3ABSB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with adeninylpentylcobalamin and ethanolamine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Ethanolamine ammonia-lyase heavy chain
total genus 74
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3absB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3absB02
3ABRB 3ABQB 3ANYB 3ABSB 3AO0B 3ABOB
chains in the Genus database with same CATH superfamily
4YC7A 3GA5A 9ABPA 2JZNA 4R4JA 1IOZA 3CXRA 4G01B 3WTCA 5I51A 3DMFA 3O9ZA 2XD9A 5AKHA 3NJ8A 4QBKA 4PZCA 1YZFA 2XUFA 1ZGZA 4B9AA 1T6YA 2MMGA 3X1JA 1WP4A 3F5DA 1JNYA 3A1EA 4PSVA 2FR8C 2XNDD 2ZQ5A 3QFRA 3OLYA 1BCRA 4WHMA 4A8JC 4D0RA 3W5VA 3PQ4A 3H9EO 1CQJB 3GF4A 5JNUA 3MWKA 4NH4A 5FF9A 5TQVA 1I4TD 2VTKA 1IZYA 2QA5A 4D3ZA 4XEHA 4YMUA 1KERA 3E22B 4HNQA 2OM2A 4EA7A 2OD9A 3LW8A 3PC7A 2NO4A 1MQ9A 2O7VA 2QZZA 5JCZA 3CWZA 3FJOA 4DRYA 2X8AA 2CLCX 5D5PA 4JC5A 5KYYA 2FFJA 3VZQA 1RI2A 1XX6A 3A8TA 3EZXA 3FPBA 2GUGA 4TT8A 4TXNA 2CV1A 2L42A 4N3CA 1E2BA 2QMUA 3NQ41 3ZUPA 4JU8A 5LSAA 3AY7A 1C8VB 4G3XA 3SSMA 5AVZA 3CB2A 1TM5E 1V1RB 3G0IA 3JVVA 1YS7A 3NUGA 4HLDA 4JC0A 4EARA 4CKCA 3P27A 1MC1A 5KYWB 1LGYA 2HA5A 2PAAA 3UMVA 1UANA 4V0NA 2ZKIA 4YCBA 3NC0C 4KV7A 2PNJA 2WVHA 1CE8A 3E05A 1BIFA 2IC5A 4GKAA 1KKLA 1RJDA 2IYPA 4R54A 5EHGA 5C31A 1UXHA 2ZUTA 3TX2A 3ZDZB 4L3VA 3CSUA 1IHXA 2OILA 1V5FA 4RE5A 2R2AA 2OKGA 3ZX4A 1WJGA 1P17A 2BMVA 2FW9A 1SPBS 4GBMA 4PVDA 3ZY5A 1UUFA 3DZKA 2AZDA 1WX1A 2AJDA 2YN0A 4QUEA 4WGFA 1SEPA 4NJEB 5NLLA 2PUDA 1FLDA 3BJZA 1L7RA 1MX9A 1Y1KE 1ZITA 1KI6A 3AUYA 3KYDB 2GD1O 2Q6LA 3HNRA 3QKRA 4GX5A 3WK4A 4G9BA 3ZBPA 5HDQA 1ATIA 2CXHA 2XDQB 3ZWVA 1VHQA 2VYVA 3ESBA 3F6CA 4ZCMA 5DISB 3PXDA 3FTQA 5AVYA 1F7UA 5E1MA 2FSFA 5BOSA 2QMOA 2DF8A 3VDXA 1WNFA 3A3PA 1DO2A 3KZCA 3IRUA 3O4HA 1JHRA 3L1IA 4UHBA 4V39A 1Z0SA 2HJRA 3WS7A 5KPDA 4JXZA 1Y3DE 4I3HA 3GJ0A 1BE8A 1Q19A 3ZXYA 3S7ZA 3VPGA 1J24A 2EARA 3AB8A 4Q39A 5ALLA 1WUJS 1H2XA 1R1DA 4DEYA 2W0SA 3LVRE 4IZIA 2PWBA 2EX1A 2P6PA 1GQFA 2ZYSA 3TKYA 3EVZA 3INYA 5IVIA 4O0LA 1X1SA 2XKBA 5I4IA 4YGXB 2ZWVA 3QEOA 3KQPA 2QS9A 3MRXA 5ER9A 1OLXA 1IBKB 1CEYA 4Q12A 4WASA 3HADA 3WGYA 2QMQA 4ZIRA 1L8YA 4LHXA 4LY3A 1M73E 3IAUA 4FZJA 2WILA 3DBLA 4QSHA 4B3IA 3PGLA 3M6AA 2EDAA 4N7MA 2I5PO 3WJ2A 5JQGF 2IODA 4ZYYA 1Z38A 1T8UA 2WTEA 4P0QB 3RM3A 3BE8A 2GBLA 4OBEA 1SN7A 3WAKA 4F11A 4HDNB 4CTOA 4H7JA 1UBFA 3ORHA 3M4ZA 2ID8A 4MRPA 4NOLA 1BWQA 4PXSA 3FPKA 3U4IA 4V03A 2CHVA 4XYLA 3U5TA 2FQ1A 4HWPA 3GWZA 1U98A 4US0R 1QU2A 3IVRA 1HMAA 2DWQA 2WHPA 3PEFA 4IL5A 1UZNA 1KAGA 4MWCA 4EG6A 2CXQA 3VSCA 5I7OA 1XV5A 1PT5A 1F5NA 1M1UA 2GKOA 1KEEB 1EB9A 1G20E 1CZRA 1PT8A 3KEMA 5HKLA 3CEHA 5CVEA 2Q6KA 1FBTA 4J1TC 4REMA 2RGEA 3ZC3A 4RTMA 5EZYB 2FWAA 1MKYA 2HAEA 2WAOA 2MSCB 2WICA 1OZHA 3AUTA 4G5OA 3V7FA 1IOVA 2P6MA 2ET6A 1FP2A 4HGOA 1VIMA 2I6XA 4E7OA 1NJFA 5GINE 5KTTA 1UK6A 1MAWA 3ONNA 1WY7A 1DT5A 3A70A 3FA2A 3O4RA 4TLMB 1CS4C 2HMVA 3ETCA 2BM0A 3BL8A 1M2JA 4MMYB 3RS7A 1E3WA 1E5VA 2XAUA 3CUYA 3JRXA 1O4WA 3R0ZA 4O4JF 4B2LA 1BKYA 4MJ3A 2MYUA 1V63A 3C6ZA 5L9AA 1FXUA 3AH8A 1PBNA 2Y67A 1AKMA 1LB1B 1SIOA 3HB0A 4E3ZA 4CIVA 4QVKA 3ZQJA 2P0EA 1P72A 1WQ3A 2Z0MA 2VQFB 1ZUHA 4AO6A 2B4TO 4FDVA 4I9UA 1XK7A 1NHNA 3LI2A 1DIOB 4FBGA 4IS2A 4LUCA 3TK1A 3TM5A 2QLMA 3AFHA 1V6CA 5A4DA 1VLVA 3MT8A 4AKEA 4QM6A 2AFHA 1QUFA 1USVA 2QE7D 1W85B 1HH4A 2G4VA 3EVBA 2DFNA 3GEGA 5J5CA 5FL7D 3W9SA 2GQ0A 4I3FA 5HZHA 1B76A 1SZPA 2D1YA 1UODA 5K0TA 2RSLA 3ADPA 5E4TA 3RBXA 3SMVA 2QNRA 4ZZ3A 1UBJS 1G8FA 1Z47A 2CKMA 2VC2B 2MR5A 2OBMA 1MUUA 3ZWWA 1SUCA 3IIMA 1GGHA 3CE6A 3CHYA 1WS6A 3F67A 1JVBA 1DOZA 2X76A 2WF5A 3LT2A 4LV6A 1U2TA 1WMDA 2RHWA 2LE0A 1NXVA 1ZOOA 2ZM6B 1CR2A 5BWCA 2C9CA 2QZ9A 1JIIA 4COKA 1FLAA 1QYDA 4NBTA 4WFQA 2OFWA 4RSMA 1VPWA 1QAQA 5KTPA 2P7HA 2PMEA 4Z4FA 2G83A 4CTNA 2HLDA 4KP7A 4I8XA 4Q0MA 3RQSA 5CT4A 5DU2A 2CLIB 3OOJA 4BO1A 2C2KA 5FOWA 3I2HA 1RJ9B 3FLBA 1H0RA 2QLTA 1OCEA 1SM4A 3GLGA 2EC5A 2R85A 4O2LA 1FSZA 4GFDA 4AP9A 3MMNA 4IIFA 5ULLA 4PSDA 3UY4A 3WV5A 1X7YA 1JEQB 1VKNA 1AO3A 3OT1A 2G9NA 5DBOA 4NZNA 2XB9A 1ISMA 4RHEA 3F6EX 3FYDA 3H05A 1G55A 3BT7A 3DJFA 3Q9NA 5FT9A 1W8DA 2GCOA 4K40A 3T5TA 2XXJA 4WRRA 4S1OA 4BTEA 3EPLA 4DMHA 4FUQA 1UBRS 2H3HA 5ALKA 4CF6A 4Z49A 3ORQA 2XMZA 5IN4A 2FMKA 4BB6A 1HNWB 4NCJA 2VJAA 4Q1DA 5EIXA 1TT5A 1J49A 1H66A 1P8JA 2WFZA 3B6ZA 3D8NA 4IVQA 5REQB 3SNHA 2E6UX 1L5LA 1MO4A 4YAFA 1Y9DA 1PNTA 3JZFA 1L7QA 1XF9A 1T0JB 1SUSA 4OHYA 4B1FA 1WZ6A 2FQWA 3G0OA 3HYNA 4K6KA 3SP1A 2VCEA 4OGFA 4EHDA 1TKRA 2QVGA 4FFDA 2CNBA 2J46A 4A91A 5CA1B 5DMXA 4DWVA 5DYWA 1Z0IA 2J9ZB 1GPAA 1M6NA 1US8A 3NM6B 5HUHA 3E27A 1I4EB 4N5HX 5LYJA 2YYZA 3DO6A 3PQ6A 1UXJA 4G4JA 1A8IA 4P54A 1VE3A 4OBWA 1JPVA 1MR3F 1HNXB 1QRAA 1VJRA 2AQHA 2X19A 1K5DA 3KYCB 5EUMA 2YFYA 1H3EA 2JASA 3BD9A 3FFAA 4MTLA 2LW7A 3P2YA 1SOWA 1B1CA 3KOMA 2D0IA 3V4PB 4CRWB 1NKVA 4XWWA 3JASB 2XNDA 1XTIA 1PFGA 2QD3A 4I3GA 2F00A 1I9GA 1QDUA 2A1TR 1G98A 1QGZA 4WUTA 5FFMA 2D8AA 4AKTA 3NM4A 4BMOB 3CRVA 5IDYA 5FBWB 3OJLA 4S2UA 5EVCA 1PHRA 3PUKA 1UOOA 2FP3A 4XQGA 3AEQB 5KYTA 5EVJA 1TRHA 1QE0A 1XPJA 4XFDA 3UMFA 2OBYA 3VHXA 2ZBGA 5JXWA 1NRJB 1OJ7A 3C5WP 2EJCA 4G0MA 5I5EA 1KHTA 1ZVKA 3D64A 4I9NA 5E6RA 1THGA 4F97A 3I3OA 3WK5A 5B1SA 3EQ6A 1ATZA 3LFUA 1M83A 2DHDA 4ND2A 1XZLA 2DKOA 2I55A 2JVJA 4UBMA 4V0SA 5THXA 2D7JA 1J0CA 4AFNA 4DQXA 1L8QA 2GPTA 3IVMA 1E89A 3AVXA 4P81A 2HL6A 4G1CA 4D3DA 1UPUA 2XXAB 3F90A 2B1JA 3RWOA 1W19A 3RRZA 2FSGA 5TS3A 3DXYA 1C7IA 3HUUA 3VR4H 2GI4A 1CB0A 3CCFA 2WSYB 3AJRA 4BNZA 5JRDS 3D3JA 2FW8A 5BWNA 2E4YA 1H8EA 1KK3A 1MZPA 4H31A 1V16A 1IHYA 4LXHA 4XKJA 5EMLA 2QSYA 4DNPA 4F4CA 1OH7A 1HSZA 2BKLA 3KZXA 1TYBE 2F8TA 1W2GA 4X91A 4HPXB 4BFYA 4A6XA 4DRXB 3HPQA 3NFRA 3VKWA 1G1AA 2C96A 4MRMB 1CJVC 1A4XA 1S7GA 4MKHA 1MC4A 4G0UA 5BO5A 4LSMA 7AT1A 1VE1A 4N6OA 1ISFA 4II7A 1V11B 4G85A 3E7WA 5FUYA 4OQXA 3K0SA 2XB8A 1I3LA 2PK3A 1C3EA 3C1OA 4ROSA 3ZWXA 4JYPA 1T0BA 2JAWA 2P9TA 5TRTA 3MTIA 5AHXA 5M04A 1BXZA 3T5BA 4IZOA 3DAOA 3JQGA 3CNNA 3DF7A 3FOBA 1GPLA 2EZUA 1Z07A 3B52X 3G6KA 1NPYA 1UM8A 3L0CA 5GONB 2WFLB 3WMXA 4EGFA 3VJKA 4JR2A 4LYFA 1Y4UA 1QVRA 4HZIA 1YB1A 1JDUA 2ZCUA 2D2XA 2QLJA 2BEUA 1CV2A 2FPIA 4HGRA 3R8XA 2AT1A 4BN5A 4UVHA 1ODSA 3BJRA 3LA8A 4P34A 1TJNA 5KWIA 4EVIA 1JHUA 4P4UA 1P0PA 4LF7B 3H83A 2VP9A 2TS1A 1ORRA 4TZ0A 1MDBA 1J2JA 2Q4BA 2BTQA 3FWPA 3O82A 4AS2A 4CIDA 1P9OA 2XYGA 2JFNA 4B85A 3Q8MA 4P93A 3STYA 4A92A 4QQKA 1JI3A 3BAZA 4M0MA 1V5WA 3OX2A 1QGED 1T3LA 4X92A 3DT8A 3VR5D 2VDKB 5IUJC 3WOHA 2J9FA 3L8YA 2RONA 5BXQC 4PIPA 3FUTA 2BJHA 4ZVRA 1YASA 1EQ2A 1QRRA 4BO5A 2V4MA 3CIFA 1BMDA 4R2JA 1OC4A 1YNSA 2ECOA 4EL5A 4G8BA 5T4BA 1GFIA 4MWEA 3BE5A 1JKJA 1VHDA 3NUQA 4OFZA 1HG1A 8MHTA 1XWIA 1KI3A 2VK8A 1WR8A 1MAVA 2IP1A 1NRWA 3L0PA 5EJFA 2XDAA 2D1FA 4R51A 4UARA 4WECA 2IELA 3TD2A 5KTMA 5FO0A 4IZ6A 2Q6IA 5L3SA 2HT6A 3AEZA 5AM0A 3AYZB 3PNBA 4U2DA 1SC1A 3RABA 5JYDA 4C89A 4TTRA 4TL9A 2PSSA 3DOJA 4XIFA 4EATA 5BR4A 4J3FA 2GLUA 5JSZA 1PQYA 4HLUC 4LGCA 1B41A 4LC9A 3GP3A 4NYIQ 4S24A 3TPZA 4DMGA 3P71T 4EFMA 1QTRA 4B6RA 2SCUB 3U1BA 1KQOA 1YK0A 5JFOA 3TNLA 2I6TA 3QNWA 4LRXA 3P4UA 1SBQA 5GIOE 4B3MB 5KCZA 4JI7B 2PEZA 1N0HA 5DVZA 4F6CA 3T1YB 1JR3D 1ZGJA 2OAP1 1E18A 1CY8A 1HDOA 2AVNA 3FHCB 1ADJA 5T3YA 3UGKA 2G0NA 4PG4A 3T3PB 3DXFA 3KD2A 4I0WB 1BDJA 4BNKA 3PUWA 3W6NA 4HLUA 1TYAE 2CC2A 4Y9DA 5GVRA 5IJ9A 1A3CA 4FNOA 1O3YA 1LPAB 4RFLA 4W1SA 4YRNA 1O54A 4P7BA 3IQFA 4KO8A 4EKYA 2GN4A 1O94D 4L6IA 3WLIA 2HPVA 3DFZA 4HAWA 3WYAA 3AVWA 1LKZA 1JIJA 3G88A 3M6FA 4X65B 2HSZA 1U3FA 4QYIB 1MEJA 4AJEA 3A3NA 2YFHA 1ZCJA 2PR7A 1KSHA 3R77A 4WVFA 5A5DA 3GVXA 2QDKA 4HQKA 3L46A 2IQIA 3CUWA 2O3QA 1Y5MA 2FPOA 1PJ3A 4TVKA 4JJZA 2DUWA 1GILA 2BEUB 3E2MA 4IKPA 4OHVA 2AJ8A 3T5CA 3D8TA 4H2DA 3ZE2B 3AL0C 1OZAA 1XELA 4IXNA 1KFEB 3RAEC 1E0KA 1U7PA 3N75A 4I50A 4KRGA 1QTNA 3FPEA 2CDAA 2O0LA 3M5WA 4UAJA 5JE8A 3QEAZ 3JPWA 3KCQA 3QOXA 1JT9A 5EWLB 2X1LA 1AKVA 1ZU5A 2B9EA 3AHGA 3MXOA 5JRJA 2GN6A 1M6EX 2OAEA 1GG5A 1J06A 3QBTA 3UH1A 4NE2A 1S4QA 3LNTA 4X6XA 5MGNA 1IHPA 4HGZA 1Y9AA 4EAAA 1HQCA 1VKHA 4OLJA 1K3UB 1YZLA 3TVDA 4PN3A 4GRDA 2NZ2A 4BNXA 4DVGA 2Q9AA 1AUPA 2A5DA 3AOEA 4OXRA 4UC0A 3WKAA 4MPPA 1P1BA 3SD7A 4ENRA 5JI2E 3NG1A 3WP1B 1KI1A 4R8MA 4REQA 3I6YA 4RA6B 1TIBA 2OWEA 4CHTA 2XTNA 4QJ5A 1EXWA 1EVLA 4XM0A 3CUTA 4DV0B 2QTBA 4YP5A 1VHLA 1A9OA 3LC7O 3IXLA 4G67A 1RP1A 2ACKA 1KARA 1EFPA 4R84A 3UEOA 3IUNA 5D87A 4MS4B 5ELLA 1MX5A 2F9LA 4LZLA 4TV8A 5I9TA 1E94E 3WADA 2XT9A 2Y0CA 2VHYA 3LHSA 1VMKA 3ZXSA 1TVCA 2HMTA 4QDKA 1PI3A 3WLFA 3PHJA 4JUIA 3PX2A 4C6HA 3WY9A 4DSOA 4LSGA 4E1VA 3EGVA 3I5UA 4KPEC 5J2UA 1ZW1A 3L3BA 2ZIFA 4DIBA 3U4QA 2DE0X 3SOZA 3CLTC 5KTYA 1J21A 2PGJA 1IUKA 5FI3A 3MT7A 2Y1OA 4EGSA 1G8AA 4DV1B 1DCMA 1XQ1A 2X9QA 2X9LA 2R6JA 3CNQS 2XUAA 4IDCA 3CY6A 4NJMB 3SEAA 4B8YA 3COSA 4UPEA 1NLFA 2RCYA 5DX0A 5IJ0B 2O2SA 5LZ4A 1Y33E 4KXMA 4DV7B 4NKRA 3AHEA 4NPCA 2FW6A 2QD2A 5KSYA 3OP4A 4KUHA 2P27A 4KFUA 1XTJA 1WZIA 1KMHB 3KB1A 4EI8A 4V1CI 2ZYWX 1I2ZA 4Z9BA 1DRWA 3UJ6A 5AM2A 2XBMA 2OK8A 2R62A 4NOMA 3AHDA 1Z5NA 1Z7GA 4PQRA 2GXAA 4BIIA 1DEKA 1YRBA 3QJ5A 1MPTA 3EDOA 2PUBA 3P94A 1HQDA 2R751 4N8SA 3WC4A 5EE9A 1U0NA 1V64A 3A6GA 1NLMA 3PNPA 4EFDA 4NZ9A 3UTDA 4AU1A 2VJOA 2AX4A 2ZR8A 4DCPA 3LM8A 3KV3O 3NM5A 4M8SA 1CUIA 5LCXA 2XGJA 1ENYA 1N6OA 3DFUA 3C97A 2A9PA 3OCVA 4RPHA 3FVVA 4FMPA 4ZKEA 3THOA 3UATA 4IXMA 3G2HA 4YIKA 5EMHA 1FSSA 1HOXA 4F6LA 5LOVA 2C8JA 2HA4A 4FFVA 4OQNA 1DEHA 3JALA 4JLNA 3MTBA 3ZE1B 4F6RB 4HN4B 4I4NA 4PZEA 2LGJA 1RYZA 1BCSA 3WGHA 4BVAA 5JY6A 1Z56C 4HNSA 3ISJA 2H6EA 1X87A 3GX1A 4I5IA 2IOFK 3AILA 1Z4KA 5EJGA 3U7JA 5A9RA 4MVCA 3DMYA 1QANA 2BBSA 1G9XA 4CKYA 1ANKA 2E37A 5G4KA 3V1NA 2PKQO 5K0CA 4ER7A 3KEFA 1M8GA 4Q4JB 5AJVB 3W9BA 3QXJA 2R8ZA 2YWEA 3PR1A 4UKDA 2XBUA 5JPDA 5E6SB 4GE3A 1D2NA 1Y63A 2KB0A 3PU6A 2Q5LA 2PWYA 4FCVA 3R9KA 4EA6A 2ZUUA 3LK6A 4P53A 3AOGA 4X1KB 2YN2A 4RKEA 3N7UA 4O3MA 1RYNA 1N78A 5CJ2A 2WB4A 5IXJA 3HS3A 2QRGA 4IXWA 3MJRA 1H85A 1QFYA 1U1IA 5FCDA 1NN3A 4BN4A 1P19A 1PO7A 1QZTA 1KDVA 1STOA 1AQUA 5KI6A 5BV7A 3E9DA 2O8DA 3SM9A 3WZLA 1OYWA 1TMKA 5FX2A 2M6LA 1WXLA 3TOCA 3KFXA 1W88A 4CZ2A 1JDZA 1OU0A 2AHOA 3ZK7A 4QTTB 4F0JA 4ZGGA 1OZGA 5IKEA 5LJLA 4DLPA 4HWTA 2XMQA 4KMOA 4AF6A 3IIEA 1BHJA 2BTQB 1WABA 4GU5A 2BY4A 4MEJA 1GNTA 1ZI8A 4DM7A 5E4FA 3BEDA 3ZS8A 5LMUB 3EGCA 3FDIA 1U80A 1A5ZA 5TS2A 3AF0A 3H5RA 4HDQB 4AWAA 5L7YA 4DA8A 2WVJA 5I47A 4M0KA 4FSXA 3EWIA 4ZYLA 1VLHA 4D6YA 1BEUB 1K6IA 5A6VA 1P81A 1TF5A 3DLCA 3GT3A 3AHHA 5JC1A 3BIJA 1IEVA 2Z2KA 3Q15C 3ZYCA 1TM7E 2V74B 3ETJA 3EIEA 4YRSA 4OK5A 1NLZA 5DM60 3QX3A 1C0LA 2NUTB 4J7UA 2LPMA 3DHWC 2DSNA 4TSRA 4P92A 3RHSA 5IFLA 3N2GA 3BKXA 4LJ9A 3G0CA 5C34B 2G40A 1YB5A 2P4SA 3X1ZA 5HBGA 4PO1A 1R7RA 4GQAA 2JLUA 1JU4A 4DREA 1WB6A 3DTVD 3U0VA 2BZGA 5IAKA 4YK7A 2JVIA 3CVOA 4YXWD 5I4KA 4R05A 3GBPA 2PUVA 1QPGA 1N6NA 2GF2A 3LX8A 3HDJA 2WPNA 4E6EA 4M2LA 4LHVA 3QE2A 5HIMA 3HP7A 2G25A 3EASA 4OU5A 2GPSA 2HCRA 2AHRA 3C3YA 2ONYA 5KSZA 3HCFA 4B3GA 3ICWA 2WJIA 4RGQA 1EFAA 1JHDA 4E09A 1CX9B 1GZUA 2BZ1A 3EODA 3PXCX 1BVRA 3E03A 3NALA 4WZBB 1VL0A 4JDPA 3WHLA 5BURA 4DLKA 4R2WA 5CB4F 1U6KA 5HGXA 1MJGA 4B3BA 5JSQA 4RMGA 1HTTA 3LUPA 4IOJA 4X85A 1NMXA 1V26A 3WRVA 5DNYB 1F7VA 1UC5B 2VUIB 2HRQA 4YASA 1KO8A 2FZKA 2P62A 2DHQA 4HL6A 3AKZA 2OHXA 3KKOA 1K8YB 1FK8A 3Q8XB 1SH7A 2OYSA 5FBQB 3G5TA 1USWA 1MABA 4IJQA 4R2KA 2NO1A 4IYRA 5MN5A 3OQHA 4AZVA 3E5NA 5CYFA 5MF6A 1N2OA 1IG3A 4FGSA 5E6RB 4KO4S 2WPDD 3CVXA 2Z04A 4QHSA 5JJCA 2BFDA 1P29A 4BQPA 4XJXA 3AMVA 4PE5B 1I3MA 2EJWA 1P2SA 4NARA 2W9XA 1P6XA 3MXTA 4N5LA 3HI4A 2YMPA 1KAEA 4X5OA 2GBIA 4OAPA 5FDFA 3DQPA 1RQ7A 1Z4LA 3QBDA 1XVLA 4GZMA 4QEZA 5J58A 1E3QA 4J1NA 5BRNA 2RFLA 1ORWA 3ASUA 3KWFA 4GP9A 4N8EA 2W11A 4XGIA 4Y2PA 5IJAA 1B3RA 4XGRA 4FT2A 1GPWB 2FDXA 4R2LA 1WB9A 3P2MA 2ZXUA 2JFBA 3F78A 4D3SA 4DMFA 1NSYA 2XR1A 3KXLA 2O3JA 2PBZA 2SCUA 4EHBA 5AJTA 1AKUA 3QVGB 2PL3A 3C8HA 1CVIA 2V7PA 2X5KO 3A9WA 3BCRA 4HB4A 2VOJA 3MD9A 3C4VA 4CUZA 5CT9A 1E7RA 2I7DA 3FPHA 1P3JA 4QUBA 5CFQA 3SS9X 4PQYA 1HX7A 4IF4A 1JMVA 4P4SB 1CJTC 4X45A 5TF0A 1HDEA 1IXRC 2JAOA 4BP3A 1JFTA 2Y1KA 3S1AB 4GT1A 1D6JA 1IVSA 1E3IA 3IDFA 5LU9A 1PZFA 3LK7A 2XYVA 1NYTA 2VP6A 2NO0A 3LQRA 4ZMRA 2BFFB 1EHCA 5FO1A 1A9SA 3JZMA 3UV3A 4KRFA 5KQRA 3NTXA 3ITNA 1LQUA 1LSJA 1YE5A 3L4BC 5ANRB 5KTNA 1GGVA 4U8HA 4BB9A 3LY8A 2HHCA 2EFHB 2PXHA 4LWOA 2VJYA 1SRQA 3R7AA 3UZUA 3PUIA 3EBOA 3GFFA 3GZTB 5DM70 1P9NA 3IKTA 1ZUNB 4PZPA 2FUG1 1WQ1R 3DTYA 3WYFA 2E4ZA 4EI9A 1AMOA 1MC8A 2R79A 3DHEA 2AXNA 4MQEA 1U65A 2WLSA 2H8GA 1U0BB 1NBMD 3G49A 2SKDA 4G65A 4DZZA 1XPUA 1RJ9A 3BTVA 1XRMA 2QRHA 2B98A 2GMWA 2VAMA 2FPRA 2WQZA 2BMWA 3RS9A 1DFGA 3NATA 5D01A 4TTTS 1YIAA 2O5EA 4AJJA 4PCVA 3SKVA 4NIMA 1ADGA 4MIKA 5DLPA 5KZMB 2X22A 5KDDA 3FRHA 4I1VA 4U5QA 4R81A 3LVFO 3WNCA 3RODA 3BMNA 4GGOA 3TE7A 1M2HA 3K0FB 1TT5B 2QQEA 5BYJA 1B8OA 4GL2A 3WYGA 2F1KA 4LWZA 5ALNA 4E70A 4GXNA 4CU5A 4D0LB 4ER3A 3Q87B 4EITA 4D3YA 1HDIA 4IDQA 4WK4B 1HGXA 1YL6A 1M6HA 2I1QA 2VXBA 3IOYA 4QUIA 5CA0A 4FT4A 1LF5A 2CL6X 3I92A 1B2RA 5IDWA 2XA9A 3GLQA 3QU5A 2DFPA 2YOHA 1IHDA 1VL6A 2Z6AA 1GZHB 2IPAB 1VFPA 2ZT8A 3KZMA 4EVSA 3VKGA 1XZQA 2O23A 4N3AA 3FHLA 4JJIA 4Q5IA 2RC5A 3FF1A 3IPAA 5FTWA 4I36A 3Q3VA 4GIBA 5BQ5A 2UXCB 2ENWA 3FFBA 2PIAA 5G0VA 4CG2A 5AKYA 1NW3A 4XUCA 3EPKA 1Q74A 4RD3A 2GVZC 3KSDO 1DAOA 4BZZA 3E8SA 3LQKA 5IANA 1SD1A 4KH1A 1CF9A 3D5QA 1PWYE 2K7ZA 4K87A 5LZ9A 1AH2A 2AOTB 2YHIA 2YY7A 2JBAA 2CBXA 1SVOA 2V98A 3GMIA 2HKIA 4KSCA 1HE3A 1O87A 2KLHA 4ZU3A 3ZDQA 3E5HA 3GNQA 3VNBA 2AFIE 1E5QA 1CP2A 3MSXA 3PUHA 5AR1A 1YRHA 1XRSB 1JALA 2Q5JA 4Z0HO 1YR8A 5DLEA 2FH5B 4CXMA 2IS2A 4F93B 3AB7A 4DJTA 1HRYA 3CLUD 4Y2RA 2O1EA 4HAUA 5HCNA 5AKGA 1AXGA 4BNTA 3O75A 3QHAA 4DV3B 5IYZB 1XZBA 2CLOB 1Z35A 3O8RA 3HRIA 1C7RA 3IMCA 3KZOA 5A4MS 4TT3A 4C6SA 4WA7A 4YJ3B 1N3LA 4EB6A 1K1EA 4JA2A 4QDJA 3CLUC 4QFMA 5BSVA 2B94A 5ESWA 1RTKA 4CHGA 1DTWB 1PJZA 1A88A 3LGXA 3OCZA 4GDMA 3MUNA 3NW9A 2HK9A 1ZY2A 3I58A 4BRUA 4YT4A 1Z3CA 1ZGAA 3BCHA 4ZCSA 1U3DA 4PC6A 1ETUA 5CR9A 4CKEA 4NHOA 5H83A 5K5EA 1BTOA 4HTAA 1X74A 3ZGYA 1C9DB 4ZYWA 4B4OA 3LCRA 1Z4IA 3D4IA 3LHFA 1FDVA 1NVFA 1TU4A 1UM9A 1UXIA 5AK4A 1GDTA 1TCCA 2YVQA 4KXNA 4W6QA 1PWEA 1KPIA 1DIAA 2J6IA 3CEAA 2VWQA 2CFSA 2VNAA 1S1MA 5B2FA 3UAGA 4D4HA 1DO0A 3BDAA 1YHYA 3D02A 1QRTA 2VQ3A 3TI7A 4D9NA 1NASA 2A9QA 3DZJA 5ENDA 3ZQ4A 4RETA 2IDMA 3O8NA 1KOGA 2QAIA 1B16A 4K3VA 3OPYB 1KBOA 2EQBA 4P82A 2PH5A 3AIIA 4D9HA 1Y48E 2RKBA 2BGRA 2XIJA 4G4IA 5HUJA 4F4UA 4JZKA 3CCBA 1IIRA 2BR5A 5EJ2A 2UYOA 5A6SB 4BVJA 5TVKA 4DMLA 5ABPA 2BH2A 3ZOZA 5AW6A 2OP1A 1E79A 1A1VA 1ZOLA 2DJ5A 3OLXA 1EFRA 1IQ0A 2Q9CA 2X13A 1NMZA 2V9CA 5J4VA 3I9OA 5LD2C 2J9FB 1PS8A 4RA9A 1X0XA 3J7AC 2FW1A 3A1UA 3FXAA 4R2IA 1JFVA 1RXIA 4CDGA 2AI1A 1NHGA 3AKCA 5CEEA 1TCBA 2B8WA 1VJ1A 4RPGA 4WT7A 1CZUA 2BR4A 2YDYA 3OQPA 5G1OA 4R68A 2C77A 4DBLC 4PLCA 4D96A 4ZEVA 5IHPA 5IZ4A 5JD3A 4IDNA 3CF4G 1XNHA 4MUIA 2WKPA 1NBWB 4BOYA 2K7FA 2IHVA 1NIPA 1FF9A 1LW7A 3DDWA 3IEIA 4O5OA 4CMIB 2PL9A 2FV8A 4OK6A 3LVBA 1QMPA 1QOPB 2I7TA 4PANA 1PJCA 5ENVA 2GN0A 4WBNB 1KDOA 2H5LA 3ONFA 5DXAA 3ZHBA 1IH8A 2ZREA 1F06A 4BLTA 5EJMA 3K15A 3WIUA 4NG4A 1G2QA 2E4XA 4IEEA 4UFOA 2J0QA 3K4PA 4GH5A 1JEAA 3O5AA 3DR5A 5E7QA 2EVWX 3ZZ1A 4MAFA 4NP6A 4D4GA 2VA9A 2FWRA 2HZBA 2O4CA 1NXTA 4UU7A 2ORED 3JQDA 3M81A 4H3KB 3Q9UA 1T6NA 2J5BA 1BYUA 1UBLS 4EYKA 2X0DA 1LWOA 1LBQA 1ULTA 1E3JA 2PXXA 1Z68A 2XE7A 3GNSA 1WUYA 4R5HA 3EZ7A 4DJFC 3AVVA 2YV3A 2VWHA 3T7AA 1N2CB 3CLSD 3EQ2A 4O2AA 5C52B 2TMGA 2JAQA 2YWXA 1PGOA 2BGUA 5FNVF 2JRCA 5H80A 3RC7A 3ZQUA 2E5FA 4W1PA 4KXVA 4KR9A 2G08A 3K16A 3UTCA 3ICVA 1V11A 1W6UA 2FMHA 2NTYC 3Q5GA 4RD4A 2CSXA 5AKZA 2DLDA 2YZ2A 5I01A 1YJAA 4W5OA 3RTGA 4DZTA 2PN1A 1WDTA 4PLWA 2PQMA 2EU8A 1FX0A 1ZN2A 4HB0A 2OZVA 4RLQA 3RRJA 4YMLA 5F9FA 3DFFA 1PQWA 5TB5A 3MSCA 3UW3A 2BW0A 2NG1A 2NOAA 3TZKA 4WJLA 4URYR 2JDIA 3SQOA 3L84A 1GAQA 4KZPA 1T3HA 3QVTA 5AKJA 5E2IA 3FYHA 3PITA 1VFNA 1S8FA 3KVRA 1NUHA 1X1RA 2HBQA 4OMUA 5IAOA 4CF7A 2OZLB 4GLFA 3IAAA 1OXUA 4NE7A 4EHFA 1JG2A 4KC0A 4GR9A 3F8TA 1FZTA 3PIDA 1TQDA 1FFDA 1GNLA 1BMTA 4JC4A 4ESEA 4QL3A 3TN7A 4C2BA 1JMYA 1WCYA 5DZSA 5JVDB 5LA6F 4DNFA 1AE1A 2H7YA 2Q3MA 1Z88A 3DVQX 4KMRA 4BMVA 1DAPA 1T9ZA 2YQ4A 4JI3B 1O0BA 2IZ0A 1KE2A 2FPPB 2ZB3A 4K0RA 1YVUA 3ETGA 3H42B 5JQWA 1E32A 4F06A 4IJUA 4JKIA 1IEQA 5LDDC 2I4LA 3T9FA 2J5XA 4ZJPA 4CIWA 5DV9A 1L4HA 1F8GA 4UHHA 3UV7A 2XTAA 4G89A 5FWXA 2ZSEA 1U9CA 1XCGB 1RZVA 1P2FA 3U26A 2X8BA 4HDRB 1A8SA 3WGZA 3VAAA 1ZR4A 5JECA 3OECA 4RM2A 1C5KA 2UZ3A 4RH0A 3QF4A 1RWWA 4E6PA 2AR9A 4QLOA 3BA6A 5CBKA 1OC2A 5KMGB 1O96A 3TMKA 2EFCB 3RSHA 3PPVA 3WRWA 4FJ1A 2PZMA 2WZDA 2X3YA 3IP5A 4J43A 4TTQA 3C48A 1ZRSA 1H42A 1X70A 2Z43A 3BK7A 3H1TA 4PIVA 3HO1A 2CDRA 2IIVA 1XZIA 1RXCA 5TGDA 4ACBA 1M1XB 2IY8A 3W6UA 4LRSB 4TV9A 5LYJB 3SVTA 1S0UA 4PTLA 3HDVA 4Q21A 4Y2QA 2W8BB 3OE5A 3QE4A 3VR0A 3W3AD 4HPWA 4B45A 4FLEA 4QDUA 5BMVA 3KAQA 3LPDA 5KAMA 3V8EA 5KCMA 2PGOA 1TADA 2A9VA 1K8RA 1Z16A 1N57A 2PKXA 3C6BA 3EJWA 1IFXA 1Z29A 4AUMA 3TQOA 3PC4A 4WNAB 4X93A 1VP3A 1N6KA 2R5FA 4H7DA 1NU8A 1XZGA 3TNJA 4HNUA 1UMCB 4MRNA 4RC9A 1RMTA 2BKXA 2IUSA 2WTBA 4LY9A 5EXDA 2Y6VA 5HRAA 4LXTA 4LYGA 3ND9A 5JO0A 1D6SA 2ZVDA 4KIFA 1B8UA 3TQHA 5A0VA 1Y89A 2E55A 3FBTA 4LG1A 5DCWA 1UJBA 1U2RA 2W6ZA 3JR3A 3O1IC 4PX9A 4YCJA 1A7KA 4EJ6A 1VBNA 1XRNA 2JPDA 2VWPA 4HXGA 1ZVJA 4QYIA 2UDPA 4FE3A 1O95D 4RVHA 4YCCA 5JJLA 3STHA 4EPWA 2W2PA 5G4LA 1JLRA 1R3UA 1SQ5A 1IU9A 3S8MA 4ZODA 2WOOA 1N2GA 5H9VA 2C4NA 1F6WA 3DWGA 3UGTA 2IHUA 1B15A 1T0PA 3FMVA 3HEAA 4HF7A 4L57A 2YVUA 5T6BA 4CM7A 5AHOA 2KJQA 4HGQA 3KHUA 3WK9A 4FHCA 4MGKR 4G23A 2AKEA 3TNDA 4KVFA 1RI5A 2YJ3A 1Z6XA 4Q4AA 4WZBA 1XD2A 2QZSA 1SG9A 1GG8A 3EEQA 3LAWA 1IG0A 1O5TA 2J32A 4GOMD 3S27A 4HDSB 4IKOA 1HMYA 1QORA 2ZULA 3C3EA 4IDBA 4L16A 1MX3A 4O33A 4WLVA 3TM4A 4W9MC 3ILXA 5JC8A 4ITRC 1CZKA 2NWQA 4L73A 4URXR 1IMOA 1R8JA 3PEYA 3NIBA 3DBHB 1W4LA 1EGVB 2HUNA 2OSVA 521PA 2O2YA 3L7NA 4PLTA 5CH3A 1HY3A 3L8DA 1FNSA 3VPFA 2GUWA 4CJXA 3GXBA 5PGMA 4CQLB 4B7AA 1I1HA 5BXYA 2J6HA 2QTHA 2QT1A 2RBKA 2B5VA 2WYWA 1TKBA 4HB3A 3AY0A 1POWA 2FUNB 5AW8A 2FE1A 4K6FA 3U7QB 1K66A 3JALB 4J0EA 4JLOA 3KLNA 2V8BA 3O9MA 1AZTA 3U3XA 3LT4A 3N6RA 1N2IA 3DV2A 2H1HA 2VHXA 3EEIA 3PA6A 3HCOA 2GZRA 4RK0A 5JQGB 3AEUB 3EWNA 2QRJA 4DLNA 4DPLA 2YDXA 5FYDA 1CDOA 1PJTA 3QVOA 2EOAA 4PW0A 1JFFA 2IOFA 1XP5A 2IHTA 1JQJC 2IHZA 1CT9A 4YUVA 3WLQA 1U94A 3AVPA 3EXHB 1G4AE 2HWUA 2QTVB 2B20A 2XXBA 1IY9A 4JI4B 1CUAA 3CWQA 1TM2A 1IY8A 2V6JA 4B3SB 1XZNA 1SC4A 2D7CA 4LY6A 2O6LA 1BN7A 2J4CA 3ROTA 1M6YA 5TPWA 1IBMB 1JG4A 1M0TA 4YUWA 4RD0A 1LK0A 3W8FA 1NKSA 1U0HC 4Z9AA 4EUEA 2HHAA 4ZQGA 3TRHA 3HUEA 5JDIC 2CFRA 1ZCBA 4X1IB 1EFRD 1WOYA 3KQTA 1AHPA 5JU6A 4UW9A 1GPUA 3FFWA 1FJGB 4KV9A 5IVDA 4PYLA 5IK2A 5JJKA 3DBRA 2XCIA 5FYQA 3MLEA 3U9SA 4FW8A 4HDKA 1ESNA 4MV3A 3U13A 3ZD6A 2DUJA 4WZ6A 3DMDA 1EXVA 1H93A 4RSRA 1MJNA 5IJ9B 1A7AA 1IPFA 1SZDA 2VQSA 2WEKA 2M6RA 1E2EA 5DYGA 4HV4A 4G0OA 4Y3UA 3A26A 2O0KA 1WULS 1SQ6A 3A1VA 3H2KA 4GMDA 4QJ4A 4A82A 1Q7CA 3C2QA 3MRTA 4CV2A 1OB5A 3AT1A 1MDFA 4GD3Q 5BSKA 5I9NA 1TPZA 4AYWA 3IAEA 5D3MA 3A9TA 4HBGA 4HH1A 1G7SA 4J2TA 2NTEA 2PZEA 3K1ZA 1T25A 1WTAA 2W2TA 4GP6A 4QPDA 2I2FA 2P1RA 3PE4A 5KX5F 2ROQA 3FCUB 4C5AA 4O29A 4ZAGA 1PJLA 3IPLA 5CEJA 4R9RA 2I67A 4KDFA 1IL0A 1R5OA 2E4AA 2MSWA 1RHKA 3OP1A 1IN5A 2PX0A 4P3OA 4CVNA 1AT1A 1L7AA 1W35A 1N8SA 3L02A 4PAQA 4C0HA 4EB0A 1M9NA 1C9YA 2X6QA 3STXA 3NVMB 2OAQ1 2WYIA 4JJFA 4KYIB 4L78A 3IBCA 1OY1A 1M6VA 1RPAA 2A57A 4I1SA 4RV4A 1URPA 2BUCA 5T8KC 2HZ7A 4D92A 2X2PA 3P20A 5F77A 3OC6A 3SI7A 1DCKA 5FAXA 5FUWA 1IWPB 4DUGA 1UBCA 1ZUD1 2BFPA 5HS4A 1KAHA 5HQ3A 3D6VA 5CJJA 2GN2A 3R5KA 3N5KA 1ZGHA 1OBOA 1Y3HA 2GJ9A 3BFJA 3ROMA 4DIKA 2P9BA 3FF4A 1VCOA 2WF6A 3IMKA 4JBIA 1ZKDA 5BN4B 3KKKA 2D3WA 4HAXA 3RSLA 3IEPA 3HH8A 5G40A 4GPTA 1XK6A 2V59A 5ALZA 2IZZA 3SG0A 1J5XA 5B5SA 3NKLA 3DAPA 3EPHA 2ODAA 1E2NA 3OAAD 4J03A 2JG3A 4HNGA 3TSAA 4MV8A 1T36A 2BDEA 1GGJA 2DHCA 4ILKA 4QWWA 4S1NA 2PYIA 1IZ7A 4NMHA 1UF9A 4JKYA 1TUBA 4Y6OA 3U09A 4B5LA 4MV4A 4FMDB 1OH8A 1UADA 2HNAA 2FRDA 5EOVA 1MQ8B 4WCFB 4PX2A 3C3DA 4HUQA 3ESZA 2JFQA 5BV8A 3OETA 1NL3A 1E6LA 1RQRA 2QHXA 4Y2TA 3ANYB 1ZONA 2ORYA 4LOIA 1B6SA 3C0KA 2NQTA 4HATA 4ZVVA 2OOSA 5FUVA 3S28A 1KI9A 4KMMA 4ISCA 4MRMA 2YV5A 2F59A 1MO3A 3U81A 5KQSA 4MOWA 5DWQA 5TLSA 1MNAA 3UUFA 2I3GA 2ZUBA 4LYAA 3NDRA 4S0XA 4OXXA 4FFWA 5L6MB 2ONZA 2L69A 5HRUA 3NU1A 1EK1A 5JEDA 1IB6A 2EKZA 3REQA 2B21A 3C8DA 3UC5A 1RE1A 2QMYA 2I33A 2V5AA 2VT6A 4PPNA 4DUPA 3QA9A 3I0NA 3I9V6 5K8CA 1G9SA 1HPLA 3NLLA 2FP4A 1E2JA 2HF2A 3HRKA 1EYZA 1VIDA 4FE7A 4N65A 4TL6A 4A0RA 4GNRA 4KNVA 4RKQA 1F38A 3FUUA 4F4IA 3EEOA 2PXCA 3LF1A 4HWOA 4Z4IA 4XWTA 2VTBB 3ELBA 2SECE 3LUFA 4XQ9A 1UPXA 1OAAA 5IXSA 4QYMA 3MJCA 3D0RA 3ZCXA 3L7JA 4HEA6 3BB4A 1QKJA 5L40A 1GRNA 3AFNA 5DHPA 1PD0A 4MQ4A 1BXGA 3OESA 3O74A 4IDDA 3ZCQA 1P77A 1N7HA 1W5TA 1NTOA 1QYWA 2OCAA 2VJMB 3LXUX 3QWHA 1W0JA 4OQQA 1A4RA 4GI3A 4RZ2A 4XH9B 2H63A 5I3CA 4RPJA 4PPQA 1JJBA 1GL6A 1Z4QA 1W5FA 4WCDA 1J3DA 3S99A 1ZMXA 4G2TA 4LCBA 3V8MA 2VZ8A 2HW8A 1JNXX 5JAZA 4BVKA 3HG7A 1J4AA 4I2NA 5EZQA 1J7JA 5K8IA 3BREA 4PSCA 3AVQA 4B84A 2NUPA 1KMQA 1NJ5A 2YNMC 1OROA 3CKYA 3RYFA 3W4IA 4EUFA 5BUSA 4RTKA 3WVNA 4DGQA 1M2EA 3FGPA 2Y71A 1UEJA 4LJ7A 1VQ1A 1T8YA 2G9RA 1A8HA 3B9BA 5D1NA 1FU7A 2HY7A 3EXG1 2EKDA 3D1LA 1RC8A 4RKRA 3MCUA 2OLKA 1QLWA 3IP8A 5D5HA 2WWHA 1FNNA 3L7OA 1T5BA 1V37A 1P91A 1U2QA 3QU2A 1U7WA 1ZWLA 1T5OA 2DR3A 2R1TB 3LYHA 3UKJA 3MB8A 3FPCA 4UBJA 2G6TA 4IGIA 4BXOB 2WFMA 4NZMA 4RVOA 1Q15A 4I55F 1M8JA 2G17A 3G1TA 2C2XA 1KZGB 1ZM3A 3Q7QA 3K6SA 1QSGA 4YONB 4IX9A 4KN6A 4EMSA 1R5JA 2PFSA 1QR6A 3VJLA 1J9EA 2AMJA 4ATNA 4E1AA 1W1UA 2Q7OE 2W4QA 2P3LA 1HKUA 1PJ4A 2O0JA 5GV7A 1L5RA 2OCXA 2GHQA 1PFYA 4N1AA 4E5DA 3ZJTA 2A4MA 2V0NA 3O8QB 2NM0A 3N2KA 2YHAA 4WCFC 2H48A 1DG1G 3PNVA 3NUZA 1YR2A 3UMGA 1GKYA 3NAMA 3CZQA 4EGCB 4KQIA 3B1ZA 3GFSA 1W8IA 2PS3A 4JXJA 4O4LB 2WHXA 2VVTA 3JTEA 1OB2A 4L8LA 1P4SA 2RC6A 4NE9A 4C1BA 2BR3A 3NBKA 5MFPA 4B0PA 4XXHA 5DTQA 2AOVA 821PA 1W76A 4F5DA 4RAQA 2WE8A 4I5GA 1FRVA 1ULBA 2YVAA 4C87A 3T3OA 4ZK6A 1OA0A 5LQKA 3K70C 1HF3A 3KTAA 2CXXA 2ZBEA 5EKTA 4R1UA 4AIRA 3G5AA 3ASVA 3DKIA 5K4GA 5ALRA 2BHNA 4F5YA 4ND7A 4MV5A 1H2AS 3G0DA 3IPCA 4DRZA 4KQFA 2FZLA 3CZCA 4C30A 5KOJB 1WDWB 1Z0AA 2I3ZA 2CNOA 4PX5A 2DVMA 4Q02A 3TCNA 3ZXXA 1HK7A 1Z12A 1DX4A 5E7MA 4NG5A 4HSEA 3W2HA 3KPUA 2NU6A 4TUYB 2FSVC 1YIDA 3PEUA 1KAMA 1UKCA 2OHHA 4KQEA 2X2FA 4UCXA 4QUKA 1NFRA 1K88A 1LC3A 3M4XA 1C1DA 4LC1A 1BS9A 3QBEA 1ZGBA 4XWGA 3IJPA 4HQOA 1UJNA 3IDQA 4L4SA 1Z3IX 4M1WA 4I14A 1HMFA 4OSOA 4RS4A 3IGFA 2EFEB 3RS5A 2D3TA 3UAOA 1G21A 2IQ5A 1TCVA 3W2GA 5FWYA 1AK1A 1RQ2A 2YULA 4C04A 3PGKA 1VXOA 4JFRA 4US1R 4OUKX 4O4IB 5FR1A 2HJGA 1CW2B 1E2DA 1GNQA 1QR2A 2J3MA 4BNDA 1NAHA 3TVYA 2AUNA 5CD9A 3EFOB 4C3OB 5I45A 2NZXA 4PU0A 5A4JA 3WA7A 1USUA 3PFGA 2Q3FA 1R0XA 4QASA 4RENA 4HQLA 1G59A 1UFQA 3KB6A 4JZYA 5CVDA 3EIHA 1JAXA 3PTLA 1M0EA 3UGJA 4BFCA 3I01M 3B7GA 5HMMA 1XKXA 4YJ2F 4EI2A 3GPDG 3IR6A 2W8BA 2FDCA 2FW7A 3ZKWA 4BCBA 1V7QA 4D0NA 3GRCA 1F8UA 2WWFA 4KGXA 5EQDA 1HL7A 4ZZ1A 2HGZA 2QVYX 3OIVA 3P9ZA 4X60A 2R8RA 4YFVA 3VR6H 5LJIA 4UU1A 1MOQA 2VRBA 2VA8A 1II0A 4HX9A 3HKEB 3WMWA 2PT9A 4N9WA 4CKBA 2BL4A 1V5GA 4G4GA 5J1TB 2RGBA 3BMQB 1TTTA 2VDWA 2ETXA 1CFJA 5BNWA 5DGXA 1QTQA 1PNVA 3P2IA 3PXAA 3DFMA 4IS3A 1SXJE 4CR8A 3W77A 1TAUA 3NT2A 4DW8A 2H08A 5CDGA 3L4KA 3NBZC 4HNVA 3ZHRA 5G3YA 4DLTA 5IBPA 3TAUA 4ZIRB 4AMYA 1NWCA 4EY6A 4G0VA 3OT1B 4OEHA 2QRZA 1WDKA 1Y1SA 4BECA 2H2WA 4Y9UA 3SSAA 4CMEC 2EAUA 1G4UR 2XGSA 2LY4A 3O83A 5SZIA 4G26A 2FPPA 2CE2X 4CLEA 1I7SB 1JH9A 2XWQA 5JMTA 1P2VA 1UDWA 1UWVA 3HMQA 3PHBE 5ELXA 5KHOC 5DT9A 5TX7A 5A5FA 5BVHB 1ZNQO 3PR3A 5T7BA 3WL6A 1A0OA 5JMWA 3SN6A 3BULA 4C76A 4BNGA 4FVTA 5EIWA 3TVTA 2J3IA 1GYQA 5FOSA 4YALA 3OM1A 4UFNA 1C81A 3SE7A 4G0WA 5HHTA 3RG2A 2H2IA 3NHRA 2B92A 2ZB8A 2BAGA 4WY8A 4HQNA 5AVWA 4YV7A 2W6CX 3OE7D 4TT3D 3R7DA 1R9MA 1Q83A 3PFKA 3OZEA 1NQXA 4RTLA 2R6ZA 2PL1A 3TQ6A 3FKSA 5AVKA 4MQUA 5ARCA 4NABA 3DAFA 2HU2A 2WIAA 1MJ5A 3G85A 4X7RA 3VI3B 1AQJA 2RHLA 2QTMA 1EVQA 2XLBA 4LFAB 4F04A 1BVHA 2Q2OA 1E6MA 4KOEC 2IY7A 4QXRA 4CEIA 4HAOA 2H2FA 1YAHA 2MT9A 3K31A 2QRNA 5EL0A 5IH3A 2HEGA 1N7JA 2RHJA 3V4LA 2C2YA 2HF8A 5EIHA 3C5EA 1PV2A 4U8GA 1PW5A 3S29A 3TKAA 4U7PB 5BN3B 1XZFA 1E8NA 3DL0A 3IAS1 2R60A 1QYIA 4QRIA 3UG7A 4U2CA 4PINA 2BJWA 3KE9A 4PBTA 2J0SA 1EZZA 2R8PA 5IHXA 4W5TA 1JPUA 1TK9A 2BFMA 3R1IA 4MGYR 3O26A 3NC1C 3ONDA 3K1YA 1G2IA 3N7AA 4MINA 4HAVA 2IV7A 4ZVSA 3ZJVA 1BHQ1 5HZKA 2ORVA 3BGVA 5KHAA 3EF0A 5K8UA 4BJ5A 4AS1A 3RBVA 1ZM7A 4FGZA 5C7LO 1QFMA 1JIVA 3X1XA 7REQA 1PR9A 3DE3X 4H6PA 3L8GA 1D1PA 1TC1A 1SB9A 3QUTA 4L9RA 3ZK9A 1VECA 3IT3A 4RMNA 4JLJA 1K6JA 4MW5A 3VR4D 4BFZA 4NXNB 1DQPA 3M0EA 3T9BA 4LBVA 2WJGA 3HDGA 4DC1A 5FWDA 1DRJA 1CYEA 3HABA 3I52A 3TR0A 5HX7A 1FQJA 4G9EA 3UJ9A 3EAFA 3DP9A 4TROA 2QD4A 4MUMA 1Z6QA 2J9RA 1T4GA 4GM0A 2V7TA 3IERA 5AK3A 5KKAA 3ADDA 5EG5A 2XAAA 1ZLYA 2IPNA 2O3SA 3R9XA 1DL5A 4NEHB 3OY2A 4CETA 2VWGA 3TF5A 1UAGA 3QVSA 2JKYA 2I91A 1G5FA 2BM8A 1AOXA 4X1IA 3GOQA 1T8SA 2CNKA 4I8IA 3RSFA 2GJ8A 2A0FA 5EMKA 1NFFA 2ZT7A 3PJRA 1H4QA 1RR6A 3U16A 3HYSA 2M1XA 3F6SA 1JQKA 4N41A 1FUEA 1GJRA 2AFRA 1YUNA 3OPVA 3Q6IA 5IDXA 1DLJA 5DBIA 1XL0A 3ISVA 2JLXA 3PNQA 1G8HA 1KK0A 3M70A 1ZDMA 1HZZC 3DXXA 3MYRA 2B1GA 4KH0A 3WZ2A 3C70A 4RJ2A 1GFWA 5FHRA 5M5BA 1GLVA 1XE3A 3PCRB 4NOKA 3PEEA 2NTVA 4PZLA 3ITKA 3ZD8A 1KJ9A 3HA7A 4M38A 2Q07A 4RYDA 4V0RA 3C3AA 3P4XA 1K63A 2BYTA 1E2UA 3N0TA 3EGXB 3KXIA 3IHWA 1B6GA 3KVOA 4HB2A 2B2CA 4TQUS 3L1HA 1J5PA 3HDQA 4UU8A 5B53A 4FB5A 1Q0RA 2PLRA 3VTZA 1T8PA 2XYRA 2YHBA 3RARA 4OB8A 3DKVA 1IK4A 2R1UA 5EPOA 3NS7A 4NJEA 1JR3E 1X80A 3ANSA 3PL1A 4ZOLF 2B8EA 1Z08A 1BXRA 3PPYA 4GYWA 3B48A 3K0BA 5LZ5A 5D5QA 1G6KA 4K3UA 3SXUB 3PD1A 5J4LA 4FJ0A 1FXWF 3QVVA 4RVCA 3W3AA 3DHYA 1N7GA 1OD6A 2HJSA 4DIMA 5BORA 4X7PA 3JTMA 2VP3A 4A1OA 4UZFA 1WO8A 3JVIA 4BZPA 2CZGA 1R6AA 1F0YA 3ORYA 3OWHA 2C4TA 3V1UA 2G88A 2JIMA 3RAJA 1QPZA 1QVVA 1RVV1 1W93A 1W5EA 4L08A 4EIWA 2Z09A 3L04A 2QLLA 4CR7A 4HYTA 2A58A 4E32A 1I1NA 2P2GA 2OO5C 4OFXA 1DV1A 1VG9B 1P1HA 3S40A 1V1RA 1RHJA 3HCPA 1NHMA 1RLJA 3WBBA 5FWNA 1APBA 6Q21A 4IQFA 4DQLA 2KSQA 1TW2A 2JJ1A 3KR2A 4UXIA 2QROA 3SIRA 3WFIA 3KJFA 3N0WA 4RF4A 1KY2A 1Z0UA 2OFOA 1QVZA 1S02A 3AEKA 2A35A 3DOEA 4G97A 4CV3A 3SHWA 3K9CA 2O3TA 3NBXX 1TLTA 3DS8A 4L8FA 5L3RA 3LGAA 4ACAA 1ZA2A 1HXHA 2QN1A 1X38A 5ICMA 1M5RA 2IL1A 2CK3D 1YOVA 4NBWA 2GEBA 1CIJA 1EB8A 1XCJA 2A7QA 3MHTA 4U7WA 3KBOA 3MGBA 1UZLA 3D4PA 2LHJA 3DKKA 5J2UB 4U6QA 2IU0A 1K4MA 8ATCA 4B8WA 1ZVMA 2AV6A 2I9KA 3D5EA 4JEIA 3F9IA 1EM8A 1I7DA 3IUPA 4PG5A 4RTJA 3ZVMA 5CX1B 2B35A 3RAPR 3Q3IA 3VMMA 5JJIA 3EZ9A 3T5AA 1IRXA 3LBNA 4K9DA 4PS1A 3EK2A 4RACA 1EK6A 4W6ZA 4QLAA 2YCBA 3R3YA 1ZJ6A 2Q99A 1A9XB 2JEOA 1F0KA 3VC3A 4ABTA 3GLVA 4ID3A 5EFZA 5JW6A 1MO2A 1GO2A 5H7XA 5L95A 1NI3A 2W4IA 3DO5A 3FIJA 4HFMA 1XDUA 3C7CB 3GLFE 3DTVA 4U00A 4X24A 4E2YA 1MV8A 1UXGA 3HCDA 3IEKA 3HXQA 4AQYB 1U6JA 1VSBA 3QPUA 1XLTC 2CCGA 1SC9A 1UBUS 5G3ZA 3UPTA 3NYWA 2H9AA 2VL7A 1XTTA 3ESRA 1JBEA 4HYEA 3C3BA 3UT6A 4C01A 1V0JA 3IUSA 3SR0A 3LQFA 2F2TA 3CRNA 1CKEA 1T10A 3FTCA 3NBQA 3H17A 1AURA 1OAKA 3FNRA 3JX9A 3MPUA 3SS7X 4IW3B 4BWFB 3L4JA 3TW8B 1SA0A 2GWRA 4DJEC 2FPIB 4J0IA 4ZAXA 3U56A 2WSSD 5EWJB 4RH3A 1BGWA 1SD2A 1OGJA 4Y2UA 4YPVA 2J85A 3ANXA 4RIFA 1FL9A 5AIAA 3O0TA 2PUTA 3PS9A 2RK6A 3OO1A 2FZVA 1R6DA 1BDBA 3WQHA 4IMPA 1H0SA 1T5IA 4HQ6A 2OSBA 1ML4A 2BGWA 3TUIC 3UJCA 1UCFA 1ODFA 3CLHA 2Z58A 4HNHA 1C1HA 2KQUA 4JJGA 4JC8A 4EBBA 5CG2A 2KBEA 3KAPA 4ZOBA 5G1NA 2BOVA 4Y9RA 2JBWA 2G76A 4DXHA 4CCWA 1DDIA 1ZP6A 3BSWA 3JAKB 2E0IA 2QWXA 4X00A 4Y0NA 1JE1A 1LEHA 1Q50A 4U7DA 2WLTA 1RRCA 1EZ4A 1WEKA 2XCTB 2QUKA 5FPYA 1XVIA 2L82A 4RPLA 1Z5GA 1L5SA 3MJVA 4AM8A 1JZQA 3P9IA 5ESRA 3CT4A 4M1EA 4BNYA 4U7JA 1U2GA 5DMHA 2IYYA 2ZCVA 3U6BA 2V03A 2JLWA 1GGFA 3WSTA 4LE0A 2X40A 1CG6A 5ALXA 5KJ1A 3OD1A 1PT9A 2V7GA 2I8AA 1TUEA 4TMYA 3I9FA 1C4XA 3LY7A 3CPHA 3V4RA 1QG0A 3H2SA 4FSHA 1AZLA 4KJZA 2ZYUX 1VZ2A 4P8RA 5JNTA 1GUYA 1N9GA 4GRIA 4BO8A 4V1CA 4NK5A 1IHOA 3HWX1 1ESZA 4I1OA 2B5WA 3ZNOA 4L76A 5L3QA 1MG5A 5DLYA 1N2BA 2MINA 5FA8A 1G18A 4LPSA 4KDEA 3H5AA 2ISQA 3QJGA 1A9TA 1QGYA 4I1RA 1NRXA 4LC0A 4B40A 5LNK6 2CRJA 3HDHA 3NT5A 1G2PA 2AFHE 4IMRA 2Q8QA 3PFNA 3HMKA 1V6AA 2P2YA 3IVAA 3NHBA 4JB0A 1C3OA 1KIMA 4WOKA 4DQUA 2NSDA 1COWD 3TL2A 4IIHA 4DCNA 1OBFO 4MI3A 3KPWA 4QARA 2QD5A 2Q6OA 1JHQA 2BGTA 3AEQA 3FW1A 5AM4A 1AN9A 1DX6A 5E3HA 2HYIC 1JLHA 1RACA 1RLTA 1H1LA 1XVVA 1LTKA 3QVWA 4FXPA 3AFIA 5JAOA 3UAWA 2VRNA 3IEMA 2DWPA 4PY2A 1BJTA 1JPJA 5P21A 2IH4A 2IVZA 1MB3A 4DFDA 1W52X 1NHWA 5ALMA 2CVHA 2W5UA 1SVMA 5ARDA 2RI6A 3I5MA 3L0ZA 1SHZA 5EZ6B 2WTUA 4B75A 3IDOA 3LDHA 3CF0A 3UT5B 1L3IA 4G5QA 2QI9F 1SELA 4OI2A 4B6JA 1ZNXA 2GM9A 4X3CA 3VH2A 1RKQA 3BGDA 3AR4A 4WMLA 4AN0A 3HYLA 1I4DD 5JATA 2ZTVA 4KQCA 1K2WA 1SOAA 1T0HB 4XR4A 4FEEA 3PGA1 1WL8A 3FAKA 3FLAA 4BCCA 5IC5A 1EJ2A 2ZT5A 1E9VA 3HEMA 3T9CA 4JT4A 1UAYA 2VHUA 3OZFA 4LNUB 3RRMA 1GSHA 1DRVA 3UVEA 1CUCA 3ECAA 5B57C 5KOJA 4L28A 1GUBA 3OZVA 1XLWA 4DCCA 5DN6D 3MB5A 1A1SA 5BPHA 1D6MA 3SMQA 3BBLA 1R0YA 3NHKA 2FZEA 3BFPA 1D1QA 4OREX 1EX1A 2ZR9A 2Z1DA 5DH9A 3HLYA 3AX6A 3LW7A 5CJPA 1L7VC 1XHEA 3NHFA 3ONEA 4JK3A 4P7GA 3EVTA 3L4BA 4WD3A 2OXTA 1N92A 1H2WA 1IN6A 2OO3A 5AHWA 4AJNA 4NEQA 4RK7A 2WB2A 3VNAA 1U9YA 3G5MA 2VFAA 1HT2E 1KGSA 3D3EA 4F9TA 1N1DA 2Z5VA 1AABA 4CLDA 1R0SA 2BMFA 3G2QA 3OTIA 4BKOA 5HK9A 2EATA 4LHWA 5F2KA 2HWYA 3C45A 2PL5A 5CIYA 1CY2A 3ETEA 3JYOA 1DQZA 2HMYB 1FXWA 2ZJ7A 3KQNA 1F2TA 3IBYA 1UL1X 3DPUA 4P5PA 2PCJA 5AOAA 1W36B 4BFVA 3CGGA 1GNRA 1TZKA 4UUOA 2ID4A 1I4WA 3W4KA 4CCAA 3CX3A 2IKQA 4TVBA 2CMHA 1XF1A 2A14A 1QH0A 3MOSA 3A2LA 1ZISA 5HDBB 1XD2B 2X4IA 2W6JA 2HQOA 4JBHA 4M8KA 4N6NA 4XARA 3RFTA 4G1UC 3M6XA 3RHTA 3WHKA 4ZVQA 5I9SA 3GLHA 1CQPA 1KQGA 2Y1GA 3DCJA 3HSKA 3QU7A 3WK6A 4JWTA 4FHEA 4DN6A 4YUAA 4XWKA 4UASA 1BKSB 1ZCAA 2H65A 3VR1A 4F86A 4YAOA 3MWEA 3T3HA 2GZ1A 3FNGA 1Z5UA 4A6DA 1ZAKA 3ZWOA 4BJ6A 4LOJA 4AG6A 3ZWAA 1OTXA 1HSMA 4QT0A 4Q16A 4B6PA 6PFKA 1G8JA 2IXTA 3OZRA 3QFHA 3R75A 1X7DA 2H0RA 5F35A 3IV7A 2VT3A 3O1JC 1P0CA 1SUAA 3DEAA 3Q7RA 5KNLA 1BJRE 2X6RA 4GKBA 4ZEXA 4MV7A 2QF7A 1H4SA 1EG2A 1QGUA 1P2GA 3INNA 5IC6A 2R68A 2DH6A 3P9SA 4CMJA 4DSUA 1SBHA 4TKVA 4CMAA 4W99A 5F64A 3KHKA 5FA6A 1RHRA 3LMKA 1LTQA 2CLDX 4S1WA 2FCAA 5EE0A 4YJDA 5ALTA 3CWCA 4URFA 3FIUA 1RSZA 4EG5A 4ARCA 3W04A 1VRWA 2VBGA 3OBBA 3BH0A 1WSDA 4BQOA 1KY5A 3O9VA 4RU1A 1VYHA 2CYCA 2Y9PB 2EFGA 4FPXA 4O2BA 5C2JB 5EMNA 4I4TB 3EF1A 3CO5A 4MPDA 1JWLA 3MWLA 5LFAA 1YQWA 4U39A 3B60A 4R1PA 2ANBA 1UFRA 1R0KA 2Q62A 4WX2B 2WD9A 1FX1A 1B4DA 2I7VA 4D99A 3HCAA 1W87A 3QOFA 3VXKA 4OXIA 4E5UA 3W90A 1N2SA 3QFSA 4UHFA 5ESDA 4D42A 5K0SA 2Q1UA 4A8JA 1V1MB 4CCYB 5LB2A 2QL6A 5HP4A 3GGOA 2YUKA 4MQFA 3MEQA 4H0CA 5CH5A 2XUKA 3EC1A 3K72B 2BFBB 4PFSA 4B7CA 3L2OB 1HLGA 4FE4A 1G19A 2C5LA 3VZDA 1ZIXA 2XZPA 3PJGA 3UHPA 3GRZA 1HE8B 1AJEA 2A4KA 2FQQA 2V8OA 4HUTA 3VC1A 4D1YA 1REQA 3A6KA 2IUEA 4Q9AA 1WF6A 5H4GA 2UYGA 4IQGA 5L4SA 1BG6A 1WW2A 2IITA 3LJKA 3LUBA 3UBMA 5AO9A 4DLAA 4N7JA 4HVLA 4PFQA 3OCJA 4JYAB 4JROA 1WCV1 3EE6A 1OXXK 4NBVA 4M83A 1EP2B 4PTZA 4E08A 3G79A 3KTOA 3LDAA 3U4QB 2CLMB 2CD9A 2R5NA 5DASA 1ZMRA 3O4JA 3U3KA 3CVWA 2W37A 2HGSA 4XASA 3FGZA 2EG9A 2NV0A 5IH7A 3GZ4A 1YQQA 3DCIA 3IV6A 4WN9B 4ERXA 4LMAA 5T67A 2ZYRA 5FOQA 2H59A 2G5TA 1N75A 1T1EA 1EFTA 2BJVA 3NPAA 3UXEA 1HQKA 1PFWA 3A4MA 2FN8A 3E2PA 2OXFA 4UM8B 1RFLA 1LJLA 2R8XA 4XSGA 4DWOA 2QRMA 5CLJA 3V32A 3U0BA 3X0DA 4BBZA 2NU9A 4JVMA 5HOEA 3ABZA 4Q24A 2HK6A 3AP1A 4MJLA 4OHWA 2YYAA 3VR4A 3N8KA 4UZSA 1O94C 3OM8A 1F4PA 1N36B 4KK4A 1U04A 3N74A 2E21A 5FFFA 3R74A 4G37A 621PA 2ZETA 4RCVA 1U8AA 3H6KA 3A6JA 3OFNA 3DP7A 1G4HA 2P3QA 3JVUA 4Q1CA 4BTLA 5A3RA 5BV0A 1J09A 3RH0A 1GQQA 2YXEA 4UMDA 3HKBA 2FMTA 4HGPA 4JX9A 1W5SA 4MCJA 1EVYA 4NL4H 3VR6A 3OZ7A 3VC7A 5JSHA 1OFGA 4FCTA 3VU9B 1B93A 2COUA 3SXPA 4F3RA 2VF7A 3B6EA 2HTEA 1FMJA 1YJ5A 4RULA 3PX7A 4INZA 4J4TA 1GXSA 2Y1CA 4EG0A 3K9WA 3VR5H 3TRJA 5BUZA 4C06A 1Z8FA 3GGJA 1XJCA 2Q9UA 4M1SA 1UC8A 3RK1A 5KMGA 2F1OA 1P80A 4BHTA 2OESA 1SUEA 1O5IA 4K9QA 5HBRA 3AM1A 4ML3A 3ROGA 1T8TA 1U8TA 2QPAA 4HWRA 4J3NA 5FPKA 1EUYA 1PG5A 2COKA 1U90A 4I4TF 2CWWA 2NSYA 3QNUA 1IM2A 2G1UA 2OY0A 4FS3A 3F96A 3P9YA 5IKXA 1GSAA 2R7AA 5K0NA 4FOTA 4NU5A 1UKBA 4TUYA 3HEBA 3IT0A 4O5AA 3ZXUB 5LIPA 1JSCA 3A36A 1TKCA 2GN8A 3CJRA 5EZYA 1S9DA 4CLXA 5JAIA 2DQZA 5D3ZA 1G8KA 3T7CA 4LDNA 2D8MA 4Z9FA 1FFYA 4EL0A 2CBZA 4UE2A 1EP3B 2JCGA 5C8DA 1JN0A 1UEXC 4QQFA 2A3NA 2BN4A 4AUEA 4D26A 4CM6A 2Y8EA 1DAFA 4BLUA 2JIZA 2VKTA 2CUKA 3HY3A 5D6NA 4Q34A 3RG8A 2IE0A 2WFAA 3TIIA 1G3MA 3D7LA 1HT1E 2O8FB 3FCOA 4UNPA 1Q3KA 3DE2X 4ZJZA 3O6VA 3ILVA 5EMJA 1S6YA 3EDQA 3GGCA 3EMDA 4KXYA 4EHNA 1YQXA 4G25A 2QD1A 4BWYA 3AEXA 1DCFA 2HC9A 3A6FA 4J8PA 4EKNB 4DQKA 3ANLA 5HKBA 1ZJYA 2PRJA 4C3VA 4JXKA 1T8WA 4C78A 2V58A 2AOUB 2VS1A 2UVPA 1KI4A 2Q4EA 4ZXFA 4IG9A 3SC3A 1FTWA 1RS0A 5FI0B 1P7VA 1LI4A 4K88A 3TJRA 4EEXA 1CD5A 4CIAA 4PTYA 2X15A 4OHXA 3G6WA 4BQFA 4ZI7A 1G6HA 3UMCA 1L5KA 3O92A 1VJ0A 1X77A 2BHLA 4QVGA 1BDMA 3IH5A 1SCUB 1MF7A 1ZRHA 4XQCA 4DTCA 5JZ9A 5EINA 5EJ8A 1W0KD 3T3MB 1GTMA 3FUCA 5EQTA 3R6TA 4HT3B 4OJTA 1AF7A 2O7SA 1A9ZA 2HWWA 1QF9A 4IFBA 4E2XA 4U9HS 1E7SA 1GOTA 1Z62A 3V1MA 2VHTA 3G9XA 2HPAA 1GV1A 1SHTX 2P67A 1I33A 4Y6RA 5FLEX 4IAOA 1JLSA 1KO5A 1XYVA 2IPXA 1Y3BE 2VK4A 2P1ZA 3GIWA 1IVYA 3JV7A 4M4SA 4WGGA 3IXMA 5AW5A 5TPZD 3RB8A 3ZQKA 1VYVA 4PFJA 2R11A 3UYKA 1KBQA 1TTHA 3PG5A 4U7HA 2AA3A 5IKOA 3RVPA 4R98A 2R1TA 2PT5A 4OQLA 4OM8A 2EP7A 2JJ8A 2Z4TA 1A04A 4I4LA 3H97A 5AK6A 5CB0A 2SBTA 2LXNA 1Y4DE 2NU6B 4HXFB 1HZZA 1R10A 4N01A 4YH1A 3FOCA 1EUDB 2P68A 3P1JA 3WXBA 1NN0A 5DTJA 4LJ6A 3T12A 3RJMA 2O0MA 2FI1A 4NECA 3QKWA 2OUIA 4AXXA 2WWTA 3E5RA 2H0AA 4JSYA 1WHTB 1QIMA 3EPPA 1KKMA 1NFQA 3I3SR 2B7BA 5JTUA 1JU9A 3DYIA 4AZ0B 4BEJA 3AL2A 3RADC 1NG9A 1M2NA 1XTBA 3NYQA 3NO4A 2HOQA 4JNCA 3U2QA 4YJ2A 5JAUA 3CUKA 5HJ5A 4PLYA 2PEYA 2GCNA 3KQOA 4Q9NA 5TT1A 2YHIB 1GPMA 4HAZA 4JGIA 2EW2A 4H9GA 3W7VA 2G0AA 4RK4A 3VYUB 1T0UA 3ET4A 4BQQA 3G0BA 4BRWA 4X20B 5BWOA 5K6AA 1SIBE 1U2GC 2XDYA 3IBSA 4QO7A 4RH1A 4CM5A 4NWIA 3WFZA 5KOHA 3BXZA 4QOJA 4GOJA 2CLKB 2GLXA 1M5UA 2WD8A 3M9WA 1T35A 3HDYA 1F6DA 2C82A 2G5GX 3E4CA 5KNCA 1RT9A 2PZ8A 1E2MA 2YJNA 3GH3A 4MW9A 3GJQA 1X7WB 3V8QA 1P5FA 3H13A 4NHEA 2Z95A 3D43A 4UZEA 1YUMA 2AOXA 3G8DA 3K8YA 4QAQA 1RTTA 1E7MA 1GFZA 3OLQA 3P97A 1SVUA 3CKKA 3S8EA 1FP4B 3VZCA 1ILEA 2I66A 4F6RA 2E4VA 1SXGA 3AW9A 4B3DA 1ST3A 3OF2A 2VPQA 4QU0A 4UXHA 5FXMA 1WETA 3J80A 4FN5A 4FINA 2H4YA 3PRJA 4OBXA 3MTQA 1CFZA 2BBTA 3R09A 4YGYA 3STVA 3TR5A 1MIOB 3U4HA 2Q27A 2G9QA 5AKIA 5DLDA 1EUDA 1UFOA 1PR5A 1TCAA 3UJBA 1CHNA 1OIXA 1SG0A 2OCPA 2ZRKA 3LDFA 1SXQA 2H8KA 4KWHA 2YJ6A 4TV9B 4PO3X 1N5OX 2WJAA 5DNUA 2OD2A 1X9HA 5CPFA 5C18A 5GZ1A 2ZJ6A 3ZVNA 1WPRA 3G7UA 4RW0A 1GU7A 3EA5A 1SAYA 3VHXB 3ETDA 2IXEA 3QUCA 4ENSA 4BN0A 4BLRA 4JB2A 3W5CA 1N7IA 3FOZA 3C41J 4LWPA 4QIHA 5EIBC 1TAGA 2ZR7A 2BELA 4XVQA 4IG4A 4WZAA 4AY4A 1S2OA 4NC9A 2G5PA 4ZZ0A 2JBAB 3LBIA 1MB2A 3BHNA 2J6CA 2ZUCA 3CS3A 1JIKA 5CA0F 1JSRA 1DWPA 3QFTA 4E30A 4TL8A 2YHSA 4M1KA 4BFTA 4PYNA 5AM1A 2D0DA 4JHXA 5JBQA 2NUAA 3Q88A 1I3NA 2ZUDA 3DNFA 4PXYA 1O8CA 1YB2A 2XCUA 5DW0A 2V0CA 1BXGB 2UZ1B 2ZRCA 4MGZR 1HWYA 3B6KA 3TTSA 3URKA 1IUPA 4RZUA 4GE0A 1ZK3A 5JVDA 1SCKA 4H1VA 2Z30A 1WD7A 2CSUA 2FA9A 3QVGA 4CMEA 2F4VB 1U81A 2I2DA 1Z6YA 1BU8A 2I4TA 1K6EA 1X14A 3Q7IA 4GPEA 4WIAA 2OZLA 2G82A 2FF7A 2QRKA 3ND8A 2REBA 1G38A 3EY9A 4HC4A 4E12A 5KTSA 3FR8A 3JSXA 4HN9A 4RJLA 7MDHA 1ULZA 1BROA 4UVEA 2W22A 1S01A 1PSZA 1GZ3A 4L3OA 2B5OA 4UUQA 2Y0DA 3BGSA 5CB4A 1QP0A 3WBJA 2ECPA 1P18A 4M6WB 4H4CA 2IK8A 4PM4A 1EI9A 4JL6A 2YRQA 2GNOA 5MHTA 4US2R 3AVYA 3BG5A 1ETHA 3HCNA 1E6UA 1XCOA 1IBRA 2IGTA 3D2LA 3IC5A 5AJWA 4GVPA 2V5VA 3TMAA 4BPRA 3PC8C 3SJUA 2E87A 3W0LB 4ETNA 3LLUA 2QUIA 4MWGA 1JJ7A 3SR3A 3TTTA 1BEEA 1W30A 1XSEA 4EJMA 2WIFA 3EH2A 1AGYA 3JRNA 4TZKA 3UHOA 2CVQA 3H0EA 3NASA 5CCEA 1YTUA 3WWCA 4A26A 5B64A 1VKOA 3IKVA 5JEEA 2GFIA 1LD3A 4HRXA 1VHTA 3U7IA 2NZVG 4XYGA 4RO0A 1V4NA 4M8NE 1MHTA 3OY7A 3EEBA 4Q4HB 4R0NA 5CFZA 1QZ3A 3RROA 2H92A 1U7HA 3ZZTA 3GLIA 1NPDA 4LJKA 2B78A 2HNBA 3MOIA 2B0JA 3C3MA 1ZWKA 3EHDA 3EW9A 5EP3A 5FOXA 4EECA 4AY2A 1PTKA 1OLUB 3BGIA 3RVBA 5LUBA 1NUUA 5JLJA 1EDBA 1JWBB 3L18A 5CBPA 1U0OC 2ZUWA 1JLMA 1YC2A 2FWBA 1WHTA 4J0QA 4ZEOA 5HNKA 4Y6QA 4YP0A 5I5GA 5EJ6A 1LV8A 1W5AA 3M89A 5JANA 4MR8A 1LDEA 4BNLA 2VJLA 4YCLA 1IVNA 2PVCA 1SBCA 5K3DA 3AFOA 5C32A 1IQPA 4NX2A 3E15A 3UM9A 4E07A 2CNLA 3Q98A 5KOYA 1NG1A 4QICA 1LF0A 3CPSA 3GOHA 4QOGA 1T9HA 3VVMA 1UPCA 3FHOA 5D00A 5EP4A 1J6UA 4L4XA 1M2OA 4Q9DA 4QTYA 5JI3E 1GN9A 1DZ3A 3P7MA 1CPYA 3UFBA 4YRRA 1ODTC 9MHTA 3DUFB 1DWUA 2NGRA 3GPCA 5K8VA 1LBHA 2YN4A 2J33A 1WZ2A 4ZAWA 4BV2A 1B74A 3KO8A 4ETWA 4NCNA 4XD7D 1R37A 4DR7B 1QF7A 4I5DA 4U4AA 4AY5A 2YINC 3O31A 3ABIA 4FDTA 2OBLA 2ERYA 1TT7A 4WLFA 5TQ0B 1ABBA 5FBRB 3V6MA 3AEYA 4HDSA 3VNQA 3ZWMA 1EPUA 2YXPX 2Z3ZA 3ZVKA 3T7EA 1GA6A 1VPEA 2EGHA 1YR1A 2W6ID 1XNGA 5HA5A 4EUSA 4LNAA 1QM5A 1CEQA 2VEDA 5H70A 2HXGA 1TUIA 1BW9A 2DQSA 2P7IA 3THRA 4FYHA 3T94A 1MW9X 2IVFA 3WFJA 1PR6A 4DYHA 4MMXB 3K30A 3H18A 3LX5A 1WMFA 2IGBA 1CUSA 1OKKA 3QEMA 3RKSA 4E4TA 2EX4A 4X1KA 5CDUA 4A8JB 2X3FA 1NVMB 1H2FA 2GGSA 4UUPA 1H4TA 4D43A 5AJYA 2QXUA 4L8YA 1K9SA 2BC9A 1P7WA 3SX0A 3BF8A 5IK2D 5K4AA 3DTTA 3TQQA 3ZKWB 2BMJA 1T6XA 3ZE0B 3HBMA 2ZOSA 5AKKA 3IP9A 3MGAA 3V4SA 1ZD8A 4UAUA 5CXSA 1KAQA 5DHTA 1ITZA 4ZK2A 4PVCA 3D3QA 3W3ZB 4OCZA 4N0QA 3HXPA 5K6AC 2C04A 4IUYA 3DOFA 3FH0A 1FVFA 1GZ6A 2AJTA 5DYYA 4B3HA 1V3UA 2EW8A 5DSXA 4ARIA 4KR3A 4LQDA 3FTFA 1ES9A 2YNMA 1DPGA 1V3TA 3W6ZA 4OQ4A 1AQNA 1HDRA 4HQRA 5THQA 1Z0DA 2AH5A 1XDSA 4BB5A 1RYFA 1O8BA 5AJUA 4HZGA 4GICA 3QBJA 4CYMA 4M54A 5B7NA 2BF7A 3KFVA 5U1PA 1GY8A 1FFAA 3W8DA 2GCEA 3M9LA 4OSEA 3VU1A 3HUDA 5F98A 4OJNA 3AWIA 5DRTA 4AMZA 4NCAA 5DHQA 1UDCA 2DTXA 4FMCB 4YLEA 2VF4X 4LCEA 1XTUA 4JB3A 1MT3A 3MF4A 3NKFA 3OHMA 1GAXA 3Q7SA 3WGJA 1LA2A 1VGVA 4H1HA 3S2IA 4UMFA 1YZ3A 2RGUA 4PHGA 1CU1A 1HL3A 1M2WA 2VZ0A 1V25A 3BRWA 1JAHA 1Z75A 2IOYA 1RLIA 3DWFA 3FUWA 4OD0A 3RS4A 3QEMB 4FC6A 1BDHA 4LXQA 4WACA 4AO7A 2I8LA 3WG9A 2O52A 5AI8A 3FYUA 1NZJA 1O5OA 3IP3A 4LTNA 3HCBA 3RYCA 1E0DA 2QV7A 2X23A 3MD0A 4R8RA 4TTVA 2AR7A 1KVSA 5FKJA 3WL3A 1IXKA 2ZRPA 3THWB 1Q2UA 5FV4A 3CZPA 4LZNA 2FPWA 3B20A 1X1TA 4HEQA 1DBIA 1LPOA 3CXUA 4IHKA 3NP9A 4PC3A 3SDSA 2JK1A 3EYAA 3ZV3A 1NVWQ 1QRDA 4C7OB 5F2EA 4GLJA 1U0RA 2FX2A 2D1RA 4XQ0A 4F4FA 2A9FA 1RW4A 3NXKA 1T6BY 4FU0A 5F1KA 3UFXA 4C0QC 3AUSA 3LLSA 1E2IA 5HEKA 4OJQA 4RIHA 1OSNA 1JJIA 2V9ZA 3SQMA 2ZRIA 2YJ4A 1WKVA 3K8OE 2SKEA 1DKMA 4GOOD 2FSPA 3EISA 3KJGA 4D4MA 3NBYC 1B8VA 4F8EA 1UBTS 2B82A 2XQIA 2ZVQX 2C5BA 3LZCA 4GLBA 1OFVA 1X1EA 4I4CA 4JL5A 4UOEA 5CAEA 2QKYA 3R44A 2VSOA 1OTYA 2DG2A 4J16C 1BN6A 3ICCA 3QPDA 3V5NA 1WG8A 4IMIB 2O8VA 3WRXC 1AD2A 4U2GA 3N70A 4C0LA 3JASA 4MPJA 4NYMR 4UUNA 1I6WA 1S7CA 1UJCA 1SCQA 3QG1A 5TARA 1EX6A 2AEFA 2H7VA 3QMWA 1X9GA 4HQ0A 1KJ8A 3V97A 5IWAB 4K1LA 2FSVA 5BSEA 4H18A 2F3SA 4UU0A 2GOYA 2XT6A 3BCSA 4FYVA 1L5WA 1YI0A 2ZWPA 2P2NA 2ZSBA 3WB2A 4W9RA 5JD4A 3TECE 3GUHA 3H8JA 5T8KA 1Z0FA 2W71A 4MQEB 1Y6QA 2X77A 5F51A 1PS9A 1ZMBA 4MA4A 5JPIA 1GCGA 3II6X 1P5ZB 2FEKA 1WZEA 4MK4A 1RPZA 4G0NA 4JOCA 4F8JA 1YIOA 4QGSA 1KNQA 5FWAA 4YCNA 1CNFA 3G2JA 5IAEA 3HFSA 1WB4A 4QX6A 1IXSB 3LU1A 3D7SA 1EU1A 1P7YA 3U17A 1XMQB 2DXIA 1TF7A 2HBRA 1X2BA 3F9RA 3W05A 5IJ0A 1H3NA 3ZH2A 3BZWA 1FA9A 1OXVA 3CJQA 2VHVA 3D1JA 3NGLA 1P1KA 5EMMA 3UWSA 1CJBA 1TD1A 4DV2B 4D9CA 4UD6A 4IZHA 2P6RA 2O8EA 2ZR0A 4BEVA 1LLQA 4OXNA 2ZQYA 4HGYA 3U80A 4QQRA 3JVDA 5JBNA 1N0WA 5DK6A 3NHPA 1V5EA 4HZUB 4GZ6A 3ENNA 4WKOA 1RAAA 5EC8A 3OF5A 3BILA 3HZOA 3PWKA 2UYCA 1VG1A 4WFKA 1O9HA 2OHGA 3M6WA 1TEXA 3QI7A 1U3CA 3B70A 3EQ7A 3DE1X 1N25A 5HR5A 5K6TA 4DGSA 2EZ9A 2INGX 2MSEB 4L95C 4O4HF 3P19A 3V48A 5E7IA 1FU8A 1HMPA 1O94A 1UJ4A 4AUKA 4TRJA 4RL4A 4TKZA 1K97A 5C35A 4RNCA 5AYVA 2VLIA 2V7UA 3QWBA 1L8XA 1IY0A 1A96A 2GTPA 4ASUD 1T9DA 1Q6YA 5FADA 4DM4A 4MHSA 1U5AA 2RJ3A 2DBRA 4YQYA 3OIGA 3GFOA 1DJMA 3ZV6A 5AI5A 4DA0A 4DBLE 1IJFA 5IBRA 5AXCA 3Q9SA 5E8RA 3RD5A 1MN6A 4ZCQA 4GBJA 1WHSB 2VDUE 2VHCA 4MLCA 1NJ1A 4RABA 2Z9BA 1TVEA 1G3RA 2WMNB 4NFSA 4Y7DA 2YZNA 3OTGA 3OFKA 3V00A 5KOHB 3VR5A 4WK6A 1Z2PX 2ZXEA 4BMNA 3FGHA 1I30A 4B82A 4BC0A 3AXSA 3BWDD 3PC3A 3EFOA 2RIPA 2GZDA 5LU8A 3LQ2A 1VBMA 1YFKA 2V54A 5LLSA 5COAA 1IM8A 2BPOA 4ZTUB 2F9FA 4XUGB 1D4OA 1RD4A 1LBSA 1ULSA 1ZN8A 1YE3A 4NZPA 1T26A 1IRIA 4BLSA 3TG8A 1IAVA 1GADO 2G80A 2O07A 1ECJA 3BZBA 3H6GA 4RF5A 1L4UA 4ZVLA 2IF2A 5HF6A 1M2KA 4EJSB 4ZDKA 2N1MA 3TEMA 3QXHA 1KYQA 4C7MA