2BELA

Structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
243
structure length
243
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
publication title The High Resolution Structures of Human, Murine and Guinea Pig 11-Beta-Hydroxysteroid Dehydrogenase Type 1 Reveal Critical Differences in Active Site Architecture
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 91
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2belA00
3T4EA 1JVSA 3HUDA 5A04A 4OIMA 5JDIC 4QFDA 4MP6A 3IS3A 1T25A 4CM7A 1QRRA 3FNHA 2BGKA 2EWMA 2GDZA 4BB6A 4G65A 4N18A 5H82A 1MV8A 3V8BA 1BHSA 1IHYA 2GUGA 2AQIA 4WOKA 3B1KA 1R0LA 1C1DA 2GASA 2Q1UA 1LXCA 3DOCA 3GY0A 1GQYA 3FRJA 4JJIA 4YAIA 1GYQA 4W4TA 2C29D 3DZKA 2BGMA 5F1OA 1D4FA 4WUVA 1LQUA 2VOEA 3U09A 5T8KA 2BHLA 2J3IA 4JQCA 1KC1A 3C8MA 4WKGA 3I6QA 4CMHA 1VJ0A 4RVUA 1EEHA 4IJUA 7ADHA 3PGJA 2BGLA 3M1LA 4FCCA 5B37A 1K0UA 4PLFA 3WS7A 1V3TA 4FFNA 1EQUA 1M6WA 4HFJA 3RQSA 1EVYA 3EVNA 3M2PA 2B4TO 3E9MA 3PP8A 4B4VA 4J0FA 4TRRA 4NJOA 1X7GA 3RUAA 3H3FA 5DBFA 2ZB3A 4RQTA 1DIGA 3VVBA 2GN6A 4EEXA 1NAIA 4FFMA 1R12A 1HZZA 1SC6A 5JC8A 1MXFA 3JQ9A 3H4VA 3AU8A 1NASA 1Q0QA 4J91A 3V1YA 2HK9A 1LLQA 2C5EA 1DLJA 4FJ0A 4YDRA 3UCXA 3QIVA 4S3MA 3VZSA 4DYVA 2Q46A 1LC3A 3KTDA 1ISMA 3NDIA 3GUCA 2ZCVA 2J3KA 4WJZA 3ADPA 4K28A 2CD9A 2YDYA 3A1NA 3OF2A 2O2YA 4FFPA 4WK6A 5DT9A 4J16A 1ZW1A 3WTCA 2BF7A 4UREA 3GA0A 2GGSA 1H94A 3OH8A 2W8ZA 2GZ2A 4YJHA 5EQDA 3QHAA 2G1UA 4A26A 2V65A 4RZIA 3WGOA 1OAAA 1T2EA 1XQ6A 1R0KA 3ORFA 1CEQA 2RHCA 1DAOA 1TXGA 4GVXA 3OMLA 4HWKA 1SEVA 2QQ5A 3VKVA 3GN1A 5BSFA 4J90A 1E92A 1EUDA 1B26A 4AVYA 1PS0A 1GQ2A 1F12A 5DP1A 5K9ZA 3AFMA 1B3BA 4RPGA 3GOHA 4A73A 4A7PA 1Z74A 4S1VA 2IXBA 2JJYA 3G79A 5U9CA 4I5FA 4EBFA 4W9NA 1NQAO 2CMDA 3LT1A 4U6SA 3R3JA 1DRVA 3T7CA 5TLSA 2G82A 4K6FA 5GY7A 2QX7A 3GGOA 4CLXA 3TJRA 1KY4A 1OMOA 3BTSA 4QO8A 2PKQO 4ZHSA 1R0SA 4K26A 4OMUA 4QO7A 1T4DA 1H93A 2VWGA 3CTMA 3DZHA 1Y8RB 4H3VA 4H16A 3OQ6A 3QW2A 3M2TA 1H2BA 3JYNA 1Z6ZA 4ALMA 2W2LD 5CG1A 1PTJA 4MVJA 3GT0A 1T2DA 1JWBB 2UYYA 5GZ1A 4BO0A 5T64A 4DYDA 5JAMA 2AG8A 2PLAA 4RVFA 4ZJUA 2HJRA 1N9GA 1ADGA 3GNSA 4OOFA 2P9EA 1LDBA 4U0JA 1P1KA 2X1HA 1C14A 1JQBA 1M66A 4ALKA 1I30A 2Y0EA 5A3VA 2Y99A 3JQBA 4Z0HO 1PJQA 4HUJA 5TT1A 3U4DA 3ETEA 4MVJE 4CLRB 3HWRA 4NQZA 3UOGA 3K2EA 1PR3A 1WDKA 2GN4A 4CQMA 3AOGA 3LC1O 3VTZA 1P1HA 3CMCO 3S2EA 4JBIA 3WGIA 2O4CA 3JQ7A 3VPFA 2CVZA 1EE2A 1ZKMA 2HMVA 1JWAB 3GLQA 3WGTA 1QYXA 4AJEA 3RD5A 1RYDA 4DLAA 2CVQA 2YY7A 3LLSA 3I9MA 3OJ0A 1PZGA 5IDQA 1XA0A 3C7DB 4GL4A 2PD4A 1I32A 2X5KO 3FPLA 3JYOA 3FBTA 3C1TA 4BUCA 3JCZA 5HA5A 3WWZA 4F45A 3E18A 4RF2A 1QKIA 2DKNA 3GVXA 1HE3A 1I2BA 5KNLA 4JP3A 2W2KA 4BHTA 5CDSA 1NPTO 5COQA 2Q2QA 4I8XA 4J7XA 3ZDFA 2ZK7A 4BO5A 4EGFA 1ZVMA 1GYRA 4LK3A 1UAGA 1DIAA 2IXAA 3L9XA 1C3VA 4BKOA 1U28A 1A71A 1SBYA 1M76A 1P1JA 3ZV5A 3I4CA 5KOIA 2J3JA 3TZKA 2NTJA 3K2BA 4R4JA 4CJXA 1LEHA 1I24A 1UUFA 2IODA 3O8QB 3GC6A 4XB1A 3UHAA 3WXBA 4NFSA 2JD2A 4DBZA 3HB4X 2PZLA 4ZRMA 4GSKA 1QORA 5KVQA 4BOYA 5COAA 3TRIA 4FIZA 4E5PA 3ETGA 3ON5A 4PG4A 4BQRA 5A5FA 2JKVA 2ZIZA 2V6MA 3T7EA 1KBZA 1O9BA 1YB4A 4DMLA 2X9NA 2PD3A 2X0IA 3AJRA 3IJRA 1I01A 3DBLA 4UVGA 3RC1A 4D43A 3MEQA 4L8VA 2AXQA 2C7VA 4WOJA 3RBXA 5KJ6A 3G0OA 5JO9A 1O6ZA 3RKRA 5KIAA 3EC7A 1KS9A 1XDWA 2WSBA 1P45A 4INAA 4R5MA 4MIYA 1LJ8A 3AY3A 1HEUA 2EW2A 2B37A 4ONEA 4UVIA 5JSFA 4DIOA 1ZBQA 2O3QA 5DCWA 4CMKA 1A4IA 2NADA 3QE3A 3OA2A 1ZXBA 1BXKA 5JPIA 4RDIA 1DC6A 2B35A 3BA1A 3DFUA 1FK8A 4NBRA 4EJ0A 1NP3A 4PIVA 5EINA 3DXFA 4ND5A 3KM0A 2X0NA 3MJCA 1DOHA 3E5MA 2WJPA 1KIFA 2FPGA 2V7PA 3HHPA 1DO8A 4CLEA 4W99A 1CETA 4PLPA 2PWZA 2C5AA 1UR5A 4I5EA 1U5AA 2WYWA 4WLUA 4MJLA 4OKNA 4E2XA 4ZICA 5I7EA 2IYOA 1R4NA 4U5QA 2DFVA 5IZCC 3KYCB 3B70A 1A9ZA 4JP2A 4O0LA 4E5NA 3IKVA 4Y9DA 4CMIA 2P91A 2A92A 2OOSA 3ITDA 1LLUA 4D0RA 2HQ1A 3RUIA 1PJTA 3BAZA 4KWHA 2FHSA 2HRBA 2I65A 3NJ4A 5B12A 3GG2A 3ZWYA 3ZW9A 1GAEO 4P4GA 3H7AA 5C3MA 3QA9A 1RM0A 3DB2A 3WB9A 4BMSA 4CMJA 4XQGA 1DC3A 3RIHA 3H9EO 3PZBA 4U7WA 1I33A 4EI2A 3KO8A 4IDFA 4M1QA 3EGOA 4WLVA 3VOSA 1U2GA 5G4KA 2VN8A 1NQTA 5CAEA 1Q1NA 4CPDA 4AFNA 4XCVA 5G0UA 4OH1A 4CR6A 4DC1A 4H15A 1NHGA 5DNAA 1AUPA 1J49A 1LUAA 3PIDA 4XIYA 5DP2A 5T8KC 4BO7A 3G17A 1RM5A 5DZSA 4EYEA 3R3SA 3PQEA 3C7CB 3PFWO 1YBMA 2E48A 2FR0A 2OUIA 3LLVA 1JA9A 3BMQA 3JQFA 4ILKA 4CM9D 3KYDB 5GZ6A 1Y6JA 2JFFA 4M89A 3LZ6A 4HBGA 1YGYA 5JY6A 2NACA 5F1PA 3F6YA 4E4YA 4UUOA 3RCBA 2HRZA 5CEJA 4IS3A 3OP4A 4M87A 4DWVA 3WGYA 5CPFA 1RWBA 1WLYA 3OJLA 4R69A 2NQ8A 3PYXA 1E3EA 4CM6A 2DAPA 5AOVA 1E7WA 2VYVA 2Z1NA 3JQ9C 4NIMA 2Q1TA 1MC4A 3LF2A 4J1SA 4YR9A 2YUTA 4OM8A 4CMCA 2X8LA 4E32A 1BW9A 4TSKA 3AUUA 4BO2A 4CMAA 2OBYA 4DPLA 2P9GA 4BNWA 3D3WA 4FJ2A 4PLYA 2V6GA 4J7UA 1DXYA 3ZWOA 4YAJA 1ZK1A 3VTFA 1HDOA 4IDGA 2VHXA 5G0TA 3DBRB 2UAGA 5L7TA 5IAAA 1P77A 1SOWA 4CM3A 4PRLA 5BNIA 1W6UA 2UVDA 3PYMA 6ADHA 3CZMA 2I3AA 1T26A 2YW9A 3JTMA 5IFLA 3RFTA 1T1RA 1DEHA 1NWHA 3NTOA 3MJEA 2C0CA 2YHIB 3BMCA 2ZB4A 3NT2A 2I99A 1YBAA 3W4JA 4A5OA 4J3FA 5IXYA 4CL3A 2VNAA 1T2CA 1KVUA 3TL2A 3ZHZA 1U3WA 3WQRA 5L4NA 4J2OA 2VRCA 1DJQA 4YXFA 1MFZA 5A5EA 4W9NC 1P1FA 2EGHA 2EP7A 2E82A 1ENYA 5JMPA 1T2AA 3ANLA 3FWNA 4HNHA 4PLTA 1N92A 2RBEA 2NQTA 3CINA 4MKXA 2X86A 4FDAA 2DBZA 4KUEA 2NU8A 3VAZA 1GZ3A 3O26A 1NVGA 3WJAA 2P5UA 4NJMA 1B2LA 5CPBA 3PVZA 4L4XA 1ONNA 1H6DA 3IP1A 2C59A 4ZRNA 3OIFA 2JCVA 4B79A 4IQ0A 1SCUA 4AG3A 2BI8A 3S55A 2Y05A 4XQ9A 1SNYA 1DSSG 3ASVA 1C0PA 4R1TA 3PQDA 3PJFA 4QSMA 1PGNA 1T4BA 3NGXA 1QXSA 1NR1A 3CE6A 5AXCA 1UXHA 3JQBC 3LT0A 3I3OA 5KJ1A 4K6CA 1BG6A 2H1SA 3HFGA 4P4LA 2BFPA 4BNYA 2CSUA 3U62A 5JCXA 4RLSA 5EQFA 2DTDA 4FD3A 5KKAA 3WDSA 2YYYA 1IHXA 1V6AA 3H9JA 1BSVA 4R1UA 1DIHA 1D7OA 1HDZA 3PIIA 5A03A 4XYMA 3VDQA 2AW5A 1FDWA 4CM5A 4BO8A 2EHDA 3WIDA 4YEDA 1ZMTA 3V2GA 2B83A 2X9VA 2WTBA 4AJIA 3X2EA 2O3JA 3FNEA 1UDBA 1ZCJA 4UEKA 5JLAA 4AJ2A 1QG6A 3GNQA 1GZ6A 4DC0A 1OC4A 1WMBA 2FSSA 1A7AA 3H5RA 4R01A 1IYZA 3WICA 4AJ4A 2VT2A 1KOLA 3RBVA 1LRKA 4O5OA 1HLDA 1ZEJA 2IZ1A 3CKYA 4FN4A 4XDZA 3F3SA 4NG5A 4JGBA 4YYZA 1BXGB 1ONOA 3VC7A 1K6XA 3H8VA 3RUFA 4NBWA 2HSDA 1PR9A 3GVPA 3INTA 5L51A 3GDGA 1H6CA 2Q45A 4GGPA 3ZHXA 1E1LA 5EN4A 2JHFA 3BMQB 1SB8A 3ASUA 3GHHA 1ISFA 4WLNA 1LA2A 1H9AA 1VJ1A 4XJTA 3ZNNA 5CHEA 2HMUA 2X0JA 3QWHA 1N1GA 4GX0A 2A35A 3UCEA 4N5NA 3W8DA 4GWGA 1MUUA 3PQFA 3NAQA 1N8KA 1JVBA 1ZXLA 2ZYGA 3EY4A 3BHMA 4OYRA 4YJFB 3OM9A 3R1IA 3DHEA 4LSMA 4CMBA 3WGHA 4OJNA 2O3UA 5G0SA 5ICSA 3A14A 1P44A 1VI2A 4F6CA 3NDJA 4DPMA 4XX0A 4L76A 2VRBA 2Y1GA 4EEZA 4IJVA 2W4QA 4NHEA 1A72A 5L45A 3QVOA 1RM4A 3BHIA 5F1KA 4J7CA 2HK7A 1P0CA 3QWIA 1QYVA 3NYWA 3AFNA 1LLCA 1K6IA 1PJ4A 3NT4A 2VYNA 3MWEB 4MVJG 3GG9A 3QJ5A 2DBQA 4LVCA 2HMTA 4L0QA 3KEQA 1DJNA 1LDEA 4JBHA 4YJGA 4AJJA 2BI7A 5KTKA 2R2GA 4P38A 3AI3A 5FI5A 3IUSA 3KETA 1NTOA 1UXJA 5A3JA 3AUAA 3MWDB 1YWGO 1HZJA 2C2XA 4CR7A 3H5NA 5GZ3A 4CL8A 3WYBA 4LCEA 2JL1A 2R00A 3FWZA 1Y8RA 4CM4B 1NYTA 5KVVA 4XR9A 2VHYA 3QVTA 4GPD1 4CM8B 2QHXA 2D2IA 1GPJA 1GCOA 3CEAA 4D42A 1XU9A 4BNUA 2AQ8A 2UDPA 1HE4A 3JD4A 1EUCA 1SAYA 3I9JA 4MKZA 1PZEA 1UDCA 4IJWA 2OL4A 1Z45A 2GD1O 1J5PA 3D7LA 2Y1DA 4JK3A 2B0JA 3L4BA 4GKVA 1X7HA 5IDYA 4E5YA 1JTVA 3RROA 2D1YA 3HSKA 3DBHB 4XGKA 3R6DA 2HK8A 4NNJA 4EJMA 3UAGA 3QVXA 4TRJA 3ZWAA 1O89A 1SMKA 3GAFA 3JSAA 4NJMB 3ZV3A 4I5DA 3DTTA 3IOYA 5I9LA 1YL5A 2VWQA 3K73O 4I9HA 4CLRA 3RSHA 5IDWA 3UUWA 2PY6A 5TIIA 1YE3A 1C0IA 1N2SA 1ZK0A 3JQFC 3LT4A 3EZLA 1BDMA 1ARZA 4J1NA 2H9IA 3ZV4A 2ZJ1A 2GR9A 3LYLA 2Q99A 3BIOA 1ZUD1 3RUDA 5IF3A 1AXGA 3SLKA 1EDZA 4J4HA 1KETA 2J5KA 1EK5A 4AL4A 4RPHA 4E3ZA 4IBOA 2Y67A 3PK0A 1H2HA 1VSVA 3FBGA 3RC7A 1N5DA 3S1LA 1E7MA 4MVJP 4CLOB 4BNHA 4MP3A 4XD2A 1NFQA 2P4QA 1LU9A 4KMSA 4J1QA 3RC9A 4PG7A 5K6AA 1JAXA 4NK4A 5IDXA 5JCJD 2NU9A 3FNGA 1IOLA 3L9WA 3ICPA 2YFQA 2RH8A 4TKLA 2AA3A 3NGLA 2JAPA 2BD0A 3QWBA 4GH5A 3UF0A 2Q1SA 2IYPA 4NK5A 1Q7GA 3DZGA 4AJKA 3MJSA 1NPDA 3LT2A 2Q3EA 2P5YA 4EDFA 5G2OA 2J5QA 4LW8A 1TVEA 1KEPA 1RJWA 3L6DA 3MJTA 1PGPA 5JXWA 3OQ1A 2H6EA 3O8QA 4Q3CA 3GR6A 4O1MA 2EJVA 4JIGA 1XHLA 5JYDA 1VL8A 3I83A 1Z7EA 4KTTE 4M55A 3ZW8A 3IC5A 4ZQBA 4RQUA 3JV7A 4XRGA 2ZCUA 2PV7A 2CDAA 2OHXA 2OFPA 4YAEA 5HS4A 4GWKA 3E1KA 1P9LA 1Y1PA 1XKQA 4IGEA 1TLTA 1I3NA 3BXXA 4II3A 1DIRA 2DBRA 1OI7A 3ZGYA 2QYSA 1Y9EA 5EPOA 3VPHA 3ULKA 4BGIA 2E49A 4TROA 2Y0DA 1G0OA 1R4MB 2NWQA 3EMKA 5HRUA 3C85A 3ZNQA 5EMHA 2WWRA 3V2UA 5AQ1A 2PH5A 5FF9A 5I7FA 4UAGA 4MIEA 3NX4A 1QSGA 3OJFA 3WR5A 4YPOA 5KJCA 4WCFB 3ENKA 3GPDG 4BMNA 1I36A 2E6UX 3ZV6A 3ZHBA 3WQQA 1RKXA 3F9IA 5ILOA 1ZSNA 4YRBA 1P31A 1DLIA 3PTZA 5AXDA 3S8MA 4GAEA 1I3LA 4MP8A 3IQDB 3UFXA 4B7XA 2Q49A 1MXHA 3D3EA 3I4FA 3W4IA 3D0OA 4C7JA 4OXNA 4R9SA 1BDBA 1EMDA 3ANNA 4BNNA 5C7IO 2DC1A 2LDBA 3ABIA 3RASA 1UH5A 1Q7CA 3JQGB 2VZ8A 4MOWA 5IZ4A 3NTQA 4RJTA 1PSDA 2PFGA 3QQPA 5THKA 2VCYA 4PZEA 3KYCA 3VH3A 6LDHA 2O4UX 3GMSA 4AJHA 1QLHA 1CRWG 4XYEA 3UICA 1GU7A 4URFA 1SO8A 2CDBA 2P9CA 1YQGA 3H9UA 1UP6A 1VE9A 3ZU5A 3M1AA 4HV4A 4YJGB 4IDDA 1E0DA 1MLDA 3CH6A 4UVDA 3AM5A 5JE8A 3GRKA 1LLDA 1QP8A 3H2SA 1ZH8A 4Q3NA 4FJ1A 3DHYA 3ICCA 1QV7A 4HFNA 2AG5A 5G0WA 3DZJA 4R3WA 4R41A 2Q50A 3F5QA 5THQA 1MG5A 3GEMA 2FN7A 2IEBA 3B6ZA 3AM4A 1EK6A 4IQ8A 1IPEA 4R68A 4BQPA 5HWSA 1WXDA 3IAHA 3SC6A 1DB3A 3KYDA 2VZ0A 1YL7A 1A7KA 1A4UA 2O50A 1JLLA 2FR8A 1W0CA 2YV1A 3WYEA 3WFJA 1E1KA 3WG9A 1EQ2A 5IN5A 1PQUA 4PLWA 4A10A 4MO2A 3TZQA 4IJKA 1U5CA 3G1TA 1F17A 1N1EA 4J43A 5ITWA 1AXEA 3GEGA 4R54A 3I9NA 4Y67A 3X2FA 3KSUA 4XKJA 1IE3A 1SEPA 2D8AA 4TVBA 3DBVO 1HWYA 2DTEA 4BNMA 4JJGA 1I3KA 1YDWA 1P0FA 4NDNE 2X9GA 2EF1A 2Y0CA 1WPQA 5MDHA 1LDGA 1ZMOA 2QG4A 3OJEA 5K0ZA 1V9LA 4MDHA 4XA8A 1EVIA 1Y5MA 2J5RA 3DBRA 1EVZA 3SJ7A 4QXMA 2HDHA 4EZBA 1X7DA 3PHGA 2O7SA 3FF4A 5DF1A 5L9AA 4F6LA 2VUSA 4BMVA 3JQAD 1EZ4A 2YHIA 3W8FA 3WBFA 2HJSA 3K92A 1UZMA 2JD1A 5I9NA 4JCOA 1HE5A 3UVEA 4BKQA 1PL8A 1RM3A 4PCVA 3ROPA 1U4OA 1E6EA 2WD7B 2X0RA 4C4OA 2X7HA 4DGSA 1ML3A 1NX6A 3NV9A 4L9RA 2PD6A 1FDUA 4PN3A 5A4DA 3U4IA 1CWUA 4PGFA 4P4NA 4OQZA 2UUPA 3SC4A 2JHGA 1PEDA 1QYWA 1GV1A 2YQ4A 3SVTA 2ZB8A 5LC1A 4BGEA 1E6UA 5LDGA 3L77A 1PZHA 2TMDA 3JD2A 3AUSA 4GLLA 2QRJA 1TA4A 2NM0A 1UDAA 1J6UA 2R00C 2PZJA 1U9JA 1WZEA 5AVOA 3E9NA 1VLLA 2YHUA 4MVJD 5I7SA 3FTPA 4W7HA 3UKOA 4IXWA 4UVHA 1PJLA 4AICA 2Q4BA 5F3RA 4J1TA 3K31A 5ADHA 3QV1A 3ST7A 3KSZO 2GYYA 2EV9A 2EXXA 3QSGA 4CV0A 1T1SA 1W8DA 3L4BC 1YKFA 1ZSYA 2F00A 4GVLA 4MKRA 2X5JO 4GMGA 4D3FA 3WNQA 4UEJA 3STHA 4QEDA 2PKQP 4BO9A 4CV2A 4BNTA 4W7IA 3RU9A 4CQMD 3KRTA 1K5HA 4OGWA 2CF6A 4U0KA 2OGUA 2VQ3A 4LCJA 1DRWA 1JKIA 3W6ZA 4RL6A 4OAQA 1JN0A 1LSUA 4DTIA 1Y81A 2E4AA 5DN9A 3AI1A 4BKUA 5H81A 1E7SA 3HDJA 1PX0A 3AK4A 2ZB7A 3RC2A 1C1XB 1ENPA 1U3VA 3JQDA 1F14A 4H7PA 5TGDA 4TRNA 1M67A 3ANMA 4R5HA 1ZK4A 4DQVA 1LI4A 5C5IA 3KUXA 1E3WB 2WEKA 3PHJA 4EUEA 4E2YA 5KJFA 5EERA 1VKNA 1Y9AA 4KP7A 5A06A 1HSZA 2ZATA 2PGDA 1AGNA 3TZ6A 5K6AC 4IDEA 1LX6A 3MTJA 3GNTA 1K2WA 1K6JA 1WAMA 2PZMA 3SEFA 4DREA 4GI2A 4TWRA 4Z9XA 4G2NA 2E37A 1CERA 3KEOA 1LNQA 2D0IA 4L4RA 5ES3A 1IY8A 4DVJA 1PU2A 3ZCXA 3KSDO 2NU6A 4J9VA 1KYQA 2D5AA 2DBVO 1IPFA 2Y66A 1ZNQO 2RH4A 3GVCA 3PHIA 4IDAA 4IMRA 4M86A 1X13A 4GMFA 1ADCA 1BXGA 2WDZA 3AOEA 4QTZA 2G5CA 1GDHA 2C82A 4L74A 4YRAA 4C7KA 4F46A 3HJAA 3I5MA 3INGA 5TC4A 2VWHA 3EK2A 4GX5A 4D3DA 2C54A 1GR0A 3DAPA 3S2IA 1HF3A 3GF4A 4YT5A 3WGGA 2O2SA 3NJ8A 2GRAA 3HDYA 5BSHA 4ZGWA 2GZ3A 2WE7A 2D59A 5U4QA 4A0SA 4E21A 1ZO8A 1H5QA 5LDHA 2VHZA 1HDGO 1YQDA 4XDYA 1KVRA 4XYGA 3LF1A 3Q1LA 4IZHA 2VTEA 4GSLA 3O9ZA 4YJFA 1EFKA 1HYHA 3V1UA 2UV8A 3DWFA 4HXYA 4ND1A 4YB8A 3OEWA 1ENOA 3RU7A 2EEZA 4QX6A 1Y7TA 4ALLA 4XQCA 1BXZA 1ADFA 2YDXA 4R3NA 3D5QA 4HADA 4A03A 2VHWA 3QRWA 5TQVA 3VH2A 4J2HA 1PL6A 1VM6A 4CODB 2PNFA 2C2YA 1TT5B 3WQSB 5JS6A 3OQBA 2A4KA 2JFGA 4DIBA 2AE1A 1F8FA 3LC7O 1P74A 3E03A 1A5ZA 1U1IA 4FOOA 3PLRA 4EJ6A 4XGNA 2ZTVA 3IMFA 2AQHA 4HFRA 2OZPA 3RUCA 4E12A 2SCUA 1BRMA 1XR3A 3L6EA 4NBTA 4BIIA 3ETDA 3PJGA 3VPXA 4CM4A 4YT4A 4CM8A 1XU7A 1PIWA 4J4TA 4II2A 5KVCA 3IKTA 3Q2IA 4Z3DA 4UUPA 2Y1EA 4CMEA 3KVOA 3BMNB 1V8BA 2ZJ0A 4XJSA 3QP9A 1ZSVA 3MTGA 2I9PA 5JAIA 4PLVA 3CZRA 4E2WA 1I2ZA 5TRTA 4PLZA 4FB5A 5EESA 1NPYA 3W8EA 1LDMA 3DBHA 1YH3A 4CV1A 2NTVA 4HFMA 3TF5A 4BGVA 3W4KA 4WCDA 4CQLB 3ENNA 1PWXA 3CIFA 3U5TA 1YJ8A 1WVGA 1J0XO 1X1TA 4LSWA 2XXJA 1GV0A 1Y8QB 3KZVA 5I9MA 3E82A 4FQ8A 1NXQA 4MVJF 3S2GA 4R9RA 4YACA 5CDGA 4ALJA 1P1IA 4J4BA 4N7RA 4KQWA 1ADBA 1F06A 4JROA 3BZUA 3DMYA 1U2DA 4E30A 3PI7A 3NT5A 2VYVD 2UUOA 1W73A 4AJNA 3ZI0A 1LRJA 1OZAA 3GGPA 1T2FA 4AJOA 5HTOA 2D5CA 4YT8A 4CLOA 5IXSA 4E2ZA 3TZHA 3TSCA 4TMFA 3QVSA 4IS2A 2VOJA 2VUUA 4U6QA 1LDNA 4NPCA 4FOSA 3DMTA 3GGGA 2D4AA 5C7OO 5BR7A 4ITUA 3ZNOA 4E13A 2NV6A 2BKAA 2YV2A 5G0VA 2A94A 4IDBA 1LSJA 2HKIA 2DUWA 3RBZA 4U8GA 1TI7A 1UXKA 4NBUA 1E77A 1NM5A 1VJTA 2AEFA 3PWKA 3U4HA 3DTYA 4Z9FA 4FFOA 5A1TA 4ZQFA 3OIGA 5BNTA 1XEAA 4CUKA 2BFOA 1SOVA 3WSVA 1O94A 1MX3A 3PFFA 4WE3A 4CM1A 3JQCA 4JJFA 4Z3KA 2ZYAA 3TFOA 1P3DA 3LVFO 3Q11A 5TNXA 2BFMA 2VRCD 2G76A 3IIEA 2HUNA 4YAKA 3BMOB 3F4LA 5DOVA 3F1LA 2Y1FA 1ORRA 4BNFA 2PTGA 1ISJA 3FD8A 5JC1A 5TF4A 3PJDA 3PXXA 4IQGA 1GFSA 2BH9A 1R4MA 2FWMX 3K9QO 3V1TC 4LRTB 1VL0A 3QVWA 4FR5A 3E8XA 4MIOA 4WCFA 1A27A 5B4TA 5DULA 3A4VA 1BVRA 5JYEA 4Q3BA 1C0LA 4WECA 1KEUA 1IULA 2WD8A 5BT9A 1O8CA 3OECA 3MOIA 2O7QA 4RDHA 1R66A 4WEQA 1FMCA 2CUKA 4XR4A 5ENDA 1Z7BA 1ZK3A 5A05A 1M2WA 4RF4A 1ZK2A 4FC6A 5DDIP 5BSEA 4YCAA 3A9WA 1CIVA 4RVDA 4BV9A 1PGOA 3UXYA 3WJ7A 1C0KA 5CEEA 3D4PA 1HETA 4PLCA 5C37A 1BGVA 3JQGA 3A28A 1NQ5A 4Q39A 1EDOA 3E6AA 3PWZA 4D45A 3GPIA 4G5HA 1JKFA 2CDCA 3TDKA 1U4SA 3KB6A 4XZ3A 1WDMA 4HX5A 2QYTA 3TPCA 2JAHA 1HRDA 3PGXA 4ND2A 1DC4A 3ROQA 2I6TA 2Z1MA 3D5TA 3HDQA 3LK7A 4DLLA 2NU7A 3D4OA 2P2SA 1ISIA 2GN9A 1SPXA 5ICMA 4PLHA 1WW8A 3ONFA 3BTVA 1X15A 4LN1A 9LDBA 2J3HA 5FWNA 3LQFA 3HE3A 4R1SA 2GNAA 1PQWA 4BNVA 3JD3A 1IB6A 2IZ0A 1F8GA 4YVFA 2PR2A 3U9LA 4P8RA 5L7YA 3ZWWA 3OBBA 5HM8A 4OXKA 2B4QA 1MFPA 3GRPA 4CLHA 4JX8A 1R6DA 2NVWA 1DDOA 5IG2A 4Z6KA 4UUNA 1D1TA 1H9BA 2RAFA 1O0SA 3RUEA 2RHRA 1NFRA 2ZTLA 3DAGA 3KXDA 4WLEA 1ZIDA 1DRUA 4A27A 2PK3A 4B3IA 3H9GA 1QLJA 4RPKA 1LSOA 2DTXA 3AOEC 3KYBA 4TVOA 1UAYA 4RZHA 5KVSA 1E1MA 4NZ9A 2P4HX 3AY7A 4D46A 4OKIA 2G0TA 4PLGA 4RV9A 5L3ZA 1OC2A 2ILTA 3NTRA 2HAEA 3SJUA 4ZVVA 4L75A 3KHUA 1KC3A 1HSOA 1W4ZA 2XPCA 1UXGA 3HQ4O 4J49A 1PWZA 4HNGA 2DPGA 4IDCA 2FP4A 3EDMA 4I1IA 2AQKA 3TZCA 5JDCA 3L0DA 2YV3A 5CEFA 4ZU3A 3VHRA 1HLPA 2DVMA 4EUHA 1R15A 3OEYA 1ENZA 1FDVA 2YFHA 3H2ZA 4I9UA 4UVEA 1YOVB 5EJ2A 4CUJA 1D8AA 2X23A 3ROMA 1DFGA 3I52A 1AHHA 2BELA 1FDTA 2B5WA 2XXBA 2VYND 3G1UA 2NVUB 1B16A 4Q3DA 3IJPA 2CZCA 1VKOA 5ITVA 3DZFA 3VH1A 3Q9UA 2WD7A 3AW9A 1B15A 4BV8A 2VHVA 3I9LA 2J8ZA 4PVCA 3B1FA 3DZBA 1Z75A 1V3VA 4O59O 3P2YA 4JBGA 5JBIA 1U3TA 3B1JA 4WGGA 2JCYA 1H0KA 1O95A 1KVTA 2EJWA 5A9RA 3DOOA 4BO6A 4G81A 2VWPA 3TL3A 5A9SB 1M75A 1X0XA 1PJSA 3WLFA 1B8PA 1DAPA 2QRLA 4BNLA 4DXHA 3D1LA 5IN4A 4R51A 1H6BA 1SZJG 3E9QA 1HYGA 4BO4A 4MVJI 1E5QA 1EFLA 4RVGA 3V5NA 3IDSA 2OP1A 4B3HA 1TT7A 3TNLA 3Q0EA 1XLTA 4CMEC 4OL9A 2Y93A 5TJ9A 4HKTA 1OFGA 5JAQA 4AJPA 4BNIA 3GVIA 3UH1A 5ER9A 5CDYA 2FZWA 2WYUA 3E5RA 2POQX 2B4RO 2W2LA 2ET6A 4YQZA 4IXTA 3FI9A 3DO5A 4Z9YA 1YO6A 2Q2VA 4D0SA 3H5AA 4JLWA 3MJVA 5AYVA 1PJ3A 4MINA 2EG9A 4WNCA 5LCXA 1GQQA 3FHLA 1HXHA 4BO3A 4E6PA 3JQ8B 3PDUA 4ZQEA 1XYGA 5GMOA 4DA9A 5JMWA 4JXKA 4PG5A 4I08A 2QRKA 3GZ4A 4YBZA 4P22A 2IZZA 1C1XA 3C1OA 1MGOA 4DRYA 1N7GA 2XOXA 2AHRA 4Q3EA 1YXMA 4UUMA 3U0BA 5FFFA 1LDYA 5I8WA 3WLEA 3O4RA 5FYDA 1E3WA 2C07A 5KKCA 1T24A 3Q6IA 3ADOA 1ZFNA 2OMEA 4OHUA 4D41A 3PYLA 1IZ9A 3RJ5A 2ZQZA 3WX0A 2A9FA 3N7UA 4PVDA 1HDRA 3AI2A 5BNFA 5COBA 4GBJA 2EKQA 3Q9NA 3DMTC 3PRJA 1TB4A 3WWYA 3ZNPA 2GO1A 5F5NA 3OETA 3OA0A 2D3TA 4QT0A 2HLPA 4ND4A 2CFCA 3JQAA 4OSOA 3GZNB 1G1AA 4KQXA 3DONA 4FFLA 1DPGA 4B8WA 2QW8A 1HYEA 5B4VA 4J9UE 4NI5A 5ER6A 1ZJZA 3DDNA 1PJCA 1JAYA 2NNLD 3F1KA 4TRMA 4GGOA 1QR6A 2VTDA 3F47A 1FXSA 5JY1A 1ONPA 3VH4A 1X14A 4LISA 2O3RA 1TEHA 1U3UA 4IIUA 1ZJYA 8ADHA 4B7CA 2DU8A 3C3XA 3SX2A 4YAGA 2OBNA 3LC2O 4TZTA 5EL0A 3RFXA 3OFSA 3PEFA 1E7RA 4KZPA 4XB2A 4AJ1A 2ZKLA 3GFGA 2Y1CA 4IM7A 4WLOA 2H63A 5H83A 1PGJA 2Y1OA 3DFZA 2P68A 4RCVA 3D4NA 4WCFC 4X54A 5KCZA 2FPIA 3QWAA 1AHIA 3WGZA 4BNGA 4NR0A 5L7WA 1ULSA 1TT5A 2DT5A 4IY1A 4DL9A 3I9OA 3GEDA 3JD0A 4D3SA 1NBOA 5G4LA 1FF9A 4YJDA 3OHSX 3HG7A 1L7EA 3L07A 4GLOA 4QUKA 5HS6A 1XGKA 2EIHA 1FJHA 2FOIA 4BVAA 4ZQHA 1KEWA 1V0JA 1QV6A 3ZN2A 1GL3A 2C7GA 4Y6PA 1V35A 4LGVA 2CNBA 3MOGA 2CY0A 2GLXA 7MDHA 4CUZA 5CFZA 5TSDA 3DQPA 3WSWA 5L53A 2DQ4A 3G3EA 2B5VA 2YJZA 4GQAA 4FFRA 3TN7A 3IP3A 1G6KA 1CDOA 1NVMB 3E48A 1MB4A 3U4CA 1GADO 1DFHA 3BMNA 4BO1A 1PJ2A 2VT3A 2ZTMA 1E3SA 4NBVA 1ZEMA 4O6VA 3P7MA 3HZZA 3MCVA 1GZ4A 3D64A 1EBFA 5AXAA 3GHYA 1VRWA 2DM6A 2Q4EA 1H6AA 3PWSA 3GUYA 1IZ0A 3DEYX 3DL2A 3UN1A 2PA3A 1C1DB 3TFQA 1I3MA 4XYBA 4DPKA 2QIOA 4CQLA 4CMGA 2ZYDA 2FSVA 2EERA 3O38A 1F0YA 2V6BA 1A9YA 2QZZA 5T6BA 3FTNA 3RVDA 3KV3O 5TJHA 2I3GA 1DFIA 1Y8QA 3UW3A 4EW6A 3A06A 5L95A 5DCUA 1WZIA 3WFIA 1QYDA 2PGLA 1E5LA 2IRWA 3AUTA 1DHTA 4B7UA 3VVCA 5CDUA 3PHLA 4N5LA 1BVUA 3F5SA 4YQYA 4NMHA 3P5SA 4MPDA 5AXBA 3TQHA 4CM9A 3DZIA 3ITKA 1NFFA 3F4BA 4LVUA 3DR3A 2GZ1A 3FN4A 1MG0A 2RIRA 2X22A 4YRDA 4DMMA 1I10A 1PGQA 4KTVE 4ALIA 1E3JA 3K5PA 4JNKA 2AE2A 5JO0A 1D1SA 2IEDA 2PZKA 1ZZEA 1E3LA 5J23A 1B14A 1PL7A 5KJEA 1Q0HA 5F21A 4AJLA 3PJEA 5FI3A 4J0EA 4ESOA 4D79A 4LMRA 1PZFA 1U8FO 5KWEA 3FCOA 3NDRA 5JDCC 1AE1A 4FGWA 3IUPA 3I9KA 2FRDA 3O03A 1R16A 4L4SA 1WMAA 4DIFA 4TZKA 2PH3A 4W6ZA 4J6FA 3AWDA 3JQ6A 4F3YA 4OOEA 3BTUA 4GX1A 4YJHB 4E33A 3ROKA 2X5OA 3G49A 4BB5A 4EITA 1YONA 5A02A 1NWCA 2X58A 4ZQGA 3INRA 3JQAB 4PRKA 3L4SO 1B0AA 1LTHR 2EW8A 3BMOA 4NU6A 3ZWBA 1DC5A 1OBFO 1GEGA 4LRSB 4RORA 4IGFA 3FSRA 1Z82A 4RO0A 1P1RA 2JCXA 4FSHA 1IUKA 3ZWNA 3K30A 3WOHA 3FR8A 3R0IA 5BSGA 3FR7A 2I76A 3PDJA 4FGSA 2NTNA 1UZLA 4IPTA 1GYPA 3H9QA 4UEOA 5F5LA 5U1PA 4KDEA 2O48X 3ZU4A 1GUFA 2GF2A 2IE0A 8LDHA 2YZ7A 2C20A 3ZZNA 1HE2A 3GH3A 4IIVA 4B4UA 4KUGA 4PG8A 1K89A 4K9DA 4ALNA 3P2OA 4Q9NA 1RPNA 2H5LA 3ONEA 1CQJA 3S2FA 1GCUA 4M54A 3ZWCA 2VZ9A 1N9GB 1PQPA 3GDOA 4L73A 1I5RA 3K8ZA 2F1KA 2WMDA 4BNKA 2NLOA 3V2HA 1GUYA 3ZWPA 1WP4A 1MA0A 4BS9A 1XQ1A 2BFAA 1CF2O 3SXPA 2GSDA 4FBGA 1BMDA 3GDFA 2FPPA 1EUZA 2O3SA 3AU9A 4OXYA 1CQIA 4CQMB 4Z0TA 3BTOA 4NH4A 5JDIA 3PHHA 2X6TA 4E31A 1ULUA 2FR1A 3JQ7B 4R16A 3ONDA 3ZWXA 1YBVA 1JKJA 2Q2WA 1AN9A 1XSEA 4CR8A 4MVJM 4MVJH 3UGKA 3K6JA 1B8UA 3KOUA 5ILGA 2DUUA 3HFSA 3QLJA 5JFOA 2I5PO 1JDJA 1E3IA 4JN6B 3WNVA 2YQ5A 3L6OO 2LDXA 4YA6A 1FDSA 5B1YA 2ZTUA 4ZA2A 3T4XA 3WYCA 2JD0A 5BQFA 2W2KB 4XWYA 2EKPA 5IJZA 1CJCA 2WM3A 1NVTA 2HCTA 3F46A 3GQVA 5T57A 5DBIA 2VUTA 1BWSA 3VPGA 4O63O 4BL5A 1YDEA 1HL3A 2HO5A 1LRLA 1X0VA 4N5MA 3JQEA 2B69A 3C7AA 3DOJA 1RYEA 4XRRA 2AMFA 3NUGA 4ROSA 3QWFA 3RUHA 4BGUA 4CLDA 4WNIA 3Q2KA 5L4LA 4ID9A 3PLNA 1ISGA 4M49A 1YB1A 3PPIA 1VC2A 1JU9A 3KBOA 1UXIA 3C1AA 2Y68A 4QFCA 1PJBA 3AM3A 3N74A 1VL6A 3M6IA 2EP5A 3SBOA 1N7HA 4FW8A 3ZWMA 3WMWA 1YJQA 4I5GA 3HDHA 2W90A 5DBGA 3EZYA 3CPSA 4FPXA 1PS8A 2AEMA 4I9NA 3ZH2A 3DBLB 3HADA 5DOZA 5MGBA 1P33A 1PS9A 3VDRA 1EBUA 2DFDA 1I2CA 3TWOA 1G0NA 1O5IA 2V6FA 1HKUA 4B4WA 1YOVA 4E5KA 3K96A 4KWIA 3FNFA 4RF5A 1U7HA 2JFHA 4RPLA 1YS4A 3SLGA 3OSUA 4NU5A 4DUPA 5T5QA 1NQOA 3JD1A 1GD1O 4IZIA 3GVHA 1B3RA 1XELA 2NVUA 3CUKA 3I23A 5L4SA 1R37A 1XWFA 2WE8A 1EVJA 4IMPA 3EW7A 2I66A 5DCYA 3NKLA 3B20A 4UULA 3U3XA 1E7YA 5FEUA 3Q3CA 9LDTA 2RCYA 4ND3A 4DBVO 1GTMA 1ID1A 3WIEA 3HB5X 4K1LA 4WLFA 5A9SA 1SB9A 4OQYA 4GKBA 3CMMA 2HU2A 1I0ZA 2GPTA 3WGQA 1R4NB 4W82A 4YTEA 2CF5A 5B4UA 3W6UA 5I7VA 1VSUA 4CMIB 3HNPA 4RF3A 2AEJA 1LSSA 1OOEA 1YB5A 4TKMA 1XG5A 1GUZA 3AY6A 3LU1A 4PZDA 3JYPA 3ZWVA 2G17A 2CVOA 2NSDA 3JYLA 2DLDA 4BNXA 1B7GO 3H3JA 2TMGA 5A9TA 1WDLA 2PKRA 4IUYA 1DHRA 2Q1WA 4FS3A 3NEPX 4Y6SA 1X1EA 1QMGA 1D3AA 4QECA 1E7QA 2Z95A 3VKUA 1KERA 3C24A 4KUHA 5G4KB 3RJ9A 1YVEI 2B36A 2EKLA 2FY8A 2HMSA 4KOAA 4RLHA 5JNLA 3GAZA 4XEHA 3WMXA 1B8VA 4BKRA 1GY8A 3HN2A 3KLPX 4RGBA 2I67A 3CXRA 5TT0A 1KVSA 3JQ8A 4WASA 4Z0PA 4BNJA 2O3TA 1HDYA 4A2CA 1Q2XA 4LMPA 5ENVA 1U7TA 1L1FA 5CG2A 1QYCA 3CSDA 2DPHA 2QZ9A 4HY3A 2X4GA 3P19A 1DIBA 1Y5RA 1LC0A 2BMAA 4M8SA 4XIJA 4ZN6A 4D7AA 4Y8VA 5TX7A 1XCBA 1V3UA 3N58A 1NR7A 3RAJA 1YRLA 4PG6A 3WBBA 1M6HA 4QQRA 1Q0LA 2FMUA 1UP7A 3BYZA 4D44A 1E6WA 3GK3A 3EYWA 5I8ZA 2GERA 3OJOA 3I6IA 3VPSA 4BKPA 4DQUA 2HMWA 3H65A 4Y6RA 4ZD6A 1U8XX 3VZRA 1NAHA 1BW9B 1KVQA 5T67A 5CDTA 3QY9A 2R6JA 4E0BA 1VPDA 5EIOA 1XIVA 3GZNA 4WEOA 5JCJA 3D3WB 1HTBA 4NFHA 4DQXA 4YWJA 3OICA 4XQEA 1S7CA 2FZEA 4R1NA 3ZU2A 1MP0A 4FC7A 3DAFA 3JYQA 2IDZA 1Z73A 2NUAA 1CYDA 1BTOA 5JAZA 1IL0A 4B3JA 4OO3A 4E5MA 2ZQYA 4B4OA 1KY5A 4RPJA 4GX2A 1GEEA 1UJMA 3BMCB 3BHJA 2OO5A 1YQXA 3HN7A 3DHNA 5CP8A 2EGGA 2OXIA 1E1NA 4XGIA 4N54A 4Q3AA 4IINA 3RWBA 4TQGA 3MZ0A 2OORA 1LBEA 3OIDA 4KDFA 3I1JA 1DBVO 4DLBA 2Z5LA 3NRCA 4OSPA 3GMDA 2GN8A 2PGJA 3KLMX 1KEVA 1HDCA 3EVTA 5JW6A 4WPGA 3DC2A 1MC5A 5C7LO 3U49A 1GPDG 1UP4A 2VNSA 4Y98A 3H6KA 1Q7BA 4NFYA 4XYLA 3TOXA 3MJ4A 2O23A 1JW9B 1YL6A 1S6YA 1UZNA 1I8TA 2WYVA 3RKUA 1EE9A 3ZU3A 3EUWA 1HDXA 3RI3A 5HBRA 2OP0A 2BLLA 3GFBA 4YT2A 4EUFA 4RVSA 5L40A 2J6IA 1ISHA 1L7DA 4PFJA 2BRUA 2NVBA 3UCFA 3IL2A 1NHWA 1WWKA 2XAAA 3EAGA 4HP8A 1HT0A 3RFVA 4BNZA 1LQTA 4PZCA 1J4AA 2XF8A 1WNTA 3EHEA 3GN2A 3WTBA 3W1VA 3PZRA 4B8ZA 4CV3A 3FPCA 3LDHA 3TOZA 2W98A 3VZPA 5IZCA 4RVHA 3LSYA 3ZHYA 1K3TA 5TS3A 3VZQA 2GCGA 1NNUA 3COSA
chains in the Genus database with same CATH superfamily
1SC9A 3QE2A 4OGGA 2ST1A 4REQA 4EYOA 4MP6A 3Q6MA 3IS3A 1T25A 3FNHA 1ZI8A 4G65A 4N18A 3RAEC 1MV8A 2OILA 1BHSA 2DQSA 2ZJ3A 2AQIA 2X2PA 4BLQA 3V8RA 3W3AA 3G88A 4MR7B 3ZIDA 5A4MS 1R0LA 4JQOA 2UYQA 4EGAA 4GOJA 1XQWA 4QASA 2PSFA 1C0EA 2FSHA 5CVDA 4DR7B 3FRJA 4H1WA 4R7ZA 2F3TA 4ND8B 4JYBA 2C29D 4HATA 5FKJA 5CFQA 5L3SA 2VT6A 1ABEA 2WIJA 1QIGA 3BGOS 4ZT2A 5HCUA 5HUJA 3RV3A 1A69A 4UXIA 3WYNA 4QUAA 3U09A 2VOEA 3G59A 4B35A 4FDTA 2OCGA 3O2QB 5CA0F 3NOOA 4NF2A 5D5PA 1AZTA 1DPFA 3JATA 3A6GA 3I6QA 5AK4A 4CMHA 3V1NA 4IJUA 4INPA 4BZWA 1T3HA 3M1LA 2ACKA 3QKRB 1K0UA 1WVIA 4N3AA 3WS7A 1V3TA 2Q2NA 3L7YA 4K1XA 4OF4A 2QSYA 1EVYA 3KB1A 3KZ1E 3E9MA 2PKXA 4JNCA 4ARVA 1NATA 3AILA 4B4VA 2DJ5A 4J0FA 4TRRA 1X8LA 3ZVLA 2XMQA 3L1KA 5ALUA 4D6PA 3OD1A 2FUG6 1K9VF 1M2GA 3IMKA 1DAHA 4FFMA 4MUMA 2GJ4A 1DKUA 1FFEA 5E7MA 5JC8A 1CNMA 3JQ9A 1Q1GA 3AU8A 1XRJA 3NOXA 4YDRA 1AK1A 1FC0A 2QVLA 1H69A 3RB8A 3VZSA 2YX1A 3ERCA 2JFYA 2HA2A 3IQIX 1PFGA 4UNIA 3KTDA 1L9XA 1KRHA 2NT4A 2GEFA 4PXAA 5FUMA 1IPHA 9MHTA 3EH2A 1YBHA 3V1KA 3VNRA 2J3KA 3PEYA 1KHTA 1V9CA 3TINA 4K28A 1FP4B 1KJZA 4WK6A 2ZROA 3OF2A 4K3UA 4QYIB 4ZJZA 2JBHA 3LA6A 3WKEA 1ZW1A 5KNDA 2J1LA 3UGJA 2GGSA 3G2HA 4ZCQA 3EXHB 3E35A 1V96A 2RHGB 1T8TA 3OESA 4A26A 4BMDA 3IULA 2V65A 1OAAA 4RH1A 3N3AC 3G82C 1ORIA 3H2IA 4QOGA 4MGHA 2P69A 3H97A 3OKPA 5JVDA 5L6MB 4TXNA 2Y9MB 3QELA 1SEVA 2QQ5A 2XA9A 2B61A 1RRKA 3LAWA 4QGHA 3HBAA 4C4ZA 4JYZA 4KHPB 1NBMD 3O6VA 1E92A 1B26A 1QHIA 2O8VA 2Z2XA 4G5YA 5IVPA 2ZVPX 4RK1A 2VSYA 4OM7A 1Z0IA 2FSFA 3LWZA 2IYWA 2RKOA 5G1OA 5B2FA 1NQAO 3CUSA 3LT1A 3FZEA 1U9IC 3D8BA 4UATA 3VSAA 4K6FA 4WESB 2ERCA 1L3IA 3MT8A 3BE4A 3TJRA 1OMOA 4MRMB 4Q19A 4AMVA 1J56A 1Q50A 2L19A 1XZEA 1VE3A 2P79A 4K26A 4LG1A 4QO7A 4R0NA 1T9KA 4EG6A 2OZLB 3ZQ4A 3LQKA 1H3FA 4H3VA 4FKMA 1U63A 2R96A 4KFUA 2RI0A 4G89A 4LMBA 4EJSC 721PA 4QDXA 5HZKA 1XDUA 2W2LD 3GJ3A 2WPDA 4G4SP 4JODA 1B76A 4ALMA 5JH7F 1PTJA 3IV7A 4Z0NA 4LJ8A 4AKEA 2R6GA 1C81A 2Z9BA 3WLHA 1V6CA 5JAMA 1SCQA 5E2AA 1PF7E 2JANA 3KJHA 4RVFA 3UMRA 5L6LB 1K7FB 2HJRA 5JD6A 1QIIA 3GNSA 2IYQA 4J0GA 4MUYA 3LV8A 1PRYA 3PKIA 3P8ZA 4WT7A 3KOWA 4A4DA 4DLNA 1U99A 1VL5A 3A10A 3ZHOA 1FX1A 1M34E 3AFIA 4AMUA 5BR4A 4GKJB 4KR6A 1I30A 3I5XA 1BA3A 2PV0A 3UV7A 4UCFA 2G04A 2Z5GA 1T5LA 1PNVA 3ETEA 2OFFA 4JJAA 2HT1A 4P84A 1G6Q1 1KYTA 1L7BA 1OGYA 1JXAA 4GP7A 4IOJA 4NQZA 3UOGA 5KOHA 1XV5A 4Q12A 1WDKA 1YHYA 5DISB 1UF9A 3LC1O 1P1HA 5DNYB 3QI2A 1F0KA 2FFAA 2HDOA 3I28A 4FNOA 2MWMA 5E6UB 2FFHA 4X3CA 2WYOA 3HV0A 1EE2A 1ZKMA 1JWAB 2ID4A 1RYDA 3P1JA 3ZCQA 1VKZA 2YY7A 3EQ9A 4PZ0A 3I9MA 3NFRA 4E3WA 5B55A 3CV3A 3U3RA 3C7DB 4CF7A 3K35A 3F7NA 4E11A 4JLKA 5KU1A 2PD4A 5BPHA 2O2IA 3JYOA 3FBTA 4BUCA 3WWZA 1K97A 3E18A 2YRWA 1QKIA 4R98A 3SZ3A 3HJHA 4U2BA 2GJ9A 2GZSA 5TV2A 1V5EA 1HE3A 5G02A 3P26A 2NYRA 3PD0A 1NPTO 2BY4A 5COQA 5CDSA 1JAHA 2P9BA 5ARDA 3UT5A 4BO5A 4HEJA 1Z8FA 2JGDA 2YJ5A 4YLGA 3KELA 1N8NA 3IPXA 4JS0A 4AT1A 4YRMA 3PC8A 2IXAA 4HH0A 1C3VA 1U28A 3WLLA 3FE2A 3ESCA 2W22A 4W1RA 1JYFA 4X1IA 4YRLA 4JJ8A 4ZYTA 1QQTA 4Z3OA 1G17A 4CG1A 4QFBA 4ZU6X 3KPWA 2W4IA 2PL3A 2QTVB 2W37A 3B7GA 3H2HA 3HB4X 2NO7A 3QMPA 4UE2A 4UOQA 2Y77A 3G8DA 4BNDA 2NW6A 5KVQA 2L69A 3JATB 1AU9A 2OO5C 4TYNA 2VO1A 2EFDB 3RTCA 2BC9A 5AUQA 5A5FA 4PG4A 5LP6C 1EK1A 3LA8A 2V6MA 1TMGE 5ALVA 2PD3A 3SFTA 1W8IA 1I01A 2VAMA 3G0IA 4UVGA 5LZ8A 3LDAA 1R0YA 3KX2A 2UYOA 1K8ZB 3RBXA 4D43A 5A7HA 1RZUA 2CLCX 1L5WA 2VHUA 4KYUA 3AQIA 3SHQA 1O6ZA 4BXOA 3THXA 5FPQA 1S3FA 1ZISA 5AW5A 3RAGA 2HBYA 3GLRA 1LJ8A 2WA1A 1WCV1 2WMYA 1II8A 3AY3A 5ALDA 3FMGA 2EW2A 2ARKA 2FWPA 3CISA 1DG3A 3R0ZA 4OYLA 5DW0A 1ZBQA 2YN0A 2O3QA 3LFHA 1VI6A 5AOBA 4EPTA 1QIHA 4YBRA 2XKJE 3VDMA 4EENA 1ZXBA 4HLUC 4UTPA 2H9AA 3GCWA 1TRKA 1YRHA 4YGXB 5KYNA 2VT7A 1ZVVA 4LF4B 5JPIA 4MR9A 3PC4A 1OH7A 2X40A 2BE7A 3PFBA 1IHUA 4QHYA 2FN3A 4ZQCB 4EJ0A 2PUWA 4GPAA 2PX2A 3NLLA 2OQRA 4ZFNA 4TKZA 3AVXA 2FPLA 3BD6A 1J8VA 3OX3A 1DJLA 1DOHA 3E5MA 2WJPA 1AH2A 2V7PA 5DLDA 4FLEA 2G72A 1CC1S 1CETA 3N70A 3QMMA 5FR1A 5EY5B 2BH2A 2C5AA 1MJFA 4I5EA 5JIBA 1P61B 4WLUA 2WYWA 4ZICA 1RQ2A 1Y3AA 3MW8A 4G8BA 1R4NA 2XMDA 3HKDA 4PWZA 3R09A 2DFVA 2WHPA 3BGVA 3A26A 1M8FA 2QMHA 3UK1A 5IZCC 4LNUA 1KJ8A 2VAWA 3B70A 1A9ZA 4MQ6A 1I1QB 2QUHA 3IKVA 1R00A 4R81A 4O4JB 3SZUA 1NF9A 1Z34A 3VR1A 1P8JA 3WSTA 3HYCA 1P9NA 2PIDA 4RJKA 2E4XA 3PNSA 3BAZA 1QGDA 2HRBA 3QMVA 5LQCA 2I65A 2A88A 4FMBB 2QROA 3ZWYA 4EVIA 4MV1A 1GAEO 4P4GA 1IN4A 3DS8A 3ML1A 3NHKA 4X85A 3SYMA 3WB9A 2R62A 3K05A 4QDOA 2V59A 2QPLA 3EQ2A 4QATA 2WUWE 4U7WA 5DTIA 4EI2A 1GNSA 5MHTA 3EGOA 2GWHA 3NNNA 4FZRA 4WLVA 1U2GA 5G4KA 1E2DA 4G6ZA 1Q1NA 4MYRA 2F9LA 3W04A 1XCJA 3EMVA 3TVDA 1XCOA 2VPWA 2IGBA 1Q22A 4CR6A 4UNRA 5IYZB 3U44A 3OEHA 4RMJA 1SU6A 5BN3A 3G17A 1RM5A 3CWQA 1SVSA 5DM4A 3IV6A 4M4SA 1TM2A 2Y1LA 4DNXA 4F9EA 2PJRA 3LLVA 4QODA 3BMQA 4G5RA 2CCGA 3OPQA 4ILKA 4YREA 4ZKDA 3KYDB 5GZ6A 4YY3B 4Z49A 4CEJB 3BCUA 2IYTA 2JFFA 4M89A 2GILA 4P2GA 3LZ6A 4B48A 1ZC3A 4HQRA 4B7ZA 4B76A 2FLWA 4G0OA 3VR5D 5F1PA 1DGQA 1D5CA 1IZ7A 1GRVA 1SR8A 2VH2A 3N0WA 2HRZA 4JT8A 4RVCA 4UUOA 4IWXA 4IS3A 3OP4A 5KHAA 4E5VA 4MGKR 4B83A 4BE7B 3CKLA 4R69A 1PR6A 2QNBA 1P5ZB 1QZTA 2NQ8A 4Y6GB 4YCNA 4BPBA 5LBUA 2BAGA 1R0WA 3B3JA 3H5IA 1BH6A 3O84A 2Z1NA 5DYNA 4D25A 4G9BA 1EFRA 3LF2A 3Q0TA 2R7AA 2UKDA 4YR9A 3F67A 1JGTA 3DXZA 1Y4UA 3AVVA 2YUTA 1FBNA 3QNMA 4OM8A 4UM5A 3S6JA 2GBCA 1E1RD 2BP7B 4GR9A 2GM9A 5HIIA 1YAHA 3F6PA 4CMAA 4X71A 2P9GA 5CYGA 1HK7A 4JKOA 3D3WA 2WB2A 1L5YA 1DXYA 4F85A 4O2AF 1IVYA 4DLSA 2QBYB 4HB3A 2VHXA 1YD7A 3FOBA 5KTSA 1G9XA 4DA7A 2XJ9A 4X1YB 3KQHA 2A2ZA 1UM8A 3CG4A 1KAQA 1V16A 3MMPA 2VBFA 1XMQB 1RHKA 2HPAA 2XMSA 2YNMC 3PYMA 4PRLA 5CDFE 3BXEA 1NUSA 5H80A 1RMTA 3BILA 3CZMA 3Q3VA 4ZV9A 5TVKA 4MV6A 3IJ5A 5B58T 3EC1A 3FPJA 4F04A 1JG2A 3IVGA 2AK3A 1VBMA 2X0DA 2Z1DA 1NW6A 3GFOA 4KQMA 4L16A 2NZ8A 3L8CA 5T4HA 1YBAA 2VPZA 5AIAA 3TCNA 5IXYA 4WKPA 3UT5B 3VJRA 2DR3A 4CL3A 3CF2A 1ZG3A 4Q1FA 1V37A 1WQ4A 4K46A 1XYYA 4YJ3F 4YRZA 3F5DA 4AZVA 4I1RA 2QD3A 3FHTA 1X9IA 3OZAA 5H7XA 4J2OA 2VRCA 4RFSA 4DRZA 4AC9A 3BCHA 1Q7RA 2IY8A 2PRKA 3Q98A 5FTWA 4DNQA 1WBDA 1UK8A 5LZ5A 3JARA 2O8BB 2I6QA 5JMPA 2NZ2A 1TKBA 4PLTA 3ONNA 1QWOA 1DC7A 4QQ8A 4TTIA 2GK6A 3SHOA 4D8TA 3GEEA 3L6CA 2NQTA 1EXVA 5J2TB 4F3TA 1GSAA 4FDAA 3UC9A 1E2NA 3Q7IA 4Q7MB 4NMWA 2BCGY 2FMFA 4CFZA 1XVIA 1ZJWA 4DV0B 1TPYA 1FDIA 3TSYA 5AM2A 3O2NA 3A6HA 3SYLA 4CIXA 4EB6A 4LOLA 5CPBA 3PVZA 2BPOA 4LQCA 2BGIA 2JLBA 1ONNA 4L4XA 4RSMA 2Y1WA 2PZAA 3IP1A 2J9RA 1P39A 3JWHA 3HYSA 1DCMA 3QLUA 3THXB 1U8UA 1WXFA 4K6MA 4AG3A 4DLXA 3FMOB 4UDYX 3REGA 1SNYA 1EDBA 2DGDA 1C0PA 3IO3A 2PBZA 3LQYA 3N7TA 3LG2A 5BV0A 2XE8A 4OJKA 2PVCA 5I9BA 5AUNB 1A8IA 4RYLA 1JHQA 1ZUIA 1W4AA 5AXCA 2QJTA 5HDBB 2QRGA 3ZTTA 5JEEA 2IUSA 2J32A 3JQBC 3GQBA 3I3OA 5FP0A 3UV6A 2BFNA 2ABWA 1KEKA 4X62B 4P4LA 4JBXA 4J29A 4DCJA 1CT9A 3IHTA 2QR3A 4S0XA 3FVWA 1P7WA 1FVFA 2DTDA 2XUKA 3BXHA 4FCVA 1ITZA 1E62A 5EQFA 5HJ5A 2YCLA 4QPNA 5FPPA 3HO6A 4DCTA 3K0BA 3OU6A 4HOYA 2HYDA 1J0AA 1TK3A 2HQBA 3KP1A 1XZIA 3E7FA 4Q9IA 4WOCA 4G8DA 2AUMA 2V55B 3ZCPA 3STVA 3H9JA 3VJKA 1UQTA 1BSVA 2NOAA 2AW3A 4R1UA 3R9IA 1DIHA 2GT1A 4XSGA 2PBFA 3PIIA 4CM5A 1FDWA 1AG9A 1XE3A 3RU3A 3WIDA 5JWRA 4I2VA 3STUA 3KYIB 1JR2A 4J07A 3DO6A 5G3ZA 5AM0A 5LYJA 5LU9A 2WJHA 3A8TA 1PD1A 1N77A 2WTBA 3K1ZA 3DEZA 1IAQA 2A9VA 4HEQA 1R6BX 2PSHA 4AJIA 3FNEA 1H8EA 5KNCD 4K9PA 3ENWA 1GG2A 2PQMA 1PP4A 4EKEA 2WTMA 3HXQA 1JHXA 5JSKA 3T1OA 5G3YA 1N2XA 4DC0A 1H4VB 2D0DA 2HT6A 4ODIA 1SD2A 2X4DA 2B21A 4XASA 3SN6A 3V8PA 3PC2A 1F4LA 1P18A 2M2IA 4GNKA 3ZW7A 4IIJA 1IYZA 1YZLA 4WBXC 2VT2A 2QD2A 3DOHA 1NYQA 4O5OA 1RXSA 4OFWA 2VLBA 3V4VB 4MYDA 3HJFA 4QYXA 3G7UA 4RTNA 2AR0A 4GDFA 4XDZA 3NHYA 1V3QE 3H16A 1Y4DE 2EBHX 5EJ7A 2X9LA 4JGBA 3ZGNA 4YYZA 3WGNA 4ESEA 1GNQA 2BHSA 2ZANA 3MD9A 3ORHA 2HSDA 3GDGA 1JALA 4TKUA 4ZYUA 3O3CA 3MMXA 1VYHA 3ZGVA 3H2YA 4XTCS 1W46A 1OF1A 3BMQB 1PT5A 1SB8A 3UHPA 4PFQA 1CUCA 1LA2A 4BDTA 4XJTA 4EA6A 4Z1MD 1FQJA 2HMUA 2RIPA 2X0JA 2XBLA 2J9XB 3AR2A 4W63A 4BLSA 4D9IA 4N5NA 4HNSA 4HZUA 4GWGA 1G6HA 1DARA 3FPEA 4LK2A 5B1HA 3AONB 1JVBA 4RKRA 3TQIA 5AR1A 3CQ9A 2F67A 4MUNA 4KZKA 1TEXA 3DHEA 3CUVA 4WXEA 3PXAA 1L6IA 5G0SA 3U80A 3T3GA 4D4LA 1CY2A 2ZUDA 1OBOA 3MB5A 4HXEB 4YMIA 2R7KA 2A5GA 4MWZA 4D4GA 4XX0A 2C7BA 5KOJB 1M1ZA 3LGAA 3WLSA 5BY2A 1J90A 1MTZA 4IJVA 1ESDA 4X6YA 3E3AA 3ZJ4A 4R2JA 2W4QA 2X3YA 4OI4A 1H4SA 3QVOA 4RZXA 2GYUA 5HQJA 2HK7A 1P0CA 2J41A 4FSDA 2C3MA 1G3RA 1K6IA 1LLCA 1PJ4A 5C4IA 1O6BA 2ZS7A 5FX2A 1L7RA 1X7ZB 2JH9A 1UINA 1SCJA 3QJ5A 3STXA 4BN0A 4LVCA 1XPUA 2XXAA 5JJIA 3S2UA 5K3BA 2EWWA 3TZLA 5H16A 2WT9A 3HCFA 3OLWA 2HF2A 4DJEC 3QKUA 3HYTA 1Z4MA 5KTKA 1NDHA 2R2GA 4AP9A 4YIHA 1Z17A 1T0PA 1XAIA 3AI3A 3DEIA 4BX8A 1UXJA 1JJFA 3NIBA 5DB4A 5A3JA 5FJJA 3IOEA 2MSCB 5EOVA 1RT9A 2H3EA 5BOSA 4HD8A 3A1UA 3T1TA 3OZRA 3ZCSA 3EOZA 4RENA 3V42A 1Y8RA 1NYTA 1V4NA 3GJTA 4OJYA 2VHYA 3ETLA 2H07A 1GLVA 4GPD1 1JL3A 2YN4A 1X2EA 3L02A 1KIMA 5LA6B 1CY1A 1W6RA 1IVSA 2AQ8A 2I1LA 3H2BA 1JEDA 1GITA 1HE4A 5CH3A 2GESA 4X65B 4X66B 3EY9A 1M8KA 4EG0A 5KTRA 2QRPA 4WL0A 3O1IC 3ZCVA 1ZRNA 3F78A 1MENA 3REOA 2Y1DA 3D6MA 1WXXA 4HNTA 1NT2A 3TM4A 2XGMA 5IDYA 1HNZB 1SVKA 1KWKA 1QOZA 2HRCA 5AMXA 3RROA 2XNHA 3G8AA 4N0EA 3GJ7A 1QPBA 4BFWA 1DAMA 3N6RA 4EJMA 1M0TA 1XWWA 3NAZA 1QE5A 1V8ZA 3QVXA 4TRJA 4EAAA 1GL7A 3GAFA 3JSAA 2JAUA 4KAAA 3SZMA 3ZV3A 5HK9A 4HNUA 2O7VA 2R1UA 2VEOA 1YL5A 1KAHA 2VWQA 4IHAA 5JSZA 4LC9A 3R9WA 4S2UA 3UUWA 1VDMA 3G13A 1QO9A 1YE3A 4WXHA 1C0IA 1N2SA 4R40A 3JQFC 1GGVA 3LT4A 3RADC 1ARZA 4PPNA 4BMYA 1AHPA 2H9IA 1ZN7A 4HDCA 2XUDA 1QFMA 2ZYHA 5I5EA 2Q99A 1WW3A 1IMOA 4QPDA 4NMXB 1ZUD1 2Z4SA 5CA1F 3WB0A 3E53A 1EDZA 5EG5A 1KETA 1EK5A 4TKVB 4EVSA 3A32A 4RPHA 5FEMA 2Q3FA 5EQJB 5EZSA 3O94A 3PK0A 1VSVA 2RGNC 4FMCF 1KI9A 4NU8X 4BFTA 3O0DA 1S3SA 121PA 2C5BA 1A8PA 4B82A 1LPSA 2P4QA 2Z3ZA 3C70A 5IS2A 2WY2D 4J1QA 1W5TA 3V7FA 4BV3A 5LP1A 3ADDA 3AC0A 4BIMA 1QFYA 3AP2A 4B3DA 4JLDA 3I6ZA 3SR3A 3WWCA 5K6AA 1V7QA 4HDSA 1PYOA 3ICPA 3AGQA 2GLUA 3FLMA 2BD0A 1X1DA 1CUBA 3Q85A 4GH5A 1UJCA 3UF0A 3BB3A 3Q9LA 5AJWA 3ELUA 3C1UA 5IULC 2AJ8A 3LT2A 2Q3EA 3HL4A 2GYWA 4JI1B 5EJGA 2FN4A 3ZD9A 1T3ZA 4PQGA 1EHIA 2OV4A 3KZMA 3L6DA 4HLNA 4EG8A 1CPYA 2EVWX 4Q3CA 3GR6A 4JOQA 5DFAA 2BFWA 2PBRA 3HY4A 3M6FA 3ZVNA 1Y8ZA 2EJVA 1RRVA 3GOQA 4JIGA 4AO8A 1LF5A 2A30A 4LF6B 1XHLA 1VFNA 3MYRA 2CNWA 1JB1A 4KTTE 3ZW8A 3RVRA 4L02A 4ZQBA 4CVNA 2F1HA 3I6BA 3B82A 1E5DA 1X19A 2VZEA 2ZPUA 3CH7A 1Y5NA 3KCNA 2IOQA 5F9HA 2VJQA 5D2CA 4JZYA 3UMSA 2IVZA 5DHRA 4BRSA 3HI6A 2OHXA 1D07A 5DLPA 5C32A 1MC8A 1Z35A 4C0HA 1TEVA 1XKQA 1Y1PA 2IELA 3QKSA 1I3NA 4IGEA 3OFNA 3I9FA 1EM8B 4RXMA 3ZGYA 4PPYA 3FFBA 2IH5A 1Y9EA 2SICE 4ZGGA 2QY6A 2BGJA 3ULKA 3DCJA 2VDWA 1R10A 1T36A 2WZQA 3C85A 3EMKA 1X1QA 5EMHA 3VR6H 1ZR2A 2WWRA 1R18A 3V2UA 2PH5A 3EODA 3HYLA 3MJHA 2PZGA 2RH9B 3OLCX 4MIEA 3LUHA 3NX4A 4XD7D 3LUJA 4AXBA 4E46A 1CDZA 3KTOA 3ENKA 3K4HA 1UFVA 1PZXA 4MV5A 2OD7A 4QUGA 4HZUB 4P58A 3F2IA 4QM7A 5AI8A 1DO2A 3U9TA 4DR6B 1P31A 2OFOA 1XF9A 3NIDB 2QAGC 3BE8A 1CJTC 2WABA 2FU5C 2O0MA 4EZEA 3FSGA 3NVKI 4U6NA 10MHA 4OXNA 4BNNA 2LDBA 5AVTA 4U63A 4JL5A 4Y2GA 1V8PA 4FYJA 3JQGB 1M9NA 2VZ8A 3UPUA 1PSDA 3GA5A 3VM6A 4M6WB 3QQPA 2B7LA 3GV0A 3KYCA 1OXMA 5SY9A 2PUHA 1RKBA 3IPRA 4H1UA 1AM4D 4XYEA 3K71B 4RVOA 1SO8A 1W19A 2O8CB 3DL7A 1C9NA 2CW5A 2I3BA 4BP3A 1Z2EA 3LQQA 3DE1X 3O9VA 4EW2A 2AJDA 3H9UA 4TTSA 2ZVDA 3RHZA 1QE3A 1VBFA 4E1AA 2JJ1A 2Q8QA 2NO5A 3NETA 4PQYA 3H99A 2BMEA 4DDUA 3K5IA 3A9VA 4BC0A 5EVCA 2O1WA 4R2XA 4JYAB 1GZUA 4X20B 1QIFA 1N3BA 4IRXA 4JOSA 4GPTA 3F71A 1A1VA 4PS0A 3LPCA 5BOSB 3MRTA 4F97A 1EXDA 3ICCA 1QV7A 3H5OA 1KAGA 4UARA 3C8ZA 1OUMA 3JR7A 2AHOA 2XMPA 4Y2SA 4B34A 4F1JA 2Q50A 4Z2AA 4LYJA 5D3KA 2P9QA 3CU5A 3BZBA 3UFBA 3C4JA 1G8PA 3GIDA 4N0PA 4RTJA 3HK2A 3Q8WA 4MW6A 1A0OA 4FWTA 2FN7A 5HQTA 2FZGA 1DVRA 3B6ZA 3BREA 3AP1A 2X9QA 4YNBA 3G9QA 4QU8A 3UUFA 3KR1A 1NMZA 3PT9A 2LP4Y 2CXTA 2H0QA 3IAHA 5KAMA 1VIVA 2JJQA 5E7IA 3EZXA 4JT4A 1YL7A 4TTRA 4ZP1A 1ODJA 1QGOA 3BK1A 4YRSA 1QIJA 2O50A 1JLLA 2VDRB 1W0CA 4I19A 3EZ2A 1OFIA 3E3NA 1XZCA 1D1PA 3S28A 1JX6A 2C9ZA 4AZ3B 1PQUA 3M5CA 4OAPA 3G1TA 3PNQA 1E20A 1KO5A 3KB8A 3QPBA 1JBKA 4INOA 1AXEA 1AN0A 2JGAA 3IBTA 4I6GA 4Y67A 4GR4A 1GTJ1 4DSNA 1IUNA 3KSUA 4RFVA 4PX9A 3LYHA 1QGUB 4RQBA 4UPEA 2WTXA 3NHBA 3UJAA 3DBVO 2LW7A 2H16A 2DTEA 3Q3HA 2OGTA 1N36B 4PN7A 3FZYA 4MQ5A 5JWOA 2W71A 4WKBA 4OHFA 1MOQA 3I39X 5A62A 1TF2A 2WKSA 4MDHA 1Y5MA 4I36A 5KDLA 5HKKA 3GLFB 2YZKA 3S5UA 3FXAA 3OOJA 1KS2A 3AHEA 3SR4A 1D7AA 1EVZA 4LBYA 4R6WA 4QXMA 1M10A 2KI5A 3ZHQA 4EZBA 1X7DA 3BG5A 3DW1X 3CB4A 1TJNA 1F51E 3GI1A 1KE1A 1GP2A 1TO2E 3DXYA 3PHGA 2IE8A 4P86A 4FFWA 3SHVA 2CNOA 4MVYA 5DRYA 3ZY6A 5L9AA 3KEFA 4F6LA 3T0FA 3JQAD 4XDGA 4GZLA 1KZYC 1K7CA 3MCAA 4DR1B 2Z2YA 2C8JA 3WBFA 2HJSA 4MTCA 1BGXT 4LHSA 1UZMA 4QDUA 1K4YA 5ESDA 1YRYE 5GJVC 5I9NA 3F6RA 1J1IA 3KWJA 2YIDA 4LV6A 2QI9C 1AS2A 4RK6A 1FIUA 1PL8A 1XJCA 1GCIA 2H2DA 3FPGA 3ROPA 1D0SA 4C87A 3WKDA 3H5VA 2ODTX 2X0RA 5FA6A 4B3RB 2MR5A 4R71A 5DHSA 5JG7A 2QM3A 3KU1A 3NV9A 2PD6A 1KBOA 2JI7A 4P4NA 3MMNA 3OVMA 1RMQA 3CLTC 1P8AA 1QYWA 2YQ4A 5IT4A 2ZB8A 3UIEA 5LDGA 4OQPA 2FSIA 1BS1A 1U31A 2V97A 1YQUA 1RHMA 2VDNB 2NM0A 3DQQA 4I3FA 1SXQA 3VNUA 2AR7A 5GONF 2ZKIA 3MAGA 5LWQA 2YHUA 4MVJD 3PX7A 3FTPA 4FHZA 1W49A 3FMIA 4IXWA 4MGIR 3I30X 4AICA 1LPNA 6NULA 4S1PA 1SK9A 2QDXA 2XITA 5AUOB 5K0EA 1P62B 3Q8XB 3ZXUB 4BUJA 4DR2B 4B4KA 4TPKA 4RTKA 4QBFA 1WB9A 1KMIY 1XTQA 1ODKA 1TX4B 2EHJA 2XMZA 2EV9A 4ZVTA 1P60A 1XLUA 3E15A 3AESA 2PHZA 2EXXA 1MPXA 2IP2A 2VDWB 1BKDR 3L4BC 2VR1A 2F00A 1TU3A 3FH0A 4GVLA 4MKRA 3SDSA 2X5JO 4TMXA 5DYYA 3M70A 2BDEA 1IATA 1WDWB 3A1EA 5EIFA 3BBLA 3WNQA 2X8BA 2GCNA 4M9XA 3PJRA 3FNRA 3ZJYA 2JCBA 1FTNA 1QCDA 1U2PA 3NPMA 4CKCA 2O8EB 1SU7A 3TQOA 4CV2A 2MU1A 2QR2A 4OHKA 2OD9A 1JHUA 3MF4A 3RU9A 2XB2A 3QXHA 4M0CA 2CF6A 4QYSA 4U0KA 4D02A 1TDJA 4DADA 2GCEA 1Z2DA 4KRFA 4U4AA 3ZD7A 3N5KA 4K6GA 4D4KA 1DRWA 1M0EA 4OAQA 4KR7A 3NV7A 4LWPA 3FF1A 2G08A 3IAS1 5H81A 3S40A 5BRJA 3JU3A 4QM6A 5J1SB 1GU1A 4MPRA 1FW8A 1U3VA 2I2FA 2ON6A 4H7PA 1F14A 4K9RA 5DLYA 4GBMA 3ETNA 1L5LA 1KZGB 1OFUA 1Y1TA 1M67A 1R9JA 4TYPA 3PUZA 1ZK4A 4R5HA 5BQOA 3C0KA 5BUSA 1LI4A 5ALOA 1THTA 3KUXA 2WEKA 1L7AA 2QTMA 4IUDS 4KYIB 5LUBA 4ZALA 5E9QA 2P0AA 3A3NA 5EERA 1Y9AA 4MW4A 3PQ3A 4DMGA 3HA7A 4KP7A 3LJKA 3HJNA 2XV1A 3IIMA 3HL0A 4C7VA 1QC5B 1LX6A 4D8YA 3L1VA 3GNTA 1ZBDA 4GPEA 3R9XA 2OR3A 3RRBA 3DE6X 1YHNA 3TG2A 3PICA 3ZHCA 4ACAA 1JU4A 4TM8A 4DREA 5CXQA 1ZESA 4NS4A 4G2NA 2JAXA 4JZKA 4QAJA 4QYMA 3VPDA 2E37A 1CERA 3KEOA 3HUEA 4L4RA 4MUIA 4F3KA 4DVJA 4CDNA 1VHJA 2VQ6A 2YXEA 2HRRA 4J9VA 1MIOB 5IMBA 3IHWA 1KYQA 5A5DA 5LMUB 3IVCA 3BORA 1IPFA 3CLSD 4D5EA 5F98A 1X13A 4I4TA 1XCMA 2WDZA 3AOEA 4QTZA 3UC5A 1ZICA 5KYWA 5LB2A 1NC3A 3HJAA 3I5MA 2VWHA 3CZAA 2LUOA 5AKZA 3OOWA 5F35A 3JZAA 3S2IA 4D3DA 1JDVA 3ETCA 3M5DA 2O2SA 4YXWD 1C5KA 4PO1A 2EC5A 3BE5A 1ZD2P 3DZ8A 1JDTA 2BFDA 4E21A 1ZO8A 2VHZA 1LS6A 1HDGO 2D62A 1KVRA 1ZYUA 2IITA 1KMHA 2VTEA 3OTHA 2NZWA 4LRWA 4YJFA 4JLOA 4TYWA 1HYHA 1WCXA 2P77A 3P9RA 1RAIA 4LAFA 2V7EA 1YJCA 3L7JA 2EKZA 1ENOA 3KCQA 5TMDA 2X2EA 3N6XA 4YH1A 1Y7TA 4ALLA 1DKPA 4RTPA 1BXZA 2FWBA 3UHFA 4R3NA 4CIDA 5ICFA 1FFCA 2CUTA 2VHWA 2JLQA 5AHRA 5ALSA 1CZUA 4P3NA 2H18A 4X45A 5IF9A 1PL6A 4CODB 3DCYA 1KSFX 3I04A 3BEOA 1U9YA 2ZIXB 5ICGA 2XZTA 4LWQA 1EU1A 3ILHA 1X7XB 2A4KA 2JFGA 2Q3BA 3A9RA 3IELA 3MWEA 1H1TA 4P3YA 3UB4A 5F2KA 4W9RA 3N2LA 1P74A 1NRXA 2IXDA 3DGEC 4LBZA 3THOA 4D80A 1U1IA 2E87A 2XSZD 4TTQA 3PLRA 2D1TA 1TA9A 4X6XA 5AI0A 5C8YB 3H75A 3D8RA 1W5FA 3N2IA 1V5FA 2EARA 2OZPA 2WG0A 4OD0A 2VDOB 1IU9A 3CGWA 4E7OA 4F12A 1BRMA 1EJ2A 2AKAB 2OFXA 3L6EA 2I33A 4YPVA 3PJGA 3OEED 5CH8A 1HKHA 3VNBA 5H5JA 4LIPD 1IUOA 3BCRA 1EEXB 1RAFA 3LX6A 4CM8A 5ED0A 4TV8A 4II2A 1Q3TA 4RHEA 4WZ6A 4Y1FA 1QJ4A 4DDVA 2CB9A 5FA8A 5K09A 4WXPA 1NYRA 2BONA 3HEBA 5EEHA 4CMEA 1R1DA 2LZ0A 4K05A 3AHGA 3NWPA 1Y5LA 3FPHA 4HZIA 4K40A 5I47A 5JAIA 3UOWA 1N3IA 2HNBA 5TRTA 4NC9A 4RH0A 3TQCA 1FXWA 1VE6A 2O2DA 2P41A 1TIPA 3O95A 3PNOA 4LDQA 5FBWB 3L1JA 3DBHA 2GO7A 5E9WA 3URMA 1R0ZA 2QJFA 2XCQA 3W4KA 3QV2A 4E5DA 4DLWA 3TF5A 1BKSB 3BE6A 3U56A 1PWXA 1XJWA 1BU8A 1ZJJA 3EEBA 3G6KA 4TYMA 4CEHA 2PQ0A 3U5TA 4HEA1 3RSGA 4RGYA 4Y1RB 1QMPA 1QQ6A 4B6SA 3WJ2A 1J0XO 1X1TA 2I55A 3HO8A 4LSWA 1VLQA 3TH5A 3UT0A 1SXJC 3L0SA 4N5IX 1H2XA 4FZ5A 4GUAA 4UD6A 1VKRA 4OHXA 5LD2B 4MVJF 3R75A 1JYSA 4A6PA 4IG9A 3AF4A 3WHLA 1SVLA 3MGAA 1SXGA 3ED5A 4N7RA 4MYHA 4JROA 2BTEA 1MAWA 3DMYA 3RLIA 5D6OA 3ZKWB 5BW5A 1HT3A 2VI5A 4KQ2A 1S8OA 1OWLA 3NM4A 4B2LA 1LRJA 4PXSA 5LKRA 1I4WA 5HTOA 1WBBA 2PVSA 2QN6A 1RYYA 2O0LA 1C9JA 1YCGA 3HYRA 1A76A 4FDUA 3B9QA 1X77A 2G25A 3LUGA 4UMFA 3TZHA 4KE6A 4HCJA 3QVSA 3EUFA 2VOJA 3MJFA 4TMFA 1PVDA 3DC7A 5JD3A 5C31A 1XZAA 2GPYA 4KIJA 5LR6A 1QPGA 1LDNA 1RC1A 3EA4A 3DUWA 4FOSA 4UNNA 5JZ9A 1T5OA 1P7CA 3IPCA 3OI7A 5C7OO 1S2GA 3TCXB 4E13A 1FBTA 2NV6A 2YV2A 3ROTA 5G0VA 5AJTA 1Z5PA 3P9CA 1G7RA 3N8NA 4RK7A 4U8GA 3WXMA 3QEBZ 1E77A 4Y6QA 2AEFA 3U4HA 3EMBA 3VKFA 4DSUA 1FNNA 3KQUA 3NBMA 2QD4A 4FFOA 5A1TA 1NU6A 1Z3IX 3DNMA 5BNTA 3BWXA 4C06A 2VCHA 4RSRA 3HSYA 3E9DA 3GO4A 4U7FA 2DOKA 3MAAC 2ZSAA 2J0EA 3CRQA 3JQCA 4UUQA 1MOPA 3ZTWA 7ABPA 3EFBA 3TFOA 3VV3A 2NZVG 3LVFO 4C05A 3A6JA 3Q12A 3Q11A 1FA9A 2BZSA 1JHOA 1QH8B 3AHCA 2HUNA 3C8DA 2QRHA 3L0PA 5GJCA 4YAKA 3TTVA 2XQVA 1OYOA 1JG1A 3F4LA 3NWBA 4WFKA 1WTCA 2IDJA 5DOVA 1FYFA 4BNFA 2R1TB 1WSDA 5LXTB 1ISJA 5TF4A 3PJDA 1DE0A 2GD6A 4HJXA 1EQAA 1GFSA 3KHKA 1S8FA 2BH9A 3ANYB 4GOLD 4LZNA 4F6RB 4LRTB 1SKMA 1TZCA 1VL0A 4FFBB 4V0QA 2WINI 4KLZA 3ZE6A 5BNWA 1XZGA 1L5OA 3A3YA 1NT4A 5B4TA 2BFCA 4L3OA 2Y1XA 2YICA 4GXQA 1YUMA 1ORHA 1KEUA 4J1TC 3S1AA 4EMSA 5HIJA 4RDHA 3MOIA 4JB8A 2CUKA 5HTKA 1Z7BA 2DHRA 2ZRAA 5HHTA 2ZIFA 1M2WA 3ZDEA 4WIAA 1IQUA 3A9WA 4IIEA 4LDAA 1WZNA 1W36D 3UPTA 3NMUF 3FX2A 3ND5A 2X0KA 3UXYA 3WJ7A 4OQ4A 1WBJB 1ZN8A 2UUBB 4QPPA 3GGJA 3T99A 1HETA 3M1IA 3T5CA 1FPQA 4PX3A 3BMXA 1J2YA 3C5WP 2XUQA 3NM6B 4HDMA 3RYHA 1EDOA 1G9TA 3PWZA 4D45A 4I50A 4DM3A 2AXEA 4WXYB 4A9AA 1JKFA 1FDRA 1JZQA 2HU5A 2FZ5A 3CPJB 3IO5A 4RDCA 3KB6A 5KO2A 5IT0A 1WDMA 4HX5A 5CXSA 3TPCA 2QVGA 2G3YA 2ZUBA 5FT9A 2D2FA 5DM2A 5I4CA 4AURA 4QBGB 3G2JA 4A2WA 3UWSA 4ER7A 3CVWA 1QAOA 3TL6A 4C0KA 4DLLA 3R6WA 3L79A 1BRTA 1WP9A 3D4OA 2NXJA 1RI3A 1P4HA 2P2SA 1JV2B 5FFNA 1E63A 2ANCA 2JJMA 3LKBA 2PUBA 2XY4A 4OQEA 2R6AA 1NXTA 1M1XB 4U39A 2DXIA 2ONJA 1TW2A 1ZUNA 3AF0A 5FWYA 4MW9A 1J9ZA 3BTVA 2A33A 1LPOA 4BTVA 1X15A 2IS4A 3C3PA 2KSQA 3HE3A 2VZLA 2HV9A 3QOXA 4AM8A 4BNVA 1M5UA 1Q57A 2I8LA 2FV8A 3L6RA 1HDIA 2XLCA 2ZJZA 4R1MA 3S7TA 3T94A 4QKQA 4DV2B 2PR2A 2H65A 1MJ5A 5FULA 3JAKA 5L7YA 3F4KA 5ELLA 3ZWWA 2W2OA 2ZI5A 2B4QA 3GRPA 1L5VA 2YIMA 4CLHA 3KOYA 2QMUA 1YZNA 3AKEA 3RABA 1A9TA 1P5HA 4BRUA 5LQKA 1ZPDA 1H9BA 2OVFA 2ZREA 3MN1A 2RAFA 3N86A 3NHLA 1EH5A 1O0SA 2DRIA 1IEWA 2RHRA 3KU4A 4G5QA 4XCXA 2J0SA 2QJWA 1Y33E 1ZIDA 1DRUA 2PK3A 4CTKA 2WFLA 4B3IA 1VYTA 1T91A 2DTXA 4NATA 5EKTA 5C3UA 4QREA 4MYTA 1A88A 2CGEA 3X1KA 4JI0B 3V8VA 1OJ7A 1E66A 1RWMA 2WJAA 4MA4A 3B6MA 3EIHA 1C3JA 5JAOA 4X7MA 2ILTA 4UNSA 3SJUA 3H04A 2NNWB 2JFVA 4ZVVA 2QR5A 3DO8A 5B3AA 1CNEA 3KHUA 3C6XA 4B81A 1HSOA 4JLSA 3TO5A 1YCDA 4B8YA 2XYVA 1TTQB 4O25A 4X1KB 1P2TA 1ZWKA 4KXFB 4AKGA 4KWTA 1T8RA 3T7AA 1JFTA 3FVRA 1ZGJA 2Q1XA 3OWXA 3QPVA 5DH9A 3TZCA 3L0DA 4F4DA 1XTIA 1TJ3A 4LOKA 2YV3A 5CEFA 4G0ZA 2IH2A 4JR2A 1G20A<