1IDOA

I-domain from integrin cr3, mg2+ bound
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
184
structure length
184
Chain Sequence
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRIN
publication title Crystal structure of the A domain from the alpha subunit of integrin CR3 (CD11b/CD18).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 71
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 1996-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1idoA00
4IHKA 1JV2B 1SHTX 1YVPA 3IJEB 3ZDXB 1XDDA 2VDKB 2VDRB 4WFQA 3K6SB 1N3YA 2IUEA 2I6SA 2NUTA 1LFAA 5ES4B 1JLMA 1L5GB 1SHUX 2ODPA 2ODQA 2WW8A 5KYWA 2I6QA 3TW0A 3ZQKA 5HGJA 3EG9A 3QA3E 3E2MA 2VDMB 4A0QA 3F78A 1SQ0A 4MMYB 1BHO1 1M2VA 4Z7OB 4WJKB 3K6SA 1XDGA 3EH2A 4HQLA 4UM9D 3TXAA 3HXOA 3ZDYB 2VDPB 1CQPA 3PPWA 1PD0A 3V4PB 1IJKA 3GXBA 1DGQA 1ZONA 1U8CB 3EOAI 1DZIA 4HQOA 1ZOPA 4MMZB 1FE8A 4IGIA 3F74A 3NIFB 5HJ2A 4MMXB 3K71B 1U0OC 3ZE2B 4NENB 1UEXC 2WINI 5E6SB 2X5NA 1MQ9A 1PD1A 1RS0A 3PPYA 3EGDA 5KYXB 1PT6A 1MQ8B 5BV8A 1JEQA 2NUPB 4M76B 4NEHB 4WK0B 5KYYB 3V4VB 5KYUB 1MHPA 1Q0PA 3EFOB 5E6UB 2VDQB 3ZDZB 3PPVA 4NENA 4F1KA 3BN3A 2VDNB 1IDN1 1QCYA 4HQKA 1NA5A 4DMUB 5HDBB 1V7PC 4PN7A 1T6BY 1FNSA 3ZE1B 1MF7A 1U0NA 2VDOB 4HQFA 5E6RB 3VI3B 4O02B 4XW2A 3RAGA 4IXDA 1M10A 4UM9B 1QC5B 1TYEB 1IJBA 1CK4A 4Z7NB 3TCXB 4C2AA 1PCXA 3EGXB 1AOXA 4C2BA 2B2XA 1OAKA 2QTVA 2O7NA 3BQNB 3FCUB 2ADFA 4G1EB 3ZE0B 3FCSB 3M6FA 3K72B 2VC2B 1RD4A 4Z7QB 1AUQA 1QC5A 2NUTB 3HI6A 3TVYA 3EH1A 5KYWB 3IBSA 4C29A 4G1MB 2NVOA 5E6SA 2XGGA 2VDLB 3EG9B 3EGXA 3NIDB 3T3MB 5KYXA 2XWJI 4CNBA 1JEYB 2NUPA 5KYYA 5LN1A 1M1XB 1M2VB 4FX5A 5KYUA 2M32A 2XWBF 3EFOA 3N2NA 4JDUA 4UM8B 5E6UA 1AO3A 1XUOA 1RTKA 5KYNA 3HXQA 3BQMB 1M2OA 1YVRA 1N9ZA 3EOBI 4CN9A 2ICAA 1RRKA 4BJ3A 3PPXA 4HQNA 3Q3GE 1MQAA 1JEYA 5E6RA 2I91A 1IDOA 1MJNA 1ATZA 4CN8A 3NIGB 4F1JA 1M1UA 1ZOOA 1BHQ1 3EGDB 3VI4B 3T3PB 4WK2B 1JEQB 4WK4B 1T0PA
chains in the Genus database with same CATH superfamily
4ETWA 2A1UB 3RJ5A 1XZQA 2VUTA 2XUGA 3HJAA 1HKUA 3IULA 1YE8A 5T8KA 4CXMA 1ST2A 1BYIA 1Y7HA 4LHYA 3T5PA 2BRUA 2PWZA 2XT0A 3ROGA 3SF0A 2JHAA 1NVEA 2W2KA 4HEHA 4ZODA 4RTNA 1BMQA 1FQOA 3SZRA 4GGPA 1I7LA 4EYSA 1GRNA 3LUCA 4YJHA 2H0QA 3L49A 4OBEA 3O3NB 2WG0A 4FBMA 3WLOA 2RIRA 3KSMA 3PFFA 2JGLA 4UQOA 1H0SA 1Q17A 4ENTA 2HSJA 1H23A 1XPJA 5BN1A 2OD7A 1DEXA 5I7UA 3ZD7A 2Y1KA 4FS8A 5EUBA 4Z4GA 4P7JA 4L72A 3V8PA 2ZJ0A 4GBJA 2VT6A 3K53A 4BQPA 5EMMA 4JOCA 1AN9A 2J85A 2ONYA 3SQWA 5ELMA 1EK5A 3DL2A 1O5IA 3VYRB 1D8TA 1A76A 1EIZA 4IIHA 1W96A 1GNQA 3E9CA 5JRZA 4MGKR 2H8KA 4U00A 3RYFB 1VPEA 4RORA 5MN5A 1U8FO 3QBEA 4NENB 1O97D 3SF8B 4V1CB 1KC3A 3JVUA 4EY7A 2SKCA 1C30A 1YKSA 3SXUB 4BGEA 2HJVA 2F2TA 3OP4A 4G0WA 4NK5A 4OP1A 4M76B 2IXBA 4AN1A 3DQZA 3NDPA 2GJAA 3BM5A 1CVIA 1YS4A 5BYJA 1VJDA 2DLDA 5FWXB 1IZ7A 1XCGB 3C41J 3DVQX 3TRJA 2C31A 3IBTA 4JZKA 2ZI3A 2I2WA 2YJ3A 4JU9A 3L79A 1SD2A 4N18A 4U2GA 5J4KA 5L7TA 2AQIA 3HWX1 6Q21A 3SFVA 3GLFB 2X19A 1SKMA 1FFYA 2Y76A 3CLTC 5LD2C 3OIDA 2D1TA 1JPJA 2JNWA 3EMBA 4H3SA 1YOVB 1Q0UA 2IA5A 1FP1D 2JS7A 5DHSA 3UWSA 4UHDA 2QTMA 3EYAA 3TM4A 3J7AC 3DTVB 4TS3A 2P9GA 1OAOA 4J0GA 2OGWA 4URUR 1Z0FA 1HEYA 4KL8S 2WUGA 1C4WA 3HCWA 3HBFA 3TCXB 3I9NA 3E3NA 5F9FA 3PJGA 3NYRA 5A04A 1XRJA 3BGVA 4ALMA 3G13A 3PRYA 1WF6A 4V0QA 3CNEA 2IH2A 5HQJA 3GUCA 2NMVA 5D6OA 3MFYA 3NNNA 9MHTA 4Q9LA 1KAEA 3LBAA 4PEVA 4RYDA 4CG3A 1R00A 1PYGA 3KHSA 1IPHA 1C7RA 4UXJA 1QX4A 4Y6SA 1I2AA 2MSCB 2E9SA 2O48X 3IT0A 1WZCA 3O92A 3KAKA 2PBZA 3O1LA 4HWOA 1JEAA 4LMAA 2R1VB 2C1EA 4QX6A 4MYCA 1GCGA 3REGA 4KE6A 1DARA 5IXYA 5DIZA 1MQSA 5I4BA 2PSHA 5DBFA 3CXUA 2UYGA 2PT5A 1WVMA 4PYNA 5AJUA 4N40A 5FBVB 2JGAA 3OKFA 3SC4A 1HL3A 4GOXA 3Q8MA 3U7RA 3K5WA 4OLHA 3NBAA 1ZICA 2EKQA 3FZQA 4LDPA 1U0RA 4NU6A 1VYVA 4OQNA 4MR8B 4XVRA 4ECAA 1N5JA 1BU5A 1CWUA 2H4XA 2NPOA 3LS2A 4RLFA 5DXFA 5TQ2B 1AQJA 2BUBA 4TUYB 5DM4A 3THRA 4P38A 5IBRA 4B3DA 2C61A 4CIWA 1JR6A 1LTHR 4HB0A 4O4IF 4B6PA 2IBTA 3B36A 3THOA 2AXNA 1NNUA 3OIGA 2PGAA 1SKQA 4FDMA 2FETA 4ED9A 1OH6A 1E79D 4IF6A 2QUIA 4PBSA 4YXWD 1LNSA 2I1WA 1GAXA 3A11A 2ZJOA 4NJOA 2YWEA 3OZFA 3EXEA 4OMCA 1KZGB 4YTEA 3UAXA 1HMYA 1O4VA 3DE0X 1ECLA 2C20A 1SC1A 4HD8A 5JZMA 1B42A 1Y6RA 3PUIA 4Y2TA 1NVBA 4YJ2F 4KE7A 1SQ5A 4CE6A 2HPVA 4LJSA 3E2MA 3JTMA 5GONA 3WYDA 1T0IA 4ALLA 1XTQA 4AUKA 3BMNB 3S7ZA 1QVVA 4QU9A 2Q5HA 1R8JA 1ZDMA 2G77B 3DLBA 4TLMB 2F48A 2JIPA 1YVEI 3H5TA 4EW3A 3DKRA 4KBYA 1O57A 2C2YA 2LP4Y 3R5KA 4Q9AA 3OCXA 4YWJA 1RWPA 3DMTC 4F45A 4MINA 1YE3A 4BIMA 3STWA 5G0WA 3QA9A 4ZCMA 1HNWB 4WEQA 2JARA 3WFIA 1NBIA 2NU7A 5CD1A 4J0CA 4OX9B 3VNVA 3DKKA 3OPVA 2JEYA 4NY1A 4QYMA 1VPWA 2ZDHA 4OU5A 4NSNA 4QBKA 3NNDA 4AM8A 4TUYF 1UKZA 3DDZX 4IV5A 4CKCB 4GYYA 4HRVA 2Q1WA 2XNDD 4EPXA 2R79A 4REQA 1YRBA 5ERXA 1GAQA 3G8DA 1ZMOA 2OE2A 3HP4A 4O8CA 1JTEA 4PYLA 3MYYA 1KIAA 3ROPA 1FP4B 1U1CA 3RD5A 3STUA 1IBLB 5HKKA 5B58T 3JY6A 5DVZA 1K9SA 4HZUA 2B2CA 4NHEA 3ET5A 3ZV4A 5IVHA 3SIXA 3TQOA 1T3ZA 4TMFA 3KR2A 2RKWA 3ZLVA 3K6JA 4PTYA 1XVAA 3KWJA 3B60A 3N7TA 5CITA 3AVPA 2EBWA 5I7WA 3UMFA 4X1KB 5AM4A 2W6MA 4DMLA 2N1BA 1MBZA 4YRFA 1WPQA 4J7UA 3BQNB 3R41A 4LKOA 4G24A 4LCEA 2PT6A 4GUDA 3SIPA 1FYFA 2KI5A 1E1QA 1X0XA 2VK2A 3GFRA 1EZZA 3JWEA 4M1ZA 3L7BA 2A4KA 1X42A 4QQRA 2OY0A 1IG3A 3VR6D 2DETA 2TS1A 2PKQP 2X9GA 4E5MA 5ETJA 3SHFA 3GBSA 4CTKA 2P5UA 3TECE 1UKBA 1UBGA 2QSYA 5C35A 1LLUA 2X42A 5HFNA 3GJRA 4AMVA 3DFUA 2RHJA 4DLBA 1ZMRA 1MAVA 5IASA 3UMYA 2UYYA 4YB8A 3ER6A 3VR4H 1MZVA 3OQVA 3BVPA 4NDNE 2ZQ5A 1BVRA 5G2OA 3OEHD 1XBTA 1FYVA 4G5YA 1KARA 2HDNB 3EOBI 3K0KA 3L43A 3RHFA 2CBXA 5KWIA 1ZW6A 4DUGD 1GL7A 3HCRA 3RYIA 7MHTA 5DYGA 4F6LA 3AJEA 3B5IA 3EQ8A 3GQVA 1QVWA 1U7UA 4KK4A 1N5RA 1X92A 3IOYA 2PTGA 1AQ6A 1OXXK 1PBNA 1CP2A 2AXEA 3TSCA 3VZBA 3WJ7A 5FL3A 1JSRA 4J75A 2XX3A 1NQVA 1Z7GA 2AZTA 5KNLA 3P0RA 1K3UB 1QO9A 1M1YA 4XDGA 4M8KA 1RAIA 2NTJA 4MYSA 5TDHA 5A62A 2Z6AA 4JCOA 4OJQA 1RBYA 2VJNA 5HM6A 3IJ5A 2BLLA 4GWKA 3UJCA 5KTSA 4XYLA 1XZEA 1YK1A 3IQZA 4F5DA 1T1RA 1XMIA 1Z5OA 4TMVA 4XJSA 2ZRGA 2HW8A 8OHMA 2PRIA 3U7QB 3OZBA 4DIUA 4HSEA 1QH1A 2I99A 2ZJAA 4Z2YA 4RZUA 4H0CA 4M0CA 3WJAA 4G65A 2RAVA 1VKHA 1M1YE 4AIRA 3JARA 2EFJA 3X1DA 1ZL0A 1VB5A 3PGKA 3GW8A 4WNAA 5DI9A 4B40A 2AJDA 3ZH9B 4KRFA 1QOZA 2WYWA 3HP7A 5I4IA 1Q6YA 1FFXA 4N03A 2B1RA 1QIDA 2KSQA 3G2HA 3KQVA 2FPIA 4X5OA 4QSHA 1P1HA 1V7ZA 4QNMA 4KQMA 4KREA 1R10A 1OB2A 4ZI7A 2GRAA 3K31A 3KPUA 3FZYA 1IJKA 2VJOA 3LRTA 1G19A 3KQUA 2CL7X 1IQRA 2FEPA 2COKA 2ERYA 1W35A 3F4KA 5KNBD 1F20A 2VPYA 1WVIA 3TRKA 1Y7PA 4R2KA 4HLCA 2A5YB 1VZ3A 1GXSB 4US2R 2Q3HA 3DKVA 4KWEA 1WU7A 5B6IA 2ZR7A 3UJHA 2E4XA 3SVLA 4BN5A 5IT4A 4WN3A 1TGVA 5FYDA 1PQWA 1QB7A 1W6UA 1WPGA 4NTZA 3ZX4A 4TXJA 1MNQA 1NE2A 4A03A 3WBKA 3TDNA 2NSDA 1I3CA 1BEZA 4PC6A 5JNLA 2JBHA 4OHFA 4ROSA 3IIEA 2C42A 1HFWA 3FY4A 4YP6A 2D5LA 2FSGA 2WG2A 3CR7A 2Z8ZA 3MLEA 3UV7A 3WOHA 2QTRA 3NHZA 5CH3A 1GDDA 3PP8A 2AQHA 2PT7A 4MUYA 2ZRPA 3LW8A 3ZJTA 1RCTE 1VBFA 3R8CA 3LY8A 4OFWA 5A3RA 5ALXA 4EGQA 3AY7A 1BN7A 2W43A 4AUNA 1CR6A 3H0CA 1RXIA 1BGVA 3GWGA 5FI0B 3T1VA 1NJ2A 3NLLA 4JOBA 1VA4A 2IOFK 3N3BC 4KFRA 1YR7A 3ITNA 3M6UA 2HMVA 2XDAA 1DPGA 1QE3A 4JP2A 5EQFA 3D4OA 1JKJB 3EFHA 4ZFNA 1U28A 5I7EA 1GGNA 1OLUA 1Q92A 4JHXA 2AJCA 3CW2A 4M9ZA 2AK3A 5THKA 3A2LA 1Q14A 4TRMA 3ESQA 2EZ8A 4L5BA 4RTKA 2BI4A 4QDOA 2OCYC 4QOSA 1YMUA 4HFRA 4NFHA 4PIMA 2AFIA 1CX9B 3VAAA 1D6NA 2H57A 4UXHA 1PV4A 5C8VA 1IB6A 3H11A 1B76A 5C5EA 5I5EA 3QLVA 1GLVA 2P69A 1INLA 1A4IA 4WE3A 1JXQA 3OJEA 3ON5A 5EY5B 3KJEA 4D80A 2GLXA 3D0QA 4R2JA 3Q2KA 2BL4A 4L8WB 3B9PA 5JPIA 3UYLA 2MHCA 1O77A 1LK5A 4JKYA 4M49A 4ZT6A 1Q0LA 2AFIE 4ODIA 4LJYA 4XUDA 1SVOA 3IURA 3OJCA 4H77A 1LK7A 2ZDQA 3AOEA 3NTXA 4HATA 1VGVA 3IPXA 1L4YA 2GVNA 2CZGA 2O6HA 3A9SA 3KFLA 3VPXA 5ES4B 2ODPA 1LQUA 1MB4A 4BNZA 1FA9A 4DCVA 1R5OA 1OX5A 3KQTA 1N6OA 2YJ6A 3WG9A 5LD2B 3NTVA 3UAOA 1GZ3A 2QG6A 3FOFC 3LKZA 5F3DA 1B8PA 2PL5A 3F6PA 5KO2A 2FFBA 1AKRA 1JLHA 1WZEA 4UNPA 4BFCA 4CQMA 1SKUA 2OL4A 4NCJA 4II3A 1T36A 1ECCA 3L77A 3DTVD 3EZ7A 4QYIB 3LXXA 1QE5A 3BAZA 4LDRA 5ARCA 4ER3A 1IVSA 1BROA 2EQBA 2HUNA 2I78A 3SAJA 4MKFA 4XTRA 3RVMA 4DM3A 4YYZA 3GYGA 1IN5A 4W9RA 5DTIA 4IQ4A 3PKJA 3UOWA 3LDUA 3TZLA 4PLFA 2Z2JA 2A0KA 3B52X 3IDFA 3ENNA 4M9XA 4RD2A 2CVZA 5FCDA 1NATA 1NKTA 1XKLA 2DM6A 2XB6A 3LA6A 3RS7A 5C5DA 5JZBA 1P1KA 3U09A 3N0WA 2C8JA 1U7DA 2Y1LA 5IU6A 1XALA 3EFOB 4L51A 1ISMA 2AFVA 3G5UA 3ZHSA 4P54A 4BPBA 3KRTA 2IHJA 4JXKA 5KQRA 4BKPA 3KDPA 3R3JA 2NAFA 3OE5A 4MW6A 2JIBA 4LVNA 5ER9A 4C14A 4BLOA 2NVUB 2WJAA 2DU8A 1UDRA 4LRSB 1NM5A 4M1OA 3IILA 4Z5XA 4HVAA 1OCEA 4K03A 4YRIA 1FNSA 5AVVA 4S12A 1GNRA 5AVQA 3K9CA 4I1OA 5FEMA 3R8FA 1GZ5A 4I46A 1DQYA 1TZBA 4KP7A 1DV2A 2GDZA 3EVAA 5DBIA 8LDHA 1IM5A 4A27A 2RI6A 2Q6IA 3VJRA 1JJ7A 3B2NA 2G80A 4NIMA 5F2NA 4Y2PA 4XWWA 3IC5A 3C6YA 3SFZA 4X8OA 3MT9A 4DQKA 3SU8A 2GWHA 4H60A 2WVAA 3HZHA 1GNVA 1KXZA 4Q37A 2H8GA 1OV4A 1ZGZA 3DYBA 3JALB 4GQAA 1FFBA 4JT9A 1QR2A 1EFLA 4IOJA 1NF9A 2XJ4A 2GTPA 1RLMA 2BBOA 2FUNB 3DXYA 3K16A 2X8LA 3T41A 4X1YA 5KYXA 4RIGA 2AYXA 1RRPA 3HJHA 5DYYA 13PKA 4NHOA 1XZBA 3GDOA 4O08A 3AUSA 4ZDIA 5REQA 4CEJB 3R3XA 4CKYA 3OLYA 2IPNA 3AKCA 3DAPA 1GQRA 5HZGA 2OCIA 1RRVA 1VHWA 1JIUA 2GEDA 1NQAO 2A88A 3B1KA 3COPA 4OGLA 1V6SA 2Y05A 4YHHB 1ZG3A 4EZBA 5AO9A 4XX0A 1XD2B 3MINA 1PGPA 2H85A 3F71A 1PTJA 3GEEA 3L0YA 4NCIA 2UUBB 3P0EA 3RJMA 2F64A 1X8LA 1E66A 4QUEA 5CPBA 1EXDA 5DTRA 4WLOA 3NJ4A 3ULKA 2DT8A 2VBGA 3K8YA 2DR2A 1FP6A 3COSA 3P2JA 1O94C 2J9YB 5FO1A 1WQ3A 1WR8A 3CLSD 2PUHA 3IELA 4WFIA 5HIIA 2PPVA 3B6EA 2PRYA 3EISA 3OUZA 2H29A 2PL9A 3B2EA 3T9FA 5C8DA 4C08A 1Y6FA 3RUDA 1L5HB 4MVJF 1X3SA 1GQFA 1P5ZB 1TYDE 1UMCA 2QTZA 4L8FA 4ZCLA 1P45A 4BNIA 4K88A 4D6PA 2BMDA 6NULA 3BGWA 4MQ4A 3LLSA 4OREX 3TVTA 4EHFA 3A1NA 4DJJA 4XYMA 1JALA 1DP4A 3FKQA 5KVVA 1IYZA 3D4PA 3KXKA 2IW3A 5ICCA 4COOA 1Z16A 2GLTA 3UWMA 3N2EA 2W6OA 1ZD2P 3BA1A 2YXEA 1V45E 4BATA 1Y3DE 2GPBA 3U26A 1LPAB 1E2PA 1C7EA 1RLJA 2QTVB 5KTOA 5BW5A 1G6OA 4XLLA 4OI1A 2VWHA 4ARAA 5B1EA 3H83A 2FFHA 4BZWA 2PKCA 1XZAA 4U02A 2H7XA 1OD6A 4JI4B 4RF5A 5K4HA 3ZD8A 1QH8A 2GBLC 5KCMA 1YJ8A 3AUUA 3U2QA 2ZYSA 1PJBA 3HA7A 5B64A 3D2LA 1MABA 2GJ9A 2EV9A 4KKXB 5AKLA 1PGOA 5F77A 5DTMA 1VL5A 4PZDA 1W0JA 4Q3OA 1GFWA 5D00A 4ZT2A 2B94A 4UBKA 4BEJA 3KKPA 2VHTA 3DLPX 4NOJA 3RK0A 1E3JA 3O03A 3ZEIA 2CXNA 4IXNA 1I13A 1Y5NA 1LXCA 1NI3A 1I14A 2NSHA 3FB4A 2RGAA 3MAAC 1BFUA 3PDJA 4BUJA 1DWQA 4D96A 5EIFA 1JLRA 3IALA 4CU5A 2IUTA 3IAEA 1AB6A 3EEQA 4LDNA 3O7WA 1NQ5A 1MH9A 4C0BA 2O54A 4V0OA 4LZPA 4BX0A 1BDBA 5HR5A 2R87A 1DLIA 1JDBC 2AJTA 1F8FA 4YN3A 1YL7A 3GGJA 2AXPA 1J0AA 3GFBA 5JAOA 2P3OA 3ESCA 5FL7A 5BW8A 3AVXA 1KO7A 4NFYA 4JODA 3WK4A 1TZKA 2V55B 3VJMA 3NHRA 1BS2A 4YP1A 3LCMA 3T5DA 3BCHA 2ZS9A 3RUHA 1YQUA 2ORWA 1NC3A 3U4QB 2YKGA 5DBGA 1P4SA 5LSAA 3NGMA 4DNXA 2QG4A 2CFCA 4NJEB 4OFZA 4B33A 1LKZA 4WCFA 4C7KA 4EZIA 2AG5A 3HH8A 3RS9A 1QJCA 1P0PA 1UZUA 2W6ID 1JHVA 2E1PA 3FOAA 4R31A 3UENA 4OXYA 1VKZA 3FCOA 3WFJA 5DZSA 1X87A 4MR9A 5JARA 3NHMA 2Z3ZA 5IDXA 1YC2A 1C0LA 1SVIA 3TOSA 3WC4A 1SBQA 1T2NA 4IMJB 2I80A 4G1UC 2CXQA 3D6MA 4K7JA 2BI8A 2LCFA 1Y6GA 1E5QA 1X74A 5LUAA 3M6VA 4JX9A 1C7QA 3TG2A 1CS0A 5I51A 1YA6A 1P2TA 2Q9CA 4OGWA 3SMQA 3QVGB 1RC0A 4MSUA 3ZI4A 3P0IA 5H70A 4EITA 4ZZ0A 1FW8A 2UUOA 4KYIB 3I73A 2FFAA 3GVHA 4XGKA 1AV6A 1AHNA 1OYVA 1HF3A 4PYQA 4NULA 3EWSA 1ZN7A 1WY5A 3HFJA 3LX5A 3R0XA 3WQQA 1NT2A 3TTXA 1MO2A 3THYB 1C7ZA 4LXYA 5BXQC 5JZ9A 1L3CA 1LZLA 2ORYA 1CB0A 2OP1A 1LI4A 4M1TA 2ZWMA 3ND8A 5IP5A 1XK7A 4DC9A 1DIOB 4DV3B 5IDQA 2NZVG 4DABA 1W36B 4CLRB 1BVHA 1HE3A 2PR2A 1FP7A 3D1JA 3B48A 3OZTA 2Q6VA 5AW7A 3OTOB 5AI0A 2AT1A 2FZ4A 1HTWA 2ZXEA 2BKEA 4M0LA 4LNUB 4C3UA 3W6UA 1BXKA 3HCFA 1IZ8A 3IVCA 4KMMA 5ITVA 3CGWA 3VBCA 1DGQA 2HF2A 3W3AH 4DQXA 4I5GA 3U7GA 1OXBB 1Z2OX 4UVIA 4EQ6A 4DTIA 2D4HA 3PGMA 1IHDA 1Z22A 3DTYA 5GP1A 5JRDS 2W2NA 1FZTA 3RR2A 1RS0A 2LIVA 4TLBA 5CX1B 3ZDQA 1HLGA 1VL0A 5IBQA 3LKDA 3LPNA 4FGJA 2J6HA 1TVEA 3MGGA 4JYMA 4QXOA 4ZYZA 1SBTA 2VO1A 4MW2A 5LNK1 2C4KA 4MQMA 2BFDB 3IR5A 1E1RA 4MW7A 4R7ZA 1YJQA 3RTBA 5AW5A 1C3OB 1RKVA 5KAPA 4C0XA 2L2QA 3WIUA 1J8QA 3WTCA 1CJUC 2F1KA 3AR8A 2MIIA 2G5PA 3TXXA 4BBJA 1R0LA 3LVFO 2XBLA 4MITA 3MRVA 2QBYA 2WJ6A 5CCDA 5CA1B 5KUTA 1YBMA 5LMCA 4MW0A 3D64A 5B3JA 4W1RA 4AS2A 4OB8A 1G8GA 2OXTA 2JLUA 1NPTO 2M98A 3W04A 2ETXA 3CHYA 2A5DA 3ZVNA 4H2DA 5LYYA 4WXRA 4G41A 4YQEA 4QT0A 3SM9A 4LF4B 2PT9A 4REOA 3K1JA 2X8WA 1ULTA 2G76A 4PBTA 4RF4A 2QSJA 3K0SA 1ZN2A 3HPRA 3EDRA 3NGLA 2ZREA 4MJ3A 3J81A 2O14A 2CLLB 2DX7A 1JE1A 1URPA 3LO8A 4KCGA 1NQTA 4D0NA 1ATIA 1B41A 1J42A 1FP2A 2V7VA 2XSZA 1WY7A 1U3VA 1Z34A 1QHYA 2HSWA 1NJ1A 2P4QA 5CLLA 5C80A 2ORED 4Q3NA 2O52A 3HN7A 3HYSA 2RH9B 3RSLA 4P3KA 3HU2A 4OFBA 5AXDA 1MMFB 5IZCA 2M1ZA 3DE7X 4MIYA 1XRSB 4RETA 3HCOA 5CM2Z 5E4TA 1H6AA 5D5PA 4E08A 1TVKA 2VLIA 3DT6A 4ND2A 3THWA 1UT5A 2G40A 3F4BA 3RKRA 4I1SA 3CLTD 2WIFA 4JEUA 4UBOA 3SBXA 5H80A 4C76A 1K7YA 1XUOA 1W4RA 4YIHA 3N6XA 4D3FA 4KDCA 1PJZA 5KOHA 3SICE 1V3VA 2E5FA 3VHLB 1U2GC 3FYUA 3AM1A 4MQFA 3ESYA 3TNLA 5I7RA 1L5FA 3DQQA 3ITEA 3ECSA 5KQPA 4RMGA 2REBA 1LF0A 4WACA 5HRAA 5LXTB 3OHMA 5CA1F 4HX5A 3K4QA 3G02A 3WMEA 1SU8A 2C2KA 2BFFB 1HT0A 3FLAA 3TQFA 1EE1A 2RBGA 5HFAA 3TZKA 2QJTA 1NT4A 4QODA 3M6IA 5FLXA 5GMOA 4J2OA 5HUJA 2G9ZA 3BORA 2V3WA 2JFQA 3VYTB 1XJWA 4OQPA 4BQRA 1S1MA 1T2VA 3KPJA 4FLEA 4EFDA 3MWDA 2OBMA 4R9SA 3CLRC 1EX1A 2PMKA 2BJVA 1FNDA 1LY1A 5K01A 2GZDA 3UATA 4HPJB 2WNSA 5BORA 2HK6A 1JFFB 1EK6A 2IEBA 4CGZA 1N0HA 4MLZA 4PRKA 4Q1EA 1ETHA 2H9IA 4E4YA 2PJRA 4BVJA 4YV0A 3KVNA 1WL8A 2R0QC 3FE2A 1FXSA 3LH5A 3QBVA 4C0KA 2QIOA 5CPFA 2XUOA 3PXCX 5TSDA 5EZYA 2FQXA 2TMGA 3H2KA 4EUNA 1WZ2A 1R37A 2AG8A 4J9UE 3OIWA 5JS1A 1R9NA 2P9QA 3Q6IA 4W5HA 4TPKA 2GXAA 1FJHA 3GFQA 1NLUA 3AFIA 5KWVA 3I45A 2OXRA 1VJGA 4QTXA 4E33A 4AMGA 3HJRA 4RHUA 1NBMD 3TKYA 2FEWB 3ZCRA 2EGGA 3MD0A 3OQIB 2OYCA 2HMAA 3OQOA 2HA5A 3Q7TA 1XD8A 2GESA 3GQBA 5IC6A 2P65A 4IKOA 1QYDA 3WNCA 1ZVQA 4YFYA 1GARA 1G7TA 3SVTA 5DYIA 1TE2A 4QOHA 3SR3A 2UUCB 3MS7A 4Q4JB 4R54A 3VKUA 1N9GB 5LDDC 4Q47A 3KYDB 3GEIA 1QB8A 1SU6A 2ADOA 2QTGA 2YRFA 5GJCA 4AKEA 1YE5A 3DHVA 4TRNA 1XNJA 4NYIQ 5HKBA 2VRCA 4FFLA 1IDN1 4R40A 2XNKA 1T9ZA 4QO8A 3BE5A 4XVHA 4DMUB 2WB4A 1GKIA 1MIOA 2D5CA 1WMEA 2BWJA 3RU2A 1PW7A 4BGUA 1TC2A 2R68A 2DWCA 1PT8A 5JXIA 3EDCA 1ABFA 4PLWA 2O2EA 2OD2A 1CUJA 2X1MA 2FF7A 3FDXA 2CYAA 1RJDA 3ETDA 3IAAA 3R3ZA 4RWZA 3U9SA 2AMJA 5SYAA 3KB6A 4FFDA 4BP3A 1DIHA 2HNAA 4MXDA 2AFHB 1KEUA 1TYAE 1HPLA 3FG9A 5J9FA 5CA0B 2P6OA 3IEXA 4TKLA 1QGED 2IZ1A 1ZLXA 1TIBA 2JBAA 1BOOA 3GK3A 2VAPA 4N7BA 2GYUA 4L8YA 3S5UA 2WUFA 3FHJA 3SSAA 3OU7A 1ESNA 2QV0A 1NY6A 2MMGA 2OHIA 4M6WB 4D9FA 3ZHBA 4L2IB 2ZXFA 4TSRA 4A36A 2QQFA 4KQ2A 3CVYA 3PGVA 1GA4A 2ZVQX 4YUZA 1KNXA 1RJEA 2O8DA 3WL8A 2ZRJA 2X0JA 4I1PA 1XJCA 3NATA 4QULA 1CCWA 2WHPB 5DGIA 1HT1E 1P5FA 4C20A 4JT8A 2IP4A 1LVUA 1UXHA 4JVNA 4CJXA 3L4KA 3PQ5A 4FX5A 3DLIA 4UATA 5C2JB 3SE0A 2A9OA 4UM8B 4ZPXA 3ILXA 3V9AA 3ODGA 5HPYB 3P26A 4B3BA 4E4TA 1RADA 3CNBA 1KIMA 1G17A 3RB8A 5TF0A 3RIYA 4EKIA 1T8RA 4ENPA 5AFSA 4XZ3A 5DNYB 4ISCA 3FM9A 4PFQA 3CNOA 4YFVA 2RH8A 1T6XA 1VHQA 3AWDA 5DDIP 1FSPA 1XMXA 3HFRA 5EWJA 3NBZC 1P1FA 1THZA 4NZOA 5AVUA 4RSHA 3KT8A 3U1TA 4EVSA 5B5SA 2A9VA 3OWXA 1NW3A 3D6TB 1S1CA 4YMIA 2EIXA 5FF9A 1VJ1A 5K2MA 2OPBA 3PR1A 3PHLA 4FOLA 1VE6A 3DEAA 5A7GA 3MPUA 4J76A 2BCGY 2FZCA 3PA8A 4FGUA 2R1TA 5CA0F 4D9HA 2QL9A 2C7BA 3OOHA 3N8GA 2J5XA 2ZVDA 4D9BA 2WKSA 2E0IA 4XWYA 2WFMA 3B5EA 3AESB 3BWCA 2PRSA 3NPMA 3NQ41 1JFRA 4LTMA 1E2IA 4WBNB 3JQ9C 4LGVA 2ZPAA 3O21A 3QKRA 3VSCA 1JLMA 1VCMA 1DX6A 1ENYA 4CT5A 1VJ5A 1PWHA 2CVQA 3DWEX 3B70A 3HDGA 1GR0A 1HMPA 2GAIA 2JASA 1ZW1A 1NI5A 3KWMA 5U4XA 3CRMA 4MB6A 1SK9A 2DT5A 2YXBA 4HWTA 4KAAA 3V1KA 4H6PA 3VMMA 1ODSA 1WBDA 2D54A 4AX4A 1UQRA 4ETMA 1BS1A 4BO9A 4BJ1A 2OORA 1NIJA 3P2MA 4B4KA 2RAUA 4HNAA 1JDBB 2NPIA 1CUZA 2JHFA 4JQZA 2GUGA 4QE3A 3T95A 4AWBA 3GNSA 3O8RA 3AKZA 3ZE6A 2YQ5A 4IQ8A 1ZR2A 3DPUA 2A2ZA 2QYSA 1ZCJA 2EP8A 3A1WA 3N7UA 3T1TA 4WESA 4ZALA 2L19A 1SUWA 1N6IA 4G4JA 2QRVB 1S2GA 1WOMA 1W8DA 1J6UA 2TMYA 1EXVA 3HVIA 1SNYA 2O6LA 4QL3A 4EKDA 3PQ4A 4GSKA 3N2YA 3S1AB 2CNWD 4KWIA 2X77A 3BD7A 2O8BB 1NFFA 4QJ4A 1VSTA 1Y1SA 4Z3OA 5C3UA 1HKHA 4C0HA 1XDBA 4TSFD 1Y8QB 2YV2A 4UUPA 3HNRA 4B3MB 1TQ2A 4WBNF 3I53A 4GPTA 4UBMA 4LJ7A 4W5RA 5JFOA 2VAVA 1T8WA 4Y67A 2X6RA 4MI9A 3NU1A 2H2IA 3EMVA 3RVLA 1T9GR 4DV1B 2DCUA 2OAGA 2Y3IA 1CJKC 4RVNA 3UAZA 4R8KA 2P6UA 3B1FA 2EWWA 1GG5A 2H0AA 3PFWO 3H8JA 3D8SA 3M5DA 2DJ5A 4G1VA 4JLNA 1SHZA 4W82A 4PZ9A 2I3ZA 5IAJA 3R9IA 1DJMA 3GI1A 1SQFA 3HM9A 2WVJA 5COQA 2GCOA 4KX5A 3FYTA 4P6VF 3NORA 4D4JA 2LKDA 4JBHA 4GWLA 4JJEA 1ORTA 3BGIA 3KK0A 4K5QA 1XXLA 2NVBA 1G2QA 3FNFA 4N1AA 4W9NC 4DHEA 1O95A 3A0UA 2PWAA 1Z5GA 3KC2A 2A59A 1E2EA 4GLJA 4IFBA 1PUXA 1M33A 1B0ZA 2WF8A 3GG9A 3MMXA 3HY4A 4K9PA 4WWHA 4DG9A 3T52A 2QLLA 4LYAA 1TO1E 2OKCA 4Y8VA 2WD7B 3MBIA 1QIFA 5CURA 1V9SA 3JQ6A 3VC3A 1NRJB 3IT1A 2UZIR 2VXBA 1GPUA 4CUZA 1W9HA 3Q7PA 2GN2A 5DLYA 1UBKS 3AY0A 5D5QA 7ADHA 4ALKA 2HJWA 1YNOA 3TEJA 1XF9A 3NC1C 5F76A 3HUEA 2OGUA 2G6TA 1P5RA 1CJBA 5EJIA 4R8MA 1RZUA 4JI2B 1EWKA 4XRGA 2RIPA 1YI1A 2REQA 1SUBA 1ZA1A 5HP4A 4XCVA 3HXPA 3JAKA 4OQMA 3DVRX 3IJEB 5K5EA 5ADUS 3UAGA 1GTG1 3OCWA 2XADA 4HB3A 3V97A 4B48A 2MSNA 2HYIC 5A1TA 1JMYA 1HOXA 2OHXA 4GMHA 4ON9A 4R1NA 3ZDEA 2JCGA 1LDBA 5B58C 4DUPA 4JBLA 3HNPA 5DP2A 5DU2A 4MK4A 5JATA 2ZG6A 1CE8A 3IQIX 2C2WA 3UWOA 4TRRA 1BCRA 3FCYA 3T38A 3EWNA 1JG4A 2GHRA 1XDSA 3Q9UA 1JA0A 1DTSA 4HUQA 1I6MA 5JLJA 3KD2A 1AUOA 1E5XA 1VIVA 1M7GA 3G5LA 2PJZA 3NWEA 4KO4S 1Y4AE 4RH3A 1UJMA 1ESMA 4NZZA 3UMRA 4DWJA 5M04A 3EPLA 4EGCB 4DQVA 4NBTA 1G63A 1E3DA 1EHYA 2FPMA 2W8ZA 3CINA 1JIJA 2XVAA 4G0QA 1FMFA 2RKBA 3WGTA 4FZRA 2XWSA 4F4IA 1GFSA 1XLTC 1RI4A 2F1HA 3E7XA 2DPYA 2SBTA 4XJXA 4JR1A 2GK6A 3C6MA 5AK6A 5I8PA 3IAFA 1QGUB 4C2UA 4K9OA 4V39A 5JUWA 1JEQA 2PWPA 2HHLA 3B9RA 3CR3C 2DQYA 3R9XA 3PRJA 2N9UA 2EFCB 3GG2A 1U4SA 1K3FA 3UXYA 4YX9A 4B7UA 3U7EB 4P3YA 4OX9Y 3UAYA 3JR3A 1NU8A 4K2AA 3R23A 4PHFA 1QTRA 3IR6A 1KJ9A 3N9IA 4IXWA 1V1MB 3MWLA 3VI3B 1WP9A 3FMGA 2I1LA 5KZMB 4CV0A 1KI6A 1VECA 1FJ2A 1SUAA 4Z7NB 1TMKA 4U2EA 1G5HA 2DKNA 4PC3A 3SOZA 1PCXA 4UQPA 1ZGJA 3G2JA 3M8KA 1II8B 3E1SA 1BXZA 3DV0B 2PUAA 1P2FA 4FXPA 4IIGA 2H65A 1XDZA 5IH7A 1TCAA 2MYTA 2V7WA 3K30A 4KYUA 3EDQA 3WVNA 2P2YA 4A91A 1IRIA 4ERNA 3NHAA 2XBUA 2ACWA 2PMFA 1WEKA 3PYLA 5JSYA 1NVKA 1LJ8A 4EECA 4QOJA 3SR0A 2PPLA 2RG1A 1X1DA 4UAUA 2MJLA 1JLLA 2E6UX 3K0CC 1FRFS 1WTCA 4FGLA 5G1NA 5CB4B 3KV3O 5A9RA 2CMDA 3G88A 5CVDA 2D59A 4CKXA 5I9BA 4F46A 3PQFA 4J0FA 4Y2SA 4X8MA 3KUKA 1KQGA 5ED4A 1HE4A 4WXPA 1ZESA 5ILOA 1WB6A 4ND7A 4A5SA 1HDYA 2VUUA 6YASA 1FYWA 5EI5A 3Q1LA 3WKEA 3EZLA 3K1AB 4DR6B 4Z4FA 2G25A 1M8PA 4F4DA 1FFSA 3TTUA 2PZ8A 3TLAA 3FHLA 1GPNA 2O5VA 3D3WB 3JSXA 2PH7A 1T5DX 2XQJA 1OROA 3M1IA 4IP0A 4PG7A 3AP1A 3P5BA 4XOIA 5JNTA 2I1VB 3T3EA 3ZQ4A 2WZCA 4G5QA 3G5MA 3WK8A 2K7ZA 1D2AA 4WGFA 5AJVB 1ML4A 4B7CA 2WSBA 3ESZA 4BNDB 1VSBA 2WUVA 3E15A 1H69A 4MWTA 2COEA 4CFZA 1M54A 1K86A 1T2FA 3WSVA 1QQTA 3LQ1A 3F46A 4TROA 1AHHA 3ONDA 3PDIA 4L28A 2DULA 1OWLA 4RKEA 2GJKA 4BFTA 3R0JA 5HRCA 3ZDRA 3F78A 3IHLA 1NNEA 1HOTA 1XI2A 3CBQA 3I9LA 3ITDA 4G5OA 1ZM9A 1ZQ9A 1AG9A 1P1BA 3GUYA 3UJNA 4FE3A 1W5FA 3GLHB 3IO5A 1J2JA 5FTKA 3SEZA 1Y80A 4KFUA 5AKYA 1GL9B 1QGZA 4EMBA 2ENUA 1FFWA 3JWGA 2OQVA 3E70C 2AL7A 3DC2A 3KM0A 4B46A 1MC1A 3TZEA 1TECE 4GD3Q 2VQEB 5HTOA 1NUHA 2J1LA 1B1CA 2X2OA 4G1FA 5A7HA 4QD3A 1XTJA 4DA7A 4ROTA 3M9XA 3AZQA 4UNIA 2Z83A 1HY3A 5A2GA 1G8FA 4R8LA 5BSVA 3QY0A 3FTEA 5K09A 5KHOC 3QELB 4ALNA 4OJYA 1Y7TA 4OHKA 2KMLA 3MCUA 3IL2A 2PCJA 1YTLA 1MG5A 1XHEA 1F2UB 2ZRDA 3M5PA 4CKBB 5DK6A 1GGVA 3KSZO 3QOXA 1FC0A 1GV0A 2QNRA 5SZKB 3SYRA 4MW9A 5AJTA 5BUSA 1AY0A 2OGTA 1SCQA 3O4FA 3SLGA 2JKVA 1KK0A 3HCPA 4XJTA 1RYYA 5LDGA 2BH2A 5EKUA 1J8YF 3VPGA 5E6RB 3UQYS 2WU4A 1SULA 3SYTA 1JE0A 3MOSA 1M10A 1K2VN 5BW4A 3KQWA 1MR3F 3QQPA 2VYVD 2L69A 2X9VA 4LWZA 1UQUA 1IEXA 1LI5A 4OVKA 4EHNA 4GXQA 2R6DA 1UBNA 1JWBB 5LOVA 1YJ5A 4AKTA 3LLMA 3Q85A 1LLQA 3Q5DA 3V55A 2JFPA 1M73E 4MWBA 3QVJA 3NZEA 4IGEA 1O8CA 5EZQA 5ALLA 2R11A 3TVYA 1PG5A 4F72A 4Z9YA 2VF8A 5CDTA 3DMNA 3W8NA 1E4OA 1UJ2A 3BREA 3IBSA 4KRXA 4YJFA 1Z3CA 3S2SA 2P9HA 4KQJA 1KQ3A 1K3TA 1T5TA 1DRVA 4HAWA 1AQUA 4OI4A 4K9MA 1MX1A 4KR0A 2J08A 4ATNA 5ADWA 3TN7A 2FA9A 1LPOA 2GA8A 1CRLA 2P9BA 4FP9A 2R9VA 3VR6H 2QNBA 4FCWA 4EJ2A 3OX2A 3VPHA 2AA3A 3VO2A 2PVPA 2D62A 2IYEA 3LPCA 5BR8B 5D7NA 2DR0A 5HJ5A 1OAAA 1P2SA 1T0BA 4IGKA 4LF9B 1OX6A 4MQUA 1KH3A 3DZJA 4HLUC 3WQHA 4BGVA 5BN3B 4OKNA 2IEAA 2R8XA 1PV1A 3R44A 5JDCA 5TLSA 3UTCA 3PNPA 1U0HC 4PX9A 1E1CB 2PAAA 2YYZA 3JAMA 4IM7A 4QZVA 2JH8A 4Z2AA 1M6VA 1DCTA 5BP7A 4L5JA 2FPKA 4DMRA 2P9EA 3FFXA 5F5LA 5AK0A 1I0LA 3K1ZA 1ZOIA 4N0MA 5EYPB 1X7YB 3CSSA 3LKVA 3RQSA 4UEQA 3ILYA 3JYOA 3T7CA 3C3JA 4QLAA 5KNDD 2QD3A 2H1OA 1JR2A 3IB6A 3M89A 4N4AA 4WXYB 1EJ2A 1T8YA 2SKDA 3A0RB 2NZUG 2WZBA 4JS0A 3MMNA 1R0BA 2HA0A 1X86B 3PU6A 1YAJA 2B4QA 3EQZA 5TGDA 1E0SA 2QWXA 1N2ZA 2JHCA 1KE1A 2C4UA 3D7SA 2Q9UA 2DFDA 2EYUA 4Q3AA 3ISJA 2VXCA 4WFJA 3ZBUA 2MR6A 4FB5A 5EJ4A 2CV2A 3PNMA 2ZQYA 1N9KA 1S2LA 4IPTA 4IRUB 5AOBA 2XLBA 5ITZA 2F9MA 2OCDA 3K0BA 4UAGA 1N4AA 2E5LB 4XX1A 2GN9A 4MHSA 4R3UC 1J8DA 1DBRA 1K4YA 4KAFA 2IKQA 2ZAMA 3ZHTA 3U44B 1PD0A 4ZRDA 3AB7A 4JUBA 4BZPA 3BEDA 3Q6MA 4KO2S 3WAKA 4E30A 1ZHOA 1G4UR 4P81A 4C4RA 1DC6A 2G08A 1DV1A 3FDZA 1QOPB 2NPFA 2YHBA 3GDHA 4BCDA 1U0OC 3TB6A 3JASA 3PHJA 2NV2B 2D7DA 4B4OA 4DIEA 1ORHA 2BEUB 2CYBA 3AINA 1OOEA 1UINA 3B9QA 4G56A 5CVEA 4TQAA 5EVCA 2OFWA 1X9IA 3TAUA 4JD5A 5LP6C 4J7CA 3AFNA 4D3SA 1B43A 1UWVA 1H0RA 1SOWA 2LPMA 1A5AB 1EAYA 5TPWB 1E7YA 3S2IA 4V0NA 5IFLA 4CFYA 2RH4A 3KKLA 4RFVA 3EWIA 2RSLA 1RBZA 4LJ4A 2ET6A 3G1UA 4MYRA 2AR9A 4H3KB 5CT9A 5K6AC 3SHWA 4HPWA 3NXSA 3TNJA 2HLHA 2Z4TA 2WWXA 2ZUWA 4DPMA 5ADVA 3I01A 1NRXA 3CIOA 1G42A 3HR8A 1HM5A 1L9KA 4CCSA 1N2IA 4BAGA 5ALPA 4E5PA 4E88A 4LZZA 3LXMA 2RE8A 2BVNA 3EQ2A 2ID4A 4ABYA 4PF1A 3GJ0A 2VSOA 4LJ8A 4RD6A 3ZHXA 5JALA 2P79A 4N8DA 2ZUSA 1UC4B 3V8BA 4QSMA 4YALA 1TQ6A 2WWHA 3IIJA 1O2DA 1IWBB 1RCUA 1LWNA 2AOUB 2C5BA 2PKRA 3B2QA 3L7LA 3MM4A 5K6RA 1RWBA 5ALJA 5ECWA 1TD9A 2R86A 5FADA 2C3OA 2V5VA 2IX3A 4BNJA 4JIGA 1DC8A 3L8ZA 1OH8A 1GNLA 1J09A 3IHTA 3VYVA 1RYDA 2JGDA 5D1HA 1PFVA 2AUTA 2HZBA 2PV7A 3U39A 4U7WA 2X22A 1DL5A 4HAIA 4IKPA 4ZOEA 5L3ZA 3UEOA 1E2BA 3HXTA 4I50B 3TMYA 1YGYA 1RJGA 5KJEA 4BV2A 1OZFA 5ALVA 2XF8A 1H1LA 3ABZA 1TB4A 1VRWA 3HACA 2Z9DA 4PFJA 4QATA 3ZXIA 4E5YA 5BN4A 3O91A 2NO6A 2BUCA 3ZDFA 4RC9A 4MTLA 3K2QA 3H0EA 1AKYA 1TI7A 2GYYA 1DE0A 3VHQA 3CF2A 4GGMX 5EA2A 1VJRA 3NFYA 5EE5B 3FKSD 4MPPA 1CJMA 2R8BA 2H4WA 3DOHA 4OO3A 3B1ZA 5BSMA 1ADBA 1FL9A 1QR6A 2ZBQA 1BIFA 3DULA 1BTOA 4JGBA 2WB2A 1QM5A 1QAOA 2X8JB 1KSFX 1SCJA 4LSMA 1NC1A 3UT6A 2XI4A 4OF4A 3JQRA 4J6FA 1PHPA 2X2FA 4Q3BA 5GM2A 1CNMA 2IOYA 1U94A 2ZU0C 3I0ZA 1RZ3A 4Y2RA 2DP4E 1L8XA 2W7TA 3FPGA 1NASA 5ALTA 3ZS9A 4HFNA 4N9QA 1SUFA 2O0JA 4TQGA 5AKGA 1CY4A 2TYSB 5GJWC 1YCHA 4WOJA 4AZTA 5A4MS 5EC8A 4LX8A 3EGIA 4TLLB 4OGGA 3MCWA 5CGZA 1A98A 1V16A 4UZSA 4P35A 2ZI9A 5EEHA 1MGOA 2AW3A 3B6IA 3I8SA 2YJZA 4MYUA 4NPHA 2OQRA 2PQMA 4TTVA 1ZK0A 1AX9A 1X8XA 4AT1A 3FJ1A 1Z4IA 3L4JA 3GR6A 1A7UA 4XB2A 5AIAA 4ZVMA 4A23A 1Y5RA 4PPQA 1G2IA 1M5UA 2C04A 3VTZA 4DW8A 1Y98A 3OQHA 4CQLB 5K20A 1L5YA 2VATA 1ZM7A 4AJJA 3T94A 1KQFA 5DM70 1WDMA 3M9WA 3PQ7A 2XGSA 1UFKA 1QYCA 4QARA 4RWEA 5D86A 4WZAA 4Z3DA 1I94B 3CLRD 3GRPA 4EF5A 1X94A 3VZCA 1E1YA 3W8EA 4DLVA 2IIVA 4QFCA 1Q83A 2FG5A 2LZ0A 4TL9A 5H7XA 4UDYX 4Z7JA 2CD9A 5JH7A 1O9GA 2PS9A 3QVXA 5COAA 3HJUA 4TVBA 1CIJA 3TJZA 1SY7A 3IODA 1B15A 3GEMA 4WZAE 4CW7A 4JFAA 1PKEA 3CSUA 4NQRA 1R4NB 3M4XA 1Z7BA 3A6EA 2F43B 4FC6A 1A9ZA 1JDPA 4TS9A 5LA6F 4ER7A 4MWDA 4MH0R 2DH6A 4YS6A 1SH7A 4XGQA 3FVWA 4JWKA 3HL0A 3KPYA 4WKBA 4HYYA 3JQFA 2Y0EA 1Z82A 3P1JA 4K9NA 5TMDA 3L6DA 3AZPA 1P19A 5HILA 5J47A 2WILA 4OU4A 1APBA 2DHQA 2NTVA 2R4TA 3H9CA 4EKGA 2VTKA 4B6FA 5L4LA 1J7KA 1PU2A 4ZI5A 1I7QB 4JN6B 3A27A 1C3VA 1Z0KA 4ZT4A 1Q0SA 1WXIA 4KPGA 1JMVA 4B3CA 1H2HA 2Y66A 3QE9Y 2CV0A 1TF5A 4TLCA 4K46A 5EJ2A 3UFXB 3IDOA 3GWZA 4P08A 4UARA 3DZIA 3F3SA 3KB8A 1M66A 4IDPA 4UHJA 4ZCRA 2PE5A 4Q9KA 3TRFA 1IEWA 1T8PA 2XMCA 4RPIA 3DBIA 2X9LA 5BR4A 3I0MA 4OJNA 5DGDA 5I9NA 1J24A 2VYQA 3F5MA 4OAPA 4YDQA 2IH4A 3INNA 4RAOA 4TWZA 2Q5FA 3PNLA 4XEUA 4EF6A 1EQAA 2GF0A 3EUWA 3KU1A 4ZO8A 1NTRA 2B78A 2PD6A 1KYVA 3PSHA 1LLCA 1KKUA 1SMKA 2A8YA 3BF8A 4EAQA 5KSOA 3W5DA 1JVSA 3O4GA 1X7WA 4C1NA 4AWAA 4CLHA 4L76A 4OL9A 2FN8A 2X23A 3NDJA 4XQ0A 3WL4A 1OI2A 1JQ3A 1KA9H 2QQEA 2Y27A 3M2PA 1IBMB 4QNNA 3OE7A 2BM8A 3D3NA 4M0FA 3Q3HA 2HBZA 1U3CA 1FU4A 3U9LA 1U8ZA 1A7AA 1I6LA 3KQMA 3I5UA 2CFRA 5DCLA 2KW5A 3BD9A 4O4HA 5JQGA 1P61B 1QP0A 2P67A 1R5BA 4G01B 2PIDA 4P4NA 1MC5A 3F96A 3I28A 4HAZA 4PPYA 1L5GB 4B3RB 2EXXA 1U9JA 1DQRA 1B2LA 3N74A 1DRUA 3KE9A 4PLCA 3I6MA 4RIIA 2C9BA 5JD6A 3CMCO 2QAGC 1NZFA 2JCBA 1BHO1 1SOVA 4CFSA 1M3SA 3WDKA 5B12A 3IJRA 1SVMA 2Q45A 1J4AA 2VJYA 2PX8A 3FLBA 1YDGA 3C3EA 4JB8A 5CAEB 1C1DA 3UJ3X 2NGRA 2E87A 3AJ8A 2YINC 1A95A 4YJ3B 1IOLA 5ALWA 2AGVA 1PLKA 3SQOA 3WNVA 4KLCA 2G88A 4LSGA 4E1VA 1GSHA 3BILA 2RGNA 4H59A 4WHMA 5SYNA 1AIPA 4NXNB 3QP9A 4RA6A 4OXRA 1XNGA 1E60A 3ED1A 4QVIA 1Q84A 1CW2B 1QK3A 3DOFA 4GL4A 4LYFA 4D9MA 2DE0X 1EH5A 2MMCA 3GAMA 4QQKA 5F9HA 1PT6A 1VMKA 4MICA 2UU9B 3FJYA 1HQCA 4LHSA 4MNTA 5CB6A 3LX4A 4ZJYA 1XPRA 4R0NA 3TDMA 4OCZA 3CEJA 1GOTA 4J4HA 1S7GA 1ZNZA 2B99A 3ZDZB 4HTAA 1BYUA 4KACA 2IZZA 5AKHA 2BBSA 721PA 2NU9A 3PITA 4QWWA 2JC3A 3H16A 2BFPA 3GGPA 3N1UA 4JL8A 5K7SA 2R66A 2XNCA 3MWYW 3D6AA 3SJCA 2BELA 3K09C 2C83A 1A04A 3QPCA 3H84A 4BVHA 1J1UA 1PNTA 2PZEA 4C21A 3CEAA 3R9WA 3H9UA 1Z25A 4X7BA 1XTUA 1JIKA 1I24A 1QGDA 3NEJA 1UBHS 2AG1A 3H2ZA 3IV7A 1ABBA 2XMSA 1OR8A 3WJ1A 2WM8A 2R1ZA 3JQPA 1S8NA 2YZKA 4MWCA 1YL5A 2Q0SA 2QMOA 1E7QA 1UBLS 3I34X 1SQSA 3UMGA 4KYVA 2QN8A 4K0KB 3W2HA 1UJBA 2VWQA 4YJ3F 1NLFA 4MS1B 1W46A 1ZHHA 2W6PA 1W581 1XE3A 2YWXA 4F1WA 1X7XB 3JRXA 3OIUA 3ELUA 2I6UA 1G8KA 4LJ5A 4ND6A 1MPTA 2YHAA 4I1IA 1LZKA 2VNKA 1JKMA 1Q3HA 2AXQA 1ZVKA 4DBVO 2P30A 1XVVA 3CT6A 1IH8A 1ORRA 4MCJA 4ENQA 3MPOA 4F9EA 1KKMA 1UFQA 5JDIC 1SUPA 1SG9A 2PXAA 2R62A 1EVEA 3BHMA 1FUUA 2EX4A 1EGMB 3LVQE 3TZ6A 1GAWA 3BMCA 2ZB7A 1U2DA 4MIKA 4Q15A 1WXGA 4GI1A 1U0FA 4GYJA 4E21A 2J5QA 4EKEA 2OCGA 3RYHB 2QUZA 1T9CA 1XLWA 5UKDA 1DUIA 1W8IA 4YLEA 3SS7X 3SJBA 3ZWXA 5CLJA 1C2YA 3F8SA 1BHQ1 1R6BX 2X4DA 3MNFA 1RJ9B 1KZ6A 3HJCA 3K0AB 4D02A 4F60A 5J4VA 2LRHA 3QW4B 4N9WA 3BDAA 4X0EA 5LP6B 2C3MA 3R3VA 2ZTHA 2E48A 2CNKA 2HLDA 4ZO9A 2Q4EA 1YS9A 3KALA 3T0FA 3ZWPA 4F3YA 1ZAYA 3IOBA 4BRWA 2BFNA 5IJWA 2VHWA 4AJHA 3M83A 1I33A 4WLNA 1CV2A 2HIGA 2JJ1D 4N7MA 3V8VA 2RGCA 3JATA 3DBLB 2PH3A 4OOFA 1SQ0A 1SD5A 1Z37A 3EW7A 2WSLA 3KOXA 2FFRA 3OI7A 4B79A 5JJKA 4MR7A 3I39X 2B34A 2PEZA 3D7LA 5SYMA 2EYQA 1PR2A 3TSYA 4PAQA 4PHHA 5DGCA 5KI6A 2BT4A 1DIBA 4M0MA 3PUKA 2G0TA 1JJFA 4S1OA 1V1RB 4N5MA 1Z88A 4X85A 2ZULA 4FYPA 3QLJA 5GGXA 2IXGA 4YCMA 3BHNA 1T9AA 1YHYA 3WNBA 3FTCA 5JNVA 3F7OA 1P73A 1IIBA 2I8AA 2OC9A 2IPLA 3B7WA 2ZRBA 3OESA 4ZVVA 3ZE2B 4GS5A 2PKEA 5L53A 3OMWA 4C5CA 5D8DA 4Q00A 4TRJA 2XIQA 4TV8A 5BQ5A 3U49A 4ARZA 1WCV1 3EIUA 4CNQA 4DSUA 1PVVA 1TNDA 2XE4A 8ABPA 1RZRA 2J7KA 2ZYUX 1HXHA 2F00A 1EGVB 4P31A 5IYZB 3ROKA 4N6NA 5FYQA 4U7FA 2WIGA 3E3MA 3C5VA 3HJGA 4LS3A 5BWMA 2QL5A 1Z5NA 2BFWA 2BP7B 3N0XA 4LK2A 1ZC3A 5G40A 4AO6A 2CHUA 1EVJA 2Q3EA 1NXQA 2DXIA 3ZU3A 3BWVA 1MFZA 5C8XA 1ZCFA 3IX7A 5AKJA 1QNLA 3D3KA 1JMKC 4C3OB 5G1OA 2R8YA 3MIZA 4C7OB 1Y9EA 4B34A 4FLMA 4S1TA 4WKNA 1L7OA 4F7WA 1DAMA 2IXAA 4FFWA 5EVJA 3G89A 3DBHA 3IYLW 1EU1A 1XA4A 2X8BA 1B0AA 3E3OA 3VVLA 1G20A 3NEAA 4D2IA 1U8UA 4FDAA 1SWWA 4V2UA 1ORVA 3NH9A 1K7CA 4KJZA 4DADA 3A6PC 1XMVA 2ZRIA 1AZSC 3K70D 1K5HA 3QEAZ 3AVUA 1RBQA 3E5HA 2BY4A 4EL5A 1OZAA 4FCTA 4LE0A 2WYOA 3C6KA 1AZTA 2VQSA 4JA2A 3EJ6A 2O2DA 1HZZC 2ZYRA 2RHTA 5LIRA 2XCTB 5HNKA 1G20E 1ZH2A 1ZSYA 2CY0A 3ASYA 3HDQA 1NF2A 3M3PA 3PX3A 4LEIA 1OZGA 4K8RB 3TLGA 5H68A 1M7BA 1QU2A 4UAVA 4ASUD 2PZGA 4NU5A 4ZGBA 2YYAA 3U0VA 3HN2A 2RMKA 3QF4A 5AVOA 5FPKA 3L2OB 2P0EA 1VDMA 1OZHA 3LKBA 1QVRA 3FNQA 2HBYA 4YAGA 1P7CA 2FLWA 1KYYA 3DFKA 1QGAA 3K9NA 1VGRA 5BNFA 4B35A 4DG5A 4PZPA 1KI4A 1ZIPA 4EPRA 121PA 1J9ZA 1QHSA 2AF3C 2I22A 3A1SA 4S35A 4RX1A 3OLZA 1IDOA 2R6HA 2XKJE 7YASA 1XHFA 5AHWA 2IY8A 3WYCA 4PE5B 3KYIB 1SVLA 1A71A 2PVCA 3A8TA 3QSYA 1RI5A 4L95C 2XT9A 1S9HA 4OTZA 4DT1A 1E5LA 4NMLA 2YV4A 4YLYA 3E8MA 2YVAA 3S70A 4G4IA 4KZKA 4P98A 1SUCA 1YQEA 4R1QA 4QGSA 2V74B 2F8MA 4OY3A 4R84A 3SBEA 1BDHA 2G7MC 3JU3A 4P1ZA 2NU6A 2GF2A 4YI3A 5I47A 4KXYA 1SBYA 3RJ9A 3R7WB 1DZ3A 5HGJA 1SCBA 1SZDA 4IEFB 4JNCA 2JIOA 4URXR 3OEED 5AYVA 3DR5A 4U7PB 2J4CA 2D5BA 2IFTA 3AF4A 4QG7A 3D7RA 2VS1A 3R0QA 4X95A 1PX0A 3N6RA 1MOQA 2GXUA 4XD2A 1MJFA 3BH0A 2Q1XA 4FU0A 2KHZA 3AXTA 3PLNA 3PVCA 2HCBA 1UOEA 2I3AA 4MUBA 4CEHB 2QUHA 1DAOA 1J2EA 1UPAA 4IUBS 4LXXA 4CI9A 1BWRA 2I67A 4BJ6A 1LX6A 1JT9A 1O6CA 1UIRA 2DHDA 3K0HA 3ORFA 4IIBA 2YHIB 4P5PA 4IRMA 2WFZA 1OIVA 3PT9A 1PFGA 1CY6A 2LIPA 3E4DA 3WRYA 4A8TA 1MQ9A 3PPYA 4O5AA 2XMPA 1YWGO 1KMCA 1VCIA 3QVLA 3AONB 5BW6B 3ODPA 2DY0A 2H63A 3V4VB 2AN1A 2FWMX 1ZI6A 1IY8A 1GCIA 1C2TA 1RM3A 2I5PO 1ZBQA 4MVJH 1IM8A 3C3MA 5LVAA 4YT8A 4XQ9A 2LTAA 5CTJA 1ELOA 1L4HA 5K05A 1R0WA 3AJRA 4I4IA 5KREA 1Y3IA 4BRSA 4EAAA 3IBGA 4EYEA 2C7PA 5C52B 1CF9A 2FXVA 2Q2NA 3UCFA 4B3FX 5T41A 4Q34A 2LD4A 3DE4X 4HRAA 2E85A 1EDEA 5I9TA 3DEJA 2RGYA 1JDUA 2ZCJA 2YBDA 2Y1XA 3AHHA 4Q05A 2CFOA 4DV2B 4ZEOA 3PS9A 2RHBA 2F9LA 2J41A 3V7FA 1R6XA 4D79A 1IXKA 4BQQA 1PZMA 2CFTA 2ZUEA 1R9JA 2KBEA 4D0SA 1T5IA 5EKXA 1Z4JA 2QZJA 1RRGA 3FCUB 3SYLA 2EF0A 3OJ0A 4TTAA 3UMCA 1Y7IA 2FR8C 4GOND 2Q1TA 4RPHA 5T67A 2HXSA 5A6SB 2IZ0A 4U3JB 4YASA 4BTVA 5BSGA 3ZZNA 1EUYA 2W4MA 3HYRA 5J58A 1XWWA 2NO9A 3VR5D 1OB5A 2WF9A 4LJKA 1ECFA 3MT8A 1MB3A 2C5AA 1PV2A 2JH3A 2HU2A 2Q4RA 3TLKA 3V8RA 3PUVA 4C6TA 2HA3A 2CMHA 2IYVA 5CNIA 4CUJA 3FHCB 3IMFA 4EBFA 2ZIEA 1A0OA 3GBPA 3O73A 2GBFA 4I9UA 2DSTA 2FW9A 2I54A 2RHDA 2IODA 4O1IA 2QAGB 2QEQA 3C87A 4GMFA 4BMNA 2B4RO 5GV7A 4B74A 4BQFA 4D9NA 3PGJA 3W9YA 3N2IA 3IUPA 4RLSA 1R6DA 3LGXA 5JADA 4RHCA 5G0VA 3QY9A 1SC6A 4KFTA 4MGIR 4EW1A 5JSQA 5KNCA 4BQEA 2V0CA 5JSHA 3UXMA 1AGPA 2FEXA 5EG5A 5H3HA 5EGSA 2XQVA 4Y9DA 3GEPA 4J4TA 3K8ZA 2QTAA 4DY4A 3GFSA 1I8TA 4RY8A 4PG6A 4RSGA 1NKSA 1RDFA 4WIAA 3SZMA 2JIDA 1RJWA 2GF9A 2HDWA 3JPWA 4QPZA 3O2NA 3I6BA 4XKJA 2XXJA 2H7CA 2I71A 3AI7A 3T3DA 3ZU6A 4CL8A 2BMFA 4OUKX 2ATCA 4UNQA 3EAQA 4YY3B 3P71T 1SVNA 1IN6A 2IDZA 4LJ6A 2D00A 4C89A 1PL8A 2ECKA 3G0BA 4L9RA 4QDZA 1EUQA 5K0ZA 4MRAA 2PUJA 5IF3A 1PKXA 1XXHB 3S99A 1ISRA 3PR2B 1NW9B 5DTEA 4YUVA 2WLTA 1Z8DA 4F86A 3GIWA 1CUYA 4MV9A 3V4LA 3E7FA 4UDXX 1DAEA 2VDMB 4W5WA 3ZCSA 3GRUA 3LBHA 2XCQA 5JFGA 4GRIA 2FCAA 2Q99A 1XDGA 1FU8A 1WE2A 3L01A 3WYAA 5C1BA 5GJVC 4OQXA 2XCSB 3BIFA 3AF5A 3SEAA 1BKSB 4EJSC 1ISPA 2DAPA 4GDMA 2HK7A 1G0NA 1NBWB 2ZTLA 1S02A 4KC0A 3T1QA 1SQGA 1GTSA 1T0HB 3MJDA 2BRUC 2CDRA 3SQLA 1HYGA 3OVMA 3QMMA 4NCAA 1UOPA 2MINA 3I76A 4WZBB 5DYWA 3V8EA 4LDZA 4AMZA 1IPEA 3ONNA 3GZTB 1S4QA 3AF3A 3U13A 3HTXA 1GCUA 4W5JA 2XECA 4MRVA 3L8HA 4BFXA 4FT2A 5DHQA 1UFOA 1XVUA 3ZKWA 1L8QA 3IJPA 2WKRA 2XZPA 4BBAA 5IT0A 1AHIA 2QZPA 2H5IA 3GA7A 3G8AA 4B6OA 4PS1A 1ID8A 1QV7A 2OV8A 1ZU5A 2QP3A 1JTFA 4IFEA 2WU1A 3MAGA 4E2WA 2PHZA 4LTDA 1YULA 4YK7A 4F4UA 3U1BA 3L5KA 3MSCA 2BR3A 2M2IA 4LYHA 4U9HS 4NE7A 3IVMA 3RVKA 4DR1B 1W30A 4FHEA 3LT1A 3WL7A 3QVKA 4TZ6A 1H6DA 1US8B 2BTQB 1UK8A 1FXWF 3WLIA 5HRUA 1XQ9A 3K1YA 2RAFA 4YLGA 2C9DA 1QLJA 1DAKA 3QXHA 1JHDA 1CDEA 4ZQCB 1VCHA 3G59A 3OUTA 5ARBA 3JZMA 3KKNA 2O8EB 1GR1A 3ORSA 1RD4A 3DDHA 2WWFA 3IKLA 3OCJA 3UWKA 3OPYB 3NFRA 4KBFA 3AEXA 5EHXA 2RK3A 4FOOA 1NDHA 4G1MB 1RLOA 1E0AA 4X71A 5FAXA 3CZ5A 1N6LA 5CIQA 4PAMA 5EKDA 2YS6A 4AKGA 3KBOA 4CCWA 1KORA 2IEZA 5HE9A 3D5EA 1MOZA 3H4MA 3NS7A 4LJAA 3U9TA 3ZWKA 4BKQA 4ZC1A 4UREA 3A7DA 1CR1A 2BGKA 5EEGA 4WOBA 1XU9A 1YCFA 2EP7A 1OREA 4B7XA 3JQBA 3KZMA 5B1HA 1UC9A 2E4WA 1F5NA 2XAAA 1X9GA 4KDEA 4D41A 2O1XA 4DGSA 2PYIA 3BPSA 1A9SA 2EF1A 1O7JA 2IYXA 3ZY3A 4YRBA 2HUPA 3QVOA 3K8OE 1U9IA 2IHKA 2PAFA 3G8YA 3X1MA 1UMKA 3QFHA 2IF2A 1W85B 3KNZA 5M34A 1HQYE 1D6JA 2YIDA 1YRQA 3ETJA 1T5LA 3MMSA 3KR1A 1X1CA 3IIKA 2K4MA 1VIAA 4RESA 3FZEA 1C9MA 2WNIA 3CR8A 3JXEA 3VAZA 3AU9A 3DE6X 2O8NA 4C07A 2QM3A 3BJZA 2PJUA 2XUIA 3LGSA 4IGAA 4OQZA 4WDRA 3W5IA 3ZXXA 3RAEC 3QTBA 1WEHA 2J33A 3B85A 4D5EA 2JGEA 3WWPA 5IM4A 3AVVA 2H51A 3VFDA 5IN4A 2QKYA 3DMHA 1DELA 3L3BA 3RF7A 4UBJA 4B71A 3O8OB 2WWGA 3NRCA 1DG3A 1QTNA 1EK1A 2WEKA 4LQ4A 4YYEA 1P1JA 4EMTA 3OLWA 4G85A 4DVGA 4KR6A 1GQQA 3OKAA 4FSHA 1BA2A 4BGIA 4CMEA 1ZK1A 4FN4A 4X3OA 1WTAA 1NMQA 3HZRA 2Z08A 1EGAA 1L5MA 2DJIA 4INZA 5DX0A 2X4LA 2JVJA 4BLRA 3JWPA 3LK7A 5LQRA 5E1BA 4L9WA 1Y8RB 4JX8A 4LRTB 3WLHA 5KYYB 1UBMS 4KU4A 3J80A 1YA8A 2R7AA 2WJWA 3I23A 2H2HA 1G6HA 3D0RA 4UTVA 2CVOA 1GIAA 3T0IA 2H9AA 2B21A 3QXGA 3MTDA 3CF0A 2HL6A 4FIDA 4CKEB 4ZI3A 2IS2A 1SCUA 3KKZA 4JQCA 2HDHA 1BC5A 4GMGA 3TVDA 2XKKA 4C05A 3NBMA 1XROA 3COWA 4ZV9A 3LQQA 1S2MA 2A0FA 4C5BA 4QGFA 1E7RA 3DEHA 1AXEA 1A7KA 2C2BA 3BXGA 4NATA 5DSXA 4Z4CA 5BQFA 4MP3A 5FOXA 4Y98A 1OXVA 5DWQA 2FE1A 2G4LA 2ZBPA 3AR7A 3O90A 1NIPA 1ADYA 3QWHA 4ZOLA 1WUYA 3VJKA 3QHPA 3WRVA 5AR1A 4A9AA 4BO4A 5FUVA 1W59A 3OA2A 5IZ4A 4ZYYA 4HQ6A 3HU5A 1PNOA 1GO2A 3N58A 2Q2OA 3FTDA 2YXNA 4R1TA 4XR9A 4YAOA 3V34A 4DIKA 1FW6A 3C8DA 2IHBA 3GMIA 2VHYA 2IELA 2XMZA 4IZIA 4OHZA 3DCNA 2LV8A 5AW1A 1RRFA 2D3TA 2VF7A 4R1LA 2Y9MB 2C4TA 4M9SA 1G0OA 3QE2A 1MO3A 4KPUA 3FDJA 1E8DA 2EL9A 1TZCA 1NXTA 4G8CA 4GEGA 5A4JA 5K8LA 3QU4A 3KAQA 3KOOA 3UW1A 4TVSA 2CFIA 3CX8A 3A70A 4ENWA 5K0LA 1B6SA 1L7RA 1D07A 1BW9B 1UXJA 2JAXA 3G2LA 3QJGA 4JUCA 5EHZA 5ALRA 1G66A 3G2IA 3AIOA 4F84A 1RU3A 1T4CB 3ZY2A 1AMUA 2R7NA 1CETA 4GZ6A 3HDYA 3WJ2A 1XEWX 3AEKB 2YFHA 4X61A 2JLRA 3JD3A 5JLAA 1G8PA 3DHEA 1OKKA 3HYCA 1MLDA 5CFQA 3UKDA 2QP4A 2R3SA 3PDCA 4UZFA 5FOVA 2Z9BA 4X6LA 2YY6A 3GCWA 4PYJA 2QN3A 3RGWS 5LQJA 4QUJA 3BHJA 3L0SA 4GR9A 1W52X 4IDHA 5IMBA 5T5QA 5IMSA 1CUBA 1USIA 3KIPA 5I8WA 3I5MA 4AMBA 4RHFA 2J9RA 5FJIA 1G3RA 1BXRB 2F90A 4ZCQA 4I55A 1JV2B 4EMUA 5CFRA 1JQKA 5DNWA 3RBXA 1EVQA 6ADHA 1SU7A 1N8TA 4NMWA 4YJDA 1C8KA 2Q28A 4B43A 2QXTA 1XTBA 2PXCA 5JCOA 3AR2A 5EERA 1JHMA 1TU3A 2FEMA 5F3RA 3JRNA 5BQPA 4AZWA 5AW3A 3LZCA 1E2UA 5JTUA 1OLSA 1VJ0A 3A4MA 3ZZTA 2FPOA 3TW8A 4HNVA 1PQ4A 1CBUA 3OM0A 4IIEA 5FQNA 2WJHA 3DFIA 3RT1A 2VPIA 2RGRA 4BP1A 5JYEA 2E5WA 3C6BA 4MTCA 1L7NA 2FN7A 1PG0A 2YFYA 3D31A 2GB4A 3L6RA 4KE8A 5KHAA 3O1IC 3OT1A 2QDXA 3WA6A 3CTMA 5L3RA 1GTVA 4C0AC 1E61A 9LDBA 5E9JA 3B89A 4TWIA 3TSAA 2FDCA 5C9ZA 1T10A 2PV0A 1NQOA 1N2EA 4RZSA 3MOGA 3IUJA 2VNHA 1T34A 3DT9A 3TAXA 1PNQA 1KP9A 1Y8CA 3IAXA 1NVUQ 2H2FA 2RJNA 4Q5IA 1QF6A 1CVRA 3H65A 3AMVA 3GJTA 3N8IA 1ZJ6A 4QO7A 5A4IS 2AIRA 3A4IA 4MS4A 4NZMA 2I6GA 4ESEA 4LWOA 2VCYA 3A32A 4NG5A 4TXNA 1PK8A 4EEZA 3Q87B 4FGZA 1J23A 4HL6A 4BOYA 2BEKA 3V4ZA 3SLKA 1Z4KA 2VP3A 4P86A 1Q0PA 2EJCA 4PGMA 3RS5A 3LQFA 2QVBA 2HI0A 3HPQA 4MV0A 3LHFA 5FLKA 3LTNC 1PRYA 2C99A 2HQ1A 3E9EA 2YWDA 3GNLA 3MB8A 3PEEA 4YJKA 5KYVA 4DCJA 4CMIB 4F06A 2PUCA 3IKMB 1NG1A 3L8DA 2BKAA 2Y6VA 3LLCA 1RHMA 3QENA 4OL0A 5LP1A 3MHTA 2O8FB 4EA9A 4BECA 1E3WB 5JPDA 4REMA 2GLUA 3N0RA 1G59A 3UJ6A 2ZJBA 1FS5A 4IIJA 2HCTA 1TZJA 4AZ3A 1ZD3A 4ZEMA 1A9TA 1HNNA 1OJLA 1WQ4A 2PJDA 3RAJA 1FRVA 1YZNA 4EY8A 4ZQFA 4UM7A 1Z4PX 3ZI0A 2G07A 1FQWA 1CF2O 1B14A 1VG9B 1WPXA 2W90A 3OMXA 4NYMR 4L5IA 4PZCA 4RS4A 3KJGA 3LUBA 3SCZA 2BSAA 4C0JA 2WJPA 4EG6A 2ZITA 3AM5A 1EFAA 1UK9A 4XQGA 5IWAB 1M8GA 4O2AB 4X3CA 1G60A 3UQZA 5T3YA 1VBNA 1ZUNB 1TQ8A 2VSQA 3BTVA 3HMQA 5GQSA 2QTHA 5IT9A 2GD2A 1EX9A 2GPYA 4YXWA 3FWKA 4WNIA 1WRBA 4S0ZA 4J8PA 2ZR0A 4RD4A 4EA8A 1M2VB 1U7WA 1UCFA 2HCFA 3AP2A 1UMDB 1QP7A 1GLNA 1FUEA 2LDBA 3IP8A 3GELA 3NAMA 2CVFA 2V98A 2YNMC 3WLLA 3U3JA 1LI7A 4XH9B 2HT1A 2QGNA 4LRUA 2MSWA 2YY5A 1ENOA 1U0GA 4NWIA 4HGRA 4RMNA 3RV3A 3VISA 1W88B 4EJSB 3GRKA 5C5IA 1R27A 4BNVA 1VC2A 3QPBA 5DWVA 5F12A 3A6DA 1PFKA 4LPSA 3TPZA 1BX0A 3AEZA 4RKQA 4EM6A 5JR3A 5KVAA 1Z6ZA 2W2KB 2NT4A 2CLFB 4BVBA 1RC1A 1UDCA 3EZXA 4EIWA 5CCXA 1BZYA 2GEFA 5NLLA 2NTEA 4KSYA 1IWPB 3T5GA 4KWCA 4LE1A 1GP2A 1L4MA 2GZRA 2H1RA 2YBEA 4KSCA 4ZIRA 4L5AA 4V0MA 2KPOA 1FB5A 3C3XA 4JBNA 1RPTA 4RZHA 3OO1A 2ZYHA 4OHVA 1R9GA 4HR7A 4FIZA 2V1XA 5JXGA 2WIKA 5LQSA 1JDTA 1KJIA 3P94A 1U5AA 5IUKC 4PZYA 1KU0A 3BB4A 4WJLA 5KSWB 3EZYA 3QPAA 1DQZA 2JLXA 2BGUA 2Z30A 5KNDH 4V0ME 2BCJQ 1V8OA 1CDOA 2VRBA 1GGMA 3ZN2A 4PXYA 2PNJA 1SVUA 2QY9A 1TUBB 1ZRNA 4IHAA 5EP3A 3JQ7B 2PUDA 1MEEA 1LDGA 1QDUA 1NY5A 4RK7A 4CZ2A 4IL5A 1U3GA 2B4YA 5EIOA 1NU6A 5BOVA 4BTEA 2O0HA 5JMWA 3EEOA 1FVFA 4MUAA 3LC7O 3SS8A 5J2TA 3IQHX 3AV3A 3QFRA 3B20A 1KP3A 1V5IA 3CVXA 3HCDA 2PYZA 2B92A 3RS4A 3RRMA 3ZJ5A 4HNQA 5DLPA 4EG1A 2G0NA 3FTQA 1LJLA 3V2UA 4X62B 4MJLA 1O6GA 3LO5A 1I4LD 1R7RA 3FVTA 3K35A 4XIJA 2XXAB 1DNPA 3Q98A 4CPDA 2NUPB 2JLVA 2DEUA 3GPIA 3IPAA 2LCQA 4AF8A 4GRDA 3VR6A 3P2YA 1Z75A 2ZJ8A 5C3MA 1XPOA 5JW6A 5AI5A 3KQSA 3ELWA 3RIEA 4HS4A 5JVDA 3TTVA 4LFAB 1M8JA 2AQKA 2IIBA 5JAMA 4EFKA 2IZ6A 3PPVA 5JT1A 3U7JA 5K0NA 5FTNA 4Y0VA 2G8LA 3JQGA 4INAA 5FXMA 1JA9A 2HK9A 3AFHA 3CLUC 2PFSA 4JC4A 5CH5A 3VGPA 4GBGA 1DAGA 1WMAA 2G9NA 3FB1A 3LP5A 4C4SA 2OXFA 1J7JA 3WGZA 2B61A 4XYEA 2UUPA 4M2LA 3U4HA 3OEHA 1V48A 3INTA 2VPPA 1N25A 3NM6B 5AKKA 4YMTA 3NASA 3ZU2A 1WAMA 2IYTA 4X60A 4BP8A 5C18A 4D42A 3WISA 1YUMA 2Y0BA 3THSA 4DUGA 3ZW8A 2JRCA 4YUWA 3ZCXA 2Q1YA 5IJXA 1XELA 3LP6A 1ZJWA 1HC7A 3LYUA 3TZQA 4PINA 4F5WA 4MV3A 1HDCA 2YXPX 3WLSA 2ATXA 2NVOA 1BU8A 2Q21A 1YR6A 3BYZA 4QUKA 3GJ7A 3UHAA 3X1YA 4AIIA 1LS1A 1IK4A 2BGTA 3C4JA 3EHEA 4NBWA 1IC6A 4U2FA 3NXKA 5D3ZA 4IVQA 5IN5A 1ND5A 1Z3IX 4RANA 5EQJB 4NV0A 3PE6A 1V3QE 4UHFA 1W44A 3N8DA 3A4LA 2FRXA 2GBGA 1BH6A 1DC3A 3EUAA 2CMFA 3UMBA 2DWQA 1S7CA 3SZ3A 2VT3A 3BUSA 1ZITA 3MWEA 3E84A 4HOYA 3SJUA 3ORRA 1Z7EA 2GPNA 2YV1A 4ND8B 4R9VA 2O5RA 2VTVA 3RS0A 3ZD6A 2ON6A 3GAZA 4Y9SA 3EXEB 4E12A 2EHJA 4KI0A 3NBYC 2ISQA 1NF3A 1R64A 4RE6A 3WSWA 1E1MA 3MFQA 4MEAA 5HIKA 5F7ZA 1DSSG 1QYRA 3NALA 1TT5B 3OZEA 1MP0A 5K8JB 3L05A 2WT4A 3RVQA 2DY1A 1U2QA 2PSFA 5KNBA 3HP1A 3ZE9A 2ZBVA 1NVFA 4D8UA 2H4JA 2ZI5A 3OM8A 2BHNA 4PHGA 2E18A 4YPFA 4FHDA 4Q4HB 1KAOA 2PXHA 2O06A 2VTBA 2ZIXA 4O1MA 4QVGA 3V33A 3ICCA 5DASA 5H59A 3T1OA 2WVGA 4URWR 2R2GA 1IN7A 4ZYVA 2A9JA 2UZ1B 3A6GA 1W4AA 2NU7B 5M2QA 2V6JA 4JR2A 5HBGA 3CRVA 1T2EA 3NBFA 3MJVA 3VHXB 4Z6KA 3VZQA 1C9JA 2W48A 1N2CA 2NQ2C 5ENDA 1M2NA 2WOJA 5E0KB 4LJLA 2Z5VA 4AUEA 4RK1A 2J0SA 2FPPB 3P2EA 1EFRD 1KI7A 5L6LB 3CIFA 1DWOA 4B6SA 1JRLA 3MELA 3TGLA 1RXVA 4TN1A 3IV9A 2XDQA 1JIQA 5FPTA 4KHPB 3W90A 4G8JA 2PG3A 4E6PA 2C2XA 1OTXA 4HBZA 3KSRA 1XRRA 3AYXB 4W63A 5SZHB 1N2CE 4LUCA 3KJXA 2JVIA 3KKEA 3C6QA 4JMLA 2EKBA 4CV3A 4G36A 3OM9A 5G1PA 4NARA 3EQ9A 5ILQA 2A1UA 1VI6A 3E0XA 5GONF 4F9GA 3DZDA 3KQLA 1SG0A 2DQ4A 3Q7EA 1M2OB 3D2CA 2OWEA 2W0SA 4WASA 3AO0B 5IARA 1MX5A 3GUVA 3X3HA 2O3QA 1V1JA 1TUIA 1U8TA 1Y3BE 5DCWA 4DMFA 3OQNA 5FOSA 1X1TA 1QO0A 4J4BA 2YHUA 3CUWA 5BXYA 4R3WA 5CDFA 3RVOA 1YRAA 16PKA 2H31A 2FVYA 3PYMA 4RVDA 3JX9A 3TGWA 6AT1A 1DJOA 3E81A 5J4YA 4RK0A 2R6AA 1MA3A 1QG2A 3GJZA 4DNFA 4KHZA 4Z9FA 1UC5B 3DF7A 1G8MA 4N12A 3RM3A 1Z5ZA 3HBJA 1H8HD 3BG5A 4Q39A 1MVOA 1RW4A 3SS9X 3ECCA 2R7LA 4FEGA 2ZT5A 1EA5A 4I5FA 4Z0TA 3UMVA 5CDFE 1WUTA 2HXGA 4NECA 4PX5A 2VPZA 2FLVA 1PR6A 2XA9A 4KQGA 4UFOA 3RYFA 4BWGA 3SF8A 3QVTA 2X1HA 4V1CA 3ZWMA 1I3OA 1BMFD 1P7YA 3SXUA 4YUXA 5IBCA 3CZCA 1QIHA 1JA1A 2A1IA 3UMMA 2J3JA 4ZT5A 4UFNA 1IY1A 3Q3VA 1PAUA 1EK0A 3BGDA 3E35A 3H5WA 4J91A 3MJFA 1RI1A 2WSSD 3C15C 1SVWA 1GUDA 1XMPA 4Q16A 3UMSA 4ICIA 4ZO7A 1CEQA 2Y99A 1JG3A 5IULC 3AJAA 2GO1A 1C3XA 1ZD1A 4PG8A 1YOVA 3DPSA 4YBRA 4G1CA 3TUIC 1RYBA 3IPRA 4XIGS 3DTVA 2Z8YM 1BCSB 2WYUA 4HB2A 2IU6A 1N8SA 5HCIA 2AN4A 1QH9A 2PY6A 3ORYA 4YRCA 1U8XX 1Y89A 4A5OA 2HBQA 1OHHD 4BMPB 2OM2A 3WBJA 3RQIA 1ZN8A 4JSTA 3WYBA 4NJMB 2FPXA 1DAIA 2QW1A 3OJFA 4URFA 4HX9A 4QYWA 1BD4A 5A0FA 1GAJA 3UK2A 1HV8A 1F0PA 3FIJA 4FYVA 1IXZA 4ZQIA 2HF7A 1M0SA 2ASEA 2FPIB 1G8HA 2I6QA 2HC9A 3GFOA 2OCBA 2OXEA 4PM4A 4UVHA 4MUMA 2OYSA 2XA2A 3BRWA 4L0MA 3CKMA 2A7QA 2R1VA 4B73A 4WCVA 3PX7A 2BKVA 1K6EA 1T0JB 4PGGA 1GT91 3ANXA 2CWDA 1DOZA 4RVHA 1N8KA 2O07A 3BFJA 3SHTA 4LCBA 3TXAA 3N5KA 5DLDA 5C34B 1EZ1A 2WAYA 4ZJUA 1Z29A 2WVHA 2NVWA 5KDLA 4MPDA 1FZQA 3IHKA 4DOMA 4PWYA 5L45A 1RXCA 4MKXA 4MR8A 5J5AA 4O4JB 3UHFA 4ZU1X 2R8ZA 5TQ2A 1Q3KA 5JMTA 3V4RA 3AKDA 3L18A 4ITRC 2HD4A 1NYLA 4GECA 2X5NA 3KZXA 3IMCA 1ODLA 5A3VA 1XTIA 3OHSX 1J21A 4JUFA 5BV8A 3QKSB 4HH0A 5JAIA 2ZZNA 5A71A 3GUUA 1NZJA 3BJIC 3UZUA 3U1VA 2PH1A 2DUWA 1RPJA 1WULS 1QLWA 5HZKA 4GPIB 4I1VA 2CJXA 2O4CA 3EWAA 2OG2A 4RELA 4XQCA 3GMTA 5CFLA 3V6LA 1K0FA 3LWBA 3NHUA 4YRLA 2DMRA 1RABA 1Q22A 2JK0A 3LHDA 3NKLA 5EXTA 1DTWA 3WGJA 3ZCPA 4DWOA 3K9FC 3W1WA 4UOZA 1NYRA 1V5EA 1ZJJA 3EVZA 4LQCA 2A0WA 1RHRA 1KI9A 2LW7A 4P22A 2HJGA 4R8VA 4PG4A 1YOBA 4IDFA