1IDOA

I-domain from integrin cr3, mg2+ bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
184
structure length
184
Chain Sequence
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the A domain from the alpha subunit of integrin CR3 (CD11b/CD18).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
molecule keywords INTEGRIN
total genus 71
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 1996-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1idoA00
3BN3A 1U0NA 3V4VB 1LFAA 4C29A 4C2AA 5E6RA 4C2BA 5KYWA 1CK4A 3K72B 5KYNA 4HQNA 3VI3B 4A0QA 1N3YA 1MQ9A 5HDBB 3PPYA 1IDN1 1M2OA 2ODPA 4IGIA 5ES4B 5KYWB 4MMYB 1UEXC 4Z7QB 5KYYB 3EGXA 4G1EB 3NIDB 3EFOB 1MHPA 2I6SA 2VDNB 3ZDZB 4MMZB 3ZQKA 5KYUA 3EH2A 2XWBF 2VDPB 2QTVA 1N9ZA 2VDLB 4MMXB 3TVYA 1OAKA 4NENA 1YVRA 5HJ2A 4WJKB 4HQOA 3PPWA 4XW2A 3BQNB 4Z7NB 1JLMA 3M6FA 3EGDB 1IDOA 2VDKB 2XGGA 3HXQA 1JEYA 2ICAA 2VDQB 4WFQA 1PD1A 2NVOA 1ZONA 3EG9B 3EG9A 1M2VB 3T3PB 1MF7A 1QC5A 1JEYB 2VC2B 1ATZA 1JV2B 5HGJA 5KYUB 1NA5A 1PT6A 1ZOPA 1AO3A 4NEHB 4UM9B 5KYXB 3NIGB 1PCXA 2VDMB 2O7NA 1JEQB 3ZE2B 2VDRB 1U0OC 3EH1A 1T0PA 5E6SB 2IUEA 2NUTA 2VDOB 4WK0B 1XUOA 3EOBI 4JDUA 3BQMB 4HQLA 1RD4A 3EFOA 4F1JA 4Z7OB 3K6SA 1U8CB 5KYYA 3K71B 5E6RB 3TXAA 1BHO1 4HQFA 1YVPA 4HQKA 4CN8A 1MQAA 4UM8B 5LN1A 4IXDA 2NUTB 1V7PC 3EOAI 5E6SA 2XWJI 2ADFA 4CNBA 5BV8A 3ZDYB 3F74A 1TYEB 1MQ8B 1CQPA 3E2MA 1XDGA 1L5GB 3K6SB 1RRKA 3T3MB 3N2NA 1SQ0A 1BHQ1 3TCXB 1QC5B 3IBSA 3V4PB 1RS0A 2NUPB 1M2VA 1RTKA 1AOXA 3F78A 3GXBA 3HI6A 4DMUB 1JEQA 4IHKA 1PD0A 3IJEB 4UM9D 3ZDXB 2X5NA 5KYXA 4WK4B 1Q0PA 3EGDA 5E6UB 2B2XA 5E6UA 4O02B 4BJ3A 1T6BY 1MJNA 3PPVA 2WINI 3VI4B 3RAGA 3ZE0B 4F1KA 1XDDA 4FX5A 3HXOA 1M1UA 3FCSB 2ODQA 3ZE1B 1SHTX 2NUPA 1ZOOA 4M76B 3NIFB 4WK2B 1IJBA 2I6QA 1M10A 1FNSA 3FCUB 1IJKA 4PN7A 3PPXA 1AUQA 1QCYA 3EGXB 3TW0A 2I91A 1M1XB 4G1MB 1FE8A 2M32A 2WW8A 1DGQA 1DZIA 4NENB 4CN9A 3QA3E 1SHUX 3Q3GE
chains in the Genus database with same CATH superfamily
1HOTA 4B5LA 4YV0A 5JXGA 2O54A 3I92A 3BN3A 1QNFA 3PLAE 3CPEA 1KDYA 1X38A 3RKRA 3AUJB 3S5JA 2VK1A 5DBEX 1WUKS 3KO8A 3WLMA 4LJKA 3L7MA 5KWVA 2F9MA 2PH1A 1T5IA 1ONNA 1L8LA 4YECA 5DCUA 2QMEA 4HR7A 5HBRA 3FNHA 1CNMA 5LA6F 4L8VA 5C1IA 4B9EA 4D5GA 4E31A 3SJBA 3Q7IA 5DX8A 4F86A 1G5QA 4Z7QB 1PSDA 4J0GA 2NU9B 2FQXA 1Y3DE 2J85A 4BOYA 3KE9A 3IE2A 5DB4A 1GG5A 3OQJA 4G67A 3IAM1 1U02A 1CQZA 3QVWA 3H2KA 3OOHA 4ZEXA 1L4YA 2PWBA 2YDYA 3E9NA 4IEIA 1ZK2A 2UXBB 2RGYA 2CXSA 5T8KC 4RIIA 1P3DA 3RTEA 4DUZB 4P4GA 5G0VA 3A14A 3TVTA 3OX2A 2VH1A 3OC6A 2LKDA 4XX0A 4JENA 5LXTA 5I51A 4RESA 4WGFA 1T9ZA 1KZYC 4CMEA 1X94A 3F6RA 1KI6A 2JI4A 2F1JA 5AM5A 3V3TA 1QTNA 3HCFA 3U7EB 3S28A 1G2IA 1YJ5A 3F5MA 3QKIA 4RA6A 5HM6A 1LPBB 2PMEA 2A57A 1I33A 4HB2A 4URHA 1IY0A 1H2XA 4IIJA 2H5JA 5DHQA 2BUAA 4M1MA 2VJYA 3WC4A 5E4JA 2H7XA 2AEJA 1B4DA 2Q46A 4RNDB 5H8WA 1Y80A 3NGLA 4MB2A 7REQA 5JFTA 1VPLA 2HGSA 5HTKA 2ZYVX 1H69A 1THMA 1CEYA 2RI0A 4YV7A 3U44A 4ND5A 4M6WA 3L6BA 1UDAA 3N7AA 3U0BA 4CDGA 1LX6A 1JSZA 1RBZA 4KACA 3LT2A 3S55A 4TMXA 2SKEA 4YRDA 4WBNF 1J24A 2R6CA 1Y5LA 2Q50A 3EC7A 4ETIA 3Q3VA 1FSZA 5TVGA 2IS6A 3TLAA 1GLGA 4ZOLF 2FJUA 2FN9A 1GG8A 1GA1A 2BEUA 2W4IA 2P5TB 2ZYRA 1WY7A 4KSYA 5EHGA 3ZTYA 3RE1A 1BHQ1 2F6RA 2FEMA 4PGAA 4C7VA 4HH3C 2XD9A 5I9IA 1THTA 1GTVA 5HNKA 1S2IA 4Y1RB 2JI7A 3PC7A 4KE6A 4C6SA 2WFAA 1WMDA 3IKTA 1CR2A 2BTQA 3UAXA 4R2MA 3A70A 3FCEA 1D2EA 4GPTA 5LUBA 3WGQA 5JSHA 1WR8A 4B6GA 1RMQA 4F1KA 3Q3CA 5A02A 5HKBA 1U6JA 2DY0A 1QIHA 2G08A 5LD2C 4DJDC 1TZMA 4EOGA 4P38A 4U3JB 3SXJA 3LBYA 1M10A 1RRMA 2I2BA 3FLBA 4Q1EA 1X39A 1QF9A 2QL5A 2JFWA 3FB4A 3L06A 5ALOA 2O5EA 3NBKA 2CVHA 3RT7A 4YMWA 3C1OA 3NEJA 3I04M 4Q7QA 1KAGA 2CD9A 2VNKA 4C04A 5TQ2A 1DZIA 1P74A 2PA3A 3DBLB 4EIWA 4CLDA 4BX3A 1BQ4A 1OZGA 1U8FO 2GZ1A 2I2AA 1A1SA 3AHGA 3BFKA 4LVUA 3HRIA 4WY5A 2DFDA 1KE2A 5LQNA 2NU9A 1SCKA 1T36A 2A14A 3E05A 3BT7A 1HX7A 2V45A 3A2LA 1WHSA 3M5PA 4M1EA 3KT3A 1TE2A 4QSHA 4R9VA 4NZZA 3ASZA 3ZWOA 1G8FA 1LQ2A 1UMDB 3S1LA 4MVYA 1R00A 3PUWA 5L95A 4P22A 5DHTA 1IL0A 2J9RA 1IG0A 1TYBE 1P4GA 4FJ0A 1DXOA 4MJXA 2IHYA 4MVJM 5IARA 1ZEJA 1BXZA 5EIFA 5CCDA 3WGUA 2ST1A 3UJBA 4JJIA 3FRJA 4ERXA 2I6SA 1CDEA 2ZRDA 1MFZA 3TLMA 4DRZA 4E94A 1KPHA 3RH0A 4NCKA 4F4HA 4CMKA 3N76A 2VF5X 2Z9CA 2B2NA 2GWHA 1ONBA 2IS1A 1G21A 3D81A 3GO4A 3LT5A 5U1PA 1AMOA 2YWHA 1IM8A 1DDOA 1TZJA 2F64A 2HMVA 1A2KC 2O1XA 2XVMA 2ZI6A 3SQMA 3EWIA 3EMVA 4MV7A 1ZMTA 3G89A 1DWUA 3A26A 3H83A 3NWOA 2DM6A 3UMVA 1RI3A 2ZROA 3EXAA 3R20A 3R3ZA 4UJ3A 2V7PA 3OF5A 4WNYA 5G40A 4KOEC 3CR3C 2QTVB 5GJWC 2HNKA 4A0RA 4XWOA 4W5TA 4LC9A 3LUFA 2HA4A 4I50B 3DMTA 4RACA 3TAHA 1SZDA 5KYGA 3EGCA 3FM9A 1RADA 3DE6X 4NEGA 3WK6A 4B87A 2C3OA 4RV5A 3BWBA 4YRMA 3QU4A 1EBUA 1U5BA 2Y1LA 1CP2A 2NSLA 1R9NA 1WSBA 3NHBA 4QOFA 4N5DA 1JHYA 1Y1LA 4PAWA 4R2HA 2CNKA 5GADl 2P2ZA 2AI2A 4JOBA 2ZIUB 3T7AA 2HH9A 1AHPA 3TOVA 1L5HB 1OIWA 3OH8A 5IJ9B 2H7VA 3EUAA 1Y9EA 2R0QC 2A5JA 3BSYA 3WSWA 4ALIA 4CQNA 2NYUA 1G8PA 1TW2A 2J7PA 4W1PA 3AVTA 3KRTA 1L1QA 3TQCA 2B5WA 2GPWA 1KVSA 2OHFA 5TDHA 1GUDA 2EW2A 4LNUA 1MQAA 3KZ1E 3W3AA 2WMYA 4PX3A 3W78A 5AESA 2HF2A 5TF4A 4DMHA 2CUNA 1AK2A 1XEWX 4UC0A 3ZR4B 4NBVA 4QM7A 2POCA 1EFHA 4M3NA 3VZBA 2PMFA 3ZLBA 3OZXA 1VMIA 4GRAA 2IQ5A 1G21E 5DNYB 3PA6A 3PL5A 5IEBA 4I3FA 1H66A 1E5XA 1JHAA 3KYBA 5HHTA 3KX2A 3EISA 1G2OA 4NX2A 5ITVA 3HR4A 1TYZA 1NXOA 1DI0A 2P5YA 2ZTLA 2PUEA 3U37A 3MUFA 2K7ZA 2NXWA 3R0JA 1QH9A 3F6BX 4P7GA 4F3NA 3UKOA 4TMWA 5EXDA 4ESEA 2ZBEA 1JG2A 2H54A 2Q3EA 4Q05A 4UTRA 3UBMA 4MDFA 3A1TA 9GPBA 4J75A 1WF6A 1TCVA 2JHCA 4R0MA 3VZCA 1IJBA 1BS1A 1X1RA 4I9FA 1HE3A 5G4KA 4JT2A 4ZHSA 3WMGA 4F21A 1ZGJA 3WB2A 1LDBA 2R4QA 3H13A 3TQHA 1YQQA 3WGZA 2AG5A 4HUTA 1UOOA 2YV1A 4NENB 5TGTA 4CQLB 1ONPA 2Q5EA 3SYNA 4GQBA 1JQDA 1Q0HA 1Z2AA 2V5UA 3CUYA 4HF7A 1K89A 4QD3A 1X8XA 2XMZA 3HLTA 3EZ2A 3JD3A 1RI4A 3FDFA 4U8GA 1A7JA 1T9GS 1I32A 1LY1A 3CRQA 1NJ5A 2H9AA 5DHUA 5FADA 1D7OA 3TE6A 3WKBA 3FOFC 4Z51A 3K92A 3I28A 4C14A 4YH1A 1CIJA 1D9XA 2CFSA 3GP5A 4F3TA 1FU4A 3LDFA 3V32A 3JVDA 4RY2A 5DMXA 3H3JA 1WVIA 3UENA 1XZMA 2QTAA 1DKOA 2O2GA 1XVTA 3DO6A 3L7YA 3QXSA 4JQSA 5TLSA 1K6MA 3R6LA 4K2HA 2I9KA 1B26A 4G5FA 5TV2A 1JB1A 4D7AA 2QRNA 1MC1A 3B1YA 4MQ5A 4LIPD 1M8FA 1V8ZA 2FRDC 4ZDWA 1AD2A 4ZVUA 5K0LA 2V96A 3DDSA 1O2DA 1G20A 4ZAWA 1RAFA 1NC3A 1DRKA 1ZBQA 2PZKA 4PE5B 4Z6KA 2HIHA 2WKQA 1FYXA 1F14A 4IMPA 2VNSA 3BB4A 1KZ6A 1XLTA 3PGXA 4NHEA 3OEEA 5ERYA 3GBVA 3KSUA 2AA3A 2UZ3A 3RB8A 3V9AA 3B3JA 1OFVA 4TKUB 2CJFA 4CV0A 4YPOA 2V0CA 1I3KA 3W5HA 2IZ5A 4O63O 4ZCPA 2PQMA 3MWYW 4MYUA 3ASVA 1KSHA 1Z6TA 1E4EA 3OP4A 2FP4A 1ODFA 1XRSB 2ZJ7A 5CPFA 1K97A 3ZWKA 1OLOA 2P2LA 2R1UA 4CVNA 3V4LA 3PQ4A 4PQYA 1NG9A 4KGVA 1YBHA 1LV8A 1JAYA 2I2CA 2BUCA 3R3UA 4J16A 2HA7A 3GNSA 3ETNA 4PZUA 3AEZA 4RPJA 1IN7A 1NL3A 1QAMA 3KWLA 3UWOA 2D5IA 5GIPE 4BO7A 4C08A 4FNAA 4L72A 5KOHB 2ZJ3A 3FYUB 3MJDA 3QVVA 4QYIA 2VYVA 1IC6A 1JLHA 1SZCA 2BKAA 2ZQ5A 3B60A 1MMFB 5CH5A 5AJWA 3L04A 1SN7A 1SKAA 2IUSA 2QG6A 1CS4C 3ELBA 4F2HA 2E5FA 2AJCA 1EGHA 1BRMA 3SDBA 3BWMA 3FUCA 3IUPA 4FFMA 4ONEA 4JC0A 4H7KA 2X5XA 2BR5A 2J41A 3N2NA 1LBHA 1BCRB 5DBHX 3ROQA 1M0WA 2O3RA 3WGIA 1WSAA 2WJ4A 3LA6A 2IYUA 1EM8B 3N2YA 3OC0A 4HATA 3UMCA 4CLRB 5KJ1A 2CLOB 2OGWA 1FRZA 4TTVA 2AOUB 3S2FA 4ASUA 1V16B 3NTOA 3O47A 3KM0A 4NYIQ 3WK9A 1ML4A 1IZ7A 2PMCA 4UTXA 1N8TA 5SYAA 3Q2KA 2J0QA 2JIOA 4X91A 3BJRA 3EXHC 1I6KA 2X2EA 2O7RA 1FTGA 1ZJYA 2FKNA 3G5TA 4IIDA 5GJCA 1Q17A 2VRBA 4G5XA 1VJDA 4FX2A 4YMIA 2GZHA 2XZPA 4JA0A 4QQFA 2EDAA 2EDCA 3OTHA 4FEYA 3V48A 3B8EA 3W90A 5IVDA 2RBKA 4BL5A 3T35A 3QBDA 4Q1FA 1LW7A 2OG1A 3LHFA 1DQZA 4GPZA 1QRAA 1TU0A 3SHQA 4D81A 4EKNB 3UQYS 4DIEA 4KR7A 2DR0A 1S1MA 4C05A 3T06B 2UXDB 2J6CA 2OM2A 1A2OA 4TPKA 1MTOA 3A9CA 4PCAA 1ZH2A 4FEAA 4R41A 3B7WA 2FI1A 3PGJA 3QEAZ 3NVKI 1GKKA 1EPUA 1N3LA 5JSZA 1F2TB 3VRHA 5JC8A 3QKRB 1G5TA 2CCKA 5HFNA 5IJ0A 4YCNA 3PPIA 5EWJB 3R3XA 2CB0A 5FX2A 3H2JA 3V97A 3R7FA 1MAAA 5K0NA 4F2GA 3VI3B 5HKOA 1DEAA 2J6IA 3O21A 5CD1A 4MW9A 4Q4HA 1U6KA 3TW8B 4RHYA 4GI2A 3G9UA 5KC8A 3N7UA 1QP8A 2OCKA 3BWXA 1L5LA 2O3SA 4F72A 1MXHA 1KK1A 1FRFS 2B8JA 3DFMA 1GFZA 4JELA 5G0TA 1E0AA 1AM4D 5F1OA 3WHKA 2GERA 2ZXUA 2WJHA 2ZBDA 3PE3A 3ZY5A 4J3JA 3KP1A 3P9YA 2WYHA 2B9VA 4YWHA 2CKDA 5DNCA 4XSVA 2MMCA 2R2AA 5AIAA 2IBMA 4I55B 3DM5A 4RADA 4AWAA 5CBKA 1YCHA 3STWA 1NRJB 1WXQA 3JAKA 4LE0A 3PQFA 5F2EA 5KYVA 2P9BA 5ALFA 3GOHA 5FP0A 2VRNA 1P19A 3DEYX 4BS9A 2PXXA 2UVQA 1DARA 1XRMA 3KNZA 4XRRA 4JT8A 3D9QX 4FCCA 4C7MA 1DC7A 2WWXA 2ZRGA 4LVNA 4Q9DA 1L7RA 3T0FA 3OFNA 3ZLJA 1HM5A 2IYSA 3C87A 4XIFA 5I7SA 2OFOA 1M7GA 3GEHA 1E9AA 3KZVA 4JI1B 1JALA 1E9VA 3VR4D 5DE3A 3R9KA 2PNFA 4G26A 2VDRB 2YY5A 4K87A 4PPYA 4EG4A 5KUTA 2XUIA 1F9EA 3QYFA 4AT1A 1M2GA 3NBMA 4UM7A 3NP7A 1JR2A 1NKVA 3GW8A 4DPKA 2QB5A 1UFRA 1MD9A 5ADHA 1B43A 2QJRA 2XW6A 1ZM3A 3O26A 1U9CA 3IHTA 4R0NA 1I6LA 4KNVA 5FA5A 3ZBQA 2JASA 4PFJA 5BSGA 3D3EA 3KT0A 2ZE6A 4FSDA 1DBWA 4QBGB 2ZDHA 1JI0A 1VXOA 3FIJA 3RVBA 1CQJA 2C4MA 4WLOA 3EZNA 1ZUWA 3AEQB 3B1JA 2D06A 2C9CA 3PFFA 2P4SA 4DADA 4PQRA 2X9NA 3CWZA 1Z5OA 1UWCA 3I39X 4WH0A 4KB5A 4OHVA 4Y1EA 4EUSA 4B3XA 2FW8A 4FQ5A 2ZTSA 4D4HA 1I3NA 1QF7A 5G3YA 2NUPB 3ZBTA 3CXUA 3QLJA 3G2HA 2ZT7A 2QM0A 4RVNA 5A05A 2XAUA 5IC5A 2ZRKA 4MKIA 5HKAA 2I4TA 1S2LA 1X7HA 2JGDB 1AF4A 2HA6A 5ALNA 3JW8A 1W1IA 3HY6A 4AU1A 1UBLS 2PE5A 3QPUA 4RM2A 3TDMA 3OPNA 1QO0D 1PG0A 2CZQA 1IM2A 3OQBA 4JBXA 4G9EA 1QVRA 3GPIA 3IB6A 1DKLA 5AVXA 5K3FB 3D7SA 1OZFA 4G4IA 2O5VA 2XQIA 4LKRA 1OASA 1M75A 4R1MA 5H80A 3U7JA 5HYVA 5TEWA 4E2ZA 3WSVA 5INTA 2UUAB 4Z9YA 2GDJA 4EI8A 2IYZA 1OYYA 3O6VA 5BT9A 2O07A 2Q0SA 1LLUA 1A4XA 3PP8A 4JEHA 1IRXA 3WQSB 2O8FB 5TSDA 1R6DA 1C4XA 5L6MB 5FV7A 1SXJC 1CY1A 2WC1A 3H65A 1Y4ZA 4LYHA 3PHGA 2FZKA 1QIIA 3AZPA 1GUFA 3ZJYA 1QVZA 2WSSD 1QH8A 1Y8QB 3LD9A 3PQEA 4OHWA 4P3KA 2CUKA 5K3SA 5IKXA 1C2TA 2GK3A 2VT2A 4MYRA 4F46A 5DHFA 3S4YA 4Y9UA 3R9IA 1RCFA 2IITA 1E9CA 5DH9A 1B8NA 1U8XX 4C3OB 3R5FA 1W8IA 2O4CA 5CXQA 1Y1KE 4QUIA 4UMDA 2HNAA 3CT6A 2G28A 3V2GA 2UZIR 4LRWA 3PEYA 1NVVR 2GH1A 1O9BA 2W8BA 3QW2A 5IJ0B 3U09A 4KPUA 3IEPA 3FRHA 4MMYB 2YOFA 5ADVA 4KDRA 5AW5A 2BIFA 4PRKA 3PV0A 4X9XA 3I0ZA 3OY2A 2I6TA 1U4OA 1AQIA 3OKCA 2C99A 3LT0A 1EFKA 1EQAA 4PFQA 4FGKA 2VT6A 2A7XA 3AFHA 4L73A 4OJMX 3V7WA 1ZH0A 4KDEA 4II3A 1QGYA 1U94A 2H92A 1TCBA 1Y4AE 3E7PA 4HX2A 1JR3E 4KQ1A 3STHA 3BJEA 2FDRA 2GZ3A 3D6HA 4K8OA 4NS4A 4ZOCA 1KMIY 1OTXA 4F60A 5JI3E 2VYCA 3CF6R 1RYFA 2FZVA 2V7EA 3HJFA 2REOA 2X13A 3IHWA 1GP2A 5JWOA 3JZFA 2SKDA 4JROA 4QOJA 5GINE 3IKJA 1B0ZA 3FHTA 1YR8A 2N46A 3I0NA 2E1RA 4QJ5A 3Q72A 4NFSA 1XD2B 4DXDA 2CLKB 1UBTS 3HBJA 4UAGA 3SNKA 3JQ9A 2QU8A 3GVXA 5B2ZA 2JGIA 2HPZA 3DSRA 1C1DA 1JKJB 4JLPA 3UT5A 3HCNA 3ZCTA 4EI2A 3NHMA 4JNKA 1TF2A 4DOMA 2ZI7A 1DSSG 1KZ9A 1UM8A 5G53C 2CK3A 4IIEA 4LPKA 2DPHA 4NYJQ 4OMDA 1HDIA 2VN8A 3AF6A 3CUTA 3AHFA 1BZYA 3UGKA 3NKVA 2NUTA 4DIFA 3GLGE 3N2LA 4RSRA 3FE2A 2UDPA 1YRAA 2GBPA 2IW3A 3W7VA 4IDHA 4HBZA 2YBDA 2OYSA 1R12A 3ZPXA 4QT4A 1HI9A 5BY2A 1RXUA 4XJXA 3QVLA 4C03A 1KEKA 2P9EA 4BGEA 3REFA 4U6QA 4EL5A 1PZHA 4KNYA 4XR9A 1GQQA 4QXAA 2B21A 3GCZA 1NV8A 3P2YA 5I9TA 5KOHA 2ZSEA 1JR6A 3QKUA 3WXMA 3RRMA 3SIRA 3DE3X 1J5EB 5SYMA 2BV3A 5GIOE 4J0QA 2H59A 1YQUA 1MVOA 2ZSAA 1J07A 2MYPA 4IYJA 4Y2RA 1PLLA 4JVSB 4FDMA 1NZFA 2VHUA 3IH5A 3DB1A 4JC5A 4YRNA 2O8NA 4PLZA 2WU0A 2REXB 3IUEA 1P4RA 1UBHS 2E4ZA 2HQOA 3HEBA 3TB4A 4BASA 1Z6AA 2QZSA 3HDHA 5CYOA 2XV1A 3M4YA 1OJ7A 1K06A 4TYQA 3RIGA 2BFAA 3WGOA 1J2TA 2A9VA 4XIYA 5BRAA 4N3GA 5LNK1 1Y7PA 2QD1A 5FAKA 3QMWA 3H2HA 4PO9A 2MSLA 2WVAA 1G8YA 5FR1A 1LPPA 4DMKA 3AY6A 2W6ID 3V8MA 3ESBA 2ZYUX 2DPXA 4OI0A 3HYCA 2G7ZA 3PPXA 2EEPA 4MITA 1FLDA 4UFOA 3TW0A 1Y6QA 3QFSA 1CRPA 2CEAA 3V8EA 4LOHA 1F2DA 4BRZA 1U2PA 4HGNA 4IHJB 5D3QA 3VSEA 3G9TA 4D96A 4JI3B 2X9GA 2QENA 1CDZA 2Y27A 3Q4GA 3RK1A 1ZD1A 2XB4A 3ONFA 3GMTA 3P9SA 4AIIA 1NUSA 3K5PA 4P9NA 4RHEA 5I8ZA 2JBAA 3FUWA 2J9ZB 4ZK2A 3Q40A 1MBZA 5EQFA 4F8YA 5AKLA 1L6RA 3MUOA 3RODA 4BV9A 4EVSA 4RTPA 1ZHHA 2QTMA 1HTTA 5B2FA 4AQ7A 3KPWA 2OECA 3U1VA 3JPWA 2AOVA 1JEEA 2IHBA 3S27A 3R5JA 2PBFA 2QVYX 5KTSA 3ZVKA 3QEBZ 4QVGA 4BCCA 2GR9A 3EVZA 4OQMA 3MM4A 3CWCA 3QRWA 4F3KA 2ODTX 4Q21A 1C8BA 1E2UA 1Q2XA 4YWJA 3TK1A 1TJ5A 4PVCA 2WB2A 1RWMA 4X61A 4ZXFA 1E1CB 1ZWKA 3MJCA 2C8KA 4A8TA 2IX3A 1SCJA 1YXMA 3GYBA 2R97A 3G5UA 4FUTA 1C30B 2F17A 2G76A 4KSCA 4TROA 4NENA 2GT1A 3FJYA 3SZ3A 1NW8A 3WMRA 4H1WA 1MW8X 1L5ZA 5JQGF 3DAHA 1ZJ6A 2CMFA 3KJQA 1RZVA 1OOEA 1L1EA 2CWDA 3KXPA 3P9KA 4I1SA 4C6HA 4O3FA 4RTNA 3PXEA 4DDWA 4GE0A 4DEXA 1W19A 2FXVA 1ZM7A 4PFSA 1U2DC 4JJ6A 1QF6A 1N5DA 3LLSA 5C32A 3FH0A 1VG9B 3PVZA 3CS3A 1K3TA 3EQ2A 1QX3A 3UTDA 2CDAA 1I6WA 2AWOA 1MX1A 1EFTA 4LZZA 3MS4A 2VHTA 1VPWA 1FNDA 1L8OA 3NOVA 1Y6JA 4DB4A 2ZUSA 2O2HA 1ZICA 3LY5A 2ZT8A 3P4UA 1EVYA 1L8QA 4KBFA 3DG9A 4DDMA 1M5RA 1E3TA 1KZ7B 2ODWA 2E85A 1VE1A 3NB0A 4MQEB 3PHBE 2HY7A 5EXXA 3SSNA 2WWRA 4BWVA 2ZSUA 3L8HA 4RTSA 3VPXA 5K6RA 3UMMA 1UADA 4B4WA 1NJ2A 1YL5A 2F3RA 4M1WA 4Q4JA 5AHWA 4XB6B 1MA0A 3FCYA 3RF7A 1TT5A 1QRSA 1T13A 1DB3A 1UPUA 3UJPA 2O4UX 4D6YA 2DETA 2RK6A 4DDHA 1NF2A 1UKAA 1DQSA 4UD2A 1NBMD 4HD8A 2VJDA 2AK2A 3HXTA 4IVQA 1O5IA 1WXHA 4KQXA 5I7AA 1Z28A 3LSYA 3BK7A 1TZCA 1EESA 1AQJA 4WKOA 2O7QA 1K9SA 1RYYA 4G5OA 1IB0A 2B2XA 4WLEA 1TW3A 1Z8DA 3AEUB 3GD5A 5SICE 3RAGA 5JD4A 1PNRA 2Z8ZA 4F8JA 2PZLA 2N42A 4BNZA 1Y3BE 2XCIA 3WLPA 4BGUA 2EKPA 3DPSA 1YZQA 3M9WA 2NSJA 5UKDA 1GTJ1 3GVCA 3OJFA 4YNBA 2CL6X 1H1LB 4YRPA 1KWGA 1N25A 2FZLA 2PMBA 2WW8A 3EIFA 3HRKA 1A69A 4G5YA 4UCXA 1HLGA 3FJOA 4YI3A 5T5QA 1P5JA 4FR2A 4NMLA 3TWOA 4KXXA 4MWEA 3FF4A 4DUPA 4F6RB 3EWAA 1B0PA 1RQNA 2QS9A 2Z04A 2X15A 3FYUA 1KI4A 4Q48A 3RQIA 3GLIA 5AUQA 4B09A 4FHEA 4RQTA 3ONVA 1ADYA 1EEHA 2OGUA 1SA0B 2G04A 3I64A 5MF6A 4PWYA 3MAJA 1Q14A 2HMWA 4MGIR 3U4MA 4FHFA 1P0IA 3TOZA 3QPCA 4PYNA 16PKA 3BZUA 4OMUA 1XTPA 1MQ9A 2JEOA 4WADA 4I6EA 5FPTA 1FFCA 5THXA 2WLSA 1B00A 4AMZA 4DIUA 2VTBB 1MJFA 1EVEA 3OESA 1N6OA 3UK1A 5F98A 4IV8A 2OO5A 4PPGA 1Z15A 1P61B 2G1UA 1ATIA 1YDMA 2RKOA 4HAXA 5DASA 4UHCA 2YX1A 2H5LA 4L5CA 4B9AA 1T5OA 5DCYA 1PEAA 3K1JA 1UFOA 2B6HA 4IQ4A 4OGKA 3JWJA 5M7EA 1KJWA 1N9ZA 1EVZA 3BMCA 3R7LA 3T9CA 3GI1A 4AKHA 3UHOA 5TQ2B 4EATA 1RM3A 2LDXA 1JJVA 4PLTA 3H0KA 1KI2A 3BFVA 3O9VA 1GPDG 1G9XA 4DMRA 3H97A 3MTIA 4RX1A 5CLLA 2QY6A 5IJXA 4C3UA 1JFSA 3LC0A 1K0FA 1TYCA 2ZRNA 4DA8A 3E53A 4N5LA 4B6QA 1LFDB 2QVGA 5CYFA 4BLQA 1ABFA 2PKQO 4QG3A 1RWBA 4CT5A 2IH5A 1NHGA 3HXMA 3M34A 4HN4B 1JZTA 3A28A 3NDBB 4PX9A 2WUFA 4HK4A 1JIJA 4JBWA 1UK6A 3E58A 3CKKA 3IUMA 4XUEA 3EGVA 1Y63A 4EKDA 5CNJA 1IBCA 1MC8A 3B8HA 2VDWB 3EZXA 3GFPA 3I2KA 5K5EA 1YS6A 2FR0A 2BEUB 3LRTA 4RVHA 3DEJA 3PTLA 1ID8A 2VKQA 3MJHA 1T8TA 2WE8A 2QDKA 1D6SA 1ACJA 2QD2A 2PX0A 2HADA 4ZAFA 4AJHA 4HNTA 2J4FA 1HA3A 1NQUA 3EDQA 4HQKA 2W6PA 4OGFA 4YFYA 1JMVA 1T3SA 3PXBA 4TZTA 4CNQA 2I3BA 5DCWA 3LYLA 4RF3A 2PBRA 1RPNA 1MKYA 3AZQA 3GVPA 4R2LA 1CNEA 3PXGA 3KJEA 2KWIA 4EGQA 1HZJA 3W5JA 1N36B 1V6CA 4UVIA 1JE1A 1VBKA 3D43A 4FZ3A 4WVFA 1JLSA 5CFZA 2PNJA 3K1YA 3V4FA 2IYXA 4JP1A 2B8NA 2BDEA 3EQ9A 1OLUB 4TYMA 3CIFA 4ZOEA 1AS2A 3E8SA 2XUQA 4D6PA 4QICA 5AUNB 1G3UA 4CE6A 1GO2A 2XMRA 1GL3A 1NF3A 1XXHE 3PSHA 3S8EA 3KSAC 2PUWA 2O2EA 3V8NA 4E1BA 1IYZA 5LKAA 1JHMA 3C3MA 4RVSA 4E4TA 3EZGA 2PT5A 4O2AA 1M0SA 4QWWA 4BNJA 1JWBB 1Y1RA 3L1JA 1KJ8A 4R31A 1N2IA 1C9JA 4NSNA 5IK2A 4NZ9A 4D3XA 1SHTX 3A1NA 2PL5A 4L7VA 1MA3A 9MHTA 2Y9PB 3COYA 5E1BA 2X5OA 4RGQA 2A9KA 1ZOSA 1A9YA 4INAA 4QDXA 5C3UA 3T9AA 3Q1LA 5KTYA 1XZ8A 4U2EA 3KR2A 4TV9B 5EHZA 2J48A 3CG0A 3CMCO 5ICSA 5IXSA 3U3RA 1WPQA 1KMNA 2R1TB 3FDXA 4Y2QA 2ZG6A 3N75A 4QIHA 1NUQA 4WESB 4RF4A 3TE7A 3QY0A 1BA2A 1MJHA 3DVAB 4JX8A 1XPRA 1X1AA 3FMOB 1IBKB 3ZS8A 2Y77A 1CK4A 3BBPA 1KEZA 1R3DA 1E9DA 4MV4A 4NAHA 3OIYA 2GPYA 1V0JA 4JSRA 5JSKA 3N74A 4N5MA 3QEKA 3DMRA 1RI1A 2C61A 1W44A 3B6IA 2RGAA 3HFSA 2B94A 4BP1A 7ABPA 5AXCA 1FP7A 2JAOA 4BLTA 2EKBA 3NU1A 4KEAA 4LZJA 4EH1A 3BHIA 1NLZA 1RXVA 3PUZA 5JUWA 3IOCA 4FFBA 5EJEA 4B82A 1T4CB 1MHPA 2Y68A 1JVSA 1RJ9A 3NUQA 2HDWA 3A04A 4WJZA 2I9PA 2ZSIA 4ALLA 4BX0A 1H65A 2J5RA 4GMDA 3DL2A 3IUYA 2OXCA 1SPXA 3M5CA 4MUMA 4X6XA 2OUIA 2DTXA 2I71A 2L69A 2Y0EA 2ZU6A 1ZVMA 2NZWA 4RE6A 5IK2D 2AN3A 1TM5E 3RTGA 2IHVA 2G5PA 3CJRA 1EFRA 1AIPA 3RIXA 3BWEA 4GMGA 3U80A 1HYHA 2QD3A 2W2KB 3GRPA 5TC4A 5G1PA 1DTWB 1VLMA 3IO5A 4MQFB 2B4YA 1YZLA 2WP0A 2PZAA 4YXFA 2JKVA 4M0EA 2EW1A 4KO4S 2QX9A 1RHMA 1AKUA 2XJ9A 2CVFA 4KZPA 3KFXA 5EZSA 1E59A 2FJ0A 3AETA 2WZCA 3DDOA 2G9ZA 3EGOA 3EIHA 4PHHA 2QE7A 2WTEA 3FIUA 1CUWA 4IWNA 5LZ5A 3VR6D 2B30A 1S8OA 5IAAA 1Y34E 1ZUD1 4V1CA 1XZKA 2BHNA 1NVFA 1F2UA 4CU5A 2WV7A 3UWKA 1MAVA 1WZIA 1X74A 3MCZA 3PCTA 1MO4A 4QU9A 3UN1A 3AUTA 1XK6A 5C5CA 3HKEB 4IZHA 4CZ2A 1CUXA 1PUXA 1JWLA 4N7RA 1B23P 3OD1A 5JW6A 1H9BA 4NYMR 4CM8B 4X7PA 1RQ7A 3QNUA 2WF6A 4IOJA 4LXGA 4O8ZA 1Z47A 4BN5A 2YRWA 4CDNA 4MVJD 1ZIYA 3O0TA 4QPDA 2GBFA 2HV8A 3CC8A 1LSSA 4CTNA 1RXYA 4PXAA 2GHTA 1YACA 4V0LA 5KO2A 4JLSA 5KNBH 3M6WA 3MBOA 1PTJA 4TSFD 1ZC3A 3KKNA 3OQVA 2RIRA 3ACCA 3X44A 4Z5XA 5CA0F 5K2OA 3ZQUA 4Y1RA 3X2FA 1HDGO 3WLAA 1DMRA 1TCAA 4DILA 3PHLA 4ZHQA 1MRSA 1N2CA 5TGZA 1UAGA 4A5SA 3ORRA 4O4JF 2NU6B 1MX5A 4ENVA 4ZICA 1AUVA 1C8KA 3DLAA 3NPAA 2IOHA 2J9YB 1PT5A 1WCIB 1SAYA 2ZYGA 4WBNB 2HT1A 2QF7A 2HWKA 3F6SA 2OYCA 3RU2A 2DHQA 2QDXA 3ACBA 5B58C 3TO5A 3KDSE 3HCWA 2PRJA 3GF4A 4FB4A 1YJCA 3WRYC 1C30A 4L4SA 4F9EA 4EG0A 5JAPA 1N32B 5JDCC 1T4MA 2B0CA 2X1MA 1BWPA 1TQHA 4FP9A 4B75A 1OWPA 1BWQA 5BSHA 5JQWA 5LBTA 3DMNA 1P9NA 1YBFA 4LF7B 4LJYA 4MINA 1T0IA 4KV7A 4IJVA 5KI6A 3UA3A 1DBSA 4TMVA 4B4DA 2ZWIA 2X0FA 4D98A 2IBSA 1GAXA 1JHZA 1IPHA 1QHYA 2DWPA 3DO8A 4UEWA 4OSEA 3ESRA 3KUXA 5ES4B 1YKFA 4C0WA 1JA9A 4JBIA 4MS1B 3ESZA 4BNVA 4G0VA 2PIDA 3EODA 4GPBA 4U7GA 2UVDA 2O50A 2VDNB 5IYZF 3SF0A 3U19A 4OMFG 4WN9A 1U0LA 4DNFA 1L7EA 3CRVA 3ETJA 2FDCA 3TVYA 3BL5A 3ECSA 1AMUA 1BX0A 1PZEA 3DHVA 3DFIA 3ZWCA 1Q44A 2H4FA 4ZMSA 4JU9A 1KO4A 4L2IB 2D5AA 3P2EA 3PCRB 1FFSA 1DG1G 1TXGA 1O94D 3NAGA 1P18A 4HDRA 4OHXA 1QC5A 4OXRA 5LQRA 5FUXA 4DWOA 3OBBA 1ENPA 2EFHB 4M83A 4PNPA 5LA6B 2CV2A 1R10A 1EWTA 3ST7A 3WMXA 1EBFA 3RYHB 4B81A 2YINC 1QP0A 1XWIA 2XGMA 4UOQA 5H7XA 1U2DA 2AT1A 3WLOA 3ZK8A 3QTLA 2W37A 1AVTA 1NRWA 4RH3A 4ZI7A 3SHWA 2WKWA 1N5IA 1XLTC 2AZMA 1T5SA 1E9EA 2X8BA 5K8IA 4MP6A 3DJFA 4X54A 4Y9TA 1T91A 3BH0A 4OHOA 1VP9A 5LB4A 1NY6A 3RBAA 3WK7A 1ADBA 4B73A 4AYWA 4PAQA 1DX9A 3QF4B 1WMAA 3ESDA 3BTOA 3OG9A 2ZJBA 5EP4A 3RLIA 5HE9A 1I5OA 3HFRA 3H8SA 2WWWA 4W7HA 2ZUUA 3FFBA 2O59A 3QU7A 5J40A 4UMEA 3H7AA 4LYDA 4M88A 4P35A 3A4YA 2PAAA 2C0PA 3TPZA 3TBFA 5AQ1A 5L51A 2HQ1A 1U2RA 1NN5A 5FULA 3WV5A 2ISSD 3FHOA 4KQGA 2Z98A 2NXJA 4OP2A 1QFYA 4HGZA 4S2UA 4XQEA 3TL3A 4DMFA 1KY3A 2O3TA 1EUDA 1FU7A 3H05A 1GQYA 4OBEA 2ZM5A 4OATA 5EMMA 2YVUA 3CZAA 3DEFA 1IK4A 2OPHA 5CBPB 1UJ2A 5JZBA 3JY6A 1C7JA 1M6VB 1BGXT 1VLZA 2FPWA 2BEVB 3B1VA 3G2IA 3P20A 4KMOA 4MV9A 3LDAA 4DA6A 4F5EA 4PYJA 3V7YA 3O8QB 4WV3A 3X1WA 3GLVA 1R64A 4GW3A 4BQQA 5L9AA 4A16A 4GR5A 1NUHA 1T43A 2VP9A 2J6BA 4FSXA 4MUHA 4PPFA 4XH9B 1G38A 3U7FB 1GRNA 2X0DA 1Y3AA 1CUSA 1JEAA 1U8TA 3NTXA 1KP9A 3NWPA 1QV7A 1XF9A 1CULC 5HMMA 4UOEA 4GWLA 1UBFA 1YWGO 5KTPA 4FIZA 3B51X 2DQYA 3VO9A 1EWRA 2Y0DA 1YDEA 1VYVA 3MRTA 3CZ9A 4RZ3A 5EXPA 4PZ9A 4MTLA 3T1TA 2R4TA 2ENUA 4YYZA 2G25A 2PVSA 4X0EA 5DHSA 4M87A 3TOCA 1KAEA 1GPKA 4E7OA 2GUWA 4RANA 4A36A 2HCTA 4Y8VA 5B64A 2XQGA 3ANTA 1QPGA 1N3YA 2YIJA 4OLJA 1W29A 3SNHA 1OXUA 4IUBS 5JI2E 2LBPA 4MKFA 4ZQIA 4DT1A 4IGIA 2OBYA 4XJVA 3A1VA 1U0JA 5HZHA 2XXBA 1G3QA 1NV9A 2X0NA 4H0FA 3ZWPA 4LYAA 4RWEA 5FPQA 4LJLA 1B76A 4IJKA 3JQBC 1IBSA 1Y4SA 4CKWB 3RSQA 1KO5A 2FDXA 4JJFA 4GXQA 4M86A 5BOSA 5BWNA 1X70A 5JPCA 4PTZA 1VL2A 5DI9A 5EWLB 1S8NA 3CLUD 1MNQA 1DT5A 1T8YA 2I4IA 2JAWA 3GEMA 2XUFA 4TUYF 1LDGA 3FVVA 1RHKA 5E3JA 2NZVG 1W4AA 5FEMA 3QMVA 1HMYA 4H3SA 2J4DA 3O1IC 2JC3A 3Q1KA 1C9NA 2OORA 1NN3A 2XYRA 1KXZA 8LDHA 3I9JA 5C81A 1E0JA 2ZTVA 5LOVF 3K8OE 3IO3A 2QRKA 3N28A 3WOVA 4RLQA 5HGXA 4P7BA 2Q1TA 3KQKA 1W96A 4I55F 4IOKA 4QELA 2QAGA 4Y98A 4Z8XA 2PSSA 3ETDA 4JL8A 3TS1A 5K0ZA 2DJ5A 1NYRA 2JFQA 2WTAA 1N0HA 5DNAA 4BO3A 1GNVA 4HB0A 3FKJA 3ZCQA 5HF9A 2B9EA 3DCIA 4D57A 3BE8A 3EXEB 1I7QB 2DQ4A 1F06A 1UZUA 3PRKE 1KZHA 3SZRA 1CQJB 4NZOA 5P8WA 3P0FA 3FSEA 2BJVA 1RBQA 4MVJF 2XYGA 3OA0A 1U2TA 4TYPA 3JXEA 4FBGA 1KQOA 2X9QA 3EB9A 1TTPB 2PDAA 1XEWY 4H1HA 4BUJA 2JI9A 1R50A 2XODA 3SC4A 1DAMA 5AVVA 3RBVA 5CG2A 3THXA 2AVNA 4GGPA 4JWTA 4UFNA 4BNWA 4CTKA 4ER7A 3WWEA 2IHNA 2PKWA 1E7YA 3N87A 4II2A 2DLNA 4UUNA 5CUQA 1RS0A 5F12A 4IDNA 3ZKWA 1J23A 3TTVA 4JLAA 4Z1MD 2BEJA 4KVAA 1H5UA 8AT1A 2GKGA 2VVTA 3AG6A 4BP3A 4W5NA 1AUPA 3F0TA 1H42A 1DAKA 1PQPA 3HDGA 2PKCA 5C80A 3VKHA 1A5AB 2ZBGA 1Z5GA 3FDZB 3G2MA 4NMHA 3ZE1B 4XR4A 1J70A 3CR8A 3OIUA 1TLFA 4OFXA 3K53A 4N76A 3JAKB 3WHIA 4R5MA 2FN8A 2DE0X 3KQMA 3R24A 3RNOA 4I0WB 5REQA 3IR6A 5I5GA 5BSVA 3CEMA 4NYJR 1E3DA 4NL4H 2E48A 4QEZA 2ZS7A 1SUIA 1FX0A 1G19A 1TAGA 2IHJA 1JHPA 2A92A 3CKYA 3GLHE 4MWTA 5AXAA 4RKWA 3RCBA 5KPJA 1I4TD 1Z39A 3IT0A 4Q4LA 1KZ4A 4V0KA 2XBUA 2QRVA 1SCQA 2JIZA 5BT8A 4NDZA 2GWRA 4EG1A 4IJWA 1J39A 1RZRD 1NMZA 1RKQA 2FEAA 5JNUA 1NFFA 3UJAA 1CYEA 5A7FA 1G7RA 5EWJA 1XNHA 2WTMA 4EA9A 4UHHA 2IIQA 2SNIE 4LJAA 3BM5A 3UB2A 4CKXA 2V7UA 1NVXQ 4FOOA 1G1MA 2XB9A 4JBLA 1P6QA 1NW6A 1S4QA 1T9HA 2AJTA 3ACDA 3DBVO 3RUIA 3BULA 3PX7A 4ACBA 3MF4A 3EZ6A 4LG1A 1QIJA 4H4EA 3QGMA 1P0MA 3U40A 4TOIA 1K1EA 3ZJ5A 2XUDA 2XMGA 1ZP6A 2I8CA 1EX6A 3I4FA 1S3GA 1L4FA 4PC3A 1QAOA 5BNTA 4QGHA 1WW8A 2P9YA 2Z9BA 2ZI5A 2FAXA 4TSRA 4ISBA 4S0XA 5DYWA 3WLIA 1Z5WA 4W5JA 1YZ3A 4URVR 4MUKA 2YVQA 3HYLA 5HCIA 4WDRA 1SKBA 1Y9DA 4HTFA 3VC1A 3U7GA 1E2LA 2VQEB 4RETA 3AR8A 2JCBA 3UY4A 1EAYA 1GQFA 1WEKA 5M34A 2NACA 2JLSA 3NV7A 3R7AA 1XALA 3TIFA 5AI6A 3HFGA 2Q8PA 3NUGA 4FKBA 4FOPA 2L19A 1SVWA 3LF1A 1R7RA 2DUWA 4RMHA 1EE9A 1BKYA 2O8DA 3AUXA 1IVYA 4ARIA 5IVIA 1JPNA 3LCRA 1K92A 1XTSA 2EHDA 3NMUF 2QNIA 2PGXA 4XGQA 1DUSA 5BQOA 3ZDYB 3AWDA 4DNXA 1IH8A 3VSDA 4K3UA 4C0AC 3KTFA 3QE3A 4PX2A 1A5ZA 4GC9A 1ZC4A 4K0RA 4P0TA 3S2IA 2R85A 3HKBA 2WVGA 4ZMRA 3RD5A 3TCXB 1SU4A 2FZGA 4AUMA 2R7NA 1JR4A 5D3MA 1YAHA 4F2WA 1VPVA 3GDOA 1ZJ5A 1M33A 1QOZA 1R0ZA 3D6UA 1NP3A 3PWTA 1TMOA 1E4EB 4WI1A 4K26A 4YK7A 3U5TA 5LQMA 4ZVRA 4MKZA 2G8NA 3COPA 4US0R 3ISVA 5JJ5A 1IN8A 1Z25A 3GXOA 4ISCA 1L3IA 3WGVA 4HZGA 1D1PA 3D0OA 3TD2A 5CU7A 4HNGA 4CG3A 3GNQA 2WHXA 2I1WA 3EAGA 1R0KA 2A1TR 2RARA 1R0LA 2R48A 3Q7TA 5CAEB 4LY0A 3PGKA 1J1UA 4LDPA 4X20B 4R71A 2AS0A 3CE6A 5FA6A 1DADA 1A9XA 1G20E 1WB6A 2PZBA 3D6AA 3WAJA 1NW4A 3T99A 3TNJA 3AHIA 5K09A 2BC9A 5EZQA 2EKZA 2VRCA 3WL4A 1INLA 4MXDA 1P39A 2VF7A 1VMAA 4Z49A 1ZAYA 2I87A 2O06A 3KKPA 3OPMA 2ZFUA 3O2NA 3GEEA 4WBXC 4FYYA 4RTJA 2EG9A 4G0ZA 4O4HB 3PQ5A 4BE4A 6AT1A 1HLPA 1PFGA 2G4VA 2H3HA 3VYTB 8ADHA 2HMYB 1B73A 4AMVA 1XD9A 2Q5CA 4HQNA 3E9RA 4YCBA 3DEZA 1E3LA 2E2WA 4AJ9A 3A27A 3DB2A 3G5AA 1GKLA 2WP8J 4J2OA 3SLRA 2DSNA 2ONCA 2X8JB 3SM9A 2CFCA 3UXMA 1NJFA 4K03A 1KRXA 3V33A 1O03A 3H2ZA 3UWMA 3HVRA 5KYYB 4WKBA 4ZPJA 3GRRA 2RBGA 1ZFNA 2IP1A 4LBWA 2OWEA 2JGMA 3K0EA 2DFVA 4PC7A 1Z68A 5CHEA 3V8VA 5LFAA 1AUOA 2OC9A 3UPUA 2QP9X 2NUAB 3KV3O 3NHUA 1NBIA 3KLMX 3LBHA 5T3UA 3CVXA 5AT1A 2LCIA 4LRYA 4IQGA 3U3ZA 4F2PA 1NASA 1OXBB 3PPWA 5EG5A 4QXPA 1NVEA 2WJGA 3R23A 5ESXA 5F3RA 3I6YA 2ZDGA 1FQKA 2MHCA 4RXTA 1GSAA 1FBNA 4B32A 4BLOA 1XTJA 3D2LA 3EVAA 3LQ1A 4FSHA 3WWPA 1E9BA 3E7DA 3D02A 2OCAA 2DCUA 1Z06A 1MVLA 5ER9A 3WYFA 1R0BA 2RAFA 1Z3IX 1R66A 3KYJB 3PDHA 4K9PA 5IF3A 1TEZA 3ZNPA 3HYSA 4HSEA 3IVGA 1L7VC 1LNQA 4ARZB 1P62B 2VK2A 3QHPA 4Q9IA 1RAAA 2F43B 1RWOA 5BWMA 1H2ZA 4O0MA 4RCVA 4ZO4A 4BP9A 5AJTA 4EPXA 3GRVA 1V2HE 1UDXA 3QF7A 4IV5A 2EFJA 3AR4A 4AG3A 2WWFA 2HK8A 5BWCA 3GA7A 1E79D 1XTRA 4LQCA 2G06A 4NTZA 4FMDF 2ZGVA 1RWXA 5CRIA 1U63A 3BZWA 3I72A 4KFUA 1Z4JA 3F3YA 5CPBA 4DLBA 5B57C 1XT6A 5IT9A 4UU7A 1PJRA 1MFPA 1WV0A 3EFHA 1VKHA 2W9XA 2ZT5A 3D8SA 4MPRA 5FOWA 2AFVA 1XQWA 5FTLA 5E9JA 2HKIA 2C5AA 3AKCA 4IIVA 4B3CA 4WUVA 1SXJD 4Q3BA 3WFIA 1HOXA 1YB5A 4WOBA 4Q1DA 3CH7A 4PVDA 4KQHA 2ZJ1A 3Q8KA 2OZLA 4QDKA 3IIMA 1V1RB 1CQPA 2F9LA 2EAUA 2WHPB 3KS9A 3T34A 2QLMA 1MV8A 3D54D 1XRLA 2W2PA 1GJRA 1Q1BA 1P2BA 4BN0A 3GUHA 5IT5A 1RRFA 3W3ZB 4WVLA 4ZC1A 5KOJB 4Y2JA 2DPMA 4R05A 5A4JA 2AMYA 1G5PA 4M8LA 4US1R 3JRXA 3AFMA 4AF8A 4DLLA 5I9LA 3O8RA 2RIPA 3IJ5A 1A0OA 3TIGA 4OLAA 2G1KA 4NG5A 3TRFA 3ZLVA 3ZU6A 5A1JA 4WZAE 1BE6A 2XCLA 3EW9A 4UEQA 3ETHA 2Q2VA 2WB4A 2VP0A 5EGNA 4YP6A 5E0KB 4TYNA 4WFJA 2G63A 1RLTA 3BRWD 3VQTA 1A5TA 3HWSA 3WK5A 1R4MA 4C0XA 1FL9A 1XAGA 5FYDA 3NOQA 3IESA 5JCOA 4YDSA 4YLGA 5HFJA 4YA6A 5LZ4A 3CX4A 1FOEB 3NIWA 1MIOB 4NBKA 3RM3A 3O93A 5JS8A 1NOJA 2IIBA 1FP4A 3ANSA 2A86A 3JV7A 2EL9A 3B2NA 1VL1A 2BW0A 3ONEA 2QN3A 1BDBA 4BVLA 2H2GA 4ARSA 4Z4HA 3MWEB 1BDJA 2X7JA 4I9GA 2HXGA 3TCNA 1VHQA 2HJVA 4L4UA 3VNUA 3OTIA 2PM8A 5WRFA 1YJBA 1YMVA 1ZN2A 2ZULA 1KIFA 4L5YA 2JK0A 4QFCA 4BVBA 4MCAA 4HDQB 4A6XA 1K4KA 1DCKA 4BBJA 4L9SA 3QUTA 3W5DA 1IK6A 3GYGA 5H83A 4BVKA 2EXXA 1X1QA 3DOJA 2NVUA 2JJQA 4JSTA 3GZNA 5D01A 3RSSA 2CHGA 3T0GA 4UUAA 3AB7A 3TINA 5JRZA 4QTXA 1ODSA 1HGXA 1HLDA 2ZSJA 1Y3HA 1NNLA 3PEEA 4N49A 5KU7A 3KZNA 3AESB 2HSDA 1AKWA 2AYXA 4C4SA 1NE2A 1WCV1 3DYIA 3G0BA 3R75A 1NKTA 5AW2A 2G0TA 2YMMA 1YTLA 1JSXA 2K4MA 2X76A 1ADFA 2EJVA 3OSUA 3PR1A 3S5UA 1P1CA 3A9VA 3MD0A 4RD4A 1KJQA 1ZNYA 2P2GA 3FW1A 4ZQHA 4YP1A 2FWPA 1YE3A 3TN7A 4J0DA 4XOUA 3PDIA 2BISA 4F85A 2V6JA 2VYFA 3U49A 2PLAA 4GI3A 2WAMA 4IKPA 4MUAA 3H2GA 4RTLA 1YB7A 3D2BA 1ZG3A 1K68A 4YJ2A 2N1MA 2M6KA 3WISA 4IH9A 1ICEA 5MGBA 2O0KA 1KBZA 3L0CA 1RYZA 3EEBA 1SURA 3GP8A 2HU5A 2ZIEA 1ZU5A 3ESYA 1XDWA 1UJ4A 2ORVA 3H19A 3C98A 4PBTA 2R8YA 5KCZA 1OCEA 3MJTA 4RLSA 3M70A 4CCAA 2QSJA 4FYIA 3WDSA 1RRGA 4U7HA 4PSUA 1F8YA 1RMTA 4ITUA 2ESRA 2IKSA 2CJPA 4TTIA 4BUCA 2R25B 1QAQA 1FFXB 1ZESA 4ZYVA 2B4AA 4HNUA 3ZOKA 3HY4A 1DWQA 4Z1OA 2YJTD 3PJGA 4BBZA 3U7QB 1EFCA 3GRUA 3WADA 3NAZA 2JFXA 4G24A 3LBAA 4IF6A 3L5OA 3BX1A 5FKJA 4LQ4A 1OX4A 5BRNA 5DISB 1HQKA 4JS0A 4JU8A 2LR0A 1KETA 3I73A 1UBOS 2DCMA 4NV3A 3EDCA 2Z6QA 1NYTA 2O8BA 5G41A 4NE9A 3R44A 2AW3A 3JRNA 3ZS9A 5DOVA 2JKYA 2JGJA 2P4UA 2ZRBA 3QJ5A 4NHOA 3LKBA 2ZUFA 3C0KA 4YQZA 1TJ3A 1V9CA 2CXPA 3HUEA 3F5FA 3S7TA 4TWAA 2JFYA 3RRZA 1FPQA 1J2JA 5EUQB 1M2VA 3WSTA 3OVMA 2FEWB 1F7UA 5JASA 1U28C 2YW2A 2Z1DA 1XCMA 3D4BA 3OCCA 2I2WA 4RYLA 5HIIA 4DYHA 1ZK3A 1XHEA 3JAWA 3L8DA 1QIEA 4ZU1X 5HKKA 5IN5A 2HHHB 1XDDA 2Q0QA 4XGKA 1C1XB 1NVKA 2ACVA 2G1AA 3DQPA 1IEQA 4BE9A 5H3CA 1NXPA 1KKLA 5C18A 1QDUA 2WD7A 4OOEA 4C4TA 5FTMA 2D54A 3GPDG 4WFIA 4L95C 3T4EA 4YIHA 1JVNA 1DBRA 1H94A 1NM5A 2FWJA 3DFZA 2FPXA 1TD1A 1G2QA 1YASA 1WVGA 3EEYA 4S35A 4Y30A 4V0MA 2A78A 3FUVA 2BELA 3AR9A 5AFSA 5KYWB 1K5PA 2COUA 3D6TB 1XSEA 3N2EA 2PSJA 4KVGA 2Z30A 3DAFA 3E61A 4KXFB 4TTQA 2GN4A 3T5PA 3LY8A 1C80A 4C22A 2VUUA 2HU8A 3TZEA 2GN8A 5FWAA 1GCAA 2WAOA 5CCXA 5KNLA 3OFSA 1EFAA 3C3WA 2IU3A 4OYRA 4BV3A 3KKZA 5EHQA 1B93A 4EB3A 2NGRA 3AI3A 3BDAA 4S0ZA 2FZ5A 5HZMA 2PGJA 4REMA 3RT1A 2IV2X 3W6PA 1DJNA 3KD2A 3W6OA 2QAGC 5KINB 3BIOA 3BL6A 1X7ZB 1LQUA 1RM0A 4J4HA 1MC4A 5A03A 2OBMA 2WZQA 1PDOA 1ULUA 2YCLA 1Q3KA 3L6DA 4OXQA 4QU0A 1VYHA 4RZXA 1PYOA 5ALYA 4BMOB 4JYPA 2V4UA 4OFZA 3DOUA 2VPZA 3HP4A 3ML1A 4GPEA 4GMFA 2OQVA 1UKZA 4BIMA 1FRQA 3DLTA 4FE3A 3P4YA 1M3SA 3T4XA 4C89A 5JNTA 3PC4A 3PQ2A 1YVRA 3EIXA 2MIIA 4LQLA 3G8AA 1XYYA 3LO5A 5F77A 3V2HA 1NVBA 1ZK1A 3IP7A 4TXNA 2HAEA 1JG4A 3NTVA 3H2SA 4BEWA 4I4TA 3U3XA 2PX8A 1JYFA 4DBLE 1AN9A 3IUNA 1I36A 4Y18A 3N5CA 1DWPA 4XTRA 4Z3OA 3ISJA 3RG2A 1ZL2A 3QQ5A 4DLAA 1CUYA 2MT9A 2OCGA 3O4FA 3LX8A 1CUGA 1NMEA 4J6EA 5EC8A 4XWYA 5ESWA 1X7WA 4A10A 1GRVA 1QQ7A 4X71A 2RGGA 4GZLA 1TAQA 4NLLA 5KQGA 2GCIA 3VO1A 5AXDA 1XC7A 4BNDA 5FHQA 1RRCA 4Z8YA 4MI6A 1ZKMA 1R3UA 3FHJA 3IBFA 1CFZA 3GRYA 1OPXA 1SIUA 4OQXA 5CFRA 2Q6KA 2WWGA 1U8EA 5JEDA 2Z57A 4HUJA 1NN1A 2QYOA 4E2XA 4ESHA 1MR3F 3EN0A 3GJTA 2CWWA 1ISHA 2M1ZA 3QM1A 4FVTA 5JVDB 1TMKA 5E4YA 5EESA 4EMUA 4LA4A 3AKEA 4QTYA 4YEDA 5CLJA 3AB3A 2BM9A 4DLUA 2V0GA 4YCJA 1UZNA 1BG6A 3RADC 1BAPA 1KF0A 1E6EA 3A9TA 5TQVA 4DZZA 2EZ8A 1L5GB 3G1UA 1W48A 4KJZA 1VE6A 4QASA 3K20A 1QIFA 3M8KA 1LK7A 1TKBA 1W0JA 1BYUA 1EEXB 4F71A 3G68A 4WA8A 3WXBA 3F78A 3A1UA 3REQA 2BGNA 3NVMB 2KW5A 5B7PA 5E7QA 5K45A 3BWDD 5FFMA 2XECA 5E4FA 1L4LA 1RAIA 2O3QA 3EARA 3CN9A 3D4PA 4M7PA 1WZ2A 5IZCA 4LRSB 4S05A 2O0MA 2XDWA 4EJSA 2OMKA 2WA2A 1ZH6A 1PO7A 3A2MA 3CH4B 2AOTB 4OKNA 3SKVA 3WHLA 1ZD8A 1N0WA 4FILA 4NJEA 5HCNA 5LOVB 1CY4A 1T2DA 2XQFA 4BNXA 2C59A 2FUNB 4IRMA 1UIRA 3DAOA 3W9BA 1ONOA 2QY9A 4EB6B 1DIRA 3SM3A 5IX8A 3A6EA 4ZEVA 1HDCA 3E9YA 4A8PA 3QVTA 1ZRMA 2JVKA 5CIWA 3BIWA 1VE5A 3NWJA 4FQ8A 2JNWA 3LWZA 3WP0A 1M1YA 1XJ0A 4FFWA 4JEMA 4OK3A 4TUYA 1XG5A 4C5CA 4IICA 1ZZGA 1PE0A 2AG0A 4UZEA 4YCMA 3RFTA 4C9BA 5BUCA 1U0NA 4GC5A 3HO8A 1AUXA 2GKSA 3MTAA 4ZAVA 3MLEA 1FVOA 3I1JA 3JZIA 4UCWA 4ND3A 2PUJA 5FLYA 3B13B 1HTWA 4L1KA 1TC1A 1GT6A 2DFLA 1QIKA 1Y3IA 1AV6A 3E27A 3GPCA 3HMKA 4TMZA 4AN4A 4CCYB 5L3VA 3CPJB 3W34A 5BVHA 1XLUA 2J32A 4JASB 5LDGA 3GLGB 3O84A 4IUYA 3BREA 5C8YF 2A84A 3WZ2A 4G1EB 2JGEA 2XYVA 3UKDA 1E2MA 2W6OA 2C7RA 2FEXA 1A9PA 1ESNA 5FI1B 3TSYA 5H82A 4GBMA 4R1TA 1N5MA 3KZMA 2Q2NA 1J0EA 4Z0PA 3R8CA 3V9PA 4EGCB 1QGOA 4GMHA 2E5LB 4JVMA 2E4UA 2VNHA 2PJDA 5FF9A 2ZJAA 1NQTA 4Q7KA 3K96A 1OV4A 3P9ZA 2BN4A 3VKWA 1YVUA 3DE7X 1B2LA 1C7QA 3FCCA 2GD1O 4OMCA 4PC2A 3RHFA 1O4WA 3G3EA 4HEA6 3VU9A 2GDZA 1DPFA 1SG6A 1FP1D 2D74A 2XUOA 4H7JA 2BMAA 4S1NA 5EE9A 2PX3A 3B52X 3FZNA 3GQBB 2AFHB 4ENPA 2IS4A 3QPBA 4KWTA 4KQ2A 3I4CA 3GJZA 5GWXA 4IIFA 1G17A 4QODA 1BIFA 3N0VA 4LCEA 4V39A 3HJRA 4OHZA 1DKUA 1EK1A 2QJFA 3MGBA 3U3MA 4EUEA 5TRTA 5FNVA 2PUCA 2XMCA 3JQ7A 3JVEA 4HN2A 2YW9A 3VR3D 4ZV4A 3OQIB 3TNYA 4DTCA 4FBLA 5DXJA 2O0HA 1ZBDA 521PA 2PH7A 2VQDA 4DV6B 3DVQX 4FMDB 4KAXA 4RVUA 3OLCX 5IN4A 5ICCA 4OIMA 2H51A 5G3ZA 3VR6H 4CMEC 4MGZR 1SHZA 2P2NA 2QRQA 4QNMA 4FJ2A 2FR8A 4KYUA 5DYNA 1XJCA 3L77A 4HWTA 4LXIA 1QGDA 1T8PA 4PS1A 4GHWA 1YU9A 3RYIB 5E3HA 2XQJA 2AKYA 1U0TA 5BN4B 2IELA 1T6XA 1XZHA 1H23A 1W2HA 3QWBA 3NM5A 4E22A 5M29A 4QXOA 4RY9A 5CGQB 5PNTA 2ZT6A 1CRLA 1GGNA 2IZ7A 5AHOA 5B1SA 3O5AA 4UTPA 1YKSA 4PHGA 3RYCA 1DFIA 3D5QA 3M1AA 1E3IA 3LT1A 3AVOA 2C2KA 2MINB 2OWDA 4IDFA 1LD3A 2C7VA 2OK7A 4A4DA 1BJRE 4AROA 5KTMA 1E5TA 2NT4A 1HFKA 2C2HA 5D1HA 4PW0A 1MB9A 1O57A 1Y8RB 4F3YA 4J3FA 2R87A 4BBAA 4HNVA 3IUQA 3BSSA 2WUGA 4RE5A 4X8HA 5AOBA 2WT8A 4AJ4A 1XPOA 1YOVB 3H75A 1MENA 2CNWA 2FMFA 1Y7HA 3IVAA 3DZBA 1OYWA 1LX7A 3JQEA 3RV4A 4BRSA 1E69A 1M2NA 2W7TA 4E12A 5JCOC 1CLUA 1Z16A 2RGCA 1CT9A 3CEAA 4H0CA 2WTBA 4K46A 3EUFA 2WJPA 4C7XA 4LWPA 5JSQA 1RQ2A 3NEPX 5EHIA 4DNPA 3DULA 1FUUA 2X1HA 3C8DA 1GTG1 2C9MA 3DWEX 3CH5A 3O3NB 4CMHA 2JFVA 4UAJA 1TDJA 1ZS9A 2EP5A 4LJ5A 4Q39A 1D03A 1GNSA 1GQRA 3GJRA 3V4RA 3GCGA 2FMHA 3ZVNA 1ZPDA 2P8JA 3JQCA 2MSNA 3MELA 2XYQA 3VZDA 5KQSA 4OX9B 4UDNA 1X7XA 3SC2B 3LRPA 3LXUX 1PAUA 4RKQA 3TKYA 2UYCA 3NJ8A 4ROTA 5J2TF 3CGWA 4CKYA 4EW3A 5LVAA 2G5TA 1UT5A 1HDRA 2YVKA 1EXDA 4E2FA 4MHTA 1YI1A 1VPEA 2WE7A 3H4MA 2OZKA 5EZ5A 4BWFB 4EUHA 4F97A 4FFLA 2GLXA 4HXGA 4WJKB 4YJGB 4TRRA 3B6JA 3W2HA 2G3YA 4EHAA 2HJHA 1Z6YA 1XVVA 4URZR 4ZJYA 4KUHA 4I5IA 2AC4A 1SCDA 1Z2EA 1ZVKA 3SR4A 1UBCA 1Z22A 3HXQA 5DT2A 1PR1A 1PD1A 3BDIA 4JOSA 4PQEA 4XI9A 5K9ZA 1SBQA 4K6KA 4O3MA 1EJBA 1C1YA 1H5QA 5KTNA 3FTDA 4QJBA 3MW8A 4US2R 1U0HC 1NONA 5CLIA 2FX2A 1IJFA 4MQ4A 2GBLC 2WWHA 3AIMA 1C0LA 2Q5LA 2FUCA 4BO9A 5HIAA 1IMJA 3AERA 3BSFA 1E7MA 2CLCX 3EA0A 3EXHB 1FNCA 2GN0A 4IINA 4RTQA 2NP7A 2CHVA 2H2DA 3FHLA 2VHZA 2FP3A 2VHVA 3AF0A 1M8KA 4MHOA 5JHGB 3ZQ6A 1LF5A 1I1QB 2BT4A 4XUCA 1XTZA 1CDDA 1PG5A 3BWYA 4GSYA 1W7AA 4LEIA 1E7WA 1WAMA 3DMHA 4W63A 3OLWA 3I2IA 1KU6A 1CC1S 3RHZA 1BDIA 2EBUA 1T0JB 3EXFA 4OHBA 1I01A 2DECA 3LCCA 4YUVA 2P7IA 3SP1A 1EGQA 1R4NA 2DFNA 1O95C 1BROA 1BWSA 2HNBA 3NETA 3NR2A 4KPEC 2OGSA 2RJ3A 1OH5A 4MQBA 2YICA 4O5OA 4YCAA 1G0NA 3KYDA 3SXPA 3TTYA 4DRYA 3DDHA 2ZIZA 2QE7D 3H84A 4L4ZA 3ZGNA 2P2YA 5KJEA 4MYHA 1FVXA 2Q28A 3LF2A 1L4HA 1Q21A 4QQRA 3VHQA 4D74A 4CLOA 1V9SA 3QVKA 1IBLB 4O4JB 2A94A 3UPTA 1EP9A 3QBVA 4QJ3A 4G0MA 3SSOA 3ROKA 1XU9A 4BAZA 3VKGA 1KQFA 2EJUA 4LDZA 1SEPA 4EQ6A 3HL4A 2YWCA 4N8SA 5EUMA 1EKXA 1XDSA 1RM5A 2FETA 5ECYA 3NATA 4CMJA 4XB2A 3QPWA 2QN8A 2BGLA 1NE7A 1U0GA 1QGUB 2ZYIA 4KZKA 2IWRA 1YBVA 3JSXA 4HL6A 3HWRA 4F7DA 1MAWA 4X97A 2ABWA 1AURA 4MR7A 1NRXA 2JANA 2QT0A 3EY9A 1KJIA 3WGYA 2M32A 4KE8A 5CDSA 4I8DA 1VC2A 3DFKA 2BMVA 1TQDA 4NECA 3OZAA 2I78A 3LXXA 2GXQA 3H5OA 1B1AA 1F0YA 3NHAA 2X6TA 3N0XA 3Q3GE 5DLDA 1QFSA 3U6BA 1GPH1 1U2EA 2DPGA 2VAPA 4IGEA 3VV2A 5LQJA 4RCZA 1OI7A 3SGLA 1N8KA 3KKKA 3T3NA 4JXZA 3ZUGA 2VTVA 3ND5A 4C29A 3N2ZB 4COKA 4N48A 3PGVA 1D09A 2CNLA 3TVDA 1Z9BA 2FCRA 4OA5A 4G0PA 1VOTA 5CVTA 1HG1A 2H16A 1GU0A 1Q1QA 3D8RA 1Y3CE 1UQTA 3MTEA 1YR9A 4TTRA 5L7WA 4AJNA 1XCGB 1MABA 3QI2A 3S2ZA 1UQRA 2C83A 3PNSA 3ICQB 1UEXC 2IU4A 2XSZA 1JYSA 1SM4A 4I5DA 4HYEA 1E63A 4NCXA 2EL7A 4KXVA 1PR3A 2QN6A 2XT9A 3DTVB 5J2UB 1TIPA 1XRJA 5I5EA 1GTZA 5F2OA 3UUWA 2PUBA 2YTZA 4R68A 1HNWB 2QV0A 2GBGA 3INGA 2GFQA 4FI3F 3ZV6A 4YCCA 1JLMA 1QO0A 2PKYX 3G23A 4NXMB 4Y6PA 1NBAA 3THWA 2O23A 1KI3A 2QG4A 3BPSA 3K1AB 4CQMA 4DR7B 2ZKIA 3N5KA 4CLXA 1N4DA 1N92A 3HBLA 4EY3A 2VJNA 2ROQA 4LF9B 4AZWA 1KFCB 1E0KA 1P7PA 2AX4A 4ND4A 1V1MB 1OI4A 2YXLA 2BR4A 2IZOA 1PTKA 2GUGA 3K5HA 5F1PA 2YWEA 1HNNA 1A9QA 1TVKB 3N1UA 4F4UA 2C3PA 5KSWB 1GNRA 2Z5GA 1LWNA 4GBGA 4EG5A 5B1EA 1VA5A 4V0RA 3W5AA 3KQHA 3GPBA 3PENA 2G36A 3SF8B 3KOZA 1XUOA 3IV9A 2C3MA 4CEIA 1P8AA 3SE7A 4XGRA 4DLRA 4G56A 4QT0A 4BVGA 1VKRA 2WF5A 3R5SA 1CQWA 5CX1B 1FX1A 4DA0A 4KXWA 3TUZC 2FG5A 4GD3Q 5JO9A 5HJ7A 1AQUA 3AY7A 1I14A 1EZ1A 3E5MA 2VEDA 1RJDA 4GXNA 2QWXA 2PT6A 4UAVA 2HIGA 2DMRA 3WWDA 4DQDA 3N39C 3F4KA 3TAXA 4EB8A 1JSLA 1U8AA 1X1DA 1Q84A 1XZIA 3R5HA 3JS5A 2HB6A 4WCFB 5CEEA 1I4DD 2Q3MA 1XDGA 5FPSA 4EFNA 3G0DA 2DAPA 1V8FA 2PZEA 2UZ0A 2WAAA 3E82A 1L7DA 1UOPA 4YMVA 4KE7A 1CJCA 1QFZA 2P9HA 2Z6VA 2BEKA 3CMMA 3K8ZA 4GL4A 4UARA 5LZ9A 3IBYA 2O2JA 2UVPA 1AGRA 3K94A 2OKCA 1HYQA 2Q3DA 3LP5A 3OHSX 5IFKA 1TVMA 2OAEA 5LU8A 1G5IA 1ZD4A 3C6XA 1QHHB 3D4LA 3VI4B 4AD8A 1R27A 2J46A 5AVJA 2PZJA 3LPDA 2FMKA 2J7KA 3RTCA 1WZNA 3OKAA 2BFBA 5FTWA 3F9CA 5BVGB 1WD7A 2OB2A 4OPMA 5GQSA 2IX9A 5I9BA 5A2QA 3D6NB 1CJUC 4MRRA 2VYND 1RQRA 1JQBA 3JASB 3AL3A 5BUSA 2RHMA 4MYSA 3EFBA 2ADMA 2I91A 3JR7A 5FCDA 2R6DA 2PKRA 3CLSD 4Z7NB 3GMDA 2AFIB 1C3EA 1DIGA 2LVBA 4QOEA 3UWSA 1DUVG 3LZ6A 5D84A 3RWMB 2ZCJA 1M34A 3L0IB 3L92A 3VPGA 3C6MA 3SJAA 1LLFA 1H6AA 1D1TA 1W5EA 2OCLA 4C7OB 5IDWA 3ZQJA 2Q3BA 3I32A 1V35A 4UPEA 1X9HA 5D7BA 2R7MA 1XXHB 2Y2VA 3IGFA 4X90A 1ZDMA 4QHSA 1VIAA 5SY9A 4D0LB 4GP9A 4EYSA 5KMGA 1PX0A 3BD7A 3LT4A 3ROMA 4X1KA 1M2OA 1MOPA 4RPCA 1OXXK 1HEIA 5IAKA 4EFDA 2OHOA 1BU8A 3QELA 1U3UA 3EWSA 1LLCA 2QEQA 1ITZA 2RK3A 3EGXA 3JALB 3PNQA 1R8YA 2ZBVA 3LY9A 3WS7A 1Y1QA 2B0JA 1OZAA 4BFVA 2AN5A 3FLAA 4EY5A 5LYJF 3VNVA 2ATVA 5KJFA 1OSNA 2ORED 3IMCA 5CT9A 1WU8A 3BHMA 2ZR9A 4EY8A 4R84A 1RVDA 4J49A 1N9GB 3HDQA 5JALA 4GH5A 3ZWMA 1TM4E 1XXLA 3JQ6A 1NVMB 2X4LA 2W2MA 4KNWA 1WTCA 4OBWA 1TM2A 2FN7A 4QL3A 3TNDA 4B5KA 1DIOB 2RK4A 3OKFA 3URKA 2BYTA 1JZSA 1UFVA 4BJ5A 1W46A 2XMBA 4YASA 1APBA 3EXG1 3C3JA 3DHEA 2VWQA 5A6SA 1D2GA 5KNCA 4KQKA 3QBJA 1VFPA 1VJCA 2F3UA 3MGCA 5FJIA 1NMQA 4AJOA 4ITRC 3RUEA 1WMFA 2PRKA 3LH5A 3UJ7A 3SS8A 4D0RA 4ILEA 3IJPA 3FWPA 5DMHA 4RHCA 3FFWA 3ZHBA 6GPBA 5B6IA 3LC1O 2EBFX 2QNBA 3I9OA 3Q9SA 1KSGA 4RDIA 4A2PA 4CMCA 5B2EA 2QMHA 4KXUA 4OJQA 3BIXA 3TZQA 2HN9A 3X1ZA 5CVJA 2KBEA 4F1JA 3S7ZA 1GT91 2OP0A 1EFDN 4K1XA 4N65A 2IDZA 1KI8A 3KQLA 5EZ6B 5ICFA 3FA2A 2I4OA 4O2BB 3T1HB 1OWOA 4DIKA 3ZKAA 4E4YA 2EJBA 4JLKA 3ABSB 3N59A 3A3NA 3JZAA 3THYA 1IQUA 3QZUA 1P9LA 1XTKA 2ADFA 2NLOA 2ZJFA 4WOPA 3RJMA 1Q22A 3I58A 1R5OA 4QNRA 4TT8A 5LXTF 1LI5A 3H3FA 1PZGA 3K0AB 3K6SB 3FGNA 4E3ZA 3ZE7A 3OIWA 3ESCA 4CM9D 1ZZEA 3TRKA 3S68A 5D1NA 4LSWA 1NMSA 2ARKA 4LYFA 3EXIB 3L8MA 3TQSA 2C4NA 2WFMA 4RV4A 4CIXA 4ES6A 3BAFA 1S4MA 1YT5A 2IXFA 1ILWA 4Y6OA 3UJDA 3SR3A 3A7DA 3DE4X 2YZ7A 3DWGA 3RVRA 2WDPA 1CJMA 4V0NA 3LUAA 3TXYA 4MIKA 3R74A 4YRAA 1VRVA 1LNSA 1Z35A 4HVTA 2EC5A 4TL6A 1EUCA 4BMXA 4EMTA 2ZVPX 4HNHA 4JNCA 5BP7A 4PC1A 1PFYA 4F96A 1JG7A 3LQRA 5FOSA 5DIFA 4HMPA 5JNVA 1QG2A 3ENWA 1T2VA 4KR0A 4E88A 4LHWA 5C1DA 1V7CA 5KSZA 1NPYA 2CE7A 4D02A 3ICEA 2VJPA 4YO7A 5KNDA 3LAWA 5JJBA 2L42A 2PGDA 4CIDA 1F4VA 2FOLA 4L28A 1E3WB 3N53A 4MWBA 2YDXA 1UMCA 2PGIA 3RSOA 4A6EA 4NH4A 4YV2A 4FEEA 4MYCA 2ACWA 2HEGA 1NI5A 4MR8B 4B8ZA 4OSOA 5J9FA 4E15A 4YR7A 1UM9B 2N75A 4QDUA 2IH4A 4A1OA 4GOJA 2HHCA 3IPXA 1FNMA 2P2SA 1VIMA 1GSOA 3ZWWA 3NTLA 3O94A 2OM6A 3B5EA 4U2GA 1EA7A 4B3FX 3PK0A 4Q9HA 5A5EA 1SR8A 5HXAA 2V9ZA 1SQ6A 5JSYA 3S8YA 2A33A 1D2NA 2BEWB 1ZJWA 4L3VA 2AEEA 2BFFA 3E03A 4L6AA 3UJ8A 4YRSA 2FPKA 4PV7A 4Z3KA 5JR3A 3P2JA 3VR3A 1XHFA 1A1VA 2D5CA 4QUEA 4U2FA 3GUVA 4IGKA 1SCUB 1SKYB 1GQSA 1QHIA 3EF3A 3L3BA 3VTZA 4CMIB 4IJ5A 1YGYA 1Z0DA 2JLRA 1KQNA 2ZUEA 2VATA 1SULA 2JL1A 1QIMA 1EFPB 2OD2A 5HF6A 3KLOA 5LBIA 2BRUC 4BLUA 2RBEA 4KLRA 1XCOA 5TJ9A 5L3QB 5JPDA 721PA 3ZYCA 4NCBA 3UUEA 1JPUA 3HABA 3O3OB 4LOJA 1Y5IA 4U9HS 1QZTA 1X6VA 2P0YA 1F7VA 1E99A 4PLVA 4EBBA 2BDTA 1ND6A 3EAQA 1CW2B 2YNMD 2P5SA 3L8YA 3EF1A 1DBIA 2E4VA 3CLUC 5EE5B 5EVJA 1D7AA 1QFMA 3KTAA 2H4XA 2ZIVB 2ONYA 3AHCA 1VI6A 2AEMA 4BKQA 3LQKA 2C4KA 4KMRA 4M53A 3ZI4A 1P3Y1 1N8SA 1X1SA 3GFSA 4P7JA 4EJFA 1B6RA 5SY6A 3QUSA 3T5DA 2N1BA 3GY0A 3QH4A 5TPWA 3FPJA 9ATCA 3NBUA 1Z5PA 4ZT4A 4JKIA 4OXNA 3L8EA 3ETEA 1BW9A 1Y81A 3BXEA 1ZX1A 4LISA 3VGPA 4E13A 5L3RA 6ABPA 2FPPB 4FWBA 5B1YA 1MJNA 1LRLA 1WW3A 3L4SO 5BYJA 4FYHA 1SBNE 2GAIA 1E7SA 3IBCA 1R0XA 2GBCA 2OO3A 1E8NA 3NNDA 1NTRA 2VZEA 2D7CA 2Y0BA 3WNQA 4EELA 3N3BC 5P21A 1FDVA 3VU1A 3NQ41 4QVIA 3DBRB 4B3TB 1UKBA 1WTAA 2I6QA 2FB9A 4MWGA 2GCEA 2QMQA 4JBNA 3ZHCA 1J20A 5ANRB 1PNVA 3C1UA 2PT7A 4I08A 1VPTA 3LUBA 1GITA 2QJTA 3Q0IA 2ZI3A 2UUBB 3RUHA 4P58A 2HZBA 1ZH8A 3K31A 4ZOLB 1XELA 1CXZA 1E3EA 3M4ZA 2VAXA 3KSRA 1II8A 3LDUA 1J0CA 4XYGA 3SCZA 3L4JA 4K7JA 1KY4A 4UBIA 4ZVNA 2OXRA 2R6FA 4TLEA 1J1ZA 1NJSA 2W2NA 4FGSA 4HFJA 4MUXA 3FWKA 2XCUA 1DIBA 4WERA 3MIIA 1OU0A 1SO8A 4X1IB 4C2BA 4D44A 1NNSA 1XRPA 1IHDA 4DQUA 2D3WA 1P5HA 1YA6A 4N9WA 1AA9A 3HTXA 4JZYA 1XAJA 5SZKB 1U80A 5ALJA 3CUWA 2OQIA 1RQGA 5HDBB 1I2ZA 1K9VF 3UW1A 2A9RA 5DNVA 1CRWG 3GGDA 2FZCA 2VRCD 1DO2A 3OWOA 1SB8A 5ECWA 1M2JA 2NYAA 4YPVA 3P0IA 4QRIA 1RXWA 2VZ8A 2I0FA 1X9GA 2YHIA 1XCBA 4B4VA 4H27A 1V3QE 1R74A 1T2UA 2QGZA 3IQEA 3QPDA 4D3SA 1HDXA 1Z0AA 1PGJA 1TU4A 4KJXA 4ADSG 4AMYA 1XDBA 1SOWA 5KEIA 1BNCA 1P9OA 4HLCA 5BSTA 4HX5A 5EYPB 5FWXA 3R7WA 2PQ0A 5JH7F 3HB1A 4KYIB 4V2UA 4NESA 3C85A 2W6QA 3VOBA 1BRTA 1ZMBA 3L79A 3WOHA 1EQUA 1XLVA 4MVJH 2VAWA 1JIUA 3C3XA 1GGJA 1OAAA 3GLRA 4XCXA 1K4YA 3FG9A 3HPRA 1Q0UA 2F90A 2ODEA 1P7ZA 3GHHA 1U81A 3OHPA 3QE0A 1UMKA 4PIPA 4RGVA 1CR4A 1EDDA 1BX3A 3CEPB 3UMSA 4ZFNA 1T3LA 3BIJA 5ALEA 3VHXB 2OZPA 1NQ5A 3DE2X 2A0FA 4FKMA 4FTWA 5FBRB 3AFIA 4IJQA 3W2IA 3U62A 1BE0A 2G5CA 3ETLA 3OCVA 2PZFA 3VTKA 2GEKA 4NMXB 1D2HA 1ZVJA 2WKPA 5F3DA 4FU0A 3RKSA 4ZI7F 2XNDA 3FSRA 3CW8X 1DIHA 3IEXA 3V7UA 3H99A 1PFVA 5HRAA 2I34A 3OETA 1DAFA 2RI1A 3OT1A 5LMNB 2YZNA 1IOZA 1UFKA 3IAS6 4ZALA 4BJ1A 3DL7A 4B83A 5A9TA 1C9MA 1V7QA 2OV4A 3K09A 1E6KA 4X64B 2V1UA 5LB2A 3PZBA 3IXLA 1TTQB 3DHNA 1XRRA 1RJFA 3CNEA 1Q0QA 3MGGA 2R5NA 3N8HA 4RH1A 3T7EA 4DYVA 4XIIA 2WFZA 2Z5FA 4XB1A 3R9WA 2A6PA 1UPBA 2EFDB 4MKRA 4RENA 2WOOA 5DXAA 1XEAA 3WNDA 3WDLA 3L02A 1OLXA 2XVYA 2HWWA 3P2IA 4TKMA 2NTVA 2R6AA 3EZFA 4OYHA 1ORWA 3GN1A 5DBOA 4JP8A 3GMIA 4P54A 1PLKA 2Z58A 5EIAA 2R8BA 4N0QA 2J0SA 1YI8A 3A4NA 4RHUA 2QM8A 2EWWA 3VBCA 2JVJA 2WI8A 3CO5A 3N2GA 4YQYA 5KTRA 2AR9A 4OI1A 1NWHA 1CB7A 3S2YA 4MPJA 5L7TA 1LKZA 5ARBA 3G2NA 1WSDA 3KQQA 3WYDA 2JIQA 3D7LA 3KPVA 5AM1A 2EQAA 3GJ5A 3ZWDA 4B71A 1X8KA 1UPTA 4RPKA 1D2AA 4YI5A 1Y89A 1AUQA 1VIVA 2AF4C 1M1XB 4AKTA 2NO1A 1NQXA 3G9ZA 1ACLA 4MPDA 4ZO9A 4XQ9A 5LYJB 1EVIA 3F6CA 2QNRA 2GTIA 2JLQA 1OD6A 2XZOA 3I5YA 3HKCA 1GNQA 1Y9JA 1XYGA 3L05A 3V46A 3UTCA 2A1TS 5JYEA 1ISJA 2JCYA 1SC1A 5DSZA 4C2AA 3ANXA 2FFJA 1YDWA 3CZ5A 1XROA 2VBCA 3SJCA 3LL4A 3SYRA 4JMPA 2O2DA 2HQRA 3VOAA 4EEKA 1FFHA 5A5VA 4MW5A 3GZJA 4MWZA 4TV8B 2X41A 5C8YA 3INNA 3R6GA 1AHHA 3JQRA 4AY6A 5L3SA 2WIJA 3OFJA 2BL4A 3DTTA 3DZ8A 3GLFB 1TO6A 4CYMA 2X3UA 2DWCA 2I8LA 3Q88A 1H2HA 4G09A 2E4YA 2CLFB 3KCNA 2I8AA 1IZYA 4NBRA 4R1SA 4LGYA 3QKSB 2VDPB 4EZBA 3LWNA 4YJHB 5EP1A 1N5RA 3ND9A 4UDXX 5HJ2A 4MJLA 4XDHA 2GPNA 3BQNB 4JHXA 1KYXA 2J7PD 3HCOA 4POAA 4B1FA 3AEKA 3HSSA 2VJLA 3Q9NA 4RNCA 4RLFA 4TTTS 1Q83A 5KHAA 3IEIA 1C7FA 1V11B 5H0IA 5BYKA 2FU5C 4L6IA 4N3AA 1EU1A 3COSA 1AJEA 4DJ5X 1WU7A 1CUCA 2FGJA 4EPVA 2EIHA 2PWYA 4INZA 1L1FA 3ZWNA 4BNKA 3D3KA 4E3WA 2PO5A 2WM2A 1QMPA 5EMHA 5F23A 2P35A 1Q74A 4HDSB 3EBPA 4HDNB 2G88A 2FOXA 3AL2A 3D1VA 3H9GA 3JWIA 4EKGA 4Q0MA 1FUEA 5JWHA 2VJAA 3AV3A 2H2HA 3ZXYA 1S01A 3VZPA 2AMJA 3K4QA 3ZI7A 1C2YA 1LPMA 1JX6A 2ZB8A 2CXOA 4IMIB 4S1VA 4BO1A 1YVPA 1CS0B 4EO9A 3PICA<