1IDOA

I-domain from integrin cr3, mg2+ bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
184
structure length
184
Chain Sequence
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion protein
molecule keywords INTEGRIN
publication title Crystal structure of the A domain from the alpha subunit of integrin CR3 (CD11b/CD18).
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 1996-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1idoA00
4C29A 3HXOA 1M2VB 2O7NA 1SHUX 2M32A 1M1XB 3BQMB 1BHQ1 1QC5A 3FCSB 1TYEB 3PPVA 1JEYB 1LFAA 4XW2A 1XDGA 5HGJA 3V4PB 3ZE0B 3TVYA 1YVRA 3EG9B 4DMUB 4F1KA 3K71B 3EG9A 4HQFA 1AO3A 2B2XA 4IHKA 4MMXB 4CNBA 3K6SB 2XWBF 3PPYA 4IXDA 3K6SA 5BV8A 2ODQA 1SQ0A 4HQLA 4Z7QB 2ICAA 4WK4B 5KYUB 1DZIA 3PPWA 2NUTA 1CQPA 5KYUA 4JDUA 2VDNB 3QA3E 3TCXB 5E6UB 1V7PC 1MQ8B 2VDRB 4M76B 4G1MB 3RAGA 1U0NA 5E6UA 4FX5A 4HQOA 1OAKA 1T6BY 5LN1A 1QC5B 1RS0A 4F1JA 2I6QA 1FE8A 3NIFB 3VI3B 4A0QA 4C2AA 5HDBB 3EH2A 2XGGA 1M10A 1UEXC 2IUEA 2NUPB 2NVOA 2NUPA 3ZDZB 3M6FA 3ZDYB 1AUQA 1DGQA 1MQ9A 1ZOPA 2ODPA 2VDKB 2VDOB 2VDQB 4UM9D 1MF7A 1IJKA 3EOAI 3T3PB 1JEQA 4BJ3A 5KYNA 1PD0A 3VI4B 4PN7A 2VDLB 2VDPB 5HJ2A 4IGIA 1JLMA 4MMYB 4NENB 2NUTB 1MQAA 4NENA 2QTVA 1XDDA 1RTKA 3ZE2B 4WJKB 3EGDA 1N9ZA 3BN3A 1ATZA 3ZDXB 1AOXA 1MJNA 1PD1A 4WK0B 2VDMB 1L5GB 2I6SA 1SHTX 2X5NA 4NEHB 5E6RA 3V4VB 3TW0A 4CN9A 3EOBI 4UM8B 5KYYB 3E2MA 2I91A 1U0OC 5KYYA 1QCYA 2XWJI 1ZONA 1BHO1 3ZQKA 1NA5A 1JEQB 2WINI 3T3MB 4HQKA 5ES4B 4WFQA 1U8CB 1XUOA 4UM9B 3NIGB 3EGDB 3IJEB 3EGXA 3BQNB 3HI6A 3IBSA 4Z7OB 1M1UA 3GXBA 4WK2B 1PCXA 1IDOA 1M2OA 3Q3GE 1M2VA 3FCUB 3K72B 5E6RB 1PT6A 4Z7NB 1T0PA 1JEYA 1YVPA 2VC2B 3F78A 4G1EB 4HQNA 3HXQA 3NIDB 3ZE1B 4C2BA 1RRKA 5KYWB 1IJBA 3PPXA 3TXAA 1FNSA 5KYWA 1RD4A 5E6SB 4CN8A 3EH1A 1JV2B 3F74A 1IDN1 5E6SA 4MMZB 1Q0PA 5KYXB 3N2NA 3EFOB 2WW8A 1CK4A 5KYXA 1N3YA 3EFOA 1MHPA 3EGXB 1ZOOA 2ADFA 4O02B
chains in the Genus database with same CATH superfamily
1X3LA 4H4CA 3PVCA 4Q48A 5J4YA 2YZ7A 3IUJA 3IVXA 4ZU3A 4J1SA 1TUEA 2WKSA 1CQZA 2QX8A 1PLJA 3SEQA 2EJCA 3B1KA 1LJLA 1BCRA 2EZUA 2N0SA 2XZTA 3LQFA 3Q7TA 4IIGA 1VHDA 3T9BA 3K0SA 4Q39A 3SZLA 3DEFA 1QR6A 3C8DA 3VR2D 4PSAA 2PXAA 4ODIA 3EZYA 3PJRA 4JUIA 2C07A 3HCFA 1A7UA 1CY7A 1NFQA 4KQ9A 5DJ5A 4YN3A 4OQQA 3OLZA 2Q7XA 2ZR7A 2GA8A 1RWQA 1WQ4A 1FSZA 1NNSA 1NF9A 1PEKE 2C9YA 3N07A 4LTMA 4QLAA 1P5FA 3AQ4A 3EAFA 4LJ6A 1U5AA 4EI8A 5L4LA 1NURA 5FB3A 5TF0A 1F0KA 2Y68A 3GHYA 4QSMA 3U48A 1FXWF 5LJLA 3Q8MA 4OBXA 4L4YA 4B3DA 3E1SA 4C4ZA 1JHUA 4E21A 1JSCA 1DQYA 1EDZA 5AXBA 5TNXA 3WIEA 5ED4A 4Z3OA 1V3TA 2YWFA 3AKCA 3WAJA 3L02A 5GGYA 2I3AA 1VI2A 2DFNA 3EIEA 3KVVA 3S2SA 5I9IA 2XHEA 3REQB 1CS4C 4RAOA 3LQ2A 2QRJA 4ZVLA 4JBHA 1WD5A 1X7ZB 1S2GA 4BEWA 3HZOA 4KEAA 3VHRA 4WNAA 2I54A 4U2KA 1M7GA 3OETA 8AT1A 3DZFA 3EJ6A 1T36A 3FSJX 1LXCA 2Q5LA 4K6GA 4AP9A 5AIBA 3DZGA 1ZCZA 3D2AA 1N6OA 3OM1A 3RG8A 2YIVX 4V0SA 2IZ1A 5HHTA 3UICA 1RWKA 1Z5GA 3PQ3A 2HPVA 4MKHA 4V3CA 5L3SA 1GZ4A 3I01A 3K96A 5IWAB 1G8KA 4K86A 4R40A 1E9SA 2AVDA 4F2HA 5LQRA 3BWBA 3ITEA 2DC1A 3HPQA 1X0VA 2YL2A 4FPXA 4P8RA 1Z6ZA 1T6NA 4FDAA 3WWYA 2DKOA 1PZHA 2IIQA 3MTBA 3OE7D 5E4JA 4TN5A 4UEJA 5KNCA 2QRZA 1NVWQ 3DEZA 3PNSA 1RYDA 4D4JA 5ENVA 3N2EA 1X1QA 2CUKA 4J1NA 4RD6A 4RHTA 5F33A 2F3SA 2P8SA 4L0DA 4LOLA 3IP5A 4AQDA 4DLBA 4YT4A 1H65A 2WYHA 3TZ6A 2VA9A 3WMEA 4F3KA 4UM9B 4HDRA 2JATA 1RI3A 1TU4A 2GDZA 2HMVA 4GMGA 1L3BA 1QGED 5AM0A 2LCIA 4K9LA 4YAIA 5ABPA 1DCKA 2C4NA 3N2IA 5CVUA 1SK9A 2ENUA 2PV0A 2HWUA 1V95A 3LHKA 4L51A 4LJ7A 2L17A 5AJYA 3ZQ4A 1MNAA 4UBJA 3B1YA 3F78A 1T91A 4I08A 2P3QA 1ZD4A 2Q3EA 5IYZA 4WEOA 5EIEA 3KB8A 4PIVA 3WMXA 3ONNA 4LAFA 2R97A 1C4KA 3RRZA 1CQIA 1KR5A 1MJFA 1J97A 4HXEB 1LA2A 2CV2A 2K7ZA 4Z4EA 2BFEB 3W04A 5G1OA 4EGCB 1G3MA 5T5QA 4MVJM 1OH5A 1A82A 3NZEA 1ZK0A 1F6DA 2CL7X 3AESA 3H9CA 3Q5GA 2Q6IA 4NQRA 4YTEA 3STYA 3TBFA 3NNSA 4CQJA 2ZIVB 3CJRA 2HEGA 3MOSA 2CHEA 2WNSA 3QMPA 1FVHA 4I81A 4ESOA 3DLTA 3JY6A 4O4IF 1P75A 3G7NA 1BKYA 3LDHA 3QK7A 4YDRA 5FCDA 2CLDX 2G06A 1K7EB 1MPTA 1WW2A 2JFOA 1Q1NA 1G4HA 1TKAA 3D6HA 5AKHA 3OCUA 4OQMA 3EZNA 3B36A 5G53C 5CX4A 5C8YB 1DAIA 5AI8A 1MOSA 5GV8A 5J1SB 5FBQB 3RD5A 4CLEA 1DQSA 4PU0A 4CKWA 3HCDA 1QJ4A 4PYJA 2J09A 3PHLA 1V5EA 4ZN6A 1Y3IA 5BXYA 4BDSA 1K86A 3QXGA 1UBHS 4MUEA 2C7QA 3A6FA 2V7WA 2WB4A 1M66A 2C5EA 1GFSA 3N0WA 2GCNA 3GPIA 4JLVA 1KEZA 1RBMA 1FP4B 4V0OA 4Z9YA 2OORA 3F3SA 1TMKA 4TMKA 3ZNQA 7REQA 1C3OA 4HNHA 3RS5A 1PAUA 4OIFA 5CTJA 3TXYA 4Q3AA 1IXRC 1GSIA 2OL4A 2XVMA 1SHLA 4BV8A 5KJ6A 4UM9D 5C7IO 1BVHA 1Z4KA 4ER3A 3D1LA 3IP6A 2WSIA 3EGIA 4ZVNA 4ZDKA 2Y71A 3Q6IA 1CY2A 4H7EA 1LTKA 1DC5A 5DASA 3LLVA 5CNJA 4E5KA 3FCOA 2NUTB 5LMZA 2BFDB 1WXFA 3PGKA 2W11A 1MVLA 4HRXA 3F7TA 4XGRA 2W48A 1WUYA 2IBMA 3IESA 1IZZA 1ZVKA 2VT3A 1N6IA 3HABA 3QH4A 3FI0A 4YRJA 4AJ9A 1I1QB 5EZYA 3WA6A 1WX1A 2DFKB 4IJMA 4OHXA 3VVBA 1V4BA 1YZVA 2QLTA 2JFWA 1DMSA 1I1NA 2YV1A 3MOGA 2D6FA 1ZXLA 1TRKA 1GQRA 5GOTA 3LT0A 1XHFA 2KJQA 4UUAA 4PXSA 2QSJA 1KPHA 1R0LA 3ONVA 2GM3A 1SZCA 3G0BA 1G6KA 4UU1A 1JG3A 1XD8A 2FUKA 2IY8A 4RK0A 1GJRA 4C89A 2DJIA 2WA1A 3MRVA 3BYZA 4JBXA 1A5SB 4JI2B 1Z33A 2BE7A 3BFJA 3OUTA 4NTZA 4F4UA 7GPBA 1LPAB 3O82A 4ZOBA 5IF3A 1JZTA 2XGMA 5CK5A 2QR5A 1ISMA 4C4OA 2C20A 2E0IA 4Q15A 1H2YA 2XNHA 3K94A 3PYLA 1KF0A 3H4VA 4IQFA 1H0HA 1OVGA 3DT9A 4G1EB 2HLDA 3EBPA 2CFCA 2HC9A 4TQUS 4UCWA 3RVQA 2WWFA 3NBQA 4R71A 4UOEA 1XWIA 2ZAMA 3IBFA 5EPOA 2JGIA 1HFJA 3RUPA 1LDEA 4OM7A 1NRJB 4CGYA 4DZZA 2CJPA 1UFVA 2I8AA 4MDHA 3FNFA 4BRSA 5CVDA 1R16A 1ZHOA 3ADCA 1KH1A 3QUCA 2F62A 3C3WA 3I6ZA 3E58A 4I46A 3SYTA 4MVJH 3SS9X 2QX7A 4G81A 5DBIA 4LHEA 4K7JA 3E3MA 1DRJA 2VTKA 4CZ2A 3F8SA 2FCRA 1X1EA 3ZZTA 1P60A 1BMFD 3G1UA 3CLVA 4HXYA 3ZHSA 1NUHA 1RJWA 3EZ7A 4RVUA 1ORWA 5CTAA 2HNKA 5CJ2A 3ASZA 5ITVA 3JVUA 3IT3A 4IMPA 1BHQ1 2QNBA 4LFCB 1TYEB 5JAUA 3ECAA 3I58A 4IF6A 5DHFA 5C46F 4ARUA 5I9NA 3EXHC 3NDBB 1JLLB 1HLGA 2XWQA 3MERA 2A4KA 4RKRA 4AN0A 2HSEA 2VVTA 2C4UA 2GXUA 2W6MA 1I24A 1H2HA 2CXRA 3JRWA 1CSEE 4MDEA 3P2KA 1F12A 4YO7A 3K6JA 3IA2A 3PI6A 1DXOA 5KQRA 1DP4A 4FGJA 3PYXA 3FTCA 2YDXA 4YJ2B 4MLPA 4GE3A 4L5AA 4OMDA 3GELA 2VT6A 3PA8A 1T6ZA 2ERXA 2BJVA 2JI6A 3M5CA 3SHVA 1NRWA 4H31A 3FNGA 2YZNA 2WKRA 4QBGB 1WHSB 3A4TA 1B8PA 2J3HA 2RH5A 3E53A 3RGGA 3SS7X 4BFVA 4K9MA 4XZ3A 3L1JA 1WTAA 1AMOA 1FDWA 1Q6YA 1U1EA 4GM1A 4YRPA 2LWIA 3G2QA 1L5WA 1YDFA 3PPIA 3LQ4A 5IKOA 4EZIA 1WVGA 2P40A 1E5LA 2YIDA 3V5NA 4C2UA 1DCMA 5C3UA 4YQFA 5DEIA 3FOZA 1M6EX 4FHDA 3UN1A 1VKJA 3WLRA 3UMSA 1QQAA 2EWWA 2J59A 5REQA 2E5WA 1O96B 3RUIA 1XU9A 4JOBA 3C5VA 3IKVA 1ATZA 3S7ZA 4E5MA 4RF3A 5HPYB 3DBLA 4MS4B 1JQEA 5DKFA 1SBIA 3UWMA 2H00A 2PUCA 3BKXA 5CHYA 1CNFA 1X13A 1ZJJA 2BM8A 5JHHB 5GJWC 3L8DA 2Y1XA 3QELA 5CVCA 1T8UA 2AIRA 1WKCA 5AJXA 5CXUA 1AS3A 1W76A 2AYXA 1CDOA 4U2BA 2I6XA 5I4IA 2FLWA 5BV7A 1NA5A 1WU8A 4KZPA 2BGWA 1CUYA 1P1KA 3D54D 2PLAA 3QE2A 4OGFA 1TAHA 2GAFA 2QT1A 2RH4A 5AOCA 4BX3A 4BOYA 4UPEA 1RW4A 3RFFA 5E4YA 1FTGA 1PR4A 4HMQA 4ZCLA 2PFSA 1UP6A 2QROA 1U9IC 1JNYA 2P7IA 5C9ZA 8ADHA 1ICEA 1ZH0A 2QPOA 1HYBA 3WBFA 2JGFA 4OKIA 2F4VB 2WP0A 1K3FA 3OUZA 2G5CA 2C3UA 1U9JA 5JLAA 3ZQJA 3HI4A 3L79A 1PVOA 3K72B 5CLFA 2IU3A 2H4ZA 4YHBA 2J8ZA 4INZA 1JQ5A 3A7EA 1BXGB 4UTPA 4KLAA 5LIRA 1TVCA 1A7AA 4KO1S 1BX3A 2WJAA 4YJDA 5AICA 5LDGA 2MYTA 2QPTA 4JXKA 1F51E 3FUWA 3SJBA 5TJHA 2YRXA 3CNHA 1ZJZA 3QMWA 1OWOA 4GDFA 1BN6A 2ROQA 3NHRA 4DB4A 4G86A 3R0XA 3RSFA 2FW6A 1RWPA 1DFHA 2ID4A 1JN0A 2D59A 4MYSA 3UJHA 4KVZA 2IZZA 1TYAE 1D2CA 2PS0A 2QQGA 3PT5A 3TQRA 3FPSA 1B6GA 2GBPA 2V59A 3BSFA 5FD8A 1DCTA 4WXHA 4JB3A 2F7SA 4EHNA 3DEKA 2OD9A 2Y1WA 4O02B 4HDAA 4MCHA 4DKXA 1DUVG 5BP7A 2WLTA 3VMFA 3JU3A 4R2JA 2PT6A 2GI4A 2JH9A 3VU8A 3DEHA 3M6IA 4OMFG 4DWJA 1N2EA 3H8JA 4FS3A 4GQBA 4L72A 2P6PA 4P22A 3LZ6A 5BW5A 4OXKA 5H3LA 3NIWA 2J9GA 2WYVA 2H7YA 1GL7A 3CRVA 4KDRA 1CUAA 3NC4A 1U7UA 3IOBA 4I3GA 4X94A 4QDTA 2O5EA 1DRVA 1PUXA 3K6SB 1BFKA 1EQAA 3MM4A 4DOMA 4EMSA 1QYVA 1NY5A 5KOJA 3BMOB 1QTNA 2XWPA 1P73A 3OEYA 1X1CA 1CYEA 5ERXA 5B37A 4EP1A 4KXVA 1D07A 4IIVA 3EGEA 4RIEA 3WLHA 1P2BA 3EGOA 3FCXA 4ALIA 3CO0S 5IH7A 2EFHB 3KFXA 2IELA 4FB5A 1ILEA 3CUEF 1WXIA 3IJPA 3FOEC 4Y6PA 4N7RA 3OZCA 4B35A 1KMHB 4LXIA 1RLMA 3H1GA 4HF7A 5LSAA 1F3LA 2CEAA 5AMXA 3H6HA 1E2BA 3AP2A 3AHHA 3UT5B 2V6GA 2EFEB 3MINA 1E9FA 1G2QA 5DMHA 5BMVF 5KSZA 3M3PA 3RTCA 3QBVA 5KB3A 2VBCA 5JQGF 1RQ7A 5CLHA 5G3YA 2FI1A 4P32A 3VZPA 5HF9A 3RYCB 3BWCA 3QLTA 3EC2A 2JFUA 3W6ZA 2BBSA 1G8YA 1H0KA 4XAQA 2FQWA 4LYGA 1JR3D 1JF8A 2G4CA 1ZEMA 4ERNA 4ND1A 5LPNA 4EB3A 2BFFB 2R8OA 3E22B 2OR3A 2RHOA 4LY9A 5JJBA 1MJNA 2XNCA 2I4LA 3R24A 5IAOA 4MGIR 3CUSA 1DT5A 3EXHA 1HYEA 3FKJA 4JLWA 3JQPA 3WWOA 1RPTA 1KYYA 2BAGA 4B6PA 3KETA 1OH7A 4FSDA 3HYNA 4I3FA 5LCXA 4B83A 2WKPA 3FRIA 2F6RA 2VHTA 4DIMA 1L9XA 4R9VA 3OZGA 1NJ2A 4G9EA 4KH0A 3JCZA 1ML4A 1BHO1 4KVFA 4QTXA 2XIJA 5K3CA 3L7DA 4UM5A 4BMCA 1P4GA 1YZYA 2X0JA 4W7HA 4DRXB 1I3KA 3PGLA 3EK2A 4M8KA 2C7GA 4B71A 1N8SA 4WFQA 1ZI9A 3FYTA 1DTSA 3VDMA 2WFLB 4I9NA 3G9TA 2VSYA 1G2PA 2J1LA 3GEDA 4XYEA 3T8YA 3NORA 4IGEA 4Q9IA 1YE5A 3EGDB 4EGAA 3AR6A 3FUVA 4I1YA 5TY0A 4FYVA 4KO2S 5DM60 3UPTA 5CM8B 1Z2CA 1C7QA 3WVNA 4PX3A 4CTNA 5MDHA 2HLPA 4RF5A 4KWHA 1NF2A 1FDVA 1TF7A 4WBNF 3SKYA 2EOAA 3SK0A 3K9CA 1CEEA 1DXQA 5GWXA 5A5GA 3LSTA 3V4ZA 1P5ZB 2ZWAA 1POWA 4NBWA 2QN2A 3FMGA 3EFHA 4M88A 1XYVA 2ZBGA 4PW0A 1QVAA 3MAAC 4XR9A 2GOYA 4KMMA 1NTOA 1K7CA 2W4QA 2VSXA 1XLTC 5EGNA 3ZCXA 5KPJA 3F5FA 1L7DA 4DR1B 4YJ3F 4NXNB 1D0IA 2OV4A 3C6QA 1E60A 3PE6A 4C05A 4X54A 3JWGA 2JGRA 1X42A 4FWTA 4Q37A 4MWZA 4OG2A 5CB0A 2VHQA 4PO9A 2WF6A 1R50A 2VF5X 1BCSB 3PD1A 4R5MA 4BV9A 2BR4A 2VKTA 2O48X 2RBKA 1MXHA 2QTGA 4JC4A 3VGJA 2X3YA 4B6SA 3I4LA 1EHIA 5HDQA 1E3SA 2BHRA 2XBMA 1FZTA 1NSFA 3I6QA 3V4PB 4V2UA 3W05A 3EZ9A 4HI0E 2G9VA 4I9FA 4ALKA 4MVJI 3FMOB 3EPKA 2FWMX 4DLUA 2WM2A 1AV7A 3UM9A 4CIAA 1U9IA 4P1ZA 4DQXA 3I72A 2XQGA 3OZFA 1JQBA 1N7IA 1QDLB 4U6NA 5E7MA 2GETA 4A6DA 4F9EA 3DYIA 2I4TA 1XRJA 1QQ5A 2JJ2A 3PWTA 1A9XB 3DXFA 1P19A 1TMOA 1PFQA 4V24A 1GADO 3IAM6 4KLZA 1UC4B 5LZ7A 3AY6A 2GTPA 1UKYA 2Z6VA 4LMBA 1XU7A 3V4LA 5EJGA 3GLUA 4C0XA 2ZJ4A 3OM0A 1NVXQ 2PX5A 4J9UE 3H8SA 2Q6KA 5HFNA 3U9TA 2P8JA 4X6LA 5ECYA 5F7OA 4DV7B 2IYRA 3C1UA 3LW7A 3RV3A 4GLFA 4KI7A 2WAYA 1DGQA 5I9BA 1DG3A 1BXRA 3OBBA 2DFPA 3V8EA 3K70B 4A1FA 1BIFA 3QFFA 2NZWA 3EHEA 3CH5A 2O7RA 2WHPB 1I3OA 4HEQA 1OZGA 2GEVA 3P52A 3DOOA 3DDSA 3MMNA 4GOMD 2WG2A 3G0HA 1J2UA 3QBJA 2NU9B 4NOJA 3ZWBA 2JPDA 4RENA 3N8IA 2IYTA 4RMGA 5KCZA 4KTTE 4BS9A 5H7XA 3U17A 4ZJUA 2BIFA 4RMJA 5AUNB 3RC3A 1EFPA 2V7EA 2Y3IA 1MVOA 1CULC 2PKYX 2ZUDA 1W59A 3FNIA 4L7QA 4P93A 5KQPA 2AL7A 2JKVA 1GAEO 2B5WA 1U1CA 2IKSA 1U3TA 1FRVA 2DHCA 3P27A 4KO4S 3A3NA 4G0NA 4OTZA 4IOJA 4TSRA 3DMYA 1EUCB 3LF2A 3KALA 4F3CA 3G0DA 1YFKA 4EG0A 2GN9A 3KQHA 1AKRA 2F3RA 2GJKA 2WEKA 1V71A 2Z3VA 3Q5DA 5FOXA 4FFBB 3U81A 1IK6A 5ES4B 1GN8A 3PXBA 4QOFA 3S8EA 5CPFA 2C98A 2V7XA 3ROTA 4JOSA 4QUBA 2I78A 4WCVA 1QIEA 3RS8A 1PEDA 5C80A 4P0QB 1WWKA 5K0SA 3PP8A 3LHSA 4HYEA 1DL5A 8MHTA 1C8LA 1WUKS 4HLCA 3PFGA 2QYHA 4FYJA 1DV1A 2I7TA 2EG9A 1ONNA 3H2YA 4NMHA 4NBLA 4DCNA 3RH0A 4N9QA 4CQLB 1ACLA 3T7JA 3DULA 1IXYA 1NW8A 2Z8YM 4QREA 2BFMA 4PX5A 3S44A 2DM6A 5DNCA 2PLRA 5JNVA 1YMUA 3RU9A 3SLKA 4DUGA 5KTTA 2FR1A 3KTAB 4AYWA 5JZVA 4AYTA 3PDHA 3B8HA 1LU9A 2C29D 4KACA 1SCQA 4DC9A 1YS6A 2Q5HA 2KBEA 2NO9A 2O07A 2Y1GA 2WBLC 4IMJB 4A03A 3MS4A 4K9NA 1V5GA 3T1NA 4FOTA 4RTOA 2H2GA 1TI7A 4EFDA 2QN9A 3TB4A 4LV6A 2WD8A 4R98A 3FMIA 3CUYA 2JAUA 3IAUA 1YR7A 1F2TB 5JCJD 1OLUA 1OH6A 2PD4A 2XQJA 1QYXA 2FDXA 2XNKA 5EP2A 1Z0UA 1OHHA 2OHXA 4QPDA 4BCDA 1U4NA 4XGQA 1K6JA 2WWWA 1WPXA 2G28A 2HFJA 3H6GA 3PFBA 4QPPA 4NU6A 3WNVA 1G16A 1H42A 2Q5OA 4K46A 4MVJD 3SJAA 3K70D 2YV2A 1E59A 1NDHA 1U8TA 2EJVA 3G3EA 4PBRA 4QSHA 4EPVA 1ISSA 2O06A 5B5SA 1MH1A 2BCJQ 1EXWA 1J5XA 4B3TB 1EK1A 2QG9A 1Y6GA 1BW9B 1K9VF 2FGJA 3RSOA 4D8WA 2OV3A 3H5TA 3CY6A 4S1TA 5DBOA 2HIGA 4MYRA 4IXDA 1RAEA 4PQYA 3ISVA 3NQ41 3ABZA 5BN1A 3L8HA 1GTJ1 1N5KA 1XCGB 1XGKA 3IQGX 3M2TA 3E05A 4RKEA 1GOTA 4IL5A 5BN4A 2JGLA 3C85A 4XOUA 5CDUA 1ZCAA 3BMCB 1VB3A 4WMLA 3OBIA 4FZJA 1U0HC 2YH2A 1U0NA 4POAA 3ZHYA 4WJLA 4DHEA 2BPOA 1ORTA 1XWFA 3L0OA 4BNFA 2YNMC 3H1TA 4ML3A 3R4VA 5DZSA 2N47A 4ETMA 5E1OA 2NW6A 3I4FA 3GI1A 4FOLA 1HE5A 1PP4A 4GE0A 4BMPB 2VPTA 4LFAB 1ZYUA 2IXDA 2JHGA 3O8BA 5ESDA 5I7AA 4IIYA 3HMKA 1XPUA 2WU4A 3GG9A 3HA7A 1IZ7A 2IPXA 1L6IA 1XLTA 1RQPA 4LCJA 4YAJA 4AJ1A 3L8FA 1UK7A 2K4MA 4LMAA 2IPLA 1USIA 2W9XA 5TT0A 4B2IA 2J6BA 1FSPA 3I6IA 3O1HB 4RWZA 2C9ZA 3RS3A 1QSGA 3FSGD 3FYUC 2DPGA 4OL0A 4ARZA 2ILTA 2O2EA 5JAZA 1GXSA 2FSPA 3GJZA 4LPKA 1RMQA 4RA9B 4WXPA 3UC9A 3WYFA 3KE8A 4PTLA 1YIOA 3GVXA 4IBOA 4HWPA 3E3LA 3CZ9A 4LF8B 5J5CA 3NC1C 4PANA 1TO6A 4Q7JB 5A71A 2PX2A 4L07A 2FZVA 3BFXA 5ECGC 1AK9A 3PWKA 4YJFB 2PSDA 5G0VA 5AXCA 4D43A 3VDQA 5K2OA 4UJ5A 3QVWA 4HNAB 2W2VA 1ZUNA 3WNDA 3B48A 4GFDA 3G68A 2C99A 1NVGA 1R6TA 2OBXA 5CH8A 3ZV7A 5LXTF 2EQBA 2HA5A 3G49A 3ILYA 4EPWA 2PRZA 4PC2A 5TC4A 5AW4A 4DV5B 2UVPB 3NFRA 3H0EA 1X74A 4X3CA 3WGZA 1GU1A 2W6JA 3GJ7A 2FZKA 3N28A 4LBZA 4X44A 2I3ZA 4YBZA 1OCEA 2SBTA 2ZCVA 3EXIB 1IWPB 3EPPA 3HB5X 2VP2A 3AJAA 4TQGA 3S2ZA 4EA9A 1JALA 3BE4A 2EX1A 4OHVA 3ESAA 3A6JA 2NXJA 2QUBA 3VHLB 4BO8A 1U3UA 2PZBA 3LWDA 3N2KB 5DBHX 2NXWA 5DCUA 5BQPA 1ODTC 3E5MA 4G0OA 3RR2A 2HBZA 3H5RA 3OQPA 1N3BA 1CTQA 3EA5A 3O2QB 3P71T 3PKJA 3SDSA 2UYOA 1GYPA 4LUCA 3GUYA 2TECE 3A32A 4EUKA 3AEXA 1BMDA 4KPFC 3KS9A 2DBVO 1R9MA 4F2GA 1H2WA 1HORA 4BXOA 3RIEA 1AZLA 3A1FA 3DD5A 3EULA 1M2VB 1SHUX 3I64A 1ZBDA 1T2AA 1ITZA 3DWEX 3AR5A 2BN4A 3LM8A 5AKKA 3H5OA 4PIPA 5CJPA 2ALJA 2I7VA 2GKOA 2CB0A 2PPVA 4I50B 4F7WA 1W46A 3VDNB 4MJXA 1P61B 3GEGA 3WGHA 3WO1A 2C4WA 4CEHB 3O1JC 4B6JA 3I2FA 4Q19A 4RL6A 3AVWA 5JRDS 1WMFA 1WXGA 3A6DA 3HVIA 4L1KA 4A9AA 3HVKA 3PNLA 4U2DA 5K99A 1CBUA 4PSKA 1O7JA 4FILA 1PSZA 1ACJA 4NBUA 4F71A 4BQSA 1WNFA 2PV7A 3TR0A 4MEAA 3DHWC 7MDHA 2WWTA 1LPSA 1SELA 2NX2A 3R3UA 5DOZA 3WBKA 1XF9A 3QKTA 3KSAC 3SF8B 4ZV4A 1PDOA 4WZAB 3O8CA 2NADA 4XX0A 3G8AA 2PFKA 4H18A 1N77A 1QRRA 2XAUA 1QB8A 4FFMA 1Y3HA 1UWVA 3RWOA 3JD2A 1SOMA 3CSDA 2R66A 3VC3A 1AA6A 5SZJA 4H7IA 4NJEB 1E1QD 4GAEA 1GUZA 5KCMA 2AFHA 2FZCA 5DULA 3Q7RA 1RC0A 2G09A 1BE0A 1ELOA 1GL6A 1Z4LA 3NNDA 4EGSA 5HVNA 4XLTA 3N74A 1SWWA 4LHXA 4LNAA 1E1KA 3CEAA 4HXGA 4LSMA 4ZCSA 3RTAA 4DCUA 4DB2A 5AOBA 4ENSA 1N6KA 2SICE 2QL7A 1E7QA 2W6IA 2PSEA 3BMNB 3OQIB 4KJXA 1Q92A 1UMKA 4KXFB 1A3CA 1AA9A 3M4JA 3MWDB 2R84A 3CVUA 3F2IA 3EODA 3LWZA 3VGPA 2LPMA 2D0PB 4TGLA 4YRFA 4ZODA 2EARA 1P8AA 4DGSA 1QAMA 3DDNA 1CLEA 1XRQA 1YZ3A 1NSTA 4NMMA 4KFTA 1EFDN 4NNPA 4D6PA 5I9MA 4DREA 2OC9A 3U09A 4NE7A 3R20A 2WHXA 3IAAA 3VV2A 2VH2A 2FSHA 1HG0A 2WIKA 4EYSA 2C54A 4NEGA 3LPNA 4QM6A 1FFYA 2X2OA 3V80A 3OQMA 1W1UA 1G7TA 2AD1A 2HH9A 3KG2A 4N6OA 1P2UA 3KPJA 1NR5A 4JBYA 1J33A 1RQLA 4QGFA 1H1TA 1QWSA 3UAYA 3HTXA 1TJ3A 2JJMA 1EUQA 5JJKA 4DDVA 1YB4A 2YNMA 2B8NA 1XJCA 4DA4A 4YI3A 1QHFA 1PNOA 4L3WA 3GA5A 4ZVTA 3TBHA 3F4KA 1NQVA 2AJTA 2JLQA 1W87A 1CRWG 3KKNA 1NJFA 4FFWA 1GPJA 1Z8NA 3KSRA 2JIZD 1IWOA 3ILHA 1B0ZA 2CNLA 3EN0A 4UOQA 4CDGA 3EOZA 3CF0A 3MJCA 3HK2A 1MORA 2D7CA 3SY8A 1SBHA 1W93A 5JJIA 1XHEA 3TFOA 1G8MA 3LC1O 1KP9A 1OT5A 4E88A 5JALA 4DGQA 2ZRDA 2UYHA 1A69A 1OFUX 3NT5A 2XUZA 4NF2A 3ZJ5A 4D25A 3FYUA 3EWSA 4TT3A 1J8QA 1Q0HA 3PXGA 3EAQA 2AYZA 5K8TA 2DRIA 3Q85A 3KJQA 2HDNB 2CHGA 2VQSA 2ZIXB 4B09A 1NUQA 3MPOA 4QECA 3AFHA 1KYIA 4Y9RA 4ZVSA 3DFUA 4NU5A 2OYRA 3U4MA 5KHOC 3S0JA 2TRSB 2QTTA 1XTUA 1HE3A 2VO1A 3HYRA 3N6VA 3ANSA 3CMMA 1DBVO 2IYYA 4KGVA 4IH9A 5ERGB 4FR0A 3L77A 2YIJA 4L0CA 3EG9B 2J87A 1TQ6A 1IMJA 1FU8A 4KX5A 1EM6A 2PZEA 4Q3BA 2J85A 2Q0QA 1UOQA 1NUPA 2IYUA 2VK1A 3OWOA 4OQZA 1BD3A 1YB7A 4O2AF 5I8WA 3L0SA 3K0FB 4KQCA 4I5GA 3K9BA 4BMZA 5EP4A 5LKRA 1EYZA 1VE6A 1HSZA 1LV7A 3PF9A 3MWEB 3FXAA 1F9AA 2PKXA 1PFGA 1EE9A 3PNOA 4G1CA 4IDAA 3E8XA 3GFGA 2IFTA 3EMBA 3GAZA 4HGQA 2CDBA 1E5VA 5IAKA 1KFKB 1WXWA 3QNMA 2P7HA 3D4BA 3FF4A 1NR1A 1RXIA 2DLNA 2WU8A 3MBIA 3MRSA 3KD3A 4WNIA 5FLKA 4AT1A 3BB4A 3O4GA 1Y9ZA 3ICEA 1O9BA 3A6LA 3ZW8A 1SVIA 1UL1X 2V7QA 3C8ZA 3G85A 4ID9A 3UH1A 4DMRA 4DR5B 3HE3A 4I1IA 2PT7A 4O4LB 5IUNC 2ZZKA 1U0SY 3P4UA 1UOPA 4CKBA 4W63A 2GS9A 2XF2A 3TFWA 1VLJA 5IDQA 1N33B 4R2IA 3FJYA 1HURA 2PX4A 1P91A 3LP5A 1NXQA 3L5KA 1CPYA 2FETA 3DKVA 1U1IA 2VBGA 5IG2A 3GPBA 5DMXA 2RAVA 3ZVKA 4HLNA 1QVZA 4XEUA 3VR2A 3X1WA 2AJ8A 1L3CA 3QYFA 5IM4A 1RTKA 1S2OA 1VPLA 2OHFA 3DCIA 3O4JA 3I0ZA 4XYMA 4LXHA 3W34A 4RA6B 2XE8A 3I32A 3NBYC 3QIVA 4GI7A 4M1KA 2YY5A 4BNWA 3DR5A 1Y82A 1G8AA 1JJFA 2QV7A 3IXLA 4CODB 4I9GA 1JJAA 1G4UR 1K6XA 4MKIA 5EXEA 1L1EA 4JJIA 2DAPA 4XIJA 1RRCA 1XD9A 1E2JA 4KNWA 2IZ6A 3KXLA 2G40A 4JUFA 1KR2A 5DT9A 2C2MA 3HVJA 1GL9B 5EESA 2ZIWB 2D5CA 2G7ZA 3AR8A 2MSWA 1KVQA 1DU4A 3TQFA 4JB2A 1RKUA 4AG3A 4WCDA 3HB9A 2V03A 2PUBA 1KDOA 5K6RA 3STUA 1NBAA 5EIOA 3V3KA 3VJMA 1WCV1 1EFHA 2XCQA 5DTRA 4D9EA 4R8SA 4F1WA 1I36A 4ZMSA 3E9YA 4HPXB 1N4DA 5J23A 2UXCB 1NJSA 2ZTVA 2D0IA 3OWXA 4HDQB 1V5WA 4ZVVA 3MGBA 4PLYA 5BQFA 5ESWA 4E33A 3M70A 3NVMB 1BX1A 2X13A 1KHTA 1JYFA 2NZVG 3B5EA 3KUKA 3OECA 4YUYA 1JIUA 1U02A 2J3EA 4GKKB 5CITA 1PJQA 2F1IA 3BMQB 4CF3A 4KQFA 3X1KA 3FUTA 2RC6A 4LQDA 2FJ0A 2PUHA 2SCUB 3DZIA 3SN6A 3OCXA 3HXMA 2IDMA 4DSZA 4A8HA 2XUAA 3TMYA 1S8FA 1PL8A 1ISJA 1XPOA 3E84A 5ALEA 1M6WA 1FA9A 1O6FA 1RIIA 3H0KA 1DO2A 3KU1A 3OE7A 3PFHA 1C9DB 1WG8A 2G83A 3I9V6 2DUWA 4RK5A 2YICA 1FUIA 5HIIA 1UJ2A 3IOCA 3NM6B 4CEJB 1DX6A 2VXOA 1XEAA 3TSOA 3CGGA 1EUDB 3OSZA 1SCUA 3QA9A 5AYVA 4AD8A 1MBZA 4DYDA 3GNLA 1YCDA 3DTNA 5FKJA 1E1LA 5JSZA 3KOYA 3E7FA 2YBEA 4JJFA 4KXMA 2EFCB 5TQ0B 3L7MA 1JQKA 3FE2A 4YV1A 1CJKC 1GY8A 3CN7A 1K4YA 1VLQA 4KKXB 4CG3A 3ZCVA 3K09C 5I51A 1NGSA 4MB6A 3VSBA 1M5TA 4QDUA 1KAMA 4IHKA 1BQEA 3IVGA 5LLDA 2XKKA 3KFLA 1PJAA 3DOCA 3UK6A 1JFFA 4RTLA 2ZM6B 1K66A 1K9SA 4Y1FA 4Z5XA 1F7VA 2QJFA 2QW8A 5CGQB 2OHVA 4MPJA 1CZLA 3AUXA 4L50A 1LH0A 1Z26A 2VJOA 5BQ5A 2M6RA 3BTVA 5LZ9A 1M72A 2O2ZA 4YRLA 2YBDA 1KE2A 2WT8A 3ADKA 4RKWA 5TPWB 5ISMA 3SM3A 1XRMA 2QYOA 5EE1A 1U8EA 4PHHA 3H19A 3JD4A 3K1AB 1R37A 3BWMA 3OX4A 2A84A 2X14A 2AMYA 5EMMA 1KJNA 2WABA 3KX2A 4EY6A 3ORFA 1IHXA 1X7ZA 4AY4A 1CIJA 2PG3A 2PTHA 4Q4LA 3DDOA 1U7HA 3KXKA 2NV0A 3L7JA 3SSOA 4HWTA 1BD4A 2G77B 2UZIR 3TDKA 2B4QA 5J2TB 4OQEA 5L3QA 2FMTA 3D8UA 1H0SA 2ZFUA 4O3MA 3H9JA 2V55B 2FEWB 2H7CA 2GBIA 3D4LA 4GP6A 1PLKA 2O57A 1O6ZA 1NW3A 1NU8A 2POQX 3O75A 3CF6R 3ROPA 3IC5A 3CLSD 1DO8A 4GX2A 1Z8HA 3EZGA 3P97A 5EVJA 4TWRA 2CVHA 3K16A 2ZM5A 4MR8A 3EB9A 4PC3A 1UKAA 1CJVC 3L93A 1TADA 2WOJA 4PC6A 3BG5A 1CUIA 2P9JA 3PWSA 4RSHA 3IHWA 4OCZA 1VPDA 4AJPA 1Q44A 1E5QA 2XGJA 5EJ9A 3PS9A 3VV3A 1W30A 2FPOA 5CYOA 4E2WA 4DYVA 3FR7A 1G55A 2XTAA 5JLJA 1KKLA 2IGBA 5FNVB 5BQOA 5H80A 4MV0A 1YZLA 4PPGA 4AMYA 1D09A 2YWEA 4QFDA 5FTKA 3C3BA 3D3JA 3DLIA 1FLNA 2H5EA 2IPAB 3BD9A 3IDZA 1C7RA 5DGDA 2Q29A 1SB9A 3T5MA 3TZQA 1JEYA 3RVNA 2MSLA 1PKEA 3TLYA 1MTOA 3PXAA 2BTQA 4HG2A 3O94A 3LXRA 4L0QA 2FLKA 2WFZA 4KE6A 3WP1B 4EHHA 3QJ5A 4BRUA 1TCVA 4EPRA 1PT9A 1YUMA 2JF0A 1HNZB 3BRWD 4KLNA 4Y2SA 2C4HA 1WDMA 4J03A 1RAFA 3NHBA 4DRZA 4NXMB 2AKYA 3EGCA 1CIPA 3ZWMA 4D9JA 3QPCA 5ADVA 1QBKC 4UEKA 3MBOA 1BVUA 4KXXA 2YFYA 4KQKA 4MR9B 4C6HA 3WLFA 1NUUA 2XE7A 3MJ4A 1CJCA 1L4MA 1XRLA 4GOXA 2VPWA 1JL3A 1ONSA 9ABPA 2YXDA 5DHRA 5JV5A 4CR7A 2KS6A 1PQPA 1W5BA 5EJIA 3PBKA 3HJTA 4OB7A 2PIDA 1U6KA 1C4WA 1UZLA 3D7NA 4IJ6A 5B36A 3V34A 4UQLA 1XZLA 1JB9A 2MYUA 2AMJA 4GF5A 2UUPA 5ALTA 3QU5A 5CCBA 3GJRA 4RELA 3HFRA 2IE0A 2G80A 1CVIA 3FPHA 5F1YA 4DNXA 3S2GA 2A59A 4ENWA 1C9YA 2R8XA 1UJ5A 4KQ6A 1BJKA 5AXDA 4JI0B 2IT1A 4A5SA 3PUIA 1J2YA 1AS2A 3DMGA 3AVQA 4ID3A 4WN9B 1C2YA 3NGLA 4CNBA 1RXUA 1U4OA 2JFZA 5EYPB 5EXSA 1KFJB 1CR6A 2Y0EA 4BNZA 1M0TA 4ARVA 3VKFA 3SNKA 3WQQA 3CH4B 1UWKA 4ZV9A 3EGWA 2AWNA 5FADA 3NR2A 4PBSA 3L1IA 4I5IA 5EKDA 3RKSA 2KBFA 2V1XA 3O2JA 2CWDA 3RVJA 4MWDA 1QC5B 4P98A 5SY4A 1ZJ6A 4W9RA 3VX3A 4EYKA 3D7SA 1YAJA 5T3YA 1P1FA 1BMFA 1BG6A 4M99A 1PFUA 4N01A 1Z7GA 2DKFA 4OUKX 1T1JA 4FHGA 3ZGOA 4BYMA 3T7IA 1NNI1 5C1BA 1A7JA 2Q1UA 4IGAA 2D4AA 4HT3B 4M98A 1W73A 5M04A 2FFQA 4OFBA 4YV0A 3LVFO 5GP1A 1TM3E 2PMKA 5T64A 3COYA 1VRCA 1K5HA 2J0UA 3OFVA 4HN9A 2Q0XA 3LLMA 4KIWA 5JMPA 1M5UA 4EQZA 1LSOA 1QO0D 2QL9A 2W2NA 1CY0A 2VSQA 3B6EA 3DCYA 4CR6A 3T3OA 4BLWA 2BTOA 3WGOA 4MB2A 1U99A 4URVR 5I9SA 2BFDA 4CL2A 2O6HA 1OZHA 1V0JA 2IF0A 3SE7A 4UAVA 1B93A 1SFRA 4M86A 3LE8A 2J46A 2JGMA 3GLGB 4FJ1A 3K09A 2B0CA 1QF7A 3BH7A 4Q3EA 1XJQA 4GDMA 4R2LA 2R9VA 4RXUA 2DPMA 1PR5A 1LWNA 3U7JA 1ISRA 2I6FA 2PGNA 3F3KA 3QTLA 3TSZA 2XF8A 4OHWA 2B34A 2FPSA 3RBXA 2HYIC 3AX6A 1B8NA 3AU8A 4OHMA 2HLNA 4L5YA 3MYYA 4U0JA 3SQWA 5AJZA 1OX6A 3ESZA 2BV3A 3VNQA 3TS1A 4NCHA 1HSOA 1NU6A 1TCAA 2EKBA 1HZZC 1OYYA 1B6TA 2IHYA 2Z04A 3EXEA 5JO9A 4V0ME 4HCJA 1XP5A 2A7QA 3ICPA 4IHJF 4Q02A 5CM2Z 4B46A 3OZTA 3QUBA 2A1UB 3FHCB 5KDDA 2J0QA 2REQA 1BHSA 3V8PA 1WHTB 2GNPA 1Y8RA 1N34B 3T7AA 1HLDA 1N5MA 1N57A 3G2PA 1FBNA 2AZTA 4C0QC 3RU3A 1ZJWA 2P4SA 4IUCS 4LOKA 4URWR 1H6AA 2YRFA 2YN0A 4FKMA 3IPXA 3M89A 4RLQA 4F92B 4C0WA 1YS2X 1RD4A 2PKEA 5HIMA 2KM1A 3QVVA 2VAVA 3E70C 4I4NA 3SKXA 4BFZA 3URKA 3O3CA 3EE6A 3ONEA 1RIFA 4MLDA 2O2JA 3HB4X 1WEKA 5FUQA 3TRHA 2GCOB 3TD9A 1ODFA 3MUFA 1KO5A 2GEJA 2FWIA 1EWYA 2XUPA 2H6EA 2IEGA 4EGJA 2OZPA 2JHAA 3PEEA 2HWYA 1ZOOA 4PHTA 4R3NA 3SHOA 1SBCA 2Q3HA 4OUDA 2BJWA 2EFJA 3CBGA 2JLSA 1LI7A 5DSXA 4IYRA 5JXGA 1RXWA 5HX7A 2BGMA 1IHPA 1M1XB 3BQMB 3IODA 3MTIA 2FJUA 5IT0A 1PX0A 1OX4A 3JARB 4XW2A 3TGWA 1UEIA 5IN4A 2AQHA 1QZUA 1UT8A 1GUYA 1U2DC 1OFVA 2C1XA 3MJFA 5DBFA 4QEKA 2XSZD 2B1IA 2I22A 2DFLA 1YDMA 2I2XB 3IHKA 4DLNA 5C0OE 3PC6A 4B81A 2Y92A 1BVYF 2WWHA 4DC0A 1SA0B 4JCCA 3T7KA 4AWAA 5KTNA 1CEXA 3JSXA 1MPXA 3NUQA 1GUDA 2NU8A 1T4GA 2GHTA 1TQDA 2I4OA 3EIHA 5DNDA 3IOEA 1USKA 4IDHA 4YJ2A 2O8FA 2VQFB 5FI5A 2MJLA 2SKCA 1HDEA 4V0MA 3OSUA 1NX9A 1ZN9A 1V1RA 2GUGA 5HZGA 5AVVA 3DMFA 3LLCA 4FBMA 1JR3E 1UBMS 2IXTA 1LBHA 2WK1A 4M9UA 1EVJA 1CUZA 3ZVNA 1XZBA 2CZCA 4P4TA 1A50B 1WHSA 1L7EA 4G6ZA 3C7TA 2CVOA 4QQKA 2W2PA 5EAIA 2W2LD 1HBJA 4TSFD 3ENZA 2QYTA 3M4XA 4BN4A 2WG0A 4N40A 1NQUA 1NG9A 4TVBA 3PEUA 1YU6A 4N3BA 5CVJA 4FEGA 5HBRA 3TJZA 3U7IA 4QNMA 3WWZA 4G0UA 4ONEA 4V1CB 3MSXA 3H13A 1XDWA 4MP3A 4A73A 3PE3A 5JZOA 2IL1A 2WUEA 3WK7A 4YMUA 4ARSA 4JZYA 2VAMA 4AN1A 2FN4A 2QKYA 2IS1A 2FPPB 3BFVA 4XA8A 3UJ6A 4CM1A 1Z74A 2Z1DA 3KOWA 1YRQA 3QQ5A 3ED1A 1AV6A 4YK7A 2ECQA 1NI5A 1R3UA 4JJ7A 4A82A 3SEZA 2CMHA 4GL4A 5ENZA 3BTOA 2X5XA 1EKXA 2PSSA 5C5CA 3IP3A 1WB6A 2R6FA 3HYLA 4KAFA 2L69A 4PRYA 1A5AB 4RYLA 1AVTA 3TQHA 2RHMA 1KIFA 1GV1A 1ENOA 1KHHA 1T34A 1AF7A 1E63A 3EVEA 4JHXA 4L78A 4AXBA 3U7FB 3PC7A 2QIOA 3D6VA 3LYLA 3UV6A 1XVUA 5HOQA 2ORIA 1JSXA 2FVXA 2W2KB 3WK8A 2XE4A 3IJEB 4HH3C 5FOQA 2G88A 3QI7A 5IDWA 1SOVA 2YWBA 3T3NA 1WULS 1LNQA 5T4FA 3X1XA 1ZH2A 4TTQA 1RSZA 4BBJA 2QDKA 1WW8A 1JR3A 5TARA 3SIXA 1UDRA 2L19A 4PNZA 1P2SA 4O59O 1K75A 1QHNA 1RJEA 4G5QA 3W9UA 5GTDA 1ZGJA 4P0PB 4PV7A 4NX2A 2IU6A 5CAEB 4LCBA 1B16A 3KSMA 1UPCA 1Y3CE 1X7WB 2QW1A 4JI6B 1Z5UA 4W82A 3TTXA 1E7YA 2RHDA 4GZ6A 4FSXA 2B21A 2PZMA 4MA0A 1VB5A 4JXJA 4MICA 4R68A 5IWCA 2X0IA 3BWEA 4NAVA 4AS3A 2ZRQA 4YP6A 3K70C 1GLGA 2JIBA 2ZPAA 1CRPA 2B2CA 4DXDA 2IHZA 4FFOA 2PH1A 4OJNA 5L95A 2PD3A 3D9QX 2W8BB 4ZOAA 4JITA 2JI8A 3OHPA 4KODA 5M2QA 2QW0X 4G4GA 1N1DA 2EZTA 4RYDA 3MCAA 3DV0B 1XF1A 3JWPA 3NLLA 5D7BA 5CURA 1F60A 1ZD3A 2V96A 4M8NE 3GAMA 2I9PA 4RGBA 2ZUEA 4IJKA 1TNDA 3DT6A 4PGGA 3R6GA 1DEXA 4WH0A 1U1GA 2J9ZB 3WB9A 4Z3KA 2XOKD 3K6SA 2P2NA 3EQ7A 1HZZA 1C5KA 3GFBA 4GPZA 4KMSA 3ZVLA 4E32A 5ALVA 1MB0A 2CFSA 2NMVA 4MWEA 3ELBA 4AUNA 3QFTA 4WDRA 2VDVE 2NZ2A 1GDHA 1U1FA 4XE5A 2XMCA 1X8XA 3IAEA 4ENPA 3P19A 2NM0A 4HS4A 4IRXA 3W2HA 2H4YA 1KI3A 3GD7A 5U4XA 1YR9A 3U4QB 3NETA 5CU7A 3KQWA 1F0YA 2OXRA 2C2BA 4E2XA 2RGAA 3HJCA 2BR5A 3L5OA 3PEFA 3QXJA 3Q4GA 4L02A 3M2PA 1FMJA 4TXLA 3RIYA 5B1EA 3UT5A 2ZJ3A 3KLOA 4LSWA 4WKNA 5JAMA 3CUWA 5CA1F 3IUPA 3OZDA 4JP1A 1A9QA 1ECCA 1HE2A 5EKUA 2VHUA 2CLOB 3C70A 3F7NA 3R7NA 1SKYE 2X0DA 2X4IA 2OZLB 2IPNA 5ICCA 5KC8A 4KW7A 1K3UB 1EQUA 1R2QA 4E14A 8OHMA 3VOBA 5EI5A 4IXMA 1EWRA 1RAAA 1U2DA 1FP7A 1YQQA 4IFBA 1UK8A 2HD4A 4D3DA 4BO9A 3UA4A 3EVZA 3P9RA 4G24A 1JLKA 1UK9A 4Q3LA 2ZE7A 4MV7A 4EPXA 1GPUA 5JISA 3ZDEA 2XUKA 4QHYA 5BYBA 5KKAA 4EBFA 4YR7A 3RSGA 1DJNA 1UDCA 5KQMA 1AX9A 4MQ5A 3HR7A 2X5KO 1UZAA 5AVZA 2IW1A 3A4LA 4CKCB 1Z4JA 1JG2A 1HC7A 1AK2A 4NARA 5I45A 3GLVA 2O59A 2FFAA 3FNQA 1D6MA 2YQZA 3EZLA 4PRKA 3SR0A 2HGSA 3PC3A 4AZVA 5J4KA 5A5VA 5CCXA 1DBRA 2I1LA 2MMGA 2RBEA 1XPRA 1PJ3A 2O23A 2ZRJA 4RADA 1X92A 4LXXA 2XMSA 5FUMA 1G59A 4DR6B 2UAGA 1Y34E 1XC7A 4DF3A 3PUJA 3AJ8A 2JFPA 3RHFA 1MV8A 5LWHA 3IPRA 2D3TA 1YH3A 4R1TA 4BJ5A 1B26A 4S1NA 2NPOA 1SBQA 2CVZA 5FA5A 5C1OA 4E4RA 4QYIB 3GRCA 1BXZA 2VQEB 2OCIA 4D0GA 1U94A 3AM3A 2FQQA 3JRNA 2VL7A 3DNPA 1R12A 1GM5A 2GCEA 4HJXA 2ZVQX 1WP4A 3N2LA 1SR8A 3R44A 3R5XA 1KO4A 2RGGA 4MVJE 4X85A 3WK6A 1KDYA 3RVMA 4HGYA 4XTRA 1HR0B 1FYEA 4JS0A 3V8VA 1Y1KE 4MUKA 1J90A 2NSDA 1VPWA 3E5RA 2V7BA 4XVRA 1N2GA 1IVSA 3SF0A 3SQMA 1R27A 5EMKA 5G4KB 3TX6A 1V1MB 2HT1A 2CNKA 3W1VA 2JFFA 2DU8A 1KC3A 4C6TB 4OHBA 1J49A 1ESCA 1Q1QA 1UC5B 1V2GA 2IPMA 2WUGA 2GK6A 4JLJA 3M5DA 3NHAA 1YE3A 1FVOA 3NWBA 6CHYA 4HDKB 2PRJA 5P8WA 1PL6A 1RWBA 3ILVA 4HQFA 4HFRA 4P31A 3IRVA 3CB4A 3R5TA 3F6EX 1EPUA 5ALYA 2QUJA 2BOVA 3ZZ1A 5AVSA 2BM1A 3PR1A 4WECA 2HQOA 3HU1A 4IMIB 1TF5A 3MILA 5IYZF 2FMIA 4EI2A 3WLTA 4RFSA 3PQFA 1XSEA 3HRHA 1Z08A 2CY0A 2JBAA 2JIQA 1JEDA 3S2YA 5LZ2A 1A9XA 1CZRA 1Z62A 1OFIA 3RFVA 1T26A 3QVGA 3WYDA 5TX7A 2I4MA 1A2KC 3T1QA 3MSCA 4M0MA 5K3FB 3ICQB 1T1RA 3KUDA 2AFIB 3KWJA 3OLCX 4HQ0A 5JCJA 1YZTA 2AMFA 1OLXB 2IUYA 3NJ8A 4GW3A 1QFYA 2VDWB 3QWFA 4TS1A 5SICE 1S01A 1EK2A 1L4GA 1LSJA 2TMYA 2W6NA 5ELLA 1SZJG 2HHAA 1DO0A 5D5PA 1P1BA 3SC4A 4MVJA 1W2HA 1BSVA 4Z9XA 2Q6OA 3FTEA 2I80A 2VJAA 4IH1A 5ENDA 3O6VA 1NPTO 1QF9A 2FFBA 3VZQA 4YA6A 4CPDA 3NP9A 5IASA 2C7PA 3UK0A 3VZRA 4B31A 1JAXA 1S3SA 2IIVA 2VZLA 2QTVA 3CTPA 3LKVA 3NJRA 4G0ZA 4HATA 4JX8A 3SYMA 4LWPA 3ZD8A 4J3FA 5K0CA 1N9ZA 2Y1OA 5DBGA 1NFFA 1TB4A 3TOVA 2JKZA 3ASUA 5I5GA 5BYJA 4LX8A 1SK8A 3KWFA 3CWQA 1G9XA 3A1SA 1MEOA 3DZHA 2I0FA 1GGFA 1NIPA 1ZKDA 1D2EA 1C0KA 3FKQA 3LO8A 4OHFA 2VCEA 4Q7LA 3GLIB 5ALZA 3JS5A 2ZYWX 3CTMA 1PV1A 1T8WA 3GUCA 4REQB 3Q72A 1N9GA 4CETA 2FX3A 4L27A 3SBXA 3UENA 3W4JA 2BFOA 4BC1A 2PMFA 3PUWA 4RNCA 5FFMA 2HF9A 4BMYA 2B7CA 4BBZA 6LDHA 1CUFA 4DXAA 4U3JB 1C1XB 2PZJA 3E9NA 4X66B 2CFRA 3BWDD 4OX9Y 1IOVA 3BK2A 3GRUA 2VRNA 1AUVA 1KQFA 3MBKA 3EQ2A 4O08A 2PYZA 3TEMA 3UK7A 4ETWA 2QXUA 2VHCA 3HUDA 4IEFB 1WKBA 4IRUB 2HW8A 2O8BA 2GCPA 4CJXA 3GWZA 4G5RA 2C5BA 1PT5A 3FSGA 4GQIA 1YASA 5LB4A 3UB3A 1YJQA 4CLOB 1NVUQ 5AW1A 3VO9A 2J0SA 4PNEA 5HS6A 1ZK4A 4B5KA 3ZY4A 4UU0A 3THSA 1KETA 3SBOA 2ZB3A 5DM4A 3SICE 4KSCA 1UC8A 5AI5A 1PVDA 1LC3A 1YQWA 2EFDB 2ZRPA 4QXMA 1NLFA 3F9RA 4DQUA 1MV5A 3LUCA 3CZQA 4H17A 2AFVA 5FTWA 2O2IA 4L5IA 5IAJA 4JB0A 1K2WA 1NI3A 1H9CA 2RCNA 1F2TA 5K0FA 2XQIA 1UBOS 1P72A 4YMLA 5IXSA 1UAAA 4RD0A 2XKBA 3WQBA 4UTVA 3O3MB 2OV2A 4FGZA 3ERCA 1OAOC 2WJJA 1JX6A 1DKMA 5KI6A 1AMUA 1W96A 4GQAA 5U4QA 3UH0A 4H6XA 1DELA 1DV2A 2Q6LA 4L73A 4ZPJA 1ENYA 4EEKA 5LP6B 4IFIA 5GGXA 1PR6A 1NQTA 1JZQA 3CX6A 1TJ4A 2WM8A 3N59A 3MUNA 5ANRB 4R4JA 5J4HA 1E9DA 3H1AA 4PLZA 5EUBA 3I1YA 5FULA 3O2SB 3JD3A 1ZMTA 5I9TA 4E1AA 4B3SB 3BD7A 4D26A 2OLKA 2WVHA 4ENVA 1PKXA 1GPKA 1PJSA 4BP3A 3DMRA 1OFTA 1NW9B 4R1OA 1XB2A 5LJIA 3FH0A 3L01A 5CEJA 1KRWA 1SCIA 5DGXA 2I2CA 1ODJA 3HWSA 4MDFA 1KQNA 2IUFA 2VP3A 4MITA 2K87A 1K88A 5IZCC 1UEXC 4HYQA 4TWIA 1RQGA 1D1PA 2QQEA 3KLNA 2C92A 3AKZA 3D64A 1NRIA 3THRA 3ZYCA 3HGTA 2HIMA 2ZJFA 3IKJA 4HR7A 3ZKAA 2P75A 5CDFE 4TL7A 2J9FB 4JEHA 1TIPA 2GJ9A 4ZRNA 1JEQA 4KITB 1C3XA 4LMRA 2HK6A 3PL5A 1P7VA 3EFBA 4JMLA 4UBKA 2Z1MA 5DPMA 4UEQA 3RAPR 3WHIA 3GA7A 1T5IA 3UTDA 3IE2A 3ZLTA 4HFMA 1JDBC 2JJ1D 2W98A 5H81A 3OZUA 2FQYA 4GKJB 4CGZA 4NK4A 2QLBA 5E7QA 3ZIUA 3ZJ4A 1A2OA 4YLYA 2GEFA 1N2XA 4XLLA 4B2LA 3TQQA 1JAHA 3H99A 4LSGA 4IIBA 4TWBA 5DW0A 5TR9A 3TMKA 4D3FA 2NNWB 1NV9A 2ATVA 4GMFA 3QVKA 3D2CA 1V41E 3EEYA 4P3XA 2XUOA 3HLKA 1V45E 2NUAB 1OYVA 4YJFA 4B17A 1IN6A 4A4DA 2LE0A 3D8RA 1B73A 2QAGC 5BVHB 1PHRA 4HNAA 3PUKA 2FG5A 3QZUA 4HWRA 1Q91A 3ZWPA 1OR8A 3KKOA 2ZCJA 2J3DA 1E1QA 4HH1A 4KQIA 4NCNA 1B6RA 4ZZ1A 1SC3A 2H54A 4JASB 4YUAA 3HUFA 1PYOA 4AURA 3TE6A 1SO8A 3KAPA 3PA6A 2NXEA 3K9NA 3NKVA 1OBOA 2PCLA 4WZAE 5BSUA 4ND4A 4ISCA 3QVMA 2NV2B 2JFXA 2ODWA 7AT1A 4RH0A 4B3JA 3EXIA 2PXXA 4ZTZB 1SZPA 2C95A 3N8GA 1QK5A 1ORIA 1YDWA 2FPXA 4QOJA 3GT0A 1H2EA 3K20A 4M60A 2BKVA 4UUQA 5JC8A 3N2KA 2Y2VA 3BGIA 3UIEA 3DDHA 5CDFA 3UB2A 1W34A 2Y76A 1HRKA 4RJ2A 1WO8A 3GLHB 5CNMA 5K0NA 5MF6A 4V38A 3EXFA 3PD0A 3AVPA 1KO8A 4XQ9A 2X4DA 1X80A 3CCFA 2A6PA 1DAHA 1SNYA 3ZW9A 3UMVA 2HO5A 4P7GA 5EPUA 3WMFA 4ZHQF 3LY8A 1RLJA 1TVKB 4OK5A 4CFYA 4NP6A 2AFRA 2FPRA 2P9CA 5H1YA 1QUEA 2BGLA 1OTYA 3TUZC 1FFXB 3H5WA 4QODA 2H1VA 2C04A 2D00A 3CX3A 4R1NA 3QNUA 2GD1O 2H31A 3DFFA 3MCVA 1DUIA 2VWPA 3ETHA 3NAQA 4Q18A 1W5EA 3KHKA 4DSOA 4I1PA 5JXIA 4XJSA 5F23A 1LFDB 4B4VA 1P2TA 1COWD 2JIZA 2DERA 2JVKA 2FF5A 2HYDA 3PJGA 3H42B 4TWAA 5KWVA 5IXJA 4CCWA 3G7UA 3LKBA 2RK6A 3K3PA 5JSYA 1FX0B 1GNTA 4NHOA 1W5SA 4C0JA 2IXEA 1EFLA 1K06A 2B83A 1J20A 1L5YA 3VKUA 1M34B 1VYHA 2XCLA 3CH7A 3MMPA 5AM5A 3WBJA 2Q45A 1P7YA 4XCXA 1VJTA 4KX3A 1N8NA 1M6NA 2FE1A 3M6XA 5A5EA 5A9SB 5DNEA 4D4IA 4FQ7A 4WZAA 4A0QA 1LLCA 4PPNA 3K4HA 1I7SB 1I4OA 2ZVDA 4MQFA 5M3BA 2JI7A 1ZA2A 2P9FA 1USUA 1YONA 1K0UA 2DFDA 2IUEA 3A4IA 3E1KA 1W8IA 1XO1A 3KZXA 4MV9A 4GC5A 4OA5A 4ECEA 4WZZA 3CUKA 4NY1A 5JARA 3L4KA 4DUZB 4OXYA 1L5HB 4KIGA 3RSCA 3EA4A 4NJEA 4NABA 3HLYA 2CL0X 1VJ0A 3DB1A 3FVVA 3PI7A 3BIXA 3O8NA 2R1TA 4B3RB 1VBNA 3CLSC 2C88A 3FSRA 4X9XA 3GLFB 3NHSA 5IJ9B 2AZ4A 2RAPA 3FTFA 2IYAA 3TNFA 3RJZA 4WJKB 2Q8NA 1UWCA 1WU7A 1YB5A 1C1YA 3QLVA 1QH8A 1OAOA 2D1QA 3ZDFA 4ARBA 1QIGA 3L8CA 3YASA 2BEVA 3KT6A 2GYUA 2G0NA 2R8YA 3EQ9A 3ESXA 3KTOA 4HAUA 1JIVA 3A36A 1EBFA 1BWQA 1GG9A 2QM8A 2IY7A 3NWPA 5EQTA 3A25A 3C6XA 1C9EA 2I1VB 1WBBA 2J3KA 4QZVA 1AS0A 1KJJA 5B64A 4HGRA 4B9EA 1T4MA 4AX8A 3FYCA 4PZCA 2XD9A 3AF1A 4BQIA 3AJDA 3KHUA 4RGYA 5DIFA 5TQ2A 5SYNA 4RO0A 3VR5D 4GT1A 3NBAA 5AK0A 1URPA 4J2OA 3EG5A 4ZVRA 3J7AC 1XZIA 4WIAA 3EMKA 1LF5A 4HDCA 1T2CA 2XVYA 3E61A 1FMTA 5AW7A 3DE1X 2OZKA 1EA5A 1WNTA 1DOZA 4EX6A 1D7OA 1WB4A 2WYOA 5FORA 3UMJA 3MCWA 3NBXX 1ZM9A 1PWXA 4EFMA 2HDHA 2ID9A 1CZOA 1AQLA 1FNSA 3RNOA 2P5TB 1D2RA 2J5XA 3GDGA 3W5SA 2O8CA 2YZ2A 2VJCA 3E03A 5EHIA 1PFKA 3QFHA 2XDWA 4B40A 4BNDB 5FP0A 5TS3A 1YGYA 4PGAA 1QFMA 2P77A 3LPAA 2P3OA 1EM8B 3IEPA 3QLEA 2W6QA 3UZUA 4BPBA 3I6BA 3RUFA 4NEQA 3OQBA 1U5BA 3HJNA 2FMKA 4EHBA 5A4JA 2HM7A 4KWCA 3AEQA 2UUAB 1P1CA 2EVWX 1L7MA 1MAUA 5BNWA 1U2SA 5HEKA 4ACAA 1RLTA 2YJ3A 4JYPA 1WSBA 2ZB7A 1VHTA 3NHUA 3NV7A 3H0CA 1I7QB 1S1CA 4QUEA 3BM5A 1GSHA 1I7LA 2EKZA 3TOSA 3ZE0B 4QDJA 1O0SA 4N41A 1P80A 1U2EA 4YWHA 3EG9A 2QAGA 3N87A 1Z0IA 5K9ZA 3VHXA 6AT1A 3HNOA 5G4LA 3AF0A 1TUBB 3OJLA 4L3VA 3KQQA 2DETA 3PHGA 5CHEA 4MKGA 4BGDA 1XALA 5L8VA 3MWEA 5FOTA 2FRDC 1V7PC 1QS0B 3NAMA 3PK0A 5KOYA 4K6OA 5TVKA 4YDQA 4Q03A 3CKMA 3K31A 3ZDRA 4KN9S 3VTZA 3V46A 1YUNA 1QVWA 1RKVA 3CUVA 4D82A 1XXHB 3IQIX 5CM9C 1KU6A 1TAUA 3CVOA 4WA7A 3ZWNA 5DOVA 3GF4A 3OEWA 1SJ9A 4EB6A 4YACA 3ZYZA 4YMSA 1R0KA 2F1OA 5JATA 2ZYUX 1LY1A 2ZYRA 4ITRC 2XLCA 1TL7C 3IEXA 4LRUA 3OUUA 1UPBA 2XW6A 1KEWA 4BVBA 1CKEA 3FTDA 2VRWA 2AXEA 3A4YA 2GNAA 1ZU5A 3TW6A 2HHLA 2QTNA 3R23A 2IEYA 4N0QA 3PC8C 1TK9A 3LUGA 4HPWA 4WOCA 4ZT6A 5JMOA 1QUFA 4H08A 2A7XA 3ZDXB 3TRDA 3AMVA 4UHFA 1QLHA 4LF7B 1PG5A 3KJIA 4DT1B 1TZBA 5GOZA 2ZRLA 3FOWA 3U1VA 5AM2A 1G8JA 4YAOA 3AOGA 2B8JA 2R1ZA 4RXTA 5JECA 4Y9SA 2LBPA 1G7SA 1NN1A 1RRFA 4GKVA 3T0IA 3UJDA 4CHGA 1I6KA 1UKCA 3NUZA 5IANA 2ZTSA 4CIYA 3OT1B 4R8MA 1X9IA 3OCVA 4AKTA 2AE2A 3UAGA 1E62A 2DFVA 3SC2A 1ND5A 1O8BA 1R0CA 1S9DA 4QRIA 5F3RA 3GRPA 1D8TA 2HBRA 1O1YA 3RT7A 4C2TA 1IBLB 2ZJ0A 1TJNA 2ZS7A 1AU9A 3PG5A 3PXXA 5KDOA 5HRCA 3VU3A 2E87A 4PSVA 4HK4A 1RHUA 5KMGB 1NW6A 2GFQA 2QF7A 3FRJA 3IP8A 3ROQA 3QTBA 4U02A 3S2UA 3V8BA 4Q7EA 5BVGA 4RV9A 3PB3A 4RS4A 3II6X 5FUBA 3V4SA 1KDPA 3BMQA 1W75A 3ZE1B 2QYSA 3TLKA 4G9BA 3QKUA 4IIXA 5KPDA 1Q14A 2OVBA 5DHUA 5G0UA 3F74A 4BNMA 2WD7A 4TLMB 2JLCA 4AF6A 3MLEA 3T4XA 1GEEA 2WJHA 1GDTA 3KLPX 1XIVA 1U8XX 3DDUA 4YS6A 5HMLA 4ACBA 1B23P 2YV4A 1KDRA 3B12A 3EXG1 1QIDA 2C0PA 2FNAA 4FFPA 3BE6A 1I80A 5FAKA 5B30A 1BOFA 3VA7A 2A9VA 4YRZA 4X3OA 5JR3A 1C0LA 3ZE7A 1JJBA 4L5BA 1IN8A 4MYTA 4QG3A 1E4VA 1KZHA 2DZDA 4F5YA 5TQ0A 1G291 2XMGA 3IEVA 4PINA 3O31A 3PVZA 4B74A 2A0WA 2QZ4A 3AEZA 3UAOA 2O5VA 4EAQA 5B4VA 3HB0A 4UAJA 1UKEA 2DY0A 4PYNA 4AS1A 3ROMA 5AKJA 5E3JA 1ZL2A 1E66A 2XZDA 4DCOA 1M5RA 1VYUA 4GPD1 5J2UF 1QU3A 4A2WA 3BUSA 3ZVMA 3LFUA 1F2VA 4NFYA 3H17A 4QAJA 1EX9A 1JG4A 1WCIA 3OEHD 1XCJA 3BRWA 3H97A 3W06A 1ZHFA 4C76A 1BKSB 1W94A 5I3CA 4FX5A 2Z8YA 4W99A 4FB4A 2IXAA 3I4CA 1XELA 2QBYB 2G7MC 3HRKA 2GD2A 3I9FA 1E6MA 3IUYA 2C0CA 2NU7A 2I6UA 3JYLA 2ANCA 3MNFA 5TPWA 4HHEA 3M4YA 1VG9B 1J8DA 1S3GA 3C4VA 4FFDA 5ECDA 3W5HA 2RGCA 1P39A 4HL6A 5FUYA 3TF5A 4FMDB 4UASA 1NXTA 1US8B 3KKMA 4JZKA 5JS6A 5EWJB 4LWOA 1DEKA 1SUDA 2FVYA 2YW9A 1T6YA 4X65B 2YXBA 5CXSA 1QO7A 3LECA 4PO1A 5K09A 3NEJA 1XR3A 4NAHA 1K8RA 5KAPA 4Q7QA 4PN7A 4MW1A 1MH9A 1RKXA 1V4VA 1CZKA 1GCGA 1XDDA 2VHYA 1DLJA 2C5SA 2AT1A 1T8SA 2MSCB 4PY2A 5JZBA 5BUCA 1QHGA 1E2DA 1WKVA 1UAYA 4DIBA 1Y37A 3QVUA 1HUQA 4OXQA 5IDYA 1QRSA 1NHGA 2P1DA 4RH3A 4DAEA 3TGPA 3HGMA 3OPYB 2EX4A 1GPYA 2REBA 3HJFA 4COOA 5CA0F 3NOOA 3AHGA 3ZH2A 2DLDA 3AH8A 6NULA 3GFRA 5EIHA 3WXBA 1AZWA 2GYWA 1GCOA 3VC7A 2NTJA 3GRZA 5JH7A 4IOKA 5JS7A 3CG0A 3GXOA 3HO8A 1QRTA 1DWQA 2R8RA 4NPAA 1YOVB 3ROXA 1AXRA 4A0SA 1VLLA 2HPAA 3OKCA 2HA7A 4M6WB 4BGVA 1FFGA 2FMHA 4I5FA 4K87A 4RSMA 4RPJA 4W5HA 1W8DA 5C5EA 5J58A 4PG6A 1EGQA 4J0JA 4CV2A 3KELA 4DMCA 3DBIA 2LKDA 2RC5A 2JGNA 4BX0A 1NJ1A 2WSLA 2OAP1 1ZJYA 3JPYA 2RHTA 4B34A 4BGUA 1ZUWA 3QEOA 1QO0A 2JS7A 4WJZA 1V37A 2CLIB 2OG1A 1EVEA 3ACBA 1O3YA 4L4RA 1L8OA 1B74A 3M81A 4Q16A 1SGWA 4CWAA 2PUVA 5KNCH 3V2UA 3LDGA 5HJ7A 4W1PA 5B7PA 4HNQA 4R05A 1GGEA 3IEIA 5EJ5A 2XIQA 2Z9DA 1J0BA 2PYIA 4GECA 4HAIA 4C4AA 2QAIA 3KWMA 1ZSVA 2HRBA 2XMZA 3CISA 3H9QA 3PC8A 1RP7A 4MINA 3UAWA 1A5TA 1QANA 2UKDA 3O92A 3WICA 4FCTA 3MJSA 3PX3A 721PA 3NX4A 1XP8A 4MR9A 4M0DA 1G20A 2HJVA 4ZTUB 3I76A 4J0GA 4UULA 3FNBA 3O8OB 3RFCA 1XYYA 2V74B 3CO5A 3IBYA 4K6MA 4D8TA 1S5PA 2ZT5A 1OPXA 5DTJA 2KYRA 2XJ4A 4XCQA 2I34A 3STHA 4YV7A 3GLGE 4WSOA 2ODNA 2GR9A 2XR1A 1Q3TA 4IHQA 2ZJ1A 5B4UA 5CB6A 5AW3A 1YXMA 2C8JA 1HE8B 3IUSA 1XA0A 4XJXA 4BV2A 1H5QA 2AOTB 4EUFA 1NBHA 4LDPA 1ADYA 4YUWA 1I4WA 2JRLA 4WN9A 3ROZA 4MI3A 3ZHRA 2B99A 1NJ8A 1IM2A 2D2EA 3QU7A 1LZKA 1MEEA 2HIHA 3PPWA 4IUBS 4L9SA 3TQTA 5I7EA 3GUUA 2CL6X 1RQRA 4NFHA 4URUR 1NN3A 4HS9A 5IDXA 1P9NA 2K2QB 2YYSA 2CKMA 1SXIA 3PVSA 4PR0A 1AF4A 4HAWA 3IP1A 3LSYA 1IATA 2YHAA 4RK6A 5B6PA 1RS0A 4Z49A 4WFKA 1DTWB 3EH2A 3QY0A 4TTPA 1TPZA 2PJDA 4LYYA 1Y81A 4OEHA 3FGOA 4A10A 4AQYB 1ACMA 3IMKA 2W6ZA 1R6DA 4OP3A 4HZGA 1M7HA 4UQPA 5EUQB 4I1RA 1RXYA 4E51A 2VUTA 4ZOCA 2W83A 4TTSA 1T3LA 2Y4NA 4JD5A 3C8HA 2GPSA 2NXCA 1V9CA 3D6JA 3U4IA 3ZQ6A 1ANKA 2I4RA 3ONFA 3L92A 5HFAA 3FVRA 3PU6A 1ORRA 4R9RA 4WUTA 1BRMA 5E38A 3EVCA 4OL9A 2XSZA 5BT9A 3VR6H 2XT6A 5BOSB 4ZAGA 1NN5A 2WJPA 3K8QA 4KK4A 2O8NA 2PQMA 1PD1A 3JALB 4LGMA 1REQB 1UJ4A 4J7AA 3VJLA 4IW3B 2VHEA 3DWGA 3C41J 2QENA 4IAOA 4NCKA 3GNSA 2DWPA 4WESA 3PGVA 2VLIA 4B87A 5HZKA 2ORWA 1SEVA 1WIWA 3HO6A 4HX2A 5JY6A 4B6RA 3C48A 3L7IA 2PR7A 4MCJA 5LUAA 2VEOA 3ZW7A 10MHA 1YZFA 2HMSA 5G1PA 4OBBA 1B3BA 3FY4A 1EH5A 3HC7A 1X7YB 4MRPA 4O4HF 4RHXA 4RKFA 5THKA 3U37A 1S8OA 1FLAA 3HJRA 4G09A 1JEJA 3RS0A 4BKQA 4JL5A 1YJCA 1N7HA 3FG9A 2YMMA 1EJ2A 4OJYA 4PLVA 3KEOA 2ZI4A 3A1UA 3V4FA 2W2LA 3P9QA 4TSFA 4X1OA 5IVHA 3DBHA 2I99A 1T3HA 1SHJA 3HY6A 3UJ8A 5A02A 4GM4A 2Z6AA 3BTSA 2Q3JA 4EY5A 1ZM7A 2QEQA 4OLJA 5FHRA 4BLVA 4AKHA 4TUYF 2A1UA 1UWLA 3TI9A 3PUYA 5FF9A 1OGJA 3QITA 5HA5A 5TEWA 3N8HA 4ISBA 1Q12A 4MQLA 3LFHA 3AR2A 3RS2A 3HXQA 1MX5A 4QELA 4IVRA 2RONA 1LPMA 4JKYA 3WIBA 4CQMB 5EHZA 4ZIRB 2F8TA 4ZYWA 4UFPA 1Q95A 1ODSA 3FTPA 1XDSA 2HJ9A 4QOGA 1SKBA 2JBWA 3OOWA 3RHSA 3L6CA 3JASA 2G9ZA 3O0TA 1ZCJA 3TXXA 1Q1EA 4MI6A 5IJ0B 4IGFA 3BORA 1XKTA 4BB9A 5D3ZA 1QHHB 4K9SA 1MC1A 3FGZA 3R3SA 4S24A 5H8WA 3RC8A 2DHRA 3LDFA 4IDQA 2GCOA 1E0DA 2R6DA 1ECGA 4JBNA 1UPTA 4HYTA 3M3DA 2VQ6A 4A26A 2HNAA 2EG5A 5T6BA 3R7WB 2OM6A 1NLZA 3VTFA 1K92A 2ZRMA 5IJWA 4CUZA 1AGNA 3BJZA 4CCAA 3E4DA 5JRJA 2UUOA 3ASYA 3ZK8A 1E5TA 4PBTA 1ZG3A 3LQRA 3P9ZA 3AVXA 1W36B 1DX9A 1X39A 2REXB 3JTEA 4O4JB 3BE5A 2KMLA 5CCEA 3L6EA 2P5UA 3I2GA 4BJ1A 2MMCA 5ETJA 5BW8A 4EJSB 4R1SA 2B2XA 2CJYA 1LX7A 2ZI5A 3X1ZA 1Q50A 1KXJA 1GWNA 2Q07A 4P08A 5D8DA 3ZX4A 2ZBQA 1PK7A 3KVNA 3TKYA 4EKGA 1G4AE 1M74A 4QYTA 5CB4B 1C1DA 1QIJA 2I33A 1XA4A 2IDKA 1TA0A 3BGWA 5GJCA 2FEMA 2BF4A 3DW1X 1TRHA 4RF2A 2JLRA 1J8VA 2YFQA 4G3XA 3FN4A 1Z38A 2G9UA 1YZGA 4JEIA 3OD1A 4X8OA 3W8FA 4Q9KA 2CJWA 2JFQA 1A8UA 3GBVA 1WV1A 1AHHA 2VHXA 3IB6A 4LXGA 2GFIA 4QVGA 4TYNA 2I67A 3DP9A 2P2SA 3G8YA 2EGHA 4HZIA 4QPZA 5G41A 3VI3B 1UZUA 4FNMA 3IPCA 3E5NA 2O8DB 3GH1A 1J06A 1E96A 3AC0A 3O8QB 3T94A 4Z8YA 3KZMA 5GIPE 1F8GA 3JZMA 1Z9BA 4FSHA 3S28A 1CQJB 4LRTB 2V5VA 1VHQA 5L7YA 4L7VA 3O38A 1RBZA 4MS1B 4EOGA 2GJ8A 4H1WA 1TIBA 2J3QA 3JQQA 3EF3A 4BLQA 3MS7A 3FCYA 5TS2A 1A1SA 1V3QE 1JQ3A 2D62A 4EY4A 1RLOA 2CCGA 1CLUA 1H5UA 1XZ8A 3K0AA 1JKMA 4D02A 5BMOA 3VAYA 4V1CA 4IKOA 4R83A 2EV9A 2XOKA 3ASVA 2WJ3A 3FYSA 3THYB 3U31A 4RY8A 4Y7DA 1DEHA 1PGJA 2GUWA 3M4NA 1IE3A 3Q6MA 1ZUIA 5E1BA 3REOA 3A58B 1E2GA 3NPAA 1Y4UA 3UMCA 3EIOA 3RADC 1LB1B 1YC5A 4FN5A 1E2FA 2Q5JA 3G1TA 3GMSA 4X93A 3OLQA 4MUMA 5EGSA 3T52A 1M1NB 2NPIA 1E6LA 3GJ5A 3RRYA 1J2RA 1GPWB 4R1MA 3THWA 1OXTA 1JHZA 1R4MB 2BEWB 2IY9A 3OPVA 1VG0B 5CCDA 4DARA 2X0FA 4PZ9A 3MQ2A 1W2GA 1Z22A 2X22A 3HU5A 5BSVA 4L08A 2AK2A 1LQ2A 1ZGHA 2D0DA 3IUEA 1YJ5A 1JU4A 4D79A 3QBTA 1SUWA 1AKUA 3E9RA 4DV3B 4U7JA 3ZJYA 4E30A 3BRCA 3HN7A 5G0WA 3RTBA 4G0WA 4RABA 5IM4F 5E8RA 1V9LA 3HB1A 3W5UA 5FTNA 3P4XA 2XNJA 4GMXA 4QRHA 4PFJA 2E4VA 4Y2YA 5EOVA 3VTAA 4FZRA 2XYVA 2I62A 1TKRA 3AIOA 1HL3A 5AI9A 1EP9A 3RO7A 1UM9A 1S6YA 1XKXA 1GNPA 1PJBA 2Z6QA 3L0YA 3SJZA 1KNQA 4RLHA 4S1WA 4P4UA 5CNIA 3PDIB 4C7XA 2OFOA 3LMKA 1G60A 4O4IB 3TLJA 4Z7JA 3NHLA 1GITA 5AVUA 5JYDA 4R2XA 5AESA 3EGXB 1IBMB 2PUJA 5DLYA 4BVJA 5LVAA 3GFPA 4LXYA 1YBAA 2JGDA 2CMKA 4UMVA 3F47A 2A58A 4TZTA 3AWDA 1UBUS 4ZEVA 2ERYA 4MQ4A 4A91A 3KT0A 4O8ZA 2BMAA 3OOEA 4R8VA 4HDNB 2B6HA 4GLLA 5IVPA 1XMVA 3T3DA 1Z73A 2ZBVA 4NHEA 4MHTA 1B1AA 1P7WA 2FN3A 2ZBPA 1VMKA 4QHTA 4KYVA 5FEUA 3ZHZA 1GZHB 3PC4A 2VAXA 4JLMA 1ZIXA 4AU1A 4G56A 2R86A 5A5FA 3AL0C 3QHQA 5IBRA 3I28A 2R6HA 4NVRA 3H83A 2F1JA 3TRFA 4EUNA 4PLWA 4OI2A 1QQ7A 4B3IA 1PJLA 3UBMA 1RXCA 2OOKA 4MUGA 4BFCA 3JYOA 3WLSA 2J9YB 2IIBA 2PL1A 1YI8A 2ZJZA 3EDCA 1EHYA 4JVLA 2FR8C 4OO3A 4U39A 4YP1A 5KU1A 2B5OA 1Q16A 5LQDA 1O2DA 4CKEB 3WGTA 3C1OA 3UQYS 2XQVA 3VOTA 5LDDC 4M1WA 4YJ3A 5D84A 2R96A 1OASA 3JVIA 3GGPA 1Y0BA 5HG0A 1XKQA 5CLLA 1YRYE 2AF3C 4DSNA 5KYTA 2JL1A 1Q7BA 4TXJA 2XYRA 1XX6A 1BU8A 3ESRA 1IY2A 1D9ZA 1STOA 3DZJA 3IP7A 4M1SA 4DLKA 1Z63A 2NVWA 1HXHA 4I1VA 3ZY5A 2CCJA 3UO8B 3OWHA 4EG1A 2ILVA 5K6AC 1G0NA 3CW9A 2XXAA 1S89A 1TDJA 3OCZA 4R84A 1KO7A 1TKBA 2Q1SA 5FPYA 4F91B 1VP9A 4JMPA 1Z7WA 2EJUA 3FUXA 1ZNXA 3I05A 3ETLA 2OZLA 4QYWA 3AWIA 4Y2JA 3BE8A 4GWLA 4BP8A 1THMA 3K9LA 1TF2A 4NEHB 3ZWOA 4JNKA 4Q4AB 4ZT3A 5JSUA 1PJ8A 2BP7A 3PXDA 2WJ4A 5L3ZA 3T5PA 4U7GA 1AZTA 5FIUA 4ZEWA 1FS6A 4FZVA 3IIKA 1Q7CA 1VLHA 4UXJA 4CMKA 4DM3A 5LYJB 4FS8A 2PX8A 4TVSA 4WAUA 3H4MA 4LDQA 1HMYA 3KZ1E 2WVJA 2ZJ5A 1OQAA 1A8PA 2WAMA 3UWSA 4KREA 1K6MA 4G8CA 5ICMA 5IPFA 5LOVA 4BNGA 2DXIA 4C4XA 4ARCA 2O54A 1CUBA 1WS6A 3F0TA 4CKCA 4RMIA 4CM4B 2C5FA 1N2OA 3JQDA 5HQ3B 3WWPA 5F9HA 5FLXA 1OGIA 2PUEA 1VL1A 1KI7A 5B1HA 1M2OB 5E1MA 4ESVA 3RKUA 1U0EA 3QKWA 2Q1XA 4ZVUA 3NYIA 1YL5A 4ON9A 4PG5A 2YUTA 1JPUA 5P21A 3H65A 2QZJA 4EKIA 1VMDA 2AFIE 3QFSA 4KUHA 4GD3Q 4RV5A 4ZYLA 4JEUA 4H2DA 4DTIA 4G41A 1TAGA 2ID8A 2IU0A 3UEOA 2II6A 2J4CA 5IC5A 4BTLA 3FVQA 1Z07A 2VFAA 3Q7QA 4KO3S 3PHJA 4CKXA 4MDYA 1NMXA 4LXQA 5JTUA 1OPRA 3ZU2A 3ZS9A 1AHNA 4CHTA 2AVNA 3BFPA 2ZRCA 2G76A 2DWCA 4PZZA 3JQAB 5BNTA 1M8PA 4TLAA 1PJZA 2VOJA 2GWRA 1XCOA 4YASA 3A6EA 1KA9H 4ZPXA 1KQ3A 1U3CA 3OX2A 3EVBA 1QP8A 1ULBA 3N75A 5CX1B 5DH9A 2JLZA 4D74A 3ZDBA 4R3UC 1KDZA 5G4KA 5AH0A 3DLHA 2YQ5A 3HM9A 2OXTA 2ES4A 5EJAA 2GO1A 1G42A 3T1TA 4N0EA 3ZEIA 2W2OA 1EFRD 3DAGA 4RV4A 1RI2A 4BKRA 4IIJB 2CDAA 3W2IA 3SQNA 2Z2YA 1M1YE 4IV0A 1ISPA 1RWMA 4BEBA 1GPAA 1NDQA 3GLIE 5EKSA 3ICCA 3LA8A 3T1OA 3KJFA 1OLSA 2DQ4A 1YRBA 1EDEA 2NXNA 1JBQA 2PMDA 3QYPA 4ZT4A 3WZMA 1P7ZA 4M4SA 2Q0HA 2A88A 3FM9A 4QE3A 4HUQA 3RBZA 3W77A 5KTYA 1JDNA 3F71A 3WIUA 2JCSA 2IKQA 1Q19A 1GA1A 1VIDA 5M7EA 1AG9A 3Q15C 4GKAA 2QRKA 4JNCA 1KZGB 5HCIA 5KSWB 3VJRA 1X6VA 2P5SA 2GEUA 4KXQA