3ABSB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with adeninylpentylcobalamin and ethanolamine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 74
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3absB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3absB02
3ABQB 3ABRB 3ABSB 3AO0B 3ANYB 3ABOB
chains in the Genus database with same CATH superfamily
1NOJA 2OZPA 3I37X 5LZ2A 5FLEX 1F0NA 3A2LA 1PKEA 5D01A 1FCJA 1XBTA 4O2BB 5F51A 5AVJA 3WMFA 2AWOA 5TIIA 1QNFA 4JKYA 2QA5A 4HQKA 1Q2UA 4MKRA 5COQA 2QPLA 2XB8A 4Z9AA 3WGTA 4KQ6A 2BLNA 1LJUA 2YX1A 2GTHA 3LI2A 1QB8A 5ALDA 4J1TA 4Y1RA 4ZO4A 4JEIA 5IC6A 5LCXA 4ZPJA 1GL7A 1YQQA 3IRVA 4RQAA 5IMBA 5E4JA 2ODNA 1HV8A 3UJCA 2CDBA 2CFSA 5JPCA 2DETA 1MV5A 1SOMA 2FW1A 4LOLA 4BO4A 5CYFA 1HNWB 3IPAA 1Z2PX 1OT5A 4RLQA 821PA 2E87A 1Y6GA 2ZBUA 5B4VA 2AYXA 4V38A 2FW0A 1IUOA 4OHXA 3F73A 4CI0B 4TKUB 3SZOA 1JZSA 4RHCA 4Y2XA 5JT1A 4KI7A 3DKVA 3FUVA 3VNUA 1VJDA 1OAAA 3BRWA 5G41A 5B37A 3W6ZA 1PEAA 6NULA 2VHYA 4FMCB 3ZDRA 1M1YA 4INZA 6ADHA 1FS5A 2AF3C 3FH0A 4FCVA 5FFFA 2H92A 5JDCC 3DPSA 3AKCA 2Y1XA 4K9OA 4R41A 3VU8A 5MFZA 1E6MA 3SHFA 4IVRA 5B6PA 4I3GA 1H9CA 4H3KB 2BJVA 1DEXA 2VNSA 2X6QA 1TVKB 3LLCA 1PW5A 4L9SA 5AW4A 4AS1A 2UXBB 1NYRA 3MINB 1AHPA 5KMGA 5KB3A 1ZITA 1BQEA 4IGAA 5CT6A 3HA2A 1VLVA 3H5AA 5AJVB 4E2YA 4J1NA 4M1ZA 4ERXA 2WJWA 3K0HA 4MWZA 1Z6AA 3BHJA 2PAFA 1NSTA 2IZZA 2WW8A 3G13A 2VI5A 3O9MA 5K0CA 4UHHA 1KRHA 2UYCA 2CF5A 5KVVA 2PSEA 2V5UA 5I45A 1MQSA 2FPIA 2R00C 2XT0A 3HN7A 5MHTA 3IV9A 3UMFA 2G0NA 3AZOA 2LUOA 1QM5A 3R40A 2YMMA 2A9VA 3AHCA 3DEZA 4DCUA 4D41A 5EJ9A 2VH5R 3G8AA 4YK7A 3EC7A 3PUJA 3PNQA 4AECA 1NT4A 1E63A 3K1JA 4D99A 3ECSA 5F3DA 1TTHA 5F64A 2FN9A 1GQOA 2A5JA 4KHPB 1NT2A 1GNLA 1R00A 4Q7JB 1SOWA 1C4KA 4M1MA 2F1HA 3QUAA 3G2LA 3IVMA 4X1IA 2A9JA 2H1IA 3O2QB 4WNAB 4MIKA 4TMVA 5KDOA 1Q7CA 3ZZTA 3RAFC 1GZDA 3DAHA 3PT5A 1WHSA 1GAJA 1OREA 1DFHA 2AG6A 3V97A 4ENRA 1PLKA 2BMVA 1DAOA 1CYDA 1UWKA 2JBAA 4RHTA 4DYVA 5DTRA 1Y7LA 5A4FS 1O77A 5E6SB 5ICFA 1YS6A 3ZBUA 2OFPA 3P0HA 3GDWA 4L6IA 1HMEA 3NONA 1AKEA 2WTEA 3E22A 4C2AA 4DMGA 5IHPA 1S96A 1W9MA 4LRWA 4AJIA 4I1RA 3ZDQA 2XBMA 4GEKA 1VKRA 2VSFA 2CEKA 1GCOA 5BSMA 3KALA 3Q7QA 2WU4A 1VPEA 3LGXA 1B42A 5CJJA 1O95C 1TF7A 3WGNA 1GFWA 1R27A 4ZOQI 3CLTC 2B1QA 5LP6A 1PNVA 3S99A 1AS3A 1S6YA 1ZRHA 3JYHA 2WUVA 1YBAA 4DG5A 4EHKA 2FFQA 1K7FB 4QLOA 3V00A 1FUUA 5MF6A 3T7SA 1D1SA 4FX5A 2A0XA 4OL0A 1P4GA 5KCZA 4IOLA 3TINA 2E6KA 2Q1UA 3L0BA 3R3YA 4Q12A 4CKWA 4NJEB 5JSFA 2FDXA 3PWKA 4XGQA 1THGA 2X9LA 2OE2A 1GPAA 1H0HA 3UTDA 2TMGA 4HNRA 1YHNA 4PN3A 2O7SA 3O9VA 4WOPA 4IILA 3BRSA 1EMDA 4B3XA 2MDTA 4L4XA 1JKJA 4YPFA 1DMRA 4ZO6A 3U6BA 1OC4A 3TMMA 2ERYA 5G0VA 2XGJA 3AVPA 5EJ8A 5IDXA 2QT0A 4GHWA 4ZOEA 3NHPA 3SIRA 3EXG2 1A04A 4M1SA 4AO8A 2H4FA 1PWXA 4WLNA 3IMEA 4PPGA 2F9FA 3L07A 4P4TA 2W8ZA 1K99A 3ZV4A 1ZINA 2EBUA 4M1QA 4B47A 6REQB 3GXOA 5IUNC 4IQ0A 2HMSA 4XDYA 1ADBA 2BFDB 2NYVA 1QX3A 2X1LA 5DX1A 3CX7A 3GD7A 4MB2A 5FLKA 4N48A 1TAUA 4ZAWA 5DBHX 4ZAVA 4R2WA 3GB9A 4E07A 1WX1A 4B2LA 5TSDA 3FI0A 4I9FA 4IX9A 5C8YA 4JLAA 2BZ1A 2FX5A 5F23A 3ZDFA 3H7IA 2IZ1A 4G85A 1B00A 4GAEA 4R8RA 5D85A 3GH3A 4PNPA 2ZJ2A 1SVMA 3BSYA 5HEKA 3VMMA 2NO1A 3KAPA 4LECA 3WDMA 1L5OA 3S81A 4JP2A 3IV6A 2DEUA 3IDSA 1NG1A 1LQUA 1YCFA 2X77A 3NNSA 4FMBB 4WZBB 1A27A 1DOHA 1YOVB 2IEIA 4FOOA 5ARCA 5C31A 2XSZA 5KYWB 3TLYA 1OB5A 3M9LA 3OKFA 2AX4A 4K7JA 1THMA 1RZRD 1Q14A 1KAMA 5K8CA 2FJPA 2BV3A 2WHRA 1QZ3A 3R9XB 1V64A 5CXSA 1XQXA 4EABA 5E4TA 1C0PA 4LZNA 3EPKA 1T3ZA 4G2TA 4WBNA 5HKOA 1SG6A 3ANXA 4K0RA 3UUGA 2JFZA 4H7JA 4QO8A 4RZIA 5CW2A 1O95D 3WRXA 2ZSEA 1A8PA 4GYWA 5CYPA 3CLTD 5BUQA 3WLJA 4MEJA 4C4YA 4W5QA 5KKAA 1AE1A 1QNLA 2WWTA 5FPSA 5LVAA 1NN1A 4NDNE 4QQFA 1YFLA 4JDUA 1XAJA 3A6JA 2GQ0A 1CP2A 4ZOBA 3R75A 2VPWA 2QXTA 3P45A 2YIVX 3CF6R 2QUHA 2CO9A 3O8OB 5DZSA 5EQDA 2HHJA 5ALRA 5JRDS 1ZGZA 4AN0A 3PEEA 1K2VN 1TTQB 1WS6A 3R0ZA 4BHTA 4TTVA 5FWDA 3ER6A 2OXEA 4L2IB 2QPTA 4ISCA 1D3AA 4KQKA 3THSA 4BTVA 4ZJUA 4GWGA 2G1JA 3TGLA 3V7UA 4CPDA 4EYEA 4C4XA 4EY3A 4O5OA 1Z0JA 2UYOA 3NHZA 4OFWA 1Y8QB 2H0RA 3C8ZA 3WWOA 2IDMA 2J7PA 1EFRD 2AYZA 3T5MA 1P74A 3IE1A 5CM2Z 4MS4B 1S1MA 1NURA 2JNWA 3E6AA 4G97A 4ZAZA 2EJVA 4F12A 3ELYA 3KYDA 3PVSA 2GEFA 5EERA 4M9QA 3TVYA 4X9XA 3FHLA 4BCDA 4QYIA 2XVAA 4GDMA 4IHJA 1TZCA 1P7WA 4RK0A 3PC6A 3W7VA 1VE3A 4Q9AA 1AXGA 1GUBA 4YRZA 4OI4A 3ET5A 5AKEA 3CLUC 3ZIAD 3DWFA 2AQ8A 1VMEA 5DTJA 1GTSA 1N5MA 1AVTA 2IYXA 2PYIA 1S7CA 4OQQA 5EXSA 2NO5A 2I99A 2C04A 3IB3A 2KX7A 2RGWA 1IEVA 3WS7A 4A0GA 5JD5A 5JSZB 3FSRA 4M9XA 4EJMA 4GKVA 4GWKA 4DPLA 4S3MA 3BA1A 1PG2A 1GPWB 2O05A 3D31A 3F7MA 5EWLB 2WD9A 4G0VA 1JGTA 2ZUUA 5CB0A 1R8SA 4ZT4A 3EHEA 3ZKAA 1UDWA 1GA1A 1XJWA 2CLFB 3TTXA 2B9VA 3KTAA 4M7OA 1CS0B 4UM5A 3JQ9C 4ZOLF 3IO5A 3VX3A 3TW0A 4I55A 1M0WA 2CLCX 1KK0A 2W6OA 3OTHA 1DFGA 3MW8A 4JI3B 4D4MA 3WYAA 4JI7B 1QYIA 2WSLA 3ZCXA 2CDCA 4F5ZA 1IK6A 2EFGA 2RGGA 4HB0A 3QUTA 2WYOA 2R66A 4LSWA 1U1GA 4OJNA 2XYGA 3W2GA 1PDWA 2JI4A 4AO6A 1KDPA 1U6JA 2PSFA 4AL4A 5FO1A 3PD0A 3E81A 5IEJA 2GKGA 3UWSA 3CG0A 5D3QA 3VZBA 5CDFA 3A6GA 4KHZA 1PJ4A 1UK8A 3L7AA 4L15A 4Y6PA 5EXTA 1JBEA 4ER6A 4GQIA 4MYCA 4I6EA 5B1HA 4DPMA 4NS1A 2JFPA 1IHPA 4HY3A 2C42A 2D2EA 2FEMA 1V3QE 3OX4A 1ODJA 5HHTA 3EVCA 3NDPA 2O3TA 4KMMA 2Z6AA 2JKZA 5A71A 4YUZA 4GBJA 1S1CA 5JSQA 2OCXA 4N3CA 1Z7GA 2HU7A 4PLVA 2G9ZA 3CNBA 4POAA 2EBFX 2HREA 3UOGA 4ZZ3A 4RTLA 4BGDA 1Q0QA 3LOUA 4YV7A 5DDIP 2Z09A 2WF7A 1XAHA 2I87A 3BD7A 3IC5A 1XDBA 3IA7A 5AVWA 2NV2B 1JSXA 3C3XA 3DQPA 2QRQA 4CM8B 5F7XA 4X1OA 4C5BA 1WMSA 2WG2A 3CLUD 3ECAA 4RW0A 3ZEIA 3T5BA 4QIHA 4IKEA 3CGGA 3DUFB 2EFHB 1AKNA 1PUJA 2XCTB 1MX9A 3OPQA 1DX9A 4IDHA 1YI0A 1QGAA 1SBZA 4ZP1A 1E2HA 4NQRA 2PGDA 3AILA 4F8JA 3ROFA 1T2UA 4EAQA 2P6UA 2BGNA 2YFQA 5JYCA 3O92A 1LPOA 4FWTA 2QUJA 3AGPA 3T7CA 4EYKA 2HHHB 3AGQA 3L0OA 4JUFA 2R9VA 1XTUA 4MHOA 4JFAA 2VN8A 1Z5NA 1ZZEA 3NFYA 5DLPA 5F5XA 3FGNA 1KDYA 5FV4A 3SX4A 2GM4A 1QGOA 3K0FA 4UZEA 4Y2TA 5FOUA 3UAWA 1K66A 3HJFA 2O19A 2BCJQ 3F6PA 1XZGA 2Z2XA 3OAAD 3H2SA 4PYKA 3S2SA 3K0AA 4JXXA 1U2PA 1HA3A 2B8TA 2FWAA 2J3HA 3BD9A 3I32A 3PFFA 1HM5A 4ISBA 3G9QA 2XXBA 4LVNA 1RLOA 3DBRB 2O7RA 4RPCA 4RJKA 2QUAA 2VXYA 2BN4A 4OHYA 4HGZA 4ZOLB 3CN9A 3OTWA 3V4ZA 3OX3A 4B33A 1AC5A 1NKVA 4F9GA 2X4IA 4BJ3A 1L7BA 2OD9A 4ND1A 3TNDA 4ENPA 4Z1MD 3IP6A 4B3IA 1D6JA 1Y1RA 2BUCA 5AM3A 1CZLA 1OASA 1YZVA 1E79A 1PTJC 1PYDA 1VSTA 5GJCA 5DGTA 4UATA 1ZMOA 2G77B 1CY7A 1I36A 2JH8A 3AR8A 1RKVA 4LKRA 3QFHA 5DNUA 2HLDA 3G9XA 3UK7A 3JQBC 4AB1A 3VVCA 4P32A 3D2AA 2BKEA 1CUBA 1DBRA 1SXQA 1FQKA 3GFRA 2FFRA 4MTCA 1KSGA 1KJ9A 4C6HA 1YNSA 5AUQA 4L5AA 4DDMA 3L9WA 4FHCA 3B2EA 1KYTA 5F3WB 4F3CA 4Y9RA 1U0BB 5REQA 1XMOB 4BV3A 2ZQYA 3NYIA 2Q1XA 1BOOA 1MO6A 4K87A 2OZLA 4OQZA 5K0GA 4K1LA 1LSSA 1VKJA 1KF0A 3LV8A 1WUHS 2YXBA 3AR7A 3WRYA 3Q11A 1X0XA 3IT3A 3NTLA 4QXMA 4FFPA 4XJSA 2P79A 3VC2A 2WSSA 2F2TA 3THWB 3OFJA 3W1WA 3ROZA 2VQ6A 2J9FA 1GYRA 2WWVD 4UCXA 3UHFA 3ZOZA 2BZSA 4HMOA 2OCBA 3ZZNA 2DUNA 2RONA 3AUXA 3K4HA 3KG2A 4XOIA 2RB4A 4KPFC 4U39A 4D02A 4EB6B 2JW5A 2WYUA 1A50B 2BFEA 3LVRE 4RY0A 1DAKA 1VCMA 2F4NA 1DTEA 1TQ6A 4IJQA 5TS3A 2AHRA 5TS2A 3BSWA 1SIWA 4OH1A 2M6KA 4OIMA 4ZVSA 3I61A 1JLRA 5IC5A 4O4LB 4KQMA 3R7SA 4CNQA 1T9DA 1T1JA 2XYPA 3V33A 2IZ5A 4FOLA 4WN9A 5E8JA 3GP3A 1C7RA 1JRLA 2WKPA 1ZKDA 2PH1A 2E55A 4ZTUB 1R4NB 3RROA 1S4MA 2V7EA 4KOEC 5BMVB 2RBGA 2HSJA 5BO5A 3ZD6A 2ODEA 4PXSA 10MHA 3RVOA 3SQNA 2W90A 4DMHA 1OA0A 3UWOA 4RL4A 5KYXA 1IJFA 1UBOS 2QJTA 5KWEA 5JW6A 1QS0B 3I23A 4R2IA 4DSTA 1ST2A 4YV2A 4YP6A 2PO5A 5FD8A 2JGMA 1AK9A 3U48A 3WMXA 1NI4A 2PH3A 3PFIA 1PGJA 1PLLA 5CIYA 3ZDCA 1DWOA 5FLYA 1XAIA 2ZM5A 4RK1A 1P2TA 2PQ6A 5M5BA 4GYKA 1WM1A 5HJ2A 4BP9A 1D1QA 2BFMA 2VLIA 5CURA 1UM8A 2O50A 3IP9A 3RFXA 2WU3A 1KORA 1QKJA 3B7PA 3BCUA 4EQ6A 3KYCB 4HWRA 4TRRA 5F2OA 4ALKA 1TL7C 3V9AA 3BRCA 1EWVA 2ZLBA 1KJQA 4C3VA 3ILXA 1DJPA 1N9KA 1JEDA 2GETA 4H6VA 3MWYW 1FDVA 1G8HA 2D1FA 1DKUA 1BA2A 1JR3A 2R1VA 2YWFA 3C6XA 5CFOA 5JDIC 1B93A 3NHRA 1D07A 3QWAA 1X14A 3C3EA 1CW2B 4EENA 4NVRA 2HXGA 2X8WA 2LZ0A 4H31A 1NX9A 3EB9A 3I2JA 1SCJA 1LDYA 2YTZA 1JEJA 3AF1A 3KU1A 1QAQA 1VHWA 3IODA 3NETA 4GXRA 3CISA 3U0VA 5HOQA 3ODGA 2GZRA 2PXXA 3CUSA 2QRKA 4GZMA 4YT8A 2C58A 2JGDA 4NBKA 4RJLA 5FTNA 1M2KA 3VKFA 3LQQA 1I10A 3NORA 5EWJA 3X43A 4EA7A 2Q7DA 1NU8A 4AZ0B 5K0ZA 2JFHA 3T7DA 3JWHA 4XM2A 4RH0A 2IY9A 3O6VA 4FHZA 1W8IA 2CLMB 4HNQA 4DCCA 2UDPA 1ZICA 4MGYR 3SHQA 3U4HA 2HIAA 3TECE 2DULA 2DCMA 2O48X 2XCLA 3GHYA 3KHSA 4OK5A 4ML3A 5DCLA 5EKXA 3TB4A 5K05A 3PYLA 3ZQ6A 4ZVLA 3LDFA 5ESDA 2Z8XA 1P18A 2FRXA 3LECA 1A2KC 4CMIA 3FHOA 2Y1FA 1RYMA 4KP7A 4TSKA 3LKVA 2YQIA 1T9GS 2FPGB 2HWUA 2CHGA 2HPHA 1SZDA 2VR1A 3FYUB 3IMFA 4BPRA 3JW8A 1YDGA 3I2FA 4FFOA 2ZJ7A 4KQWA 4OXXA 4MW0A 4RKEA 1JQDA 3W6PA 4C78A 1KI2A 2ZW9A 3N6XA 4L4ZA 1TF5A 1ZM2A 1RWKA 3DYIA 1YAJA 3H5VA 3I53A 5CDSA 3GUZA 4X8MA 1SC4A 2Q7OE 1RQNA 2DTDA 3E9NA 3EF1A 1J0CA 1RD4A 3A1FA 1M7HA 2I2FA 3LDGA 5TPWA 3GR6A 1JWLA 5JBNA 2XMCA 3FPGA 3KDAA 3NBFA 4QGGA 4MVXA 1H5QA 3OKPA 4Y7DA 1U4NA 1W85B 2N1MA 3GLHE 3O47A 4G84A 4WASA 2CMKA 2CCGA 5ALFA 1NF8A 4V39A 3KXDA 4N65A 1AB5A 5KJCA 3MT8A 3TUZC 5BYKA 4K2HA 3WL4A 3I28A 1OLXA 3DT8A 1ZG3A 2JAPA 1PQWA 3FXAA 3GV0A 1OGIA 2ADOA 4OM7A 3TOZA 1A7UA 2P6PA 2JGFA 4M7WA 3RRMA 4GRAA 4QDTA 1ODLA 2X9VA 3IBFA 3R5JA 3WO0A 3WVNA 1HOXA 3S29A 1Z7EA 2BEVB 4YUAA 2O1XA 4IG9A 4A9AA 3SZUA 3U7EB 3P9QA 5KEIA 3JU3A 1O4XB 2RAFA 2AWNA 1NTOA 2ZSAA 2W6JD 3UYKA 1CKEA 3NI2A 3QY9A 1BA3A 2JIPA 2IH4A 1MG0A 2PU7A 3V2UA 4R2KA 4NZPA 5DBGA 5HQ3B 4WCVA 4WEQA 1JWBB 2R8XA 4QFMA 5GPBA 2ASVA 4Q01A 2AUNA 1Y9AA 4DDTA 2QV0A 1B23P 2XXJA 3B1KA 3FX2A 4OB8A 3C48A 1ODKA 1D8TA 3OCVA 2AI3A 3NBUA 4G8CA 3KR9A 2J6BA 3ORYA 2V8BA 5LUBA 4C43A 4R68A 3QXGA 3WLSA 3TLBA 2IUSA 1N6RA 5BN4B 5CCBA 2C2KA 3K16A 5HOEA 3T5TA 4CODB 5EVCA 2AN1A 4Q4DA 4B84A 4BKUA 3QP9A 1PR2A 1QPGA 3EZ7A 3M1AA 2QE7D 4AJOA 3G6KA 3SQXA 5JS6A 2FQWA 2IDJA 3KOXA 2AXQA 4GMHA 5FHRA 2QMQA 1DJNA 1Q0SA 4LJKA 4I14A 2L2QA 1REQB 2AZDA 2PHZA 2YZKA 4M2LA 3VKUA 4GKKB 2FQYA 3I3OA 4BVLA 4HLCA 1CF9A 1XR3A 2OZKA 5K8TA 3NAMA 1E2NA 1LH0A 3FR7A 1MLDA 2NXWA 2GBGA 3H11A 3KC2A 4ZTBA 4EEKA 4D7AA 1TVCA 3RC8A 1VJCA 2FWIA 3HK2A 5AW8A 3AVTA 4Q9HA 3K71B 4PSUA 1WVGA 2I7DA 3W1VA 3IVGA 4UUAA 1KU6A 1Y5MA 4LHSA 3OPVA 2XF2A 5AUPB 4LF6B 4LYGA 5A6SB 2BGJA 1UJ4A 3K92A 4H3VA 3P2OA 1ITZA 1Y3IA 3DEFA 4INOA 3SEAA 4YMGA 1YXMA 3NTXA 1HYHA 4Z6KA 3JYPA 4G63A 3BVPA 4TXNA 1R6BX 2GXQA 1DJOA 4RAOA 4IQGA 1FK8A 2FSHA 4IV5A 2Q0HA 3Q3IA 3AOGA 3NATA 2EJWA 4QBGB 2F8SA 2GBLC 1S8AA 1T43A 2FP4B 3AUFA 3WYGA 1BWSA 4EDHA 5BV0A 4G9BA 1TU4A 1RXIA 2WHEA 4L08A 4W7SA 3V8NA 4H1WA 1KWKA 4I99A 1PEDA 3DOCA 4L3VA 5I5GA 3ANMA 3RRNA 3I8OA 4LZOA 2NQTA 4ALIA 2I2XB 1KMQA 3O82A 5IJ0B 5KNCD 5G4KB 4BN4A 6Q21A 4AJNA 1X80A 3PLNA 1KRXA 2O1WA 1GIAA 5LKRA 3PXDA 4C05A 1HDOA 1SG9A 4UCFA 2ZTUA 2ZTVA 1AKTA 4JGBA 4EYOA 2UXCB 2PE5A 1F2DA 1E94E 4FM9A 4ARUA 3WK8A 2GRAA 2VDPB 2L69A 4EUSA 1AGYA 2FDCA 2DQKA 4MOWA 1WB9A 2F48A 2C4WA 3FCEA 2RD2A 4K0KB 3RVLA 3IUNA 1T8TA 2J9GA 2HRBA 3B53X 3X1YA 5BQFA 4R51A 2VOJA 5BSGA 4ZYYA 1C7QA 2ZYVX 3DJFA 4DBVO 5AW7A 8LDHA 1KVRA 3F47A 1ZOLA 3AERA 4M3NA 2J5BA 3VHXA 1GARA 3FNQA 1NFFA 1VB3A 1WDMA 2VUSA 4MIEA 1BFKA 4BS9A 1CNEA 2RI0A 1D2MA 1O9BA 2WTXA 4E15A 5BWOA 2FCAA 1IHOA 4MYDA 2BMJA 5AIBA 3R5HA 3LCVB 1S3FA 4YCMA 3PGXA 2BFWA 4IGIA 3NM9A 3A1CA 3QLUC 4HAXA 1LEHA 1WD7A 2ZUWA 3GG2A 3QHAA 1KAOA 1GZ7A 1M1ZA 5SY6A 3V1TC 1GGHA 5ESWA 2RCYA 2GCNA 1KE2A 5AW3A 4UDNA 3T1NA 1VDMA 4H60A 2EEZA 2L18A 5CLGA 2B69A 2NQ8A 5GV7A 4X54A 4D9FA 1V1MB 3W5BA 2EZ4A 4I0WB 2CBXA 1M5TA 4NONA 5AK3A 5DGIA 3W3AD 4RTKA 1E96A 1X13A 4LF9B 2GYUA 4BMOB 4LRQA 3W6OA 1MGPA 4OLJA 3A8TA 1ZMRA 1E7QA 4TQ9A 2IEYA 3VSDA 3QE9Y 5BXYA 1YBMA 2BAGA 1EVQA 3MNFA 3QEMA 3EAGA 5ECWA 3NHAA 1KI6B 2JFUA 3DV0A 4O1IA 3OA0A 3WWZA 3KSZO 4P34A 1DDGA 3ETHA 2ZPUA 4CR7A 2W4MA 2W98A 3KWMA 1NNEA 1EAYA 3IAS6 5FPTA 1YR3A 3CUYA 3I4LA 1PS9A 3TQ6A 3W4KA 3V4RA 1VSVA 3ES9A 3TIXB 1R9JA 2HMUA 2YVLA 3PNLA 2Q9CA 3C41J 3GJXC 1LX6A 3IQEA 1X8KA 1J24A 3KM0A 3ZKWA 3J7AC 4DEXA 3D8SA 1EUYA 5K3SA 1N2CB 4XCXA 5CB8A 3CY6A 4IKPA 4CM1A 1K92A 2DSTA 2WEKA 3HKBB 3MWGA 4N3BA 2O2SA 5TY0A 1H69A 3A27A 5I4IA 3FB1A 3B9RA 2QZSA 2SKCA 3C87A 4CLOB 2LNDA 1P1RA 3EXHA 3FD8A 4B6EA 1W88B 7GPBA 4EK9A 1GAWA 1I1NA 2A5LA 3D4NA 4I7EA 3QI7A 1BE8A 1QV9A 1UL1X 3P2YA 1MG5A 3C2QA 4FBMA 3GA0A 1VE9A 5FB3A 4QZVA 1CQPA 2R6R1 1PVVA 2DTEA 2V1UA 1RAHA 2VFAA 1E89A 1J9ZA 2R7MA 3GEIA 5CNKA 3SQDA 4F85A 5JNTA 2Z2KA 3QKRB 3UMCA 4OLFA 1QSGA 4U3JB 1TUBA 1V4NA 4M0PA 4CM5A 4D9MA 4R6XA 1A5BB 3P94A 3ONNA 4WQMA 1YVPA 1WABA 5JE8A 1RXSA 2YYZA 2PGIA 4BP3A 5KTTA 3COWA 3HY3A 4Y9UA 2QM7A 1F4PA 1EM6A 2ZE7A 3W8FA 3RCBA 4BX0A 4AAYA 3IBYA 1NIPA 1MOQA 3HB7A 4IO0A 2I2WA 1XVIA 1NM5A 4JDPA 3UWDA 1DO2A 1XLTA 3UICA 3ROKA 3ZU3A 1SUAA 1N3YA 2QRVA 1Z06A 2ATEA 2V0CA 1U2RA 2QIOA 2W2VA 3FZYA 4UUNA 4ZVMA 4BMNA 4BV8A 2C8JA 3LC0A 4F6LA 4LXXA 5M2QA 1XD8A 3EQ7A 2Z4TA 1G18A 2GLTA 3GQVA 4RV4A 3R5SA 4Y2GA 4DBLE 2OQIA 1HRZA 2BYTA 3GFFA 4PAMA 1HT0A 2DXIA 2QN1A 5SYAA 1PEYA 3M3PA 1EFVA 3CS3A 4R69A 1LPAB 5NULA 3GZJA 5AOAA 1UJNA 3C45A 4PZEA 4RM3A 5ECDA 1DINA 3UMVA 1EKXA 1SVOA 3T7JA 2G3YA 2Q6KA 4ZI3A 1E2KA 3EC1A 2Y2UA 3L7BA 4WLVA 4RYLA 5CYOA 5GJBA 3QXHA 3R6LA 4G23A 3H75A 1ESDA 2Z2YA 1HE8B 5F21A 1LLUA 3ZE8A 1YGPA 2I3BA 3I72A 1KA9H 4HTAA 5DSXA 4AC9A 2ODBA 3IYLW 3NWEA 5C2JB 3CVVA 1GADO 1WDTA 3ACCA 1UAAA 1SCUA 1CDDA 5TC4A 3VNAA 4YY3B 4G4SO 2AOUA 2N47A 2YWEA 4OHVA 4UM8B 4XI9A 3A2NA 5EVJA 3NEJA 3SYMA 2G8LA 3BOSA 4LW8A 4RKQA 4HWOA 2CUTA 5LXTF 3ONWA 3ZE1B 5DHAA 5K6AC 2V1XA 2YS7A 4OF4A 3EVGA 1S0UA 3KV1A 2EFJA 4WLEA 2DQZA 4P0QB 2QN9A 4MVJF 4N8SA 5DYYA 5EMNA 5SYNA 2DHCA 2DR3A 2VF7A 4KPYA 4JASB 3LC1O 3LPDA 1DBIA 4RCZA 4D3ZA 1VCOA 4C7XA 4DANA 2YCBA 1L5QA 5BNIA 4PS1A 2IF2A 2OBXA 2ZPTX 4XM0A 1XI2A 4F1WA 2J0UB 2EWVA 1P91A 5IWAB 1OI4A 4YGYA 3CUTA 4EM6A 2E37A 2EW2A 4LN1A 4OYLA 3V8MA 4CM3A 2FWJA 3ODPA 4N0EA 2DG2A 1EX7A 1DUIA 3CLSC 3X3HA 1CRPA 1A8UA 2JD2A 5IPFA 1TMYA 3ESZA 1J97A 1PR0A 3WOVA 2PGXA 1W36B 2W8BA 1FDOA 1Z4MA 2X2EA 1FMFA 4E5SA 3OSUA 1UFVA 2R4QA 4M8NE 2W0MA 1F5SA 5IJAA 4E21A 2F1RA 3IAS1 5HZGA 5JZOA 2O8BA 3M6IA 4U7TB 5C34B 4TTIA 3A9SA 1DIGA 3PPWA 1XHFA 2AXPA 2P11A 2R6JA 4HH4A 4KQHA 4LX8A 5FO0A 5JCJA 3NBYC 2CVHA 3A11A 4B1FA 5KKCA 4NOLA 2FVXA 3G88A 4HNAB 4Q1FA 5JVDA 4PX2A 3C14C 1NXOA 2I33A 3KFLA 1XMVA 3VUEA 4IJ5A 1BU8A 3FCXA 4PSAA 3JQGB 4JJIA 4YCBA 4RA9A 1MA3A 4LMPA 3ZWQA 3LPNA 1YS7A 3RK4A 3ZK8A 4CHTA 1F7VA 2IVFA 1KJWA 2OUKA 4J0HA 1VMIA 4DDVA 4JLVA 1U0LA 4AG5A 1T5DX 4IV8A 5ERYA 4FBLA 4QULA 3G89A 3E1KA 3ZCSA 4MGIR 4DRXA 2XI4A 2V7XA 2NAPA 4WA7A 3J81A 4WZAE 1BSVA 1Q1QA 5FUMA 5IWCA 1S2GA 3ZHQA 3MWFA 4DVJA 2YWJA 4YI5A 3I5MA 3OLZA 3HPRA 3I2YX 3ITKA 3LHSA 3P9KA 2HNKA 4GPAA 4QFBA 4QXOA 3DMGA 1E5TA 2V59A 3A32A 3L1UA 2HCJB 3MTJA 5L51A 1PGQA 1SZCA 2ADMA 1QHGA 1VLJA 3MUFA 3WWYA 4CFYA 5L4LA 4TN5A 4CKBB 3U81A 2G0TA 1NNSA 3QYAA 4R9NA 4DC9A 1TO2E 2PK3A 2C8LA 4N03A 2YOGA 3U9SA 5IKEA 4PTLA 1XTIA 1JJVA 1JIIA 1NXVA 1US8A 3Q8KA 1HI9A 1OXVA 3A70A 3ND5A 1R4MB 3CNLA 1B8VA 3EVZA 5DPMA 3ZH2A 4PZPA 4UZSA 1X6VA 4Z0TA 4DJDC 1IAVA 3MCUA 2IYAA 2FZWA 3BC1A 2C61A 3OX1A 1J5XA 1O96B 1TECE 4XTRA 1RR6A 3RO7A 2HK7A 1EK1A 1KS9A 1I3LA 3OE4A 1JV2B 3NW9A 4U7GA 4C14A 2J3KA 5COAA 4TLLB 1Q0UA 2X3FA 3QE0A 3ROXA 5IVHA 1B7GO 3CLSD 4B46A 2X1MA 3FSGD 4QUHA 4C0QC 1KEKA 1R4AA 2KB0A 3RABA 1VG9B 3WKAA 3D02A 2IJGX 1F2UA 2YV5A 3VXKA 2ARKA 4D8XA 1USKA 1WSDA 2JBHA 3W5IA 4JYZA 3PPVA 4Y18A 1FX0A 1SVLA 1RFGE 2GSDA 4PSVA 3CSSA 4TWBA 3VJKA 4DEYA 5CG1A 1KVQA 4Y2SA 4DSUA 4V0QA 1NU6A 2PL1A 3TRFA 2X9QA 2XOKD 1LLQA 3G23A 3W5JA 3IQIX 3R0XA 4F6RB 5LUAA 2FOXA 3Q0TA 4EFKA 1P9WA 3CF0A 4EHLA 3QFSA 4D4GA 2A14A 2X19A 2P4EA 4JLKA 4MKZA 3OT1A 2NTNA 3VR1A 4W8GA 4B3HA 1I9GA 5JRZA 4BNWA 1PJSA 3ESYA 2ID4A 2IYYA 4B82A 1I7NA 4W7HA 3QI2A 4XUGB 2ET6A 1YQEA 5EKSA 3B6IA 4REQA 1RQPA 5CVVA 1JB1A 3IUYA 3H42B 5IRCD 4YRLA 1KQOA 4M1TA 3I8SA 4MAMA 1J06A 1TJ5A 5DN6D 5KPDA 1T2VA 4P7JA 2JZCA 4PZZA 4HN4B 5G1PA 4QQ8A 3UZUA 2OGTA 1NNI1 4FKZA 4I36A 5G3YA 4PCAA 2JI8A 1ZK2A 4ZU6X 4ETIA 3QQPA 1L5MA 2DFPA 4DA7A 4Q19A 3GIDA 1WKCA 3BK1A 1VKZA 3BXOA 3EEYA 3LXXA 4FHGA 2J3JA 1B6RA 4OBBA 1LBIA 2B21A 4UTXA 1OE0A 2B3DA 1G5IA 2Y1GA 3TSYA 1TUGA 1JX6A 4MRMA 3PITA 4D0GA 1UXJA 2OXCA 4JI0B 1J09A 3HXKA 4GGMX 2QTVA 1XCLA 2VVTA 2YRFA 1KEEB 2HLPA 3NEPX 3HKDA 4HKTA 4DMRA 1WZUA 1Z2OX 2J0VA 1LJLA 4QDZA 1FBNA 1GPBA 1FRFS 1N5IA 5BRJA 621PA 1DSSG 1I6LA 1U1IA 2ZE8A 4C7MA 4YMWA 4GX1A 3K72B 1P0FA 2QSZA 5A1JA 2R751 2CHVA 1QG0A 2YZMA 3RWOA 2QORA 2QTBA 4MKXA 1IDN1 1UBUS 5AW9A 1TIBA 3EH2A 2VG8A 5T4HA 4EMSA 1JKMA 3ZVLA 3F4BA 4CM4A 3RT7A 2VJKA 5HZKA 2C3OA 4REMA 1T0HB 2HTFA 2RAVA 1E0SA 4U00A 3UBMA 4OQNA 5DYGA 1FLAA 4L74A 2WM9B 7REQA 1I24A 3DAYA 4L3WA 4OGFA 3VGPA 2WYIA 2GCOB 4WERA 3MGAA 1GAQA 1DIHA 3FPEA 4ZK2A 5JI2E 1VL0A 1FVFA 4ENSA 3N2GA 4OGLA 1SOVA 5BMOA 4URXR 1V6AA 4TUYF 2D1QA 2WLTA 3D3WB 3HR8A 4HNGA 4Q1AA 1P4SA 1MXFA 5FAXA 1X15A 3NHFA 1BO6A 1NVUQ 2JLVA 1GTMA 1EBFA 1A4RA 1NE7A 1SBCA 1VL2A 4M89A 4CIYA 3HTXA 1O5OA 3NIFB 4HV4A 4O1MA 1ZCBA 1NXSA 2GN8A 1X1AA 4MYHA 3F27D 1GTJ1 2BRUC 4Y0AA 1ZGBA 1Y6FA 1L7VC 1FP7A 1NRWA 5D1HA 1U3GA 3RYHA 1Z17A 3B5JA 5CGQB 2HUPA 3DLTA 4QDXA 2CXNA 4WL0A 3BL5A 2DQ4A 3TB6A 2RHTA 5F7ZA 4C29A 5B12A 4UQOA 3OWXA 3EIUA 4JNCA 3NDIA 5E6RB 2P4QA 1VOTA 4GE0A 5E9WA 4M8KA 4NIMA 2RFLA 4DCTA 3WBKA 1EGHA 1HTBA 4HDNA 3EBPA 3U3JA 1GG2A 1WSAA 1TZKA 1TFUA 3H4MA 4HPJB 1XA0A 1V3TA 1IE3A 1LK7A 3ETJA 1FP4B 1GU1A 3AHDA 1QTNA 1ZIDA 4MVJI 5J2TF 5KQGA 3SYLA 4ZIRA 1KJIA 3BQNB 4DADA 3IPRA 5EJ7A 3MQ2A 5AVVA 1QTQA 3N8IA 1R2QA 2PH5A 4N5MA 2FQ1A 2FEOA 1K6IA 4LDZA 4LISA 1V8DA 4D44A 2HA5A 3FUWA 5BV8A 4JOCA 5JSKA 1F6BA 1RCUA 3D6TB 4B4WA 1L4GA 4EITA 3JVDA 4LWOA 3RM3A 1XMXA 1LLFA 5AHRA 1YCDA 2Q9AA 1I4LD 1KDTA 3AHIA 4NENB 1CJVC 4F3YA 4W82A 4KYIB 5B6IA 4BXOB 3E2IA 4RJIA 1RYFA 4BNVA 4OL9A 1BGVA 2RGEA 4ND8A 4S1TA 3WGGA 1QFZA 1S2NA 2AMVA 3ND7A 1T0PA 3PB3A 4JU8A 4NI5A 2QI9C 4Q66C 2JKVA 3OCXA 2HT1A 4BMCA 4PLGA 2DM6A 1JHUA 2Y1OA 5CXUA 1BXRA 2J8ZA 1EB9A 4N18A 3C7KA 1L5HB 4WY8A 1EK5A 5IJWA 2CBZA 3BAZA 2R00A 1RI1A 1N9GB 3L8CA 5CTJA 1XPRA 4ONEA 2FPKA 5U4XA 3K2EA 1EAMA 1H6AA 2CJFA 3H0CA 4OMFG 5HQJA 5I8PA 3KP1A 2O0KA 1ZJ4A 2OV6A 3HU3A 3QBDA 2W2NA 3QSGA 2EERA 2EDAA 2OXFA 1LCIA 2OG2A 1PAUA 1RPNA 1COZA 2DKFA 2MSNA 2RC6A 3C6MA 2DCUA 3ISJA 3L1HA 4TUYB 4Y6QA 1LXCA 1MVNA 3QLJA 4LXGA 5ALTA 2NTJA 5J4VA 2J7KA 4B3TB 1Q0LA 3P9YA 2GCEA 3K1YA 4QATA 4OUDA 1S8FA 3QW4B 1BVRA 5A7HA 3UA4A 2NP6A 3RIMA 2RH5A 2VXBA 4F3NA 1E9FA 1HYQA 3IESA 3ZIUA 3LM8A 2ECFA 4M9RA 4A1OA 4KFUA 3R5TA 1AUQA 1GNQA 1PYOA 3EGIA 1FX1A 1YVDA 3RS7A 1JECA 1YQTA 3D7NA 1P3JA 1W96A 4KZKA 3A4LA 5EGNA 4KWEA 1RZRA 2XYRA 3ESQA 5DT2A 3LFHA 3UWKA 2B92A 3FMFA 1E7YA 3EQ9A 4BX2A 1J8QA 3VR2A 4C9BA 3T99A 1QF6A 2PWZA 5FA5A 5IJ9B 2NP7A 1T1GA 3QVLA 3BMOA 2JK0A 2JHCA 1O95A 2RGAA 1HNZB 2Q21A 1TYCA 3GMSA 3MXOA 1SXJE 4C0JA 1MQ9A 4DJJA 3JQPA 1NLFA 1XJ5A 4U4AA 2NXNA 3CYFA 4JV5B 3VBEA 5A1TA 1P1IA 1P7YA 4IWYA 5J2TB 3AM1A 1GRVA 1H2AS 1WY5A 1ZH2A 3BKWA 4MVYA 4FIZA 1P4AA 5IBRA 4MRPA 1ZWLA 4KLCA 3R6TA 2I71A 4D56A 1K3TA 4RU1A 4MR8B 1RRPA 5K6RA 1T9AA 4EO4A 1G7SA 2PKWA 3SXJA 4E70A 1BXGB 4BRSA 3LY5A 1NBIA 1F6DA 3K1ZA 5B1YA 3LCRA 1PDVA 3NHBA 4XGRA 4DLUA 1FSSA 1V6SA 2ZYDA 221PA 1N0VC 2X8LA 1Q91A 1VBFA 4L78A 1QQ6A 1MD9A 1V7ZA 1TTTA 1J0DA 4FJ1A 1NR7A 2QM3A 3R74A 4I66A 4IZ6A 1JLLA 4H7DA 4MDHA 1TM3E 2FPWA 1WBDA 3DFMA 3GGJA 5FJIA 2GM9A 5ENDA 1F51E 2RGUA 3WFJA 2YWXA 1NP7A 3PDHA 2ADFA 4HNVA 2O8DB 5HK8A 1M9NA 1H6CA 4HI0E 1J1UA 3VVBA 1SUFA 4B6JA 1GKIA 2GNOA 2Z9CA 3TH5A 3PC4A 2ACEA 4NARA 4Q9KA 2PLNA 1SURA 1IQ0A 1XZJA 3FVVA 3KQSA 4H0FA 1WU7A 3IP8A 5JADA 2FKAA 4X65B 3X2EA 3ZIAA 4KV7A 2C9ZA 4MV9A 5CAEA 5AW2A 3VH3A 5JXGA 5J2UA 1QPZA 1M5RA 3AEYA 3LDAA 4TV8F 3D5TA 1E9EA 2OC4A 4V02A 5IUKC 3WJ7A 4UFOA 1EUDB 3IMCA 1I5RA 1MB2A 1UC8A 1FU4A 3KUXA 2JGLA 4RDXA 2CLLB 2C9YA 4EL5A 2BLLA 1WULS 4NBWA 1ORHA 1CE8B 1YT5A 1NOIA 2PZLA 4HYTA 2OV4A 3L04A 2QRZA 4GU5A 4FCTA 2NX2A 1RJ9A 2H7CA 4TV9F 3LXRA 4MJ7A 4H15A 4JIGA 5HMLA 3HB0A 3UHAA 2DKNA 4NYIQ 4QBKA 1G41A 4EVQA 1D0SA 4MR7A 4IIGA 4ZPXA 4MWTA 3QITA 4RIIA 4G07A 4ECEA 2CVFA 4JELA 4H77A 4MARA 1EVEA 3STHA 2Q0QA 5JC8A 1W5FA 4MMYB 1KEZA 1YB7A 4R5HA 1ZLYA 4D2IA 1ZONA 2QY9A 2HRDA 1NPYA 4ZVUA 3UF0A 1UOOA 2QTHA 4HDKB 4M21A 2QZ4A 3VAZA 4B79A 5CD1A 3BREA 3NBMA 4JB2A 3ZX5A 3M4YA 1YZ3A 4MRRA 3U4QA 9MHTA 5H7XA 4YAIA 5D1NA 4C0BA 5B30A 3WL7A 1XF1A 4Q7MB 2I5PO 2V55B 5J40A 4QBFA 2BSQA 3TKLA 2I6GA 1F7UA 2BGMA 4OYHA 3GDOA 4GOND 3H4TA 3O93A 1UBNA 4G1BA 4LMRA 4ZZ2A 2AJ8A 3PT9A 4TOIA 5SZJA 4CQJA 2VT2A 4HAOA 3L84A 2I2BA 4G09A 4EA6A 1UIMA 4HDSB 4JYMA 4RS3A 5IVIA 3SSAA 1KERA 3NWJA 3AP1A 3TJMA 4C0AC 4LNUB 3MWDA 2AN9A 2K7ZA 2QX8A 1DWQA 5AVUA 2ZS8A 3RFUA 2A7QA 5JQGF 1TAQA 4UVEA 3VPCA 2EZ9A 3ENNA 4INAA 4QBTA 5CA1F 3GJ6A 1ORIA 1PSDA 1EA7A 2C5EA 1ZESA 4JVNA 4NEHB 4RVFA 2AQKA 3TOXA 3UJDA 2WBLC 2MSEB 1TEHA 3FGHA 2Z58A 4CQLA 4O4HA 2BFCA 1GRRA 2X0IA 3AFOA 3O8LA 4TVBA 4DBLC 5T41A 3LZCA 2BVNA 3RUAA 1NXPA 3B51X 5LMZA 1EINA 3CLKA 2X4GA 2XZOA 1EXNA 4KQEA 4PCLA 2E4VA 2XAUA 3NCTA 4FOPA 1JDTA 4WGGA 2OO5C 3CLRC 5CDTA 5J23A 4IDGA 3JASB 4HWGA 2K5UA 3OECA 4UEKA 4DXAA 2QYSA 3MFYA 4EF4A 5BN3B 2QGFA 2P1ZA 1CUHA 3NRJA 4EG7A 1F9EA 2A0FA 3DVRX 3T4EA 3GLQA 2AG0A 4Q3KA 5DX0A 1SB9A 2GDZA 3RBZA 3BE4A 3ZU6A 1MAWA 1Y1PA 4R1LA 1F0PA 4RHYA 4RV9A 3EAQA 4WCFC 4TLDA 4W6QA 1JQJC 3HEMA 4ENQA 5I9BA 4GG1A 2K2QB 5K09A 3CW2A 3NJ4A 2VYCA 1IMOA 3OAAA 4HD8A 2FJ0A 2BISA 3RKUA 3SR3A 3V7WA 2RK3A 4TV9B 2CXOA 2C2XA 4HDRB 4J16C 1E3SA 1L8OA 4PPYA 5JSYA 1M2JA 4RJTA 1BCRA 2Y76A 4GNKA 1YUMA 2CNOA 4I9GA 5HTOA 2C4TA 3BXPA 4F72A 1G5QA 3OQHA 2RJOA 2WZDA 3IKLA 1FNCA 4Z1MA 1C9MA 1C0EA 2DTXA 3ED1A 2Z9BA 3OZSA 4XPZA 1MCZA 1NWCA 3AJRA 4LJ9A 5FL3A 4A03A 1SKYB 1CT9A 1GN9A 4ZGBA 1UPAA 1FL9A 2D2IA 1G5PA 4GP6A 2XDQB 3U19A 5C8VA 1M34A 3F5FA 4N8EA 5F33A 1N1DA 2WP8J 3QPAA 2TYSB 3VSBA 2PX5A 3LLSA 2Q6LA 3S1AA 3SZMA 4J07A 1ZQ1A 2WJVA 3SHWA 1UJ5A 5DI3A 3L6BA 3D4LA 3FNEA 3OT5A 1H6BA 3CVXA 1F8FA 1V35A 4JNKA 3UMRA 2N3ZA 3LK7A 1ZA2A 1UMDB 3H8SA 6ABPA 4D8VA 3P2MA 4I1VA 4KR9A 2WFMA 5LYYA 2W6CX 1KJJA 4FHFA 2IHVA 5JV5A 4BNDA 3LTNC 3BF8A 2VHVA 2H1VA 2JG3A 1H8HD 2WSIA 4Q3EA 1TLLA 1SKAA 1YZYA 1HC7A 2JB9A 4ZKDA 4M9CA 5A02A 3OQPA 1EUCA 1R4ZA 3CZ9A 1X8JA 1P2VA 1GVHA 1XQ6A 3GJ3A 4C4RA 2FWPA 4TKVB 1IN1A 3AEQA 4W5JA 3WQQA 4DAEA 4EMTA 2OHVA 1MC5A 2YFHA 2NSHA 3CLRD 4UUOA 5JLJA 4EHAA 3JQEA 2C2OA 3HWSA 2Q8QA 2Z3ZA 3KTDA 3AVXA 4ZCLA 1KGDA 5HG0A 5JMTA 2ZCJA 1OI7A 2AQHA 2R7KA 3D7SA 2EQBA 3K0CC 3N74A 1EZ1A 2XE4A 1LPSA 1KC3A 1VG0B 4DF3A 3EK2A 2JAHA 4DJEC 2AHOA 4W8OA 4X90A 5BWBA 4FT2A 3II6X 1OFVA 4QREA 4CR8A 4KITB 3EGDB 3CNOA 2HHAA 2XNKA 2ZRAA 1RJGA 3EDMA 4Q18A 3WJAA 4U7WA 5TNXA 1P0CA 2AVDA 2FPRA 3HP1A 1JSZA 1LS6A 2Q3HA 2Y1LA 3PUVA 3OQOA 3PNKA 2XGOA 2ZXUA 3KKEA 5CBPB 5DNCA 1IN8A 3V3KA 3N3AC 4LYHA 5P21A 2OB2A 3D54D 2PS9A 1ECGA 4PXYA 3L3BA 5ALWA 2PZMA 1H2ZA 3TSOA 1I9CA 2BJWA 5FCDA 4DUGD 4JGGA 2AJCA 2QRMA 5A3RA 1P1HA 1M8GA 1N6HA 4KXFB 2GZ2A 2J31A 1MRZA 2QWXA 2RB5A 1U99A 3MA0A 5E6UB 4E14A 2F67A 3H9QA 1OIWA 5C80A 3YASA 5EPOA 3OJOA 4MCIA 3UJHA 1PTJA 2H1SA 1FTGA 4L8GA 4DUPA 3BGIA 4U6NA 1NRXA 3H5IA 3U7GA 5LBTA 1EFUA 4NPAA 1AUVA 3QFCA 4JUDX 4R9SA 1M1UA 1YL6A 2QW0X 3LPLA 3ICQB 4KDFA 3UB3A 3ZY5A 5HFAA 1Z6TA 1EM8A 1PV1A 3ESXA 2XOXA 3OZGA 4UPVA 5COBA 4XLZA 3RTAA 1GTZA 3LKDA 3GRPA 4Y9SA 4GOLD 2PGJA 4DA8A 1W4CA 1YQDA 5ALNA 4LYDA 3CUWA 4RHEA 1SKUA 1ZU5A 3LD9A 3R8XA 3BMQA 3NBZC 2CSUA 4DN6A 4UC0A 5K8UA 1FP6A 2OMKA 4YP0A 1MX3A 5FUYA 3KB6A 1S89A 2XMQA 4BNFA 4COOA 1NPTO 2M6RA 3MTBA 4MV8A 3MOGA 1AZWA 1JU3A 3N2EA 4MA0A 4KO8A 4PFSA 1GSIA 1GNTA 3C6QA 2W83A 1R6TA 3OIDA 1ZD3A 4JI8B 2JKYA 3IT1A 4AQDA 4IXWA 2GOYA 5L3SB 1ZDMA 3K4QA 3PDUA 5KNCH 3T0IA 2O8CB 2AKAB 3GU3A 3K35A 4NC9A 3I6IA 3KJIA 1T0UA 2BUBA 2R8OA 1G2QA 3G5MA 2WFZA 3MWJA 5CG2A 2XAAA 1NNUA 3FKSD 1YC5A 3CSUA 1P2GA 4CR6A 2GO7A 5K1ZA 4FC6A 5DU2A 3SR0A 2JGIA 3F71A 2J9YB 2XXAA 2RKWA 4JSTA 3PFBA 3VGJA 3QRWA 4MO2A 3AI2A 3IR6A 4EVIA 2WYWA 4NU5A 3STXA 2GK7A 1ZUNA 1XK6A 1W94A 2PRZA 3ZLUA 4BVBA 5FBRB 1UFRA 1R9NA 1CDZA 4KIWA 1RXWA 4AQYB 1Z3IX 1JLKA 1XZDA 2MR6A 2ZSFA 3JWGA 3LT4A 4QJIA 3RG2A 3RJMA 3UK6A 3VTKA 1V5GA 4HR7A 1HDYA 2N75A 2OPBA 2O8EB 1QFSA 2VQDA 2ZYHA 3FROA 4QTUB 4F9EA 5JBIA 5CM8B 2EXXA 2WB4A 1UMCB 1LBHA 3C7CB 3MYYA 4NOJA 2F43A 5FT9A 1YFKA 3OJWA 1FQOA 4QUGA 3QWBA 5FBWB 1UKVY 5K2MA 3ZW9A 1HUQA 3NAQA 5CX4A 2V9PA 1KFCB 1TA9A 3PUIA 4ESHA 1PFYA 2VRBA 3VR3D 3HB1A 2A5GA 3N7TA 4KVGA 4ZQEA 5EEGA 1CZKA 3W3AH 1E9VA 1N78A 4HSGA 2FZVA 3UGQA 4AZ3A 1CY6A 1GAXA 2Q27A 4HX9A 4N3GA 5D8DA 3R7BA 3T9DA 4MKHA 2FG7C 4DCVA 9GPBA 4PGMA 1WD5A 4H7PA 3TMKA 5BV2P 5FFNA 5JCXA 2WA2A 3KV3O 3DLAA 4RD6A 3JQDA 4ZHQB 2W6JA 3KQTA 5T67A 2YY7A 3F9CA 3KTOA 3LUBA 4KR3A 2W00A 4OYYA 2BKAA 3IA2A 1J9EA 1VKNA 4CEIB 4HB3A 2G06A 5DIFA 5BQXA 5EGSA 4LV6A 4Z5XA 1NUHA 3D4OA 2ZI9A 3QEJA 2GCIA 1R9GA 2IPAB 3JTMA 1J1IA 4NYIR 2OK8A 2OAEA 1QR6A 5L3VA 1TMKA 5TQ2A 3ZV5A 4BO5A 1N3BA 1T2NA 3LS2A 2HSWA 2Q3LA 2ODPA 3ZVRA 2PU5A 1K3FA 4YJ3A 3ZC3A 3BD6A 2F1OA 1U3UA 2WF5A 2WDPA 4E13A 4MW6A 3PWTA 1QYXA 4TYMA 4UTVA 3FNHA 3HM9A 4NEGA 4OY3A 2GZ1A 3OQVA 2VYND 4D0NA 1RWBA 5F4BA 1SN7A 2V6IA 2YWGA 3P0JA 3LXMA 2EJTA 1QANA 3TX2A 1UAGA 3LVQE 1MW8X 1E7SA 3LP6A 1YMQA 5CT9A 1J8DA 1XYGA 2PRYA 2R2GA 3AQ4A 2BKXA 1KI3A 3GBPA 2JIDA 3BMCA 3BAFA 3HUEA 4FFDA 3H8VA 4FTWA 4WKCA 2CVPA 4C01A 3N0VA 3OHPA 1QP0A 1ETUA 1A98A 1U9YA 1LLCA 5JNSA 3WA7A 2XRFA 4YPVA 1FW6A 3FTCA 3PWSA 3L01A 1L8LA 1IY1A 1CR2A 5FEMA 1ENYA 2VBIA 3O83A 1AK1A 1PD1A 2H17A 1KYXA 1E1YA 2H4YA 5BN1A 1X7YB 1J07A 2VDUE 1X7XB 4HCJA 1E5VA 1XXLA 1RLMA 4QHYA 2XB9A 1VHDA 4WZBE 1GV0A 3IJ5A 3O75A 3PZBA 3IAAA 3X1WA 4BRZA 3AQIA 3FZNA 4JY7A 3EY9A 1TPYA 1Q84A 2B1JA 1AGNA 2V5VA 1KAQA 1V0JA 5FTLA 2O6LA 4RHXA 4QDUA 3CR8A 2OPHA 1BD4A 4X7RA 5LP6F 3IOCA 3JATA 3GJ0A 4QSHA 3O7MA 3FIJA 2V7QD 1E1NA 2ECPA 3NH9A 4LXIA 3PWZA 4UD2A 4XDHA 4BO8A 5KNCA 1O94C 5TX7A 4BNIA 3P9ZA 4CL2A 2VK1A 1LS1A 3A58B 5K3DA 1VJ0A 1J1ZA 3EOAI 3DZ8A 3LUCA 3FHCB 3T5CA 4BFVA 2HJSA 1Z38A 5K3BA 3OPNA 2I7XA 2ZVDA 1XQYA 2QRUA 2D06A 1WF3A 4FEGA 3FYHA 1NVEA 1X1EA 3DFZA 1E6LA 4GKBA 3E3OA 3EFEA 3PR2B 1Q11A 3TS1A 2CC2A 4BLPA 4PYRA 4TQGA 2QVBA 4KOAA 3KJHA 3Q7SA 4P4UA 1T6BY 4BWGA 3VAAA 5KWVA 1UBGA 5AKYA 4AN1A 3GRRA 3PZRA 4B9EA 3ZD7A 1KDZA 2A1TS 2ZK7A 1CZHA 1DRWA 3I6YA 1P2FA 3ANYB 3K9WA 2I7VA 1SA0A 4M54A 4UNSA 2P62A 3T5GA 3UCFA 3VAYA 4S1PA 3NV7A 2H51A 5LYJA 1KI8A 5HSGA 3P52A 4LQLA 1BNCA 1II0A 4RHFA 2N0SA 2H0AA 3BIFA 3LUHA 2AVNA 4KX5A 4M0CA 3KETA 1T9BA 2VJLA 4WJZA 1W5SA 3AHJA 1LA2A 1AURA 4KK3A 4IIUA 4D9CA 4QTXA 1QK3A 5KYUA 3LQRA 2VNJA 5B7GA 5C8YF 1CUIA 4FFBA 5TEVA 4KPGA 5EP2A 5AI0A 5EZ6B 3O38A 2BTQB 1E8MA 1Y5RA 1HMFA 2J1LA 1FVHA 2VA9A 3PX2A 1U0JA 4FGKA 4NESA 4URYR 3WLNA 1XNQB 1I14A 1SXJC 2QL6A 3P4YA 5JS1A 2X0EA 3ADBA 4RETA 1XWIA 4KXXA 3W3AA 1DTSA 3R7FA 5FNVB 2QLMA 5TMBA 2OOSA 4MGHA 1H4TA 3JSXA 3LKBA 2Z5LA 2BM8A 2NSYA 4KCGA 4J7AA 3O5AA 3JPYA 1XO1A 4EW1A 4G4IA 1E2QA 4JCOA 5I3ZA 5A0VA 1P4RA 1ZIPA 4WBNF 2HJ9A 1UIRA 1H2XA 1PRYA 2GBLA 2XT6A 4J0FA 4MH0R 3W6NA 3GLRA 3E22B 2NO0A 2XECA 2DECA 1NQ5A 3GFPA 1NUSA 4UXIA 4AUNA 4POOA 4B3GA 1Z15A 3FJOA 3THOA 1ADGA 1JNYA 5IEBA 2GZHA 1NFQA 1V11A 2I6XA 3F74A 1V95A 2H7XA 4CEJA 3P27A 2GM3A 2YL2A 1O94D 2WIFA 4IWXA 4XEHA 2PUBA 3EULA 4QQNA 2IK8A 1Z37A 1Y3CE 1ND6A 1QV6A 1WXXA 2ZDQA 1KH2A 2VWPA 2AV6A 1U4OA 3RE1A 5PNTA 4BNXA 1P4HA 3JVUA 1TCAA 5TB5A 2ACKA 3V4SA 2AN5A 3UKOA 4Y0VA 3FDZA 3TTSA 2PS3A 3JRXA 4NNJA 2HM7A 1T5LA 3AJAA 3UJ8A 3VSCA 1N2OA 1XXHE 2FMKA 1H0SA 1CQWA 2P5SA 2YQ4A 3ESDA 1QFXA 2IVZA 5HKLA 3T4UA 3WYBA 1GNRA 3CX4A 1Y1QA 2OFOA 3GJSA 3OU7A 4OGWA 1CULC 1HEYA 5LDHA 1EXDA 3PNBA 5KZMB 1E98A 1T0BA 2PKRA 1EFPA 2W2MA 2QZJA 1YO6A 2Q5HA 3BIJA 4JJ8A 4CGZA 1AABA 5JTTA 1P60A 1YIAA 4XWGA 5FYQA 3L8YA 3IVCA 4E32A 2PZEA 3FZGA 3IBTA 3INNA 3AIKA 3F6RA 2ECOA 3CBQA 3CO0S 3KKPA 4GSKA 3HWX1 4RUKA 5JAQA 3QVXA 1XTRA 2REXB 1Q5PA 4IHJF 4RY9A 1XCPA 3QLUA 1ENOA 1I4EB 1XKQA 2JJ1D 2VP3A 3ZWPA 2CV1A 1PZGA 2ZSIA 5FOSA 2J5XA 4QU9A 4Q93A 3OCJA 1VHQA 5A9SA 2CNKA 5L45A 1OJLA 1E62A 4II3A 3C4VA 1CUWA 5B2ZA 3TZEA 2OHJA 3AB7A 4XB2A 1SXJD 5LKAA 1FRNA 4HGNA 1SUIA 4K1XA 2LP4Y 1KVSA 3HO1A 4RFLA 1CIJA 5C8YB 1EE2A 1L2TA 3ENZA 3PL5A 3JSAA 1H8ED 1VPTA 1YZFA 1Q0PA 4ROSA 3NZEA 1YQ9A 1FFBA 2B3TA 2R1UA 1V1JA 2IU4A 2ZYUX 1N3IA 1VM6A 3NH6A 3L4BA 4TMXA 5AM5A 3BE8A 1BFDA 5H3HA 3ZW7A 4KGDA 1Y1LA 1Z4NA 1WB5A 2EGUA 3GH1A 1IRIA 1HE5A 1L7NA 3QTLA 3HUDA 1YRYE 2AQIA 3VKVA 4DMFA 3K6SB 1T25A 3PE6A 1JEQA 1NV9A 2F8MA 4Q7KA 1YDMA 2GBIA 4G5QA 4ZQIA 3OKAA 5EJMA 1ZL0A 2P78A 1QYVA 2B4RO 1P1KA 5DYIA 5B36A 1CQXA 1WV1A 1KPHA 4I55F 4WBNB 4I81A 1MNQA 5AKZA 4NG5A 1Z34A 3U62A 4LYJA 4PZ9A 1U9JA 2ZIEA 1QRAA 1SQGA 1WSBA 3KXLA 3F8SA 3N8HA 1QQ5A 4PGGA 4RMNA 3NOXA 1TM4E 3GPLA 4O8CA 1EDDA 3COVA 4Z8YA 1U8UA 1A0OA 1CDEA 3L1JA 3Q0EA 3STYA 1Q7RA 5I7OA 4LSZA 3PDCA 1NMZA 4YRPA 1V41E 1D5CA 3ZDAA 1U0FA 2D1YA 4LZLA 4BZPA 1PZHA 3VYTB 3U7RA 4BMZA 4NBNA 3NTQA 4CU2A 1XFDA 6GPBA 1ST3A 1C30A 3HA5A 4KC0A 2XCRB 2NXEA 2ZRPA 4EBBA 4BMYA 5HUQA 2YIDA 2WFAA 4CQNA 5KTNA 1YZHA 2Q3JA 4KFSA 4E30A 2QHXA 3BFVA 3AWIA 2R3SA 4KRGA 3GLFB 1Y6ZA 4JP3A 4GEGA 4RFSA 4BJ6A 5ALKA 1LTKA 4QASA 1JALA 4M1YA 1UBFA 3DPUA 3RU2A 3WXMA 2FJUA 3MZ0A 2R1ZA 4GE3A 2RK4A 3R7LA 1FFYA 4YUWA 2GEKA 1KI7A 3O4FA 2IIBA 2B5WA 4RKFA 4ZCQA 2EW8A 3P4UA 1A4XA 1K89A 4YAJA 2OB1A 4QYIB 4IHJB 3RRFA 2X0JA 3LLVA 3O84A 1J00A 1Z0DA 1LK5A 1Y7PA 2Y92A 1BKYA 1JT9A 4EI2A 1U3DA 1H9BA 4GYYA 4TL9A 4XQEA 2NACA 2BWJA 1WHTA 4NWIA 2CLIB 3D4BA 4V2UA 4BYGA 2FOLA 3O8BA 5DGDA 2WHXA 2BP7B 5KKNB 1O6BA 1QHXA 3N1UA 5K0BA 1VGVA 5CR9A 1HSNA 1QTRA 2J0SA 4EWLA 1YRHA 3AZQA 1T4CA 4WFJA 4RYDA 5FPYA 4B9AA 4QG7A 3ZX4A 1VIMA 3UIEA 1W6RA 3VC7A 3KQHA 4ERNA 1IB0A 2RSLA 4RXUA 1EU1A 1U31A 3P9RA 3U13A 4UU7A 4WESB 5J5AA 4BY9E 3PXGA 3ZZUA 5TGTA 3NFRA 3P32A 1MEJA 4J3NA 4YAGA 5FQNA 1P7VA 4HTFB 4O59O 1VHJA 3BKXA 3K1TA 4GR9A 1CY0A 1R88A 1I01A 2JI6A 4MRVA 4PM4A 5DM60 3PA8A 1GRNA 4LJ5A 1SU4A 1JI0A 1Z0SA 3PNOA 2CF6A 1LPBB 1CX9B 1Q1AA 2ZRFA 3MJSA 4ME6A 4IRUB 4UVHA 3ZLJA 1DARA 4RDIA 4H4CA 3RTEA 5DNWA 3SN6A 3G0BA 4E2XA 4ZU3A 3N0XA 1FP1D 1OX6A 2DBVO 3OI7A 2P30A 3RNOA 1QVRA 4KNYA 4DWWA 3DGFC 1F4LA 3U5ZB 3BWVA 4JQYA 5EE1A 3TUIC 4RTMA 3QFFA 4OAQA 4O4JA 3OSZA 2GPWA 3AZPA 2ZWMA 3S28A 4U9HS 3V55A 3MGKA 2P75A 1NC3A 3T34A 3IQFA 2ZP1A 3AUSA 3KJNA 4E51A 4FYXA 1ZI9A 1PJAA 5LZ5A 4C1BA 1S2OA 1GGJA 3PDJA 3CG4A 2ODWA 4YJ2B 3WKBA 4BFUA 3FPAA 4FN4A 2VK2A 4BNHA 1E1KA 3FSGA 1EE9A 3KLPX 1Y4UA 5EJ4A 3HBMA 3OM0A 5K01A 4F8YA 5K3OA 2VTBB 4I4CA 4Z4EA 1G60A 1HFKA 1IBCA 1MO3A 3UANA 4FGWA 1J3XA 5IU6A 5K7SA 2SECE 3GGDA 4WHMA 1NUQA 1UWVA 2FMIA 4PV7A 5UKDA 4P98A 3UFXA 1Z6ZA 2ZREA 4F7WA 5H0IA 1WBJB 4OI0A 3ZEAA 4G1MB 2YBEA 1B74A 2EL9A 2UV8A 3NTUA 4FYIA 2ONZA 2XOKA 4I4TA 1V9CA 4MPDA 3ZXSA 3WGIA 4KB5A 2O8NA 4KSYA 2GUWA 4UHBA 2EU8A 4DWOA 1A97A 1JEEA 1KMHB 2YMQA 3U1BA 1SULA 1UPCA 2O2CA 2ROQA 2CNDA 1G4UR 1P81A 5KYNA 3DP7A 4D6PA 3I1IA 3F3MA 5KTMA 2VHJA 2XRZA 3TQRA 3GX1A 4ZVQA 1WNFA 1Z0UA 3BYZA 3OD5A 3OOYA 4P82A 3MTDA 4CM6A 1RHKA 2O59A 3JZAA 2VSOA 2AMFA 2XMRA 2ZYIA 2W7TA 2IUYA 3A36A 3COPA 1P6XA 2HO5A 3ETDA 3GFGA 3N8KA 4LHXA 4P3XA 4LEIA 5DN6A 4EATA 5KTOA 2HLHA 1Q74A 2C84A 3Q7PA 4CL0A 1JXAA 4EG5A 3GI1A 4DQLA 3K0FB 3M2TA 3GRYA 2QAJA 3LBFA 3WP1B 4L02A 2Y9MB 4MX8A 3GLIB 3TNFA 2CUKA 2XQFA 1XTKA 3K0AB 3R5KA 3RRJA 3VR5H 4JB3A 3EG9A 3ZDZB 1V16A 1O6GA 3I1YA 1KP3A 3K09A 4FJ2A 5JCZA 4LBWA 3FA2A 5CVTA 2R5NA 2GAIA 4OD0A 1DLJA 1OW3B 1QG4A 3A1NA 3ID6C 3KQOA 1ZD2P 1RJWA 2GPTA 3L40A 4EG0A 1FIUA 2G4VA 4JBWA 4G8JA 1XVVA 2YBDA 3K1AB 5ALGA 4A2PA 3FWKA 5L4SA 1TE2A 1TW2A 3E8MA 2ZTSA 4FXPA 4B6QA 1XX6A 5LB2A 5ELLA 2E3JA 2I6FA 2XDWA 2UYGA 1HSOA 3MGGA 1U4SA 5IK2D 1RLTA 2Z04A 3O3OB 1JIQA 2FFHA 5AJTA 3JVIA 4LS3A 3L7NA 3O8CA 3O1HB 3A4MA 3L6UA 1G2OA 3LJKA 1T3TA 5FJJA 4I6GA 4TLAA 3C8MA 2YJTD 5F35A 2ONJA 2W70A 4BFSA 3ETCA 4XDGA 1PFWA 1ZUD1 3BEOA 2B1IA 3CJQA 3OLQA 1AIPA 1H1LA 1RLUA 1W581 2C97A 3LG2A 3A4VA 3AV3A 4GBMA 5REQB 2LEFA 1XNHA 1IM5A 3PHCA 2YYAA 5LD2C 3N87A 3ZV7A 5IAAA 2XHZA 2BEUA 2PR2A 3BE6A 1ABEA 1UKAA 3ELWA 2OFWA 1DE0A 3LC7O 4PLWA 4XGNA 4Z0PA 4S0XA 2HSGA 3B9PA 2A0WA 4MZDA 4A3SA 3D8RA 4IIJF 3BERA 1X7ZA 1MB4A 1U0SY 2XR1A 2GNAA 4RZSA 5C8XA 3BWBA 4A6PA 5E9AA 3L6RA 3U60B 3D3KA 3ZDYB 4O02B 1OLOA 4OEHA 2WWXA 4MPPA 3H99A 4ZI5A 5IAOA 2P3OA 1WXQA 2HFJA 3DBHA 3O1JC 5H80A 3ZDDA 3HL4A 3GLTA 3DEKA 4G5YA 4GUDA 1J70A 4S2UA 1G42A 2BFFA 1XL0A 2PX6A 3IPCA 4KH0A 4PINA 3JAKA 1OBFO 1PV4A 2XB2A 2OHIA 4MR9A 1ML3A 1UDRA 3EIXA 4EFNA 1PJLA 4WN9B 3GBSA 4YAFA 3TLKA 3LRXA 2BHLA 5JZ9A 3KCQA 4JP1A 1XSEA 3GCXA 4OKIA 3M5PA 3PDWA 3KXIA 5TR9A 3KOOA 1V47A 2IIPA 1LF5A 1YJBA 1OFUA 1LLDA 4HSEA 2B7LA 1I13A 3FPHA 4EPVA 2AI2A 4BMPB 2Q5OA 3KVNA 3JQ7B 1JS1X 4FU0A 4NV1A 4UDYX 2ZJ0A 4BASA 5L9AA 1MOZA 2ZI4A 3C24A 4M0DA 2RHDA 2GHIA 4DDKA 3BJMA 3ETGA 3D3NA 1CUSA 1TTPB 4LJ8A 1DKRA 5H82A 1VIVA 1NI4B 1I6KA 1KDOA 1QTIA 2IYPA 3LBYA 4EJSB 1MABA 2XQKA 4W5OA 1V5FA 3DCJA 3LPMA 3KU4A 1NAIA 2NGRA 3LL4A 1ZU4A 2BKVA 3LOQA 1N5RA 5TJHA 5U9CA 5HNKA 1VZ3A 1GRQA 1RRKA 4DM4A 1CEQA 3FHTA 4A23A 2EKPA 2H57A 3KT3A 3IPYA 4JOSA 2YQZA 4MKGA 1PTKA 1C8KA 2Q9UA 3BXZA 3FUXA 4JK3A 1MAHA 1XMSA 4GVLA 3CXRA 3NVDA 4XXHA 3C3YA 4CN9A 1G59A 5GP1A 3ZD8A 1D1PA 4K2AA 3T3NA 2BFPA 3MHPA 1MT3A 1XDUA 4J4BA 4LI3X 2JRCA 4G0YA 3THRA 3GUCA 2WKQA 2EAUA 1MOPA 1GL3A 3CIFA 721PA 3G79A 1IY9A 1U94A 4PTZA 3FUCA 4OUKX 1YDEA 1F1BA 1P8JA 4Q3CA 5HS6A 1GAEO 3B1XA 3WJ1A 1KQNA 2Q5FA 2VSXA 3PNSA 3MOIA 4FXOA 4LJ4A 1EVYA 4BB9A 2BRUA 1PS0A 5DT9A 2CCKA 4NZNA 4IIJB 3NBXX 4KAAA 3PHIA 3RTGA 3PDIA 4J1SA 3S70A 1LC0A 1GU7A 2YYSA 2NOAA 3MERA 1IQPA 5ES4B 1MH9A 3HQ4O 2FWBA 3B78A 4HB2A 3FOCA 3E1SA 3IUPA 3WO1A 4FEAA 1JIUA 2CJPA 2W2QA 1ML4A 1USUA 3KHTA 1QZUA 3BB4A 3N2ZB 4CMIB 1IVNA 5AVSA 5KYYB 3DLBA 3OX2A 3CX6A 3QVOA 2QGNA 2BBWA 2R48A 4MWCA 3LW7A 3Q87B 5A0FA 4LE0A 1CXZA 4FQ7A 1UJ6A 4TZ6A 3VQTA 4PQGA 1VPWA 1M8KA 2HH9A 3AESB 3QKUA 3HLTA 1PNOA 1TFRA 4MA4A 1JPVA 2JFBA 1V25A 4LXTA 1W4LA 2HF2A 5LA6A 3Q2OA 4YH1A 1CJTC 1LF0A 2IRWA 1M2OA 3AUKA 2ZRJA 2NU9A 3IH5A 4FK8A 5AM4A 2QQ5A 1CLEA 1RKBA 1S02A 4M7RA 1U1EA 4BO1A 1LDEA 4QJ4A 4PLCA 1PN3A 3IHTA 3JWEA 1PJBA 4AP9A 4UM7A 4ZCIA 1UBJS 3CIOA 4TWIA 5JANA 3ETEA 1HYBA 1VLMA 2X9GA 3I34X 4IY1A 4Y98A 4YJFA 3T9AA 1WBBA 2O1SA 3HJAA 4KNVA 4RWZA 1HORA 1JZQA 4Q1CA 5CM9C 1OBOA 4JH0A 4IIYA 5IKXA 2UXDB 2DJ5A 4MQEA 3ZBTA 2PWBA 4IDPA 1U3CA 4PG4A 2YMPA 3W9UA 1CR4A 3N3BC 1KWGA 3AEKB 4IUCS 2XD9A 2L42A 1XROA 1ZEMA 4GW3A 4ALJA 4F45A 4PQFA 4ZMBA 4J2HA 2Z3VA 4KQIA 4HNSA 2R0QC 3V2IA 4KLAA 5IC4A 2HOQA 5EMKA 2TS1A 1HETA 3PQFA 2RHRA 3SX0A 2ZXFA 2HRCA 1FY2A 4ZRNA 1AB6A 3ORFA 4PLZA 1L4BA 4RQBA 3MMXA 3CRRA 4JLUA 5K9ZA 4CT4B 2OKCA 4L9RA 1ZNYA 2OHHA 3QEAZ 4YDSA 2I03A 4H3SA 2CJWB 4I9UA 1IY2A 1DZIA 1ZEJA 5C35A 2QG6A 1UFQA 3R3ZA 4LRTB 3TQCA 3W78A 2FZ5A 2ZJ6A 3V1UA 4DA9A 1T8PA 4QGAA 2IHBA 1XJ0A 4ZYZA 5IKPA 1RABA 3FM9A 5I9NA 1L5FA 1QHIA 1TU3A 4BIMA 4Y1EA 2SCUA 4J2OA 5GV8A 3PHLA 1GSOA 4IXDA 4YV1A 1CNMA 2EX0A 4OQXA 1ELOA 3TN7A 2WAYA 5ERXA 3ZHTA 1LDGA 1RYHA 1UCFA 1VCNA 4I5DA 1QRDA 3EVAA 2W37A 3A1DA 3BN3A 5CUQA 4YCDA 1GNPA 1SC3A 1BDJA 1V96A 2XMGA 5B2FA 1T5BA 3RLIA 4PO8A 4P35A 2I4RA 4KXQA 5B3JA 2FX2A 2QQ0A 4R2MA 4IFTA 3C3CA 5GGYA 1B3RA 1RWOA 2YHBA 3NGXA 1R7RA 2OBNA 3K73O 3UG7A 4UOZA 4N49A 3LH5A 1A96A 1K75A 3UGTA 1RFLA 3PP8A 4TXJA 1Y8RB 3O4HA 3TDKA 3WNCA 1ZK3A 2FUCA 2QM0A 2RI1A 4L51A 1QOZA 4E0BA 1RZVA 3OJXA 2ZU6A 2AC7A 2VJAA 4PNHA 1OAOC 2G5TA 1J90A 1MO4A 4RK4A 4GLFA 1OTHA 5K3AA 3OPXA 2B2NA 1DQPA 5K0JA 2XNHA 4DQXA 1I6WA 3ENWA 4MDFA 5HDQA 1Y98A 2WV9A 4H7FA 2QJOA 3EN0A 1F8GA 3G02A 4J1TC 4DNQA 2WIDA 5HJ7A 1PQ4A 5KSZA 3PXXA 3NIBA 3EGCA 3DL2A 2UZ0A 1Z75A 2ZWIA 4RZXA 1ZK0A 4UHJA 4FD2A 5DK4A 3TPFA 3VPDA 4GDFA 4OX9B 3ND8A 1X80B 3T38A 3GRKA 3UY4A 3VKHA 1TVEA 2ZIZA 4PR0A 3HFJA 4OMDA 3OUTA 3AVQA 1ZRSA 1DQYA 5FWAA 3OOWA 1RC1A 1YR1A 5EIFA 2LDBA 4JBXA 1UBMS 3EFBA 3QE3A 1URPA 3UV3A 3PQ7A 3NGMA 1DAIA 4JC5A 3M6XA 4XIGS 1AA6A 1R16A 1JHPA 3M82A 4QUJA 2YJ4A 3VISA 5H83A 4P36A 1B0AA 3QVJA 4FNMA 4RKWA 2C9MA 2CB0A 2W0SA 4O4IA 5I47A 1BXKA 2PLRA 5FKJA 1UQRA 3D6NB 1ULUA 3S2GA 3ET4A 1KZ1A 1QHHA 3PICA 3SJAA 2WTBA 1Q57A 4ARBA 4FFWA 3ME5A 2YS6A 6LDHA 4KPUA 3B3AA 3CB2A 3NEYA 3R6WA 3JAWA 4ZMSA 2EVWX 3U7QA 2ISCA 3MIZA 1IWPB 4NZ9A 1OZAA 4N40A 4X24A 5HF9A 4C20A 3O3MB 4BO9A 1NHNA 1WCIA 4X95A 3OCUA 5HFNA 1IN6A 4QX6A 2QPOA 1MVOA 3L0CA 3OE7D 4A4DA 3OCYA 2HU2A 1KRWA 3OM8A 3FDXA 3EXFB 1NA5A 5B7PA 1SOUA 1Y4AE 2VPZA 4WBSA 3H1BA 4LXQA 5ICEA 5EY5B 3N76A 5JCPA 1Y63A 5KOHB 5BPHA 2GD0A 1CIPA 2KBEA 2JGAA 2QTTA 1QWOA 3LX8A 3DCIA 3QPVA 1RAFA 2P5UA 3SJCA 2QD3A 1JQAA 3QEMB 2A5YB 4MCHA 1I3OA 1O97D 2DFNA 1VRVA 3WB0A 4A36A 1V26A 1JHOA 4CKEA 1R0SA 1R8XA 4AJEA 3ZQJA 5A0TA 4AICA 3QFTA 1PJCA 2I6QA 1IOLA 2MT9A 3W3ZB 1MRNA 3JYQA 3BWYA 1A69A 1ZOPA 3HB5X 3ZKWB 2A9PA 4HN9A 2KJQA 3MFQA 3DE0X 1L4MA 1OZHA 2VF8A 3KSMA 4QYXA 5M7EA 1ADJA 1RMQA 1ENPA 4HS9A 4LV8B 4WK0B 5G53C 5AJHA 3SM3A 2AOTA 2QDXA 5DI9A 5BYBA 3RHTA 2GEVA 4L75A 1HMPA 1L4HA 4IH9A 4R3NA 1DKQA 1NVFA 1YFJA 3EXHB 3RJTA 3RS5A 1IRXA 4B7AA 1THZA 3EX7C 1FFXB 3V2GA 4BFYA 1XG5A 2HJRA 1CRZA 5AKHA 2B6NA 1ZXLA 1WZEA 2FPMA 1TEZA 1MC8A 1F48A 3AF2A 4XWOA 1BWQA 1X77A 1VKHA 3A3PA 3LKZA 4UUPA 2CZQA 4YAEA 3QMVA 3UC5A 3OPYB 3WYEA 1JYFA 1L7PA 5KTRA 1H8HA 1HKHA 1JQKA 2D1TA 1ZH6A 3EYAA 3JYOA 3QZUA 5U4QA 2HQBA 5H8WA 2CXRA 3DDUA 3H84A 4ZT6A 1WLYA 1YH3A 4LBZA 2IYZA 2PGAA 4B6PA 4R01A 1J20A 3JD2A 3PCXA 1GFIA 4LDAA 4NJMB 3ROEA 1TKAA 3FLBA 4C4ZA 2ZSUA 1IUKA 4I1YA 5FORA 5CMLA 3LCCA 3PUHA 2B99A 3B6KA 4L76A 1C1XB 1JFFA 4M1WA 1JIJA 521PA 4ND3A 1ONSA 4EKIA 2OCGA 4DM3A 4TLCA 4WOKA 4WCFA 4XZ3A 1TZ2A 2PUVA 1UK7A 4G24A 3JR3A 3AMVA 1ESNA 1RCTE 1EEHA 2P9FA 3DLIA 3I9KA 3N2IA 4JX9A 3Q5GA 5DYTA 3SEFA 3W2HA 3TW4A 5JAOA 5B64A 4GLBA 4D1YA 4KAJA 1ZVMA 4J16A 4GOKA 1AN9A 4B6SA 3C7AA 3FJYA 2R84A 2PBFA 2G80A 2C92A 4DUGA 2O0MA 4JGIA 5KQPA 4RPGA 1RXYA 4UTNA 1HOTA 2G88A 2GERA 3CQ9A 3L1VA 3DT9A 1T1EA 3EFHA 3OO0A 5ALHA 5IXJA 1JUDA 3HJUA 2Q7XA 4HDCA 4TSFD 2PUTA 3K2BA 1OXBB 5TPZD 3S2IA 3W2IA 1AZSC 2OV8A 3TE7A 4XUDA 1KIFA 4V3BA 4K9QA 2C3YA 1R5OA 4GLOA 3KNZA 2QN7A 3NASA 4JL8A 3TXYA 2J4FA 4LOIA 1NY5A 2IXEA 4DLYA 1B6GA 4QGBA 1MC4A 3FF4A 3QJ5A 3K30A 4IEFB 4P84A 1V7CA 2V54A 2Z8YA 3ADDA 1D4AA 1FSZA 1SCUB 1BVHA 3EQ6A 3DBIA 3T54A 3GWGA 3PXEA 1A1SA 3NHYA 5EZ5A 2JLBA 3LHKA 2AOUB 3HJHA 5F2NA 5J4KA 3WIEA 2WG1A 3KPVA 3DBLA 2F59A 1HT2E 1DC6A 2EW1A 1TC2A 4DQKA 4NECA 5E2BA 5CIQA 1TK3A 2G17A 4RIEA 1HWYA 1KFJB 4LC0A 2G36A 3BGWA 3T95A 3WRXC 1X19A 2HPAA 5LWQA 1C14A 5ALQA 4YRGA 1AOXA 3U7HB 1XU4A 3UV7A 1RPAA 4DIFA 3O94A 4L0DA 4MQUA 4J94A 3UT5A 3UVEA 1JJAA 3KXKA 3RADC 2H07A 2XLBA 5DXAA 4CVNA 4A16A 2VKQA 1CUFA 1E66A 2ZUCA 1TVMA 3L9XA 3EVDA 3VX4A 4ED9A 4UNRA 1APBA 3VPBA 1NJ8A 4KBGA 4WH0A 2ENUA 4ZALA 4UHDA 3MTQA 3DZDA 3CW9A 3REQA 5AK4A 1GQFA 3K0CA 1F14A 3DE2X 1P9LA 3GIWA 4KX3A 3S44A 4PNZA 3FKSA 4WZAA 3CRZA 5CFLA 1ZN9A 2OZVA 2W8BB 2DQYA 1JDSA 4YRNA 3AR6A 3MTEA 2WOJA 2VRCD 4AKGA 5HIMA 5CB4B 1PLJA 3EQ8A 1WUTA 2D59A 2OBMA 2SICE 3E18A 3HNOA 4NCXA 3OIFA 2FGJA 2DT5A 4O2AA 1Y4DE 2J6CA 3A06A 5EZSA 1X70A 4C7BA 4R3UC 4Q9NA 3IEIA 4QELA 3FYUC 4MQMA 3G0IA 3O8RA 2GYWA 1EIWA 3CMMA 1UMBA 1L3CA 5IKOA 1K8QA 4DNXA 2PLFA 4D46A 4ZICA 5ITWA 2YW9A 3PFGA 1J21A 5K0LA 1L5KA 2BM1A 1WCV1 3E53A 3K8ZA 3EVTA 1N57A 4TL7A 3SQWA 1LI4A 2OOKA 3T7TA 4NFSA 1IXKA 3B82A 2R8PA 1J0EA 2P3LA 4KUGA 3SNHA 5I3CA 3NIGB 1T5OA 1GM5A 3Q0IA 1CTQA 4V24A 3SYKA 4PG8A 4DRXB 1I30A 1WPRA 1JFLA 2QS9A 2WR8A 3L5KA 4R54A 2RBEA 1VMKA 4R84A 5CA0A 2GN2A 3O1LA 5FEUA 1ZM3A 3VR3A 1TRHA 1BE1A 3PXBA 2IS1A 1SBIA 2UZIR 2Q3BA 3PNYA 3I6BA 1LY1A 4KWHA 8OHMA 1YDHA 2VRNA 4O5AA 1U80A 5E7MA 1BN7A 1XTVA 2YVAA 5BVHB 3MYRA 1FTWA 2CNNA 4JYPA 4G1UC 4DL9A 3F9RA 4HWPA 1OFTA 4IAOA 3GO4A 4IJWA 4MKIA 3SAJA 1R64A 3AVUA 2DWQA 3THXA 4P54A 1ZOOA 3MUNA 1S2DA 3H8JA 4A8TA 4U2EA 1V1RB 1FBTA 5LJLA 3BTUA 3WE7A 3CNHA 2AD5A 5BQ3A 4ZODA 5I7VA 1XB2A 1V5WA 1KY2A 5DV9A 2ZRCA 3JR7A 5H02A 1NASA 1VL6A 4RZUA 3FWHA 5LQUA 5E4FA 2QB5A 1K0FA 1A5SB 2O23A 2XWBF 5DWVA 3TIVA 2B1RA 2O7VA 1L7EA 2VTKA 4IBOA 3WLFA 2O5CA 4XPIA 4I8XA 3PFCA 4GO1A 1X7HA 2DLNA 4N6OA 1F2UB 5ALUA 5BSWA 2ZRIA 1WUYA 4H08A 1XQ9A 4TKMA 2BEKA 4X1KA 3CEJA 3UJ6A 1I5OA 4HLQB 5B3LA 3QF4A 2EF0A 1RE1A 2VYNA 4NULA 3EISA 4KIFA 4BO3A 4XR4A 4EG6A 3IOEA 3D81A 3K9FC 1XCJA 3U3OA 2ZDGA 1HL3A 2PGLA 3F1LA 3B85A 4KSBA 3NRCA 3IUEA 5BNFA 1HKUA 5DW3A 1H66A 1VQ1A 2P3SA 1TYEB 2XADA 5A5GA 1GKYA 2DBYA 2PBLA 2OBYA 3LA6A 2VJOA 4M8SA 4Q3NA 4NZOA 2HF7A 4FHDA 2O4CA 3OT1B 2KLHA 5ALSA 1WV0A 5DGCA 3GAAA 5I7UA 1FRQA 4ZRMA 2CDRA 3AL0C 3K0BA 2JIOA 3TTVA 2VBGA 3R3JA 1UMKA 3JD4A 4DC0A 1ULTA 1N1MA 2FR1A 3HBFA 4JKOA 4LCBA