3GMDA

Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKVTYPMVAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKAVSGIVNAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of 7-azaindole-pyrrolidine amides as inhibitors of 11 beta-hydroxysteroid dehydrogenase type I.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 96
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmdA00
2RCYA 4QFCA 1A71A 1UDCA 1UZLA 3WLFA 3K6JA 4LRSB 1XA0A 3KO8A 3HDJA 3ZW9A 4D46A 2Q2QA 3IDSA 1C3VA 3MEQA 4U6QA 2NU9A 4UREA 1AHIA 5L7WA 4QSMA 4P4GA 4PVDA 4ZQEA 5MGBA 4Y98A 5A5FA 3KYDB 1RJWA 1V3TA 3WGHA 5AXBA 5KTKA 1E92A 1QYWA 1Y9EA 2FR8A 5JDIC 3GC6A 1SB8A 4PRLA 5DBGA 2V6GA 3UOGA 4FFLA 3RFTA 1XCBA 2PZKA 2VYND 3CKYA 4PN3A 2D3TA 3ZU5A 1EEHA 1NM5A 3KEOA 1SEPA 4IDDA 3VTFA 5L95A 3HFGA 1HYEA 2QHXA 1HL3A 4NG5A 3VH1A 5G0VA 1FDSA 5TT1A 1X0XA 6LDHA 4IDBA 3GDFA 4KWHA 4Q9NA 1P44A 5IJZA 1JKFA 4J1TA 5ER6A 2B4RO 4D0RA 4DMLA 3WGIA 4BKQA 3SLGA 2EP7A 4D41A 4ILKA 1BVRA 4U6SA 3PWZA 3ZDFA 4BNXA 3GGGA 2NTJA 1N7GA 3IS3A 4JJGA 1N9GA 1DC3A 2HLPA 3GAFA 3ADPA 2X5KO 5BQFA 1DLIA 1ZJYA 4DQXA 1BDBA 2PK3A 3JD2A 1ZSNA 3EMKA 4PIVA 3ZV3A 4Y6PA 3GT0A 4TZTA 1VC2A 2PZLA 4G2NA 4R69A 1YONA 2HKIA 4YT5A 4YJHA 3VHRA 1HWYA 1K2WA 2WTBA 3CUKA 5JC8A 2W2LD 3A1NA 2VZ0A 2E49A 3LSYA 2A35A 3B70A 4J91A 3PYLA 4H15A 4IGEA 3K2BA 3WQQA 3ZWVA 1MFZA 4Z9YA 2WDZA 4ZVVA 3PQDA 5G2OA 3DONA 1Y7TA 3LC1O 1EK6A 2X0RA 3GDOA 3VDQA 1NFRA 3KETA 4CV3A 5F1OA 4H3VA 1A4UA 3ULKA 3GGPA 3ONEA 3TQHA 3H7AA 3S2IA 3I23A 1LSOA 1PJTA 2QRLA 3VZSA 2PY6A 3QWFA 4K1LA 4P22A 5T67A 3TPCA 5CP8A 4HWKA 1I3KA 5FFFA 1D3AA 4WLNA 5CDYA 1DIRA 1M2WA 4IS3A 4N18A 3AY3A 4TQGA 3WGTA 1E3SA 2X23A 4BNIA 5CAEA 1S7CA 3HADA 3JQ9A 3GNTA 3FR8A 1A5ZA 1KERA 3JD0A 4R1SA 1JU9A 3DZGA 1DIBA 3H9EO 2DKNA 2Q99A 4MIEA 3ZI0A 4W7IA 1BG6A 1N92A 2Q46A 5GZ1A 1O8CA 4KDEA 1P74A 3AW9A 5AQ1A 1YDWA 3QRWA 1GY8A 3I4FA 3PVZA 3RC1A 1C1DA 2NQ8A 3DMYA 5JCXA 3U4CA 4M1QA 3AI3A 1Q0LA 3P7MA 1P3DA 2WSBA 4MKRA 4PFJA 1PJBA 1B3BA 1PGJA 3PQEA 5MDHA 4QFDA 1WNTA 1YB5A 2ZB8A 4M86A 2IXBA 4UUNA 4BNVA 1QYVA 2ZTVA 4FJ1A 4CLRA 5TF4A 1H5QA 3DMTA 3Q2KA 4NZ9A 4WEOA 1YS4A 1ZK0A 3EY4A 1D1SA 3NT5A 3FD8A 5EN4A 1LA2A 1NQOA 3AY6A 3ONDA 3JQFA 3Q11A 3W4JA 3E6AA 3JV7A 3I1JA 5BSHA 3D3WA 4I9UA 1YO6A 1I8TA 2CUKA 3OMLA 3I9OA 3JQ8B 1QP8A 1UAGA 4YVFA 1LSUA 1FDTA 5TQVA 1LLQA 3BHIA 3Q1LA 1HTBA 4OQZA 1YXMA 4NBUA 3KB6A 1L7EA 1Z82A 3JYQA 4WOJA 2C59A 4ALMA 3KOUA 2Y1CA 4H16A 1AN9A 1LRJA 4XEHA 3JYPA 4NJOA 4WLVA 4PLWA 1DDOA 2F1KA 4O59O 2NTNA 5L3ZA 1TT5B 4A5OA 3DZKA 1H2HA 4PVCA 1ZXBA 2HRBA 1JKJA 2XPCA 1HZJA 3C7DB 1IULA 4CM4B 4OH1A 4AJ2A 4RJTA 5IFLA 5LDGA 4YA6A 3DZFA 2YYYA 4HNHA 4I5GA 1HLDA 2QRJA 3OH8A 1KEUA 4ND1A 1NPDA 3UN1A 3MTGA 4UUOA 4WEQA 5EL0A 4GVXA 2I3GA 2YQ4A 3V1TC 3WBBA 1Q0QA 4XCVA 1BVUA 1PSDA 2B4QA 3ZWWA 2D5AA 2HCTA 1E0DA 1YL5A 1GADO 3CH6A 2BH9A 4LSWA 5IN4A 3VZPA 5HS4A 4Z9XA 3D0OA 2WEKA 4RZIA 4ALIA 1B2LA 3W8FA 5KOIA 4JXKA 3ITDA 3LT4A 3N74A 1ISFA 5JNLA 4FPXA 4FD3A 1W4ZA 4UULA 3PI7A 4AJ4A 3GR6A 4IDGA 4PLHA 2X0JA 1R4NA 3OA0A 4BO2A 4YJGB 4XDYA 1NWCA 3H9QA 1XIVA 4YQYA 3FPCA 4L4RA 2BI7A 3L4SO 3VH4A 1WDKA 1ENYA 3PWSA 2OUIA 4NK5A 1GU7A 4F3YA 1P31A 4E32A 1E3IA 2TMGA 2ZB7A 4RDHA 3U9LA 3VAZA 4BGVA 3W6ZA 3QHAA 2J5KA 2QZ9A 1M75A 4GQAA 1M67A 3I9JA 4HADA 4OAQA 1VJ0A 1H6AA 3F4LA 4XGKA 2PZMA 4RGBA 2IEDA 3U62A 1T24A 2O3RA 1FK8A 2WYWA 2O48X 4DUPA 1GDHA 2IEBA 1E3WA 3C24A 4R54A 1I30A 3MJSA 4IDEA 1X0VA 4LGVA 3DQPA 4FS3A 1DIHA 1Z74A 3ZNOA 3H5RA 4YXFA 1X7GA 1KVSA 3GHYA 3A4VA 1A27A 1QYDA 2EF1A 4CMHA 1XHLA 5A06A 1ZSVA 3PHJA 1VE9A 5BT9A 2O2YA 1EBUA 2VOEA 4IQ8A 4WGGA 1X1EA 4TWRA 1CDOA 1HYGA 4L74A 2X0NA 4MVJP 4RORA 4E0BA 4MVJD 2VWPA 3WQSB 4ND4A 3RQSA 2CY0A 3WFIA 5IF3A 1Y6JA 4RQUA 3ZHXA 1DC5A 3V2UA 1JTVA 4S1VA 3U4IA 4LMRA 3AM3A 3ICCA 3F4BA 1JWAB 1UXHA 4FOOA 1GQQA 1DFHA 1I36A 2YV2A 4OGWA 3LDHA 3OP4A 1M6HA 3BZUA 3CE6A 4KUEA 3WSWA 4B4VA 3QIVA 1UXJA 3INRA 3L4BC 1R4MA 3EK2A 5U1PA 3H3JA 1KVTA 3MZ0A 4M54A 4BNJA 1HRDA 3NTQA 3D64A 5FEUA 2C5EA 4LCJA 2EJWA 4I9NA 4XKJA 4AJOA 5ILOA 2IODA 3MOIA 2VUTA 4Q3AA 3U4DA 4MP3A 4YDRA 1YQXA 3G49A 4KTTE 1TVEA 3PIDA 3GA0A 4DL9A 1H6BA 2C29D 4E2WA 5JYEA 1XELA 3QWBA 2Y0CA 1SO8A 4BO0A 1LLUA 4PLZA 5DP2A 3IQDB 5H82A 5CDSA 4RV9A 1QV7A 4Z0TA 1GV0A 4ID9A 4WUVA 5JCJA 2OBYA 2AE1A 1WW8A 2J5QA 4KWIA 3AOEA 2XOXA 3LLVA 4CR6A 2PTGA 1PGOA 3K96A 3ZHZA 4YCAA 1ZK1A 1Q7BA 2X6TA 4PRKA 4WASA 3CSDA 1G6KA 4GGPA 5CEJA 2J6IA 4J4TA 1TT7A 4GLLA 4I08A 3CMMA 3DL2A 4ZN6A 4MP8A 2BI8A 5JAIA 1BXGA 3GAZA 1D4FA 3LYLA 2CVZA 3SC6A 4E5NA 5TJHA 5A4DA 4YJFB 4GWKA 2F00A 3QV1A 3R6DA 2YY7A 2AG8A 4HV4A 2ZQYA 2YFHA 1JVBA 3IP3A 4J9VA 3DEYX 2H5LA 3EZLA 3FTPA 4YRAA 1UAYA 4A0SA 2YHIA 2VHWA 2VNSA 1WDMA 2OO5A 1OOEA 3K30A 3MJVA 3JQFC 4BNTA 4BO4A 3HN7A 1NBOA 3KYDA 2DFVA 2ZJ1A 1DFIA 1PU2A 1XU9A 1HDYA 3E5MA 5TIIA 2C2YA 3LC2O 3TZHA 4BGUA 2R00C 5ENDA 5F3RA 2GPTA 2X5OA 2X8LA 5BNIA 4RPHA 5AOVA 5TX7A 2LDBA 4N54A 5KJCA 4DBZA 1NAHA 3PPIA 4PZEA 1VJTA 4W99A 2O3SA 3GEGA 4HX5A 1B3RA 4EEXA 4QX6A 1V35A 3HFSA 2VUUA 5IDYA 5H81A 5JY6A 2IYPA 3NYWA 2GZ2A 1I5RA 1AXEA 1UP4A 4R3WA 5K6AA 1QYXA 3OFSA 1FDVA 4IGFA 3KSDO 3HHPA 1ZXLA 2HDHA 2CSUA 2I76A 4K6CA 5T57A 1ONOA 2Q3EA 4IMPA 1PS8A 4GH5A 1EVYA 4CL8A 2NM0A 1PGNA 3FCOA 4J6FA 4PG7A 1KEWA 1U3VA 2LDXA 2NACA 3L6DA 1Y5RA 1LUAA 1AXGA 5GY7A 3ASVA 3VC7A 2E82A 5JMPA 5JY1A 3NKLA 1D7OA 4MINA 2VRCD 4J1QA 2X0IA 4MIOA 4ND3A 4BO5A 1J4AA 3G17A 1H2BA 2UDPA 3PJEA 1T2FA 5G4LA 3RUAA 3WR5A 1XSEA 4R3NA 1NR7A 2JHFA 3I6QA 3GMSA 3V2HA 4YJDA 1PL8A 3ZH2A 2DAPA 3X2FA 4BV8A 3JQAD 1AE1A 3PDJA 3WJ7A 2ZQZA 3KEQA 4IZHA 2VT3A 1MGOA 3S8MA 4XDZA 2VWQA 2BFPA 2D1YA 5I9NA 2GGSA 4ZQHA 4C4OA 5JE8A 1JQBA 2GASA 3JYLA 1LEHA 2VN8A 4AJHA 5CDUA 1YDEA 1HDXA 1PJ2A 3IJRA 4GL4A 1RM4A 4BL5A 1M76A 4IDCA 4IQ0A 3WICA 3ICPA 4GPD1 1GCOA 4QTZA 4II2A 8LDHA 1R0LA 4LMPA 5COAA 1JDJA 4PLFA 3SJUA 4UVIA 2WJPA 3AM5A 2FWMX 3GVPA 4EW6A 4IJVA 4ZHSA 3FNFA 5FF9A 1ZW1A 3PFWO 4HUJA 5DCWA 1ORRA 4LRTB 3T4XA 1F14A 1DSSG 1Z6ZA 1PQPA 4U8GA 4CV2A 3PK0A 4IM7A 5A3JA 1TA4A 2YZ7A 3KLPX 1I3NA 3ZU2A 3TZ6A 1KC3A 1CEQA 3E82A 1GAEO 1Z75A 3AUUA 3NRCA 5DOVA 1MA0A 2DUUA 4J9UE 4INAA 3UH1A 1PJ4A 3GVIA 3RIHA 3ROMA 5JDIA 1EZ4A 5EJ2A 3PZRA 3GGOA 3QVXA 1FXSA 4BVAA 3FWNA 4R1UA 1ISMA 3RUIA 4XYGA 3KBOA 7ADHA 1F0YA 1PEDA 3PFFA 5IAAA 3WYCA 3QVWA 3CZRA 3PZBA 3VTZA 3KUXA 1B8PA 3QVOA 2HJRA 2YUTA 3TJRA 2GYYA 3C1AA 3LC7O 4OO3A 1VL0A 4RPJA 1Y8RA 3AFMA 3LF1A 4MPDA 3TZCA 4PLPA 3RC7A 1CIVA 1LDYA 2RAFA 3HUDA 1I2BA 1UP7A 1XU7A 2YJZA 3H9GA 2B0JA 4XQ9A 4R4JA 2WYVA 1L1FA 3SEFA 3VPSA 1C14A 2B5VA 3S1LA 2B37A 4EJMA 4J4HA 1P77A 2O3QA 1LSSA 2W2KB 5KJ1A 3LZ6A 1OC2A 5I9LA 4XB1A 4RF5A 1V8BA 1IZ9A 3HZZA 1N1EA 4JK3A 2Z5LA 1UR5A 4PLGA 2DTEA 3BTSA 4EEZA 1KVQA 1KEPA 1QLHA 2PZJA 3KSUA 3LT2A 3HB5X 3SVTA 1MXFA 1E7RA 2AXQA 4BO1A 4MVJG 4TROA 1EMDA 3NJ4A 4RZHA 1P1JA 1GYPA 4GSKA 1N8KA 2DBVO 3O03A 4IXTA 1U3WA 2J5RA 2UUOA 4DIOA 2A94A 3BHMA 3E5RA 6ADHA 4KQWA 1PS0A 1JW9B 4F45A 1T26A 3W4IA 5AYVA 4Z6KA 2PKQP 2ZYGA 3CEAA 2Q50A 2Y67A 4EJ0A 4BNHA 1DJNA 1F12A 2PNFA 2NLOA 1W0CA 3RBZA 4OXNA 4P8RA 2AQIA 1ZSYA 1B0AA 1TT5A 2OL4A 1T2EA 4CM5A 4WCDA 3KXDA 1D1TA 2O23A 1K0UA 3WXBA 4ITUA 1HDGO 4UAGA 1EE2A 1M66A 4FFMA 2J3KA 3JQAA 4QEDA 5EPOA 1CJCA 3T7EA 3TSCA 5A5EA 1A9ZA 1O9BA 3VOSA 3OJLA 4BNUA 3GNSA 2I65A 4J7UA 5ITWA 5HBRA 2OHXA 4DTIA 3F1LA 4PZDA 3AK4A 4RLHA 3TOZA 4AJLA 3KYCA 1Y8QA 5JPIA 1G1AA 5L53A 4RO0A 4E5KA 4NDNE 4IQGA 2VRBA 4PLTA 4A03A 4DA9A 5A9SB 4CM1A 1O5IA 1GQYA 2AE2A 1GQ2A 3KSZO 1YQGA 2B35A 3HWRA 4C7KA 3E9QA 1YQDA 1YRLA 3DOCA 4K28A 4FQ8A 4CM8A 4CM8B 3D4PA 4HP8A 5ES3A 3RSHA 3LF2A 2EERA 4ALLA 2PGDA 3BMCA 4P4NA 4F46A 4KUHA 3U3XA 3IKVA 4W7HA 3CIFA 4KOAA 1VKNA 3K5PA 1MUUA 4GX1A 1A72A 3HQ4O 3GUCA 3A28A 1ZK4A 2JCXA 4FGSA 1DO8A 3D1LA 4W4TA 3M6IA 2OMEA 3PJFA 5I8WA 2Y1OA 4HY3A 2NQTA 4Y67A 2DLDA 1RM3A 3SBOA 2HMWA 4M8SA 4L0QA 4RPLA 1IL0A 2Y1EA 4J0FA 3RU7A 1N2SA 1GFSA 2NVWA 3PLNA 3GDGA 3GZNB 5TGDA 5ADHA 3OIGA 3RAJA 1HKUA 3IMFA 4AJJA 1IE3A 4CLOA 3IKTA 2HK7A 3KLMX 4HFJA 1SB9A 3JD3A 3DBVO 2RHCA 2NWQA 4PCVA 3OIFA 1Z7BA 5KVSA 2Q1WA 2O50A 4JBGA 3ZNQA 2IZ0A 3WDSA 3SXPA 5TSDA 2PKQO 5L4NA 2Q45A 1PZFA 3PGJA 4UEJA 3UKOA 2O3JA 2NU7A 1GTMA 2Y68A 4WECA 3WMXA 1K3TA 3HB4X 1HYHA 2W2LA 5H83A 2Y0EA 1TB4A 1LDNA 1K5HA 4Y6RA 1HDOA 4UEKA 5A9TA 1A4IA 2JL1A 4GMFA 4B3IA 1HETA 2EG9A 1W73A 4ND2A 2ZTLA 4FOSA 4L8VA 4O1MA 4GGOA 4J7XA 4IDFA 1L7DA 2O4UX 1LLCA 3HDYA 4YJHB 3GLQA 3S55A 4AJ1A 4UUPA 1W8DA 4RF2A 4D3DA 3A9WA 2EW2A 3JQDA 4EGFA 1J49A 3DBRB 3GN2A 2TMDA 2G76A 5DCUA 4A73A 4NBWA 1CERA 1EDOA 2VWHA 2R2GA 3QQPA 1A9YA 4FW8A 4PLYA 3NT4A 1WLYA 4IY1A 4B4OA 4J1NA 3ZWBA 3PWKA 2E6UX 2J8ZA 3GEDA 4XA8A 2NNLD 1R4MB 4AJKA 1W6UA 5KKCA 4DLAA 2HK8A 1VI2A 4BMNA 2W4QA 3AFNA 3JD1A 1R0KA 1I24A 3GFGA 4QECA 3RWBA 1B8UA 4ZQFA 4WNCA 1M6WA 1PJSA 4WJZA 5I7VA 3ZHBA 5L45A 3PQFA 3WWZA 5JAQA 2NVUB 4RL6A 2H1SA 3STHA 1YJ8A 3IP1A 1P0CA 1E5LA 1G0OA 1DIAA 4CJXA 1HE4A 1MXHA 5DP1A 5C7IO 3V2GA 1DC4A 1WAMA 4FR5A 4HFNA 1HZZA 3IJPA 5COQA 4XYMA 2FZWA 4HFMA 5B4UA 4AJNA 1E6WA 4IJKA 5BR7A 3W8EA 1E3LA 2X22A 3VPHA 5AVOA 3T7CA 3DHYA 2EW8A 4R5MA 2W8ZA 4UVGA 3M1LA 1I32A 2ZCUA 5TS3A 3U4HA 2FPIA 2PH5A 5G4KB 3W4KA 4A27A 4CMEA 5DOZA 4MVJM 4E2XA 2UV8A 4U7WA 2FN7A 5BSEA 1PX0A 2FR1A 2X86A 3L9WA 4U5QA 1C0KA 5THQA 1F06A 1ULSA 4BNWA 4DIFA 2ZATA 3BTOA 1HT0A 1IHYA 4B7CA 4FB5A 3B1JA 3OBBA 4NU6A 3RUEA 3B20A 4OKIA 2FPPA 3OJFA 1GPDG 3NT2A 4J0EA 4YT4A 4XGIA 2V65A 3GN1A 3O9ZA 4PZCA 5L51A 4BQRA 2C7VA 3DMTC 1UZNA 4BNMA 3BAZA 3PTZA 5DT9A 2VOJA 1FJHA 2V7PA 5TJ9A 1Y81A 4LN1A 1ZIDA 3JQAB 3BMNB 4WLFA 4MP6A 3VKUA 4CMJA 1PWXA 1WXDA 3TRIA 1LC3A 1PS9A 3CXRA 3PHHA 1RPNA 2EKPA 1ONNA 2I67A 4J2OA 1R66A 3WGQA 1GEGA 4D3FA 4ALKA 3BMQA 1Y5MA 4B8ZA 1QG6A 5DULA 5F1KA 1LDBA 3SLKA 2YQ5A 3WIDA 4GX2A 4BKPA 1EVIA 3EVTA 2D8AA 1P1HA 2FP4A 4CMCA 2JKVA 3TDKA 1MX3A 4O0LA 2DBRA 5BNTA 1PIWA 1DPGA 2GUGA 1V6AA 3ZWPA 3JTMA 3QJ5A 3P2OA 3SC4A 1GD1O 1TXGA 3ZWMA 1ADBA 4BIIA 3UVEA 3LK7A 3RC9A 1JLLA 3E03A 3VZQA 5JSFA 5KCZA 1MG5A 5KVVA 4Z9FA 1CETA 1O6ZA 2P9GA 1Q7GA 5TLSA 1E7SA 1VKOA 3UHAA 1V3VA 5L40A 5JLAA 1U8FO 3JCZA 4DC0A 2GCGA 4CPDA 1P45A 4TZKA 1NAIA 4AJPA 1XYGA 4CM7A 5B4VA 4E5YA 1ADFA 4UVEA 4DPLA 4CUKA 1HXHA 4ND5A 4NR0A 1PZHA 3CZMA 1P33A 4WKGA 1OFGA 3DZIA 3JQ7B 1LDGA 4BKOA 3GFBA 4HNGA 3OHSX 1V3UA 4CMKA 3AUAA 2BFAA 5AXAA 1A7AA 2PH3A 3U0BA 1QORA 2HMTA 3QW2A 3WMWA 4E2YA 4WPGA 2CNBA 1VL8A 1E6UA 1TI7A 5TT0A 3UCXA 3H5NA 4IPTA 3PHIA 2WE8A 2HMUA 1I2CA 1ULUA 3G0OA 3ZCXA 1E3EA 4IUYA 1PQUA 3HNPA 2I5PO 1DJQA 4G81A 4J3FA 4N7RA 3A14A 2B5WA 4GAEA 3TNLA 4ZQBA 2DPGA 3UXYA 3KRTA 1I0ZA 3QWAA 5F1PA 3GF4A 4CLXA 2D5CA 2ET6A 3QE3A 1EVZA 5COBA 3UAGA 4DYDA 1PJ3A 2HAEA 4CUJA 4FCCA 4OL9A 4XX0A 1GL3A 1NNUA 4D45A 3BMCB 4GKBA 2AHRA 4BMVA 1F8FA 5CG1A 1NFQA 1U1IA 4FC7A 3ETGA 4AJEA 3AOGA 3ORFA 1ML3A 3RKUA 1FDUA 1WZEA 4CMIA 3B6ZA 1EQUA 3GVXA 4UEOA 4XQGA 3U49A 4WCFB 4CQMD 4R1TA 1RKXA 4JJFA 2P91A 1LDEA 1K6JA 4BO7A 1LQUA 4TVBA 2YW9A 2QIOA 3KYCB 4WE3A 1T2DA 3JYOA 1LQTA 3GPIA 4PG6A 4XRRA 1O89A 3ZNNA 1WDLA 2R6JA 4OOFA 1ZZEA 2BD0A 5IZCA 5U4QA 3MJ4A 3Q9NA 5GZ6A 1GYRA 1O94A 1MP0A 1YOVA 3JQGA 3JQGB 4FFPA 4KDFA 3K92A 1H9BA 2AEMA 5CEFA 5KJFA 2GN8A 4IS2A 3GUYA 1KYQA 1MLDA 3DB2A 3O8QA 3OEYA 2YDYA 3PDUA 4Q3NA 1J0XO 1ZO8A 4XYEA 2P9EA 1ID1A 2DC1A 3DZBA 4KTVE 3NEPX 1LLDA 5B12A 1MC5A 1YBVA 2D0IA 2WD7A 2WD7B 1UXGA 1RM0A 3Q6IA 2IYOA 1P1FA 2EGGA 4Q3BA 3RUDA 3RD5A 5JAZA 1U7HA 5KNLA 3EVNA 3RCBA 5CDGA 1IOLA 4MVJA 3JQBC 1XDWA 1G0NA 3RFVA 4D0SA 4XWYA 3FNEA 4XR4A 4JLWA 2E37A 4KQXA 2VTEA 4JQCA 1SMKA 1H9AA 5F5NA 1Y8QB 4J43A 3TL3A 2BFOA 4ZJUA 3F46A 4JROA 3V1UA 3GY0A 1U4SA 2IDZA 4PLVA 4OM8A 4K9DA 2PD4A 1I10A 4BGIA 2H63A 3R1IA 4XGNA 3C7CB 4FDAA 2OOSA 1E7MA 1ZH8A 5C7OO 4J90A 5A03A 4NMHA 4IMRA 3GNQA 5HS6A 2WYUA 1BXGB 4XB2A 4R41A 3JD4A 5THKA 4Q39A 4BV9A 1GZ3A 1HEUA 4BO8A 5T64A 1ZEMA 4JP3A 3GZ4A 2YV3A 2GRAA 4F6CA 4D42A 2W98A 4YEDA 3EHEA 1ZUD1 2CDAA 1ENOA 2FRDA 3GG2A 3OETA 4Q3DA 1SOVA 4R5HA 2AQKA 1H0KA 5B37A 2OP1A 2AW5A 1VSVA 4E4YA 4L76A 1HLPA 3I9MA 4JBHA 2NTVA 1X14A 2J3HA 1HE5A 4D44A 5HA5A 4CV1A 2VHXA 3OQ1A 2Y0DA 4MOWA 1ZBQA 2CVQA 4PG8A 1KY5A 1N9GB 1QR6A 5EESA 3IL2A 1SEVA 4EDFA 5CFZA 5DBFA 2IRWA 1BHSA 1U2GA 3KHUA 5A05A 3ABIA 2ZYAA 3ANMA 3I52A 3VPFA 1C0LA 4RCVA 1U5CA 4R1NA 1NWHA 4TVOA 3AM4A 4XQCA 1PGQA 1EE9A 3M1AA 5JFOA 3ST7A 3E9NA 4B4UA 4BNYA 2UUPA 3OQBA 5T5QA 2YFQA 3O8QB 4Z0HO 5C3MA 3ONFA 5HTOA 3B1FA 3UF0A 1MG0A 2X9GA 3CINA 1HDCA 4XIJA 1DC6A 5F21A 5TC4A 4ZGWA 2GD1O 4A7PA 4DVJA 2GERA 4BNLA 4HFRA 1NQTA 4W9NA 3FPLA 1DRUA 3AY7A 3E9MA 3JQ9C 4GX0A 3NDRA 4J1SA 2AA3A 2GN4A 3D3EA 3DXFA 4DLLA 4WCFA 4I5EA 1KC1A 1RM5A 3DOOA 4YBZA 5KKAA 3CTMA 1DOHA 3DBRA 4XQEA 1VRWA 2AEFA 3WGYA 5I7SA 5FI3A 3ZV5A 1YL6A 3GZNA 4KP7A 3Q2IA 4CLEA 3WGOA 3VPXA 1AHHA 5IG2A 4NU5A 4CM3A 1Y8RB 1NPTO 3GVCA 3TZQA 2AQHA 2VTDA 4YACA 4BNFA 4ESOA 3KYBA 4G65A 3W8DA 1XR3A 2G82A 3QLJA 4NNJA 4WNIA 4DQUA 1NR1A 1N1GA 2GNAA 4BKUA 3NAQA 3OJ0A 2A92A 1PJCA 3AU9A 3WOHA 3P2YA 3GRKA 3DOJA 4YAGA 4IXWA 4CM9A 1VL6A 2ZIZA 3PYMA 1P9LA 4LSMA 2JFHA 3E8XA 2W90A 5K6AC 3TFOA 1IZ0A 1NFFA 4I9HA 4D79A 4DC1A 2P9CA 1BRMA 4TRMA 4EYEA 5CEEA 1NHGA 3B1KA 4MJLA 4URFA 2OXIA 4OSPA 3BHJA 1T2AA 1PL7A 3RC2A 4YAKA 1ARZA 1UJMA 1EFKA 2A4KA 1DHRA 3DO5A 2YDXA 5DCYA 2JCVA 4CL3A 1E77A 4RVHA 1PZGA 2FR0A 2PWZA 2ZB3A 4RLSA 1D8AA 3ADOA 5HWSA 1DBVO 3PXXA 1E5QA 3JQ7A 4OYRA 3MJCA 1LC0A 5I8ZA 1PJQA 1IUKA 3L6OO 5L4LA 1LX6A 4OXKA 2Y93A 3COSA 3C3XA 2BHLA 3TZKA 4A26A 5FWNA 3RI3A 3ZV4A 4BNGA 1ZEJA 1FDWA 2O7SA 1SCUA 5ER9A 4ZU3A 3TOXA 5IDXA 3DBLB 4QXMA 3DBLA 4R16A 3VH3A 1P1IA 4YT8A 1IHXA 4LK3A 1GV1A 1K6IA 1ZFNA 4E12A 2EXXA 2CDCA 3FRJA 3GG9A 4NQZA 2V6BA 3ROPA 3L07A 1E1KA 2ZKLA 1OZAA 2CMDA 3FSRA 3QA9A 4U0KA 2I3AA 1HDRA 2NADA 5KIAA 3WG9A 1BWSA 1KOLA 1IYZA 3M2PA 1NVTA 3FHLA 3NDIA 3VH2A 1B8VA 3NGXA 4RF4A 1ENPA 1X7DA 4WLEA 2VHVA 4C7JA 1YGYA 3N58A 2OGUA 2NV6A 3AUTA 3AWDA 2E4AA 2VYNA 3BXXA 3NJ8A 2HQ1A 1LDMA 2VYVD 4ROSA 2C5AA 3H9UA 2HU2A 2Q2VA 4ONEA 2BRUA 1EFLA 1J6UA 3DTYA 4CMAA 4YQZA 1NASA 5B1YA 2B36A 4EJ6A 1GUFA 4NFYA 2DU8A 1XWFA 4NJMB 2VHYA 4YT2A 1Q2XA 3NGLA 1KETA 4E6PA 4EZBA 3WGZA 3I6IA 4YJGA 4CLDA 1YWGO 3WYBA 3V8BA 4D3SA 4RF3A 1KEVA 4DPMA 1LXCA 3ZWYA 3BIOA 2FHSA 3JYNA 2P5UA 3KV3O 3LLSA 4JGBA 1RYEA 3PJDA 2WMDA 4QT0A 1VSUA 1PGPA 2DVMA 5DDIP 3RJ9A 3BTVA 5AXCA 3FNGA 3WBFA 3OIDA 1R4NB 4TMFA 5EMHA 3LT0A 5T8KC 5C7LO 4D7AA 2G5CA 2CF6A 5DF1A 3UUWA 1LJ8A 3E18A 3DZJA 4G5HA 5TNXA 4GLOA 3VKVA 1ZK2A 1B26A 3WTBA 2HUNA 3H2ZA 4FSHA 2UVDA 1P0FA 5EQDA 4CM4A 1HE3A 4DLBA 4Y8VA 4Z3KA 2RBEA 3ZWXA 1KVUA 1OMOA 4XYLA 4DMMA 3HDQA 4CMGA 3WNVA 4DWVA 2PKRA 1DB3A 5G0SA 4M89A 4I5FA 1FMCA 3D3WB 3ZZNA 3ZHYA 5L7TA 2YHIB 1U28A 3EC7A 4KZPA 5GZ3A 1WVGA 2A9FA 2WM3A 3F1KA 4M49A 1R0SA 3H2SA 3W6UA 4NK4A 4ALJA 3OSUA 4K26A 1ADGA 2GF2A 2P4HX 3IUPA 4WK6A 1KVRA 3NTRA 3JQCA 1RYDA 1NPYA 3QVSA 3WJAA 1C1DB 2VWGA 1OC4A 2C0CA 1JWBB 2NSDA 4XJSA 3EUWA 3D5TA 2EHDA 2O3TA 3H65A 4JJIA 5A3VA 3GK3A 3S2FA 4IBOA 1P1KA 3Q9UA 1IY8A 5L4SA 3F6YA 3F9IA 4NBTA 4NFHA 4Q3EA 2HK9A 4JX8A 3QSGA 4B8WA 2PV7A 1QXSA 2PD3A 1TLTA 3DBHB 4P38A 4OKNA 4DBVO 2O2SA 2C54A 3RKRA 4W9NC 1JA9A 3ZN2A 4BHTA 1X15A 2Q4EA 3V1YA 2HJSA 3ETDA 4CQLA 3H6KA 1DFGA 3DAPA 2ZTMA 1PL6A 3UCEA 3OA2A 3RU9A 4Y9DA 2EKLA 2ZJ0A 3VDRA 1ZKMA 3AI1A 4NBRA 3HJAA 2H9IA 3CPSA 3OQ6A 2C07A 5L9AA 3SX2A 1C0IA 3F3SA 1T1RA 4E2ZA 3ZV6A 2FMUA 4N5MA 1RWBA 1WP4A 3DFUA 4J7CA 2EWMA 4IJUA 3FI9A 3TFQA 4ZRMA 2DT5A 3WX0A 3QWIA 2OP0A 4B4WA 3QY9A 1UP6A 4YR9A 3GEMA 3RUCA 4UVDA 4MKZA 3ON5A 3ASUA 3W1VA 3JSAA 4JBIA 3DBHA 3GHHA 4XYBA 4BO3A 4ZD6A 4CMIB 4IZIA 2YV1A 4FFNA 4I5DA 4TKLA 3FN4A 4QO8A 3UICA 4MO2A 3E48A 2Y66A 4E5MA 3SJ7A 2I66A 3I83A 3I9NA 2IE0A 5KVCA 4B3HA 1QLJA 2YHUA 2ZB4A 2DTDA 3D5QA 2BFMA 5G0UA 3L0DA 3V5NA 3TL2A 5ILGA 2CDBA 5CDTA 3KZVA 2FY8A 1HDZA 1VLLA 4LISA 3DDNA 4HKTA 1SC6A 1JAYA 2PR2A 3ZW8A 4FC6A 4PG5A 4GMGA 1NYTA 3GH3A 4XJTA 3DHEA 1DHTA 2GZ1A 4TRRA 3MOGA 2I6TA 4R68A 4YJFA 2VHZA 2XAAA 2NU8A 2AEJA 2G17A 3R3SA 5JAMA 1Y1PA 4GKVA 3G1UA 2QW8A 2Q1UA 2BKAA 2P2SA 4L75A 4BGEA 3RBXA 9LDBA 2QX7A 4DYVA 2Y1DA 4CR7A 1ISHA 5DBIA 2DPHA 1QRRA 4YYZA 3EGOA 4FGWA 3JQ6A 4CQMB 4GI2A 1U5AA 3TWOA 4E3ZA 1TEHA 3EDMA 3EW7A 1CF2O 4MVJH 2XF8A 3D7LA 3OM9A 2C20A 2Y1GA 3I9KA 2GDZA 3P19A 5IZ4A 1EDZA 3O26A 1X1TA 4YTEA 3E1KA 5FYDA 4KMSA 2EKQA 3FNHA 4R01A 3D4OA 3PYXA 2GO1A 3H3FA 3ROKA 4EUFA 1R37A 4OMUA 5I9MA 3ZWAA 1KY4A 4NFSA 2PA3A 4CM6A 1PJLA 4I8XA 1IPEA 1ISJA 2V6MA 3K73O 1HSZA 3GVHA 2GLXA 2JCYA 3OJOA 2NU6A 1V0JA 2DFDA 4E5PA 5KVQA 3JQEA 3I5MA 3K9QO 2H6EA 1NXQA 2Q4BA 3GMDA 1YVEI 4YWJA 3BMQB 5JMWA 2UYYA 1T25A 4OJNA 5AXDA 1PTJA 2DM6A 3WS7A 5C37A 3BMOB 1C1XB 2PGLA 2JAPA 4NPCA 1Q0HA 4H7PA 3L77A 4ZQGA 4RPGA 1XGKA 1K89A 1MB4A 1Q1NA 1E7YA 3AI2A 4BKRA 5HRUA 2HSDA 3K2EA 2FSSA 3KM0A 1MC4A 4RDIA 4BB5A 3AU8A 1ZNQO 2RHRA 3BMNA 4BQPA 3AJRA 3NUGA 1HE2A 2G1UA 2B69A 1YH3A 2Z1NA 4DRYA 4RPKA 2ZYDA 2VZ9A 4B7UA 4DREA 3LVFO 3T4EA 1E7QA 3ETEA 1DXYA 3OF2A 3VVBA 4GWGA 5I7EA 5G0TA 4RVSA 1ADCA 4M55A 2X9VA 2DTXA 4E30A 2E48A 1B16A 2QRKA 4IINA 3WWYA 5BSFA 4EUHA 3PLRA 5JYDA 3RROA 3VPGA 1EUZA 2AG5A 3HN2A 2VCYA 1NP3A 3WB9A 1JAXA 4NH4A 4YRBA 3PHGA 4LVUA 1E3JA 1EUCA 3IOYA 3S2GA 4EI2A 5IDQA 3WTCA 3L4BA 1UDAA 2FPGA 1FF9A 2ZCVA 3I9LA 2IXAA 3KVOA 3TN7A 3F47A 1BMDA 2D4AA 3D4NA 5TRTA 3AUSA 1SPXA 2QYSA 4CMBA 1Q7CA 4HBGA 8ADHA 5IXYA 2C2XA 4LVCA 1T4DA 4TKMA 3LT1A 3LQFA 5JXWA 4E13A 4DGSA 4JP2A 4AG3A 1PQWA 1DRWA 2P5YA 3PGXA 5CHEA 3WYEA 1R15A 4OOEA 2XXBA 3U5TA 1QMGA 2RIRA 1ZMOA 2DUWA 1NQAO 3BA1A 1YE3A 5T8KA 5A9SA 4AL4A 2QZZA 2DBZA 4BUCA 2O4CA 3Q3CA 3IUSA 1E1NA 1EK5A 3ITKA 3VVCA 1KS9A 1LBEA 1ISGA 1EUDA 9LDTA 4TSKA 1U7TA 1X7HA 1P1RA 2OBNA 4IIUA 3DFZA 1CQJA 3QVTA 2SCUA 1KIFA 2JD0A 1AUPA 3U09A 1GCUA 1Z45A 1C1XA 2HMSA 3C85A 1YBMA 2GSDA 4AFNA 5IZCC 4AICA 2AMFA 4DIBA 7MDHA 4JIGA 2JJYA 2Z1MA 4RVGA 4U0JA 5JDCC 1BW9A 3EZYA 3R3JA 4PG4A 1Y9AA 1MV8A 5ICSA 1UXIA 4YAJA 3I3OA 2P68A 3TF5A 4MVJI 2EJVA 2JAHA 1GZ4A 3FBTA 3O38A 3BYZA 2EP5A 1EBFA 2HMVA 3ZU4A 1IPFA 1WZIA 3NV9A 1PZEA 3DAGA 3HSKA 2EIHA 4D43A 1EVJA 4JCOA 4NHEA 4XR9A 2VQ3A 1BGVA 4CLRB 2CD9A 4YB8A 3G1TA 3WSVA 4MKXA 1H6CA 4CMEC 1QKIA 5IN5A 4B7XA 4J4BA 1UUFA 1ZMTA 1SAYA 1E6EA 2QQ5A 3DAFA 3ZWOA 2BGMA 3ANNA 5A1TA 4KUGA 1GR0A 2QYTA 3OECA 4NJMA 4LCEA 3WIEA 3PRJA 1C0PA 1ZJZA 2HO5A 3RUFA 1I01A 5K9ZA 5KJEA 4FBGA 5BSGA 5GMOA 1YB1A 2ILTA 4O6VA 2NVUA 4Q3CA 2Y99A 4NI5A 1H93A 1B7GO 2GN9A 5DN9A 4BB6A 1DEHA 2X5JO 1E1LA 5EERA 5LC1A 2Q1SA 2PGJA 2JD1A 1XLTA 3VZRA 4JN6B 1CQIA 4L4SA 3K31A 3M2TA 4FJ0A 3GPDG 1B15A 4R9SA 1WWKA 1UDBA 4E31A 1I2ZA 2FOIA 3IC5A 3JQ8A 4O5OA 3S2EA 4CUZA 1EQ2A 4NIMA 3MWDB 5L7YA 1KBZA 1Z73A 2NVBA 4CV0A 3CMCO 1U8XX 4EITA 1ZVMA 5G4KA 5U9CA 3FWZA 1DAOA 2BLLA 3I4CA 1YOVB 1SNYA 1NTOA 2JFGA 1YBAA 4BOYA 3NDJA 4CQMA 1U3TA 3C1OA 3ANLA 2D2IA 4EUEA 3DTTA 4K6FA 1JVSA 3DZHA 4P4LA 1F8GA 4CODB 4CQLB 1B14A 3R0IA 3ZWCA 3QP9A 3RFXA 4RQTA 3ZU3A 4M87A 1T4BA 2D59A 5JDCA 3Q0EA 4GSLA 3JQBA 1BW9B 1NX6A 4W6ZA 1QSGA 1T1SA 2CF5A 4MIYA 4UVHA 3GOHA 5IXSA 3FF4A 3PJGA 1E3WB 4BS9A 2JFFA 2BGKA 4QQRA 2O7QA 1ZCJA 5JC1A 4FJ2A 3ZWNA 3UW3A 1YKFA 3WQRA 1K6XA 1SOWA 1XEAA 2BELA 3RBVA 2WD8A 2Q49A 1I3MA 4A2CA 3RUHA 4QO7A 2C7GA 1O0SA 1SZJG 2DBQA 2JD2A 2JHGA 4ZA2A 3RASA 4CLOB 4X54A 3DR3A 3WNQA 2WWRA 5JCJD 3C8MA 3FR7A 3F5SA 1Z7EA 4WCFC 5EINA 3FTNA 4II3A 5T6BA 5A02A 2PLAA 2BMAA 3L6EA 1I33A 5G0WA 4RVFA 1LI4A 2CFCA 3IAHA 4PLCA 4R51A 1BTOA 2I9PA 2X58A 1ONPA 1YJQA 2X4GA 1XKQA 4OIMA 4Z3DA 3MTJA 4I1IA 5JO0A 1QV6A 4BMSA 4CLHA 5EQFA 1F17A 2RH4A 4OHUA 2I99A 3EAGA 1NHWA 1WPQA 3PHLA 2Q1TA 1E1MA 2FZEA 4TRNA 4EBFA 3WLEA 2P4QA 1E7WA 1H94A 2POQX 4BNNA 3K8ZA 4DPKA 4DXHA 4ALNA 1AGNA 1LNQA 1NQ5A 4NBVA 2QG4A 2NUAA 4B3JA 5C5IA 2J3IA 4OSOA 2X9NA 3H4VA 1OAAA 2W2KA 3MWEB 2EV9A 1CWUA 4B79A 4CM9D 4O63O 5CPBA 4AVYA 1PR9A 4ZICA 1R12A 1BXKA 3P5SA 3OICA 4N5LA 4W82A 4XZ3A 1VM6A 1LRKA 2C82A 3INTA 3ZNPA 4YPOA 3X2EA 4J2HA 1NVGA 3DC2A 2V6FA 1MFPA 1A7KA 1QYCA 4XIYA 2GR9A 2EGHA 2VYVA 3AOEC 4S3MA 3LU1A 2BF7A 4L4XA 2OORA 3C1TA 4R9RA 2RH8A 5JO9A 1NVMB 4ZRNA 5A9RA 3HG7A 5BNFA 4LW8A 1PR3A 4MVJE 2AQ8A 2GZ3A 1DRVA 1S6YA 2GN6A 3DHNA 3HE3A 3OEWA 2Z95A 3GQVA 4YAIA 3ENKA 3MJTA 2UAGA 4BNKA 1LSJA 1U3UA 1YL7A 1LRLA 2CVOA 4JNKA 3INGA 4E21A 4GBJA 3PP8A 1PWZA 2B4TO 1JKIA 5CG2A 1YB4A 1N5DA 1UH5A 1H6DA 1VJ1A 1XG5A 1LTHR 1R6DA 5JS6A 4IIVA 3WFJA 1X13A 1UZMA 2ZTUA 2G0TA 4IJWA 2EEZA 4CR8A 4A10A 5JW6A 5A04A 2DQ4A 2VRCA 1ENZA 3QWHA 3KTDA 3DWFA 2VUSA 3H8VA 3H9JA 4FIZA 4L73A 1GYQA 3L9XA 4BO6A 4BNZA 1DIGA 4TRJA 3GRPA 5DNAA 1GZ6A 1HSOA 1U2DA 2BGLA 3O4RA 3UFXA 4Z0PA 1DLJA 4XD2A 5I7FA 1IB6A 1JN0A 2OZPA 1GEEA 3BTUA 5ENVA 5ITVA 5LDHA 3NTOA 2Y1FA 1U9JA 2ZK7A 2O3UA 2VNAA 4FN4A 4WOKA 1N7HA 1DAPA 4QUKA 4MVJF 3HDHA 1ZK3A 3MJEA 2B83A 3RVDA 4AJIA 3MCVA 1UXKA 4WLOA 1I3LA 4N5NA 1O95A 2IZZA 2X7HA 1HF3A 2FSVA 4OXYA 3UGKA 4F6LA 1XQ6A 5LCXA 2X1HA 5JBIA 5DZSA 3G79A 5EIOA 5K0ZA 2R00A 1WMAA 1XQ1A 4BO9A 5KWEA 4E33A 1V9LA 4GVLA 2PFGA 5ICMA 1J5PA 1OI7A 3N7UA 4IDAA 1LU9A 1GPJA 2CZCA 4RVUA 4MDHA 2PD6A 3ROQA 4YAEA 3IIEA 2XXJA 3ENNA 1BXZA 1U4OA 3A06A 3OJEA 3PEFA 1SBYA 3FBGA 1ISIA 1BSVA 3C7AA 3F5QA 5KJ6A 3NX4A 1GUZA 2VZ8A 4Y6SA 1CYDA 3G3EA 3UCFA 5B4TA 5IDWA 1WMBA 2IZ1A 1VPDA 2Q2WA 2VT2A 3RJ5A 4WLUA 4YRDA 4GX5A 4J49A 4PGFA 1CRWG 4FFRA 5F5LA 5J23A 3EYWA 3WGGA 2Y05A 4L9RA 4HXYA 4DQVA 3PIIA 1BDMA 2J3JA 3H5AA 4XRGA 3BMOA 1GUYA 2HRZA 1T2CA 4FFOA 1R16A 3ZGYA 4RVDA 5CPFA 4J16A 4UUMA 2OFPA 1OBFO 2WE7A 4OQYA 5FI5A 5HM8A
chains in the Genus database with same CATH superfamily
3GLSA 3GRFA 4JT4A 2CHEA 4R3UC 3A4YA 4IX9A 3I2GA 3HS3A 3TJMA 4B4KA 2JHAA 3R3VA 3RO7A 3ZW9A 3GCXA 2FNAA 4HXFB 1C3VA 1A4RA 2WILA 1BA3A 5REQA 821PA 2JLQA 3D6MA 1MB3A 5DYIA 3RS7A 4N5HX 4OBEA 4KXNA 3KU1A 4QSMA 4PVDA 1WLSA 4V0QA 3RNLA 3D6FA 3AJEA 1DV1A 1GGEA 4CW7A 3KYDB 5B1SA 2IHVA 4HS9A 4LDZA 4KR3A 3WGHA 1MDFA 5AXBA 5KTKA 1E92A 2X4DA 1T5BA 2FR8A 3I73A 4FE4A 5JDIC 1SB8A 4F12A 3LCUA 4DCSA 5AVUA 5K09A 2A0KA 3ZR4B 4FFLA 4Q03A 1OLUA 1XCBA 2RGUA 1R6AA 1ZAYA 2DQSA 5I4IA 3VR5H 1FSSA 2XODA 4LRUA 1XZNA 4UE2A 2QD3A 4EB3A 1NM5A 3KEOA 1SEPA 4KQJA 2ZW9A 1AO3A 3A1CA 3TE7A 1NE2A 2P9FA 1XNJA 2PZAA 1XFDA 4NG5A 2DFKB 2Q0HA 1Q74A 3T1QA 4I6GA 5EGSA 5JYBA 3GWGA 2H54A 1XP8A 3IEXA 4N41A 4UHCA 1JDUA 1JKFA 2VG8A 4HJXA 3RM3A 2JLWA 4DR4B 1A97A 3PEEA 3RIYA 5HJEA 1XTUA 5KWJA 4J0HA 2EP7A 2DHEA 3V7FA 2J9FB 5HQ3B 4BNXA 4RXMA 3K15A 3LFTA 2IXEA 5E6UA 1U7XA 2NTJA 4AZ3A 5EJ5A 1ZVVA 3FPFA 2P75A 4OHBA 2QAJA 5SY4A 2G3YA 1CJMA 1N9GA 4EKGA 1RQ2A 2HLPA 3GAFA 3TVDA 1PVOA 4OXXA 3OHPA 3AT1A 2QXTA 5DNUA 2BMEA 2CXQA 3OG9A 1BDBA 4FSXA 4G1EB 4MLDA 3VSAA 2EGUA 4V0LA 5DU2A 4G2NA 2PZLA 1CJKC 1YONA 1QIGA 4ZYLA 5CLIA 5AUQA 1S2DA 3ES9A 1K2WA 3N59A 1KOGA 4RSRA 3WGKA 2W2LD 3KKQA 2A8YA 4EMUA 1P5RA 3A1NA 5J3JA 3OFVA 4QPDA 3PR3A 2ZWAA 4ND6A 2J59A 4JT9A 4MS4B 4QUJA 5K0TA 5IEBA 3W9SA 4H15A 2OC9A 4IGEA 1QIKA 4EELA 4Z9YA 4F96A 3N5CA 4JJAA 1OCEA 1U9YA 2GEVA 3L5OA 5JVDB 4UU1A 1ZNXA 5G2OA 4DYHA 1A82A 3N3AC 5C31A 1EK6A 3ZKWB 1QQ7A 1GT6A 2DY0A 3VDQA 3Q3HA 2C4HA 1NFRA 1IDOA 3NWJA 3NLLA 5F1OA 3NOOA 3ULKA 3GGPA 5G0TA 1PJTA 2QRLA 3GEEA 4A16A 3OX4A 4PSKA 3QVMA 3NG1A 1UBOS 3SP1A 3TPCA 2ONKA 2DGDA 5CP8A 4AMYA 4AIRA 5I3CA 4JC5A 1XLWA 4FDUA 2DSTA 4OB6A 5I4KA 1T8UA 1Y8AA 5CDYA 1M2WA 3L1KA 4N18A 4JI2B 4RVNA 4EY3A 1RLUA 1KO8A 3OZTA 1FU7A 2B1RA 3H1AA 4LQLA 4BNIA 1UQUA 1OAOC 1S7CA 5ARCA 3GNTA 1VXOA 4LZJA 1A5ZA 3JD0A 1UFRA 2GXAA 4MEAA 2WU1A 2IV3A 4JI0B 4PPQA 3H9EO 4CGZA 2GZRA 3N0XA 3A6EA 4FYVA 4HGOA 2VAMA 3JS5A 5F52A 1T9DA 1Q83A 4L02A 3MMNA 4PBSA 4RTOA 3AW9A 2P27A 2Z3ZA 1FRFS 3F67A 3QRWA 1N2IA 1PJ8A 2Q6IA 1ZVQA 1I6MA 1JLKA 1WV1A 2B8WA 5AVVA 5CB4A 1J42A 1Z22A 2HZ7A 3UWDA 3AEQA 1JZQA 4DM4A 4X97A 2I1QA 4M1QA 2R86A 5LN1A 1P3DA 1L3IA 1E3MA 4PPNA 5SZKB 3W1EA 4KKVA 3HCBA 2NAFA 3NONA 3QOFA 5ALMA 1A5BB 2FWRA 1I7LA 4M86A 1P5JA 4UUNA 3ICQB 1RKBA 3VQTA 1QYVA 3A25A 1LZLA 2JGDB 4FEAA 4F5YA 2LKDA 3PEYA 2Z3VA 1EU1A 1NDQA 3C7KA 2VH5R 1YS4A 1L3BA 4WSOA 2HREA 1D1SA 1GU0A 4R2LA 4LOLA 1POXA 1C30A 1ZH2A 3FD8A 1XCJA 1NQOA 5AVSA 4A8JC 1SA0B 2M9MA 3KJIA 4KN8A 1F0KA 3I1JA 4KWCA 1NVWQ 2VJCA 1CRQA 2ZWIA 3PWTA 1PYDA 4DM7A 5BQXA 1Q16A 3EEFA 4JLJA 1FP7A 4Y7DA 5AVYA 2CUKA 3JQ8B 3T12A 2FEPA 2IDJA 2VDQB 2KE5A 4KJXA 3EGWA 1VLZA 4LYGA 2HJGA 1LLQA 4L2IA 5JHHB 4GG1A 1TCUA 3KE8A 1E58A 1KJYA 1GG2A 1WZCA 5C80A 4NBUA 1UT8A 4NYJQ 1AZLA 1Z82A 4ALMA 3EFEA 2Y1CA 1JECA 2VDWB 3GJ4A 4H16A 4OQLA 3ZXSA 2CFOA 2P5SA 2H1LA 3REGA 1LRJA 1QHXA 1DBRA 1S3FA 1Z07A 3G6KA 3I04A 4WLVA 3TGWA 4UPEA 2MSCB 2GCNA 4QDZA 5L3ZA 5BSKA 5GVSA 2QRMA 2HM7A 5LQJA 1PFUA 2WJJA 2BSAA 3AEZA 1KHTA 3P8ZA 2Q6TA 3OESA 1FJGB 3LBFA 3LW7A 1HZJA 1WG8A 5DW0A 3OQJA 2YWEA 4JLVA 2BTEA 1Z16A 3PDCA 4JMPA 4YA6A 5E2IA 2V54A 3OPQA 4WBXC 3UJNA 4OUDB 3OH8A 4HX9A 2FGKA 1C41A 2IGBA 5KS2A 3UN1A 2QQGA 1XPRA 3QXGA 4RIFA 1NZJA 4RENA 3IUQA 3VJKA 2V3WA 2Q5HA 3FZGA 3NBQA 3OC6A 3IP7A 3OX3A 4KMRA 4COKA 4YUYA 2OLJA 3N5KA 3V1TC 1Q0QA 5LP6B 2WF5A 4TOIA 4OREX 2Z08A 2B4QA 2I2BA 3IFSA 3ZWWA 4MWDA 3WLNA 1QGAA 1OGYA 4FINA 4HNAA 4DRXA 1E0DA 3DNPA 5TMEA 2GJAA 4LSWA 1QGOA 2JARA 5FTNA 3Q6NA 5HFNA 3MWYW 4C2AA 5AIBA 5HS4A 3U3KA 5GVRA 4ALIA 1FBNA 3M6AA 1IQRA 1SG9A 2FV8A 4XUDA 1C3XA 3TKAA 1PWYE 4CKWA 1IZZA 2QTAA 3FUTA 3FB1A 3QK7A 1EP2B 2C9OA 2MSEB 1DV2A 1V16B 2Y6UA 4MX8A 5LKRA 2XA9A 1CHNA 1I4EB 1A2BA 1W4ZA 3L0IB 4LPKA 4OGGA 4AJ4A 5B5SA 3R5SA 3CX6A 4OA8A 3IEKA 2WAYA 3OA0A 4FSDA 4MVYA 3ZE8A 2GHRA 5KOJA 3A1WA 2G36A 3ZLBA 1E60A 4KREA 5L3SB 4PGGA 1VP9A 3FPCA 3T3OA 4ESEA 3L4SO 4EG4A 2ZR0A 3TQSA 1ENYA 3G2IA 3PWSA 3ZE9A 5LYJF 5HGJA 1TYCA 2ECQA 3NS7A 2VYFA 2PL9A 4U3JB 3R24A 1P31A 2XVAA 2XYRA 2TMGA 4GNRA 4PIMA 5DMXA 3VAZA 1EUYA 3T0IA 2QZ9A 1PNQA 4JLNA 2Y1XA 4HVAA 1M75A 1QV9A 3IV6A 4Q15A 4QRDA 2DJIA 5F1YA 1TJYA 2PZ8A 2QV0A 2ZBPA 1RWPA 2FZ5A 2HJ9A 2II6A 1OXUA 2A5LA 3AJDA 4P54A 3L4JA 1FOEB 1JLLB 3DW3X 3AKEA 4TT3D 1H6AA 3F4LA 1KH3A 1SCNE 4DLYA 3ZHVA 3OO1A 2PZMA 4EB6A 3U62A 2RIPA 2BUBA 3DR5A 3KBBA 2R4TA 3R9KA 2WYWA 4UAUA 3QVJA 1M6VB 5AKGA 1LPMA 2HJWA 2IEBA 3N2KA 3R3WA 4G0UA 4RDCA 1BS1A 1NN3A 1SWWA 2COUA 1Z4JA 4AKEA 3OZ7A 4IDEA 3JAWA 1ORWA 3DQPA 5F33A 3FKSD 2FG6C 4HPJB 1DKPA 1BFDA 1OREA 1TO6A 3DOFA 3CLRD 4KI0A 4M7WA 3V1NA 4YXFA 1E9EA 1X7GA 3CYFA 1XJ5A 2COEA 2QDXA 1UCFA 3LWZA 1WV0A 2YWCA 2IHJA 2X3FA 1FFBA 1MIOA 3CF4G 4ZV4A 3SFZA 1VE9A 3HXLA 1XMXA 4RD3A 2O2YA 1EBUA 1G3QA 3K94A 3NNSA 3RVMA 3U81A 2WF9A 1TA0A 5FUVA 1QTRA 2PXAA 2Q5CA 3AR6A 4KRFA 3V4LA 1CDOA 4O4LB 3GP5A 4WNAB 1NG9A 2CXUA 4RORA 1GHTA 1T9KA 1ZGAA 4HH0A 5G02A 4MVJD 3EULA 4GC5A 1QU3A 2R62A 4ND4A 2EX0A 3DVQX 3IB3A 4ZODA 4O4IB 4RQUA 3MK31 2P77A 3ZHXA 2I7DA 1II0A 4EYSA 1QDUA 3ESCA 1JWAB 2J87A 2I4TA 2QLLA 1RLJA 1ZRMA 3F4BA 4TWZA 4F1KA 5HRCA 4I4CA 4NAVA 4JLMA 3EGDB 3K6SA 4NY1A 3QEMB 1DFHA 3RK1A 4OGWA 3CG0A 2O19A 2QE6A 2QD4A 5IC6A 5CA0B 3W7AA 3DV0B 4IF6A 4PQEA 4FWIB 3OX1A 2AK3A 4FZVA 4C6HA 4B4VA 3OJCA 2W0SA 5D5QA 4KITB 4HSEA 5AI6A 3GLVA 3CLTC 4QWMA 1UXJA 4QDJA 1G41A 3QX7A 1Z0SA 1KVTA 4Q9HA 5BWOA 1W36C 3D64A 1CZRA 4REMA 1KQ3A 4XKJA 1TFUA 5ILOA 2A14A 1Z39A 1YR6A 3BKWA 5AI8A 4DV2B 2XNHA 4D3ZA 3U4DA 1CS0B 1TK9A 1YQXA 4OSEA 1QLWA 3G49A 1U8YA 3PIDA 4H35A 1VMEA 2G6BA 4LE2A 1VE5A 4IP0A 4LHZA 1H6BA 1N5RA 3L05A 3F7OA 5JYEA 4H6WA 4QU8A 4R2IA 2XQFA 3UJ6A 4BO0A 1QUFA 2B94A 2J6BA 1IRXA 1PD0A 1UM8A 4C87A 1QYIA 4BFCA 2BTQA 2ZUBA 2VSFA 5KCMA 1GV0A 3IHKA 3P4UA 3P4XA 4ID9A 3K70D 2QTWB 4B5KA 1RFGE 1ODKA 4WUVA 5B1HA 1EZ1A 2AE1A 3HO8A 3HNOA 1O6GA 2FEXA 2FVXA 3F8TA 3NH6A 4NOMA 4CR6A 3RNOA 2WWYA 5NLLA 3ZHZA 3C14C 4UHFA 2IOYA 3FAZA 1GSAA 3SZLA 4EQ6A 4PRKA 4WASA 3PG5A 1Z6QA 2H08A 2WTUA 2HSEA 4DRZA 1U2GC 1TKAA 3I1IA 4AKSA 4J4TA 2QSJA 4BN5A 3V42A 4I08A 5CGQB 1WB4A 4QYTA 4ENWA 4ZN6A 4CKCB 5KSWB 4LRQA 3U5ZB 4AKGA 3JX9A 2FH5B 5JAIA 1ETHA 3GAZA 4E5NA 1D4FA 2P5TB 1P4GA 3Q7QA 5HILA 4C0XA 2F00A 4YRPA 1NF3A 2PAFA 2YY7A 2AG8A 3BL5A 3UUGA 1NU8A 2YFHA 1JVBA 3IP3A 1NJ8A 2NPOA 4RTRA 3G2JA 3MGBA 2OV3A 3OT1A 2G1PA 2CYBA 2Y4NA 2J0UB 1QANA 3CF6R 3QUQA 2ZSEA 2XB8A 2ZP1A 1YDFA 4TS3A 1P3JA 3KTAA 1H8ED 4QU5A 3USCS 2R11A 3FUVA 1RCFA 1WDMA 1OOEA 2OO5A 4BO4A 1V4BA 3TLKA 4CHTA 1NC3A 1V45E 3FVTA 4HDRB 1PU2A 3ESYA 3AR4A 4CKBA 2P6NA 4U1RA 4PZZA 1OJ7A 1N34B 1Z26A 5E9JA 1SHZA 2B92A 3UM9A 4BGUA 5DRTA 2HHCA 2F59A 3AW8A 3UHPA 1GUBA 4AZSA 5EJEA 1NATA 2CWDA 3LLCA 3RRFA 2X5OA 3E7XA 4E1AA 4CXMA 1EIZA 1KK3A 1JMYA 2AOUB 2X8LA 3MAAC 4RPHA 3GDHA 5TX7A 3LHKA 4QG7A 3G9XA 2LDBA 3EH1A 4OHXA 2AOXA 2ZM5A 1Q7TA 4JITA 1JDTA 1US8A 3D6VA 4PZEA 4K9NA 4D2IA 1XXLA 2YXEA 5FEUA 1TFRA 4K8OA 1B3RA 1VHTA 3DKRA 1EVEA 3GJZA 4RACA 4TTJA 4HRXA 2JJ1A 3KKZA 2NUTA 4OF4A 3RAGA 1LNSA 3JZIA 1WVMA 1U9CA 2V4UA 1TQ2A 3EVZA 5IDYA 3TMAA 3IKJA 5JY6A 2IYPA 3NYWA 3Q3EA 3LUCA 1AXEA 4R3WA 1IVNA 2YH2A 4HF7A 4OX9B 1TW2A 5DE3A 1O96A 3IA7A 4RGQA 3KSDO 2DQYA 5JQGB 4URUR 4K6CA 4YPFA 3REOA 3W34A 2Q3EA 4MHTA 4K46A 4C0QC 1JDPA 2ZRJA 5K7SA 3W5BA 1HNZB 4XM1A 2NM0A 3FCOA 3N8IA 1IMJA 1KEWA 1U3VA 4IG4A 3GO4A 1P75A 4TS9A 1AXGA 3PTAA 3ACCA 1KORA 3U7QB 1HQYE 2G9VA 4DMUB 3B2NA 1G9SA 2E82A 2HD4A 1T5IA 5JMPA 4CIWA 1D7OA 5JY1A 4MINA 5CH5A 3C15C 4RQBA 4MIOA 1QFSA 4EB0A 1PFVA 1J4AA 3G17A 4FMPA 5AJZA 3W3ZB 4DARA 5G4LA 2VAVA 3EFOA 2P4UA 3G2OA 4MW7A 1XSEA 3OOJA 4FCWA 2GA9A 1GNPA 2JHFA 1L5VA 5GJVC 5EMJA 2RE8A 3TG8A 4MQEB 2DAPA 2ZSKA 3ECAA 3WJ7A 4MA4A 5DTEA 2O2CA 2ZYTX 5JATA 2FEKA 4IZHA 3N2IA 3FKSA 4ZT4A 4AZVA 3KJXA 3WZ2A 1JDVA 5CVEA 1Z5VA 4MI1A 2VWQA 3D7RA 4XDZA 3FDJA 4A23A 3ISVA 3KZMA 3P4YA 4MJ7A 4WXRA 1J8YF 1PT9A 1QHIA 2X2OA 1XHEA 5I9NA 4ZQHA 4C4OA 4HN4B 2O0LA 4Z49A 2FG7C 2W2QA 2D0PB 1U99A 1ZD4A 3YASA 2ATCA 4G67A 4PC2A 4DTCA 1Z3IX 3I5XA 1WU8A 5HK9A 2RHHA 4KX3A 4QOHA 5ED0A 3L8FA 2C5FA 1DX9A 4I7EA 3IQZA 3TQCA 5TV2A 3BSYA 4IQ0A 1GGJA 1SCJA 1SJ9A 5C1OA 3DXYA 1R0LA 3DMHA 1NE7A 2XGOA 3EB9A 4FXOA 4OJTA 1GRCA 5EE5B 3ZQKA 3ONWA 1F4LA 4F8EA 1ZX1A 2VSNA 5BWCA 2IOHA 1FUEA 2JKZA 2JIZD 2H65A 1ZW1A 1Y3CE 2YVKA 4RHCA 1ORRA 4LRTB 1M6VA 3T4XA 1F14A 1QQAA 4OFZA 4R84A 3H84A 4RSHA 4YCLA 3GXBA 1X1SA 4PC3A 3E2PA 4IM7A 4G9BA 5A3JA 1SH7A 1YZHA 1YA8A 4GXQA 2J3LA 4BGDA 3TH5A 1CEQA 5LNK1 3KXLA 3RVBA 3AUUA 3PNOA 2JGDA 2WDPA 3OD5A 2ZXEA 4INAA 5D7NA 3GVIA 3LOPA 1ESEA 2MINA 4HB3A 2PT7A 5JDIA 1TKBA 4QODA 4PYOA 5IWCA 4M3NA 3B51X 4PO8A 2B2NA 5EJ2A 3NJRA 4CEJB 2WPDD 1DTSA 4CKZA 4BFVA 3JAWB 4N0DA 1UKZA 3ILVA 3PXDA 4Z51A 3B1YA 4PNEA 2JLXA 3DS8A 1Y82A 3H42B 4R1UA 1PFKA 1JTEA 3B89A 3LPAA 5AHRA 4JUIA 2MCFA 1ISMA 3RUIA 1NW5A 1JIIA 1KDRA 4L0DA 5FAXA 2QUHA 4W5TA 3PFFA 1YB6A 4LTDA 2P2LA 1EWTA 3F71A 1XZJA 3U37A 4AMUA 4GDFA 5D7BA 1SHUX 2Z8ZA 1L4UA 3T1OA 4JJ7A 5CITA 1FU8A 3QVOA 4DLUA 5A4IS 5TQ2A 1SRRA 3UWMA 2WJ6A 3B3AA 5B1EA 1UQTA 2FFBA 2VFAA 1UFQA 2VDWA 3HUDA 1XU7A 1UP7A 3F2VA 4LZNA 3P9KA 4PHGA 3ZY5A 5KHLB 2EJCA 5JZ9A 1DKOA 2R9VA 3BSFA 4CF4A 3UK1A 1IN7A 3KL2A 1ZHFA 4P83A 6GPBA 1E6MA 1C14A 2B5VA 3PEWA 3NNDA 4J4HA 1TZMA 2B9EA 3F6BX 3MWEA 4C0SA 2PKEA 3LZ6A 5EMKA 3AL0C 1L7MA 3MIIA 2XIQA 4ZOLA 5I9LA 2CYAA 1OKKD 4P5DA 5KNCH 3QE9Y 1V8BA 4EHJA 3NC4A 2EQ5A 2FG5A 2H31A 4JI7B 4DCJA 3SSAA 3QF4B 3LPDA 2BZ1A 2H4HA 2Z5LA 4PLGA 1PKXA 2AL7A 4V0OA 3BTSA 4TV8B 2I1VB 3T3HA 1KEPA 3KSUA 7GPBA 3HB5X 4F5WA 1MXFA 3N1UA 3JVDA 1RVDA 1RQRA 4HCJA 2XWBF 2IOFK 5FHQA 3W6OA 1TO1E 4EF5A 3B7PA 3N86A 3QX3A 2XCTB 3GBVA 1D5WA 3E5NA 2NZWA 2Z3WA 3NHSA 3PIRA 1GYPA 1IXRC 3C8HA 3PL1A 1BGXT 3V4PB 3ZK7A 4BE4A 2G63A 3BWVA 1YBFA 1Z34A 3KLBA 4HNAB 4UHDA 2DBVO 1L5ZA 4EFLA 3D6TB 3WYNA 2XUHA 1EP1B 4P36A 4HDAA 1IOWA 3RK4A 2F9LA 3OZAA 3CRQA 2BMVA 3D6AA 3CUEF 3EQ7A 1SK9A 3IT1A 2JATA 4Z99A 3WNZA 2UUCB 2XDAA 1JH8A 1KDOA 4JUBA 2ZBFA 1PHPA 4J0CA 3W4IA 1R7RA 3EXEA 4Q16A 2P30A 2VEOA 5JSZA 2WFLB 1R64A 2A4MA 3M4ZA 3R77A 1O2DA 1MA3A 13PKA 2OCBA 4K9LA 4MV9A 1NULA 5FORA 1GSOA 2EL7A 4EJ0A 4I66A 4Z54A 3KQLA 4B82A 1JR2A 6REQB 2HR1A 1F12A 1FS5A 1ODSA 1V95A 2FQQA 2I1LA 2DP4E 2NLOA 4U2DA 1I13A 2AQIA 3EIWA 3HL4A 4O5AA 2JGJA 4WACA 3STWA 3TJZA 3TRKA 4WAUA 2Q5QA 1ZP6A 1EGHA 3QEAZ 4KB5A 3ZDZB 1JL3A 3V33A 3CLUD 3F8WA 2OG1A 2ZROA 5DISB 4H08A 4RTPA 1JEJA 4WINA 1EE2A 1M66A 5CMLA 5H5JA 1QK5A 1UBUS 3T7EA 3AF1A 3TSCA 4F5EA 4OUKX 5KDDA 3U4GA 2Z6VA 1SBHA 3O31A 4BFTA 3OJLA 2XMPA 3RYFB 3WRWA 3CWZA 2I65A 5AW8A 2FW1A 3A11A 1QPBA 5HBRA 1PCXA 1QCYA 2BFDA 3WK6A 2HX1A 4PZDA 1E9BA 3AK4A 3OCZA 4RLHA 5A2QA 3OE7A 4Z2YA 3KYCA 4Z8XA 3CURA 3DAYA 1G1AA 1VXRA 3URMA 3AHIA 3W79A 1X1QA 2H8KA 2JIRA 3UWSA 5J9FA 3SVZA 3K70B 2P6RA 3W3AH 2AOUA 2H1VA 2V59A 1BFUA 3CM0A 2AE2A 1GQYA 2I33A 1V5WA 1NY5A 2A86A 2PBFA 3X1ZA 1YQGA 2CVPA 2MU1A 3CX4A 3LCMA 1DJOA 4C7KA 3HYCA 3E9QA 3GRZA 1YRLA 3DOCA 4WZBE 2QN6A 3RREA 4K28A 3LX5A 3MSXA 4CM8B 5ES3A 3FYHA 1P80A 4OHVA 3ZDYB 3M6MD 5FFMA 5KTOA 3ZZUA 3L2OB 4YGXB 4DLSA 3EIQA 3T3IA 1HNNA 1TUIA 4UC0A 5EHZA 4KUHA 3U3XA 3IKVA 3GLHB 3CIFA 4KXUA 1E8DA 4QJBA 4XFDA 3MUNA 2FKNA 5SV2A 1F51E 1VKNA 2D5BA 5FXMA 1A72A 2O8DA 2CVHA 3SJCA 2JCXA 1OLUB 4JKIA 5GTDA 3LOQA 4RMNA 3Q88A 5A6SB 3KV1A 2K2QB 4TLAA 4Y67A 5SYNA 2PL5A 2EU8A 4YMWA 4L0QA 4E22A 2Y1EA 4J0FA 1PG5A 4C20A 1FS6A 1VE6A 1LJUA 3L0YA 2NVWA 3FHOA 5ADHA 3G23A 3KKEA 4HG2A 3OIGA 5BYBA 3FSJX 4DLXA 3VO8A 2UVPA 4YUAA 4AJJA 5EZQA 4D3DA 3R4VA 1L4FA 4FX5A 4HFJA 2XCLA 3OOHA 1EXVA 1SB9A 1EB9A 4QXRA 5DEOA 1UMDA 4KSCA 3I42A 2MR6A 4UXHA 1ZRHA 1XZIA 3LRTA 3TOVA 2A7XA 2HIMA 1D04A 4L95C 4CKXA 4C2UA 4JBGA 3DE7X 2IZ0A 1RYNA 3WDSA 3I45A 2WR8A 3ZNQA 2MYPA 2PKQO 2ODQA 1PAUA 1ZNZA 2Q45A 1PK8A 3UKOA 1OVGA 2W8BB 1I3CA 1T10A 5CAEB 1E1RD 1BMQA 1H22A 1XF1A 1Z29A 2D2XA 2W2LA 2ZPUA 4Y9TA 3ZHCA 1W75A 4C0JA 3DZDA 1D03A 2VDNB 2GILA 2X2FA 2JL1A 3ODGA 1MRZA 2ZYHA 4BBAA 4RSGA 4DCCA 3UAXA 3D7KA 3L6UA 1NURA 3I8OA 4FOSA 4L8VA 4BMZA 4O1MA 3LYHA 3ZLJA 2AC7A 4IDFA 5HQJA 1L7DA 3I5YA 3PDIB 2LXNA 5JYCA 1GQRA 3FVQA 3MPOA 2YFKA 2Y76A 1I4WA 1RJEA 1KFBB 4MQEA 1GTVA 4UUPA 3IJ5A 4KYUA 2XH8A 3ENZA 3PFNA 3A9WA 1VIVA 3ZKWA 3QYFA 5K3BA 5EJ8A 5FX2A 3JQDA 2P3LA 3O2JA 1CUAA 4NABA 4Z7QB 3MC1A 3DBRB 3GN2A 1G5PA 2TMDA 4C7XA 3QA3E 2VLBA 3T99A 4PLYA 5HOEA 2JS7A 1WLYA 3FG9A 1FFXA 4J1NA 4ARCA 5F7OA 1XCPA 1CQJB 3NVMB 5A3QA 3A4TA 3GEDA 3PUYA 2NNLD 2HL6A 4R81A 4ZI7B 2R66A 1E3QA 4HNQA 3JAKA 5FUXA 4IFTA 4AG5A 5DHTA 4EHBA 3MAJA 3JD1A 1GDTA 2ZUUA 3GFGA 4QECA 2CHQA 1JPJA 1MC1A 1NI4B 2ID7A 2IBMA 1PJSA 4WNCA 3T9FA 2O2DA 1QAQA 3AVOA 4HQ0A 4WJZA 3PQ3A 1BKDR 1CEXA 4US0R 3TO5A 2PJDA 2ATIA 5IC5A 2VP6A 1EHCA 3PDIA 2H1SA 4WVFA 2ZVDA 2PL3A 3H1PA 5F2NA 4D80A 1CE8A 2QT1A 2LZ0A 3OLVA 1XZEA 4LBVA 2BDTA 4H2DA 1HQCA 2CMGA 3GP8A 1C81A 3FOWA 2D7JA 4I55B 5DGTA 1A4XA 1QHGA 1WAMA 4WKBA 1HZZA 5DP1A 5EC8A 5COQA 3UV6A 4LF5B 4XYMA 2XGGA 2FZWA 3DVLA 3ND7A 3X1JA 4QXPA 8OHMA 1E6WA 1I1HA 2V0GA 2CMHA 2YV5A 3A8TA 3DHYA 1X94A 2EW8A 2GS9A 2VP2A 2W8ZA 3LA8A 3ZGLA 4CMEA 1NKSA 2FPIA 3NBUA 3W4KA 1IQ0A 2V0CA 5BN4B 1VYVA 1RZRA 2G5PA 5DOZA 4E2XA 4LC0A 3UQYS 5J58A 4B4DA 2JFPA 4NC9A 1T3SA 4C3UA 4MPPA 2X86A 5DW3A 5D3MB 5T7BA 1XCMA 3F7TA 4M0UA 3VU8A 3T7RA 1ULSA 1Y7IA 5BWMA 2PZFA 1ABBA 2ZATA 1P5HA 3C5WP 2CHVA 3A3NA 2O9JA 4F8JA 1HT0A 2F1JA 1MAAA 3AEKA 3Q1KA 4RYLA 4B7CA 3OY2A 2XDYA 1II9A 1MGPA 3B1JA 4FB5A 5LJLA 3RUEA 4A9AA 3BORA 2J6HA 2BL4A 4HHEA 3MUOA 4ZYWA 4HYQA 3OJFA 4UBLA 5J2UF 1GPDG 3DW1X 4QOGA 1X7WB 4J0EA 1RHQA 2DWCA 3MJHA 4YT4A 4XGIA 5I51A 1XDUA 3B13B 5I7WA 1RI5A 2XNKA 2PHZA 2YWJA 5FHRA 4BQRA 5CA1B 3B3FA 4RVCA 5JS1A 1URPA 2Q9BA 3BAZA 5E6SA 2G4LA 1T9BA 1Y42X 2CE7A 4UMDA 1EDBA 4YI5A 1AGXA 1RLOA 2A1UB 1Y81A 1OZHA 5ALNA 4AUNA 5CNJA 2BMJA 4BQEA 2C7PA 5IJAA 4WLFA 4MP6A 1J24A 4CMJA 4DIKA 1LC3A 1PS9A 1Q6YA 1R00A 1R4AA 1RPNA 1N3IA 2V3VA 1VSBA 3NHRA 4JDPA 2I67A 4QPNA 1R66A 4D3FA 1AKRA 4D57A 1YR7A 4TTRA 3R5KA 3JPWA 4JYPA 3SLKA 3WIDA 2OSVA 3N8GA 4BKPA 1DWQA 2ZE6A 4CMCA 3RUPA 1Z2EA 2VQEB 4DBLC 2E4WA 4JNCA 3W2IA 3EPKA 3A9RA 2QY6A 3EXHA 1NW3A 3TDNA 1AMNA 3V1LA 1TXGA 3DKPA 2VIIA 1GTZA 1ADBA 3ZWMA 4KGZA 4BIIA 2DR2A 2CHUA 1KI8A 2W6CX 3UVEA 5SY9A 2WC1A 1MJHA 3LK7A 1QO0A 2Z5GA 3Q40A 4ZO9A 2BFDB 4IJQA 2PCLA 4F3KA 4Z7JA 2P9GA 4XOIA 1Q7GA 2QMZA 4ARZA 1ZA2A 1GGFA 2H92A 1LV7A 3RABA 3UHAA 2IS4A 1ONSA 4NNOA 4RHXA 2PMCA 4DC0A 1CZUA 3KVVA 1ZHHA 3H87A 2WV7A 4NG4A 3PGLA 2XQJA 3H9BA 4TZKA 3KKOA 4EKDA 2OCKA 4JI4B 1JMKC 3SX4A 4D3XA 4CM7A 4Q7KA 5B4VA 5JZVA 2VXCA 2LPMA 1UAAA 4E5YA 1FQOA 3HYLA 1ADJA 4EVSA 1EUCB 1IPHA 3V8QA 4X94A 4BLQA 4C0WA 4DPLA 5KWIA 1F9EA 1PZHA 3GCWA 1E2KA 5HG0A 3FYCA 1LZKA 1DADA 3BFXA 4NTZA 3DZIA 3KKKA 5EJ9A 3GFBA 2X77A 1H9CA 1F2UB 3ZDRA 3E84A 1I9GA 2BFAA 2QQEA 3PFBA 3U0BA 2I0FA 2OV6A 1QORA 2HMTA 3MLBA 1YRHA 1L5NA 3U7EB 1M5TA 1VL8A 1E6UA 1IRIA 3GEBA 4J0QA 3ROTA 3S7TA 3QZUA 2B4AA 2F3UA 2J9FA 4KQKA 4MV0A 2HPAA 3T5GA 3C98A 2HWXA 1LVHA 2YZKA 4IPTA 1AHNA 3STUA 1M34B 4M0MA 2ZIEA 4WWHA 2FRDC 2ZJ8A 2HXYA 3L92A 1DQRA 2M32A 5JQGA 3G0OA 3R3ZA 1G38A 3G8DA 3S2ZA 1BYUA 3SGLA 3RTGA 1KK1A 3CLVA 5HOQA 4EPXA 5AICA 2C1XA 4B71A 1YDGA 3IMCA 4G09A 4Y6QA 5BR8B 4BBJA 5F9HA 5J4HA 1UBKS 2QPAA 1K8YB 4MB2A 5F1PA 4RMIA 1AGYA 2FXVA 3GF4A 2NZ8A 2ORYA 1VG8A 2ET6A 2XUQA 3NAZA 3QE3A 4CLXA 2Z6AA 4MS4A 3IMGA 4D9FA 4ZOLB 4P82A 1X77A 2I22A 3AV0B 5FFNA 1CUDA 1VFNA 4D45A 4LRYA 1YZUA 2GM5A 3EOAI 1UKBA 4GKBA 2P90A 2FUG6 1F8FA 3GCGA 5CG1A 3DTVA 3EJWA 1G7SA 2BM1A 1WUKS 3KYJB 5CA0F 3DGEC 1GPKA 1NRWA 2D54A 1ML3A 1XJ0A 5EHXA 4M22A 1WZEA 4F60A 1QH8B 4HN9A 2PX5A 2E89A 4Z6KA 3KZOA 2L42A 3GVXA 4UEOA 1NNI1 3ECCA 4HB2A 4HH1A 4DG8A 1EH5A 4MYCA 2QAGC 4QGBA 2E5WA 2P91A 3CNLA 5DNEA 1K6JA 4BO7A 4BVFA 2QIOA 1PQ4A 2R1ZA 1T2DA 5A0TA 2OCAA 1YS7A 1TD9A 2P2GA 3WP1B 1LQTA 1MCZA 5KOYA 3EGXB 3TLGA 3WKCA 1GG8A 3DT8A 3RYIB 1VE7A 5FKJA 1IZ8A 2B7LA 2BD0A 4GOJA 3AR9A 3SIRA 5ALVA 4B85A 3FOAA 1XU4A 1X1BA 4IKEA 1OWOA 4NOLA 4KDFA 2PKXA 1ULAA 4XIGS 1PJRA 2FAXA 2ODPA 1OWLA 1TCVA 2RHJA 3LECA 1SC1A 1JHDA 3GUYA 1KYQA 1MLDA 2F6RA 2WLTA 3ABOB 3OEYA 1RMTA 4IS2A 4FNGA 5HR5A 2EKZA 4XYEA 5K4GA 2DC1A 3MELA 2ZRAA 2D0IA 4AWXA 4C2TA 5EVJA 3HXTA 2EFCB 4DEXA 1L7VC 5AK4A 4BZXA 3JWIA 3CB4A 3ZWDA 2NZVG 4O8CA 4OFWA 3EXFB 1IATA 3RD5A 2I8CA 2X6QA 4Y2YA 1S9HA 3DPIA 3KB8A 3WK4A 5AW3A 4ZEXA 1ORIA 3OUUA 1NMYA 4MK4A 3FNEA 3ICWA 2FZKA 4XWYA 3KEGA 3LKBA 1SU6A 4F71A 1WXFA 3KJNA 1PL0A 3KOZA 1SMKA 1V39A 5F5NA 3K0KA 3AR5A 5ECWA 3EX7C 1Y48E 2BFOA 4MV7A 3KFVA 1SFRA 3O4JA 3I8SA 3F46A 4JROA 4OP1A 1J8QA 3V7YA 9ATCA 1U4SA 2IU6A 4RQAA 4X7BA 4UD2A 2PD4A 3A70A 5IVPA 1B23P 5D2CA 4M9ZA 5LYJB 1KARA 2FPKA 2HEGA 2KQUA 4UZEA 4WV3A 5KYWA 1QPZA 3DM9B 4XGNA 4LF7B 3B8EA 4Q1BA 1N0HA 2IF2A 4OATA 4W1RA 2YHBA 3P9SA 3ZCVA 1ZH8A 4FFVA 1U2SA 2RC6A 1X86B 2XT0A 2HWYA 3TG2A 2DQZA 2E0IA 3CPHA 3HRKA 4BBPA 4A92A 3OEED 1K66A 3AVVA 2B9VA 4BPBA 5J40A 1BXGB 3VBCA 3ZG6A 2OZVA 1K68A 3JD4A 3TLBA 1J20A 4XLZA 4X7RA 1GZ3A 1P18A 1HEUA 3HUFA 1YFJA 1Z0UA 2F48A 3P2MA 4JP3A 2WF7A 5ALDA 2FRDA 4Q3DA 2WAOA 4P7FA 1RIIA 4LTMA 3RC3A 1SOVA 2ZYIA 4RKFA 3QNWA 1SBCA 3HYRA 3IT0A 1WHSA 3FWYA 4B9AA 2CKDA 3TAXA 1N2EA 3HA7A 1VA4A 1VSVA 2AW5A 4E4YA 4OX9Y 4TSFA 5GJBA 1XD2B 2JGMA 1DRJA 4P4TA 4BX0A 3SM9A 3C8UA 2C9BA 3OQ1A 1VCIA 3UEOA 3D3JA 1KY5A 4J2TA 2QRNA 3F78A 4UDNA 2SNIE 1Z68A 5DBFA 1GZHB 1BHSA 1XZHA 2ZBDA 3V3TA 3VZBA 5H4GA 2X0DA 4H7EA 2WSMA 4QLOA 4L15A 2JZOA 3I52A 1UBTS 4R1NA 2Z8XA 1FNCA 1NWHA 2QU8A 4WZAA 2QGFA 1ZIYA 2V7QD 3AM4A 1EE9A 1KO5A 3DHVA 3M1AA 3NC0C 4UBKA 3ST7A 1FJ2A 3BT7A 2UUPA 4ZYTA 5T5QA 6CHYA 1V6SA 2HTFA 5I01A 3TCXB 4FE3A 3I2YX 3BB3A 5IT9A 3ONFA 1XWIA 4LJAA 3B1FA 5HTOA 3GD5A 1EYZA 4HPWA 4Q1VA 1NBAA 4LXXA 1M2VA 3GRVA 1MG0A 3A1EA 2ZSDA 4ENUA 1D7AA 1NW4A 4XIJA 4ZVMA 1JRLA 3BXEA 3GAMA 1DC6A 1Y3AA 1EM8A 1JG7A 1Q0PA 2JI8A 4DVJA 3ETNA 4BTEA 5DNYB 1U0GA 4LBWA 2QVZX 4HFRA 2K7ZA 3IURA 2ZLBA 4HDOB 1H66A 3MMPA 3SDSA 2AGVA 3E9MA 1Z17A 3FYDA 4GX0A 2BWJA 4MMXB 2ZSHA 3DXFA 1UJNA 2SKCA 4YBZA 5KKAA 3FJ1A 1MENA 3ZC3A 3DBRA 2G4VA 2J48A 2O2ZA 1VRWA 1U6IA 2VHEA 3WGYA 4BFSA 4UMVA 3ZV5A 3U3ZA 5I5EA 2JZNA 3WGOA 3U3MA 5EKTA 1AHHA 2FPLA 5IG2A 3JU3A 2W83A 3GVCA 3SF0A 5DX8A 4PS1A 3TZQA 4BNFA 4C04A 3IEPA 3KYBA 4G65A 2AS0A 3W8DA 5DB4A 1ID8A 2G82A 4DQUA 4NNJA 5IJ0B 2Z2YA 2VZEA 2Q5LA 3EDCA 4RKEA 1N1GA 1E4YA 2XUFA 5DX0A 3B3GA 2GCOB 2RHGB 3TW8B 5HTKA 2CLDX 3OJ0A 2A92A 4UM7A 2ZJ6A 5IMBA 2AVNA 3WOHA 1YJCA 3DOJA 3K0AA 5EIFA 4IXWA 4CM9A 3T94A 4ZVLA 4ZI3A 5KI6A 3MERA 1PT6A 1ZCBA 1WCV1 5AUOB 1V43A 3E8XA 4OP2A 3RTCA 1W52X 1BDJA 3TFOA 1RQXA 1IZ0A 3UMVA 4DC1A 3C4JA 2W22A 3KSAC 1B0ZA 1MQ9A 1K27A 3I61A 5ECYA 1BRMA 3NHFA 4MV1A 4TRMA 1FNMA 1MDBA 3HA2A 1NHGA 3B1KA 4R2XA 1DBIA 3HGTA 1PL7A 2PO7A 3CVOA 1KEKA 1UJMA 2PQMA 1MJGA 3BF7A 1TYDE 1CVLA 1VGVA 3DO5A 5FPSA 3SG0A 1DO2A 5DCYA 2JCVA 2OXTA 1E77A 5H59A 5C7YA 5G1NA 1QX4A 1U31A 4FHCA 4OJMX 2V96A 2B3DA 4RLSA 5HCUA 2XOEA 1D8AA 5HWSA 4FX2A 1G8JA 3PXXA 4ZT3A 2YS7A 5CJPA 1VLVA 1P0IA 2WT8A 1LC0A 2JLRA 3N6XA 5I8ZA 4W5NA 3DEAA 1IEWA 3KQSA 1BH6A 3TZKA 5E7JA 1K92A 3UUEA 4A6EA 1IXSB 4TKZA 4A26A 1K7SN 5T3YA 3RI3A 2XVXA 4MAFA 3ZV4A 1I4LD 1FDWA 2ZRMA 5LBUA 3O6VA 4BNGA 4C29A 2QN2A 4JEIA 3D8SA 3IDFA 5TR9A 2AWOA 4ZU3A 2BKVA 2WV9A 2RKBA 3BA6A 1KFJB 4R16A 4W7SA 1U2EA 3KU4A 4HDKB 4YIHA 1SC4A 2QAGA 4WQMA 4H60A 1ST3A 1Z7GA 2X9QA 3E58A 1GO2A 4EZEA 2PRIA 3LY5A 2IPAB 3T38A