2BELA

Structure of human 11-beta-hydroxysteroid dehydrogenase in complex with nadp and carbenoxolone
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
243
structure length
243
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The High Resolution Structures of Human, Murine and Guinea Pig 11-Beta-Hydroxysteroid Dehydrogenase Type 1 Reveal Critical Differences in Active Site Architecture
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords CORTICOSTEROID 11-BETA-DEHYDROGENASE ISOZYME 1
total genus 91
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2004-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2belA00
1PR3A 3B1KA 4XB1A 1LUAA 4J0FA 3OEWA 1W0CA 5G0VA 1P74A 5AXCA 1Q7CA 3KYBA 3RSHA 3ST7A 5JC8A 2FPPA 2P4QA 2JAHA 2ZCVA 3DZGA 2HQ1A 2IEDA 3DBHA 2HMTA 3ASUA 1Y5RA 2EP5A 4TVOA 1Q0LA 2YV3A 2ZYDA 1V3TA 3ETGA 5IDWA 3QJ5A 4Z9FA 3A06A 2EKQA 3DZHA 1YBAA 2O3JA 1R15A 3ZWVA 2C54A 4D3DA 5FFFA 4BMVA 2DC1A 1B8UA 4MDHA 2ZTLA 2J5KA 1Q7BA 3IP3A 4D3FA 1H6DA 3NDIA 4JK3A 5DOZA 1GZ3A 3ROKA 3V5NA 4OO3A 1U3UA 2ZYAA 2G82A 2VHZA 4GGOA 1ENPA 1DOHA 1UZLA 1VSVA 2Z95A 4MVJE 3EVNA 4NFSA 4Y6PA 1YJQA 4I9NA 4O6VA 5JYDA 3C7CB 1QORA 3FNGA 5IG2A 4TMFA 4NU5A 5F21A 5DCYA 2GLXA 3KYDA 1JA9A 3FPCA 5GY7A 3NDRA 5HA5A 1B2LA 5TLSA 1YVEI 2HJRA 2YFHA 2CSUA 4IJKA 4E21A 2HMVA 3AI1A 1SBYA 1R0KA 3LVFO 2CF5A 4MIOA 3AY6A 1U4OA 4W82A 2ZK7A 1P44A 4XGKA 3LLVA 1E7QA 3GZ4A 3W8FA 3JSAA 2WEKA 1EVJA 1ULSA 1T24A 4AG3A 4I5EA 1W8DA 3B1JA 1HKUA 3PDUA 3UCXA 4ZGWA 2B5WA 2Q1WA 2I66A 1MGOA 5KVQA 4FCCA 1C14A 4EJ6A 5LCXA 4RLHA 4XDZA 1DAPA 1U5AA 3C1TA 2EF1A 3OMLA 4BNYA 1VL0A 2NWQA 2NACA 4J1TA 1ONNA 1YOVB 5A3VA 4I5DA 3DO5A 4WE3A 3HQ4O 3L9XA 3FBGA 4B3JA 5JMPA 1UXKA 4GMGA 3BA1A 1T2AA 5ES3A 1V35A 2BFPA 1QYWA 1FMCA 5IN4A 1E6WA 3NV9A 4IY1A 1KBZA 1QYCA 4NI5A 4LVUA 1DPGA 2NADA 5AOVA 3S1LA 1O0SA 1DSSG 3LF2A 1HDXA 1PGQA 1UAYA 1NQAO 1BGVA 3ABIA 4KOAA 4YVFA 2EEZA 1Z82A 3KYCB 4M55A 5JCJA 1ZJZA 2IXBA 4J16A 2Q1SA 1Y8QA 1A9YA 3B70A 1EUDA 2QYTA 4UUOA 4Z9XA 1Y9AA 4QO8A 3I9KA 4G2NA 4MVJI 3VAZA 2YJZA 2Y1CA 1P1KA 2DAPA 2YDXA 4U6SA 1ZW1A 4CM3A 5U4QA 2PA3A 4IDBA 2Q2QA 1WMBA 2V6FA 3DZFA 3MJCA 1ZXBA 4LK3A 4W6ZA 4IS3A 1U7TA 3EHEA 1VJTA 3SBOA 3JQEA 3V1YA 2OOSA 1ENYA 5KJ6A 1PJSA 1DHRA 4E5PA 2PD6A 3FRJA 3R6DA 2QRJA 1LC3A 1LDMA 1WPQA 5L4NA 3V2UA 1TVEA 3DBLA 2X1HA 1XLTA 2O3TA 3WYCA 3S2EA 3L0DA 4HKTA 1TA4A 4AJLA 2OORA 3H3FA 1NQ5A 2GD1O 2JD1A 3L6EA 3AU8A 3LT2A 4Q3CA 3IC5A 4ZQHA 4WEOA 1G0NA 4XYEA 4CM8B 1Y5MA 1W4ZA 5C7OO 1H9BA 4E6PA 4W7HA 4BS9A 5CDUA 3OIFA 3PPIA 3TZCA 1HDCA 1NX6A 1XDWA 3TN7A 4FFOA 5ER9A 1DBVO 4L76A 5EQFA 2W98A 1QR6A 3PYLA 2I3AA 4H3VA 4GLLA 5T5QA 4U5QA 1N5DA 2PWZA 4BO0A 3ROQA 4FBGA 1HZZA 4TRRA 3TL3A 2NVUB 2IDZA 2HRBA 4YACA 3WS7A 4W9NA 5TJ9A 6LDHA 2PD4A 3ONFA 4MKRA 4UREA 3DL2A 1QYXA 3GRPA 4LVCA 5L9AA 4UUNA 3QVWA 5T57A 4XZ3A 2ZB3A 3CEAA 4WOKA 1PL8A 2H9IA 4J9UE 3ROPA 2NU8A 3ENNA 5IFLA 4CUZA 5L7YA 1ISMA 4BB5A 4HFNA 3DZJA 2B35A 2JHGA 3HDHA 3IOYA 3BMOB 2NLOA 1C0IA 3KTDA 4BNJA 3ITKA 4TWRA 5MDHA 1IULA 1KY5A 3K2BA 3CH6A 4J4BA 4CMHA 1AN9A 3TWOA 4XGNA 4I8XA 1E7YA 3RUHA 1GL3A 1ZEMA 4BNLA 2FY8A 1DLJA 2G0TA 3AW9A 2ZIZA 1GD1O 3E6AA 2GSDA 2VTEA 2VT2A 1U8FO 1LTHR 4UVHA 2SCUA 3GAZA 1NNUA 3ZU4A 4CMBA 2P4HX 3PQDA 1PJ4A 2FPIA 1SMKA 3OH8A 1U5CA 1UZMA 2FWMX 4LISA 4N18A 4CL8A 2JKVA 5JBIA 2UUOA 3X2FA 5L53A 1FDTA 1HSOA 5F1KA 3WIEA 4LSMA 2GZ1A 1K0UA 2O48X 1V8BA 1U3VA 2VZ0A 4RVUA 1O8CA 4AJJA 3JQGB 2X8LA 5TT1A 2E6UX 4CMGA 5IAAA 2BI8A 4E0BA 2D0IA 4L4RA 3EZLA 1EBFA 4CM9D 1YKFA 5A9SB 4CMIA 1UDAA 3ZI0A 4INAA 5JDIA 3OM9A 4JNKA 2O3UA 5K6AC 1PJTA 2Y1GA 3MZ0A 3UGKA 3VKVA 3ZWWA 5I7VA 1WVGA 1AXGA 1E3JA 1B14A 1Z7BA 3JYLA 1H9AA 2EJVA 1SNYA 4YDRA 3VOSA 2E4AA 2B83A 2A94A 2D5AA 3ANNA 4B8ZA 1WNTA 4CM1A 3VPFA 1M6WA 3OIDA 3CZMA 2GPTA 2UDPA 3KETA 4FR5A 1VJ1A 4FJ0A 4IZIA 4AFNA 2GF2A 3WJ7A 4BIIA 4TQGA 2Q46A 4Z3KA 3I6IA 1VPDA 5A9SA 3RASA 3K9QO 3DTYA 5C7IO 3NT5A 1UR5A 2ZB8A 1UP4A 1BXGA 4GX0A 3RUIA 4AJIA 3DQPA 3E9QA 1KERA 1BW9B 2CF6A 3ZWCA 1VC2A 3LYLA 1B8VA 2O7QA 3EGOA 1DO8A 3PLRA 1F12A 3MJSA 1RM5A 5KJCA 1LSUA 3VPHA 2RHCA 4OJNA 1UJMA 2PY6A 1L7EA 1X7HA 5JSFA 1DXYA 4FB5A 1Q0HA 4HP8A 5ER6A 4XIJA 1EUCA 2Y1DA 3HJAA 1MXHA 3LLSA 1PL7A 2B4RO 3QP9A 2VZ8A 4AJNA 1BVRA 1NQTA 3M2TA 1CWUA 1YL7A 4K6FA 1UDBA 4J6FA 4XJSA 2HKIA 5JDCC 1GR0A 3WIDA 2BI7A 4CLOB 5A06A 4EW6A 2FSSA 1HTBA 2XF8A 1PJ3A 1DC6A 4NBWA 1LQTA 1VL6A 3M6IA 3FWNA 1A71A 3L77A 5CAEA 2J3HA 5CG2A 1D1TA 3DAPA 1E1KA 4TVBA 1C0LA 4DRYA 1U2DA 1OFGA 4GWKA 1IHYA 1C1DA 3H9EO 3G0OA 3AY3A 1NFFA 1T4BA 3GUYA 3KLPX 4EZBA 1ADFA 1N7HA 2ZQZA 3AOEA 2D4AA 3PIIA 5H82A 4IGEA 2HCTA 3H2ZA 1EUZA 2CZCA 3D1LA 1YWGO 4I9HA 5L95A 1PWXA 5A02A 4A26A 1UH5A 2BH9A 3AFNA 3M1LA 3A4VA 1N9GB 4PLCA 3ZW8A 5JNLA 3QRWA 3WOHA 5HTOA 1PL6A 5K0ZA 5G4LA 1T2DA 3WFJA 5KVVA 1V6AA 1R66A 2I65A 4UEKA 4WNIA 4XRGA 5L51A 2ZATA 2PR2A 1R4NB 2A9FA 3FBTA 4IDAA 2JAPA 1ML3A 1GPDG 1JVSA 3W4JA 4R1TA 2B0JA 1VKNA 2OFPA 2QIOA 5H83A 5IDXA 1IZ9A 3SX2A 1ISHA 2VYNA 1GYPA 4G5HA 5JE8A 2CVZA 2YW9A 3U9LA 2NTVA 2JCXA 3U09A 2C59A 4BGIA 5ILOA 3N58A 3KB6A 3EW7A 3NYWA 3JQGA 4DIOA 2X58A 4TRMA 4L4SA 1H6BA 1XR3A 4F45A 4DYDA 3PJEA 3RD5A 2QG4A 3DBLB 1MLDA 1YOVA 2BFOA 5L4SA 1S7CA 4LN1A 1NPYA 3ZW9A 2YV2A 4EUEA 1SCUA 3AUSA 5L7TA 4EITA 1PJ2A 1Y6JA 3WGTA 4LGVA 4UVEA 1MXFA 2WM3A 7MDHA 2PGJA 4NBTA 3F6YA 3Q11A 5GMOA 3WMWA 1JKFA 4H15A 1QSGA 3HFSA 3FI9A 3K30A 4BB6A 1NHGA 3DZKA 4JQCA 3DMTC 3D3WB 3UHAA 3GR6A 2PTGA 3BMCA 1JAYA 2OHXA 3E9MA 2WD8A 3OICA 1U1IA 2VQ3A 1A9ZA 3D4NA 4JP3A 4CLDA 2I67A 4J2OA 5EL0A 4D45A 3O4RA 3W4KA 2FPGA 4DC1A 2HK9A 2VYND 2AQIA 2P5UA 5EINA 3RFTA 1GV0A 3ZNPA 3C1AA 1NVGA 2XPCA 1R0SA 3BTVA 4AJ2A 1NQOA 1ISIA 1KVUA 2WYVA 2X9VA 3PHIA 4J1QA 5A4DA 4RJTA 1DJNA 1FDWA 3K5PA 3BIOA 3B1FA 3F1LA 2DTDA 4LCEA 4PLFA 4PG4A 3IP1A 3SEFA 3BHIA 4YJHB 4Q3AA 2IYPA 4UEOA 4E5NA 2DUUA 2V7PA 1MC5A 2V6MA 1BDBA 1P3DA 2AEMA 2NVUA 2WSBA 3RFXA 4QXMA 1M76A 4EDFA 1MFPA 4P4GA 1Q2XA 1DDOA 1KEPA 5AXAA 2I99A 3PHGA 4L4XA 4PCVA 3AM4A 4QFCA 1HSZA 3SJUA 1XU9A 3HFGA 4RDHA 3D3WA 3LF1A 1I36A 1ZSVA 1NYTA 3OQ6A 4QO7A 3U49A 1NVTA 5JYEA 1CF2O 3L6OO 1SAYA 1YE3A 3U5TA 3GGGA 1Q0QA 4QQRA 3AFMA 2JFHA 1HRDA 3A14A 2O4CA 2P9EA 1PGOA 3CMCO 4KWIA 4AJPA 4W99A 4D44A 3GPIA 3PRJA 3SLKA 2JHFA 4CV3A 1E6EA 4JN6B 3GVCA 3R3JA 4NIMA 3JQ8A 4EJMA 2GR9A 1T4DA 4NZ9A 5JW6A 1YO6A 2FHSA 3KLMX 1P9LA 4KQWA 4AJHA 2Y1EA 4XYGA 2ILTA 5I9MA 5AQ1A 2C5AA 2PZLA 3RU9A 4E30A 4OSOA 4YAKA 5ICMA 2EWMA 2NU9A 4PN3A 3GHYA 1JKJA 4N5MA 1HL3A 4BGEA 2NV6A 4II3A 3D4PA 3Q9UA 1LRLA 3JQ6A 4PLVA 1N7GA 5TT0A 2XXBA 4ZVVA 4I5FA 3NT2A 4N54A 4NH4A 1VE9A 5COAA 5CDSA 3ETEA 1P1FA 3AOEC 2OO5A 2EGHA 5B4VA 2FOIA 5KTKA 1A7AA 1E5QA 4GKVA 4IDEA 5TX7A 4CM7A 3VKUA 2YY7A 1B16A 2ZJ1A 2J5QA 4ZA2A 4Q3NA 5A5FA 4HFMA 4QEDA 4IJVA 3GG9A 1ZFNA 5T64A 3GNTA 3LDHA 3FR8A 3KSDO 3LK7A 1EEHA 4YAIA 1KVRA 1FXSA 4DQXA 4CMJA 4J9VA 2J3JA 3KXDA 2GZ3A 2ZTMA 3S2GA 1XU7A 3RC9A 3VPGA 4OH1A 1BHSA 2DPHA 1WP4A 4GLOA 3CMMA 2H5LA 4NJMB 4M8SA 2BHLA 1DEHA 3K2EA 4IDFA 4PRKA 1HDYA 4P4LA 3RUEA 5AXBA 4M86A 1E1LA 2W2LA 3E5MA 3UICA 3WGGA 1ZK3A 1ZO8A 1DLIA 3G17A 3H3JA 1B26A 1ZSYA 5KWEA 2IYOA 2EV9A 1MFZA 1QV6A 2FR1A 1E7WA 3RUCA 3F5QA 3KUXA 2Q4EA 4FC6A 5JC1A 3I9JA 3OSUA 5T8KC 1ZSNA 1CERA 1H2BA 4XIYA 2J3IA 4IDDA 1A72A 1C0KA 1AGNA 1DC3A 2I3GA 3DXFA 4CMCA 4EI2A 1JN0A 3QE3A 3H65A 3WLEA 4DXHA 3E48A 4CLRB 1RYEA 4IBOA 4IINA 4BHTA 1N1EA 1YRLA 3ZHZA 3EYWA 1X13A 3GG2A 1NASA 1NPTO 3GNSA 2JFGA 4BNHA 2X5OA 2PH3A 5BSGA 4GSKA 4LW8A 1EVIA 1PWZA 1ZXLA 2BF7A 3NAQA 4BV9A 2YDYA 2B37A 1FJHA 3VC7A 3ZU3A 4RLSA 1O9BA 3OHSX 1LC0A 3VZPA 3ADOA 3PK0A 4L8VA 1XQ1A 3CKYA 3H5AA 4DWVA 4PG8A 4E2XA 4KUGA 3LU1A 1XYGA 3NX4A 3ZDFA 3D5TA 1I0ZA 3FD8A 5FEUA 1I5RA 1XGKA 2GN8A 1ZMOA 2X9GA 4EBFA 4FS3A 4FFRA 2LDXA 2AQHA 1R12A 3FN4A 3L9WA 1EFLA 4NJOA 1V3UA 5JDIC 3DOCA 3OJFA 3ICPA 1FDVA 1VM6A 2DBVO 3WQSB 3UH1A 3BHJA 1UXJA 3L6DA 4CMEC 2C07A 2P68A 4FSHA 2GYYA 1IYZA 2P91A 5HWSA 3IUSA 4L9RA 2ZJ0A 1TEHA 1DFGA 3Q1LA 1NXQA 3H9GA 3RUDA 4UAGA 4D7AA 4RQUA 1GQYA 2VRCA 1LSOA 3HADA 1I30A 3EUWA 4UULA 3C1OA 3NGLA 1QV7A 1HYHA 1JTVA 4BOYA 1GDHA 1WWKA 4ND4A 2X5KO 1DIBA 5CFZA 1HE2A 2E49A 1HWYA 3F1KA 3K31A 4A27A 1X15A 4BVAA 1G0OA 1U4SA 4D42A 3WGHA 4GBJA 4RPLA 2J5RA 5ICSA 1PQWA 1HYGA 1ADCA 1PZHA 3JQAA 4J2HA 4K6CA 3DMTA 4Z9YA 3WBFA 2VTDA 3JQ7B 4OGWA 4Y67A 3QWFA 2NVBA 3GN2A 3OFSA 2BLLA 3KO8A 3KVOA 4EEZA 4LMRA 5IXSA 4WJZA 4P38A 4Q3DA 4BO6A 2VHXA 2YUTA 2VT3A 3GT0A 3I52A 4MKZA 1VSUA 1B3BA 4JIGA 4WKGA 4ZRNA 4BNZA 4WPGA 1HDGO 3EAGA 4IXTA 1J0XO 1QYDA 5EERA 3DBHB 1TT5A 4GI2A 3MWEB 1BMDA 4S1VA 3AUAA 2X0RA 4R9SA 1V0JA 4XA8A 2Y66A 3OBBA 3S8MA 3U62A 2VYVD 1R4NA 3MJVA 1E7MA 4MKXA 3OF2A 3SXPA 4BKRA 3JD1A 3UKOA 3IJRA 3GGPA 4UEJA 4OKIA 4CM6A 3WSVA 4IZHA 3AM5A 5TS3A 3UXYA 1Z73A 4XJTA 3WGZA 1KC3A 3L4BA 4CV2A 4RV9A 4BO3A 1UXIA 3JD4A 5J23A 2FRDA 5G2OA 1A4IA 4E13A 2UYYA 1CDOA 2XXJA 2E48A 4AJ1A 4IQ0A 4YJFB 4RF5A 2JL1A 4IUYA 4M89A 4MVJP 4IMPA 4RPHA 2O50A 5I9NA 5IZCC 1E5LA 3LZ6A 1I33A 3ZCXA 1H0KA 1KVQA 1XIVA 5EJ2A 2P9GA 1OC2A 1MC4A 3UF0A 5BQFA 1YS4A 3DR3A 1I3KA 2X0NA 4TRJA 4I08A 4J43A 2WD7A 4R3NA 4MVJA 1NFRA 2LDBA 3F47A 4E33A 5T8KA 5IZ4A 1Z74A 2FMUA 5CPFA 4ZU3A 5U1PA 5JAZA 5KJFA 4B7CA 3Q6IA 4RF2A 1XHLA 4YJFA 4JXKA 1PGJA 1D1SA 1LLUA 2Q2WA 1GADO 2ZQYA 4J7XA 4WOJA 4YPOA 2A92A 4B3HA 4DMMA 3E8XA 4ALIA 1D3AA 2D3TA 4FD3A 4EGFA 3IDSA 5DN9A 1LXCA 1ZBQA 1BRMA 1LNQA 4WASA 3W8DA 4YJHA 3ULKA 3WTBA 3DFUA 3ICCA 4Q3EA 2AG5A 3CUKA 2C82A 2DT5A 3PVZA 5DP1A 5F1OA 3UAGA 4IDCA 1WW8A 1UXHA 4WCFC 2Q49A 3I9MA 4WCFA 4J90A 1R4MA 1SEVA 4UVGA 5FWNA 4FGSA 3P2YA 4BGUA 4CM5A 1GUFA 1Y1PA 2W2KA 1BWSA 1DIGA 4IQGA 4WLOA 1O94A 3IL2A 1XG5A 1HZJA 3H9JA 4RF4A 4CL3A 1HLDA 2Y93A 4NBVA 2XOXA 3SVTA 1KS9A 1GQQA 1JW9B 3DOOA 1KETA 1HDOA 5G0SA 1NVMB 1HYEA 4TKMA 3TNLA 3HWRA 1B3RA 2Y0CA 4PLGA 4AJ4A 3WWYA 3GVHA 5ITVA 3GEGA 2NTNA 3FR7A 3K73O 4WLNA 1JLLA 5MGBA 2GUGA 3TPCA 4OYRA 4RGBA 1DHTA 4BNVA 1CEQA 3LQFA 3C7AA 4L0QA 4G65A 3ZU2A 4CLEA 3I9NA 3F46A 5ADHA 1VKOA 1DIHA 3I5MA 2X0JA 4RPKA 3WDSA 2GN6A 1LEHA 3PJGA 4Y9DA 3JQ7A 2CNBA 1YB1A 2DFVA 4AL4A 3IKTA 5BNTA 3FCOA 8LDHA 3NTQA 3EC7A 3ONEA 1DRUA 1LSJA 4PZCA 4JBGA 4R51A 4WLVA 3C7DB 3D0OA 4U8GA 2DQ4A 4FDAA 4CLRA 1N1GA 4DYVA 3ZHXA 1LQUA 1MB4A 1VLLA 1EE9A 1TT7A 2B4TO 4O59O 3K6JA 4XD2A 5FI5A 3G79A 4GGPA 1DAOA 4RL6A 2EW2A 5ENVA 2P9CA 2ZTUA 3ZN2A 4H16A 1QXSA 2GCGA 3W1VA 5CEFA 4R1NA 1QYVA 2HLPA 4NBRA 4ONEA 1NP3A 1KY4A 1WZEA 2DLDA 3C3XA 1B0AA 1O6ZA 4W4TA 1P0CA 1E3EA 1ISJA 4BNGA 3DB2A 2HDHA 3FHLA 4BNXA 3GY0A 4M49A 4O63O 3E9NA 3OP4A 2VNAA 1Z75A 1EFKA 3HE3A 2IRWA 2PV7A 3PI7A 3RIHA 4O1MA 2EW8A 2H6EA 3IS3A 3GHHA 4A73A 1KYQA 5DBFA 5KKAA 4E5KA 1OMOA 1F8FA 2Q4BA 1U8XX 1PZFA 4E2YA 1YDWA 3KSUA 4DVJA 5JMWA 4O0LA 1YQGA 2ZKLA 2R00A 2R00C 5L3ZA 2AEFA 1KEVA 4J49A 4DLBA 5JCJD 2IZ0A 4B3IA 2YHIA 4PG7A 4PGFA 1KEWA 2YZ7A 1VI2A 2X22A 2NUAA 2R2GA 5TC4A 4ILKA 4F46A 1TLTA 1OC4A 4QFDA 5TSDA 3VHRA 2DVMA 4DUPA 4C7KA 2PK3A 1OOEA 2YHUA 4CM9A 2GO1A 3DEYX 1TI7A 3PP8A 5EQDA 1SO8A 4R69A 2FR0A 1LU9A 4ITUA 4OKNA 4JJGA 3PFFA 4WEQA 5JCXA 9LDTA 3C8MA 3H9UA 2W2LD 3GLQA 4E5MA 5B4TA 1J49A 1EVZA 3AY7A 3B20A 5JO9A 4FC7A 4J3FA 1PU2A 3GZNB 3QWHA 4PVCA 3I3OA 2VOJA 2BD0A 2BFAA 3WNQA 2WE7A 3DONA 3PGXA 5IXYA 5JY1A 2HAEA 3ON5A 2RH8A 1SOWA 1IL0A 1S6YA 4B4UA 4PLHA 2RAFA 4KTVE 1L1FA 3WBBA 1SOVA 3UFXA 3RUFA 1X1TA 3GPDG 2PFGA 4EJ0A 3WGIA 3GF4A 2W4QA 1MA0A 5BNFA 4B79A 2DBZA 4FFPA 2V6GA 1X14A 3INTA 1BSVA 1MP0A 2CVQA 2WYUA 3R1IA 3GFGA 1I24A 4R01A 4YAJA 2HMWA 2D8AA 1UP6A 3HHPA 3KYCA 4YJGA 4R1UA 3D5QA 5CP8A 4MO2A 4CUJA 2D5CA 3RVDA 1VL8A 4TSKA 1GCUA 3HB5X 1J4AA 1JWAB 3PEFA 4ALNA 2O3SA 4YAEA 3BTOA 1GYRA 1A27A 1GCOA 4MJLA 2C2YA 4Y6SA 5IZCA 4URFA 4BKQA 4CQMB 1K89A 3RI3A 1U3TA 3WJAA 1E7SA 1GUYA 4JP2A 2JFFA 4N7RA 1T1RA 5KJEA 2VCYA 3KRTA 4R54A 4PIVA 2FN7A 3MJ4A 3AK4A 4HWKA 4QTZA 4DIFA 2OXIA 4BQPA 1P1HA 4XX0A 3PHHA 1NR7A 3ZH2A 3I4FA 1MV8A 4NK4A 1QKIA 5L40A 1LRJA 3U4IA 4JCOA 5BSEA 3ZWMA 1XEAA 1ZZEA 2PKQO 3PHLA 4XQCA 1P33A 1ORRA 3ZWOA 3WG9A 4CMEA 4NMHA 2DBRA 1OZAA 4RDIA 1WDMA 4CV0A 2GDZA 4NDNE 4YT2A 3GA0A 1HE4A 3GQVA 3KYDB 1GZ6A 3D3EA 5DF1A 3WYEA 4B4OA 4XWYA 4D79A 3QLJA 4O5OA 2YYYA 1PQPA 4Q9NA 5CHEA 3F5SA 4ZD6A 4HNGA 2B36A 3VH3A 2B5VA 1WZIA 3AM3A 4PLTA 3O03A 3TQHA 1IHXA 4MVJG 4A7PA 2NQ8A 4RCVA 4BO1A 5L4LA 5C3MA 5DULA 5DT9A 2OZPA 2CFCA 5EIOA 1EQ2A 5GZ6A 4BKPA 1NAIA 4IGFA 4UVDA 2I76A 2O3RA 2PD3A 3RWBA 4GX2A 3ZWBA 1EBUA 2NNLD 1OAAA 3EZYA 3Q3CA 1UXGA 5CPBA 3OQBA 4F6LA 4M1QA 1K3TA 1E3WB 3OA0A 1E92A 5IN5A 5I7FA 5TNXA 3UOGA 3OQ1A 4DLLA 1K6JA 3GEMA 5L7WA 2Y1FA 4CLXA 2H63A 4HADA 4KQXA 3NGXA 1UDCA 3GVXA 4OOFA 9LDBA 2PGLA 2Y67A 1Z7EA 1IOLA 2CD9A 2JJYA 3PXXA 1QMGA 4FFNA 3H5RA 1TXGA 3E5RA 4CM4A 2HK7A 1ISFA 2J3KA 1LLQA 1KOLA 2GRAA 3JQDA 5KIAA 3T7CA 3H9QA 3JQ8B 3VVCA 5F3RA 4TZKA 4YJDA 4J91A 1ZK2A 5C7LO 4B7XA 4KZPA 2AE1A 2BGMA 2EIHA 3INGA 2Y0DA 1QG6A 2ZB7A 3TJRA 3ZV6A 1WDLA 3OJ0A 4D43A 2RHRA 3SC4A 2D59A 3UCEA 4DGSA 2DBQA 3NKLA 4DPLA 3WSWA 3DBRB 4NU6A 1PJLA 4BNIA 1Q1NA 5AVOA 1NM5A 3VVBA 4RVSA 2B69A 4YWJA 1R6DA 4XQ9A 4BGVA 3I9OA 1GEEA 1B15A 4N5NA 3PZBA 4BL5A 4PVDA 4HFRA 1V9LA 2W90A 2HO5A 4QX6A 3HDJA 3C85A 1U28A 3MTGA 2X23A 3PZRA 3I6QA 3HN2A 4MP6A 3FPLA 3OJOA 5A3JA 3OEYA 4B8WA 4FIZA 2VUSA 3TOXA 3IIEA 4OM8A 1RPNA 4MVJM 4U0KA 5TGDA 5EN4A 4OXNA 1PQUA 2UUPA 1LDBA 1W73A 4BQRA 3CE6A 5ENDA 5DNAA 5I9LA 5JAMA 1EZ4A 2JCYA 4IIUA 4DBVO 4ND3A 2CDAA 1U7HA 4L73A 5U9CA 3V1TC 1YQDA 2F1KA 3LC2O 7ADHA 1ARZA 4KWHA 1P45A 3H4VA 5TIIA 3RAJA 4DREA 1NPDA 3NRCA 4F3YA 1I3NA 4NFHA 4FFMA 2OP1A 4RO0A 3OJLA 4R16A 1DIAA 2Q45A 3NDJA 4XDYA 3WB9A 3DHNA 3QWIA 1T1SA 3JTMA 3PGJA 5A1TA 3JD3A 3F4BA 2O7SA 1Y8RA 3KM0A 1DIRA 5ITWA 4XKJA 3CPSA 3GAFA 4A10A 1AXEA 2PZKA 1SB9A 2DFDA 4ALLA 3RQSA 3A1NA 3DFZA 4OQYA 1EDOA 4E2ZA 3DZBA 2BGKA 3MTJA 4BO2A 2PZMA 2AHRA 1N8KA 3HZZA 3R0IA 4YAGA 1HLPA 1RM4A 3AUUA 3JQCA 1LA2A 3PWKA 2Q1TA 3TRIA 1SZJG 3WFIA 5TQVA 2E37A 2J6IA 1PGNA 2BKAA 4PRLA 1E3WA 1I2ZA 1O5IA 4CQLB 2RH4A 3ZNNA 4P22A 4ZQEA 5JS6A 2OMEA 1PTJA 1RWBA 1YB4A 3JYPA 4WUVA 3P5SA 5KVCA 2WE8A 4R4JA 1B8PA 3ZV4A 1JKIA 3BZUA 4GX5A 2HU2A 3LC1O 2PKRA 1YL5A 2Y05A 3GOHA 4KTTE 4CMKA 4C4OA 3UUWA 3WXBA 3UCFA 4DC0A 3ZHYA 4Q3BA 1ISGA 4XYLA 3VZRA 5DDIP 4RPJA 4PZEA 5TRTA 3DDNA 3IAHA 1N9GA 4TKLA 4BNWA 2RBEA 3VTZA 2FZEA 4GAEA 3WGYA 4YR9A 5KNLA 1YBMA 5FF9A 4RZHA 4D3SA 2GZ2A 4L75A 4U7WA 4KMSA 1CQJA 2DUWA 4Z0PA 4XR9A 3WLFA 4JBIA 1LRKA 4J4HA 1FDSA 1ONPA 1YGYA 1LSSA 2DM6A 3JD2A 1M75A 2C0CA 4Z0TA 3KOUA 2EXXA 2BRUA 1IPFA 4OXYA 2X7HA 4Y8VA 3B6ZA 3TFOA 2UVDA 3M2PA 3PYXA 3H5NA 3OIGA 1ENOA 1M6HA 1IB6A 4WCDA 3VDQA 3D7LA 3BAZA 2VWQA 3VPXA 1DC5A 3PTZA 4P4NA 5G0UA 4JBHA 4QT0A 4Z0HO 2W2KB 1VRWA 2IEBA 2IE0A 3WNVA 3ETDA 4K1LA 2BGLA 3NT4A 1EMDA 1K5HA 1P0FA 1DFIA 1M66A 2O3QA 5F5NA 5IJZA 3DBVO 5T67A 4J4TA 2C29D 1KVTA 2G1UA 4HBGA 3HDYA 3KZVA 1YXMA 3O38A 1Y9EA 2VOEA 3QSGA 5THQA 1CETA 2YQ4A 3D4OA 3W4IA 2OBYA 3OETA 4BO8A 1UZNA 1E6UA 4EUFA 1J5PA 5KCZA 1Y8RB 3TOZA 4GWGA 1U9JA 4GMFA 3U4HA 3DHEA 4E5YA 3RJ9A 1DJQA 4PLWA 3VH2A 1BW9A 3LT0A 4ALJA 2WJPA 3TZQA 2CUKA 1QP8A 4XQEA 4Z3DA 3H7AA 3DC2A 1KC1A 5DCUA 3RC2A 5BNIA 3FSRA 3KEQA 3VH4A 4PLZA 3GDOA 3Q2KA 1GPJA 1ZEJA 3E18A 1O95A 4RPGA 3BTSA 3F3SA 4IQ8A 2HSDA 4UVIA 5DP2A 5HS4A 5COBA 2WYWA 5IDYA 1RM0A 2EGGA 2AMFA 3ZHBA 3CSDA 3UW3A 2PH5A 2QZZA 5KOIA 4A0SA 4NQZA 3WTCA 2Z1NA 1AE1A 2X0IA 1LI4A 3TFQA 5I7EA 1PEDA 3FNHA 4ZICA 3V2HA 3P2OA 3Q2IA 3L4SO 1EK6A 5TJHA 3HB4X 4UUPA 3ANLA 3AOGA 3BMNB 4NPCA 4XB2A 4R9RA 3QIVA 4CLOA 5KVSA 1BXGB 3JQAD 5KJ1A 2VN8A 5JPIA 1DRVA 4YBZA 5BR7A 4OHUA 3BMQB 1CIVA 4KUHA 3PYMA 2YV1A 1H2HA 2JCVA 3GDFA 3SC6A 5LDHA 4J7UA 1PJQA 4ND1A 1M67A 3KSZO 5K6AA 1E7RA 2EP7A 1P1IA 3MWDB 4RVGA 4HXYA 1BG6A 1ENZA 2Y0EA 1QLJA 1PJCA 3WGQA 4CQMD 1I3MA 3HNPA 1KEUA 1LBEA 2HJSA 4LMPA 2QYSA 4GQAA 1I3LA 2Z5LA 5COQA 3VZQA 4CM4B 5G4KA 3PJFA 4B7UA 5AYVA 2PZJA 3PQEA 4PFJA 1HXHA 2D1YA 3MOIA 4WK6A 3DWFA 2G5CA 1SB8A 5A5EA 4XQGA 3TSCA 2ET6A 1O89A 3SJ7A 3NTRA 3JQAB 4NG5A 4R5HA 2BELA 1NWHA 4MVJF 5B12A 1XSEA 4OAQA 4W7IA 1ZKMA 3T7EA 1ZMTA 2DU8A 5HM8A 1GFSA 4CODB 4DBZA 4XYBA 4NNJA 4QECA 4WGGA 3RFVA 3RBVA 1E1MA 1F06A 3INRA 1Y81A 1F14A 3JYQA 3CTMA 2Q1UA 3X2EA 3GMSA 4BNFA 5EMHA 4ALMA 2DKNA 2O23A 1A5ZA 5JDCA 3GRKA 3EK2A 4FFLA 1WDKA 3P7MA 4BMSA 4DMLA 3A28A 2FZWA 2H1SA 3IQDB 3NTOA 2E82A 3QVTA 4YEDA 3W8EA 3I83A 1N92A 3EVTA 1BDMA 1NAHA 3DMYA 3GEDA 3RC1A 2G17A 1PR9A 4DIBA 5A05A 2Y68A 4CQMA 5CDTA 1I2BA 3HG7A 1SPXA 1YDEA 3KEOA 3E03A 4DL9A 4NK5A 1HDZA 5CEJA 2Q2VA 1F0YA 2X9NA 4I9UA 1MG0A 4IJUA 3CXRA 3UN1A 3LT4A 4GH5A 1EVYA 4YJGB 3RJ5A 3S2FA 5HBRA 2DTXA 1T2CA 2XAAA 4ZQGA 4R41A 1HT0A 1IE3A 4A03A 2C7GA 1UAGA 3RCBA 3ZWYA 5JXWA 1VJ0A 1JU9A 2IODA 2O2YA 5A04A 2BMAA 4PZDA 4RVHA 2Q50A 3WQQA 1D7OA 2Y99A 3GUCA 3U4DA 4MINA 2UV8A 1ZJYA 2J8ZA 3RKRA 4ESOA 3DZIA 4I1IA 3QQPA 3PJDA 4PG5A 1PZEA 1P1RA 1XKQA 2FSVA 3D64A 2WDZA 3JQFC 4KP7A 4D41A 3JQFA 4E4YA 2YHIB 3LT1A 1PS9A 4D0RA 1KVSA 1BTOA 4BNKA 1E1NA 3BMNA 4D0SA 2AQ8A 4MP3A 4Y6RA 4R1SA 1BVUA 3RC7A 4YRAA 1W6UA 3V1UA 5IDQA 5JY6A 3RU7A 1LDGA 3AI2A 2QQ5A 1LDEA 3QWAA 8ADHA 4K9DA 4NBUA 4YCAA 2I6TA 3AJRA 3JQ9A 1SC6A 1ZVMA 2NSDA 2TMDA 3JQ9C 4G81A 4GVLA 4ID9A 4IXWA 4JX8A 1I01A 3EMKA 1BXKA 1ADBA 4BNNA 5JAQA 1E77A 3PIDA 5JAIA 1DFHA 3O9ZA 3KHUA 1C1DB 4GKBA 5FI3A 1ID1A 3Q9NA 4PG6A 3UVEA 2VNSA 3BXXA 4DPKA 4EEXA 3G49A 4XYMA 4ZQFA 4ND5A 4AICA 1C0PA 3MJTA 4C7JA 3U3XA 4D46A 5B4UA 1EK5A 1GU7A 1FDUA 3O26A 4F6CA 1A7KA 3O8QA 2NVWA 4BKOA 4XCVA 2AXQA 3MJEA 2A4KA 1GY8A 2Q99A 2DPGA 4YT4A 4OOEA 3I23A 2VUUA 2IXAA 1UP7A 3VDRA 1GUZA 4X54A 5KKCA 1Y8QB 3HN7A 4RF3A 3ANMA 2C5EA 4U0JA 3STHA 4RORA 3H6KA 3W6ZA 5DZSA 3Q0EA 4MVJD 3NJ4A 4AJEA 1DC4A 1P1JA 3EDMA 4YQZA 3IJPA 4AJKA 1PS8A 3P19A 4TZTA 3GN1A 3ROMA 2NTJA 5T6BA 5DBIA 1ZIDA 3WGOA 2EG9A 4J0EA 5G4KB 1SEPA 1WLYA 2V65A 1UUFA 1YQXA 1U3WA 4H7PA 1NR1A 1PJBA 5EPOA 2HMUA 4JJFA 1HETA 2ZYGA 5HS6A 1K6XA 2JD0A 2FR8A 2QRLA 3AWDA 5EESA 3ONDA 3ADPA 3G3EA 1PIWA 2OP0A 3MOGA 1Y7TA 3DAGA 2OGUA 4YRDA 2POQX 4YT8A 2RCYA 5A03A 1T2EA 2JD2A 1Z6ZA 2AW5A 1HF3A 2G76A 1LLCA 3BMQA 3PLNA 4AVYA 4CMAA 1D8AA 2CY0A 4GSLA 3ZGYA 2GERA 2A35A 2VHYA 1X1EA 4M87A 1GEGA 3VPSA 2Y1OA 5I8ZA 1E3LA 2NM0A 4QSMA 1B7GO 1EE2A 3GGOA 3NUGA 4E3ZA 3E1KA 4IJWA 4OQZA 3VTFA 1C1XA 1JWBB 4FPXA 5DCWA 4CUKA 1V3VA 2QW8A 3W6UA 3GFBA 4YT5A 3FNEA 4OXKA 1RKXA 2EHDA 4XRRA 2IZZA 1Z45A 5K9ZA 2PKQP 4ZJUA 2VZ9A 1CYDA 3ZWNA 1GTMA 5CEEA 5CDYA 1T25A 1ADGA 2C2XA 4DPMA 1GAEO 6ADHA 4LSWA 4RVFA 5L45A 3MEQA 4JJIA 1G6KA 1T26A 3WWZA 2X5JO 3GMDA 1CRWG 3V2GA 5BSHA 2GASA 5TF4A 1FF9A 1X0XA 1XELA 4GPD1 4JGBA 3G1UA 4ZRMA 2P2SA 2BFMA 2B4QA 3CIFA 4W9NC 4DLAA 2HMSA 2OBNA 4UUMA 4GVXA 3I4CA 3WMXA 2AEJA 3BMOA 1JAXA 4WCFB 3QHAA 3KBOA 4GL4A 4OSPA 2Z1MA 1CQIA 2HRZA 3RBZA 2HK8A 4CQLA 1ZNQO 2EJWA 4MP8A 1I10A 3DAFA 3QWBA 4MOWA 5G0WA 4WECA 4QUKA 3KV3O 4J1NA 4E31A 4FJ2A 4BKUA 4DQUA 2IZ1A 3ASVA 4IDGA 4K28A 2WMDA 1YBVA 3CZRA 2ZTVA 4CV1A 5GZ1A 2VUTA 4NFYA 1JQBA 4IPTA 4ALKA 3R3SA 1ZK1A 4IMRA 4R3WA 5LC1A 4E32A 2QX7A 3JV7A 3OJEA 1YH3A 4AJOA 2VWHA 5HRUA 3HSKA 3L07A 3JYOA 4XGIA 4P8RA 3S55A 3I9LA 1D4FA 2W8ZA 4FGWA 3OA2A 3QW2A 4FN4A 1LJ8A 3QVSA 3HUDA 4HNHA 3DHYA 4KDEA 1ZK0A 3K96A 3QV1A 4FJ1A 3TZHA 1GYQA 1E0DA 4DQVA 1FK8A 1YL6A 4MVJH 4ZQBA 1NFQA 3F4LA 4NR0A 1DB3A 2RIRA 4CPDA 2FP4A 1H6AA 5JLAA 3SLGA 4PLYA 3ZWXA 4WNCA 1RM3A 4HFJA 3GNQA 3T4XA 4BMNA 2NU7A 3L4BC 4HX5A 3VZSA 1N2SA 1ONOA 2DTEA 2D2IA 1MG5A 4IM7A 3GVIA 1XA0A 4RVDA 3OECA 5IF3A 5JO0A 2ZCUA 1P77A 3ITDA 2ZB4A 1GV1A 2OL4A 4NJMA 1TB4A 3RROA 3ZZNA 1E3SA 4FOOA 1H94A 4CM8A 5BSFA 2QHXA 5F5LA 4ND2A 3I1JA 3COSA 1JVBA 3AUTA 3GC6A 1I32A 1HEUA 4R5MA 1OBFO 3HDQA 3H8VA 2O2SA 1AHIA 3AU9A 2O4UX 4CMIB 3RUAA 3QY9A 4RZIA 5I7SA 3PQFA 3ENKA 3GK3A 4OIMA 1L7DA 5A9RA 1TT5B 1XWFA 1X7GA 5F1PA 4R68A 3LSYA 4OL9A 3WX0A 3NJ8A 1PGPA 1PZGA 1X0VA 4E2WA 4LCJA 5ILGA 3FF4A 1HDRA 1XCBA 3QVOA 1LDNA 4ZHSA 1NTOA 3GH3A 2GNAA 1EDZA 2QZ9A 1GQ2A 2VRCD 3BMCB 4NHEA 1DRWA 5CDGA 3U0BA 3A9WA 2PGDA 2GGSA 3E82A 4RQTA 4BO4A 4MPDA 1I8TA 3ZU5A 1H6CA 1CJCA 5JFOA 3DOJA 4OMUA 3K92A 4LRTB 3ORFA 1M2WA 2GN4A 4S3MA 1PSDA 3BTUA 3K8ZA 1RJWA 3IMFA 1KIFA 1H5QA 4EUHA 4CLHA 2VWPA 5A9TA 3ZNQA 3WICA 1ULUA 4XEHA 4CR8A 2R6JA 4IS2A 5LDGA 1LLDA 3ZV5A 1A4UA 5CG1A 4A5OA 4YYZA 1YB5A 3PFWO 1U2GA 2VHVA 1MX3A 1ZUD1 1K2WA 1JDJA 4WLEA 4ZN6A 5AXDA 3BHMA 2WD7B 3GDGA 3PWZA 4DTIA 1ZK4A 2GN9A 4XR4A 3TF5A 4YQYA 1AHHA 4L74A 4KDFA 4YB8A 2OUIA 5H81A 4BNMA 4DA9A 4BO9A 4BNUA 3F9IA 1R4MB 2EKPA 4PLPA 2AA3A 4YRBA 3MCVA 3PDJA 1Q7GA 1F8GA 2AQKA 4IIVA 3TDKA 4U6QA 5DBGA 5G0TA 5GZ3A 2EERA 1P31A 3QA9A 4TRNA 2UAGA 3RBXA 4CR7A 2VYVA 3RKUA 1NHWA 4EYEA 2X86A 5I8WA 4II2A 1WAMA 3NEPX 3FWZA 4A2CA 1OI7A 4FW8A 3ZV3A 2PLAA 3EY4A 1R0LA 3M1AA 3G1TA 1LDYA 1T2FA 2AE2A 1YJ8A 1H93A 4BO5A 4FOSA 2PNFA 5B37A 1ZCJA 2CMDA 3LC7O 2CVOA 4BNTA 1F17A 5THKA 3JQBC 3TZ6A 1RYDA 4K26A 1E3IA 1MUUA 2TMGA 1HE3A 2YFQA 2HUNA 3JQBA 1QRRA 2VHWA 4M54A 4FQ8A 1GZ4A 1K6IA 2C7VA 1LX6A 3FNFA 1EQUA 3C24A 3WQRA 1IZ0A 3ZWPA 2Q3EA 4GX1A 2VWGA 4MIEA 2P5YA 4BV8A 1IUKA 1C3VA 3TL2A 4HV4A 5C37A 3JD0A 5FYDA 3IKVA 3PHJA 4TROA 3U4CA 3O8QB 4ROSA 1QLHA 3ZNOA 1R16A 1YONA 1NWCA 2NU6A 2I9PA 3AI3A 3IUPA 2AG8A 3FTNA 1PS0A 2CDCA 2WWRA 3GZNA 4KUEA 4I5GA 3ZWAA 4J1SA 3DBRA 5DOVA 1BXZA 4HUJA 1IY8A 4BO7A 4MIYA 3CINA 4B4WA 3VH1A 5B1YA 4JROA 3N7UA 4Q39A 3V8BA 4YTEA 4YXFA 4Z6KA 3BYZA 3JYNA 3DTTA 5BT9A 1G1AA 1NBOA 4E12A 1XQ6A 2CDBA 2WTBA 3T4EA 3PWSA 4CR6A 2X4GA 4N5LA 1J6UA 1R37A 2NQTA 4BUCA 1X7DA 1ZH8A 1C1XB 1IPEA 2V6BA 1I2CA 2QRKA 1WXDA 4B4VA 1HE5A 3S2IA 4JLWA 2YQ5A 1WMAA 2VRBA 4WLUA 1PX0A 5C5IA 2X6TA 3QVXA 3N74A 4Y98A 4HY3A 4WLFA 3WR5A 4CJXA 3H2SA 4LRSB 3TZKA 2F00A 2EKLA 1AUPA 2I5PO 3FTPA 4J7CA 3JCZA 3WYBA 2C20A 3GVPA 4YA6A
chains in the Genus database with same CATH superfamily
1PR3A 5DNVA 3G6KA 4J0FA 3OEWA 1P5JA 1W0CA 3NTLA 1C2TA 1N6OA 4QARA 5EIBD 2VZLA 5G0VA 1U31A 1U3GA 3TLAA 1W2GA 3KYBA 5HF5A 3RSHA 2QVYX 4Y7DA 1U11A 2FHPA 3ENWA 1UPTA 3W34A 2WM2A 3BXGA 4L5JA 3DBHA 4BTLA 2HMTA 1FU7A 3EZ6A 4XVUA 2FEOA 2XBMA 4CL0A 4MUKA 1EHYA 3KAQA 5CCDA 3A06A 3CUSA 3ILHA 3NHJA 2R60A 2RKBA 4DR6B 1W87A 1PSZA 3E05A 3TM4A 3TRKA 2PO5A 5EWMA 1J8MF 3U19A 4TTQA 3GQBA 5LD2B 2GKSA 4H1VA 5FFFA 5IBQA 1H6DA 3GROA 2HB6A 1Y37A 4QGGA 4X71A 3TAUA 2RKOA 3UW1A 3V3TA 5IKEA 1KMHA 2EKBA 2HWXA 1B43A 4M46A 4RV5A 1FTGA 4I2VA 2R8ZA 2VHZA 4KN8A 4RA9B 1CYEA 3QUQA 4EAQA 4B2YA 1P17A 1ENPA 1VB5A 1Z08A 4J0IA 4L4ZA 1N6RA 3PFNA 4MQFB 2PXAA 2UKDA 3C7CB 3WNBA 3ZKAA 1K7CA 1Q7TA 4G8CA 4I5IA 4TMFA 4NU5A 2PR7A 2GLXA 1QCCA 3MFYA 4Q0MA 1UKZA 3FPCA 2YYSA 3ETHA 4RM3A 1YZKA 2V7VA 1VPLA 3L6RA 2IYVA 1ZS9A 2YOHA 5TLSA 3EG5A 3RADC 3DLAA 1TCAA 3I6MA 4H7FA 4IJKA 3OC0A 5BUQA 1VPWA 2CF5A 1YQWA 1RWNA 4M8NE 2JBAA 2O5VA 4FYPA 4AKTA 5EMNA 1P44A 2OA0A 3F7NA 3B5IA 5F2KA 1EUCB 4MITA 1E7QA 3W8FA 3VC2A 3DM5A 1NN3A 2O59A 2ZJ6A 4MCJA 2C3PA 1ULSA 3P9IA 1ML4A 1ZM9A 4OB6A 3V4LA 1QGAA 5K0BA 4O3FA 3UCXA 4TQ9A 5CVUA 5LLSA 5FNVB 3UG7A 4RJKA 1C14A 1REQA 1E1QD 3NBUA 1KZ1A 2B1IA 4IXMA 4U4AA 1SUWA 2ZJFA 1G55A 1YNSA 3CZ9A 2QTZA 3IQGX 2FEAA 3HGTA 3MJHA 1DQYA 1UQRA 3O8NA 3EY9A 4J3NA 5LZ5A 1E1CB 2WUDA 3IUMA 5EXEA 4C4RA 1SC4A 4OHKA 1USVA 3Q3GE 4OY3A 5CVCA 4TWJA 2H9YA 5F2OA 2IWHA 2WUGA 1L4YA 1OGJA 3H04A 5AI4A 2BFPA 2F3RA 3E2PA 4IIGA 1E6WA 3RVPA 3IBSA 1KBZA 4BX9A 4RHTA 5IHXA 3AY0A 1Y6GA 3LX6A 1XMOB 3W9SA 1O0SA 1DSSG 4GBED 4HQOA 1G2PA 1NTRA 2CLIB 3LF2A 3ZTYA 1A5BB 4A0QA 2ODQA 3GFQA 4P0TA 3R8CA 1B74A 4KV7A 1FB5A 2XYHA 3ABIA 3H0KA 1RJFA 3HWX1 4KOAA 3Q98A 4WINA 4YVFA 1J8VA 5CLJA 2ZS8A 1ZJZA 4RGQA 2WAXA 2IXBA 1QV9A 2XE7A 4J16A 4L8FA 2Q1SA 4MKGA 2B7LA 1ZCFA 4QYTA 4YCJA 2JPDA 3G9TA 3I9KA 4G2NA 4MVJI 1OFIA 2XHZA 2EL7A 2OLEA 2Y1CA 1DRKA 5D3ZA 2QGZA 1LW7A 2DAPA 4HNQA 4OI2A 4W1SA 4IDBA 3K09C 1WMBA 2WAMA 3DZFA 4TM7A 1ZXBA 3ETCA 4UJ5A 3A3KA 1U7TA 4C2BA 3JQEA 2AOXA 4KXMA 2AYXA 1ULTA 4FMCF 1J39A 3ENVA 5KJ6A 1DHRA 4IIBA 3FRJA 2QVBA 3Q5GA 3CY6A 1KMQA 4IG4A 1J1IA 3MILA 3MMPA 5L4NA 1TVEA 3U3ZA 4ZHQB 3SSOA 1GZ7A 4L78A 4B5LA 1XRLA 3J81k 3B1XA 4K0RA 3WYCA 3TTSA 1JQDA 2OORA 3LV8A 1EGMB 2W0SA 1TOAA 1XD8A 1ESNA 3PF9A 5BQXA 3SXUA 3H3FA 4DV5B 1SK8A 1IZZA 2QSUA 2NYAA 3K9FC 1IHUA 2NUAB 3EFOB 2R6HA 1Y5MA 3VR5D 1U1DA 1KARA 1Z6YA 4I2NA 5SZJA 5C7OO 3T3OA 2OFOA 1XCPA 3H75A 4W7HA 4ARUA 3PPIA 3TZCA 4QDZA 1PR6A 3QJGA 3TN7A 4FFOA 1VKJA 3K6RA 2PA0A 2HNBA 2PH1A 3D4IA 2CJXA 2EBHX 2W98A 3MD9A 2XUKA 3MA0A 2HQBA 5T5QA 2J9ZB 1DAHA 1Q3HA 2D62A 2PWZA 3ROQA 2FE1A 2YR0A 3CX3A 3IAM1 2QLLA 2RSLA 2AJCA 3TL3A 1SD5A 4W9NA 3FNQA 4F9GA 1T2NA 1TPZA 3ONFA 4UREA 5C8YA 5AD1A 3F3MA 4J0QA 2AT1A 2IU4A 4ENTA 1VKRA 1KZ7B 1I4OA 2VF5X 4FONA 2D0DA 3BKXA 3SOPA 2DSNA 3GRPA 1U8UA 2C58A 3DEHA 4UUNA 1QFZA 4DUGA 5T57A 2HC9A 3GRCA 2ZB3A 4GR9A 3SSMA 3FSGA 2I55A 1I9CA 1L7RA 4WOKA 4J9UE 3BWDD 3ENNA 4ZT3A 5IFLA 4CUZA 4PZ0A 1X80B 2P2LA 3DKKA 3Q7QA 1O97C 2B35A 3IOYA 3K70D 3E9DA 3V4FA 3TINA 2GM4A 3DZDA 1C0IA 3KQUA 5FCDA 2I4LA 3RF6A 5FQNA 3UV3A 4YAUA 4UNRA 1C8LA 3IKJA 5F78A 4J4BA 1KY5A 4AQDA 2F6RA 5DLEA 3ECSA 4FGKA 2V4ZA 1ZEMA 2FY8A 2G0TA 1UC9A 2NO9A 2W71A 2IBSA 2ASEA 2OECA 3CX6A 4ZOQI 1AO3A 1VCMA 4B3SB 4FSXA 2R7MA 3I8XA 1QTRA 4FMBB 3AKEA 4MV4A 4US0R 4UVHA 3D7RA 5DHSA 5TPZA 1AA6A 3HBFA 3OFVA 2O5CA 1UBSB 1NNUA 1ORIA 2VQ6A 3GAZA 2XB2A 1FFXA 1QAMA 4OUDB 5HQ3B 2WKPA 1AHNA 1JJVA 2P11A 2P4HX 4KPUA 4X61A 3ZK8A 1JLHA 3UXHA 4MRPA 3UWOA 2FOLA 2Y76A 3LI2A 1U5CA 3K32A 2X3FA 2I7DA 1PD1A 3KUDA 1UBNA 2FW8A 4G5XA 3T0FA 3C39A 2JKVA 3IIKA 2JLYA 1IN1A 4GW3A 1LF0A 4HX9A 4MSUA 1YZVA 4MA4A 1PTJC 4ZIRA 4GKJB 1VMAA 4AZ3A 3OF5A 1TKCA 1HSOA 3WGKA 2O6LA 5J40A 3A3PA 3AEKB 4M0MA 2C84A 5LXTF 5TB5A 1V8BA 2O8FA 3VU9A 1ESDA 2JAWA 2VZ0A 1L5VA 3BXEA 3OFKA 1AKEA 2YWRA 1CQWA 1O8CA 1F4LA 2VJOA 3MF4A 4FMCB 4JQOA 4LOIA 2IV7A 2RONA 3VO9A 1Z18A 3RGWS 4G5FA 4UJ3A 3GIWA 4YDSA 2D0IA 2FWNA 1PTKA 1QIFA 2OZKA 1EBFA 3FGOA 4CM9D 3FPJA 2C7PA 2AEEA 3AF4A 2CJWB 1ACLA 1RAIA 1W5SA 1UDAA 2Q7OE 3OQPA 1VHLA 4INAA 4TS3A 5KNCD 3TNJA 2PL9A 4BVHA 1GN9A 1PJTA 3EXAA 3PEWA 1HL7A 1UK7A 3ZWWA 5LBUA 3T9EA 3J81A 1B14A 2HBRA 1SNYA 4HVTA 5IS2A 4Q03A 3IVRA 1MH1A 4NYMR 5J2TF 2Y27A 4DLUA 4X6LA 1KY3A 4K81B 1VXOA 3NM6B 1NI5A 4ZODA 4EA7A 5AK3A 3U7HB 2GPTA 5D3QA 3KETA 1CKEA 2QIPA 4IZIA 3P0FA 4Q6BA 4I81A 3WJ7A 1EZZA 4FZJA 4TQGA 4FBMA 4IV0A 2G04A 4XSHA 1U8ZA 2ZPTX 1T3HA 3D6NB 3NT5A 5C7IO 5THXA 3ACBA 3GV0A 3M1IA 4JBYA 1BXGA 3ROFA 2JGNA 4EI7A 4YDHB 1KERA 5E6SA 3ZWCA 3J80A 5HE9A 3EVAA 3EGOA 4KXWA 5D5PA 1XJQA 1F12A 4F7WA 5EIWA 5KJCA 1MRNA 3FZGA 4OJNA 1FBNA 1UJMA 3ONNA 2PCLA 1BGXT 4QAQA 5EC8A 1TZBA 1NW8A 1Z5GA 4FN5A 4M37A 5EWMB 4OI1A 1PN3A 5JSFA 4HP8A 1MAAA 4WV3A 3PUYA 4FQ7A 1EUCA 1JA1A 4NVRA 1HG0A 2ZQ5A 1B6SA 4UNIA 2WC1A 1BVRA 1E9EA 3MMSA 1CWUA 3NWBA 1YL7A 3QOYA 4HQFA 3VPDA 3NOVA 4KPYA 3BXZA 3GZTB 4XJSA 3V1LA 2HKIA 4W1QA 1GSHA 1C30B 3OG9A 4CLOB 3IE0A 4HDNA 2XYQA 3EDQA 1M8KA 3EPHA 1PJ3A 2C8KA 1QH8B 3PS9A 4FHCA 2PQ2A 4NBWA 1VL6A 1J33A 3QU2A 4QHSA 2WUFA 2YVLA 3FDFA 3INNA 2J3HA 4OB7A 2FPUA 3IJ5A 1JIKA 1R88A 1YK1A 1FFYA 2BCEA 1E1KA 3HXOA 3PC7A 1C0LA 1RXEA 4OL0A 3JTEA 1PK8A 2PANA 3V34A 2QRVA 1UBJS 2YMMA 1M1YB 1X3SA 4TX1A 1CHDA 4IH4A 1VTKA 3LVRE 1NW3A 4L8YA 4NCXA 1SRQA 2HI0A 2QK4A 4MAAA 1A8IA 3GUYA 4EL5A 1G8MA 3T12A 4PYRA 3ZUPA 2JEYA 2D4AA 2QVGA 2WKRA 1JSLA 3A4MA 3DL4A 3H2ZA 1EWTA 2P75A 2C7QA 5LP6C 5ALEA 1ZGGA 5FJIA 5IF9A 1NUHA 1YWGO 4RELA 5CD1A 5E1OA 5JZOA 3AFNA 3M1LA 5J9FA 1N9GB 5HTOA 3WOHA 3HRHA 2WJ6A 5K0ZA 2SECE 3G8AA 1HO3A 1DO0A 1T2DA 1JECA 2DLNA 3AX6A 3CLSC 3WFJA 4AKEA 5FLXA 4F2HA 1S7GA 5L51A 2ZATA 2PR2A 2P2GA 1DAGA 2J07A 1NJ5A 1S1CA 1TGVA 2GK6A 3LG2A 4IDAA 3W3AD 3U6KA 3L8GA 2JAPA 4DCCA 1J0AA 1AKUA 3SEAA 5IDXA 3VC1A 2Z83A 4XFJA 1ISHA 4LNHA 4RIFA 1GYPA 1OX4B 2GTHA 4E15A 2JLXA 3FVQA 3CVUA 2YW9A 4FYYA 2ODPA 3WL5A 1T0JB 3C3AA 3K0EA 3WLKX 3UXEA 3LDUA 3U09A 1GTRA 2XNHA 6REQA 3IKMB 4XI9A 5ILOA 5AKEA 3B2QA 1ZBDA 4CTMA 3WP0A 3RS9A 1E20A 4Q4HB 3VQTA 2R6FA 2WBLC 5CYOA 4PZPA 2I87A 2GJSA 3A1FA 1BJRE 1XR3A 4N4AA 3DE4X 4DYDA 1QF9A 1H1TA 1UKEA 3RD5A 1DQNA 5IBCA 4TV8F 4LVOA 1S02A 4NDZA 3ROXA 4YMHA 4LN1A 1Z6XA 3WHIA 1KDZA 4NZNA 3VJKA 1H2YA 3Q4GA 1P61B 3T5GA 4IGKA 5ALQA 4EY5A 5AJXA 1KMMA 1NVBA 2H4HA 5L7TA 1AMOA 2D1TA 4JC5A 4LGVA 2HA7A 4UVEA 5AJVB 4QHYA 7MDHA 1MD9A 2Q6IA 4LXGA 5G40A 3F6YA 2OWEA 2FPOA 2ZSDA 5GGXA 1B73A 5LQKA 2RH5A 2GZMA 3FI9A 5BSRA 4TTSA 2PUFA 5H7XA 5EHXA 2QL6A 2PTGA 4GLFA 1JAYA 2BONA 3P94A 3VNAA 3E9MA 5K8TA 3SHVA 1GA6A 2P1ZA 2Q3LA 2AFHE 3NB0A 4F9FA 1TMKA 1A9ZA 4BLVA 4ETNA 2A0YA 3NWJA 5H3CA 4GYYA 1TCBA 3SQMA 1AK1A 4C9BA 5BV0A 1QVRA 4CLDA 1CUUA 5KTMA 2FPGA 4HVCA 1UOOA 2PGAA 4QUAA 2I2WA 1AZLA 2AQIA 3AV0B 3OCUA 4EZIA 5A3RA 3UMCA 4MVCA 5EINA 1GV0A 4S24A 1F4VA 3HMQA 3EGXB 4LBWA 3MJRA 2XPCA 3BTVA 5AKIA 2B1QA 5FBRB 3SU8A 5IWCA 1B6GA 1DADA 2F1OA 2NT3A 5HXAA 4J1QA 3PHIA 4OV6B 1Y1KE 2REQB 3LLCA 5ABPA 1FDWA 3K5PA 5CD9A 4HG2A 1WTCA 5EP2A 3B1FA 3N2EA 4LCEA 4EUNA 4ACBA 5H4HA 3GFFA 5JYCA 4PLFA 4ZI7A 1RWXA 4UQOA 4F21A 1K66A 4CKCA 3LHKA 1F60A 4Q3AA 2IYPA 5C52B 1OGIA 1IFXA 1UOEA 4JJEA 4Z4FA 1J2UA 2DUUA 1JTEA 1RRKA 2V7PA 3A4YA 3JZFA 2QX8A 5EE9A 3RTGA 3UK2A 3IVMA 3UB3A 2GARA 2ZWOA 3DNMA 4I50A 4A5SA 4DXDA 2NVUA 4QXMA 1ZP6A 2NG1A 3LRXA 1ODFA 1W4LA 1PZNA 3LCUA 1RJDA 2QW0X 3N7AA 1G5IA 3FJYA 3PHGA 1TMOA 4L4XA 2JJ1A 1IUOA 2ACEA 4Q7JB 3HFGA 1YJXA 4RDHA 1MAUA 3U49A 1I36A 1ZSVA 1NYTA 2FRVA 1UPCA 1NVTA 3ILXA 2REQA 5HEKA 2CK3A 3L6OO 4GPAA 5AUOB 4LJLA 1GGJA 2JFHA 2WRZA 3FVWA 1HRDA 2YX1A 1ANKA 2ODTX 1VMEA 3CMCO 3O4FA 3L8DA 3AVUA 4NESA 1P6XA 5TEWA 3VUFA 1P7CA 3IAXA 1UJ4A 1E6EA 4Z86A 5C8VA 3RYIB 5KSYA 3K70C 1MGPA 3JQ8A 4G0YA 4Q7LA 4P92A 1UBFA 5EJIA 3TSWA 1JQ3A 5B2FA 5E7IA 2ECQA 1CULC 4GRDA 4JVSB 4ZOLF 2C1EA 3EG9A 4CW7A 3O2NA 4EMUA 1CDZA 1QFJA 3A4IA 3N39C 3VNRA 4EA6A 3IRVA 1TU3A 1G16A 2JI9A 2H4FA 1CJVC 3D4PA 1T9DA 3CLHA 1LRLA 3S1SA 4COOA 4H1WA 1M2OB 5AHXA 4ZVUA 1CPYA 5KNDD 2C2KA 2KLHA 3NT2A 3NALA 4I5FA 4MV7A 3M89A 3MTAA 1QHNA 1VE9A 4NH4A 5FWAA 2ZUEA 1AGRA 1B00A 4NE2A 3QU5A 4W5NA 5IW8A 1TJPB 1GTL1 4QHTA 4RS3A 5J2TB 5KTKA 1JDUA 2H11A 5CA0B 4ZCMA 5DI9A 3BEOA 3BQMB 2RGDA 1P80A 2YY7A 1M1NA 3KSRA 2Q41A 2OAGA 4Q3NA 3WHLA 4HFMA 1E61A 3IODA 1QHIA 3KOWA 5KYGA 4J3JA 4DA7A 1L0BA 2IITA 2PEYA 1UK6A 2GT1A 1O96B 2H16A 2FW6A 1EEHA 3LK7A 5JROA 3DLCA 1M7GA 4Q9IA 2IV3A 2P9YA 3MTIA 3SYRA 2QJOA 1RZ3A 1H2AS 3DF9A 2P5SA 3AR8A 2ZTMA 3T1TA 5C8YB 4LZLA 3ZX5A 4KOEC 1XU7A 4E08A 3RC9A 4TV9B 5AHOA 1L6RA 3VPGA 4PCAA 1IC6A 4DNFA 1BHSA 1UMDB 2DPHA 3IEKA 1QBKC 2CKDA 3EPPA 2H5LA 3AGPA 5A5DA 1M0WA 4EKEA 5FADA 1JMYA 4EX7A 4OH7A 1PV4A 1S5PA 2XGJA 4LX8A 2XDYA 3EVGA 4P4LA 3RUEA 5GIOE 2JASA 3IAAA 1Y9DA 2PGXA 3E5MA 4BDSA 5KX5F 1HH4A 1PP4A 2DY0A 4MO9A 3MGCA 5KWEA 4PWYA 1QV6A 2FR1A 1E7WA 5HG0A 1GKLA 4HC4A 5KZMB 3NNDA 1JEYA 1WXQA 1VLVA 4ZO8A 1CERA 1OIWA 2E5WA 1XTUA 3AVOA 2XDQA 4XIYA 2YRWA 3N2NA 2AXNA 2JGJA 4P83A 3VYWA 4B43A 2C7RA 4R2XA 4OJKA 5F2EA 2FVYA 3AR9A 4ZCTA 4EI2A 1S8AA 1T1EA 2OGTA 3BOSA 3N53A 5FPYA 4JL5A 3RSSA 2FW1A 4WKBA 4XCQA 1C81A 3N1UA 2WTMA 1N1EA 1X70A 2Y1XA 4FUTA 2J87A 3EZNA 3H9CA 3I28A 1E1RA 2ZSUA 4JMLA 3SZ3A 3V8PA 3VZCA 4CU5A 5LZ2A 3R9WA 5L3QA 3OSZA 2QRPA 3ZZTA 1HUQA 3H1GA 4MAMA 1X13A 1N0VC 3J7AC 4O4IB 5FTWA 2IUSA 3MERA 2JFGA 2OXCA 4URWR 5D5QA 4ERNA 3BCHA 1A8PA 1XCGB 1Y42X 1JDTA 3CNBA 2JHAA 2WIAA 3DEFA 4GSKA 4MWEA 4OVKA 4TLBA 5IT5A 3CNLA 3ZY2A 4PYQA 4N40A 3GLSA 5D7NA 5CMLA 1GPYA 1ZU4A 4O25A 4YAOA 1MO4A 1JIQA 4CBVA 3EGDB 4CIVA 2XMRA 2VF7A 3OHSX 1LC0A 2JRLA 2GJ4A 1K8RA 3GYBA 2EHJA 3QKWA 4PG8A 2OGZA 3ZDFA 4R8LA 1I0ZA 3FD8A 3IEXA 3DTVA 5FEUA 1KWGA 4HWSA 1Z07A 5EPUA 5K3FB 1OWLA 2QM3A 3F98A 3VPCA 3L9WA 4TUYB 5JZVA 5DHRA 1FA9A 4JVLA 1KI6B 4HOYA 5AKJA 3IDFA 4HAOA 2JVJA 3UFXB 4B33A 5JDIC 1MB9A 3IV6A 1F48A 5EWLA 1FDVA 1QQAA 1VM6A 3DULA 4KPFC 4NICA 1CQXA 1VP3A 1JLMA 2RGNC 3UH1A 3EPRA 4JIMA 3EEBA 1F0NA 3L6DA 2C07A 5EPEA 3BD8A 2ESRA 2GYYA 3BQ9A 1BJKA 3IQIX 2WZDA 4QJ5A 1AZWA 4L4YA 2G06A 4KR0A 4L9RA 3ISJA 3T7JA 5LOVA 3Q0IA 2WLSA 1N2CB 1QG0A 2P62A 3ZLJA 4CM9A 2J5XA 6YASA 3O1IC 1UWCA 2W2OA 3BERA 5IN4A 1X7YB 2H8KA 2VRCA 2IEYA 3FMOB 2QT1A 1E1RD 4KLZA 3EUWA 5LXTB 1TZKA 1VL5A 1Y48E 5BURA 3L49A 3P9PA 1TCCA 1DIBA 3HCWA 1KK0A 1LX7A 4X9XA 1X15A 4DR3B 1YU6A 1G0OA 1U4SA 3N6RA 2OB1A 3WGHA 2HIGA 3BWVA 4GBJA 2X8AA 3OZSA 5HK8A 1PZHA 4URHA 1ABEA 1ECGA 3JQAA 4G3XA 4J2HA 1WSAA 3CRZA 5AVXA 1ODSA 3H87A 5HQ3A 1CY8A 2OV4A 1KL7A 2PFKA 4NG4A 4Y67A 2NVBA 3SJZA 3GN2A 4U8HA 4TS1A 4EB6A 1P4GA 3DVAB 3QFFA 2G9ZA 3R2JA 5CXSA 5K3SA 4EW1A 4M88A 2DPYA 2Q2NA 3K9HA 1IY2A 2VT3A 3HV0A 3I52A 3AL3A 3JARA 4RM2A 4JIGA 4N49A 4WKGA 2JLCA 2F48A 4MR8B 4XW2A 3ZX4A 5FI1B 4EHHA 4N48A 4FLMA 4JJKA 4FFSA 1V6SA 1DWPA 2W83A 3DBHB 4GI2A 1WXWA 2CHQA 3AUAA 4R9SA 2QAGC 2GTPA 4U3JB 5J5AA 4XA8A 3DYIA 1V9SA 4O02B 5JFGA 3OBBA 4M0LA 4F6RB 3TRDA 1R4NA 2YJNA 3ESBA 3IMEA 1KJ9A 2QSJA 3MJVA 4ZVSA 1S8FA 3OF2A 5ESXA 4MPRA 4HUQA 4TS9A 2YV5A 1VCHA 1MB0A 3AV3A 4DHEA 1A9RA 1I2MA 1L5RA 1XEWY 5KHLB 3L6UA 5HUJA 1C3EA 3TIVA 1YZLA 3L4BA 2QVLA 3WYNA 3H5LA 4BO3A 2ZXUA 5G2OA 1A4IA 1CLUA 4E13A 5HRAA 1C3JA 1Q0ZA 4ZZIA 1OAOA 4Q9LA 2KYRA 4IUYA 1T5OA 3IAM6 3QELA 1CVLA 2CFRA 4ZJYA 2FEWB 1E5LA 2NX2A 3TR6A 1IM2A 2QM0A 1H0KA 3H1FA 5EJ2A 5CYFA 2HHJA 1MC4A 1KAGA 2ZYIA 3IAS6 2RHLA 3UF0A 1YS4A 1SOAA 3KX2A 3FHJA 2WM9B 1R3UA 4R0MA 2X0NA 4FZVA 3TZLA 4W5RA 1AKWA 1W4BA 4J43A 3VR1A 1OH7A 4V2UA 5GVSA 4R3NA 4LJ7A 3PX7A 2LDBA 1PR5A 3AUKA 2EBUA 1NN1A 2I3ZA 2JIOA 3K1ZA 2MDTA 5AHKA 4EZEA 1L4LA 3RM3A 2I7VA 2WV7A 4KBYA 3OMXA 2NSJA 3NCHA 3Q6IA 4RF2A 1GRRA 4A2QA 3W5JA 5IHPA 3A1TA 3RTAA 1D1SA 5IVKA 1GADO 2XODA 2ZQYA 4GECA 1VA5A 1JI0A 4YPOA 3SMQA 3C97A 5J1TB 3INYA 2ZDGA 1XPOA 1L7XA 3JZMA 4KVFA 3FUWA 4IVPA 1KMCA 4QGHA 3BE5A 3C3MA 1DXOA 3GJ3A 2YC2C 3WTBA 2EX1A 3ICCA 2G7ZA 1QM5A 2AN9A 2BGIA 2C82A 2XNDA 1I9GA 3BL8A 3CUKA 5KYVA 3VR6H 3PVZA 4Q4LA 2R4QA 4JLMA 5JXJA 3RVRA 3U56A 2Q49A 5ALNA 1RI3A 3HA5A 4WCFA 4F1JA 3JZIA 2KJQA 3B6KA 1G8AA 5FWNA 3EVEA 4R1QA 5JSUA 5LMZA 3EGWA 2W42A 2H2GA 4XXHA 2VRNA 1WVIA 2FFJA 4ZDIA 2J4DA 2WMNB 2ZU6A 1ZAKA 3MYRA 4CM5A 4PQRA 1RI4A 3ESAA 1DIGA 4JVOA 1C80A 1FDOA 2BMJA 3GEEA 4TL9A 4PPYA 4IUCS 3C6QA 5ICEA 1ITZA 3H9JA 4MYRA 2GYWA 2F8LA 4KHPB 5ICGA 1UPXA 4BNDB 3VNUA 1RWMA 3K0CC 4QUJA 2CXRA 3TGPA 1RP1A 4NBVA 3LKVA 4V39A 3REGA 3DVAA 5DHFA 1PKXA 4LY9A 3TXAA 5E4TA 2H17A 2N0SA 1KS9A 4HWOA 4UNPA 3LDGA 5KQLA 1MW8X 4CEJA 1HDOA 1HA3A 1KI6A 2BTQB 5G0SA 1XD9A 5LXTA 1NVMB 4PBSA 4PIPA 3GLGA 1AU9A 5DGTA 2QPTA 1VJDA 3K1AA 2CVPA 2HDOA 1RJGA 2A0WA 1X8LA 2Y0CA 3V80A 3OLQA 5ITVA 5D3KA 2HA6A 4F3NA 3GD7A 3FR7A 3P9ZA 1YJCA 4WLNA 5HZHA 1GQSA 1X3LA 2Y2UA 3EOAI 3C7TA 3LH5A 1VFPA 4BNVA 3LQFA 4CT4B 3C7AA 3RJMA 3CUUA 2GZAA 4X94A 3I9NA 2HA3A 2YWHA 2VUHB 5C0OE 5ADHA 3WNZA 1I6MA 4N3CA 1KQNA 4Y9DA 1WV0A 1BX3A 3SX0A 3O2JA 3N5CA 2CNBA 2GEJA 1YB1A 3L8YA 3IAFA 1D4ZA 3D7NA 2IS2A 1LSJA 4JBGA 5AO9A 1OFUX 3R40A 4WLVA 1RBMA 4I1SA 1IQUA 4U8GA 2F1HA 3ORHA 4M0PA 2A9RA 1T36B 2HYDA 3OFJA 4FDAA 1N1GA 3U1BA 3ZHXA 1MB4A 5REQB 2E55A 2C4VA 2ZRIA 1TT7A 4KV9A 1N2EA 1XTPA 4MV1A 4TSFD 4UM9D 5DGXA 4AN1A 1K7SN 4D8WA 5FXMA 3G79A 2BKLA 5CVJA 3U4QB 1ECFA 1U99A 3DDCA 3I34X 2ZTUA 4BP8A 2BM8A 2MYPA 4WZBA 4RPIA 1FP4B 3IE2A 4H16A 3MCUA 4R1NA 5ALWA 1QYVA 4C3UA 1QP7A 4KVGA 5DISB 4JEHA 4ONEA 5IT9A 1SGWA 2F9MA 1CFZA 1KY4A 2B4KA 3N7TA 4OHPA 3U2QA 3QUBA 2NO1A 4YCCA 1P91A 3VUEA 2PJDA 3W90A 3RSZA 1PFYA 4DJJA 9ABPA 4DE5A 3D2AA 4JUDX 4KVZA 4Y2PA 1ZGJA 2B8JA 1F0KA 4PGAA 1YCHA 2HDHA 1LLFA 4Y1RA 3TLCA 1L4NA 3TG8A 2BF4A 1QQ6A 2ZBQA 1YBFA 2ES4A 3BA6A 4KRYA 2EYUA 2NUTA 4OLBA 2XDQB 3LS2A 3Q6MA 4EHKA 1EFKA 2E1PA 1H69A 1YJ5A 2PV7A 3PI7A 5MN6A 1GU0A 1YASA 3D8TA 3D4LA 4OP3A 3K7EA 4A73A 4NEQA 3WMFA 3GUZA 4YUZA 3EOBI 5F23A 2RGXA 5LP6A 1HQCA 1B0UA 3WK7A 3TJMA 1DRJA 4DVJA 3V1MA 2TMKA 4U5XA 1DI0A 4ZEXA 3EGDA 4AMGA 5JMWA 3P2KA 2FU5C 2QVZX 2ZKLA 3CSSA 5JQGF 1W2WB 2I1WA 4JI8B 3OE7D 5I4BA 5DK6A 1XO1A 1RYYA 3QI2A 5L3ZA 4YMUA 2J9GA 1KEVA 1TIKA 2CHEA 2A0FA 3FKJA 4XEUA 4DLBA 4B3GA 1E94E 3QXCA 4PG7A 3I39X 1VI2A 2CKMA 2QJFA 4TXNA 2G0AA 4Z54A 4F46A 2VDVE 1TLTA 5CW1A 1OC4A 1Z7YA 4MB2A 4P3PA 3U1VA 421PA 1TVCA 3UOWA 4DUPA 2PK3A 1OOEA 2IZ7A 4L16A 1S2LA 3B9BA 4K3UA 2O6HA 3T8YA 4YV7A 2CHFA 2FR0A 1DWUA 1XP8A 4X90A 3DT9A 5LQSA 4C01A 1R9JA 1VCNA 2BPOA 3C3CA 3GP3A 3WZMA 4Y9SA 5JCXA 1PRYA 5KNCA 4KNYA 3O3OB 2W2LD 3GLQA 1J49A 3WB2A 3GRFA 4QTUB 3TAHA 1EVZA 4IV5A 5JO9A 4FC7A 4FUQA 4RYLA 2UVQA 1ZCZA 1QCYA 3QWHA 2OUKA 3EG9B 4BP1A 1UBTS 3EC1A 4G2TA 3Q8MA 3WJ1A 4WXHA 1QQBA 2BFAA 3ZCTA 1QDEA 2VDPB 2WE7A 3AG6A 3IOEA 1YB7A 3PGXA 4ECEA 2EBFX 4F93B 5JY1A 1EG7A 3SR3A 1GZHB 1OCEA 2ZAMA 2ZGVA 4RKYA 2P9ZA 2QTGA 1L1EA 1IL0A 3QBEA 3QBTA 4LY0A 4DRXA 4PLHA 4DYHA 4KTVE 3D1JA 4FOLA 1U6KA 4RXMA 1SOVA 2JCSA 2JKZA 3M82A 3K8YA 3N59A 5DM0A 1IJEA 2XH8A 1X1TA 4R31A 2PT5A 3RUFA 5C8YF 1BC5A 2FSHA 4BYMA 4MNTA 3AB3A 3BJRA 2BMEA 1C3OB 3LM8A 3U7RA 1MA0A 1VBMA 3P9RA 1Z68A 2B34A 2BCGY 1DAEA 1SJ9A 4FFPA 3PCTA 4ND8A 3VYRB 4BBJA 2XTNA 4GNRA 5CLIA 2CVQA 2WYUA 1Z4IA 1JI3A 1R0BA 1CJBA 4R01A 1KMNA 1B0PA 1ZG3A 2WTEA 2M1XA 5IBPA 2IH2A 1CIPA 1UKCA 3A9TA 2D8AA 3D6TB 3KYCA 5TDHA 2YOFA 1SC3A 4JXJA 5ERGB 3TLGB 4CUJA 4B82A 4OQQA 1IY9A 3GUHA 2G1AA 1OU4A 4WHMA 2BHTA 3VYUB 4HH4A 1ZN9A 1PBTA 2DH5A 1GCUA 1JWAB 3I1IA 1WBJB 1WMEA 2GCOA 2QLJA 3ABRB 3ILSA 3PEFA 5KHAA 5JRJA 1POXA 1GYRA 1A27A 1GCOA 4RMHA 4NYJR 2CB0A 3VBCA 1PR1A 4B1FA 3ZVMA 4Y6SA 4Z4QA 1GDDA 1RLMA 3AIOA 3EBLA 4BKQA 4B5KA 1SVNA 1KFJB 3W06A 1U3TA 1E7SA 1XVAA 2JHPA 4JP2A 4N7RA 3D3KA 2R1ZA 2VCYA 4FYWA 5LP6F 4DR5B 2XWBF 2L0XA 3AK4A 1K06A 1M6VB 1RE1A 3T3IA 4DZTA 4WDQA 4Z4HA 3WLAA 5I5EA 1JR2A 3JWEA 1P1HA 4KHZA 3WIOA 1EXWA 4W5QA 5C81A 2VSYA 5FJJA 1RMYA 1XRQA 1QO9A 4NK4A 1QKIA 3U4IA 5WRFA 1XRMA 4KNWA 4MYHA 1XEAA 1LTQA 2PSSA 4DA8A 1JR6A 1TUBA 5CFRA 4JI4B 4J7AA 5DNDA 4C08A 2V7UA 2IYXA 3ZYZA 4RDIA 1NT4A 1Z0UA 3QF4A 1X74A 1HE4A 1BA2A 1USIA 1KK3A 1ZXXA 3D8SA 1GZ6A 3FUUA 1JYSA 2FZGA 2F90A 2V0NA 4KLAA 2J41A 4FEAA 2DH6A 3L7MA 4N0QA 4R0NA 4FBLA 2JFBA 4D79A 1PQPA 4L3VA 3B9QA 1PZMA 2B36A 3ZEAA 4HRXA 4L5AA 1U3DA 1LK5A 1SOUA 3UBMA 1FFCA 5DNCA 5KYXA 1FNMA 3ZI4A 4A7PA 1WXIA 2R4TA 1HI9A 1N2JA 4HLUA 5C3MA 4XOUA 4D8UA 4HL6A 2NZUG 1N2GA 1FUYB 1PF7E 3RV4A 2OZPA 3FYUC 4F85A 1L4UA 2EAUA 1PYDA 5ICCA 5JSZA 3LBYA 3P20A 4TV8A 5J47A 3W8NA 5ECGC 1RRFA 3P2IA 4KI7A 1KAQA 1RDFA 3QE4A 4KQ9A 4ZVNA 2XUHA 4IGFA 2O3RA 1J09A 3R7SA 2D1FA 4KB5A 4LF6B 2B30A 2H18A 2QAJA 3O7MA 4GX2A 3Q5DA 3W3ZB 5I6DA 2FPPB 4YRPA 2CNOA 3TIGA 2C8JA 4IOKA 1XP5A 3E2MA 3THOA 4MRRA 5CPBA 4X45A 3OQBA 3I2YX 3E7PA 2W6QA 5TS2A 4DCUA 1UCFA 1NZFA 2IYFA 2Y1KA 4GZLA 3S99A 3EEOA 1E3WB 2F43B 2BEJA 3WGVA 4D4HA 5I7FA 4P4SA 4TMVA 3W7AA 4G5YA 4RMNA 3UOGA 3OQ1A 4YMWA 1RRGA 3ZZ1A 4DLLA 4B3MB 2D7CA 3W2TA 1JUDA 1VE6A 3GEMA 2W4IA 2OEPA 5L7WA 4CLXA 3G8DA 1OFHA 3K3PA 4AP6A 1TAGA 1NUUA 1S4MA 1SCNE 3CF4G 3NGXA 3TLEA 2I6XA 4KO3S 4EPRA 2BJVA 5J43A 3NYIA 1ADJA 3H42B 2PGLA 1RHKA 4FFNA 2CD9A 2JJYA 4CEHB 1TXGA 2NZ2A 4X85A 2F62A 3E5RA 4L02A 3HEBA 2WFMA 5FOSA 2J3KA 3W5CA 1LLQA 4JR0A 4LZPA 1J8DA 3KFLA 3UAXA 3H9QA 5C2JB 3H1TA 5KIAA 1Y6FA 1JIVA 2VK1A 4ZOAA 4J91A 1ZK2A 4GNKA 3G0GA 4DSZA 4J16C 5C7LO 4OK5A 4Q4HA 4WH0A 1QG4A 1GARA 2EIHA 1SU6A 2AE1A 1Y3HA 4I6EA 4IIJB 3RYFB 2ZB7A 5LJLA 1VI5A 1TYAE 1C3OA 1WDLA 2ABWA 3I0ZA 4D43A 2X1MA 2D59A 2CL6X 2R5FA 4JB0A 1WMDA 3OFND 3OUTA 4ZVQA 1T9KA 2C99A 3AXTA 4IWXA 1NVAA 1TQ2A 5KDOA 2A9OA 2CC2A 2PT6A 3RVOA 4IJ5A 3LPCA 1CRZA 1Q1NA 1TJNA 1AN0A 1QE3A 2XDAA 4K5QA 5KNBH 1NM5A 2GESA 1WMFA 1D6NA 2K5UA 3FKQA 1PFWA 1W6RA 2LE0A 4GI5A 3LYUA 4MMXB 1GEEA 3IBCA 3LDFA 1PVOA 4L8GA 1JPUA 3LBFA 4AG6A 4YJ2A 2W90A 3GCDA 5CR9A 4ZEOA 5JZMA 3VRHA 4QX6A 4RTPA 2EZUA 4UTXA 4WA7A 3C85A 3EEQA 1ZM4A 1EGVB 1U28A 2C4NA 4LOAA 5IK2A 4BJ1A 5AW6A 4PC1A 3KXPA 4DCTA 4N9WA 3P8ZA 3SM9A 1NBHA 1F3LA 1SWVA 3LKDA 1T1IA 1Z5UA 3P27A 3FPLA 2KLBA 4EY3A 4GS5A 1V4VA 3OEYA 4W7SA 4YRJA 2GFHA 4B8WA 4X92A 3CB4A 1AS0A 3D1VA 2VUSA 4P3YA 5G41A 5BQPA 1FMLA 1TM4E 1Z0JA 4N8EA 4FB4A 1OBCA 4UQLA 3WNDA 1J24A 4LDPA 4TTTS 1RPNA 4U0KA 4MYSA 3GFRA 2TECE 2C77A 1FIUA 1LDBA 1Q15A 2W11A 3ESQA 3QYFA 3DHVA 5DNAA 5ENDA 4ARCA 1EZ4A 3OIYA 4IIUA 2EVWX 1CTQA 2AK2A 2YFKA 4OBXA 4QL3A 3ODPA 4DMUB 2XUZA 4CNQA 4DF3A 2FSGA 3R0QA 3KU1A 4PGGA 4WZBB 4HDRA 4YPFA 1N7IA 3RV3A 1JSZA 3X1XA 3LC2O 3UYLA 5SICE 5EJ6A 4ER7A 5E4YA 4JR2A 3EQ2A 3CZQA 3QVVA 5EYPA 1J23A 4YMSA 1PBNA 1I3NA 2OZVA 2CNKA 1CY2A 4KYTA 3PXGA 3WK8A 1IMOA 4ED9A 4Z7NB 2Y77A 2IKSA 3GPBA 3ZXUB 1DIAA 4U00A 3P0JA 1UJBA 5IH7A 1TF7A 2Q45A 1T8PA 3NDJA 4MW5A 5A62A 4OPMA 1Y7PA 5JSYA 5GAJA 3QE2A 5FEMA 1GG5A 2DR2A 5A1TA 5JZSA 2O7SA 4OSEA 3N2KA 1VP9A 4P98A 1NC1A 1T5LA 4TLAA 1F5NA 2JIRA 3TKLA 2GAJA 4TT8A 2ZR0A 3ER9A 3QBDA 1FVFA 4DLZA 2R8EA 1M34E 3KE9A 1NZDA 5C31A 2J5BA 3UMGA 4EG1A 3AEUA 3L40A 4XKJA 5BPHA 1D6SA 3GAFA 4NBKA 1SB9A 2IYWA 1NU8A 4HYYA 5F7JA 1N6LA 1YCDA 2VVTA 3WAJA 1K6MA 3DFZA 3H11A 1MZVA 3V48A 2V7WA 2QSYA 1QJ4A 4BV9A 2PZMA 2AHRA 1N8KA 1NSFA 2CE7A 5HKOA 4F2DA 3KPWA 3PXBA 1RM4A 3LQYA 5JT1A 4HH1A 2Q1TA 1WOMA 2XJ4A 4HT3B 2YICA 1YMVA 2R68A 3KHTA 4P4UA 3HFRA 2W0MA 3TMAA 2KWIA 2E37A 1XA4A 2J6IA 3O8DA 3CS3A 3ANSA 1O8BA 2O07A 4FXPA 4H35A 3AVYA 4PICA 2VJNA 2RC5A 1RAAA 3ZG6A 1VCIA 3W2HA 3QOWA 2RH4A 4RZ2A 4YV2A 4N76A 3O91A 5JS6A 3K4HA 2IPOA 3QE9Y 4L3OA 1Z26A 3EFHA 5EKDA 3ZKWB 4RH0A 4M1MA 4Q66C 3H5OA 3PXDA 5KVCA 5F1YA 2WE8A