2BELA

Structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
243
structure length
243
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
publication title The High Resolution Structures of Human, Murine and Guinea Pig 11-Beta-Hydroxysteroid Dehydrogenase Type 1 Reveal Critical Differences in Active Site Architecture
rcsb
source organism Homo sapiens
total genus 91
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2belA00
2R2GA 5HTOA 2E82A 1GZ6A 4R1NA 1K6IA 3I5MA 1VL8A 1O5IA 3TZ6A 2W2LA 1D3AA 4N54A 5F3RA 1CYDA 1MV8A 1G1AA 3EZLA 4WOJA 4YR9A 3EVTA 1JQBA 1C0KA 2FPGA 2OBYA 4O1MA 2OXIA 1K2WA 3VKVA 1DC4A 2Y67A 1NQ5A 4Y9DA 4IGEA 5CDUA 4IXTA 2NWQA 1O89A 1U3UA 4IIVA 3W8FA 4EEZA 3GOHA 4BKRA 3K9QO 2Q3EA 4E5PA 5IZ4A 4YQYA 3JQ6A 5A3VA 2JJYA 1QSGA 2AQIA 3UAGA 3JYQA 3JQ9C 5H81A 2EW2A 3BMCB 1QYXA 3D64A 3GVPA 3GC6A 3KYCA 3TZKA 4IDFA 1A9ZA 5MDHA 1KYQA 1ML3A 3Q2IA 4DVJA 4MVJP 3WLFA 4TRJA 4NBWA 4DWVA 1ZH8A 2HK9A 5CFZA 1L7DA 4DBVO 1YS4A 4LN1A 3CIFA 2DBQA 4U0JA 3V2UA 1ZK1A 1T25A 4DIBA 4LVCA 1O9BA 4GSKA 1MA0A 4IQGA 5G4LA 3V2GA 1ISIA 1TEHA 3IMFA 3O9ZA 2P4QA 1EVYA 3BTUA 3IKVA 3KXDA 3KO8A 2ZIZA 3HN2A 4KUGA 2IZ0A 1LEHA 3BHMA 4DTIA 4CM8A 4DIFA 1P1IA 4QUKA 4LMRA 3PRJA 4OGWA 4OXKA 1ZIDA 1V35A 4YRBA 4FS3A 4J7CA 3HNPA 1GUFA 1BDMA 4MP8A 1EDZA 1VPDA 1N92A 4CM4B 1KBZA 4PG5A 1YDWA 2QRJA 1H6AA 8LDHA 3RJ9A 3M2TA 5LC1A 3QW2A 1JDJA 1XA0A 3WBFA 2BFOA 3HJAA 1K89A 4XIJA 4Z9YA 2D0IA 3PVZA 1D7OA 2Q2QA 4UUOA 1RM3A 4E21A 4YWJA 1QMGA 3DZKA 3TFQA 3AUTA 1OZAA 4XYBA 2YUTA 4I1IA 3TWOA 3LLSA 4NG5A 4BNHA 2VQ3A 3GPIA 5EN4A 4CMCA 3LT4A 3K2EA 2HO5A 3CTMA 2X6TA 4WGGA 2GSDA 3DZFA 4BQRA 3SJ7A 1ZZEA 1LDNA 3QHAA 4NMHA 3W6ZA 1NVTA 1WZEA 3WBBA 3Q3CA 1LRKA 2X1HA 1WDMA 4K28A 3VVBA 3ZWBA 4WK6A 1H0KA 3JQBA 3EMKA 3GZNA 4XQGA 3KRTA 3JQ7B 4L74A 2C2YA 2DVMA 2FSVA 3WGYA 1WMBA 1YOVB 4J0FA 2YYYA 1QRRA 3CMMA 4QT0A 1LU9A 2PY6A 5HM8A 1Q0QA 3H5NA 1GEGA 2BLLA 3K96A 2Q1UA 4PLFA 3T7EA 2J5KA 3KV3O 5BSHA 1T4DA 5C37A 1R15A 5T5QA 3S8MA 1P77A 3ETGA 3FBGA 4B8ZA 1BTOA 1IPFA 5ICMA 4M54A 1R37A 3FNHA 2QZZA 3PWZA 1PS9A 4MJLA 3WNVA 1WPQA 4D3FA 3AOEC 3QP9A 3HDYA 3ASVA 1XWFA 3D3WA 3GNTA 3WQSB 1E1LA 2O3RA 4RVUA 3M1AA 2DAPA 2GUGA 1LDYA 3K92A 4PG6A 5TC4A 5F5NA 1PQPA 4J4TA 4BNIA 5IXYA 4IZIA 4JJGA 2IODA 4J6FA 4R51A 1HE4A 4TKMA 4FPXA 2X0NA 3KSZO 3RBXA 1YL6A 2I3GA 4RORA 2HLPA 2WYUA 2GN9A 3NTQA 5CEJA 2Y66A 5F1KA 4ZICA 2HCTA 5JPIA 3WYEA 3QWBA 5L7WA 4QEDA 1KVTA 5G0TA 4A73A 5JDCC 4Y6PA 3VDRA 3DMTC 3OM9A 1EUZA 1PJ3A 1H2HA 4EJ6A 5KJEA 1M76A 1OC4A 4QSMA 3C85A 5ITVA 3E5RA 5JLAA 1Z74A 2DT5A 4R01A 3SEFA 2GCGA 4RPJA 5KJ1A 3B70A 4B7UA 3F9IA 4FR5A 3IJRA 4OSPA 3QWFA 1WDKA 3DZGA 4IDGA 3WGQA 4YRDA 1QLHA 3UF0A 1AHHA 4IY1A 1LDMA 2RCYA 4NBUA 4KWHA 1T1RA 4NFHA 4A7PA 1P1FA 1MXHA 2ZB7A 4E5NA 4Q3CA 1X0VA 3IJPA 3JD0A 1JAYA 6ADHA 1U7HA 4MVJH 1DAPA 1K0UA 1Q0LA 5LDGA 4E30A 1VE9A 1DFGA 3R6DA 5B37A 4L4RA 1FJHA 1WVGA 3VH1A 3FNFA 2NU7A 4J90A 3WTCA 3PFFA 4ESOA 1UXJA 2X58A 2GLXA 4PVDA 3HADA 5BSGA 1YQDA 2WE8A 1KVUA 4HFMA 4IXWA 1HXHA 2F1KA 4MIEA 2HK8A 5T6BA 1JA9A 3UKOA 4OXNA 4KDFA 1SCUA 5H82A 3TF5A 5A02A 4MKZA 2FOIA 4O59O 2HSDA 3RUIA 3TZCA 5BQFA 1EVJA 4KTVE 1V6AA 4YT2A 1NHWA 2FN7A 1Q7GA 4TKLA 5KJ6A 4Y6SA 5L53A 5K9ZA 3HFGA 4CV1A 2PR2A 2PGLA 1I3MA 1UP4A 1B15A 4CMKA 2A35A 3BAZA 4PG7A 4PLTA 4BNWA 3DONA 4BNFA 1XR3A 1A5ZA 5HBRA 3COSA 1Y8QA 2AEFA 2Q45A 2RIRA 3B1KA 4OSOA 3DZBA 4AICA 1PGQA 2PA3A 3DQPA 4LCEA 2HUNA 5EIOA 5TLSA 5L4NA 1IYZA 3IUSA 5A9RA 1ADCA 5EERA 4NJOA 2ILTA 4OQZA 2QG4A 1BG6A 1HDZA 3WX0A 2YHIB 4NFYA 3OEYA 4L75A 4F6CA 3DTYA 4NDNE 3NT5A 1R0LA 2EGGA 4MVJI 4IDDA 3HUDA 3I4CA 1EDOA 2Y99A 1NP3A 4D0SA 2BH9A 3BA1A 1K6XA 3JQGB 2ZB8A 1PIWA 4N5LA 4TRMA 3H8VA 4GMGA 4AJIA 3ZV4A 4IS2A 2AXQA 2W4QA 2A4KA 3SVTA 1P0CA 2G17A 3UFXA 1CRWG 4ZHSA 5A05A 1C1XA 4RF3A 4FOSA 1T1SA 1G0OA 4NJMA 4EEXA 2QYTA 3I9MA 4YAIA 4NU5A 3KZVA 3AI3A 1B16A 1F0YA 1WWKA 1HWYA 4AJNA 2HK7A 4BNTA 4DGSA 2V7PA 1GDHA 5C3MA 1EZ4A 3GQVA 3NTOA 3K30A 3LK7A 4Q3DA 4D3DA 5FFFA 4XYLA 2CF5A 4EITA 1T2FA 4K6FA 2AG8A 1XGKA 1EUDA 1FF9A 2BGKA 3HDHA 3DMYA 3CKYA 4TWRA 3AU9A 3ONDA 3WGZA 4FFMA 4WASA 1HLPA 4R9RA 4BNZA 3P5SA 4OJNA 5TQVA 3I4FA 4HXYA 1X1EA 4II3A 2AEMA 2HMVA 3O26A 3PYXA 1J0XO 4BO6A 1GYQA 4BUCA 5LDHA 1H5QA 4IDEA 3MJ4A 1HDCA 1SB9A 3OP4A 1KEWA 5EESA 4BNNA 5T57A 4I5GA 4RVDA 2G5CA 1EBFA 1QYWA 2JCVA 2NTJA 4OOEA 1JU9A 2I9PA 1D4FA 1LXCA 2GPTA 4UUNA 5CHEA 1OI7A 4RF4A 3RUCA 4DA9A 3G3EA 2R00C 4NFSA 4J16A 1NASA 4Z3DA 1R4NB 4TSKA 4YBZA 4ALLA 3WQRA 5T8KC 3HZZA 4FGSA 4CMIA 4HFNA 4PZEA 1MXFA 1C0PA 3A28A 4UVDA 5IAAA 4DPLA 1E7YA 4NHEA 4E5MA 2I6TA 2Y1GA 4TMFA 2V65A 3GZ4A 2JD1A 4Y8VA 1TT5B 4YTEA 2W90A 5EL0A 1LSUA 2O3SA 1ISGA 3UGKA 2YV1A 5DOZA 4CLXA 1EMDA 3GUYA 1E7MA 2VWGA 3G79A 2X0RA 2X22A 2VZ9A 4GKBA 4ZU3A 4HV4A 2ZQYA 3C1OA 1PL7A 4JGBA 4CLOB 3DOOA 1DIAA 1DLJA 4R3WA 5ILGA 4W9NC 1LDEA 3H9JA 1YDEA 3QWIA 2LDXA 1G0NA 2JD0A 1XSEA 2PZMA 1ISJA 5BNFA 5FWNA 5I9LA 2B0JA 3P19A 3WGGA 3JQAD 2PV7A 1AHIA 1WDLA 2AEJA 2P68A 2O7SA 5JSFA 4RO0A 4W99A 2FSSA 5GZ1A 5JE8A 2O3QA 3UXYA 3PHHA 3U4IA 5B4TA 1B3BA 3PFWO 3D4OA 4GWGA 4A26A 3JYNA 4F3YA 2YFHA 5IDYA 4E6PA 1KS9A 1H6CA 1MFPA 1R66A 2VRCA 5F21A 1WMAA 1YE3A 4L4SA 4C7JA 3L0DA 2NLOA 4L8VA 1NFRA 4OQYA 1SMKA 4YA6A 1SZJG 1VKOA 4CM6A 5F1OA 3VZPA 1JTVA 3PQDA 3VPHA 4YJHA 4R54A 5L51A 2VHWA 3JYLA 4DQUA 1F06A 4KUHA 2PZKA 1NR7A 4AJ2A 1KETA 2I3AA 1IZ0A 2DM6A 1X7GA 1R16A 2JAPA 2LDBA 3KVOA 3ZDFA 3ZWVA 4CMHA 1PJTA 2OOSA 4I5FA 5HS6A 5A9TA 3BHJA 1ULUA 3VH3A 2YW9A 5JXWA 1ORRA 2WSBA 5TSDA 2Q46A 4R5HA 4PLHA 4WCFC 5KVVA 1JLLA 3LF2A 4R5MA 1HEUA 3ZZNA 4U0KA 1D1TA 3TQHA 4U6SA 5BNTA 1PS0A 2RBEA 4Y6RA 4EUEA 2BI8A 3ROMA 3PLRA 4FBGA 4EI2A 4WCFB 3E9MA 3ROKA 3LT0A 3AJRA 1XQ6A 1VLLA 1Z7EA 2O50A 4MPDA 3ONFA 4YT8A 2J3JA 1I2CA 1FDSA 3AK4A 2JCXA 3Q0EA 1N8KA 2FY8A 1ZEJA 1VRWA 3JD2A 4DQXA 3OFSA 2C5EA 4OAQA 4KQXA 5DDIP 1YGYA 2Q2VA 2QRLA 4P38A 3TNLA 5B4UA 3NUGA 5TX7A 3PZBA 3RJ5A 3I9JA 1HE5A 2GN8A 3QWAA 2AQKA 3TPCA 2WD7B 2ZCVA 3G1UA 4AVYA 3NJ8A 1YL5A 4YVFA 1EFLA 2J5QA 2QW8A 3NAQA 1SB8A 1SBYA 4RV9A 1HSOA 4BB5A 4CL3A 3H4VA 1VSUA 3TL2A 3BMOA 4FFNA 4TZKA 2VHXA 1EVIA 5CDSA 5JW6A 4JX8A 3T4EA 1PZFA 1E7QA 4L76A 1GZ4A 2GDZA 4BHTA 1EBUA 1F8FA 4FIZA 2EKLA 5THKA 3KBOA 3O38A 4F6LA 1E3LA 4LSWA 2IYOA 5ILOA 3C3XA 2JKVA 1A7AA 4OKIA 2W8ZA 4BNJA 1IL0A 3B1JA 1VC2A 2NSDA 5T67A 5U4QA 3KLMX 3GVCA 3GR6A 4BGVA 5C7IO 5GZ6A 5BT9A 3I9NA 5MGBA 1DDOA 2FP4A 2X7HA 5JBIA 3DDNA 3QRWA 4DUPA 4WLFA 5DCUA 1DOHA 1U2GA 3WWYA 1BDBA 3RBVA 1IE3A 2Z1NA 5G0VA 4E3ZA 1QR6A 1ENPA 3HFSA 4BO4A 4TROA 3GT0A 5A4DA 3VHRA 3S2GA 4YT4A 1ZKMA 4BNYA 1NFFA 2EHDA 3AFMA 2OZPA 4JXKA 4A10A 2AHRA 1A9YA 2DPHA 3GN1A 3DBRB 4MVJG 4Z9FA 5IN5A 4E31A 4RF2A 5TT0A 1TB4A 3A14A 2UV8A 4IDBA 4DL9A 2HU2A 3PTZA 1U28A 1UXGA 2HKIA 1YWGO 1FDUA 3WLEA 4YJFB 2FRDA 1DFIA 3AY7A 3EUWA 4K26A 3FNGA 4CM3A 4BKQA 2DBRA 1E3WB 3I1JA 1FDWA 5I7SA 2UYYA 3R0IA 4ALIA 3A9WA 4XD2A 2X0JA 3UN1A 2CDCA 4XR4A 2G82A 2C20A 2VT2A 1UXHA 4O63O 4RVHA 4XYGA 5DULA 1UJMA 3NGXA 5TRTA 1PJ2A 3GVIA 4EUFA 3CZMA 5K0ZA 3GAZA 4IZHA 1E3EA 2EW8A 3VVCA 3BMCA 3RCBA 7MDHA 3H5AA 4XEHA 5KCZA 3DOCA 2C07A 2EXXA 3GPDG 3JQ9A 3KEQA 3ZW8A 5I8ZA 5BR7A 3C7CB 3F6YA 1O6ZA 2ET6A 1HF3A 3TN7A 3WGIA 2TMGA 2BFAA 1F17A 1UXIA 3FCOA 2CMDA 3FNEA 2O3TA 5COBA 5JCJA 3W8DA 4WLUA 3HWRA 3JYOA 1YL7A 1GV1A 5F1PA 1IHYA 1U9JA 3VZRA 2C5AA 4ZRNA 2VNSA 5EPOA 3RFTA 4CUZA 4GL4A 4IJVA 4IINA 1NAIA 1B14A 3LC1O 1KVQA 3WJ7A 4CL8A 1ZSNA 4FD3A 3SLKA 4II2A 1XELA 3E6AA 4AL4A 1GZ3A 1PGPA 4BV9A 1X1TA 4ND1A 3DHNA 3DFUA 1ZVMA 3LSYA 4Q3NA 5KVCA 1BVRA 2IZ1A 1MG0A 2DPGA 2I99A 1ENOA 4QO8A 4FFPA 4EDFA 4CM4A 3DWFA 4CQLB 4XKJA 4HKTA 1UP7A 1E7SA 3BXXA 3NDJA 3BMNB 3QA9A 4XGIA 1JN0A 3G49A 3A1NA 2GF2A 2JFGA 1BXGB 3NT4A 4QO7A 2RAFA 4Y98A 5C7OO 1H6BA 1BRMA 1VL6A 4J4HA 3CXRA 1ZJZA 3GUCA 2OORA 4ZQGA 1P44A 2Y68A 3SC4A 3RC7A 3UICA 4TZTA 3C1TA 4BO3A 1ZXBA 1Z75A 5KTKA 1IPEA 1J5PA 3PHJA 4I9HA 2HRZA 3RUHA 3R3SA 4Z6KA 5U9CA 3RC2A 5TIIA 4XIYA 2WD8A 2NNLD 2FR1A 4PIVA 4UULA 4U8GA 3AFNA 1JW9B 2GYYA 1MUUA 2P5YA 3B1FA 3K5PA 1N2SA 1MP0A 1I33A 2J3HA 3GNSA 2JCYA 4YAEA 1NQAO 1CWUA 4TRNA 3FBTA 3JQ8B 4FFLA 3ZWXA 3MJSA 4CLHA 1ZW1A 2O7QA 4DMLA 1ZSYA 3IAHA 3JQ7A 1L7EA 2PD3A 2Y0EA 4FDAA 4M89A 4CMGA 3CUKA 3P2YA 1YOVA 1N9GB 3ANLA 2DBZA 1J6UA 4UEJA 2B5VA 1PZGA 2X23A 1RYDA 4J1QA 3GMSA 1DIGA 2GASA 3E9QA 3R3JA 3ZV6A 1U5CA 2P9EA 1ONPA 1H9BA 1TT7A 1V3TA 2AE1A 2OP0A 7ADHA 4UVHA 3L77A 2D5AA 5U1PA 1FK8A 2YHUA 1TLTA 3N74A 3FI9A 3U3XA 3MOIA 2EG9A 3CMCO 1V3VA 3INGA 3WFJA 1I36A 3OSUA 3RUFA 2CY0A 3OA2A 1VJTA 3AOEA 4R3NA 5JYDA 1JKFA 1JVSA 2Q1TA 2QX7A 3ASUA 4YJDA 1I8TA 3LZ6A 4M1QA 3HB5X 1UDAA 2PZJA 3GAFA 3U62A 1NPDA 1S7CA 4EBFA 4EZBA 1KEUA 2JFHA 4WLEA 4URFA 4GX5A 1DHTA 1NTOA 2VN8A 1ISHA 2CNBA 2V6MA 2ZTUA 3ZWYA 4AJHA 4D45A 4NK5A 1HZJA 5J23A 2GGSA 2F00A 3HE3A 5JDCA 3F4LA 1E77A 3DMTA 3GGOA 5A5EA 3N58A 3QY9A 5HA5A 1LC3A 2PGJA 2PKRA 4HADA 4DC1A 5BNIA 2CF6A 4L4XA 3OMLA 3ZW9A 3S1LA 4D7AA 1ZNQO 2XXBA 4ZQFA 4BO8A 4B7XA 3AWDA 2EKQA 2H6EA 2HMSA 4FJ0A 1B2LA 1PQWA 1U3VA 1W73A 2VT3A 4IGFA 4GMFA 3I9OA 1ZK3A 2W2LD 5TJHA 3F46A 4BKUA 1XDWA 1PEDA 1YVEI 4ZD6A 4O0LA 4NR0A 1N7HA 3GDOA 4DIOA 1ADFA 1E7RA 2ZYDA 5CEFA 5T64A 2UVDA 2EJWA 3GEDA 2PNFA 4RVSA 4YRAA 4BV8A 4RDIA 2OGUA 4J1TA 4TQGA 5DBFA 1FXSA 3MWEB 2PFGA 1EK6A 2IRWA 4XR9A 3EVNA 1BW9B 2W2KB 4J9UE 5KVQA 2O4CA 4WOKA 4BL5A 3PHIA 4J7UA 1A4IA 2CVOA 1SC6A 2OHXA 2EKPA 3FD8A 1E6UA 1DO8A 2Y0DA 3JQEA 2E4AA 2ZB4A 2FMUA 1B7GO 3KSDO 1S6YA 2BMAA 4JCOA 1PZHA 4QECA 3LF1A 1PWZA 3PQFA 1A4UA 1W0CA 2O3UA 3FF4A 3TJRA 4A2CA 4B4WA 5EQDA 4JK3A 4HBGA 4HP8A 2OP1A 3MJEA 3JYPA 1DC3A 4E2YA 1BWSA 2EEZA 2J3KA 4B3HA 4CQMB 4CLRB 1ZMTA 1OFGA 4YB8A 3X2EA 4PRLA 3WSWA 2YHIA 2AQHA 1DRWA 3EDMA 1SAYA 4M49A 2C59A 4R41A 4XJSA 4B4VA 1I30A 2V6BA 1YJ8A 4JNKA 3JQCA 5CEEA 2CD9A 1D1SA 4J7XA 3CZRA 3ULKA 4NNJA 1KEVA 2X9GA 3JQGA 3LLVA 1ENZA 3GFBA 5KKCA 2FPIA 2H5LA 1HDXA 4BQPA 4O5OA 4RZHA 5IZCC 1NYTA 2B35A 5FF9A 2CVQA 1ULSA 1W4ZA 4E32A 2YQ5A 4ZJUA 2DU8A 2IDZA 3QSGA 2VTDA 2GZ1A 3ADPA 2HJRA 2ZTMA 3GNQA 5FI3A 4C4OA 1PQUA 2Y05A 5A03A 1M66A 3OJOA 3IL2A 1XQ1A 3DOJA 2D5CA 4PLVA 1P1KA 4CV2A 1YBMA 3DZHA 2ZYGA 3M2PA 4R9SA 3E03A 3SX2A 1E1KA 2WJPA 1P1HA 4LMPA 4I5DA 4CMEC 1VI2A 2R6JA 3ZWCA 3UH1A 1IUKA 5JS6A 3WOHA 2DFVA 5FEUA 4WEQA 3ADOA 4D46A 3U0BA 1HDOA 1MC5A 4CMJA 2GR9A 1WP4A 1YO6A 2Z1MA 3OEWA 1U3TA 4YAJA 3RWBA 4LGVA 1MGOA 4GI2A 5ER6A 1I10A 3PEFA 5I9MA 3DAFA 3ROPA 4YPOA 3NEPX 1XIVA 1C0LA 2PTGA 3RD5A 4MKXA 2X5KO 3PIIA 3V1UA 1E6EA 5KOIA 2EGHA 3HHPA 1OBFO 3ZU5A 3L07A 3L4SO 1H6DA 3W8EA 4YACA 4AJ4A 5K6AC 1PR9A 3L9WA 3TOZA 3E82A 3JSAA 2PKQO 2A94A 4ND2A 4GKVA 2WDZA 3GF4A 3ZGYA 4QTZA 3EGOA 1R4NA 3KHUA 1GTMA 2Q4BA 2R00A 4D3SA 4XRRA 2BKAA 5DN9A 2XXJA 5A06A 1T2CA 4ZA2A 3VTFA 2J8ZA 3VKUA 1T4BA 3W4KA 5T8KA 3JQFC 1TT5A 3INRA 4G2NA 3ZNOA 1NVMB 1LLCA 5ER9A 1DC5A 1QORA 3HN7A 1YB4A 2QYSA 5IDQA 2NTVA 2JD2A 3OIFA 5HWSA 3NX4A 1MG5A 4QXMA 1XKQA 3H9GA 2DBVO 2I65A 3WYBA 3CSDA 4LSMA 4ZRMA 4CLOA 4MDHA 3BIOA 1R0KA 5A9SB 2J6IA 1CF2O 2V6GA 3MJVA 4OMUA 3WGOA 4EW6A 3RUAA 2XOXA 4BMNA 5A5FA 3O8QB 3JCZA 1DFHA 1Y9EA 4E13A 2W98A 4W9NA 2WTBA 1RM0A 4W4TA 3GEGA 3V1YA 4IJKA 1QG6A 4BO7A 1LSOA 3DBLB 5KVSA 3AI2A 3RAJA 3DBVO 3GVHA 4N5MA 5KIAA 1VL0A 3FR8A 2BGLA 3QVXA 4RF5A 5FYDA 4JN6B 4J0EA 1E1NA 4ONEA 5TGDA 2QIOA 4M86A 1NPYA 4BB6A 4IIUA 4QFCA 2C29D 5KJCA 4PVCA 4P22A 1DIBA 5JO9A 5DP2A 3AUAA 3GFGA 4Z0HO 3C7DB 2P9CA 4YQZA 4XQ9A 1GEEA 4AJ1A 3OH8A 3TZQA 2IZZA 1GUZA 1AN9A 2YDYA 4RLSA 4EYEA 2VHZA 2O48X 3LYLA 3HB4X 2PH3A 2ZYAA 3HSKA 3RFXA 3ZHBA 3LDHA 1X14A 4KUEA 4A0SA 1YONA 1IOLA 5CDTA 4UUPA 3F1LA 2AW5A 4ND5A 4H3VA 1E3JA 2C7GA 1NXQA 5TF4A 3K8ZA 4WCFA 3JQAB 4OH1A 2TMDA 3WB9A 3RSHA 3W6UA 3PDUA 4ID9A 4L0QA 2D3TA 3NTRA 4P8RA 2P4HX 4U7WA 3DO5A 3ORFA 1JWAB 2EERA 3FRJA 5I7EA 2GN4A 2Y1FA 2YV3A 2UAGA 1V0JA 2WD7A 5JDIC 4UREA 2XPCA 4TVOA 3ON5A 3DEYX 1PL6A 4J9VA 4K9DA 1ZK4A 3GHYA 1IY8A 5DT9A 2EIHA 3DB2A 4FOOA 1M67A 3L6DA 3MWDB 1GYRA 3D5QA 4PLWA 3STHA 5JC8A 3GRKA 1DPGA 1DJNA 3EZYA 3OECA 1CIVA 4M8SA 4MOWA 5TS3A 2UDPA 3BTSA 2WWRA 2G1UA 1B3RA 2YV2A 1H2BA 3KSUA 4E0BA 4E5KA 3OF2A 4CR6A 4GQAA 2X9NA 4BNKA 3PXXA 2G0TA 1QP8A 3S2FA 1PJSA 3I6QA 1GQYA 2FR0A 1ARZA 4CM5A 3HG7A 1A7KA 4PLZA 3P2OA 2I66A 3PWSA 4Q3AA 3W4IA 3TL3A 1I3NA 4ZGWA 2D59A 1LDGA 4FW8A 4WLVA 1CQJA 1D8AA 1PS8A 4K1LA 4AJPA 5THQA 3QQPA 3HDQA 4MVJM 4P4NA 1SOVA 3R1IA 5JC1A 4OL9A 5DZSA 4BO1A 3Q1LA 4M55A 1E5QA 1YQGA 5C7LO 4WPGA 3QVOA 4CMAA 1P0FA 4NPCA 1LQUA 1K3TA 2JL1A 2Q1WA 4G65A 1OAAA 1M6WA 3DFZA 3GDGA 3U49A 3FTNA 3H6KA 4JIGA 3VOSA 4AJJA 1NX6A 1R4MB 3DBRA 2J3IA 5TJ9A 4A03A 4ALJA 3OETA 2AE2A 1RWBA 2NU6A 3U4HA 3WFIA 4RVGA 9LDBA 3DTTA 3G0OA 2BI7A 3INTA 1I3LA 2DKNA 1WZIA 4HUJA 4YJFA 3BMQB 5ITWA 1BSVA 4OHUA 1E3WA 1GYPA 2HDHA 1LDBA 1PGJA 2BF7A 5A1TA 1XG5A 1P1JA 4Q3BA 4JP2A 1C0IA 4I5EA 1RM5A 3OJFA 2ZK7A 3D5TA 1I2BA 3DBHB 1EFKA 1UZNA 1ZEMA 6LDHA 3ZI0A 4JBHA 2IEDA 2Y1DA 2YFQA 3E8XA 3O4RA 3TDKA 5A04A 2B36A 9LDTA 1JKJA 3GMDA 4DXHA 1SEPA 3D1LA 1ZSVA 5GMOA 2QHXA 3OHSX 4CUJA 4PRKA 5IF3A 4F46A 2Q2WA 5L4LA 3ZHXA 1ADGA 2D2IA 2DLDA 2OFPA 1KOLA 4BGUA 2DFDA 5JAZA 3IS3A 5DOVA 4DRYA 4CV3A 3D4NA 4ND3A 1YRLA 1XEAA 5JY6A 1EQ2A 2UUPA 2I67A 1DC6A 1DB3A 2VOEA 1A72A 3DAPA 2EWMA 2GZ3A 1UUFA 2X4GA 3AUSA 5EJ2A 3FWZA 3H9QA 4Y67A 5L40A 1Y8RB 2VTEA 4IJWA 2X0IA 3JV7A 3C8MA 1Q2XA 3H3FA 3IUPA 2E37A 5COQA 5IG2A 1Q7CA 3B6ZA 1P1RA 1NVGA 1A27A 2DUUA 4HY3A 4YJGB 2O2SA 1N5DA 4X54A 2BELA 4JJFA 1WW8A 3TOXA 2VZ0A 3H9UA 4CM9A 4R1TA 3S55A 1Y81A 4E2ZA 1J4AA 1JWBB 4RQTA 1H9AA 4J91A 4CQLA 2I5PO 1Y5MA 1TA4A 3BMNA 1E92A 3QVTA 4BVAA 4MVJF 1BXGA 1C14A 5JYEA 2X5JO 4B3JA 1DXYA 3PJDA 4ALNA 2NUAA 2VRCD 2CUKA 4BNMA 5LCXA 4JROA 4G5HA 1PGOA 1UR5A 5AXBA 4FB5A 3DC2A 4CR7A 4NBTA 4S3MA 3RBZA 1ZJYA 4PCVA 2PGDA 3DHEA 4RVFA 1K6JA 2ZJ0A 3RUDA 1R0SA 3ENKA 3I83A 3VZQA 3ETEA 4UVEA 3GVXA 1M6HA 2JHGA 3PHLA 3RC9A 1PJBA 1X7HA 2CZCA 3NT2A 3QLJA 1L1FA 3SJUA 1YKFA 3I23A 3PPIA 2ZTVA 2XAAA 4YCAA 2O3JA 2Q1SA 2AA3A 3VTZA 2POQX 3JQ8A 4MP6A 2Q49A 4K6CA 4MVJE 3RQSA 1PGNA 3CE6A 1WXDA 1KEPA 4DYVA 2P9GA 1GR0A 5BSFA 1HDGO 1M75A 2B4TO 2NVWA 2VWQA 3WS7A 3WG9A 4PN3A 5JO0A 5JNLA 4GH5A 1N9GA 3AW9A 1I01A 3ABIA 3FHLA 3I52A 2ZQZA 2Y1EA 1P9LA 1DJQA 4ITUA 3VH2A 3EK2A 3FPLA 3ZV5A 3QIVA 2GO1A 3RVDA 5JMPA 3IKTA 2NM0A 4UEKA 3WIEA 4I9UA 1DLIA 4PLCA 3NGLA 4PG8A 4OM8A 4PLPA 4UAGA 3WSVA 1DRVA 4TVBA 3AY6A 3K6JA 2NVUB 1SPXA 3AU8A 4IMPA 1Q1NA 3V8BA 2DTXA 3Q6IA 4WUVA 1KY4A 3NJ4A 2NU9A 1F14A 1LUAA 3QVSA 4ZQHA 3GRPA 4RJTA 1I3KA 5IN4A 4XZ3A 3ZHYA 2J5RA 1OC2A 1BMDA 3EY4A 3OQ1A 1VM6A 5G0SA 3ZWMA 4D43A 4XRGA 1IB6A 1H93A 1IHXA 5I9NA 4RPKA 5CG2A 1SO8A 2E6UX 3H9EO 5ES3A 4DREA 2QQ5A 3DAGA 1GAEO 2GD1O 4A27A 1V3UA 2G76A 1E6WA 2VUUA 3NDRA 1C3VA 1P74A 3UCXA 4J3FA 5KJFA 4GX2A 3ANMA 2V6FA 2EV9A 3WNQA 1QXSA 1PR3A 4DYDA 2ZATA 4MKRA 4EJMA 1LLQA 3L4BC 1NQTA 3ZU3A 2DC1A 3GG2A 3FN4A 4MINA 3PGXA 1KC1A 1Y5RA 4IDAA 4CM9D 3MZ0A 1E3SA 1LA2A 2B4QA 4GVXA 5DP1A 5G4KB 2B83A 3LT1A 5JMWA 2NVBA 2EJVA 2PD4A 3MJTA 4G81A 1T26A 1XYGA 5L3ZA 2JFFA 2PWZA 3KYDB 3E1KA 1P45A 4Q3EA 4PGFA 3BTOA 5FI5A 1LC0A 5G0WA 4RZIA 4FJ2A 4XB1A 1ZMOA 3G1TA 1Q7BA 4INAA 3ZNQA 3WJAA 2GRAA 3GG9A 3G17A 3MEQA 2EP7A 3OQ6A 3MTGA 1MC4A 3UUWA 4YAGA 3ENNA 1BW9A 1U8FO 4LRTB 2W2KA 4OIMA 4J4BA 2PLAA 3U4DA 4P4LA 4D0RA 2IXAA 3KTDA 1UDCA 1PSDA 5DCYA 3KYBA 1C1DB 3MTJA 1HYHA 1SNYA 2B4RO 4XDYA 3UCFA 2O23A 1AUPA 1EVZA 2YJZA 1GCUA 1FDVA 3PHGA 1DBVO 1YQXA 4CODB 4IPTA 4KP7A 3MOGA 4YDRA 4LK3A 4B7CA 5JCJD 2QZ9A 4A5OA 3K73O 3PQEA 4GX1A 4N18A 1EE9A 5F5LA 3VPSA 5DF1A 1T2DA 3RKUA 2HMWA 4CQMA 2WEKA 3VH4A 2CDBA 4CLRA 1RM4A 4E2XA 2BGMA 4OYRA 1DSSG 3OJEA 3OJ0A 4E4YA 4RPLA 1I2ZA 2GNAA 2P5UA 4I08A 4U6QA 8ADHA 4GBJA 3P7MA 1Y1PA 1CDOA 2UUOA 1RJWA 3AM4A 4XYMA 3ITDA 2Y1OA 2NQ8A 4JP3A 3CH6A 1ZCJA 2CSUA 4Z9XA 3WR5A 5ICSA 5EMHA 4NBRA 1UDBA 2E49A 3FTPA 4RLHA 4BO2A 3AM5A 4FC6A 4DBZA 4RDHA 2C2XA 5L7YA 4W7HA 1EEHA 2DTDA 1XHLA 1JAXA 3PYMA 3QWHA 4EGFA 1GQQA 3VZSA 3KYCB 4FFOA 4GX0A 4D44A 3WIDA 2YQ4A 3S2EA 3CINA 4J1NA 4IJUA 2FZWA 4JBIA 3M6IA 1T24A 3AI1A 4XCVA 3ZWOA 5IZCA 4L9RA 2WYWA 1PU2A 1YH3A 2VHVA 5AQ1A 4DQVA 4LCJA 2YY7A 1JKIA 2OUIA 3VDQA 5ADHA 4R1SA 4GLLA 1DAOA 5I8WA 3UOGA 1BHSA 5I7VA 3QVWA 2JHFA 1QLJA 4AJOA 4Q39A 4LVUA 4XB2A 4TRRA 3U9LA 3Q2KA 2O2YA 1YXMA 3ZCXA 3C1AA 1KIFA 1GUYA 1KERA 4W7IA 5EINA 3JTMA 1DRUA 3AUUA 4CMEA 4CM8B 2CDAA 4XQCA 3WMXA 2RHCA 4B3IA 3HDJA 2H9IA 1HDRA 3DHYA 1E7WA 3GEMA 3PZRA 4FSHA 4D79A 4OO3A 4J43A 2VUTA 3ROQA 1B8VA 1J49A 3OQBA 4KDEA 4CLEA 3PDJA 5CPFA 1I24A 3ZWPA 4Z0TA 1EE2A 5B12A 2BRUA 4H15A 4FQ8A 5CPBA 4UVGA 4MIOA 3VPGA 4RL6A 5AVOA 2HRBA 2Y1CA 4KWIA 2NU8A 1I32A 1P3DA 5K6AA 1U1IA 1NWCA 1HRDA 3GY0A 1WLYA 1NAHA 1NNUA 1YBAA 1UZMA 4IM7A 4WJZA 4FJ1A 2YZ7A 3I6IA 3O03A 3H2ZA 3ST7A 3MJCA 3WDSA 3CEAA 3ZWNA 2Q4EA 4CM7A 1W6UA 4N5NA 3WYCA 1NWHA 2IYPA 1E1MA 3FWNA 2WMDA 3JQBC 3EAGA 4DC0A 4NU6A 4CUKA 5EQFA 3QJ5A 5IFLA 4I8XA 5GY7A 3EW7A 3GGPA 1ONOA 3RASA 3ZN2A 1B8PA 3JQFA 1X13A 4NH4A 3LQFA 1P33A 1LRJA 1T2EA 3GZNB 1U4SA 2IE0A 4MVJA 1NBOA 3AM3A 3VPFA 1YB5A 1LSSA 1P31A 1XLTA 3A06A 1E5LA 3GGGA 4NQZA 4CQMD 3C7AA 4HFJA 5A9SA 3NDIA 2VYVA 2Y0CA 4NIMA 1ONNA 2HMUA 2HJSA 4IDCA 1V9LA 1O8CA 1Z45A 2FR8A 2I76A 4DMMA 2Z95A 1ISFA 2EP5A 3O8QA 3AY3A 3LU1A 1HLDA 4CPDA 2RH4A 3TRIA 3KB6A 1ZO8A 2Y93A 4H7PA 2GN6A 2HAEA 3DBLA 2ZTLA 4B4OA 1ZUD1 3RU7A 1M2WA 5L45A 3D3WB 3JD4A 4P4GA 3ZNPA 4YT5A 3H7AA 4UVIA 3F3SA 5IDWA 3AOGA 4FC7A 4H16A 3IP3A 1HE3A 4BMSA 3GH3A 4RPHA 2CFCA 3NKLA 4R1UA 2DUWA 2OBNA 5L7TA 5AXAA 3BHIA 1ID1A 4QX6A 1BXKA 2XF8A 1NPTO 2HMTA 4WNIA 4XGKA 1YJQA 2VYNA 1QYCA 4WEOA 1XU9A 4YAKA 3U5TA 1PWXA 3V1TC 4BNXA 1GFSA 1LNQA 3OIGA 5DCWA 3ZU2A 1Y9AA 2FWMX 3EHEA 4YXFA 1MX3A 3PJFA 1W8DA 4N7RA 2DQ4A 1HETA 1X7DA 4XGNA 1PTJA 4E12A 1XCBA 3KOUA 1IULA 2ZCUA 4R68A 3X2FA 4DLBA 4J2OA 1JVBA 3DR3A 4BKOA 4JBGA 4E2WA 2OL4A 3RIHA 4RPGA 4QQRA 4ZN6A 1MFZA 4CM1A 3DZIA 3RU9A 3JQAA 3ETDA 4ZVVA 2PKQP 2X8LA 4NZ9A 2C0CA 2WYVA 1LSJA 5HRUA 2FHSA 4BIIA 3ZHZA 4RCVA 1Y6JA 4ZQBA 1B26A 3VC7A 3D0OA 3ZH2A 4ND4A 2SCUA 4PZDA 4KZPA 1NR1A 1UAGA 2BD0A 1QV6A 3HQ4O 1UXKA 4C7KA 3RUEA 4ROSA 3KM0A 4XWYA 5G0UA 3S2IA 4QFDA 4WNCA 3KEOA 4J1SA 2QRKA 2A9FA 2X9VA 3GN2A 4R4JA 4XA8A 5JDIA 1O0SA 3H2SA 4JJIA 4F45A 1PL8A 5DNAA 1IZ9A 3UW3A 4WLOA 1CEQA 3IQDB 1ISMA 4D41A 5CDGA 3ANNA 1HYEA 1ZK0A 5JY1A 2WM3A 1YBVA 3SLGA 5CP8A 4CLDA 3VAZA 2PH5A 5KNLA 3FPCA 3F5QA 1CETA 1NHGA 4CJXA 1EUCA 4XJTA 1ADBA 1HKUA 3IIEA 2VRBA 2VWPA 3QE3A 2D4AA 1VSVA 2E48A 2GERA 2H63A 4Q9NA 4GVLA 4HWKA 3Q9UA 4LRSB 1GPJA 4CMBA 4MVJD 3WTBA 1EQUA 2RH8A 3WQQA 4CR8A 4JQCA 1Y8QB 1Z82A 2A92A 2NV6A 1E0DA 2VYVD 2PD6A 1CQIA 1GQ2A 1GD1O 3BZUA 1YB1A 4W82A 4AFNA 1LLUA 3N7UA 4NK4A 1HL3A 1NQOA 3CPSA 4BO0A 3DL2A 3OICA 3IOYA 1U2DA 1LBEA 1GCOA 3H5RA 2VHYA 1B8UA 1R4MA 1R6DA 1AGNA 1F8GA 1X15A 3IDSA 1RYEA 1B0AA 3EC7A 4JLWA 2P2SA 2X86A 4YYZA 4BNVA 4NI5A 4BGIA 3T4XA 3BMQA 4DLAA 5IDXA 3LC7O 4KOAA 3KLPX 2ZKLA 2YDXA 1C1XB 3D7LA 1O95A 1GV0A 4WCDA 1E3IA 4BOYA 1NM5A 2IEBA 2H1SA 4NJMB 5KKAA 1HSZA 1QKIA 3U09A 1MLDA 1F12A 2VYND 5A3JA 4UEOA 4XDZA 4GGPA 3K31A 3EYWA 3LT2A 3DBHA 4RGBA 3ITKA 1DHRA 2JAHA 3BTVA 4R16A 4PLGA 4IMRA 3DZJA 3GHHA 2C82A 1PJQA 3PLNA 3ONEA 1A71A 2O4UX 3ZV3A 3FR7A 3K2BA 3L6OO 4B4UA 4PG4A 5CDYA 1U8XX 3WGTA 3U4CA 2B5WA 3V5NA 2IXBA 2X5OA 4PLYA 1LRLA 3GK3A 3OIDA 4Z0PA 3F4BA 4DPKA 2FZEA 5I7FA 5BSEA 4BS9A 1I0ZA 3PYLA 1Y8RA 5CG1A 2Q50A 3PIDA 3PI7A 1N1EA 3PJEA 3F1KA 4L73A 3RROA 3VPXA 1RKXA 3F47A 4YJGA 5C5IA 5DBGA 4W6ZA 1GPDG 4WLNA 5AYVA 5JAMA 5JCXA 2BHLA 2P91A 2VZ8A 3NYWA 5B1YA 3L9XA 5IJZA 1BXZA 1OOEA 2BFPA 5GZ3A 1AE1A 3KETA 2OO5A 1K5HA 1UZLA 2OMEA 3SXPA 3ZU4A 4ILKA 4CMIB 1GADO 3IP1A 4BKPA 1V8BA 1AXGA 4GGOA 5HS4A 1TI7A 1AXEA 1DIHA 1QYDA 1HYGA 1DIRA 1PJCA 1PZEA 1LJ8A 4PZCA 2PK3A 4B79A 4BNUA 3W1VA 4YEDA 4UUMA 4IQ8A 5TNXA 5JFOA 4ALMA 2GZ2A 2AMFA 1CJCA 1PJ4A 4IS3A 1Z6ZA 3ICPA 2B69A 1ZBQA 4IUYA 2AG5A 4J2HA 1ENYA 3WGHA 4WECA 1EK5A 1LLDA 1LX6A 1VKNA 3I3OA 3TFOA 4BNGA 1OMOA 5L4SA 4MO2A 4FFRA 2AQ8A 4NBVA 4CV0A 3OA0A 3F5SA 4BNLA 4XX0A 5CAEA 5TT1A 1ZFNA 4GWKA 3JD3A 3RKRA 2HQ1A 4ALKA 1I5RA 1UH5A 3H3JA 4LISA 1WAMA 3I9KA 1GL3A 3A4VA 4M87A 4GLOA 1HE2A 1GU7A 2BFMA 3LVFO 4HFRA 4O6VA 3Q11A 4BGEA 1Z7BA 3RFVA 3OBBA 2VCYA 5KWEA 4BO9A 4GAEA 5B4VA 1PJLA 1N1GA 5COAA 5AXDA 3PK0A 5L95A 4S1VA 3WICA 1BGVA 1PX0A 3PP8A 4IBOA 4YJHB 4E5YA 2VNAA 4U5QA 4J49A 4D42A 1HTBA 4OOFA 3GA0A 3SC6A 4I9NA 2NVUA 4OXYA 3ZWWA 2VWHA 1Y7TA 3ZWAA 4XYEA 1Q0HA 4HNGA 1X0XA 2Q99A 3TSCA 4AJEA 3IC5A 4E33A 1BVUA 3OJLA 1QYVA 2C7VA 2VUSA 5JAIA 1ZXLA 4WE3A 1SOWA 4DLLA 2C54A 2CVZA 1U4OA 2FPPA 3NRCA 4LW8A 1KY5A 3GDFA 3I9LA 3H65A 4Z3KA 1KVRA 3PJGA 3PGJA 3MCVA 1O94A 1QV7A 3E48A 4AG3A 4FCCA 3TZHA 1NFQA 5AXCA 3RI3A 2B37A 3QV1A 3D4PA 5ENDA 1UAYA 4DPMA 3E5MA 2D1YA 3DXFA 3D3EA 3LC2O 3UHAA 1GY8A 4EUHA 1G6KA 3Q9NA 1SEVA 4KMSA 4GPD1 3UVEA 5L9AA 4MP3A 5G2OA 4BO5A 4KTTE 3SBOA 3JD1A 1KC3A 3B20A 4OKNA 3WMWA 1DEHA 1LQTA 1HDYA 3L4BA 1R12A 3GLQA 2NTNA 4AJLA 2NADA 5G4KA 1Z73A 2DTEA 3KUXA 1UP6A 3NV9A 3L6EA 3BMOB 4FN4A 4WKGA 1VJ0A 5AOVA 1CERA 2Z5LA 3RC1A 4KQWA 3E9NA 4MIYA 3KYDA 1N7GA 1TXGA 3JQDA 1FDTA 2ZJ1A 2NACA 5H83A 4AJKA 1TVEA 1VJ1A 5IXSA 4FGWA 1U5AA 1U3WA 4PFJA 2WE7A 3WWZA 3PWKA 1ZK2A 3C24A 1RPNA 4HX5A 3WXBA 1MB4A 1T2AA 4ZQEA 3W4JA 4XQEA 1FMCA 1LTHR 2NQTA 3V2HA 4BMVA 2EF1A 3UCEA 1C1DA 4RQUA 4B8WA 1KVSA 3E18A 3FSRA 2RHRA 3M1LA 2VOJA 1HT0A 3ZNNA 1LI4A 5JAQA 3ICCA 1XU7A 1H94A 1WNTA 4R69A 1U7TA 2PZLA 4EJ0A 4GSLA 1HZZA 5DBIA 4HNHA 3BYZA 4IQ0A 2D8AA 3T7CA 5ENVA 2ZB3A
chains in the Genus database with same CATH superfamily
2C5LA 4BQNA 3WZ2A 2YN0A 5L4LA 5EWJA 2FRDC 4IF6A 2C9YA 2FG6C 4CW7A 3OEEA 2DGDA 4Y9UA 5A0VA 3PT9A 1O5IA 2C0QA 3KALA 3L2OB 1KF0A 4I1VA 1Q2UA 5KX5F 3ZE1B 3PEWA 3R24A 4YP7A 1Y1KE 2WJIA 4LYHA 1JQBA 1C0KA 2X19A 1I7PA 1IEXA 2FEKA 3L8DA 4LJYA 4R7ZA 2Y67A 3GCWA 4HO1X 4XWAA 1YFJA 1CUFA 4LCBA 4HDQB 5JNUA 4IGEA 1XRRA 1BHO1 4MITA 1WR8A 4F6RA 1JYSA 1UFOA 1U3UA 4DIKA 1SOAA 4WZ6A 5IKMA 2EYQA 3MSCA 3GEPA 4D3XA 2H52A 4E5PA 1J2UA 4YQYA 4AY4A 4W8OA 1R8SA 3JQ6A 4K87A 5SV2A 3QYAA 3WAGA 4O2BF 3ZGZA 1UT6A 1JWLA 1L7MA 1U0JA 1U0RA 2FPOA 3JQ9C 1T9GS 3CRQA 5GP1A 1FDOA 2KBFA 5AJWA 3BMCB 4RS4A 2ZBGA 3GC6A 1HK7A 5CCEA 3AQIA 4ENUA 3OCCA 4DVJA 4FE3A 3BF7A 4MVJP 1P7ZA 3VTAA 4DWVA 1J06A 4TRJA 5H4GA 5KTMA 5LJIA 3AR6A 1R5BA 2J7PD 2CLFB 3PR3A 5FUQA 4LN1A 4D56A 3FNIA 4U0JA 1SUCA 1Y3HA 3V2UA 2A5LA 4DLTA 3WDLA 1ETUA 4IXNA 3HKCA 4DIBA 4URXR 3G0IA 3NETA 4A91A 3CG4A 1NA5A 2G9VA 4LJSA 1ZOSA 1VXOA 5EVJA 4BPBA 5WRFA 3IMFA 7ABPA 1KMHB 4HHEA 1SUIA 4GBGA 3O9ZA 2KB0A 3SR3A 3IKVA 3AEQA 5BQXA 2HF8A 5CURA 1XJCA 1MX9A 1B4DA 1RJ9A 2UZAA 4XQ0A 3EGVA 1Y48E 5BNWA 1LPMA 2HA5A 3I1FA 1L7NA 3O8NA 4JOSA 4UM7A 5CW1A 4YASA 1KYTA 5F64A 1K08A 4HAIA 3VQTA 3Q3IA 2H2GA 4RD1A 2IOHA 5IW8A 1HYBA 2WHPA 3S2YA 4Q37A 1EK1A 1MO4A 2E2WA 2BBTA 4H7KA 1NNEA 1EDZA 3CKKA 1I6KA 4RD4A 2BEVA 2CUNA 5FOQA 4A16A 1KI6B 2QRJA 3EIEA 2POCA 1X1RA 2VZEA 4MQLA 4X8HA 8LDHA 1UKCA 4O4JF 4GUDA 2IYQA 3U7RA 3TLKA 3QH4A 3AVQA 1JEJA 2OORC 1K8QA 4LJRA 1ODCA 2DFNA 1J00A 1K89A 3HJAA 3FFBA 3L7DA 1CG6A 2PUWA 4XIJA 2PMEA 2D0IA 5K8TA 4UUOA 3IB6A 3LLUA 1FP6A 1D2AA 4CNQA 3IP5A 3KJFA 4K3VA 2VBGA 2DE0X 4X3OA 2QW1A 3TWOA 1YTUA 3UG7A 4NG5A 2Q07A 5CB4F 1SWVA 2FFRA 1GNVA 4PYMA 2HO5A 4JJ8A 2JBHA 3LOUA 4NZYA 2JFOA 2X6TA 2IA5A 4BQRA 2DFLA 1DAKA 5DM70 4NMHA 2V8BA 1WY7A 4OQDA 3ABRB 3E9CA 1UBCA 1R1DA 1Z0IA 2IGBA 2Q8PA 3OKFA 4WGFA 1LRKA 5D87A 3RVQA 1FFHA 1H2YA 1WDMA 2RBGA 4FNAA 4C3VA 4PSKA 3GAAA 3WYFA 4E03A 1YB2A 1VCNA 3A9UA 1ORIA 1TMYA 3JQBA 4B2IA 3EMKA 4XQGA 5BRJA 4DM3A 5K05A 3S40A 4AROA 1Y3AA 5KNCA 5M04A 2D06A 1USGA 4G01B 2Q1YA 2DVMA 5BSUA 4L0DA 1WMBA 4KWEA 1P1CA 3CEHA 4BBZA 2YWJA 3C6MA 1T34A 1LU9A 4B34A 1Q0QA 2HYDA 1GEGA 5KQSA 1RWPA 3K96A 5BSHA 1CKEA 4HMQA 2Y0BA 4KHPB 4XIFA 4XX1A 4EGAA 3FOEC 5T5QA 1WF3A 4RKEA 2I29A 2PLWA 4QFBA 4N6GA 4QGSA 2WMNB 1WSAA 1NSFA 1SCQA 2E5WA 2NNWB 2PL3A 1K3FA 2F8LA 2BKEA 2GVDC 5A0TA 5IPFA 4M54A 2OAQ1 2XCQA 3FAZA 2X0EA 2QZZA 3PWZA 5BQOA 1TO6A 1GFWA 1G60A 2PUBA 3QELA 1XF1A 2Z09A 2PSSA 4P0PB 3KK0A 5JXHA 2PL1A 3HLTA 2GUGA 4KFUA 5FA6A 4MR8A 2XDWA 4BNIA 4TV8F 3WKBA 4CDMA 5IXYA 4Q4JB 3ADKA 3U3MA 4LK2A 2IODA 5LFAA 3PXEA 4TKMA 5HR5A 2I54A 1LGYA 3ZE7A 3W3ZB 3PDIA 1IHOA 1YL6A 2ZWOA 4JI6B 7REQB 4AXBA 2QI9F 1UBJS 1WKBA 1W48A 4YIHA 4ZICA 1GLNA 2YR0A 1YUBA 3B85A 4HWRA 4PBSA 1G5HA 2WHXA 2ZRKA 3C8UA 3IPAA 3QWBA 4GSYA 3IH5A 5H3CA 4EZIA 1BKDR 1IHDA 1TYZA 1Z0SA 3KE9A 3VDRA 4A1OA 3E9EA 4XGRA 4EL0A 2QY6A 2EBUA 4L3OA 3X1JA 4QSMA 3KJHA 2PU7A 2IW3A 2OGWA 3A9RA 4K2HA 1RVV1 3GJ6A 2E4UA 2G9NA 1E3TA 3CSUA 4RPJA 1U6KA 3ROTA 3OFKA 2WNIA 1BOOA 3F9IA 3IJRA 4FR5A 3QWFA 4OSPA 2G3YA 4KFRA 2EGUA 3AFGA 3O3OB 1UKVY 2OAGA 5FLEX 3R3HA 4ZGGA 4PNZA 4JUFA 2WJJA 3AF5A 2VHEA 3B52X 4BC1A 4NBUA 5E7QA 4V1CI 4KWHA 5HOQA 2CFIA 2Z8XA 4D6YA 2OPBA 1CJMA 1P1FA 3WVNA 1DQRA 2QL9A 3C97A 1CP3A 4DJDC 3ASZA 3K1AA 5AI6A 6ADHA 1MZVA 1QHYA 4MVJH 1DAPA 2YV5A 3PE4A 1K3UB 2D4HA 4KXMA 4YX9A 1VE9A 1Q7RA 1U0OC 1HE8B 2G67A 2OCIA 3R6DA 4EG0A 3FTFA 1WVMA 3FNFA 1OZFA 2A0KA 3WTCA 1E2EA 1JJ7A 4QVGA 2ZJ3A 3FKJA 3TSYA 1UBOS 5FWXB 4E5VA 1OH7A 1RJEA 3PKIA 3V8RA 3L7OA 4OUDB 2W6MA 4UMFA 1YVPA 2I6FA 1OYWA 5LVAA 1RC0A 2J0SA 3LQKA 2W2XA 3I72A 3NLLA 4MKZA 5FA5A 4IAOA 4R71A 2FN9A 4YCMA 2HSDA 3D6HA 3MS2A 4K9PA 5BQFA 4TXMA 3HEMA 2SHKA 4KTVE 1VBFA 1VG8A 1DQZA 2MINB 1JNXX 1SZDA 3A6HA 3I2FA 5KJ6A 2BEJA 2G25A 2B1GA 3R8XA 1J9ZA 1ZX1A 3BGOS 2PR2A 1I3MA 1B15A 3R3WA 4PG7A 4PAMA 1UJ2A 3SP1A 1U2RA 2PFSA 4FGZA 2XXAB 2DXIA 1G8YA 3IEPA 1PT8A 1XR3A 1A5ZA 2HDOA 2VEOA 1I4DD 4N5DA 3ZE0B 3B1KA 4G5FA 4IQFA 5IMBA 2YWFA 1FMTA 1PEKE 2PA3A 2ZI4A 3VPBA 4N65A 4X92A 2WFLA 1XCPA 2QMYA 3AEKB 4N4AA 1RBZA 1RLJA 1IM2A 3L6BA 1OXSC 3OEYA 3K35A 1I6WA 1ODIA 2Y0PA 3NT5A 4HLNA 4NARA 4OJYA 3THOA 4DW8A 4F3KA 5CX4A 1F1BA 3SM3A 4D25A 4KXWA 3FKSA 2CXSA 3QF7A 2BP7A 1ZCZA 4TL9A 4CNBA 3V3KA 1NJ1A 4N0EA 1CFZA 3HXLA 3BK2A 3I76A 5H80A 5E4JA 1PIWA 1VBMA 2FPIB 2HA2A 2OBXA 4N5LA 4PGAA 1FNSA 1H42A 3O1HB 4RH3A 1YZQA 3T3GA 3ZV7A 1U63A 4BLOA 2CCGA 3Q3GE 4B0OA 4AY2A 1EGAA 2AXQA 1G8KA 3H9BA 2QJTA 2XCOA 3DD5A 2KJQA 3L7CA 1KPHA 3VR2A 4PGMA 3AKYA 3VM6A 3ZIAD 4EJ2A 1D9XA 1N3BA 1QGYA 5I7WA 1G0OA 4ZI3A 1SVWA 2CHUA 3A6JA 1CUEA 5ALSA 4K0RA 3IPXA 4MVYA 2FPRA 2GEVA 3V3TA 2QUKA 4I3GA 4ILEA 1T8UA 4KFSA 3BILA 4TTJA 1U04A 5CUQA 3IE0A 4JBXA 5ALNA 5DNVA 3ZHVA 1F0YA 1A8QA 2B7CA 4CCAA 1MC8A 2AOVA 1PAUA 3M9XA 2JLUA 2Z9CA 4L9WA 1CUDA 3P4YA 3PCTA 4GS5A 5C34B 4XDHA 3LJKA 3EH1A 1Z4NA 4D3DA 3I6BA 4UNNA 3ECCA 1T8TA 4L9SA 4ZDWA 2VNHA 4EITA 4K6FA 2R6R1 3QY0A 4BZWA 3DYBA 2ZYWX 2C1XA 1LPAB 1V96A 4Z4CA 1E2PA 4MLDA 5B64A 4OQMA 1UDRA 3F8SA 1MAAA 3K09A 4OJNA 3JWGA 4BP3A 4YMHA 4HXYA 4NFLA 5JYBA 3S99A 3U3RA 3PYXA 1DJMA 3SG0A 3G23A 1AB6A 4GYJA 1H5QA 1L5OA 2TECE 1SB9A 3M6UA 4JJKA 4ZTBA 1D2GA 2ZJZA 5T7BA 2Q27A 5EESA 3GFQA 4DG9A 5T57A 1OIXA 1U3FA 3B6KA 4HDRB 4I5GA 2JCVA 3MUEA 4MVWA 1JZTA 5ALOA 1JU9A 5BOVA 1D4FA 1HMPA 5KYTA 2AT1A 1EK2A 2JRLA 4GXQA 5J4LA 1KHTA 3VR5A 4L50A 1QIFA 1PBNA 4KO2S 1UBEA 3EX7C 4NEQA 3AL3A 1NQWA 1OBVA 2ZYIA 2MSNA 3HZZA 2GFHA 1GKYA 4FGSA 4TTQA 5FIUA 5IS2A 4HFNA 3G02A 2WU1A 3A28A 1C0PA 2AR0A 2HBYA 2BR4A 3IRUA 3Q0TA 5IAAA 4DPLA 3GFTA 1GSHA 4HPJB 3B36A 3EZNA 2I6TA 4NHEA 2Y1GA 1DIOB 1THMA 5FADA 4EHBA 2QXTA 3C15C 2OM2A 3LO5A 1TJ3A 2F7SA 1A98A 5DGCA 3THXA 1ISGA 1NDHA 3O8CA 2YV1A 4HXFB 5DOZA 2J32A 3U9TA 4DLWA 1NW7A 1V26A 5DNWA 1AUOA 4FYYA 2MR6A 1XCMA 2WWWA 2X0RA 3IAFA 2VZ9A 3FH0A 1ZONA 4OKSA 4WV3A 2GF0A 4B76A 2OXCA 4PC6A 5A5GA 2ZQYA 3GLIE 1PL7A 2BTQA 4EPRA 2ZW9A 1E2GA 3DOOA 4AI6A 1U8ZA 3H5IA 1LJUA 2H1LA 3NAMA 1DIAA 5I7OA 4R3WA 4W9NC 4ZFNA 3AVVA 4JR1A 2NVOA 2NOAA 2ACKA 2QRUA 1XQVA 4K9SA 1XSEA 2PZMA 3KKZA 1EFPB 5I9LA 4GKKB 2BGIA 5D51S 4KIFA 1WX1A 3WIUA 1PEYA 3WGGA 4RGQA 1AHIA 2EZTA 1S1CA 4MZXA 4KQIA 4LJ4A 2KSQA 3DOIA 2FHPA 4RO0A 2FSSA 5DLEA 5GZ1A 5K3EA 1Y3BE 4Y7CA 3UYLA 2BTEA 2YMPA 1KYZA 4I1PA 1C30B 2VDNB 2CZGA 3KQMA 4CG2A 4FGJA 5DWQA 2EFYA 4Q48A 3OPVA 3N5CA 3MCZA 3LCCA 5LLSA 1KS9A 4KBGA 2VRCA 5FX2A 2ZRFA 1V3QE 3T9FA 1YE3A 4L4SA 3VISA 1DKLA 1M1UA 1NF8A 2BBWA 4OK3A 5LZ8A 3DD1A 3ZQUA 4CXMA 1AKUA 4ZYYA 1NFRA 4OQYA 4YA6A 4LA4A 4Q1BA 3K9FC 3D81A 4Y2SA 5JNTA 1P19A 3PQDA 3QV2A 1L5LA 2LWIA 5AJTA 2VHWA 5DSZA 4DLYA 4DQUA 1O97D 1MABA 3KZOA 4QPZA 5GONA 4AJ2A 1WULS 1P1BA 1RQXA 4KQCA 3UG6A 4J94A 3ZDFA 1M6EX 4P3OA 4UAJA 1QPGA 1UPUA 2W4MA 3TOVA 3ZXXA 3PTAA 4F12A 3D4LA 2ODAA 2G6BA 3IEIA 2Y1LA 1NKSA 4KN6A 4NRDA 1ULUA 3B1VA 5JXWA 4PHTA 3W5VA 2BCGY 1GNQA 5TSDA 4LFBB 2Q46A 5FI0B 721PA 2NN3C 1OH6A 4PYLA 4R5MA 3UPTA 3P9KA 4RK5A 4Y0NA 1D1TA 3TQHA 3W5HA 1CTQA 3OPNA 1PS0A 4KJZA 3QVLA 3ZWQA 2BI8A 3EPJA 4NV1A 3ROMA 1KARA 5AW8A 4FBGA 5ITZA 1IIBA 2WMYA 3GLSA 1Q20A 1PV1A 2E4XA 2VSFA 3WGNA 1G2PA 2AOTB 1OLSA 1Z7EA 2FPSA 4OTZA 2WWIA 3JRWA 3ONFA 1I4LD 2PMDA 5CYFA 5G41A 3KP1A 5C31A 4B83A 1J9EA 4C6TB 1N8KA 1SCDA 2FY8A 3NIFB 3FFAA 3I1YA 3U7IA 3SYNA 1O08A 2C5EA 4OAQA 4KQXA 4G5GA 4P38A 2CL5A 1SBQA 2ZE6A 1T6ZA 2BMJA 3NUGA 5TX7A 2EJCA 3I9JA 2HFKA 3TPCA 3ZS8A 3G1UA 4AVYA 3NEAA 3QEAZ 1C4KA 5JROA 4X41A 4CIWA 1XMIA 2J5QA 4HNUA 2WF8A 4R9NA 3KPWA 3NAQA 1JF8A 4LDAA 4RV9A 3NO4A 1Q1BA 1S3GA 1DKMA 3SZRA 2XDQA 1QS0B 1B23P 1T0IA 4C4YA 1QGUA 1YU9A 2YZKA 3SHOA 1EVIA 2ZBVA 3DWGA 3PPXA 3BQMB 3TD6A 5IAKA 1U9IC 4LI0A 2C42A 4CKBA 4JYPA 5K8CA 5JJKA 2G7ZA 4JX8A 5EMJA 1KY2A 2HPZA 2V5AA 4R7TA 3UB3A 3DAOA 3AGQA 3S29A 5BW8A 5GOZA 2RGRA 2GDZA 4BX8A 1VJGA 1F8FA 1YIOA 5A6VA 4C04A 4PPYA 5THKA 5CGQB 2QX6A 4G1EB 2C2BA 1E3LA 4AZ0A 1JZQA 3LNCA 2M98A 1ZLXA 2C5GA 2PRZA 3ILYA 2W58A 3BFKA 1IL0A 5AK0A 1VC2A 2NSDA 3QEOA 5U4QA 2G1AA 4O4LB 2UYGA 3HJUA 4IFTA 4PQEA 1ZI6A 4ZC8A 1QH9A 3I9NA 2YHAA 3O83A 1DDOA 4F5EA 1DTSA 5JBIA 4IIEA 1JQKA 1CQJB 3DDNA 4DUPA 1GIAA 3KR0A 2IVZA 4WLFA 1OI2A 1DOHA 1D4ZA 1N6PA 1U2GA 3KE8A 3PGA1 2Z1NA 3H2KA 4HN9A 3GEHA 4LC1A 3V1MA 6NULA 4KR6A 2PEYA 2IYRA 3CNNA 3HFSA 3JPYA 4BO4A 4LTNA 1JQ5A 4KNYA 2H2IA 5A4DA 3VHRA 4PYNA 2XDYA 4IIYA 2ZRHA 4MHSA 1Z38A 4FBLA 5SYNA 4WY8A 4YECA 2QM3A 3FNRA 5TE9A 5E2AA 4DR7B 3F3MA 5IC5A 1LBIA 1A9YA 2LPMA 2WZCA 3GN1A 1VB5A 5AT1A 3VDMA 4B40A 1KDRA 2ENUA 4E31A 5F52A 4HWSA 2AEEA 1R6BX 1JT2A 1P7WA 2HU2A 1K8YB 5K45A 2IFTA 3DTVB 3MT7A 5F7ZA 2Q3DA 2JIBA 2FRDA 1CXZA 1KAQA 2XTNA 1KNQA 2O1SA 2EDAA 4ARUA 4K26A 4DCNA 4FNGA 4CM3A 1FNMA 2C92A 4BKQA 3I1JA 2GZHA 2I9KA 3WLIA 4A4DA 3A9WA 4XD2A 3BJEA 2X0JA 2GAJA 3C3PA 4XR4A 4FYXA 1PLLA 2VT2A 4BN4A 1QJ4A 1UXHA 1QC5B 1RWNA 2NSYA 4RIIA 4WCDA 1X9IA 4LWQA 2DWCA 2I87A 2YJNA 3LTEA 3PTLA 5TRTA 1CUZA 5IAJA 1PJ2A 3KQOA 3CZMA 5CIWA 2FFHA 2O7VA 4OMCA 1SJ9A 2V6IA 4IZHA 4U9UA 5C8XA 3BMCA 3F6SA 2OV4A 4M0LA 5EIEA 4DLUA 5K3OA 2H08A 3EBLA 1VPLA 1UEIA 2EXXA 1AK1A 3JQ9A 3TFWA 5BORA 5IWAB 4ZGBA 1P4JA 1X94A 4ZODA 4Q3LA 3IMEA 3WGIA 1OASA 1QUFA 2R8OA 4L5CA 5KREA 4U4AA 5JD3A 1CZOA 4DQDA 5A4FS 5GIOE 2WP8J 3FNEA 2L17A 2O3TA 3ROEA 4UHHA 3W8DA 4WLUA 4GPEA 1W0KA 2ON6A 1KMHA 1OF1A 5F1PA 5ILQA 1U9JA 3TGLA 1U0TA 2C5AA 2VNSA 3NBQA 5TS2A 2HB6A 4IINA 1OUMA 4BFLA 3OU6A 1NAIA 1B6RA 2OCGA 3A3NA 2NPIA 3IAS6 2I03A 2QZJA 1KVQA 3LC1O 3AKDA 2CMFA 4C5BA 1U99A 4BV9A 1PGPA 1TNDA 4DV4B 1P4SA 3CCCA 2ZJ5A 3DFUA 5KVCA 4Z5XA 1MG0A 3KSMA 3B1YA 4P5PA 3TLEA 1T10A 2I99A 3D7SA 3A1WA 4FFPA 2JB9A 4GYWA 3G7SA 4LYYA 4M53A 4OXRA 3D6JA 4RV5A 3UHOA 1XZBA 3DWFA 4M9CA 3STYA 1FSZA 4YROA 1UP7A 2BJWA 1Z17A 1P4AA 3V97A 4XGIA 4W1QA 1L5QA 5JSUA 4R0VA 1N1MA 2FMFA 4IIDA 2XUOA 4HATA 4Y98A 3K2IA 4L15A 2OGZA 1H6BA 3RFFA 4GXRA 1YS1X 5DX8A 3O94A 5SY9A 4O4HA 4J4HA 1KEKA 2BFEB 2OORA 3LV8A 4MEAA 4ZQGA 4X66B 3UICA 1UWLA 1D2CA 2XUKA 2Z43A 4JLDA 3C1TA 4MCJA 3B3JA 5AW0A 2R2AA 5E4TA 1Z75A 1JE0A 4NX2A 3O95A 5E9QA 4CI0B 3UJPA 4I9HA 4IGKA 5IJAA 3R3SA 5U9CA 4KMMA 3RC2A 4OHZA 1U0HC 4PIVA 4UULA 1XJQA 2GYYA 5DTJA 5SICE 4UNQA 5ISMA 1GGVA 1RMYA 2PVSA 1N6OA 1N2SA 1DQPA 3F49S 4LX0A 2PGNA 4PCAA 2GZMA 5IN4A 2AN4A 2I34A 4ZVKA 4YAEA 2VCHA 4GP6A 4NAHA 5JQGF 5EUMA 4TRNA 1PW7A 3FBTA 4C4AA 3L05A 1ZM4A 3ZWXA 4A8PA 4BWVA 1LV7A 5A4KA 3LKZA 4DEYA 3W2GA 1KSFX 3UV3A 1C9DB 4DMLA 3R9KA 1ZSYA 3GIWA 1IOWA 2YIDA 3HV0A 3V7FA 2QVGA 1NUTA 1S01A 1OXKB 1JJAA 3CUKA 3OZCA 1SA0B 4NABA 4X60A 3QU9A 4ZVLA 2F4VB 4PTZA 3GLFE 2B5VA 5CT9A 1RYDA 1Y8AA 2C94A 5KNBH 2WINI 1CRLA 2VI5A 1UJNA 1U5CA 3UT5B 5JECA 3IPCA 1Y7PA 5FPKA 3HGMA 3L8FA 1H9BA 2OP0A 3ZBTA 4UM5A 1WQ3A 2HBRA 3NAZA 3CN7A 3L77A 5FFMA 2WIBA 2NV2B 3MGGA 3QFRA 3DHWC 4LEIA 2XKKA 2O8CB 1KJQA 3N74A 1YRWA 1OI4A 2H4HA 1JIXA 4WKOA 3L40A 1NW3A 1RKVA 3HABA 3INGA 1F60A 1Q92A 1FNCA 2DFPA 3OCVA 1VYUA 4LMAA 4R3NA 4DB2A 2XNJA 4KQEA 5ELLA 2Q1TA 3K3PA 4A2PA 2XODA 3ZCRA 1T5DX 4U3JB 4BQFA 3HB5X 2FU5C 4ROTA 1Z83A 4KN9S 2HJGA 3KSRA 4F8YA 3ONVA 5LKAA 2B92A 1BKYA 1NPDA 1BRTA 3OOWA 4EBFA 7REQA 1Q11A 1WXHA 2Q2OA 2RJNA 2JFHA 2FVYA 1Z2AA 2CXTA 2R87A 3M6WA 5BW4A 2RGBA 2HMYB 5HF9A 2QTBA 1EKXA 3FLMA 3TMKA 3BAFA 2C8JA 2NXEA 1NTOA 2C2OA 2FW8A 2TRSB 2WWXA 2V6MA 3OOEA 4HSGA 1JR3A 3KJNA 3ZWYA 4G0XA 2EJBA 5DYTA 2HREA 2DKOA 2GGSA 1OBOA 1UWVA 3KQLA 2IIVA 4Q7EA 4US0R 3BSYA 1WPXA 3F4LA 1E77A 2CYAA 5KAPA 3TQSA 3SZOA 3USCS 3UWDA 4O3MA 3VHXB 4PSDA 3W1WA 2ZT5A 3MRTA 3FHTA 3ETLA 2O5EA 1NU6A 3F9RA 4HADA 4DC1A 3R7WB 2UUBB 1N9ZA 2QKYA 3KZXA 5LU9A 1OA1A 5FR2A 4L4XA 1OY1A 2JIRA 3KOZA 2KQUA 3AIMA 1BHQ1 2HXSA 1OW3B 4ENRA 3B7WA 4RTSA 1PHRA 2H6EA 1UPFA 2OBBA 1IBRA 2W6ZA 4FJ0A 3RW9A 5BMVB 1QCCA 3LP5A 4JGIA 5CA1F 1KXZA 4GMFA 4HWTA 3WLHA 1XTZA 4LNUB 5DEIA 5LLDA 3F46A 3FJ1A 3PGLA 1XDWA 3MIIA 5JTUA 3OPYB 2BM8A 4ZD6A 5JG7A 4LXYA 1T8WA 2ZRAA 3GA5A 3I2YX 4NR0A 1GXSB 1P2FA 4MAAA 5LXTF 4FYPA 5CEFA 3E9YA 4JZYA 1M1NB 2O1XA 5FWXA 4CTOA 2VPIA 2RE8A 3GEDA 4LDPA 1MO5A 2GYUA 4OUDA 4BV8A 1LLFA 5AVUA 2F8SA 2IS1A 1J8YF 4P82A 4TQGA 3P4UA 2H4YA 3MWEB 1EK6A 2IH4A 1YJCA 2IRWA 3I5YA 4TZ0A 3EVNA 3O21A 4DRZA 5L6LB 3I9V6 3SMVA 1BW9B 1GA6A 1ORTA 4I4LA 2JH9A 4J9UE 3FNBA 1Q1EA 2E18A 1EXWA 5IYZF 3GPLA 2MINA 1DKNA 2EP8A 3LE8A 4WOKA 1RYZA 3IR6A 1W1WA 3PHIA 1R0XA 4RY9A 1ODJA 2EKPA 2OHXA 4J0HA 3IAM6 5FAXA 3SHFA 2GEDA 1DO8A 4X8OA 1R6XA 3MCTA 4ZPJA 3DUWA 3HJTA 3HBFA 4YPFA 1B7GO 3KSDO 2BMAA 3PUWA 2UYHA 3FTDA 3IIIA 3PQFA 3L84A 2CLCX 3FF4A 3IGFA 1NC1A 2QP4A 4PO3X 4JLNA 1T9ZA 4TV9B 4UEQA 5EQDA 3VJKA 4OAPA 3WV5A 4A2CA 4JK3A 2OP1A 3D9QX 4EFDA 4OI4A 1XZ8A 3SIRA 4E2YA 3KDSE 3IOCA 1MHPA 2H1IA 1JJIA 4B3HA 5FAKA 1E1DA 1D5CA 3F6EX 3AEKA 3KV1A 3R41A 5JD5A 1FSSA 2ZI9A 2H1OA 4ZTZB 4Q16A 3W3AA 4LRXA 2FN8A 4D4HA 5GADl 1KQOA 3SNKA 3TJMA 2C59A 3H97A 4XJSA 4ZXPA 3P9IA 4Y2QA 4KV7A 4A3SA 5CEEA 4GC9A 3F2VA 4J7XA 3WHLA 2R25B 4C6HA 3CZRA 3B12A 2Y6VA 1VI6A 4BEJA 3LLVA 4NMWA 4HEQA 1K6EA 2R9VA 1ENZA 3GFBA 4H9GA 1RI1A 3UB4A 2FPIA 4YRIA 4K88A 1J09A 4H7IA 4EW2A 2QRHA 1DMRA 4YI5A 4KEAA 4RZHA 5FF9A 2CVQA 2JI6A 1T35A 1CQPA 3KLOA 2I2WA 3COPA 3N2KB 5JH7F 2YMMA 4CETA 4IX9A 3DCYA 1L3IA 4HDMB 5K8JB 3L7AA 4CGYA 5BPFA 2HJRA 2O05A 4GL2A 3I2HA 3EF1A 5E9WA 2Y05A 2OZVA 2AI2A 3DOJA 4BWFB 1XTJA 1YBHA 1PDOA 2FZCA 3IXLA 3EUAA 2IYYA 2D2FA 3NHWA 3SX2A 1S2LA 2RHJA 4UMEA 1E1KA 3OJXA 4MYTA 2A86A 4BZXA 4CMEC 3UH1A 1P0PA 5JS6A 3WOHA 5TGZA 1DZ3A 5AM2A 1R7RA 1EJ2A 3D7NA 4UM9D 3ADOA 4HLQB 4KBFA 3U0BA 3HA3A 4KH1A 1JFFB 3FETA 2GR9A 3KXIA 1WP4A 2D0PB 4QJBA 2H5IA 4RH1A 4ZO8A 1IJEA 3OEWA 1U3TA 1VBNA 3LCUA 3RWBA 3NVKI 4LGVA 2JAWA 3KT0A 1BN7A 1NXWA 6GPBA 5KNCD 4ETIA 2ZRBA 5I9MA 4YO8A 3BT7A 4JEHA 3UK6A 3OT4A 2PTGA 1RRVA 1VRVA 4RSHA 3PIIA 5BMOA 1EG7A 5KOIA 4HDRA 4EK9A 2GAOA 3IDQA 3AVUA 3L4SO 4LOHA 4LY6A 2XHZA 3W8EA 3SDZA 2WB4A 5EJMA 4DCJA 3JSAA 2PKQO 3ER6A 1Z2EA 2A94A 3FMPB 4ND2A 4A92A 1ULBA 4GKVA 3ZH9B 5BYAA 4KZKA 2XRFA 2EFHB 1JDTA 3SU8A 4KPEC 1HA3A 2BEWB 1WXFA 4RZ2A 4B45A 4CTKA 1XWIA 2LRHA 2NZ2A 1K5PA 3JVVA 4IDHA 1B74A 3TBKA 1R5JA 1PFGA 1VA4A 2D1FA 2R8BA 2XXJA 3VSAA 3THYB 2J8ZA 3ZD7A 4NOJA 2IDMA 3EVAA 1ZNYA 3OZXA 1PVVA 3A6KA 2QN6A 1XA4A 3HCOA 3HB9A 4DMUB 3F7OA 1ORVA 5AKKA 2DETA 1KFEB 3IR7A 2WTAA 1ZI8A 2O8EB 1P2GA 1DC5A 1UKYA 3W5DA 1N75A 3BJZA 4EA9A 2GCOA 5IDQA 3OX3A 3AKEA 3MJRA 2R7NA 2NUPB 3CLUD 2YRWA 1XKQA 3C45A 3LUPA 4U2DA 2I65A 3NANA 3V4LA 2FR8C 4YONB 2YYAA 3CW9A 1EM8B 5A2GA 4MDHA 3BIOA 4D0LB 4D9NA 1R0KA 2PL9A 2WUFA 4E70A 5A9SB 1XVUA 1CF2O 1Q17A 2V6GA 1T2VA 3C7KA 3WGOA 4EW6A 5JJIA 5KSZA 2AFVA 3RUAA 2XOXA 3E7PA 1LS1A 1Z2NX 4BTVA 5A5FA 4RYDA 3JCZA 2B1JA 4DJ5X 1EESA 1JLKA 1Y9EA 3V00A 4JCCA 4W9NA 1EFPA 3JVDA 2BSXA 1XZHA 3GXBA 4LJKA 2PUFA 1AZSC 4KIGA 2HU5A 3W9SA 1ODTC 4QNNA 4IJKA 1HOTA 3HWX1 2QN3A 4S1NA 5D6OA 3RVJA 1LSOA 3FVVA 2BGWA 4NBNA 1A5BB 4WY2A 5CH5A 4DDTA 3RAJA 2OK8A 5AK4A 1ZD9A 2G9ZA 1C30A 4QM6A 2OD7A 2BGLA 3VYTB 2WYHA 2J0VA 2Q9BA 2JDID 1HT3A 3KTFA 4JN6B 4Q12A 4Q1EA 5TGDA 1TTPB 10MHA 4RACA 4Y1GA 5GINE 3T5AA 1WMSA 4BB6A 1NVUQ 2O7NA 1EINA 4QFCA 4YJ3F 4C08A 3NWJA 1L8LA 3COZA 4MWDA 1QNFA 4GR5A 2IIPA 3F96A 4P22A 5JO9A 2R11A 3HPRA 3RK0A 1K2VN 1I14A 1G7RA 1WXQA 3GRZA 4HWOA 5DP2A 4FYWA 1YZKA 1T36B 3G9QA 4I3FA 4MV4A 4EMSA 3C7DB 2BKLA 2FOLA 4RADA 4ZI7B 2QTNA 3OP1A 2W11A 1JEYB 1KDVA 5K0SA 1HEYA 1XJ0A 3A31A 2XUHA 3CPHA 3EIXA 1GZDA 1KGSA 2ZGVA 1XQ9A 2PH7A 1NBAA 3M4XA 3WGLA 2VHZA 5CXUA 2O48X 1J0BA 2D5LA 3JZFA 3ZX5A 3LYLA 4UBIA 2PH3A 2ZYAA 3HSKA 1X14A 4D9BA 5EGNA 4A0SA 1SXJC 2KWIA 1IOLA 2P75A 1BJKA 4O8ZA 4RTRA 3EPRA 3IDFA 3ZUPA 4CG3A 4YAWA 4QYTA 5K2MA 1WP9A 1C3EA 3D43A 1F6WA 1SXJB 3OIWA 4G36A 4LTMA 4YJKA 4E11A 1Q0RA 3JQAB 4OH1A 2B6HA 3WB9A 4D9JA 4ZZ0A 4X3CA 4C6TA 4ID9A 3MHTA 3GZTB 4X1YB 5I9TA 3OM0A 4RQBA 4U7WA 4D82A 2HADA 3W5BA 2R96A 2YCLA 3FGZA 3IAXA 1WV0A 2EERA 1TM4E 1ZP6A 4XB6B 2SCUB 3UJ6A 1FFXB 3KQQA 3P20A 3MBIA 4FOLA 4MULA 4OB7A 3V8VA 3ZOKA 3WDKA 1ZM9A 1V0JA 5CT6A 3IDZA 4UREA 4JBWA 4PQGA 2WG1A 2HHJA 2XMZA 4OPMA 2R8PA 4MPRA 2L82A 1PUJA 3LUAA 2OHGA 3AIIA 3FKSD 1IDN1 4FZVA 4QXOA 3EQ7A 2JBAB 3U4AA 3WMFA 4Z9AA 1SXQA 4R31A 1DG9A 1NI4B 2W00A 4ED9A 4HRAA 1QS0A 1Z3CA 2GBLC 1IHUA 3B9RA 3CLVA 3MWDB 5LA6F 3HCRA 1S2IA 2KYRA 1DJNA 3AF2A 1WBDA 4M8SA 1CIVA 4MOWA 4UUBA 2Q9UA 2Q3HA 5A6SB 4ZEMA 2HF9A 4NCJA 5TEVA 3NVDA 3VR2D 5BSWA 1E20A 3EODA 2YV2A 4E0BA 4C21A 1EUCB 2XZDA 2PWPA 3D6NB 3JX9A 3OF2A 1Y1TA 3EWAA 1U9IA 2X9NA 4BNKA 4O5AA 3REOA 1QTRA 1TUBB 2FJUA 4OQPA 4OHXA 2P9YA 5P21A 1ECBA 1FUYB 4HGNA 3TAXA 3T7KA 1R6TA 2FR0A 3Q72A 3UOAB 4PLZA 1M1YB 3P2OA 4MSUA 3I04A 4Q4DA 1OB2A 3ZW7A 2QQ0A 3HJNA 4PAWA 3W4IA 4CF5A 3A26A 5C1PA 4YMGA 2VK4A 2JLZA 1GZUA 5BSKA 2D59A 4RXUA 4M1EA 3MIZA 4FCWA 4UNPA 3SS8A 1U9ZA 1CQJA 2ZJAA 1MJGM 4KGVA 5BWOA 4BWYA 4C1BA 4D4IA 3QQPA 3R3YA 5AKZA 3R1IA 5JC1A 4S0ZA 4OYLA 3C7TA 3Q1LA 1O6GA 3FYCA 5C7LO 5DW0A 2Q2NA 3LBAA 4RTJA 4M7PA 2VAWA 4O4IB 1YNSA 3I1IA 3JVEA 4R1OA 5M3BA 1K3TA 1JS1X 3KXKA 1P61B 2QUHA 1KJIA 4OK5A 2QDKA 1OAAA 2XDAA 1SK8A 1UIRA 1C29B 3DFZA 3FTNA 4JIGA 1OWNA 1SQGA 1NX6A 2XVZA 1WMEA 3G8YA 1NNSA 1TVMA 3ODGA 4RJJA 1X7XB 1RWBA 4F92B 1OX5A 2CJFA 9LDBA 2QZSA 2H9YA 2YWBA 4NCNA 1GTG1 3NI2A 2WK1A 4MYRA 4RVGA 5BSMA 1U0EA 3G0OA 2BI7A 4Y2JA 4H59A 2DKNA 2ZS9A 3DTVA 2VPQA 2V0CA 3FCXA 1JDPA 4GLFA 5BWNA 1FTSA 3BMQB 4FSDA 1RWWA 4PN7A 2AIRA 3U1TA 5FUWA 3VYVA 1EGVB 1SIBE 4EAQA 3AL2A 4V2IA 1DKUA 2OHFA 4JR2A 3FUWA 4RCZA 4EX7A 2P9QA 2IXGA 3RDPA 1QC5A 2ZK7A 4BECA 1LVHA 2GHRA 4X8LA 3UMGA 3OMWA 2W2NA 2CL6X 2IL1A 4JBHA 1FXWF 1VJDA 2OR3A 2ZBPA 3K9GA 5B1HA 3WLMA 2I7DA 1L7RA 1F4VA 5DHPA 5EKDA 5ALHA 2OPHA 4AMUA 4KU4A 4D4LA 2C95A 4DXHA 1PZXA 1GN9A 1NURA 1ZINA 2A7XA 3MGBA 5G40A 3OHSX 5GMOA 4CUJA 4PRKA 3A1CA 5EA2A 1DAHA 3FDZB 3BRWD 5FQNA 1T9HA 3R7FA 3U48A 1G5PA 2WJ4A 3NOQA 3ZHXA 4LKOA 2IU4A 2DLDA 4RFSB 4CKYA 5IABA 2DFDA 5JAZA 3IS3A 1PCXA 4A36A 3T5BA 1RJGA 4DRYA 3QW4B 1RPZA 4AKGA 1CUXA 2B82A 1UEXC 1YRLA 1XEAA 4B3FX 2I67A 1XBTA 2HCFA 2F55A 2QR3A 5L3QB 3TTXA 3AILA 3IVGA 2GB4A 3CEMA 5DNEA 3FWZA 4F9GA 1JMYA 1MORA 2HRDA 4GOLD 5BO5A 1Y8RB 4IJWA 3OU2A 9MHTA 3ZY3A 3HP7A 5HRAA 5HW0A 4WH0A 3VU8A 2OSVA 1NVGA 1A27A 4L4ZA 1RQLA 2O2SA 1KJ8A 4QNMA 3U7JA 1TL7C 5KHLB 5KOYA 4FMCB 2G06A 1YR8A 1Z4LA 5HMLA 4MR9A 4C7XA 4KIWA 4JJFA 1Y6FA 4J0DA 3TOXA 4B3BA 1I9GA 4WRRA 2VZ0A 4ZHQB 3DA8A 4LXHA 3WLRA 2Q0HA 3JWPA 5LB2A 1JWBB 1QMPA 3SEAA 3RS9A 2IYNA 2J0UB 1PK7A 4B09A 4PNEA 5A7GA 1YAJA 2VUIB 3LCVB 2A9PA 2LZ0A 3P9PA 1E0AA 3LLMA 5DNDA 4ALNA 2VRCD 4MWOA 2X0FA 5LCXA 2FB9A 2MSKA 2PANA 3ZCVA 1PD1A 4CR7A 2BFEA 3PXUA 1JYEA 2YXEA 1QFYA 1F0NA 3AW8A 1HTTA 1MRSA 1V16B 3AP1A 5D86A 3DMHA 1ZJYA 3DKVA 3CNBA 2XE7A 4PCVA 3C14C 4RVFA 2JGKA 3LQ1A 2WWVD 3ANXA 4E94A 1Z4PX 5CU7A 4JUCA 5TXGA 2BLNA 4ZVPA 5CH8A 4BE9A 3K0SA 1HLFA 4CCSA 3ETEA 4UVEA 5K3BA 1M6HA 2JHGA 3GFFA 2V54A 3HJGA 1Z25A 3CW2A 2CZCA 3LX6A 4KMOA 4ZEOA 3EMDA 3RF6A 3O93A 4ENTA 3I23A 3ZIUA 1JNYA 4ZOLB 5EKXA 3ZQ6A 5B36A 2EZ8A 1V39A 2YXNA 3VTZA 2J85A 4WINA 1QGOA 2Q49A 3A3PA 2FYTA 2MSLA 1YS9A 3KPUA 5T4HA 1P5FA 1TFUA 2E9SA 1PGNA 3CE6A 1PQYA 3FA2A 4CDNA 5BSFA 1VE6A 1M75A 2NVWA 2B4TO 2PN1A 3AR5A 2YN4A 2AG0A 1YIDA 1P8AA 3LOQA 3STWA 4PN3A 5JNLA 1SA0A 2JAXA 4ES6A 3E3OA 2HZBA 1Z63A 2HGZA 4JJEA 3FHLA 3MAGA 2MJLA 5DEOA 2ZQZA 3I01A 1SUPA 3I09A 1L6RA 1E2LA 2Y1EA 4MLZA 4WKPA 4KIJA 3WHIA 3VH2A 4TZ6A 1E9FA 4ML3A 3SQWA 4DY6A 3UT5A 3ZV5A 2HFJA 3QE4A 4AY6A 1EH5A 1GVHA 2V8OA 4XGQA 4CBVA 3B89A 1ZMBA 4L85A 3WLOA 1J5EB 3VNUA 1GOT