3ABSB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with adeninylpentylcobalamin and ethanolamine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Ethanolamine ammonia-lyase heavy chain
total genus 74
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3absB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3absB02
3ABQB 3AO0B 3ABSB 3ABRB 3ANYB 3ABOB
chains in the Genus database with same CATH superfamily
3JVDA 1DB3A 2YXDA 4KFRA 2CK3D 2QXUA 5JSQA 1M33A 1XHLA 2O1EA 4JEHA 2P1DA 3FCXA 2EKZA 2F64A 2WYVA 3WSTA 5M2QA 4MQBA 3MLBA 1AG9A 2YV3A 4ZYWA 5JAPA 2XNDA 1XPRA 2P35A 4WZAA 1XB2A 2ISSD 4MYHA 5DEOA 2ZB2A 2IXDA 2Z1MA 3OFJA 5CCEA 3OMWA 1YI0A 4KH1A 4LMPA 2ODPA 4O4LF 3WS7A 2QYTA 3VBCA 3QF7A 2Q1WA 5K4GA 3ZWKA 2H9AA 2P65A 4MA0A 4BUCA 1E2HA 1XFAA 3JQFC 2FMIA 4J0EA 1OZAA 2YUKA 4YHHB 4C4RA 3FUUA 1JHAA 5DGXA 2WDPA 3A4MA 1Q6ZA 2PZBA 4D9JA 3C16C 4NMXB 5JARA 3T1HB 1T3SA 4CHTA 4QDJA 4UZFA 3W5JA 2HAEA 1U2SA 5AK4A 1FUKA 1NXPA 3HM2A 3LC0A 5AOCA 4HLNA 3JQRA 4HSEA 1DXQA 4JLPA 5A7GA 4FEEA 3FSEA 2BKUA 1SVUA 3I2JA 5CXXA 4X62B 2VTBB 3USZA 4QUBA 1QU3A 3WL3A 3O0TA 4EB6B 1QE5A 2I29A 4ZQIA 2AZXA 3EISA 4S0ZA 3TFWA 2BSQA 4BMCA 3F5QA 2PL9A 4IBOA 1V5GA 2M2IA 5LA6B 2IBTA 3B2EA 1DC3A 3K9HA 4GP9A 4HYYA 2VL7A 3FVWA 1OBHA 2XA2A 5AXBA 5JZOA 1JBQA 2XNDD 4CMHA 1Y4UA 4M8LA 4PHFA 1CFZA 1RDFA 3WQBA 2GCOA 2JFGA 2H29A 4KXMA 2P6UA 2C4KA 4W1RA 5BWOA 2Z3ZA 2HOQA 3IR5A 4NFLA 3KPVA 4U3JB 3UJAA 5AFSA 1P39A 2KE5A 3E05A 1P2FA 2VJKA 3E9YA 4MWOA 4OBXA 3K6RA 4DCPA 1COWA 1GRRA 2IELA 3CW8X 5G02A 3CY6A 2E85A 4AXXA 3A6GA 1TEHA 2P9BA 2XWBF 4P80A 1EU1A 4H1HA 1IXKA 3WGQA 4L73A 4ZEOA 4CT5A 1R27A 2QVBA 3IUMA 5JI3E 1Y3AA 4OQNA 2G1PA 1GL7A 1P2SA 4B33A 2Q3CA 4K6FA 3H11A 5C7OO 2VP6A 3VISA 3U16A 2OV1A 1AUQA 5DP2A 5EEHA 1JJIA 3O4FA 2O48X 2XV1A 4L51A 4Q3BA 4MI6A 5KSPA 4GKVA 1EHIA 5JMOA 1K7SN 4LJKA 1E2FA 2Y0EA 4TTPA 1T91A 1F1JA 3JARA 3ZZUA 3HVJA 4XRRA 3WNZA 1XA4A 3Q0IA 4WUVA 2OKGA 4B6QA 4LYFA 4Q9HA 3B1JA 2AOVA 3FOAA 2RIRA 1KYYA 2OVBA 5EIWA 3UGKA 3CCCA 2ZS7A 2OXIA 3RARA 3QITA 1D7AA 1RABA 4UPVA 4J0FA 5FLXA 2XXBA 2AFHE 1J5PA 3QKUA 2EG5A 5IH3A 4DPMA 1Z0KA 1HORA 1Q7CA 3KM0A 4RKFA 4DMLA 2DTXA 1FUUA 4OLBA 3ASYA 1W2WB 2HO5A 2Z3WA 2BYTA 2C5EA 2JJ1D 2FE1A 3RODA 2D2IA 3ZGVA 1ZCFA 4B3RB 5L3QB 2Q5JA 2W2MA 4FCWA 1NVXQ 4X94A 1HZZC 3LCCA 5CW1A 3OG9A 5IX8A 3ZHZA 3GRRA 3VVBA 3P9NA 2B9VA 4X6LA 1GFZA 2G5CA 2W93A 1R64A 1TU0A 2FDXA 1UT6A 4GOJA 4TLAA 3LTNC 1O7JA 2ZB8A 3IOEA 4WE3A 1G1MA 4MRRA 3UJ3X 4QKQA 4QASA 2YOHA 3ZIAA 1Z5PA 4QPJC 3GDOA 2NO4A 3QX7A 5F64A 2PSDA 4X44A 3AHHA 5SYNA 3RVSA 3WQRA 2PUVA 4C03A 1RRVA 2JHAA 2C92A 1S4MA 4UNQA 4CM4A 4PLYA 1CJVC 1DCTA 4G4GA 3V1KA 2O2JA 1ZD2P 4AJLA 4BKRA 1SOVA 5EMHA 4E1BA 1R0BA 4BO9A 1JQKA 1KEWA 1VPEA 2EBWA 2YVAA 3M9XA 4FONA 5EKUA 4AYXA 2QAJA 4YCNA 3U1TA 4CIBA 1IULA 3J81k 5DZSA 4WD3A 5EIXA 5K8JB 4BEVA 2AJDA 3AI2A 3FGOA 3I37X 3PSAA 5K9ZA 1K08A 3R3ZA 5BYBA 1F0KA 4K9DA 1L5FA 2VWGA 4XGRA 1JWBB 1G7CA 4IV5A 2F43A 3JRNA 5TJHA 2AJTA 3DZCA 3RF6A 1IHYA 2XZOA 3K9BA 4UJ3A 3HBJA 3ZX4A 1O0CA 4TMWA 5JQGF 1T1RA 4Z2YA 4Z3OA 4KIFA 1ZQ1A 4TYPA 1VHWA 5HF5A 5LBUA 4TSFD 3N2YA 1CQJA 1H2WA 3FPHA 3CSUA 3KCQA 2P9JA 5E4TA 3ZWXA 4KAAA 4ETWA 5B2EA 2NLOA 4BRUA 3DULA 3A6ZA 4MWTA 2Z2ZA 2IFTA 4HS9A 3Q2IA 2GKGA 3BWYA 1NJ8A 4IZIA 5HUJA 4NZYA 2LRHA 4Y2TA 2QX9A 4XIYA 3WMGA 1PR4A 3K0CC 3KOXA 1RKUA 1E6LA 1SBTA 2UZAA 3CPEA 3CUWA 3ANSA 1YFKA 3SHVA 5B7GA 2PBFA 5JH7F 4WVLA 4OI4A 4EHAA 1MH1A 3B36A 1LPPA 1SVLA 1T6BY 5KAMA 1E7JA 3EVNA 3R3UA 1WBJB 2QZ9A 3IVGA 2R86A 1WVGA 4HWOA 4R8KA 1A7JA 2R0QC 4D9KA 2FR8A 2BJHA 2X4GA 3UOWA 4LEIA 5CGZA 2VSNA 1GZ3A 2VSYA 3I9JA 4IGFA 1HG0A 1D8AA 2BKAA 3EQ8A 2YZMA 4G0OA 1UMCA 3LY5A 2R1ZA 3SXUB 1JQBA 2QAGB 5HRCA 5KVAA 2BMAA 2R00A 2G83A 1RWVA 4D9CA 3BBLA 4RLHA 4CEJA 1KKMA 1K98A 2QN1A 4ZEMA 1DSSG 1A4XA 1AX9A 2CWWA 4FMDB 4YTEA 1DRWA 2B78A 1WS6A 2J3LA 2PEZA 1YZHA 3H1FA 4YMUA 1ZNWA 2AFIA 3E8SA 3HS3A 1T2AA 1Y9ZA 1IY0A 2CN1A 3HVHA 2BGKA 4OMDA 5D3QA 2JFYA 5EWLB 2QTRA 5JDCC 3VZBA 4LKOA 1HDCA 4BVJA 4G0UA 2OZEA 4BNXA 1PYOA 1R0YA 2BEWA 2VT3A 3CVVA 3DMHA 1M0EA 3LFHA 1ZGHA 1Y6ZA 3A7DA 3FMOB 4FUTA 4GSLA 3NWOA 1AK2A 2PUTA 3GRCA 4MMXB 5CH5A 4QU9A 3PX2A 4TS1A 3G5LA 3JRXA 4A23A 5DGDA 3R3SA 5JRDS 2YBEA 4JJAA 1HF3A 4DEYA 4EEKA 3FVVA 1P44A 1XN4A 4MV4A 4NMWA 2ODAA 2P4EA 3FHTA 1Z2OX 5G4KA 3H2GA 5E7QA 5KKNB 4UEKA 4NODA 2AQHA 4PF1A 3LC1O 4RM2A 2ALJA 3IIJA 4GRDA 3HUTA 3TLZA 2D1QA 1WMBA 1Y4AE 4WASA 5EZQA 4JUBA 2PNJA 2X9NA 5MN6A 1ZPDA 2ZUCA 2I6GA 3NKVA 1DZIA 4LTMA 4BEBA 3N53A 3O9ZA 3ZE6A 4GVLA 1BJRE 1BMTA 1P1HA 1Q77A 3LOPA 1KL7A 3AHJA 3TIVA 4MPJA 2XT0A 4UD2A 3A32A 4IDCA 4I99A 2QORA 2QDXA 4BWYA 4EPRA 3EMKA 4GX0A 1ZKDA 4J94A 4MRAA 4UXHA 5FLEX 2EFGA 1F0NA 3ABOB 1M0TA 1XP8A 3CO0S 4IDGA 1NJ5A 3IA2A 3T4EA 3LVBA 2GEKA 3ZR4B 2D2EA 4DLSA 3IMEA 1WVMA 1SPXA 1UBTS 4S2EA 4V38A 5DYYA 1RJ9B 4FHZA 4PYRA 4X8LA 5LQSA 4CR7A 1XAIA 4EO4A 1HEYA 2XMQA 4J76A 1ZI9A 3RRYA 3TUZC 2GN9A 4OUKX 1F06A 4TKVA 5A5FA 1NNEA 4HEJA 2IJGX 3BGIA 4RD3A 3GVHA 5FULA 4CRWB 3UVEA 3FFAA 2RH4A 1UWVA 3EBPA 4KMRA 5IF3A 5EL0A 3PYXA 3S70A 4B4WA 5KOHB 1KF0A 1ND6A 4QUDA 4LNAA 3R0ZA 1NYRA 4PPYA 4BE9A 3TRKA 4A6PA 2JFPA 1E2PA 2HGSA 2ID4A 1P1FA 2WIFA 2ZJOA 4MB0A 4GI1A 5CMLA 4ZT6A 1ESEA 2R66A 2VKTA 2ACEA 1NG9A 1XVVA 1QYCA 1LC0A 1MV5A 2A9QA 1I30A 1Y9AA 2QJOA 3K0EA 1IB0A 1XQ1A 2FFJA 2SKEA 4JLWA 3JQ8A 4U9HS 1T34A 4JIGA 5B58T 4O2RA 4ZVTA 4M6WB 4Q1VA 3WYDA 2PRKA 3VGJA 3OM8A 5JEEA 3I01M 4FNMA 2CNWD 1XLUA 2VHUA 4KX3A 3TEFA 1P4RA 4US0R 2J9RA 2QRQA 4KBYA 2VJAA 5IUKC 1SOAA 5AOAA 1P5RA 1DAEA 1EXWA 3HSYA 4A9AA 5LWQA 3H8JA 2BGGA 1KFEB 1M6VB 1TZKA 2W11A 2I5PO 4UJ5A 2C7GA 2JLRA 2SBTA 3QM1A 1NSFA 3AR4A 1Y3IA 5SZJA 1UQTA 1QGOA 2PR7A 1SNYA 2V1UA 1DVRA 3OIYA 5J3JA 3DEJA 4EUEA 4F8EA 3HXLA 1W5SA 4CNBA 4RH1A 1SCBA 3N2IA 5BURA 2FE4A 5L3ZA 4DV4B 2UUPA 1TQ6A 5ALHA 1SO8A 1GN8A 1VLQA 1KARA 2ZYDA 5A2QA 1T9CA 3EDYA 1KYXA 2P2CA 2ZSHA 1H05A 2OLJA 3TN7A 2QJRA 3L7LA 4KIUA 4QTUB 4CE6A 3KJGA 1QYRA 2QTHA 5JTTA 4XD7D 3R74A 4IVQA 2ZJ0A 2IUTA 1I0IA 1POXA 4ENUA 5HX7A 4OLFA 3M7IA 5DPMA 2VAWA 4IYRA 3KTAB 4BL5A 1L8OA 4RBNA 3NWBA 3EZFA 5IKEA 1OYOA 3CUYA 2H57A 4EGAA 3O4JA 5BNTA 3H5AA 1MAAA 3WYCA 4W9MC 1XVAA 2OCGA 5ICSA 1Y6JA 5ALMA 2V96A 3UJ8A 3PNLA 3VC2A 3OZ7A 3KU1A 4Q4AB 1NNI1 2GK6A 4FHGA 3P32A 4L72A 5LDHA 2UYYA 4YVFA 1HL3A 1FP4A 1LFAA 1O2DA 5FJJA 2PVPA 5KTTA 4CEIB 1EFHA 4D9IA 1JHMA 1ZH0A 3OZWA 1E6MA 2PUHA 3FRIA 4TQUS 5F2NA 1QOQB 1ZSVA 3K15A 3GX1A 4OTZA 4GBED 5IVDA 1DCFA 1RLTA 1X7XB 1L6RA 3U3XA 1GPNA 1XDGA 2ZGVA 3KB6A 1GGMA 3PUIA 4FYHA 4Q3LA 2P3QA 3LQ4A 4G5QA 1A9OA 2GD2A 4YRFA 5DNAA 4ZV7A 3JAMA 5HA5A 2GXAA 1T9GR 1RNLA 1U3GA 2J9FB 2XTAA 4FKBA 3WOHA 1L8AA 5DWDA 1DPGA 4P5DA 4B7CA 4G8CA 1EUQA 1U8FO 1YQWA 1NQ5A 4YUVA 5CDFE 4UMEA 1W87A 2KI5A 4RABA 1XELA 5IBCA 1DADA 3FWNA 1V4NA 3R0VA 3INRA 2G9ZA 2IYTA 1YS2X 2IA5A 5HG0A 1OU4A 2C54A 3DC2A 4E7PA 2OQVA 2VF7A 1D4FA 2ILTA 3L0SA 1KBOA 5JYEA 3NHMA 1OE0A 1CZRA 2W2LA 4ARZA 5JHHB 2CKMA 2X3YA 3JD2A 2BZ0A 2MINB 2RI0A 1JXOA 2RIPA 4FHEA 4GHWA 3DCYA 4G0VA 4B4DA 4AJKA 4E4RA 4HGNA 3RSZA 4BNUA 4GBMA 2P0EA 5TQVA 4F1WA 2OG2A 2VK4A 2JJMA 4QRDA 4EI8A 5KOJA 3MT9A 2HZBA 4V1CI 2CFRA 1RI5A 4IJWA 4EA6A 2QL5A 4KVZA 2IYYA 4R2JA 5IC4A 3NFRA 4HK4A 1Z22A 2X42A 2P75A 3PGLA 1U3VA 1KEZA 3V4RA 4BXOB 1U02A 2ZRJA 1YQXA 1X0VA 3A4IA 1E8MA 1WXFA 5JEDA 1Y63A 2Y1WA 4IIGA 3GBVA 4PBRA 4TMXA 3OZRA 4KVFA 4LXGA 2CBZA 3TKLA 1H1DA 1GJRA 2IUEA 1Q15A 1M8PA 5IDXA 3Q7QA 5CIWA 4LC9A 4NU5A 1SUBA 5FUWA 5TV2A 4OQFA 4C0WA 1GILA 2AEEA 4IEIA 4GW3A 1ECBA 3H8SA 1KO1A 1NV8A 4BNNA 1VHLA 1S89A 3NT2A 2ADMA 4K46A 5F12A 2XE7A 4LE1A 4O4HA 4MYRA 3H8WA 2Z9DA 4YRQA 4UUPA 1KMQA 5M3BA 4BMYA 4YT5A 3WHKA 1F8GA 5HRAA 1W85A 4P5PA 1H4VB 2XECA 3EF1A 1NM5C 4IEFB 5FFMA 3ZWQA 1UP7A 3MOIA 3QLVC 3S5JA 4GPEA 4HPJB 4Q1BA 2YJNA 4JKYA 4RD0A 2PX6A 3FVQA 5EP4A 1G17A 5A3QA 5J2UA 2G9VA 2QQFA 3OA2A 5IYZF 4UZEA 1NGSA 4UOQA 2QRUA 3AZQA 5DGHA 4FXOA 3O91A 2JFZA 4Y6PA 1FYDA 3Q3VA 5AJVB 4FYKA 821PA 2GPAA 1Q0SA 3GEGA 1XRNA 5A4KA 1TADA 2VDWA 5BXQC 1J0DA 1FXUA 1T2VA 2PBRA 3ZLTA 3ZY5A 5FLYA 2AJBA 3KOOA 4PW0A 2IVFA 3OUUA 3R5SA 3L82B 2XMBA 4GIBA 1TMGE 1EHYA 5ENZA 3GLIE 4GKBA 2VJOA 3PT5A 3JZMA 2RH5A 1HYHA 3ZYZA 2KMLA 2Q1TA 2DLCX 1WQ1R 3LHIA 2WD7B 1XAHA 3LYAA 3K1TA 2HJVA 3PR2B 3H75A 1S0UA 2VF2A 3PUXA 2YRXA 3PB3A 3CRZA 3LKZA 1JLRA 2VHJA 1CPYA 2ZTMA 3KT0A 1W94A 2CLCX 4B6EA 3TPCA 3ZJ5A 1W25A 4FFRA 4H17A 3KAPA 1I4EB 1GXSA 1NNSA 2FMUA 3NZEA 4AUEA 1YR3A 1JFRA 4UUNA 4OH7A 1CRLA 2I7TA 3WB9A 1RBQA 2QGZA 5CLJA 1COWD 4OSPA 3FKSD 1Z0ZA 4KL8S 4NP6A 4OPMA 2XZTA 3IVXA 2JLWA 1Y3DE 3DT9A 2PMEA 2LIPA 3EVDA 4E5NA 1YONA 5I4CA 3T5BA 2GHTA 3F3SA 3D5QA 3WK8A 1D2EA 2DQYA 2YRQA 3MVEA 3ROTA 1N2OA 3BIOA 2C4MA 1ADCA 1P7VA 2V7QD 2X9VA 3V8VA 4A0RA 5BT8A 1EFVA 3IJRA 2CVZA 3TOCA 1ZIDA 4AZ0B 1P6XA 4MI9A 4EG1A 1XA3A 4Z3KA 2D7CA 2GKOA 4X54A 1E3WB 2ZR8A 4I1VA 3PPYA 2R6HA 3HYCA 5ALEA 5F7JA 2WICA 4JXJA 1S3IA 2P9GA 3PDIB 1THTA 4C0BA 1TXGA 4N18A 4ZO7A 3N7TA 3TTYA 2NV6A 1U7XA 4PZ9A 4TWBA 2G4VA 1XRMA 3W3AA 4LZZA 3UB2A 4CT4B 5IJ9B 1YU9A 3OMLA 2HZ7A 3CNLA 3FAZA 2IEBA 1ZC3A 2AX3A 3FPEA 3KE9A 3RS8A 2GCNA 2O8VA 3BQNB 4PSVA 3RVMA 3DAHA 4EHKA 1DDGA 4UU0A 3NHKA 3A0RB 1Y37A 3CKLA 4FDLA 2YNMC 4N0EA 1YOVA 2QD3A 4LY9A 2RCYA 4Q01A 3VX4A 1YVDA 2X14A 1PEAA 3P0EA 1ZINA 1YRAA 4ZQBA 3TLAA 3G8AA 2PZMA 4OKSA 4OVKA 2X0IA 4B34A 3GPLA 2O1XA 1BYIA 2OZVA 1S2OA 4WKPA 4BVEA 4K8RB 1NTRA 4FEYA 2ZP1A 4DM4A 1PJZA 1PEYA 3AX6A 3B1KA 4HDSB 1BA3A 2HU5A 3O8OB 4QOJA 4ZYXA 5DI9A 2GD0A 4K9LA 5LXTA 2IOQA 2PH1A 3ZI4A 4LXHA 1QZTA 3ZCSA 1YUNA 3OBBA 1CZHA 4UCQA 4HDMB 2B5WA 1Z5OA 2ZQ5A 3NIWA 3OY2A 3OOYA 5BRNA 4D8VA 4ZDJA 721PA 2H1VA 3KXIA 2CBGA 3LQ1A 3VPHA 5FUQA 4DV2B 3QUQA 3CG4A 1N5KA 2CNKA 4EENA 3M6VA 5FL3A 2VHTA 1Z4JA 3HO8A 2OK8A 1RQPA 5CA0F 1XZPA 3TNYA 3FJOA 2CUTA 1OJLA 3HJCA 2VR1A 4IHKA 3QF4A 4J0HA 1BDBA 1L4MA 1JHPA 1YWGO 5GVSA 1AF7A 1NUHA 1XA0A 4J9UE 1CEYA 2E4AA 4IJ5A 4E21A 1EDOA 3IAM1 2P2GA 1P4HA 4H7KA 3ORSA 2FDCA 2QMYA 2PX0A 3Q7TA 3KQPA 2GEBA 5D1NA 2YIVX 5EXSA 2WY2D 5T4BA 4ZGWA 1SHJA 1I3KA 4IIXA 3F1LA 1KEEB 3LNTA 2GEJA 2HA5A 1O9HA 2A67A 3DEHA 3GR6A 3C7KA 3OFNA 4XKJA 4EJ2A 2IYVA 1ATZA 3D8SA 2CXQA 2GWRA 4PC1A 3UV6A 1Q7TA 2P1ZA 4HRXA 4YBZA 2O8DA 1Q5PA 1BVUA 1YI8A 2LE4A 4XQ0A 1P17A 3MYYA 1EM8A 2ORYA 3ZE0B 5BORA 5HP4A 3GV0A 1GYQA 1PTKA 4OP3A 5AJUA 2HWKA 3WOVA 2FMTA 2X0NA 2R9VA 5EP2A 3ETJA 1JKFA 3DDHA 4NMMA 1DV2A 3UH1A 4YCMA 4DV0B 5FWYB 1ZISA 4D0NA 3ANYB 1P5ZB 2V45A 4Y2HA 1VLJA 1GZDA 4RHUA 4ZTUB 2M6RA 1ZOPA 2EFDB 4RVGA 2O3TA 1RTTA 3BE6A 3A9VA 2FFHA 2Z98A 3F0TA 2EDCA 3F5SA 5T5QA 2O5EA 1I1HA 3PGXA 5A5DA 3E8MA 2Q46A 1ORVA 4LXTA 5C1DA 5CA1A 3CV3A 3IPCA 3SMQA 4UULA 2VBCA 4KQMA 4KQXA 2FP4B 3CVUA 3RIEA 1A9RA 2C1ZA 2G40A 2ILVA 1KJJA 1P73A 1XCGB 4CI9A 3RS3A 3TJZA 5KWSA 1VMEA 1C1HA 5T64A 1RWBA 3DZDA 3LRTA 1YACA 5FAXA 2IIBA 3UYKA 1P4JA 2PHZA 2Q4RA 4G63A 4CWAA 5CT6A 4I0WB 3BGWA 5DHTA 1DARA 3ZZMA 3RBZA 2I2AA 1EGQA 1YFJA 1VI2A 3D8UA 3LG2A 5A71A 3SGLA 1K8ZB 5JD6A 3ZZTA 2VXYA 1U31A 1P3DA 3HDTA 3ISVA 4X91A 3RYIB 5KOIA 2Z4TA 3L9XA 4GMDA 1PV4A 2IYOA 1QYXA 4WKGA 5E95A 4EELA 1YCHA 2O7SA 2H1OA 3MA0A 1NQUA 1Y8QA 3THOA 5E6UA 1IZ0A 1JBEA 1O8CA 1T9DA 3VC3A 5FORA 4LDPA 5CLGA 3TQ6A 1XKTA 5ALSA 2IV3A 2BMEA 3N7UA 5JWRA 5KZMB 3LAWA 1NJ6A 2ZYSA 4GLFA 1EUCB 2VEOA 2FEOA 3FNBA 3PC2A 1J1IA 4Q12A 4LBZA 1OBFO 2H5IA 3OZXA 5D00A 1W7AA 1NXWA 1V3UA 3AM4A 1SUCA 2YZKA 2XHZA 2C3PA 4CG1A 3TZ6A 2E55A 3QH4A 1KVRA 5DRTA 4GBGA 4DUZB 2CZGA 1R4ZA 4AP5A 3WKBA 1DIOB 1E1MA 3HHPA 3LZ6A 4OHRA 1I01A 4J3JA 3WXMA 1ZHOA 3FTEA 4N7BA 3E5MA 4NS1A 2C59A 1JFVA 2Z95A 2FPIA 4P35A 3N58A 1XEXA 2RKBA 3RKSA 1M2JA 3DTYA 4B3HA 1XZEA 2WINI 4LZNA 2BEUB 4RQTA 3QK7A 2BEWB 3CLVA 3A31A 1XMXA 4NTZA 5ALTA 4ZXFA 3DE4X 3W0LB 2FR0A 2CUNA 4OJKA 5EFZA 3HO6A 3ADKA 2V5VA 2BFAA 1JR4A 4LQLA 3F96A 3BTSA 4RMGA 1QKJA 2H7YA 4LHXA 2ESRA 2YVUA 3CEPB 3TEMA 2A9FA 1VMAA 1TD1A 2AQKA 2HJHA 3A10A 3FR7A 7ADHA 4F4CA 1NASA 1FNSA 3ABRB 2V3CC 1ATIA 3A3PA 3PE3A 5CT5A 4MGYR 3M6IA 4KI7A 4PG4A 3I9V1 4U7HA 3WNBA 1Z36A 2OOKA 3L02A 4B3XA 2C57A 3PJDA 4BCCA 2OKCA 1E92A 4F92B 3KUKA 4DRZA 2DHDA 2RGNA 3KSAC 5IRCD 2H48A 2IBSA 1G9SA 1N2BA 4YP1A 3MJDA 1G5FA 4QBHA 5E2BA 4CLHA 1ACMA 3EFOB 5K3CA 3THXB 2CB0A 2HM7A 3R3WA 4TSRA 3TCNA 4HSGA 2A59A 3MCVA 5HCIA 3N39C 5JFOA 4IVPA 4BE7B 1AUXA 4FBMA 2NO7A 4GEGA 4IIJF 4JNCA 5KWVA 3I92A 1CY4A 5HZKA 1T2NA 2AYXA 3R7BA 1F5SA 2QMUA 2OV8A 3WK4A 3B9QA 3IMCA 1IBMB 4S05A 1ID1A 1H4QA 2R79A 5DMHA 1U28A 1ZMXA 5CTAA 3SHFA 2YKGA 2ZETA 2LZ0A 3EGVA 3KO8A 1W1UA 3SLRA 4IP0A 1U7UA 1ZN8A 2OGUA 5KB3A 3CKYA 3B78A 3LS2A 5BNFA 3OZBA 1NMSA 5CD9A 3I28A 2TRSB 4AB1A 3ICCA 3GHYA 4LXQA 1QH1A 5IT5A 4QU5A 4V0SA 5LD2C 2F62A 2ZI3A 5FF9A 2WSYB 1X0XA 1OBVA 5CRIA 5I01A 1Y8RB 2AF4C 3GARA 4Y2QA 3RVKA 5BO5A 3BIWA 1BXGB 2R4TA 3DZBA 3OLYA 4J2HA 5LOVF 1E0DA 4EB0A 1NF9A 1OOEA 1KP2A 4FFDA 4TLDA 3UMBA 3COPA 4J0IA 5JROA 3Q3JB 3KR9A 3RPEA 4AMVA 3ZVMA 1J0XO 1A9PA 3FUTA 3E1KA 3N70A 1H5QA 1LVGA 3TNDA 3KSBC 3B8EA 3DE1X 1N3BA 2GAFA 3OZFA 2O8FA 2XUOA 3SR4A 4PM4A 3EC7A 3LPNA 2IXFA 4JJIA 4FKZA 4XXHA 4ME6A 4YCDA 5AI8A 4LYDA 3AVTA 1L5KA 1ODLA 1UXOA 5DYTA 1MX9A 4B3BA 3UBTA 4L08A 4TZKA 1OB5A 4ARIA 1L8XA 4QNNA 3RWMB 3L7AA 4O2AA 3DKPA 3TIGA 3ZE2B 1HMAA 3FFWA 1DJOA 3OOSA 1SXPA 2O8FB 4NZMA 1NHGA 3TR6A 3ZJTA 3Q9NA 2WWGA 2DPGA 4ON9A 2DTDA 2QTNA 2ZXEA 2NM0A 3WGTA 1F8YA 1SQ6A 1QMPA 2EZ8A 1NBHA 5CM2Z 2YMPA 1W49A 1F2TA 3M6AA 3GJYA 5GGXA 2W6JD 4FHCA 1XVTA 4RSMA 3RYHA 3VUFA 4RTSA 4I3FA 2DU8A 4YR7A 2V7QA 3LWDA 5WRFA 5K3EA 1E7SA 2EFEB 4MVJD 4LRYA 2XTNA 3IQIX 1FFCA 4XE5A 3TL6A 5JU6A 3IJEB 3OQ1A 3TM5A 3TXXA 4OM8A 3RYHB 4U2FA 3EGXB 3PWSA 4YDSA 3JWGA 4UHHA 1OXKB 5ENVA 1GQOA 4DWOA 3G2PA 3EFHA 4IWNA 4TZ0A 4BC1A 1W2GA 1VXRA 1XHFA 2BFEB 2WP8J 3GCZA 4GXRA 4WFIA 2PZEA 4HQRA 3STWA 3N8IA 4UW9A 1V3VA 5AMXA 2NQ8A 4DMCA 5AICA 2XD9A 3KJFA 1FTNA 2WJYA 1IY2A 1RFGE 1T4GA 1ZK3A 3D0QA 2X0FA 4BV3A 3IAEA 3GJZA 1E62A 2O3RA 2DWUA 3AU8A 4ALMA 4AWAA 2PTHA 1D6JA 1YRYE 3KLMX 4INZA 3ZLBA 2JJQA 4NDZA 1N3YA 3FPFA 1DWOA 4QJ5A 1RC1A 5E0KB 3UIEA 3QXHA 4J8PA 1OFUX 1WXXA 4BN4A 3ADOA 5JVDF 4LI0A 4A0FA 1CTQA 2ZE5A 3BMQA 1EJBA 5G1NA 2PM8A 1QIIA 3FMPB 2FPGB 2ZJBA 1AT1A 2WD9A 1FL9A 4JP8A 3T9BA 4MUNA 4FE4A 2V7TA 2GEVA 3T3NA 1ZOSA 2GS9A 4HL6A 2QIOA 3A58B 1GN9A 1FFYA 2G70A 2IYSA 3R2JA 4G09A 3RDPA 2H5LA 1ZMRA 1K5GA 4FGSA 1NT2A 2JASA 5COBA 4Z9AA 5A6SB 1XZDA 4TYMA 3SYRA 1C7QA 2IWHA 4RXTA 3VR6A 4DMUB 4Y7CA 2HF2A 3ZU5A 3I0MA 3D81A 3KFLA 1E32A 4QQFA 3AFGA 1I5OA 2ZRFA 4HNHA 4OHKA 4PNZA 3AB3A 3O74A 3ZZ1A 4KXWA 3BM5A 1H66A 4I8DA 1FXWF 1XTRA 2CE7A 2XODA 1H3NA 1CSEE 4W82A 3UUEA 1AKMA 2ISCA 4IDBA 5T3UA 3LPMA 5TB5A 1IBKB 2Y2VA 2KS6A 1Q95A 3OZUA 3IQFA 1G3UA 3F2VA 2VHXA 5JQGA 3ZGZA 2OXTA 1QRVA 4E5DA 4FS3A 4N82A 1P4SA 5JO9A 3W9UA 3AH8A 1O87A 4EPYA 1K6IA 4PINA 4ZCLA 5AVZA 3RU7A 1WZUA 3KEQA 3I32A 4IS3A 1Z82A 3UAVA 3S8EA 3PA6A 2RJOA 3R09A 1R10A 4WBNF 2LCIA 2ZDHA 1X74A 4PZ0A 1M2VB 4ZV9A 4CFYA 4YAKA 2JW5A 3OPQA 4ZJZA 2D00A 1A7KA 1V48A 2BH9A 2O05A 1WA5A 2JC3A 3KWMA 3IEPA 1WPXA 3PDWA 2CXOA 4W8OA 2HT6A 1N2CB 4NHOA 5D3ZA 3ROXA 4DJJA 3TG8A 4BBZA 4MA4A 1NW7A 3EQ9A 2YXEA 3KBOA 5CJ2A 5IJXA 3DHVA 5CB0A 4RJLA 1SD5A 3LDAA 3R5HA 4POOA 1WW8A 2FX5A 3GEBA 3QW4B 3T4UA 3H2YA 4GXNA 3A1UA 3L2OB 5E4JA 1VMKA 5TQ0B 2X0RA 3C5WP 3I2YX 2YHIA 4FSHA 4BWVA 3AHIA 4B40A 1DEHA 6ADHA 1IXRC 3LDHA 4EBBA 1JE1A 1DKMA 2VYVA 2WG0A 4BQEA 3ETNA 4IJKA 4ZQFA 2I3BA 1IBLB 2QYHA 2WKWA 1HYEA 1N8TA 1T8WA 3H13A 4I5DA 1YR7A 4EG4A 4UAUA 1PQWA 1FBTA 4C6TB 5IBQA 1BA2A 1P1CA 2AFIB 5HJEA 4F56A 3EVEA 3I9KA 4DPKA 1XEAA 5BT9A 3ZBQA 5TPWA 3HUDA 1YVRA 1ONOA 1XR3A 4XPIB 5DHFA 2VO1A 2OQ2A 5TARA 4DIOA 1UPXA 2BFOA 2CDBA 3D54D 5JS2A 4ZAGA 3MF4A 4DZRA 5LZ9A 5EAIA 2NP6A 1F7UA 1MJNA 1H8HD 4J2TA 1IOZA 1Q7EA 1TT5B 1OJ7A 4G4SO 1EXMA 2QJFA 3T9AA 1PFGA 2CNOA 4QGBA 4U0JA 4LSWA 1X87A 1XEFA 4H15A 4PFKA 1LTKA 1W4CA 1CQIA 2YY6A 2R84A 3SJ7A 3GELA 3KOYA 1RI3A 3GVCA 4CV0A 1L7NA 3CONA 3PXCX 3FYTA 2VHYA 5BSHA 3A06A 4NDNE 5B4VA 1L4LA 3LU1A 1AIPA 3VO8A 3WO0A 5C35A 1V47A 3R40A 1IJEA 2HUPA 1A5TA 3AG5A 2W2VA 4LOLA 4OH1A 5F7XA 1Y6QA 3S55A 4HO1X 4F11A 1TJ3A 1N7JA 1C9MA 1E1QA 3JQPA 4ND4A 3U9TA 3HJHA 5E6RB 1Y1LA 2QL7A 4MUEA 3IS3A 4FQ5A 4R8VA 3RUDA 4KPUB 3G2QA 1DMRA 4D9MA 3BX1A 3V1YA 2IZ1A 1M74A 4TWZA 3DO6A 4YJ3B 1AABA 1JKIA 4BLPA 4HDCA 1TLLA 3STUA 3LECA 1C1DA 2JLAA 2Q1UA 4Y6SA 4CN9A 2VJPA 2XEXA 4CL3A 1U98A 1I13A 1MX1A 3CZCA 4C05A 4AT1A 4BO7A 4E33A 2KLHA 3IPXA 4ARVA 2UZ3A 1L7EA 1Z6PA 1I6LA 4JT9A 3AWIA 4IMIB 2EKDA 2IYNA 3HJRA 3I83A 4W4TA 2HTFA 3U7QB 2JLZA 3KQNA 3CEMA 2O2GA 4K9SA 4UHEA 1WCIA 3RFXA 2GPSA 3BBPA 1NFQA 1IONA 4HLDA 3ELDA 3UXEA 1GPWB 1SUSA 1I6MA 2WWXA 1O96B 1B23P 2DFKB 3ND9A 1I2DA 1T8SA 5H9VA 2O2ZA 2VPPA 3ZTYA 5CA0A 2PLNA 2W6QA 3FMFA 3FYUA 1OPXA 3VHXA 2OWEA 2XNKA 1WU7A 4ER0A 2GCEA 5E7JA 4NU0A 2WYWA 3NDPA 1O77A 3I23A 2GF9A 2K7ZA 3L0IB 4TVBA 5AKEA 3UQYS 2FZ5A 3VPDA 1Y7PA 4BJHB 5CBKA 3ZG6A 4LSZA 4EJSA 3CN9A 2D1RA 3I39X 2PRSA 3I52A 5AKGA 2O54A 1RYDA 3VR6D 4H7JA 4HVAA 3QJGA 3PHIA 2RONA 4TMFA 1ELOA 2KBFA 5E1MA 1QE3A 3EGXA 2KYRA 3CGGA 2O06A 4BVFA 4C22A 3W8DA 2UZIR 1T10A 4OXYA 4H35A 1LXCA 5ALOA 1I3CA 1TD9A 2FWJA 2IXTA 2P5UA 3C7TA 1LZLA 4CTMA 4NXMB 4RZQA 1Y8RA 2CYBA 2DWCA 1F12A 4WW0A 5A9SA 2CL5A 3IMFA 3Q2OA 4DARA 1PKEA 4NOKA 3T5AA 3D3NA 2FEXA 4OF4A 1S4QA 2JH9A 1U3DA 1PR6A 2JGMA 2AD1A 1ENZA 3HYSA 1XDDA 1KFCB 2J30A 2XOKD 4P93A 4WERA 3VU9B 4WX2B 2FSFA 4DA0A 4H0NA 3L93A 3A9WA 5J4KA 4O3MA 3DDUA 5AM3A 3WLMA 4B7XA 4WEOA 4MUHA 1C14A 3CLTC 1GADO 1P9OA 5C3MA 1MZVA 1CS4C 1FBNA 3NIDB 3A0UA 3CJQA 4B7ZA 1ABBA 1DJMA 1NDHA 1GU7A 4R83A 3IILA 1R6XA 1AE1A 3PE4A 3GJ8A 4Q1DA 2X3UA 3N2EA 1VKZA 3LD9A 1VL6A 4G36A 4OGKA 2JCGA 4UUQA 3PL5A 5CVCA 1CY0A 4MWZA 3WL4A 5KHLB 4ZGBA 1DELA 1GPDG 3H9CA 3K73O 4IIYA 3U4CA 5HZMA 5K5EA 2UAGA 3KDPA 4QUGA 4ER5A 3P7MA 1IY1A 4EO9A 3ILHA 3GNSA 1NURA 3AFMA 3GOQA 2ONKA 3WB1A 4YXFA 2PNFA 4U3JA 2A4MA 3LA8A 2Q4OA 1GXSB 5DW0A 5J4LA 1LVHA 5KNDA 2WEKA 3H99A 3X2SA 4B2YA 1QLHA 4RIHA 1QHIA 4TUYA 1ZX1A 5DB4A 1KQPA 2NO9A 3FYHA 3P0HA 1C8BA 5CLLA 5K8IA 3ZDZB 1H9BA 3GYBA 4JQYA 3ZOZA 2DJ5A 4ZCMA 3PDCA 1HY3A 4LE2A 2C3OA 4X3PA 2B35A 2W6JA 1WMSA 3QTLA 4H9GA 3HCNA 3WRXA 4FIDA 4JXXA 3S1AB 5G4KB 3TJMA 3NI2A 6REQA 5LUAA 2I7VA 1XC7A 5EZ6B 5DYWA 5LB2A 1BFUA 3CX3A 2RAPA 2EJUA 4BO6A 2ZIWB 3PFGA 5E6RA 6Q21A 4TL7A 1C7FA 1GZSA 2XCUA 4BX3A 2QW0X 2F3QA 5LP6A 3CPJB 2NU9B 3VA7A 2B6NA 1EZ1A 1YI1A 3RASA 3WP0A 1RRCA 2QUIA 4CQLB 4BYMA 2W2KA 2B8JA 5DLQC 3W78A 3TLXA 3I5YA 4KLCA 5ES3A 2UVPA 1NXOA 4H6WA 5IWAB 5DCLA 4F4IA 3N3BC 3A05A 4D3ZA 4DEXA 1U90A 3F9CA 3ASUA 4COKA 4Y2SA 3ZJVA 5IYZB 2D6FA 2C1XA 4KQKA 4LV8B 2OGTA 3SFTA 3QOWA 2EX1A 1TTQB 1H4TA 3UJBA 1TZBA 3ESXA 3I09A 2CT8A 1NUUA 1QLJA 1DWUA 1K99A 5TS2A 2Y0CA 2OP1A 3NG1A 1U2GC 2FZGA 5FLKA 1PFKA 5IJWA 1UMCB 4EZBA 2OO3A 4OD0A 2PPVA 2R2AA 3EBOA 3SYNA 4IWXA 5FTKA 1SBHA 2XE6A 3BZUA 5GMOA 5DNUA 1HMEA 5EESA 4RFSB 2XWSA 4KXFB 4YUWA 1JHUA 3RJMA 4EDHA 1EDDA 3W7AA 1NUSA 1O0BA 3ODGA 2G8NA 1FY2A 1YR8A 3OY7A 3PQ5A 1SWWA 1MG0A 1RZRA 4DMKA 1FX1A 3CSSA 4M86A 2B21A 3HXKA 3WYGA 4IJUA 2A0XA 2JIPA 2PZ8A 4DSAA 3P9YA 4Q3NA 3V33A 5K45A 5K8TA 1U1IA 2HXSA 5IDYA 5CEJA 2RHJA 1E3QA 1B00A 1YUBA 1RHQA 1VI6A 1GDDA 3A27A 4M99A 3AJ9A 2A3NA 3UMGA 4DQVA 4XA8A 2PUFA 4UHBA 2VK2A 4GEKA 1PQYA 3LUFA 1KH1A 3I1JA 4J0CA 2ECOA 3K4QA 5G41A 5TMDA 2P90A 4RZUA 4CKEB 2AIRA 1U63A 1WZNA 5EZYF 1T1GA 3LV8A 4PZAA 3ZCRA 1LX6A 1TW3A 3WIDA 2OHJA 4PANA 1Y5MA 3BGDA 1G4UR 4LS3A 4PGHA 5B7QA 3PENA 4C4YA 2ASVA 4CLXA 1DEAA 2EQBA 3BFPA 1PNRA 2ZS9A 4E6EA 1MIHA 1W19A 3SX2A 3HMKA 1PQUA 1KJYA 4MINA 2LV8A 4AS2A 2HD4A 3L9WA 4MKIA 2QRLA 2JG3A 1CUVA 2NYUA 1Q0PA 4MV7A 4XAQA 2W8BB 1IOVA 3DE6X 5DBFA 2WHYA 2G9UA 1RACA 2F17A 2B34A 4P3XA 2IZZA 1WF3A 1GQ2A 2D74A 1G3QA 4RHTA 1GL6A 1ADJA 2ZYAA 2Z43A 5ALYA 3C8ZA 4XD2A 1OROA 2WR8A 4NECA 3TDNA 3KKEA 1SKUA 1FUIA 5K3FB 5BR8B 2O8DB 3CF6R 5D85A 2RBKA 3LMKA 1ZNXA 3RRNA 1KMHB 3DUWA 5BN1A 5EJ8A 4O0MA 3ZHXA 3AG6A 3I76A 2IX3A 3G88A 2QT9A 1Z4OA 2W98A 2F90A 2V5AA 4NBRA 3ZBTA 1G66A 3FCAA 3NFYA 2NVUA 3ZNNA 1P77A 1LX7A 1X3LA 4F04A 3CH6A 5ES4B 4N5IX 1BRMA 1QAQA 3RHFA 1HTWA 4JLNA 1CUEA 1KR2A 1WABA 2PUJA 3CF0A 1NVEA 3JVIA 3VPXA 3Q9UA 2ORED 4PWZA 4BP9A 1QH9A 2ZJFA 3TVDA 4HQ6A 2BTQA 1ZI8A 4P2GA 2Q2OA 1VCIA 4HFMA 4KEAA 5H0IA 4D9HA 2EJTA 1S9HA 3TQHA 1QAMA 3NW9A 1Z63A 4V0LA 4AF8A 1VIYA 1ZW6A 1YGYA 1YRWA 1LH0A 1XF9A 3AV0B 4OKIA 1QUEA 4QTTB 1FMFA 3SHWA 3BS4A 2J6HA 4YAIA 3R3HA 1MNQA 2RHMA 1QH0A 5EHQA 4C7JA 1YC2A 1VSVA 2PFKA 4RJJA 4DJEC 2W4QA 2I2BA 1JXQA 3MWDA 4PSDA 1C3XA 2BHNA 1JA1A 4URHA 5J2TF 1DQYA 2J3HA 2JK0A 5BRAA 5AW3A 2X9QA 1K89A 3CZ5A 3LXMA 3OX4A 3K09A 1OF1A 1MMFB 1N2IA 1SXHA 1ZH8A 1LJLA 2AFVA 1X7ZA 1E2KA 3QKRB 3S2YA 3DTVD 5JBNA 5BOSA 1WD7A 2O2EA 1OTHA 3MWDB 4ZI2A 1ECJA 3HJGA 2FPMA 4GI7A 2FHPA 3D8NA 4KYVA 4OQZA 5AJHA 1US8A 3EPPA 2GQ0A 2P6RA 2OENG 1V5IA 3K9WA 4YJDA 1UPUA 2Z2IA 3E81A 3HRHA 5IZCC 1I10A 1RIIA 2BFMA 1RYMA 2F59A 2GPNA 4HG2A 5CCBA 3EVAA 4AKSA 2PBLA 4GX2A 2AFHB 2A94A 4G1EB 3QOXA 3L84A 2WT8A 4ZJPA 2QNRA 2KHZA 1X1AA 1G20E 2VF4X 5CIQA 3T12A 1VJCA 4NJEA 4PN3A 1U1EA 2FZCA 2V7VA 3OJOA 4HQKA 1JKJB 1IN5A 4IH4A 3R6LA 4XB1A 2YYSA 4JT2A 4JVOA 4JOCA 3V42A 1LNSA 4JJKA 3UTCA 2HBYA 5AKLA 2IV7A 1F7VA 2Q3DA 3AEZA 2Y8EA 1NJFA 3WLIA 3ZE8A 3NHJA 4LXXA 1I11A 4E13A 1TM2A 3WLFA 3EOBI 3K32A 5CB6A 4LWQA 1ETUA 2UYCA 4PFSA 1KY4A 1TCCA 2Y1CA 3HWSA 4P7KA 5EMNA 4HAYA 3ZY2A 1P8AA 2FW9A 3NC0C 3SIPA 1ID8A 2ATEA 4MAFA 5BW6B 3DL2A 1XWFA 4O63O 1M7GA 1OLOA 1J9ZA 4TS9A 1O3YA 1SXIA 3QBVA 4TZTA 2FLKA 4WJKB 2E89A 1O9BA 2EHDA 2WLSA 1MAVA 4URYR 5DVZA 3VDQA 1UEXC 3KKOA 1UBNA 3QMWA 1FFHA 1GPKA 1VIMA 4YHBA 5TF0A 2IU3A 3PJGA 2IYRA 1TUBB 2JAQA 121PA 4KR2A 2H07A 4HPWA 1RS0A 1CZOA 1KYVA 3O73A 1RADA 4KOAA 4PZDA 5C1PA 1YQ9A 1FJGB 3VKVA 2GXSA 1Q7BA 1SOWA 5LZ7A 1QIKA 1KMNA 2OCBA 4IS2A 5ICGA 3OQOA 1K66A 4Z2AA 2GASA 2VK8A 3ASZA 3QA9A 2B8NA 5AHXA 2QMHA 1AS3A 1WY5A 1ZQ9A 4J6FA 3TX6A 4BNDA 4AZ0A 4XM1A 1VPTA 5BPFA 3FFBA 4C6TA 2XGJA 3TD2A 4GYYA 1P1IA 1P5FA 2BRUA 2R96A 2O3QA 2ZDGA 1JEQA 1XNGA 3HACA 2FPSA 2V55B 2LW7A 3ZDFA 1LWOA 1OA0A 3LPCA 5HTOA 2Z2JA 4RPKA 1W4RA 4NV0A 1QIJA 4F8YA 1HRDA 2HQSA 3OM9A 2CVPA 1FA9A 4MROA 5E9AA 2ZUFA 1F17A 5E6SA 3PKIA 2VQEB 3EY9A 4QXAA 5T41A 3I42A 3HCDA 3PGA1 1UBHS 4RFSA 1F48A 1VRVA 1GYRA 1JMYA 1UK9A 1WDMA 4RHXA 5K2OA 1Z0FA 3HP1A 5JJLA 4Z9BA 1E79A 3QQPA 1ACJA 5CK4A 2B36A 2SCUB 3R4CA 4DTIA 5GIOE 3EZLA 1K8QA 3KETA 2OMKA 3ANNA 1EJ2A 2I6QA 4RF3A 2PLAA 3KOZA 4UBLA 3UV7A 4AFNA 2AQIA 1Q7RA 2VZEA 1CQXA 1HPLA 1JQ5A 1UC9A 1N6PA 2WWFA 3HY4A 5CFQA 3FF4A 1QG4A 1KH2A 1ZUWA 1DL5A 5FFFA 4ZQEA 3KQSA 1YZKA 1TYAE 2QTLA 3MGCA 4JQOA 3SHOA 4ZU1X 1JB9A 2ZUVA 2CZCA 5JC8A 5CYOA 2HLPA 2WF6A 1T0IA 4H7FA 3W2HA 3UMYA 4HDOB 3LVQE 2H08A 4WSOA 3R41A 3ZS8A 4D02A 4DM7A 1M2EA 5IAJA 2IWRA 3ZJ4A 3HXOA 4FLFA 2H2WA 3NAMA 3D3KA 2WJIA 3OU2A 4NEGA 5K0NA 2GSDA 3VR6H 3ADPA 4NCNA 3CSDA 1G5IA 4DYHA 5CB4B 2IOYA 3DF9A 3OCJA 2CLIB 1L5HB 1PR5A 2QM0A 1SXJD 1GZHB 3BDIA 4QULA 5E0OA 5HEKA 4OYLA 2WKSA 4NS4A 3QE2A 4KRFA 1OX4A 4AZVA 1E2LA 2VYND 1QK5A 3C6XA 4HHEA 5IJZA 3JVUA 4RCYA 4WVFA 2Q9UA 3B82A 4P7GA 2VATA 4HX2A 1IHDA 3CH5A 1JVBA 1U9JA 2AXQA 1WUIS 1V45E 1ZD5A 3D8RA 5HIJA 2B1RA 1RBMA 3TWOA 3ND6A 1B73A 2YVLA 1JLMA 4Q66C 5DX1A 4IJMA 1TYZA 1KHHA 3G6KA 4WNAA 3X2FA 1R0WA 2JNWA 3K0HA 1BWRA 1OR8A 1L1FA 4ZT4A 2RHRA 4OJMX 1D4ZA 2H8GA 1IAVA 1IU9A 2VSQA 4C4OA 5JAQA 2FMFA 4M9UA 1QVVA 1QHGA 4G1FA 4I4NA 1D3AA 4LTDA 3TMYA 3S8YA 4CV1A 1J1UA 1OXVA 2CS1A 2WT4A 3DZFA 1Z0IA 4L8YA 3IDFA 4R98A 4HXFB 1PJ8A 2W9XA 5U4XA 3RVOA 1FRFS 1G8JA 1JSRA 3HU5A 4N3GA 3SJUA 4ZJYA 5A62A 2ZB4A 3V48A 2X1VA 1G5PA 4E94A 2QU8A 2OY0A 4RWZA 4C08A 2VXOA 3M70A 1D1SA 1QP8A 2P9ZA 1U3WA 4U6SA 3FROA 5LBIA 2DBRA 3ZKAA 1WKVA 1DZ3A 2WF9A 1NI5A 4KR3A 2IIVA 4MKRA 4FDUA 3ICEA 3K30A 2IU0A 3DBRA 5EA2A 2B5VA 1Z5ZA 3AR3A 4WWHA 1D04A 4F4JA 5B3KA 3C41J 2WSSA 4DIDA 2X8JA 2I6SA 1T8PA 3O1HB 1U2ZA 2Y93A 3RIYA 4DY4A 1XJ0A 4IRMA 4YN3A 4BIMA 3HTXA 2JAPA 3K20A 4AF6A 2HA2A 4I9FA 4OQLA 3SM3A 1UAGA 5AO9A 2A84A 5FB3A 1XTVA 3AMVA 3IHTA 1XLWA 1Z37A 4R3WA 3RVJA 5HW0A 1X80A 4OIMA 2VF8A 5CM9C 2HV8A 3UT0A 4MNTA 3JZFA 3D2AA 3ORYA 4F6LA 5K7SA 3CNOA 3AF2A 3EVTA 3PK0A 1U8UA 3I45A 2NTYC 4NBUA 4ZC8A 1DS6A 1RJEA 1HLFA 2F1HA 4F6RA 4WCFA 4Y1RB 1BU8A 3ETLA 5A7FA 1HQDA 4QLBA 4L16A 2C2MA 1BE6A 2VDLB 3Q10A 3RYFB 3BRWD 4Q37A 3PKJA 1LPAB 3G0DA 4OBBA 1MB9A 2IIQA 3WAKA 2IYZA 4B47A 2IC5A 4KE9A 1DCKA 1R5OA 2BM9A 3LXRA 4U8GA 3SX4A 2PKYX 5CM8B 1E1KA 4ENQA 3OZIA 2Y67A 3S2GA 4J9VA 5EUBA 5JISA 4B3FX 4EAAA 4HTAA 1JL3A 1TDJA 1AHIA 2NO0A 3DL7A 4H2DA 4JBGA 4CDMA 2OORC 3QRWA 1QUFA 1XTSA 4YEDA 4Q3EA 2XQKA 1FNCA 2N1BA 2X8BA 1JG7A 3FSGD 1Z5GA 4ZTBA 3OI7A 3OKFA 1ECFA 3RU3A 1YZNA 2QYSA 2GBLC 1YHZA 4QVGA 3H5TA 1USGA 1SPBS 4LYEA 4YFYA 4DCOA 4Z7JA 1N57A 3RJTA 1NMYA 1WCV1 1DDIA 2R8PA 1J21A 3P9KA 4X20A 3DBRB 3SD7A 1K7FB 1U0HC 1KKLA 1RYBA 3MRXA 4UXJA 1Q91A 1X70A 3GRAA 3KSRA 2AHOA 2EGUA 1RAIA 3DBVO 2ARKA 4AMGA 4F97A 3L7JA 4OQDA 3DMDA 2QR3A 5EMKA 1LWNA 2XWQA 3CISA 5D2CA 3CLUD 1I24A 5ADUS 1UFKA 4MW7A 1Y5RA 3IP6A 4UAJA 4L75A 3L1HA 3D6JA 1VI5A 4PZEA 1BD4A 5JCOA 3U17A 4C01A 4E03A 4EFNA 1UP4A 4CIAA 4O4IA 2VNIA 1A69A 1K7YA 4IM7A 2Y0DA 5FR1A 1DAPA 3T7JA 3KKPA 1WHTB 2VOJA 1DWPA 1QV7A 2RAUA 4EY7A 3H2ZA 1HURA 3ILSA 3PD0A 4DNXA 4F86A 4RO0A 2W8BA 3VAYA 2WT9A 2FN9A 2R97A 3GOHA 2DMRA 5HKAA 3TZHA 4TMTA 4UEOA 5CYFA 3I9MA 4DIEA 4W1SA 1FFEA 1ZXXA 2BMFA 1QVAA 3IIMA 2ZUTA 1JPUA 3H2BA 3V4LA 3MCAA 3W5VA 1ZBQA 4C0QC 4EKYA 1HT3A 4LF9B 4QEDA 3PXGA 3RLFA 3IGFA 1QHNA 5JD4A 2Q5LA 2AXPA 3INTA 3ZWBA 4O5AA 2C94A 5EPEA 4K9NA 2KX7A 3CRMA 3IXMA 4UEJA 3GQBA 1O6FA 1R0SA 2IEIA 2W6ID 4CKEA 2XB2A 2H0AA 3KZMA 3KJQA 4MQFB 4WECA 1SKBA 4WV3A 4IH9A 2P5YA 1QO0A 4IKEA 1JR3A 1U8XX 2V6MA 1UH5A 4CKBA 2DHEA 2EJBA 4LQDA 2OFWA 5E3HA 4U2EA 4WIAA 4GMXA 4UNNA 2FK7A 1RHMA 1XVLA 1GUZA 3Q98A 4TVOA 4TKUB 4TLMB 3S40A 5B1EA 4JY7A 4I1OA 4D81A 4YMLA 5JSFA 2FSPA 2J3MA 3A1CA 4UTPA 2OCYC 2VXBA 2DCUA 1HDZA 2AI1A 4WXEA 1J0CA 4RMNA 4GRAA 5IJAA 2NOAA 2UUOA 4ZKEA 1SK8A 4O59O 2O2CA 3MW8A 1QTNA 4M38A 4F2HA 2G9NA 3L6EA 2XUKA 3QZUA 1TK9A 1PR1A 3VV3A 3B5IA 3H6HA 3GJSA 1FUYB 2UZ1A 1JEEA 3U3OA 4QUEA 3WLPA 4TLCA 2DETA 1I4WA 3VYWA 4C3ZA 2ZDQA 3NWJA 3MJEA 1MJFA 4N39A 3M3HA 1IM2A 4ZOQI 3GJXC 1YE3A 4Y2UA 2RHDA 3LM8A 5KBYA 1ULZA 1U2GA 4LRTB 3L0BA 4PGGA 4R9UC 3CM0A 4BMOB 4G24A 4WACA 1M75A 1K86A 3ETDA 3FJYA 1PJTA 1LDMA 3M5CA 3NBYC 4JVNA 3RIMA 5CB4A 1FYFA 4M22A 2FG7C 4OHMA 1RKQA 3C87A 3P4YA 4GDFA 4BFZA 1G2OA 4NBTA 1P1RA 2GD6A 4MCHA 5GZ1A 4RQAA 1SBNE 2WFZA 5AVTA 4YJGB 1OIXA 1L1QA 3AW8A 1F8FA 1IHOA 3B6KA 1T1SA 2XKBA 1HE8B 4F5YA 3BFJA 1T25A 1M54A 1SVOA 4Y8VA 1B43A 1G21A 3O26A 4FFWA 4N5MA 3G1WA 1IE3A 4IUBS 3W4KA 1D09A 4WY2A 3ZCVA 5FPKA 3IAS6 4GGMX 4CEHA 3RVQA 2HNKA 1QR6A 1Y9EA 3IUPA 3SQMA 5KWIA 2GM9A 4YV7A 3S5UA 1YB2A 1DC4A 3C6ZA 4X65B 1JWLA 3AP1A 1M2VA 4B3IA 1YBVA 4DA4A 1DXOA 2IHTA 5F98A 3ZQKA 5AIAA 1M72A 3CGWA 2ZRKA 2PBZA 3I3SR 1SHKA 3W9SA 1RXIA 1PDWA 2WWIA 5HZGA 3NOVA 3MJRA 3V4OA 3RYCA 5EIHA 1OB2A 3LW7A 2Z8XA 5LBTA 1KK1A 5KPDA 4N0MA 3E3NA 4FDMA 1F2DA 4EZIA 2AG6A 4L5BA 3R6GA 3SZ3A 1DRVA 4P22A 1Q3TA 2W2KB 3TLKA 3B6EA 1JKMA 3UW3A 3GU3A 1V35A 2OM6A 4ZIRB 9GPBA 3BXEA 5JATA 4E5UA 1H42A 1QDUA 2P6NA 2PZFA 4N8SA 4MUIA 5KWJA 2ZB7A 3IP7A 4CZ2A 3E2MA 4GG1A 1KE2A 3WGUA 2BJVA 5KYWA 1KU0A 5KTRA 2GN4A 4RHEA 4GPTA 1MRNA 1D7OA 3E18A 5IXJA 4QFBA 3F97A 2WOJA 3P8ZA 4GSKA 5B3AA 4E30A 4R0VA 4ZMSA 5GIPE 3A4LA 3H1EA 4AKTA 3BH0A 4G5YA 5AKZA 3T1QA 3D1LA 3RWOA 2HIGA 1DAKA 1EA7A 1U04A 4Q05A 4AJOA 4D74A 2P9FA 3CHYA 3FR8A 4NIMA 1H6AA 3ZWCA 1O1YA 2HXGA 2PXHA 1V2HE 1J8QA 3N6VA 1B42A 5K6TA 3D59A 2QTVB 1J2YA 3G68A 5KQSA 3V4SA 2VA8A 2H4HA 3L8DA 3PFBA 1VKNA 5I8PA 4Y2RA 5JMPA 8ADHA 2QL6A 2RKWA 2JF0A 1CCWA 2DGDA 2CNLA 4JMPA 1VHQA 2J09A 5IVKA 3A1DA 5FP0A 1YULA 1CY6A 3JD4A 4R1NA 2C4WA 4TXJA 2YXPX 3U13A 2RFLA 3EDOA 4UQLA 3IJPA 2FPLA 1GUDA 3DBHB 4FZJA 4OSOA 3CX6A 4KGXA 4YYZA 1TZCA 2VBFA 1FNBA 3C24A 5DKFA 2JARA 3I8OA 4MW9A 1NJ1A 5DSZA 4ATNA 4BFYA 1P2TA 3L6RA 4RIFA 1K2VN 1CUCA 1LRJA 1YUMA 1ZIYA 2G5GX 2GCPA 3HWX1 2ZJ6A 3G8DA 3L79A 5FOSA 4XVQA 4R8MA 4YX9A 3PU6A 1FSFA 1A98A 3MTJA 1YBFA 5LVAA 3UWOA 1YOBA 2O5RA 4FSDA 1GCGA 2WMDA 1S9DA 2B37A 4BWFB 4CMEA 4MGEA 5K8CA 1KOJA 3Q7PA 3U09A 3DOHA 3ZNPA 1QOZA 2C5GA 2NUAA 2TSYB 4LDNA 5TQJA 2Z2YA 4OYYA 3N2NA 2AA3A 3AJ8A 4TSFA 5JDCA 3FGZA 4GYWA 5DSTA 2AG1A 2YFQA 4FU0A 4Y1EA 1QPBA 1Q17A 1NONA 2GBLA 3MJVA 3QWIA 2ZIXA 3CW9A 4II7A 3EAGA 1PS0A 3SAJA 1S8AA 3FPAA 4P54A 4R68A 1X8JA 4U1RA 3O84A 3VMMA 4YC7A 2I71A 2VAMA 5C1BA 5CG2A 2OR3A 1Z5NA 1QLWA 4ZREA 1DOZA 1HLPA 1SU6A 1TKRA 1ZAKA 1FDTA 1UINA 1J07A 2PH7A 2QW1A 3G23A 1A4RA 3C7DB 4FR2A 4PO1A 3GRVA 4BAZA 4YUAA 3JARB 3S6JA 3HU1A 3D4PA 2Z0MA 4EARA 3OQIA 3SC4A 4MEJA 4X8HA 1BXRA 3QYAA 4UPDA 4ZVUA 4LGMA 1GGJA 1U81A 1CR1A 2HWUA 1PW5A 5CH8A 1ZUD1 1GUAA 1K2WA 3AUXA 1K1EA 3DAOA 4BP8A 4HP8A 4DJDC 3SQDA 3H1GA 1ZGJA 3EZ6A 4DLAA 3K70D 5JV5A 3GEIA 4AJ9A 4S0XA 4IKPA 2P3SA 1TGYA 5I5GA 4MYTA 3QVKA 1MT3A 2OD9A 3OH8A 1ZD9A 2GVDC 3VSCA 3HVUA 1Z4KA 3UPUA 2TMYA 3DKIA 4EW6A 4MGHA 4V24A 1KNQA 4UCFA 4M9ZA 4UKDA 4JYMA 4HUQB 4RSRA 3BFXA 1G3RA 4HYEA 1SCUA 2R6GA 2IZ6A 1XRSB 4G25A 5BN5B 1NW6A 1W6UA 3F9IA 4QUHA 4BYGA 1SJ9A 3NJ4A 5LA6A 1SD2A 2AW5A 5T57A 3D6TB 4ZICA 1T6NA 1L7RA 4TRNA 3VTKA 3TLCA 4JXKA 1CUDA 2PPLA 3QVUA 3CWZA 3DE0X 1SM4A 3D6NB 4EDFA 5CH3A 1RXWA 1Y7TA 4JX8A 1VPWA 3KSZO 3TSAA 1WRBA 2I7XA 3OKAA 4S1WA 1L4KA 1RWMA 4ND5A 4WFQA 2AUNA 4ND8B 5DM1A 4KPEC 3R3YA 4M3NA 2OFPA 2Z6VA 2R7KA 2PFGA 4L5JA 3TE6A 3WWPA 1SBZA 3PQEA 2OBNA 4I9HA 2I03A 1A97A 2LPMA 3QJ5A 3R5FA 3VO1A 3DCNA 4DW8A 1PNQA 3IAS1 4IVRA 2XGOA 1VYTA 4DG5A 5JZBA 3BMNA 5J2UF 1IB6A 4HXYA 5ER6A 1IY8A 1ULSA 1V95A 4PAWA 1UZUA 1GR0A 1AUVA 3ET4A 4FFSA 1EE9A 4WNAB 3H19A 1T36A 5K0SA 3JAWA 4DRXB 2Y1OA 3PQ3A 4KQWA 2Q5OA 1EBBA 1LVUA 2X22A 1OV6A 3S1LA 5JC1A 1FSZA 4Y6QA 2HSEA 3BREA 3LY9A 1QRUA 3O7MA 4F71A 1JRLA 5FPTA 2EOAA 1W4ZA 3E0QA 2JHFA 4OFBA 1Z68A 2V7BA 3D2LA 3IEIA 1GRQA 4C4SA 1NN3A 3BD8A 4W5RA 4HQOA 3QUCA 1JDTA 3QTTA 5AT1A 2XLBA 5FD8A 3RD5A 4CGYA 8MHTA 4C7OA 1GGKA 2BGTA 2Y92A 3H9EO 3OD1A 3W7BA 4MO9A 3DVAB 3QE0A 1CJMA 3GRYA 4CF5A 1BN7A 1F8XA 3L6UA 1ULAA 1QU2A 3KT8A 4C88A 3PHBE 2NU9A 3LGXA 2VSOA 3QY9A 4TLBA 1WKCA 3S27A 2AR9A 1ZITA 1YVEI 1EX7A 4MVJF 4RQUA 2JATA 2V7WA 2RB4A 4ZYVA 2QTFA 1C8KA 1I1QB 3TL2A 2FVYA 2REOA 4AX4A 5ECYA 4RTKA 3D9QX 1U2TA 1MKYA 3H5WA 1VBNA 3BIJA 3K0BA 1JR3D 4I1SA 4PZZA 5EERA 3QE3A 1QVWA 1S2IA 2Y6UA 4FQ8A 5EQJB 1GTL1 1J06A 5F5NA 5G1OA 1E3SA 2HLDD 3HE3A 3QP9A 2ZRHA 1K5DA 4UM8B 5GQSA 3A6KA 3N2LA 4BJ3A 2A88A 1NF3A 1C2TA 3FCOA 5F3DA 3CCBA 3IUJA 4HLCA 4DA9A 2I2FA 3GT0A 4EYGA 1YTUA 3B1WA 2FPPB 2RK6A 3GMIA 3OPYA 1T0BA 2BZ1A 1RZVA 4O02B 1ZUNA 2PWYA 3O8QA 3HL0A 4LDQA 3UM9A 1P9NA 5JMWA 4KXLA 5EE3A 2W2NA 3C85A 3THWB 1T0UA 3HB9A 4TROA 1OYWA 1WHTA 3DPIA 4D4JA 4O2LA 4ID9A 3RIHA 1B3RA 5A6VA 4L5YA 1V9SA 4B2LA 1D5CA 4ZAVA 2IHVA 1BWPA 3L7OA 5FYQA 1M2GA 3DVLA 2GESA 4QQ8A 4YMHA 3VH3A 5DASA 4CKWB 5JASA 4WK0B 1FOEB 3P96A 4S1PA 4TYYA 4CQMA 1NR1A 2C61A 3DMPA 4P8RA 4YJ3F 4C2BA 1XKQA 4NCHA 1G7TA 3Q3GE 3AEQB 3H9JA 2IDJA 4Q0MA 5KQMA 3HA2A 2GZAA 2MR6A 4MKZA 3RTCA 4PONA 2DPMA 2ZITA 3T3HA 2JFNA 2Q5QA 3QVGB 2O52A 1WTAA 4BLQA 1E4YA 2XKAA 4J49A 5FCDA 3WB0A 1H8HA 1QOPB 1SU4A 3M9LA 4KQ2A 4X20B 4J4HA 2GK3A 1Y89A 3MTGA 3DDOA 3R7WA 1E0JA 2FOXA 5DN9A 3BRCA 3FXAA 1I2MA 5FAKA 3ZXUB 1HZZA 1ZGGA 3EIUA 4IIJB 5C46F 1RHKA 2FI1A 1HDXA 3Q9LA 4U9IS 2XSZD 2HBQA 4P2BA 5AI5A 3HJNA 3OCVA 1R8QA 5LQUA 2LR0A 4E5PA 2HJGA 1O6BA 3B48A 2G6BA 2AWOA 3FSGA 4KZPA 1Y1SA 1RFLA 1PJQA 1TU3A 3BMCA 3MWFA 1HYGA 3ONDA 3JALB 3MWGA 1MOPA 2EWVA 1LY1A 3ETGA 1P3Y1 2AZ4A 2ZEJA 2CFTA 1T2CA 4O4JB 1WB5A 4ZP1A 4MRVA 1GTVA 2ZRCA 2QMEA 2YJ5A 2OHXA 2FXIA 4RSGA 4AN1A 5KVQA 1OWNA 3DTNA 4DBLC 3QX8A 4UDYX 1BDIA 1KZHA 2WIJA 4FLEA 2PT5A 1VCHA 3ANMA 1OHHD 3IYLW 3DUFB 2WLTA 1VG0B 4GS5A 2O7QA 4QZVA 4L50A 3GZNB 4UREA 1EAYA 3WL5A 2W2LD 1T2DA 2YZGA 2ZJ4A 3D6HA 3ITEA 2GERA 1VJ5A 3PZRA 4X41A 3DBLA 3RNOA 5FPPA 3SJBA 2NMVA 1N2GA 3FYDA 5EY5B 1PV1A 5T6MA 1G5HA 4YIHA 5D5HA 2P9EA 1HDYA 2Y77A 2DY0A 3EG5A 4ZALA 1PX0A 3I9NA 5BNWA 2DTEA 2ZBUA 4OJNA 2FN8A 1P8JA 2WNHA 4HEA6 4CCAA 1JIVA 3AKDA 1C9EA 3NALA 2CDNA 3EZNA 4PC6A 4M9SA 3VU3A 5BVGA 1FTWA 2NUAB 2YJ4A 4DWVA 2FMKA 1YDHA 3NAGA 3ZYCA 4FTWA 4OHBA 3SZMA 1LQ2A 3SDZA 5IH7A 2MMCA 1U5BB 1ZJ4A 3K0CA 1EFVB 2H1IA 2YZ2A 2I8AA 3TQCA 1N25A 1C81A 2ERCA 4S24A 4MSUA 1T6XA 5E8RA 2PZJA 3GUHA 2XMDA 5AVJA 4QE3A 1KORA 3B1FA 1UMBB 3GFFA 1L5ZA 2RAFA 3BGVA 3JALA 2X40A 2ZYGA 3V8EA 3LCJA 3VZQA 1MN6A 2WIKA 3A6LA 5T67A 4HNAA 3T3OA 2I22A 4J29A 2WFLB 3FAKA 2J0QA 1P0QA 1GT6A 3I73A 1T6ZA 4D0GA 4E14A 4YRPA 5BWMA 1JFFA 1F4LA 3G5MA 3JS5A 4I1UA 4O2AF 4UHFA 3U7QA 5CLFA 3GLFA 4OBEA 5HSGA 3NGXA 9LDBA 5FQOA 2FJPA 3TZKA 2N3ZA 2DLNA 1CEQA 1AGRA 4GPAA 2BTQB 2GN8A 5TEVA 3ZXIA 1EK6A 1G64A 2IPAB 3BCUA 3L0YA 4QOSA 1IQUA 4EWLA 4GT1A 1U8EA 2R5FA 3EARA 3LUJA 4FYYA 1LLUA 1ZYUA 3W2GA 3IMKA 3OZDA 3JWHA 1PR0A 2V1XA 2KJQA 5H5JA 3A1TA 3L0CA 1W0JD 2DUNA 2LIVA 3BAZA 1Y5LA 4A8JA 4X24A 3KQUA 1Q0LA 1TOAA 2OESA 3DHWC 1B74A 2WUVA 2AN3A 1LJUA 1DHTA 5A4FS 4A0GA 5KTKA 1Z7WA 4PNHA 4MYSA 4EYOA 4GVXA 3W5HA 4K7JA 4X1OA 1GG2A 3I9V6 3UK0A 2DCMA 3I5MA 4KSCA 1CDZA 4Y6OA 3UZUA 3ZPXA 2R3SA 1RM4A 5KVCA 1DNPA 1T5OA 1WMAA 4LHEA 4PCLA 5DYNA 4DJ5X 1HFKA 3N6RA 1M1ZA 3JRWA 1XZMA 1T1IA 2JBHA 2PX4A 5CTJA 3UGQA 5SZKB 1JAIA 1VLLA 2P30A 2Q6LA 3KVYA 3MTAA 3QG5A 4CMCA 1KFKB 5AQ1A 3PIDA 5DIFA 1UADA 3NBAA 2GLXA 4ZVRA 2G5TA 4X1KB 5JNSA 3WGGA 3ZV5A 4HQ0A 2WVGA 1BH6A 4HMQA 3UBMA 2XMGA 2BE7A 1UOEA 1TJPB 8OHMA 1OW3B 2ZR7A 1XPOA 1IPFA 5JRJA 1GQYA 4YALA 2WPNA 4GSYA 2PGXA 5EJ9A 3O3MB 1T0JB 1IUNA 2JDIA 2FR8C 1QWSA 1CT9A 4JT8A 1EZ4A 5SY9A 1NYTA 2NNLD 4MR7A 4BNHA 1ZUHA 4EPTA 5EVCA 4FEAA 2JEOA 4BNJA 5TNXA 2RGAA 4LHYA 1AH2A 1GR1A 3PD7A 4DUGA 1H3FA 2WJHA 1BC5A 1BXZA 2FZKA 3JATB 4MEBA 4DYVA 4E32A 5AVKA 5JZSA 1L7VC 2PUDA 1V1MA 2NU7A 5FI0B 1DQPA 1GFSA 1KYIA 1TM1E 3L6BA 3WGNA 1NHMA 3P45A 5TVKA 4C2UA 1WKBA 4LOKA 4S3MA 1O94D 2QRNA 3EPJA 1YCFA 3WADA 4YIKA 1QJCA 2FMXA 1FJ2A 3WRYC 2OE2A 3PIIA 3MD9A 3ESZA 4Q7EA 2O8EB 3T7RA 1OFVA 5CLQA 1ZD3A 5TQ2B 4AZ3A 2DPLA 5F78A 2QN8A 1R66A 1P7ZA 2EERA 2BPOA 1N75A 4HB0A 2JI4A 3UXMA 1WD5A 5DIZA 3GLVA 2WI8A 4YMWA 1CP3A 3KQYA 1V9CA 2FX2A 2ZJYA 3NHFA 1N1EA 5CFZA 4O4HB 1B6SA 3SDSA 3GGGA 3JQAD 1JJBA 1GZ6A 2VK1A 3VKGA 3EGOA 4CG3A 1NOKA 4ABTA 2OO5C 3NT4A 3BKXA 4I2NA 4P0TA 1B7GO 3ADBA 1U7WA 4QODA 1QQTA 2WKRA 3A3OA 3EDQA 2P4QA 2CCJA 1B8NA 2F3PA 3QY0A 4REQA 2X6QA 5CX4A 2Z4RA 3U7EB 1L8YA 3KB8A 2W00A 4AW9A 3DGEC 1LNZA 2WWVD 4EYSA 1ILWA 2CNNA 4A5OA 4U2GA 3TM4A 1ZGCA 4ZZ1A 2IEGA 2OGZA 3AGPA 1UDWA 4H7PA 2I7DA 4B82A 4Q9DA 1H1TA 2MOKA 4JI7B 5DNEA 3DG9A 1N9GB 3SYLA 4X8OA 3LLVA 1OTYA 3F4KA 4FC7A 4ZPXA 5KDOA 2BBWA 1KPIA 5K6RA 2JIOA 3NBZC 3L0DA 2YYAA 1OUMA 2BFFA 3W5BA 2MJLA 5IAGA 4MVJP 4X1KA 2A5JA 2Z8ZA 3K9QO 3GJRA 3WJAA 4M7WA 4DCJA 2WJ4A 4GM4A 1YBAA 1DO2A 5I9BA 4L0MA 3DEZA 2HF8A 4MV0A 1J49A 4CKYA 4X7BA 1H22A 1II8B 2XTZA 3LYHA 2GK7A 2J9XB 1ADBA 4IOKA 3NKFA 2F8LA 2VQ3A 2FUKA 3C8HA 1E5VA 1GVNB 5H81A 4R40A 3T5CA 3UFXB 4BTEA 1Y4SA 1Y5NA 5ALNA 1XHEA 1LQUA 1DTWA 1EFDN 1MU0A 4EAQA 1CY1A 4R2IA 1YS7A 3U4HA 1ILEA 2PUGA 2D8MA 4D45A 1S02A 1Y3CE 2AUMA 3PI7A 4AMYA 1JDPA 5KPJA 4NCJA 5SICE 1COZA 2H1HA 4M89A 2QRGA 2WVJA 3AETA 2G5PA 2EATA 3CUSA 4UEWA 4V0RA 1ISHA 4S1TA 2ZATA 4KRYA 3UT6A 3WBFA 5B1HA 5JSYA 1U8YA 1NYLA 4TTAA 4EUHA 1YV9A 3OZVA 4C3VA 4XB6B 4ZCQA 2R5NA 2V59A 1YS1X 7REQA 1L7DA 4IMRA 5DLYA 2JKYA 4LJRA 2CLKB 5L45A 3C3AA 4L5CA 2ZRGA 3MN1A 5HQ3B 4G0WA 1L5RA 3OIFA 4OFXA 3W5DA 3T0IA 2PSJA 1XMSA 3I5UA 1WW2A 4NRDA 1J2RA 1O6ZA 1WPGA 3EIEA 2FA9A 3QF4B 1JLLA 3K35A 3OIWA 5GOZA 3U26A 3LBHA 3RTBA 1D0VA 3T1VA 5L6MB 1YZVA 1E0KA 1T9AA 1ULBA 2O0MA 2XB4A 4JJGA 3RS7A 4B48A 4DLPA 5B12A 1TAHA 4UBJA 2FN7A 5AW5A 3STTA 1KQFA 1EKXA 2DFLA 2JZOA 3GMTA 1AKQA 1WO8A 1ZD4A 4G1MB 4TTSA 5GJWC 4KG7A 1BX3A 5L9AA 1N2CE 1Y3HA 2C78A 2G9QA 4FPXA 5C8YA 4BTVA 4MWGA 4E15A 2LWIA 1MUUA 3RS5A 3M5PA 2ZRMA 1UM9B 4P3KA 2MYUA 5CK5A 5I9IA 5KOHA 1NC3A 4YAEA 2V3WA 4QAQA 2DBQA 1E58A 1SKYB 3M4XA 4RHFA 1JDSA 4O6VA 1ZOIA 2Z6AA 1HDGO 4JLOA 3BWVA 1X14A 1GTZA 4D4HA 5CA0B 3NCTA 1QAOA 2NPIA 5M29A 1EAMA 1DI0A 5EHXA 2C8LA 1H2ZA 4M1WA 3GP5A 4BJ5A 4AM8A 2D13A 1VKJA 4IDFA 3F8WA 3RTAA 3HJAA 4AJIA 5JANA 3CT4A 3K5HA 1WHSA 3U81A 1LBQA 2XNCA 3EXG2 3OURA 2AFIE 2X41A 4R05A 4CHGA 1P2VA 1NP6A 2FSVC 2J3KA 3GZ4A 4UVDA 1YDFA 2QTZA 5ALPA 3T1NA 4GBJA 2EFJA 3NVKI 2GXQA 1TW2A 2Z1NA 3B13B 5DI3B 3ESRA 3WGMA 1D6MA 4C06A 1MFPA 4AN0A 2PZGA 3HXMA 1GLVA 1P5JA 4ND2A 5CD1A 1FRVA 3N2ZB 4UE6A 3A2NA 4DC1A 3WIOA 2F3UA 4M46A 5A4AA 2AGVA 4AVYA 1J47A 1T5BA 4YP9A 4ROTA 3LO8A 3ER6A 2J3IA 4YRMA 1L5HA 3N2GB 2J8ZA 5KNBD 3CNNA 4CODB 5TMBA 3VM6A 1W0JA 1VKOA 4E0BA 4KK4A 1HSZA 2V98A 4KQGA 4R5MA 3ZDDA 2CJXA 2QD4A 1JKXA 5HFNA 1JTVA 1RHJA 4ZT7A 1C4XA 1T2EA 1A9QA 2XVMA 5FUBA 3L8ZA 3UF0A 1I51A 3U7RA 3WDSA 1L4EA 2G88A 4C14A 1R4NB 2GCGA 2HEGA 1O4VA 1UJ5A 2YVKA 2V6JA 3DLHA 3EWSA 4US1R 5C51B 4HDNB 2B1JA 1EWRA 5EXTA 2TMKA 3KSUA 3UW1A 5A0VA 3KD2A 3NHAA 1U2QA 3V1LA 4KE7A 3K9NA 4X92A 3AM3A 5DTJA 3E3LA 1F3LA 1QB7A 5FQNA 2JJ8A 5SZIA 3DKVA 3SJCA 4D2IA 4DLZA 5G1PA 3DXYA 4GP7A 4GWLA 1UJ6A 2OZKA 1G2QA 1UFRA 3I05A 4FD3A 4OQXA 3HUEA 3B60A 1FQOA 1CR2A 1EB8A 2IYPA 4JP2A 3NC4A 3OCXA 1QK3A 3WLEA 1Y0BA 1M9NA 2AOTB 2PWZA 2EW1A 3ONEA 5DM70 3RAFC 3KFVA 4OBWA 3VDNB 3ESQA 3UCFA 2CJFA 4BV9A 1ICIA 3HCRA 2M1ZA 2OPHA 1J9GA 3UMFA 1EQUA 4ZDWA 1G6Q1 1UC4B 2IQ5A 1Z73A 5JXGA 1AK1A 4L74A 1B8PA 1Y6GA 2Z30A 2KB0A 2MDTA 1E1NA 2KBEA 4IO1A 4I2VA 5D86A 3SBEA 4DNQA 3U1BA 3RYIA 2OV3A 4L9AA 3CG0A 1JYFA 3PNYA 4LFAB 4O4LA 4XEHA 1XBTA 2QK4A 1HI9A 2YHIB 2WU4A 2A9KA 4QSMA 1VYUA 4Q93A 4QICA 5P21A 4E3WA 1IBCA 5C4MA 1SURA 3W79A 4JI2B 3DT6A 1JT9A 2IYWA 2NZYA 4DG9A 1BCRB 1IN1A 4A1OA 2QJTA 2ZSIA 3HFJA 4OQ4A 3G49A 3U2QA 4MR7B 5HKLA 4L28A 1KQOA 4CMGA 1G0NA 1REQA 1KJQA 1RLIA 3MWEA 3U49A 2A3RA 5B4TA 1O6CA 3N7AA 4WL0A 5LQJA 1L4BA 1YASA 3PGVA 4FGUA 3T7IA 2NVWA 2HCRA 3VH4A 4M0KA 4DNOA 4P0QB 2WFMA 1EUCA 1U80A 3ETHA 5H3CA 3TXAA 3A8TA 4PQGA 4Z7NB 5AM1A 1ZVKA 3W2EA 4GOLD 1SUWA 2PL1A 4G0PA 2RG7A 4GVPA 4B8ZA 5C5DA 1OX5A 4UARA 2PWAA 1RRFA 1J70A 4P7BA 3MQFA 1ZJ5A 3PBKA 1UBSB 5HE9A 3ZXSA 3O8BA 2F3RA 4YMSA 2W6PA 1J8YF 3JZIA 1BEZA 2WFLA 3FWPA 1EEXB 3AL2A 1I36A 4I4TB 3TI9A 3O4GA 3VNVA 3ZDEA 5JBQA 4DIFA 2B8TA 2H1RA 2XDQB 3U0VA 4BEJA 3WVNA 5JS6A 3E1SA 3QXSA 1Y1KE 3EB9A 3GROA 3U56A 1PLLA 5L7WA 2OV2A 1KI6A 1DKLA 1P1BA 3K8YA 4RENA 4BHTA 1M1UA 1AXGA 2CVQA 3NH6A 4RD2A 3ZIDA 4DFDA 2WABA 1A9XB 1JEYA 2RI1A 2I3ZA 3O8LA 3DOIA 4JROA 2V5UA 3FZNA 2ZBFA 1IM5A 3MM4A 4JX9A 4R1PA 5EJ7A 1M1NB 5J1SB 1U8TA 2VPXA 3LCRA 3PV0A 3KOWA 2PJZA 3HZZA 1UWCA 2MSLA 2ZRNA 1FLDA 1OD6A 4LC0A 3TKYA 2OQRA 2P9YA 2O8CA 2REQB 4H6VA 1YR1A 2CXPA 3KBBA 4P4UA 3LUPA 4PYKA 1PFQA 4DLTA 3CLTD 5EVJA 4HUJA 2VDUE 2D5LA 4BFLA 3VYUB 3OESA 5JO0A 1ZFNA 3QNWA 3H5IA 5BSKA 1VFPA 2IF2A 4KQHA 4PS0A 2FRDC 4DYDA 3KLNA 2FPGA 2C31A 4QNRA 5C52B 1M6HA 3C4JA 3DQPA 3FE2A 3MK31 3G9UA 2QA5A 2GCIA 3ZDRA 2AG0A 3GVIA 1OILA 2ZB3A 1N8SA 3SBXA 8ATCA 3QKIA 4AY4A 3EGDB 1JHRA 1FF9A 1E1QD 2NNWB 4PLZA 1FP2A 2QQ0A 4QREA 1XCBA 5U9CA 1GPYA 4ZI7F 5CB4F 5FUYA 1L7AA 1TJNA 5FBQB 4BKQA 3QVTA 4FM9A 4F6RB 2AQ8A 3C6QA 1PRYA 1VECA 4JL5A 2GZMA 3JQGB 2PE5A 2ANCA 3VYSB 5KI6A 4U02A 1TM7E 4F5ZA 1PJCA 4EHBA 3JCZA 5JPDA 1BQ4A 3DBHA 1H0HA 2NSHA 2ZU6A 5A05A 1W0KA 1SY7A 3HJTA 2HSJA 2Z8YA 3GA7A 1XTZA 1EJ6A 3I61A 1HTTA 2WVAA 2IYAA 1QO7A 2J7PA 1VGVA 4NG4A 3T1TA 4NPAA 3NYRA 2ONJA 3U3ZA 4HV4A 2QNIA 1AKTA 2CMGA 3HEBA 3SJZA 4KNYA 3VZDA 2WJ6A 4EJSC 2QX8A 4F5DA 4IVNA 4MLDA 3HNPA 3PNMA 1Z7YA 1CVIA 1R4MB 4D8WA 4TTTS 3TOZA 4U2BA 3FM9A 3CVWA 3RBXA 2VJBA 1G6HA 1R6UA 1VFNA 3LHSA 3X1MA 1AOXA 4KJXA 4HGQA 4N54A 1PJ4A 4LJSA 1PGJA 1VJTA 4RSHA 2CLHB 4TV9A 1YS4A 2GZ1A 2GAOA 2L18A 5DWQA 4CETA 2C20A 2W4MA 4B9AA 2FP3A 1BOFA 4CQMB 2XVXA 3QVVA 2ECPA 1J09A 2ZI7A 1SHTX 1UXGA 1VBKA 1TC1A 2IXAA 2OHFA 2V74B 2G0AA 4ALKA 1VP9A 4UAVA 1ANKA 2PYIA 1ESMA 4WEQA 4ZT2A 2R47A 2FW1A 1L8ZA 3D3WA 5BSGA 4B6JA 2GRJA 4DC0A 3FPGA 2X5KO 3DP7A 3NJRA 4PQFA 5C7LO 3BWCA 5JJBA 3L7BA 3ZIUA 2N9UA 3NLLA 2ZWPA 1BD3A 4OLHA 1KFBB 5D6NA 3VU1A 2C1EA 4F1KA 4XJVA 2PSEA 1ZRNA 4AWBA 4GMHA 4FOTA 3LT4A 4GPBA 2P1RA 4ZDIA 3BXHA 2E5WA 4E2ZA 4FYPA 1E9RA 3GCWA 4NYJR 1GYPA 3HA5A 5T4EA 4EG6A 4QARA 3ROPA 2X4IA 3EEIA 3TIXB 5H82A 3E4CA 4EG3A 1PHRA 1RT9A 2CHUA 2I4IA 1O0SA 3RK1A 4ASUA 2ZW9A 2QPTA 3R6DA 2VF5X 2PAFA 4ZO6A 1VB5A 2PD3A 4YRDA 1DBIA 5CAEB 1BWSA 3FNIA 4EP1A 2WKQA 4H16A 5EMLA 2O8EA 1AS2A 1DC6A 3P19A 2PV7A 2ZSUA 2A7QA 2P9QA 4M1QA 3BEDA 5CX1B 5C1IA 5BP7A 1BRTA 4CKWA 1QPZA 1XWIA 2PS9A 5MF6A 3F3KA 4S12A 3R77A 4EM6A 2ZAMA 2OFFA 4JA2A 2A35A 5LMUB 1WX1A 4G4JA 4I5GA 1DX9A 2JLSA 1OLXA 4B5LA 1OXSC 3A36A 1A04A 2ASEA 3CE9A 3Q7EA 4GOOD 4MS1A 3PCTA 4KQIA 5L95A 1JWAB 3BWMA 3KKLA 3TDMA 4DIKA 3ZJYA