3GMDA

Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKVTYPMVAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKAVSGIVNAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Structure-based design of 7-azaindole-pyrrolidine amides as inhibitors of 11 beta-hydroxysteroid dehydrogenase type I.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 96
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmdA00
1MX3A 1YDEA 2E4AA 3GZNB 4XR9A 1PJSA 2BFOA 1P33A 1PR3A 5JSFA 4U5QA 2Y1DA 3LT1A 3E8XA 1V0JA 5C7IO 1D4FA 5H82A 1R4NB 3PZBA 3HDJA 1EDOA 3I9NA 1JKJA 3B1FA 1ZUD1 2AMFA 3D3WA 4PLCA 4JNKA 4Z3DA 2DM6A 3MOIA 1ZFNA 1VJ1A 1NQOA 3PYMA 3CSDA 4RPHA 1QR6A 2AQ8A 2DTDA 1JLLA 1NBOA 4PLZA 1KERA 4CPDA 3STHA 4QQRA 1FF9A 3DWFA 3WGTA 2VYNA 5TNXA 1TT5B 3O9ZA 3QIVA 3IIEA 4DIOA 2NVUB 4M54A 1I2CA 5B1YA 5C37A 3DAGA 3ZW8A 3LC7O 3GPDG 2RH4A 1SBYA 3CEAA 1R0KA 4OMUA 1MB4A 3VVCA 4YR9A 1H6BA 1M67A 2GN8A 2CDAA 3DZJA 3IUPA 4U6SA 4CV2A 4DGSA 4DLBA 4E4YA 2RAFA 2RBEA 3HQ4O 1HDGO 2V6GA 2RHCA 1QYCA 4GX2A 4NDNE 2W98A 3GR6A 5JMWA 1V6AA 3Q11A 3PQFA 1K6IA 1Y5MA 5JMPA 3V1UA 1EZ4A 1ZNQO 3NJ8A 4NBRA 1A7AA 1T2AA 2YW9A 1QYDA 3FNFA 4WLUA 2OORA 4HXYA 3LU1A 5K6AC 4J2HA 4PIVA 2XXBA 2P5UA 1M6WA 2H5LA 3NYWA 5L7YA 3GNQA 5BSFA 2NNLD 4GL4A 2GUGA 1YRLA 1DB3A 1SB8A 3WYBA 1E7QA 2EIHA 1JW9B 3ENKA 4CMBA 2POQX 3NT5A 4LW8A 5TIIA 3NUGA 4CODB 4WLEA 4B4OA 2DBQA 3RBVA 1C1XA 1PL8A 4B7XA 2B83A 3PYXA 3FBGA 4XB2A 4RO0A 3PDJA 1SCUA 4GSLA 1ZEMA 2V6BA 4CMHA 1GAEO 3BHMA 4QTZA 3L6EA 1WPQA 2G5CA 1YQDA 3P7MA 3ICCA 4YJGA 2JL1A 4LSWA 3L9WA 4QUKA 2PFGA 3JYLA 1LDMA 3GC6A 2CDCA 3KEOA 4OSPA 1VL0A 1CQIA 3WGYA 3KZVA 1B26A 3SEFA 3NRCA 4YT4A 3AOEC 4AJ2A 4YVFA 2D8AA 2E37A 1PSDA 4DYVA 1T2DA 4TZKA 4GPD1 2Y1EA 3MJVA 1I01A 4IBOA 2EJWA 1AHHA 2J5KA 3MJCA 1Z74A 3DZKA 4FFRA 5L4NA 2O7QA 2ZB7A 4L4XA 5JE8A 5DBFA 3IS3A 3NJ4A 5GZ1A 1UR5A 1UXHA 3G17A 2Q1SA 2Q46A 3PIIA 5TC4A 1KEVA 1RM4A 2Z1NA 3PEFA 3W4JA 4EEZA 2TMDA 2ZJ1A 3BTVA 4BO2A 3L07A 3JYPA 5HRUA 3MWDB 4INAA 3GGPA 1N1EA 2J6IA 1BXGB 2FPGA 4ND2A 1LUAA 1LDNA 2DFVA 2PK3A 4PLGA 5CFZA 1C0IA 4RVHA 2DKNA 3OEYA 2NU9A 1TVEA 2VYND 3I9MA 3ZV6A 5L4LA 4MINA 3W8DA 2NTJA 2NTVA 3WWZA 1H9BA 4MIOA 4YAEA 5F5NA 4CQMA 4BKRA 5KTKA 2O48X 4D0RA 4CLRB 3ANMA 4HFJA 1I3LA 5BNFA 1J6UA 1B8VA 2GNAA 3UUWA 1PZGA 3DZFA 3TWOA 2QIOA 2QRJA 5G4LA 5JDCC 2O2YA 4ILKA 3WIEA 5KJ1A 2W2KA 4OSOA 5TT0A 4J3FA 1ADGA 2HMUA 3ASVA 1C14A 3GHHA 2O3TA 4LMPA 2P4QA 3VAZA 3U49A 3L4BA 2HK9A 3F1LA 1ML3A 2IEBA 3HFSA 3RIHA 4TWRA 3VPGA 4I5DA 5K0ZA 4R5HA 4XKJA 3W6UA 2DBZA 1BDBA 4CL8A 4YAGA 1I8TA 3K6JA 3AU8A 3H5AA 3H7AA 1H0KA 1I2BA 1DHTA 1PIWA 1UZNA 3RROA 1JDJA 1E3EA 3DONA 5G0SA 5MDHA 1T4BA 4CQLB 1X7HA 4TQGA 1U3VA 1EBUA 1ZJYA 2Y1GA 3ZNPA 1Z6ZA 1DLIA 4I5EA 4TRNA 3Q1LA 1GPDG 1VKNA 2O4UX 5F21A 3VKVA 4B8ZA 4CLOB 3OA2A 2WM3A 2FMUA 2NU6A 5DP2A 2NM0A 1DDOA 1NWCA 1E1NA 4FFMA 1K2WA 3WWYA 1LRJA 3NV9A 4DC0A 4LCEA 4CMIB 1WMBA 4EITA 2HCTA 3IAHA 3JQFC 4CM8A 3ZHXA 3F6YA 4AJ4A 4ND4A 5CEJA 4OOEA 1SC6A 1V3VA 2GN6A 3G79A 5IDYA 3ZCXA 1S7CA 2Q1TA 4JBHA 4MVJP 5EJ2A 3V1YA 1VJ0A 5THQA 4R3WA 3AM5A 3HN2A 3VTFA 2X86A 1ENZA 4OQZA 2WYVA 4OOFA 3S2FA 1EBFA 4Y6PA 5IAAA 3L77A 3E9NA 3W6ZA 1P9LA 2O4CA 1KEPA 4QSMA 3ZNOA 5H81A 1N9GA 1NM5A 2IXBA 1ONOA 1W6UA 5BNIA 2I3GA 4KUGA 1DAPA 1GQ2A 1B8PA 1PJCA 2H9IA 1ZMTA 5JO9A 1P1HA 4ND5A 4XYBA 1Z75A 3GA0A 1I10A 1GU7A 1P1JA 1X1EA 4I5FA 3GPIA 4DWVA 4WCFA 3SXPA 3VH4A 4W6ZA 1CF2O 4IIUA 1EVJA 3U4IA 1ONNA 4PZCA 1YL6A 4IZIA 2I65A 1OFGA 1X1TA 1HLDA 3WB9A 2G82A 3NDJA 1U7TA 5ILGA 3SLKA 1DEHA 3ZHYA 3JD3A 3JD2A 1HT0A 4NBTA 3H6KA 1DFHA 1F12A 2I76A 4ALJA 4WOJA 3FD8A 3VPXA 1YB1A 1GV0A 3AU9A 2ZYGA 4DLLA 1UDBA 4U0KA 2AQHA 2I67A 1DBVO 1EE9A 2VZ9A 4MVJA 3PWSA 2BKAA 2FP4A 3E82A 2WJPA 4LMRA 2VTEA 3JTMA 3Q6IA 3EVTA 2ZQYA 3ZHBA 1I32A 2ZYDA 4XRRA 3CPSA 4B4WA 4CM6A 2RHRA 3GUYA 1NFQA 4BMSA 2G76A 1HXHA 2FOIA 2PV7A 3FNHA 4MP6A 5BSGA 4AJNA 3CE6A 3H5NA 5L9AA 3UCXA 1UAGA 2I3AA 2FR0A 4I9UA 3RJ5A 3SJUA 1KVTA 4YBZA 4UULA 3QRWA 3BMNB 3U09A 3EUWA 4U8GA 2VNAA 3FN4A 4J0FA 3DTTA 1YVEI 1LQTA 3JQ7A 1YJ8A 4LSMA 4CV0A 1YBVA 4DYDA 5L3ZA 5T8KA 1HYEA 4BNIA 3NGXA 1GUYA 4GSKA 3R3SA 3ZW9A 3I3OA 4NG5A 3I23A 1YXMA 1SAYA 3FWZA 4R9SA 1BXKA 4YRAA 1KYQA 4J0EA 5TT1A 3RASA 3WIDA 3GFBA 4NJMA 1P31A 1ZZEA 4ITUA 4RL6A 4ZGWA 1YL7A 2OO5A 2C54A 1E7SA 1U3TA 2DU8A 4N7RA 4CM5A 3OIDA 3UH1A 1PWZA 5L53A 4R1TA 4J1TA 1FMCA 3HB4X 4S1VA 4MO2A 4M49A 4ZICA 1Z45A 1IYZA 1X7DA 2VZ8A 3ONFA 4E33A 1AE1A 1QLHA 7ADHA 1LC0A 1YE3A 1PS0A 2QZ9A 3F5SA 3V1TC 2GO1A 3UGKA 3KTDA 1W73A 4L76A 3H5RA 4IZHA 4N5NA 2VZ0A 2HSDA 2Q2QA 2AEMA 3MJEA 1LLCA 2VUSA 2DT5A 2OZPA 3IP1A 3OP4A 2PLAA 4XCVA 1UXJA 1YOVA 2DFDA 1G0OA 3IOYA 4WPGA 1NVTA 1HSZA 2BGMA 1VJTA 4BNVA 2V65A 4UUMA 5A4DA 1WAMA 5F1OA 3OJLA 5KVQA 1KVQA 2Y68A 3ZV4A 1XQ1A 2GERA 3PQEA 2B5WA 4BV8A 1KC1A 3EGOA 4MVJD 3TOZA 3OH8A 1J4AA 5JYEA 4RPKA 3A9WA 3DHNA 3I4FA 5HA5A 5A9TA 3QWBA 4BNKA 2NUAA 1NFRA 2DVMA 3GVCA 1IULA 4IDGA 4AJKA 4E5MA 1BDMA 2PH3A 3UCFA 5BQFA 9LDTA 3OQ1A 2WWRA 3HB5X 3LLSA 1EFLA 2QW8A 3C85A 2GRAA 3F46A 3GDFA 4I1IA 5AXDA 1PTJA 1ZMOA 5EQFA 1I24A 1R12A 4B4VA 3G3EA 4P22A 4XDYA 2C59A 1ISHA 3ZN2A 3C3XA 3H9JA 3DMTA 1DIBA 2UDPA 3QVTA 1C1DB 1U2DA 4PRKA 3JD1A 4RVUA 1KVUA 4ONEA 4GKBA 4BS9A 3A28A 1YS4A 4OM8A 4EI2A 3ETGA 3DMYA 3DBLB 4J2OA 3QHAA 2JFGA 3V2GA 3JQBC 3PK0A 2HO5A 3FCOA 2P4HX 3BMCB 3KSDO 3GAZA 3MJSA 4YRBA 2CSUA 2A94A 4R41A 2AEFA 2HDHA 3P19A 4WJZA 1DC6A 3LC1O 2CUKA 3GEDA 3E1KA 4XQCA 4IJKA 1UP4A 4BMNA 1UUFA 4PZDA 3BMOB 3RD5A 3RVDA 2V7PA 3WGOA 4IM7A 1F17A 1U8XX 2BD0A 3DBRA 1B3BA 4FN4A 4J43A 5DZSA 2J8ZA 4ROSA 3H9EO 2I5PO 2PA3A 2IEDA 3I1JA 3NKLA 5DF1A 1LEHA 5L45A 1XYGA 2C07A 5JCJA 4A73A 4LISA 5EL0A 3LDHA 4KTTE 1ZH8A 4R68A 2GDZA 5C5IA 4CLHA 3ADPA 3WFIA 1TLTA 3ZWVA 2BLLA 5FYDA 4F6LA 4JK3A 2PGDA 3F47A 2RIRA 2CVQA 1MG5A 2BF7A 2W2LD 4TVBA 1EDZA 3GAFA 1T1SA 3CZRA 2Y0EA 4RF3A 3WFJA 4RVGA 4Z9XA 3RU9A 4JN6B 4CM3A 3JQ9C 4PCVA 3UKOA 4FW8A 2GYYA 1Q7GA 4FFPA 1BHSA 2HQ1A 4G65A 4DL9A 1CJCA 2DPGA 1T26A 1QYVA 4EUHA 4DXHA 5BNTA 1ZIDA 1M6HA 3LYLA 4J6FA 1ZCJA 3UAGA 4AJ1A 5JW6A 4TMFA 5JC1A 3BMQA 1P0CA 5KJFA 5THKA 5IJZA 9LDBA 1SO8A 1IZ9A 1UDCA 2VOJA 4URFA 5FEUA 1N2SA 2FY8A 5JDIA 4JXKA 1YWGO 1EK5A 2ZYAA 4AG3A 4B8WA 4ZRNA 2BH9A 2FPPA 3WGGA 3EZYA 3TZHA 3AW9A 4ZU3A 2P91A 3D4NA 2B69A 3DZGA 1OOEA 1P1IA 2G17A 4KDEA 2XF8A 1E7WA 4D3SA 1JAYA 1KS9A 2D1YA 3R6DA 1F8GA 1P45A 1U5CA 2ZB4A 2JCXA 2ZTVA 3FTPA 4OO3A 4P8RA 4Z0HO 3COSA 5AVOA 2PY6A 3L6OO 4WECA 5ITVA 1ULUA 3Q3CA 4DQVA 1AXGA 3PDUA 3M1AA 4NH4A 1YKFA 3D3WB 3K30A 1D8AA 2B35A 4KQWA 1R0LA 2W90A 5AQ1A 1IB6A 4YAKA 2YV2A 1GY8A 1ZK3A 3ROMA 3DOJA 1KVRA 2X5JO 4IQ8A 3LK7A 3GGGA 3BA1A 4AJOA 2VT2A 2VHVA 3WBBA 4XWYA 3JQGA 2QRKA 4ZA2A 3W8FA 3AY6A 4O0LA 3OQBA 1JVBA 4FOSA 1T24A 1E6EA 2B5VA 3JQDA 3K96A 5IDXA 1WWKA 3GHYA 1O95A 1H6AA 2HMVA 3TZQA 4NR0A 1GD1O 3FBTA 3AI3A 3DFUA 3NT2A 3KLPX 4WCDA 4MOWA 3UXYA 1NPDA 3VH1A 1LRKA 4MVJH 3QV1A 4D0SA 4HFNA 4CM7A 1LLQA 3R1IA 1Z7EA 3I9JA 3K73O 3EC7A 4IJWA 1ZVMA 5KKAA 4P4GA 5IXSA 2YV3A 4R5MA 3EVNA 2GR9A 3INGA 4MVJM 3PGJA 3V2HA 3BHIA 3MZ0A 4NBUA 2D0IA 4XQ9A 3ENNA 3DBHA 3UICA 2RCYA 1U3WA 3QVSA 4O5OA 1C1XB 4BHTA 2IZ1A 1ZSYA 4OXKA 5T5QA 4UVDA 1Q0LA 4LRTB 2PZJA 4FD3A 3DTYA 3WJAA 1B2LA 4II2A 5BT9A 1B7GO 4ALKA 1IZ0A 5A9RA 2Y99A 2EEZA 2VT3A 3OJEA 3ZWNA 5G0TA 2JAHA 4YJGB 3ZZNA 1HDCA 4HV4A 5IDWA 1F8FA 1GCUA 1XDWA 3Q2KA 1QKIA 3RUHA 2QRLA 2W8ZA 2C82A 2GZ1A 1KETA 2CVOA 4XYGA 1MXHA 5DOVA 4YTEA 1EE2A 4DBZA 5AOVA 2YZ7A 4RZHA 3QW2A 3WGHA 1VM6A 3BTOA 5L95A 4HY3A 3E6AA 3RFVA 4TKMA 3C7CB 2VTDA 4TSKA 4IY1A 1EUDA 1WDLA 3GDGA 5KJEA 1GZ4A 4MKZA 1ID1A 1WLYA 1XKQA 3Q9NA 3QP9A 2EXXA 2IYOA 2YV1A 1VSVA 4Y67A 3GVHA 3PJEA 1WW8A 5ER9A 2EERA 4D7AA 5I8WA 3B6ZA 1ADFA 1P74A 1LLUA 3I83A 3WGIA 2B4QA 1X15A 2B0JA 1EQUA 1R4MB 3IDSA 4G5HA 4HBGA 3ZU5A 1E3JA 2QQ5A 1UXGA 4CQMB 5K6AA 3RC7A 5CAEA 5ITWA 2E48A 2DUWA 3FTNA 3QQPA 4OKNA 4J1QA 2DC1A 2VOEA 3EMKA 4F46A 3RUEA 5JAZA 4UEJA 4PFJA 3ZV5A 1LA2A 4BO1A 1LX6A 3UW3A 3OECA 3WG9A 1QMGA 4E2YA 3VPHA 3C8MA 2GD1O 3I9OA 4U0JA 5DP1A 4II3A 4E0BA 4YPOA 2W2KB 1A5ZA 3I5MA 4A5OA 2PKQP 5FWNA 1ENPA 1G6KA 3PIDA 1VPDA 1Y1PA 1GZ6A 3RUFA 3D3EA 1PWXA 3OFSA 1A27A 2FSVA 3ZNQA 2W4QA 4FGWA 2C7VA 2EF1A 3VKUA 3IL2A 1ISJA 1PQWA 5A9SA 4OIMA 1PQUA 4XYEA 3SBOA 1KBZA 4JBGA 3ROKA 3ZWYA 4BKPA 4K6FA 2ZTUA 3PQDA 3B70A 3AOEA 1J5PA 2ZCVA 2EP5A 2JCYA 3AFNA 4DQXA 5DCYA 4OYRA 4BO7A 3JYOA 5KJ6A 1E6WA 4Z0TA 1HE5A 3FNEA 3GH3A 1T2CA 2FR1A 2BI7A 3BAZA 4J91A 4QECA 3RBZA 3VPSA 4NFYA 3ETDA 1QV6A 2D5CA 1N8KA 5T64A 1YGYA 3F5QA 4E30A 2C20A 3PI7A 4OHUA 3QE3A 4E6PA 2Y1OA 3AUSA 3KSUA 2X7HA 4L4RA 4W4TA 1M66A 3RC9A 4EBFA 2DLDA 2OXIA 5HS4A 4AL4A 4DQUA 4CM8B 4S3MA 4NQZA 1PQPA 4OL9A 3L6DA 1Q0HA 1Y8QA 3A1NA 4WK6A 1H94A 4PLFA 4A7PA 5IXYA 3U9LA 3GZ4A 4PLHA 1YO6A 4ZD6A 1L7DA 1M75A 3HN7A 5A5EA 2Q2VA 4Y9DA 1VI2A 4WGGA 3WDSA 4GX1A 3WGQA 4JCOA 1LSUA 2BGKA 3LF1A 4Q3NA 3QSGA 1T2FA 1YQXA 3BHJA 2NVBA 2D3TA 2Y67A 5JDCA 3G1TA 2C5EA 2PZKA 4B3HA 4WCFB 3FI9A 1I0ZA 4QXMA 4FJ0A 2GF2A 4XJSA 4D45A 3W8EA 4NNJA 4L4SA 3VDRA 2C2YA 4BNJA 3L9XA 1Q1NA 1RPNA 2IDZA 5C7OO 1XR3A 4LVUA 3IC5A 4B3IA 3ZU2A 2R00C 5CDUA 1LSSA 1NAIA 3HNPA 2BFPA 4J7CA 4CV3A 2BGLA 1FDVA 4N54A 5EN4A 1LU9A 2CDBA 4GMFA 2J3KA 2PGJA 1JWBB 5CDYA 1HEUA 3G0OA 1RKXA 1ZXBA 5IN4A 4BNXA 4UVEA 4BV9A 2ZQZA 2E6UX 3E18A 1UP6A 5TX7A 4M8SA 5JBIA 4QO7A 4EUEA 4CM4A 4OXYA 4WLVA 3ZH2A 3RC2A 3ZI0A 2P9EA 1PZFA 3MOGA 4RV9A 3K5PA 5JYDA 5JPIA 2A92A 3MTGA 4GWKA 3RKRA 4Z9FA 3WQRA 4RPJA 3JQFA 4J9VA 4M89A 2WE8A 4ZHSA 3FPCA 2OUIA 1QRRA 1AN9A 3H9GA 4D46A 4RPLA 2WTBA 1E5LA 1QYXA 3N74A 1CETA 4IPTA 5CHEA 4YAJA 4CUJA 1P1KA 4RQTA 3WOHA 1QYWA 4YEDA 3ZWCA 1MUUA 4HADA 2PR2A 3T7EA 2Q2WA 3JQ7B 4B7UA 4BKQA 2JHFA 3D4PA 3PJGA 4DA9A 1DHRA 2E82A 3O8QA 1HF3A 4DUPA 1NPTO 3ITDA 2LDBA 3GMDA 4NI5A 5IDQA 1IPFA 3GUCA 3ITKA 3PGXA 2EG9A 1IHYA 2EKLA 3PZRA 3TZ6A 4E2WA 1NQ5A 5I7VA 4NJMB 1RM5A 1EVZA 1B16A 2E49A 3ON5A 1JVSA 4J4HA 3FRJA 4WKGA 1MGOA 4BKUA 4TKLA 3S8MA 2JKVA 1EQ2A 5JAMA 1P77A 1PS8A 3RUIA 3D1LA 1P1FA 2CFCA 4XGIA 3OF2A 1E1MA 4DPKA 4N5MA 3DOOA 1HDRA 1K6JA 1U2GA 3ZWAA 3C1TA 3TJRA 3CZMA 5KVVA 4W9NC 3DB2A 5I9LA 1GL3A 1A9ZA 1PJLA 3RCBA 2PWZA 2HK8A 3EHEA 2CVZA 4FFLA 1Q7BA 1HE4A 4GGOA 3ZU4A 3PHJA 3GGOA 4MIEA 1XU9A 4X54A 4ZQBA 3NAQA 4XEHA 1KVSA 4Z0PA 4ZQEA 3DZIA 1YOVB 1JU9A 1ZEJA 3JYNA 3ONDA 5ICMA 1XSEA 4BNZA 3LQFA 3GNTA 3P2OA 3W4IA 2AG8A 4I08A 4R1SA 2EW2A 4Y6SA 2JFFA 4J7UA 5DDIP 3WTCA 3JQ8A 4EUFA 2J3IA 1E7YA 4LK3A 1ZBQA 4WE3A 5ADHA 5FI3A 3QWIA 3DC2A 3RQSA 4NMHA 1W4ZA 1OZAA 1XGKA 1SPXA 4BGEA 2Y93A 1A4IA 2X5KO 4IIVA 3V5NA 3DZHA 1R6DA 3OJOA 3IKTA 4MPDA 1NXQA 4I9HA 4BVAA 3U5TA 3VVBA 1HE3A 1CWUA 2VHWA 2GCGA 4MVJI 5I7FA 1DIRA 4RGBA 3WQSB 2EJVA 2VHYA 4B7CA 1ZSNA 3KSZO 4KOAA 5LC1A 5JCXA 1BRMA 4RDHA 2UVDA 4NU6A 5DNAA 1YDWA 4CUKA 3AWDA 3TF5A 3K8ZA 4GLLA 4Q3AA 3H8VA 4Q3DA 2ZJ0A 4UEOA 1P44A 2X9VA 3I6IA 2PKQO 2Y66A 4WOKA 4AJHA 3ABIA 2O50A 1HYHA 2JAPA 4XR4A 4UUNA 5B37A 1L7EA 2ZKLA 1U5AA 5KJCA 5JLAA 4A10A 2ET6A 2P9CA 3BZUA 1I30A 2ZIZA 4CMGA 4K6CA 4PLPA 3R3JA 4UVIA 4F45A 2I66A 1O0SA 4HX5A 5JAIA 4LN1A 1E1LA 5FF9A 5A05A 1XHLA 1IHXA 2FZEA 5DOZA 3VH2A 3IP3A 2ZTLA 5ICSA 3K9QO 4FB5A 4TRJA 4YA6A 4L73A 3KB6A 2YYYA 4DVJA 2FZWA 5ENVA 1LRLA 3NT4A 5CPBA 1O94A 3DBRB 3ZNNA 1DFGA 1PGNA 3GMSA 2XAAA 4FR5A 1NR1A 1U4SA 5JY1A 3WJ7A 1AUPA 1F14A 2WMDA 2Y05A 4QFCA 2V6MA 4CMAA 2W2LA 1V8BA 3E48A 3LZ6A 1CEQA 2J3HA 5KKCA 3AK4A 2BMAA 3OIGA 3IMFA 3ADOA 4NIMA 1RJWA 3DHEA 2VYVA 3DDNA 4RLHA 1PS9A 3B20A 3JD0A 3CINA 2YQ4A 3AM4A 2NQTA 1U4OA 4XB1A 5FFFA 3RC1A 4RCVA 2A4KA 3WXBA 1ZK4A 3ANLA 5HWSA 3S2EA 1PEDA 4MKXA 2D4AA 5LCXA 3OIFA 5EMHA 3CUKA 4CMEA 5HM8A 1DJNA 2CY0A 4L8VA 4IS3A 4O1MA 2JD1A 1XCBA 1C3VA 2UUPA 1HTBA 3TQHA 1JKFA 1V35A 3N58A 1OC2A 2P2SA 3QWHA 5DBIA 4RF5A 5EPOA 1LSJA 3BMQB 4CMEC 4NK4A 1I3MA 3CIFA 1RWBA 4GWGA 5A02A 1LXCA 2PNFA 4BO3A 1Y5RA 3JQBA 2OP0A 4WUVA 1DOHA 2GSDA 3E9QA 3AOGA 5IN5A 2NQ8A 2AQIA 2DBRA 2DUUA 4BGVA 4OXNA 1G0NA 2GGSA 2VWPA 1O89A 2P9GA 4BO6A 4FFOA 4TRRA 1BW9A 4JIGA 3RBXA 3WGZA 4BQRA 4B3JA 4W7IA 2Y0DA 4RVSA 4ZJUA 5CPFA 4Y6RA 3PLNA 1B8UA 3AI1A 4IQ0A 2BI8A 5F1KA 1VL8A 4DIBA 5CEEA 1YB4A 1NTOA 3DR3A 3KETA 1IE3A 3H9UA 2IE0A 1SNYA 4IDBA 3WQQA 2ZB8A 4AJIA 3V2UA 4YT8A 4ZN6A 3BTSA 4FC6A 2B37A 4RZIA 1KC3A 3UF0A 4NHEA 3QWFA 4HWKA 4ESOA 4Z3KA 3DOCA 1SMKA 1DC3A 4EYEA 1M2WA 3JQAA 3WMWA 3KYCA 2XOXA 1MA0A 4LRSB 3RFXA 1G1AA 1WXDA 4CL3A 2OP1A 4PLTA 5G4KA 2DAPA 4IMRA 3CMCO 4RPGA 4YJFA 2HMSA 1W0CA 1LI4A 4GVLA 3EY4A 2FSSA 3JQGB 4YJHA 1DC4A 3DZBA 1H6DA 3OHSX 1UJMA 5H83A 3JQ9A 2BRUA 4XX0A 1UXIA 4XYMA 1WZIA 3U4HA 3TFOA 4BO5A 3EW7A 1PL6A 3NEPX 1LJ8A 4GX0A 3AUTA 1DJQA 2HJSA 3GK3A 3HDHA 3H2SA 1N1GA 4PLYA 2QG4A 3PFFA 3WSVA 4ND3A 4CMCA 4P4NA 3NX4A 4YWJA 2D59A 2VYVD 5ENDA 3WX0A 4DC1A 4BGIA 4EJ0A 3HSKA 5EESA 3S55A 2YY7A 4OKIA 4PG4A 1E92A 3ZU3A 4E2ZA 1EEHA 4DLAA 2B4RO 4PZEA 2CMDA 3QVWA 5BSEA 4W82A 2J5QA 1GV1A 3OA0A 1HDZA 3DBHB 1LC3A 1CYDA 1MV8A 1PU2A 2I6TA 1NQAO 1PX0A 4UUPA 4FJ1A 1MC4A 3D4OA 1S6YA 3FR7A 3SX2A 4IS2A 2UUOA 3I9KA 5DCUA 3WR5A 2CD9A 3OEWA 4JX8A 3NTQA 3VHRA 2G1UA 3QY9A 1QG6A 4HNGA 1PL7A 2Q49A 3K31A 3VOSA 2DTEA 4R16A 3GRPA 5L51A 3G1UA 5I9MA 1RYEA 5L7WA 2X1HA 2OMEA 1K0UA 3KEQA 1FDSA 4IDEA 3VH3A 1HRDA 2VRBA 4MVJF 2EGHA 2X0JA 3PHHA 5ER6A 5F1PA 2AE1A 1ZK1A 1B15A 3B1KA 2D2IA 3CMMA 4GLOA 4FSHA 3PTZA 3HE3A 2YHIA 5JXWA 1PZHA 3BMCA 4BL5A 3INRA 1Y7TA 3SC6A 1Q2XA 5KVCA 2HMWA 3WYCA 1MLDA 1WDKA 3E5RA 4BNFA 4XD2A 3KO8A 4QEDA 1XEAA 3KBOA 2PGLA 4W99A 4A2CA 1JTVA 2ZK7A 4D43A 5B12A 5TS3A 4GI2A 3LT2A 3Q0EA 3JQAD 3WSWA 1Y9AA 2ZCUA 1KEUA 5JO0A 2VRCA 2X6TA 1B3RA 4G2NA 5F5LA 4CR7A 2VHXA 3ULKA 1BGVA 3AI2A 3VPFA 3LF2A 4CUZA 1GUZA 2Q50A 2ZATA 3PVZA 4K9DA 3KYDA 1PR9A 3ANNA 5A3VA 4O59O 1M76A 2NTNA 4RJTA 1XWFA 1NYTA 4ALNA 2XXJA 4PVCA 1MFPA 3WICA 4DRYA 4FFNA 5TJHA 2HKIA 3T4XA 4EEXA 3E5MA 3PP8A 2X0NA 4QX6A 4Y98A 4XGNA 3VZRA 3SVTA 2OL4A 1A71A 1P1RA 3TNLA 1OI7A 5TRTA 3CTMA 5A9SB 4E3ZA 5CEFA 1NWHA 2C29D 3DO5A 3JQEA 1Z7BA 4EJ6A 1QXSA 2IZZA 4IXTA 4MDHA 2BFAA 3AJRA 2X22A 3OJFA 1VSUA 5DT9A 1A4UA 2JD2A 5DULA 1YB5A 3RUAA 1XLTA 4J7XA 1ISFA 4E2XA 3FNGA 1GTMA 1XA0A 1JKIA 3WLFA 5KVSA 3VZSA 5T57A 4NFHA 3UVEA 4BGUA 3ICPA 1EK6A 3HJAA 4YRDA 1SEVA 3LC2O 5JC8A 4J90A 1LNQA 1PGJA 1BSVA 1E3WA 4ALIA 1GPJA 2C7GA 1XELA 3PPIA 2XPCA 1TT7A 6LDHA 2NWQA 1H2BA 5IFLA 2AHRA 3L4SO 4FQ8A 1Y6JA 4AJEA 5G0WA 4P38A 4R1NA 1Y8QB 2GN4A 3NDIA 4GX5A 4BO4A 1LDGA 4BNLA 4KZPA 2GN9A 4MIYA 1R0SA 3RUCA 4BNUA 5B4UA 2R6JA 4YAIA 3GOHA 1Y8RA 2HLPA 1F06A 3O4RA 2DPHA 5LDGA 4LVCA 4A27A 3JSAA 2BFMA 2IZ0A 2C0CA 2NVWA 3RSHA 1R15A 3IKVA 4CLXA 4NK5A 3FPLA 4E5KA 2IRWA 4R3NA 1E5QA 5J23A 4ALLA 3ZWMA 1IUKA 2WEKA 3BTUA 5AXBA 4XQGA 4K26A 2PD3A 2WD8A 1T1RA 3QJ5A 4E5YA 3OICA 1AGNA 4D44A 2VRCD 1NNUA 3GVPA 5A04A 4L0QA 2G0TA 3CH6A 3JV7A 4WNIA 5T6BA 5A3JA 5KIAA 3WMXA 4DTIA 2I99A 2IYPA 3GQVA 1ZW1A 3AY3A 3M1LA 2AA3A 1ISGA 1YH3A 3RJ9A 2GZ3A 2JD0A 1I36A 4H16A 3K2BA 3ORFA 4ZQFA 4JP3A 1HWYA 2O7SA 2YDXA 4RDIA 4XJTA 5HTOA 1VLLA 2AG5A 3GNSA 1PGOA 5GY7A 8LDHA 1NQTA 2WYUA 3BYZA 2HUNA 4IUYA 4CM4B 4DMMA 4WEQA 2Y1CA 3DBVO 5TLSA 2ZTMA 4WEOA 1UDAA 1TB4A 4NBWA 3P5SA 1A72A 3GG9A 5I7SA 1K89A 2H6EA 3UOGA 1YBMA 1EUCA 4JJFA 4EJMA 3AUAA 1XIVA 1U3UA 2WD7A 2X9NA 1ORRA 4L75A 1E3LA 2NADA 1E0DA 3K92A 5I9NA 2QHXA 5TJ9A 1IL0A 4KUHA 3FSRA 3GEMA 3M2PA 2GLXA 4JP2A 3SJ7A 1ENYA 4YT5A 4OGWA 5C3MA 1HSOA 4TVOA 4XQEA 3GF4A 2A35A 1KY4A 1Z82A 3TL2A 1ENOA 3GZNA 4EGFA 1GYRA 2YDYA 1HYGA 4KMSA 1JQBA 2C2XA 3C7DB 1PZEA 1R4NA 1Y9EA 1K5HA 3O8QB 3EK2A 4I8XA 4D3DA 5KNLA 4PRLA 1UAYA 1N9GB 2PKRA 4JLWA 3LSYA 2HU2A 2PD4A 4XIYA 1X0VA 1XQ6A 1GCOA 4AICA 4PGFA 1EVIA 2EW8A 1DRUA 1YONA 3O26A 4PG6A 4U7WA 2NSDA 5JAQA 3TFQA 4LCJA 2X8LA 2UYYA 4YCAA 3HZZA 3GEGA 4YACA 1U8FO 2HMTA 1TT5A 5IF3A 4DMLA 1V3UA 2R00A 2NVUA 3H2ZA 3MTJA 3KVOA 4YXFA 3N7UA 3PHIA 4PVDA 5G2OA 1DIGA 3CKYA 1R4MA 1H6CA 1HETA 3GVXA 4G81A 2EWMA 3PHLA 3KHUA 2CF5A 2HAEA 4WASA 3INTA 4JROA 4L74A 2JFHA 4O6VA 4BMVA 1DPGA 3ASUA 5A5FA 3F3SA 5LDHA 1Q7CA 2BHLA 1DC5A 4BUCA 5U1PA 2RH8A 3JYQA 1UXKA 1OAAA 2B36A 3Q2IA 4RF2A 4BNYA 1PJ4A 2NU8A 4KDFA 3T4EA 1DRWA 1NX6A 4DPMA 1I3KA 2TMGA 2Z1MA 1OMOA 4YDRA 3JQ8B 4CR8A 3D5QA 1C0LA 3AUUA 4IGFA 2HRZA 2CNBA 3HDYA 1D3AA 1QV7A 1DIHA 4BB6A 4TRMA 4WLFA 4RVDA 1WMAA 3F4BA 1ISIA 4DBVO 1IY8A 1CERA 2O3UA 3JCZA 3L4BC 2QYTA 3IUSA 1X13A 3H4VA 3EDMA 5EINA 4E13A 1PJBA 4KQXA 1BVUA 1DO8A 1E3IA 5HS6A 2PTGA 1I5RA 4N18A 5G0UA 4J4TA 3X2FA 1J49A 1B14A 4R1UA 4MJLA 1N92A 3QVOA 4J1SA 4PLVA 2DTXA 1NFFA 3PRJA 2A9FA 4GH5A 3DAFA 4NJOA 3ZWPA 1YJQA 2UAGA 1LTHR 1D1TA 3ONEA 4JBIA 1GFSA 1HDYA 3X2EA 4DIFA 1UH5A 2JHGA 1I33A 2O3JA 3GN1A 1XU7A 3E9MA 4UAGA 1ONPA 2OBNA 3IJRA 4KUEA 4WLOA 1CQJA 4J1NA 4W9NA 5T67A 3P2YA 4IQGA 4R9RA 2BELA 2Q4BA 4FBGA 4XZ3A 4A26A 1D1SA 1H2HA 5TGDA 1BXGA 3ZV3A 2R2GA 1SB9A 4GMGA 1BXZA 3QVXA 4Q3EA 3ZWBA 3K2EA 4IDDA 4GKVA 5CG1A 2YUTA 1YQGA 3I4CA 1HDXA 2HK7A 3KYBA 4GQAA 5BSHA 2EKPA 1HZZA 5JY6A 3F9IA 1MC5A 3GFGA 4LGVA 4O63O 4YT2A 4F6CA 1H93A 4Q3CA 1XG5A 4CLRA 2FN7A 4IXWA 1P3DA 3D5TA 1SOWA 3B1JA 3G49A 2VUUA 4HFRA 2X4GA 3U4CA 3EAGA 3W4KA 5F3RA 2X5OA 1TA4A 4WCFC 1H9AA 4IJUA 4CQMD 2H1SA 1GZ3A 3OMLA 3DQPA 4M55A 1AXEA 3FF4A 4XIJA 3TSCA 1Q0QA 1ADCA 2IODA 3TL3A 2AW5A 1JWAB 1MFZA 3IQDB 3LT4A 3WLEA 4E32A 4H15A 1LLDA 4M1QA 4CR6A 3BIOA 1BTOA 3HHPA 1GUFA 1PJ2A 2WSBA 4FJ2A 1PGPA 1JAXA 1N5DA 1NPYA 3DL2A 3OBBA 4MP3A 2UV8A 1LDYA 4N5LA 4QT0A 3WBFA 3PJFA 5GMOA 2FRDA 2Q3EA 4C7KA 4I9NA 1JA9A 4R51A 1WZEA 2WE7A 4ZQGA 4CQLA 4D79A 4FOOA 1O9BA 4W7HA 1GDHA 4CLOA 1B0AA 5EIOA 4AVYA 4PN3A 3WTBA 1O5IA 3EZLA 5A06A 4GAEA 4WLNA 3HUDA 3PHGA 3ZHZA 2QYSA 2GPTA 1DIAA 1EUZA 4UVHA 1QLJA 4CMIA 5COQA 4A0SA 1AHIA 1X7GA 1V3TA 4YQYA 4HFMA 1A7KA 2VUTA 3JQ6A 1U28A 2O23A 4F3YA 3H3JA 3OETA 1MG0A 4FC7A 1BW9B 3E03A 4ND1A 4E5NA 2LDXA 1DLJA 4CJXA 1T4DA 2D5AA 3QA9A 5TF4A 1FDUA 1GQQA 1O8CA 4FS3A 3F4LA 5U4QA 1KIFA 4XYLA 3AY7A 4IGEA 4NPCA 2OOSA 4IINA 3RFTA 2VN8A 3RAJA 2SCUA 3WNQA 1FK8A 4RVFA 2X9GA 3MWEB 3ROPA 1E7MA 5T8KC 1ZSVA 5L40A 3ZDFA 2X58A 5ILOA 1GEGA 3MEQA 4CMKA 4E31A 2F00A 4NBVA 1T25A 2PD6A 4IDFA 4NZ9A 3NGLA 3C24A 1GYPA 3ST7A 4E12A 1HDOA 2AQKA 3JQAB 5U9CA 1E1KA 3VDQA 3KYCB 3PFWO 2PZMA 3VZQA 1VC2A 4BO9A 3GLQA 5G4KB 1NVMB 4ALMA 2DQ4A 4DPLA 1UZLA 3A14A 1MP0A 3I6QA 4YJFB 2WYWA 4YJHB 3R0IA 1SZJG 1WVGA 3DHYA 5AYVA 1DFIA 2VCYA 5B4TA 3FR8A 4ZRMA 3LLVA 4I5GA 4BNHA 2EKQA 4IDCA 1TXGA 3F1KA 3C1OA 5COAA 4RQUA 1HE2A 5JFOA 4PLWA 2X0IA 4KWHA 3OM9A 4HNHA 5B4VA 4XGKA 4CMJA 3GDOA 3VZPA 4XDZA 1YBAA 2HJRA 4UREA 1UZMA 3UFXA 1CDOA 4RLSA 4AFNA 4CLEA 5CG2A 3DFZA 3GVIA 1W8DA 3D64A 4ID9A 1ZJZA 4RF4A 2YFQA 3DAPA 4FIZA 5L7TA 3IJPA 3NDRA 3PWKA 4CV1A 4DREA 3S1LA 1U1IA 1TEHA 3I52A 4Q9NA 5CP8A 2NV6A 3PXXA 4TROA 1NR7A 3A06A 1FJHA 1GQYA 3BMNA 4IMPA 4XA8A 5EQDA 4AJPA 4B4UA 3UCEA 3U0BA 1KY5A 1E3SA 3OQ6A 1V9LA 3PJDA 1NHWA 2Q1UA 1IOLA 5CDTA 2Q45A 4ZVVA 1EMDA 4NFSA 2H63A 3ROQA 5HBRA 4P4LA 3D0OA 1N7HA 3LVFO 5AXAA 3U3XA 1P0FA 3C7AA 5EERA 2OBYA 2EHDA 3HWRA 1L1FA 2Q1WA 5IZCA 1NHGA 3HFGA 3W1VA 2ILTA 2P5YA 3H65A 3ZWWA 1I3NA 3TZCA 2Z5LA 2FPIA 4E5PA 2DBVO 3QLJA 4HUJA 3LT0A 1BMDA 1MXFA 3DMTC 3T7CA 1TI7A 4J4BA 2VQ3A 4BNGA 5JS6A 1VRWA 5IZCC 1RYDA 1NAHA 2X23A 5KOIA 3M6IA 4XRGA 1OC4A 2YHIB 3I9LA 3RU7A 8ADHA 1NVGA 2FR8A 2PH5A 3TDKA 4UVGA 4D3FA 4MP8A 4FPXA 4YB8A 4ZQHA 1LQUA 2CF6A 4YQZA 3U62A 1O6ZA 1E77A 5K9ZA 5I8ZA 3JD4A 2YJZA 1ZXLA 5C7LO 5GZ6A 2NU7A 4TZTA 3BXXA 3MJ4A 1GEEA 1A9YA 4BKOA 3Q9UA 1FXSA 4IDAA 1WP4A 2WDZA 3KUXA 3S2IA 1X0XA 5GZ3A 4JQCA 4OH1A 3TZKA 2O2SA 1JN0A 2VWQA 3MJTA 4CM9A 4K28A 4L9RA 3WNVA 5CDSA 2YFHA 1PJ3A 5COBA 4EW6A 3TPCA 4EZBA 2NLOA 3WYEA 1ZO8A 3KYDB 4Q3BA 5ES3A 3S2GA 4D42A 1R37A 3AM3A 4A03A 2EGGA 3ZWXA 3RI3A 2VNSA 1VE9A 3RKUA 2EP7A 2C5AA 4PG7A 3PWZA 4BNNA 1CRWG 1FDWA 4QFDA 4R4JA 4R69A 3WS7A 4BIIA 2Q4EA 1ULSA 1HL3A 4KWIA 1RM3A 1J0XO 3SC4A 4CLDA 1K3TA 4YYZA 4JJGA 4D41A 2V6FA 1C0KA 1OBFO 4BO8A 1ZKMA 4NU5A 4MVJG 1DRVA 5KWEA 1N7GA 3VTZA 4PG5A 2GZ2A 1DSSG 3H9QA 2NACA 3GG2A 1DXYA 3GRKA 1ZK2A 4GBJA 4OQYA 3RWBA 5A1TA 5L4SA 4M86A 1EFKA 4J49A 1QSGA 2VWGA 4OJNA 5I7EA 2Q99A 3FWNA 4H3VA 1EVYA 1NASA 1R16A 1VKOA 1C1DA 2JCVA 4YJDA 3EYWA 3ETEA 3NTOA 2IXAA 4OAQA 1LSOA 4M87A 4BOYA 1E6UA 1LDEA 1E7RA 3FHLA 1E3WB 4H7PA 3HADA 3DBLA 3HG7A 1U9JA 3QWAA 4QO8A 4KTVE 2P68A 4C4OA 1ISMA 1F0YA 1SEPA 5JDIC 4AJJA 2J5RA 1PJTA 4Q39A 3O03A 1LDBA 4UEKA 1WDMA 3KOUA 4BO0A 5DN9A 1ARZA 3C1AA 2OFPA 4Y8VA 3VC7A 1DAOA 4AJLA 4BB5A 1BG6A 2AXQA 1Y81A 4FDAA 1U7HA 2O3SA 2VHZA 4KP7A 5IZ4A 1YL5A 1GADO 5DBGA 1Y8RB 1RM0A 5CDGA 1H5QA 1SOVA 4FGSA 4U6QA 4GVXA 4J16A 2JJYA 4MKRA 4CM1A 3A4VA 2YHUA 3BMOA 2B4TO 4R54A 3DXFA 1BVRA 1ZK0A 4UUOA 3OJ0A 1CIVA 3TOXA 4PG8A 1FDTA 2J3JA 5KCZA 2Z95A 6ADHA 1KOLA 1HKUA 3D7LA 2I9PA 2FWMX 1KEWA 1WNTA 5A03A 1D7OA 2QX7A 1QORA 3KM0A 3OSUA 3RUDA 5TQVA 5BR7A 2OGUA 3H3FA 1T2EA 3AFMA 4FCCA 2AE2A 4CM9D 1VL6A 4BNMA 5IG2A 3SLGA 3KLMX 4WNCA 2AEJA 4EDFA 1LBEA 4RORA 3HDQA 3V8BA 2PZLA 3PYLA 2FHSA 5JCJD 5G0VA 2QZZA 3KRTA 5FI5A 4IJVA 2O3QA 4JJIA 1IPEA 4BNTA 2HRBA 2YQ5A 3UN1A 2F1KA 3JQCA 4JGBA 3M2TA 3ZWOA 4BNWA 2O3RA 4HKTA 3CXRA 3GT0A 2X0RA 1QP8A 3DEYX 4MVJE 3O38A 4HP8A 1BWSA 4C7JA 4K1LA 2GASA 1NP3A 4J9UE 1I2ZA 2Y1FA 4BQPA 2VWHA 3KXDA 1ADBA 5DCWA 4Z9YA 1Z73A 2WD7B 1C0PA 5TSDA 3U4DA 7MDHA 4B79A 3GY0A 1PGQA 3GN2A 2EV9A 3L0DA 4GGPA 1GR0A 5MGBA 1K6XA 2Y0CA 3MCVA 3TRIA 3PLRA 3ZGYA 2OHXA 4R01A 5JNLA 2CZCA 3NTRA 4E21A 4Z6KA 1PJQA 2ZB3A 3KV3O 5AXCA 1R66A 1UP7A 1GYQA 3TN7A 3UHAA 1X14A 1HZJA 1HLPA
chains in the Genus database with same CATH superfamily
2E4AA 1YDEA 3OHMA 3L06A 2JLAA 1P33A 5JSFA 1MB2A 1I7NA 3CX8A 2CXHA 2Y1DA 3EC1A 5C7IO 1EDDA 2X13A 3EG9B 5H82A 5SV2A 3GLFE 3KQYA 4LNUA 3BH0A 2WMOB 3P9NA 5T4FA 4JNKA 1OXUA 2DM6A 3B2EA 2E6KA 4MR9B 3VAAA 2WVGA 3PYMA 2I1QA 4LJLA 4RZQA 2LRHA 2DTDA 2RB5A 2VIIA 3PC6A 4GLBA 4AX4A 1QGDA 1MVLA 3SIRA 1FF9A 2VSQA 4FYJA 5E4JA 5H8WA 1NJ5A 2HLDA 4K9SA 3TW8A 1XTIA 3U40A 3WGTA 3L4JA 1TT5B 3K9WA 1PNOA 2Q5EA 4BFUA 1GTRA 3T7RA 4DNPA 5K8LA 1Z06A 5HOEA 1I2CA 2HDOA 4KMOA 4LBVA 2C42A 4TTQA 1OXKB 1FXWA 4LDJA 2CL5A 2HC9A 1JAHA 1IK4A 2RH4A 2J0UA 3QMPA 1CY6A 4OMUA 1MB4A 3PITA 1GXSA 2E87A 1H6BA 1M67A 2A6PA 3IUPA 4NCHA 3KD3A 1AK2A 2ECQA 2XEDA 4FNGA 3CX3A 2RAFA 2R86A 2PSSA 2V6GA 2CV0A 1E4EA 3HYCA 2RHCA 1QYCA 4QDKA 5F23A 3THYA 2GNOA 1RKVA 1UMKA 2C9MA 1NLFA 5IJ9A 3OG9A 5EXTA 4QQFA 4EZEA 2HQOA 3WKAA 4Z3OA 1GTL1 2H59A 1G2QA 4IW3B 4ZEVA 1KO8A 1C3OB 2JLBA 1EZ4A 4N82A 4Q3OA 3DQZA 3NJ8A 3GJ6A 2WD9A 1J5EB 2YW9A 1V5GA 1D0IA 1AKUA 1QYDA 2LVBA 2OORA 4WLUA 4DCMA 5K6AC 3RT9A 3EHDA 2XXBA 2B9VA 2H5LA 3HA2A 2FCAA 4FGJA 2NU8B 5KINB 2BGWA 4FI3F 5FFNA 2GUGA 4I1YA 5DN6D 4ZYLA 1YS7A 3B5IA 1E7QA 4RIHA 1JW9B 5E6RA 3Q2OA 1CZNA 1P29A 2J1LA 1KFCB 4Y0VA 1TJ4A 2G4LA 4EW2A 2QRVA 3FZQA 5TIIA 1HGXA 4B4OA 3RBVA 3L7CA 5CD9A 1J39A 5EZYB 3FBGA 4MWZA 1B1CA 1ZD5A 3I6BA 5ALQA 1D2HA 1KO5A 4OYHA 1ZEMA 3AESA 3TZBA 3L5KA 2G4VA 4OEHA 1EB8A 1GAQA 1NJ1A 5DNVA 2NO1A 2G5CA 2WIDA 3L6EA 4G5YA 2ZXFA 3ICCA 3WLAA 3IUJA 4XD7A 1YZKA 2J30A 3L9WA 5LB2A 2AMJA 3OOHA 4DDTA 3TLYA 4G9EA 7MHTA 3L0IB 4OYYA 1XCGB 3KZVA 2E1PA 4GMDA 3R3XA 5EEHA 3RTAA 4ZYVA 3QA3E 3NRCA 1X6VA 4YT4A 3U44A 3CUUA 1Q5PA 2AJTA 5DHTA 2H1LA 1VKJA 1XZIA 2CL7X 1NXTA 3DE1X 1KFKB 2QA5A 1ONBA 2EZ8A 4GP6A 4AIIA 5B57C 1H8HD 3FTQA 2I4MA 5HCUA 5L4NA 2PXXA 3TDMA 1AF7A 1XWWA 4OCZA 5FBRB 4G9BA 2NAFA 1QKKA 2J87A 3VYRB 1W87A 3IS3A 5DBFA 4JP1A 4D8UA 1UR5A 1NRIA 3THXA 4KNYA 3G17A 5ALOA 2DPMA 1JJVA 1GVNB 1MX5A 1KEVA 1MT0A 4BVJA 2YZGA 4WY2A 1W75A 4EEZA 3ZWXA 5T4EA 3L07A 3J80A 4WK4B 4JNCA 3AMVA 3IMEA 1N1EA 3ILXA 1EM8B 4LYAA 1ZOSA 1K3FA 2FPGA 2WJWA 4ND2A 1OXMA 2DFVA 2D74A 3KPJA 4GHWA 4C2BA 2RGRA 1AO3A 2V5AA 1XNGA 1C0IA 1U94A 1FBNA 1N5LA 1R0YA 3K1AB 3R5JA 4RVOA 3DP7A 2A58A 2AH5A 2HLDD 2NU9A 3I1FA 3INYA 1V7QA 2QTRA 3RS7A 1M73E 2NTJA 2NTVA 3CLVA 3S2UA 4MIOA 3GUVA 4YAEA 16PKA 1MOZA 4CQMA 3PGMA 4HPJB 5D6OA 4ZFNA 4V0QA 1XTKA 3IBGA 4H7DA 4CLRB 3AY0A 5BNFA 4LGYA 1J6UA 1B8VA 2RBKA 4MQMA 5DTQA 5DHQA 3B3JA 3BULA 2AD1A 2QRJA 1JMYA 5JDCC 3WIEA 3ZLVA 1P2BA 4OSOA 3HCPA 5H9WA 4J3FA 2HMUA 1W94A 1PCXA 1Y1RA 3UXEA 2JFXA 4LF9B 4KQGA 5KCMA 1PLLA 2O3TA 3OPQA 1Y3IA 2WAYA 1IDOA 5GOTA 4C21A 3KKLA 3R5FA 4NESA 1J99A 1QGZA 1YR6A 5NLLA 2QNIA 3V3KA 5JV5A 4EHFA 3HFSA 4Y1RB 1U0SY 4URWR 3TSOA 3A6KA 4LG1A 4I5DA 3OM8A 4V1CB 3U7EB 4DRXB 4ZOBA 4NPAA 5B6IA 4JYZA 4S2EA 4H27A 4LTDA 4MUAA 4OQXA 1U8YA 2R6R1 3AU8A 3H7AA 3ZWKA 3PQ2A 2MSKA 3NV7A 2IWRA 1I2BA 4R1LA 5HRCA 1PIWA 5A5VA 4ND7A 2YICA 1JDJA 1OLXB 3DONA 2A9PA 2QRGA 3FUXA 1RRMA 3ZDCA 4MEAA 3D8TA 2F90A 5EMMA 3E4CA 4ZOQI 1U3VA 1EBUA 2X1LA 4HH1A 1NNI1 3AEYA 3BRSA 4M3NA 3T12A 2JLCA 1P2DA 1Z6ZA 3Q4GA 4H1UA 1GPDG 2O4UX 1EQAA 3B85A 4B8ZA 2HDWA 3OA2A 1CY1A 4K03A 4Y2JA 4E4RA 1CLUA 1NWCA 2YJGA 4XD7D 1E1NA 3ER9A 1XMPA 1K2WA 3HCFA 3OQJA 2GLTA 4U2FA 3WWYA 4PQRA 1JLRA 3KZKA 4OK5A 1WMBA 1BC5A 1QIEA 1SQFA 2OM2A 3SVZA 4OQEA 4AI6A 3ZCXA 5J2TF 3G79A 4KXNA 3NS7A 1BMFD 5EJ2A 1VJ0A 3VTFA 1VYTA 1ENZA 2WYVA 5CJ2A 5L6LB 5IAAA 3GH1A 3H04A 1DGQA 2O4CA 2WTXA 1MAAA 4XUGB 3NHWA 5LKRA 2ODTX 1SN7A 4QNMA 2SCUB 5HUQA 3EFOA 3ZKAA 3R0ZA 1B8PA 1EFUA 1B0ZA 2W6NA 1J2TA 4XYBA 5F7JA 1I10A 1VP9A 2A14A 4FMDB 1VXRA 1X2BA 3QEBZ 2W6OA 3X43A 4KPFC 4JXXA 5DI3B 2HNKA 5TF0A 1G4AE 1J7JA 3VH4A 3MLBA 1CF2O 2D3WA 4IIUA 4WK2B 1ONNA 4EAQA 1YVUA 1OAKA 1P4JA 5JNWA 2OV6A 1QFZA 3C4VA 3TNDA 2YYAA 2ZS8A 3WB9A 1HLDA 1O77A 5CM9C 4H0FA 1GJRA 5ILGA 2HM7A 1DEHA 3ZHYA 1JH9A 1JJIA 3AB8A 4MICA 3QFFA 3JD3A 1VL2A 1BCRA 1HT0A 3FMOB 5D5QA 2JCBA 3A1TA 4N3CA 2QUHA 1F12A 1L3IA 1NLUA 2HIGA 2ZT6A 3NOXA 3PFNA 3SY8A 3WB0A 4BTEA 3NC1C 4URYR 1YB1A 1GV0A 2B78A 2XYVA 4DLLA 2PR7A 3LBIA 1KY3A 2JH3A 4LY3A 1DBVO 4AO7A 4H6XA 1EE9A 4FZJA 2G1AA 2O1WA 2VZ9A 3TE7A 4E94A 2HSGA 4PPFA 3F6BX 3PWSA 2BKAA 5JPCA 5BN3A 4K9MA 4R8LA 1ORWA 5EE9A 4C5BA 4LMRA 1T29A 4O5AA 1OZ0A 3KQSA 4WHMA 1FTNA 2A1IA 1RI1A 3RSOA 4JEIA 2ZQYA 3A0UA 4N7MA 5E4YA 3ZZ0A 1V8DA 2JIZA 2NPIA 3VQTA 2ACWA 1VGVA 3KPYA 1Z35A 3AR9A 3GUYA 4PYJA 1NFQA 4BMSA 4IWYA 2HBRA 2OHGA 4P3XA 1D9XA 1P2FA 1QS0B 4KVGA 4TKZA 5ENZA 1M0EA 4L9AA 3O94A 4HAOA 4EHHA 3FNHA 2QLBA 3CE6A 3H5NA 3BRQA 3KKKA 3W05A 4C29A 1DUVG 4WESA 1W5TA 1GNRA 2FR0A 4I9UA 5B7QA 3RJ5A 3NG1A 3NVDA 1Z5VA 2R7AA 3A6GA 3EVBA 3BEOA 4KR2A 4IVPA 4EY7A 2DT8A 3HBMA 3JALA 2ANCA 5NULA 4Q7EA 1XB2A 4QYIB 5J5CA 3G88A 4W1SA 3CR7A 4ZK2A 2CV2A 4J0FA 2J9RA 1WXXA 1F3LA 2R68A 4OXQA 3EFEA 3UJNA 1KJNA 1KIAA 4OJTA 1M54A 4LSMA 1AIPA 1ZDMA 3W1EA 1GLNA 2I1LA 4WERA 5L3ZA 1POXA 4C5CA 1OR8A 2QV0A 1SQSA 1V5IA 2QOEA 1GUYA 4B83A 2VJDA 1WPRA 5JZMA 4KSYA 1WUKS 2C7QA 4S1TA 2ZBEA 1SAYA 1U6IA 4R9SA 2RD2A 1BXKA 1P4GA 1SELA 5ANRB 4J0EA 3WIDA 3JR7A 3PFKA 1D07A 3NR2A 4FNMA 4ECEA 6CHYA 1ZZEA 4GI1A 1OLUA 1E1DA 1XA4A 3MTIA 2QW1A 1YL7A 2OO5A 1E7SA 2ZAOA 3L1IA 4NLLA 3U7JA 1I4LD 1O58A 2D8MA 2VI5A 1RAEA 5G1PA 3YASA 4CKWB 4D92A 2C9YA 4EYGA 3RHTA 1K7FB 2MR5A 1YS9A 2NPOA 3PL5A 4LZAA 2HSEA 4R1TA 4ZWNA 1QG4A 2QL7A 2QUZA 1WO8A 3HB4X 3ETJA 3TW6A 1FLNA 1KRHA 2P75A 2X2FA 1Z45A 2VZ8A 2UU9B 7ADHA 1MRZA 1II8B 3VR1A 1U7WA 3OE7A 3PV0A 1LWNA 3ZK7A 1PS0A 1XPRA 2CMKA 3N05A 3V1TC 1J2UA 4G63A 1XJWA 1Q17A 4HSGA 4KLCA 1RXEA 2NX2A 4ZKEA 5ECYA 4M4SA 1JLKA 1E2IA 2OZLA 2HUPA 4ER6A 1RPTA 2Q2QA 2P6OA 3B6KA 3FHJA 3MJEA 2VUSA 4I19A 4XCVA 5DISB 5BN4A 2PS1A 3KQVA 2VVTA 1PV2A 2ZSFA 3N2GB 4Q7JB 2O05A 1Z9BA 2C98A 3ETLA 3L8CA 4KYUA 3KT6A 3HY4A 3OCYA 4PSCA 4F72A 1AH2A 2BE7A 2BGMA 3G0IA 1VJTA 2GYVA 3KTOA 3RVLA 4X95A 2V65A 4UUMA 1UQTA 4BNDA 5A4DA 3ZV4A 3S5JA 3FOWA 3KZOA 4R8SA 1MAVA 1KYTA 2R6HA 3R23A 4D97A 4ZI7A 5BRJA 2J3QA 3KL2A 1O94C 3FZYA 5AUQA 5CJPA 4EL0A 5CD1A 2FEXA 1TIKA 2PIAA 4RPKA 2FX3A 3GJSA 3PNOA 3IPXA 3TTVA 2GAFA 4MV7A 4J0CA 5TGZA 4EHDA 4QA9A 1D4ZA 1U0LA 2JIZD 2PH3A 3IQFA 2IHZA 4PGHA 3QBTA 2ZOSA 1FS5A 3UCFA 5BQFA 9LDTA 4HLCA 1PUIA 3TI9A 4RTSA 5IRCD 3A1SA 3KR1A 3LLSA 4FUTA 1SUWA 3W6PA 1MABB 1GZVA 3JWHA 4IZOA 3T3HA 1PTJA 3P0IA 1I24A 2PQ0A 4PNHA 1V3QE 2HEIA 3REGA 2XOKD 2G9QA 2H65A 4URHA 3I42A 5IH7A 1NULA 1EE1A 4MCIA 2VAMA 3H9JA 2ON6A 2GEBA 3KTAA 4JBWA 2UYQA 4MUHA 3OPYI 3JQQA 2VPQA 4PX5A 3H05A 1E5DA 4I1VA 4BXOB 1G20A 5CBPA 1L7NA 5AK0A 3VHQA 5HPYB 2QUAA 4RMGA 5F3WB 2VSNA 3JD1A 2ATCA 1EESA 3A26A 3VNBA 2WIGA 4BS9A 4RAQA 1EWTA 1YS4A 2BMWA 4OM8A 2PXCA 1YZLA 1Z0ZA 4EI2A 2B1IA 4J2OA 2OYCA 4BX2A 4KHPB 1G5PA 2RGXA 4CI9A 3UGTA 5ADVA 1D2NA 3W8NA 5IZCC 1WKCA 1H2EA 3C8DA 3X1DA 3FCOA 3M70A 3OF5A 5TDHA 4MV0A 2QVGA 4HAWA 4XVCA 2A1TS 3BIJA 4JJ4A 3LHKA 1WCIB 1Q3KA 3TB6A 4G67A 2FPKA 2E0IA 3GIWA 2A94A 2XI4A 3NAGA 4OU4A 2EBHX 4V3BA 1Q11A 1XQ9A 4X92A 1C2TA 2KX7A 1DC6A 2PWPA 4RHTA 1DZIA 3E1KA 1TM3E 1HG1A 3TKYA 5KPJA 4XQCA 4KO4S 4JI4B 1QFYA 2X2OA 2YXNA 1UP4A 1TECE 4IJKA 2OXCA 3NHFA 2EW1A 2XDQB 3ZW7A 2Q4RA 4RFSB 4EYKA 4I6JA 1LVUA 1KGSA 3RVDA 3MPOA 3WGOA 5ALSA 2F62A 4IM7A 2WVAA 4JLOA 4O4JF 4FN4A 1X42A 1R8XA 2F6RA 3OE7D 2BP7A 1XK7A 3W3ZB 5CDHA 4DJEC 5P21A 3V7FA 2IEDA 2XTZA 2A9JA 4W5TA 2XYPA 5A5GA 5CFPA 2HPAA 2NUBA 2CKDA 1OZFA 3R9XA 2ACKA 5K4GA 1VFPA 2V7TA 4G85A 4AXBA 1TKAA 4CLHA 3WFIA 1ZA1A 3MBKA 2GT1A 1UJ4A 2BLLA 3HCRA 4I4IA 5FYDA 1VSTA 5DTJA 5GM1A 4KEAA 3DKVA 2CBXA 1Q1ZA 3JTEA 1T1SA 5FV7A 2O54A 2QBYB 1Y4AE 3T3IA 4Z9XA 2H3EA 2W83A 3BXGA 3GLKA 3LHFA 4K0KB 3UKOA 5F9FA 1VLHA 2DHQA 4YASA 5FWXA 2AXPA 3HV2A 2A88A 2DETA 1KSGA 2WI8A 4G65A 5FUVA 3WLIA 1ZD3A 2AFIA 4RK7A 5LP6A 1CJCA 3C5VA 3NWBA 1KQ3A 4YMSA 1QQ7A 2QSZA 3CRZA 3KXLA 1V5EA 2GN1A 1TYBE 1VG1A 2JI8A 5BNTA 3UAGA 3LYLA 3FRHA 2RGAA 4IFEA 3Q7PA 2GNPA 4X63A 3ICOA 5GV8A 3SQNA 3ZBPA 1JQDA 4IH4A 4NV3A 4OB8A 1L8XA 1KO1A 3DDZX 4ON9A 5THKA 4R8VA 5CTJA 1DEXA 1UDCA 4URFA 3BE5A 5GP1A 3PHBE 4AG3A 4BJ3A 2BH9A 2NYAA 1DX6A 1RBMA 3MTBA 3WGGA 2ZYIA 4JA2A 3EOAI 3SHQA 5FPSA 1T4CB 2WJ3A 3AW9A 4G01B 2P91A 1KP3A 3KEGA 3DZGA 3V1NA 4HS9A 5DNUA 1P1IA 2Q5OA 4RZSA 2PHZA 1UDRA 4M98A 2P9BA 3L6BA 1PT5A 1RI4A 3D6HA 3GEEA 1XTTA 4KYTA 1OXTA 3R6DA 4RVNA 1F8GA 3B78A 5AVOA 2JCXA 4OO3A 3BH6A 4NBLA 3COSA 3TM5A 1VJGA 2PY6A 2HWUA 4UE6A 1FPQA 5CIQA 1ULUA 1I1NA 4OHRA 1AXGA 1Z4MA 3PDUA 3M1AA 1CLEA 3QU7A 4LNUB 4NH4A 4Z7JA 5CA0F 2Y0BA 4E5SA 3F73A 3SR3A 2PVCA 2VRWA 4FE7A 2CNLA 4D0NA 4KH0A 2BGTA 2G1JA 1ESMA 1NOJA 1T6NA 1YDFA 4K5QA 4O4LF 1D8AA 1ZRSA 2YN4A 3ECCA 3VSDA 1TUEA 1SKBA 4JMLA 4UPEA 4GKAA 4UFPA 4G5SA 1XZKA 4S12A 4RV5A 2W2NA 4WZ6A 1CJKC 2X5JO 5K6TA 3GGGA 1TRKA 3Q1KA 2VKTA 1OH8A 2VT2A 1IZYA 2VHVA 1U0OC 2P4SA 1E6LA 2B61A 3OUUA 5B6JA 2FMKA 1C3JA 4HRYA 3ILYA 4KITB 4CF3A 4UU1A 2C99A 2J0UB 4ZA2A 3W8FA 2C2OA 3AY6A 3CLRD 3OQBA 1MZVA 4O0LA 5ITZA 1JVBA 1MF7A 1GXSB 1FFGA 5EP2A 4IGIA 5KYUA 1E6EA 1N6HA 4HQ6A 1R8SA 1WWKA 3GHYA 5ALGA 2H5EA 1E4EB 1O95A 1XHEA 1YGPA 2GXUA 2HMVA 2I2CA 1GZSA 2VUHB 2WFMA 3CG0A 1ORIA 1GQSA 4NR0A 2OEPA 5ALZA 5IJ9B 1S8OA 3P71T 1PR5A 3B7WA 3ND9A 4XX1A 4F96A 1LRKA 1U0JA 2R9VA 3V4FA 1LLQA 3WL3A 1Z7EA 4GSYA 4X3PA 3K73O 3EC7A 3PRKE 1AKQA 3EPKA 3UC9A 1YE8A 4YYEA 1JG2A 3GGDA 4P4GA 3SR4A 1DQNA 2FPLA 4JQYA 1Q74A 3AFGA 4A8JC 1EHCA 4X66B 3IA7A 5LWQA 5E6RB 3PGJA 2BY4A 4NBUA 3MZ0A 4KFCA 1LW7A 4PPQA 2KS6A 2QRVB 3DBHA 3RAEC 4U6NA 2YWXA 4O5OA 3AQIA 3C16C 3L84A 5LLTA 1X7XA 4AQDA 1N0WA 2VXBA 3D43A 3CNBA 3ZU6A 4ETMA 1XC7A 4XWAA 3VGPA 3PQCA 3PG5A 3KS9A 3AESB 3MFQA 1P3Y1 5A9RA 1CX9B 3QUAA 4IWNA 1A9RA 1SCDA 4GT1A 3ZWNA 2FW8A 2QZJA 4WJKB 4WZBA 4HV4A 4FXPA 5IDWA 4KN6A 4CEJA 3K2IA 2QYOA 2C7BA 1GCUA 4YUAA 3QLUC 3Q2KA 1MB0A 4GKJB 4R31A 4XIGS 1KNXA 2QRLA 5JSHA 4R8MA 1QO9A 1BFUA 1KP9A 1EVLA 1PYOA 4GW3A 3SZ3A 3U44B 2FN3A 4FP9A 1NNSA 2CVOA 4HGQA 1MXHA 4TV9A 5DOVA 1VPTA 3P9YA 1JEQA 3CEJA 1Z8HA 4GYJA 4DBZA 1DELA 1L7OA 1G63A 1J9EA 1Y9JA 5AOVA 1R10A 3IAEA 3WGHA 2QSYA 3BTOA 3OAAD 3TLXA 4ATNA 5D8DA 5IYZA 5L95A 3UBMA 4HY3A 3ZUGA 2A57A 4PF1A 3BIWA 2VHUA 2VTDA 3DNPA 4B75A 3R7WA 1P0IA 1GZ4A 3MWYW 4IHQA 3HFRA 1WLYA 2PA0A 3BSWA 4QQKA 2Q9UA 4OTZA 2YV1A 1VSVA 1FNCA 2PLRA 1ZOPA 3KU4A 4N0PA 1I13A 1Y89A 1N0IA 3ZXUB 3I64A 3BWEA 4PTZA 2NSJA 5ER9A 1L4HA 3LPAA 2FPGB 2EERA 1M2HA 4R6XA 3UAZA 4D7AA 2M98A 5I8WA 3T8YA 3KBBA 3T06B 1C9DB 2O19A 3PT5A 3MYYA 2OVFA 4JT8A 2AUMA 2NU9B 2B4QA 5H70A 2B3TA 4TKUA 4CQMB 4CYMA 3RC7A 4BDSA 4RW0A 3KLOA 1YFKA 3PFIA 2E48A 2DUWA 3I0ZA 1C7JA 2FFRA 3QQPA 4CKCA 4MTCA 2Z04A 3RS5A 2WZDA 2X0KA 5TMDA 1W93A 5KWJA 1IVNA 5J2UF 3OECA 3UHOA 4FWIB 3VPHA 5EPUA 2IVZA 4E2YA 2AMVA 2ACEA 4E0BA 1NW3A 3PDIA 4L22A 2JPDA 2ZPAA 1H05A 1O95D 2PKQP 3PNLA 5E0OA 3ZS8A 1XF1A 2DULA 2G88A 3FPGA 1GZ6A 1M7GA 1OXSC 3A36A 1SKAA 2HXGA 3RUFA 3OFSA 1NF9A 2FSVA 3FUUA 3COYA 4MUKA 3C5HA 5IAKA 2QMYA 4EYSA 2NOAA 4GYYA 4R1OA 3SBOA 2WSLA 3LUDA 3EIQA 3ZWYA 2Z43A 4BTLA 3M4JA 4L8FA 2Y71A 4LV8B 1C80A 3DL0A 4OQMA 4OYRA 4BO7A 1ACMA 1DX9A 1OU4A 1SBCA 3JYOA 4Y0AA 5HK8A 1W4RA 4PNEA 5DIZA 1NJSA 4RY2A 2BMEA 1MA3A 3W2TA 1VBKA 2ZITA 2P0AA 1MDFA 4ACBA 4R2KA 3SMQA 3RBZA 3RT7A 3F7OA 4FDMA 4B7AA 5AKIA 3V34A 1G8KA 1TO2E 4G0YA 1NBAA 5TQJA 3HR4A 4ZAZA 2QZPA 3OLXA 5T64A 1KOJA 5LQNA 3C1UA 3BE4A 3F5QA 5BOVA 3RHZA 4E30A 2GCOA 2PJDA 3PI7A 4OHUA 3P2MA 2WM2A 1C4XA 1KQOA 1RYNA 2Y1OA 3AV0B 3AUSA 3D7RA 1EUQA 2X7HA 2OFOA 3GIDA 3NHRA 3P27A 4W4TA 4P7FA 4DDVA 5HS4A 4IKEA 1FXUA 4DQUA 4OK6A 4NQZA 5F7OA 1LPMA 4N0QA 2AFVA 4A7PA 3Q8MA 1COWD 2MYNA 5AOCA 4PLHA 1FFWA 5E9AA 1JEDA 3GLSA 3TX6A 1L7DA 3HN7A 3KPVA 1MO2A 4Q37A 5A5EA 2R87A 1DCTA 1RRFA 2Q2VA 3KUKA 1M6YA 1P6QA 2Z9CA 4WGGA 3WDSA 4GX1A 2WZQA 4TSFA 5DBHX 1FW6A 1E6KA 3PVSA 1E1RA 2KJQA 2ZJFA 4K88A 1EVKA 1RD4A 4BYGA 6Q21A 2BSQA 5IAOA 3VR6A 4Q3NA 4DB2A 2P6MA 3EFOB 3KQUA 3KUDA 1YQXA 2Q07A 5F2KA 1NG1A 4ENPA 1B1AA 1QG2A 2QLFA 2PYDA 3V8EA 3DEJA 3OLZA 4OBXA 5JH7A 3G1TA 1QKJA 5TPZD 1FRZA 5K51A 2WJVA 1NW9B 4C2AA 3DT8A 3B13B 3FI9A 4QXMA 5FLKA 3ZTTA 2GF2A 4EY8A 5G53C 4TYYA 4L4SA 4BNJA 2BGIA 3HYNA 4POOA 2R4UA 3L9XA 7REQA 3BJIC 1QTIA 2IDZA 5C7OO 2QM7A 3MRSA 2W6MA 4F2GA 2ZRHA 5KHOC 3ND7A 2PO7A 3G2LA 1AZSC 3F3KA 3ZU2A 3K9GA 5EJMA 1LSSA 3IODA 4MJ7A 2A5DA 3PNMA 1SR8A 2UYHA 1QVAA 2BFPA 1O0BA 3ZJTA 3K9CA 3G2IA 2BGLA 1XXHE 1JPNA 1N3YA 1TM7E 2FB9A 1LU9A 3FOCA 2Z1DA 2J08A 2PGJA 4KXQA 4QOHA 3WL6A 4LAFA 4K3UA 5IN4A 5GTDA 2QTLA 1VA4A 4WINA 4DXDA 4E15A 2OCDA 3IMKA 3BZBA 2OCAA 4PSVA 5BN3B 1BKYA 2E6UX 1I7PA 2JATA 2NXWA 1UP6A 2V7GA 3E18A 3EMVA 5TX7A 3ZHCA 1VP3A 3SX4A 4YIKA 4EECA 4OXYA 4UD2A 4WLVA 1VIDA 4HZIA 5DGDA 4HWRA 1RHRA 2P9EA 3K5PA 4L0MA 4CKXA 2ADMA 1JHAA 4D9NA 2A92A 5AJUA 3MCTA 4HDKA 4WZAE 1Z5NA 4ZPJA 5LZ5A 5KYVA 4CQJA 2DWQA 3K53A 4RHCA 3RNLA 3H5WA 2RHJA 1NW5A 4F4CA 2VDPB 4M89A 3F7TA 1DJMA 1HBJA 2JZCA 3AVTA 1XMSA 2OUIA 4FE4A 4DV7B 3C97A 3JZMA 4WESB 3SKVA 1QRRA 1Y9DA 2CYBA 4EKIA 3PA8A 3CN7A 1OVMA 3O1IC 2WHXA 3QBDA 4RGYA 5HMMA 3WZLA 1XX6A 2DOKA 1GUBA 2FKAA 1QYXA 3I8SA 2WKRA 3JALB 4C3ZA 3BL5A 4LTMA 1YS2X 1WCXA 3K4PA 4P7GA 4CUJA 7ABPA 4HLQB 4RQTA 1ZHHA 3E0XA 1QYWA 1JQAA 4YEDA 3CF0A 5JROA 1C81A 4Z9BA 1KAOA 3VO2A 4C08A 1SKQA 2PIDA 3HCCA 2QQEA 2I6FA 3T3GA 3TKAA 1VA5A 4Y3UA 5AVVA 1DXHA 1WMDA 4Y9RA 3H1TA 1HF3A 3EIOA 3KL4A 3U48A 3GMDA 3MELA 2JK1A 2VP3A 5ALRA 2HO4A 2EKLA 3KE9A 3PZRA 2PSJA 3RADC 3A2KA 4FU0A 2Q7DA 4GOJA 1RM5A 1OLUB 2ZFUA 5K01A 1B16A 4MPRA 2ZYWX 4WKGA 2VT7A 4IEFB 1RIFA 4BKUA 3ET5A 3JU3A 4DS3A 1EQ2A 1EJ2A 1P1CA 4YRRA 1M1YE 2WWGA 3CVWA 4TSFD 1TTHA 3HB1A 1E1RD 3GLTA 3CWZA 3I9FA 4I0WB 1K6JA 4BFZA 2GCPA 2IPNA 3HYLA 2FYTA 2WU8A 3C1TA 1J8DA 4V0MA 4BASA 2HFKA 2PGNA 3AHCA 1I6MA 2V3VA 3FTDA 3LVBA 4WNYA 4HNVA 1N2IA 5AHWA 4KXMA 4NFLA 5I9LA 1GL3A 1E1QA 1PJLA 5EG5A 5GWXA 1Q0ZA 2PWZA 3AHGA 4OHVA 1GGJA 3OKAA 4J6EA 2OZLB 4FFLA 2W71A 4ZCSA 4MIEA 4BX3A 1KVSA 4HZUA 1E2GA 4ZQEA 5BN4B 3PLAE 3DZIA 3BHNA 1OH5A 3ZQJA 4AW9A 5B1EA 1IEXA 3JYNA 4PRZA 3WY9A 1T9ZA 3ONDA 1XP8A 3EY9A 2AYZA 4L8WB 1FL9A 1M3SA 5BO5A 2IZOA 4BNDB 3NYQA 4R05A 4XAQA 3P2OA 3VYSB 3GI1A 4I08A 3H2HA 3GJ8A 1Z22A 4ZI7B 3WTCA 3NANA 4DKXA 4QPJC 1JG1A 5DNDA 2P67A 3BWVA 5JHHB 1ZH2A 2J3IA 4QBIA 1DKQA 1W1UA 2QNRA 4KQKA 4XWTA 1MPXA 4KB5A 5CA0A 3QZUA 3RQSA 3DE0X 3WMFA 1W4ZA 4EF5A 1LBSA 3H8WA 5KYKA 1XGKA 4DF3A 1YJBA 3MT8A 3G6WA 3VVLA 1XVLA 2Y93A 4IIVA 4RSHA 3V5NA 3WZMA 4P2BA 5HSGA 3IKTA 4GBMA 4WBSA 3IX7A 4Q1FA 5FPTA 2H2IA 2Y4OA 2ZU0C 5ELMA 1U2RA 4IXMA 1Z33A 1UBCA 1AM4D 4L2IA 1K75A 4RGBA 4RULA 4GOOD 2VHYA 5IUKC 2BGGA 4B7CA 1VCOA 2ZJOA 4KOAA 1S3GA 3OT5A 4TTAA 2R8OA 1E2PA 3FB1A 1NBWB 3EQ6A 3KTAB 1NLZA 2QROA 1HT2E 3AWDA 2BM9A 3RHFA 3K6KA 3ZGXA 2FRDC 1G20B 2P6UA 3GLHA 5CBPB 2I0FA 2O8EA 2O2DA 1XDBA 4JLKA 4TTIA 1XTBA 4H3SA 2JAPA 2FFHA 2QLTA 4NE2A 2IDJA 3OI7A 2YOFA 4Q5IA 3E23A 3LH5A 1A8IA 4L5AA 4RENA 3BZUA 1BKSB 1RE0A 2Z3WA 4WKOA 1U4NA 4JU8A 3RSFA 5EIXA 2VJLA 4K6CA 2Z8XA 1EU1A 2ORWA 2I22A 4H0CA 1EZ1A 3E22A 4QDTA 1JYEA 4R1PA 3ENWA 3CNOA 1Z4OA 5B2FA 5JAIA 2IVFA 4MV1A 1E1LA 2AZTA 3H8JA 3M83A 4TQUS 3ZGLA 3FPKA 1FQOA 5LZ2A 3Q3HA 2P9ZA 4UMFA 3N70A 5IU6A 3ZLTA 2A9QA 1IJKA 1DKOA 2GCEA 1FRFS 1RAGA 1WEHA 2XITA 1V48A 3C3KA 3VH2A 2ZTLA 4EFLA 1EXNA 4LHSA 4EI9A 5ICSA 4LRYA 1TVKA 1TA9A 4ZVRA 4TXLA 5CYGA 1NMYA 4C3UA 2V3WA 2XWBF 5K4AA 1BEZA 2BMFA 4YJ2F 3B5JA 4UUAA 4UE3S 2AC2A 2CMHA 2V0GA 1GPWB 1OYOA 2JARA 3DXXA 4AZ0A 2AKEA 3WE7A 3ZDBA 3NT4A 1PGNA 3COWA 2BP7B 3IP8A 1E1QD 3O8LA 5SYNA 2QUIA 2RC6A 3EXG1 1SXJA 4ZZ2A 2JHAA 2W2LA 3OOJA 4DILA 5KSOA 1V8BA 4DDHA 1GDDA 3ESDA 3N8IA 4BFTA 5IF9A 3R9XB 1M5UA 2GS9A 3IIIA 3BT7A 3ZOZA 3DHEA 1GP2A 2VYVA 4B3DA 2J07A 4OIFA 4K9NA 4M7WA 3CINA 1IQPA 5CCXA 1G8GA 1H69A 1ISPA 1Y80A 2E18A 3RYHA 1VG0B 4KNWA 3RC1A 3NZEA 4RCVA 2JVKA 2AG6A 3P0JA 1TJ3A 3U3OA 1BH6A 3ANLA 1HL7A 2REOA 1LPBB 3CUSA 5HWSA 1Y3DE 4IRUB 1IY9A 5BSKA 3SQXA 5BPFA 2C2BA 3MGKA 1R3UA 2J4CA 3LBHA 2PE5A 1C4KA 2JLUA 5FWXB 1RXSA 5I51A 1I4EB 2QWXA 1YR9A 5HM8A 3IULA 3TCNA 3BXOA 4GEGA 2AFIB 4O25A 3A9VA 5LP6B 1A8UA 3TZLA 4M9XA 2IHTA 4F5YA 1Q50A 1KYZA 1XCBA 4RTJA 1HTBA 4F93B 1JTEA 4TWZA 1C9YA 1YNOA 3G7SA 4NX2A 4LYEA 1HQDA 1LSJA 2QGZA 4NK4A 5EIBC 1I3MA 3FMFA 5EPOA 1NONA 3NLLA 5A02A 2W6IA 2ZE5A 3COZA 2PNFA 3QJGA 1GPBA 4GQIA 1NIJA 4RJIA 5GONA 3U3MA 2Q6TA 4QYMA 1QRDA 4TPKA 2HHLA 1NVWQ 3ZYZA 4JZYA 5BMVF 2FMHA 2HY7A 2OHFA 1FVOA 4RX1A 1FMJA 2NQ8A 1JDBB 2ZJAA 3UATA 1QQTA 4BGVA 2W42A 3RK4A 1T0JB 2VWPA 2P9GA 1L4YA 2J0EA 3FLMA 2FU5C 4JIGA 4LE2A 4B3JA 4XW2A 1YA4A 3VR4A 5CPFA 2OGSA 2H4JA 2KHZA 2FFJA 3KLBA 3ZHOA 4IQ0A 1TAUA 4MJXA 3KPWA 1KMQA 2CXOA 1GPKA 2QTMA 4Q9HA 3CZAA 5DHSA 2YVKA 4LHYA 3SIXA 4AJIA 4YJ3A 4KQ6A 2GHIA 1IHOA 1JS1X 4QYXA 3NHJA 1XXLA 5ALHA 2ZT7A 4RZIA 1XAHA 4HWKA 2GPWA 1AQUA 1Z68A 1ZOOA 3GP3A 5CR9A 4KAXA 3URMA 1L3BA 3C3DA 2H54A 4AF6A 2ID4A 1G18A 4EYEA 1K9VF 3PR1A 4OA5A 3JAWB 3L92A 2GM4A 1WXDA 3HHEA 4F4FA 3TUZC 5H16A 1MAUA 1XKLA 2DAPA 2CLSA 3HBFA 3RTDA 2FG6C 2ZT5A 2HMSA 4MA4A 4P81A 1W0CA 1LI4A 2CJPA 3IBTA 4K9RA 4KV9A 4YJHA 2VZLA 2E4YA 1H6DA 2VUIB 2G3YA 1G9SA 1UJMA 3AP3A 1VGQA 3FPHA 3I30X 3MQ2A 4EY3A 4ZYWA 2QQGA 1XRLA 2QTNA 2AN5A 3HR8A 4XX0A 1UXIA 3N8KA 1O4VA 2B2CA 2B8TA 1LCIA 3EW7A 3FWPA 4J3NA 3KQMA 3TLZA 3CH7A 2PBFA 3Q87B 4GX0A 4DV5B 1Z4IA 3GK3A 1GTSA 1BXRA 3ZI4A 3N2IA 1CVIA 1BN6A 1N1GA 1PK9A 3GBVA 4MPTA 4IJ5A 4DM4A 2NSLA 4S1WA 2GCNA 2WP8J 4ND3A 1NN3A 3WISA 3MVEA 4YWJA 5AW4A 2ID7A 1QCDA 2D59A 1K0FA 2DWCA 2PX4A 1ODIA 2VYVD 4L4ZA 5ENDA 1J42A 4X5OA 4DC1A 4MYTA 4DCVA 1PVOA 3KG2A 1JHMA 3BC1A 2CNWA 4RH3A 2C4WA 1RLTA 3ZU3A 1E92A 1TZKA 1TL7C 1EGQA 1EEHA 1T0HB 4B3FX 2CMDA 3QVWA 2DMRA 4W82A 5BSEA 3K6SA 1I3OA 3WAGA 3L8EA 3X1KA 4RVCA 4JOSA 3GROA 2F3PA 3IDFA 2Q4TA 2WAMA 3UO8B 3DBHB 2JEZA 1H42A 2QD2A 1PU2A 5KYTA 1IM8A 2I8LA 3P9SA 3REOA 2Q29A 4EIWA 1YAHA 1X7XB 5IKMA 1V37A 2H8KA 3H87A 3W7VA 4QYWA 2O8BA 1IN4A 3D4OA 3AVOA 2YNMC 2GKOA 3DM5A 4IS2A 2UUOA 1YVPA 3VC1A 3ZQUA 1W96A 5H02A 4AKGA 4JX8A 3VHRA 1G291 3C8HA 2W6ID 4ARCA 4WZBB 4CEJB 1PL7A 3F7NA 3TQSA 2EOAA 3ICEA 4TL8A 5C8ZA 1GRQA 2DTEA 4R16A 2P3SA 1YF3A 3GRPA 1ESCA 1QH9A 1X2EA 4K9QA 5L7WA 3LMKA 2WA1A 3IDAA 2DHCA 5FOTA 4JWKA 1FDSA 1U0RA 4BWFB 4YUYA 1QIHA 4TV9B 1HRDA 2Q3JA 4UJ3A 1JEQB 2HF7A 4OBBA 2YS6A 1Q7EA 1TM2A 3NXKA 4GF5A 3UQYS 1HQKA 3VR4D 1C3EA 4ZO8A 4G5GA 9ABPA 1E61A 3CMMA 1BMTA 4QGGA 5FNZA 4GLOA 4D1YA 3KAJA 5C8VA 5IYZB 1JILA 3IV7A 5CB6A 3P52A 2CXXA 1DTWA 3INRA 1Y7TA 3SC6A 1MLDA 4JU9A 3R7WB 4JC5A 2PZEA 1YZVA 2CWDA 2HA3A 2J5BA 1NMZA 3GJ7A 4X44A 2R6DA 3KO8A 4QEDA 5IARA 4DW8A 2Y92A 3E2MA 2NQ2C 2MSEB 2VYCA 1YZFA 1JTVA 1U9IA 5HE8A 4D81A 1T6BY 4ED9A 4H4DA 3RK1A 3X1YA 3U16A 3AVVA 5A0TA 2BZ0A 5B12A 4M22A 2YWDA 2ZT8A 3CUYA 1ZWLA 3IAS1 4GI2A 4IEIA 6NULA 1H1LA 4F38A 3Q0EA 4CIWA 4UTVA 1Y9AA 4HQNA 4YGXB 4UMEA 1ECJA 4E11A 4M6WA 4TKUB 4LF8B 4UBKA 1FP2A 1DBSA 2QXUA 1ZJ6A 3DEIA 3BGVA 3Q85A 4JSTA 4N0EA 1KI1A 5K8IA 2CXQA 4EA8A 2ZATA 1V26A 4CKCB 5K3DA 1JIUA 3GRZA 1PFGA 4U7JA 1GSAA 4G09A 2ONYA 2N75A 3ZH9B 1M76A 3G8BA 2G6TA 4EJSC 3RAPR 4DEXA 3T5CA 1E2MA 1UJ2A 4H6VA 4QBGB 1Y3FE 4ENWA 1PNRA 2JJ1D 4JX9A 4PO9A 3PDIB 2HKIA 5A0FA 2EX4A 3T4XA 1UL1X 4N5DA 4QRIA 1C9EA 2PKCA 3HPQA 3L1JA 5EHQA 2X0NA 3R7DA 4OP2A 4X00A 4XGNA 2V9ZA 1A71A 2I33A 3B7PA 4B8YA 3TNLA 4LQCA 1V6CA 3AL2A 3QMMA 4WKCA 2M6KA 3Q40A 3T7IA 1VMEA 2W93A 1KH3A 1IBSA 3CTMA 3C4JA 3NRJA 4P92A 4L51A 4Y9UA 5TRTA 3ZQKA 1XALA 2CNKA 4QPZA 4KIJA 1NWHA 3TRDA 4LA4A 3OU2A 1P61B 4JLPA 5FDFA 1Z7BA 2IZZA 2QVLA 4J0KA