3GMDA

Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKVTYPMVAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKAVSGIVNAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Structure-based design of 7-azaindole-pyrrolidine amides as inhibitors of 11 beta-hydroxysteroid dehydrogenase type I.
pubmed doi rcsb
source organism Mus musculus
total genus 96
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmdA00
1IULA 3B1JA 4Y67A 3JQ7A 2C7VA 2D5CA 3LDHA 2VUTA 3C85A 4PFJA 3WGHA 4K26A 1B8UA 3D5QA 4BNIA 2J3HA 4J7CA 3GUCA 5J23A 2EP7A 2QZ9A 3DMTC 4TQGA 1R0KA 3ICCA 5G0UA 4CL8A 2GN9A 5KKCA 4U0KA 1HYEA 3D5TA 2BLLA 4AJNA 1ZCJA 4NJMA 5GZ6A 2DBRA 2ZCUA 2Q1TA 4QEDA 4CMIB 1U28A 1I32A 4DPKA 2PTGA 4PLZA 1VKNA 4II2A 2GF2A 5THQA 3ZHZA 4E4YA 3EHEA 2Y68A 3FTPA 1QKIA 1C0LA 3E9QA 5JO0A 1CRWG 1R0SA 4FPXA 5DBFA 1P77A 1VL8A 3BHIA 5B4TA 4CMEA 2VYVA 1VM6A 1XLTA 4BB6A 2NTJA 4RV9A 4OAQA 1N9GA 4WCFB 5IAAA 1B3RA 3TFOA 1XSEA 3P5SA 3JQEA 2EWMA 1PJCA 5LDHA 1HYGA 1ORRA 5CDSA 2B4TO 4E5YA 3HN7A 2BH9A 1Y6JA 4MP6A 1NQ5A 4R1TA 3NJ4A 1KY5A 1A4IA 1LNQA 4BVAA 2J5KA 5KCZA 1J4AA 4QFCA 3A14A 3VTFA 3EY4A 1EVYA 3OICA 1H6BA 2P9EA 1C0PA 1Z45A 1Y7TA 1WAMA 1D1TA 2NVBA 4PVDA 7MDHA 4IXTA 2WYWA 1MB4A 3TQHA 4W7HA 3C7AA 4KUGA 3ORFA 4U6SA 2NACA 3PZBA 4XJTA 5BSFA 4RLHA 2YV3A 3OF2A 1GQYA 2FZWA 5A5EA 1FMCA 4EUHA 1I33A 3SX2A 3RUEA 4NHEA 4DYVA 2Y66A 2ZB3A 1P1IA 4YACA 4YJHA 3RI3A 4J1QA 3DBLA 3VHRA 1EBUA 4CMHA 1ZBQA 3F4LA 1RJWA 4YB8A 1GEEA 4G2NA 4BO7A 2D2IA 1QYXA 5IFLA 1T2CA 3EW7A 4DTIA 4U7WA 4J7UA 2D3TA 1NX6A 3WWZA 2V6GA 3S2EA 1NXQA 5I9LA 4J3FA 2J6IA 1MUUA 2O23A 5A04A 2P4HX 3NDIA 4ID9A 4R68A 1I0ZA 4BIIA 1PS0A 1KVSA 1H2HA 3I4CA 3E18A 1Z74A 1DSSG 2C5AA 4I9NA 3A06A 4BHTA 2AE2A 5IDWA 3QWAA 1E3SA 3B1KA 1ZK1A 3C24A 1PGJA 3AU8A 1RYDA 1TT7A 4GKBA 4ZRMA 1Y5RA 2Q2VA 3Q2KA 3PDJA 3RQSA 4A0SA 1F12A 1E3WA 2O3JA 1W6UA 4R4JA 3HFSA 3K31A 5JMPA 1J5PA 4E2XA 1U7TA 4BNGA 4PLWA 4DLLA 1HDCA 4RPLA 1FF9A 1MLDA 5F5LA 2GPTA 1GAEO 3DTYA 4CM1A 1GCOA 4R3NA 3VKUA 3WLFA 5I9NA 3F1LA 4LRTB 2X5KO 3WOHA 2FPGA 1U7HA 4Y9DA 1BVUA 5JC1A 2IEBA 4CLOA 2HRZA 4AJ2A 4Z0PA 1A4UA 3VPGA 2XPCA 1YOVA 1MFPA 1NVMB 3IMFA 1DHRA 3PYLA 2Y1DA 3WGZA 2OP1A 3JQAA 3DBHB 4CM4B 4M55A 4D0SA 2Y05A 3E6AA 1VC2A 2RAFA 2HO5A 3KEOA 3VH2A 3WYBA 4ZGWA 3RCBA 1HDOA 2VHWA 3LU1A 3LC2O 2J3JA 3V5NA 1A72A 1DDOA 1GUFA 3UAGA 2ZCVA 1DO8A 2G0TA 5ES3A 1PZHA 1TB4A 3ASVA 1PGOA 4MKRA 4AJPA 1Z7BA 4GQAA 2X0RA 3RAJA 5DT9A 2NWQA 3KZVA 5L9AA 5COBA 5F1OA 2W90A 1HE2A 4P38A 3WBFA 2W2KA 4EW6A 2BFMA 3S2FA 3UF0A 2GN4A 3PIDA 4PLCA 2H9IA 4XIJA 1KEVA 1PJ2A 3PGJA 2GZ1A 3PTZA 3SVTA 1RM4A 4XDZA 2WSBA 4RVDA 1YRLA 5TJHA 1HE4A 3NT2A 1F8FA 1IPFA 4QO8A 1QV7A 2X7HA 1TEHA 4TRJA 1UXHA 5A5FA 1C1XB 2HJSA 3JSAA 2ZTVA 1H94A 2G1UA 1GPJA 3TZHA 2GN8A 1X0XA 4KWIA 5LCXA 3M1AA 2AG5A 4FIZA 3DMTA 1PGPA 1X1TA 4NJOA 1T25A 3GGPA 4MKXA 1I3MA 2H6EA 5HTOA 1YL7A 5C7IO 4BUCA 2C20A 4FFPA 5T67A 2E6UX 4AG3A 1E6EA 2JKVA 4KDEA 3WYCA 2AEMA 1Y9EA 2R6JA 3WGYA 3CE6A 4GGPA 3U4CA 3KV3O 4BO4A 3WTCA 3HDJA 1EVZA 4XZ3A 3IAHA 3D3WB 4Q3NA 1E3LA 3JQFA 3U4DA 2V7PA 4MIEA 2O7QA 3DQPA 2B69A 3D1LA 2W4QA 2Z95A 2DBVO 2YHUA 4FS3A 3ZCXA 3GF4A 3W6UA 3FTNA 3HQ4O 4FGWA 5A9RA 2FSSA 2VYVD 3S2GA 4HFRA 1AN9A 4ND2A 3VOSA 3ZV4A 1WVGA 3W4IA 1VLLA 3C1TA 3JD2A 3MJVA 4AICA 3F46A 2VN8A 3JD3A 1JVSA 5K9ZA 1X1EA 3FF4A 2FWMX 1BMDA 3HUDA 3JQBC 3H5RA 3LSYA 1GUYA 3L9WA 3TZCA 1G0OA 2X9VA 4A5OA 3T7EA 1C0KA 3I6IA 4E12A 1U4SA 4HX5A 1V9LA 3FR7A 1U2GA 1GYRA 3I83A 3B20A 5EESA 4IDAA 1EBFA 3IP1A 4DC0A 2J8ZA 3CMCO 4YJGA 2D1YA 2C5EA 3HDHA 4XD2A 1NPDA 1P1RA 1MG0A 3GPIA 4CMBA 1YVEI 3V2GA 1Q7CA 3R1IA 1J49A 1BTOA 2DVMA 2PKRA 2Q2WA 1HE5A 1QXSA 1LDNA 3BXXA 4B79A 1PJTA 3ZGYA 3SEFA 3A4VA 2X5OA 2JCYA 3RJ9A 1PJSA 1OFGA 4HV4A 4TRMA 3KVOA 3A28A 2H1SA 1KYQA 3LZ6A 4BKQA 4CV0A 3DO5A 2DPGA 1UUFA 1MXFA 1MGOA 3KHUA 3IOYA 1K3TA 3QVWA 1RM3A 2IZ0A 5AYVA 1ZKMA 3E48A 3JYOA 5TNXA 2EHDA 3NTRA 2VCYA 2YFQA 5FI3A 4KWHA 5JFOA 4E2WA 3M2PA 4GWKA 3JQ7B 1UXKA 5DF1A 1I01A 2EKLA 4BNTA 4Y8VA 4BNUA 4XX0A 2A35A 2C54A 4IJWA 3DOOA 4N5NA 1IYZA 4P4NA 4D46A 4YT5A 2ZTMA 5JCJA 1A71A 4R3WA 3F4BA 4IZIA 1MV8A 4HFJA 3ICPA 5CFZA 4KDFA 4XKJA 1AE1A 4UUPA 4NJMB 4N54A 3ITKA 1BXZA 4B8ZA 5T8KA 3ZV3A 4YJFA 4I5EA 5THKA 3L9XA 3WGTA 4IJUA 1H6DA 3PGXA 4FCCA 3WJ7A 1LRJA 4LSWA 3MTGA 3CH6A 4L76A 3PRJA 1O89A 3MOIA 1R12A 3QWIA 3OSUA 4JBHA 3QJ5A 3GZ4A 4RVUA 2QRKA 2BFPA 3K2BA 1OC2A 2VHVA 2YV2A 1PL7A 2HLPA 2VT3A 4QUKA 4LK3A 4YT8A 1PR3A 1UZNA 1IE3A 1VL6A 4YBZA 4JBIA 4Q3CA 3Q0EA 3ZNOA 3PFWO 3ZW8A 3JQAD 3AUSA 3U4IA 1Z82A 4ZD6A 3JQGA 4DMLA 4GSKA 4OL9A 2RIRA 3RD5A 1A7KA 2WD7A 4Q3AA 1B16A 3FHLA 2DT5A 1TT5A 1GV0A 4FFMA 4HUJA 4BKPA 5KIAA 1ZSYA 3NGLA 3T7CA 5T6BA 3VVBA 2R00A 5JNLA 2NU9A 2ZIZA 3CMMA 5JO9A 4DWVA 1K6IA 1IL0A 4YWJA 3VKVA 4AJKA 4YXFA 4M8SA 3T4XA 2P5UA 3NGXA 5AXBA 3AUUA 5IJZA 4TVOA 3O8QA 1N2SA 1CERA 4MDHA 1KOLA 3GNTA 1YJ8A 1HYHA 2D0IA 4MJLA 1XEAA 1V8BA 5B4VA 2FSVA 3K96A 3N58A 1L7DA 3FR8A 2QW8A 4XRRA 1HDYA 4W4TA 1F17A 3ZNPA 4W6ZA 2HKIA 2WDZA 2LDXA 1IZ9A 3PI7A 4Z9YA 3N74A 3DBLB 1XGKA 2POQX 5KVQA 5DBIA 5JW6A 4E32A 1D4FA 1U8XX 3LT2A 5DCUA 1SZJG 2IEDA 3E03A 5L95A 3WG9A 3NJ8A 3P7MA 1DIRA 3UOGA 4YVFA 2EKPA 3KXDA 2A9FA 3D4OA 1YB5A 1JWBB 2AA3A 3GNSA 1NQTA 5DOVA 3PWSA 4J9VA 1YL5A 5JYEA 4NBTA 4PIVA 3GHYA 4ZJUA 5C7OO 3DL2A 3QV1A 1N7HA 4PZCA 3RBXA 1UP4A 1GZ3A 2NVUA 1JTVA 2YDYA 4A73A 3AUTA 2CDCA 5G4KA 4IMRA 2DC1A 2OL4A 3E5MA 2VYNA 4Q3DA 1KVQA 1QMGA 2J5QA 4R5HA 1K6XA 5I7FA 3FSRA 3X2EA 1XG5A 4J4BA 1T24A 2GR9A 4MVJE 2PFGA 4YPOA 1YJQA 5JSFA 1JWAB 5F21A 4ALIA 4F3YA 1MA0A 1FDTA 3JQBA 1PJ4A 4ALNA 3DOJA 3CUKA 3BTUA 4B4VA 3P2YA 3EDMA 1BSVA 4ALKA 3R3SA 4DMMA 4XYMA 4E5MA 1UP6A 1WNTA 4R1SA 5A4DA 5TX7A 1ULUA 3FNFA 4R1NA 3JQAB 2HUNA 1CDOA 1SCUA 3EAGA 3ROKA 2EF1A 1B3BA 4P22A 1ZJYA 4PG5A 3ZV6A 2Y1FA 3OIGA 3PJGA 4ALJA 1EDOA 4JP2A 3G0OA 1HLDA 1LA2A 5TSDA 2E49A 5BNTA 4LMPA 4A26A 3DBRA 2I67A 5HM8A 5B1YA 2EERA 3FI9A 4F46A 1UXGA 3PHHA 4XQCA 3RFVA 3B6ZA 4PGFA 1VSUA 5JDCC 4YAGA 3RJ5A 1TA4A 2VT2A 3O03A 3NT4A 4CUKA 2JAPA 3VVCA 2CSUA 2VHYA 2W2KB 2FY8A 1T2FA 3WDSA 5IZ4A 3I9JA 1LXCA 1PQPA 2ZYDA 4W9NA 3DHNA 1R4NA 2XOXA 1K5HA 1HZZA 2ZYGA 3JQ6A 2B37A 4XWYA 5JC8A 2NTVA 2BKAA 1I24A 4DBVO 4DPLA 1RYEA 2X1HA 3AW9A 4UVDA 4EZBA 4BO0A 3WGQA 2BGKA 5K0ZA 1I36A 3PHLA 2ZJ0A 1HWYA 4B7CA 4BKUA 4FOSA 1FXSA 3C8MA 5I7EA 1GUZA 1D3AA 4R41A 1I2ZA 4XQ9A 4ZU3A 3PHIA 4A27A 3L6OO 3HADA 3QY9A 5JCJD 2Q50A 2GLXA 3GFGA 1HEUA 1HDXA 1R15A 3W4JA 3B70A 4D42A 1WMBA 4JIGA 3QW2A 3W1VA 3PQEA 4HY3A 5EQFA 3JTMA 3TRIA 1B15A 1QLJA 4I08A 1T4BA 3DXFA 3LF1A 2Q99A 1XHLA 3AOGA 4QXMA 5TS3A 1LDMA 1V35A 1YB1A 4YAJA 3VPHA 4A03A 1PSDA 1V6AA 1UH5A 1DIHA 4LW8A 2HMSA 4OOFA 4WJZA 8ADHA 4JN6B 1PL6A 1E5QA 3GDGA 3AFNA 3IIEA 1NR7A 2Y1GA 3IC5A 2QIOA 5DN9A 3N7UA 3GUYA 4NFHA 3RC2A 1WLYA 1O95A 4PRKA 2OGUA 4GSLA 1E1NA 4RO0A 4DQUA 3RBVA 1F06A 1ONPA 4I9UA 3W4KA 2NTNA 4JP3A 4CPDA 3KYCA 4O59O 1ADCA 2ZYAA 3E9MA 2HU2A 2VZ0A 1DJNA 3KO8A 4R9SA 5ENVA 5I8ZA 2RCYA 4D43A 4FC7A 5C37A 2JCXA 5KJ6A 3ZHYA 3BMNA 4DLBA 2UVDA 1FDUA 5EJ2A 4RVHA 3RC1A 4NMHA 3I9NA 1BXGA 1YQGA 4J91A 4ZRNA 4BNJA 5HS4A 1U3UA 3MJCA 3TJRA 4RPHA 1W4ZA 4FR5A 1O8CA 4GKVA 4CM6A 1X7DA 4YJGB 4RPJA 2Y1EA 1TLTA 3OJEA 4GH5A 1H5QA 1P0FA 3ZU5A 3ZZNA 2ET6A 4IMPA 4J7XA 2C2XA 2VQ3A 3ASUA 3E8XA 1NYTA 3M2TA 4J0EA 4Z0HO 3PLNA 1E1KA 2B4RO 2NU7A 4UULA 3WQSB 3ZU4A 5IDYA 7ADHA 1ZXBA 3OJFA 1R4MB 1T2EA 1JVBA 4TMFA 3V1TC 4CV1A 3WIDA 5JDIA 5TT0A 3WNVA 4L4XA 3V1UA 1WZEA 3K8ZA 3U09A 1XIVA 1X14A 1H6AA 3OJ0A 1DJQA 1ZFNA 1ZO8A 1UJMA 1NHWA 3DB2A 2PD3A 1R0LA 5EPOA 1IOLA 1P1HA 3GAFA 4B4UA 4IS2A 1ZK4A 5T57A 3H9GA 4CM8A 4E5PA 3GDOA 4AJJA 3D3EA 3H2ZA 2BFOA 4TRNA 2NNLD 3A9WA 1E7MA 2VOJA 3ROPA 4BNXA 2I76A 1LSOA 3DAFA 4NQZA 3RUCA 3HSKA 1QYWA 3PWZA 1LU9A 4XB2A 1ZIDA 4LRSB 1DAOA 4Q3BA 1NHGA 5FWNA 1ENOA 1V0JA 3PJEA 1H6CA 4E5KA 3QP9A 4UEOA 3C7DB 4ZQGA 1YONA 5DP1A 1RM0A 3ZWPA 5JY6A 3EZYA 5G4LA 5JPIA 4N18A 3UKOA 1Y9AA 1KVRA 2BI7A 3NTQA 4ALLA 1DLJA 2PWZA 3TZQA 1E7RA 1PWXA 1P45A 4PG4A 3DHEA 5U1PA 2PZLA 4E3ZA 5IG2A 5JCXA 5L7TA 1Y8RA 4J2HA 3FBGA 3JV7A 1H9BA 1LDGA 2JFGA 1SB8A 3JQGB 5H82A 1EK6A 1L7EA 1ISHA 4M49A 1T1SA 3TWOA 4B4WA 5JDCA 2IZ1A 3QQPA 5CG1A 2V65A 4JXKA 2D8AA 2FHSA 2VNSA 4F45A 4IINA 5TGDA 3FD8A 3ROQA 4MVJH 3S2IA 4DUPA 1PJQA 1ZMTA 4G65A 1FDWA 1YXMA 2FN7A 2P68A 2BGLA 3UN1A 2ZTUA 3ZHXA 6LDHA 3AM5A 3O8QB 4PLPA 4WECA 1R37A 2GSDA 5EN4A 3WICA 4RF5A 3UH1A 4YCAA 1GL3A 3RFTA 3ST7A 3ZWXA 4HXYA 2AEFA 3LLSA 2GZ2A 3G79A 4IQ0A 1ENZA 1I8TA 2AHRA 5KVSA 3RVDA 2OBNA 4W99A 1AUPA 3GVXA 2NV6A 1YB4A 1WWKA 1UAYA 2QHXA 3GAZA 4KMSA 5AXDA 5L45A 1SMKA 3C1AA 1P31A 2HJRA 3AI1A 3AY7A 1PIWA 3SC4A 4AL4A 1U4OA 3STHA 1BGVA 6ADHA 2B35A 3HWRA 3AOEC 1OC4A 1Y8QA 2QZZA 1BW9A 4EI2A 3ZW9A 2Q3EA 1E77A 1MXHA 1ISJA 4YJDA 1LLCA 2PLAA 3BTVA 4J9UE 4N7RA 4CR7A 1Y81A 4K1LA 2PK3A 1QV6A 3VDRA 2IDZA 4M87A 5BR7A 1DC4A 3U62A 1OI7A 2HSDA 1W73A 1KIFA 4HP8A 2AQ8A 2Q45A 4OSPA 3JQ8A 1DBVO 1E1MA 3BYZA 4IDGA 4K6FA 4PG7A 4WLOA 4HNHA 3E5RA 3GR6A 3H3JA 3KSDO 4I5DA 1HSOA 2P91A 1DLIA 2C29D 4A7PA 5ILGA 4E21A 4GLLA 4DXHA 1DIBA 3OQBA 3MZ0A 4OKIA 3FRJA 4UEKA 4CUZA 1W0CA 4D79A 1A5ZA 1ZJZA 3H9EO 3DZKA 1I2CA 2NLOA 4IQGA 3I5MA 1YBMA 3H9QA 3ANLA 5CP8A 2C2YA 4PN3A 4WLUA 1ADBA 2B4QA 4M54A 1JAYA 2PA3A 1EQUA 3GVHA 3RKUA 2I99A 3RIHA 2B0JA 1VRWA 4CQMA 2CUKA 2PGLA 3Q9NA 2ZQYA 3OBBA 4GLOA 2P2SA 4LVCA 3PHJA 4LCJA 3KYDA 5L40A 3DHYA 4YT4A 3BMOA 2CZCA 3GGOA 1I2BA 2ZKLA 5CDGA 1X15A 3WQRA 3ZWOA 3RBZA 2WE8A 2VHZA 3OQ6A 4JGBA 5L3ZA 1CQIA 4CMJA 4TKMA 1DIAA 3DBRB 3K5PA 3VH3A 3GLQA 2PH5A 1NAHA 1NWHA 3HE3A 5IN4A 4U8GA 2E48A 5ILOA 5G2OA 1LC0A 5CDYA 1JQBA 4EBFA 1K0UA 3ULKA 1UP7A 3K30A 4J0FA 2DTDA 1LC3A 1EE9A 2X9GA 1AXGA 1PGNA 3BA1A 1LSUA 3PPIA 4BGEA 4E13A 2X0JA 5EINA 1PWZA 2AQKA 3G1TA 1UR5A 1UZLA 4E0BA 1Q7GA 2PNFA 3JQ9C 2WEKA 1J0XO 3HB4X 4L75A 2YV1A 3QWBA 2OFPA 3G17A 4YRDA 4ZQHA 4TKLA 3PVZA 1ZNQO 3F9IA 1Z73A 1JKJA 2A92A 2BF7A 2HMTA 1E0DA 4J90A 5DCYA 3IDSA 1H9AA 1SNYA 5CPFA 4O1MA 3IUSA 3KETA 3SC6A 1R6DA 4XDYA 1GR0A 3BMCB 4FQ8A 4MVJA 2Q46A 2PZKA 4XGNA 2BFAA 1BHSA 5C5IA 4NI5A 4YYZA 3ETGA 4RVGA 4EJ6A 4D45A 1KVTA 2Y0DA 3L0DA 4AJEA 4R16A 5KTKA 1HKUA 2HMVA 4I8XA 1LDBA 3AM3A 4CMCA 4BGVA 4RZHA 1T2AA 4CQLA 5L4LA 1LSJA 3DFZA 3GEGA 3TOXA 4BKRA 4A2CA 1UDBA 4H16A 1EUCA 3GVPA 1ZK3A 2A4KA 4EGFA 2DQ4A 1EMDA 5C7LO 4RVFA 1E92A 1NQOA 2QYSA 3GN2A 1X7GA 3VH1A 3KLPX 5U9CA 3DZGA 4BMVA 3HDQA 3ANMA 1LRLA 3F5QA 2I3GA 4OKNA 4BO6A 1U3TA 2QQ5A 4W82A 2OOSA 4MP8A 4MVJG 2IZZA 3O9ZA 4ND4A 1U3VA 2CVQA 2YZ7A 3I9KA 3K92A 1E7SA 1GTMA 3HFGA 4MVJI 1D8AA 4N5LA 2O3SA 4LGVA 3RUFA 4Y98A 3KYCB 2LDBA 1B8PA 1D7OA 4EEZA 4PRLA 3L07A 5HS6A 2NVWA 5BT9A 3EMKA 2FR8A 4IS3A 3GK3A 2RBEA 5TRTA 1IHXA 3RROA 2GO1A 1DAPA 4W7IA 4Q9NA 1YQXA 5A3VA 3ZWVA 1UZMA 2GN6A 3ONDA 4EITA 1KVUA 1BXGB 2EKQA 5L7WA 4XA8A 2B5VA 1G1AA 4D7AA 4QFDA 3BHMA 5HA5A 3WLEA 1DFIA 3RU7A 3VH4A 2C7GA 4Z3KA 1KERA 2VWQA 3E1KA 4QO7A 3U4HA 4NFSA 3GNQA 3QIVA 4WLNA 2ILTA 1YO6A 1N7GA 2HRBA 3GN1A 5G0SA 2HK9A 4B8WA 1NP3A 2D4AA 2VUUA 3EYWA 4I5FA 3RC9A 4Y6RA 1BDBA 4ALMA 4KUEA 5A9SB 4Z9FA 1U5CA 3TPCA 3TZ6A 1ZEMA 1WMAA 1DEHA 3CKYA 2P4QA 3OH8A 2HK7A 5TQVA 3WJAA 1RKXA 1NWCA 5JAIA 4R54A 3GZNA 2YHIA 3AOEA 4MVJF 2QX7A 4NBRA 4QSMA 2CD9A 3AUAA 5AXAA 3GGGA 2PD4A 2AE1A 4C7JA 1LSSA 3V2HA 1LLUA 1SOWA 1GYQA 2GZ3A 1HRDA 3GEMA 3VPSA 3G49A 4B4OA 1KY4A 2DFVA 4UVGA 3GH3A 4BQRA 4GX1A 1TVEA 3NDJA 4MPDA 3OA0A 2PGJA 1K89A 3KRTA 4X54A 5ICMA 3ZN2A 4FFRA 3JD1A 4R01A 2FOIA 1X0VA 2Q1SA 3JYNA 4YT2A 3AFMA 1YDWA 1GU7A 1PR9A 3F1KA 2ZK7A 3TFQA 1MG5A 1ISIA 1OZAA 3D0OA 1LJ8A 2X58A 1NTOA 1XU9A 3E9NA 1SAYA 2BD0A 2G76A 2IYOA 4BMNA 4BNLA 5IXYA 2OORA 1HETA 1GEGA 2O7SA 1Z75A 2GRAA 3I9OA 2B5WA 2WWRA 2EG9A 1N9GB 1NPYA 1YQDA 2FR0A 3PJDA 1P9LA 3DZIA 4OQYA 1PQUA 5ER6A 1DRWA 5IN5A 4RF4A 2DBZA 2TMDA 1PTJA 3GY0A 2PZMA 1N1EA 4CQMD 4YR9A 3DTTA 2DTEA 2B83A 4RQUA 3SXPA 1QSGA 4OJNA 4EUFA 3H2SA 8LDHA 1XR3A 2EV9A 3KUXA 5CAEA 1WP4A 4GPD1 5KVVA 1IHYA 5MGBA 3F6YA 1QP8A 5CDTA 4BO3A 3WBBA 1EDZA 4B7XA 3L4BC 2F1KA 4P8RA 4WLEA 4OOEA 1G6KA 1D1SA 4AFNA 4CLRA 4OMUA 3AU9A 4RLSA 1FDVA 1L1FA 4YAKA 4ZQEA 4DPMA 3WGIA 1C14A 3R3JA 1DPGA 3JYQA 4WGGA 4WEOA 2DU8A 5A05A 3JQ9A 4JQCA 1DC6A 1M6WA 2E4AA 4DIOA 4GI2A 3RFXA 1XCBA 2AXQA 1CF2O 2UDPA 4CM7A 3CSDA 3RKRA 4XYGA 4YJHB 4RF3A 1F8GA 4NPCA 2HAEA 1ISGA 2C07A 5ICSA 2P9CA 5JS6A 1ADFA 1Q0LA 4RVSA 3WGGA 5H83A 4IQ8A 1T1RA 4J1NA 2YYYA 3JQCA 3EK2A 4FBGA 1QYDA 1WZIA 3LC7O 1MC5A 3GDFA 4J4TA 3K9QO 5KOIA 3C3XA 3WFJA 4YAEA 4XGIA 1SOVA 4CUJA 5BQFA 5HBRA 1TI7A 3GRPA 4IJKA 5TLSA 4IDCA 4NFYA 1C1DA 4YA6A 3W8EA 4YQZA 4JJGA 1Y8QB 3OFSA 1JA9A 1BW9B 4INAA 2H5LA 5JAQA 2ZJ1A 3FPCA 1B7GO 4UVIA 2PKQO 4E31A 3ZV5A 1EFLA 3GRKA 2VRBA 4DRYA 3TF5A 2G5CA 4HBGA 1QR6A 3EZLA 4ESOA 2E82A 1E3WB 2O4UX 4BO1A 1I5RA 1NVGA 2O3TA 3DONA 3JQ8B 4O5OA 4LN1A 4XQGA 4IDFA 2Q1WA 3ON5A 3T4EA 3U0BA 1QYVA 3V8BA 4BO8A 2DUUA 2FP4A 4E5NA 2PY6A 2YQ4A 1LI4A 3EVTA 5ITVA 3KEQA 4Y6PA 4NNJA 4CLOB 3BIOA 2G17A 1LEHA 5GY7A 3EVNA 4DLAA 1YOVB 3FCOA 4EDFA 4QECA 1O9BA 3GVIA 3QVTA 4BNKA 1LUAA 5EIOA 4NU6A 3RUDA 2F00A 3QHAA 4CMGA 3S8MA 2WMDA 3ABIA 4CQMB 1N5DA 3KYBA 3G1UA 4ONEA 3OM9A 1XYGA 2XAAA 1HE3A 5DCWA 1HDGO 2WE7A 3U5TA 2BELA 4PVCA 1NQAO 4OGWA 4L4SA 4NK4A 2RH8A 1YH3A 4L74A 4IPTA 2J5RA 3INTA 4M1QA 1IUKA 5G0WA 5LC1A 3S1LA 5L7YA 3CXRA 2Y67A 1Y5MA 1ZW1A 2IXAA 3MJSA 1ID1A 4JJIA 4KTTE 1OOEA 4FD3A 2YJZA 4TWRA 4RQTA 3WMWA 4OHUA 5T5QA 4RZIA 1V3TA 4WE3A 3Q1LA 3HJAA 2FMUA 1MFZA 4YQYA 3H5AA 4JLWA 1O0SA 3VC7A 2CMDA 1I30A 1NFFA 3TZKA 3H8VA 1QORA 1LTHR 1WDMA 4KQXA 4PLHA 2X5JO 2VRCA 5IF3A 3EC7A 4P4LA 2OHXA 3WGOA 3UGKA 5IZCC 2E37A 1FJHA 4GWGA 3INRA 4BNVA 4PG8A 1DC3A 2NSDA 4MVJP 4ROSA 2OO5A 1LLDA 4RCVA 1P3DA 1M6HA 3LC1O 2PZJA 4OO3A 4GX2A 2CY0A 3ENNA 3H6KA 2CF5A 2X86A 1BWSA 1K6JA 2Y1CA 2UV8A 1P0CA 4AJLA 1ZUD1 3SBOA 1R66A 2EEZA 3MJEA 2DAPA 2O4CA 5KWEA 1PL8A 1PS8A 1WDLA 3KOUA 1IY8A 1PU2A 3EUWA 4I5GA 3FPLA 3PDUA 3M6IA 1DFHA 4WOKA 3ZDFA 3LT1A 1U5AA 2J3KA 1UDAA 2FRDA 1I10A 1UXIA 4ZN6A 2I9PA 5COAA 5ENDA 2EW8A 4ZQBA 3L4BA 3UFXA 4J49A 1CJCA 3E82A 3EGOA 3UCXA 3MCVA 4D41A 2DBQA 2VTEA 3KB6A 4XR9A 5A9TA 2OUIA 1CEQA 4NG5A 1GDHA 2HMUA 3V2UA 4FGSA 5B4UA 3GT0A 1U3WA 4IIUA 4H7PA 2R2GA 4WLFA 2V6BA 3GG2A 3RU9A 4EUEA 3V1YA 5TJ9A 4K6CA 3QLJA 1YDEA 4FFNA 3OEYA 4NR0A 4BQPA 5F3RA 5FI5A 9LDTA 4Y6SA 5IDQA 1ARZA 3K2EA 2QRJA 3CIFA 4UVEA 2O48X 2BI8A 1A9ZA 3VDQA 3VPFA 5L4SA 4UVHA 3BAZA 3TSCA 1KETA 1E7YA 2EXXA 4J6FA 1A9YA 5U4QA 3IKVA 5JLAA 5A1TA 3OIFA 3SLGA 1BVRA 5ER9A 5L51A 4NZ9A 4CLHA 3PFFA 1UDCA 1ZK2A 2YHIB 3FNHA 4B3JA 1B0AA 2VWGA 3WQQA 1H2BA 4Q3EA 3IS3A 3H9JA 1XQ1A 4D3DA 1A27A 3RSHA 3SJ7A 2AQHA 3BZUA 4WLVA 4ND3A 4G5HA 5EQDA 3ZU2A 3I9MA 1IZ0A 5JE8A 4C4OA 3VZRA 2JD1A 2J3IA 2C0CA 4TSKA 5GMOA 2VYND 1SEVA 4UREA 1ZSNA 1SBYA 2GERA 3FWNA 4YJFB 3U9LA 3BHJA 2OBYA 3ENKA 4XYEA 4GGOA 1GYPA 4JCOA 3GOHA 1ZZEA 5JBIA 5KNLA 1VJ0A 3LLVA 3NUGA 5KJEA 2ZATA 4KZPA 2UUPA 3D4NA 5A06A 1GQQA 3O26A 1EZ4A 1X13A 3NYWA 5IDXA 3GC6A 3S55A 5JYDA 2O3QA 1GCUA 1M76A 1LDEA 3NV9A 4PLTA 1T4DA 2YY7A 3ZNQA 3QSGA 1WPQA 4DQXA 4N5MA 3OJLA 5FF9A 1NVTA 5DNAA 2PGDA 4HKTA 4XCVA 1B2LA 4AJ1A 1C0IA 1E7QA 2EGGA 3I6QA 3JQFC 4OH1A 3DC2A 3UUWA 4E6PA 4E33A 1RPNA 3PHGA 5F1PA 1WW8A 4L9RA 3M1LA 2WD7B 2X22A 3DWFA 5JMWA 5DULA 2QRLA 1TT5B 1Q2XA 4NDNE 1O6ZA 4CV2A 4DIBA 3WYEA 3D7LA 2X0NA 4FDAA 3WB9A 4KUHA 3QWFA 4XJSA 4RL6A 4BNMA 4CLRB 1PQWA 3FN4A 1WXDA 4DYDA 3ADPA 3PJFA 3SLKA 5A03A 2WYVA 4K9DA 3COSA 2ZB4A 3ZWMA 1PGQA 2JHGA 4CL3A 3I9LA 2FPPA 2GGSA 5DBGA 2VHXA 4MKZA 4OXKA 1Y1PA 1CETA 5IXSA 5CHEA 2W2LA 3RASA 3IJRA 3UXYA 5CDUA 4ZHSA 4CLEA 4MO2A 3G3EA 1E6UA 4CLXA 1E7WA 4FJ1A 1MP0A 3BMQA 2OMEA 4DL9A 3PK0A 4XIYA 3PXXA 5IZCA 1HF3A 3Q3CA 4B3HA 3HNPA 2JL1A 3RUHA 2DUWA 4WASA 1JKFA 4Z6KA 1PEDA 1EUDA 1K2WA 1NPTO 1U2DA 4XYLA 3QWHA 2VRCD 5CG2A 1W8DA 4MIYA 3LF2A 1DIGA 5LDGA 5KVCA 1GPDG 1ZMOA 2YQ5A 4BS9A 1CQJA 5KJCA 5TIIA 1I3LA 4DBZA 1C1DB 2I66A 3KSZO 3MTJA 4GX5A 1P74A 1CYDA 3GEDA 3ADOA 2NVUB 3WIEA 1LRKA 2GCGA 3O4RA 3R6DA 5G4KB 2X4GA 2HCTA 1IPEA 2O2SA 3WSVA 4BNYA 1G0NA 3QVSA 1QG6A 1AHHA 4PCVA 1VJTA 3NRCA 4J1TA 2VZ8A 3UCEA 5FYDA 4YAIA 3UHAA 1AXEA 1B26A 4FC6A 4FN4A 4BL5A 2GDZA 3OIDA 4O6VA 5EL0A 4HFNA 3ZWBA 4M89A 3FBTA 5JXWA 2AW5A 1KC3A 1XA0A 4IM7A 1N8KA 4UUOA 2W8ZA 2ZB8A 1VL0A 3TL2A 2H63A 3TDKA 5T8KC 1ZH8A 2XXBA 3ITDA 4IDEA 3DZJA 9LDBA 3ZWAA 3DMYA 3L77A 4LSMA 4WCFC 5CPBA 1LLQA 1NBOA 4RGBA 3QA9A 4WCDA 2UYYA 4IY1A 5ADHA 4BOYA 4PLVA 1XU7A 1JKIA 5CEJA 2TMGA 1VI2A 2Y0EA 4NH4A 2I6TA 2QG4A 4CLDA 3H3FA 4J4HA 2O3RA 3HG7A 5L4NA 2DPHA 1EVIA 3GG9A 3NKLA 2A94A 1MC4A 1GQ2A 1QYCA 2PH3A 1TXGA 3OA2A 5T64A 4G81A 1M2WA 2RHCA 2ZB7A 3Q2IA 3OP4A 3IQDB 2JD2A 2Y1OA 1R4NB 2YFHA 2PKQP 4OM8A 1B14A 1Q1NA 2R00C 3AY6A 4EJMA 1ISFA 1JU9A 4CR6A 4F6CA 4GMFA 2AMFA 4MP3A 4WOJA 5JY1A 3W8DA 3NTOA 2VZ9A 4WNCA 1RWBA 4J43A 3GVCA 3O38A 1ONNA 2IE0A 1Z6ZA 2CVOA 4AJIA 4FB5A 2BMAA 5FEUA 4CM9A 3WS7A 4AVYA 5BSEA 3MOGA 3CTMA 1HDZA 4BV9A 4TZKA 4BKOA 5DOZA 3PEFA 1EE2A 3W6ZA 4R1UA 4IUYA 1N92A 1E5LA 2EJVA 1T2DA 1VSVA 1VKOA 2WTBA 4XGKA 2FR1A 3DZFA 3HZZA 1XQ6A 3IKTA 3GMDA 4QQRA 1NR1A 4TRRA 4EJ0A 4HWKA 4Z0TA 2HMWA 1GADO 3OETA 1PZFA 1JW9B 4IBOA 1KEUA 3R0IA 5G0TA 3WXBA 1BG6A 2EGHA 2GYYA 2X9NA 1E3IA 1SC6A 3DZBA 4U5QA 5B37A 3JYLA 3CEAA 5C3MA 4JROA 2Y93A 4ILKA 3PYXA 4JNKA 1I3KA 1EQ2A 4H15A 4R5MA 5BNIA 4JJFA 3NX4A 5CEFA 1PJLA 3AJRA 3BMNB 3K6JA 2OZPA 3IL2A 5TF4A 3GA0A 5AXCA 4XQEA 3IP3A 3NAQA 2XF8A 1ONOA 3UW3A 4M86A 3IUPA 3H65A 3HN2A 2GD1O 2JFHA 4TROA 1NAIA 1C3VA 1DOHA 2JJYA 3FNGA 4DA9A 4CJXA 2IODA 1PZGA 3QRWA 1S7CA 1U1IA 4BNZA 1XWFA 2OP0A 4L4RA 3VTZA 4U6QA 3ZWWA 3D4PA 2V6FA 1CIVA 1HL3A 3OMLA 1GZ4A 1EFKA 1KBZA 4UUNA 2HDHA 4GL4A 4FJ2A 4D44A 4PZEA 3MWDB 3AI3A 2VTDA 1LX6A 3ONFA 4IGFA 2PD6A 1H93A 1I3NA 2W2LD 3LVFO 3QVOA 5GZ3A 4DC1A 5AQ1A 4ZA2A 4L8VA 2NQ8A 4MIOA 4J16A 1YBAA 1KS9A 2UUOA 1A7AA 4BO2A 3I1JA 1E6WA 4NIMA 3RUAA 1R4MA 1DC5A 4I1IA 3WWYA 4CM5A 4Z9XA 2O2YA 3OQ1A 3A1NA 4IGEA 3WX0A 3W8FA 4JX8A 1BDMA 3Q6IA 3GPDG 4CM8B 1V3VA 2EW2A 3JD0A 3ZH2A 1M67A 4W9NC 3TNLA 4B3IA 1ZVMA 4CV3A 1HT0A 4OQZA 2Q4EA 3PQDA 4H3VA 3I4FA 2WYUA 4E2YA 3PIIA 4MVJM 3PYMA 3KTDA 1PX0A 4DQVA 4WUVA 4YEDA 3DDNA 2CDBA 4WK6A 4DREA 4IJVA 4AJHA 5TT1A 1NNUA 4K28A 4NU5A 3FNEA 4CMIA 2Y99A 1HDRA 4BMSA 1HXHA 3I3OA 1Z7EA 3WTBA 1P44A 2NADA 3OHSX 5BSHA 3AM4A 3LQFA 1M66A 1X7HA 5JAZA 1HLPA 4LVUA 3L6EA 1OMOA 5K6AC 1SEPA 4Z3DA 3NDRA 4DIFA 5DDIP 4F6LA 1ADGA 2BGMA 4II3A 5I8WA 4RPGA 3OEWA 2SCUA 4GVLA 4R69A 1P1FA 3DBVO 5B12A 4E30A 1Q7BA 3AWDA 4GMGA 4WKGA 4WCFA 2X8LA 3QE3A 1E1LA 2EJWA 3H7AA 1ZEJA 2I5PO 3ETEA 3H5NA 1Y8RB 5AOVA 3WR5A 3UCFA 4UAGA 5I7VA 2EP5A 2EIHA 3I23A 4IXWA 5GZ1A 4WEQA 4XYBA 3L6DA 1H0KA 2CF6A 3F5SA 2IRWA 4JBGA 2ZQZA 4OYRA 4RDIA 3DOCA 1LQTA 5BSGA 4ND1A 5H81A 5CEEA 1YKFA 2D5AA 3KSUA 4ZQFA 2AG8A 4NBWA 1ZK0A 4BO5A 1VJ1A 1DXYA 5I9MA 3TL3A 5KJ1A 2JFFA 1ML3A 4YTEA 2WJPA 2AQIA 4YDRA 3HB5X 3ZWYA 5KKAA 1U8FO 1GD1O 2YDXA 4OIMA 3ETDA 4EEXA 3TOZA 2Z1MA 1YL6A 3DFUA 2NU6A 1HTBA 4UEJA 3VZQA 2NU8A 3VAZA 1NM5A 1QLHA 3BMQB 3HDYA 1PZEA 3QVXA 2JCVA 3MWEB 3RWBA 5COQA 3AK4A 2BHLA 4CMAA 3VZPA 4MVJD 5I7SA 3PWKA 4J2OA 2NM0A 4PLFA 2G82A 1EUZA 3UICA 3RC7A 4IDDA 4PZDA 2CFCA 1Q0HA 4BNWA 2GNAA 4MOWA 4CM9D 2QYTA 1SO8A 2RHRA 3AY3A 2JHFA 1FK8A 1EK5A 1UXJA 3GHHA 5DP2A 1KEWA 5JDIC 1DFGA 2NQTA 4UUMA 1BRMA 1CWUA 4ITUA 4QX6A 4TZTA 5AVOA 3MJ4A 1DRVA 2JAHA 4CMKA 4QTZA 3CZMA 4IIVA 4IDBA 2V6MA 4BGIA 4KOAA 1DRUA 3CINA 2O50A 4OSOA 4PLGA 1N1GA 4FFOA 1V3UA 5DZSA 5L53A 4CR8A 3ZI0A 2BRUA 2X6TA 1XDWA 4S3MA 1ZSVA 1GFSA 3C1OA 4U0JA 3NT5A 1NFRA 4O0LA 1GY8A 5A02A 2JD0A 3PP8A 2Q1UA 1F14A 3FWZA 5FFFA 3UVEA 4AJOA 5ITWA 1HZJA 2IXBA 4OXYA 4BNHA 5MDHA 2OXIA 1E3JA 2RH4A 4RDHA 4CM4A 3DBHA 4CMEC 2Y0CA 1UAGA 3KYDB 4BNFA 2D59A 2FPIA 4QT0A 3BMOB 1P33A 4LISA 2WM3A 3WMXA 3LK7A 1EEHA 3CZRA 2I3AA 4D3FA 1NFQA 3H9UA 3JYPA 4WNIA 1ENPA 3DAPA 4P4GA 2HK8A 1JLLA 4DVJA 3ZNNA 3X2FA 4HFMA 1DHTA 1JAXA 4BO9A 1B8VA 5HWSA 3SJUA 1EVJA 2IYPA 3DEYX 1FDSA 3GMSA 4I9HA 4XEHA 2B36A 3KBOA 4NBVA 4WPGA 4GVXA 3F47A 2Q4BA 4R51A 1LDYA 3ZWNA 2W98A 2VOEA 3Q9UA 4RPKA 4GBJA 4URFA 3PLRA 1XKQA 1PJ3A 2PV7A 3D64A 2I65A 3GQVA 1C1XA 4S1VA 5F5NA 3P19A 4OXNA 3OJOA 2FZEA 1E3EA 2DKNA 5F1KA 1T26A 3Q11A 4D0RA 3U3XA 1OBFO 3VZSA 3ONEA 3BTSA 3LT4A 2CDAA 4TVBA 3RUIA 1LQUA 2P5YA 1S6YA 3DAGA 2O3UA 2ZTLA 4XRGA 1P1JA 1O94A 3BMCA 2NUAA 4FOOA 4DGSA 4CQLB 4O63O 4FJ0A 2Q2QA 4ZVVA 3ANNA 5HRUA 2HQ1A 3PQFA 2Q49A 1HSZA 4BB5A 1R16A 4FW8A 2CVZA 1SPXA 3D3WA 1M75A 4XR4A 4L0QA 1F0YA 1OAAA 5K6AA 4IZHA 1ZXLA 4KQWA 2DLDA 4LCEA 4BV8A 4CM3A 4D3SA 2CNBA 4CODB 3VPXA 3HHPA 3BTOA 5EERA 3I52A 4XB1A 3U49A 3B1FA 1QRRA 2Z5LA 4KTVE 5JAMA 1GZ6A 1XELA 2C59A 1YS4A 1JN0A 1PJBA 3WFIA 1P1KA 1YGYA 1GV1A 2AEJA 1ENYA 2UAGA 4AJ4A 3TN7A 4A10A 4HNGA 3ROMA 3CPSA 3GFBA 3ZWCA 3P2OA 3PZRA 1O5IA 1YE3A 4FFLA 2VWPA 4C7KA 1VPDA 4NBUA 3KLMX 4JK3A 1J6UA 4NK5A 2DTXA 3WSWA 4HADA 3ZHBA 3JQDA 1PS9A 1Q0QA 3IJPA 1DB3A 4B7UA 5A3JA 2VNAA 3ZU3A 2X23A 4EYEA 5EMHA 4RJTA 3F3SA 2XXJA 1KEPA 2VUSA 4PG6A 1RM5A 2WD8A 1YWGO 4ZICA 1ISMA 4PLYA 4RF2A 1IB6A 4YRBA 1KC1A 2YUTA 2DM6A 1VE9A 3NEPX 4GAEA 1AHIA 3K73O 4BNNA 4MINA 3AI2A 3MEQA 4FSHA 5G0VA 1YBVA 3JCZA 1NASA 1WDKA 4YRAA 3MJTA 5KJFA 1LBEA 3LYLA 3JD4A 1AGNA 5BNFA 4BGUA 2VWHA 2GUGA 3WNQA 2PR2A 3KM0A 1JDJA 1MX3A 2YW9A 5TC4A 2X0IA 4ND5A 4E2ZA 3C7CB 2C82A 2Z1NA 2GASA 3DZHA 3OECA 1BXKA 1ULSA 3DR3A 3INGA 4J1SA 3GZNB 4R9RA 5A9SA 4KP7A 1SB9A 2P9GA 1U9JA 4GX0A 4LMRA 3L4SO 4Q39A 3LT0A 4L73A 4RORA 3H4VA 2DFDA
chains in the Genus database with same CATH superfamily
1IULA 1L5LA 4CIAA 3B1JA 3LDHA 4LA4A 1L7XA 4BP1A 2EKZA 4PFJA 5LP6A 3AI7A 4IO1A 4IUDS 2MHCA 2J3HA 4FWIB 1DBSA 4CBVA 4RDXA 1OH6A 1U0FA 4G85A 2QZ9A 1PNOA 3ID6C 4TQGA 3O6VA 4BAGA 1ZUIA 5CCBA 1TMKA 1TKBA 3BRWD 4U0KA 1YCHA 2ZPUA 5HE8A 2QVBA 1XRSB 1GG5A 3PFGA 4K8OA 4L3VA 1NXXA 4NCNA 1ICIA 2V59A 2W6JA 2Q1TA 3T61A 4AN4A 1M5RA 3QYPA 2VP0A 5JVDF 4FP9A 5A6SA 2FK8A 2ZE6A 5THQA 5LZ5A 4J0GA 5ITZA 3R3XA 1RQNA 2OESA 5KEIA 2Y9MB 4E4YA 5CXSA 1QKIA 1C0LA 1LFDB 3E7PA 5FWXA 1R0SA 1W96A 1NA5A 3AG5A 3IV9A 1DWQA 1P77A 1SXJC 2C3PA 3QVLA 3B3QA 4G9BA 4JH0A 3VZBA 3BHIA 3ZHUA 3QX3A 3CX7A 4MV5A 4PCLA 1Z38A 2VYVA 4TKUB 2CT8A 2B30A 1XLTA 3B89A 4B2YA 1XRJA 5FBVB 5E95A 1CCWA 1EWQA 4OAQA 3G2PA 1NQXA 5BVGB 2YY6A 3TFOA 2JIPA 4WGFA 3PNVA 4UTOA 2J9FA 4LC0A 2ZLBA 4MGKR 4KLNA 3BBPA 1Z4MA 4QG3A 1XDDA 4JUAA 1YZFA 1F2TA 3QBDA 2FXVA 2XCIA 3HN7A 1EDDA 4MP6A 4RK1A 1IBMB 4WINA 2IK8A 3HCOA 3GJ3A 4CTJA 1X8JA 4BVAA 1JVNA 2YWGA 3JZFA 3VVLA 4OAPA 2FZKA 5K2MA 3EY4A 1EVYA 3OICA 4KN8A 1WD5A 3RT1A 2WVAA 3P2JA 3R7WB 1CUHA 2HU8A 3GLFE 4JT8A 1NE2A 1U2GC 1Z35A 3LQQA 2M6SA 1N6PA 3K0FA 3JALB 2LCQA 4OA8A 2ZIAA 4PVDA 1OV4A 5JG7A 2Z57A 1QIKA 1OJ7A 2D06A 3ONVA 1L3IA 3W6NA 1P5FA 5C35A 2BTEA 1IM2A 4JQZA 5BMVB 2JLUA 3QTTA 2Y2UA 3EY9A 4UE3S 1L5OA 4W7HA 3C7AA 4Z1MA 3ORFA 3ITNA 2NACA 4NOMA 3L1UA 4U6SA 4RLHA 4TUYB 4L51A 1GQYA 3OZRA 5L3SA 4FZRA 1ORDA 1TO6A 3QGMA 2WJ3A 3CB4A 4QGFA 4UFPA 1P1IA 1A77A 1BS1A 1A98A 3RI3A 3WYFA 3V4RA 2JEOA 2RGNA 4GPAA 3AF1A 2GD6A 4DV3B 3COJA 4YRRA 1WUIS 1ZBQA 4YB8A 2PMDA 3D8BA 5FPPA 3PEWA 2XNKA 1GEEA 4WUTA 1Q57A 4MYHA 1T2CA 3F6SA 4NCKA 1YR8A 4PNPA 4U7WA 4C01A 2ZIFA 4J7UA 2D3TA 2V96A 3V1MA 3WWZA 4OJTA 5IJAA 1ZH4A 2VPIA 1F4PA 1QHHA 3PRHA 2HA3A 3CUSA 2C7OA 1PS0A 3AGPA 4US2R 4ZZ3A 1YZUA 5EJMA 1FCJA 3E18A 1JHYA 1RBQA 2C5AA 1PWYE 3A6JA 2BEUB 1GA6A 1EU1A 1P2FA 2AJTA 5D3KA 1OPRA 3UEOA 4BHTA 4CIYA 1FMFA 4H7JA 1NI3A 2GXSA 2VXYA 1COZA 4L27A 3K6SA 3VHQA 3FUXA 2OCLA 3KEGA 3HUTA 4H1TA 5F3DA 2O2GA 3C24A 3HYNA 4KYVA 1PGJA 3AU8A 3IIIA 1YB7A 5JV5A 2ZUDA 4GKBA 1RJDA 3HU3A 3AZQA 3CZPA 1R88A 5FOTA 1TCCA 5C8VA 5MN4A 3RQSA 4A0SA 1NF8A 2QU7A 4R4JA 3HFSA 4NZPA 5CCXA 2OZLB 4AY4A 4E2XA 5I7RA 1MAWA 1Q2UA 3IE0A 3PQCA 4P93A 4A15A 1HDCA 3RS9A 1ZOIA 1SWVA 4D96A 4RD2A 5EJIA 2CHGA 2R97A 3SQMA 2ZUFA 2EFGA 1JZQA 5CXXA 1HBJA 3F1LA 3IHTA 2QSYA 4DGQA 3RHTA 3ZXIA 2HSJA 1YJXA 3DEHA 4TQUS 4AJ2A 4DDVA 2P9QA 4V38A 2RAUA 4J29A 4YMSA 5AW9A 1YOVA 4YNBA 3ESYA 1MFPA 2GEUA 2E4XA 2VRNA 3N75A 2BHTA 16PKA 2Y1DA 3DYIA 3M6MD 3DBHB 3FYCA 4I3GA 4MJ3A 3IUNA 4CM4B 1C2TA 1Z8HA 3GB9A 1AQJA 1DO2A 1SXQA 3E6AA 5JJKA 5HIMA 5IXJA 3OC0A 3STUA 1MJNA 1TOAA 2RAFA 1E20A 3CEMA 5K3BA 3OBIA 3RCBA 3CLTC 1R8JA 1HDOA 3EISA 3S68A 1A72A 4NZNA 3UAGA 3P9CA 1IWBB 1DO8A 1AK9A 2VEDA 3AF0A 3L4EA 2HIMA 3MF4A 3WA6A 5M04A 2PEYA 3ASVA 1AGPA 1RXSA 1XEFA 3L82B 4L85A 1H2FA 4IKEA 1UMBA 3FWKA 4H7EA 4S12A 1Q92A 2Q0SA 2NPIA 2W2KA 3N8NA 2WILA 4HJRA 4KAAA 4KHZA 3S6JA 2VP6A 4JCCA 3VOAA 1KEVA 4D1YA 3PGJA 4QASA 3QELA 4TMVA 4TVKA 5F52A 1RM4A 2VH5R 1KO8A 1FLAA 2ZXUA 3NT2A 1T5OA 1T4MA 3SF8B 2Q6OA 3G68A 5F7JA 1TEHA 5B6PA 1P75A 1UXHA 4TRJA 3E7FA 3LXXA 4B84A 3JSAA 5DBHX 2ZTVA 3LQ4A 2G1UA 4Q34A 5EXDA 4TT3A 1VYUA 4HB0A 3KVRA 3DULA 4ZVSA 4JSYA 4OFZA 1X1TA 4MTLA 4BX9A 4E4TA 1KWKA 1U0TA 1I3MA 2DX7A 5CT6A 3PL1A 4YGXB 1TF2A 1ZD9A 1ZH2A 4OHZA 3Q9SA 5C46F 5AO9A 4CEHA 1RDFA 1JHMA 3A31A 4G0YA 2ZBPA 3JASB 1TEZA 4AG3A 1V8DA 3IH5A 2WHEA 1DQYA 1NQUA 1EK1A 2AEMA 1Y9EA 1NBMD 2R6JA 4KDEA 4KXXA 3WGYA 3OZDA 2XNCA 2A8YA 1YACA 3WTCA 3LE8A 4PAGA 1SUFA 4XZ3A 3BT7A 4K0KB 1IM8A 3IAHA 3N5KA 2DT8A 4RJLA 2MMGA 1CUGA 3NC1C 4Q6BA 5EXXA 3SN6A 3KQNA 3TRDA 4I1SA 3UAZA 4WXYB 1B2RA 1RIIA 3O21A 4MIEA 5HQJA 1OH5A 3G9ZA 1QH8A 2J0UA 4A1FA 1EB8A 2M98A 3KELA 5EHNA 3T1OA 1TLFA 2DBVO 2AOXA 3TYXA 3ZCXA 3GF4A 1V39A 2B94A 3K16A 4FGWA 4KIWA 3W6UA 5JPDA 3NKVA 3SFTA 4A4DA 2J9XB 4QJ4A 5FCDA 4QDOA 3G6WA 2O8CA 4G5RA 2IEIA 3NHJA 1EHIA 4MIKA 2Z2XA 3L8CA 5KX5B 3C1TA 3WGLA 4LGMA 1LB1B 1JVSA 4EKEA 1WV0A 4OP2A 4PZPA 1BMDA 3HUDA 3JQBC 4OQFA 2VTBB 2B92A 5CA1B 3AP1A 3O75A 3ICOA 4B33A 5GM1A 2XUOA 4A5OA 4Q4DA 1P7VA 2XRYA 1SBIA 4TGLA 4ZU6X 2HQOA 4RENA 3D2CA 3CB2A 1F48A 1G18A 2I2FA 3UW1A 1GYRA 2N46A 3GLTA 2F43B 5EUQB 1A9OA 1WX1A 4YUWA 1HNZB 1XT6A 3DFFA 4IDAA 1EBFA 2JGAA 3IP1A 3PQ5A 5G02A 5TY0A 3T1QA 5BR8B 4TYYA 3CMCO 1I3OA 1TM3E 3MS2A 3HDHA 1AKEA 1HM5A 3GPIA 1IWPB 4KCGA 1YVEI 4Z7NB 5GJCA 3G8DA 4P7BA 4W5TA 1G42A 3W34A 1KQ3A 1BTOA 2H9YA 1AS0A 3CLRD 4B6QA 2PKRA 3LA6A 1T4CA 1HE5A 4KJXA 3U39A 3DP7A 3IGFA 1PJTA 1SULA 3FYSA 3SEFA 2I8AA 2Z9CA 4MV6A 2UUAB 2ZIUB 4KOEC 1P8JA 4HDNB 1XHFA 3B9QA 4HV4A 3KVOA 1YS7A 4WN9A 3VKFA 5HBGA 3CPHA 3V8MA 4MDFA 3LZ6A 5ENZA 4MZDA 3F9RA 1X1RA 4HLUA 2X76A 4PPQA 4CV0A 4LF5B 1UUFA 1MGOA 1WP9A 4ER7A 3ABZA 3IOYA 3QVWA 1RM3A 2IZ0A 4QJ5A 4G4SO 4S24A 2L17A 1ZKMA 3QV2A 2FLWA 2VHQA 4PBTA 3OQMA 2IU0A 2C2OA 4LMAA 4CKEA 1WHTB 4EJFA 2YFQA 3EG9A 2PCLA 2XUZA 4LNUA 1CIPA 1A97A 2B2XA 1ZHOA 1HFKA 5BQ5A 2XZOA 1XNQB 1W4AA 3FMGA 3GLHA 2QL9A 4L15A 1CY6A 3UGJA 2ZE5A 1L7PA 4JBXA 4UTZA 2VT7A 4PQGA 4RD4A 4P4NA 2RH9B 4J0CA 4J3NA 4JI3B 2ZTMA 5JCJA 4EW2A 4ABYA 4I6JA 4CEIB 3SR0A 1TAGA 3B9PA 5G1PA 5DYGA 1RABA 1MV8A 2FEMA 2GAAA 3IIJA 4FYHA 3DMPA 1QCZA 1TM2A 3RWMB 5CFZA 2JLYA 4KDFA 2CXNA 4U2BA 4XKJA 3PV0A 3DEJA 1JRLA 1UCFA 1NXSA 2IA5A 2OWEA 3U81A 1D9XA 5A3RA 2RD2A 4BPBA 2X7JA 4B8ZA 3ZV3A 2VSFA 3PXCX 4B32A 2W5UA 5KTRA 4RSRA 1WUJS 2FFHA 1QO0D 3WGTA 4B43A 1NUQA 1V8ZA 2BFFB 2J3MA 3HKCB 2OUKA 4FCCA 4YP6A 3C39A 3WJ7A 5B5SA 3IURA 2GT1A 2YIDA 1ZA1A 4HAYA 4FW9A 4TT8A 1N8NA 1Y3FE 5FBKA 4QOGA 4OH7A 4MQFA 1H66A 3JVUA 3NNNA 3QJ5A 2L82A 4JBHA 1XAHA 4QPPA 4TMYA 4G07A 5BP7A 3MHTA 3BSSA 3DOUA 5EQJB 2VQEB 2IJGX 2R1VA 4A23A 3W1EA 1YFJA 4LK3A 1TK3A 4YBZA 1BROA 4JBIA 4Q3CA 1IHOA 3QQ5A 2PXCA 2XMZA 3JRWA 3NHYA 1EP3B 3SHOA 3Q7PA 3FDXA 2HTEA 3CUWA 3FZQA 4EUSA 5DLEA 2NPOA 1R5OA 1OH7A 2IDKA 3STTA 4UKDA 1A7KA 1T43A 3HXTA 3QFCA 3RVBA 2QF7A 1B16A 5JWOA 3FZYA 3GLIE 4A92A 5CGZA 1KIMA 3K0HA 1N2GA 3GFQA 5FP0A 2EYQA 5JSZA 1KZHA 4BKPA 4X7RA 4F3RA 1M2GA 4LDNA 1CZRA 1H8EA 3T7CA 2R00A 2F4NA 3HKBA 2NU9A 3QVUA 2EFEB 4WOPA 1QK5A 1RSZA 5HCIA 4WFQA 2XY4A 4M8NE 4YWJA 3K0AB 3TTSA 3HB7A 5AVWA 2YNMA 3DXZA 5AXBA 1JMKC 4TVOA 4DRZA 3N2KB 1N2SA 2YTZA 3AJ8A 3IPCA 3GNTA 1AQ6A 2D0IA 4KV9A 5K0BA 1BKYA 3A4IA 3HB9A 3G5TA 5K99A 1TW2A 1JSRA 5T41A 3OEHD 2F7SA 2ZJ7A 3FMFA 4FZJA 5FWYB 5AVSA 3DEZA 5A71A 4OSEA 2CXQA 1Z6TA 5JBNA 1CUAA 3UXEA 3ZNPA 4XWWA 2JS7A 1QO7A 3GLRA 2MYUA 3NXSA 1UKVY 5DBIA 4YALA 1YD7A 2ADMA 4GPIB 4UZEA 3U3JA 2OMKA 4N5HX 1PDVA 5KQSA 4YDQA 2VK8A 2XUQA 5HPYB 4ZVPA 5AHXA 5L95A 2OO7A 3N8GA 3UOGA 3OU2A 4YVFA 4TS3A 3KXDA 3W9SA 5JALA 3D4OA 4F86A 5CNMA 2WMYA 1NQTA 2JGFA 2ZTSA 3D8UA 3PWSA 1XZEA 1L5NA 4AZSA 1T3ZA 2GFIA 2UYQA 4PIVA 3AVOA 4C76A 1OBCA 2CFIA 5BUSA 1N4DA 2XGJA 3IYLW 4UDXX 5IRCD 2O0KA 3GHYA 4EO4A 4RIGA 4RESA 4LF8B 3KOWA 4PZCA 4EFNA 1G2IA 1GZ3A 3GWGA 4KFSA 4AF8A 1I2AA 3KWLA 2CDCA 4INZA 4AXXA 5BOSA 3E23A 4KXLA 1CRLA 3E5MA 1EFTA 1TQ2A 2G28A 3D7KA 2VYNA 4Q3DA 3U3OA 1QMGA 1TW3A 2BL4A 4KAFA 3R9XA 2QW0X 1XG5A 1X7ZA 1VJRA 4C7OA 3WKCA 1MABB 1HGXA 2WM2A 1GU1A 3C97A 4YPOA 1YJQA 3AB3A 3KE8A 2PQ0A 5JSFA 4PXAA 2EFCB 5F21A 1V6SA 3Q8LA 2PX4A 4RV5A 5AIAA 5CBPA 4IV8A 4X94A 5LWQA 1PJ4A 4G4JA 4WL0A 3A7EA 3KKEA 4BB9A 2GEKA 4E7PA 3KOOA 4U7JA 3OZSA 4QOFA 3QOWA 4REQA 2CDNA 1BSVA 3WI7A 1UWKA 3ONNA 1XKXA 2VAVA 1TYDE 1GUBA 2H06A 3ANSA 3GFOA 3LS2A 4LWPA 4XYMA 3R7DA 5A4DA 1POXA 1RJFA 2BFCB 1TPYA 1SC1A 4R1NA 5AW1A 2PLRA 1POWA 1FFWA 1IXKA 2NYUA 3JQAB 1CD5A 3AR2A 3MOSA 1JDBB 2ETXA 4HAXA 4PINA 1CDOA 2ZSHA 3CN9A 2YVUA 1Q1QA 3DM5A 2X0FA 3SS7X 3GYBA 1RRMA 1SU6A 3FFBA 1OWMA 4X91A 1BVHA 1QJCA 4ALJA 2XECA 2IU3A 4I2VA 4J0QA 3T7SA 2IEZA 3LX6A 5TSDA 5BNTA 2C9CA 1QOQB 3KZNA 1GZ5A 2ZJFA 1K1EA 5T4BA 4A26A 2WSMA 4Q4AB 4EB3A 3CVYA 2I67A 3AB8A 4FGJA 2HMYB 5HM8A 2EERA 3H6HA 5JNVA 1UXGA 1L6IA 3B6ZA 4PGFA 3K20A 1QFXA 2HNAA 5JECA 1TA4A 4GMKA 2NNWB 3O03A 4BE7B 4CUKA 4XSVA 2JAPA 4XGRA 1VCHA 1CB0A 2H7XA 5FBQB 10MHA 3TIXB 3DWIA 3AYXB 3V4PB 5IZ4A 3L7CA 2Q3MA 4C0XA 2MJLA 3KV1A 4U2KA 1N32B 1KORA 1R4NA 4FGUA 4YP5A 3FOCA 4ZIRA 1DVRA 2WVHA 4XWYA 5DGXA 1IZZA 3WHLA 2CJYA 5EIWA 5LA6F 3AL3A 2AT1A 2H52A 3HVHA 4QYSA 4DBVO 1Q83A 4F1WA 1X9HA 5GV7A 2QUIA 2X1HA 1SVNA 4AZTA 1L7QA 3RODA 5KZMB 4UVDA 4B83A 3VVBA 4F6RB 4CL2A 1KDRA 4BO0A 3WGQA 5E6RA 4PFSA 1XAJA 3UJ6A 1JJAA 1Q91A 3EXHB 3PHLA 5KINB 3EE6A 4FOSA 5I7EA 1GUZA 4I50F 3SFZA 1PKXA 4NYMR 3TM4A 2JLCA 4ZU3A 5FBHA 4KQHA 2H3EA 1W4LA 3TQSA 3GMTA 1TAUA 3W06A 1R15A 3CR7A 5BW6B 3W9BA 5LLTA 2LZ0A 4KGVA 5AM2A 3AC0A 3WL8A 1WMBA 4Q4CA 3K9FC 3QW2A 4DHWA 3W1VA 3BDIA 1PSWA 3QI2A 5EQFA 2WJWA 1COWA 1J2EA 4LHVA 7REQB 4ZO4A 1OX4A 1T4BA 4QLBA 3LF1A 4F4FA 5KTOA 4IKOA 1LDMA 1YB1A 4A1OA 1M10A 3IP8A 4QXPA 4LX0A 5HGXA 1XNRB 1V6AA 5IW8A 5ADUS 4LW8A 2HMSA 1R8SA 1IM5A 1Z15A 1CHNA 1PL6A 2Q9UA 3G6KA 3AFNA 3IIEA 1NR7A 2HA2A 1VG9B 2QIOA 4C0WA 5C4IA 4RHFA 4KJZA 1JAHA 2ABWA 2QGZA 4G56A 3FWHA 4DQUA 2AD5A 2C77A 1ONPA 2RKOA 1AKYA 4JP3A 3PFNA 1SXHA 4O59O 1ADCA 5KTMA 2HU2A 3NJRA 1DJNA 2WB4A 3PA6A 2RCYA 3CLTD 1Y1LA 5C37A 2ONZA 2GS9A 3H2HA 4JWKA 3ZHYA 1ILEA 3A70A 4DLBA 2XIQA 1MAVA 4G5XA 1FDUA 1UKZA 1RYNA 3IMCA 3AKCA 1VFPA 1YDFA 2VJAA 4RVHA 5EJ2A 3VI3B 5INTA 1U9IC 3QVVA 1X9GA 1VLQA 3LUDA 1LBTA 3I1YA 3MSCA 2PL5A 1KQNA 1U3UA 3TJRA 2VSQA 3NNDA 3N7TA 5AKKA 4K3UA 2PM8A 4TS4A 1VCOA 1W4ZA 2UZIR 4FR5A 5FLYA 4CM6A 1FFYA 2BEWA 4C43A 1X7DA 2AFHB 3KALA 4F60A 3K8QA 4YJGB 3OJEA 3S28A 3K6RA 4C1BA 1NATA 2QKYA 2LD4A 2FWRA 2ET6A 2ATIA 2R47A 4JHLA 3GH1A 2FGKA 5IS2A 3WA7A 3IODA 2VQ3A 2QXTA 1B1CA 1KI1A 2Q7OE 3E8XA 2ROQA 3M2TA 4J0EA 4QXOA 4TSFD 1EEXB 4Z0HO 1QGUB 5JU6A 1VLVA 7ADHA 2NU7A 2DQYA 3Q5GA 3H04A 4OP3A 3WQSB 3EBPA 1RBYA 4FMDF 3SGLA 1V4VA 3ZU4A 3NDBB 4HGZA 3AR9A 2Z3VA 1T9ZA 3N39C 4G89A 1FSGA 2ZUUA 3MS7A 5JDIA 3WNVA 3A9SA 3G2IA 1WE2A 3K8ZA 4N39A 1XIVA 2DCUA 2NO1A 1DAHA 1RRFA 5K0NA 3DKIA 4D3YA 1H2XA 1UJMA 5AJZA 1DEOA 2RGWA 3DB2A 3ZI7A 1Y63A 3SKXA 2E9SA 2PWAA 3KL2A 3W3AA 4N3AA 4CQJA 1TYBE 3RRFA 4O2AF 2ZJ3A 3D6JA 3EARA 3ZHVA 1NULA 1G3RA 3C3JA 3D3EA 5IWCA 4P1ZA 4PQFA 2BFOA 1ORIA 3D1VA 4DR1B 2QU8A 5CH3A 4WW0A 2NNLD 3B1XA 2GEVA 4J6EA 1RZVA 3DMRA 4D5GA 5A0VA 1E7MA 4BNXA 3OMXA 2C7RA 1NV8A 2O5RA 3NDPA 2I76A 1PZNA 1QGED 3PNPA 1PDOA 2IPLA 3RUCA 4MGZR 3OPMA 5JAUA 1QH1B 4RKQA 4HAIA 3LP5A 4ANFA 2XUJA 1ZIDA 1G6HA 4OI4A 5JRJA 1EFUA 1LBQA 5FUBA 5EHGA 2SCUB 1NBAA 2YRWA 3CCCA 4DB2A 1LGYA 2Q1YA 2VDPB 3MJRA 3O3NB 2WUGA 4RTMA 4YP1A 4ZQGA 1CHDA 2X4IA 1UEXC 1O4WA 1K06A 1OIXA 4DILA 2VP3A 3NYQA 4XLZA 4BEJA 4Z1OA 4LF7B 2P9HA 3WRYC 4D4KA 2D5IA 2VP9A 3COPA 5NLLA 2GAIA 1TTQB 2GK4A 1OV6A 1P45A 3TGPA 3DE5X 3G9XA 5B57C 3PGKA 1Q77A 2QLNA 4F4JA 1Y8RA 4IV5A 3V33A 1LDGA 2GXUA 4Q9IA 4AZWA 2PRJA 3JQGB 3T7RA 5H82A 4I1VA 5KO2A 2G83A 2O2IA 3HBNA 1XXLA 2JFXA 5J2UA 2W71A 1T3LA 1ISHA 3N9IA 1T1SA 2H2HA 4G4SP 4B4WA 1EESA 1YI8A 4HVTA 1C8VB 4E6EA 2DB3A 2A9OA 1OYVA 3WNDA 4JXKA 3E81A 4FYXA 4IINA 1T6YA 3FPAA 5CH5A 3SBXA 3ROQA 2OK8A 2P79A 4RNDB 2Q62A 1G4UR 2XRFA 3ZDZB 5ICCA 3V4ZA 1XX6A 4HC4A 1ZMTA 1PHPA 2WJVA 3C4QA 4G65A 1FDWA 1IDN1 1YXMA 5DV9A 1YHNA 5D7NA 4EX7A 3I05A 1NLYA 4AY3A 2V98A 2GTPA 2PL1A 2NU6B 4PLPA 2GSDA 1TYCA 4LBVA 1M1YE 1Z5VA 5EN4A 1YTLA 3ZHTA 3LGAA 3DLBA 1I2DA 1IEWA 3FPGA 1GL3A 3IEPA 5FNVF 2QJTA 2BPOA 3RTDA 3UZUA 2GZ2A 4I4TB 5FYQA 1I8TA 1M6VA 2AHRA 2LV8A 4M0EA 4P0TA 4ZREA 3SK0A 4PGMA 1BJRE 4Q3KA 4W99A 2YRFA 1GGVA 4C6TB 1YB4A 1QVVA 1WWKA 3HCDA 1O9HA 3GJ4A 4MA5A 1XRQA 2QHXA 3BCUA 4RELA 4ER6A 3ZVKA 1EFRD 1RU3A 2HJRA 3BWXA 1ORWA 3P0RA 5B3KA 1MRNA 1E63A 1BGVA 2IS2A 5LFAA 3HWRA 1XMIA 3VJKA 4DC9A 1OC4A 3IIMA 3GYGA 4AWXA 4EI2A 5CBKA 3ZW9A 2Q3EA 2ZSFA 3PHCA 1ISJA 4DUZB 4BVJA 1YE8A 2PLAA 3PC2A 1UXOA 2H1HA 2BBOA 1Y81A 3L0PA 3MCWA 4JB8A 4M8KA 1ZC4A 3NS7A 5BN4A 4YCJA 2PK3A 2PPLA 2WDPA 2Q3CA 4UAVA 5GJVC 3TXYA 2IDZA 4M87A 5AM4A 2XEDA 4A8JB 1KIFA 3GZTB 2AOUB 2A84A 4OSPA 3JQ8A 1AV6A 4PG7A 2XUGA 4WLOA 3H3JA 3GR6A 1YZYA 3I45A 3KSDO 4DSTA 2IIVA 2P91A 4L22A 2JASA 1JQDA 3HPRA 3OT1B 2HNKA 3FRJA 1A5ZA 4ZOBA 1ZJZA 4XSHA 3H9EO 4ENTA 1Z0AA 1JG6A 3GUUA 4JQSA 1Z07A 3HU2A 4NV0A 4ZYUA 2A86A 3ADDA 2DWOA 4QQFA 2C2YA 2Q6VA 5E9JA 2G77B 2X2OA 3K0BA 4WLUA 1O3YA 3Q3HA 5EMNA 4DLTA 3AR3A 3CW2A 1WXQA 2J09A 1ADBA 2IHTA 2B4QA 4M54A 4B09A 4CL0A 3GVHA 3GZJA 3KXIA 4QYWA 3RIHA 5H7XA 2RSLA 3RKUA 4QJ3A 1MJGM 4HZUA 4CKZA 3U4QB 2CUKA 2B78A 2IY8A 5E3HA 3LHKA 4G4GA 5D3MA 5E7JA 3RVKA 5LZ4A 5D00A 2P2SA 3G0GA 3I0ZA 1GPYA 3SM9A 3PHJA 4LCJA 2BP7A 1OUMA 1UQUA 4OL0A 4WBNA 2C2MA 2X2FA 2ZKLA 1GCGA 1OASA 2CGEA 3WQRA 3V1LA 1HMYA 1CY2A 3EXAA 3PCTA 4JGBA 5L3ZA 4CMJA 1C41A 1DIAA 3GLQA 3AERA 4N5DA 1E8NA 1Z6XA 5DLYA 4IIHA 2WAXA 4U8GA 2AHOA 4C06A 2PJZA 5EPEA 5CDYA 2WWHA 1JQBA 2YWFA 3U17A 4EBFA 3IPYA 4QLAA 3ULKA 1UP7A 1KMCA 3FCXA 4MUGA 4NEGA 2DTDA 4QYXA 1IUPA 2BKLA 1EE9A 3PPIA 1AXGA 4W7SA 1GU0A 4WNAB 4J8PA 4E13A 3BWCA 3D8RA 5EINA 3IERA 1GTVA 3I92A 1UZLA 2A14A 3P4XA 2FUNB 4D4IA 1AB6A 2YXDA 2GYWA 1DNPA 4L75A 1IMOA 1JLHA 2OFPA 5LYJA 2MSLA 5D3ZA 4LYDA 3GT4A 3F9IA 1YIOA 1RKUA 4GXQA 4EFLA 1JKJA 2A92A 2BF7A 2SICE 3IFSA 1QWSA 1UMDB 2DY0A 4FZ5A 3V1NA 3TRFA 4IDOA 4A9AA 4O4JA 4BMXA 3IDSA 3KBBA 2WMOB 3EZGA 1PVDA 1BS2A 4KG7A 5FV7A 2B98A 4MVJA 2FPMA 1FRNA 3MUFA 3KUCA 3P2KA 2Q46A 5C5IA 3ZCSA 2BFAA 3QLVC 2HCFA 3QU5A 3X43A 4DDMA 1NM5C 1Q1BA 3W5HA 3HSSA 2FZ4A 5JZ9A 4I3FA 3U1TA 2WTMA 4B3FX 3S7ZA 2CHQA 4EJ6A 3RS2A 2Y0DA 3TINA 5HZKA 2JGRA 4M0DA 2PUAA 4C6HA 2W6JD 3CRMA 3AM3A 4ZTUB 1D4OA 1T2AA 1ZD2P 2ID9A 1UJNA 2Y6VA 4RZHA 3M0EA 4S1TA 3G9TA 1W9HA 2COUA 3GEGA 3CVWA 3RWOA 2VPZA 4HWGA 1N3BA 2FX2A 3MFYA 4V0RA 1ZK3A 1HI9A 2Z8XA 4FBLA 4EGQA 1V4BA 4ZI3A 2DQ4A 1N5IA 1FX0B 2E89A 3ML1A 4RVFA 3GN2A 1ND5A 1X7GA 3PICA 2HM7A 5JVDB 1FPQA 4FI3F 2I2CA 1FLDA 3REQB 2OOKA 3SKYA 5EC8A 3LPLA 3SYNA 4Z7QB 3F5QA 4N1AA 2NUTB 2ZVJA 2I3GA 1GVNB 1YA6A 3PQ2A 5HSGA 4OKNA 3PGVA 3DVLA 3GFVA 4W82A 4ZT6A 5BSMA 3T3DA 4CT0A 2IZZA 1P9RA 4ND4A 4BWFB 4GZ3A 5ALHA 4AY6A 1YDMA 2CVQA 4G0MA 3KR2A 2BT4A 1R9NA 3OE7A 4D02A 821PA 5H1YA 4UUQA 2A9PA 2XX3A 3T3MB 1HT2E 1RKVA 3KYCB 2FA9A 5H68A 1WUHS 1NBME 5FI0B 2QW1A 4PRLA 4AP6A 3M1IA 1H2YA 1V9SA 5BT9A 3OPYA 2IZOA 3GK3A 2RBEA 1PDWA 1IHXA 4KN9S 1XDGA 2GO1A 4BTVA 5KNCA 1YQXA 1GO2A 5A3VA 3ZCVA 3E1GA 3NKFA 4QC2A 2J32A 3NO4A 4M83A 2Z8ZA 5AJVB 2WFMA 5AM1A 3EEBA 1KSGA 9GPBA 3HXPA 1MJFA 3QKSB 1QUFA 3LUPA 1WB4A 2XHZA 3QITA 2WZDA 4NONA 3ZZ1A 1XK7A 2BIFA 1VB5A 1NOIA 2B5VA 3G5UA 4D7AA 3E2IA 4MH0R 1NBHA 4QFDA 4Z3KA 4JWTA 1ULTA 4QOSA 3RU7A 3VH4A 3E2MA 5H8WA 3EUAA 3ADBA 3COWA 4NFSA 1M8GA 1NJ5A 4G5OA 2BEVA 5LUBA 5FNZA 3QIVA 2G06A 1ZONA 3G13A 4MRSA 3C3BA 3UC5A 4O2LA 1CIJA 2QTVA 1N7GA 3FNIA 5A2QA 3ZX5A 2HRBA 4LWZA 1KU0A 2X8JA 4GRDA 1NKTA 2PGXA 2D4AA 2WUFA 4GXRA 4Y6RA 3E15A 3U2QA 4ALMA 2QVYX 1X7YB 4BMOB 2JF0A 4K03A 1YV9A 3UTCA 1DEHA 3CKYA 3OY7A 4ZZ1A 5DWQA 5TQVA 4D8XA 3WJAA 1KF0A 1R50A 3FUUA 3X2SA 5J4KA 4R54A 3CLHA 3GZNA 2C95A 2R5NA 3AOEA 4KRGA 4MPJA 3PNYA 4UU7A 5DWDA 1IXSB 2ZTHA 5B58T 3QX9A 3L06A 2YZNA 2BTOA 3MTEA 2PD4A 2C9MA 1LLUA 2VH1A 1GYQA 2WAOA 3GARA 3TM5A 2GZ3A 1EFAA 1BCSA 5J5VA 2OCBA 2VSOA 3GEMA 1YU9A 2NO6A 4ER3A 4EI7A 1RAGA 3BGDA 4FEYA 4BQRA 3FHTA 3CT4A 1TVEA 3NDJA 5B64A 3OA0A 1OLUB 3JVEA 4WVFA 2Y92A 3ZDXB 2HLDA 3IDQA 1BGXT 2BFEB 4RZ2A 4ZYVA 5L6MB 1U7PA 1VZ3A 3JYNA 4YT2A 1SC9A 3AFMA 4ZWNA 3WGNA 3HCWA 3I2GA 1JTFA 3FOFC 4CIBA 1J9GA 3DV0B 1MG5A 4P5EA 4Q7KA 2CLCX 2OO5C 3KUUA 1LJ8A 1JU4A 3KSMA 4HQKA 3LAWA 5AI4A 3SSOA 1ZD3A 5IXYA 2G9VA 3W6OA 2BTQB 1GEGA 2QLLA 4I1UA 1TVKB 1A96A 1Z75A 2GRAA 3IHLA 4LPKA 1LPSA 4YI5A 4EH1A 3JY6A 2B5WA 2P2CA 2PWYA 4OB6A 3KFLA 2HTFA 4XOUA 1XZIA 1UWVA 5IN5A 4JVSB 1P17A 1PQUA 5BWOA 3FGOA 1JEEA 4RF4A 2DBZA 2TMDA 1E6CA 4QBKA 4X00A 3GY0A 4I2NA 3ASZA 5DYYA 5TDHA 1YUMA 5JWHA 1DBRA 2AJDA 2JPDA 1EQAA 2PAFA 4HWPA 1NT2A 2QYOA 2DTEA 2JI4A 5FQNA 3SXPA 3I04A 5BVGA 2AYYA 2YWDA 2VK2A 4IR7A 1TQ6A 8LDHA 2HMAA 3KUXA 4G5GA 2ZB2A 5DHRA 4PSVA 3BIXA 1OBHA 2E6KA 4UOEA 3AVTA 2ZWVA 1KA9H 4Y9RA 5DTEA 4G6ZA 3W2EA 2BFWA 5ICFA 3IA7A 1VG1A 2IFTA 4UBJA 5JQGB 1SD5A 4EL0A 1XPUA 4P8RA 4WLEA 3IAS6 5TVKA 2JNWA 4CYMA 1D1SA 1THMA 3UO8B 3FGPA 2R48A 4B2LA 1L1FA 4NQRA 4A0QA 4ZQEA 2C98A 2YS6A 4NTZA 1W581 1WEKA 2O7NA 1PYDA 2PIAA 2GD2A 3GCZA 1G21E 2J41A 4KYTA 1DARA 1F0NA 3FJ1A 5BYBA 2W2XA 3R7WA 4H17A 2E4AA 3TRJA 3V32A 2JIQA 3MAAC 4CI9A 3JALA 1CF2O 3M3PA 5FOVA 3LP8A 3ICEA 2NT3A 1O58A 5F9MA 4HDRB 2PUHA 4KN6A 4CM7A 4LQLA 1HNXB 5AUPB 2VZEA 4Q4HB 3WYDA 1SCDA 1G7TA 5BMVA 1ISGA 4YV2A 3PD0A 3FSJX 1XYVA 3B85A 4TUYA 3ZS8A 1A1SA 4IQ8A 2JFNA 4GOKA 2YYYA 3JQCA 1WZIA 3LC7O 3IKLA 3ND6A 1W0KA 5K1ZA 3JATB 1IQRA 1E2DA 3B3FA 3ES9A 4M88A 4CUJA 1ULHA 2AOTB 1K4YA 3GCGA 3Q7SA 1F2VA 1RTTA 3VYSB 2V6IA 4X1IB 1A2QA 2CD7A 4P81A 4IDCA 1X86B 3BJIC 1JSZA 1Y8QB 3PFKA 4INAA 3W77A 3IP7A 1CLEA 1U90A 3IUEA 3VBCA 4DQ0A 4KIFA 3MLBA 4DDUA 3JRXA 4LHZA 2PKQO 3ABQB 1FFSA 1KL7A 2GCOB 3F97A 5I5GA 3T8YA 3BH0A 3VU8A 1XQ9A 3REOA 5IAGA 4JJ8A 1UZUA 3O9MA 5I9TA 3UG6A 2G5CA 3TF5A 3EZLA 3NEAA 2POCA 3GRAA 4LI3X 3O8DA 4G8CA 4Y1GA 2AC2A 2M32A 4AP5A 2HHLA 1PFQA 3OOWA 4IDFA 2Q1WA 4BO8A 2O1XA 1QIFA 2P3LA 2FFJA 2VJLA 2W2QA 1IN8A 2H1CA 3LUGA 3NW9A 2FVYA 3EOBI 3R6GA 5BO5A 3KDAA 2OT3B 1W75A 4Z54A 3A1UA 1NMZA 1G64A 1TTHA 3C8HA 3EF0A 4XASA 1NT4A 1S2OA 3KEQA 4JC4A 4DWOA 1E5XA 3PRYA 3EC2A 3CR3C 4Y2PA 2WINI 1BU5A 3OT5A 4PAMA 5DNDA 4Q3LA 3N2EA 2M6RA 3T9DA 3FCOA 1RAHA 3RF7A 4UMFA 3TW8B 2FE4A 4QECA 5AR1A 1U28C 2JA2A 2PJRA 4HMOA 5JISA 2EBUA 4NCAA 2AXPA 1TIKA 5EIOA 5KYYA 3UWMA 5E4YA 3M4JA 3QHAA 3N2GB 1KMIY 5BYJA 2XZLA 4C2BA 3MELA 1WZUA 2W37A 3E1SA 4ONEA 1WQ1R 1IN7A 1XYGA 3K8YA 4YMTA 3L7YA 3ENZA 4UFNA 1UBSB 1HDGO 2WE7A 3U5TA 3N6XA 1HTWA 121PA 4PVCA 2YWJA 1BU8A 1FY2A 1NN0A 1JGTA 1NQAO 2FEWB 3C8DA 4OGWA 1FFAA 1H0RA 2OB1A 1TFUA 3R2JA 3TW6A 1CQIB 4JXXA 4H35A 4IPTA 4L74A 4W5HA 5HF6A 3F96A 3IBGA 4AAYA 3I4LA 3CXRA 3TEJA 1KOGA 1Y5MA 2IZ5A 2V7QA 3OZTA 4G63A 4RKWA 3HDTA 4KTTE 5LSAA 3BAFA 3BG5A 1HQCA 2YXBA 3HVKA 5E1DA 3FTCA 1M8FA 3ANYB 3MW8A 1V41E 2LWIA 1CZOA 4NZOA 3GGCA 5KNDA 3HJAA 4MPPA 4UNPA 3R8CA 1H42A 5K8VA 3COYA 4JKYA 2VNKA 1L7RA 4NE2A 2OFXA 2NVOA 4Q82A 2FYTA 5EWJA 2REXB 3EGDB 3JPWA 3PFIA 2QDKA 2WJYA 4Y1RB 4DE5A 4MLZA 5CYOA 4R0NA 1JFVA 3TB6A 3D02A 4CDMA 5F2OA 4YRKA 1JP7A 1XD9A 2X5JO 1O03A 3HTXA 5LDDC 4A0GA 3JWEA 3SZUA 4P4LA 3UENA 3O8RA 1LFAA 3MD0A 3C41J 3KTAA 1CEXA 2BSXA 1I1QB 3LZDA 2E37A 5C3UA 1FJHA 4GWGA 5IZCC 2IH4A 3EODA 1TC1A 1U2DC 1XP5A 3QYJA 4MTCA 4N5IX 5ELMA 1T3TA 2VQDA 4FVTA 4DW8A 3BXZA 1EM6A 4RCVA 4C6SA 4EPTA 1R9JA 4KGXA 1L8XA 2PRYA 2X5XA 2AH5A 4MB6A 2CF5A 1GG2A 1DXHA 3NBFA 3OC6A 4ZDWA 5DN6A 3OFKA 1ZNZA 2ZETA 3QEKA 5AOBA 2MMCA 1DC8A 1R66A 3EIEA 3MJEA 3OG9A 4GI7A 3G7UA 4CKXA 4PAOA 1F7VA 4MARA 4LFAB 2O4CA 5KWEA 1FTGA 5KDLA 5BY2A 3BDVA 5E1OA 4BX3A 3KB2A 5JQGF 2B34A 3U9SA 4P3PA 2FV8A 3PDHA 1ZUHA 4CI0B 4P0PB 1Z7WA 4I5GA 1RAIA 2QRVB 3AKEA 3P2EA 4Q9KA 3PDUA 1VL2A 3M6IA 4WOKA 2CUZA 2QMHA 2WUEA 2J3KA 1GSIA 4V1CB 1S8AA 2L18A 2NXNA 3H1TA 4LY0A 1I10A 1YU6A 1PD1A 1GITA 1ZM7A 4M1EA 1M0TA 5COAA 2P65A 3U6BA 1NURA 1G16A 3I2IA 3DE1X 3L4BA 3ZY6A 2EZTA 3UFXA 3W04A 5JNWA 1G6Q1 3GDHA 4A0RA 5BXYA 3P1JA 3K4QA 3AL0C 3HCPA 1PLJA 4J49A 4KGDA 1CJCA 2WIKA 3EGOA 3UCXA 3MCVA 3UQYS 5BMOA 5B6JA 4D41A 2VTEA 1U0NA 4DMGA 1H8ED 3F74A 3CEJA 3DYBA 3NAGA 3ILSA 5A9TA 2JIMA 4TXNA 4JX9A 2ZRNA 3V2UA 1BHJA 1Q50A 4ITVA 2EBFX 3DL0A 4BATA 4B80A 2R2GA 4INJA 5J5AA 4ZU1X 1Z3IX 3ZEAA 3H84A 4EUEA 3LW7A 2XD9A