1XROA

Crystal structure of active site f1-mutant e213q soaked with peptide phe-leu
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNQFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 104
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xroA00
1UOQA 2QM0A 1NU8A 4YK7A 4KACA 3AJAA 4HAIA 4W1SA 4LXHA 1D07A 5ALTA 3PUIA 4BC1A 1R1DA 5EIEA 4Q82A 1BCSA 2ZYRA 4H18A 1QE3A 1CVLA 5KBYA 1KEZA 1UWCA 3OOSA 5JZSA 4AO7A 4KE9A 5EGNA 5J3JA 2ECFA 1CUVA 4HTAA 4PV7A 3BJRA 2ES4A 4K6HA 1UK6A 4FWBA 3H17A 1CUCA 3MGAA 2WTNA 2RIPA 2YASA 4WFKA 1XKTA 1QIMA 2X8BA 3PF8A 4W1PA 5ALFA 3FVRA 1XZHA 1ORVA 1ZICA 4Y2YA 2VJBA 5FOQA 3GROA 3WJ1A 2FJPA 1BN7A 2JGEA 5CH8A 5CW2A 5HCUA 4DNOA 1AGYA 3NOXA 1RYYA 3L1HA 1HLGA 3V1KA 5HQ3B 3FLBA 2C0PA 2G5TA 2RHTA 1U2EA 3S8YA 1ZJ4A 3IULA 2PX6A 5HZGA 4PF1A 1A7UA 2Z3ZA 1SCKA 2ZJFA 5T4BA 3T52A 5DNUA 1QTRA 2XMGA 4WJLA 1KU0A 1O6GA 4N5HX 1KU6A 5ALMA 2OG1A 2OCIA 5AIBA 2QOEA 1CUHA 1ZD3A 4KEAA 2WG1A 2HHAA 3IURA 2WKWA 5LZ8A 1EA5A 2QZPA 2HA2A 3FNBA 4BCBA 4G4GA 1ZGCA 3AZPA 4TGLA 4HRYA 4BC0A 1Z68A 4DSZA 3C6BA 2C4HA 5CBKA 1MJ5A 4Q05A 5AOCA 2ACEA 4QWWA 1VXOA 1ZGBA 2QMQA 1AMNA 5JD4A 4DIUA 4DNPA 3VISA 1MU0A 1UKAA 3D59A 4B85A 2GZRA 2ZYSA 3OG9A 5C8ZA 1DTEA 3C43A 2GBGA 1XFDA 1N5MA 3BXPA 1AQLA 4FNMA 4B0OA 3T4UA 2HA5A 2R8BA 1XRMA 4X7BA 4A23A 1CUUA 5K3AA 3D7RA 2EDAA 4Y2SA 3I1YA 1I6WA 3ESDA 3FSGA 2O7RA 4C4YA 4AZ3A 4ITVA 5AM2A 4JH0A 1MX5A 3G0GA 3DKRA 3AIMA 1CRLA 3PFBA 1XRNA 2BGNA 3ED1A 1L7RA 1IUPA 4JYPA 1XROA 4HXEB 3H1BA 4CG3A 3BF8A 3R0VA 5FV4A 4ARAA 5IH7A 2Y1KA 5DNVA 1L7AA 1WOMA 2HA7A 4BDTA 3C5WP 1WPXA 2XUKA 3F8SA 4UFOA 3DD5A 2B9VA 2QVBA 2XMBA 4IH1A 2Q0XA 3M3DA 2IITA 1GGVA 4LYEA 3BIWA 4FOLA 3VJMA 3H18A 1CLEA 1CUZA 2DR0A 2DHCA 3RARA 2PSEA 5HQ3A 2XE4A 4BAZA 3FYUA 4KE6A 1U8EA 1QLWA 1CUBA 4G8BA 1FJ2A 3R40A 5CH5A 4DGQA 2PSDA 2GYWA 5BWBA 2I78A 4OB8A 4X00A 3ZI7A 4XIIA 4DYHA 2XUPA 5ALZA 1EH5A 5ALLA 3EQ9A 2XB6A 2BCEA 3DS8A 2BJHA 4B80A 3V9AA 2CKMA 1CUWA 5HKAA 4UFNA 1ACJA 3U1TA 3V1LA 1T4MA 4OYYA 1E8NA 4UBJA 1ORWA 2JGKA 3ZLUA 1CEXA 1TCBA 4QZVA 3V48A 3FBWA 1P0MA 4CFSA 5A7FA 3HZOA 3FCXA 2XUDA 1Q0ZA 5HF6A 3SK0A 1DWOA 1F0NA 5F4ZA 1SFRA 1ZD2P 5A71A 1QZ3A 2X5XA 1UK7A 2VSQA 4J0KA 1W76A 4C88A 1DQYA 1SOMA 4UPDA 3ICVA 4DM7A 2DCMA 1UT6A 1OXMA 3ZV7A 3EF3A 1LPBB 3KSRA 4KAFA 2PSFA 4HVTA 1L7QA 3FYUC 4DMKA 5EHZA 1T2NA 3G0BA 1QIEA 2O2IA 5BOVA 2WG0A 4RE5A 4KAAA 3S2ZA 1WPRA 3IUQA 4BDSA 5DNWA 1CIJA 1QFMA 3D5EA 3PUHA 4GECA 3I28A 3QZUA 4ZV7A 3C5VA 5H3HA 3IIIA 5LZ5A 3HI4A 1WCYA 5JANA 4K6GA 1C4XA 5AI8A 3Q8WA 4H7DA 4J0HA 4HS9A 2VT7A 2Z8XA 2PUJA 4FLEA 3AUKA 1X70A 2H9YA 1HQDA 5AKGA 3GBSA 5AM4A 5CT5A 4AZ0A 1VE6A 4UBMA 3LP5A 1ZI6A 2Z8ZA 4LXGA 1YASA 2W6CX 2WJ3A 1QOZA 1R9MA 1YCDA 1ZI9A 3AIOA 5ALHA 4EY8A 2V9ZA 4LIPD 1WB6A 3QBJA 3D3NA 3FYTA 1XZAA 1S8OA 2C5FA 2XUHA 1F6WA 1HPLA 5AK5A 2ZSIA 4G4IA 2QXTA 2OQVA 1RP1A 2WILA 2XI4A 5K3FA 3RKSA 3G8YA 3KDAA 1BEZA 3WWEA 1J1IA 1IMJA 1AX9A 1CUEA 5AIAA 1XRLA 5HK9A 2XUQA 2XMRA 3FWHA 4Q3KA 1MT3A 2JGJA 1CUFA 3MVEA 4G4JA 1WB4A 2HA3A 1NU6A 1ZIXA 3C6YA 1P0PA 4QDZA 4E46A 2PU5A 1VKHA 4Y9SA 5LZ7A 3C87A 3GFFA 4N8DA 2HRQA 1QIGA 1FSSA 5E4JA 2R11A 3VKFA 2PBLA 3QVMA 1F8UA 3WL6A 2B4KA 5EHNA 2C5GA 5CURA 1H2ZA 2PU7A 3MUOA 4EY7A 1BEEA 2JGMA 3V1MA 3O4HA 5T4HA 4RGYA 4P93A 3F9CA 4CIAA 1YSCA 5AJHA 1YS1X 2PL5A 4EUSA 4ROTA 4NS4A 1CUDA 2HRRA 5KREA 1RWQA 3C6XA 4H7EA 2HL6A 1J06A 1BCRA 3IBTA 4IH4A 2WJ4A 2QUAA 1VJ5A 4U2DA 1CUYA 1JKMA 4QNNA 2ZSHA 4M0FA 4E11A 4K2AA 4KAJA 4LXIA 1MN6A 3HLKA 5FLKA 4U2CA 3ZLTA 1GKLA 1K63A 4OB7A 1VZ3A 5AI6A 4Q3OA 2VT6A 3QM1A 1P0IA 1QIHA 4OU4A 3JWEA 1LNSA 4BZWA 5K3BA 3F97A 5DTJA 4ZXFA 3PFCA 3QMMA 5AKXA 4BCDA 5CT6A 1H23A 5ALJA 3C70A 4JUIA 4ZI5A 3C8DA 3QYJA 2VA9A 1QIKA 3HACA 3OC0A 2EEPA 3M83A 3H0CA 1XLVA 2QTBA 4TPKA 5CRIA 4Y2VA 4NMWA 2HU8A 1H2XA 2AJBA 4J0GA 4J03A 1GQRA 1X2BA 4AX4A 2NW6A 1YS2X 2QXUA 4Y2RA 3C6ZA 2LIPA 1A8UA 2QJRA 2HU7A 2UZ0A 3VJLA 2BUBA 3ESCA 3VVLA 3WK8A 4WCVA 1TCAA 4F60A 5ALRA 1JMKC 4X92A 3WK6A 4BRZA 2RONA 1LBSA 2HU5A 2G5PA 4BAUA 3TRDA 5HF9A 4QDXA 2WG2A 4EHBA 4Y2TA 4ZGBA 4BYMA 5JZBA 3QPCA 4FHZA 4J3JA 1AKNA 1R88A 3LLCA 3FLAA 3AZOA 4FFVA 2WFLB 2RGUA 5C8XA 3HRHA 3IB3A 3B3QA 2DFPA 3DL4A 3VDXA 4G8DA 1SCQA 4Y2XA 1VA5A 1QONA 4CCYB 1XRRA 5FPPA 3LCRA 3ANTA 2OCLA 1XZIA 5C81A 1ACLA 4CG2A 3WLAA 3CXUA 5CT4A 1QIIA 1EI9A 4I3FA 4OCZA 5AKKA 4X94A 5EFZA 5JASA 5EIAA 4B81A 1MAHA 1MO2A 4NVRA 3HSSA 4UHDA 1VXRA 4BP9A 2XMSA 4OU5A 1LZLA 5D3ZA 3STUA 1VE7A 5K3FB 3R3ZA 4OSEA 4HXFB 4X85A 5D7BA 1XQXA 5HK8A 1LGYA 1BROA 1W1IA 5K5EA 1YB6A 4FLMA 3JYHA 4TVKA 2XQIA 1UKBA 4CCWA 1CUXA 2D5LA 5CTAA 4PSUA 3DOHA 2B61A 4HXGA 3E4DA 4G9EA 2QR5A 3W04A 3D2CA 4MYDA 3WKCA 4BE9A 3WKDA 4B9EA 3OTQA 4GI1A 3H19A 4UHFA 5D3KA 1QTIA 1YAJA 4PSDA 3DNMA 3WYDA 1DX6A 1ZOIA 4X95A 1LZKA 2AJDA 2QT9A 1UZAA 1XZBA 4GXNA 4XX1A 5A7HA 4GW3A 4O08A 4BBZA 1R3DA 3YASA 4BB0A 4EBBA 2GBCA 1TIBA 4K5QA 3H2JA 5HFNA 4N5IX 5ISMA 3F98A 3ESBA 4PQEA 4BVKA 2V98A 4HZGA 1EINA 4BCCA 4X93A 5ALWA 4H7HA 5ALXA 2HFJA 2YH2A 4RPCA 3QMWA 2J3DA 2VAVA 4QLOA 4X6YA 1FFEA 2ACKA 2VAXA 5AK6A 3WWPA 3NWOA 1CUAA 5FKJA 3WKBA 3C8HA 3F96A 5CH3A 2JGLA 5AKJA 5AK3A 3PI6A 1IZ8A 4MQMA 2H1IA 4GWLA 4PO3X 1LPPA 5D6OA 2V96A 2XUGA 4I4CA 1CUSA 1G42A 2PM8A 4MXDA 3STWA 5IVKA 2Z5GA 5C7YA 2OAGA 4ARBA 2CZQA 5I9IA 3LS2A 4UBLA 4Y2QA 1K6EA 2C58A 3O9MA 1J2EA 4F5ZA 5LZ2A 2OLEA 1C7IA 4JEIA 4AQDA 4PSCA 4E14A 2C7BA 2QRUA 2WIGA 1N5RA 4X3CA 2WFMA 1SC9A 2WLSA 1JU4A 1E3QA 1XKLA 3TGLA 3CN9A 2GYUA 3G0CA 4KYVA 4BAGA 5AICA 1U65A 1LPAB 1EDBA 3WL7A 5E2IA 4AB1A 3QH4A 3G0DA 2AJCA 3KOOA 4XWGA 1GPLA 4MWSA 1QO9A 2CEKA 2QKYA 4X71A 2Y6UA 3FVTA 1Q84A 4KRXA 4MWTA 1ZD4A 2Y2VA 3WL5A 4AN1A 1P0QA 2JIDA 2WFZA 4X6XA 3WZLA 2DSNA 1H2WA 1XZEA 3I6ZA 3DYIA 5LYYA 2OGZA 5ALGA 3A2LA 3G9TA 1CUGA 2FJ0A 2XT0A 4DTCA 3G9ZA 4Y2UA 4G5XA 4M0EA 3P2MA 2JEZA 5LLSA 5ALUA 3ILSA 5EHQA 2ZYHA 3M82A 1EK1A 4DMFA 1Y7IA 1LPNA 1FFCA 1YA8A 1G4HA 1WHTA 4YX9A 3W2TA 4FFWA 5LKAA 3VVMA 2OXEA 4C87A 1EXWA 1ZIYA 3EQ8A 1QJ4A 5ALSA 1UKCA 3ANSA 1X2EA 4QEKA 1ZJ5A 4HRXA 4RE6A 3HYSA 4QWMA 1W4LA 5DYYA 2VJAA 4CI9A 4C4XA 1BN6A 4WY5A 3H2IA 5AKZA 2OGTA 3WI7A 1GPKA 2J3QA 5DYTA 3OPMA 2P8SA 1B41A 3CN7A 4EZIA 5EHXA 5I8PA 5JIBA 4C6HA 4AMZA 3BL8A 1B6GA 4P08A 2I03A 2PSJA 3WWOA 2GYVA 1Q0RA 2DHDA 4IH9A 2D0DA 1FFAA 1MAAA 2WUGA 4UFPA 5IKXA 2O2HA 4GLBA 1A8QA 4KR0A 5AH0A 3FAKA 4AO8A 4QDOA 4UHBA 3IUJA 1ETHA 1Y7HA 4FMPA 3HXKA 1CV2A 2XUJA 4FBLA 4DNFA 2OGSA 5AKLA 3KWFA 2HADA 3A6ZA 3EBLA 2WHPA 5E4TA 4IQ4A 2W22A 4UUQA 1AC5A 1ODCA 1QFSA 3PDCA 2G4LA 3E0XA 4Y2JA 2ONCA 2XMZA 2WTMA 3ZPXA 5AK4A 2J4CA 1PFQA 2XQKA 5JALA 3N2ZB 5ALKA 2HM7A 2CUTA 3DDUA 3WZMA 3FCYA 3H2KA 3IA2A 4H7FA 4QDUA 3H2HA 5BV7A 1AURA 3UMJA 1CQZA 2RAUA 1R4ZA 1ODTC 3AINA 4K6KA 1BS9A 5AI5A 3W9BA 4X91A 4W1RA 2VQ6A 3ZWQA 1JU3A 4L9AA 3I6MA 3C45A 5ALPA 4CIBA 4Q3LA 3IVMA 3M81A 1G5FA 3H04A 4WDRA 1YR2A 1R50A 2OAEA 4UBOA 5FRDA 3ESAA 1F0PA 3WK9A 1VA4A 1USWA 2VJDA 5JZ9A 1TAHA 3GZJA 3PF9A 1IZ7A 3SC2A 5LKRA 1HKHA 4BRSA 2CJPA 5A6VA 1M33A 1CQWA 3WMRA 1ZI8A 5FXMA 3AZQA 2ORYA 1YB7A 4B9AA 1QO7A 2Y2UA 3QPAA 4U2EA 1QGED 4YASA 1TQHA 5K3EA 3D2AA 2DQZA 3Q0TA 1ODSA 3STYA 2BFNA 3I2HA 3V1NA 3KD2A 5HF8A 2RHWA 1EX9A 5KWJA 3DL7A 5ALOA 2BUCA 1MTZA 1UOPA 4GBGA 1DX4A 3GUUA 5JAOA 4C4ZA 5K3DA 4A16A 1HBJA 1N8SA 4KRYA 3LIIA 3O9VA 2BKLA 1XQYA 5CXUA 1OCEA 3D4LA 1ZD5A 3MUNA 5LIPA 4UHCA 3KWJA 5BWCA 3WJ2A 1H22A 1EK2A 1GPNA 5AKIA 3O4IA 4W63A 1E89A 1XZGA 2XLBA 1TCCA 2GBIA 4LYDA 2XMCA 1AUOA 5ALYA 3VXKA 4L0CA 1MNQA 2ZJ7A 3KXPA 4DNQA 1YAHA 2VTVA 1FFBA 5ALEA 3WL8A 1CFJA 2VATA 3WWDA 2XDWA 1Y37A 3O4GA 2IIVA 5EIHA 1FFDA 3R41A 1K8QA 3A2MA 3LIPA 3H1AA 4QA9A 3BJMA 4F21A 3DCNA 1WHSA 4LKOA 4ZV9A 2EDCA 4LHEA 2JEYA 5A62A 3HEAA 1DT3A 1BE0A 3L1IA 5CT8A 2WUFA 3AILA 4OYLA 2VF2A 3G02A 2XUIA 3R3VA 2QS9A 4GDMA 4WY8A 1PJAA 5JAUA 2OPHA 3RK4A 4WDQA 3I2KA 4G1FA 2XMDA 2WU3A 4FDMA 3WWCA 1IUOA 4QLAA 3WQHA 2WIDA 4D9JA 3BWXA 1G66A 3TJMA 1A8SA 4KJXA 5FUMA 2YXPX 2WM2A 5ESRA 4FNGA 2Y6VA 4FLFA 4BATA 5I7UA 5C8VA 2H7CA 3O95A 4J0DA 1DQZA 1E5TA 6YASA 1MX9A 4G9GA 4U2FA 4CG1A 3BE8A 1VLQA 5IVDA 5JD5A 2GBFA 4H7IA 2X76A 4XVCA 3IUMA 2ZVDA 4P92A 3QITA 4WFJA 3I1IA 3GELA 5AOAA 1EDDA 5T4EA 2DHEA 2CB9A 5T4FA 5K3CA 2FX5A 4DSAA 3G9UA 3HC7A 3G0IA 1TRHA 5JATA 4QE3A 2B20A 3BDVA 4B6GA 1JI3A 2BGRA 1GT6A 1DWPA 2BAGA 5E4YA 1UK9A 3A70A 5IVHA 1UFOA 1GZ7A 1H2YA 1JT2A 1BRTA 3B5EA 1LBTA 4EA6A 4Y2PA 5ALIA 4B82A 5AM1A 2WIKA 2HIHA 3NGMA 1TKRA 1XZJA 2HFKA 5ALQA 5AKYA 3STTA 4PW0A 4AXBA 1LPSA 4ETWA 4YPVA 5HKBA 3W05A 2WFLA 2HDWA 2WIJA 4H77A 2WUDA 4DMHA 3DJYA 1W6RA 1UOOA 3IUNA 4BP8A 1R9NA 3WIBA 3F67A 1JFRA 4GEGA 3RLIA 4B7ZA 3U0VA 3R3WA 1XRPA 4IO0A 2HA0A 2VJCA 5HFAA 4V2IA 4U2GA 5CMLA 1W52X 4INZA 2XQFA 4XJVA 2JF0A 5A2GA 3HJUA 5SYMA 3NUZA 5JADA 1IUNA 5FDFA 2XUOA 3W9UA 4X90A 5CXXA 4CCYA 1DINA 4W1QA 3W06A 4KE7A 3DEAA 1ISPA 2BUAA 1UK8A 3EIOA 5AM0A 5LZ9A 5JAPA 5AKHA 3JW8A 3G7NA 1LPMA 3RM3A 1QIDA 3HABA 1THTA 3FYUB 2PKYX 1U4NA 3L1JA 3WK4A 4QDTA 1C7JA 4J0JA 2JBWA 4MEAA 3G9XA 1XZKA 2JGIA 1BU8A 4A5SA 4IHAA 4ZWNA 2I3ZA 4BVJA 2Z3WA 3K2IA 5IVIA 3QMVA 1A88A 4F0JA 4AO6A 3OURA 1YA4A 3O0DA 2O2GA 5EI5A 2WJ6A 4Z49A 3QPDA 1CUJA 1EVQA 3DQZA 5YASA 2IX9A 1XRQA 1XZFA 3UUFA 3WKEA 5AHXA 3ZLVA 4J0IA 2WU4A 1JJFA 1EB9A 2V97A 3AFIA 1XZDA 2WHRA 3I2JA 5AKEA 5ALNA 1EB8A 4U2BA 1XZCA 2HA6A 3I2GA 4DMCA 3O4JA 3DOIA 3WA7A 5LZ4A 4UHEA 5AI0A 3I2IA 4KE8A 3R3XA 4MJ3A 4L3WA 4BTLA 3PICA 5AM3A 3R3UA 1QIJA 1UXOA 2CBGA 4RNCA 4UBNA 2QUBA 5LP1A 1W75A 2YYSA 1LLFA 1O6FA 5FPQA 5HF5A 1WM1A 1GQSA 3GA7A 1EDEA 2XUAA 4FBMA 4FKBA 2WHQA 4X97A 2QJWA 3K9BA 4P9NA 5A7GA 2ZJ6A 2E3JA 3SWWA 2WUEA 3DLTA 4MYSA 1XQVA 2C0QA 4S0XA 1THGA 1DT5A 2XUFA 3FSGD 4W9RA 1VZ2A 5DTIA 3E3AA 2WQZA 3CCBA 3CCCA 1E66A 4ZREA 2J4FA 1XZMA 3FLEA 5JAHA 1MX1A 5JYCA 2CMFA 3ICWA 1MPXA 4EY5A 5AO9A 2I3DA 2XLCA 2OQIA 4Q1VA 4H35A 4UBKA 5SYNA 3IDAA 3BIXA 1SCIA 1CR6A 5DYWA 5CT9A 1WB5A 3R3YA 1JMYA 5FP0A 5KWIA 5ALDA 4MEBA 4X6UA 4JNCA 2RI6A 3WIOA 5AM5A 3WKAA 4Q34A 1JJBA 3FOBA 5JARA 4DLNA 2ROQA 1LPOA 1VOTA 3DKKA 4OB6A 3BDIA 1DWQA 5DWDA 4FTWA 3I6YA 3TEJA 4EY4A 4C89A 1PV1A 4EY6A 5DLPA 2H7XA 3WK7A 2H7YA 5AI4A 3WYNA 4H7JA 4G8CA 1CPYA 2WIFA 3AIKA 3E1GA 1EVEA 1N1MA 3A2NA 2G63A 4BE4A 1XLWA 5AI9A 2WSLA 2O7VA 5AOBA 4BVLA 3H2GA 4N8EA 7YASA 4EB0A 4NZZA 4ZRDA 2PPLA 4J7AA 1K4YA 4Y7DA 2XQGA 2AXEA 2PSHA 3UUEA 1XZLA 3STXA 4B84A 3BF7A 1HL7A 1TK3A 4C01A 2XQJA 4B83A 4UBIA 1E8DA 2AJ8A 4GHWA 4B0PA 1CUIA 4JYMA 1XQWA 4OUKX 1AZWA 2JGFA 4M0MA 1MNAA 5AP9A 3K6KA 1NX9A 4N8SA 1Q83A 4I19A 1OILA 1HDEA 3OM8A 4E15A 1JJIA 4AMYA 2FUKA 2HA4A 3N0TA 2PVSA 4BZZA 4UHHA 4OPMA 3STVA 4BTVA 3WA6A 4WFIA 1EHYA 5DJ5A 2PUHA 2AJLI 4H0CA 3WK5A 2XMQA 3X3HA 3DYVA 1K5PA 3D0KA 4OD0A 1QIFA 3B12A 4MQLA 1GXSA 3VJKA 3D2BA 1GKKA 1DU4A 1IVYA 1E8MA 3I2FA 1XLUA 2OCGA 4PNZA 1J07A 4L72A 2OCKA 2GZSA 2DQYA 4AN0A 4H7KA 5ALVA 2WHPB 2K2QB 3PE6A 3SX4A 5JD6A 2VEOA 2ZYIA 4J0CA 3EQ7A
chains in the Genus database with same CATH superfamily
5HVNA 3ZBQA 1A5TA 2QM0A 5HE9A 1T0PA 4LE1A 1NU8A 5FLYA 1FLAA 3FDJA 2MSDB 3KUCA 3KEOA 3KG2A 2XTZA 4D46A 1KI6A 1LDEA 3EGXB 4PYRA 4FC7A 3ELBA 4HAIA 1EHCA 2O4UX 4LXHA 3QEAZ 3UVEA 4Q12A 1FS5A 4BMDA 1JHDA 2ZITA 3KXKA 4LDRA 2HB6A 3ABSB 1U8UA 1OWOA 3MPUA 5D1HA 5F73A 4EHKA 4NQRA 5KTTA 1Z4KA 3W4JA 1NYLA 5BSKA 2P3SA 3BIFA 5A0FA 3H8JA 3JPYA 5T8KC 3AC0A 1I2BA 4J4BA 2A58A 5KYWB 4EHFA 3AKZA 1BCSA 3QV1A 5IM4F 4YQYA 2ZCJA 2Q7XA 1QRSA 2NPFA 1BOOA 2IYQA 5KBYA 1KEEB 1PD1A 3CO5A 4H1UA 1T1IA 4WUVA 2EG9A 1HT3A 4R16A 3OOSA 4DSTA 5F7JA 1ZU5A 4EHIA 5JZSA 3I1FA 4KE9A 2FEKA 4MUIA 4ZCQA 1ND5A 3AVOA 5EGNA 2A30A 2GERA 2QROA 1CUVA 1TEVA 3VJRA 1XX6A 4ZOLF 1DELA 4M7WA 1TUBA 3KYDA 1UK6A 4FWBA 3FAZA 3U4DA 3A05A 1T9BA 3W5UA 3EX7C 4EQ6B 1COWA 3AJEA 1RJ9B 2QIPA 3PX7A 3CUYA 4ZQGA 4FJ1A 4D97A 4IWXA 1EFRD 3GGCA 1VE9A 2DUWA 3RUPA 4G0WA 1TI7A 3CVUA 5KYGA 1FDSA 3CJTA 3KVOA 2ZAIA 5BW6B 3GRYA 3T7TA 3QIVA 1YR9A 3EPRA 3GEBA 1P1KA 4W1PA 1JWLA 5BN5B 4BEBA 1PTKA 3D8NA 1WZIA 3ISJA 1U8FO 1Q0QA 1ZICA 2D5BA 2R1TB 4ZDIA 2VJBA 1BFDA 4G09A 4JVOA 4CGZA 2PGLA 1VJDA 4U9HS 4QTZA 5DIFA 5CG1A 3GROA 3SLKA 4D3YA 3SNHA 2OC9A 3ZWVA 3AR4A 4YJ3A 2NO4A 4N47A 3OZRA 1BN7A 5CH8A 1LVGA 4DNOA 4AW9A 2P77A 1OV4A 3TOVA 3GC6A 2JLWA 1R6XA 1AGYA 4PSAA 1PT9A 4KXQA 5KC9A 4TS9A 4F3RA 1F06A 3V1KA 2BCJQ 1J70A 4D5EA 4GKJB 4JITA 5EFOA 4DLSA 3CSUA 2X3UA 3ANLA 2G5TA 4N3NA 4ODIA 4RC9A 5JC1A 2RIRA 3IKJA 4Q66C 1T3GA 1FFYA 2AFHA 3UWOA 4WBXC 4KJZA 4RXMA 2E55A 4KXMA 3NYQA 4JJEA 2IX3A 1ND6A 2BPOA 2X5OA 5JXJA 3QFHA 2A7QA 1WXQA 5A4JA 2PH7A 3TSOA 1IQ0A 2I2AA 4TS1A 4HNUA 2A0XA 2QD1A 1X1EA 2OD9A 2ZJFA 1D2GA 4AG3A 3EVTA 3H4VA 4QM7A 4U8GA 4EGAA 1KO8A 3T52A 3KJIA 3PEUA 1ENOA 3GLHA 3RHSA 5DNUA 1IHOA 4TMKA 4WJLA 2FYTA 1SBCA 3FHJA 1S2NA 4BYGA 4JLJA 1P3DA 1Q22A 1XIVA 4KDFA 3RUAA 2PLNA 1Y1SA 2QN9A 3QFCA 4F9TA 3NDPA 2ZBDA 3V8MA 2QOEA 3NB0A 1A8IA 2EJBA 3GPIA 1NNI1 1BYIA 3D7SA 4M21A 2AEMA 2C1EA 4TXJA 3SXPA 4E3ZA 4EG1A 2HLPA 3ETCA 2MR5A 2WM9B 3NONA 4BECA 3MJDA 1OVGA 4QREA 1RWVA 1VSUA 4UU1A 5KCZA 1GQFA 3LW8A 3QLTA 1L5WA 2APJA 1WKBA 1E7SA 1N5JA 3CX8A 4WXPA 3B20A 3K2QA 2HA2A 3FNBA 3DDWA 3GY0A 4L57A 3RBVA 1K4MA 3UHJA 5C7IO 1TF7A 3K92A 2QLFA 3C6BA 3K1ZA 1CZNA 1QGUA 5LB4A 1HQCA 3TTWA 3B1JA 4DSZA 3ZVMA 2Q6LA 3B1FA 4I1OA 4TMXA 3SVZA 2YKGA 1JLKA 1JHUA 4LQ4A 4U6QA 4Y1RB 5CBKA 10MHA 2BDUA 4KFUA 5AVJA 4HNQA 4K9MA 4RZQA 1M8JA 3Q11A 1OAOC 1JJAA 2JDIA 4PLZA 4Y1GA 4B3JA 2PZAA 5F7OA 3IAHA 1Y3AA 4P3OA 2WYVA 3RS2A 3PQDA 2QMQA 1UKYA 3SQNA 1XK7A 4DNPA 2F1HA 2VN8A 1ZIPA 3GMTA 3ZWBA 1GV0A 1RMTA 4H0NA 4XLZA 1JAZA 1E7RA 1MU0A 5LUBA 3D59A 3A14A 4LYFA 4M89A 4OQ4A 4QAQA 2CMDA 3OOYA 2GZRA 1KP3A 1MC1A 4HQKA 1YDHA 5IPFA 3C43A 2GBGA 2QWXA 1RBYA 1O03A 1JS1X 2NO0A 2VG8A 3L06A 5SZIA 1XFDA 4I1SA 4HI0E 4PVCA 3VR5H 4DQUA 5JQGB 1AQLA 4GAEA 5J9FA 4BN0A 3A04A 3NBUA 4WK0B 4W9MC 5K4GA 1NVDA 1ZD1A 4QJ4A 1VJTA 2HA5A 2PKXA 2X8JB 3CHYA 3RRNA 1GTZA 1X9IA 2X2OA 3GD5A 4XASA 4A23A 2W6OA 2YNMA 3ZXSA 3DVRX 3SP1A 2OPBA 3B2EA 3CPJB 2NUPB 2NZ2A 4LYGA 3UANA 1RDFA 2COEA 2EDAA 1QP4A 2E5FA 1IOZA 1KAEA 5L4SA 1DADA 1AKRA 1L5VA 1FYXA 4HTFA 2IV2X 3L0DA 1GPYA 1I6WA 3ESDA 2JLQA 1KFJB 4X65B 1UM9B 5LLTA 4KLAA 3I2YX 2XGMA 2O7RA 1C9MA 2F3PA 4ENWA 2BBWA 5LJLA 1K1EA 3WLNA 1IY2A 1FXWF 3WDLA 4ZPXA 2GNPA 1RXYA 5AVVA 4DHEA 2J59A 3FUTA 3RJ5A 4J2HA 1IYZA 4N7BA 4Q4JB 5I7WA 2A3RA 2WU0A 4N9WA 4GQBA 4MRSA 1J5XA 4F1JA 3OY7A 3PFBA 2G36A 1XRNA 4UEOA 4Z99A 4EYOA 3V33A 1L7RA 3LSYA 3ZWAA 4DABA 3NHZA 5BYJA 3L7MA 3UNXA 3EB9A 3MT7A 1XTIA 1UMDA 3TTTA 5ICEA 1IIBA 4QECA 1Q1NA 1M34E 2K7ZA 2P65A 2IKQA 3H1BA 2QTNA 2IYUA 5E0OA 1QRRA 3FOEC 4IPTA 4EJSB 4CG3A 3M5WA 3IT3A 3UUGA 4NYJR 4BLPA 5JYEA 1D8AA 2IOFK 2X0JA 3ECCA 3GGSA 1GFIA 2A1IA 3RYFA 4DCPA 2OEPA 3VPDA 1I2DA 2JK1A 2WUVA 3P9ZA 1SQFA 4DRXA 5BMOA 1FUYB 3KR9A 3NBQA 2P9TA 3N75A 2ID7A 1UINA 4P58A 3BFVA 4DB2A 1HSZA 1QOPB 3PFGA 3T06B 1A98A 4NULA 1E2JA 5FWXB 1E9EA 3GLHB 1JQEA 1TVKB 1L7AA 1ZCJA 4IXTA 3WLFA 1ZSVA 2QUJA 1E2LA 3F8SA 2BMDA 5K9ZA 2B9VA 1X1AA 3KL4A 1JHOA 5ELMA 4B75A 3QOYA 4KNVA 4MUMA 1GGVA 1HE5A 3GLFA 3R7AA 2J32A 1XWFA 4PONA 2WIBA 4JL8A 3RUFA 1Z06A 3G2OA 3K0BA 3P9QA 2EVWX 1GFSA 1CLEA 3H2BA 3T3EA 4KRFA 1N7JA 3QFFA 2DR0A 3AEQB 2AMVA 3WHPA 1G8YA 2Q1WA 4Q15A 3TTUA 2ZAYA 1O96B 1SBYA 1HZZC 2PQ0A 2XE4A 1S2IA 3AV0B 1WSBA 1NMEA 1VLVA 1D2EA 2GM9A 3PUZA 4KE6A 1QLWA 2WABA 3TYXA 3KAKA 5FI3A 3W0LB 3ZY4A 4WNYA 4XUGB 5ENVA 5KYVA 2CL5A 1QZZA 1KZYC 2IY9A 3ZCTA 1KAHA 1U7TA 2IU6A 2XYVA 3OPYI 1CY6A 2AEJA 4OJQA 2PSDA 4OHMA 1GCOA 4BN4A 2CWDA 5M3BA 2CE2X 2PXCA 4AY6A 3HUDA 3FDFA 3V9PA 5DMHA 3JYOA 3EW9A 2DFTA 2Z2XA 5DGCA 2C31A 4RA9A 2ILTA 4XIIA 4UU0A 4P82A 4RFLA 1H66A 4FXOA 5ALZA 5ALLA 3WTBA 3ZGXA 3MCVA 3N0VA 3QVWA 3JALA 2SICE 3CZCA 4N7RA 4Q7JB 3V9AA 1IH8A 3I9OA 5IHXA 1CUWA 5CFOA 4F8JA 621PA 1NVMB 1PJSA 4PXAA 5HKAA 2M2IA 4RK0A 1FNMA 2JANA 2PKCA 2KMLA 5EE1A 3F0TA 1R8QA 3DBIA 3V1LA 1L1RA 1T4MA 2O8CA 4P4NA 5KJCA 2B69A 3BD6A 3S2IA 4GMHA 2BFBA 2JGKA 5BO5A 2N1BA 2WZQA 3R74A 3ZLUA 1UWLA 4X7PA 1OF1A 1TCBA 3LY5A 4HQNA 5FAKA 1A4RA 4QZVA 5IU6A 1NXQA 4GMKA 2JCVA 5AXDA 4BNVA 3GVPA 5AQEA 1T6BY 2PO5A 3C1TA 2XWPA 4JHXA 4YJKA 1B23P 3IO5A 5JAZA 4R1MA 4YRMA 2DPXA 3Q3VA 3A7DA 3DMFA 1SU7A 3TQRA 2JGAA 5KYWA 4LE2A 4EYKA 1F0NA 2BFDA 5EE9A 5F4ZA 1B0ZA 3ZW9A 1WBJB 1ZD2P 1VPWA 2YC4C 3GBPA 1RFLA 3IJ5A 3PXEA 5EWLA 1O4WA 5ERGB 2VHQA 4H3VA 2FFJA 5A71A 2DKNA 2VSQA 3LY9A 1R4MA 3Q7QA 3QWFA 1C0EA 4RPKA 3D3EA 1VQ1A 4NDNE 2D6FA 1WLSA 4YRLA 3F3MA 4JC5A 1DQYA 3RVDA 4F38A 2FUNB 1A1VA 4I2NA 2BEUB 1U8TA 4GWGA 1JWAB 4X84A 2X9GA 4CF6A 3AF2A 5A1JA 5K01A 2BTEA 4NFLA 4DF3A 1KEPA 3SKXA 4YYEA 1BJTA 1Q21A 1CNFA 1G20E 1T4BA 3KEGA 3EPPA 3JAMA 3VTKA 3IBSA 4MPPA 2OMKA 1GVNB 4R2IA 4AF6A 4TYYA 1QORA 4GLLA 2PSFA 2BSQA 1ML3A 2P8JA 2YIVX 2Q7DA 2UUBB 4CQJA 5DOVA 3RLFA 3ADOA 3BHJA 2VTKA 5EHZA 4U9UA 1S1CA 3ELDA 2RH8A 4FCCA 5FF9A 2WU8A 4K6OA 2PRJA 4KXUA 4URZR 3G79A 3S1AA 1ESZA 1H5UA 3M4XA 3OKFA 1A50B 4RORA 2DGDA 4IM7A 4IF6A 4J94A 1RRPA 4BO2A 2O2IA 5HEKA 1FLVA 1TTPB 2WG0A 2PCJA 2R0QC 4K0RA 3NC4A 1CWUA 3H5NA 3CZ4A 1N9ZA 1OBVA 3C3DA 5IJWA 4I6JA 2AMYA 3SOZA 5JO9A 4GR5A 1JWBB 3KPUA 1SQ0A 5DYNA 4CODB 2BCGY 4HMQA 1DAKA 4HHEA 4MRAA 1UWKA 3NIDB 4WVLA 2Y1LA 1TM1E 2FAXA 2GKGA 2CVFA 2B25A 4LHWA 4I4LA 3OPNA 3OZXA 1M8KA 1NJSA 3I28A 3KR0A 4PAOA 5JCJA 3QZUA 1ENZA 2V4ZA 1DEOA 4DEVA 3C3YA 3B6EA 3GN2A 3PQ4A 4MV7A 4LISA 3IIIA 1HYQA 2HCFA 5LZ5A 1MIOB 3ND7A 5KTSA 5EAIA 4MMYB 5ICSA 1THZA 1XP8A 1SMKA 4G5SA 4NZYA 4JP8A 3AU8A 4NNOA 3ZS9A 4EHAA 5HZMA 4GKBA 4K6GA 2QL9A 5F76A 4CDNA 4WZBA 2QBYA 2X5JO 3KEMA 4URVR 1EVYA 4MW2A 2C97A 3GRVA 1RKQA 1K8ZB 1T34A 1ZA2A 2PUJA 4JL6A 3VVCA 5FL3A 4Z4CA 4NCXA 5LPNA 2H4WA 2SHKA 1U2ZA 2E4VA 2Q7OE 1X70A 3T4EA 4ERNA 1W94A 5KOYA 2NAPA 1IHXA 1O95D 3KU1A 1G8AA 3QE3A 4ZGGA 2A9VA 3WB0A 2CVHA 7MHTA 4HWKA 4OMCA 4P6VF 3MGKA 3K70D 1YUMA 5AM4A 5CT5A 3DZDA 1C7EA 3PC6A 5LP6B 4XIFA 1QYCA 1UC4B 1H05A 1YASA 3EY9A 1R6VA 2HQ1A 2RAPA 3RFXA 4F6CA 2O19A 4P0QB 2FVYA 1KHTA 1QOZA 2FWIA 3JS5A 1BJKA 4PNHA 2DBZA 1RQ2A 3G5LA 1ZI9A 2OD7A 3QOFA 2WV7A 3R6DA 4G5FA 1JIIA 4IDAA 3QKRA 3KQKA 2FFBA 3GUHA 4OHKA 2LCQA 4EY8A 1EP9A 2NXCA 4B48A 5B4UA 4JLVA 1IMOA 3TNYA 1NAHA 2E5WA 4W6ZA 3BCSA 3BXGA 1SUEA 2VNAA 5GTDA 5C1BA 2XNKA 2FR8C 4RUKA 1KY2A 3FWKA 3PC4A 121PA 4C5CA 3WAGA 3KYJB 1ZGAA 2DPHA 4DILA 1Z6TA 1CF2O 1XEFA 5AK5A 1WXIA 3WYEA 3ZZTA 2HSEA 3GFTA 3SQWA 1J4AA 1M1ZA 3LLVA 4O0LA 4BB9A 2I91A 1R0BA 3I53A 2ZRMA 2QXTA 3LBAA 2OQVA 1RP1A 4G0YA 4KO4S 1TM4E 4B4VA 1X1RA 4JJ7A 2JHCA 4M9XA 4YRQA 5DKFA 3UF0A 3QBVA 1U7UA 2WHYA 1GAEO 3TB4A 4MYHA 1EAYA 4F3KA 2Z6QA 3JY6A 4A2QA 2AFIA 1J1IA 4N5LA 3WWEA 2IEZA 1U6IA 1RE1A 1F1JA 1ZD8A 1CUEA 3KLOA 2YJ5A 1V71A 3F78A 5AIAA 2E4YA 4KIUA 4EEZA 1KZ4A 1HNZB 3V4LA 4FEYA 1JEEA 4OXXA 1NAIA 4V0SA 4DY6A 3EDRA 5M29A 3IVRA 3PG5A 2HZ7A 3LMKA 4Q3KA 2IP2A 4UJ5A 8LDHA 1JLSA 5BYKA 4I46A 4HWGA 5DM70 1P1FA 1SM4A 5ARDA 4DA9A 5K4AA 1J6UA 2LCFA 5HS4A 1Y89A 3MVEA 2YXNA 3H87A 1UJBA 4D57A 4IHJB 4RKFA 5ADHA 1KMNA 1TADA 2X15A 3M1IA 1G8MA 1NU6A 4PHGA 1XO1A 3AMVA 3MBKA 3T1NA 3VZBA 1PQWA 5AHOA 4E46A 2O57A 2NTVA 1LW7A 2VPZA 5DM60 3HVUA 4W5NA 3N05A 1JGTA 2O52A 1S3IA 1QP7A 2V7GA 4D0NA 4Y9SA 5BOSA 4I55F 4JLKA 3PDIB 3V4OA 1G8JA 2EFYA 2VPWA 3V4FA 4B6FA 5EN4A 5K0EA 4N8DA 1ZJWA 3HHPA 1QIGA 3MLBA 3PLAE 4N3BA 4R84A 2ZT5A 2W90A 1I4WA 1KYVA 3VKFA 4BS9A 3ONVA 3JVUA 1F8UA 4AJ9A 3EG9B 3RWBA 1FUKA 1JPUA 2HIMA 3AR7A 1XJ0A 4G67A 1AM4D 2I80A 4RW0A 5AMXA 3AVUA 3JQBA 2C5GA 2D1TA 2QLMA 3MJRA 5E1BA 4ZT4A 2JJ2D 2ZSUA 4RH3A 3HBMA 4R69A 2ERXA 2PU7A 4GBMA 1RPNA 4NOKA 4KFRA 2JGMA 1UBLS 4U7TB 3GWZA 1BMFA 2MSWA 3IOMA 2QX4A 2HF8A 3D1VA 5FLKA 1Z5UA 4GP7A 1Y7LA 1ZOPA 1NHWA 2A0UA 2BN4A 2H4HA 1TPZA 3F9CA 1M1UA 3VHRA 1YSCA 4CIAA 2R1ZA 2C8LA 1EZZA 4IJMA 4XRGA 4QXQA 1UXGA 1DIOB 3QJYA 4YDHB 3AJRA 5FNVB 1CQIB 4UMVA 4F97A 1OH6A 4G5OA 4F4HA 2QDKA 1SOUA 3AF5A 3OWOA 4TV9F 2PR2A 3BD7A 1JDBC 1YOBA 2HRRA 3TD6A 3U31A 3X2EA 1E2EA 2GRAA 2G8LA 2CL6X 2V6JA 1M72A 3G49A 3KKNA 1VMKA 3KKQA 4JI2B 5FI1B 1KEKA 4QUGA 1G5RA 1WMBA 2XUZA 4J0FA 3WGKA 3OF2A 1BCRA 1U98A 2PUTA 2RKOA 2ZB8A 4KN9S 3UKOA 4BTEA 4EATA 2W6ID 4YAGA 1K97A 1Z4IA 3UJHA 1J97A 1Z0FA 3IBTA 2ZUDA 4KO3S 2PFGA 1SBNE 4RS3A 2IELA 1VJ5A 2LKDA 2CLKB 5BURA 4PBSA 1OASA 4YJGB 3TX6A 2F3RA 2EX0A 2XNHA 2IIBA 5EL0A 4XFJA 1NNEA 1JKMA 4RIEA 3D0QA 3QX3A 3TLKA 3WGUA 3QYFA 2QNIA 4NJMB 4I1UA 3R8CA 1UDXA 2G0TA 1V26A 2CDAA 4GSLA 2V6FA 1Q16A 3F6RA 3L4SO 4K2AA 4LXIA 1U4OA 3ZNOA 4DGSA 1JHAA 4D6PA 4CTNA 1SKMA 3HLKA 3AF6A 4FKMA 4R01A 4DMMA 3B1ZA 1DFIA 1U0GA 1MO3A 2ZLBA 1M2FA 2Y1WA 1DQNA 3NDIA 4J7CA 4E09A 4OB7A 2PFKA 3ESQA 3L4KA 4CV2A 4TTJA 2A9KA 3DO5A 2P0YA 4XGIA 4FINA 5F98A 1IB0A 2FOLA 2DPLA 1QIHA 2CXPA 4A1FA 1E3TA 1X1QA 4Z7NB 4F2PA 2YDXA 4WPGA 4EKGA 1EM6A 4FWIB 3DZHA 2AS0A 2ZR0A 2PXAA 4RZSA 3L6EA 4BZWA 4U39A 3N2KA 1WPGA 1JQJC 3BRQA 2AL7A 4U7FA 1VB5A 2ID9A 3B1XA 3UB2A 4O5AA 2WJPA 1G291 4UUOA 2OUIA 5CCXA 4KXWA 1BW9B 2PDAA 2W83A 4YONB 5B12A 4XM1A 5ETJA 3F97A 5GJVC 4ZXFA 3W2IA 4OK3A 3PFCA 1UWVA 4YAFA 4PQFA 3T1OA 3NBYC 1L7EA 2QAIA 1UMDB 3PCXA 4II3A 2HSGA 1CBUA 2WV9A 2WQ7A 1LUAA 3A1CA 3NASA 3OJLA 5KU7A 2FPPA 4BZQA 5J4VA 2R5NA 2X2PA 4IIGA 2F3UA 1Y5NA 3LPNA 4L6CA 2FI1A 2VFAA 1SXPA 4JUIA 1NW8A 1U80A 1ZL2A 2PD6A 3LC1O 3WIEA 1JYSA 2P4HX 3EEBA 1PHPA 4CQMD 2DFLA 4FGUA 5IFLA 4V39A 4RABA 2ZBEA 3HACA 4XAQA 1S7GA 1T0IA 5F5XA 1YFKA 1Q7EA 1U0BB 4ND1A 1U99A 4EYEA 1H0SA 2C7VA 3S2EA 4C2BA 5C51B 1HXHA 2VHWA 2O2SA 3WRVA 1IM8A 1MO6A 1RLIA 4Q4HB 5H7XA 2PS0A 3AH8A 3CNBA 3EC2A 3M70A 3WQSB 5G41A 3SIWA 3IESA 3O47A 5F78A 1ILEA 4D6YA 4GWKA 3OWHA 4Q9LA 4P81A 2SNIE 4IG9A 5IDYA 1VTKA 1P9OA 3DFFA 3W6NA 5HZHA 4IMRA 2QYHA 1RQPA 2AJBA 1FNCA 5TS3A 2W98A 1GQRA 2F3SA 3I8SA 5IF9A 1EIWA 4BVAA 2EJTA 3F7NA 5T8KA 1KF0A 3DV9A 3VO1A 2O8BB 1YD7A 2WSBA 2BRUC 2DQ4A 1P73A 4UD2A 5I9SA 1U3FA 4BFCA 2LIPA 1L3BA 3IP6A 3EWAA 5DEOA 1A8UA 3A58B 4J91A 3U80A 3UJ7A 4ECEA 2YMLA 2UZ0A 3E9YA 3UICA 3QIAA 5HMMA 3V8QA 3U3OA 4AJHA 3VVLA 3FZNA 4WCVA 4RX1A 2PKWA 2ZRFA 2FZGA 2VF7A 4BZXA 1C9EA 4WI1A 5CEEA 3QPWA 3M5CA 2YMPA 5LP6C 3OU7A 3WK6A 1AQIA 1W4CA 2SCUA 2D4AA 2WWHA 4NJOA 4H1WA 1FZTA 1C3JA 2SBTA 3BMCA 5JSZB 2J5RA 3TRDA 3IV7A 5LA6A 5TMEA 3B6ZA 1E2BA 1QFJA 3D3JA 4QDXA 2WG2A 2C83A 3NVMB 4YA6A 1LKZA 2Q6IA 4Y2TA 1XMJA 3LY7A 1DJNA 3ZDXB 4ZGBA 7YASA 5E6UB 1QH9A 1IJKA 1OI7A 4BYMA 1RM5A 2X1MA 4EUNA 5CFQA 3QPCA 3RRZA 5CYFA 3RF7A 4J3JA 1DX9A 3TLAA 1AKNA 4ND8B 4X8HA 4HNAA 3BWMA 2B78A 3LLCA 1CZOA 2FMFA 3MMXA 5B7NA 4I50B 4UDXX 2IPXA 3WB2A 3K1JA 1L1FA 2QNRA 2NLOA 1TJ4A 2Z2ZA 4D96A 3IB3A 3RUEA 2QPOA 5CXQA 2ZVJA 3ONWA 1O5OA 3DL4A 4KX3A 4TL6A 4ZAYA 4G8DA 4IWNA 5GZ6A 1QZTA 5HHTA 1SCQA 2QG6A 3O7WA 3PX3A 4Y2XA 3CT6A 4KH1A 4MGEA 1U3TA 3JQCA 3H5WA 3VYSB 4HGOA 1P6QA 1SU6A 1S3GA 2BONA 5JCPA 2J3MA 2P2NA 3LXMA 1G41A 3VSBA 1GTVA 3DTVB 3T8YA 1Z4MA 2QORA 1HX7A 4WLNA 1KSJA 2OCLA 1MQAA 3VH2A 3UYLA 1TYEB 4P22A 3WAJA 4ACBA 4CG2A 1ACMA 4HNTA 1EI9A 3ZVNA 4M4SA 3JYNA 1HDIA 2ASVA 4JOQA 2ZWVA 2R9VA 4ZGWA 1L6RA 1NL3A 4DXDA 1Q0TA 4C7MA 2IOFA 4D4MA 4NVRA 4IX9A 5KNDD 4MIKA 3D3WB 5DNYB 4GPZA 4H7PA 4P7GA 1D9ZA 2YYAA 2ODPA 3OETA 2IF2A 1VMAA 5AXAA 4GQAA 3RYFB 3NIGB 5IANA 1ZD9A 3TTSA 3THSA 4D5GA 1XTRA 4PX5A 1NLZA 2W6JD 3DWIA 3CEPB 1IPEA 2C2BA 4BP9A 4Y1RA 2QTVA 1EPUA 1JEJA 1C14A 2EKPA 1JDTA 2QK4A 2X14A 4OU5A 2BTQB 4GU5A 4PC3A 4PGFA 4UUNA 1G0OA 5FR2A 3ZEAA 4KPYA 1RWBA 2C2WA 2CNBA 5LQMA 4KODA 3B5JA 2C03A 4ISBA 3PUWA 1V7CA 2VJNA 1W29A 3GO4A 4GOJA 4C6TB 3RTGA 4CKCB 5HQTA 3AJ9A 5D7BA 5BT8A 2XXAA 4LSMA 1OH7A 1V25A 3NBXX 4WCFC 4HPWA 3M4ZA 1R16A 1C1HA 3EEQA 2OFXA 4ZT6A 1R6TA 1V8DA 1M1YB 4L4ZA 3SQLA 1H1DA 2WB4A 1PFYA 2VKQA 1IK6A 2OFPA 3TQQA 3KQUA 1W1IA 3FYSA 4KTTE 2B4TO 2OXCA 3D3WA 2O2DA 3FDIA 4NHOA 1EVIA 1KNQA 5TXGA 1JAIA 5CHYA 3RW9A 4D99A 1IEXA 4R6WA 3JYHA 5DI3B 1D4FA 1DBQA 5K6AC 2C92A 4GZ6A 4C4TA 2VUIB 1H65A 2D0PB 2GLXA 3F4LA 4CCWA 3LPMA 3FZGA 4EO9A 5CTAA 4UTVA 4BJ6A 1U9IA 1JAHA 4BQNA 4BWGA 5JSFA 3MXTA 3HU1A 4RZIA 1XTKA 4G9EA 4DT1B 3CEAA 4MO9A 5IUJC 1IN8A 4CLRB 5EEHA 1KK2A 4CTMA 5M34A 1CP2A 3HKEB 3M5PA 4IZOA 4CMEC 4YXFA 5EIWA 2Q21A 2Q5FA 4TTAA 1RAIA 2EJVA 4I5IA 4BE9A 4XB1A 4OATA 3G2QA 2OM6A 3IVGA 3NM4A 1PR0A 3OEHD 3OTQA 4Y9UA 1NQ5A 3PNLA 1A8PA 3WGOA 1N0WA 3IGFA 3UZUA 4IYJA 2G83A 4EPYA 1XTVA 3O83A 5REQB 5KVQA 1Z38A 2FSUA 2Q4OA 1MXHA 4R0MA 4PCAA 1T9GS 2FPIB 1QTIA 4E1BA 8GPBA 2DU8A 1RC8A 3DNMA 3QVGA 4CTJA 2XBLA 4L8WB 5DIZA 4HVLA 1TYBE 1JEDA 1L8XA 1U63A 4JP2A 3BJEA 4X95A 1VM6A 2HKIA 3A6HA 2AJDA 4H15A 4NU6A 2Q5JA 4UM9B 3HLYA 2ZRBA 3J7AC 2IGBA 1NDQA 4EJSA 1UZAA 1XZBA 2RHGB 4GXNA 1FIUA 1EQAA 3S8EA 4LXYA 1MRSA 3BBPA 2OYCA 3KU4A 1RWKA 4BY9E 4TLMB 4Q1DA 4BBZA 2D3WA 3R3HA 1GNTA 4HQFA 4RTOA 2PVCA 3CNQS 3KOWA 3F5QA 4LI3X 4B6EA 3WBBA 2ZUUA 1QB8A 2B98A 2RCYA 3D5QA 2GBCA 3F9RA 3NHLA 3ZWKA 4EBBA 5KOJB 1TIBA 3AHJA 3AFGA 4NOMA 4QEDA 4WN9A 4XM0A 4KK4A 3PGKA 4BKPA 5M2QA 4YRJA 4U8HA 3P5BA 4WXRA 4G0XA 5ISMA 1M9NA 1DRKA 2YOFA 3AHEA 1ADGA 1F8XA 2E49A 1PRYA 5CB8A 5HNKA 1ULZA 5AW5A 4PQEA 4CV3A 3B70A 4BVKA 3RBZA 4ZZIA 4KI7A 2C9DA 2V98A 2V54A 2Q3LA 1NP6A 3QU9A 4U2KA 4HZGA 3LNTA 4DUPA 1MDFA 3IP8A 4YJDA 4HPXB 3MC1A 1EVJA 3PHCA 3P9SA 3TXAA 4AJOA 4D74A 2IBSA 4BVEA 2ADMA 3ZCUA 1AKWA 2OHXA 1TCUA 4H7HA 2OLJA 4MRPA 1N78A 3CVYA 1SU8A 2DECA 3PQEA 1RLOA 4C0JA 2GHRA 2HK9A 3DFIA 4JKYA 4RMNA 3N7UA 1XP5A 3N5KA 3QMWA 1KQGA 1W59A 1YULA 4OUDA 1JSZA 1F9AA 4DT1A 3AONB 2J3DA 3MLEA 1ISJA 1YUBA 4FQ5A 1BDJA 1WDLA 4Z9FA 4X6YA 4GOKA 4D8YA 5FUBA 4M8LA 1N1GA 5CPBA 4G26A 2RHLA 1SXJD 3PBKA 4P5DA 3GRFA 4RH0A 5AVXA 3MHTA 5DBGA 1G6Q1 4ND3A 4ZDKA 4N39A 3CJRA 5FKJA 2C98A 4GS5A 1H85A 1VLLA 1HG1A 1NPYA 2R6DA 2BEJA 4O2RA 3HBAA 3C6MA 5CH3A 4I08A 4BGDA 1FSZA 4HD8A 1KYQA 3H5VA 1RIFA 3RNLA 4Q16A 4B87A 4D9FA 5A3QA 4C30A 2H1IA 2V8BA 1W0JD 2QLTA 1EEXB 2WMYA 4DLTA 1UH5A 2XUGA 3D7NA 4KOEC 3HDQA 1L0BA 1C81A 2WAOA 3EVFA 2RE8A 4XYMA 3GP8A 3LF1A 4FGKA 1YE3A 1PQUA 3K6RA 1Y0BA 1KMIY 2G40A 2WM8A 2JI6A 4ARBA 1QVAA 2Y68A 1T9GR 1B76A 5TGTA 1LDYA 3TEFA 3NC1C 1K6EA 1XCGB 2ATIA 2LVBA 3O9MA 1U9CA 3F47A 4NY1A 4X8LA 5CLHA 1ILWA 4OHFA 3UJPA 4EX7A 4ARZB 1QYWA 3L0SA 4DCJA 2XE6A 3ETNA 4F5ZA 2O2ZA 2OLEA 4I5DA 3MMZA 4B79A 4DIEA 4JEIA 4AQDA 3B53X 3CZQA 2OZLB 2K87A 2IYZA 2NO7A 3A6DA 4LAFA 5HWSA 3M4NA 3K96A 1PVOA 1DJOA 2VYCA 4OP1A 4RENA 4X3CA 4KFSA 1GRCA 5CNIA 1DCTA 5REQA 3N59A 1JU4A 1E3QA 2JIRA 4HOYA 3CN9A 3R5JA 4OK6A 1XCBA 2P9QA 4HDNA 4Y98A 5L95A 3KHTA 5FTJA 2GYUA 4KYVA 3TQIA 2W71A 3LXXA 3D7LA 3D8UA 1JECA 1QO0A 2PA0A 1WLYA 5JJBA 2CJFA 3OICA 3ST7A 4GXTA 4UPEA 1AV6A 3CTMA 3L0YA 4AROA 2OUKA 5B7QA 1ZOSA 2NYVA 3UCEA 4JN6B 3ZJ5A 7REQB 1GQYA 3EQ6A 3TMKA 2IC5A 2AG0A 1CHNA 2ANBA 2Y6UA 4ZP1A 3HBNA 4L74A 1E9SA 2FFQA 2Z98A 4JODA 3M6IA 1WDMA 4MWTA 1G1MA 3PA8A 3H2SA 1Q1GA 3JSXA 4NNPA 1IUKA 2Y2VA 1SUBA 3WL5A 2C0CA 4DYVA 1K27A 4WE3A 4MV8A 1U2TA 2WFZA 3TINA 1KFCB 4LX0A 3R5XA 4A9AA 4FXPA 2Q1TA 2ZZNA 2C3MA 3NWJA 1I33A 1KIAA 2XSZA 3Q3HA 5E6UA 4M0KA 4B3XA 4DJFC 4C03A 3BK2A 4DR6B 4CL8A 5JXIA 2OGZA 2X40A 1W2HA 4A3SA 2HNAA 3E0QA 3F1KA 2I7VA 3RAEC 1TJYA 4Z9BA 2GFQA 1L5GB 4RF2A 2IEYA 2J9YB 1EUYA 4UZEA 4DTCA 2PVPA 4RK5A 3NHJA 1W88B 1XNHA 4W7HA 1JZQA 2YWXA 4M0EA 4U6NA 3A6KA 3TBFA 4D41A 4DPMA 1WX1A 4RMHA 4D8UA 2C9YA 1REQA 4S2EA 4DLLA 4EECA 1JQBA 3UAYA 1AG9A 1PL7A 3ILSA 1CR0A 3F9IA 1H8EA 2ZYHA 4H6PA 1EK1A 3QA9A 5ITZA 5D2CA 1FFCA 2AC7A 2YHUA 4ZPJA 4NEQA 4RTJA 4ZYWA 4UMEA 1HC7A 4LJ5A 3Q9LA 4O4LF 4W4TA 4TWZA 3HA7A 4M0CA 4NFSA 1SG0A 1DZ3A 1NVWQ 3KFXA 4MHOA 2ZBVA 4TLEA 3VVMA 3PB3A 4ETMA 4CIWA 2OXEA 1Y3BE 3TUIC 4DLPA 5IYZA 5LWQA 2IUTA 3NU1A 1I3OA 2Q45A 1ADBA 5GOTA 2CYAA 3VH1A 1A2KC 4LRQA 4YMUA 1P2GA 1RPAA 4MUFA 2GEFA 1UJ4A 2JAWA 4MW1A 5ALSA 2ZRKA 3EZ9A 4RS4A 1A7KA 3TTYA 3UT6A 4NJEA 1N2CA 1X2EA 1LTHR 1X7HA 2KQUA 4YT4A 3QVJA 1IN5A 4HRXA 4MS1B 1H9CA 1DAIA 4OA8A 4RGVA 1MABB 4QWMA 4CEHA 4JXJA 4I9NA 1YZUA 4C4XA 4WY5A 6ADHA 2D5IA 1SELA 1YRAA 3VC2A 3H2IA 3BILA 3K09A 1PK9A 4QO7A 3I01M 1F60A 4DCNA 1EFTA 1Q77A 1KRHA 3SFTA 2XJ4A 2GK3A 3IQWA 3F8WA 5A3VA 3WI7A 1ESEA 4DDMA 5B2EA 2VBFA 3OE5A 4IWYA 2P8SA 1IQPA 2DUJA 4XQEA 3T7SA 4C05A 2AR9A 5EHXA 5IT0A 3ZWMA 3CC8A 2VPQA 4CMIB 3BH7A 1W73A 4P32A 4US2R 5I8PA 4C6HA 1C3OB 4KQFA 2VR1A 1B6GA 4QHSA 2HBYA 3OZDA 4KQXA 4P08A 5D84A 5F1OA 4HQ6A 5J59A 2BDTA 3TDKA 2VPPA 2I03A 2CBXA 4TWRA 1Z4OA 2VRNA 1UZNA 3B6IA 5AJUA 5A4FS 4QYMA 4BB6A 3H83A 4HNHA 4Y6GB 3Q8KA 4B3TB 1VMDA 2OKCA 1DFHA 3ZDDA 1E9DA 1CZUA 2IHNA 2CNLA 2WUGA 2WMDA 3DKPA 3FBGA 2OQRA 2POQX 3ZXYA 2O2HA 5LYJF 5EMNA 2UVPA 1Q57A 3GU3A 1AA6A 4H1HA 5L3QA 3ETEA 3B89A 3QNUA 1ZHOA 1PV2A 2R7MA 3Q3GE 2CLEB 1G4UR 2W0SA 4FK8A 4KR0A 4PLHA 4Q1AA 1KMHA 5LNK6 2BBSA 1T1SA 1MXFA 2EKDA 2UUPA 1W49A 4XYBA 1FQOA 4J16C 4AO8A 1ID1A 3TZBA 5I9BA 3AKYA 3QLEA 1SJ9A 4L9RA 1ETHA 4UHBA 5BRJA 4FPXA 3HI6A 1R3UA 1ZFNA 2XUJA 1ONOA 2GARA 3MWLA 3FCOA 3V6MA 5AVSA 1CKEA 1WHTB 3S7TA 4R2KA 5AKLA 3VFDA 4OH1A 3N87A 1SCBA 1XI2A 2ZB2A 3WWYA 5IYZB 1QDEA 1QRDA 2R8XA 5BWNA 1QUFA 4DWOA 4OTZA 2TMYA 4R4JA 4LPKA 5F9FA 3GLFB 3DBLB 2FG5A 2EJUA 3I32A 3WGJA 1QVZA 3GMSA 1ZIDA 3EASA 1YJAA 3GGPA 1EM8A 1I0IA 5L3QB 5LLDA 2CLDX 1F6BA 4KWHA 4Q39A 4I55A 5GV7A 2WYIA 1UAGA 1TYDE 5AK4A 1I94B 4W9NC 2BIFA 5BUQA 1YR6A 2ETVA 2VRBA 2PTHA 1ZM4A 4HB2A 4MGYR 3PHBE 2C95A 4X61A 2BY4A 4PU0A 2WJJA 4ND6A 1QQBA 3D8BA 1DXQA 4RPLA 5JVDB 5BVGA 2H1LA 1TUGA 4M6WB 5J40A 1A9PA 2VUHB 3CF4G 2V1XA 4GL2A 3O8BA 5ABPA 4HRAA 4WCDA 2PANA 1CVIA 2G71A 2QW1A 1C3OA 2MHCA 2IH2A 3LTEA 3IP5A 3K4PA 3WLIA 4CM5A 3CH4B 4EMUA 3EZYA 3SZOA 1QRUA 4TKLA 5LZ2A 1CQZA 2RAUA 4DV5B 5K03A 2EFHB 1R4ZA 1JALA 1MX3A 1NUHA 2C3OA 1FTNA 3QEJA 4Z51A 1PS8A 1ZBDA 3OOWA 1E1QA 3OOEA 1BS9A 5AUPB 1LK5A 5EHIA 5BN4A 3CWZA 2BH2A 4G1BA 4MYCA 5K20A 1EM8B 3W9BA 5TQ0A 4G8JA 4W1RA 3ZZMA 1ATZA 3KHSA 3QSYA 4XARA 4C7OA 3PYMA 3DZGA 4P4GA 3ZWQA 1KC1A 3LDFA 1XTSA 1YKGA 4MICA 1PUJA 5FOTA 4BWFB 4B7AA 4CEHB 1W19A 1GNSA 1EFLA 3EJWA 3JQ7B 5E9WA 2OBYA 3WRXC 3ZIAA 2YWBA 3I6MA 4JD5A 5I8ZA 2ZETA 3ZDCA 3GDFA 4GKVA 3KB8A 4JQOA 5JYBA 3TGPA 5ULLA 2K7FA 1B8OA 2BZSA 2I1LA 3T9FA 4ANFA 4S05A 4Q3LA 1TECE 3UPDA 2B8JA 1KOJA 1O94C 3M81A 4C7VA 3D4OA 3H04A 3K8YA 5HFJA 5K8CA 2IH4A 1EQ2A 3L6UA 5TX7A 3ESAA 5E2AA 3T7AA 2ZIWB 3W3AH 1UBNA 2QG4A 5T64A 4OX9Y 1SZCA 1GADO 1SCUA 2PGAA 3AP3A 1KK0A 4ZQEA 4PYOA 4RJ2A 2E18A 1IY9A 2VJDA 4R0NA 2P9EA 4FT4A 1FDUA 2FPMA 3B7PA 4FX5A 5LU8A 4KQ1A 1IXKA 1PJLA 4GSYA 4GF5A 2JFZA 3ITKA 3OAAD 4XDHA 2E5LB 1CFZA 3I9NA 1JH8A 2CJPA 1GHTA 4JBYA 2VNHA 3L5KA 2AOUA 4HLDA 4INJA 1M33A 4FCVA 3TE7A 2F9LA 3KKPA 3L4BC 4FZRA 3OUUA 4C7OB 4C4PA 1RRKA 2B1RA 5JY6A 3KT0A 1QCZA 2UVPB 2ORYA 3LYUA 4NKRA 5IH3A 1Z25A 2PTGA 3FHCB 1YB7A 4LJ7A 3KD3A 4KPFC 1JVBA 3IKMB 4B9AA 4OL9A 1Z28A 1WSWA 2Y2UA 4MX8A 4QHTA 3RVSA 3VX3A 1JP7A 5IBQA 2E87A 1I6LA 5C3MA 5CFMA 4OXQA 2GN6A 2SCUB 5CD9A 3QEMB 6REQB 4K03A 3Q0TA 4U00A 3VMFA 4HFMA 3T94A 2YHSA 1A4IA 2Q8QA 4HB0A 4ERXA 3N2KB 4H59A 3KD2A 4MTCA 4IRMA 1N6NA 3TPZA 4P33A 2XYHA 1EX9A 3GAMA 1YI0A 1WVMA 5LQKA 1TMKA 3A3NA 1ZH0A 1TKBA 4QL3A 3N2LA 3FJOA 2AT1A 1C41A 3ACCA 3IE0A 3FRHA 1MC5A 1ZINA 4QTUB 2DBRA 3O3OB 5TARA 3TW8B 4LJLA 4K9KA 3GLQA 1DAMA 1P44A 3W5VA 2FW7A 1MTZA 4AAYA 3G0OA 3NTOA 4PHFA 1DX4A 2X0KA 3KZXA 2DBYA 3DMHA 5CDFE 1U8ZA 2VOEA 3EVBA 4F9GA 3EAGA 4C4ZA 3NP7A 2WSSA 4LXQA 1PJQA 3BVPA 1ANKA 3QYAA 2FN9A 1V16B 1CDEA 1XVUA 2YFKA 3BXZA 4A16A 5CA0B 5CDHA 2J3JA 3FYCA 2NU7A 1HBJA 821PA 4B33A 1N8SA 4KQGA 2Y0DA 5IJAA 4NSNA 4R8MA 5I5EA 1A97A 2R96A 4QSHA 1XQYA 3NRCA 4KU4A 3LQRA 3MILA 3RC3A 1YTLA 5CXUA 1E5QA 3ITNA 1OFIA 3A4IA 2PX8A 3MMPA 3S81A 3KJEA 4Z4IA 2ZIEA 1DHRA 1JVSA 3U39A 1S0UA 5LIPA 2IPOA 5I48A 2QW0X 3A6EA 3RF6A 1ADCA 3KWJA 3RREA 1EMDA 1B42A 5DTMA 2VXYA 1FP4A 1MG0A 4B6OA 5F23A 1KO5A 2P7IA 1TM5E 1QVRA 1APBA 5KAMA 3WV5A 1F2UA 2WNIA 2QX8A 1WNTA 3VZRA 3S2YA 2R00C 5LQSA 3QI7A 2ZE8A 3CUVA 1QFZA 1E89A 1XZGA 2XLBA 3PVZA 5B6PA 2Q5IA 4OI2A 2GBIA 2JFNA 4HNAB 3CUTA 1UJMA 2ZYDA 4GOND 5JFOA 1P9NA 2VDPB 4L8VA 2XYGA 4L0CA 2ON6A 1V11B 3UGTA 2IT1A 1X77A 3FOFC 1V1RB 2ZJ7A 4FJ0A 1QO0D 1TU3A 3GAAA 4HP8A 1FFBA 4FYHA 1QG4A 1UXHA 1P7YA 3JQAB 2ASEA 3UB4A 7AT1A 1U0SY 3S28A 3WL8A 1MJNA 2D2VA 2HMYB 4R8KA 1VDZA 1NPDA 4FP9A 3ME5A 3WC4A 2V7VA 2XYPA 1YHNA 4GRAA 4BLSA 5A9TA 2DXIA 3LT0A 4GGPA 3ZIDA 2VATA 4QO8A 3C98A 4F8EA 5BW4A 4UEJA 5HQJA 3RC7A 4TOIA 3OPVA 4TMZA 1Y37A 2J87A 4JC8A 2WE8A 5FULA 3TZHA 3SN6A 3BXXA 1J8QA 2X9LA 3LOQA 3MT9A 4YJ2B 1RYMA 3PRHA 5IJZA 1K8QA 3HLTA 3C15C 3H1AA 1SXJE 2ZM5A 1WP9A 1KAQA 1H4VB 1DMRA 2DYKA 3TLGB 3OP1A 4ZI7A 5IMSA 2WWYA 3CKYA 3R77A 1YMUA 5FIUA 1FDVA 1M1XB 2EDCA 1HQKA 1VCHA 1W1UA 2QE7D 4GYKA 4PRZA 5FNZA 4YRKA 3HY4A 1L4KA 1BXGB 3EC7A 5B7GA 4AG6A 4HXYA 1HDRA 4CFYA 2WUFA 1II9A 3AILA 2XVAA 3EFOB 1SHTX 3ROQA 5EVJA 1YJ8A 4O2BF 1DFGA 1V6CA 2VF2A 3B6MA 1YZKA 3M2PA 1Q15A 2JLVA 3U4HA 1DRVA 3G02A 2W6MA 3BA1A 1E3SA 1I1HA 1OA1A 1YCFA 2OOSA 3DT6A 2QL5A 3R3VA 1WAMA 4S12A 3ZCSA 4G6ZA 2QS9A 1PNVA 1X7DA 1CIPA 3EMBA 3RVBA 4JXZA 4N49A 4C1NA 3DQPA 3IH5A 5TJHA 1NI5A 1RRMA 1ZSYA 3AY3A 5NULA 3I61A 2JEOA 2B9EA 3F49S 1I3MA 5CU7A 1ZMBA 3PXUA 3GLGB 2NX2A 1G8FA 2C9ZA 4I9GA 3UFXB 3USZA 4LBZA 2GZ1A 2BGKA 3G2LA 4U7GA 5KYKA 2RGXA 3GXOA 3VGJA 1VGQA 2PS1A 1YBAA 3BBLA 4HNRA 3WWCA 5JHHB 3NKLA 1PG5A 2CNWA 4C0HA 2W42A 2YN0A 4ILKA 2VF4X 1I3CA 3ID6C 3MGGA 1YIAA 2UVQA 1VLZA 3INNA 4ZOCA 1SKUA 3HDYA 1A8SA 1UBMS 3VV2A 5KQRA 2DPMA 2Q0QA 2YXPX 3QTTA 4UOQA 4ADSG 4GM1A 2I22A 4HDMA 3VR4D 1FP6A 3KQLA 3R2JA 2I34A 2FQXA 3TB6A 1UBRS 5JNTA 3HY6A 4FLFA 2FZ4A 4DADA 3ZI0A 5HCNA 3MFQA 2I6GA 3AY0A 4LDJA 5TQ2A 2CVOA 1HT1E 1FNBA 3KCNA 5SICE 4BATA 4BV3A 5M7EA 3AERA 3O95A 3U2QA 2FN3A 4I14A 1QG2A 5BQPA 5HS6A 5IC6A 1DQZA 1E5TA 2VNJA 3B5IA 4JSRA 1MX9A 5F12A 4G9GA 3T0FA 1AKYA 2C5HA 4WKNA 1RADA 3CUWA 1IBMB 2ZJAA 2GXUA 3PJRA 4HZIA 1LF0A 1T9ZA 2X76A 2XNDA 1JTEA 2ZKIA 4XVCA 1TW3A 1TTTA 4OQEA 1VI5A 2ZVDA 4P92A 1NBAA 1G2IA 3R5TA 1PTJC 3CNEA 3MJFA 1XQ9A 4XX0A 1HWYA 5AOAA 1Z7GA 4QPCA 3TI7A 1Q1EA 3MTBA 2RGRA 3U4QA 5T4FA 3B9RA 1OYVA 3HDGA 3KJXA 3QK7A 5ARCA 2HYIC 1HETA 1F8FA 5B4VA 3C3BA 2HPVA 2VP4A 5MFPA 2AD5A 3V34A 3OPYB 4ZCMA 2Q41A 4BMCA 3RRMA 3NKFA 2BZGA 2NUBA 1Q7BA 3RRJA 5HP4A 2GF2A 2PL1A 3C7CB 3I9MA 5JJIA 2R8RA 4C0WA 1T4DA 1JZTA 3L7KA 1U6JA 2LGJA 3UJBA 7MDHA 3ZE6A 5HIAA 3KOUA 4EFLA 3AUYA 3Q9SA 1G8HA 1JHYA 3EZLA 1N4DA 1YO6A 2FMUA 3G68A 5E4YA 5HJ5A 3UC9A 3A70A 1GZ7A 4X20A 1H2YA 1JT2A 2ZJ1A 2I66A 4OXIA 1BRTA 1FU8A 4MVWA 4NFYA 5DTQA 5FB3A 3VPFA 3W4KA 5I51A 1TW2A 3DAYA 1I4DD 2COUA 2Y0CA 2DQSA 2YW9A 2PR7A 4PX3A 2QTWB 4BLTA 2H18A 1NP7A 3K5IA 4F2GA 1D7AA 2CCKA 2RAFA 4KQIA 3ETDA 2XOKD 1TKRA 4L4UA 4KX5A 1VKZA 2QLBA 3L79A 2NQTA 5AKYA 3STTA 3ZY3A 2BM8A 3PNYA 3T9BA 1X87A 4TUYF 1HDGO 2XTNA 1AA9A 5FL7A 1MQ8B 1V47A 5E7JA 4ND2A 1QQ6A 2ZE7A 2B5VA 1SHJA 2OMEA 1Q20A 2F43A 3DUWA 3E15A 3P4UA 1CRPA 4AL4A 3MS2A 1KH2A 4RJIA 4IDQA 4LECA 4XEHA 1JXOA 2IYPA 4PZZA 2BOVA 5B64A 2KJQA 1OAKA 3N86A 2X3YA 4OL0A 1BO6A 1DIAA 4RSGA 3MWJA 4ED9A 4CM9A 2GA8A 3Q6NA 4ZJUA 3U6KA 2CHGA 2J30A 1LQUA 3ZU2A 5BNTA 4KNYA 1YMQA 3BSYA 2OO5C 3BH6A 3DFZA 2OXRA 4MKFA 3PQCA 2HJ9A 4LTNA 1ZM3A 3NHBA 4X1IB 1Q6ZA 2V7QA 1C8LA 5A0TA 2CD9A 3HBJA 2EZUA 2Z8YA 2XW6A 2W11A 4D0GA 4D8TA 4EP1A 1JFRA 3FTPA 3IOBA 3EDYA 4B7ZA 3WIVA 4HADA 2H0AA 4Q1CA 3R3WA 4CMEA 1QG6A 2WC1A 3GRZA 1Y1KE 3FPSA 3WZ2A 4AD8A 2HA0A 1Z6AA 3K5HA 5U1PA 1DS6A 3CR3C 3CYFA 2XX3A 3GG2A 1U02A 2QSZA 421PA 4TMWA 1C1XB 4I1YA 4NONA 3NI2A 1G5TA 5HFAA 3ZZUA 4ABYA 3L7NA 2Q3FA 1XTJA 2V4UA 3HK2A 3AVWA 2LV8A 4J9UE 4ZEXA 2DQKA 3ZGOA 4M2LA 5KNCD 3BSFA 1W52X 4B3FX 4DLAA 1MKYA 5AFSA 4MW6A 5CA0F 3PNSA 2HHHB 4XJVA 2V03A 4E2WA 3DVSX 3KNZA 3KQMA 3AEKA 4QJIA 1RJDA 1XD2B 3VUEA 1NJGA 2GZAA 3LVQE 3LFTA 2BGGA 3NUZA 1ULSA 4PR0A 3TVTA 4HDRA 3UMYA 1YS4A 4WT7A 3GI1A 4P36A 5DT2A 4X90A 4LHZA 5CXXA 1A95A 2NWQA 3LUBA 3Q0IA 4D0RA 5GINE 1RHQA 2BUAA 1UK8A 3UYKA 5LA6B 5AXCA 4UNSA 5MGNA 5LZ9A 3V1YA 1HO3A 1BXKA 3KT8A 3ZI4A 2LD4A 4ZO7A 3C0KA 3G7NA 2B4YA 4TV8A 1KZHA 3UJ3X 3WFIA 5LQRA 1LPMA 4DVJA 3BMOB 3RWOA 4ENPA 3RVPA 2AC2A 4B7UA 4LK3A 3BWBA 1PGOA 1TUBB 1B26A 3KYDB 4CUJA 4ASUA 5E2BA 2FWBA 1THTA 4YJ3F 1NQAO 2A14A 4RF5A 1U4NA 1BKSB 2IE0A 2Q5HA 3SOPA 3IQZA 3DMRA 2IUYA 4IIJB 1DRJA 2ZJOA 3E18A 4LOHA 4MRMA 3O2QB 4RTMA 2EOAA 1EVZA 1KI1A 1A76A 1TA0A 3IT2A 4YAWA 5GVRA 5C5EA 1VBFA 1AGNA 3UG7A 2XSZD 1C7JA 4UM9D 1A9ZA 1S6YA 1TKAA 4FDLA 1YK0A 1VCOA 2BMAA 5BR4A 5EJ7A 1GL3A 5AW0A 1ESCA 1VJGA 1RHMA 1E1QD 2V59A 4RK7A 3UPUA 3NT2A 1VI6A 4KFCA 3LBFA 3G1WA 4QUAA 3I92A 3PXDA 3JSAA 4IHAA 5LU9A 3EDOA 4K7JA 2W2PA 2Z56A 3H6KA 5GGXA 2YXBA 1OIWA 2DUNA 3RFFA 1RABA 5FI0B 3OI7A 4BEJA 5E7IA 5IVIA 3KUDA 1A88A 1GAJA 1R37A 2GHQA 2M98A 2QHXA 2WWTA 4G0MA 3TAXA 4F0JA 3BERA 3NUQA 3RS8A 3LUAA 2FWRA 3L7AA 3URMA 3W5SA 4ZD6A 2G67A 2R44A 3Q85A 4QPPA 5ESWA 3OLQA 2FUCA 2MT9A 4UW9A 1Y8CA 2OBXA 3AF3A 4R68A 3SR3A 4O2BB 3FDXA 4E1AA 4RM3A 4MKHA 1ZUWA 2DPGA 1CUJA 2N1MA 3V6LA 4WXMA 3HB5X 4OHBA 1HE3A 2M6RA 1MJHA 4RD1A 5DT9A 1XRQA 3HU2A 5IN4A 1IB6A 2QENA 5JS6A 1MHTA 5AHXA 3SZUA 2C20A 3WJ7A 1YQ9A 2J8ZA 3OZSA 4KPUB 3ZTWA 1KBQA 2V97A 2JAHA 1I4OA 1TAQA 1XZDA 2DY0A 2G3YA 2WHRA 3I2JA 2IV3A 3UOWA 5IG2A 4MYRA 2J5XA 4TLLB 1EGVB 2VDVE 1OBOA 1QNFA 5EQDA 3RYIA 1O57A 3O4JA 4Q02A 1OX6A 2BLLA 1QZXA 1YR3A 4D0SA 2FN4A 1DKMA 2IPLA 3KM0A 3NLLA 3CWQA 3WA7A 2RK6A 2OORA 2I4MA 4R98A 1YQUA 3H97A 4KLZA 4L3OA 4F45A 4RY0A 5A3RA 3IILA 4CMIA 5EIBD 4LYJA 1ARZA 2RG1A 4PFJA 1JTFA 3GJ7A 1EFDN 3EAFA 1Y1RA 5B57C 4AZVA 3R3UA 1QIJA 1NLYA 3M5DA 2WSYB 4YAUA 1F2UB 1EWYA 1QE0A 3KL2A 1W75A 4RXUA 4R2LA 3RU9A 1OB2A 3U7IA 2YYSA 3A36A 1HI9A 1W5EA 4LTDA 3WBJA 3T9CA 4PTYA 5SZKB 3DE5X 3JD4A 1YC5A 4LK2A 4X1OA 3LPDA 2NZVG 1QKIA 2VAWA 1L5OA 4KQJA 2Y0PA 2WAMA 5LOVB 5JJKA 4FBMA 5I7HA 2IHJA 2OV4A 3Q98A 4FGSA 3TOCA 4QC2A 4TV9A 3T4XA 2PSSA 4KFTA 3K71B 3A9WA 5K7SA 4Z7OB 4FX2A 2UYCA 5JJLA 3QLUA 4P9NA 1GQ2A 3FUWA 4IDEA 1PEAA 4X1KA 4YGXB 1DIRA 2ZJ6A 5C4GB 4MQ5A 5B1YA 2E3JA 2XYRA 3IEPA 3KJHA 3NBMA 1Y6QA 1MH9A 4TMFA 3RBAA 2WUEA 3SWWA 3DLTA 5KSWB 3PD1A 1PDOA 3SICE 2A9PA 4HS4A 3DTVD 4K28A 2J08A 4Q3NA 4Q3BA 4KUHA 4YTEA 2VJMA 2QJTA 1NF8A 2YBEA 1S3FA 2YZKA 2W8BB 4QUBA 3U7QB 1TQ2A 5IJ0A 3GP3A 1VIYA 4WZBE 5K0JA 5DGIA 1FU7A 4CF5A 4G25A 2BFFB 3FSGD 4KDRA 4UKDA 4LOLA 2WZCA 4PANA 3QP9A 1KK3A 2EQ5A 5DTIA 3E3AA 3T35A 5EJGA 1Z5PA 2KI5A 3BWCA 4PYJA 1LSJA 2PMWB 4OQXA 2XEXA 3CCCA 4XIYA 1E66A 4ZREA 2COKA 3U61B 2QE7A 4EDHA 5JAHA 3ANMA 1L1QA 1KH3A 2CMFA 4PYNA 1MPXA 3JQFA 4EY5A 5AO9A 1YE5A 1QQAA 5L3SB 1Z2DA 5FNVF 3T3DA 4XKJA 4TS3A 3GR6A 4IGKA 4YV1A 4U7JA 3G0HA 1LWOA 2BMWA 2QVCA 5HKLA 4UBKA 5AW1A 4ZJZA 1KZ9A 2EQBA 3DBOB 3HFGA 3AVVA 2PUDA 3BIXA 3DOOA 5CG2A 1U2DA 1KVSA 1D1SA 1YBMA 2X2EA 4OXKA 3D1LA 3SXUA 1NVEA 2ZDGA 2I29A 5DYWA 1UDRA 1NR7A 1I7SB 3R3YA 1NFRA 2HF2A 3DDNA 2XCUA 3E48A 1O9BA 2VK8A 4GFDA 1OZHA 2FFAA 1KARA 3M2TA 4AY4A 2JHPA 1M6YA 2W6NA 1MLDA 4MJXA 3Q3EA 4X6UA 3UAXA 4W9NA 2RI6A 4I5GA 1QP0A 4Z1MA 1JXAA 2BEUA 2IW3A 4LI0A 2FPGA 4K6MA 1MF7A 1RYDA 4HGQA 4YJ2A 1CT9A 1P3Y1 2FRVA 3VKHA 1T9DA 3RVLA 4C3VA 4DLNA 3AF1A 2AFRA 2GILA 4JQZA 2OM2A 4AMVA 4XVQA 2P35A 3KLMX 4K9LA 1I6MA 3C14C 1AZTA 3EZFA 4IDFA 1BC5A 4OB6A 4P7BA 2RH4A 5A02A 3BDIA 5LJIA 2F8MA 1DWQA 2PJRA 1V4NA 2W2XA 2QF7A 3V8NA 2GT1A 2WF8A 5DWDA 4DM3A 3HWWA 4R40A 4A03A 1W36B 3SZ3A 3WLMA 3SQDA 4GI3A 1UXJA 1NUTA 3RADC 3Q87B 3L84A 1QYXA 1R5BA 4MB2A 3MK31 4NU8X 4YGYA 3D6HA 4MV1A 4G07A 1SUWA 2QB5A 2O3QA 1ZJ6A 2IDJA 4RTQA 2QEQA 2QMZA 1UJ2A 1KYWA 3HP7A 1BU5A 2HPZA 2NNLD 3CIOA 4IIXA 4NICA 3A1UA 3ECSA 4Q4HA 3SFZA 3PSHA 5IAOA 1HDYA 1FX1A 3NW9A 3EF1A 3HO8A 4PPNA 4KIJA 4XSVA 4FHDA 2H7YA 3GVXA 3CA8A 4ZC8A 2CLMB 1G7CA 1CPYA 4O4JA 2WIFA 1BGXT 1VIDA 1VMIA 2V74B 3I09A 4DV4B 1DEXA 4JASB 1OX4B 3E1GA 4BVBA 4CI0B 1WQ4A 3SHFA 2C4KA 2Y3IA 2B37A 2G63A 4BE4A 3HXOA 5KYUB 3I5YA 1EUQA 1D6NA 1W6UA 2I4LA 3JQFC 1HT2E 4PYIA 3O8RA 2XKKA 5DI9A 5AYVA 3RS9A 4BP3A 3HVIA 2E48A 1FSFA 2O7VA 1PT7A 2J46A 5AOBA 1R2QA 4ZVOA 5H68A 2HRZA 4FU0A 4RMGA 1F7UA 1KVTA 1EXMA 3B6KA 3OM1A 4ZYXA 3B78A 4PPGA 4XFDA 2QRVA 4UTNA 2UYOA 5T6BA 5ES3A 4EB0A 1KYZA 1NXWA 3FBTA 1IDOA 1VJ1A 2WNSA 1PD0A 2FU5C 4NK4A 3MJCA 3RYIB 1NI4A 4R1LA 3EXG1 4A8JB 5JU6A 1JJVA 1J99A 4X20B 2J07A 4XQ0A 3M1YA 3ZLBA 3P26A 5BXQC 4WK4B 9GPBA 1EXNA 4ZZ0A 3G17A 4B2LA 2JH8A 2YFQA 1TUIA 2O5VA 4BO4A 2PSHA 2O3JA 5E9QA 1GTL1 2A3NA 1E32A 3LV8A 4ZCTA 1FP4B 1XZLA 2MWMA 1ABFA 1E5DA 1NUAA 1ORRA 2GPSA 4KK3A 5P8WA 1RXSA 3FNHA 4AYXA 1CF9A 1L7OA 4IBOA 4LE0A 1F1BA 2QN7A 1R8JA 2BGLA 1R4NA 4IFIA 5IN5A 3U3MA 4U63A 5AW9A 4GMDA 1O58A 3AFOA 4YBZA 1VL6A 4C01A 1N2CB 3PUXA 1BWRA 2AJ8A 3KTOA 3IQHX 4B0PA 2EZ4A 3E7FA 4X3PA 1HNNA 2HQOA 2ZKLA 1JU9A 3A26A 3A37A 1CUIA 2XT6A 3MERA 4G5GA 3M3HA 1O8CA 3RU7A 4DBLC 4Z7QB 2AMLA 3HZHA 3KAQA 5FPSA 4MS3B 3RVMA 2P40A 1DKUA 4Q4LA 3K6KA 1K3FA 3KVNA 5AP9A 1GSIA 3ZV3A 5EZ6B 4BFSA 2Z95A 3E5RA 1CZRA 5IZCC 1Q83A 2QPAA 1UIMA 3JQ9A 3PWSA 1Y4UA 3E3NA 1QYVA 3QG5A 1G6OA 3GH3A 2WY2D 4HAWA 3OJFA 2NNWB 3ZQ4A 1HDEA 3OM8A 2ATVA 4E15A 1JJIA 2I67A 4U5QA 3PNQA 1C4WA 4JBWA 5BYBA 1RMQA<