3ABSB

Crystal structure of ethanolamine ammonia-lyase from escherichia coli complexed with adeninylpentylcobalamin and ethanolamine
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
252
structure length
252
Chain Sequence
ALDLGSAEAKAWIGVENPHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGLLEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEEILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSCYAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ethanolamine ammonia-lyase heavy chain
publication title Crystal structures of ethanolamine ammonia-lyase complexed with coenzyme B12 analogs and substrates.
pubmed doi rcsb
source organism Escherichia coli
total genus 74
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature ec 4.3.1.7: Ethanolamine ammonia-lyase.
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05985 EutC Ethanolamine ammonia-lyase light chain (EutC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.30.40 Mainly Alpha Orthogonal Bundle DNA Binding (I), subunit A DNA Binding (I), subunit A 3absB01
3.40.50.11240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3absB02
3ABRB 3ABSB 3ABOB 3AO0B 3ABQB 3ANYB
chains in the Genus database with same CATH superfamily
4G4IA 1IPHA 1Z06A 4XCVA 1KZYC 1L4KA 1OJLA 5DNEA 3UB4A 4ASUA 1JU3A 4HZUA 3TLGB 2OORA 3I2IA 5J4VA 3FCOA 2G6TA 5LL6P 1H8HD 2BTQA 2BE9A 1G21A 2XXBA 2Z2YA 4PLZA 1DKMA 3E5NA 4A6DA 3ACCA 3CUEF 1EAMA 4LF5B 4L16A 2FMHA 1VM6A 3HSYA 4OLHA 2Q46A 2Q5QA 4IJVA 4BYGA 5HSGA 1A96A 1DIHA 2QSJA 1D6NA 1WCIB 5EPEA 5EUMA 5CCXA 3HJAA 4R8LA 4BN5A 2MSCB 3KJFA 4A4DA 1QLWA 4HMOA 3U81A 4A2WA 1QG0A 3QXXA 3GFRA 4LDZA 3G0IA 3TDKA 5DHSA 3KZVA 4GLFA 1G66A 2VHXA 4L75A 1MQ9A 2FG7C 4LRUA 4J91A 4QOJA 4F93B 4G1BA 2IPXA 4PEVA 2FSVC 1EVEA 3GP3A 4ZOLF 2R5WA 3H7AA 2EIXA 1SKYB 2YVAA 2F17A 4IGFA 4BO7A 1NZJA 1E66A 5HQ3B 5ICFA 2QRJA 3PQ7A 5B1EA 4OQ4A 3RIMA 3UAYA 1FQKA 3ZCPA 1UJ5A 2VH5R 2FEKA 4DMMA 4G0QA 2JLXA 3ON5A 1GXSB 1JMYA 1FTGA 2PS9A 3RVKA 3WWCA 1FFXB 3NTQA 3B82A 1WZUA 1XB2A 2IZZA 2JGIA 3KVVA 4LMPA 2PLWA 3N39C 3OPNA 1XTIA 4BP3A 2QBYB 1W4RA 3I92A 4HPJB 3BIFA 3O4RA 1THMA 4QRIA 3ZLBA 4MRMB 2G5PA 2X1HA 3W1EA 1G6Q1 4O25A 3WIBA 1KS9A 1RAHA 4MRSA 1U1DA 2PGNA 1VIYA 4ER0A 5CXUA 5FV4A 4QHSA 4TVOA 2FW6A 1FFSA 3NOVA 5EXEA 4ETWA 1JG2A 4D42A 3KX2A 2ZIXB 3MF4A 3DZGA 4Q1DA 4P84A 5C7IO 2YVLA 3HLKA 5JNSA 2BFWA 5ITWA 5KTMA 4IO0A 1KQ3A 3MBOA 1QTQA 2C0QA 4E11A 2P6PA 2ECOA 5TJ9A 5AW1A 4LGYA 1NBIA 2ACWA 4JLSA 1DEXA 3QVXA 4INPA 5EJ5A 2CHQA 4N5MA 4O02B 3T3MB 5LP6B 5D6NA 1Y7TA 1C9JA 1EWKA 4GE0A 1OIVA 4KL8S 4GLJA 4UHHA 4JB3A 5CGQB 3X2EA 4QM6A 3T7CA 5H4GA 3VR4A 1T9DA 4H9GA 4M38A 3EWAA 1N6IA 1RLTA 4Y1GA 3K9LA 2GEFA 3OG9A 3RG8A 1LW6E 1UZAA 3SG0A 4YT4A 2JLQA 3U9LA 1MKYA 4X61A 3F5DA 4MQFA 1OZGA 4FFVA 1WZ2A 4CPDA 4MKFA 1GL9B 2HRCA 3A3PA 3EIOA 4PS1A 3DYBA 4EI2A 5KREA 1G4HA 5BY2A 4D4IA 3SM3A 5IUNC 2Q0SA 3DCYA 1FDUA 2JVJA 3LCRA 5FPYA 2OHXA 4QPNA 1CQWA 1TAHA 1LJUA 1CJBA 4RAOA 1JHXA 4H0CA 2BR5A 1YHZA 3M8KA 4JEMA 1T2DA 4FMCF 2XT6A 4OV6B 3UK1A 4AMGA 4JLJA 5BVGA 3NBUA 5DMHA 1SFRA 2GB4A 4FLMA 3WX0A 2AQHA 1PZNA 2NZ2A 3FZQA 3HWX1 4EYSA 3SIWA 1C3JA 2DF8A 1M1NB 4E22A 2EZ9A 2O07A 2P1ZA 4WVLA 3DO6A 1FBNA 1YB5A 3C3DA 2ZAMA 4KZPA 1ZKDA 3QKUA 3I9MA 3M4ZA 3R0ZA 2Z2IA 4M0FA 3TH5A 2W98A 2JFUA 1Z13A 5A4JA 1YRQA 4LJ9A 5KSWB 1UKYA 1TJ3A 4TMTA 1RYFA 1UBRS 4FNMA 2Q3CA 2X8JB 1RI4A 3IR6A 1L7OA 1EFRA 1PF7E 2JKZA 1NU8A 4TV9B 4CT5A 3D6NB 1CT9A 3X1YA 2ZZMA 3RVRA 3KYDB 3OQIA 4L95C 4E33A 2C88A 1C4WA 1MX1A 1V8OA 2QRPA 1ECPA 3C8HA 1JHUA 4BMNA 1CRLA 3L6UA 1VA4A 4XYGA 1HH4A 1ZD1A 2VDKB 3MYRA 1RYNA 2DU8A 2XOEA 4MA0A 4MPTA 1ORIA 5CM9C 3TWOA 1PQUA 4CM4B 1I9CA 1XL1A 5KYUA 2Y8EA 1XKQA 1Y9EA 2VXCA 2Z3WA 3TFOA 3K4PA 2X5JO 4NWIA 3ZVMA 5ICMA 3NCHA 4MWZA 4RJ2A 1ULTA 2H07A 2QRVA 3HFGA 3FDFA 3CVYA 5K0SA 3P0RA 3PT9A 1H6DA 1A9RA 1H2BA 3CPHA 3NEAA 3HCPA 4XGQA 3T9EA 3ZI0A 4DM4A 2B69A 2WAOA 4G09A 2HPZA 4XH9B 2PLRA 4B09A 3H19A 3IT2A 2FPWA 1VB3A 3FCCA 2RHOA 3LI2A 1CVRA 5KYXA 1BVYF 2JJ2A 3LBYA 5LOVF 3R9XA 3RYFA 3PFBA 1IE3A 1L5MA 1XXHB 3D8HA 4LOIA 2EKQA 3QXJA 4RJLA 1EWTA 2B1QA 2E82A 5BNTA 2AG5A 3OQPA 4MB6A 1TFUA 1SEPA 4G37A 4CR6A 3WMXA 4BQEA 3WO0A 5D87A 4AS3A 4XTRA 3A2NA 1CR6A 4PN3A 1ZA1A 2JIQA 4KX3A 4NU8X 1GU1A 3IR7A 4JJ7A 4Q7MB 1Q3KA 4HQ6A 4HMQA 5BWOA 2EARA 4UBJA 4JL6A 3GJ8A 4MTLA 1U2TA 2OQVA 2H08A 4X6UA 1TC2A 2BFCB 4XIGS 1VSTA 2ZUDA 1L0BA 3GVXA 4K9DA 4EQ6B 1CUHA 1MG5A 2VK1A 1R0XA 3DE6X 4Q9DA 1OBFO 3AB8A 3LL4A 4G0XA 4S35A 5E9AA 4ZDWA 3QUSA 1S4MA 4ZT7A 2NT4A 3BIWA 1WB4A 3NTLA 3QMMA 4HDNA 4XEHA 4E5DA 3D59A 3N2KB 4EMUA 5KB3A 1T5IA 4EHBA 3IT0A 4DDUA 3KETA 1E79D 4IQ8A 5FLXA 1S2OA 2ARKA 2AWNA 2PX4A 3KQVA 3S7ZA 1OFVA 2I3BA 1EA5A 1OC2A 1PEYA 2BFAA 4IX1A 1E2MA 5ARCA 3WB0A 4XWWA 2DPLA 3G23A 1V1RA 2WA2A 4BFTA 2R7NA 4UZFA 4JK3A 3ZIAD 3C85A 4FZVA 2IU4A 4JP8A 4KLAA 4HB0A 1T3GA 1T0PA 2P9JA 3G0GA 3LLMA 5ELLA 1QGED 121PA 5TRTA 3EC1A 3CB4A 3O74A 5COAA 3C14C 3H9EO 3W7BA 1QQBA 2RBKA 3C3EA 3HFSA 4E15A 1TF5A 2QVBA 2VZ9A 4W8HA 3LHFA 3ABRB 1N5KA 3LU1A 1XWIA 2ZCVA 4PZCA 4RS4A 3FWHA 5IBRA 2X0EA 3VHLB 1CRWG 2O8CB 1FP4A 5A5GA 4UQPA 4C0QC 1M0WA 5ALFA 3DHNA 2IPLA 1NA5A 3KSMA 3IBSA 4ZI2A 1YRWA 3SQXA 1ZSYA 4HPWA 5AESA 3IL2A 1NSFA 2PMDA 1AHHA 3C98A 3HVRA 2QI9F 2B0CA 4K6HA 1CZLA 4OYHA 4RVSA 4Z0NA 2W42A 3V9PA 1RXYA 4HB3A 3NHWA 1SXJA 1WMEA 4V0NA 2XR1A 2BWJA 1ESNA 4MZDA 1XHFA 5E6SB 3K9FC 1DBRA 16PKA 3LF2A 2NG1A 2AFHB 1ILWA 3RFXA 1XTBA 3EXIB 5A9SB 5JUWA 1M54A 4QBGB 5HKLA 3K9WA 3SMQA 2ZG6A 3G8AA 3TEMA 3QQ5A 5JG7A 2X0KA 3U7GA 3CNQS 1S01A 4JIGA 3R9WA 2HLNA 3IRUA 1IBMB 2G4VA 4X44A 2Z4SA 4FYIA 1MDFA 5EJGA 2HCFA 4D9GA 2Q6LA 3JRNA 4CF4A 4A36A 1XZHA 2ODWA 5EIAA 3FF1A 1N7HA 1WRBA 1XZPA 2ZRDA 3H5NA 5C8ZA 2NPOA 5HUQA 4LDNA 2G1UA 4FMPA 5EL0A 4QTUB 4FYPA 2VSQA 3D1VA 4G1VA 2ZR0A 3HUDA 1G1MA 3EDOA 3QEMB 4XKJA 5AH0A 2NU9B 2FW0A 1NUAA 2FWPA 4CM7A 1R5JA 2G72A 1TZ2A 2I62A 3D8RA 2Z1MA 2PXCA 3I37X 3OZXA 4MROA 4Y6OA 3LGSA 5HKOA 1HSZA 3OE7D 1PHPA 5C7LO 1M0EA 3KB1A 5T64A 4X65B 1VQ1A 4WQMA 3AR8A 3UMSA 1CEQA 1Z82A 3AK4A 4KWTA 1JQLB 1C7FA 1PSZA 1PQ4A 3QX8A 4Y7DA 1BS1A 4Z8XA 2WYWA 1SUWA 1W0KA 1UXJA 1JG6A 2J3IA 4EZBA 4B3HA 1H93A 3AM3A 3M5WA 3RFTA 2ZRBA 3AW8A 2IXEA 2PWAA 1GY8A 4J6FA 2BFBA 1Y8CA 3WRXC 4AJJA 4X54A 2PAAA 3OLZA 5ENVA 1GRCA 3HDYA 1Z3CA 4Q4JB 3WGYA 4EHJA 3FFBA 1LJ8A 2GYUA 4BNLA 4ZTUB 4BEWA 4Z6KA 5AD1A 4B40A 3QPCA 2XQFA 2ENWA 4RVNA 1V43A 2ASEA 5E1OA 1TVCA 1XQ6A 2D1RA 3DKIA 1U0FA 1U8EA 1UP6A 1UBCA 3M1YA 1W5TA 3UFXB 2I71A 4KLNA 4RHXA 5FADA 5ITSA 4ZVLA 2PV0A 3UOAB 5KO2A 3T9AA 3RUDA 3GD5A 1OFGA 1R10A 3HY4A 4KOAA 3W3AA 4DYDA 4X90A 3EQ8A 3CX6A 1JDZA 4Z1MD 2I7VA 2QJFA 3KSZO 1UKVY 2WMOB 4IDDA 3WNZA 3HA2A 4IDBA 3QJ5A 5C5CA 4FE4A 4X6LA 3W6UA 1AA9A 1L7AA 2GSDA 3EQ9A 4KXUA 3EH1A 4HL6A 5J47A 1U63A 2PBFA 1IY0A 1MX3A 3KEMA 2WTNA 3NT5A 1TM5E 1CXZA 3KWJA 4Q9IA 5CGZA 1T9AA 3A4MA 5HF8A 1GYPA 1MJNA 2J87A 4TN1A 2WTUA 4P4GA 3R1IA 4JVNA 2AJCA 1R8SA 2E4UA 3U4MA 4H60A 4G8DA 2BGMA 4FN4A 4EZIA 1YE5A 2PQ6A 2ZE7A 4N54A 1JHDA 2HQRA 1EBUA 2OGSA 2VUTA 3SYRA 5CFMA 1QRDA 4D9MA 1OXUA 2NOAA 4ZODA 3QBVA 4ZYWA 5LQDA 1GTRA 2ONCA 3PNQA 3Q0EA 1SOVA 5JO9A 4K26A 5EJ4A 2ZRQA 2A35A 3WL6A 2FQXA 2RJOA 2DPGA 1KK3A 2NZ8A 2XCRB 3ZCTA 1L6RA 4FYMA 5ALXA 3ZCVA 1B16A 1ND6A 1VLQA 1VYUA 2B3TA 2VKQA 3EZYA 3EZFA 4G5SA 1Y1RA 5IW8A 5CB4B 2D1FA 3EVBA 1QF6A 2LE4A 1XDSA 4JJGA 4BE9A 4PYKA 1OH6A 2DR2A 1F12A 3F1LA 1CQJA 3TTSA 3ZLVA 2Q2QA 3MQFA 3A6ZA 1ODJA 2R60A 4XWOA 3CPEA 4RORA 3D6HA 2J3LA 5H82A 3B9PA 3K9NA 1OASA 1JFVA 2V6GA 3RG2A 5CVDA 1N5IA 1OLUA 1YRHA 1W2WB 2QS9A 3RLIA 1S3GA 1MRNA 1U6KA 5IG2A 1P0QA 2C1XA 1BDIA 2J3KA 2RH5A 2VATA 2ZQYA 1VHWA 1MAUA 2B7LA 3N0WA 4C3VA 5DNUA 4OXNA 3NKVA 3HDVA 4IDQA 4DIKA 3U9SA 1DNPA 3N5CA 1MORA 4GIBA 5MFPA 4ESEA 4M1ZA 1BVRA 1HMPA 4OGGA 3LYUA 1SKUA 3UAXA 4WJLA 4ASUD 1R0CA 5LP6F 3VNUA 3NHRA 4OPMA 1PFGA 1LD3A 4MPJA 3VV2A 5LWHA 3AEYA 2O20A 1UFKA 2EFJA 4BO9A 1PLLA 4Q3LA 3FYCA 3TL3A 4E1AA 1L5HB 1IWOA 1ODKA 2HSZA 1NVUQ 4JL8A 2Y1KA 2HDHA 3OC0A 3ER9A 3COJA 3GAAA 5TEWA 2GFHA 2ZSEA 3CZPA 2F1KA 1KIAA 4QUJA 2C9OA 3WLMA 2AD1A 3ZXUB 1ONBA 3LQKA 4QGSA 3PCTA 4XVCA 4CMIA 2B8WA 4KQIA 2C5SA 3FLAA 4R1PA 1HMEA 4CM5A 2VYNA 3HFJA 3JQCA 3R24A 2DHEA 4RKYA 2P7IA 1T13A 1KEUA 4F9EA 5CTAA 1KRXA 1XO1A 5MDHA 5MN5A 1PWHA 3KXLA 4AQ7A 2V7WA 3SYNA 4XASA 1Z88A 4L5CA 5B3JC 1TIPA 3K0BA 4X8MA 1GJRA 1RRVA 3PE4A 2J3EA 1YOVA 5FP0A 2ATCA 2IHJA 5DGIA 1GAEO 2A1TS 2WBLC 5F3RA 5ADHA 1AGRA 3HE3A 1QDUA 2D1YA 2NUPB 1P44A 4S2QD 5K3OA 3IURA 2GN4A 2YVUA 1XE3A 2F3UA 2REQB 3JD3A 4C4PA 1X8JA 3BL5A 4FHZA 5H70A 4P0PB 1ZH8A 2HSDA 3HYRA 3RSLA 4RM2A 2HWUA 3NV9A 1XLTA 3NYRA 4BVGA 1KEKA 1K4MA 5L4NA 2EQBA 5CDHA 5IDXA 4NKRA 4CODB 3PQCA 3AUUA 3L1IA 4TV9F 4F04A 1Q92A 1WAMA 1YS9A 3K0FB 4IP0A 2Q0HA 2E4AA 5IARA 1V6CA 1ICIA 5FBLB 2P11A 5CB8A 2W2LA 3NGXA 1T1IA 2CNWA 3C3KA 4MCIA 5FX2A 2WJHA 4HJXA 4XQGA 3AUSA 3FTCA 6REQA 3DDOA 4CMCA 5K20A 1BW9B 3FHLA 4JI4B 1X39A 3AVPA 5K6RA 2DR0A 1R4ZA 1ZA2A 1J90A 4WKCA 5JFOA 1OWMA 3GXBA 3EJWA 4F86A 1FQOA 2J3MA 4CKYA 1FYFA 2A58A 2QP9X 1LDYA 3B1VA 3JYOA 4EY8A 3KJHA 2RHTA 5JAQA 2CMKA 4KQGA 4DC0A 4PO8A 2PPVA 4LPKA 2X3YA 5HIJA 3IJRA 2PU5A 1PE0A 2IYYA 3MRSA 1KFJB 1OC4A 2D8MA 3KC2A 2WSIA 2Q3DA 1TTPB 3KE9A 4DMLA 4M1MA 4HEA6 3WRVA 2VH2A 3LKBA 4GM4A 1U8AA 4H3HB 1CUGA 1SRQA 3OWOA 3UK7A 4HZUB 1X7GA 4EMTA 4BN0A 5T4EA 2BTQB 2BN4A 3F90A 5J1TB 2OLEA 3FRHA 3DOUA 1FNDA 1X15A 4UU8A 4FMBB 3L7YA 4KUHA 2I7XA 5EKXA 1LDGA 1EXDA 1TYEB 1DRUA 4ZU6X 2GCPA 4GZLA 4N9QA 2ZLBA 3MERA 4G2NA 5HFJA 5EIHA 3CB2A 3F5QA 3ROKA 3UGQA 1QKKA 4LN1A 3NW9A 5TV2A 4YT2A 3MYYA 2BI8A 1WP4A 1XCPA 4ZT6A 1A0OA 5H3LA 2ZZKA 2O8NA 3LNTA 1J23A 1KDPA 3QLEA 4HX9A 4XYMA 3SE7A 5KWIA 3ADKA 4WX2B 4MA4A 3WLEA 2WUEA 5DWQA 5JT1A 4WVFA 1V1JA 4YCMA 4CRWB 3CX8A 3EUAA 3NWBA 4TLEA 5CVEA 1Y98A 2O2SA 3X1XA 5JRJA 1TIBA 1A4IA 3ZQKA 2VHUA 4LMAA 1NW5A 3GZTB 3VPHA 3I2HA 5G02A 1JLMA 3B3GA 3T38A 4CHTA 4LDAA 1I5RA 5BSFA 3MTJA 1E0SA 4CF5A 3U26A 1I80A 1BSVA 2PL1A 3MGGA 5FL3A 2OHFA 4UAVA 1QFYA 3O1HB 4QU0A 4UEQA 3VNRA 4IQ4A 3VSCA 5AW0A 2XE8A 2DLDA 5HFNA 3ZDYB 3UJHA 3NG1A 1VE9A 3VO1A 4C43A 2GM4A 1D0IA 3ZEAA 4DUYB 1YDEA 2B1RA 1LTQA 1M7GA 3IKLA 3U37A 4BECA 3K9BA 4XQ9A 4HWKA 3RHTA 3PNOA 3EEYA 3C3CA 3NXSA 4M0MA 1TCCA 1BDMA 4KXFB 3BFPA 1AO0A 4M0CA 4RPHA 2ZPAA 3TIVA 3L9WA 2G9RA 2YZNA 1C0EA 1QM5A 2GVZC 4P36A 2A0UA 4L57A 5SZHB 1XPRA 1J3CA 4F7DA 5IVPA 5HRAA 4G5RA 1E18A 2HRBA 1VE1A 3GRRA 3MHPA 1TEVA 2SKDA 1AGPA 2RGUA 5FCDA 4CG1A 1M34E 2IBTA 3PEWA 1MIHA 2XMRA 2HM7A 1RQLA 3CLUC 3N8KA 4LBYA 2PCLA 4O4JA 3RUPA 3AT1A 5EAIA 2BDTA 3STUA 1JL3A 1K8XB 4HX2A 2G9NA 2V7EA 1ISRA 3U3RA 1IIBA 1UJCA 5F33A 1DZ3A 1YBVA 1O6CA 5LZ9A 4M9SA 2O50A 3H11A 4YP7A 2EV9A 1SHZA 4R05A 3VR2A 3H84A 2OGWA 4MQFB 4ZT3A 2P4QA 4D96A 3L77A 4DA8A 5G0UA 5GJBA 1KP9A 1LDNA 3C41J 4WN3A 5HZMA 4J0FA 4BS9A 2GPYA 1Z2CA 1NUPA 1WZ6A 1T9KA 3DE4X 5M29A 4R2MA 1VLJA 2I2AA 1V6AA 4OI4A 4K2HA 5AOBA 1NV9A 1SNYA 1E2PA 4ME6A 3NATA 5CIWA 1IJKA 1U9IA 3UJ7A 4I9GA 4TTTS 3I4FA 4L6CA 2QL7A 4PFKA 3ANNA 2PL5A 5IH3A 1P7YA 1MEEA 1DAKA 2LGJA 2X15A 1OV6A 4YQYA 1JX6A 4CM9A 2FFQA 4GHWA 4EI7A 5EWMB 5JAHA 2HTFA 5M2QA 2VIIA 2OHVA 1UMCA 3DGFC 2VOEA 3OEHD 4BVBA 2PQ2A 2VJCA 4XM1A 4F6LA 2WG1A 4XB1A 2GSWA 4V2IA 1TO2E 3FYUB 3ZHOA 2H65A 2LCFA 1KL7A 3GJTA 4KTTE 3OQIB 5KTPA 3BMCA 2OOKA 3RRYA 1NATA 1N32B 4EI8A 2NU6A 5LQSA 4MIYA 3VOAA 1W6UA 1L5OA 2JHGA 4ZOCA 4B2YA 4BU0A 2CMDA 1IONA 1JIUA 3GLKA 5KYUB 3MHTA 2Q07A 1HQCA 1V3QE 3A1EA 1WXFA 3KOXA 4D44A 3WWOA 1BOOA 3PITA 1FP7A 5KU1A 4HWGA 1J42A 3RWBA 3H3JA 3UGTA 3VNQA 1FMCA 1PL7A 2BMJA 1FLDA 1PYDA 3GLHA 4UHEA 3ZKWA 2PUFA 4X3CA 2IV2X 4LF9B 1T0IA 2K2QB 2I03A 5KSZA 2VN8A 3CZ5A 4I81A 3V3KA 1NVXQ 4YMLA 2OK8A 3DE3X 3KHUA 1G0OA 1VG1A 2V7QA 3GGSA 2WTXA 4GXRA 5FWNA 2UUBB 2Z6AA 1C7IA 4DIFA 1E9RA 1S2IA 5EIBD 1QG2A 2QE6A 5FTJA 5AQ1A 3R9XB 1J8VA 3U13A 1R7RA 2Q1UA 3T06B 4U7HA 5DOZA 1O4WA 4EIWA 3W06A 3V33A 5F1YA 1F20A 4GE3A 1P1BA 4LY6A 2QM3A 3KLPX 5HILA 3RO7A 2P3SA 4RIGA 1G59A 5G3YA 3A0RB 1ZO8A 3GELA 4AZVA 1SIBE 2JHCA 2RGDA 3NV7A 1D2MA 3G13A 3RF7A 1MJGA 2D7DA 1GV1A 1AGNA 1T4GA 3J81k 1F0NA 4E4YA 1VJ1A 3WL5A 1NSTA 1GCGA 1NVDA 1UT5A 5DH9A 3LUAA 5I51A 3E18A 2HIGA 4M7PA 5DSZA 3RBVA 1WNFA 1OVGA 2P0AA 2FQYA 1ACJA 1V35A 4B44A 3P2MA 2EKDA 1EGVB 2WPDD 4D92A 2QTVA 3DLAA 3WWDA 1IXSB 3BXGA 2HN9A 3CJQA 2Z9BA 3ACBA 3I6IA 1E3MA 4EUNA 4F11A 2X14A 5L7YA 4P4SB 2I66A 3ZHXA 4E32A 5B7NA 5EIEA 1KI9A 1DEHA 4NMLA 2Y1LA 2BGUA 4ND3A 5LP6C 1KY3A 2H7YA 5TT1A 1ZJ6A 3B1JA 4MP8A 2XMSA 3U3MA 4Y2TA 2VT7A 3DEAA 2WQ7A 3KNZA 1WW2A 5DGHA 3TW8A 5HJ7A 4KLRA 3JWGA 2XUIA 1NHGA 2FPRA 4YMTA 4G6ZA 10MHA 2ZJBA 3SEZA 3LIPA 4XFKA 4L2IA 4RZSA 1SZDA 1KDZA 2ODTX 5CA1F 4IM7A 3WK9A 3JAKA 2A6PA 1NQ5A 2G8NA 2VCHA 3ZDRA 4D3SA 1IH8A 3MA0A 3E3MA 4LSWA 3TLYA 4KLZA 3PE3A 4QDJA 1YVPA 4GO1A 5FNVF 1FP4B 3SZMA 4L7VA 3ZY4A 1H1LA 9MHTA 3UHJA 1AS0A 4YQZA 3QP9A 1XEXA 3W3AD 1RFGE 2YZMA 4RF5A 4E4TA 3LIIA 5AKXA 1UC9A 3LSTA 1APBA 2N42A 3STWA 2PGJA 2QD3A 3G8CA 3R3YA 3VR5D 2YOGA 4RXMA 3E27A 4LOJA 1J2YA 1JSCA 3O4VA 3UHAA 4AZWA 1SXJB 3QHQA 4F84A 3M9XA 3CFYA 1ZESA 1CE8B 1IK4A 2BUCA 2DWOA 2PH1A 2XOKD 3JQAB 3E58A 5L40A 5CVUA 1JMKC 3DL4A 4YXWA 2X3UA 3VR3A 2GASA 4XXHA 2HW8A 3FE2A 4AJKA 3Q72A 4EB6A 3URKA 4D6XA 2FMFA 1W52X 5IUKC 1OLSA 1HSNA 2UVPA 4D3FA 4YUWA 1D8TA 2O7QA 4L5JA 1NRXA 5AI5A 3HN2A 4ZVVA 1MO4A 2WF9A 4OMCA 5AW3A 4UHKA 1NVEA 2ZB8A 4DCJA 2NUTA 1OZFA 1XDBA 4U02A 3QLUA 3P32A 5KNCH 1HXHA 5HR5A 3S5JA 4LZAA 3ZH9B 3G9UA 1PJQA 4A0QA 4LBZA 3SZUA 4HYEA 2JIOA 3ANTA 1FDVA 3KR0A 4FFDA 4LRXA 5KYVA 4EG7A 5L3QA 4MJXA 3WIDA 3JWIA 1RYBA 4PLWA 1NN1A 1TD9A 3E9MA 1JSZA 3JQ7B 3S29A 4F3CA 3CCCA 2VF5X 2DGDA 3EOBI 3U5TA 2WYOA 4IDCA 3CPSA 1RXWA 3QVTA 3MINA 5D00A 3NO4A 4CMKA 2FZGA 1KY4A 1P7ZA 5AXCA 3VOTA 5LB2A 4B8ZA 4M1TA 4OUDB 1MTZA 2WUWE 4FFMA 1ESMA 3EBPA 1LWOA 2AC7A 4WKNA 1QRRA 1T8YA 1TT5A 1Y3BE 2H1RA 5CCBA 1YKFA 3LZCA 1ZI6A 2Q6VA 1NN5A 1V7QA 3HVKA 5K4AA 2AC2A 1XTKA 3HR8A 2R44A 2HL6A 5A4MS 5AK4A 3L9XA 1OU0A 4W99A 1ID1A 3AYXB 2BFBB 1XNQB 1E9EA 5IT5A 4DUZB 2Y1WA 4OJNA 4Y98A 1TTTA 5JQWA 5A4IS 2AE2A 4PLCA 4NDZA 1DOZA 4U2DA 1YU9A 2P1DA 2FZEA 3WFJA 5A2GA 1Q1AA 2JFVA 3TLXA 4B74A 4KR2A 1XI2A 2RGGA 4MUFA 2DP4E 2W4MA 2F9FA 4TL6A 2B8JA 1I2ZA 3MEQA 4ZI5A 3NZEA 1OROA 5F2KA 5HS6A 1PJBA 2Z95A 3BSSA 3FKSA 4J1TA 1UMBA 4C03A 1QIGA 5BWCA 2ZSJA 1F3LA 4MVJD 1QFZA 2JLWA 4OP1A 1MQAA 2VYND 3L7CA 1CNFA 4Q0MA 4KBFA 3U61B 4RA6A 3DQPA 3K6RA 2QX4A 5A0FA 2HA3A 3AKDA 3BFKA 2QENA 1Y6FA 3S81A 3WGGA 1ZM9A 4Q4AA 3I39X 3VKFA 2PCJA 3RS7A 8ADHA 1KWGA 3U7EB 2JIMA 3RUAA 1LW7A 2GZ1A 2FZ4A 1RQRA 3PC8C 1W5FA 3HN6A 3IVGA 4R3NA 4WNAA 4L8FA 1IK6A 3WGVA 4F5WA 5B3KA 2WKQA 3FIUA 4M9RA 3EYAA 3QVLA 3AY6A 1Q22A 1I10A 1Y4UA 4FS8A 5BUZA 2IHNA 1SWWA 1PZFA 3P2YA 3SR4A 4AMYA 5JEEA 2HX1A 4TTIA 4JGBA 3EXFB 1JEYA 1P45A 2NZXA 1MG0A 1F8XA 3I5UA 2QRGA 1V48A 2C9BA 3ONEA 1EVYA 4K9LA 1JQBA 4K0KB 3TSOA 3X1WA 4ENVA 4ZPXA 5JWHA 2HDOA 3WV4A 4C1NA 2C3UA 1KSGA 1KJIA 5TF0A 4Z4GA 4N7JA 5HK9A 4Q3AA 5B1YA 1YZYA 3EN0A 2W2LD 3L49A 2YOFA 3BXEA 2CNWD 2QRUA 1DPGA 1FQJA 3SYLA 4XUCA 2D2XA 3N2EA 5DHFA 3BL8A 4GP9A 4R84A 3KJEA 3DMYA 1L5NA 4P4NA 3FUXA 4PAWA 3RU3A 4JBWA 1E2EA 1XZCA 3PVZA 2CLCX 4TZTA 3GLUA 1H2EA 2GKSA 3T7RA 3ND5A 3ODPA 4HD8A 4O8CA 4PFJA 1E96A 1Q0HA 2PRYA 4FP9A 2HEGA 4KFSA 4UCFA 1UKBA 1HYEA 3RQIA 4WZAA 1Q7EA 3IMFA 2ZYRA 1V16B 2Z09A 1JWAB 2GYYA 1XAGA 2GXQA 3ANXA 1R9GA 2A59A 2EFYA 3PUJA 5L3SA 1YC2A 2GD0A 3OZDA 1U7HA 4A0GA 3WZ2A 1ID8A 4IRUB 3V3TA 1Q1BA 3NBKA 4NTZA 3TPFA 1QK5A 3KWLA 1BU5A 4NS4A 4RZHA 3ZDQA 1DFHA 4ID3A 2XF8A 4LXYA 4N3BA 3DF9A 4JI8B 3LVFO 1WPGA 1OW3B 1YS7A 3DB2A 4LYFA 5JASA 2AN4A 2TS1A 4RQAA 3I5XA 1A97A 1UXHA 5DHPA 3KSAC 2DQYA 1UK6A 2H1WA 5AVJA 3GEHA 4IHAA 4Y1RB 4WD3A 5HUJA 5T8KC 5GPBA 1RZUA 1RHJA 4NZPA 1E59A 4AKTA 2AG8A 4HNQA 1Y3AA 3GGOA 4BMSA 2O1WA 1NQWA 3ND8A 4AJLA 3QY9A 3ZGXA 2Q8QA 4E5UA 4MW5A 1XMJA 2J3QA 3IUNA 4DSNA 1PEKE 1QKIA 3HXPA 2WYIA 4QSHA 2AJ8A 3M2TA 1GZHB 3MCWA 5ALHA 2B1GA 3KYCA 4QDXA 1YOVB 2UZ0A 3C8MA 3NPAA 5BYBA 3MCAA 2X3FA 4UASA 3TKLA 4F0JA 4ZI7B 2PA0A 4YEDA 4YAEA 3AEZA 3ME5A 2DQKA 3H2KA 5DASA 5JDIC 2IQIA 5M04A 1ZIXA 3OCUA 3PNMA 1MC4A 3VBCA 1ENYA 5FI5A 3EZ9A 1H2XA 4LHZA 4CEJA 3HO8A 2DB3A 2IXAA 4GPAA 1FUUA 3EAGA 2FEPA 3GZNB 4M8IA 4YJFA 3G0DA 4MVJP 2ZUTA 3UK2A 1IAVA 2I1QA 2I4RA 5HIIA 1SCJA 3RAGA 1SCIA 1ZQ1A 3IPLA 5KKAA 2ZUEA 2VAMA 1MT0A 3ZHBA 3DO8A 4ZMBA 5IDWA 2PS1A 3MSXA 1JEJA 3BFJA 2BGJA 2MHCA 1VLHA 2DPYA 1VPWA 5EP3A 1KK1A 3SS7X 4BO5A 2VC2B 3T3DA 2OB2A 3GA5A 4WLNA 4Y2XA 1IZ7A 1X1BA 4I5IA 4OD0A 3SJAA 2QM7A 4CCYA 5JI2E 2I2WA 1N2XA 3OOJA 4PIPA 1JB1A 5B53A 5LA6B 1Q1EA 2VQSA 3IQXA 4MAMA 1I36A 1JB9A 1DGQA 4FW8A 2A67A 2H1LA 1Q95A 4IIUA 1EFKA 1Z4PX 4EGFA 1SBNE 4CLRB 4R9SA 1I3OA 4TLDA 3H5VA 4OQLA 1RAIA 2J08A 4O08A 1Y8RA 4PSVA 1RJGA 1GKKA 1B6RA 1DJQA 3H2IA 3M4XA 4GKBA 4Q6BA 2PZAA 1V95A 4C0SA 3AHHA 1OA1A 4NPAA 4CKCA 5K0GA 1ULZA 3NWEA 1HLFA 3O7WA 3ZWXA 2PYDA 5JXWA 5AW2A 5JSYA 1XU9A 5ITZB 1DG3A 1U3TA 4MYHA 4EVQA 5CFQA 3A3NA 3OA0A 3VMMA 4ZHQA 3OCJA 2LUOA 1K99A 1CCWA 3KAQA 4DEYA 3QEJA 4A0FA 1GSAA 3W5IA 3DMTC 1QC5A 5KCMA 3F96A 2I29A 2BKAA 4WMLA 1SU8A 5HCUA 2Z0MA 5FORA 1PS8A 4S2EA 1ZN7A 3QEAZ 1PD0A 3W8FA 4FFOA 2EHJA 5CVVA 5EHQA 3ZX5A 4JX8A 4GC9A 4CM9D 3B3QA 4NCJA 1MZPA 4NAHA 4IXMA 1IOVA 1JECA 2ZS7A 2J0VA 3UKDA 6GPBA 4GKJB 4X6YA 3HRHA 1PYOA 3FZYA 3PG5A 1ZK4A 2ZJOA 1E1NA 3CZ9A 1O87A 3DBRB 2ZDGA 3K35A 1PRYA 2CNLA 2F48A 3AR6A 3Q0TA 3SJZA 3ESXA 4MW6A 2ZRFA 1U6IA 1NLFA 4G5FA 4B4WA 4NYIQ 1U2GA 3IXQA 2VYFA 5HRUA 4QRHA 1XRMA 2IPMA 1GP2A 3ZDFA 2JNWA 4D4HA 4JC8A 3PNVA 4QREA 2JCBA 1FDTA 4JJAA 4R8MA 3PS9A 4W82A 4YTEA 5E7IA 4G01B 3ZEIA 4D45A 3OPXA 3I83A 3NQ41 1MC5A 2A5FA 2ST1A 1DMRA 1A8IA 3ZWMA 5KJ6A 1E3QA 4KE7A 3P1JA 2IU0A 3X3HA 1RZRA 4KPFC 3RRMA 2I2FA 4G8CA 4ERXA 4FM9A 1IQUA 2FEWB 3KUCA 4DYHA 2VDWB 5A1JA 4DJTA 2CXNA 2A92A 2HV9A 1BVUA 3B5IA 4MP6A 4NDNE 2HK7A 1ZSVA 2JFBA 1CKEA 3EQ2A 4NMMA 4P1ZA 2V7QD 1NF2A 4ARSA 5A4KA 3MM4A 4P93A 5LJLA 1ZAKA 3KSBC 3ZDDA 4RTSA 1DJMA 5EKDA 2J41A 3L8HA 2ZUSA 1YR8A 4IQFA 5E9QA 1BGWA 1U3UA 3MW8A 1Y9DA 3CVOA 4ER6A 4CIXA 3I58A 3IKJA 3CVJA 5ALYA 3IP7A 1XEFA 2QD5A 3JARA 4LRYA 1RVDA 4WESA 4ZAYA 4YN3A 1VPTA 1R0YA 4OO3A 1M1XB 4MUHA 4URUR 4DWWA 4HUTA 3H11B 1AQYA 2ACVA 4B35A 5KTYA 4O2RA 1T2AA 1H3FA 2IF2A 1RHQA 1PUIA 1T43A 1T5BA 4R8KA 3CG4A 1RBZA 1WMFA 2PQMA 3ICVA 3VPCA 4PGHA 2FUKA 2QQGA 4P7JA 4WZZA 1NVKA 4R81A 2LDXA 2RHWA 3FJYA 4UNNA 1COZA 1TA4A 3RS4A 1G20B 4TT3A 4Z0PA 2P2ZA 2EJVA 3AL2A 4DZTA 2OFFA 3RYTC 2HJGA 3DTVD 3ZV3A 4EPXA 1SXIA 3IEIA 3ZZ1A 1KYQA 2V03A 2WUGA 4P0TA 4XSHA 1OF1A 3IMGA 3OY2A 3GDHA 1S1MA 2ZAIA 3OEYA 3WGTA 5ERXA 3RPEA 4ARZA 5I9LA 4W6QA 3GLSA 3P4XA 5F4BA 2OKCA 4LE2A 5GADl 5KDOA 4KGZA 1XDDA 3EARA 4RY9A 1X1RA 2PKWA 2R2GA 2V65A 3PQ8A 5AK0A 2C5HA 1RRFA 3FZNA 3TTTA 5JO0A 2EERA 5LZ7A 1YMUA 4C4OA 1YQTA 1G3IA 4YJHA 1CY7A 1Z5UA 1Z2EA 1WX1A 3S44A 3E7XA 4XPIA 1EFCA 1JLKA 4B7UA 3T12A 2G28A 1SPXA 2JLRA 2H4ZA 3GEDA 2H1SA 2GJKA 2NU6B 3VR6A 2P6OA 2OORC 1G0NA 1YZ3A 5F4ZA 5ALEA 3VX3A 4CMGA 2OCPA 3NBFA 3JATA 2BM9A 3PPVA 1CDEA 5KDDA 2B8NA 2F1HA 2O2XA 2PDAA 4N5LA 5BOSA 1LS1A 4N40A 4WSOA 1YI8A 3L40A 4TSFA 4MX8A 2C95A 4U2EA 1TEZA 4ZEVA 4S0ZA 3R7LA 5BNWA 4RZQA 2X58A 2SHKA 1AKNA 4LHEA 621PA 5TPWB 3PXCX 3ZKWB 4DSAA 1M75A 5NULA 2M6RA 2OVBA 1S0UA 2OBYA 3VAAA 1W36B 4HNTA 4NZ9A 1IBCA 1N3IA 4IMRA 3OH8A 3MT7A 1CW2B 3WGZA 4BB5A 4YXWD 1Z62A 3BMQA 2E0IA 2O0KA 1CZHA 4V0MA 1GUFA 1XF9A 3K9GA 1X7XB 4BLQA 2H2WA 4XUEA 1PK8A 1WD7A 3NHZA 3UK0A 1KK0A 4IJ6A 4WK2B 4YJ2A 4R8VA 3SXUB 3IVAA 5F5LA 1IPFA 1LRKA 1F5SA 1NYTA 3HNPA 4M36A 4QQNA 3O8OB 1HDRA 5DN6A 1F4VA 1R15A 1T0HB 2IK8A 4I50A 4IFBA 1UKZA 5EESA 4CR8A 1GTMA 2M32A 3PBKA 2I1VB 3QF4A 5HGJA 3K1AB 4B6RA 3ZD6A 3GRCA 3TMKA 3TB4A 1VJ5A 1EEXB 3VKGA 5ILGA 4YJ3A 3R40A 2GEUA 4FJ1A 1QHHB 2CLOB 3ZWCA 4Y9UA 5E6UB 2V7BA 2PG3A 4TKVA 3AYZB 1T4DA 5BSRA 2IS2A 3C0KA 3QH4A 2Q0XA 1WPQA 3WL4A 3R77A 5DMXA 4OF4A 4RZ2A 2GTIA 1F2UA 2QTVB 1WVGA 3QSGA 4RE5A 3T95A 1R4NA 3ONVA 1E7WA 1I7NA 5BW4A 4HRVA 2Y6UA 4Z49A 1ZS9A 1VRWA 3ZS9A 2PUWA 2H5LA 4U5QA 3P9XA 1GGFA 3RARA 4PICA 1SKBA 3UOGA 1BCRA 2P2CA 5LBTA 4BNKA 2XEXA 4MR9B 1G8FA 4LRTB 3P52A 2QDXA 5CA1A 5C51B 3WYDA 2JARA 1T9CA 3W6ZA 4YMUA 4Q16A 3NKLA 1PI3A 3M49A 5FULA 5EE1A 2E2WA 4OQMA 4L2IB 4HUQB 3R6WA 5TQVA 5DBFA 2ORED 4NFHA 2SCUA 2WKPA 4OHWA 3U7FB 1BEZA 2ZAOA 2BRUA 1DXOA 5EWLA 4QGHA 1FNCA 1DKNA 5A06A 2Y0EA 4QE3A 1HDOA 2PH3A 5CDFA 1J22A 4DJDC 5HIKA 1BEEA 5JSQA 1H1LB 4WADA 2F55A 1KQPA 2FUEA 2FAXA 4Z5XA 3FKSD 1QVZA 3TAHA 2YFHA 2ZBPA 2VZLA 3OX2A 1TZKA 4UD6A 2GXUA 2XA9A 1YC5A 3QZUA 2DQSA 4R2IA 2BFOA 1Y34E 2GPJA 2NXJA 5AW8A 2E21A 1IU9A 3GJQA 2XE6A 4FR5A 3I01A 3PNYA 4LQLA 1OD6A 3PXAA 2CDAA 2IHYA 1LWMA 4JJKA 3HZHA 4OTZA 2BKUA 4X1YB 4EB6B 3CURA 1ZMOA 2GEBA 3OOEA 5EZYA 2UVPB 3ETNA 4M6WB 3OT1A 3VTZA 4MK4A 3KLNA 3FW1A 3ETDA 3FYUC 1JKMA 4YPFA 2UZ1A 3N28A 3NP9A 4A15A 1Z4QA 4C2BA 2H9AA 2BFDA 2CVPA 3CU5A 4R6XA 1DT5A 4R1TA 3QXSA 1Q1ZA 1NJ8A 3BE4A 1F4PA 4RLFA 5JV5A 4N18A 1FOEB 3KP1A 4Z51A 3IAHA 1E8NA 2JBHA 4LYEA 5FWYB 4TLCA 3ONNA 3WBFA 3OZTA 3ITDA 3INRA 3L0PA 4TM8A 5GJVC 3V8PA 4GSLA 1WV1A 4RTRA 4UU1A 1U0JA 1TZCA 2FSSA 2CDBA 4A5OA 1PG5A 1YH3A 2JIZD 4EGJA 2E3JA 4YRDA 1OB2A 2CXRA 2R66A 2V9PA 5KDLA 3TZLA 4BFVA 2IV7A 4PNEA 3TKAA 4WA7A 5DW3A 3SQOA 4WOKA 4AZ3A 1IHYA 4OJYA 1T4BA 5ELMA 2FWRA 4CM1A 3OJWA 2I78A 1BKYA 3IT3A 4YP9A 4L8GA 4A03A 4ZFNA 3Q3GE 2HMTA 5CUQA 5DBGA 3THSA 5C32A 5GMOA 1YJ5A 2VK8A 2ZCJA 2CXSA 1C9EA 3KUUA 5GP1A 3VFDA 5LA6F 2WKWA 3C3YA 3FDJA 2A4MA 3OEEA 3VJKA 2XTNA 4TZ0A 4JJ8A 3IDQA 3NHUA 5DX1A 2PUCA 4I1UA 1PGPA 1BC5A 3B3FA 3ECAA 1C1XA 3N07A 4UTVA 5L4SA 1ECBA 4Q21A 1EK5A 1HM5A 4B6SA 5CVJA 4WKBA 5BW8A 2HDZA 1U3CA 3AG5A 5EQDA 3IHLA 3GJYA 3EF0A 5JMWA 4OAOA 1UBLS 1ZD5A 4RD6A 4A82A 4X3PA 4K9RA 1Z15A 1UMBB 2QORA 2P27A 2R1UA 1ZHFA 4O4HA 4RSHA 1V0JA 4RA6B 3TNJA 2D7CA 1BDBA 1S9HA 3FOCA 2PIDA 2CSUA 4IICA 1UXOA 1ZNXA 2ZJ6A 3AM5A 3PFHA 1JKFA 3PUWA 4NFSA 4Q4AB 4PR0A 4WL0A 3THWA 1JR6A 3ND6A 3JX9A 2B78A 2BGTA 2DLNA 1Q7CA 1N6HA 4PRKA 2V6IA 3DEFA 3GFBA 4JC4A 2YUKA 1N6KA 4MEJA 4QBKA 1GKLA 1SKYE 4RS3A 3UMYA 1K89A 1ZM7A 2DQ4A 3JR3A 1ORWA 1I2MA 4YGYA 3LDHA 4WLFA 5T67A 3KLMX 2HHHB 1ETUA 1RCTE 2RDMA 2AMLA 4ARUA 1BMTA 1E9BA 4EMSA 2P5SA 3MXTA 5IDQA 4HDKB 4DRYA 3V1YA 1SB9A 4JI7B 1R27A 2Y1GA 3BN3A 2P2YA 2W48A 3ETCA 3D7SA 4P2BA 2R1TB 2AFIB 3RVSA 1RWXA 2Y67A 3NJRA 3N5KA 3IVXA 2P9CA 5AVTA 5HM6A 2ZE5A 4GL2A 2XGOA 3VVLA 4DJAA 2PQ0A 1N8KA 4ZN6A 2OCKA 3ZHCA 1VYHA 3RTEA 4H16A 3CVXA 2FR0A 5BMOA 1LRLA 3OO1A 4UAGA 5AJWA 2QZPA 3RYHB 4BCDA 4WAUA 1WSBA 2IDMA 3PNSA 1U9ZA 1BEUB 3QNMA 1SXJC 2ZIZA 1XMSA 4N0QA 3KQOA 4GL4A 3ENVA 2WD7B 3CZAA 5CEEA 3LP8A 4WZAB 4QHYA 1DIRA 3U3OA 3OE4A 4WHMA 3CRW1 1I2DA 1ZK2A 2F7SA 4MUXA 1CBUA 3VDNB 2QQ0A 2YV5A 3K1ZA 5EIWA 1KXJA 1Z4IA 4ZICA 1BYIA 4HXGA 5EMMA 2ZROA 2GN1A 4XIYA 1T2UA 1TFRA 2BZGA 2JCGA 1RWPA 5DM70 4QLOA 3ZPXA 1G5FA 2J31A 1E6LA 2WLSA 2ZS9A 3NM9A 4Y2UA 3T34A 3V7FA 2OQIA 2PMEA 1EI9A 2O19A 1QPGA 2JASA 1I2BA 1IHPA 4JBXA 3KFLA 4EG5A 1G17A 4YQFA 5B6JA 3C3BA 1LPMA 3IIEA 4EA9A 1EXVA 3LQFA 4F2HA 4GT1A 3A7EA 3PVCA 4E2WA 1I0IA 1LSSA 1RKBA 2P5TB 1N2SA 1PGJA 1VMAA 2YXNA 2ZI6A 3B1YA 3BWXA 4BMDA 4HDRA 1QK4A 4LOKA 5HRCA 2FN4A 2C07A 1RLUA 1U0RA 2EFHB 1HC7A 5HG0A 3TFQA 4MGYR 2FN8A 1J2TA 3DXFA 1OXKB 1DBWA 3R5HA 2FF7A 4F2GA 4HTFA 1WTAA 2AHOA 2G7MC 3CQ9A 4GGMX 1QYVA 2OMEA 3CINA 1S9DA 2C42A 3L1VA 4RHUA 5JMPA 3KV1A 1AF4A 2A14A 3MGAA 5ALNA 4AC9A 3REQA 1RPZA 3TMMA 1ESZA 3CPJB 3E5RA 4EARA 4HYYA 2ZWOA 1DT3A 1TA0A 2IOFK 4TUYA 4WH0A 4XX1A 2H00A 4PG5A 1DIAA 3T6KA 1MV5A 1RWKA 2GPBA 1VPEA 4GEKA 1AHIA 1AHNA 2ETVA 3D3JA 3U1VA 3F3KA 3MMNA 4RGBA 3W1WA 5BR4A 5I45A 2VT2A 5HCNA 3HY6A 2EJCA 3CUKA 4D9IA 1VKJA 3RAPR 5I7WA 3QQPA 1RZRD 3A0UA 3C3PA 2PH5A 2HUNA 2XHEA 3PGA1 5K0CA 2AL7A 1E2FA 1WUHS 2GBLA 2WJJA 4QBHA 4TKLA 3S2ZA 4BGDA 3TRHA 4Z4FA 4OHUA 1C9MA 1B6GA 4GX0A 2PYIA 3ILSA 1A4RA 3IQEA 2AUTA 4N0DA 1Z22A 2VUIB 3BHMA 3I0NA 4FNAA 4DPLA 1X1CA 1PIWA 5B1DA 3SF8A 2V59A 2VJQA 1KYZA 4TRMA 4CCYB 1X38A 5KCZA 1E7RA 3RIEA 1T34A 2LVBA 5DIZA 4F2WA 1ZGBA 3TQQA 4M9ZA 4WNIA 4FFSA 1LJLA 4US0R 5IVIA 4LHXA 3LCVB 3ORQA 2J9FA 2W2XA 3DVRX 1USKA 3OFVA 1Y8RB 1TUIA 5DTQA 4S05A 4LW8A 4UTOA 3DWFA 3GLIE 3QKWA 1DRJA 4CKCB 3Q12A 5F1OA 3ZWVA 4CKWA 5KUTA 3PENA 4MUJA 2AQ8A 2EP5A 3OD5A 1JA9A 1NJ2A 3JPYA 3LYAA 3QU9A 4BAUA 4ZOQI 2HA2A 1IXYA 4BFCA 1JYEA 3EZ6A 4BDSA 2FTKE 1X9HA 3DPIA 1Z45A 3I05A 4IWYA 3DDUA 5JSUA 2B92A 3SHTA 1KO1A 2AB0A 3K1TA 3KQMA 4IGKA 3PDHA 4I3FA 1QC5B 2RKWA 3FVRA 1HL7A 1YGPA 3T0IA 5BV0A 7MHTA 2GCGA 3TSCA 4Z3DA 4AIIA 1FRNA 2WFLA 3O82A 2CKMA 5EE5B 3WBJA 5BSGA 4H3KB 3B5JA 5BNIA 3QVUA 2IVFA 2DFTA 3OPYA 3AUKA 1S8AA 5C7OO 2Q50A 3A6GA 3LT0A 3TZHA 1M2EA 4XWKA 2BEVB 3D4PA 3O94A 4I1PA 4H7FA 4L4UA 2IZ7A 2F00A 2PFKA 1UXKA 4J0HA 1E3SA 1KI6B 1OAOC 1N6OA 1EFDN 1VIMA 2J59A 5DGCA 4LJYA 5CYPA 3S1SA 1MR3F 4ZCTA 2ZVJA 3C3JA 1LK5A 4QTZA 4DWJA 3DE2X 3CKLA 1D4OA 3E15A 3K72B 3VR6D 7AT1A 2EW8A 1RIIA 2VTEA 3QG5A 4YMIA 1XQ1A 4X84A 1TYBE 3LXRA 1IMJA 1W93A 2Z9DA 1OX4B 1WKBA 4JLWA 1G8HA 3IIJA 3LZ6A 4KO3S 3VM6A 3CRMA 2IUFA 4ZAFA 1OR8A 4TSFD 1IM8A 1ABBA 3RROA 1O0BA 2ZRJA 5TE9A 3SDBA 3KZOA 1BD4A 2GOYA 4MKRA 4KI0A 1IAQA 1UODA 1WXQA 2ZATA 3FPBA 4G0ZA 3SXPA 1D2NA 3E3AA 5KMGB 2H8KA 4HDOB 4NU0A 4G97A 4MW9A 3MMXA 4UOQA 4B6EA 2FQ1A 3MMPA 1LFAA 2PLNA 1KJWA 2I8LA 2QV7A 4AL4A 1XLUA 4RMIA 4V03A 1N6LA 4B79A 1ABEA 1AMNA 3GYGA 5DBIA 5JH7F 3ID6C 1JSXA 2IITA 2OCGA 4OXRA 1YAJA 1SKAA 4IIBA 2E48A 1UJ6A 2W2PA 3SQWA 2I91A 3DWEX 4MV7A 5I4CA 4F85A 1BO6A 2BFFB 2DAPA 2OE2A 3THXB 2B7CA 2AWOA 1RPTA 3WKDA 2RH4A 3OMWA 1Z73A 2JF0A 1YS4A 1DKUA 1HDGO 2Y6VA 4D25A 1BQ3A 1PR2A 2C9DA 2BDEA 5TS3A 3TLBA 5DN6D 5FOTA 3WR5A 3C7KA 1JA1A 2Y05A 2GGSA 1XLTC 3G02A 3HM9A 5JJIA 1TVKA 5AKKA 4E6EA 1O5IA 3BMXA 5BT8A 3ROTA 2C00A 3UC9A 5JW6A 2QY9A 2RAFA 3GJ0A 3M4YA 1QTRA 4MLDA 4MVJI 3C24A 4N3GA 3GN2A 3VHXB 3GIDA 4CZ2A 3AZPA 4GDFA 4TWBA 1OYVA 5DM0A 3OMLA 1U1EA 4REMA 1WULS 521PA 1O8BA 3JQRA 1NULA 1WJGA 3HWSA 3L8DA 3FPJA 4RL6A 2VEDA 2WJYA 1UQRA 3HVUA 3RFVA 4K9PA 4UULA 1NBEA 3CISA 3HJBA 2PR7A 4ARZB 3OMXA 1P1RA 1T5SA 5JOQA 1ZNYA 5CVTA 3VJLA 1WPRA 2XB2A 4EGCB 4UQLA 1AK1A 4X3OA 1W4CA 5HK8A 4O4LB 2HPVA 4QOEA 2BI4A 5GAJA 3K15A 1XCGB 3RE1A 1QAMA 4KMOA 3R5XA 1TCVA 5DULA 1KYIA 2L2QA 4A10A 4F46A 4K3UA 3ORRA 1SVLA 1QVRA 3HEBA 3QFRA 1V5IA 5FBWB 4G81A 2AVDA 3U3XA 3LV8A 5AVRA 1RCUA 4YP0A 1VL2A 3R0JA 3JATB 3DV0A 4MI1A 2M6SA 4WEOA 5FI0B 4LZNA 3RANA 1X9IA 1B73A 5BOSB 3W5AA 2QQFA 1NWCA 1Y1KE 3EZXA 2DBYA 3FCXA 4B4DA 3U17A 3G0CA 4PE5B 1G8YA 2N1BA 1TF7A 2CL5A 4UJ5A 4A92A 3V1NA 3OOHA 5LDGA 1HNNA 2DY0A 3DBLA 1Z17A 3DZIA 2IPNA 4RK7A 4RD4A 1OWLA 2XYPA 3KDPA 1BHSA 4II7A 3V1TC 3BTUA 1VJGA 3AKEA 5DDIP 4DR2B 2YUTA 2HR1A 2UYYA 3BMQB 1RXEA 1OGIA 3ENWA 5DGDA 3SJ7A 1NQOA 2Q28A 3N0RA 1JHAA 2R0QC 4PW0A 4IAOA 4RVFA 1C9KA 5SZKB 4QKQA 1Z28A 3T7EA 2NQ2C 1HO3A 4JGIA 1DEAA 1GPBA 1WHSA 4NG4A 4YJ2B 2Q29A 3T9BA 1U8FO 2DZDA 3KB8A 2RARA 4BO6A 1TEXA 1XCBA 2HJSA 3RI3A 3D7LA 4PC6A 4TS9A 2I7DA 4LF7B 3I1YA 4I50B 4R1UA 4ZZIA 5CITA 4C76A 1I6KA 4JNKA 3UQZA 4DW8A 5K0BA 2OV2A 3KWFA 1Q16A 5ICGA 2UYQA 4KPGA 4YJ3B 4MMXB 5HZKA 3ECSA 4DB4A 1BWQA 1RAGA 4RXUA 4TKVB 2PWYA 1FVXA 2B82A 1M1YB 2WABA 1CUDA 1SCBA 2B4YA 1ZW1A 2BY4A 4GYWA 1KDYA 1HE2A 5EWJA 3OM0A 2WZDA 5B6PA 1Z74A 1YB7A 1OLOA 1U7OA 4L07A 3MUFA 3U9TA 4PHCA 3BWEA 4F1WA 4GX1A 3AVVA 3AVQA 1ZOLA 3LWDA 4NZNA 3KKQA 3PFKA 5GGYA 1EWYA 1BCRB 2VI5A 3EBOA 1DBPA 1W5BA 2WU8A 3L4BC 3NYQA 3P19A 1KRHA 2I8AA 4Z9BA 2FZKA 3UA4A 5E3HA 1C4KA 1H1TA 4ZQBA 1IZ9A 2G17A 4WBNA 4CF7A 1I32A 4O3FA 4CMEA 2PIAA 3OURA 3ESQA 3OEED 3AX6A 3P0IA 4MW1A 4UEKA 4F3NA 3EYWA 4I2NA 2PD6A 4F6RB 5J2TA 1ORDA 4MI6A 4X0EA 1G8MA 2BZ1A 4QYIA 2H4XA 1K7SN 1FSSA 2C99A 1Y5MA 2ISQA 2SCUB 2PEZA 4EJSA 1JRLA 2CLMB 1KEPA 2XMZA 1KYYA 2A7XA 3B7PA 3FPFA 2KB0A 4RUKA 5CLHA 1E2IA 2P5UA 4CJXA 3AZOA 2CNNA 1N77A 4L76A 3JYNA 2FPIB 5FUXA 3SN6A 2GT1A 5T7BA 5A6SB 3G1TA 1NBWB 2C1EA 3GJXC 2HPHA 1PW5A 1K63A 2Y93A 3I6MA 2PLAA 1SBQA 1RE1A 1UWKA 3IEPA 3IOBA 3LRTA 3I32A 3PXBA 1EK6A 3KFVA 4M0LA 4EDHA 2MYPA 4JA0A 3N59A 3FOBA 1UPTA 3S2SA 4HV4A 3QKRA 1EWQA 3PFIA 5EFZA 1Z2PX 1RAFA 2WYVA 1Y9ZA 1E6CA 2W71A 5DK6A 3PR2B 1K8YB 1TYCA 1FFBA 2GBGA 3VMFA 3GEMA 4UNPA 4FCTA 1WHTA 3TQTA 3MWDA 1VBKA 3E9ZA 4IWXA 4X7RA 3Q6NA 1P1KA 4MVJG 3Q88A 4EY7A 1SBCA 3OCCA 1TD1A 1XRPA 5BMVB 1VE6A 1XMQB 1CU1A 5EZYB 5YASA 3M4NA 4F1KA 2BHNA 4LSMA 4XWGA 5JDCA 4EWLA 2X2EA 2QLLA 1E1MA 2YYAA 3ABIA 3NT4A 2XRYA 4PQRA 1UDCA 2GA8A 4ENSA 3WK6A 1NUQA 2UZ1B 5FPQA 3VJMA 4N6NA 4EJ6A 2A9KA 4JYBA 1Y3DE 1DQYA 4K8RB 1MDBA 4RFLA 5H80A 3QMWA 2CEKA 2C0PA 4RY8A 1Z2OX 4DMRA 2GZ2A 4P5DA 5C2JB 1RHUA 2O5VA 1QGOA 3V4LA 4R5HA 3CW2A 2PX8A 1NVFA 2BHTA 1YCHA 1UQTA 2O8DA 3O3MB 3PJGA 3GNQA 3K1YA 2HNBA 4UXJA 3D8TA 2ZTSA 4CL8A 5DCUA 5LPNA 4MVYA 3OFKA 2B2CA 1OLXB 3H9QA 3BERA 5DVZA 1RJWA 2XUDA 3B9BA 2GO1A 5GWXA 1JKJA 3KOZA 2OO3A 3QE9Y 2ZYSA 1W36C 5CYOA 2P0YA 1RS0A 4RGYA 1ISMA 2MSNA 2AEJA 5DTEA 1I4WA 3PUHA 1PR0A 4GQBA 1NDQA 1QGUA 1SVMA 2OO5A 2NP6A 4EZEA 1HF3A 1GA1A 1II8A 4C6RA 5ADUS 2CXQA 2WG0A 4C7OB 4AW9A 3D81A 1M5UA 2KI5A 5AHKA 5JFGA 2P2DA 1IJBA 3H4TA 4TN5A 4OFXA 4JP2A 3Q9UA 2HFJA 4C07A 2IYUA 3TIGA 5DXJA 1PVDA 1UFOA 2ZUWA 1XJWA 1U7WA 2CLEB 3GUCA 3HBAA 1EGHA 4DMUB 4EG4A 4JOSA 5HKKD 1VMDA 2ZIUB 4IPTA 4XIJA 3ZU2A 5AVZA 2O8FA 2FWAA 3OZWA 3VPSA 3Q15C 2FZVA 1C1XB 4M1SA 4L8VA 4MQEA 5FEUA 1MTOA 1G21E 2R8RA 2YRFA 1ZMRA 1EVKA 1ZNZA 3B8EA 1JILA 2B35A 1XHEA 5JBQA 4NV0A 2ZBDA 5ENZA 2PT6A 4BKOA 3VKVA 3N05A 1UC8A 1XQYA 2YN0A 3KXDA 4LVNA 4NI5A 4FHGA 1SIUA 2Z08A 1Q0RA 2QM8A 3CLTC 3HSKA 3ZZ0A 1U7PA 1G7RA 3EDMA 1E2BA 4LHSA 5JXJA 4O4HB 5KC8A 3EGEA 4JZYA 2YVKA 3AJ9A 2QAGA 2Z3ZA 1IWBB 2Z8XA 4O8ZA 3DZ8A 3KZCA 3THWB 1NF9A 1S1CA 4GZ5A 4YRCA 4C21A 2PKXA 4WE3A 2P0EA 5EN4A 2GAAA 4ZTZB 2X0FA 3CTMA 2EFDB 2HWKA 5L3VA 2MOKA 1QH0A 1Z6ZA 4GRDA 3TQSA 5CEFA 4Z53A 1UJMA 3WNDA 5DM4A 3OA2A 2YFQA 1YT5A 4CETA 1SUEA 1OSNA 3KJIA 4EFDA 2YWCA 1ZOSA 3TQRA 3D3KA 5JS6A 2UYCA 2CLHB 2PSJA 1ABFA 1CSEE 3A4YA 3F2VA 3WGKA 2XE7A 1P7PA 3FDXA 2HMVA 4YMGA 3HO1A 4RW0A 3CMMA 3RTGA 1CJTC 2WV7A 1LI5A 2H63A 4D5EA 5KOIA 2O0LA 3FTFA 1E4YA 3LHSA 4HWSA 1OBOA 4LJAA 2O8VA 1CJSA 2F62A 4MHSA 3DAOA 4CLXA 5BV2P 4PM4A 2IHTA 2D2IA 1OYWA 1TPYA 4GF5A 4I8DA 4URYR 1PFQA 1WKCA 4XSVA 4I9NA 1O58A 4ZT4A 4CLEA 2RE8A 5L95A 1WVIA 3OM8A 5C1IA 3P9IA 1YBHA 3IAUA 3RH0A 4MUYA 2ZYWX 1M66A 1Y3HA 4UM9B 2VPWA 1T9HA 6ABPA 3QXCA 2Y4OA 1YE3A 4TOIA 3WGMA 1EFLA 5HP4A 4KUEA 3GLTA 3AJRA 3OPMA 3Q4GA 5A3RA 5AI0A 2AX3A 4G36A 4GWLA 1G42A 3GEEA 3RQSA 2P75A 2J32A 2DX7A 3CRRA 4FPXA 2H6EA 2M1ZA 4M1KA 4RV9A 1AQJA 1N33B 2DFDA 4AQDA 1HEUA 2M9MA 3KE8A 3X2SA 3B13B 5CFRA 2J0UA 3QLUC 5BQOA 1DLIA 1C81A 2ACEA 4BKQA 1AN9A 1DHTA 4Y2GA 4BWGA 1QFJA 1T0JB 1PS0A 2WAYA 3AEKB 4Y60C 1GU0A 4TLBA 4DVGA 3NCTA 3H2SA 4JA2A 4QVGA 8ATCA 1WXHA 3DMPA 1ZZGA 1HL3A 1XPOA 3TJMA 4UREA 4M0DA 3RJMA 4IUCS 4QICA 1O6FA 2I4LA 4N5IX 4IEIA 4GOKA 2IRWA 4D80A 3AHFA 4IXNA 4UM7A 5ESRA 5A4AA 2WJIA 3PUVA 3VR4H 1KVUA 4MWBA 4AZTA 2G67A 3UO8B 4TZ6A 4BV2A 2C4VA 1KEZA 1UEXC 3MPOA 1E62A 4REQB 3COYA 4YJGA 4DC1A 4NCBA 2A9RA 1C14A 2DFPA 2GRJA 2C8LA 1M83A 4Y6SA 2IYRA 3DJFA 2EWVA 4HRYA 2O2JA 1E3LA 4AJIA 3A04A 3L18A 2GN8A 1TECE 4TUYB 1DO8A 2JEOA 2X4GA 3R9KA 1ZGGA 4Q12A 4RX1A 4UBOA 4CT4B 1DC8A 1M8KA 4O4LF 3ZWPA 1YDHA 1EHYA 1YIDA 4R9VA 2JLAA 2PYZA 3TQ6A 2NZUG 2ZR8A 3BBLA 4QARA 3ZW7A 1XTTA 3M6AA 4QAQA 1MGPA 3T9DA 1P2UA 1N8TA 1SEVA 2J7KA 3EIXA 4MS3B 4DLKA 4EFLA 1SURA 4WJZA 2Q2OA 3PA6A 3QLVA 4J1TC 3T5BA 1C3LA 3LW8A 4KJXA 3ZN2A 3OETA 4IJ5A 4ZOAA 4XLZA 4GVLA 4XLTA 1KNQA 3U40A 2X19A 3SF8B 3CLRC 3V46A 5K1ZA 3SCZA 5GINE 4JI2B 1CUSA 2OXFA 3DQZA 1GGHA 4IGEA 4NH4A 4URHA 4HYQA 1PUJA 4X20A 4X94A 1E8MA 3RNOA 3KHTA 3CH6A 1Q21A 2Q9CA 3WL3A 4FGKA 3PDIB 3W8NA 5K3BA 2WSYB 2Z30A 2QSUA 4F9TA 4O0LA 5HBGA 4R1NA 2JGJA 4J75A 1W2GA 3U6BA 1GDTA 1EDEA 2H29A 3D8NA 3ZY5A 4OKNA 1ADGA 4JSRA 1JLHA 3KLOA 2K5UA 3P7MA 4E07A 2AG1A 1NVTA 2BSQA 1YZFA 1RWWA 4XPZA 4YP6A 3ESYA 1C8KA 3BFVA 1R5BA 4GUAA 3TR0A 2W2NA 5CT6A 1CTQA 3K0CA 2R8XA 4X85A 3ZZMA 3GJ4A 3KBBA 4UM8B 2VK4A 3QX7A 3GLFA 2RAPA 3EGXB 1N6NA 4ENRA 4MVXA 1HT1E 2H4WA 4EY3A 4N65A 2AR9A 2HT1A 3RSCA 2WFLB 3MWKA 3UIEA 3GCWA 1TMYA 5DFAA 2X5KO 2IEDA 5DB4A 3BDIA 4MLCA 3LHDA 4B3CA 2WTEA 4ES6A 5H4HA 3QFSA 2HHAA 1WBJB 2AOUA 2OHOA 2WMNB 4RA9A 2FK8A 2H9IA 1FS4A 4Y0AA 3IC5A 3CSSA 3OCZA 5CR9A 1EXMA 1F51E 1HY3A 2DT8A 4DJFC 5CCDA 4CIBA 3DVQX 2QG9A 2R6AA 3VUFA 3HJGA 3OTIA 2XDYA 2F43A 5JYCA 3DVAA 1U81A 1AKUA 3A1DA 4L74A 4JSYA 5TGDA 3ULKA 1E0AA 1DDOA 5I4BA 4AI6A 5C8VA 3A28A 3P9PA 3PWZA 1GFZA 1VBMA 2O2ZA 4P82A 4D0SA 1L5VA 1NUTA 5K05A 3QVKA 1OBHA 4IDHA 2JGMA 1ADFA 5DZSA 1E4EB 2B9EA 2KQUA 3LX8A 4A2CA 4DNXA 5BNZA 4YPOA 2GAJA 2XYVA 3QV1A 5CFPA 1LK7A 3DLIA 1AA6A 1GQFA 2FYTA 4WCVA 1J0EA 1JYSA 3A4LA 3RK0A 2ACKA 4U2FA 1HG1A 4TTRA 3ZE2B 2H5IA 1T6NA 3BYZA 2AZMA 3EFBA 3ZD9A 2PRKA 1Q0ZA 2JGDA 5DLEA 4YI3A 2IBMA 3C5WP 3Q7QA 4ETMA 5TPZA 2FEXA 5JAOA 5BN3B 3ZJ5A 4RD1A 1FBTA 4DMCA 1V25A 1SXJE 2IOYA 1GR0A 2DWUA 1P2GA 3VSBA 4QPDA 3IUEA 3LP5A 1Q7BA 1XR3A 5CXSA 5DKFA 3A2LA 1JHVA 1SMKA 3HKDA 3H0CA 3VTKA 2H4HA 2YNMD 3NIBA 3T7TA 3OD1A 3VISA 3OQHA 1Q7RA 1UK9A 2YQZA 2X2OA 4N5DA 4U9IS 5FO1A 2C8KA 1YR2A 5LB4A 2ZSHA 4BKPA 5KIAA 3GQBA 3BIJA 4GPD1 1YR9A 2J9GA 4EX7A 3EXEA 3HY3A 4V1CI 3RBZA 3NVDA 2WJAA 5BMVF 4KVAA 3WMRA 4ETIA 1ZPDA 1LDEA 1MOZA 4PFQA 4LYHA 3BT7A 1I6MA 4HGPA 4LY3A 2GTPA 4HVLA 5DP2A 3DDCA 4JLVA 3VTAA 2AZTA 2KBFA 1J9GA 4F8EA 4MUBA 1G64A 3K5IA 2AEFA 2YCLA 5C1DA 1GGMA 2ZETA 3ZE1B 4I1SA 4B2IA 2M6LA 1IN7A 2XYRA 1K6MA 4AWBA 2QTHA 5HF6A 5C4MA 3IDFA 5DLPA 1P2BA 1ZJ5A 3PEFA 4BNNA 4JJ6A 1N7GA 1FUKA 3QHPA 2P4HX 2WAMA 1JQ3A 3D0QA 4I5GA 4TYPA 4RETA 1JJ7A 2UYGA 3FPHA 3IQHX 2ZGVA 3D2CA 3JCZA 4ENPA 1X8KA 1F7UA 1UXIA 2UVDA 4ZVQA 3W2IA 4BQOA 3TZBA 3ZIUA 2LY4A 2W6NA 1EIZA 2IZOA 1L9XA 4C0HA 1R50A 2RBGA 4KDRA 1BA2A 5EKTA 4KKVA 4UUQA 2IS1A 4OQEA 1ZRSA 4DQKA 4EMBA 3ILVA 3VZPA 1XSEA 2BISA 5DNWA 4CTJA 4NENA 1K6XA 5JXGA 1E60A 1G3QA 4IDEA 4GPTA 1ESCA 2FJPA 2VQFB 3ILYA 5HKBA 3QXHA 3HXMA 3MTAA 1R0SA 1CUUA 3FYSA 3LKDA 5D86A 1GQYA 3D64A 3U4AA 3PQFA 1EP2B 3M83A 4WZ6A 2IEYA 4HH4A 2Y9MB 2Q2VA 2BKVA 3TI7A 1K9SA 4ECAA 5KOHA 4ZO7A 4WZBA 3T3HA 3L3BA 1E5XA 3NHPA 2VH1A 3NASA 3MG9A 4FYVA 4UOZA 2WB2A 2WM9B 1B4DA 3L92A 1G63A 4D9EA 4ZK2A 3L93A 1NXTA 4OK5A 4GXQA 4NYIR 1GPMA 2FHSA 3TZCA 5C9ZA 2YS6A 5A4DA 4LC1A 4DM7A 3VPAA 1P80A 2VHVA 5BP7A 2LIVA 5FOQA 4JQZA 4RLHA 3DCIA 1ZN2A 3N2GA 3P2OA 3AB7A 1VZ2A 1J5EB 3GG9A 4MI3A 3BVPA 1J8YF 3HKBB 3P9QA 1NU6A 4BLVA 3I9V1 1QUEA 4MRNA 4YLYA 4JLAA 1KF0A 1PG2A 2BOVA 1E7MA 2E6KA 2ZUCA 3HB4X 4GPZA 3I1JA 2OP0A 4XVRA 5DNVA 1RYYA 2VRWA 2WHXA 3VVBA 1M1UA 3WADA 2C54A 2AC4A 2FEMA 2X86A 1U2GC 3AF1A 1QGZA 3VYRB 3O2QB 3GMIA 5GVRA 5IF9A 4Y9SA 3SI7A 4WECA 2N0SA 2ON6A 3C3XA 4J7CA 5L6MB 2A5GA 4C01A 4GOXA 3W5BA 3PZBA 3TOVA 3WA7A 1QTIA 2BJHA 3R8XA 1H4SA 2XA2A 1EP1B 3OZVA 2I4NA 2Q2NA 3A9UA 3BJEA 2WFZA 2CJWA 1UK7A 3DM9B 4U2CA 3SFVA 4O2BB 5EWJB 5AOCA 2FPGA 3F3SA 4P08A 3NHLA 5JSFA 1VC2A 2JAPA 2VSOA 4CUZA 4DR6B 2EVWX 5G0VA 3AHJA 4EO9A 2QUAA 3OIWA 5KBYA 4NECA 4UDXX 2FMTA 4XRRA 3JWPA 5B7GA 1P0CA 1WA5A 2ES4A 2VZ0A 4HFJA 5HCIA 1KK2A 3IAFA 1PFVA 2AMFA 2C4TA 4LS3A 4BFZA 4XRGA 3BIXA 4RKRA 2PZEA 1XTUA 1EZZA 2DHCA 3ROZA 4ODIA 4WBNB 5DM60 4O4IB 3PRHA 3IJ5A 4F45A 4JIMA 4POOA 1YI0A 4KQHA 3FX2A 4G5HA 1K1EA 4M0EA 4QYIB 3T5CA 1QRVA 4R51A 3TZQA 5AJZA 4IQGA 3P26A 4JJIA 1KAGA 1E6KA 4RFSA 3RS9A 4KNYA 2CLIB 4IOJA 3SDSA 1QP0A 4KAFA 4JJZA 3C6ZA 4K5QA 1PWYE 4XCXA 1NY6A 1OU4A 4I55A 3Q40A 1S7CA 1TKRA 2W4QA 3MWGA 4YALA 4C9BA 1GGJA 1UIRA 4J4TA 2B83A 5JNUA 3TSYA 3W9SA 3AI2A 3V8RA 3WHKA 3AFOA 2XKAA 2Q5JA 1YD7A 1H8EA 1N2CA 2WOJA 4N6GA 1I01A 1OREA 1U8YA 4R9UC 5EE3A 4OKIA 2X13A 1LNZA 2CXHA 5AW5A 3OESA 4RPIA 5AUQA 3BRWA 4EYKA 1WHTB 2F2TA 1TDJA 2Q3MA 2Q99A 4RF2A 3LC1O 3A4VA 2HK6A 4QJ3A 5JAPA 2VJBA 4C6SA 1M2WA 2IYFA 2WSBA 3AUFA 4UDNA 1MEJA 4NULA 3V1LA 3RIYA 3PEYA 3DXYA 3VC2A 2AX4A 1SPBS 1UZNA 2XE4A 3I8SA 1Z7BA 4BBAA 3W5DA 1OTHA 1NI5A 3M6XA 1TRHA 2BP7A 4BO2A 4LBWA 2I4OA 4TWJA 2D3WA 2IZ1A 4EP1A 2ILVA 2CUZA 1BDJA 1GPLA 2NSDA 4JHXA 3BULA 1GAWA 1W2HA 2NPIA 2V9CA 4J03A 1PWXA 4A6XA 2Q6TA 3HRKA 1UZMA 1UBOS 3D8UA 3N74A 3L1JA 4ZQFA 4A6PA 1I9GA 1E3JA 3PR3A 3K4HA 2XKKA 5EIXA 4X5OA 2ZUVA 2C61A 5E7JA 2IPOA 1PJLA 1UPBA 2OTCA 2RC6A 3DZFA 4DLZA 3MTGA 4DLSA 2OXEA 4IIHA 3EVAA 5TIIA 3IR5A 4YRNA 3U16A 3GLGE 5IBQA 1JKJB 5FYQA 1TJYA 5D1NA 3KR1A 3OFJA 4HWOA 3EFOA 1XP5A 3QVJA 4WOPA 1AO3A 3E22A 3ROXA 1BXRA 1R88A 1QGUB 3PRYA 5DK4A 4JEIA 2OBXA 5SYNA 4DAEA 4GOJA 5LXTB 3MUOA 2ZRAA 1Y42X 1E6WA 1Q50A 2VPQA 3DBHB 5HE9A 3DKKA 2Q4EA 2H3EA 4CTKA 3FYHA 3WOVA 1EESA 1CUVA 2OFOA 2IY8A 5AYVA 3DM5A 3IUJA 4B0PA 5GJCA 5CNMA 5E4JA 4NZZA 5EP4A 4C0XA 3C87A 3MJVA 5AHRA 3DFZA 1UFQA 1O97C 4FZRA 3Q3CA 3A1UA 4B3MB 3UN1A 2O8FB 2OLJA 4OB6A 1JR3A 2IEGA 3B6KA 3G2PA 3O1IC 3WL7A 3MLEA 1O2DA 1PSDA 5AK3A 4FDTA 1E99A 4CNQA 5J43A 3RWOA 3EPPA 3TE6A 4B4VA 2ENUA 2WSMA 1KYXA 4S0XA 1HI9A 2RAVA 3OT4A 4UUNA 1RLMA 1UUFA 1XZAA 3W4IA 3DNFA 1ESEA 2NV6A 6Q21A 1XPJA 2IY7A 4P3KA 1EIWA 1FJXA 3H1FA 2QXTA 2G88A 1OFIA 4ZCLA 1PP4A 3E4DA 3DT6A 4P5PA 1UWVA 3DBVO 2EL7A 1SVSA 1V9SA 4W9NA 2ZWPA 2DBVO 4FWBA 4P38A 4HAUA 1YXMA 2BLNA 4ZEOA 5CDSA 2BTEA 4OA8A 4BOYA 4TL7A 3N3AC 2H2HA 1K86A 2A8YA 4RK4A 1XQXA 3K6JA 3LLCA 2KLBA 4MEAA 3AP3A 4HNAB 3DTTA 2MWMA 4N5NA 3U4IA 2QG4A 5C1BA 1NX6A 3GGGA 1SK9A 3BJMA 3JSXA 5G1PA 4EO7A 1D6SA 3CRQA 1HYQA 5JD5A 4TXNA 4C4ZA 4UZEA 2G76A 1FUIA 3IPXA 3NWPA 4TVSA 3KJQA 4QU9A 1USUA 2CB9A 4QOIA 3V4PB 3VVMA 1JZSA 2BD0A 2XSZA 3G8BA 4GZ3A 4QT0A 1Y4ZA 5DSTA 4ENQA 1J06A 1OQAA 4JDUA 2W11A 1UWCA 1HDEA 1NV8A 2R68A 3JQBA 4Z9YA 3UCXA 4ZDJA 1NXPA 2BJVA 4LJ7A 3OHMA 4P33A 3A1TA 4FSHA 1X1EA 3C16C 3FHCB 5I7EA 1OWOA 1P2SA 3AOGA 3E3OA 1NHNA 2VRBA 1RC1A 5FHRA 5CFOA 4DJJA 3HB9A 4GR9A 3EK2A 3IILA 2EF0A 1M2GA 1XWWA 3QW4B 1INLA 1YRYE 3SC6A 2GX6A 4G5QA 2FR8A 4CKBB 4EKIA 3KDAA 3EHDA 1IQPA 1Q1GA 4CCSA 1JHRA 1T2NA 1YRLA 4MW0A 3HZOA 1GNVA 4E6PA 3BOSA 2I76A 2O2DA 1QGDA 1KYVA 3C74A 1QQ5A 4TV8F 3R7WA 3NOOA 2H5EA 3OQVA 1ZKMA 4B6FA 1V3TA 3IP5A 4A73A 2PSFA 3BICA 1Z83A 4XIIA 1BZYA 1I3KA 1XG5A 1RABA 2E1RA 5CDGA 1E1YA 5KYWA 1M74A 1ZEMA 2NAPA 3A4TA 2NU8B 4PAGA 3R3JA 4CN8A 2WF6A 4MWTA 1VP3A 5F1KA 1AM4D 2I2CA 2P2GA 4OHPA 3NM4A 1GQ2A 3P27A 4RVUA 3SJBA 4OI0A 2AE1A 1JXOA 4Y6RA 3ONWA 1UR5A 1UBEA 4DCPA 3QWAA 5E1BA 5JROA 3EC2A 3ICWA 3B85A 4OMUA 1BVHA 4WA8A 1CZNA 1MUUA 3K73O 2CN1A 2WF5A 4ESOA 4ALKA 1JG1A 4XD7A 1GQOA 2RGAA 1IHUA 1DARA 1GNPA 1KGSA 1OJ7A 5CG2A 5CJ2A 4BAZA 4RWZA 4YJGB 2FFAA 2MTBA 3B1KA 3ADDA 4R3WA 4RMGA 3IVMA 1P9OA 1E3TA 3VYVA 1ZICA 2QMQA 2OCBA 4M46A 4R7TA 4KQFA 4CQLB 1BN6A 5B36A 1FYEA 3IP9A 2C03A 5CLGA 4BO4A 3CLVA 3I0MA 4GWGA 3AOEC 4EW1A 2QXUA 3H5OA 3UCFA 2ZB4A 4RVDA 4XOIA 3R3XA 1QOPB 5JVDB 1QWOA 1KORA 3OM1A 4LJ5A 2GR9A 4PYMA 2F3PA 2H85A 5PGMA 3J80A 1GG9A 3DG9A 1PFYA 1LI7A 2F6RA 2GEVA 2YZ2A 5HF9A 3TG8A 3JVDA 3VC3A 3KQSA 1GZDA 2JLYA 1VXRA 4EK9A 2HRQA 1K4KA 1UEJA 4MW4A 1PR9A 1JTEA 4L5BA 2G3YA 5CDUA 5JZVA 1DMSA 1R74A 5TPZD 2R84A 2J5RA 1K7FB 3GLHE 1VG9B 1VL6A 3H2BA 1J70A 3JS5A 5ANRB 3PGMA 4J94A 2FWMX 4HG2A 4AICA 1AK2A 1JG7A 1NMEA 4DLTA 4DLVA 1E5LA 4Q7KA 3IOYA 3QVGA 3ZHZA 2IY9A 3O4JA 2AN5A 3CUVA 3KT3A 1HMAA 1EQUA 3H9GA 4KACA 5KAMA 1SAYA 4YRSA 4CLOA 4U6SA 2CV0A 1UPFA 2YIDA 1UDXA 1AQIA 1E69A 7MDHA 3OTOB 2IZ5A 2QB5A 3K8ZA 1KR5A 5AXAA 4G9BA 4G89A 2B9VA 3ESBA 2PNJA 5IN5A 1VDMA 1U7DA 4OXXA 4PNHA 3ZD8A 1WUTA 2BEWA 3JALA 1TB4A 3VKHA 4L9SA 4MNTA 4LFCB 5AM5A 5L3RA 4ZYXA 4KK4A 1U0GA 1TC1A 4BKUA 1QUFA 1OBVA 4PYRA 4DPKA 4BKMA 4MWEA 3IBYA 2IU6A 2VYVA 4RF4A 3NBZC 2QSYA 2YJ6A 1A5SB 1AZSC 5C80A 5HX7A 3RS5A 1B7GO 1XBTA 3AEQA 2L19A 3PWSA 5JD3A 1ZN8A 4MO2A 5GONB 5BPHA 5C46F 3CHYA 1SJ9A 3IPAA 1O94A 1NJFA 1KSHA 1V8BA 1TLTA 4G0OA 3ROGA 4BX3A 4TLMB 5AW7A 5K3CA 1FJHA 1TU3A 5JJKA 3SYTA 2XYQA 2RI1A 4PONA 2KMLA 1QFSA 3BQNB 1YVEI 3CNNA 1EFPA 4O33A 4DKXA 1EJ6A 3DVAB 4PXAA 2NO1A 4D8VA 4K6FA 4BRZA 4GP6A 2PGOA 3AILA 1N7JA 2H3HA 1KOFA 4H1UA 3LKZA 4NBTA 1AVTA 3MS7A 3GRYA 5LZ8A 1HT2E 3AUAA 4GECA 1R0LA 2J30A 4GWKA 2BCEA 3A1SA 1N2ZA 4XDZA 3SICE 1TUEA 3ROQA 2C4NA 4L50A 3UMVA 1P77A 4O4IF 2AW5A 1NYLA 1L4MA 5CA0F 4ZREA 1X7HA 1CQIB 1M8GA 2V54A 4N3NA 1U7TA 2F59A 1JBEA 4P7KA 3BRQA 5KQMA 1L7PA 4HR7A 2H2GA 1J5PA 1ST2A 4HGQA 3IAXA 3ABOB 1WLSA 4J16C 1US8A 1WIWA 3LO8A 4Q5IA 2ZE6A 4J49A 1Z34A 2ZULA 2RG1A 3OY7A 5CIQA 2J9YB 4JKYA 4NBWA 5GV8A 1SXHA 2BFPA 2ZTVA 5B1HA 5IJXA 3UMGA 3CZ4A 5AHOA 3DNMA 5EJIA 1D03A 3LC7O 3HN7A 4OATA 4W1QA 3WQHA 1OB5A 4R0NA 2JGAA 1QAQA 2LR0A 2HIAA 1ODLA 2XW6A 3HMQA 4TX1A 1CEEA 3ADCA 4C08A 5FBVB 1SR8A 2WWYA 5HFAA 2PKQP 1H9AA 3GWGA 4KK3A 1UOPA 1B14A 2C9ZA 1SK8A 4KJZA 3ZGVA 4AZ0B 1XFDA 2GM5A 1VRVA 1AZLA 1E2NA 1JAXA 1T4CA 1MAWA 1Y33E 2FQQA 2FUNB 1QH1A 2FPKA 4QGBA 5DLQC 2JFWA 4Q24A 1WMSA 1KPHA 3RS3A 1GTJ1 2ZJ2A 1UBTS 2G40A 2VUUA 4GKKB 1KSFX 2ODNA 4ZVOA 1U1CA 4A26A 1PHRA 5G0TA 1KPGA 4G5OA 2GBLC 2C7QA 2PGAA 3L4JA 1T6BY 4NOKA 4L0MA 4G86A 4JU9A 3OCVA 1G5RA 4GMFA 2BONA 3I9KA 2VHEA 3WLRA 3DLPX 5EJAA 3GEPA 2OV4A 2C2MA 3MVEA 2AN9A 1L4GA 2ZXEA 4I4TA 2Q4RA 4JQOA 1QCYA 2VPPA 2YHIA 1D2HA 3A11A 3QPBA 4G1FA 5A5VA 1XRNA 1OHHA 4NR0A 3RABA 3U80A 3HNRA 3DUFA 3L7AA 4F2DA 1MCZA 1V9CA 2Q4BA 3L1UA 3LCUA 3QYFA 3J81A 2Q7OE 1AUXA 1U5AA 3BB1A 4JBIA 4WASA 5LXTF 2ORYA 3WIUA 4RQTA 5A9RA 4OGWA 3AVOA 5KC9A 1D4AA 3FR8A 4G1EB 1X14A 4OCZA 5BQ3A 3OTWA 2RGWA 4B3DA 1NG9A 2D7LA 4U4AA 4AJ2A 2A1TR 3OZRA 1H2HA 2KLHA 4RDHA 5LZ5A 2XCOA 4MZXA 3WNVA 3ICQB 1AUPA 3DKPA 2EW2A 3O31A 2W93A 2DECA 3IA2A 5EHXA 4IQ0A 1CHDA 3ZDCA 4MV3A 1GNSA 5KOHB 1RI3A 3VU0A 4Y2PA 4G4GA 4EF5A 2I2BA 3KPWA 1QPZA 3D6MA 1CUFA 1QQ6A 5CAEA 2B98A