3GMDA

Structure-based design of 7-azaindole-pyrrolidines as inhibitors of 11beta-hydroxysteroid-dehydrogenase type i
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
264
structure length
264
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMTFAEQFIVKAGKLMGGLDMLILNHITQTSLSLFHDDIHSVRRVMEVNFLSYVVMSTAALPMLKQSNGSIAVISSLAGKVTYPMVAPYSASKFALDGFFSTIRTELYITKVNVSITLCVLGLIDTETAMKAVSGIVNAQASPKEECALEIIKGTALRKSEVYYDKSPLTPILLGNPGRKIMEFFSLRYYNKDMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Structure-based design of 7-azaindole-pyrrolidine amides as inhibitors of 11 beta-hydroxysteroid dehydrogenase type I.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 96
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2009-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gmdA00
1C0IA 3S55A 1PEDA 3H3FA 3PJFA 2UYYA 3ICCA 4BO6A 2O2YA 4BQRA 1VKNA 2C5AA 4PFJA 3BMOA 4YJDA 5JBIA 3JD2A 3LVFO 3PQFA 4Y98A 3NT2A 3TWOA 3WYCA 5A9RA 3KZVA 5EMHA 4ALJA 4R1NA 3GC6A 2JHFA 1B15A 1H2BA 3G1TA 3K9QO 1SOWA 3AOEA 4JQCA 5BNIA 2NV6A 3GDFA 5ER9A 4ALNA 4ZGWA 1DIHA 3EK2A 1K89A 1NQ5A 3RIHA 3QP9A 4BGUA 2ZYDA 3RC2A 1N9GA 1R15A 3TZQA 3L07A 5BSFA 2NVUA 2PA3A 1QRRA 3OHSX 4JBIA 4N54A 4A03A 3LT4A 3HHPA 2Q45A 4R5HA 2FRDA 4G5HA 5KJFA 4J0FA 4BQPA 2IEBA 1O89A 4PLTA 2QRLA 5F3RA 1U3WA 1DOHA 4H15A 3GNSA 4TRRA 1SOVA 3WQRA 4IS2A 4ALIA 5A05A 1I8TA 2EKQA 1EE9A 2VNAA 1NHWA 2O3QA 2EHDA 1KVTA 1M6WA 2FMUA 4MIOA 3VPXA 4B4UA 2ZCVA 5JC8A 1N2SA 1U3VA 4UREA 3WYEA 4TKMA 3AY3A 4LISA 3U9LA 4RO0A 3S1LA 4PIVA 5THQA 3GVIA 1ADGA 1L1FA 3RC9A 5IZ4A 3MJ4A 5DBFA 4HV4A 1GQYA 1G6KA 3DAPA 4NMHA 2HRZA 2E37A 5JNLA 1MXHA 2Z5LA 1NWHA 3RKUA 5K9ZA 4ZA2A 5TT0A 4S3MA 3QHAA 2EGGA 2X86A 4NFSA 2ZTVA 4J7XA 1H6CA 2ET6A 4QO8A 1XGKA 2GD1O 1F14A 4FJ0A 4E5YA 4Q3AA 4R54A 3OJFA 1LTHR 1QP8A 2I65A 2JAPA 5F21A 1IHYA 1GPDG 4ND5A 2YQ4A 4E13A 1IZ0A 1C1XB 4KZPA 3GLQA 3WNVA 4AJLA 4G65A 4EDFA 5U9CA 1HZZA 4CM3A 3U4HA 3PGXA 3S8MA 3MOIA 3FSRA 3Q2KA 4W99A 2FSVA 4F45A 5CDGA 4Q3BA 4PGFA 4BO1A 4TMFA 2JD1A 1YONA 4CMGA 3D0OA 2VOJA 3KLPX 3U4DA 3H5RA 3ROPA 4RZHA 4NK5A 1F8GA 1S7CA 5AXCA 4DWVA 1IB6A 4QQRA 2C2XA 2RCYA 2VHWA 2G0TA 2Q46A 4IM7A 5DCYA 5H82A 1MGOA 3OEWA 4TVBA 2OBYA 2X1HA 4IDAA 4F6CA 4RF3A 3KHUA 5FEUA 4JJFA 1JW9B 2OMEA 1TXGA 3K96A 4FN4A 3M1LA 3WR5A 4C4OA 2B5WA 2BELA 5IF3A 2FPGA 2DBQA 5IDWA 2CUKA 1C1XA 4XQ9A 1JTVA 2VCYA 4AICA 3K6JA 1DLIA 1F0YA 3VVCA 3WSWA 5JCJD 1RYEA 3S2EA 3SXPA 2HMWA 3I52A 4II3A 1ZSYA 1YB1A 2AHRA 3ZV6A 1YL7A 4RV9A 4CR8A 3I3OA 4GSKA 1JA9A 4KMSA 4E21A 1JQBA 4D3DA 2Q49A 2DTEA 3ZU5A 4BNKA 1LDNA 4F46A 3JQCA 1S6YA 1T4BA 2BI8A 3T4XA 5TC4A 1V0JA 1MC5A 3GY0A 2X7HA 5CDTA 3IP3A 5CG1A 2NTNA 5JDCC 4EZBA 4R69A 3E6AA 4B8WA 1NFQA 4R5MA 5DDIP 2XXBA 1B14A 1WLYA 1YVEI 5KVQA 4WLFA 2YUTA 1ZXLA 2FSSA 4J16A 4O1MA 3RBXA 4W82A 1MV8A 2C82A 2A35A 4WECA 3UN1A 3H6KA 1KETA 2PLAA 4JGBA 2ZTLA 1DO8A 4NIMA 3CKYA 4DYDA 2FHSA 3H5NA 4BVAA 4CMEA 4RDHA 3RUCA 4QO7A 3ZWBA 3KTDA 3DFZA 1HE2A 2EKLA 2GZ2A 1UP7A 2JL1A 4ZQEA 1PR9A 1EK6A 4GGOA 3CUKA 4FGWA 3W6UA 1GUFA 2J3IA 5JXWA 4L4SA 1LC0A 5TGDA 3BTSA 3M1AA 1FF9A 1U5CA 1VI2A 4A7PA 2BGMA 3ZU4A 3NUGA 1EZ4A 1U5AA 4M54A 3RVDA 3UCFA 1PL8A 1VLLA 3GMSA 4DQVA 1Q0QA 3O8QB 4UUOA 3DBHB 4OQZA 4ND4A 3KBOA 3ZNOA 4J91A 3A28A 5C7IO 3GHHA 3E8XA 3E9QA 3DXFA 3H9UA 3IIEA 1PJCA 2ZQYA 3PQEA 2Y1DA 3JQBA 4U7WA 3PK0A 4DIFA 4UVGA 2Z95A 3H4VA 3CXRA 4BKQA 1IOLA 3PYLA 4JXKA 3WMXA 5FFFA 5KIAA 4K9DA 4TKLA 2OORA 3GGPA 4BOYA 3VH3A 2B4TO 4J3FA 2GPTA 2UAGA 3PJDA 4ZJUA 4WNCA 3WGGA 4ZQFA 5EQFA 3QJ5A 1E1KA 4IPTA 4R16A 4MKXA 4AFNA 1GEEA 1K2WA 2HCTA 2AMFA 3K2BA 4J1NA 4UEJA 3RWBA 1LU9A 4J4HA 4GL4A 3H7AA 1NHGA 1UAYA 3KM0A 1ZZEA 1EQ2A 2YZ7A 3O8QA 1HYHA 5G0WA 1E6WA 4R1UA 2PZJA 1T2CA 3RFTA 5MDHA 5EESA 1WWKA 2CDAA 2Z1MA 3PVZA 3U4IA 4XQEA 1RYDA 3AUSA 1EQUA 4I9HA 1WZEA 3ZHXA 1QR6A 4IJUA 3DQPA 1VRWA 3DFUA 1ISJA 1GY8A 2D4AA 1E6EA 3K5PA 1WMAA 4XRGA 3U09A 2AQKA 4ZICA 1H9BA 3TL3A 3FCOA 4PN3A 1YGYA 1LNQA 4RLHA 3W8FA 4Y67A 3TOZA 5JO0A 1NM5A 1U7TA 2V6MA 1I10A 1NR1A 5KKAA 4WGGA 3ZHYA 2HQ1A 1C0LA 1J5PA 4NBUA 2P2SA 3AY7A 4CL3A 2BH9A 5G0VA 3IC5A 3S2FA 1U3TA 3Q1LA 1HE5A 2UUOA 2YDYA 4PLYA 2VQ3A 4J43A 4ND3A 3RFVA 4BMVA 4R1SA 3Q0EA 2ILTA 1PJBA 1UXIA 3DZFA 4RJTA 4MVJP 3DL2A 4XQGA 1WVGA 3TZCA 2NVWA 4AJ1A 1Q2XA 3JD1A 2VYVA 1DBVO 2ZYGA 3RUHA 4H16A 3I23A 4GVLA 1OFGA 2QHXA 2HSDA 2X9NA 3CZRA 3PWKA 2D1YA 2PH5A 5B12A 3JV7A 4PG6A 1CYDA 2VWQA 4S1VA 5HTOA 4MP6A 1PS0A 3ETDA 3FNGA 1UJMA 4CLXA 5BT9A 4YRDA 5TLSA 1VM6A 3Q6IA 1HDGO 4ALKA 1OZAA 1FXSA 3G0OA 4WJZA 5JMWA 3AW9A 3GRKA 1HDYA 3CINA 3G79A 3GG2A 4P4GA 1JU9A 1O95A 4R1TA 1MP0A 3ROQA 3VZSA 4AJEA 4GQAA 3MJVA 1Z45A 3ZWYA 1D3AA 3AUTA 1LDGA 1NQOA 3D5QA 1AHHA 1DEHA 4BNUA 3GHYA 5GZ3A 4BGIA 2ZYAA 4W6ZA 3JQ8B 4HADA 3ZWPA 4GBJA 4YT8A 4J1TA 1T2DA 4L0QA 4OMUA 3HDYA 1HYGA 2P9CA 2G76A 4ZD6A 4HFNA 1A71A 4CPDA 3FRJA 2VYND 4RVHA 1JWBB 2GN6A 4YBZA 2X5JO 3VH4A 5IJZA 1R66A 2BFMA 2OUIA 6LDHA 3PEFA 1ENPA 4TWRA 1ORRA 1YB4A 4P8RA 4XRRA 4FIZA 4DLAA 3QRWA 3KOUA 1K6JA 4BNNA 5B1YA 4UULA 3ST7A 1ISMA 1HEUA 5HBRA 4B7XA 3DZBA 2I6TA 2XOXA 4H3VA 2ZB7A 3FWNA 2DBRA 1P45A 2CDBA 2WTBA 1EK5A 1ISFA 5KNLA 4RCVA 4WUVA 1SPXA 4XR4A 2YJZA 1ADBA 3EC7A 2VT2A 3IS3A 4PZCA 1CETA 2DUWA 1EFKA 3ZGYA 1DFGA 5TX7A 1DFIA 3I1JA 5ADHA 1LDMA 2VZ9A 3QSGA 1SB8A 5ER6A 4KWIA 2Q2VA 3WQQA 3ANNA 1ENYA 4JBHA 4Z0HO 2E6UX 2IZZA 1EDZA 3JQ8A 5TJ9A 4CLRB 3WSVA 1X7DA 4PG7A 3OETA 1IYZA 1M2WA 3HJAA 4OGWA 3C85A 1PZHA 4FSHA 4X54A 2YYYA 3JQAB 3WGHA 1T2FA 1R4NB 4E5NA 3ABIA 3RUIA 1BRMA 1P0CA 2HRBA 4YTEA 1E92A 1GZ6A 2BFOA 3G3EA 2RIRA 3INTA 3RSHA 2E4AA 3O26A 5DOVA 3Q3CA 3N74A 2NNLD 4FBGA 3OJOA 3ZCXA 3P2OA 5FYDA 4I5EA 2XAAA 3IDSA 1BDMA 3VPSA 5B37A 4NDNE 3JQGB 5B4TA 4A27A 1GFSA 5CHEA 4ITUA 3A1NA 2PY6A 3C8MA 3VZQA 2OGUA 4IUYA 4WCDA 3W8DA 3IQDB 1ZIDA 4IIVA 5JE8A 3BHJA 1WDLA 5JDIC 2B36A 3JQFC 4UVHA 2QYSA 2Q50A 1MX3A 4L74A 4LMPA 3VHRA 1KC1A 4RORA 3PHHA 1OBFO 1GQQA 4CLRA 5L7TA 1UDAA 3A06A 4ID9A 4BNTA 3JYLA 4NG5A 3TPCA 1DJQA 4YT4A 2RH4A 1IPEA 3JQAA 2GLXA 5IXYA 1R4NA 3F5SA 4XDZA 4D45A 3JYNA 1HT0A 3PZBA 1QYCA 4YRAA 2I66A 1WNTA 3HADA 4XCVA 4OQYA 3ZWNA 1LSJA 4XGIA 4MVJH 4LW8A 3LU1A 2VHYA 2FWMX 3R1IA 4PLCA 2B0JA 1Q7GA 2E48A 5I8WA 3OIFA 2BGKA 2EJVA 4YQYA 2B35A 5LDHA 2VWPA 3PFWO 3K73O 5THKA 1GUYA 3JQGA 1WP4A 3TN7A 1B26A 1QV7A 1YQGA 3PQDA 5A9SB 3MWEB 3QWIA 3E48A 1DFHA 4CJXA 4EJ0A 3GH3A 3KYBA 1J49A 1CRWG 5AQ1A 3VH2A 2O23A 3C3XA 4U5QA 2H5LA 3TFQA 4FDAA 1DC6A 3ZWAA 5BQFA 3ETGA 5JPIA 2VTEA 4A26A 1BXKA 1JKFA 3HFSA 5JSFA 4YAKA 2X0JA 3B70A 3JQEA 1NASA 5DT9A 1RM3A 4YYZA 3FR7A 4YCAA 1GZ4A 1YXMA 2O4UX 4NPCA 4U0JA 3L6DA 1QMGA 2JCXA 3CIFA 2P68A 3M2TA 1F17A 5KTKA 4ZRMA 2GGSA 1DSSG 1KEWA 2Y1EA 2CSUA 4IJWA 3TJRA 1JN0A 4MVJD 1DIGA 1RM5A 4N5NA 1P77A 1IUKA 1CERA 1MFPA 4BB6A 2OL4A 4NZ9A 4JLWA 3DHNA 4RQTA 4D79A 1DB3A 1DRUA 3TQHA 2G5CA 3WGZA 4HBGA 3F1LA 4OO3A 2Y0DA 3D4PA 2GR9A 2GRAA 2Q4BA 4KQWA 4LMRA 3DOCA 3CE6A 1RJWA 3H9QA 3TL2A 3VZPA 4BNHA 1O0SA 5A9SA 1K3TA 1A7KA 2POQX 2WJPA 4OKNA 5BSEA 3KSUA 3MJTA 4JP3A 2P9EA 3JSAA 1QYXA 3NV9A 5ITVA 2ZIZA 1QV6A 2YV2A 5DBGA 3GN1A 3Q9NA 2PGJA 1B3RA 5T5QA 2YY7A 3QWHA 4ZVVA 4P38A 1FDWA 2UVDA 4R51A 4I5FA 4OSPA 1BG6A 1IL0A 3E5MA 2I9PA 4RVUA 1Y7TA 2GUGA 3AI1A 4GMFA 1I3LA 5FI3A 4CLHA 4DGSA 4FPXA 3KO8A 3OA0A 3BHMA 3X2FA 4LGVA 2YW9A 2Q3EA 3P2YA 3T4EA 4BNYA 3E9MA 1T26A 5JO9A 1PGPA 1D4FA 4YJHB 2XF8A 4IINA 3GNQA 1EUCA 2C29D 1IE3A 3F47A 3O38A 1VJ0A 2V6GA 5G0TA 4KTVE 3JQ9C 1PL6A 3PHLA 2QRKA 1E3JA 1V35A 3L4BA 5BSHA 1XQ6A 5C3MA 4UUNA 1UXJA 2EW2A 1U2GA 1M6HA 3PFFA 1GQ2A 1F12A 5CEFA 3LF2A 4RZIA 2GERA 2WM3A 5GZ6A 1EBUA 3AFNA 3GDGA 5BR7A 3DWFA 3DB2A 2FR1A 4D7AA 4BKOA 3OECA 1NQTA 4J49A 1EFLA 2D3TA 3BA1A 1P44A 3OIDA 4WE3A 3ZWCA 1YS4A 2SCUA 2Q1TA 2PFGA 4OOEA 1F06A 4EUHA 5G0UA 1PQUA 4GMGA 4B4OA 1A5ZA 2NVBA 2ZATA 4CV2A 3WIDA 1GUZA 3GVPA 1U4SA 2A4KA 2VHXA 4YJHA 4INAA 3GG9A 4YJFB 4GSLA 3DONA 4YACA 2EJWA 3ROKA 4JP2A 2XPCA 3NDRA 1WZIA 3HWRA 1V8BA 3EZYA 1RKXA 2O48X 4CQMD 3QIVA 4NHEA 3U4CA 1IY8A 1BWSA 2W2KB 2ZKLA 3LDHA 4J90A 3RUEA 1HETA 3E82A 5CEJA 1LQUA 2B5VA 3ZHBA 3DEYX 5K6AC 1SEPA 3HUDA 4U6SA 1QLJA 4OIMA 5IZCC 4EI2A 4DXHA 1X7GA 3VTFA 3VKVA 4IGFA 3QWBA 4GKVA 5ILOA 1LLCA 2B37A 2RBEA 4F3YA 1HWYA 5L51A 4LCEA 1KBZA 3FHLA 2DTXA 4J0EA 2NU7A 3FPLA 1B2LA 1N8KA 1WDMA 1DDOA 5GY7A 1FDTA 4WOKA 1XDWA 4YJFA 3PP8A 3VPHA 3KSZO 4MVJF 5I9MA 4OAQA 4CLOB 4E4YA 5KOIA 3K2EA 3RCBA 1ZEJA 3DMTA 3IOYA 4GLLA 4W7HA 2Q99A 3D7LA 5I7FA 3IL2A 3K92A 5HM8A 3AU9A 1P1HA 3JCZA 5IAAA 3WGTA 4CV0A 4TRJA 2BKAA 4E5MA 4Z3KA 3ZV5A 3FBGA 1KOLA 2GN4A 2W2KA 2G17A 4D41A 1CF2O 2CZCA 1E7SA 4PLWA 3WLFA 3GEGA 5CEEA 4FFMA 1UZNA 3GEDA 3NKLA 3ULKA 1DPGA 3GOHA 3IUPA 5JCJA 3LQFA 2NTJA 3F4BA 5CPBA 4W9NC 2B83A 4AG3A 2J5RA 3AOGA 3K30A 5DULA 3H3JA 4IXTA 1MFZA 1ZMOA 2D5CA 4IDGA 3UOGA 4FFPA 2O7QA 4XGNA 4MKRA 4DYVA 2Q1SA 1NAHA 1KY5A 2NSDA 3PZRA 3LC7O 1ENOA 1YDWA 4CLOA 1I36A 2FN7A 5GMOA 1H6DA 2WMDA 5L40A 3WIEA 3I83A 2H63A 1BHSA 5AXBA 3RBVA 1NVMB 2J5KA 2YFHA 3D4NA 2FR8A 3EW7A 1ZMTA 2ZCUA 3PIIA 3IJRA 4RF2A 3WMWA 1EUZA 2DVMA 1LSUA 1PX0A 1Q7BA 2CMDA 3GVXA 4K6FA 4CM5A 3RUDA 1N5DA 1GV0A 2D0IA 3VPGA 2EW8A 2V6FA 4MDHA 4RVSA 4DPKA 3WB9A 2X6TA 1BXZA 3CPSA 3SVTA 3MEQA 4XD2A 1SMKA 3LLVA 4L9RA 3L4SO 5HS4A 5U4QA 5CP8A 4E32A 5GZ1A 1CIVA 3WDSA 2O2SA 1BXGB 4XWYA 5DP1A 3GFBA 1SAYA 1KC3A 3BMCB 4B7CA 3QVOA 2I99A 3U3XA 3VOSA 1GV1A 2JAHA 3AI3A 3VVBA 2QX7A 3UGKA 2I3AA 2DQ4A 2NWQA 4EJMA 1ULSA 4CL8A 1U8FO 4JN6B 4F6LA 3JTMA 1Z6ZA 4RVDA 2IYPA 4CMJA 5DZSA 5KJ1A 2GN8A 2W90A 5KVSA 4PG5A 1GPJA 4XYMA 2R00A 1N1EA 2NU6A 2VWHA 1I5RA 5A5EA 5KKCA 3IP1A 4ROSA 5F1OA 3KV3O 3GAZA 2IDZA 1NFRA 3FNEA 4LK3A 5TF4A 3ETEA 2GDZA 3F4LA 5CPFA 1HXHA 1Y9EA 2CDCA 3S2GA 1I3MA 1ZK3A 2QIOA 3NDJA 1YBMA 4OXYA 3UAGA 1I32A 1AN9A 2OO5A 3AM4A 4ALMA 2FR0A 1BXGA 4J4TA 3HB4X 2Y1OA 3UICA 3TFOA 4WLEA 4ZQBA 2HLPA 4BO0A 3BMCA 4CMHA 4QXMA 4FS3A 1LXCA 3KYDA 8ADHA 1NX6A 2VHZA 2O3JA 5L53A 3WFJA 3D3EA 2X0NA 5JAZA 3BZUA 1HTBA 4I1IA 5KJ6A 1WDKA 1YO6A 1EBFA 5L95A 3ZV3A 2B69A 1SCUA 4Z9YA 1VC2A 4O5OA 3GFGA 2Y93A 2P9GA 4K1LA 3PYMA 1JVSA 4JNKA 4RLSA 4OJNA 1JAXA 3FNHA 4DC0A 4HX5A 1EVJA 1BTOA 2HJSA 1PJLA 4HY3A 5LCXA 4IJVA 1DJNA 3CH6A 4YA6A 4DVJA 1JLLA 1P9LA 3BTOA 1I01A 3I9NA 4JX8A 1NBOA 1ZKMA 3TNLA 3F6YA 4MIEA 4CM6A 3VKUA 1UXHA 1JKJA 1MC4A 4M89A 4AJJA 4OM8A 1GCUA 4IBOA 5I9LA 1VL6A 2CVOA 5T6BA 1H2HA 2WD8A 3CSDA 2QYTA 1EVZA 3JD0A 4E2XA 1J0XO 5A03A 1BGVA 1D8AA 3V5NA 3OFSA 3NTRA 5HWSA 2NU9A 3ENKA 1OAAA 4L4RA 1B8UA 2PD6A 1HKUA 3RASA 4PZEA 4WCFC 4WEOA 1G1AA 1MB4A 2BFAA 3C7CB 3ADPA 4CM9D 2JJYA 1ZSVA 4XZ3A 4A0SA 1TEHA 1VPDA 4MJLA 4PG4A 1LA2A 1KYQA 4M86A 1ADFA 3E9NA 3RC1A 1AHIA 2PK3A 1E7YA 2W98A 1DIAA 3UKOA 1OC2A 1D7OA 4HKTA 2DAPA 4Q39A 4I8XA 1GR0A 1HF3A 4YJGB 3D3WB 2ZJ0A 1B8VA 3U49A 3NJ8A 3I9JA 1ARZA 1QLHA 2QZZA 3WFIA 2DFDA 2HMVA 3V1UA 4RDIA 4JROA 2PTGA 2QG4A 1LLUA 3ZH2A 4CLEA 3OSUA 1PGJA 2O4CA 2PKRA 4ALLA 5FI5A 3I9OA 1ID1A 3M2PA 1E1LA 4FB5A 2O50A 4LRSB 1G0NA 1I0ZA 1LJ8A 1U3UA 2ZJ1A 4FC6A 4IIUA 3WGOA 3NEPX 3WJ7A 3INRA 4ZQGA 3BAZA 2NADA 5A04A 2J3KA 4FFOA 3GK3A 2VYNA 3WXBA 4A2CA 4UUMA 1SBYA 1N7GA 1QYWA 3V2HA 1ISHA 2IXAA 2WEKA 4CQLB 4R9RA 3ZWXA 1VE9A 3DDNA 4OH1A 2NLOA 2CNBA 3SJ7A 2FZWA 1WW8A 3A9WA 2A94A 5ITWA 1JVBA 1XU7A 2CF6A 1E7MA 4QFCA 4BKRA 4OKIA 4XIJA 4XB2A 2XXJA 4FFLA 5G2OA 4Q9NA 1NPYA 3PHGA 4MINA 3GUYA 3A4VA 3RUFA 4Z6KA 4BO4A 3PWZA 4YJGA 3D3WA 2HU2A 3B1KA 5TIIA 3QWFA 2Q1UA 4LSWA 4NR0A 1W6UA 1UDCA 1NTOA 3NX4A 5EJ2A 3WOHA 5EN4A 1HLPA 2Y0CA 3L4BC 1JWAB 1U8XX 4K6CA 3WNQA 2C0CA 4J9VA 3I6IA 4YEDA 5DOZA 1E5QA 3LT1A 3JQ6A 3KSDO 4NNJA 4GWGA 5U1PA 3MZ0A 4GH5A 3NTQA 1QORA 1LC3A 1FK8A 3HFGA 1E3SA 3ONDA 3G17A 1KS9A 1O9BA 1QYDA 4W7IA 1TT7A 1IULA 3SLKA 2UDPA 4ZU3A 5CG2A 5IDQA 1EDOA 2P5YA 1E1MA 5CFZA 4LN1A 4DLBA 4RQUA 3V2GA 4MP8A 4CQLA 2BHLA 2VTDA 3MOGA 4GX0A 2EERA 1ZK4A 2BRUA 3IKVA 4ZRNA 5G4LA 3E5RA 1T2EA 2A9FA 3HDJA 1KEUA 5EL0A 4HFMA 3QLJA 4DMMA 2Y67A 2B4QA 3SX2A 2CVZA 3LYLA 3AOEC 3PPIA 2YV3A 1EEHA 3SC4A 1E3EA 2GCGA 3GNTA 3AY6A 1JDJA 3T7EA 3MTJA 1QXSA 4KWHA 4KQXA 3IUSA 4RF5A 4KUGA 3W4KA 3LT0A 3F9IA 7MDHA 3HDHA 2VRBA 3I9MA 1ZNQO 2AG8A 3O03A 1R0KA 1J4AA 3BMQB 3BTVA 1GAEO 5EIOA 5JLAA 2NM0A 3FNFA 4RVFA 4RPLA 1ULUA 1D1TA 3DMYA 2TMGA 3ZWMA 3D4OA 4TZTA 4B3IA 5A02A 3ITKA 3L77A 2BLLA 5ENVA 1GD1O 5JW6A 1NFFA 1N7HA 2V7PA 4UAGA 3WTBA 1IHXA 4BMNA 3GEMA 1E7QA 4XX0A 4ZN6A 1P31A 3WBBA 2C7GA 4DUPA 4UVDA 3PYXA 2PKQP 4YAIA 1ZFNA 2DU8A 1UZLA 1X1EA 4I9NA 3HNPA 4B7UA 2Y68A 4IDFA 1UH5A 3N7UA 4J6FA 3WX0A 2HMTA 1HLDA 5JDCA 5AVOA 2AE2A 1BW9B 2Q4EA 3EVNA 1SC6A 1KVUA 2Z1NA 5DF1A 3DZHA 1HSZA 1YDEA 2X22A 3KYCB 3ZU3A 4FQ8A 4DPMA 1CEQA 3LSYA 2LDXA 3CTMA 4D0SA 5IN4A 5JC1A 4PLHA 2RH8A 3ZNQA 4KDFA 1BVUA 1PSDA 2E49A 1C0KA 2Y1CA 2PNFA 4BNXA 3I9LA 1HDCA 2DM6A 1E7RA 5A1TA 2NACA 3BMQA 5H81A 3LZ6A 4J9UE 1V3VA 2PKQO 2UUPA 2DKNA 1C3VA 4EEXA 2Y05A 4LSMA 4DIOA 4WLNA 3ZI0A 3VDQA 3I4FA 1H0KA 3RBZA 3WJAA 2O7SA 4TRNA 4QTZA 3CZMA 4OOFA 3RU9A 2GZ3A 3E1KA 5KVVA 3H9EO 4AL4A 2X9VA 1Y1PA 4MVJA 1HDZA 4CM4B 4BNWA 5L4NA 4EJ6A 2W2LD 2EF1A 3MJSA 4J2HA 4CMAA 2CY0A 6ADHA 1U7HA 4BNJA 1BW9A 4J4BA 4P4LA 1OI7A 3KYCA 3DZGA 1HE3A 1VL0A 3Q2IA 2NUAA 4Z3DA 4GX5A 2ZB3A 2JCYA 1X0VA 2RHRA 4G2NA 2HKIA 4A73A 1TLTA 1Y5MA 2AQIA 5DCUA 2D8AA 2DC1A 1E3IA 1TT5B 4XKJA 3KUXA 5ENDA 3U5TA 4GI2A 1H6AA 4RVGA 4E2ZA 2Y1FA 1KVRA 4U6QA 1PZGA 3ANLA 3EGOA 4HFJA 4B8ZA 2ZTUA 4BL5A 4M49A 3VDRA 1KY4A 1WAMA 1SO8A 2X5KO 2VRCD 3MCVA 2O3SA 3DTTA 4MIYA 1PQPA 1RM4A 2VN8A 4UVIA 4RPGA 3V1TC 1VL8A 4D42A 4ND2A 2VWGA 5HA5A 3LF1A 3WGIA 5TSDA 3PJGA 1P0FA 1XA0A 4O0LA 4CM4A 2EWMA 4EW6A 2GF2A 3QQPA 4IDEA 4DC1A 5MGBA 2IYOA 1K6XA 4IDBA 4B3HA 3W8EA 4AJPA 4PVDA 3SJUA 2DTDA 4XB1A 3ONFA 3AUAA 3ANMA 1Y6JA 4MKZA 4GLOA 3L9XA 1ZK0A 4I08A 1H94A 1ZXBA 2WYUA 4GX2A 2OBNA 4IJKA 1UAGA 4BNVA 1P33A 1UXGA 4Q3NA 1E77A 3EVTA 4GVXA 4ND1A 3PRJA 4CQMB 5KJCA 3GVHA 3TF5A 1NPTO 4CM1A 1XYGA 4QX6A 5IFLA 5JCXA 4CMEC 1K6IA 1TT5A 3OJLA 2ZB4A 2QZ9A 1P1JA 3QVTA 1P3DA 5A3JA 1GL3A 1FDSA 1HSOA 2OXIA 4CR7A 4M55A 1U9JA 2R6JA 4QECA 1XG5A 1PZFA 4D46A 1PJ4A 2QRJA 4NQZA 2HMUA 4DLLA 3ICPA 1GYRA 3FTPA 1O6ZA 2I76A 4NBTA 4XYEA 2AW5A 1RWBA 1ISIA 1ZJZA 2P4HX 1H6BA 2Q2WA 3QV1A 4B3JA 4GAEA 1NVGA 2X8LA 1DHRA 1K5HA 4XEHA 1UDBA 2FOIA 1Z7BA 4MPDA 1FJHA 2DPHA 3ASUA 4BKPA 4C7JA 1VJ1A 5HS6A 1GYPA 3IKTA 1R0SA 2VUUA 4R3NA 3UW3A 3OJEA 3UCEA 3V8BA 3JQBC 4CQMA 4TSKA 5KCZA 3WWZA 4MVJE 3UVEA 4DREA 1LLQA 3FN4A 1B7GO 3BTUA 1AXGA 2HK7A 3K8ZA 3DAFA 3WBFA 4NBVA 1E6UA 3HE3A 3AUUA 4WKGA 4WK6A 3WGYA 1JAYA 1PZEA 4HFRA 3D64A 3IJPA 5KJEA 4BV9A 4URFA 3H65A 5DCWA 1PU2A 3NT5A 4XR9A 2GN9A 3ZV4A 4AVYA 4CMCA 4BNZA 1ONOA 3ONEA 4IQ8A 5IDXA 1A9ZA 3F5QA 3IMFA 4A5OA 3DOJA 3DC2A 2VUSA 1DIBA 3MJCA 5AOVA 3L6EA 4II2A 4CMKA 2WYVA 5JY1A 1T1RA 5BNTA 3GDOA 1X1TA 4E33A 4J7UA 1RPNA 3OMLA 1ZO8A 3UH1A 3OBBA 4GGPA 4BV8A 4PRLA 5T64A 2GSDA 3QVWA 3AM5A 3TZ6A 1VJTA 2X9GA 5LC1A 3RJ5A 2O3RA 4R9SA 4DBVO 4YPOA 3DHEA 1W8DA 3INGA 4E12A 4PZDA 2LDBA 1B0AA 4KUEA 5F5NA 3W4IA 4BUCA 5I9NA 4M87A 5G0SA 3WTCA 1K0UA 4JIGA 1O8CA 3BHIA 4TRMA 2J3HA 1Y8RB 2QW8A 4O63O 3U0BA 5L4SA 1IZ9A 5L4LA 4CM7A 4Y6RA 1UP4A 4YAJA 5CDSA 1EE2A 3Q11A 2WDZA 1W0CA 3O4RA 1PS9A 1TA4A 5C7OO 4XGKA 3KRTA 4CUKA 1Z75A 1ZK1A 3NT4A 1GEGA 2AEMA 1DC4A 3FI9A 4BNMA 4BNFA 1PJ3A 3HZZA 3QY9A 2EEZA 4DIBA 4H7PA 4NJMA 5T57A 3GZ4A 1PJTA 4RPJA 3ZNNA 3HQ4O 4PLZA 4CUJA 3I9KA 3WICA 5L7WA 4NBWA 2X23A 2H6EA 3FPCA 2JFGA 4KOAA 3RFXA 4AJOA 8LDHA 2W4QA 2IE0A 1QSGA 1E3LA 4N5MA 4ILKA 1H93A 1ADCA 2BGLA 4E3ZA 2AG5A 1DIRA 1TI7A 2YQ5A 1M76A 4XQCA 4GKBA 4MVJM 1FMCA 4EEZA 2AXQA 4I5GA 4PLPA 3PDJA 3OIGA 1Y8RA 3PGJA 3RKRA 5HRUA 3GGOA 3AFMA 4FGSA 5K0ZA 5BSGA 1P1RA 1YJQA 4HNHA 3KEQA 4J1QA 3ZW9A 5JDIA 2NQ8A 4NK4A 3HDQA 4BO3A 4ONEA 3JQFA 5JS6A 4YAEA 3RJ9A 2A92A 2CF5A 2P4QA 3F1KA 2PH3A 4Y6SA 5TQVA 5T67A 2GNAA 2Y99A 1YKFA 1Y9AA 5B4UA 3DR3A 4RL6A 2O3UA 3DZKA 1QYVA 2ZK7A 4PLVA 1ZCJA 1CWUA 4FD3A 4JK3A 2PD3A 4RF4A 3FR8A 2V65A 3ZNPA 1Z74A 1JKIA 5EQDA 3V2UA 1LSOA 3OF2A 4N7RA 1A4IA 1BDBA 2ZTMA 4M1QA 1GADO 5JAMA 2BF7A 1D1SA 3QA9A 5JYEA 1MXFA 5B4VA 3WGQA 4TZKA 3JQDA 4YWJA 4BNLA 4U0KA 2F1KA 4CMIB 4DMLA 1ZBQA 4EYEA 3U62A 4Z9FA 4AJHA 3PLNA 1TVEA 2HUNA 3WQSB 3TSCA 1LX6A 4R3WA 3HG7A 1PR3A 3NTOA 3AU8A 1ZEMA 4HNGA 1LDEA 4MP3A 3DBRB 2GZ1A 3UHAA 3KETA 4N5LA 1XWFA 3NYWA 2Q2QA 4E5KA 3KYDB 1B16A 4YQZA 2QQ5A 4PLGA 4Q3DA 1NQAO 4QT0A 4BO8A 3W4JA 5L45A 3SBOA 4Q3CA 3JYQA 4IQ0A 3EDMA 4YR9A 3VPFA 3EHEA 1KEPA 3GUCA 1KERA 5C5IA 3TRIA 3NGXA 2OHXA 4Z0PA 1YOVB 3I5MA 1SZJG 3DTYA 3CEAA 5EPOA 5A9TA 3FTNA 4IXWA 2D2IA 5C37A 3QW2A 4PRKA 1GDHA 4NBRA 4E2WA 2DBVO 4CMIA 5L9AA 2EV9A 2YFQA 4MVJI 4NFYA 2VZ0A 2EP5A 1BMDA 4YXFA 3H9GA 1F8FA 1B3BA 3GZNB 4XIYA 4QSMA 1U4OA 1ZH8A 2CD9A 3PJEA 3UCXA 4MVJG 4ESOA 3R3JA 2RHCA 2RAFA 4UVEA 3ZZNA 4JJGA 3RUAA 2NQTA 1T1SA 3DBRA 1XELA 3HN2A 3TZHA 2DUUA 2PV7A 4D44A 3VAZA 1UP6A 1LUAA 1NYTA 3JQ7B 3ORFA 1AE1A 1C14A 2PR2A 4R68A 1NP3A 1XSEA 3PLRA 1GTMA 2HDHA 3G49A 2DFVA 4CM9A 2Y1GA 2DPGA 3C24A 5IN5A 4NH4A 4HP8A 2IZ0A 1DRWA 1YOVA 1LDBA 3AM3A 1PS8A 2IODA 2AEJA 1V3TA 2ZB8A 1A7AA 9LDBA 4IQGA 2G1UA 3W1VA 3JQ9A 1U1IA 1ONPA 3DBLB 2BFPA 1J6UA 3NGLA 1Q7CA 1A4UA 1YBVA 1GCOA 2OOSA 5TJHA 5JMPA 5T8KA 2X4GA 2X58A 3ASVA 3GZNA 5IG2A 3GN2A 3GPDG 2JFHA 4MOWA 4DPLA 4BB5A 1MA0A 4IS3A 1XCBA 5JYDA 1LI4A 4JCOA 1N92A 2HK9A 2D5AA 5CDYA 2J6IA 5COAA 5A3VA 4Z9XA 1O94A 4XYBA 5CDUA 3SEFA 4FCCA 3DZIA 5A5FA 4DRYA 4L4XA 3H8VA 2FY8A 4KTTE 1ZK2A 3C1AA 2YDXA 2X0IA 2WYWA 4B4WA 3IAHA 3AWDA 1A9YA 4XJTA 4BNIA 3JQ7A 4BIIA 5C7LO 2VOEA 2EKPA 2J3JA 1VSUA 1LBEA 3D1LA 4NI5A 3PHIA 2PGDA 3RC7A 5G4KB 4L75A 2JKVA 4P22A 2HK8A 3RROA 1UUFA 2WD7B 2B4RO 5JAIA 1MUUA 1ONNA 1X13A 3FWZA 3PTZA 3CMMA 3N58A 1BVRA 4EUEA 4Y6PA 2G82A 1E7WA 3EY4A 3DBHA 2FPPA 3W6ZA 1C0PA 3DBLA 2PZMA 1PIWA 3ZWVA 4YRBA 3GAFA 3KVOA 1OC4A 4TQGA 3PDUA 4LVCA 3UUWA 3FD8A 3L9WA 1Z82A 2C59A 1RM0A 5ILGA 2H1SA 4C7KA 1DAPA 4E2YA 3QE3A 2WWRA 2BMAA 3EZLA 4I5DA 1I2CA 1HDRA 3DZJA 4PG8A 2E82A 1HE4A 2I3GA 4BO7A 4EITA 1U28A 2OP0A 1YBAA 3L6OO 4WASA 4GWKA 5H83A 5K6AA 1DLJA 1UXKA 3C7AA 4Y9DA 3C1OA 3E18A 3HSKA 3MWDB 4QFDA 3COSA 1I2BA 3H5AA 5IXSA 5IZCA 3H9JA 3GF4A 3KLMX 4DTIA 3NRCA 2BD0A 4FJ2A 1I3NA 2GO1A 4OSOA 1NNUA 1XHLA 4LCJA 4Q3EA 1L7EA 1SEVA 3R0IA 1R12A 3ZN2A 2IRWA 2JCVA 3B20A 1I2ZA 3PI7A 1DHTA 1Q1NA 4B79A 4EUFA 5G4KA 1YB5A 4ZHSA 2VT3A 2DLDA 2WD7A 3VH1A 4IDCA 5FF9A 5JY6A 1KEVA 1PL7A 2OFPA 2H9IA 3T7CA 1T25A 1Y8QB 3RAJA 3ITDA 1LRJA 4OHUA 4R41A 3SLGA 5DNAA 1P1KA 3AK4A 1XKQA 1CJCA 1X0XA 3KB6A 4XDYA 4LRTB 4IMRA 1CQJA 4P4NA 2FPIA 4XYGA 1WMBA 1HZJA 5EINA 1N1GA 4BGEA 4KUHA 3EMKA 5I8ZA 4CV3A 3DHYA 2J5QA 4HXYA 1WXDA 4IY1A 4D3FA 4AJ2A 4R01A 5ICMA 2V6BA 2VZ8A 3OH8A 5IDYA 1VSVA 4FOOA 4N18A 4RPKA 4D3SA 5I7VA 3SC6A 3OP4A 4FW8A 4W9NA 2I5PO 4XA8A 3K31A 5A06A 1Y5RA 1NWCA 3HN7A 4O6VA 1LRKA 1YL6A 4J2OA 1R4MB 1Q0LA 3ON5A 1YL5A 1P74A 2C07A 1PTJA 3D5TA 3OQBA 2C20A 4E30A 3E03A 2VYVD 1LQTA 3R6DA 5KVCA 1M67A 3I6QA 4UUPA 4WNIA 3UXYA 1Y8QA 1XQ1A 1BSVA 2EIHA 3DO5A 3OJ0A 3GR6A 3VC7A 3X2EA 3I4CA 4IGEA 2IXBA 2YHUA 1YE3A 3BMNB 3LC2O 5TNXA 3ZHZA 3RD5A 2C54A 1PQWA 3GGGA 3LT2A 4OYRA 2EXXA 2ZQZA 2AE1A 4FR5A 5DP2A 4IZIA 5CAEA 1YQDA 1A72A 2C5EA 2AEFA 3ZU2A 3EUWA 2VNSA 2FZEA 3UFXA 4CODB 3GQVA 4TVOA 2JFFA 5COQA 3R3SA 2HJRA 1XEAA 4AJKA 2EGHA 3VTZA 3QWAA 3H2SA 4O59O 4BKUA 3JD4A 3AJRA 4R4JA 1NR7A 1I30A 2IZ1A 1XLTA 4CM8B 3B1JA 1ZW1A 4W4TA 4CUZA 4WEQA 1XR3A 1W73A 1MG5A 1R4MA 1YJ8A 2Y0EA 1PGNA 3HB5X 4E31A 4B4VA 2VUTA 4L76A 4BO2A 4J1SA 4CMBA 1R0LA 4RGBA 3ZW8A 1UZMA 2W2LA 4IMPA 3LK7A 4HUJA 4NU5A 4DBZA 4NFHA 1GZ3A 3KEOA 3OM9A 1LRLA 5TT1A 2HO5A 5I7EA 1M75A 1Z73A 4IDDA 4BMSA 3BMNA 1E5LA 3ZWWA 1UR5A 1KIFA 1AXEA 2PZLA 1TB4A 3DMTC 3NAQA 4GPD1 4Y8VA 5F5LA 4JBGA 2W8ZA 2GYYA 3GPIA 1LEHA 1LLDA 2JD2A 1R6DA 1ML3A 1DC5A 3NJ4A 2BI7A 1P1IA 2PWZA 4YT2A 1R37A 1HYEA 1NAIA 3B1FA 1T2AA 4E6PA 1I3KA 1V3UA 4NJOA 2DBZA 3EYWA 4K28A 4FJ1A 3JD3A 2Y66A 4QUKA 3F3SA 4BS9A 3RU7A 1XU9A 1PJSA 2WE7A 4LVUA 4PLFA 5L7YA 3H2ZA 4I9UA 2NTVA 1GYQA 3M6IA 1EVIA 1X15A 4K26A 2WE8A 1HDOA 1Q0HA 1XIVA 2VRCA 5AXAA 5LDGA 1E1NA 4CM8A 4YAGA 3ZWOA 5I7SA 4WCFB 1R16A 3GA0A 1OMOA 1MG0A 5AXDA 5L3ZA 3OEYA 1V6AA 1CDOA 2F00A 4TROA 1FDVA 1NXQA 4BGVA 4XJSA 3GRPA 3AI2A 4ZQHA 1LSSA 1DC3A 4WLOA 1LDYA 3LLSA 4GX1A 3ENNA 4WLUA 2AQ8A 1GU7A 2EP7A 5TS3A 4KDEA 4FFRA 1NPDA 4AJ4A 3LC1O 3WLEA 3STHA 4JJIA 4A10A 1T4DA 1CQIA 1ZSNA 4U8GA 1KVQA 1ENZA 3MJEA 3WS7A 1QKIA 4L73A 3KXDA 5AYVA 4CLDA 1O5IA 1ISGA 2UV8A 4M8SA 1E0DA 3P5SA 2I67A 1VKOA 1W4ZA 1DAOA 1IPFA 3RQSA 2P5UA 5EERA 1HL3A 3PXXA 4EBFA 3P7MA 4D43A 3TDKA 2CVQA 4RPHA 2P91A 3JQAD 1SNYA 1PWXA 2D59A 2OP1A 4WCFA 3TZKA 4AJNA 1DRVA 3QVSA 5A4DA 2C2YA 2AQHA 3OICA 4QEDA 4WLVA 3S2IA 4J7CA 2EG9A 5KWEA 5F1KA 1SB9A 4WPGA 4YT5A 1X7HA 3L0DA 2PD4A 1PJQA 1G0OA 4NU6A 5COBA 4YVFA 1E3WB 3GT0A 2R00C 4CR6A 3V1YA 9LDTA 4OXNA 3EAGA 2YHIB 3OQ1A 4DA9A 3C1TA 3WWYA 2OZPA 5DBIA 4FFNA 4BHTA 3GVCA 2WSBA 1WPQA 3DAGA 3BYZA 4PVCA 4WOJA 4AJIA 3OQ6A 4Z0TA 4DQXA 4CV1A 3C7DB 2HAEA 1ZVMA 4IZHA 3UF0A 4UEKA 1PGQA 1L7DA 3FF4A 2PGLA 4KP7A 3NDIA 4DL9A 1P1FA 1Y81A 1ZJYA 3P19A 4L8VA 1NVTA 3DBVO 3Q9UA 1EMDA 1C1DB 1YWGO 4DQUA 2O3TA 1A27A 1OOEA 1X14A 3DOOA 3JYPA 3BXXA 1QG6A 2Q1WA 5J23A 2J8ZA 3JYOA 1EUDA 1Z7EA 1I33A 4BNGA 1YQXA 2X0RA 4FC7A 3G1UA 4PCVA 2C7VA 2NU8A 1FDUA 3BIOA 4FOSA 1H5QA 4OXKA 5ES3A 2GASA 1MLDA 3BMOB 2R2GA 3QVXA 4E0BA 1I24A 1V9LA 4EGFA 1PJ2A 4E5PA 1PWZA 5FWNA 1T24A 4YB8A 5TRTA 1HDXA 1AGNA 1E3WA 1ZUD1 1M66A 3FBTA 5ICSA 3PWSA 2X5OA 3PIDA 1U2DA 4XYLA 2DT5A 1KVSA 1YH3A 2CFCA 2PZKA 1HRDA 2YHIA 3RI3A 3F46A 2HMSA 4HWKA 5JAQA 1N9GB 4MO2A 4BO5A 3MTGA 3CMCO 4OL9A 2NVUB 3VZRA 1EVYA 2TMDA 1PGOA 2JD0A 1YRLA 4D0RA 3OA2A 2YV1A 5T8KC 1DXYA 2AA3A 5DN9A 2IEDA 5F1PA 3ADOA 1B8PA 3A14A 4NJMB 3WG9A 3GMDA 2FP4A 1C1DA 2VHVA 7ADHA 1AUPA 3O9ZA 4BO9A 4UEOA 3B6ZA 5JFOA 3ZDFA 2JHGA 5BNFA 3WYBA 3PHJA 3TOXA 4G81A 4YDRA 3ROMA 1H9AA
chains in the Genus database with same CATH superfamily
1P7WA 4QYIB 3S55A 1ZHHA 2NXEA 2WV7A 3U3ZA 4QG3A 2UYYA 5AJHA 1SKYE 3HLTA 4G37A 1FYVA 3CWZA 1G2IA 4C3OB 4JI4B 1VKNA 2C5AA 3QA3E 2CHEA 5EPEA 3JD2A 1IHPA 2EBFX 3MAGA 3NT2A 1V96A 1OLXA 1LI7A 3L8YA 3GUUA 3EPRA 1MVNA 2R68A 2VF4X 3EG9B 4ALJA 1V1MB 4R1NA 3O47A 2X7JA 1FP1D 2RARA 4B82A 3U37A 3JWEA 2RHTA 4FFDA 4DC1A 3AOEA 4HXEB 4EAQA 1X1QA 4P4SB 4PW0A 5A62A 4BB9A 3GDFA 1M7GA 5K0LA 1T9GS 4ALNA 4ZGWA 5ALUA 3P2KA 3TLJA 1K89A 1NQ5A 1PFUA 2DR2A 1JHMA 4HDKB 4UARA 3ZUPA 1L4FA 3RC2A 2ZSAA 2CCKA 3BE6A 5BSFA 5FLKA 1D0IA 3OHSX 3SIXA 4DB4A 4JBIA 2B1JA 3LT4A 3HHPA 3NM4A 3P4YA 4NE2A 1C41A 4DLPA 4R5HA 4JR2A 4TYQA 1TGVA 1YQTA 4Z8XA 3K05A 5FV7A 1Z2CA 2JGFA 3M82A 4G5HA 5EKTA 2FSUA 3W8NA 1IHDA 2IEBA 2WOOA 4JLJA 4O4JA 3W2GA 5C8ZA 5E38A 1X2EA 4PLTA 5GVSA 5JNTA 3UMGA 1AHPA 221PA 4HZUB 2OHVA 1K88A 4OF4A 5ETJA 3GNSA 3RFFA 3ZLVA 1O9GA 4L5YA 3VR6D 1TVMA 4JXJA 1BOFA 4I2VA 4ALIA 1S8FA 3P9IA 1KJYA 3FLMA 3EWNA 2F67A 3V4RA 2EL7A 1KVTA 3ISVA 3LD9A 4MIOA 3QU4A 5F1YA 2HR1A 4Z1MA 2AB0A 3SE7A 3WO1A 1XVTA 4P32A 1C80A 1WNFA 4Y18A 3AY3A 4LOHA 2DLCX 4LISA 1IM5A 5B3JC 4AT1A 3S1LA 1TU3A 1W4BA 3IO3A 2Z3VA 3M6MD 1W5EA 1RPAA 2WPDD 5IZ4A 1TTTA 4HV4A 3OOSA 1R0WA 4AYWA 3DAPA 4NMHA 1G8FA 5JNLA 3EMVA 1ZI8A 4EPVA 1MO5A 3SEQA 1OJ7A 1PQ4A 1SN7A 2WRZA 5TT0A 4WQMA 3QHAA 4HVCA 2V98A 1OBCA 3GARA 3QU9A 4Q48A 2EGGA 2WJGA 3IQEA 5AJVB 3HYTA 1AQUA 3LPLA 1A04A 1XGKA 4WZBE 2CXHA 1F14A 3DHWC 1WX1A 3RIYA 4AZ3A 5BN5A 4F3NA 5LKAA 4R54A 3EODA 2I65A 2VAWA 1ZAYA 1M8FA 5CR9A 5IUNC 1C1XB 2D8MA 1M3SA 5JNWA 4CKWA 2J9ZB 3WNVA 4AJLA 3I0NA 3CVOA 3TQIA 4G65A 4DA6A 3NFRA 3OZTA 5L3SB 5U9CA 2GO7A 5E95A 1PV4A 1G21A 1P5JA 3I37X 4FLFA 5EJ4A 2V9CA 3PGXA 3S8MA 1CR4A 3UGJA 2PRZA 3HL0A 4Z7JA 2O59A 2GPWA 3NP9A 4K9RA 4YRPA 2J08A 3Q2KA 4OJKA 2FSVA 4F45A 1RXCA 4NCBA 2BDTA 4LHZA 3P9RA 4PWZA 1RADA 1R0BA 1T9KA 1YONA 4CMGA 3D0OA 1V43A 4KVFA 3KLPX 4WK0B 4EPTA 2GLTA 1S7CA 2QTTA 1M33A 5L3VA 3HV0A 3TG8A 4QQRA 2R60A 4EYKA 4UEWA 2VHWA 4ZU6X 3EWIA 3IALA 2YNMC 3PI6A 4IM7A 2NZUG 4N3NA 5GJCA 1AQYA 1U9CA 1ZUIA 3LQKA 3OEWA 5AVSA 3L0CA 4ABTA 2OBYA 2Q2NA 1G291 5DIFA 3X1ZA 3L2OB 3G23A 3KR0A 5AFSA 5BYBA 1A8QA 1SCKA 4YCDA 5FTMA 1CR2A 3N0WA 4UE6A 4MITA 1Z4QA 2NYUA 3DFIA 1CZOA 3JYHA 4IGAA 2J0QA 1SD2A 1I94B 5IF3A 2FPGA 4KIGA 2P9HA 5IDWA 1KE1A 3UYKA 2VK1A 4O4IA 4ZYTA 1QP4A 1CUCA 4RACA 1V47A 2QF7A 1DLIA 3NOOA 1AKTA 3VYRB 1RR6A 3JXEA 1XB2A 3AG5A 1N6LA 2W4MA 2XXAB 5A3SA 5JCJD 5GONA 4GBED 2BKUA 4JT8A 1OXSC 3S2EA 3LHKA 2HMWA 3I52A 3IR5A 3WLLA 1TL7C 1YB1A 3ZV6A 4Q7KA 3P2IA 2PBLA 4CR8A 4B3RB 1JBKA 4U2KA 2ADMA 4C03A 4E03A 4KMSA 1KY2A 4E21A 1JQBA 4PICA 1OFVA 5B3LA 2D74A 3BVPA 4RIEA 2JEOA 2PKWA 3ANYB 2FZ5A 4N40A 3ZU5A 3JQCA 4GKJB 4YRRA 5KC8A 5TC4A 1V0JA 2PX5A 3O1LA 3T7IA 1MC5A 2G4CA 2WTEA 4AW9A 1XNQB 1YC2A 2ISSD 1L5QA 2KS6A 3E6AA 4YCBA 4YUVA 1SBZA 4D5GA 5DDIP 5TGTA 4MGHA 2FMTA 1P4HA 1R2QA 1TOAA 2VQFB 1B14A 2IYVA 4OMCA 1YVEI 1QFJA 1RLIA 2QVCA 3NHFA 4IIDA 5BXQC 5FNVA 4WLFA 3SVLA 2YUTA 2E21A 2FSSA 3FW1A 3QU5A 4TMKA 3THRA 1ZZGA 4KREA 3UUFA 6REQB 3H6KA 2ZTLA 4RM3A 3TTVA 2FHSA 3QK7A 3Q6NA 4ZAWA 3RUCA 4DR5B 1VG9B 4FYKA 1JHZA 4QJIA 4D6XA 1D4ZA 2NPOA 3V34A 1H3NA 2ODQA 1KIMA 5AM5A 5EHQA 5KDOA 1PNQA 3R3HA 1PT8A 1JQKA 5AM3A 5LBIA 4XWKA 3KZXA 5EP4A 2YYZA 1EGHA 1GUFA 4PQRA 5TGDA 3OOHA 1I9CA 3KCNA 4UZEA 1B1AA 2OZEA 4O33A 1GGFA 1U5CA 4DIEA 4AS3A 1MRNA 4JBWA 3SM3A 3ZU4A 1ESMA 5EJIA 3RVDA 1NMSA 3BS4A 1T9CA 1GTJ1 2N46A 1PL8A 1XVLA 3TPZA 1JFSA 2WSMA 3AEKB 2X4DA 4UUOA 5TARA 1M2KA 3DBHB 4OQZA 4OHVA 2QTVA 4INPA 4ND4A 3ZNOA 4RA9B 3PVCA 2J4DA 2BKVA 3E8XA 4KE8A 2RFLA 2YJTD 3E9QA 1XZJA 4YROA 5JIBA 1UPFA 4KH1A 4K9OA 1EFCA 1JQAA 1KEEB 2QZJA 2ZQYA 3BDVA 1C30B 3FNIA 4DBLC 5EJ8A 2RBGA 4D9JA 2OQIA 4LJLA 4O0MA 3PX7A 2FSFA 4RK7A 5GTDA 1SBTA 4URZR 3ITNA 3DLCA 3R0ZA 3KLBA 1J70A 4M60A 4L9AA 4JXKA 3RJMA 3M6XA 3WMXA 4LF6B 5EE1A 4K9DA 1ABBA 3EZ9A 3ZVNA 1JV2B 3ZDYB 1HM5A 4RK0A 4RC9A 3ZXYA 4BOYA 2AJBA 4YCLA 2J6BA 4G0ZA 3TMYA 4J3FA 3WO0A 4HDCA 4TLMB 1AKQA 3Q2OA 3WGGA 4ZQFA 3T1HB 2IIQA 4QUJA 4MW4A 3G88A 1E1KA 1X70A 2JAXA 4IPTA 4Y9TA 3AEQA 1FX0A 3K2BA 2EATA 2MHCA 4UEJA 3RWBA 4HNVA 5AIBA 1LU9A 3HPQA 3AZQA 4EB6B 1SA0A 5ULLA 2X1LA 3O3MB 3O3CA 2CZGA 1UAYA 3LWDA 4M3NA 5NLLA 3CISA 4HZGA 4MLZA 4B34A 4KNYA 2O19A 1KKMA 3L8FA 4WADA 4N48A 1EGVB 2YZ7A 1OIVA 1S2NA 1HYHA 1JL3A 2QGZA 5G0WA 4ESHA 3L1UA 1T15A 2ZIXB 3PC8A 1T2CA 2POCA 3HJBA 4RQBA 3RFTA 1WWKA 2CDAA 2CXUA 3KEMA 1C29B 1TZJA 1HTWA 3GJZA 3PVZA 4LNUB 4WA8A 4XQEA 5SYAA 3U7JA 4WBNB 1SXQA 4RTJA 3Q15C 3O1IC 2A5YB 2XYGA 1ODIA 1P29A 1QR6A 3LUKA 3R44A 1V7CA 1OUMA 5CA1B 1W96A 4KCGA 5EE9A 1IG0A 1WMAA 1L7RA 2B1GA 4KXVA 5CVCA 2ZRJA 1XQYA 2NZJA 2GJ8A 2RHGB 3TL3A 4EB3A 5KSWB 4EHHA 1JNXX 3D8SA 3NHJA 3PTLA 3RS7A 5I47A 5KKAA 5ABPA 2REOA 4WGGA 1GHTA 2HQ1A 1R6VA 3KWJA 3KUCA 3OZUA 3TI9A 1KI6B 2A2ZA 4G4GA 4NBUA 5IJZA 1FNSA 2EFGA 4EYGA 2C9ZA 3T7RA 4QEKA 1UBHS 3QOWA 1GVHA 1FFWA 3R3ZA 1YFLA 1KDRA 2NV0A 1M73E 3LZCA 2VQ3A 3CZ9A 2YYAA 2Q8QA 3S1AA 1WKBA 2R96A 1II0A 3IEXA 4NYIQ 3GGJA 5GQSA 1G8HA 4R1SA 4BMVA 2HCBA 2ILTA 4HHEA 3T35A 3DLPX 4X6LA 3PT9A 3CLHA 3DZFA 1OFIA 2QVGA 2ZOSA 2PL9A 1OWOA 1BE1A 1WVGA 2D1RA 3GPBA 2NVWA 2X0DA 5FLXA 1Y37A 3HCDA 3DXXA 1DBVO 3HXLA 3RUHA 4H16A 5HIJA 4OFWA 1I6KA 4YXWA 2X9NA 2XCIA 4TS4A 4ZYUA 5BN3B 1FCJA 2PH5A 2F90A 1CY4A 2W2MA 3B51X 3JV7A 4PG6A 3V7WA 4IW3B 3GGSA 3FPFA 1QG2A 5HTOA 3DCNA 1U1EA 3ETDA 4HEHA 3AY0A 5AESA 1DCMA 4CLXA 3KTAB 3TR5A 1KOJA 2AZMA 3COWA 4G07A 1UBEA 4LF9B 5K99A 4FT4A 1IAQA 4LZWA 3S7TA 4PQEA 4Q4HA 1EX6A 3VHXB 1TM4E 3DTVB 5JMWA 2ZP1A 5DM1A 1Y42X 1HDYA 3DFFA 3K0HA 1KDOA 4P4GA 4U3JA 1QB7A 4D9HA 5HZHA 1A9PA 4G5GA 4GQAA 4ZI3A 4L9WA 1ZOOA 5B2EA 1FTSA 2DBYA 2MU1A 2M98A 2VYQA 2OGWA 5M34A 1LDGA 1NQOA 4I8DA 1DEHA 1GKKA 5TV2A 4PR0A 1ATZA 4QGHA 5GZ3A 4OLAA 1Z38A 4U1RA 4BGIA 5BW6B 3JQ8B 3WK8A 1ECBA 4URYR 4HADA 1SUPA 1PF7E 3I01M 4GBJA 1PP4A 1XEXB 4YT8A 4L0QA 4JLSA 5FPYA 3UT0A 2R6DA 5HBGA 2YRWA 3DQQA 4HFNA 3NHWA 3FRJA 2QPTA 4WACA 5EMNA 3VVLA 1SUBA 4UPVA 1JWBB 2EFDB 2GN6A 3CUTA 4X91A 4A0HA 1P17A 2XIJA 2GA8A 4YBZA 3MRXA 2X5JO 2XF2A 4U00A 5KVAA 1AZTA 5AUQA 8ATCA 1R66A 3UB4A 2G1AA 3QSYA 3UWKA 1XL0A 2P5TB 3BJIC 1I4DD 1K68A 3SYMA 1ENPA 3TLMA 1ORRA 1K7SN 4FIZA 4E51A 3C6YA 1EB8A 3LW7A 1ECCA 3ST7A 2WWYA 4TTPA 1ISMA 1HEUA 1F60A 4B7XA 1YDHA 3DZBA 1SU4A 1UC8A 3ETCA 3Q3VA 3HVIA 4PSUA 5AI4A 1RAFA 5ECDA 5HILA 4TTTS 1SXPA 1BDIA 2H5IA 3EY9A 1M5TA 1P45A 4OPMA 1XPUA 1U8AA 4G4IA 3S2ZA 1WMSA 3BRSA 1ISFA 3R7DA 3VNSA 4RCVA 1N5RA 2W6ID 1PEYA 4TSRA 4P3PA 2W2TA 3PHCA 4M0FA 1ADBA 4IVNA 5GAJA 3LXUX 4PZCA 4JI1B 1CETA 1TDJA 2KMLA 3ZGLA 1XCOA 3KWLA 4CHTA 2AS0A 3D2BA 3ZGYA 5I48A 1CJUC 4Z8YA 3TINA 3W6OA 1N5IA 3D02A 3WYAA 1AH2A 4ZT4A 1SB8A 3L7YA 4X92A 5ER6A 5K4AA 1BVYF 1ENYA 4JYBA 1C7JA 4BTVA 4H0FA 4PG7A 1ZM4A 2OFFA 5IKPA 1IYZA 2XRFA 7REQA 4OGWA 1PZHA 4FSHA 1BE6A 2QSZA 1YQWA 3JQAB 1DWPA 2R87A 1MAUA 1LVGA 1OAOA 5BY2A 1E92A 2ZTHA 4QUAA 3QQ5A 4TMXA 4LJ8A 4F12A 2RIRA 3G9QA 4LDPA 5CBPB 3INTA 4JI2B 3OQVA 1VIVA 4QYXA 2E4AA 3O26A 3T0GA 3MOSA 5DTQA 5B53A 2GHTA 3G8CA 5DGCA 1L5VA 3ZCXA 3AR4A 5FYDA 2XAAA 4C5BA 3HGQA 2IU6A 1DAIA 5CH5A 4NDNE 2X0FA 4DZTA 5ELXA 2TECE 5H70A 4NOJA 4FOPA 1QRDA 3NI2A 4GLFA 3A1NA 4Y2VA 1CQIB 1IXRC 1G7RA 4IUYA 3W8DA 3H1BA 2VSFA 5A6SA 4TWIA 5KYYA 1TMOA 2V59A 3IEPA 5IDVA 3VU9B 4EHDA 5JDIC 8ABPA 5KTYA 1A2QA 2BJVA 4CN9A 1QHHB 2G0AA 3U56A 2G9NA 1P0QA 2WD9A 4LZAA 4EO4A 2QYSA 4BU0A 1U11A 3CR7A 2IV7A 4LJYA 2ONZA 4OAOA 4F9FA 2IOFK 3K0CC 4I3GA 3G2HA 4S2UA 4QWWA 5L7TA 1N33B 4KQHA 4MO9A 1A7JA 1XRPA 4UCQA 4Z7QB 3LUAA 1E1CB 4JSTA 4G25A 4YT4A 1PD0A 5KAPA 5IXYA 2FX5A 4MQLA 1MPXA 3BJRA 3LNTA 5HYVA 1QYCA 4G1BA 2WNIA 4L2IA 3KPJA 1NVVQ 4KO2S 1T1GA 4M4SA 2DPMA 4BWVA 2P62A 3KAJA 1LSJA 3A10A 4XGIA 5IBCA 5AKKA 1NVVR 1NNSA 4AY3A 3L1VA 4NBSA 2JW5A 1Q7GA 1X9GA 5I8WA 3G8BA 2MTBA 4YQYA 1QE5A 2B35A 3DPUA 5GADl 3B48A 3JQGA 1RI2A 1B26A 2ECPA 3ZD6A 3ROZA 5C4IA 2LGJA 2D7DA 1ORIA 4DV5B 2BGTA 3DVRX 4MQMA 4CJXA 4EJ0A 1RYYA 1FSFA 3KKKA 3NAGA 1J49A 4LDNA 1DWUA 2XQIA 3DFKA 3GJ3A 5GIPE 3VH2A 4JSYA 1NLUA 1RRPA 3G85A 4U5QA 5KCMA 2H5LA 3TFQA 5NULA 5C5CA 3H5VA 3S5JA 5JPIA 1F9AA 4F4FA 3O21A 3IV6A 1BXKA 2JBAB 3HFSA 2IYNA 1QH1B 2ZYIA 3DT6A 4OTZA 5DT9A 4ILEA 2G9VA 4ETNA 3FYUC 4LJAA 4NS1A 2XGMA 4NPCA 3KPUA 3RR2A 5TGZA 3HZRA 4ID3A 3M2TA 2QX6A 1VZ2A 1CIPA 1F6BA 2PGNA 2XKBA 5KUTA 1QQ7A 2BEUB 4NAVA 1S8OA 4ZRMA 3NVMB 4BTEA 1M0TA 1G3UA 1DE0A 1KEWA 4FKMA 2B82A 2Q28A 4G0YA 1JN0A 4WY8A 5DNCA 2BGRA 3R0QA 4EY8A 5DTRA 1BXRB 1IUKA 1VPVA 2ODPA 2QR2A 5JXIA 2WUVA 3EUFA 1XDUA 3W2IA 2XDQA 4KC0A 2OL4A 3D8TA 4NZ9A 4RQTA 5D86A 4ZO7A 1DB3A 4TLLB 3IYLW 1NIPA 2G5CA 3TQHA 2V5VA 4ZT2A 2YN2A 3OZ7A 3WGZA 1DADA 4OO3A 1IBRA 1Q22A 3A2LA 3I58A 4MV8A 4O29A 3S27A 4EX6A 3FYTA 3VTKA 1V71A 2GRAA 1T2UA 2Q4BA 2VAXA 3H9QA 1XYVA 4GW3A 1HE1C 4J0KA 5EY5B 2OBFA 1O0SA 3TL2A 3J81A 2AZTA 5J4HA 3B1VA 2R7KA 2LZ0A 4RD0A 1TMYA 3KSUA 3MJTA 1GNTA 2P9EA 5H3HA 3JSAA 1EYZA 1HLGA 3ABZA 5C5DA 3C87A 3PUIA 1MENA 1DBWA 2ZIZA 1QV6A 2BM0A 1PT5A 3B38A 1FB5A 2CLDX 3R7AA 3THXB 2QLMA 4MQFB 1X86B 4JI8B 2PGJA 4BQFA 2ZWPA 3IBYA 4DCCA 4XUDA 5JNUA 4P0QB 3VUEA 2H1LA 3BIJA 3E35A 3K2QA 1QS0B 3MTBA 3QWHA 4H2DA 2HN9A 4I55A 2SCUB 2UVDA 2V8BA 1GOTA 2YXBA 2I6QA 3CSUA 1BG6A 1P0IA 2IYRA 3HCRA 1N6PA 4RU1A 4PAWA 1UADA 1O9HA 3PE4A 4WBXC 4CU5A 4QU9A 1S2GA 1Y7TA 1I3LA 4R2JA 2J85A 4K9QA 4MGIR 4M38A 4HQRA 3VKFA 3ZKAA 5CB4F 2G8NA 1JMYA 3X1DA 2FZVA 2PXAA 3EFEA 4LGVA 3H1TA 2Q3EA 1GZHB 3EFBA 2H54A 1A5SB 3P2YA 4LY0A 5D87A 5JO9A 1G16A 5TB5A 1D4FA 4YJHB 4EO9A 4E70A 2EKDA 1NUPA 1PKXA 2C29D 1Z15A 3I92A 4Q1EA 3HCAA 3FZGA 3SJZA 1R0RE 3KJGA 2N9UA 2OG1A 2QWXA 4U63A 1TAGA 5C53B 2CL5A 1Q57A 2ZT8A 4RTSA 3G89A 2QRKA 5F2KA 2O8DA 2FETA 1ZMRA 2WWXA 3IIJA 5KOHB 3WYDA 1ZR4A 5HMMA 3L4BA 3G0HA 5E9WA 2A57A 3E22B 5KSPA 2FW9A 4DSTA 3BKWA 2EW2A 2H2FA 1M6HA 2A9PA 3EVEA 3HB7A 2UZIR 2ADFA 2UYOA 1GQ2A 5DHAA 4C4SA 4CEIA 2QUJA 2R5FA 1F12A 2X9LA 5CEFA 2HBRA 1M72A 4TV8B 3ABRB 3DGFC 2XWBF 3CRQA 4QVGA 4R05A 2CHVA 5GZ6A 4E14A 3K0BA 4WX2B 2Z6VA 3CVJA 1JH9A 4PIMA 2GN1A 3MG9A 3N75A 1L8OA 1CQPA 1O94C 2EX1A 2XCUA 1NQTA 3I2YX 3EJ6A 3R3WA 3IAEA 4GVPA 2C96A 2D3TA 4KYIB 1F4VA 2AG0A 2JLSA 4M7WA 4TUYF 4WE3A 1K4YA 1PVVA 1USVA 1JPVA 2CCJA 3KKLA 3MELA 5EXSA 3ZWCA 3NXSA 2WNSA 1CUVA 4LWOA 2Z3WA 4XUGB 1GTRA 3MLAA 5IVIA 3VR6A 4DDVA 4BE9A 4DV1B 4D9GA 2ZTSA 4EUHA 3EMBA 2H4ZA 4QHYA 4B4OA 4C7OB 5KQMA 1E0JA 1VHJA 4HG2A 1DNPA 3ZY2A 1QIKA 1U4SA 2C7OA 2V0GA 1PK9A 2GB4A 4Q4CA 3ERCA 3DXYA 4N0MA 3WGVA 2ZSHA 4KQEA 4F5DA 2WPDA 4J2TA 5ALDA 4ZJYA 2C9OA 3C1UA 1W5FA 2EJCA 2D06A 3OQIB 4J76A 4D2IA 4Q02A 2KSQA 1ZCFA 5A4MS 4YACA 2EJWA 3E1SA 2VJOA 2XPCA 2OSBA 1VCNA 2VDWA 4I8IA 2R66A 2R86A 2W2QA 3NDRA 3OY7A 4MYTA 4QTUB 1ETUA 1M1XB 3EZYA 1H2AS 1RKXA 2IYQA 4YIKA 1YRQA 1P5ZB 1QGAA 2GVDC 4BB0A 3OPYB 1KXZA 5DNVA 4W5OA 4B4KA 1IY8A 1FVOA 1C7EA 3LHFA 2O0LA 1NVBA 2QB5A 2BZGA 4G0PA 3ACDA 4J90A 2NSYA 4X66B 5FBWB 1HETA 2B61A 2Z2YA 3ZHBA 1TTQB 3DEYX 3JWIA 3LBNA 4P35A 4MKHA 2ONYA 3PC4A 2DH6A 1SHUX 1UOOA 5JYCA 2VVTA 3PRHA 2QPAA 2BFEB 1T5LA 3GELA 5D6NA 4DXHA 3WC4A 1H85A 4DNPA 3FDZB 1G63A 1G2OA 1X7GA 1ZD2P 5EKSA 5EJEA 2HLDD 2PM8A 3BD8A 5KYKA 3SC2B 1X9IA 4JBXA 2WZCA 1T36A 2UZAA 5EZQA 1DXHA 1LLCA 1EHCA 2B37A 4F3YA 4N6OA 5AW8A 2OSVA 3HDTA 1Z0JA 3FHLA 1USIA 3H1FA 2WF6A 2DTXA 3O82A 2NU7A 3ADBA 4LE2A 3GA7A 1S9HA 2I2WA 4QUGA 5GY7A 1FDTA 1NYLA 1XDWA 4NE9A 4REMA 3PP8A 3BGSA 3KSZO 5FWAA 3J80A 2FMHA 1QGZA 3QGMA 3GAMA 4OHYA 3DYVA 3WLMA 3ZX5A 2Q3BA 4D8UA 4GLLA 4RHTA 3SF8B 1ILEA 3MS4A 2QA5A 1L8XA 1N0VC 3CNBA 4HNQA 2P6OA 1IM8A 5KPJA 2E4YA 3L8EA 1UEIA 2XWSA 3TIVA 4HB2A 1GDDA 1H66A 1J2UA 1WSDA 2GN4A 3PC7A 3P97A 4LRXA 2VDPB 4UNSA 4C21A 2FUG6 4BAZA 1NVAA 2G17A 1D03A 4QPCA 1EJ2A 1G5RA 1PRYA 2CZCA 2G8LA 4ENWA 1GKUB 4S1NA 4U9IS 2F43A 4F9TA 5AUNB 5CEEA 2LVBA 4EG5A 5BWOA 3IQZA 4ZT3A 5LYYA 2WP8J 3SHQA 3EJWA 1UZNA 3NKLA 4C4XA 3ZZTA 1TUIA 5ALZA 3GOHA 4JLUA 5JCJA 4MAFA 3LQFA 1Z4OA 4KN9S 4O2BB 4PGAA 3WLSA 4ERNA 1WF6A 4GQBA 2BTQB 2AH5A 2AMLA 4MSUA 2WHYA 1Y80A 1Q1GA 3AOGA 4FD2A 4O4LF 1E89A 4RJJA 1XHEA 3A1WA 1DPFA 1P1BA 2DECA 1US8B 3H3JA 4UMDA 4UHKA 1GPAA 3NCHA 2Q3JA 1T1EA 3EOZA 2IHYA 4LJSA 3A1SA 1GSHA 4XIGS 3TI7A 2YWXA 1MTOA 3LC7O 3K15A 3MQFA 3RSSA 3DQZA 1AK9A 1ENOA 2J4FA 3RG2A 1IRIA 1YE5A 4ER0A 1E32A 2WMDA 4EHFA 3QBDA 5JZ9A 1BHSA 2XZOA 2D1FA 5AXBA 1CUZA 3RBVA 1XJ5A 3GZTB 5FTWA 1K8RA 3I05A 3P45A 5IKOA 3BJZA 1ZMTA 4PFKA 3D6UA 3IJRA 4AKHA 3PFGA 4OHMA 4RF2A 5I01A 1EUZA 2DVMA 2YUIA 3F67A 3KT6A 1LSUA 5DO9A 2OBLA 3BB3A 4K6FA 4NTZA 4B76A 5JEEA 1B0UA 3GMTA 2ZB2A 2DQSA 4MDHA 4NMWA 4EIWA 5LXTF 2VJLA 2VAPA 2KHZA 4YRIA 4F85A 2V0CA 3O7MA 5CCBA 3OLYA 1KGDA 4ZZ1A 3MEQA 4ZK6A 4LXYA 5JQGB 4XD2A 1XC7A 2P9JA 3LLVA 1PLLA 2GBGA 5CP8A 1R8XA 4IIJF 1T5DX 5DIZA 3FHOA 2L17A 1CIVA 4WFIA 1GSAA 4AMGA 4V0MA 3GFPA 1E79D 2ODNA 3QUQA 1PZMA 2RHDA 4PZPA 2E7ZA 5KHAA 3ICQB 2BMWA 4WAUA 4XWYA 5ALYA 5CX1B 4DUYB 3ILHA 5DP1A 2IYAA 2FSPA 3GFBA 1AV7A 1KC3A 2VSQA 4MS4A 2IU3A 3U3XA 4QIHA 1YAHA 1GV1A 3AI3A 4R2IA 2XSZD 3VVBA 2Y9PB 3QTLA 3I61A 2O0MA 2PBFA 2XR1A 2NWQA 3O90A 4L5JA 5ALMA 2YQZA 4XW2A 1ULSA 3TD6A 4E22A 1KRHA 4F6LA 3JTMA 2HU7A 4M0PA 4TTVA 1NNEA 2F9LA 4YRZA 2GN8A 4YRTA 4R1PA 5KVSA 1OAOC 1GPJA 1K8QA 1U3GA 3LOPA 4TXHA 3N5CA 3CEHA 1DCFA 4G5FA 4PXYA 4RBNA 4XYMA 5D51S 4GOJA 2IQ5A 1ZM3A 4ENRA 2I6GA 1DKPA 4ZFNA 1I5RA 1W75A 2X7XA 3RAPR 3FMPB 3S3TA 5A5EA 2NZ2A 1NI3A 1FXWA 5LA6B 1G5TA 2YXDA 4C14A 3KVYA 2PLRA 5ALHA 3QIAA 4IP0A 3UJHA 1XA3A 2YFKA 2CXPA 3I2KA 3DNPA 1X2BA 4FLMA 4LK3A 4B3FX 1P4GA 3G2IA 3WKDA 2WB4A 2CLCX 3IUMA 4MUHA 1RYMA 1O57A 4RAOA 2GK3A 3WV5A 4DDKA 1BHQ1 2QIOA 4NZNA 3M6WA 3THYA 3S2UA 3T34A 4QG7A 1R10A 4FDVA 1ZA2A 5DNYB 5LR6A 4MTCA 3KSBC 3LA8A 3UPDA 1JQEA 3FWHA 2HLPA 4QAQA 2IKSA 1KJZA 1KU6A 4BO0A 1KJ9A 2H48A 4CMHA 4Q03A 3K35A 4F3CA 1M5UA 3TB6A 1C2YA 4DV3B 5ERGB 4G0UA 2VSYA 1T2VA 3KYDA 1Q0PA 4RTKA 4UNRA 1GPKA 1QTQA 4NZMA 5L53A 5MN6A 2WHRA 1SU8A 4IHJF 3CJTA 3NS7A 5F64A 3TIGA 2BE9A 2QQEA 4MIKA 3U0VA 4LF8B 1NUQA 4FW9A 4B5KA 1A88A 1VA4A 4NXMB 1KSGA 3ZV3A 3B5JA 1SCUA 2B8WA 3HKCB 4Z9YA 3ESXA 1UPAA 2GESA 2Y93A 3DCYA 4K1LA 4QBGB 1XMXA 9ABPA 4OJNA 4WV3A 2VEDA 2OB2A 3FNHA 4JLMA 5KTRA 4JC0A 2ZREA 5LCXA 1YV9A 1L5NA 1IMOA 1T3LA 2OQ2A 4IJVA 1QHFA 4RXTA 5E6RA 4HN2A 1LTQA 2AXNA 1JLLA 3I9NA 3BTOA 1ZKMA 1OFTA 1XXHE 2C4MA 2Z57A 4Y7CA 3LX8A 5BRJA 1X77A 2IYTA 5GV8A 1JKJA 1MC4A 4LGCA 2C5GA 5EC8A 4I99A 1LZLA 1KS2A 2QXYA 2DH5A 2EZ8A 1MQAA 5GPBA 1NN0A 5LQMA 3QLUC 5CLHA 1XD2B 2H3HA 4Q4AB 3JD0A 1TJPB 1Z68A 1J0XO 2JFUA 2W6CX 3VX4A 1BGVA 1X7ZB 1D8AA 2FGKA 2JFXA 3V5NA 3NTRA 4ZGBA 1CEEA 4EFMA 1Y6RA 3ENKA 4R2WA 1FDIA 1NY5A 2JIPA 3ISTA 3FVRA 3LM8A 3KB2A 2PD6A 1HKUA 1C3EA 3JY6A 1BE0A 3RASA 3AVTA 1G8KA 1G1AA 4N5HX 3AH8A 3DV2A 4J29A 3KJHA 1V8PA 4A0SA 4KZKA 4MJLA 4PG4A 3AILA 2FEXA 4PBSA 3ETJA 1RLOA 1VHTA 4IQFA 4JDUA 1MO4A 1ACLA 1ADFA 2RI1A 1E8MA 1E66A 2OCAA 1VRVA 1P9RA 1E7YA 2YCBA 4QTXA 3RNOA 4L0CA 2IK8A 3TTSA 5A03A 1VJCA 2PWYA 3UKOA 1D7OA 2VPTA 2DAPA 1VJGA 4RK6A 2VNHA 2QTAA 3ND6A 4RFSB 2ZJ0A 4EHJA 1B8VA 1UCFA 4KOEC 1D6SA 2FMKA 2FWBA 3U49A 3I9JA 1ARZA 1Z17A 1ZH4A 3H9BA 4FMCB 3WFIA 5LYJA 4OGLA 3T7TA 2PBRA 4UTOA 2QG4A 2R4UA 2H4HA 4KLAA 4RAQA 1T0JB 1E20A 3FXAA 3NNNA 2P6MA 4ALLA 3I9V1 4QLAA 1TUBA 1KO4A 3VSCA 3A0UA 3HEMA 1E1LA 4FB5A 2QLNA 1QIIA 3MSCA 3QF4A 1ZVJA 3EGWA 5AHRA 1LJ8A 4EY5A 2ZUTA 2IW1A 3D6VA 4IIUA 3HO1A 2WV9A 2PMCA 4EWLA 4ZGGA 1SIWA 4EUNA 1II9A 3INRA 4KMOA 2NADA 4ZQGA 3SQLA 4IH1A 1O7JA 1JU3A 3ORHA 3WXBA 3PQCA 2XDWA 3N8DA 5KAMA 4A2CA 2IXAA 5HMLA 2O8FA 2QN6A 3LY8A 3WB2A 3ZWXA 1TZCA 2DFPA 2X6QA 4JOBA 2HT1A 2R25B 4OH1A 3I62A 3C5VA 1SD5A 3BK2A 2H65A 3SPXA 4O2RA 5IJ0A 4KXQA 2I1VB 2EYQA 1LJUA 2A94A 1JGTA 2M1ZA 1EFAA 3ESRA 3GAAA 3WJ2A 1UXOA 1Y3BE 2J09A 1B74A 4OKIA 2W93A 4RTOA 5G2OA 1MPTA 1NPYA 1IJEA 1OXBB 1OTYA 2BKLA 2HA7A 3A4VA 4BO4A 2HU2A 1EFPA 1X7WA 5E4FA 3QWFA 4NR0A 1W6UA 4G4SO 2QIPA 1Z3IX 2XMBA 4EGSA 2W6IA 1HLPA 2ZW9A 3L4BC 1JWAB 3HMKA 1TVKB 3VNAA 2H16A 4BVGA 1KSJA 1E5QA 2BR3A 2X14A 3E5HA 2NQ2C 3IQHX 3MB5A 4QICA 3WIBA 5I4KA 3O2NA 3L06A 3ZHTA 1ZWLA 3N07A 2WTNA 1GCAA 3NTQA 3RADC 1NP6A 4DXDA 1P2SA 1E3SA 1MABB 5JJKA 1KS9A 1QYDA 3FGNA 2BR4A 2CFRA 2WWGA 3SLKA 5EJ6A 1LW6E 1D4OA 5SYNA 1Z06A 1EVKA 3PXAA 2COEA 3AHFA 4FYIA 5CG2A 2P5YA 5A2QA 2ZI7A 3O4GA 2K2QB 4QUEA 1W85A 2FQWA 4MP8A 2Q6TA 3LVRE 1NN5A 4EABA 5BVGB 3UPUA 2QLLA 2W0SA 4KWTA 5JI3E 1A5TA 1QE0A 5KQGA 3SIWA 3IKVA 5M7EA 1KQOA 4M8KA 1AKNA 3FIUA 1T2EA 4GZ3A 3UQZA 1KEUA 1QHSA 1VLJA 2QXUA 1AKEA 2VA9A 3C15C 5D01A 3TECE 2CW5A 3W7AA 3J81k 3PPIA 1WG8A 1HE8B 2PIDA 1FSGA 1Y5LA 1GRVA 1E3EA 1EX1A 2HIAA 4JI6B 3UK2A 3I04M 1Z07A 3LP8A 3T7EA 3GPCA 5KYWA 1D2GA 2P65A 3EDQA 3NORA 4H6VA 4KWHA 4NV0A 5KQPA 2ZM5A 2AFHB 3H2IA 4DCOA 1XTPA 3LT0A 4FT2A 3F9IA 5KBYA 2GCIA 4MQBA 3K0FA 2P0EA 1ZNQO 2AG8A 3I9MA 3RPEA 4WKNA 1K7EB 2RGXA 3T06B 2R3SA 2VDOB 2D5BA 3KT8A 4TUYA 5KPDA 4HATA 1TD9A 3BMQB 3R9XB 4R83A 5KHLB 1N2CA 1DZ3A 4HDSB 1JDTA 4RPLA 1Q1BA 2ZRKA 2EDCA 3ZWMA 4B3IA 5A02A 2C83A 1WBJB 1U0JA 2Y8EA 3L77A 1FS6A 4HLUA 2BLLA 3OOEA 4RMGA 1CLEA 1QRAA 1VYHA 4BMNA 3ICVA 1Z6TA 2I1QA 3QF7A 3UKDA 1ZD4A 2OHJA 4LBVA 1P31A 4XX0A 5EZSA 4ZN6A 1A4XA 4HYTA 1TMKA 3WBBA 5BV1A 2C7GA 5HQ3A 3K71B 3WAKA 2PKQP 4YAIA 1ZFNA 2DU8A 1UZLA 1X1EA 3RYIB 3HNPA 3L04A 3FVWA 4X1KB 1V4NA 3QXSA 5C46F 1Q3HA 4NQRA 4D3YA 3N7UA 4J6FA 5DMHA 4HNRA 2HMTA 1E63A 3O31A 3NH9A 5F52A 1L0BA 2HW8A 4G0MA 1SC6A 4BC0A 4HAXA 2X4LA 4HAIA 1IUOA 3KYCB 1GPBA 4HAWA 3ZU3A 4DPMA 2DHEA 4NSNA 2IYWA 2Q0XA 4FE4A 3AKZA 1FFSA 1RS0A 2FEPA 2QN3A 3TLYA 3U7RA 3ZNQA 3ZXXA 2JJ8A 3AM1A 3MUFA 2QAIA 4JYAB 4B71A 3GIDA 2PNFA 1HK7A 5LBTA 3QE2A 1VI6A 5JZMA 3HBLA 2B4KA 3QPUA 1SUDA 3QVJA 1OX4A 5A4FS 2ZRHA 1V3VA 4WKCA 3DTVD 1TK9A 1HZZC 1WZUA 2AC2A 2CL7X 3E84A 3Q4GA 4EEXA 1YFJA 4F4HA 4DIOA 4H27A 3HXQA 4WLNA 2XUHA 1Q0UA 2I6FA 3CU5A 4X3OA 4D9EA 4NBNA 4QOEA 3RBZA 4I19A 3WJAA 4QVKA 3SR3A 1AB6A 2WB2A 1EXDA 4OOFA 1TPYA 4MW1A 3LPMA 4BFXA 3HGMA 3M6UA 5LNK6 3TXYA 4O3MA 4OBXA 4MV7A 1IG3A 3U80A 1V11A 1N6KA 4AL4A 2FQXA 3UAVA 2ZEJA 2ZE5A 4DIMA 2OESA 3OY2A 1HUQA 5TPWB 1FNMA 3RVSA 4MUEA 4AQYB 5AH0A 3EZ7A 4BNWA 1ZU5A 2N47A 3S2YA 2HZ7A 4MGZR 2PT6A 2Z3ZA 2C5FA 5DM2A 1QHXA 3G9XA 2KB0A 1E94E 3F7OA 4IYRA 5IASA 2IYXA 3OHPA 1XCPA 4D4KA 5HHTA 4Z86A 1U7HA 3DAHA 3R40A 4J4BA 4W8OA 4BNJA 1W5BA 2PGXA 1GUDA 3W6PA 3Q2IA 4JLOA 3IO5A 4PZ0A 2NUAA 1LB1B 2UUCB 4RPIA 1JA0A 3FPHA 2WKPA 4MWEA 3U31A 1DXQA 7ABPA 1CEXA 1UQTA 3FA2A 1J8YF 4L8LA 1Z2DA 2ZFUA 2HF8A 3VJLA 4A73A 2GHIA 4DA7A 3TSWA 3PFNA 4DT1A 5J58A 1RAIA 2AOXA 4OXQA 1XTUA 2DOKA 4XTRA 4C1BA 2AQIA 1G4HA 3AXSA 1FFBA 1VG8A 1XWWA 2D8AA 2DC1A 3KKNA 3N6VA 4MWDA 3SQMA 2Z5GA 3VM6A 1D6JA 1RACA 1H6AA 2X9QA 3IILA 3QH4A 1PFWA 1SQ0A 2MWMA 4KSCA 4AUKA 4EZEA 4E2ZA 1NXPA 1KVRA 3P5BA 3O75A 3PQ6A 4R9NA 4B8ZA 1Y0BA 1KY4A 1SO8A 3KQVA 2XWQA 3N3AC 5K1ZA 2DZDA 3MCVA 4W1QA 3LCVB 2O3SA 1JG1A 1YMQA 4MIYA 2AZXA 4ZVTA 2VN8A 3FCYA 4A6EA 4IVQA 1XP8A 2BEWB 1VL8A 2PHZA 4RPGA 4JLKA 4ND2A 1XKLA 4ZVRA 1OWPA 4NMXB 2VXCA 1O87A 3PJGA 4LRWA 3TZBA 4LPKA 1TAUA 1XA0A 4O0LA 3AIOA 4F91B 4ZYYA 4BQOA 4EW6A 3VOAA 3FUXA 3K1YA 4B3HA 5HOEA 1MW8X 1K9SA 3Q8WA 1UPCA 4OUDA 4OXIA 4IYJA 4XB1A 1ZNWA 1T6BY 1Y6JA 4GLOA 4JB0A 4MR9A 1GVNB 3QMWA 1RCUA 1H94A 4US1R 1YIDA 2P3LA 5EHGA 3EVTA 4ND1A 4Q66C 1NBME 4ZK2A 1M2VB 3MHPA 5AVZA 5LXTA 3WQBA 1W88A 4J16C 4YMSA 3GVHA 5BPHA 3U61B 4XJVA 4HGPA 1NPTO 5CA1F 2VCHA 3CLUC 1FYXA 1MT3A 2NZYA 1THTA 5IFLA 5JCXA 10MHA 3MWGA 2HJGA 3GCGA 1K6IA