEDA 5JS7A 1Z0DA 3KX2A 4MK4A 4R1UA 4X7MA 7GPBA 2H1IA 4ENRA 4C7MA 3CLVA 1Q21A 1KP3A 3B1WA 1SRRA 3WLTA 1TU4A 2JFQA 1XHEA 3AHFA 2XRZA 4J2HA 2GJKA 4IIJA 1EX7A 4P82A 4XLZA 3TNYA 4AYXA 1H3EA 4XZ3A 4KDCA 2NT3A 3H7IA 2UZ4A 5JZ9A 2WMYA 5BN4B 2OV4A 1NTRA 4PLWA 1RFGE 1ZISA 3V1KA 5HUQA 2XUGA 1YE3A 1LZKA 3TPZA 4CN8A 4BVGA 1CEEA 2D1QA 2VBCA 5HE9A 1NMZA 1UBNA 3MJSA 3L77A 3GCZA 4X6UA 3TLAA 1XTUA 3ZK8A 1ZW6A 4XAQA 1QPZA 3R9KA 1LU9A 3R6TA 3GVCA 5F73A 3S2ZA 2X8JA 1SD5A 3UENA 1W4BA 2ACVA 1V6SA 1NQXA 2BPOA 2PQ6A 2XCIA 3KJGA 3D3WA 3GI1A 2CNLA 3R3SA 5E4TA 1G9TA 1UMDB 3SQLA 3VDNB 1L4GA 1N2GA 1WVIA 1YVEI 1WXQA 2V6JA 1A0OA 3LLCA 4LRWA 3CRQA 2JF0A 5F4BA 3UO8B 3ICEA 1BA3A 1JEDA 4ID9A 1MQAA 1OIXA 2A0FA 3G7UA 1PGJA 3D6TB 3O9VA 5CTJA 2MSNA 5ED0A 4NABA 2PR7A 2GN0A 3E3LA 5JQGA 4M60A 4UOZA 2M9MA 3LVBA 2ZREA 4O2AF 5KDDA 1Z17A 2QWXA 1NQWA 3UPUA 5IPFA 3C0KA 5JYCA 1EXNA 4KDFA 2AYZA 2NO1A 3GFVA 4UTRA 1EFVA 3MOSA 4HLQB 2PS9A 4MV5A 5EQDA 4HNUA 4MGZR 1DOHA 2XVXA 1R66A 4GXTA 4ZALA 4ZZ3A 4NBUA 3RTGA 3V7WA 4XJVA 5KJEA 2B4KA 3CLTC 2JZCA 2OV6A 1TF2A 1U7HA 4EKIA 4E7PA 3QPCA 1NUSA 2PSSA 4FS8A 3U6KA 2FX2A 1M2EA 2AS0A 2QL7A 3C48A 3MEQA 4PM4A 1RCFA 1IJFA 3IEXA 4UVDA 2JLWA 1JQBA 1T5SA 1YI1A 3LUJA 4TWRA 4INJA 2FPXA 3BSSA 4PBRA 1JH8A 2OT3B 4LZWA 4RV5A 1XWIA 3GQVA 3MS2A 2HSZA 4U7HA 1P4RA 5DRYA 2X58A 2BBTA 3TQCA 1JG6A 1M0TA 1DINA 1VBMA 2FUNB 5DBHX 2IC5A 1CK4A 5JVDB 3SQNA 4Y2SA 1XA4A 4RULA 5DLPA 3PHCA 4JXXA 4D6YA 2PUVA 5HOQA 1U80A 2ORVA 1OT5A 1ZC4A 3M0EA 4UU8A 1FDVA 1P60A 3R7SA 2JLQA 1T3HA 4IIBA 4OOFA 1MEOA 5I9SA 2QZJA 3I6MA 4AO7A 4XFJA 3K0FB 2H3HA 5AI6A 1KXJA 4GGPA 4AW9A 2XNDA 5CFNA 1VZ3A 5IZCC 1ZP6A 1ZM9A 3HKCA 2GESA 2Y1FA 1QF6A 4PLZA 2VQEB 1VLZA 2B8TA 5DGXA 2EJUA 4QDUA 2CBZA 3BJEA 1ZZGA 1CX9B 3KPWA 1JBQA 2HBQA 3F6PA 4GYKA 3RWMB 1M66A 4MW6A 5LQKA 3JAKB 4RXMA 5ALEA 2YVUA 4LC9A 1MRZA 3FOWA 4HLDA 2HM7A 3GLIA 4GYJA 2FR8A 4AUEA 1D4FA 2E7ZA 2E4YA 1NP3A 2GEUA 3WE7A 2MR5A 5L7TA 3Q7PA 3H83A 2R751 1QK4A 5DX0A 3NTUA 4ENPA 2B4YA 1PNTA 1XD2B 4A5SA 3NM4A 4S1TA 1FF9A 2H1FA 1PDOA 3NOXA 4ZQGA 1EAMA 4XQCA 3DMTA 3KZKA 5IXYA 1MG0A 4I4NA 1PJSA 2LUOA 3GZJA 3HADA 1CCWA 3FPHA 3SSNA 3QYJA 2NW6A 1XNHA 2ZAIA 3GQBB 3IB6A 4M87A 1O54A 4JJ4A 4WNYA 3KQYA 1GHTA 4FGKA 1PUXA 5JO9A 2V8BA 5JJBA 1ISSA 2O2EA 1N36B 3OQJA 3QKUA 2HJWA 4HFNA 1E2FA 3MWDB 3JQ7A 2AQKA 1VIYA 3A3KA 1CEXA 1ZNYA 2A5GA 2Q8PA 2X86A 3GUHA 1SXJB 2GBLA 4JJKA 5ALNA 3C8UA 4KAFA 5AD1A 1E3MA 4MS1B 3DMFA 3ZWBA 3W7AA 3I42A 3JVVA 2MHCA 4I50F 4LDRA 2EHDA 4MV9A 4BLOA 5BN3A 2ASEA 3OPNA 3CB4A 3AUTA 2C5FA 3OTHA 2FHSA 5ALRA 4B75A 5CVUA 5LP6A 2NVBA 1TD1A 1CR1A 1Z5GA 2G9QA 2FPRA 2YIMA 3G1WA 2IY9A 4FK8A 2NPFA 4N0QA 1KYZA 5DBGA 4P31A 3A6GA 3Q12A 1MO2A 5A02A 3O31A 3RFCA 1DUSA 1VKRA 4YCDA 1R5BA 1JQDA 2C7VA 3NB0A 3AWIA 4YDHB 3UOGA 1A9OA 2IKQA 1T3SA 1QTRA 1UP7A 4CMBA 4JLNA 3UQYS 4TN5A 2JH8A 5JSYA 1KI7A 4PZUA 3TR5A 3TUJC 4LQCA 1GGHA 1QLJA 4IHQA 3F6CA 5TQ0A 4G97A 421PA 5LJIA 3UXMA 3BZUA 3GZTB 3GZNB 3QI7A 2W7TA 2WLTA 1QGDA 5AVWA 3O92A 5IJXA 3DLHA 4MR8A 2CUTA 4NX2A 2WEKA 3G89A 3GIDA 3NAMA 3GPDG 1ATZA 2XVYA 1V5WA 3T61A 4N5LA 3T1HB 4RJTA 4AI6A 1UAGA 5E6UA 2C0QA 3F7OA 3FB1A 2PMBA 1AKTA 3GJ8A 3NWEA 3H04A 2WTUA 4HS9A 5CHYA 1O96A 3MTIA 2ORED 2QE7A 4B6PA 5IVKA 3KE9A 2ZTHA 2W4IA 2EGHA 3DA8A 4IFBA 2OGWA 3DOJA 4YRQA 4CKYA 9LDTA 1B8NA 1RU3A 3FDJA 1QSGA 2HPVA 5F5NA 4YP5A 2ZB7A 4IDDA 1BD4A 2CD7A 2Z08A 4UVHA 4URVR 1T9AA 5L4LA 1BOOA 4WOJA 1WS6A 2BFOA 2WIAA 4ZEOA 3SZGA 4YMVA 4IUDS 4HN2A 4BB0A 4BKUA 1GRRA 5TNXA 3EISA 1KR5A 2BVNA 2HYIC 3T52A 5DM70 1JT2A 4IIJF 1IBLB 4QC2A 5I4IA 5DTRA 4HX2A 4OJQA 1J9EA 5DNVA 5CM9C 4BE9A 4ZV4A 3SVLA 2RHRA 1V9LA 3IDQA 3K09A 3KJEA 2P3OA 1ZK4A 3WB0A 4DC0A 3VSEA 1SUIA 2I80A 3SEAA 2ILTA 5CBPB 1U3UA 1CZHA 5F1PA 2BSAA 3M33A 1RQ7A 3HL0A 1JIXA 3PFKA 5ALWA 5EOVA 1J49A 1MZVA 4Z4CA 2GOYA 3EEQA 2GYYA 5B1DA 1Z4OA 3JQBA 2OZLA 1QF7A 2VDJA 3KQQA 3R0JA 4DGQA 2Q5JA 3L4KA 3OJCA 4U7FA 1GDDA 3H19A 5DNAA 4LVUA 1NVVR 1U9YA 5BSTA 1Z8DA 3RSCA 4DHWA 2EFHB 4BATA 4OQ4A 1CB7A 1GRQA 4IJUA 2ZTMA 5IJ9B 4QO8A 2WYUA 3OJEA 4XWWA 1OQAA 4Q16A 1QIHA 1TEXA 4P0TA 4O8CA 3RS7A 5TMPA 1M74A 1PZGA 2TSYB 3KDPA 4RABA 5A9TA 1GZ5A 5TF4A 2XNCA 2PJUA 3A1CA 4TTSA 2X9GA 4HG2A 2O4CA 2PCLA 3FSGA 1PBNA 4HY3A 4OJKA 2AN9A 1C8VB 4RXTA 4ZI5A 5I7VA 4DLRA 3F5FA 1QH0A 1H0SA 3QV2A 1XKXA 3B2QA 3IKMB 1G6OA 5AIBA 1EXVA 3DKIA 5J2UF 3W6UA 2ZCJA 3ZTWA 2H11A 2FR8C 3ANYB 4AO8A 4LVNA 1DC7A 1QK3A 1SUBA 3H86A 1Q7BA 3RFVA 1T10A 2OCIA 1S2MA 1OFUA 1FEZA 1WPRA 3LUFA 1DQNA 4M37A 4TLEA 3R3WA 5FA5A 5U1PA 5C1PA 5E8RA 4YT5A 3MBOA 1Y1PA 1F5SA 2CZGA 3N0RA 4OJYA 3DDOA 1D09A 3AF3A 4J76A 5B3JA 4GXQA 2R5NA 4ZVLA 1H4QA 1K6XA 2HIHA 4G1UC 5G3YA 2CCKA 1JX6A 4I8DA 1IZYA 2PEZA 2WNHA 3DMTC 2WA1A 3G0BA 4TS1A 2I0FA 3RAGA 3Q9NA 3IR5A 3MAAC 2QRVA 3O3OB 1Q7RA 3L18A 5IN5A 3TM5A 2VZ0A 4UVIA 2IU3A 3ELYA 3U3DA 1KXZA 1O5OA 2YWCA 3INNA 2HRZA 1BWQA 5AJWA 4FXPA 1N2CB 2X7HA 4QPCA 3C5VA 2XE6A 4RYLA 1KJNA 3NUZA 5FBRB 3STVA 1E63A 1ZMTA 3OFNA 4H15A 3C3DA 3NYRA 1G7CA 2IF2A 3F9CA 2FSVA 4J90A 1I4EB 4DJJA 2ZYGA 1YTLA 2AKYA 1NXQA 1T4DA 1ZCJA 2Z2IA 2JGMA 3DONA 4KMRA 3WX0A 2GPJA 1XCBA 4NWIA 3IAHA 5FL3A 2AC2A 3PX7A 1FLAA 3HBAA 1RPJA 2PN1A 4ALIA 4CM9A 1PQ4A 1MTOA 3G1TA 1VOTA 4HMOA 2C59A 4OF4A 3CR8A 1JE1A 4OYYA 3TG2A 2CCGA 3I5MA 2YWHA 4P6VF 1AHPA 1C7ZA 1YHYA 4KYUA 4CM6A 1IM8A 1MX3A 1CUIA 1PFWA 2GCOB 1IZZA 1XN4A 3AI7A 2B1QA 3BWXA 2AR7A 3CNLA 2JFHA 2WU1A 3PTZA 3SF8A 1I2MA 4GLJA 3ZK9A 3ADDA 5DOVA 4E1AA 2IA5A 4LXTA 3DW3X 1AHNA 1N6RA 5GM2A 2AJCA 3B13B 1RHJA 1Q83A 1XF1A 3GA5A 2A92A 3L7OA 3NIFB 4QQKA 1FBTA 4Y7CA 3UKJA 3BA6A 4TMYA 3FAZA 2AD5A 2CHUA 3SDBA 3EZ9A 4P4SB 4RDXA 1J25A 1XROA 2O07A 2UYYA 2FWRA 2YFYA 2YN0A 4ZAGA 4HR7A 1YBMA 3QX7A 2C97A 2F1KA 1DRWA 3DBIA 4J1TC 4OOEA 1NVBA 1N57A 1G6Q1 4ZA2A 3UATA 3DL7A 3E3AA 1PLLA 1YD7A 3PFNA 1U7XA 4REQB 3PD7A 1KAGA 2XNDD 4R41A 4XGNA 3CEPB 5DIZA 3TKAA 4B73A 4G84A 1BEEA 3FCAA 1Y4UA 3X1XA 3NKLA 3N75A 3OLQA 4HDNA 3ER6A 1ZL0A 3AUJB 1QFZA 4JVSB 3GRRA 5JZVA 4B7UA 3K9CA 3PXDA 3D59A 4NY1A 1XCGB 4G01B 2CT8A 2XQKA 2OBMA 5AM5A 1RAAA 3AF1A 3WIDA 5KDOA 2IS2A 2QRZA 1PK9A 4I1RA 4KAXA 2NU8A 5SICE 3KLBA 1YR2A 4CIVA 3OQ6A 3NBFA 4RMJA 5KNCA 5M5BA 1LV7A 3IGFA 1KMCA 4JQCA 4RH0A 4UFOA 5FI1B 4BFXA 3F2VA 4FQ5A 4GI5A 3RVBA 2JEYA 3RVLA 5T7BA 1FTQA 4YXWA 3NNSA 3QTTA 1M1YE 5SYAA 3O8NA 4BNJA 5DHUA 3HR4A 4ESVA 4IHJF 1E1QA 2CLCX 3OFVA 4M6WB 4D8VA 1XZKA 2G72A 1IONA 2ESRA 2A9QA 4P5EA 4R2LA 2K87A 4G4JA 3Q98A 5CTAA 3LT1A 1AHIA 1PJ8A 3EIUA 3O3NB 4YPOA 2UUOA 2G5TA 2BGGA 1LRLA 2EIHA 3IOMA 3FSEA 3G6KA 3VYSB 1VIVA 1XLUA 2H2AA 2H1WA 3IODA 5ICFA 3W9BA 2YV3A 2X5KO 3SBXA 2J3QA 2UV8A 3OT1A 1XC7A 1MLDA 2HJSA 1ORVA 5I8ZA 1H9AA 5AJHA 1GZ7A 1L4KA 1TYZA 2Y8EA 2WI8A 4HS4A 1IQRA 1KYWA 3M4XA 1N6OA 2SKEA 2DY0A 3TQFA 3ZU4A 4CIXA 1Q3KA 4ZU1X 1M3SA 2H1CA 4U02A 3AVVA 4OHUA 2A84A 2UDPA 1FXWF 3ICQB 3DJFA 2PVSA 3NDPA 1KJ8A 1DO0A 2RGYA 4MNTA 5DCLA 3QXHA 2GM4A 2VTEA 3U81A 2YHAA 3RVRA 4DWJA 1ACLA 1IEXA 1GU7A 2I8CA 3QBTA 1EH5A 3K7EA 2GAIA 2Y71A 4Z7OB 1XEWX 5FBLB 2WKPA 3LY5A 4C30A 2DX7A 1C3JA 1RAHA 2B7CA 2C5SA 3WXMA 1N0VC 1P7WA 4HYEA 2D2EA 5HX7A 1YL6A 2J32A 2B21A 1VHTA 1Z0ZA 3VKUA 2DAPA 1E7RA 1W46A 4IJVA 3VHQA 4BMYA 3S1SA 1OIVA 2NZVG 1WXXA 4M0KA 2BELA 1P5HA 3RFXA 1E9BA 4B83A 4BNTA 5JXIA 3IIMA 1KKMA 1WMEA 3B3FA 3O8OA 4G25A 2VSXA 4PG7A 4H9GA 3V4FA 1W0JA 1M5TA 4X8OA 2MCFA 4KYVA 4CT4B 3HUEA 2D06A 1VKZA 1CD5A 1E59A 4IWNA 3C4JA 3IDOA 4H27A 2GF2A 2YHSA 3F8SA 4AG5A 2C42A 2H7YA 3Q2OA 2POCA 1RQ2A 4LZAA 3T7IA 4F9TA 4C0BA 3U9SA 1JIVA 4C4RA 1YR6A 2F3TA 2VVTA 3KB2A 3KQWA 3D1LA 4RTMA 2PM8A 1C3VA 1GLGA 2XIQA 4M22A 4IV8A 2JAPA 4JR2A 1E0SA 4QFCA 4Z1MD 4JI6B 1BMTA 4NH0A 5IWAB 2RFLA 4HH3C 3ZBPA 5FQOA 3NHYA 3U7GA 1L5WA 1RWKA 3MIZA 4WOKA 1XRQA 1YQUA 2I03A 3DLPX 4UNIA 1ZGCA 2E49A 4LBVA 3FYUA 3OT4A 2FF7A 4YRGA 4IO0A 3T7DA 4BFYA 4GC9A 3KAQA 3OPMA 3U4AA 4UAGA 4GPZA 3GA0A 1Q0LA 3GR6A 2GFIA 3QWHA 4KLRA 4ZAWA 4HPXB 1CVLA 2H17A 2A9RA 4UHBA 3AU8A 1E2GA 2P4EA 1X7WA 5IH7A 5JSQA 2NXEA 4J75A 1VPEA 1XHLA 2PDAA 2PQMA 3ICVA 4MTCA 5CK5A 4YV0A 5TSDA 4E5KA 2LNDA 1L7MA 5EWJB 2Y0BA 3GCGA 1ZESA 4N39A 1Q6YA 4PFSA 5ES4B 4BQSA 3Q3HA 1Y82A 4Q4DA 2IHUA 1COWA 3P5SA 5E1MA 2QLTA 1LA2A 3WGHA 2XKBA 3HXLA 3RYIA 1T2NA 2P9CA 2OCXA 2JKVA 3KOOA 4TKMA 3K4HA 4W5HA 5KB3A 2G9VA 5AKKA 1Q91A 5KQPA 1WZIA 5BRJA 1DZ3A 1XFAA 1E89A 3JAMA 4ENTA 2BR4A 5B7NA 1JR3D 1MOQA 3QX9A 4QVIA 3S68A 1RZRA 2OO5C 3NHJA 3VISA 1KGDA 3GDFA 2P9HA 1T0UA 2QJTA 4CMEA 1I7QB 1E3JA 3AW8A 4WNIA 4JBWA 3DXYA 1N5IA 4CWAA 2V9ZA 5CA1A 3LLMA 1W88B 3ZVMA 5ICEA 2VS1A 4PO1A 2F3QA 1XZIA 4CLXA 3DMRA 2FJPA 4FWIB 3GJQA 4X3PA 4A2QA 1QKJA 2BP7A 4BN0A 1RMQA 3U3MA 1MX9A 1VMIA 5CLIA 4IH1A 1WZEA 3S27A 2AUMA 1I51A 3K1TA 4P4TA 1E32A 4QJIA 2XYGA 4R7TA 4UJ5A 5JRJA 1RACA 1XTVA 3DMNA 5E0OA 3HJUA 3ZLBA 4QT4A 1GN9A 2FLWA 4UBJA 2OV8A 4LW8A 5JC8A 1QZUA 3IRUA 4QDZA 3WJAA 2XNSA 3PIDA 4RFLA 1T5LA 1TUGA 3M3DA 1M6VA 4ZOLA 3BPSA 4AYWA 1VP3A 4ETNA 1A4XA 4KXYA 4GAEA 1V43A 2I3DA 3DL4A 4MO2A 5BMOA 4O4HA 4FMPA 4F9FA 1QHHB 4CR8A 3VC3A 1T3TA 3BC1A 3K5WA 1LJUA 3IJ5A 1H2ZA 4KL8S 4FGSA 3WL5A 3OFND 2CSUA 1IUKA 1AKVA 3HRHA 1NVEA 1RJEA 1UBOS 1YJAA 2V65A 3DBRA 2FXVA 3VZCA 1DCFA 2OHXA 3ENKA 1II0A 5JAPA 1DEXA 2PGOA 3SYTA 2B3DA 1FYVA 1HC7A 1JG1A 3PDJA 4PHTA 1VXRA 2RHLA 4RUKA 4CV1A 3ZHOA 1TM1E 3BCUA 3UOAB 3W8RA 2AZDA 3DTTA 1YK1A 2ONCA 1WR8A 1SVKA 3PEVA 4M54A 1XJQA 1CUGA 1U3VA 4A92A 3PXGA 1FNDA 1UPFA 4WNAB 1LNZA 1LBTA 2HNKA 2GAJA 2OBLA 2A33A 3IEIA 2WD9A 4J6FA 1P9OA 4PINA 2AJLI 4FR5A 1TJ5A 4HGPA 4N9WA 3VNRA 2GK7A 4KFSA 1UR5A 2XMQA 5ESRA 4EO9A 3K35A 3UV6A 1E5LA 1P9RA 3KZVA 4RY9A 1X15A 2D2FA 3E2PA 4KFCA 2QUJA 3ORHA 1YZUA 2RK6A 3SLGA 1QUFA 1VHWA 2FX3A 1DNPA 2YQ5A 1VIAA 1WMDA 2WJVA 4X91A 1NJ6A 1S7CA 2AZTA 8GPBA 3TZLA 1Z7YA 4RFSA 4QM7A 4BLVA 1PJBA 4H7EA 1HMYA 1Z4IA 4RNDB 4ASUA 1IY8A 1CHNA 1UXGA 3G9XA 3C3WA 4LEIA 3T38A 5MN5A 1X80A 3H5VA 4XGIA 1PVDA 4B33A 3ZD9A 3QF4B 4HT3B 3BT7A 3HH8A 3PXUA 5BVHA 1BJKA 1GZ4A 3FYTA 5EQTA 1IBSA 2BEVB 1VLVA 5DO9A 4M0EA 2C9CA 1WXFA 4R3NA 621PA 5KEIA 1VKHA 1K6MA 3EGVA 4ZMRA 4C4XA 2C8JA 4JLSA 4PZAA 3EHEA 1OXMA 2XKAA 5E9QA 5CCDA 3B89A 2OILA 1ECPA 2JGFA 2XT0A 5KNCD 4X8MA 3HHPA 5EE3A 2BR3A 2MSCB 2DBRA 4XX1A 1SC6A 3RQIA 3BXEA 2GF9A 1RD4A 5HCIA 2B25A 1RAIA 3OUTA 3K0KA 4YXWD 1H4VB 2YVKA 4WK4B 3JQFC 4B6JA 3D3EA 1CF4A 1E9VA 1JAHA 1YRLA 2HUPA 1T1JA 1G42A 1AGYA 3ISVA 1G8AA 1SELA 5MHTA 3M2TA 1ZVMA 4GLOA 4MWEA 2XYQA 1YJ5A 5LYJA 4JGBA 3VBEA 3P0EA 1JIIA 4W1RA 5C4GB 3CEAA 4OYLA 4AY2A 3QKTA 2H85A 2DQKA 4U5QA 3ZWYA 1QC5B 1ZIOA 2G70A 1ECFA 2JD1A 3D7NA 3IKJA 3BULA 3BXOA 4PQYA 3EPRA 3NCHA 4OK6A 2RH4A 4LBZA 1R5JA 4LNUA 1DUVG 4D9GA 4DRXB 3EPKA 4A2WA 5CDGA 2QX4A 1ICEA 4BCBA 1XEXA 1Y89A 5AJXA 3PDIA 4HQRA 1Z88A 4UBIA 1G5RA 4CKBB 4RDCA 2NZJA 1F6DA 2Q4DA 1RBZA 5AVVA 5INTA 1D7AA 1RBQA 1TW2A 1ZJYA 2AH5A 2FW6A 4GD3Q 1O4WA 2Z8YM 4Z0PA 2IIQA 3NH9A 2PD4A 3Q2IA 4BKPA 2XUPA 3ZJTA 2R8XA 5BPFA 4ZVOA 1WB9A 5CAEB 5GZ1A 3VDRA 4H17A 3IAXA 4MWDA 4YVFA 5L7WA 3E6AA 3Q1LA 2C54A 3UJBA 4NDZA 3EVTA 2PUCA 5I7SA 3AG5A 1POXA 3ILYA 1S2LA 3LK7A 3FUCA 3LPAA 3RTEA 4COKA 4C4ZA 1I33A 2NU7A 4B32A 2HK9A 1S4MA 2HMTA 3HJBA 4RTOA 2XTZA 5DHTA 1ECBA 2X6RA 3VR3A 1NP6A 4JI0B 3HJNA 4H7DA 2VAWA 4XA8A 3L40A 4LX0A 2QG6A 3KXIA 2X5XA 1JWBB 4LPSA 1BKDR 1G0NA 1NNI1 1T8PA 4OL9A 2WWRA 3L8FA 1Y7HA 2VK1A 1IWPB 4EJFA 4D97A 1KOFA 2Q9BA 4KNYA 1UBUS 1OWPA 1G5QA 1UADA 3EAFA 5A7FA 2DR2A 4FFOA 1ZVQA 4Q5IA 1NQVA 2FG7C 1IZ7A 3SXPA 2O19A 4G6ZA 4KFTA 3ETCA 2XCSB 5GM1A 4C6TA 2DPHA 3JQGB 3RG8A 5CH8A 4C4TA 3WYAA 5A4KA 2OB1A 3A6LA 5KTSA 4A26A 1YI8A 1HT3A 4JXZA 3EWIA 2WHQA 4JOQA 4I5FA 3TI9A 3U4QB 2OENG 5JXJA 1MJGM 2W2LD 2ORWA 1GFWA 1UXJA 4BQEA 5JJ5A 1EJ2A 4D9CA 3EEIA 1NT4A 3FMOB 3IV6A 3ECAA 4I46A 4AULA 2CE2X 4QOHA 2HA2A 4AMZA 3I2YX 3A4NA 2Q9UA 4KZPA 3W2IA 2E9SA 2G7ZA 2Z3VA 1TC1A 1K92A 5DYTA 4IF6A 4U2DA 4DMGA 4GKKB 3V1MA 4N6NA 4XWOA 2GN4A 5A1TA 1YOVA 2E6UX 5J2TF 5JQGB 4BWYA 5CA1F 4F8YA 4MR9A 3PGA1 4NZYA 4S3MA 3P5BA 1XQXA 1KVRA 3GG2A 4K6KA 4QUHA 5H3LA 3PENA 3BQ9A 3LFHA 3R5JA 3UB3A 3RJMA 3ZBQA 2JLZA 2BE7A 2QT1A 4RVNA 3PR2B 1H9CA 1YGYA 2BOVA 5LOVB 4FEAA 4DCGA 3LYUA 3GJ4A 1IY0A 3QG1A 4JEIA 4MKGA 2GN8A 4K26A 2FSFA 3T8YA 4A1OA 2IV3A 4DANA 2JCSA 3RM3A 3N39C 4YCMA 1YCDA 4YJ3A 3OF2A 5FLKA 2NN3C 2VJLA 2FQXA 2FLKA 3GCWA 3M6IA 3U3XA 1NZFA 1GTJ1 1SHJA 3A26A 3H2BA 1F06A 4MV3A 5DT9A 5AW6A 5KTKA 5EG5A 2FPPA 2QQFA 2HMSA 3IMCA 2I2XB 4OUDA 3THWA 3CX4A 2ZWAA 1U7WA 3N0VA 2X8BA 1E9AA 4HD8A 1G1MA 3IAEA 3T7SA 1U3FA 3ZI7A 4AB1A 4D8WA 1PX2A 4YQEA 3WGJA 4GL2A 4O4HF 4MOWA 2XZOA 3O3CA 3SKXA 1JA1A 1S0UA 4J3JA 2K6GA 3JZFA 3CRRA 1D2EA 4X41A 2I6FA 5BT9A 3I61A 2REBA 3PNSA 3RWOA 2AG0A 4A0SA 2GUGA 2XA9A 3CW8X 2FPWA 4HWKA 1J39A 5FPTA 1E99A 4MSUA 4KVGA 5LCXA 5C7OO 1M34B 1GTL1 4KSYA 1W1WA 4RS3A 3C45A 4ZN6A 1L1EA 5DM1A 5E3JA 1K8QA 3PNYA 4EVRA 1M6WA 2AXEA 5KKAA 3G2OA 2QPLA 1Z4MA 1K7EB 3BIWA 4IYJA 1YZNA 2QM0A 3OM0A 1T6ZA 4FNGA 1V8PA 1OY1A 1ZU4A 3S1LA 3TXAA 4BKOA 4F4IA 4MVJF 5EJ4A 2JHAA 3HM2A 3WC4A 5J4YA 1CZRA 1H5NA 1CF2O 1MQ9A 2RGCA 3AF0A 3IDZA 4XIYA 3VRHA 4JI4B 2AYYA 4NHEA 3C6MA 1Q92A 1SBZA 2Q5OA 2XUFA 3IDFA 3KEMA 3P2JA 4P08A 2REQB 2P6NA 3RDPA 4CIWA 4GR9A 1L5MA 2HBYA 3H5WA 1K97A 4ARUA 3QLVC 4KJXA 3Q3VA 3QOFA 5CP8A 3HB0A 3Q6NA 4B0PA 1G16A 4R6WA 4PF1A 5BN1A 5JXWA 4BNLA 2GVDC 5IW8A 1RZVA 4QZVA 1VI5A 3HSYA 1WUKS 3KYIB 1AUOA 3A9UA 4KB5A 4AXBA 1XYVA 4F96A 2P5TB 3SEQA 3V5NA 3OFJA 4Z9FA 1KEVA 3V3KA 4BRSA 4JBGA 3HO8A 3KOYA 4L9SA 2B8WA 3L0SA 2FW0A 4MVJD 1ILWA 1HDEA 1N7JA 2Q2OA 4NSNA 5GJVC 3L46A 4EVQA 3D43A 1BCSA 1EX6A 2CLDX 2G28A 2Z57A 4KKVA 5FL7A 1NBOA 1K88A 4RZHA 3FFTA 2YZNA 5IBQA 1CUEA 1Z4NA 4C0WA 3AIIA 2ZRJA 4MV6A 3NWPA 4CT5A 3QVMA 1TYAE 2EBWA 1X3LA 4GLBA 1OAAA 2F90A 3RREA 2H2IA 2JI9A 2QUIA 2PRZA 3FPGA 3HXMA 5DM2A 3SEFA 3VR4H 2QK4A 2YJZA 2WF5A 5J5CA 3GBVA 2TMKA 3ZUGA 3VU1A 4BNHA 3I1FA 4TL8A 1FJHA 3AU9A 5E6RA 1YUMA 4GWLA 2G07A 3KEQA 1YBAA 4EK9A 1E2UA 4DKJA 4YCJA 4JLDA 1KJYA 1PP4A 2ZWVA 1Z16A 4ASUD 5IM5A 3PXCX 3ZDYB 4DC1A 5LYJF 2BGWA 1R8QA 1JTEA 5K0GA 1BX0A 3JWEA 3WLEA 4AJLA 3QPAA 2C7OA 4D9JA 1BVYF 1E1CB 1FP4A 3NGLA 3QFTA 5IAKA 4LZLA 3RBVA 4LF8B 1AU9A 5FHQA 4KE6A 1NUAA 2O8NA 1MQ8B 3O1IC 2O8DB 3EQ7A 3ZDXB 4ZYXA 4QOIA 3GMDA 2EC5A 1K3TA 1N34B 1VKJA 3CONA 1J0XO 2IE0A 1KY2A 4F84A 1DX9A 4PSAA 1E7MA 5BV0A 6Q21A 3P9KA 4YLEA 3P96A 1NP7A 2HHJA 1QCYA 3O4RA 8ABPA 1P75A 2BWJA 3JATA 1ULAA 1QFJA 3QH4A 1NWHA 1RQLA 3PC8A 3QP9A 1WUIS 3F9IA 3U7FB 2FQWA 4TSKA 4Z86A 4J3NA 4DA4A 2F9LA 2XGOA 3N3BC 3TXXA 4F6RB 5FUQA 5I4BA 3CVOA 1EDEA 3RIEA 1Q7GA 3ZEAA 5CM8B 2IW3A 2VAVA 3JWGA 3KUDA 2E4ZA 4GIBA 3IBCA 4LY0A 5FOSA 4BE4A 1C81A 2QTCA 4BNNA 2PBRA 4O08A 1RAEA 4KV7A 2QUZA 2OBNA 3JARA 4RD6A 4AF8A 1QE5A 2BIFA 1BS2A 1YIDA 1N1EA 2YS7A 4BMOB 5I4CA 2IV2X 1AM4D 3BSYA 2AFIA 5J59A 3PVSA 1I7SB 2KPOA 3WHKA 4ZTZB 1NNLA 1JEYB 3DEYX 4GMFA 1R0RE 3GJRA 4NTZA 4D4IA 1UAYA 1DEKA 4FJ1A 2AX3A 2PRJA 9ATCA 2RSLA 1AA6A 1XTIA 2IHKA 1LPPA 2FMXA 2IOFA 4QU5A 4ZRNA 5I7RA 1EFAA 3D2LA 3GLQA 3UAZA 1I2AA 1VBKA 3X1WA 1HTWA 1HSZA 3KHSA 1KMHB 3BK7A 3JASB 2J67A 2XUHA 4BPRA 2AA3A 1U28A 3SWWA 1RYBA 4Z1OA 3CRMA 3DTVB 3N8IA 1LH0A 2OQVA 3MRTA 2MINB 2P3QA 1Y7IA 2PX4A 2VP6A 4G0QA 1PV2A 1CNFA 5LZ8A 3CWZA 4R3UC 4M36A 1CR0A 3OM8A 4QO7A 3B1KA 4B85A 5CLFA 4TN1A 2HLNA 2Y1DA 4KBYA 4EATA 2PTHA 2XNKA 1Z56C 2O4UX 4FHDA 4GH5A 3ND5A 1H8HA 5CUQA