3GMDA

Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKVTYPMVAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKAVSGIVNAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of 7-azaindole-pyrrolidine amides as inhibitors of 11 beta-hydroxysteroid dehydrogenase type I.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 96
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmdA00
4TKLA 1E7RA 2CF6A 4JP2A 1Z45A 3ZV5A 4CUKA 1RM5A 1IULA 4IS3A 1UZMA 3NDRA 1GR0A 1E7MA 3H9JA 2ZTMA 4BNZA 4K26A 2PV7A 3I23A 1ZBQA 4LRTB 4PG8A 1ZMTA 1NX6A 1SMKA 4IS2A 3HDYA 3UVEA 1XELA 3DAGA 3H2ZA 3WIEA 4LK3A 1IYZA 4ND3A 1L1FA 1RM0A 1BSVA 1EE2A 3HADA 4I5DA 4BNHA 5L9AA 4C7JA 1TXGA 4CLRA 5EIOA 1ZCJA 4DIBA 5KJFA 4E5YA 2UAGA 1BRMA 1OC2A 3I9LA 1XYGA 2JCXA 2VWPA 3EC7A 3GFBA 4WCFA 4DMLA 5B1YA 4UVGA 5I8WA 4FJ1A 3QVTA 4RV9A 1PGPA 4MINA 1JKJA 2RH4A 3PVZA 2CNBA 2QZZA 1T2CA 2A94A 3PFFA 2IXBA 1HRDA 4PG5A 4IJKA 2Q2QA 4XKJA 3FWZA 4PZCA 1QYXA 2VUUA 2DT5A 1H94A 4AJ4A 2UVDA 4XCVA 4K1LA 2YQ5A 2ZYDA 3CIFA 4WLNA 2B37A 4O63O 4BHTA 4KTVE 1R37A 4ZD6A 3Q2KA 4W4TA 2HJSA 5CDSA 2D5AA 1ENOA 1U2DA 3GAFA 2OFPA 4XR4A 3FWNA 3T7EA 4FC6A 1ORRA 2RHCA 4MP6A 4ALMA 1B8VA 4WLUA 4AJHA 2PZLA 3ZWVA 4EUHA 1F12A 5T67A 3PWKA 2DBRA 1C1XB 2R00C 3X2EA 2X5JO 3RVDA 4PVCA 4J1SA 4R54A 1GUZA 5AXDA 1SCUA 2X58A 1Y1PA 4ZJUA 2V7PA 1B0AA 1GADO 4YJGB 1ISMA 3Q9NA 1PJ2A 5JAQA 5L7YA 3B6ZA 3PHJA 4WLOA 1LTHR 1P1KA 1YKFA 2DPHA 2NVUB 3DBRB 1B2LA 4EYEA 5EL0A 1QLHA 2F1KA 1UP7A 4EI2A 2HRBA 4F6CA 5JE8A 1QSGA 2X7HA 3PQFA 4WNCA 4WK6A 4U5QA 1RM3A 3GG2A 3HJAA 3F9IA 3WG9A 2EHDA 2W2KB 1C0LA 3DHNA 3WNQA 3DR3A 1RWBA 1FF9A 4JBHA 3GPIA 1YH3A 4CM3A 3U4CA 5I7EA 2BRUA 1Q7GA 5JCXA 3PZRA 1C1DA 3N7UA 3GVXA 1ISIA 1H93A 3QE3A 4DREA 4E2XA 2EP7A 1D3AA 3STHA 2ZB8A 4JJGA 5I9LA 1ZSYA 5EJ2A 1VJTA 4J1NA 4YAIA 3RUAA 1E3WB 4XD2A 3V2GA 4D3DA 1TVEA 2YY7A 3ZCXA 3IKTA 3OP4A 3OMLA 3WJAA 4CMKA 3ZHXA 2X0NA 3MTGA 3QW2A 4O5OA 2CVQA 1PL6A 2GZ1A 2EGGA 3H9UA 1YO6A 4J7CA 2GNAA 1ZK1A 2Y1OA 3H8VA 4HFMA 2C59A 2Q49A 3I9NA 2Y0CA 1OAAA 2QRJA 2VYVA 2YYYA 5EMHA 4BKRA 1PGQA 2X9NA 1MLDA 2VWHA 3IS3A 1EE9A 2PZJA 1N9GB 5A04A 1NBOA 3PYLA 4BNGA 4CLEA 3FNEA 4DQXA 1P33A 4LMRA 3DMTC 2ZKLA 2WYVA 3BMQA 2VUTA 1KYQA 3LQFA 3LC1O 2HU2A 4CMIB 1GY8A 1T2EA 2RH8A 1Z73A 2JFGA 3B70A 4PG4A 1P1HA 2PD4A 4CM6A 3OIGA 3RJ5A 4B3JA 2RHRA 3JQ6A 4E4YA 1LSUA 3DXFA 4UUOA 3HG7A 1XA0A 5CDTA 3ULKA 1KEVA 3S2EA 4CUZA 4UAGA 1EFLA 3KYCA 3IJPA 5EQDA 4DA9A 1ZZEA 2Q50A 3V8BA 2B4RO 4JBGA 4CQLA 4BB6A 4B7CA 4E3ZA 4DXHA 4U0JA 1ZNQO 5L4LA 4H15A 4W9NA 4YACA 6ADHA 1L7EA 3E1KA 4A2CA 4E30A 1XHLA 1E1MA 4NK4A 4NQZA 1LU9A 2YDXA 3GK3A 1EZ4A 4XJTA 1CIVA 5TT0A 2GR9A 1AHHA 4WCFB 4N54A 1OFGA 2O2YA 3KVOA 3WYCA 4IJVA 3GEDA 3EHEA 4CQLB 3DQPA 3DEYX 4WNIA 4YT2A 4IDCA 3N58A 6LDHA 1DIGA 1NAHA 3PIDA 1ZUD1 2HMSA 3KYBA 3OJ0A 1PZFA 4NBVA 1A7AA 3L77A 4KUEA 5CEJA 3WR5A 1E3JA 1YBVA 4QO8A 1P1IA 3W4JA 3DZJA 3DAFA 3H5NA 4O1MA 4CMBA 4KTTE 4ND2A 2FR1A 3AI3A 4II3A 3KTDA 1HETA 2Q4BA 3E03A 1VKNA 1YONA 3E6AA 4JCOA 5LCXA 4OXKA 3ZV4A 1H9BA 1ZO8A 1DDOA 1DFGA 2VWGA 3TN7A 1T2DA 3WGQA 1Y5RA 2C07A 2HDHA 4WLFA 2C7VA 4FQ8A 1CERA 2WE8A 4XZ3A 4LN1A 2CVZA 4ZA2A 3ZWMA 3KEQA 2FSSA 5JYDA 2FMUA 5JDIA 4FN4A 2R2GA 2BLLA 4BNFA 1RPNA 4M86A 4P22A 3FBGA 3AY7A 3WBFA 2NWQA 1HT0A 5JCJA 3UFXA 3JSAA 1O9BA 3AWDA 4BKPA 4CMGA 3JQFA 4BO2A 4MVJF 4TVOA 3MJEA 4WPGA 4O6VA 3QV1A 3OA2A 5IDYA 1Y7TA 2Y1CA 5TC4A 1QLJA 3W6ZA 4RVGA 1MGOA 3AU8A 2OOSA 2YUTA 4AJOA 1GV1A 2PFGA 1K2WA 2NM0A 2ZCVA 3HQ4O 3E48A 5T6BA 1LC0A 4DQUA 3TNLA 2PR2A 1LJ8A 3BTUA 2NSDA 3UCEA 2P5UA 2YW9A 3H3JA 1SZJG 3VKVA 3SC4A 5TLSA 4GKVA 4CQMA 1FXSA 5FYDA 5F5LA 1F8FA 3BHIA 1PS8A 2HCTA 3DB2A 1Y8RA 1E7SA 1QV7A 4KQWA 3WGZA 3GUCA 3JD4A 1OMOA 2EERA 4D7AA 3MTJA 1HDYA 3BAZA 4EJMA 2X9VA 1D4FA 3G1TA 4I1IA 1AHIA 4INAA 1MUUA 1ZK2A 4YRBA 5ILOA 3AI2A 3O4RA 3RBVA 5I9NA 3VZQA 4F45A 1H6BA 3LT2A 4A10A 4CL8A 3M1AA 3ZU4A 3MJTA 4E12A 1Z75A 3CUKA 5T5QA 1V6AA 1IY8A 1GCOA 3AUUA 3T4EA 5JC8A 3E5MA 4FCCA 1KEWA 1E7YA 1O8CA 3L9XA 1MXFA 1NQ5A 2VZ9A 1WDMA 1BTOA 1Z7EA 4G2NA 1V35A 1ONPA 3C1AA 3JQ9C 4KWIA 4MDHA 4RPGA 1YOVA 3ZU3A 1N7HA 3E82A 3Q1LA 2P9CA 3T7CA 1H9AA 1OZAA 3OA0A 4DIFA 1EK6A 1QYVA 2NNLD 5KJEA 2PK3A 1K6JA 2PD3A 3DMYA 4JIGA 1UAYA 5FEUA 1VJ0A 3MEQA 4DPLA 4OSOA 1HTBA 4RGBA 3FNGA 4CMIA 1NFRA 3A4VA 3GMDA 1E92A 3QSGA 4DYVA 1KVUA 3H4VA 4PCVA 3JD0A 4GSLA 4LMPA 4Z6KA 1H6CA 2A92A 4IDGA 4Z9YA 1YL6A 5KWEA 1ZK3A 5TNXA 2Y1FA 1VPDA 3H3FA 1LNQA 2P4QA 4MIYA 3FNHA 5KVQA 4FOOA 3JQ9A 2GLXA 5G4KB 4N5MA 5ITWA 4IQ0A 1W6UA 1GYQA 1YL5A 4GSKA 1M66A 4IQGA 3QWHA 1ULSA 3WWZA 3VOSA 1DIAA 4UREA 1HE5A 3PJFA 3DDNA 1KS9A 4OXYA 3PQEA 1HDXA 4GGOA 4JN6B 2B83A 1YQXA 2QRKA 1U1IA 3DBLB 3VTZA 4OIMA 1NVGA 1NR1A 3C1TA 4I9HA 1Z82A 1UXKA 4ND4A 1VKOA 4ZHSA 4C7KA 4UVEA 1GUYA 3ZDFA 3GC6A 2PKQP 3HE3A 4BNLA 4RF5A 4CLOB 4YAKA 3QP9A 1Z7BA 3UICA 2X23A 4BUCA 3VZPA 1P9LA 1UH5A 1XQ6A 2ZATA 3SJ7A 5JY1A 4PZDA 4UULA 3PHIA 2GASA 2PD6A 4R1TA 5JMWA 3HN2A 4MVJH 4JJIA 5I8ZA 4FFLA 3TJRA 4RJTA 4J7XA 3MJ4A 3PJGA 2Y93A 5DBIA 1R4NB 4FGWA 2ZTUA 4YJHA 1GPJA 4ZQFA 4AICA 5JS6A 5THQA 4HNHA 1RYEA 3T4XA 5DT9A 1TT7A 5A02A 1YXMA 4CLDA 3RU9A 1ZVMA 1JVBA 2CZCA 1N1EA 1DEHA 3LT4A 3EDMA 4L74A 3HHPA 2PKRA 1ZSVA 2ET6A 4RLHA 4DWVA 5LDHA 4LVCA 4PGFA 3PFWO 2EW8A 1R16A 4IINA 2BH9A 2BFPA 5I7VA 5JLAA 5JDIC 3KYDA 1BXKA 2VNSA 3NYWA 3GQVA 1BXGA 2H9IA 1IOLA 1DPGA 5T8KA 3V5NA 3NT4A 2B35A 1LX6A 4WOKA 4CQMD 4GMGA 3CKYA 4A26A 3GDOA 2X0JA 3PEFA 1Q0QA 4PLZA 5B4UA 3O26A 4H16A 4EEXA 5I7FA 1ADCA 5ER9A 1SEVA 3DFZA 4BKUA 4CV0A 3WWYA 1MG0A 4BGVA 4BNNA 3EUWA 1XU7A 1KOLA 2B69A 1IL0A 1MX3A 5KJCA 2Y1DA 2JD1A 4E5PA 3WX0A 4PLPA 1WMBA 1I3NA 4RF2A 5JAZA 3V1TC 3ROMA 4YB8A 2PGDA 5I7SA 3X2FA 1ISHA 1KVTA 5A05A 2FRDA 3EGOA 2Y0EA 2I5PO 4YT4A 2WTBA 3JYLA 1T4BA 2WSBA 5CPBA 4XYMA 1LRLA 3NEPX 2DFDA 2YFHA 1B8PA 3QLJA 1ZEMA 3HSKA 1E1KA 5CDYA 4ONEA 2NU8A 1ZK4A 1DC6A 2V65A 2Y05A 4BS9A 4BNKA 2G17A 4QECA 2O3SA 4YBZA 4D41A 4AJIA 4CMEA 1DC4A 4YJFA 1DSSG 4FFOA 1A72A 2ILTA 3S1LA 2D59A 3KETA 4TKMA 4BO5A 3G79A 3M6IA 4DUPA 1TI7A 1W73A 4LSWA 4Y98A 1HLDA 1U4SA 4ESOA 4AJEA 4GX1A 5HM8A 3BMCA 4RPLA 1MFZA 4I9NA 3BIOA 2OBYA 4E5MA 4BO6A 1H6AA 3VH1A 4BIIA 4R51A 3SVTA 2CD9A 1EUDA 2O3JA 2GRAA 3KO8A 2BI8A 2ZJ0A 3VPXA 2Y66A 1U3WA 2YHIB 5IN4A 1PJTA 1GD1O 4R41A 4CM4A 3F1KA 2QW8A 4DRYA 5K0ZA 2AQKA 3BYZA 1C0IA 2BHLA 2WD7B 3GDFA 3PRJA 4F46A 5F21A 1DRUA 1P1JA 4W99A 1R4MB 4D3FA 2JD0A 3F47A 4RVUA 1TT5A 4NFYA 3ANMA 3DTTA 3K96A 3KV3O 1LA2A 4RPKA 1CETA 4I8XA 1ADGA 2GD1O 1XKQA 1XG5A 1I2ZA 1N9GA 3KHUA 2WD8A 2XOXA 5C5IA 5CFZA 3V2HA 5FI3A 1P45A 3TL3A 5JDCA 1EQUA 4BNUA 1E3WA 4K28A 4ZICA 3ZGYA 4R69A 4TZTA 1HXHA 2PGLA 1ADBA 3DL2A 5C7LO 4HWKA 4JLWA 4MOWA 2VT3A 1YRLA 3UF0A 4ILKA 3RAJA 3VTFA 4L4RA 3VKUA 3PJDA 4ALLA 2TMGA 3LK7A 5KJ6A 3ZWNA 1UDAA 1DFIA 1WZIA 4E5KA 4P38A 4ZRNA 1I3LA 3V2UA 1QYDA 2E6UX 3KUXA 4B8ZA 4R9RA 5DP2A 3WYBA 1O6ZA 5COBA 4Y67A 2TMDA 3OJOA 1KVQA 3GT0A 3B1FA 3QVXA 3VHRA 4N5LA 2Q45A 1WDKA 1NFQA 4HNGA 3RFVA 2FZWA 5F5NA 3Q9UA 2IZ1A 2QYTA 1VE9A 3OH8A 1HYEA 4CPDA 1J0XO 2C82A 4W7IA 4NG5A 1VSUA 1R0SA 1M6WA 3WNVA 4E2ZA 1KC3A 3D5TA 1GCUA 2YHUA 3TDKA 3WSVA 3C85A 1JKFA 2O23A 4DGSA 2H1SA 1XLTA 4GX0A 3SBOA 3HZZA 3HFGA 3EZLA 3NKLA 1C3VA 4GL4A 3VPHA 4B8WA 2ZJ1A 3ETDA 4UVHA 3K2EA 2WJPA 1M2WA 5EQFA 3ZH2A 3L4BA 3H9GA 4MIOA 2R6JA 4PIVA 1B7GO 2VWQA 1C1XA 2GF2A 2DBZA 2JD2A 3AY6A 3DAPA 3PI7A 3AUTA 5AQ1A 1UJMA 1XGKA 3KZVA 1N7GA 1YE3A 3ZI0A 2P9EA 5F1KA 3QWAA 1V9LA 4IDDA 3OFSA 1GZ3A 3QVOA 3PGJA 4I9UA 5FF9A 3FTNA 1PGJA 1DLJA 4Q39A 4KZPA 3ZWCA 1VL6A 1FDWA 2GZ2A 4YT8A 2GCGA 3DOJA 5A5FA 1P0CA 4A73A 5F3RA 4R5HA 5A3VA 2C2XA 4R1UA 2X86A 3ENKA 5TGDA 3ZU5A 1Q1NA 1XDWA 3DZBA 3KEOA 4BNMA 3N74A 4EGFA 1PWXA 5CEEA 4PLTA 4BV8A 1TT5B 1YL7A 3KBOA 1XQ1A 1D1TA 3HUDA 4Z0HO 2EF1A 3MWDB 3DBHA 1P1FA 4U6QA 1Q0LA 4YTEA 4YAGA 5EESA 3C7AA 4O0LA 4F6LA 4ALNA 1VC2A 3TZKA 3UH1A 3UCXA 3NUGA 1ZJYA 1H5QA 1ISJA 1NYTA 1NQAO 5ENDA 3DC2A 1SNYA 1XEAA 4BNYA 1PQPA 2RCYA 4AJKA 3WXBA 2HO5A 3DBVO 3LSYA 4P8RA 4NPCA 4EZBA 3R1IA 3AU9A 3D3EA 3FI9A 1NR7A 4GH5A 5IZCC 1PEDA 2OP0A 1ULUA 2HSDA 4W7HA 2PWZA 4ZQEA 5A9SA 3WGIA 2Y68A 1QRRA 4H3VA 1BHSA 3HFSA 1DJNA 4B4WA 4IDFA 2O7QA 4ZVVA 1NXQA 1SC6A 5TQVA 5JNLA 3I5MA 4MKXA 4E21A 4ZQGA 2OUIA 3OIDA 1HE4A 2DQ4A 4J0FA 1T26A 4DLAA 1HF3A 2NTNA 5GZ3A 2IZZA 3A06A 1LLQA 3K92A 1R4NA 2Q1UA 5JFOA 5U1PA 4CQMB 4XYBA 4JX8A 3VVBA 2HK9A 4BV9A 1NPTO 1NVTA 2PZMA 3C3XA 2JHFA 1J49A 3GFGA 4PRLA 4FB5A 1NNUA 2PGJA 3DZGA 2NACA 3D1LA 3TFQA 4BQPA 3FTPA 3ZN2A 2OZPA 3AFNA 4R1SA 1BDMA 3H6KA 3QJ5A 2WMDA 2YFQA 5DF1A 3IIEA 1ZH8A 1X13A 5BSFA 2BI7A 4MVJG 4ALIA 3RUCA 2AE2A 1J6UA 3JQ8B 2HMTA 3IC5A 3TPCA 1ML3A 1YBAA 1YJ8A 3CEAA 1CQIA 1DLIA 1HDOA 4PFJA 3GZNB 4FDAA 5L7WA 3AM4A 4XQEA 3C1OA 1LLUA 1O0SA 1PJ3A 2HMVA 1E1NA 2QG4A 1QORA 2OMEA 1R6DA 1DAPA 1SBYA 5A1TA 1JWAB 2D8AA 2NV6A 4RPJA 4YA6A 4YAEA 3WIDA 5HA5A 2D4AA 3RUIA 2YQ4A 1I24A 1ZXBA 2WE7A 2G1UA 1P31A 2UV8A 5BT9A 4YWJA 3ZNQA 1WXDA 5TT1A 1JAXA 1V3TA 3IKVA 1X1EA 3RUFA 3BMQB 3ZHYA 3BTVA 3SLKA 3W4IA 5C37A 1LDNA 3MOIA 5BR7A 4AJNA 2GN6A 3UKOA 5KVVA 2VTDA 2FP4A 1JN0A 2Y1EA 3PP8A 5DBGA 3PHLA 4NI5A 4ZRMA 3DOCA 4UVIA 2C5EA 5TSDA 4E31A 2DTXA 3FF4A 5TIIA 2EG9A 1GV0A 2DBQA 2EV9A 2D0IA 3WLEA 2BFMA 1CRWG 1X15A 4LVUA 3DZFA 4BNVA 5L3ZA 3WGHA 1OOEA 1E5LA 4B7UA 4BB5A 2W2LA 4A27A 3FR8A 4U8GA 1DHTA 1JVSA 3K73O 1KVRA 4NFHA 3MZ0A 3RKUA 1CJCA 4QTZA 4HFRA 4GI2A 3I4FA 4TMFA 1PZHA 5TJHA 1V3VA 5G2OA 4FC7A 4L0QA 3VC7A 4CM1A 3RASA 5KIAA 1G1AA 5KTKA 1HDRA 2DUUA 4E6PA 4NJOA 3WMWA 1B3RA 1T24A 1N5DA 4R01A 9LDTA 1UXGA 4OH1A 3WOHA 4GVLA 4Q3CA 3TRIA 3TZ6A 3WTCA 1K5HA 2A35A 2Q4EA 4RDHA 5DULA 4NBUA 5DCUA 5FFFA 2B5VA 1R4MA 4B3HA 5JPIA 1GPDG 3L0DA 4NMHA 1BXGB 4PLFA 1JW9B 2OBNA 4BNWA 4K9DA 3E9NA 1U28A 1NQOA 2EP5A 3CTMA 4WLVA 1VM6A 3RC9A 4GGPA 3LF1A 1HDCA 2BGMA 5BSEA 4CLXA 2Q1TA 1HZJA 2P2SA 3NT5A 3PZBA 1RJWA 1GAEO 1AXGA 2H63A 3JQ8A 5DN9A 2W4QA 4U6SA 2O3QA 3S8MA 5A9TA 3BMCB 2YV1A 1E3LA 3ETGA 3K9QO 5EINA 5I9MA 3TZCA 5L53A 3BMNB 4JBIA 2UUPA 2PY6A 3KXDA 4UUNA 4M54A 1O5IA 5JYEA 3GAZA 1KEPA 2J3HA 3R3JA 4R16A 4KOAA 2Y1GA 4WCFC 2VZ8A 3PWSA 1IHYA 4Q3DA 1B14A 1FK8A 1GQQA 4BGIA 4XRGA 3GN2A 1T25A 2W2KA 3DO5A 3G17A 2BKAA 3KSDO 3AJRA 4AJJA 3MJCA 5IF3A 3EZYA 5EPOA 1P0FA 1VI2A 1P74A 2EWMA 2WD7A 1OC4A 2X6TA 3WYEA 1HEUA 4M55A 4FS3A 5K9ZA 4BVAA 4KDFA 2PA3A 2CDCA 3EVTA 3W8EA 3ZWWA 3D0OA 3S55A 1T2AA 2CVOA 1EQ2A 3WB9A 3OJLA 3GVIA 5U4QA 3HN7A 1EEHA 1N92A 2V6BA 2FOIA 3AOEA 4Z3KA 3DZIA 3IUPA 3K31A 3GGOA 4CM4B 3MOGA 1HWYA 4D44A 1KBZA 1F8GA 4CV1A 5BNFA 5B4VA 4IDEA 3RC2A 5A4DA 3B1KA 4NJMB 1XSEA 1NPYA 3NRCA 4BNXA 4YJFB 2UDPA 2W2LD 1GFSA 1LQTA 3D7LA 5IG2A 1W0CA 4WOJA 4LISA 4LRSB 3QRWA 4IGEA 1H2BA 1WDLA 4RVSA 3GHHA 4BO1A 5U9CA 1W8DA 3U4IA 3R6DA 3JD2A 5IN5A 4E13A 4N5NA 3ZHBA 3CE6A 3RUDA 2Z1NA 2VRCD 3C8MA 3VH3A 5CAEA 4NJMA 3UCFA 3BHMA 2JHGA 3GVCA 4XQ9A 5GZ6A 1QYWA 3UGKA 3S2FA 2JFHA 3W6UA 2Q2WA 2H5LA 3AUAA 1RYDA 2DU8A 2J8ZA 3V1UA 4MPDA 1FJHA 4FOSA 4PLVA 2J3IA 4JROA 4Q3NA 4XGKA 4OSPA 4Q3EA 4B79A 2AQIA 2EKPA 4OQYA 3SX2A 1UDCA 3B20A 2X0RA 4XYGA 1K6XA 1SO8A 1R0KA 1ZFNA 1A27A 3NDJA 1CYDA 4KMSA 1PS0A 1R66A 5CHEA 4AG3A 2BFOA 3CZRA 1YB1A 1BDBA 3DWFA 3P2YA 4Y6RA 2JJYA 4XRRA 2FN7A 4QSMA 3V1YA 1Q2XA 5L95A 3DHYA 3OM9A 2IYOA 5AXCA 2PKQO 2I65A 3LC7O 1LSOA 2UYYA 3ZWOA 3DBLA 1N2SA 1PL8A 1UXHA 1Z74A 4WCDA 1LDYA 1ADFA 4M1QA 1F17A 1WMAA 3JD3A 1I33A 4YRAA 5JCJD 3CH6A 2YV2A 2UUOA 1NQTA 3UAGA 1BGVA 1IUKA 2ZB3A 4BL5A 1C1DB 1P44A 4XIYA 4CLOA 1I30A 3MJSA 3G3EA 4S3MA 4A03A 2X5KO 4NBWA 1GEGA 2PTGA 1YQDA 3JQAB 5G4KA 4ALKA 4BO8A 3IAHA 2FPGA 1WZEA 4BKQA 4Z3DA 3QWFA 1PR3A 2QIOA 2XXJA 3H9EO 3PTZA 3C24A 1EUZA 2DC1A 4Z9FA 2CMDA 4FSHA 4RF3A 3JYPA 4CR8A 4ITUA 1XU9A 5CEFA 3HWRA 2I6TA 1AUPA 2PH3A 3ONEA 3RBZA 3TOZA 2X9GA 2YHIA 3DBHB 1U3UA 3C7DB 4XR9A 5T64A 3GZ4A 2GGSA 4NU5A 1SOVA 2AG8A 2EJVA 3JQ7A 4KUGA 5JSFA 4FBGA 3NGLA 2C2YA 3FD8A 4IUYA 1HZZA 5EN4A 2VHZA 3QWIA 1ISFA 3OQ6A 2VOEA 4DLLA 4WECA 4DQVA 2P5YA 4DC1A 4B4VA 2GYYA 2Y67A 1QR6A 1AE1A 3BTSA 4OJNA 4YEDA 2AE1A 4YQYA 1YGYA 4S1VA 2B4QA 2G5CA 2NU9A 3PJEA 4Z9XA 1MV8A 3PDUA 1NM5A 4IMPA 3FBTA 3ROKA 5L51A 1B8UA 1NWCA 3IQDB 5HS6A 1EK5A 1PL7A 2C7GA 3L6OO 1PJCA 3RQSA 2QYSA 5CDUA 3KYCB 5JDCC 4DYDA 1HE2A 4RQTA 4L4XA 1MG5A 4YXFA 2HMWA 4ZQHA 2J6IA 1I5RA 1KETA 1O94A 2IXAA 3I1JA 4MJLA 5ICSA 4WEOA 1DC5A 4NZ9A 4Y9DA 3H7AA 1DAOA 4XYLA 2A4KA 2IDZA 5MDHA 4P4LA 1I2CA 2I66A 4RL6A 2EGHA 3BMOB 3LLVA 3EYWA 2NQ8A 4EUEA 5IDXA 1HE3A 4KQXA 5JBIA 4ROSA 4X54A 4P4GA 4MIEA 1VSVA 1WWKA 4I5EA 4NIMA 2PZKA 1Y8QA 2OO5A 3ENNA 4ZGWA 4M89A 4AFNA 1G0NA 2EEZA 1VL0A 2HAEA 2I3AA 2O3RA 3H2SA 3ZWAA 4IDAA 2BMAA 2FZEA 1E6EA 2NVBA 3DHEA 4MP3A 3U3XA 4PG6A 3SJUA 3ANLA 3VPGA 1DB3A 1S7CA 4YRDA 1IHXA 4R5MA 4Y6PA 3O9ZA 4HKTA 3ETEA 2HLPA 1U7TA 4ALJA 5TS3A 3RC1A 2EXXA 2GN4A 2YDYA 1FDVA 4LSMA 4TQGA 4J49A 3U9LA 2BGLA 2WEKA 3ZWPA 4GMFA 1Y6JA 3NGXA 3ST7A 4R4JA 1C0KA 2AHRA 1SOWA 5HRUA 3U5TA 3JQDA 4FFNA 1GYPA 4M8SA 1LDEA 4TRJA 3RD5A 4IZIA 1BVUA 4J3FA 1LDMA 1V8BA 1SB8A 3JYNA 2JCYA 3CPSA 3RUHA 1GUFA 3NJ4A 3TSCA 3U0BA 3ZNOA 2GSDA 4HADA 3GH3A 2NVUA 5F1PA 3W8DA 4DC0A 2I9PA 4EEZA 1LEHA 1SAYA 9LDBA 4YJGA 5A03A 1R12A 1MXHA 1WPQA 3G49A 1KY4A 3JQEA 5A9SB 3GPDG 3OF2A 3E18A 4WJZA 5IXYA 1H2HA 1VJ1A 1R0LA 2LDBA 4YQZA 1LDBA 3GGGA 1K3TA 1ZKMA 1LSSA 4EBFA 1AXEA 3EAGA 3IDSA 4RDIA 2OXIA 3CXRA 1WAMA 7MDHA 1S6YA 4CV2A 3F5QA 1EVYA 2O3TA 4J7UA 4NDNE 1YWGO 2FSVA 3GEGA 1K89A 1N1GA 4DBZA 1MC4A 1VLLA 1ZSNA 3WGOA 4QEDA 1HKUA 3TOXA 2VHVA 2NUAA 3ROQA 2XAAA 3QHAA 3ZW8A 1D7OA 1I2BA 4UVDA 5COQA 4IGFA 1YS4A 4FPXA 2VRCA 5A9RA 4C4OA 3H5RA 3INTA 3GNQA 4ZU3A 4D3SA 1YDEA 3AW9A 2J5KA 3A1NA 3ICPA 1K6IA 1IE3A 1NP3A 4YCAA 3RROA 1F0YA 4R1NA 2O50A 4DVJA 1NHWA 3LC2O 1CEQA 4OO3A 1O95A 3NT2A 2G76A 4EW6A 1BVRA 4J16A 4Q9NA 2ZYGA 1JDJA 1F06A 2JCVA 1SB9A 1YVEI 2FR0A 4DIOA 3OHSX 3TZQA 5HS4A 2VZ0A 2W8ZA 2NU6A 7ADHA 1LDGA 3NV9A 1IB6A 4BO0A 1V3UA 1DOHA 3BMOA 2WYWA 3IUSA 1YB4A 1E77A 4IPTA 4BKOA 4K6FA 2ZB7A 2YZ7A 3TZHA 4TRRA 1DJQA 1JQBA 2PNFA 1SPXA 3W1VA 4W9NC 4XWYA 3HB4X 3KLMX 3GGPA 2QQ5A 1IPEA 2G82A 3D5QA 4FD3A 4J91A 4L8VA 5DNAA 1EVZA 1JKIA 3WGTA 1UZNA 1Y5MA 4GPD1 4XGIA 1C0PA 3S2IA 3GA0A 1E3IA 1WP4A 5KJ1A 4IJUA 4IXTA 4MKRA 2P68A 4CMHA 5J23A 5KVCA 5ES3A 4ND1A 1ZW1A 3LZ6A 4TRNA 4MVJP 2NVWA 1JLLA 4GX2A 5BSGA 3I6IA 1A9YA 2O48X 3GLQA 3LF2A 4AJ1A 2WDZA 3EVNA 4GX5A 4OAQA 4A7PA 5KNLA 3JQBA 5TRTA 5BSHA 2EIHA 3O8QB 1DC3A 1BG6A 4BNIA 1HLPA 3SXPA 2OGUA 2AG5A 1U4OA 4RORA 4EJ6A 3UXYA 4GVXA 3VH2A 2WYUA 2DLDA 1GYRA 5ENVA 4KP7A 5TJ9A 4HP8A 3OICA 4RLSA 1UDBA 2EJWA 3PIIA 1XWFA 1ARZA 3PLRA 3ASVA 2ZIZA 2O2SA 1GQ2A 1WNTA 4AJPA 2FHSA 4RCVA 3O38A 3UOGA 4URFA 1HDGO 3ANNA 1HSZA 1PJ4A 3K2BA 3R3SA 2O7SA 1YJQA 4D0RA 3CZMA 4B4UA 3ONFA 1ONOA 2ZTLA 1HYGA 3NTQA 3RI3A 2NU7A 1DIHA 4QXMA 4FFPA 2AXQA 2P9GA 3DTYA 4CM9A 3A9WA 3ZV6A 2VHYA 1YB5A 3PGXA 3VPSA 1EBFA 1FMCA 1LRJA 3ZU2A 3GMSA 4BMSA 3WLFA 4RVFA 4CM8A 4L75A 2JAPA 1EMDA 4GWKA 3LLSA 3EMKA 3OEYA 5JO9A 1X7DA 1P77A 3IP1A 3LT1A 5T57A 4D79A 2C0CA 4PLCA 4J43A 3L07A 1KIFA 1Y9EA 2E37A 1X7GA 1BXZA 4XQGA 2I99A 4D45A 4TRMA 4J1TA 4XGNA 3SC6A 3WQQA 1MA0A 3O03A 4OXNA 4EITA 5DOVA 4L76A 3L6DA 4PLHA 2AQHA 8ADHA 4AJ2A 1GTMA 4J90A 3WTBA 3F1LA 3QVWA 2IEDA 2NTVA 4NFSA 3GOHA 5JMPA 5K6AC 1G0OA 4DPMA 4FW8A 5IFLA 1X1TA 4GBJA 3F5SA 4CLRB 3F46A 1QXSA 4QFCA 3R0IA 1P3DA 1NVMB 3M2PA 3BTOA 2R00A 4D0SA 4Y8VA 3RBXA 3DOOA 3PYXA 1A9ZA 4BOYA 2E49A 2J5QA 3ORFA 1ENYA 1ENZA 1U3TA 5TX7A 3WBBA 4OOFA 3E5RA 1ZIDA 3PK0A 2B36A 5C7IO 2X0IA 3LU1A 4MVJM 3UW3A 3AK4A 1U7HA 3D4OA 4II2A 5DCWA 3LVFO 5G0UA 3DONA 3AI1A 4HX5A 4JQCA 4MP8A 4M49A 2OHXA 4ZN6A 3UN1A 2GZ3A 3PHHA 3QIVA 5C3MA 5G4LA 1E6UA 2O4UX 3FN4A 3F4LA 4HY3A 2X8LA 5FWNA 4R68A 4CMEC 4AJLA 3ZWBA 3VPFA 4JJFA 1T1SA 1DRVA 4J1QA 5JW6A 4GLOA 3WQRA 4BO4A 5A5EA 4GWGA 5LDGA 3NAQA 4I5FA 3H5AA 3U62A 3GRPA 1X0XA 3DZHA 5AXAA 3WS7A 1YOVB 4B7XA 2C54A 2DTEA 4IIVA 4DPKA 1CF2O 4DTIA 3ADOA 1L7DA 4NBTA 2VYND 4LGVA 3TF5A 2AEFA 1MB4A 1LUAA 4OGWA 1ZJZA 2FPIA 4M87A 1O89A 5JO0A 1YQGA 3ABIA 1JAYA 1PGNA 4JXKA 2POQX 2IZ0A 2FY8A 1UP6A 2GUGA 3UUWA 1U5AA 1B26A 1Z6ZA 1TA4A 3U49A 3WQSB 4Q3BA 2AEMA 1TB4A 3I52A 1EFKA 1M67A 5KVSA 3I83A 3MCVA 1E7QA 3L4BC 3K30A 1PX0A 5A06A 3NJ8A 4OM8A 3JD1A 3BMNA 4PG7A 3H65A 1A4UA 4KUHA 4KDEA 4MVJA 4CM8B 1PGOA 3OECA 1HYHA 4QQRA 1ENPA 1H0KA 3LT0A 2DUWA 2QRLA 1KY5A 4JNKA 4LW8A 3HDJA 3DMTA 3DZKA 4IXWA 3RFTA 2NQTA 1NTOA 5L4SA 2AEJA 1HSOA 1UR5A 3AUSA 4JK3A 3AOGA 1ISGA 2O4CA 5B12A 5K6AA 4HV4A 1JU9A 4YAJA 2VUSA 4R9SA 4PN3A 4RF4A 4ID9A 5GMOA 5G0VA 3D3WA 2H6EA 1I0ZA 2GN9A 4MO2A 2CY0A 4CMAA 1FDTA 2PLAA 4WGGA 4PVDA 4WE3A 5IZ4A 3E8XA 3I9JA 2DTDA 3PHGA 3ZV3A 2A9FA 1F14A 1IZ9A 3FPCA 4H7PA 2HRZA 4Q3AA 5F1OA 5ILGA 3RFXA 1QMGA 2RIRA 4G5HA 4BO7A 2DKNA 3GHYA 3ZWYA 1DFHA 1EDZA 1VRWA 2FR8A 3KYDB 3JQGA 3Q3CA 3JCZA 3KOUA 4UUMA 1A7KA 1MP0A 1NHGA 2P4HX 4U7WA 3D4PA 1E6WA 2Z1MA 3OJFA 2Q3EA 2CSUA 3ITDA 3PDJA 1ZEJA 1QG6A 1DIBA 2AMFA 4BMVA 4YJDA 4UEJA 1VL8A 1XCBA 5IXSA 4RQUA 4E5NA 2ZCUA 1B16A 1N8KA 4OOEA 5DZSA 3QA9A 4UUPA 1E3SA 1I01A 2DAPA 3M1LA 4RPHA 3BA1A 3ON5A 2GN8A 3E9QA 1LLCA 3SEFA 3ROPA 4NHEA 1U8FO 3QY9A 2Q46A 3G1UA 1QP8A 1Y9AA 3LYLA 3VH4A 4NR0A 3IL2A 1WW8A 2VHWA 1U5CA 1EVJA 3RSHA 3GN1A 3HDQA 5FI5A 3FRJA 2EKQA 3OSUA 1DIRA 4TROA 4J2OA 3QQPA 4HFNA 5H81A 3WSWA 4EDFA 1ZK0A 1PQUA 3JTMA 1D1SA 3M2TA 3JYOA 2HK7A 2IE0A 1E1LA 4Z0TA 4FFRA 3W4KA 3OETA 1B15A 4R3NA 4OQZA 2EKLA 3F6YA 1PS9A 2W98A 4RVDA 4CLHA 2BGKA 4XEHA 2VHXA 4BO9A 1EVIA 3U4DA 5IJZA 1CQJA 1M76A 1PQWA 3QVSA 4K6CA 3PWZA 2WM3A 2J3KA 4IJWA 1I8TA 2JL1A 5JC1A 4F3YA 3I9MA 1DBVO 3JQAD 1E7WA 2Y0DA 3JQGB 5DDIP 4BO3A 1NASA 1UXIA 1X14A 3JQCA 4OKIA 5A3JA 2Q99A 1PWZA 3UHAA 5HWSA 4L9RA 3P5SA 1PJBA 3NTOA 2FPPA 4PLGA 1K0UA 4IBOA 2YV3A 1BMDA 1PU2A 1QV6A 3DBRA 2VRBA 5GZ1A 5HBRA 4ND5A 3GG9A 5B37A 4XJSA 1A71A 1DRWA 4TZKA 3ITKA 4CM7A 5THKA 2W90A 2I3GA 2Q2VA 3PLNA 1T2FA 4RZIA 3WDSA 4G65A 4GKBA 4MVJD 1T4DA 1WVGA 5GY7A 4YR9A 2WWRA 5L4NA 4OMUA 3ZNPA 5L7TA 3GR6A 3Q6IA 4LCEA 5G0SA 4L73A 1Q7CA 4CUJA 1EUCA 1I10A 4N18A 2Z95A 3RIHA 1E3EA 5EERA 1LQUA 1PR9A 4XQCA 2B4TO 2X4GA 1KERA 3TQHA 2AQ8A 1PZEA 2X5OA 4E2YA 2Z5LA 4YPOA 1U9JA 2I67A 2XXBA 3HB5X 3NX4A 3WGGA 3JQFC 1CWUA 1ID1A 4J9VA 4J2HA 2XF8A 1J5PA 2D5CA 1IZ0A 2CFCA 4NBRA 4QO7A 4HBGA 1X0VA 1PJSA 3EW7A 4XIJA 3KLPX 4CM9D 1GU7A 4W6ZA 1UAGA 3GUYA 3CINA 3CMCO 3IJRA 4YVFA 1Y8RB 3K6JA 4CM5A 1LXCA 3H9QA 1P1RA 2ZQZA 4J4TA 4IY1A 4DMMA 3GDGA 4A0SA 5CG2A 2VTEA 5T8KC 1JWBB 3U09A 5JAMA 2V6FA 2NADA 1EDOA 1PSDA 3I3OA 5JY6A 2VOJA 4UEKA 5DP1A 3RJ9A 3W8FA 3FCOA 1DXYA 4MVJE 5CP8A 5BNIA 2OP1A 1C14A 3I9OA 3L4SO 2GO1A 4BNTA 3AOEC 4CR6A 1J4AA 2V6GA 4HUJA 2JAHA 2VCYA 4U0KA 4JGBA 2HK8A 4BMNA 4RO0A 3L9WA 4QUKA 3Q11A 2J5RA 4CODB 4QFDA 1NFFA 3TWOA 1HDZA 3WICA 1QYCA 3AY3A 1M6HA 3ADPA 3NDIA 1A4IA 3OEWA 1NAIA 4OKNA 4CV3A 1LI4A 2E82A 4NU6A 4FIZA 3C7CB 3RWBA 5CDGA 1DHRA 5BQFA 4IIUA 2VYNA 3VZRA 2D2IA 2VNAA 2IODA 2IYPA 3KM0A 4WEQA 3D4NA 4RVHA 4J6FA 1A5ZA 1GDHA 5ER6A 2CF5A 3WGYA 2BELA 2DFVA 5B4TA 4AL4A 3KB6A 4XDYA 3PPIA 2B0JA 3S2GA 1WLYA 2F00A 3AFMA 5AOVA 4B4OA 1KEUA 2HKIA 4NNJA 2BD0A 2E48A 3D64A 3GEMA 3GVHA 4R3WA 4FJ0A 4GQAA 1U2GA 2JFFA 4P4NA 4KWHA 5AYVA 4E0BA 3GY0A 5DCYA 3OQ1A 2SCUA 4L4SA 3OJEA 2ZYAA 3SLGA 2NLOA 1ONNA 3EK2A 4RZHA 4J4HA 2BF7A 3RCBA 3BHJA 3PQDA 3E9MA 4DBVO 3HDHA 1XR3A 3GRKA 3A28A 1IPFA 2IRWA 3Q2IA 4HFJA 1GL3A 5BNTA 1PZGA 1BW9B 1Q0HA 5CG1A 3IMFA 1GQYA 4BGUA 3ZWXA 3VZSA 5DBFA 4A5OA 1Y8QB 2XPCA 3GZNA 3JQBC 1RM4A 1YBMA 1CDOA 4E33A 1KC1A 4IQ8A 4YJHB 5H83A 1PIWA 4GAEA 2C5AA 4QX6A 5IDQA 2ZTVA 3ZW9A 4NK5A 8LDHA 3JQAA 1LLDA 3P2OA 4WKGA 1V0JA 1SEPA 5COAA 3GVPA 1LRKA 2DM6A 3JV7A 4ZQBA 4AVYA 3FR7A 5KOIA 4MVJI 3PYMA 5G0TA 3CMMA 5HTOA 3FNFA 1EBUA 4QT0A 3WJ7A 1E0DA 4PLWA 4JP3A 1U8XX 1UZLA 4N7RA 2VYVD 3RC7A 4CMJA 2VQ3A 4D46A 3P7MA 1XIVA 3OIFA 4TVBA 5IAAA 3WMXA 1MFPA 3OBBA 1FDUA 2X22A 4OYRA 1GEEA 4IDBA 4TSKA 1X7HA 1H6DA 3I4CA 4WUVA 1PJLA 1W4ZA 1D8AA 5L45A 3TL2A 4I08A 2CUKA 4CL3A 3PXXA 4Y6SA 1BW9A 3ZZNA 3O8QA 4E2WA 1AGNA 1ZMOA 2VT2A 3LDHA 2PH5A 3RKRA 1JTVA 2Y99A 1UXJA 4OHUA 2CDAA 4YT5A 5AXBA 1Y81A 3COSA 3F4BA 1T1RA 4XYEA 2FWMX 1U3VA 2BFAA 4IMRA 3KSZO 4Z0PA 5TF4A 1NPDA 5CPFA 2AW5A 2E4AA 3VDRA 1M75A 2GPTA 4BQRA 4CR7A 2RBEA 3VDQA 4CJXA 1NWHA 2C29D 3VVCA 1R15A 4UEOA 3BXXA 4DL9A 2X1HA 1JA9A 3DFUA 4XB2A 3K5PA 4NH4A 5DOZA 5JAIA 1DO8A 2QX7A 4WLEA 2ZK7A 2DVMA 4LCJA 1OI7A 3INGA 2EW2A 4I5GA 2AA3A 4CMCA 3MWEB 3ZHZA 1Q7BA 2OORA 2DBVO 3EY4A 4W82A 5KCZA 1PTJA 2ZQYA 1MC5A 5G0WA 4PRKA 2IEBA 5KKAA 4D43A 4MKZA 1RKXA 2G0TA 2GDZA 5LC1A 2HQ1A 2D3TA 3OQBA 2ZB4A 5ICMA 1QKIA 2YJZA 1BWSA 2HUNA 3FSRA 4HXYA 4IZHA 3INRA 1YDWA 3AM3A 4B3IA 4EUFA 3WFIA 4D42A 4G81A 1GZ6A 1TEHA 1HL3A 3IP3A 3B1JA 1E5QA 4FFMA 3ASUA 1OBFO 4BNJA 2I76A 2QHXA 3GNSA 1UP4A 1B3BA 2J3JA 4XX0A 1LC3A 4FJ2A 3L6EA 5MGBA 2LDXA 1LSJA 3HNPA 3IOYA 3GNTA 3P19A 2V6MA 2OL4A 3JYQA 4EJ0A 3RUEA 1I32A 1ZXLA 3AM5A 1UUFA 2D1YA 2JKVA 2Q1SA 3U4HA 4XB1A 4J0EA 3D3WB 3RU7A 1I36A 3JQ7B 5H82A 1GZ4A 4XDZA 5ADHA 3ICCA 3ONDA 5ITVA 1G6KA 1AN9A 4PLYA 3FHLA 3QWBA 4YDRA 4TWRA 4YYZA 4GLLA 3I6QA 5JXWA 3Q0EA 3F3SA 2VN8A 2P91A 2DPGA 2Q1WA 4J4BA 3BZUA 3I9KA 1TLTA 3A14A 1I3MA 4J9UE 3GF4A 5L40A 4WASA 1KVSA 5AVOA 3ZNNA 1FDSA 1PJQA 4FGSA 1I3KA 3FPLA 3WFJA 2O3UA 4DLBA 2HMUA 2RAFA 2C20A 3K8ZA 4IM7A 2NTJA 3KRTA 4E32A 3MJVA 5IZCA 3NTRA 4PZEA 4OL9A 3G0OA 2B5WA 3VAZA 4BGEA 3KSUA 4FR5A 2HJRA 4XA8A 2CDBA 5KKCA 4O59O 5IDWA 2GERA 5C7OO 1LBEA 3CSDA 3TFOA 2QZ9A
chains in the Genus database with same CATH superfamily
4JU8A 1E7RA 4X00A 4EVSA 1HFJA 2CF6A 4H27A 1Z45A 3V8PA 4R1QA 3ZV5A 3ZHTA 5E6RA 2HGSA 4WXEA 5AVSA 4JXXA 2JVJA 4YCLA 1C4WA 3MT0A 3NDRA 3GLHE 3KJEA 1M1NB 1YS2X 4AMUA 5FUXA 1OQAA 4NNOA 3SXUB 3GRVA 1MVNA 4C3UA 3I23A 1ZBQA 2I34A 4LRTB 4MGIR 2ZE6A 5I9SA 5B30A 1OD6A 4NP6A 4N8DA 4OREX 5F2EA 3CG0A 3MLBA 4TS1A 1AC5A 3UVEA 1NX6A 1SMKA 2IXTA 4OLHA 2ZRCA 1XELA 4M8IA 1KORA 3QKUA 2QRHA 4BNHA 3QXGA 421PA 3WAGA 3KQNA 4RXUA 4HT3B 2ZRDA 1RWNA 3QFTA 4JOSA 3S7TA 1WM1A 2WU1A 4Q24A 5TGZA 1ZCJA 4PRYA 3VU9A 4C6TA 5C52B 4DIBA 1RAGA 2E5FA 1RHMA 3OEHD 1WU8A 1WSWA 4E5YA 5JD5A 5JYCA 1KEZA 3EEFA 5HEKA 3RRYA 9GPBA 3AP2A 1GN8A 1D9XA 5K4GA 2JCXA 2ID9A 4NBLA 4UVGA 5AW5A 3SSOA 4A91A 3UEOA 2GPJA 3A6PC 4FJ1A 3QVTA 2F3UA 4PR0A 5DHFA 3TSZA 4CU2A 3SEQA 3PXGA 1ABBA 1JPUA 3ZCTA 1XAIA 5E95A 4YRMA 3PVZA 2B4AA 4MWDA 2CYAA 2IXBA 4IHJA 4IJKA 5ALFA 1VE7A 4PZCA 2ZRKA 1M5UA 4HHEA 4PC3A 4JNCA 4XKJA 2CD7A 3ZU2A 3IAAA 4AJ4A 2OCXA 1DCFA 4X66B 1SHZA 4IOJA 3ZD9A 5JU6A 4DRXB 3RK0A 1N0UA 2VAVA 1L4NA 4CCYA 3HL4A 1YIDA 1R37A 4FE7A 4H7FA 2NYUA 4ZWNA 4ZD6A 3Q2KA 1GL7A 3QELB 3ZIAA 5DI9A 2PCJA 1ENOA 4L5JA 1JQKA 4MV0A 1W88A 3V4ZA 1FX0B 3G8DA 4XR4A 5ESRA 2ZVJA 3VR4A 1IY9A 1ORRA 2RHCA 4DMRA 1NIJA 4YV1A 1G3IA 2OFWA 1WXQA 2VF2A 4EUHA 1UMDA 4FE3A 5CYFA 1UFKA 2YIJA 1K8YB 3BC1A 3PWKA 2GRJA 4HQNA 2R00C 2H1VA 2ZR8A 1JFSA 2X5JO 3SHOA 4QG3A 3P26A 4J1SA 2DHEA 3HNRA 1S2GA 3A05A 4WINA 3T5GA 3RU3A 4ZJUA 3U19A 4RTOA 4R3UC 2FX2A 1G8JA 1JPJA 3O83A 1W93A 1DX4A 2WKRA 1N36B 3PHJA 4WLOA 1R18A 2X5NA 3SR4A 1YKFA 2ZJOA 3FX2A 4GBMA 1M2JA 4V03A 3V3KA 1K9VF 2P35A 3QVGA 1B2LA 3L3BA 1CVRA 1QLHA 3NU1A 3TJZA 1X7YB 4J0GA 1W4BA 3MCWA 2OFFA 4EI2A 1K6EA 3GT7A 2QN2A 4QYSA 4WNCA 2QD1A 1MZPA 2JH9A 2Q6LA 4QRIA 4RTQA 1PX2A 2HDWA 1QQBA 1FY2A 2VPIA 4R9UC 2QRVA 5CLJA 2D3WA 3DR3A 1KRXA 4H7IA 4D9KA 3WADA 1TCBA 1FF9A 4K6KA 3U4CA 4M9RA 1ZGGA 1C1DA 1JALA 1XU4A 1YQTA 4HWPA 4BBPA 4E2XA 2EP7A 1D3AA 2W4IA 4Y1EA 1KJ9A 4LDZA 4MCAA 4UDOA 5I9LA 1YNOA 1FFSA 1SGWA 1OI4A 2MJLA 1YQ9A 2KWIA 1WHSB 1TW3A 4I8IA 4J1NA 4AVYA 4L4YA 3VKGA 2VIIA 2GNPA 2H1CA 4XD2A 4G0NA 4D3DA 1I1OA 2N3ZA 2I8CA 5CNKA 2FFHA 3OMLA 2UUCB 3QKRB 3WJAA 1GL6A 1P2DA 3P4XA 2X0NA 4LRQA 1VE6A 3MTGA 4DW8A 2HV8A 3QW2A 1EX9A 4LCBA 2IH4A 4IOLA 3H9UA 3ONWA 5HPYB 3LGXA 5KWJA 4X8HA 1EDEA 1Y5NA 4CI9A 2PZFA 2ZPAA 1TUIA 2P75A 3JAKB 3A10A 4FDLA 5DM60 2C59A 1AZTA 2WIDA 1FE8A 4QDJA 3LUCA 3RSCA 1YQQA 4EY3A 1OAAA 2QRJA 4KIFA 4NMWA 2X3UA 4OHCA 5CYGA 3RU2A 4MHTA 3R3WA 1SH7A 4NMLA 5IJXA 5DGCA 2VWHA 2JAUA 3HBNA 3KQQA 3IH5A 2JFWA 3G2OA 1XAGA 1DCTA 1NBOA 1EX6A 1WW3A 2O0MA 3A1CA 3EVZA 4MW1A 3FNEA 4US1R 4LMRA 2Y1KA 4DQXA 3DMTC 3RADC 4ZPXA 2PLRA 1CS0A 3T5BA 1RWWA 1RXSA 1U80A 1KYQA 1X1QA 3BMQA 3KLOA 4XWWA 3A2LA 1ZAYA 1MVOA 2P1DA 2FKAA 4CMIB 1MJGM 1XHFA 3U37A 5TARA 4X97A 4CHTA 2RH8A 1Z73A 3EVBA 2O8FA 2GA8A 2P1RA 3OIGA 2E1RA 4BXOA 3RJ5A 3OPYA 5BR8B 2ZXUA 1LSUA 2NQ2C 3DXFA 2J59A 1VMDA 1NW7A 1YHNA 2F8LA 3HG7A 1Z25A 3LBNA 4RHYA 5D3MA 5HJEA 3HPQA 1WMFA 4JC4A 3S2EA 4JT2A 2P2NA 3KYCA 1PZXA 3GLVA 4I19A 4DCVA 3W2FA 3JTEA 3ZDQA 3R5FA 3H97A 3E9ZA 4JBGA 2WF7A 4FE4A 5T3UA 4LQLA 4JYMA 1ZKDA 2HF2A 3N75A 4LRUA 4TLMB 4YBRA 4C4PA 1Y9ZA 4DXHA 3E7FA 1JHAA 5B7QA 5JS8A 2WB2A 4YACA 3T34A 5CVEA 3GI1A 4K40A 3CE9A 4OLFA 2QNRA 5KU1A 6ADHA 2IS1A 3E1KA 4A2CA 2FLWA 4JUBA 3P9CA 1KH1A 3AFGA 1V1RB 1EZ4A 4XJTA 1CIVA 3HY4A 2EYQA 4QU8A 5TT0A 5KSZA 2B2NA 4QJ3A 4GR9A 4MPRA 4TLAA 3ZYCA 3EQZA 4OI1A 4C4AA 5IYZA 1DXHA 3DEYX 5KYVA 1ICEA 4IDCA 2PUBA 1HLGA 6LDHA 1DIGA 5LNK1 1MH1A 3D7NA 4OFBA 1BDIA 4YMUA 2HMSA 3KYBA 4R1LA 5TVGA 3WLPA 1KMNA 2F3SA 2XUIA 4LV8B 4P5EA 2C4HA 5BMOA 3ORRA 3AO0B 1I94B 2IWRA 1JZSA 3LXRA 1E3JA 1JEQA 4RJJA 3WLKX 1ZRHA 2CFIA 3MT8A 1HFEL 5DB4A 4O4LB 4RM3A 1XXHB 3G2PA 1QIFA 3L1HA 2C9DA 3TLEA 4RENA 4EATA 5F9HA 1YZFA 4R2JA 4G0OA 4KXVA 3ZEIA 3A3KA 4HDAA 4RAOA 1LH0A 3ZGZA 2B4YA 2DR3A 4LTNA 1H2ZA 2W2MA 1RWVA 3E6AA 4JCOA 4RELA 4FZVA 4V39A 2WC1A 1H9BA 4QUHA 1DDOA 1DFGA 2K4MA 4W7SA 1P61B 3L04A 2XMBA 4MTCA 4Z0NA 2HDHA 5C8XA 4WLFA 4EF5A 2G4CA 1CE8B 2WE8A 1U28C 1Z2CA 3V00A 5JYDA 3H4IA 1G20A 4FN4A 4HK4A 2BLLA 3KWMA 4LYFA 2EL7A 2PT7A 3JZAA 3FBGA 5SZJA 4QVKA 5JCJA 3IP8A 3JSAA 5CIQA 3AWDA 1QVWA 3OZEA 2O2XA 2DG2A 4Y2HA 1QF9A 3ZG6A 1U9CA 1Y4ZA 2GYVA 2R8PA 4BO2A 3EASA 3EULA 3MJEA 5IDYA 4UDNA 4AW9A 1DX9A 3JY6A 1X9HA 4RVGA 4OMDA 1M1ZA 2YUTA 3C7KA 2NM0A 3QPCA 3MMXA 2ZYTX 2W83A 4H7HA 4QODA 1IHUA 3EXEA 4D81A 1RHKA 2PR2A 1J70A 3BTUA 4JP8A 4UEWA 3RRFA 2HDNB 1CX9B 2QN9A 3UCEA 1AM4D 1EX7A 1NVDA 2P5UA 3HSSA 4WKCA 5E4TA 3H3JA 4YP1A 2HT1A 3SC4A 2FRXA 3BN3A 4FX5A 4GKVA 1CDZA 1J33A 1FB5A 1KO1A 4NL4H 3UBTA 3HDTA 5E3HA 4FDMA 4FLFA 2MMCA 4RY9A 3BRQA 4ARCA 3KQUA 4KMMA 3WGZA 4D4JA 1U0GA 5GAJA 2BE9A 1W76A 4EJMA 3QE4A 3DE1X 3SNKA 4INAA 1ZK2A 4F91B 3EPJA 5JV5A 3BD7A 2G5TA 3AI2A 3DDOA 4I3HA 1OFHA 3P9RA 3FNBA 3LT2A 4FU0A 5K4HA 5F2KA 4DDKA 1KI4A 2AC4A 2QLNA 2G70A 5T5QA 2PCLA 2W7TA 4MVXA 3AW8A 4QHYA 1E7YA 3CF6R 5C5CA 4DR7B 1C7ZA 1HQKA 1RYFA 2JI9A 2YS6A 3IMEA 4OCZA 1MXFA 1H8HA 1WDMA 1Z7EA 5C46F 2P90A 4MDHA 3RE1A 3TUIC 4DGQA 1UDRA 2CT8A 3PEYA 1N7HA 3E82A 1SWVA 3O4FA 1H9AA 2B7CA 2WU4A 3OA0A 4B0OA 1QYVA 1FP1D 3SM3A 5I4IA 4D8WA 1K6JA 1URPA 2PD3A 3PX3A 5JXJA 1O1YA 4LOKA 4B40A 1IN1A 3G5LA 2XSZD 3SAJA 1HTBA 3GGJA 3QENA 2GH1A 3A4VA 3W6NA 4ENWA 1E92A 3QSGA 2AJBA 1KVUA 3R40A 3T0IA 1E2HA 4EW1A 4LMPA 1LS1A 5KYKA 2IBTA 1YL6A 2Q6VA 4TWAA 4KVGA 1ZK3A 2VP9A 4UD6A 1VPDA 4YPFA 4YXWA 1Z3IX 3PX2A 4I50B 5TNXA 1WV1A 3FNHA 4K3VA 4AF8A 1EIZA 2D0OB 4FOOA 3EAQA 1BQ4A 3LO8A 4S1NA 2WP0A 2FJUA 1GYQA 1U8EA 1YL5A 3GA5A 4GSKA 2Y1LA 5F12A 4C78A 1E79D 1HR0B 4EPTA 2CJFA 3KB2A 3KQPA 3L7KA 4LMAA 3VU8A 2LUOA 3F0TA 3HEAA 1FJXA 4UREA 1HE5A 1VYVA 1WXIA 3DDNA 4PYMA 1BFDA 2ODNA 1LV7A 2F43A 4IDOA 3V34A 4FB4A 1YA8A 3PNLA 1KEKA 2YZGA 3PLAE 3OEEA 4PAQA 2CMKA 2WJZB 1DBQA 1U1IA 2H2IA 3DBLB 4OIMA 4UKDA 1YVPA 4RGQA 3CXUA 1IOZA 5DBOA 4I9HA 1H4TA 1KZ4A 3G02A 2C2BA 3NYQA 1VKOA 4KR0A 4MRSA 1VP3A 4GKAA 3UK6A 3ZDDA 4C7KA 2IPAB 1GUYA 1ZH6A 2XE8A 1Y3CE 1M2OB 3IP9A 3ZJ5A 3HE3A 2R6AA 3DCYA 1F5SA 5ENZA 5GONA 4YMIA 2MT9A 3LWNA 3MS7A 3SSNA 2A3NA 3EFOB 2QOEA 1UH5A 3PUKA 1Z6AA 2HFKA 5JQGB 3SJ7A 3D3KA 1QQAA 3J7TA 4PZDA 2P6UA 5H3HA 4GHWA 1NUTA 2XDAA 4KJXA 1GRNA 3D5EA 5LSAA 3TJRA 4HAYA 2J0QA 4BC0A 3MJ4A 3OJWA 4X1KA 4XOIA 1D7AA 1XL0A 2RHLA 1SVNA 4YJHA 1QPGA 1FUIA 1XTJA 1BMQA 5HJ7A 1G7TA 4AICA 1V25A 5JS6A 3ETCA 4JT8A 5LD2C 3U1VA 1RYEA 3A9RA 4JEMA 1C3LA 1TT7A 3AKYA 5DT9A 1YXMA 3SFTA 3T4XA 5A02A 4JBLA 3UENA 1DEHA 5F4BA 4DWVA 1QIGA 5LN1A 1IK6A 1TMOA 1ZSVA 3CLSD 4NENA 2QUHA 4Q0MA 3RKSA 3ZE1B 3ZCSA 4HNTA 3HEBA 4YJKA 2BH9A 2WG1A 5AKYA 4QTYA 4UOEA 3W3ZB 1QO9A 4AMVA 1W36B 3KYDA 4JBXA 4X1KB 1U0OC 3NYWA 2PZEA 4FONA 2H9IA 1DPGA 1M8GA 3NHJA 5T8KA 1YA4A 4J8PA 3V5NA 2WPDA 2HXGA 2B35A 4RH3A 4EY6A 1LTQA 3RT1A 1YS1X 1UC5B 2VAMA 2V9CA 2AN1A 2W8BB 1Z39A 4L0MA 3VR2D 2BFCB 3FDZA 2X3FA 3CUEF 3SKYA 1J0DA 3O26A 4XQ0A 1Y80A 4P3NA 4RJKA 1GZVA 5ER9A 2XDQA 3KR2A 3M6AA 5I7FA 4OBEA 1I6LA 1KMHA 2AJDA 4BKUA 4I14A 5CVVA 2ON6A 3WRYC 1MG0A 5FLKA 5JARA 4D9CA 1WY7A 3L7BA 4OATA 5CMLA 1KMMA 1W5EA 2GK4A 2R1VB 5H80A 3UHPA 4LY3A 3K70C 5F9MA 1IL0A 5G3ZA 4BY9E 1MX3A 1TQ4A 2Y1DA 4UM5A 1G20E 3BFKA 1T8UA 3I8XA 4DT1A 3ZKWB 3HDVA 3BL8A 3AP1A 1I3NA 2HL6A 2H08A 3P0JA 3PC3A 3COZA 2PGDA 3WWCA 5E7QA 3IIMA 1EP3B 3GNLA 2FRDA 2Y0EA 3I5XA 1XCJA 5BV7A 1H2AS 3ETLA 2XNCA 3G85A 1SU6A 4G9GA 4Z5XA 1FYWA 1AHPA 5JR3A 4HNSA 2EAUA 2QLMA 1KJNA 4I55A 1ZN7A 1D03A 2PMKA 1SM4A 1TKAA 5EFZA 4JC0A 4X6XA 3UMFA 2UXDB 1E1KA 1TIKA 2I55A 2O8CA 3A7DA 4ONEA 2ID4A 4CF6A 4PQEA 1DC6A 1WV0A 5K8VA 2V65A 4H08A 5BQ5A 1NJFA 1XP8A 2G17A 3HKEA 5JZ9A 2O3SA 1YTUA 3ZZUA 4KR6A 5E6SB 4YY3B 1THZA 1C9NA 2ECPA 4CTJA 5DM70 5C1OA 1Y3IA 3MRSA 1DC4A 2BFFA 1A72A 1DKNA 3IAM6 3HGTA 3OAAD 3S1LA 3KETA 4BO5A 2V8OA 2XB9A 3DYVA 3CLSC 4LHWA 3IUNA 1XQXA 3M6IA 2V96A 2DXIA 1KQNA 1JMKC 1NRIA 1OCEA 1TI7A 3VNRA 4S1OA 4Y98A 4DXDA 2QYOA 1JG3A 1U4SA 2CUTA 1XK6A 2GPBA 4GX1A 4XTRA 4AJEA 3TG2A 4NNPA 3K5HA 4H4DA 4PX3A 4DMCA 4GOMD 1AS2A 3KB1A 6YASA 2PPLA 5AHXA 2OBYA 4G9EA 3H8SA 2M32A 4Y2TA 3JATB 4BIIA 4BWVA 4HVTA 2YY6A 3VHLB 4F5WA 1EFCA 3FKQA 1Q83A 2QLFA 3SDSA 1CP3A 4Z1OA 2BEUB 2FRVA 2BI8A 5EY5B 1DV1A 1GNPA 2YJ3A 3T7IA 1EUCB 1P75A 4R7TA 2WW8A 4YXFA 3HXTA 1PJTA 1K7CA 3BDVA 1GD1O 1N75A 4R41A 2Z2IA 4LNUB 3SZLA 4DM7A 4N40A 2QW8A 1QV9A 5K0ZA 1K7YA 2WD7B 1Y3DE 1LCIA 4LAFA 3NEJA 4ETNA 4EPVA 4W99A 4UOZA 2FPWA 3GCDA 2JD0A 4YS6A 4BNNA 3VX3A 4KW7A 1TT5A 1Y1TA 4NFYA 4TWBA 1R6XA 4UAVA 1GQFA 5DFAA 4AO8A 5JQGF 5F2NA 1ZN9A 1E5VA 3KV3O 5G1NA 3AUJB 2FDXA 4I8XA 3U7IA 2GD1O 3H2IA 3UTCA 1XKQA 2BR3A 3KHUA 2SKCA 4K6MA 3V2HA 1P45A 3M89A 5K8TA 2PUHA 3OTHA 4Y7CA 4BNUA 5LQCA 2J07A 1P81A 2XQGA 5CW1A 4K28A 4IG9A 2JARA 4L6AA 1N6PA 3RSFA 1WXFA 1R5JA 4BX0A 1HXHA 1XDUA 2F4VB 1IY1A 5LB4A 1TPYA 4X8OA 4AX8A 1CEYA 3QEJA 5C7LO 2VXCA 1XZMA 2FCRA 2WUGA 2FW9A 2VT3A 1YRLA 1E6MA 3DOHA 1DEAA 1M1YB 3I12A 3L4EA 3OM1A 4ILKA 3TX2A 4JDPA 3KPUA 3VKUA 4DG8A 2YHSA 2A9QA 2IY9A 3M5CA 3LQ4A 3HKBB 3AG6A 2Q5CA 2I2DA 4Z4GA 4ZRNA 1I3LA 4MV8A 1T4CA 2ESRA 2H17A 3A25A 1K5GA 1ULHA 4HDCA 2E6UX 1L1EA 3KUXA 4R7ZA 3WYBA 1VOTA 2TMDA 1TIPA 1T9HA 3B1FA 3VHRA 3EGWA 2Q4TA 2AWNA 1JBEA 5ALWA 5DX1A 1W5SA 4B75A 1CJSA 1NFQA 1QG4A 1IATA 3GRCA 2OD9A 2JCBA 2PL5A 4GE3A 3Q9UA 2IZ1A 2QYTA 3P2JA 1COZA 1Q1ZA 2J4DA 3L1VA 3OH8A 5JNSA 1OGIA 2H0AA 4DJ5X 1LPOA 1X8JA 2EFYA 1DXOA 4B6PA 1VSUA 3R41A 2WQZA 1NLYA 5KNBH 5AKHA 5T6MA 1TDJA 4JLMA 3K6SA 4EA7A 3IDAA 1SKUA 3FXAA 3FGOA 3N39C 4MJ7A 2IK8A 1B6RA 5FOUA 5AM3A 5CDHA 3THWA 4WHMA 1Z5ZA 2ZSIA 1XLTA 2VSNA 1ULZA 3EZLA 2XVAA 3AIKA 3GGCA 3JRXA 3NKLA 3O95A 4Y6OA 3IB3A 4ZO9A 4KQJA 5H70A 1EQAA 4B8WA 1SD1A 2ZJ1A 3EDQA 3K16A 4M37A 4BCDA 2NUTA 1G6OA 3LVBA 1M2WA 1XDBA 2Z4RA 2DLCX 1N5KA 2I91A 3UJ9A 5JASA 1KJZA 2OG1A 5KAMA 5EJ9A 2QNBA 1P7PA 3OQOA 4NYMQ 2V4ZA 2YXNA 4I4LA 4IDHA 3UAWA 2DERA 1C1XA 2VI5A 4EPYA 3W04A 2FPXA 2BHRA 1NATA 4M8KA 3T7JA 5A5VA 4MDEA 2YJTD 2IPNA 4KE9A 1UJMA 3VGJA 4XWKA 2CHQA 5BW8A 3KZVA 1Z36A 3SSMA 3EB9A 3RGWS 4MWCA 2P9EA 1E94E 5IX8A 2BDUA 4RSGA 1V8FA 1JDNA 1V9LA 3WGVA 1A5AB 3AKZA 3L2OB 1T6NA 3U3KA 1F8YA 3FNQA 2JRLA 3WLSA 6REQB 1RFGE 3TXYA 2AOWA 5A5FA 3QU4A 5B1DA 4NDZA 1WCXA 1MA3A 5EKDA 4A73A 3OKCA 4R5HA 1E89A 2CW5A 3M83A 4PPYA 2RH5A 5K3AA 6GPBA 2X86A 3ENKA 4EGAA 1JEQB 4FEEA 5J1SB 1Q1NA 3KEOA 4MA0A 1Q1EA 2GM9A 5JFTA 5KOJB 3N74A 4C7OB 3NDPA 2EW1A 1KYZA 3K8YA 4BV8A 4BEBA 1YL7A 2QR2A 2YZ2A 3E15A 1D1TA 4Z0HO 1OWLA 1WHTB 1ESCA 2AX4A 4H1TA 4ZAXA 3DBHA 4U6QA 5B36A 2EFJA 5IVKA 1UF9A 5EESA 2LIVA 2ZITA 2FWNA 3B1ZA 5IAGA 5F7XA 4ALNA 2O54A 1IU9A 1C81A 1G64A 1PJZA 1A2OA 3FIUA 5JD6A 2NUAB 3UH1A 3LW8A 3UCXA 2BDEA 1RZ3A 1H5QA 2R60A 4JV5B 1ISJA 5LLTA 4PQRA 1SNYA 1XEAA 4NZNA 4D6YA 5JMTA 1UEIA 4AJKA 4XH9B 1YVUA 3PV0A 3DBVO 5AHWA 4ZOLB 3WGNA 1FQWA 3VX4A 2PJZA 2X1LA 2E3JA 2WSSD 3ETJA 4EZBA 4KLRA 1JEYB 1ZNZA 3FI9A 3D31A 2BH2A 1JA0A 1O97C 1QU2A 1ZGCA 3N59A 2XGJA 1NR7A 4KK4A 3SJBA 1QKJA 2RHJA 4AMGA 1L1RA 3FDFA 3ZD6A 3RYCB 1ZDMA 1ULUA 2OP0A 4OQPA 4ZQEA 1FL9A 3FSEA 4YJ2F 4PGHA 2NX2A 4EYOA 1CS0B 4FQ5A 4CG3A 1C3EA 2Y68A 1KSGA 4PIMA 4H17A 4OHZA 4QM7A 4RDXA 1HO3A 2Z8YA 4RX1A 4E07A 4GQBA 1SC6A 1UKYA 3PB3A 1S9DA 4K1XA 2REBA 4HD8A 4Q47A 2G1KA 4ZVLA 1NGSA 1EU1A 1DMSA 2QTGA 3I2IA 4N5DA 2I62A 5HKAA 2FQXA 2RSLA 3C87A 5LJLA 4P80A 3T1OA 1HE4A 2DQ4A 2QMOA 4LS3A 5A2GA 1T26A 3CH4B 2CYCA 1E9RA 3H8JA 3ONVA 3A06A 1OTXA 2OHOA 2VQ6A 2H9YA 4GI5A 4EFDA 2AN5A 3O92A 5JFOA 4WKBA 3O7WA 2XXAA 1YC5A 4OQLA 4J1TC 2X5XA 3TR5A 1A9XB 4G37A 1Z4PX 4CKWA 4PFSA 3RUPA 1DUVG 4QOEA 1EFTA 3EF0A 2WJ6A 1NBWB 1NVTA 4M3NA 2PZMA 3ET5A 2Z9DA 3ZR4B 5EEGA 5FAKA 1J49A 3R9KA 2AOUB 3TXXA 4FB5A 3VNQA 3PNSA 5E8RA 5I48A 1W48A 2NACA 3D1LA 3K9NA 1L6RA 4BQPA 2Y6VA 2OZPA 5J5AA 4Z4IA 2VF7A 2XD4A 4IO0A 2YFQA 5DF1A 1ZH8A 1P17A 5AOBA 1X13A 3VPDA 3QHQA 3VVMA 2HIMA 5KYWB 3FOCA 1KDPA 3TLKA 2LW7A 4XVHA 4DGSA 3DOEA 4YRSA 3HLYA 1XVUA 2AE2A 1GKUB 5L3QA 3RC8A 1XRPA 5DYNA 3LA6A 4GOND 1ML3A 5MN6A 4Z49A 1CQIA 1DLIA 4PFJA 2PXAA 4FDAA 1J24A 1IOVA 1D04A 1H69A 2HJVA 3PVCA 3RIEA 3V46A 4W5TA 3WB1A 3CVJA 2QG4A 3NFYA 3IOCA 3T61A 2CSXA 1EGQA 3A1DA 3KXKA 2ZBRA 1AUOA 1BS9A 2C98A 4JOBA 1P0IA 3HR4A 3EGCA 3QMVA 1NL3A 1KI8A 1CJUC 1I24A 4II7A 3ABZA 3KU4A 4MQEA 3JWJA 1UBFA 2WE7A 3PRKE 3EZGA 2ZS9A 4PYNA 1L5KA 1PZMA 2UV8A 4KMRA 3IHKA 5BT9A 3U7QA 3VYTB 4HDOB 4EP1A 4GI7A 3FROA 3N28A 5CT9A 4ETIA 5LLDA 3IKVA 2PXCA 1G42A 4U2BA 4TV8B 3U1BA 2KPOA 1T5HX 3SLKA 5C37A 1TJYA 2ZEJA 3OOWA 2DLNA 4Z2YA 3DEFA 1RD4A 4FI3C 3P9XA 3S1SA 1GRRA 1M2KA 4JBNA 2ECQA 4B6QA 5DBGA 2P2YA 5I5EA 1BE1A 2PYZA 2I4OA 4NBSA 5JRDS 2BC9A 1JFVA 3ZU6A 1LD3A 1RYMA 1BH6A 1I1NA 2DPYA 3A9TA 5TSDA 5LYJF 3FF4A 1GP2A 1Z37A 3D8RA 1SA0A 2G06A 2FPOA 1F38A 2B25A 2WF5A 3O1IC 2P4EA 2ZIXA 1JBKA 3G0GA 3TL6A 1TUBA 2IUFA 2XB8A 1G9SA 3VSCA 5AIBA 2UYOA 1UQUA 4ZAVA 4BNVA 3WJ1A 3BD9A 4RHUA 1ZOSA 3OQPA 3RRXA 3WGHA 3W5CA 1Y8AA 2YMLA 3I45A 4C0KA 3IOMA 2JAWA 2JZNA 2VSYA 5IWCA 5AR1A 2QTCA 4E46A 4OSEA 4MR8A 1M34B 1NZDA 3EOAI 1KY3A 2AG6A 4CF4A 2I78A 2Z98A 4G0PA 5LUBA 1XZDA 3QTBA 4HR7A 3RKUA 1JHOA 4DAOA 5IC4A 1MIHA 4O33A 4F9GA 1FTWA 3TTUA 1DPFA 3IV9A 4RK1A 5HM6A 4IIFA 4LBWA 1V3VA 2FSPA 2N75A 5G2OA 1YGPA 4KBYA 5CA0B 5IC5A 3R3HA 3CCBA 2G25A 3TLBA 5KIAA 4N8EA 7REQA 3FMPB 2JS7A 1UZUA 2ORED 3QH4A 1ORTA 2AUTA 2AX3A 4PYRA 4Y0NA 2WQ6A 1B3RA 1KDRA 1N5DA 1SRQA 1T24A 5IC6A 4EVQA 1YT5A 1C7FA 1C0EA 3HLTA 4JJ7A 4P82A 1K5HA 5F4ZA 3TRIA 4YAWA 1XQVA 2HA0A 3WTCA 4BV2A 3VKFA 4OIFA 2X76A 3TD2A 4ND8A 2B5VA 5FFFA 4B3HA 5LQDA 5JPIA 4JI4B 3TD9A 4MWOA 5D8DA 5CRIA 4BNWA 2ZBQA 1WETA 2WJWA 3E9NA 1RKBA 2VYQA 3CTMA 4WLVA 3M9XA 5A7HA 1VM6A 1Y5LA 1TEXA 2WOOA 3EF3A 5AD1A 4JWKA 1XC7A 2ZRJA 1UIRA 3QBDA 5EE3A 3GU3A 3GB9A 4X1IB 2RI6A 3CWCA 3F3MA 4HNUA 1L5OA 4F2PA 3EQ7A 3STTA 3FPBA 1GAJA 1IJBA 3ENZA 3KCNA 4P93A 5AKEA 4CTKA 4A2QA 4RMIA 1QNLA 2L42A 3KOOA 1P8JA 3OKAA 2YIDA 5AK3A 3S8MA 4MO9A 4DSTA 2QLTA 3ETGA 3M0EA 5I9MA 2XVYA 2OENG 2X77A 3BMNB 3NC4A 2Y0PA 3OQIA 4Q5IA 3R20A 3R8FA 4KLCA 1I5OA 3KXDA 4X1IA 3SDBA 4C6HA 3CLVA 5JYEA 4UNPA 1EVKA 1KEPA 3PKJA 2QZJA 1BKDR 1DKLA 1KEEB 1P9OA 2Y1GA 4WCFC 2NYAA 2VHTA 2Z3VA 3PWSA 4Q3DA 1KSFX 3CRNA 3K0FB 1DAIA 2ZJAA 3D2LA 3UB3A 4ZVOA 4D9GA 3EIOA 4NATA 5KZMB 1Z83A 4RW0A 2BUAA 2W2KA 3CNEA 3DO5A 4IR7A 2HRCA 3AJRA 4EFLA 2FU5C 4UFNA 3EZYA 5IF3A 5KB3A 3TQOA 3A0RB 2EJUA 1P0FA 4IHJF 3TFWA 5KMGB 1P74A 2IU0A 3A6JA 3TLZA 4V0KA 1Q95A 1E9SA 1ND5A 2BE7A 4C5AA 1E18A 5E0OA 4ARZA 1HEUA 2OZVA 1DELA 2F8MA 2FUCA 4FS3A 4BVAA 2A30A 5DTEA 1TJ5A 4G5XA 3O2SB 1Z15A 2BW0A 4UJ3A 1EA5A 2CDCA 3EVTA 4EG7A 3D3NA 3K0KA 3VR4H 4X6UA 3EIXA 3S55A 3SDZA 2CVOA 3NONA 1CUUA 1WXEA 1EDBA 1USVA 2IC5A 4ENVA 3DUFB 5G41A 3V32A 4S24A 3HJRA 1QK4A 5KMGA 4M76B 1RLOA 3DLAA 5ED4A 5FUMA 1P7CA 3V80A 3LY8A 1CUEA 3E4CA 1E2IA 5G02A 1WSDA 1CZNA 1W34A 3MOGA 4IKEA 1A8UA 3MS4A 2HA2A 3FAZA 4RADA 5BNFA 1M6EX 5DGHA 3RS4A 3ZDRA 4RFSA 1P18A 4NE2A 4EW2A 1PJ8A 1YQEA 1XVLA 4WKOA 1XMPA 5B1IA 3UMGA 4YJFB 4AS3A 2JGFA 2Q6IA 2W2LD 1GFSA 2QY9A 3OE7D 4BLTA 1LQTA 1T4GA 3OURA 1W0CA 3P2MA 4WOJA 1QF7A 2ERYA 2C3OA 2DRIA 4WZAA 3KFXA 4YYEA 1H2BA 1WDLA 1AKNA 4MV9A 4RA9A 1E5XA 3U4IA 5LJIA 3IKJA 1FP2A 2A5FA 2O0HA 4JL8A 1XRJA 3IP7A 4N5NA 2FG6C 1TEVA 1G5HA 4ZVPA 2XDQB 2GZMA 2A59A 3UCFA 3BHMA 1P4HA 1Y33E 3AEKB 4DMKA 1X7WA 4TT8A 3DE6X 3S2FA 2H5LA 4MEAA 2XYVA 4A6PA 1RYDA 2G9NA 2HO4A 3ZHUA 1FFWA 221PA 1WIWA 1YVRA 2J3IA 4LFCB 4RMJA 2CXRA 3UV3A 4JYAB 4B79A 3DUWA 4FMBB 5ES4B 3U7FB 4CIVA 5GWXA 4EMUA 3EY9A 3L6CA 3TG8A 1S0UA 1PSWA 1A27A 1JDPA 1RAAA 3SS9X 4W1SA 2HY7A 4HVLA 1SKYE 3DWFA 1NNSA 2A7QA 2WFLB 3P2YA 4CEHB 3QI2A 1NBMD 1JHQA 2IYVA 3I2FA 3AERA 4GG1A 4QSMA 4KQCA 4P92A 4HEQA 4B17A 5DNYB 5L95A 3OM9A 2IYOA 3AFHA 5I01A 5AM1A 1DOZA 1LJLA 1FNDA 3LC7O 3S27A 2UYYA 4OI0A 5TMDA 2RK6A 1GUBA 1N2SA 1Q1GA 3AL2A 3P9PA 1PL8A 3MN1A 4PXSA 3ZJVA 1VB5A 3UK0A 4EF6A 4EVRA 2C88A 3JD3A 1QHEA 3K0BA 3CH6A 2KLBA 1YRHA 3GLRA 1ZOIA 2UUOA 1TCAA 2J3EA 4DJJA 4BL5A 1XHEA 1JPVA 1XLVA 1C1DB 1AUQA 2WFLA 2HPZA 3IUYA 5F2OA 1YVDA 4KR2A 1GA1A 4MYUA 5LUAA 5H3LA 2YNMD 1YB2A 3ED1A 1TCUA 2C8VA 3AHCA 4HPWA 1XP5A 2X8JB 4OFXA 1AO0A 4S3MA 4A03A 1U8AA 5C1BA 5G4KA 1YQDA 3IUEA 4KYTA 5BURA 4YRFA 4RKWA 3BFXA 1VPTA 1Q19A 1A3CA 4FYXA 1PR3A 2G40A 2YVKA 3H9EO 1N1DA 3PTZA 1QU3A 4TKVB 3KQKA 3TH5A 2DC1A 3GFPA 3LKVA 4FFDA 3DTVD 3JYPA 1ZBDA 1I6WA 4RKEA 5CEFA 4C05A 2J3MA 4D9FA 2IE8A 3C8DA 2PH3A 2CK3D 4KSYA 5E2BA 4HH1A 5ESDA 4DNQA 2ZUSA 4WUTA 4CIDA 4NCXA 2UUAB 2AIRA 1JBQA 2Q9UA 4EJSC 5CB6A 3MFQA 2GGSA 4NU5A 1NE2A 1AN0A 4ZI3A 1ZH2A 4YUVA 4V1CB 1Q2UA 3AIIA 3HYSA 3NGLA 5K6TA 2O5RA 3FD8A 3H2HA 4IUYA 1V3QE 4W5HA 1A8PA 2CFTA 5E1BA 1Z56C 3NNSA 3N76A 5C5EA 2AMLA 1GGMA 3DM5A 5K8IA 2P5YA 1MQSA 1GPAA 5KEIA 5FHRA 4DJAA 1L5SA 4QDXA 2ORIA 4JT4A 4YEDA 1Y7LA 2O5CA 4PHCA 4YQYA 3ZVRA 4ZCRA 4S1VA 3LXUX 3QEOA 4GRIA 3ZVLA 2B4QA 4OJYA 5B3JC 3TEMA 4AYTA 4WXPA 3ZLUA 2NU9A 4Z9XA 5EZ6B 2PUEA 3K09C 3K1TA 2QJRA 2P2LA 3JARA 3O4HA 4PCUA 1S8NA 3LY5A 5CT8A 5D86A 3TIIA 4GKJB 3ROKA 5L51A 5LMNB 3AESA 1OU0A 2IHBA 4K9NA 1B43A 1H2WA 5HS6A 3UW1A 1AXRA 1Y89A 1HQYE 1PL7A 4BAUA 2ZI3A 5HYVA 2O8EB 2C7GA 1JECA 4ZMRA 1QAQA 1XTRA 3KYCB 3MD0A 3FCUB 2IXFA 5JDCC 4RQTA 4IMJB 4Q18A 4MUMA 5EGNA 4D2IA 1FJ2A 2HMWA 2WVAA 2FFBA 3CRZA 4W8HA 6AT1A 5K0SA 3E9DA 3BVPA 4G41A 3CLKA 5CFRA 1KETA 3KQHA 2BY4A 4MJLA 1O95D 1G5QA 3M3DA 3VYWA 5ICSA 1CQIB 1DC5A 2K87A 3KU1A 3PC6A 4Y9DA 3BE4A 3PR2B 3H7AA 1VI6A 3BSWA 1L8AA 1T9BA 3DO6A 1N6LA 3G2QA 3N0VA 2A4KA 3DAHA 4XCXA 1V43A 2CNWA 2FSIA 2P6NA 4U7JA 2IDZA 4Z9BA 3S4YA 2ZGVA 4UPEA 5BVGB 4LF9B 4ER7A 4P4LA 3O74A 3OX2A 3HU3A 4MQ4A 3HKDB 1FXWA 4FGKA 5A5DA 1S9HA 3OX1A 4ESHA 4B3GA 3EYWA 3B85A 3E61A 3MCUA 5IDXA 3ELWA 2DKOA 5F98A 4MS1A 2D2EA 4TLDA 2IOFA 2VDNB 2CKDA 2NU6B 1XTTA 1QHFA 3NV7A 4PFKA 4BLRA 5F7OA 1WWKA 3IIJA 2LXNA 4NXNB 5DWDA 3FGNA 3IMCA 4BFUA 1T1EA 4WCVA 1Z6PA 1G0NA 3VXKA 1HA3A 1VL0A 1LFAA 4BMCA 2FN4A 3L6BA 1ORIA 2YWJA 2QTTA 4Q34A 4D4HA 4LA4A 3NNDA 2JB9A 3BIWA 3CZ5A 4G25A 1Q3KA 3UF0A 5BUQA 2FWBA 2PQ0A 4ZAFA 2J9FB 1Q15A 3H42B 4X92A 1AOXA 2MR6A 4KNVA 4RA6A 3TW4A 4JI5B 1DZIA 1U0TA 2G67A 3WDMA 3A2MA 4C1BA 4BXOB 2FW6A 1CLEA 5TS3A 3RC1A 3Q3VA 3SJCA 2GN4A 4ALJA 4YCMA 3AR9A 3OIUA 2H59A 1FDVA 2JBHA 3N2LA 4LSMA 5D85A 3U9LA 2CFOA 2OGTA 1ZRNA 3ANXA 4WV3A 5AW0A 4R4JA 1RBQA 3TIGA 5LMCA 2AHRA 1KWKA 2JCGA 4EKDA 2FEKA 1QONA 4S05A 4XLZA 4PSAA 2JLSA 2ATEA 1JB9A 3K9CA 4WDQA 4Y9UA 3VU9B 3U5TA 3QK7A 2YIVX 3PUYA 4N6GA 2CXNA 4F5DA 5GM2A 4N3NA 4PWYA 3TTXA 1BH2A 4LRYA 5FBVB 2GPAA 3Q6MA 2QR3A 2VQEB 1PWYE 1ECJA 2J7PA 3I92A 2EDAA 3HCFA 2AUMA 3JYNA 3K0AB 1KFEB 5LZ8A 2D2FA 3ND8A 3RUHA 3NJ4A 1FFHA 3B8HA 2QV7A 3IUBA 3TSCA 2QPOA 3N0XA 3W9SA 1T0PA 2GSDA 2W0SA 1Z0KA 1D6SA 3G89A 3KTFA 4Y1RA 5CM9C 4BAZA 1LKZA 2RARA 1OI2A 2UVPA 3TDNA 3W8DA 1XMVA 4BLVA 2O20A 1FOEB 4QC2A 4AB1A 3U16A 2GK3A 3WRXA 1ZGHA 1WPQA 1KY4A 3RS9A 4DLWA 1K8XB 4QL3A 3E18A 4WJZA 5IXYA 4MLDA 4JI7B 1W9HA 3IE2A 3M5WA 4WZAE 3R9IA 3GGGA 4AY2A 1ZCBA 1K3TA 1ZKMA 2ZIWB 3AL3A 2AR0A 2Q0QA 5GOZA 2NN3C 1UDWA 3HXMA 3CXRA 3K0EA 5FPSA 3TKYA 1YACA 2NW6A 3LXXA 3SEAA 4G0UA 4IEIA 5CT4A 3NIBA 3D1VA 2L82A 1VLLA 3WGOA 4Q1FA 4I6JA 1DINA 5AK5A 3WK6A 3KVRA 4H7DA 3ZQJA 3QHAA 3NHSA 4QU9A 5CA1A 3LKDA 1D5CA 2DB3A 4Q9IA 1D7OA 5M34A 3F2IA 4LK2A 5COQA 1XEWY 2ZSUA 4UHFA 1J2EA 5ILQA 5A3SA 3UJDA 5ALQA 3SQWA 2QENA 4C4OA 2G0NA 4G4SP 2QA5A 2Z0MA 4ZCQA 4BVJA 1YI0A 3BK2A 4TXJA 4PO1A 3GNQA 4P7GA 3UUFA 4JI6B 3PTLA 4IYRA 1KFCB 2AH5A 3EGEA 3FTQA 4D3XA