3GMDA

Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKVTYPMVAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKAVSGIVNAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of 7-azaindole-pyrrolidine amides as inhibitors of 11 beta-hydroxysteroid dehydrogenase type I.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 96
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmdA00
3VC7A 3HHPA 1PJ3A 4D41A 3TOZA 3DTTA 4C7KA 3FI9A 1AUPA 1E1NA 1GQQA 4HFNA 4IS3A 3ZU4A 1HDGO 2G76A 5H83A 1QLHA 4YAEA 1HYGA 4YQYA 4OQZA 1JVSA 1XU9A 1UP7A 1IY8A 4LCJA 5DOVA 1PSDA 2UAGA 3UVEA 4MVJG 1VL0A 1HYEA 3UICA 1R4NA 3M1LA 5A3VA 4CMEC 4GGPA 4Q9NA 4JP2A 2GF2A 2VT3A 3GNSA 3IUSA 1PTJA 3I4FA 3QY9A 2PFGA 2F00A 4RQTA 4ZRMA 5JMWA 4GBJA 3VKVA 4OXNA 1PJSA 2AEJA 3DTYA 1IUKA 3FTPA 2Q2WA 2P9EA 4W9NA 4AJ2A 4MP8A 4R1UA 4DLBA 3FNHA 4E12A 2WYUA 5IG2A 4D46A 2JFFA 3FRJA 4J9UE 1XIVA 1BXGA 1GQYA 4BNIA 3KZVA 3OH8A 1FDTA 5LDGA 4CMIB 1MXFA 2FR1A 3B6ZA 4DC1A 3QVWA 3RC2A 3QLJA 1EUDA 3JYQA 3UF0A 1A9ZA 2HK8A 1PJCA 2ZYGA 3HDYA 4P38A 3VPGA 5COAA 5IXYA 4PRLA 4FOOA 5ICSA 5CFZA 3TJRA 3GT0A 3QWBA 5EPOA 4CM1A 1DHTA 3WG9A 2PGLA 3R6DA 5THQA 3BMCB 3R1IA 4KUEA 5L45A 2NTVA 2QZ9A 3LSYA 5A4DA 5TJ9A 1NPYA 3U4HA 3GC6A 1EVZA 1GCUA 3H9UA 1RM5A 4CL8A 1GYPA 3GPIA 1E6UA 5BSEA 3DMTA 3V2UA 2HJSA 2LDXA 1UXIA 2ZB8A 5BSFA 3EUWA 4GAEA 2GN8A 1DRUA 2D59A 4DIBA 2PH5A 3E9MA 4J0EA 4RLSA 1LSUA 2VN8A 2ZTMA 3JQBA 5AXCA 1I0ZA 1TEHA 1DC3A 1KERA 1HL3A 3W6UA 5TT0A 3HWRA 1FXSA 5AOVA 2PZMA 4IM7A 2EXXA 2HCTA 4M54A 1NASA 4G5HA 3OFSA 1ADFA 3ZN2A 1M76A 2EKPA 5J23A 1SB8A 1EDZA 1Y8RA 1P3DA 1T2DA 4NI5A 4YACA 3WWYA 2OHXA 4MINA 5ENDA 2GNAA 3F3SA 3JQGB 4UAGA 4MKXA 1RPNA 5JBIA 1UUFA 3WYBA 4A5OA 2DUWA 2GYYA 4EI2A 2Z5LA 2VHYA 4LSWA 5DNAA 5L51A 3EYWA 4W9NC 2NSDA 2P4QA 3JCZA 3ICPA 3U49A 3Q3CA 4IDEA 1F8FA 1K2WA 1PU2A 3I23A 5I9LA 4I08A 1VE9A 4CLEA 2OGUA 1GPDG 1BW9B 2JAPA 2NWQA 3W4KA 1U7TA 3WOHA 4F45A 4BKQA 4PG7A 4AG3A 1BSVA 4ZJUA 2HMUA 4PLTA 2W8ZA 4EJMA 2CD9A 4Z0HO 4NK5A 5G4LA 1JN0A 1HDXA 1PJTA 1V3UA 2C54A 2C82A 4NJOA 4FFRA 2Y1OA 5CPFA 1U9JA 1OMOA 1GUFA 4P4LA 1KEUA 3Q1LA 1C1XA 2VUUA 1T2FA 1N9GB 1XGKA 3R0IA 1MFZA 1NYTA 1CF2O 1HDZA 3S8MA 1GV1A 2EG9A 4MIEA 4RPGA 3JQ7A 1PS9A 4XA8A 2YV3A 1MUUA 3WB9A 1NTOA 3WIEA 2Q99A 2Y1DA 1QYVA 3PJEA 4BKPA 1VM6A 3GG2A 2BRUA 1RKXA 3IIEA 3OICA 4WCFA 3R3SA 4NHEA 3IKTA 3QVTA 1RYEA 1TT5A 1C3VA 2NVWA 4R16A 1UDBA 2B0JA 2ZTUA 1MV8A 2OP0A 5T57A 1I3KA 4UVHA 5TJHA 5TT1A 4AJJA 1I3LA 3VDQA 5G4KB 3SLKA 1RYDA 3A4VA 1KIFA 2P2SA 2HU2A 4BL5A 4B3JA 1M66A 4CODB 1MP0A 1CERA 4JIGA 2FWMX 1MXHA 2DPGA 5DCUA 2I66A 1QYCA 4B3IA 1G0NA 3SJUA 1JAYA 3ICCA 1KS9A 1M75A 1YE3A 3COSA 5K0ZA 3UXYA 1P1IA 1UXHA 3HE3A 3WWZA 5I9NA 3PHIA 4YCAA 3P2YA 3ON5A 1PS0A 3GEDA 3HQ4O 2Y68A 1TI7A 3OJLA 2YDXA 3KO8A 4N5NA 2NVUB 3L6OO 4UULA 3JQAA 4D79A 4B4WA 4AJ1A 3G49A 3GLQA 3RC7A 3D3WA 1XELA 2HSDA 2P4HX 3MEQA 4JX8A 1T1RA 4YVFA 4NZ9A 1E6EA 3UH1A 4DVJA 1H2HA 2W2LA 4GSKA 1R4MB 4TMFA 4DWVA 1OAAA 2IXBA 1N5DA 2IRWA 1ZK2A 4INAA 2GZ1A 2JHGA 3ZV4A 1EUZA 4XRRA 2D8AA 5JYEA 4XJSA 1J4AA 1KY4A 1LX6A 3KB6A 3D4NA 3DWFA 3WFIA 3GEMA 4EUHA 2EW2A 2EWMA 2VZ0A 2Q1TA 3ZWYA 4PLCA 1ZW1A 4CM4A 3KTDA 3T4XA 2GN9A 2W4QA 1F8GA 4PZDA 5DN9A 1PGNA 2BFOA 4TVOA 3ZNNA 3GVPA 1FDWA 1GCOA 3FNFA 5DULA 3WGGA 3ZZNA 3HSKA 5U9CA 5MGBA 1OZAA 2NUAA 3EHEA 4GKBA 1BXZA 3O26A 2UV8A 4OH1A 4WEQA 3UCXA 1P45A 4KWIA 1O6ZA 5ER9A 1ZVMA 4Z0PA 4K26A 4CL3A 1SEVA 2G82A 3BAZA 1QYXA 4ZQHA 4NBWA 2QG4A 1Q0LA 3H4VA 5ADHA 5JPIA 4BNYA 3Q0EA 2POQX 3RSHA 2B37A 2E37A 3BMOA 2D4AA 4I5DA 4ND5A 1Z7EA 5KVQA 4YEDA 1NVTA 5HS6A 1ADBA 2Q49A 3PQEA 3VH1A 3C1AA 4MP3A 4ZN6A 4I5GA 1KYQA 5JO0A 1KEWA 2X23A 2X1HA 3QQPA 1HT0A 3H3JA 3AWDA 3D5TA 4CUZA 3LT2A 3QWHA 3AU9A 1DO8A 4RF5A 4MVJM 4L4SA 4BQRA 4NJMA 4RF2A 1UXGA 1ZJYA 3DBRA 4BO0A 4XX0A 3SX2A 3RKUA 4IDCA 4MVJP 9LDTA 1HDCA 1JQBA 5A05A 3RC1A 1NXQA 1UP6A 5COQA 2DLDA 3ADPA 4NFYA 4NU5A 3W1VA 3KYCA 1DJNA 2C7VA 1CRWG 2W2LD 3IS3A 4HKTA 4BGEA 2VRCD 1E7RA 4LMPA 4BHTA 2E82A 1PQPA 1CETA 3MZ0A 5CEFA 4TZTA 3GHYA 3QJ5A 4YT4A 2O2SA 4OYRA 4WCFC 1PIWA 2D3TA 4RVDA 4YAJA 2PGJA 3U4CA 3MJSA 4D0RA 3TFOA 4YTEA 3STHA 1U3VA 2AMFA 4IDGA 3VH4A 4HFRA 2OL4A 1I33A 4YJFB 3JYNA 2UDPA 5DCWA 2H6EA 3HADA 2GPTA 1R0SA 4R5HA 3TPCA 3PZRA 2X0RA 3ABIA 3OQBA 3NRCA 4E2XA 2W2KA 4XGIA 1R66A 3C7CB 1HLPA 4RL6A 4PCVA 2YHIB 4O0LA 3WGYA 1JDJA 3X2FA 2HDHA 4FS3A 4WJZA 2CVZA 4MVJI 3SEFA 1NPDA 2OBYA 3RUEA 3WX0A 3ONFA 1XA0A 3OJ0A 1DAOA 4C4OA 2C5AA 2WE8A 4ALLA 5AYVA 2DFDA 1K6XA 3BHIA 5G2OA 2CF6A 1DBVO 2B35A 4IMRA 4LW8A 4KWHA 1AN9A 2HMVA 2YQ4A 1GL3A 1WP4A 4NBUA 1B2LA 4ZHSA 3IDSA 1EQUA 3KYCB 2VOEA 3A1NA 4B8ZA 1YOVB 1KVTA 1VL6A 3BMQB 3DBLB 1TT7A 5JDIC 5DDIP 2WD7A 4M87A 4K6FA 5BNFA 2AE2A 2VUTA 3DZFA 3INGA 1B15A 4IQ0A 1LBEA 1LJ8A 2FMUA 3FPLA 2WE7A 5THKA 1OBFO 1ZEJA 4CM6A 3H6KA 5CG1A 5I7EA 2OBNA 4IPTA 1R16A 3A14A 5IDXA 5TLSA 5L40A 4Z9YA 1NX6A 5JAMA 1BG6A 1R0KA 4CQMA 3F4LA 1AHHA 3RU7A 3ZWCA 1PR3A 3P2OA 1D3AA 2WWRA 5TF4A 2ZB4A 4EZBA 4ALKA 2NVUA 3DMYA 3WMXA 4HY3A 5IAAA 5KJ1A 1VKOA 4LMRA 5KKCA 3DOCA 3EK2A 3NKLA 5JXWA 4OKNA 3JD1A 3WLFA 1T2EA 1GUZA 1H94A 3G17A 1Z45A 4W4TA 4YA6A 1E77A 4LVCA 3CINA 2JCXA 4RPJA 3RD5A 1ENZA 3ETDA 5G0TA 3F6YA 4L8VA 4YT8A 2AA3A 2G17A 3ZHBA 1M6WA 3UFXA 2I6TA 4A73A 3WICA 4CV0A 5EINA 1V35A 5LDHA 1S6YA 2X0NA 4CQLB 3JYPA 4IZIA 3AI3A 3ENNA 1NAIA 2A9FA 3H5NA 4CM5A 4RORA 3KEOA 1T24A 4PG6A 2ZYAA 2RHCA 5TC4A 4PLHA 3NJ4A 4QXMA 2O2YA 4CMJA 4GKVA 4BNMA 3HG7A 4LRTB 1HE2A 3RJ9A 4BB5A 2ZYDA 4YQZA 4DBVO 3PDUA 5CHEA 4M55A 3HNPA 3F5SA 4QX6A 3LYLA 4Z3KA 2HMWA 2X6TA 4XIYA 3ANMA 4C7JA 1LXCA 3GFBA 1DFGA 3BTVA 4DUPA 2PTGA 3ROQA 4O59O 1WDMA 4MP6A 4UUNA 1UZNA 2PY6A 4XGNA 4FJ1A 2WJPA 2P9GA 3AM5A 4IQGA 4E2ZA 3GAZA 4E33A 1UZLA 4R69A 2Y1FA 4RLHA 1T1SA 4PLZA 3ZU2A 2OFPA 3G0OA 1JTVA 1LNQA 1P1JA 3LZ6A 5TSDA 7MDHA 3MJEA 4XQEA 4KQWA 1YJ8A 4MPDA 3DAFA 4ZICA 1I36A 3D4OA 3UUWA 4A7PA 1BVUA 3ZDFA 2ZCUA 2FR0A 2YDYA 1VL8A 3PLNA 1GR0A 3WBFA 4TQGA 2G1UA 1JU9A 5FYDA 3LF2A 1PR9A 1ONNA 3EZYA 2CVOA 3PLRA 3KSUA 3QSGA 2P5UA 1Y8QA 3D0OA 3KLMX 4HFJA 3L9XA 3QWIA 3WJAA 5ITWA 1C0PA 2AQIA 3FSRA 1EQ2A 1K6JA 2VHZA 2PH3A 4DIFA 2D2IA 2VYVA 2PV7A 3DOOA 4J4HA 4J1QA 2VHWA 3D4PA 1Y81A 3DZIA 3IKVA 4ALMA 1T2CA 2BFAA 3GPDG 1WDKA 1U8XX 4JP3A 4R1SA 2BLLA 2HMTA 3AI2A 4WLEA 4RQUA 5JAIA 3EY4A 5I9MA 3K5PA 3TN7A 2DBQA 5JY6A 3I9NA 4U8GA 4LVUA 2YFHA 2CUKA 1YJQA 1DAPA 3W4IA 1H6DA 3KVOA 4HBGA 3RROA 4F46A 4OSPA 5KOIA 1VI2A 1ZNQO 4BNFA 2X86A 3V2GA 4PZCA 1K89A 3PJFA 2X9VA 4GMFA 3HDQA 4TRMA 3SVTA 5A06A 3RIHA 3DFZA 1W8DA 3FPCA 4K28A 1B8UA 5TRTA 3TWOA 5KNLA 3ZHXA 4FW8A 5DT9A 5IDQA 4K1LA 4DC0A 1VPDA 4UREA 1N1EA 3BA1A 3OEWA 4B79A 2Y1CA 1PS8A 2YQ5A 4DGSA 2Z95A 3DZHA 1M2WA 3FD8A 1NHWA 3PYXA 4JLWA 4ND2A 4CM8A 2E4AA 2FPPA 3A28A 1P33A 2DTXA 4FQ8A 2HQ1A 5F5LA 1C0KA 5A04A 1WW8A 3GY0A 1WAMA 1KOLA 3WMWA 1IZ0A 4HXYA 4OAQA 3LLVA 3IP3A 4W6ZA 3CZRA 4L74A 3GG9A 4PLGA 3WIDA 3GOHA 3RAJA 1Y9EA 1YQGA 2CDBA 1DIGA 4EGFA 5A9RA 1KBZA 2HMSA 2ZCVA 1H9AA 2I9PA 2O3RA 3GA0A 2QX7A 1LSSA 2WEKA 4JBIA 2WYWA 1Y9AA 5EESA 5A9SA 4XCVA 1J6UA 3KETA 1Y8RB 1AE1A 4CMIA 4BMVA 1PJQA 2EGHA 6ADHA 4E21A 1XWFA 4RO0A 3NDJA 2EV9A 1K3TA 1LUAA 1Z74A 3RUIA 3S2FA 1MG0A 4RPLA 4L75A 3ZU5A 5I8ZA 3OSUA 3WNVA 1LSJA 4MDHA 1NWCA 4IJKA 1ML3A 3GGPA 1PL8A 1IPFA 4QUKA 4BNLA 4AVYA 4LK3A 1LDYA 3EVNA 1X1EA 4R54A 4R1TA 1JKIA 3K9QO 3MTJA 3P5SA 1V8BA 1Q2XA 1JAXA 3PYLA 4ITUA 3VH2A 3S2IA 1UZMA 3RKRA 1YL7A 2FY8A 5KJCA 2YJZA 3GZNB 1JKJA 3NDIA 3RFXA 2BH9A 2ZTLA 1M6HA 2DQ4A 2UVDA 3JQ6A 4PLPA 1VRWA 3AY7A 3PGJA 3IJPA 3QRWA 2IZZA 4QECA 4F6CA 4FR5A 3DEYX 2YV2A 3O8QA 4HWKA 2NTJA 5CDSA 3IL2A 5AXAA 3GVCA 1NQ5A 5TQVA 2BMAA 3FHLA 4Y8VA 3HDJA 3Q11A 4QFDA 1FMCA 2CSUA 3LF1A 3RBZA 4UVDA 4QEDA 4BGUA 4BUCA 2OZPA 2FN7A 2WYVA 1NFQA 1EBUA 1ZFNA 4XGKA 3H5AA 4WNCA 1CEQA 1GYRA 2NU7A 3AI1A 4BKOA 4UVIA 5DOZA 1LTHR 5B4VA 3FBTA 4A2CA 1XHLA 1V0JA 3PQFA 4GL4A 1LLDA 1V9LA 4TRJA 1HXHA 3K96A 1OC2A 5A5FA 4BGVA 2O3QA 4WEOA 3OIDA 4JJGA 4PRKA 1NHGA 2FPIA 1EK5A 1P1KA 1DLJA 2LDBA 4DMMA 1J49A 3VPHA 2CMDA 3ZGYA 4D43A 3ZWBA 2RH8A 3TL2A 1NVMB 4RVFA 3MCVA 5JYDA 3QWFA 4JN6B 1EFKA 4JJFA 1BGVA 1ORRA 1YL6A 5COBA 3ZNQA 1P0FA 2AQKA 2EKQA 2VNSA 3H2ZA 3Q2IA 3D5QA 5FI3A 4E32A 3D3EA 2J3KA 3PTZA 3CPSA 3NTQA 4GWKA 4UUOA 4WOKA 1MLDA 1MB4A 1U2GA 4ZA2A 4JJIA 1F17A 4CMEA 3LC2O 3ZV5A 1ONPA 1KC3A 1O8CA 5ER6A 2E48A 5LC1A 3KRTA 1UR5A 1Y7TA 1UH5A 1RM3A 2W98A 3DL2A 4D7AA 1ZCJA 5GZ1A 4EW6A 2OP1A 3DBVO 3WJ7A 1ZXLA 2VWHA 3IQDB 3D3WB 1IPEA 4K9DA 1ADCA 3JQ9A 1YO6A 2BF7A 2Q4EA 1GADO 1QORA 3AM3A 4IDDA 3JQBC 1IOLA 2I99A 1U3WA 2NV6A 3GRPA 4IJUA 1O95A 4JCOA 4ZQGA 5BSGA 3DBRB 3OF2A 4KDFA 3VTFA 4WCFB 5I7FA 3WDSA 3C8MA 4N5LA 1VJTA 3RBXA 3U4DA 3RFVA 2VCYA 2VQ3A 1YXMA 2GD1O 4RJTA 4BO9A 2GLXA 1V3TA 3OJOA 3H65A 3I9MA 5BNTA 1KVSA 4CMGA 1A27A 3ZCXA 2X4GA 4W99A 1QRRA 2DKNA 1LC0A 3PPIA 4EBFA 1WLYA 2RCYA 3GUYA 4XQGA 4FN4A 4PFJA 1HETA 2RH4A 3VOSA 1YBVA 3ZU3A 3B1KA 4E31A 3K6JA 4GVXA 2UYYA 3U5TA 1ZSNA 3OHSX 3OJEA 4M89A 3GDFA 2O3JA 3AUTA 4CM3A 1N9GA 4BO8A 3DOJA 3E6AA 4FCCA 1LSOA 4MVJF 3ZHZA 1DJQA 3JD3A 3DMTC 2G5CA 1N1GA 3P19A 4MKRA 4P4GA 2Q2VA 4IXTA 1YWGO 4X54A 2P91A 1B8VA 4JGBA 4PLWA 3PYMA 4BNVA 4DPMA 5GMOA 1CQIA 1JA9A 1YBMA 2PZLA 4ND4A 3F1KA 2JJYA 2EGGA 3K2EA 4B7XA 1P77A 1ZK3A 3QVXA 3TSCA 3W4JA 1E7WA 5L7TA 2Y67A 5B4UA 3JV7A 1YVEI 2ILTA 3H8VA 1JW9B 1CIVA 3SC6A 5BT9A 5DP2A 1BRMA 2GASA 4KOAA 7ADHA 1PL7A 3WFJA 3ONEA 1QMGA 4O5OA 3DZJA 3C85A 4Z9XA 2DT5A 2DU8A 2Q1UA 3V1UA 5FI5A 3WTBA 3VTZA 3DZKA 2NQTA 4YBZA 4RPHA 3ZWPA 5ICMA 4AFNA 3AUUA 5KTKA 1NM5A 2NU8A 2X9NA 1X7DA 3GH3A 4W82A 2EW8A 1U8FO 4XR9A 4U0KA 3RWBA 3T7CA 1NFFA 4ALNA 4E2YA 3OQ6A 4EDFA 2HLPA 4GLLA 8LDHA 1UXKA 4BVAA 2VHXA 2RBEA 1I10A 3KV3O 3JQFC 4BQPA 8ADHA 4FFOA 5G0VA 2IYOA 2V7PA 2H5LA 5G0WA 2B69A 4PLVA 1O94A 3QIVA 1J0XO 1V6AA 1NR1A 1G1AA 2WMDA 3ST7A 4DXHA 3QVSA 4FBGA 1I30A 5CDYA 3BHMA 4QQRA 1SO8A 3ZWXA 1RWBA 4R41A 3H9GA 4JK3A 1P9LA 2DBZA 1EE9A 1H6CA 1R37A 2C29D 2VWQA 3KSDO 2PD6A 5IN4A 2EP5A 2FHSA 4LCEA 2IDZA 1BHSA 2PKQO 1BDMA 1U4OA 2IODA 4FFPA 1UJMA 3TQHA 1HLDA 1XKQA 3F1LA 5JS6A 2O3SA 5FFFA 3AK4A 1D8AA 2ZTVA 3ETGA 4IGEA 5JAZA 3CXRA 2UUPA 4QO8A 1E1KA 4CJXA 1PGPA 2NQ8A 3BTUA 1KEPA 4CM4B 1GZ4A 3EDMA 3EAGA 4FD3A 3UHAA 4Z0TA 1HZJA 3T4EA 3HFSA 3ZWOA 5MDHA 5HA5A 2EIHA 5HWSA 2VHVA 3RUHA 4I1IA 3F9IA 4DYDA 4AJEA 2Q3EA 4XJTA 1Z7BA 2IXAA 2O3TA 4BO2A 3G3EA 1UP4A 1ZKMA 3E8XA 5KJ6A 2GN4A 3JQGA 5A9TA 4A27A 4NBRA 5TGDA 1I2BA 1DLIA 3JQAB 2P9CA 3MJCA 1HF3A 4CR7A 5CEJA 4I9NA 2FRDA 3FTNA 4J43A 5CP8A 5ILOA 3CIFA 4DTIA 4XEHA 2BFMA 1GV0A 2VTDA 5F3RA 4CQMD 4F6LA 2Q50A 4YJFA 1ZBQA 3I9OA 1EUCA 4J1SA 1X0XA 1R4MA 1H93A 4R9RA 3L07A 1C1DB 1DPGA 4UUMA 4CQMB 5I8WA 1M67A 1XQ6A 4N7RA 4CUKA 3VDRA 5B37A 2DM6A 1VKNA 1YBAA 3AW9A 5TS3A 1DIBA 4CMKA 1AHIA 3JQFA 2BHLA 3UN1A 3PWZA 4EYEA 1TLTA 4AJKA 3PJGA 3ZWWA 1HTBA 2O4UX 1SMKA 4OM8A 3GK3A 4YJGB 2OORA 5H82A 1U28A 2AE1A 1NNUA 5G4KA 4YRAA 1P44A 5LCXA 3WSWA 1O89A 3HZZA 2B4RO 5C37A 4ID9A 1EVYA 3AM4A 4RF4A 5IZ4A 3WGHA 3DB2A 4DQXA 1FDSA 1W4ZA 1U4SA 1YDEA 2JL1A 4BO5A 5L4NA 2NM0A 1LRJA 1PZHA 5JCXA 2A35A 2A4KA 1ZUD1 1JLLA 3D64A 1HE4A 3GHHA 5L4SA 2B4QA 1NBOA 2I3AA 2XOXA 3U9LA 1LC3A 4DBZA 3JYOA 2B5WA 4NK4A 4GGOA 5B4TA 1SOVA 1QYWA 4RZIA 4JBGA 4QO7A 5EQDA 2NLOA 3JD0A 3OBBA 2YFQA 1T26A 5EERA 4DREA 2YYYA 4FSHA 3ENKA 1C14A 3OMLA 1DRWA 2CF5A 3DO5A 4IY1A 3GMDA 3HDHA 1WZIA 5U4QA 1E6WA 1VC2A 3GAFA 4CV3A 5K6AC 1CQJA 4Y6RA 5EL0A 4FC7A 5CEEA 1EBFA 2PZKA 4WE3A 4NPCA 1OI7A 2QRLA 1ENOA 2GR9A 1H6AA 4WCDA 1N92A 5JCJA 1LRKA 3JQCA 2QYSA 2H1SA 5FWNA 2AQHA 3OIGA 3RUCA 5JW6A 3MJVA 1T4DA 1UDAA 4WPGA 4XR4A 1IHXA 3DONA 2BGMA 2Q46A 3NTOA 3U0BA 2GGSA 4DLAA 3QHAA 4GX1A 3U4IA 4J1NA 4BMNA 2XPCA 3I5MA 3F5QA 5H81A 1IYZA 1Y6JA 4HX5A 3LC1O 5HM8A 2GDZA 3D1LA 1X1TA 4FJ0A 2D5CA 1GEGA 3RU9A 5JC8A 4HNHA 2FOIA 4EUEA 1HWYA 1VJ1A 2YV1A 1ZK0A 1LQUA 1LRLA 3KSZO 1HE3A 4OMUA 1LDEA 2IE0A 4Q3EA 3NJ8A 5ES3A 4CMBA 4FFNA 2WD8A 5C7IO 4AJHA 4E6PA 4HUJA 1DRVA 4CLRB 3IOYA 4MVJD 3MJTA 1K6IA 3M2PA 1X0VA 3VAZA 4U7WA 3O38A 2ZJ1A 1DFIA 3E18A 3IMFA 2Y0CA 3NEPX 3U62A 3EW7A 2C2XA 1GFSA 3WQQA 1SZJG 5ENVA 4BO6A 2NVBA 1PZGA 2EERA 2C2YA 3DC2A 3LVFO 2ZATA 2GZ2A 3K30A 1PQUA 2GERA 3C7DB 1WDLA 2AEFA 2PD4A 1I24A 4BKUA 2VZ9A 2VRBA 4OSOA 1E1MA 3FNEA 4HP8A 1BW9A 4BNHA 2Q4BA 3K8ZA 4WECA 5KVVA 4CMCA 3GUCA 2C0CA 4CLOA 3NV9A 5A5EA 1VSUA 3GVXA 3CUKA 2VYND 4DMLA 1Q7CA 2XXJA 4R51A 5KVCA 3LC7O 2D0IA 4I9UA 5IFLA 1TA4A 2QYTA 3GZNA 4ZU3A 3RUDA 4MOWA 4BV9A 4PIVA 2D5AA 4OIMA 3KYBA 1A7KA 4E5NA 4BO1A 1WMBA 4DA9A 3W6ZA 1JVBA 5BSHA 3A06A 2Y1GA 3NT5A 4IMPA 4R01A 4U6QA 2FSVA 1A72A 2I67A 4EEZA 1I3MA 2CNBA 4IZHA 2BELA 1A4UA 1NAHA 3O9ZA 4CV2A 2JHFA 4AJIA 2P5YA 5AXDA 4RCVA 3ZWNA 3M2TA 4ESOA 4B4OA 2ZK7A 1ULSA 3QV1A 4DYVA 4PG8A 5BQFA 1GDHA 2EF1A 1LQTA 3PK0A 1KY5A 2C20A 3GGGA 1ENPA 4Z9FA 4E5KA 5KKAA 4FGWA 1GUYA 3AJRA 1E5QA 1U1IA 5F5NA 5HS4A 5F1PA 3DAGA 1GEEA 3GFGA 3RASA 3B20A 3FBGA 2AW5A 1AXGA 4GVLA 4E4YA 3QVOA 3H3FA 4KUGA 2DUUA 4IINA 2NNLD 1PGQA 1R4NB 3JQDA 4AJPA 4B7CA 3RQSA 1NVGA 2VZ8A 4MVJA 4WLVA 1DSSG 4N5MA 4NH4A 4Q3AA 4TKMA 4URFA 1Z73A 3DAPA 3PFFA 5L7WA 4E2WA 2HO5A 4GSLA 1CJCA 4UEOA 4OHUA 3F46A 5EQFA 4J7XA 1AGNA 1I2CA 1Y5MA 4XKJA 3CEAA 1I2ZA 1YL5A 2W2KB 4GX5A 4O1MA 4XB1A 1CYDA 4KDEA 3RJ5A 3PJDA 1K5HA 3HB5X 4CQLA 3GVIA 5HBRA 3TZKA 1HRDA 1Q7GA 2O3UA 2V6BA 3QW2A 4CUJA 4TVBA 4YR9A 5EIOA 1E0DA 1XCBA 1WPQA 3O8QB 4Q3NA 3G1UA 2DFVA 2E49A 3UCEA 1FF9A 2I5PO 3NGXA 4FC6A 3K2BA 3U3XA 3L4SO 1EVIA 2WD7B 2OMEA 1YB1A 4UVEA 5C7OO 4IBOA 2PLAA 3ZWMA 1EDOA 1ZK1A 1S7CA 4E0BA 5L95A 2O23A 5CPBA 2RHRA 3ANNA 3BHJA 1E3WA 1QLJA 3OECA 5IDYA 1V3VA 2G0TA 1UXJA 4L0QA 2J5QA 3AFMA 3FWNA 1YGYA 4IDFA 5JSFA 2GUGA 4NG5A 2QW8A 3AOGA 2BFPA 4OQYA 3L6DA 4FDAA 4HV4A 1P74A 1NFRA 1PQWA 3AOEC 2AQ8A 1WNTA 5G0UA 4NR0A 4A10A 2UUOA 4Q3CA 1JWAB 2HUNA 2I3GA 4M1QA 4KZPA 1SC6A 2ZJ0A 3AY3A 4WUVA 3BXXA 2OUIA 3WXBA 1YB5A 2BI8A 4BOYA 3JQ7B 4FJ2A 1PWXA 5HRUA 3GZ4A 3P7MA 1ONOA 5CAEA 3DZBA 4D45A 5JCJD 4LRSB 1XEAA 1ISMA 1IB6A 3C7AA 1X14A 2NADA 1BWSA 3OJFA 4K6CA 4WASA 1ISIA 3LLSA 1BVRA 5KCZA 2HK9A 4XYLA 2AHRA 4Z6KA 2WSBA 3FCOA 1EE2A 4NMHA 2ZQZA 4DLLA 1Q0HA 3PHGA 2CZCA 3CZMA 1MGOA 4XYBA 4CLHA 2CDCA 3I1JA 5KJEA 1GZ6A 2V6FA 4XQ9A 2FZWA 1QV6A 1XYGA 1ZK4A 2WTBA 2J8ZA 4N18A 2ZB7A 4BS9A 3RBVA 4ZQFA 1D7OA 1N7HA 2AEMA 4IIUA 1E7SA 2X5JO 1H6BA 2ZKLA 4PLYA 4E5MA 1T4BA 4L76A 3AFNA 4KTVE 3E03A 1B14A 1DOHA 2I76A 1ISFA 4P8RA 3S2EA 4BO3A 4FPXA 1QV7A 3IUPA 5ITVA 5DCYA 4EJ6A 4J91A 3VHRA 3C24A 1PGJA 2AG8A 5FF9A 1LLQA 4R5MA 2Y1EA 1U5AA 4MIOA 4NNJA 3W8DA 4LGVA 5DBFA 2BGKA 5JLAA 4OKIA 1E3IA 3VPFA 3VPXA 5KWEA 2JD2A 3ORFA 2QZZA 3QE3A 4CLOB 2NTNA 1HSOA 4NQZA 4H3VA 5T8KA 2VNAA 3Q2KA 3H5RA 4ZD6A 5C5IA 4QTZA 3PRJA 2YHIA 3S1LA 5F21A 3DFUA 1HYHA 1WVGA 4IIVA 3C1OA 2QRJA 1L7EA 3PZBA 2NU6A 1FDUA 4GX2A 4RV9A 5JDIA 4JQCA 2X58A 4AJ4A 4OOEA 3B1FA 5A1TA 3PXXA 1QSGA 4P4NA 4GLOA 4BV8A 5L4LA 4CM9A 1SEPA 4TROA 4DQVA 2FSSA 2VOJA 4S1VA 1LDGA 1YQDA 3I6IA 5U1PA 3V8BA 1A7AA 4Y98A 5K9ZA 1U7HA 4BB6A 4TWRA 4GQAA 4L73A 4II2A 1NP3A 1ZMTA 2PKQP 3BMQA 4YT5A 3RCBA 1QYDA 3GVHA 4MO2A 1I5RA 5EJ2A 5B12A 1IZ9A 3RFTA 3BTSA 2JFGA 3BMOB 3RVDA 1YDWA 4WLUA 1E3JA 2PA3A 1B0AA 3N74A 5KVSA 3DZGA 3VVBA 3HN7A 4PG4A 5TX7A 4KP7A 2J3IA 4NFSA 4E13A 2WDZA 1N2SA 4KTTE 2Y0DA 3CE6A 3NDRA 3PP8A 4H16A 5L3ZA 3BMCA 4YJHB 4XYEA 5L53A 4YB8A 3E5RA 4BNGA 4XYGA 3UKOA 4AJLA 1A5ZA 3Q9UA 3V5NA 5DF1A 5T6BA 3IC5A 4OXYA 4DL9A 3CMMA 4ZQBA 1PGOA 1WXDA 1XDWA 3C1TA 1D1TA 1HDOA 3BTOA 3WS7A 3L9WA 4J9VA 3W8EA 4O63O 2PR2A 4EUFA 1N7GA 3M1AA 4N54A 1ARZA 2HJRA 5IN5A 5JE8A 3TZCA 4CLRA 3WQSB 1GU7A 4IUYA 4J6FA 1C1XB 3TZHA 4B8WA 5BR7A 4BNWA 1I01A 4PN3A 1R6DA 2Q2QA 3DBHB 3NYWA 4JROA 1T2AA 1ZIDA 4F3YA 3R3JA 4OXKA 1HEUA 1Q1NA 3PDJA 5L7YA 4AJNA 4BNJA 1XQ1A 1D1SA 3CTMA 4G81A 2ZIZA 4D3DA 2DBVO 2D1YA 3DHYA 4D3FA 2YUTA 2J3HA 1YKFA 2PNFA 3ZWAA 2NU9A 4CPDA 5JO9A 2X0IA 3KHUA 4I5EA 4E5YA 1YONA 1KVQA 4O6VA 1PJLA 2JD1A 4KUHA 4W7IA 2GZ3A 3WGIA 2ET6A 4PZEA 3V1YA 5JMPA 1X15A 2O7QA 2VT2A 3ASVA 5IF3A 2Q45A 2GSDA 2DBRA 4ROSA 1UDCA 1LDNA 3H9EO 4KQXA 4WKGA 5B1YA 3VH3A 4G65A 4IJVA 2PK3A 3CH6A 1Y5RA 1XU7A 1B26A 1JKFA 4RVHA 2JCVA 5GY7A 1BMDA 2E6UX 3JD2A 4PG5A 3OEYA 2RAFA 5F1OA 4R68A 1GYQA 3VKUA 2O50A 5KIAA 1PL6A 3WBBA 4M8SA 3DQPA 3NAQA 1VJ0A 1PX0A 1P31A 2H63A 3ZV6A 4R3NA 4U5QA 1X7GA 3V2HA 3Q6IA 1PWZA 1ZH8A 3FF4A 3ZW8A 4EEXA 3OM9A 1QR6A 3ROKA 3O03A 1I32A 5A3JA 4OJNA 3GRKA 3F4BA 3E5MA 1DC5A 4QSMA 3W8FA 1E92A 3DHEA 3VPSA 2JCYA 4YJGA 1QXSA 4Q39A 1QKIA 3LQFA 1W0CA 2PGDA 1FDVA 2O4CA 3KM0A 5G0SA 4LN1A 4RVUA 4NU6A 1NPTO 2X7HA 1PZFA 3VVCA 4CM9D 4NDNE 2DVMA 3T7EA 3L4BA 4NIMA 3DBLA 4NJMB 1D4FA 2EHDA 3HN2A 3H7AA 4Y67A 1VLLA 3TNLA 2J5RA 4JBHA 2J3JA 2VTEA 3KBOA 1Y1PA 3DDNA 3JD4A 3GR6A 4HNGA 4U6SA 3WSVA 5A02A 4GPD1 4ZVVA 1Z82A 3WNQA 3HJAA 4J3FA 3WR5A 1G6KA 4BGIA 3AY6A 3JQEA 4WNIA 3UCFA 4LSMA 2HKIA 3F47A 3E1KA 4YYZA 4J16A 3GEGA 3HB4X 3GNTA 4FFLA 2Q1SA 3TRIA 1DB3A 1FK8A 3KEQA 4II3A 2W90A 4RDHA 3SLGA 2J6IA 2BD0A 4WGGA 1NWHA 3OQ1A 3EVTA 1OOEA 4RZHA 3RUFA 1K0UA 2VUSA 3SBOA 3X2EA 1YQXA 5FEUA 2AXQA 4IQ8A 4PVCA 2HRZA 1MG5A 1EMDA 4J4BA 4CM7A 5I7VA 1XSEA 5TNXA 1H2BA 4E5PA 4WLFA 4ZQEA 3ADOA 3MOIA 1E3WB 4Q3BA 4I9HA 4D0SA 1SOWA 1UAGA 3I4CA 4AL4A 1F06A 4A26A 1WZEA 3UW3A 1SNYA 3WGOA 1SAYA 3ULKA 3V1TC 2X22A 3CMCO 3ROPA 1C0IA 2RIRA 3KYDA 4WOJA 5GZ6A 1IL0A 1WMAA 3N58A 2P68A 2IZ1A 6LDHA 5DP1A 5T64A 4RPKA 1O0SA 2YZ7A 1YRLA 2IEBA 4RVSA 4UUPA 2VWGA 4XB2A 4OO3A 4YRBA 1I3NA 1E3LA 4L4RA 3K31A 1O5IA 3RC9A 4P22A 2V6MA 5CG2A 2TMDA 2OXIA 4ND3A 4WLNA 4KMSA 2QQ5A 4YAGA 4GX0A 3WQRA 4JXKA 2I65A 4IJWA 1PZEA 5C7LO 1PJBA 4XDZA 1B16A 4MJLA 4OOFA 1OFGA 1R0LA 2XAAA 4R9SA 3PFWO 3KXDA 1HE5A 4PGFA 4HADA 3AUAA 1R15A 2Z1MA 2CVQA 4S3MA 4Q3DA 4AICA 2C59A 4NBVA 2OO5A 4ONEA 3TFQA 1LDMA 3DR3A 2Y0EA 1A4IA 1ENYA 1NQAO 3I6QA 1LEHA 3Q9NA 3PHHA 4I8XA 3JSAA 2HAEA 3ROMA 3IP1A 1ZJZA 4J7CA 4CR6A 1DIRA 1PJ2A 3QA9A 5IXSA 1ZZEA 4IDAA 1DXYA 1GZ3A 3ASUA 2YW9A 1DC4A 1ISHA 2BI7A 1TXGA 5AXBA 1ZSYA 2GRAA 1GPJA 1X13A 1C0LA 3KOUA 3MWDB 1GY8A 3PI7A 3BZUA 4HFMA 4A0SA 4YT2A 4WK6A 4R1NA 1PJ4A 4Y6PA 1EVJA 3E48A 5JC1A 3MTGA 3PGXA 1I8TA 1TT5B 3H2SA 3OA0A 4XWYA 4E3ZA 1LDBA 3UOGA 3KLPX 3EMKA 3MOGA 1XR3A 2A94A 3BMNA 3C3XA 1G0OA 3ANLA 4J7UA 4Y6SA 1P1HA 3FNGA 2V6GA 1LLUA 3TL3A 1ZEMA 3BYZA 3N7UA 3GN2A 2O7SA 3I9JA 3FN4A 2EKLA 4TRRA 4J4TA 2GO1A 4XRGA 1E3SA 3FWZA 1C1DA 3GDOA 1TVEA 1YH3A 4UEJA 3ZW9A 3ZNOA 1CWUA 2X5OA 3GF4A 2QHXA 4GH5A 1U2DA 1EZ4A 1VSVA 1E5LA 2C07A 3WLEA 4MIYA 3ZWVA 3JTMA 1HDRA 3NT4A 4YPOA 3TDKA 1E7QA 4GI2A 4IDBA 3ZV3A 2SCUA 3UAGA 4RDIA 4BO7A 3TZ6A 1E7YA 4QT0A 4CM8B 3PVZA 4XZ3A 2O48X 1DHRA 3AU8A 2IYPA 3JQ9C 3JQAD 2R00A 5K6AA 5AVOA 5L9AA 2C7GA 4J1TA 2VYVD 3SC4A 1B3BA 3FR7A 4CMAA 1B8PA 3WYCA 1R12A 1Y8QB 1W73A 2PKRA 9LDBA 1KC1A 3GMSA 1ADGA 3L77A 3JQ8B 4H15A 4XIJA 4PLFA 1KETA 4TKLA 1SCUA 1SB9A 1DEHA 4TZKA 5IDWA 1P1RA 3ITKA 1YS4A 3BMNB 4ILKA 2PWZA 4E30A 3VZQA 2H9IA 4ALJA 2R2GA 1LI4A 4I5FA 4GMGA 1YB4A 5DBGA 2C5EA 1X7HA 1AXEA 3PWKA 3ITDA 1F0YA 4NBTA 1Q0QA 2YHUA 5IZCA 4GWGA 5CDUA 2FZEA 1YOVA 3L6EA 2Y99A 1T25A 4Y9DA 4YAKA 1N8KA 1QP8A 4FIZA 3EZLA 5F1KA 4B7UA 3QWAA 1B3RA 3CSDA 2PZJA 3PHJA 3BIOA 2JD0A 4FB5A 3G79A 5EN4A 2B4TO 1Q7BA 3WGZA 3I3OA 1FJHA 1RM4A 3CKYA 1RJWA 5JDCA 3NGLA 1A9YA 4B3HA 1BDBA 4TRNA 3DBHA 1XG5A 4BMSA 5I7SA 1ZO8A 1DFHA 1J5PA 1PEDA 3WGTA 1UAYA 4EJ0A 2EJWA 4ND1A 2EP7A 1MC4A 4IGFA 4BNZA 4M86A 3VZSA 3TZQA 5TIIA 1GD1O 1EFLA 1CDOA 1XLTA 2EEZA 2GCGA 3S2GA 4AJOA 1BXGB 4PVDA 5T67A 4W7HA 4ZGWA 2X8LA 4R4JA 3TF5A 3INRA 3GQVA 4BKRA 3WGQA 2R00C 3ETEA 3A9WA 3KYDB 1EK6A 3ONDA 4YXFA 2ZQYA 3I9KA 1P0CA 5T8KC 2BGLA 4DPLA 5JNLA 4RGBA 3E9NA 2X0JA 4J2OA 4UEKA 3LT0A 1U3UA 2ZB3A 1ISGA 2IEDA 4BNUA 4R3WA 3PIIA 1Z75A 2X9GA 2BKAA 3GGOA 1L7DA 3OIFA 4XDYA 1L1FA 3EC7A 3ZI0A 3OP4A 5DBIA 1TB4A 4JNKA 3GDGA 4NFHA 1O9BA 3PQDA 3S55A 4MKZA 5A9SB 1SPXA 2TMGA 2CFCA 4XD2A 3NTRA 3FR8A 5IJZA 1MX3A 4B4UA 1SBYA 2IZ0A 2FPGA 2B5VA 2B83A 2QRKA 2Y05A 3DXFA 1DIAA 4H7PA 1KVUA 3K73O 3OA2A 2V65A 3PIDA 3QP9A 5ILGA 3SJ7A 2DAPA 3B70A 1A71A 1IE3A 1KVRA 2Y66A 2CDAA 2CY0A 4DQUA 3LDHA 3U09A 3GNQA 4OL9A 2DC1A 3NT2A 5JFOA 3LK7A 3L0DA 4RF3A 3I9LA 3LU1A 1E7MA 1P1FA 3O4RA 5DZSA 3VZRA 3WYEA 1F14A 3MJ4A 4DRYA 1MA0A 1ZSVA 3JQ8A 2NACA 1H9BA 4Z3DA 4CV1A 1W6UA 2XXBA 2J5KA 1ZMOA 3NX4A 3INTA 4DIOA 1NR7A 1WWKA 2Q1WA 1ZXBA 1U5CA 3G1TA 4D3SA 2AG5A 2FR8A 2OOSA 1DDOA 4B4VA 5JDCC 1QG6A 2PD3A 3WTCA 4TSKA 4D44A 4XQCA 2GN6A 3L4BC 5A03A 3E82A 1LU9A 2A92A 2JAHA 4U0JA 4CR8A 5JY1A 1EEHA 4J2HA 1OC4A 2QIOA 4XYMA 4YJDA 5GZ3A 3LT1A 1LA2A 2JFHA 3KUXA 5JAQA 5T5QA 5BNIA 4UVGA 1GAEO 3JYLA 3PEFA 1JWBB 4M49A 2VYNA 4MVJE 1ID1A 2DTEA 4MVJH 3H9QA 3D7LA 3I83A 2Y93A 3ZH2A 4CMHA 4DPKA 1MFPA 3LT4A 4YRDA 4BNKA 3K92A 3GN1A 1GTMA 2EJVA 4A03A 1Z6ZA 3MWEB 4FOSA 2Z1NA 1HKUA 4IS2A 3TOXA 3AOEA 4J90A 5IZCC 3EGOA 3I52A 4YJHA 1ISJA 2YY7A 2VRCA 1KEVA 4CLXA 4OGWA 3PHLA 3AUSA 4L9RA 1DIHA 1HSZA 3M6IA 4L4XA 2JKVA 2XF8A 1DC6A 5HTOA 4D42A 4IXWA 4QFCA 4ALIA 3PWSA 1NQOA 3RI3A 3HFGA 1F12A 2HRBA 4WLOA 2F1KA 4CLDA 4YAIA 3B1JA 1MC5A 3DHNA 2R6JA 1U3TA 5AQ1A 4LISA 3UGKA 1RM0A 5CDGA 2X5KO 3NUGA 4FGSA 4YDRA 5EMHA 3HUDA 2B36A 2HK7A 2FP4A 3SXPA 3VZPA 1HDYA 2WM3A 3IJRA 4BNNA 1BXKA 1HZZA 2VWPA 5C3MA 3E9QA 4BO4A 3OETA 4BIIA 1H0KA 1E3EA 4FFMA 3IAHA 2DTDA 1IULA 4J0FA 3H9JA 4YWJA 3ZNPA 1IHYA 1E1LA 3ZHYA 4BNXA 5CDTA 4J49A 4RVGA 4ZRNA 4G2NA 1NQTA 1ULUA 5KJFA 1B7GO 4BNTA 4EITA 1BTOA 2DPHA 1H5QA 1LLCA 3RUAA 1GQ2A
chains in the Genus database with same CATH superfamily
5JBNA 4C4SA 1LK0A 3K32A 4R1OA 4RA9A 2E1RA 3TOZA 1SK8A 3TQQA 1NYQA 3HYRA 4V0SA 2I6QA 1AUPA 1KZGB 4HFNA 4CI0B 1QIJA 4G1BA 1HDGO 4CG1A 4X97A 4YUZA 2VCEA 3G0HA 3V1NA 2Z9BA 1QH8A 1T4CB 1ECLA 5CVCA 3Q0TA 1JVSA 1S7GA 1UP7A 1Z18A 4JOQA 5DOVA 2UAGA 3HDGA 4V1CI 2ZSDA 3NUZA 4JVSB 1I3OA 4DJJA 4YUWA 5HGXA 2C9DA 3CPJB 4KO4S 2OD7A 5CR9A 3T3OA 1R4NA 3AEXA 4HC4A 2WAOA 2H8KA 3HXKA 1XMSA 2HJHA 3ESYA 1KY2A 2ZRFA 1GM5A 3QY9A 5AW7A 4HDCA 4RYLA 2UZIR 4EP1A 4F5YA 3PC3A 1N5RA 4RQTA 1VE5A 4W6QA 4LA4A 5AH0A 2MTBA 3KTFA 2J9ZB 2WU0A 1Z56C 5DGXA 1E9EA 2VJAA 5CB4F 4D80A 2W00A 3ZC3A 4F84A 4G97A 2ZVQX 1OKKD 2AEJA 1NW8A 1N33B 4NZYA 1Q92A 4UOQA 4EBBA 1T3HA 2FG5A 1AGYA 3VTKA 5ELMA 4W9NA 2QY6A 3W78A 4RJIA 2ERCA 3FNHA 4M9QA 4MV1A 2JFFA 3D7MA 5GIPE 3JWHA 2PGXA 3CCBA 4LX8A 1RVDA 1N32B 4YP7A 3OH8A 4H77A 4ITRC 3V80A 2BMJA 3AL2A 3RTCA 4CMIB 2MYTA 5LIPA 4X1YB 2G6TA 3G2QA 3G2KA 3SKYA 2RBKA 4Q48A 4DC1A 3QVWA 4IQFA 3JYQA 2C2OA 5SICE 1JHDA 1PJCA 1HG0A 2ZYGA 3KOYA 3VPGA 1ZX1A 5CDHA 4B3GA 3WGKA 5COAA 5IXYA 4LDPA 5JRZA 4U7TB 4PRLA 3DC7A 4FOOA 4AO6A 2OV1A 3SEZA 3DAHA 5CFZA 5ICSA 1N5MA 2IQ5A 1KO5A 3MUOA 4HGOA 4X20B 3OESA 3WG9A 3VI4B 4F1JA 5THQA 4UD6A 4BU1A 3R1IA 5A9RA 1PEKE 4O3FA 3LSYA 5A4DA 1MTOA 4QGFA 3GC6A 3H9UA 3OF5A 3R5TA 2HREA 1RM5A 1Y3CE 2W2XA 2P2YA 1IVNA 4V02A 3OCJA 4YK7A 3V2UA 2Y1XA 2NTEA 4MWZA 1XPRA 5ESDA 1GZSA 1W34A 4Z4CA 4GAEA 3QFFA 2JLRA 2QUZA 1CULC 1SKYE 2D59A 2PH5A 3KKZA 3N6RA 3KHKA 3ZR4B 2BOVA 5J59A 3V9AA 2A4MA 2X2FA 2FSVC 3ZIDA 4XE5A 1NONA 1P7PA 1SBHA 4DV2B 3LY9A 2ZTMA 1ESDA 4JGIA 2O8EB 4FZ5A 3WXMA 1I0ZA 3IGFA 1FPQA 4Z8YA 2WHYA 4BATA 5BQ3A 1AQIA 4YWHA 3VU0A 2EG5A 5AD1A 1Q17A 4RZ2A 4OB6A 5B58C 5CDFE 5AOVA 2YN4A 4UCXA 2AFHA 1I94B 4OK5A 4KXXA 4EI9A 2J08A 1E2LA 2FETA 3J80A 2ZR8A 5D8DA 3UJ3X 4PPFA 3C3PA 4M6WA 4WK0B 3PB3A 3P20A 2WWHA 1EDZA 4OLBA 1Q0PA 4EB8A 4QNNA 1Y4UA 4LJ8A 2ZYHA 3P27A 4PXSA 4X8HA 1VA4A 4C05A 2YJNA 5BWCA 3TZBA 2Q3BA 3A3YA 3CYFA 1RRFA 2AFIA 2OHXA 4H7HA 1HFJA 3BGVA 3FF1A 3FOBA 2XB4A 3F3SA 3NTLA 4KSCA 4Z8XA 1Z16A 4HF7A 2OLKA 2P2CA 4U9UA 3RWMB 3RYHA 4A5OA 3NHFA 1P91A 1C30A 2B30A 2J0UA 2NZ8A 4EI2A 4RUKA 3T1HB 3IDZA 2OHJA 4CI9A 5TARA 1TF2A 4GRAA 5L51A 4ILEA 1NNI1 3CEJA 2NSDA 2P4QA 2VDUE 5EE5B 1LF0A 2WUWE 4K8RB 5L3RA 5JFGA 3EEFA 1WV1A 3M4JA 2FOXA 5DNYB 4I9FA 1WY7A 2VO1A 2A5LA 3IERA 4CLEA 2TECE 3WOHA 5KOHB 2MWMA 4A4DA 1TYZA 1Y5LA 3B7GA 2GUWA 4BKQA 2XTMA 2FUG6 2ZROA 3MF4A 4NBSA 4BC1A 4M83A 4Q93A 3PL5A 1BSVA 5AW0A 2HXSA 2PUTA 2Q5JA 3WL5A 4ER0A 2HMUA 1CX9B 3OD5A 3KQNA 3BXPA 4LI3X 4Z0HO 3ZY5A 4BTLA 1GGJA 2RONA 1MHTA 3TMKA 2BGNA 2C82A 2IXEA 1TVKA 2YWCA 2Y1OA 3CBGA 3VI3B 1SG9A 5MFZA 4QEZA 1C9MA 1WXIA 2K2QB 1MO5A 5DHFA 3LUBA 2RHLA 3Q1LA 4G41A 2AZMA 2ZB2A 4HQNA 2XTNA 1T2FA 2GRUA 3AHCA 3EODA 1XGKA 2YX1A 1DBIA 3LE8A 2J7PD 3DXZA 5B2FA 5LD2C 3GJ6A 1BX3A 4KQMA 3D02A 2YWDA 1ACMA 2IOFK 3C87A 5DI3A 1KYVA 4YRMA 3JVVA 4MIEA 4RPGA 2W4IA 3EQ6A 3HXPA 2W0MA 1XVLA 5GGYA 2QDXA 5D3MB 1P2TA 4I1OA 3WIEA 3T7DA 4EVQA 1OXUA 4Q21A 2Z6AA 2VF5X 5BSWA 4POOA 1RKXA 1X7ZB 2E5WA 1Y4SA 3A6KA 2X1VA 4DR1B 3FDJA 1C3VA 2GXUA 2IEYA 1K6EA 2HV9A 1Q6ZA 4F4CA 1QGED 1UDBA 1V8FA 4N12A 3GWGA 2C4KA 3OIWA 4AG6A 4IDHA 4FB4A 2OP0A 3OM8A 4MKHA 4HEQA 2NP7A 1K06A 1OIWA 1DQRA 2ZQ5A 4Q66C 5KHAA 3U31A 4WFIA 1FS4A 1RYDA 4ZC1A 1PX2A 5I7HA 2G3YA 1D2CA 1GKYA 5AVQA 1M66A 4FGKA 1T6NA 1V41E 1WB6A 3D3QA 1A8UA 1ZL0A 3M6WA 1MP0A 3PFGA 3KZCA 2I4MA 2IHTA 1CERA 3NDBB 1PV1A 2DWQA 1Z4OA 2FWMX 4JNCA 3P9CA 3AG5A 1MVOA 4M2LA 2ZJ7A 1Z2AA 1W88B 1JKMA 2I66A 3O2SB 4B3IA 4ZDWA 1G0NA 3EEYA 3SJUA 5IVIA 4EFKA 5C81A 5I3ZA 5LZ4A 2DOKA 1S2NA 1QWOA 2H2AA 1KS9A 2JPDA 1YE3A 3COSA 1XYYA 2RGCA 3WIBA 1XDGA 4O4IA 3GPLA 4DCSA 2GZAA 2EWWA 4A0HA 3HE3A 4G8DA 4LGCA 2WAAA 5B64A 5I9NA 3P4UA 3PHIA 3NC4A 4I4CA 4XWGA 3P2YA 3ON5A 4JITA 5AK0A 1SR8A 2IIBA 4RGYA 1E4VA 5D1NA 1EVEA 2FA9A 4YRGA 3LXRA 1E8DA 3JWGA 4N5NA 5EIAA 3L6OO 2R1VB 4M37A 1ICIA 3GLQA 4DWOA 1TJ4A 2HSDA 4ZAZA 3MEQA 2OENG 1OLSB 1T1RA 1WMDA 3PGVA 1E6EA 4B3DA 1W5BA 4YRTA 4DEXA 3DMGA 4WUTA 4C29A 2QXUA 3GGCA 4GSKA 3EZ6A 4I4LA 5EWMB 1DEOA 2HBYA 5FUYA 3HNOA 4MR8A 1N5DA 1XTTA 1W7AA 1FVXA 4YI5A 1C4XA 2JHGA 1EUZA 3UA4A 1J1UA 1I9CA 2PX3A 1XI2A 2D8AA 4RMHA 1DUVG 1HMPA 2BT4A 4GC5A 4N5DA 1T1EA 1A5TA 3D4NA 3DWFA 4WXMA 1PFVA 4EMUA 3S81A 2B4YA 2EW2A 1MB0A 3NFRA 2P2LA 3W6PA 1S8FA 3D7SA 4ZO7A 3ENQA 2WT8A 3CBQA 1ZW1A 1DDGA 4CM4A 2G04A 4AXBA 3I5YA 4MAMA 2QBYB 2CNDA 2W4QA 4GHWA 5A2GA 3FBWA 1YA8A 4LJRA 3VBCA 2YWJA 4H1VA 3ZNNA 3GVPA 3FNFA 1GCOA 3WLOA 3WISA 5CNJA 1CC1S 4QVKA 5IJ0B 5U9CA 1QFYA 2QTLA 4PGGA 2I1WA 3WJ2A 2JI9A 2UV8A 3UCXA 3U6KA 4IVPA 4KWIA 4J6EA 1O6ZA 3IE0A 1C4OA 1GZ5A 4AMVA 3BAZA 3L1VA 4JLUA 4U9HS 2VDMB 4WY8A 4ARCA 1J20A 1EJ6A 4UDOA 4AJ9A 4B76A 1B41A 2ZRIA 1Y1QA 3D8RA 4ZK2A 2B37A 3CF4A 3UUFA 1JMVA 2D4AA 4MW4A 3ESXA 2YMLA 2H16A 1N3BA 1NOIA 4RFVA 4B84A 3K1TA 4ETWA 1NVTA 1YKGA 4IH4A 1K1EA 4JT2A 5HS6A 1ADBA 3AM1A 2O8VA 3ISJA 3ZLJA 1O3YA 1YU9A 2Z4TA 3UAVA 5DFAA 4QHTA 4UPEA 3RVQA 1KEWA 1RLTA 2FSHA 1CR2A 2X23A 2Y3IA 1ACJA 3DEFA 2X1HA 3QQPA 3X2FA 2ODTX 3AWDA 3D5TA 3IQHX 3QXHA 5AI8A 1Z4PX 4GECA 1R4AA 2IEIA 4YRSA 1FYDA 2WT4A 3GCZA 2VAWA 1R6TA 5KC9A 4X9XA 4NJMA 3BXEA 3RS4A 1L4YA 1JDSA 3DBRA 4F9FA 1GAQA 5KNDD 4DCGA 1PLKA 2ZBFA 1GGEA 1C1HA 1VG0B 3LUAA 4HWSA 3EOZA 3IUBA 4GO1A 2H3EA 3ZDBA 9LDTA 5IAGA 4FXOA 4UNSA 2BEJA 2JJ1D 5K51A 1QU3A 3RC1A 4BZZA 1UP6A 4X6UA 4MS4B 2H7CA 3KYCA 1DJNA 4KHZA 4JASB 2W2LD 4HKTA 4ZREA 1CF4A 5DE3A 3IAS6 2ZS8A 1G38A 4HK4A 4KXYA 4BHTA 1AO3A 1AKMA 3E9DA 2Z57A 4UHEA 5CEFA 1CETA 4V0ME 2UXDB 1KJ8A 3TE6A 3GHYA 1SUCA 3QJ5A 1WEHA 4WMLA 1L3IA 1GNSA 1LPPA 1OX6A 2IHZA 2J46A 2XYRA 1WXEA 4ZVPA 3ZQKA 5H9WA 3Q5EA 3FYHA 1BVHA 4RVDA 2I80A 2XZPA 3U4CA 3EFBA 3BD7A 3FNQA 3QF4A 5DTMA 2IUSA 4A8PA 5JD3A 1A76A 1NNSA 2AMFA 3ZZ1A 4CG2A 1TC1A 1W46A 3MGGA 1I33A 2QRHA 1V4VA 1Z13A 3AB3A 2NU9B 2UDPA 4YMGA 4U2EA 2UYOA 2ZWAA 3TPCA 4G1UC 5LZ7A 5HYVA 1JTFA 5KYWA 3MD0A 1GT6A 3HMQA 4RIFA 2W2KA 1OX5A 4BEVA 4C3OB 4DLRA 4XGIA 1R66A 1NXOA 2O19A 4RV5A 4GGMX 4TS3A 5GTDA 1A7UA 1KGDA 4BRZA 4PCVA 1UMBA 4C7VA 4MMYB 4KO1S 3K0FB 1KWKA 1F7UA 1D03A 1VIVA 2BMWA 1M3SA 4WJZA 4X84A 4GKAA 2RK4A 3ZYZA 4P80A 3KQUA 2Z4RA 5DHQA 4Q4HA 3WWPA 4MPPA 4C7OB 4KR3A 4WGFA 5EE9A 1EXVA 1GPKA 1XA0A 3OZVA 4CQNA 2ES4A 2IHNA 3C0KA 4ALLA 2VSYA 4DV0B 1W8IA 3KR1A 3VNUA 1KFKB 4QAJA 2EZ4A 2V6IA 4DANA 2E3JA 1KI9A 3PSAA 1NATA 2ZYSA 3M89A 1L4UA 3NYQA 4KX3A 3AP2A 1U9ZA 2CF6A 3KUUA 4QQKA 4WK2B 4KWHA 3IMCA 1ATZA 2JGLA 2HMVA 2OBMA 3L1JA 4CF7A 3SC2B 2LE0A 5GVRA 1B2LA 3JS5A 1EQUA 4FHZA 2AR0A 4FM9A 2R9VA 2GKGA 1KVTA 3BMQB 4G5RA 3LBFA 3VR6A 2WDPA 3RWOA 2C7QA 5BNFA 1TC2A 2AE2A 4OQLA 4OHZA 1FC0A 2YS6A 3RTGA 2LCQA 1XZQA 2FMUA 5J5CA 7AT1A 4Q02A 4M0EA 2P27A 2LIPA 3OX1A 3S99A 5THKA 4CM6A 2DFNA 1AKWA 5KX5B 5LZ8A 5TLSA 4EB0A 2ZJYA 1T6YA 4GC9A 4J0DA 4PNEA 5IANA 5L40A 1UBLS 1NX6A 2FW0A 3KKKA 5FBQB 1EB9A 4RNCA 5CW1A 1R0KA 4F2GA 1U0SY 4MWSA 1C3LA 2C3OA 4D6YA 2PA0A 1EB8A 3M0EA 4XDHA 2HSWA 2GZRA 1T91A 1UFRA 3MCTA 3ABSB 3HA2A 3ISVA 1D3AA 1R0ZA 2AT1A 2C96A 1O9HA 1S3GA 2ZB4A 3P2OA 5EUCA 3RC8A 3I1FA 4L9WA 3U80A 1E8NA 2IUFA 5LOVA 5IVDA 2OGZA 4GBGA 2IE8A 2NVUA 4ITVA 3WMXA 2FRXA 4FHEA 5IAAA 1WCWA 2DB3A 3DOCA 721PA 1UEXC 3WSTA 2P3OA 2ONYA 2X4IA 4ZYZA 3U81A 2QD2A 5JXWA 3JD1A 3NU1A 1T2EA 2ZP1A 4OQPA 2QMEA 3CINA 1F5NA 4DZRA 2CHEA 4AY2A 1C8BA 1E9CA 2ECFA 2WJJA 6REQB 3RD5A 3TCXB 2IUUA 4KPYA 2N0SA 1DMSA 2G17A 4C0WA 4MQLA 3RU3A 2R25B 2I6TA 3NETA 5DWQA 3TTUA 3UFXA 3LSTA 1P2VA 1MPXA 4LDJA 1KBOA 3AERB 1E9VA 1P4HA 1U1CA 2CN1A 2A88A 2NO1A 4CQLB 4CIXA 2YVQA 1X3SA 2ZPUA 5JZBA 3RB8A 4KRGA 3GT3A 3DJFA 1VJCA 1NAIA 4CM5A 3H5NA 2XKJE 1QE5A 1KIMA 4RORA 3I39X 3WGVA 2EX0A 2RI6A 1YJXA 2GILA 2ZYAA 2NUBA 3H1BA 3I72A 4HAZA 4MQUA 2GMWA 3R0JA 2I34A 1W48A 4QXMA 3HCOA 1XK7A 5D5PA 2X9LA 2G70A 3ZXIA 4DR7B 3HBLA 1QHHA 2JIZA 1Z38A 1MB2A 1XDBA 2PXAA 2ZYDA 4WBNF 5FPTA 2HW8A 2FFAA 4X93A 3Q87B 1UANA 1VP3A 1IJEA 1PL0A 3MFQA 3BJEA 4EQ6A 3L7OA 16PKA 1MIOA 2PZFA 5FOWA 3UA3A 5IJ0A 3V8MA 1P3Y1 1WDMA 3HJGA 3NB0A 1VI6A 2PY6A 3DFIA 2QGNA 3ZJTA 2WJPA 4PU0A 3MT9A 3BXFA 1WD7A 2SBTA 4ZVSA 3ANSA 3TL6A 3G9ZA 4HDNB 5A5VA 2FE4A 1EK0A 1P1JA 3LZ6A 1ZDMA 4TMZA 1L7VC 1TRKA 1V5EA 3MJEA 4XQEA 1QGOA 1V96A 3ZDXB 4W8GA 3V97A 3EVEA 3S70A 1I36A 2OV6A 5J2TB 1TKCA 5GGXA 2G07A 1XTPA 1CJBA 2H9YA 4O33A 5AOAA 3TKYA 5CLJA 2PMEA 2BE7A 1BVUA 1HBJA 1QGUB 2B1QA 3I9V1 3L6UA 4LJ5A 4A7PA 1FTSA 2CXNA 2YXNA 3WBFA 5C2JB 2MMCA 4F2DA 3AB7A 4LC0A 4LV5B 4YX9A 1A8QA 2JEOA 1IN1A 2CVOA 2P9TA 2EQ5A 3FX2A 3ZY4A 3NTXA 3QSGA 2P5UA 2VATA 3IP5A 3KLMX 4K2HA 4B7AA 3TECE 3SE7A 1XFDA 3QWIA 1C0PA 1FP1D 1XD2B 3OZAA 4JJ4A 1EQ2A 4QPJC 1K6JA 5AP9A 5JPDA 2PYZA 2J45A 1TQ6A 4C78A 5K8LA 2I1VB 1UBOS 2CCJA 4WESA 3TD6A 5LMUB 3IT0A 2A9OA 5B36A 4J4HA 3GU3A 3IJEB 3BDVA 1KOJA 5EIFA 4HNVA 5KYXB 3M3HA 3ODPA 4G9BA 1YC2A 4AKHA 2JA2A 3MWFA 2FX5A 3FOAA 1BO6A 2A2ZA 2I4OA 1GWNA 2HMTA 3T95A 3R5JA 1T1IA 3LUDA 4WZBE 2P4UA 1QO7A 3EY4A 3I8OA 4ID3A 5EE0A 5I9MA 2O7VA 2X8BA 3JATB 4OMFG 3U4AA 3K5PA 2Y1WA 1VXOA 4LVUA 3P1JA 4A1OA 1I6KA 1DAPA 3SP1A 2AK3A 2P2ZA 4XIFA 1SCJA 3CRQA 1C9EA 3E9ZA 1KPIA 1YCGA 4QVGA 5BN3B 3IAFA 3KE9A 1ZA2A 5KOIA 2A33A 5JCOC 3AF4A 2ST1A 3K4QA 1ZOIA 2XSZD 2X42A 1YB7A 4BPRA 1QF9A 1Z2OX 1KJJA 2QF7A 2QMOA 5C53B 4D25A 1KNQA 3D7KA 4Y2XA 4MR8B 4Z4FA 4O2AF 3M4XA 2HUPA 4MWBA 3TKAA 3VOAA 1LF5A 4MJ3A 3THWB 5KNLA 1W8DA 1ILWA 2IT1A 4L5CA 1GLNA 1QIMA 4HDRA 4B3FX 5JHHB 1M5TA 5DT9A 1N2CA 2A6PA 4K1LA 4BUJA 2PU7A 4HO1X 1N1EA 4B79A 2FLWA 4OPMA 2HU8A 1OFHA 3G6KA 1ZGZA 5ALRA 2W58A 1OWNA 2Z95A 2ZI5A 3TJMA 2OXFA 2NAPA 2IYQA 1GU1A 2W8BA 2RG1A 2D5LA 2QR5A 3FD8A 1Z5GA 2PYDA 3PYXA 4LHXA 3AVQA 4ND2A 2VP4A 3TTXA 4FQ8A 1OGYA 2HQ1A 2J67A 5F5LA 2G67A 4YXWA 4U4AA 3LL7A 5EKDA 2JATA 4NYIQ 1ZC3A 3AJ9A 4RA6B 3SF8B 3RIEA 3WLKX 5KWIA 4Z86A 4W6ZA 4L74A 5GQSA 1ZOLA 1Y9EA 4DDMA 1KJ9A 4I8DA 2I62A 3EEIA 1DIGA 4NE2A 5FLXA 4G8BA 1KFJB 1RWNA 2I3BA 3LBNA 3LWBA 4MCAA 3OE7D 4AP5A 3B78A 2QUJA 1QV9A 4MARA 4WADA 1G6HA 1TAUA 1OFUX 1AD2A 4XCVA 2INGX 2QT1A 5WRFA 4Y1FA 5HK8A 5CIYA 1OGJA 5ECGC 5L8VA 3KOOA 2CV0A 2BHTA 3C16C 1G64A 2P7IA 4CEHA 1XTRA 3IQWA 1N6OA 1XWFA 1N0HA 1CHNA 1PRYA 2R751 3R5FA 1ZH6A 1FX0A 2W4MA 3KB1A 1LUAA 3G2IA 3I05A 4L75A 1C50A 1IY0A 1DWPA 1R0YA 3OLWA 4EKGA 3Q7IA 4IGAA 1LSJA 4MDHA 4X24A 3WNVA 3L6RA 1NTRA 4IJKA 3GGPA 2L18A 3AB8A 1NBAA 4BNLA 4DSNA 1JFVA 1FYFA 1XTBA 1X1EA 3LC0A 4R1TA 3N2KA 1JKIA 4R54A 2QLBA 4FEYA 3V8VA 4RK5A 1E66A 3NYIA 3K15A 3V4FA 2HR1A 1JAXA 2PSHA 3PD1A 5LQSA 3VH2A 1UPBA 3RKRA 2FY8A 4HNQA 4QAQA 4QLAA 4KO3S 4G0YA 2BH9A 1CY2A 3F96A 3WJ1A 2AI1A 1QF7A 2LD4A 2RGUA 3HGMA 1ST2A 2DQ4A 3NDPA 5C5CA 3I12A 1VRWA 4N1AA 4NX2A 5BVHB 1RACA 5F78A 1IIRA 3MK31 2JI4A 3AY7A 3SY8A 4QECA 2HZBA 3EZ7A 2BFDA 2I78A 2J59A 2JJ1A 1ISPA 3DEYX 3O8QA 4JS0A 4YHBA 5IC6A 3ZD6A 1RJFA 3FPSA 4GYKA 2R6GA 5AXAA 1Z37A 3GVCA 2EATA 2BFEB 5CHYA 2RGGA 1QQ7A 5BXYA 5SYAA 5TGZA 2IYEA 3PNYA 1PK9A 1NM5C 1UKVY 4E7PA 1OGIA 3WB2A 3T7TA 3UWDA 2OUKA 2FCRA 4KIUA 4GOKA 5EYPA 1V1JA 4FKBA 4OQMA 3L4EA 5DEIA 1FP2A 4OL0A 5KTMA 2GBPA 2J09A 3AI1A 4KQKA 2J0SA 4BKOA 4UVIA 4IJ5A 1W4CA 1LTHR 3ZDAA 3GUVA 1S9DA 3W77A 2F43A 2ZJ6A 5IW8A 3LKVA 5ALFA 3K35A 3R74A 1LLDA 3PENA 1OC2A 2HA2A 1RCUA 4DBLE 4GDFA 3WAKA 2NW6A 5AM3A 1ZVVA 4JB8A 3OIDA 1W88A 2VRWA 4QEKA 5EVCA 1DLJA 1EXWA 5C1BA 2RH8A 1YQEA 2FFHA 4LHYA 2B2NA 5LU8A 3ZGVA 2FJUA 2BE9A 3MCVA 3OKPA 3W2GA 4BC0A 4N7MA 4TLCA 1F0PA 1VRCA 1MIHA 4JN6B 3N70A 4BECA 4HL6A 5FNZA 1XVAA 1YL6A 1E5XA 1ORRA 2ZIGA 3AT1A 3IX7A 4B3MB 5JATA 3ED5A 1PG5A 5DXFA 1GGKA 3H2ZA 3V4VB 1U98A 4FX5A 3NTQA 1XZGA 4IIXA 2W2VA 1R0CA 1V47A 3ZV5A 2ODWA 5LC1A 2UZ0A 1XU4A 1Y7TA 2W98A 3LCVB 3CUVA 3DL2A 3PC4A 4G8CA 5AO9A 4D7AA 1HT2E 3D8HA 3S2UA 3WLQA 5LXTB 3L4JA 1IVSA 2H52A 2OD9A 3IQDB 4B17A 3D3WB 1IPEA 1JYFA 2W22A 4GG1A 3CX3A 2BF7A 4B4KA 2Q4EA 3TKLA 1SKUA 4HNSA 5CFLA 2D1QA 2GETA 3DS8A 4JCOA 1O95A 2W6JA 2IF0A 3OF2A 4MKFA 1CRQA 1ACLA 3CEHA 5F64A 3E15A 3LO5A 3VTFA 4WCFB 1Y8CA 5I7FA 3C8MA 3PSHA 1QCZA 1S2DA 1VJTA 3X44A 1OZGA 4WKCA 1C2YA 4MLPA 5JRJA 1AUVA 1U28C 3ZJYA 1T8SA 2CUZA 2GD1O 4TYPA 1Q91A 1FTNA 4TS9A 4A6PA 5BNTA 1W1UA 2H2IA 1KVSA 4QOEA 5JD4A 1X42A 4XCXA 5LQAA 2DKNA 1W85A 1BHO1 3LPAA 3PFNA 4XQGA 4FN4A 1PW7A 3KQQA 2XR1A 3U1TA 5L6LB 2RH4A 3C5CA 1C7RA 3GI1A 4M1TA 4NECA 6AT1A 2PJRA 4PRYA 3CWCA 3SDBA 1R8QA 3KK0A 3OJEA 4MUFA 3BL8A 1XA4A 4RQAA 3D6MA 4UUQA 1GPLA 3ZGOA 2ZUTA 4E94A 4CM3A 1N9GA 2H8GA 4WWHA 1MKYA 1W1IA 3T1QA 1LSOA 4MO9A 4MVJF 5K20A 5F12A 1DJQA 3DMTC 4KW7A 3U3DA 1CU1A 2BIFA 3DLCA 5FNVF 4ERXA 4CIYA 3VHQA 1TM7E 2JFPA 1FFDA 3LPDA 4TUYA 3U3RA 4RETA 3VO8A 3WIUA 3CF2A 4MKRA 2CVHA 2R44A 4CKEA 4PAOA 2PO7A 2I54A 5A62A 1MV5A 1S5PA 4JGBA 3V7UA 3PYMA 1JIUA 1TCUA 1VYUA 2A0WA 1CQIA 1ZZGA 2PZBA 2NV0A 1BD4A 4PTZA 4BWVA 2CBZA 2BFBA 3B7WA 5HFNA 5KQMA 1B6GA 1VGRA 3AONB 3B82A 3JWIA 4Y2YA 3BWMA 1TZJA 1HV8A 3F1KA 3RK1A 1QB7A 3WGNA 2UVPA 1DU4A 4KIGA 3SQMA 4C7OA 1VI5A 4N82A 5BN4A 3QVXA 4L8FA 2IV3A 5GV7A 4Q1VA 2Y67A 4C9BA 1GL7A 2X19A 3I73A 3TBFA 1GDDA 4B6FA 5B4UA 2JASA 1YVEI 3SC6A 1CIVA 1ECJA 3LRXA 1OXBB 3MUEA 4GOLD 4KOAA 1GUAA 1FFBA 1U0TA 2DR0A 4MS4A 2HRRA 4U7GA 4O5OA 2RGEA 4TV8B 4OBEA 1IAQA 5CB8A 4H4EA 2RC6A 4DDHA 2ZZMA 3RG2A 4D5GA 3LTEA 3DZDA 2WSSA 4EG7A 4L28A 2YYZA 3B5IA 4AFNA 3DE0X 3DXYA 3HM2A 1X7DA 2QSJA 4NHOA 4XR9A 4EDFA 5DWDA 3RWBA 1M2NA 2GK4A 2DHQA 2JEZA 4OQXA 8LDHA 2CEKA 3ESDA 1H85A 1SVLA 1AIPA 3TXAA 9ABPA 4JU9A 5HUHA 3WY9A 2AOUA 3N8DA 5HDBB 2YY6A 3KV3O 4CEIB 3JQFC 4LVOA 3B9RA 1FCJA 1YS2X 2WU3A 4JLOA 1J09A 4LF5B 3EGDA 4K9LA 4TPKA 3M4YA 3QE4A 4CIAA 3THSA 4NY1A 2W83A 2Q6LA 4PPGA 5FL7A 3T3PB 3OFKA 4PX3A 2HV8A 1GKUB 2Q6TA 3SC3A 1B0PA 1ONBA 1IVYA 1GNQA 5IVHA 3JAKB 3CSUA 2I4TA 2JHPA 5J4HA 1EP3B 2MINB 4R41A 1P9LA 3VR4D 5AKEA 2DBZA 4FNOA 1VLVA 1THMA 1RHUA 4DLWA 1FLAA 3W5AA 1NVVR 3TCNA 2FHSA 1OFTA 1QVAA 2IDZA 3AHFA 3G0GA 1C4WA 1YQQA 3TSOA 2IODA 4L8YA 3RE1A 4Q7QA 1UJMA 3U16A 1PW5A 3COZA 5CLIA 1XKQA 4UC0A 4M7WA 3WHIA 1EDDA 2O3SA 3A32A 1QH9A 3MIZA 3SYMA 4JI0B 3ZDQA 3CXRA 3I45A 4FHFA 4HTFA 4MQBA 5CVDA 2Y76A 3W2EA 1OX4B 1CUEA 1QOPB 4EF4A 2NQ8A 3NIBA 4NCBA 1KEPA 1CCWA 3DE4X 1SZDA 4CM4B 1GZ4A 4KE6A 3JAMA 2QTRA 3K0CC 3QQ5A 1D5WA 3UHAA 2F3TA 2IIPA 4CKCB 3RYIA 1K4KA 1KFEB 3I6ZA 1KH2A 2CEAA 1ZD9A 2ATXA 3FFXA 3HBJA 3O7WA 4NJEA 3T5TA 2XKKA 1RXUA 4MW1A 4E11A 3H75A 4DJEC 3CF6R 1BMFD 2CNWD 2G5GX 5HWSA 3N8NA 3Q7EA 4OKSA 1UQTA 1HNXB 2P69A 4I1IA 2B8WA 2IHKA 4QOGA 3U39A 1UODA 4AJEA 2AC2A 1Z6GA 1QZ3A 4JL6A 1T10A 1Z7BA 1FTWA 3DHWC 5JSZB 3TNFA 1OWMA 1K8QA 3W34A 2WM9B 1DQSA 2BGJA 2EQAA 2GT1A 2GN4A 4HTAA 4NYMQ 3JQGA 1EFCA 5A9TA 1HA3A 3DMFA 4DA7A 3LDAA 1YZQA 2QMHA 3JQAB 3MJCA 2QZJA 3KLBA 1Q50A 3TRJA 1NJ5A 4RA9B 5CEJA 2GFIA 2XDWA 2JLXA 4M7OA 3AETB 4ESVA 5LA6A 4XEHA 3IHLA 4B34A 2ZIUB 3KJIA 1Y3HA 3EPKA 4EJSC 1DV1A 4OQQA 1ZJ4A 3DOUA 3FLAA 4PYQA 1AN0A 4XSHA 5ALSA 1X0XA 4RTSA 3GJZA 4GD3Q 1GJRA 1YS6A 4G4JA 4KB5A 4B81A 1D4ZA 3UH0A 1O0CA 1LPMA 1XTSA 4I6EA 1VG9B 4JL8A 5DIZA 4ZAGA 4FXPA 1M67A 1XQ6A 4N7RA 4CUKA 2P30A 2VTBB 3UBMA 5B37A 2IY9A 1YBAA 1RJDA 4PCAA 1J5EB 3DPIA 1XK6A 2C8VA 3AW9A 5CH3A 2V3CC 4NPAA 1Z6XA 3L02A 3K8YA 1Q77A 1VCOA 2E18A 2SCUB 2IH5A 1MJNA 2UYQA 1HTBA 2O4UX 3R23A 4DCTA 4OM8A 4EJSB 1TCBA 1R50A 1U28A 3TOCA 2PSFA 5G4KA 4BLUA 1JT9A 2DF8A 2QUKA 4GZ5A 3L4KA 1ZESA 1HORA 1QX4A 2JFXA 3WSWA 1JYEA 5JYCA 5KYYB 3A1VA 3HZZA 3FLBA 1GAJA 2IHYA 4TLMB 1SA0B 1ZOOA 1TW3A 2NOAA 2OTCA 3AM4A 3EXHB 4M9UA 5GONB 1XWWA 4Z51A 2HQSA 4FGUA 4COOA 4DQXA 4MYUA 1L8XA 5F76A 1U4SA 4L22A 1GPYA 1YZFA 4XVCA 1HNNA 5F7XA 2NM0A 4KACA 4XVRA 5TPZD 4QYMA 1NBIA 5JCXA 3SXUB 3KEMA 5GAJA 4XFDA 4R6WA 4TQ9A 4Z7OB 1LPSA 2H31A 1JLLA 1IC6A 1J7JA 2ATVA 1GRQA 4JYCA 4O0MA 4BB0A 5L4SA 1NBOA 3U9LA 1CRLA 3U44B 2M9MA 3NBAA 2I1LA 2WSLA 2B5WA 4WBNA 4MGIR 5T41A 1VCIA 1W2HA 2SHKA 3EG9A 4J03A 5JH7B 4O2BA 1M0SA 2GXQA 3KC2A 4JBGA 4MCIA 5ESXA 1IZYA 3T34A 1TQ4A 3GJ8A 4UCWA 5D1HA 4BV3A 1T5DX 4H4DA 2R6DA 1EZ1A 2J0UB 3E05A 4FSHA 1MJFA 1DI0A 4FX2A 2YZKA 3HC7A 4RIEA 1DRWA 4Q4JA 4CETA 5HKKD 3KELA 2CF5A 1JSCA 3CS3A 3ANXA 3DO5A 5U4QA 3HDHA 5IH7A 1E6WA 5K1ZA 7ABPA 3RVSA 1K8YB 2PUWA 1X8JA 2PWYA 5KZMB 4FC7A 2PZKA 4TKVB 4WE3A 1OI7A 2QRLA 1ENOA 3QMPA 5JCJA 1N92A 3MAGA 1LRKA 2RH5A 3NAGA 5FWNA 4QREA 5JEEA 1A69A 2YXBA 1P0IA 3E22B 4P98A 5BW4A 3R3VA 5HCUA 3TTTA 1E5VA 5ECDA 5KPDA 4AI6A 3NO4A 2PJZA 3GJ5A 1IJBA 4JXJA 2FFBA 3DONA 4BP8A 5JVDA 2BGMA 3U0BA 2PUEA 4MYTA 1DGQA 2GGSA 2HJWA 2R1UA 2VJPA 3A4LA 3L0CA 4FI3F 5DI3B 4GX1A 3D6VA 5ERXA 3TE7A 5BQ5A 3THYA 3W2HA 2EW1A 4Y2RA 2CXTA 1QCYA 2ONJA 3K70D 2NO4A 3RS8A 5JPCA 2J07A 1XTQA 5ALTA 3FTFA 2JW5A 1VPLA 4X1YA 2KLBA 5BW6B 1X1TA 4FLEA 1GEGA 2CJWA 4GWLA 4AZ0B 4RW0A 3QBDA 3ZXSA 4EUEA 3VYSB 1KEZA 3NHAA 4QUBA 1ZK0A 1BDJA 1TJPB 5SYNA 3IVGA 4OMUA 4M6WB 1YFLA 4G4IA 1ZAYA 3NJ8A 4ASUA 3R3ZA 4FFNA 3ML1A 3QMVA 4PZPA 4QDOA 1ABBA 2PSJA 5LL6P 1TGVA 2C5BA 1NX9A 5B3KA 3DWEX 1VA5A 5KUTA 2DETA 4MVJD 2AI2A 4ZVNA 4PSUA 3M2PA 3DTVD 1X0VA 3F6RA 3OLYA 5BSUA 1VKHA 2DPYA 2VBGA 4IGKA 3E18A 1XF1A 3N2EA 4MI6A 5C9ZA 1T5BA 3EW7A 1FFXA 3R9XB 2NMVA 2AZ4A 4IDQA 2J7PA 4R1QA 5K8IA 1JZQA 1AUOA 1RMQA 2ZATA 2GZ2A 3MWKA 4YAFA 3GX1A 3EZ9A 1GNVA 4HXFB 1GA1A 5ALJA 2VSXA 5CCBA 2VRBA 1PTKA 1DARA 2FEOA 2FXIA 4RZSA 4NOMA 1AT1A 1PUIA 3HY4A 4BNHA 2HL6A 5MGNA 1U02A 3UM9A 2JH9A 2AV6A 3OZBA 4UARA 2J0VA 4C0XA 4BQEA 4DG5A 4LF9B 4JKOA 2YINC 3KQTA 5A5EA 3WIVA 1VSUA 4LWOA 3RHSA 1LI5A 3AEQA 5FL7D 4P92A 4M9CA 3FDZB 4JVNA 2BEVA 1XRMA 3LC7O 1YE5A 1G9SA 3OZIA 2GCOA 5IFLA 2QYTA 2Z58A 4ZTBA 5JJLA 4OAPA 3CLSD 1AKUA 1LGYA 3B5JA 1XHFA 3LQYA 1A7KA 1X19A 2OHIA 4BO1A 4UM7A 4DA9A 1SIOA 3E7PA 3F9RA 1JVBA 1R8SA 3CEPB 4DV4B 3V42A 2HHAA 3LNTA 1G63A 2VA9A 5GM2A 2F8SA 2ZPTX 1A72A 3NC0C 4BNDA 1I3MA 1K5DA 5L3SB 3STTA 3UEOA 1L4BA 2XQIA 4RD1A 4CV2A 3P71T 3FUTA 3KYJB 2JHFA 2VTVA 1SPBS 2JK0A 2CXHA 4I14A 4B4OA 1ULSA 2ZK7A 4B6PA 5H68A 2PZEA 3HYTA 1GDHA 4IX9A 4JYPA 3HU5A 3LQKA 1DKQA 3PK0A 1KY5A 4XGRA 2HNAA 1T0UA 1KZ1A 1JXQA 4UNQA 2C20A 4YASA 1QIDA 4M46A 3WYGA 1AXRA 1DMRA 2AIRA 2JIBA 3UB4A 4E5KA 3ID6C 1A3CA 5ED0A 4BBZA 1AS2A 3AJRA 4X63A 2AN1A 4M99A 4C6TB 2FWJA 3GFGA 4TTVA 3RASA 3VNQA 1PVDA 3U26A 3CRZA 1XKTA 3HN6A 3QVOA 2IY7A 3H3FA 4QRDA 4NZNA 4IINA 4EA7A 2NNLD 1NMQA 3HR8A 4XUGB 1YI0A 3WC4A 1RKQA 4D9MA 4EVSA 2YOGA 2GJ9A 3IV6A 3M1YA 3DTVA 1NVGA 4UMEA 5CX4A 1TEVA 3ZK9A 4WLVA 5E6UB 4JUIA 5EMNA 1NR5A 1DSSG 1HNZB 5LYYA 1V2GA 4TKMA 5DLEA 1Z5VA 1Z73A 1IZZA 3DAPA 2I22A 4QPDA 3QE3A 3IHTA 3EQ2A 4CTKA 1PFQA 3CR7A 3TLGB 2XRFA 1IEWA 5BSTA 4J7XA 3ZEAA 1JNXX 2MYPA 1I2ZA 1S8AA 1YL5A 5ARDA 1G8YA 3RJ5A 3PJDA 3UJPA 3W5UA 3NYRA 4HMPA 4AD8A 4CQLA 4F9TA 1XCPA 3TZKA 2O3UA 3OD1A 1UBHS 3V8PA 2XX3A 1RQRA 4P58A 1RKBA 1T9BA 1XCBA 1JPJA 2FLVA 1WY5A 2FWIA 5CVJA 3UCEA 4Q01A 1M6VB 2VHTA 1ZJJA 3U3XA 3FMVA 4YJ2B 3L4SO 2WD7B 1UZUA 2ORIA 2OMEA 2R7AA 4JOBA 3UHFA 1KMHA 4WDQA 2OLJA 5CXQA 2MT9A 3V4RA 3RADC 4B6SA 1D2GA 1DG9A 1E32A 1EDOA 1BROA 2NV2B 2Y1KA 3FFBA 1S7CA 3HB1A 4O8CA 2OQVA 2RHRA 5AESA 1MTZA 3CRW1 3ETCA 5A3QA 3BFPA 4BJ5A 1Q95A 1K3UB 1V3VA 1XZJA 2JC3A 2YMPA 3OPYA 2CXQA 1UXJA 3S5UA 3N86A 3L6CA 4UFPA 4Z53A 1Q44A 3O1IC 1J7KA 4UAVA 3AFMA 3FWNA 1T13A 4TL8A 1YGYA 2CUNA 1BX1A 2DE0X 2GEBA 3L84A 3ZZUA 1RKUA 2GUGA 4L2IA 2XTAA 4BYGA 5NLLA 3FROA 2EJBA 2OM2A 4CIWA 3FHJA 1F7VA 1N6NA 3QX3A 1RJ9B 1ULTA 2BZ0A 3EG9B 5SZJA 2F8LA 4BCBA 4DEVA 3EQ7A 4Y2GA 4DMCA 1SD5A 2I3ZA 4KJXA 1NFRA 2G28A 4QU0A 1K9VF 3AOEC 1WNTA 2JNWA 4M60A 4QQFA 5G0UA 821PA 2WIJA 3N0RA 4RD3A 1A95A 1E2NA 4Q3CA