4NMMA

Crystal structure of a g12c oncogenic variant of human kras bound to a novel gdp competitive covalent inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nmmA00
3LDAA 1S0UA 3HU3A 1VG1A 4GFDA 3TRFA 4NYMR 4DVGA 4M22A 4WIAA 1ZYUA 4KITB 2HT1A 3GLHE 4BPBA 1VG8A 3IIMA 1G3UA 1EGAA 3CKLA 1DAIA 3U5ZB 3RAPR 1F2TB 3FFBA 1IJFA 1N6NA 3TW8B 2WKRA 4PPQA 3TW4A 1G6HA 2XX3A 5DGXA 2OE2A 4DC9A 2BJVA 2IYXA 3GP8A 1H8ED 3V4RA 4B6FA 1DARA 5B58C 4X8MA 4I99A 1G4UR 1KMQA 3MJHA 4M1OA 1Q21A 1KK0A 4P4SA 3Q3JB 2WJGA 1XEXB 2DY1A 3QEOA 3B5JA 2D4HA 4PQRA 4LJ4A 5HE9A 3QKUA 4NZYA 2WKQA 4GI7A 2BMEA 2F9MA 3GFPA 3NDBB 3HR7A 4M1KA 3LA6A 1OH7A 4F4JA 2BM0A 4OHWA 4A0HA 3T1OA 5FUVA 3PITA 1NIPA 1XCGB 3GLFE 4MGZR 3RYTC 5HKKA 3RVBA 1LS1A 1JPJA 4L8GA 4NBSA 4RD2A 5SZHB 2I1VB 3VR4A 2OUKA 4M1YA 5FTNA 5DSZA 5EP4A 1KI9A 3KQNA 4PZZA 3U3KA 3K9HA 4CEIB 1DS6A 3THXB 1PJRA 1KO4A 1ZBDA 4HSEA 3ASZA 2R6DA 4B73A 2X77A 4PSKA 1OH5A 1ZNXA 4Q7LA 4UNNA 3R9XA 2RCNA 3FHCB 2ZROA 2IYQA 5AR1A 2AHOA 5KNDA 4HZIA 1KO1A 2DPXA 1Z47A 3ETLA 4PHHA 3CRVA 3NBZC 4N1AA 4C0SA 5KO2A 1KI3A 3SZRA 3HU1A 4XJXA 1ZIOA 3UMRA 3EX7C 1HEIA 4EIWA 4BLTA 4LBYA 1MV5A 1XU4A 3LLUA 2YZ2A 4TTPA 4AI6A 3FB4A 4KU4A 3K0FA 2HCBA 1AQUA 1W0KA 1L4UA 5AK0A 1GNRA 3O8DA 4H1UA 2Q3HA 3FWYA 1TEXA 1COWD 1T5IA 3OHMA 4MRRA 4NCIA 4TLEA 4OL0A 4DDWA 3TUIC 3AUXA 1N6OA 1OIWA 2BC9A 4JT4A 2VP6A 2ZI3A 2EWWA 2JLQA 5FOWA 5IHPA 1YHNA 3GLHB 1KDRA 1Q12A 2W2VA 4ESHA 4MKIA 4ASUD 4KFRA 4FWTA 2J41A 2CCKA 2GJAA 4ZCLA 2QRNA 2FFQA 5FTLA 1A5TA 1KTVA 1TUEA 3TVDA 5C4GB 5FBVB 3VKGA 4Q18A 1TU4A 4KXFB 4Q1CA 3ZS8A 1IN7A 1QHYA 3NC0C 2GVDC 3P26A 3G82C 1E96A 2IWHA 4QGGA 2XTMA 5JCPA 4V0NA 1G5TA 4LYAA 2ZJ2A 3CIOA 3BIFA 2HXSA 1V43A 2IC5A 2IYVA 2J0VA 1TTTA 3B78A 3KB2A 3EPLA 1UDWA 3WMFA 3DOEA 4AWXA 1P9WA 4WBSA 4B3CA 2ZEJA 4Q1AA 1E2DA 1P62B 1OHHD 2H1LA 2ANCA 2J7PD 4FI3C 4UQOA 1NMZA 1X86B 3ZZ0A 4D4MA 3OEHD 1PZNA 3FKSA 2WOJA 1W4BA 4CRWB 1U0LA 2YKGA 1Q0UA 2WJYA 4IDQA 3WP1B 3K70D 3AM1A 3NC1C 1G7TA 4TLDA 3GJ6A 3GCGA 1KYIA 1U90A 3GLFB 1F2TA 5B57C 1F60A 4DDVA 3T15A 2VLIA 1NN3A 3WRXC 1W5SA 4Q1FA 1OB2A 1BYUA 1R0WA 3A1WA 4PANA 5B30A 3UWKA 3PEYA 3JZMA 4KAXA 5KSOA 3I62A 5CM8B 3R8FA 1T8UA 3K1JA 3AKYA 1RE0A 1QHHB 3NHBA 1W47A 4G5OA 1XEXA 2HF9A 4LBWA 1SVKA 1YJ5A 2LWIA 1WB9A 4IOJA 3D6TB 3EAQA 2RGXA 1E2FA 1FW6A 3QUSA 4N0DA 4GDFA 1KNQA 1E2LA 5IRCD 4OK5A 1P2TA 2P5TB 3SJCA 2FNAA 2JJ1A 1T3LA 3TR0A 2ZSEA 3EZ9A 3CM0A 2QM7A 4DLZA 4LUCA 2WPDD 5FUXA 4BWYA 4B3BA 4E03A 1FNNA 4BLPA 1E2PA 5HKKD 4JL5A 2VA8A 4AC9A 4XD7A 3A4NA 3AF3A 1KO5A 4XTCS 3BGWA 2QY9A 3KKOA 4A4DA 2CVFA 2V54A 4YDSA 1SQ5A 4CEIA 4DUGA 1KNXA 1AS3A 2JCSA 2J87A 2ZUDA 1Z0FA 3A58B 1JBKA 4R2IA 3VKWA 4LHVA 4HLUC 3J81k 4ZCIA 3GJ8A 3IGFA 1IOZA 1CRQA 2IW3A 4MYUA 4IVPA 4BFSA 2F1RA 4V0KA 1SKYE 4LCBA 4JS0A 2XNSA 1J2JA 2ZRJA 4TYWA 1IN5A 4PAQA 4CT5A 5F9HA 3U3OA 1NLFA 3P27A 3TH5A 4IVRA 2A2ZA 2WJVA 3A4MA 1YU9A 4LRWA 3W5IA 1UKEA 3E1SA 2XGJA 2AKYA 2GXQA 2VHCA 1LVGA 1JXOA 1XMIA 2B8TA 4TTQA 2YYZA 4DSOA 1W48A 2ODWA 4R9UC 4GZLA 4RCYA 4D80A 3W3ZB 2IS1A 1L4YA 3CH4B 2AK2A 2R6FA 2GJSA 4S2EA 4XIGS 1NN5A 1A7JA 1QHNA 3BERA 1G41A 4L15A 1XJQA 5EP1A 1DTSA 2IEZA 3I3SR 3A1VA 3KQKA 2GJ9A 3B6EA 4QBFA 3U44B 4FCWA 2FA9A 5HZKA 1NLYA 2ZUBA 2QRZA 1OF1A 4RD4A 3RRNA 4YC7A 3SN6A 3TSOA 3UMFA 2ZR0A 3ZLJA 1XD9A 3ONWA 5TXGA 3RS3A 3CB4A 3PEVA 2G83A 1GL7A 2CLSA 5DH9A 1QHIA 1XMVA 2QNRA 3OE7A 1FTNA 1Z6YA 2H57A 2BVNA 3CH5A 2RHDA 2G3YA 2R9VA 2W58A 5EP2A 3WRYC 3EZFA 2R62A 2YOHA 1BOFA 2F43B 3LXRA 4BECA 4A2WA 1XTQA 4IEIA 2C9CA 3QXCA 3B1WA 2V7QD 3GLFA 4BFUA 1SVSA 2WWGA 1HURA 1YR8A 1N5KA 3W3AA 4Q48A 1ZUHA 3BAFA 3ZZTA 3BJIC 2WOOA 3CNNA 1RYFA 4TN1A 3VR6A 1UKZA 1D6JA 2ZRLA 2SHKA 5HTKA 3NEYA 4GSYA 1KO7A 1LF0A 2FE4A 3WYFA 4B2IA 5HR5A 3IEVA 2CCJA 4M1TA 3PEWA 1YZNA 1QHHA 2RAPA 1WA5A 2E87A 3R9IA 4UJ5A 3REFA 2PCJA 3O8BA 4PC7A 2GAOA 4EAQA 3KJIA 1AZTA 1P61B 4YQFA 4JIMA 1N6KA 1SKYB 2KWIA 4LPSA 3TMKA 2HXYA 4HUQB 2JJ1D 1P4SA 3TUJC 2P65A 2RGNA 2BOVA 2OILA 2FMXA 2IHYA 2HJGA 1TL7C 2PMDA 2FX3A 1OFUX 1IM2A 2QZ4A 4C0BA 1AKYA 1HH4A 3EC2A 3JVVA 2CMKA 2XXAA 1SVWA 2NO6A 4A6PA 2ZM5A 1Q57A 1ZD8A 3VU9B 3EIHA 4B34A 4LWZA 1BH2A 3B60A 3ZJYA 5AUPB 1Z0DA 2P5SA 2OXCA 1DADA 2QPOA 4GNKA 5BWMA 2O8DB 2QAJA 1KI1A 3QXSA 4JLBA 5BYKA 1P5ZB 4PXAA 1RPZA 3FMIA 1TADA 1NVUQ 3K9LA 3B85A 3C14C 2EFGA 4OHZA 3X1ZA 3IPXA 2MSEB 1KSHA 1TQDA 3QPVA 4U00A 3SE0A 4RJLA 3C5CA 4YMTA 1RRFA 3THYB 2FZ4A 2GF0A 2GEUA 4NPHA 4KSCA 1E0SA 1G3RA 1XTJA 4MA4A 5FPYA 1IJEA 2JDIA 2Q9AA 1KZGB 3PFIA 2QSYA 4AIIA 4TYYA 4IOKA 3VHLB 4D81A 2VF7A 5FBQB 4S35A 4GOJA 4EPXA 4L9SA 1Q22A 1DG3A 1ZD1A 1X1SA 3AVUA 1G1MA 121PA 3HYTA 2GWHA 2Q21A 1SVMA 4DCSA 3M6AA 2ZRIA 1VCMA 4Q66C 2DFNA 3MSXA 4F4CA 3UANA 3U44A 4WZBE 4TL9A 3IQXA 1Y63A 3A8TA 5EUMA 4MRNA 2JJ2A 1E1QA 5EZ6B 4ARZB 5FPKA 3K09A 3A36A 3W5JA 4E07A 4FD2A 4Q9IA 4OQMA 2ZI5A 3PR1A 3PUWA 4DLVA 4OYHA 1E0JA 4XWKA 1TF2A 4YMWA 3KL4A 1PLKA 3QF7A 2QG6A 2W0MA 1W36B 3OIYA 4B32A 1F2UB 2R44A 4LJ6A 4YLGA 4UXIA 5DO9A 3K0SA 2R6GA 1ZM9A 1LTQA 2J3EA 3C5HA 3X1YA 2EFDB 5J4VA 5EE0A 4A8JB 3BC1A 1GM5A 1MRNA 2ZI4A 4EJSB 221PA 1X1RA 1N6LA 3RWMB 3TUZC 3ADCA 3KQLA 1YZTA 3IHWA 4KV9A 4RZXA 1RRGA 2ASEA 4Q1DA 1FNMA 1E2QA 3QXXA 4G01B 4PQYA 2CL7X 2BBTA 3QKSB 4HLCA 1W4CA 3TR5A 1HE8B 1IHUA 2IX3A 1E99A 1B0UA 1TQ2A 2EU8A 3H4MA 3IHLA 3VMFA 4URWR 5G3YA 5JFGA 1VIYA 2OT3B 5DN6A 3T1TA 1W0JA 4ZI3A 2FSFA 4HB4A 4UKDA 1M34E 4G1UC 5DI3A 4Z1MA 3W8RA 4F92B 4TLAA 4HUQA 2BBOA 1XCMA 2MSCB 4H1VA 2HJVA 2OFWA 3DPUA 4B3XA 1QVRA 1FQKA 2PEYA 2YINC 4DLUA 4ITRC 2QGZA 5DYGA 3RANA 1FMLA 2YHSA 3NEJA 4MGIR 1US8B 2VHTA 2WSSA 1WQ1R 3N2IA 3VU9A 4IKEA 1XJ0A 2C2HA 3K0AB 1JJVA 1Z06A 2R6AA 3MWLA 4QG7A 1KY3A 1XTRA 2H92A 2VH5R 2ZPTX 5AJZA 4NTZA 2ZYWX 4AURA 1QRAA 1KDTA 2N1BA 3SC3A 2P6RA 2O8DA 4NYJR 4HLDA 3KJGA 3OFNA 4LC0A 1OLOA 2IXGA 4TLCA 4OQXA 4GP7A 2OCBA 4G5GA 3IBGA 3K70C 1N0UA 2PX3A 1II9A 2ECKA 1QG2A 3I8XA 3UXMA 3B1VA 4B2LA 2GCPA 2ZRBA 2AXNA 1DPFA 3AGPA 4QJ3A 3THYA 1S2MA 5JRZA 2PT7A 4DT1B 4M53A 2JAQA 4LY6A 4CEJB 1N5IA 2NTYC 4QOSA 1NG1A 1FL9A 4A0FA 2ZQ5A 3KUCA 4HATA 3HP1A 1E6CA 1IXRC 2JATA 1AS2A 4OHXA 1RFLA 2ZU6A 4IXMA 1ZM4A 3QSYA 2ONKA 3EW9A 3AB3A 4IOMA 4CF7A 5FFMA 4JKYA 3KQHA 5BQ5A 3K8YA 2RGCA 1S8FA 4PC2A 2ZJOA 2ZSAA 5FL3A 2FGJA 3VNUA 2IBMA 4YXWA 1VCIA 3U7GA 3GJ0A 4MGYR 5SZJA 1DAFA 1CJMA 3B1XA 4JLOA 4LJYA 5D3MB 1UFQA 1U9IC 2JLWA 2Z4RA 1AA9A 1N5JA 1ZNWA 2GHIA 4TT3A 1CR4A 1SVLA 2ODNA 1Q3TA 3IQWA 2R2AA 1JEDA 4M1WA 1EFTA 4Q47A 3RC3A 3T12A 3ZS9A 2IS2A 4MDFA 1J90A 3LRPA 4QJ5A 3VTKA 2GJ8A 2OV2A 2WAXA 4B71A 3LW7A 1OB5A 1R0YA 1N6HA 5F2EA 1MO4A 3WHLA 2HDNB 2PBRA 3D8BA 2IXEA 5K8TA 2BV3A 3U4QB 3CZPA 2ZRFA 1PVOA 2XNDA 3SI7A 2ZE5A 1P72A 1R8SA 4EJSA 5L8VA 1D2EA 1TX4B 2J7KA 5KUTA 4E5UA 2JLVA 3LBNA 1DBSA 1CJUC 2BWJA 2PMKA 2R65A 5FTMA 1E2KA 1XDBA 3CPHA 3RWOA 3NG1A 1S4QA 3QKSA 2QL6A 4FMDF 2HUPA 3O47A 3SHWA 1UADA 1VYTA 1D8TA 1H8HD 4ZDJA 1AS0A 2CDNA 2OCYC 2PCLA 4R7ZA 5AUQA 5J5CA 3AP2A 4MKGA 5A0FA 4OHYA 1KI6B 1X3SA 4IVQA 2DBYA 1W0JD 1G21E 5DN6D 4KFSA 4NCHA 3KB1A 2V6IA 4AKGA 2UZIR 4Z1MD 4JYCA 1Z0KA 3KTAA 3QOFA 4KI0A 4FMCF 3SQXA 1VMAA 2ZAMA 2Q6TA 1GKIA 3B2EA 3OESA 3K0FB 1UBFA 3R20A 1G9XA 2Q9BA 3SBDA 1OIVA 5M04A 3REGA 4CVNA 1EFRA 3NVAA 4C7OA 1YKSA 4HEJA 3ZD6A 3KFVA 3RNLA 2F1JA 4TSFD 4EQ6B 2CL0X 2EQBA 2CNWD 2HCJB 5E3HA 3U60B 3K0CA 3T5GA 1W44A 1MO6A 2BCGY 3PV0A 4KODA 3TNFA 2G1JA 5JEEA 3OIWA 4BLQA 1E0AA 1UJ2A 4B74A 3GLGE 3FHTA 3CX8A 4IOLA 2C77A 1Z29A 4B48A 4W5JA 2ATXA 3AF4A 5EE5B 5KDLA 5TB5A 1HT1E 3AKDA 4TLBA 1CF4A 4QM7A 1MRSA 4JLKA 2GZDA 4A92A 4OHVA 4MQBA 3ZVRA 3QBVA 2VRWA 4B43A 3CO5A 4DT1A 1R7RA 4D4JA 3SJAA 1D5CA 2QPAA 1I4DD 3HWSA 3HU2A 2C5LA 3DOFA 4EPRA 1FMJA 2BKEA 2JLSA 1MOZA 1AIPA 1KI2A 1T91A 3OIUA 3QBTA 3OEEA 4JLJA 1SXJA 4V0ME 3CF2A 2W6ID 4I4LA 4WVFA 1JNYA 3NDPA 3IKJA 1G7CA 3UMSA 1P2UA 3U61B 5C1BA 4QBGB 5HPYB 2VIIA 2XZPA 2ZIAA 1FFHA 2BKUA 3I92A 4D0LB 2DB3A 1AKEA 2Z6VA 3SDZA 4L16A 1AM4D 1R6BX 2GRJA 2P3SA 1G4AE 1T4GA 3DZ8A 4LHXA 5D3MA 3ZVNA 1WBDA 1GRQA 4XSGA 1UEIA 2RMKA 1T0HB 1RYHA 3ADKA 1OKKA 2Z4SA 1P6XA 3C8UA 3C7KA 2G88A 1KAOA 4PQFA 4PHTA 2AD5A 2JLUA 3BB3A 2HLDD 4K8OA 4B3GA 4G3XA 2AN9A 2GETA 2CHQA 1CBUA 1J8YF 1W36D 1M2OB 4NYMQ 4IJMA 1G7SA 5G40A 2H7VA 1SVOA 4JVMA 3A1TA 3U4QA 2A5DA 3MUFA 2IYRA 4L4UA 3QPUA 1VDZA 1KY2A 3ND8A 4K46A 5FPSA 1NSFA 3B7GA 3NTUA 3PIRA 4PPNA 4C30A 1CKEA 2DHRA 3MWKA 2EYQA 2MSDB 3ZQ6A 3NH9A 1QHGA 4EDHA 4QL3A 1U99A 2XEXA 1C4OA 4BFVA 3KX2A 2G9NA 2ZYUX 1F48A 3VR1A 2AXPA 2CJWA 5SZIA 2RGDA 4JLMA 2J0QA 3UG6A 4W7SA 5E7MA 3B9QA 5JI2E 3JZAA 3ZIAA 4PPGA 2D3WA 3VR2A 1UBCA 2XSZA 1KI6A 1VG9B 3GLGB 5CB8A 2Z5FA 1XPOA 2ZU0C 4Q9JA 2J0UB 1S96A 2QROA 2QUZA 3RABA 1G8FA 3GQBA 4Q4JA 4Q02A 2RB4A 4UNSA 2JA1A 2GILA 2C95A 3PQCA 4KO8A 4CGZA 1XPRA 3DKPA 3RS4A 1NRJB 2A9KA 3BXZA 4N0EA 1JALA 1XWIA 2OBNA 1NKTA 2X8AA 2AWOA 3WXMA 3FMFA 4CZ2A 2XB4A 4DB2A 5JCZA 1EFRD 3AUYA 1LY1A 1WF3A 4B6EA 3P4XA 1U8AA 1ZRHA 4JLVA 4TL6A 5CB6A 1H65A 1IBRA 3U3RA 4EQ6A 1JR6A 1L7VC 4CIDA 3A6PC 1W2GA 3QKRB 4HI0E 2J0SA 1N5LA 4NDZA 3ZQJA 2NO9A 1F6BA 4BZXA 4ILEA 5AJVB 3X2SA 2X19A 2NO1A 4JMPA 4DCVA 2FWRA 4QHTA 2DWPA 2YNMA 1KIMA 4B76A 3SFZA 2ZYVX 1AN0A 4TYQA 2J9RA 1VHTA 4NKRA 4GL2A 1EG7A 2AFIE 3EPHA 3K0EA 3LO5A 1YR9A 2GKSA 4MRSA 1AZSC 3ND9A 1DG1G 1Z63A 4AYXA 5GJVC 4OQLA 2PJRA 3G0HA 1KSJA 1AGRA 4OJKA 1YZUA 4EPTA 4EPWA 5L3SA 1N25A 2B8WA 1YR7A 4MDEA 1AJEA 4O2RA 1D9XA 2FZLA 2EFEB 2CCGA 1G20E 1QDEA 4M2LA 2RKOA 5KNBA 4ZDKA 4HYYA 1WBBA 5CYPA 3S1AA 3LX8A 1G8GA 3MAAC 1NN1A 2RGNC 1XTKA 1DAKA 1G6OA 1Z22A 1KI8A 4B33A 1E2MA 1MH1A 5CDFE 1QG4A 1K6MA 1KO8A 4HAVA 1GZSA 3ZGXA 1ZJ6A 3FVQA 4ACBA 1IQPA 3RRMA 1E9FA 3RS5A 2GAAA 2EYUA 1SULA 4LJAA 1FOEB 2I1QA 2Z43A 5JSZA 1GTVA 4WA7A 1E9CA 2WMOB 1Z6GA 4O0MA 1EWRA 4AYWA 1YZKA 2QTFA 3CZQA 5JI3E 4DSNA 2JASA 2JGNA 2WM9B 1KK3A 1E2JA 5ELXA 2GK7A 2X2EA 4LHYA 2EFHB 1GITA 1OYYA 2ZE7A 4WOPA 1R5NA 1VYVA 2LCFA 4Q7MB 3CR8A 3HPRA 2EWVA 4URVR 3G5UA 3L43A 2ZRCA 2W00A 2XZOA 3SYLA 1EFHA 3BK7A 5LBIA 2F1HA 4DHEA 2XXAB 2W2TA 2QI9C 4D82A 3TQCA 1KKLA 2ZJ8A 4US0R 3FDIA 5A4JA 1FZQA 2E9SA 4MGKR 4WXRA 5FL7A 4BFWA 2VYFA 3PVSA 3LLMA 1TPZA 3SHFA 4CW7A 4AYTA 5FR1A 1CLUA 1W2HA 1D9ZA 4B3FX 1NVWQ 3GLGA 3W8NA 5CIQA 4JBWA 3GFTA 1OXUA 4BASA 2J0UA 2ORVA 2IYYA 2G1KA 4RD0A 5JS8A 5C4MA 1U98A 4TMWA 3SOPA 3MFYA 3TGPA 4LJ8A 2XAUA 4U02A 1E9AA 1T0JB 3VKHA 1OXVA 2P0EA 4KLZA 4HDOB 2ZJAA 1W0KD 3UK6A 3GD7A 5GJCA 1G5RA 3CRRA 2OXRA 3QVVA 5BN5A 1GOTA 1R8QA 3DL0A 3TBKA 4FMBB 1G3IA 4J0QA 3IIJA 5J4HA 1GILA 4MUBA 3B82A 1WDTA 4V0MA 1ETUA 1I4TD 3IO3A 3QKRA 1HY3A 4HB0A 5EE1A 4PAMA 1NF3A 4O3MA 4YMVA 4Q03A 1XTSA 4A0RA 3RHFA 1YRBA 1VPLA 3D7MA 3LQQA 4MKHA 1CR1A 3MLEA 3Q72A 5LDDC 2AFHE 4ZI2A 4IRUB 4NCNA 4LI0A 3L0PA 3EZ2A 2FJUA 2DWQA 4FW9A 1NLZA 4TMZA 2WWHA 4P3YA 2JIZA 4Q19A 3NIBA 1NBMA 4IFEA 4QGAA 4LZZA 1GFIA 1TQ6A 4KHZA 2NPIA 4WZ6A 3KXIA 3Q5DA 4NU0A 3FKSD 621PA 4KBGA 4EPYA 2G0NA 1Z6AA 2OCPA 4AK9A 2X1VA 2ZRMA 4C2UA 3QENA 4LJ5A 1DAEA 5AJWA 1OXTA 1HUQA 4I1VA 3BB1A 2ODBA 1ZU5A 2FPLA 5DISB 5C2JB 1SHKA 2GNOA 4KLNA 3N5CA 4JLPA 4DRZA 2HT6A 2YOFA 1G17A 4JVSB 4C0LA 1XEFA 4HAWA 2XITA 1R4AA 4MUAA 1NY5A 4US2R 1NJFA 1OFTA 3QJYA 4GOKA 4I1SA 4F91B 1HT2E 1LNZA 5EJEA 5KU1A 4D2IA 3U6KA 1CULC 2O8EA 1ZM2A 4JLAA 2R6CA 3DDCA 4MRVA 1YZLA 4Q4AB 2XOKA 4JVLA 1EX7A 5DI3B 2ZS9A 1R10A 3K9NA 2PZEA 2IEYA 1NN0A 4G5QA 1OT3A 4JL8A 4TQ9A 4GMDA 4BUJA 2DFKB 2C8VA 4TL8A 1BO6A 4QNMA 3DEFA 2ZI7A 4A36A 4XD7D 1XNJA 4LC1A 5TY0A 2GESA 2O8FB 3OIVA 4B3DA 4DXAA 4UJ3A 3FYHA 4DUGD 3V4FA 4D4LA 5FL7D 5FTKA 1E2IA 2UKDA 5F3WB 4DLSA 3X1WA 821PA 1KGDA 2W2XA 1E1RA 1KHTA 3AGQA 4XOIA 2NQ2C 3TSZA 1ZIPA 2RGGA 1N3BA 2KBFA 3BD9A 4Y0AA 2OZEA 2Z0MA 2ZSBA 1JAHA 2Z83A 4JL6A 3T34A 5GJWC 4DCNA 1XBTA 5EQTA 1GVNB 2V55B 1BYIA 3I8SA 2VSXA 3I1FA 4LGMA 4M9XA 1A1VA 5FI1B 4I1UA 1JB1A 3W9YA 1IY0A 2C78A 1KZ7B 2VO1A 5K8LA 2VP5A 3GFOA 3KFXA 4B35A 3CRW1 4ZIRB 2QP9X 4IXNA 1U0HC 1E9SA 2ZI9A 3FTQA 4V0OA 4V0LA 1Q20A 1FUKA 1U81A 4GPTA 3TE6A 1IAQA 4EFLA 1W36C 2IT1A 3D31A 2J1LA 4RCZA 1XF9A 3UIEA 5FBWB 1S9DA 1Z6TA 2CK3A 1SGWA 2VP4A 3QIAA 4LV6A 4A8JC 1ZAKA 4EJSC 1FP6A 3DO6A 5CDFA 4G5SA 2D74A 4PC6A 4IDHA 5E4FA 3OE7D 1YR6A 1MABB 3CNLA 5CITA 2KE5A 1E98A 1JJ7A 4KYUA 4OI0A 4C0HA 3AV0B 2JIZD 4DDUA 2ZSFA 3SS8A 1UF9A 2QT0A 3PENA 4TL7A 2E1RA 1RIFA 2XTNA 2AR7A 4KFTA 1F3OA 3LV8A 2QE7A 1Z0AA 4P33A 2C9OA 4B47A 4BZPA 2D7DA 1QHSA 5FOVA 4BFYA 1SXJE 1UKVY 3PUVA 3F3YA 3I73A 3LXXA 4A2PA 5EXXA 3GJ5A 4AD8A 2LKDA 1MT0A 1GDDA 3KZ1E 1ZM3A 3F0TA 3SYKA 1OE0A 1R5BA 2HYDA 5DI9A 3SFVA 4E22A 1T5LA 1DO0A 3SR0A 2QMUA 5IT5A 4F4IA 3L8ZA 1C1YA 1O87A 5BYJA 3LW8A 1OFIA 2DFLA 2ERYA 1G19A 2F6RA 2CEAA 3GJXC 4JVNA 3CR7A 2H17A 4DEYA 2OG2A 3T5DA 4TMKA 3MGCA 2BMDA 2F1IA 2QP3A 1KAGA 3K0CC 4Q4AA 1E4VA 2GCOA 3NBFA 2WWIA 5CYOA 5F98A 2QN6A 4PZLA 1GG2A 3MCAA 2ZANA 3LBHA 2XTZA 2WTUA 1Q1EA 4C0KA 3KTAB 1N6IA 2ZAOA 5GVSA 1RVDA 1B23P 1U0JA 2GBLA 1T3HA 1GIAA 2QGNA 1CRPA 1BMFA 2QA5A 1P7CA 2G6BA 1KMHA 2BIFA 4LDJA 2V3CC 1V5WA 3C4JA 5J4LA 4C7OB 2O8FA 2YOGA 3RSLA 2BDTA 5KPDA 1S9HA 4TYPA 1OH8A 2WSMA 2B7BA 5K8IA 1VIAA 3T35A 5FI0B 1Q44A 4X8OA 2H18A 3AVYA 5BN3A 4XH9B 4O25A 2VQSA 5EXSA 3E70C 5FH9A 4GRAA 1ZUNB 1G5PA 2WJIA 2VSFA 1II0A 2CHGA 4QFMA 3U2QA 1Z28A 1SXJC 2TMKA 5FOSA 4BFTA 4KFUA 4HUTA 3KQUA 3H84A 5KSYA 2C99A 2K5UA 3SYNA 1TF7A 1CEEA 1M7HA 4BRUA 4OI1A 1FX0A 2KSQA 1EFCA 1GWNA 2QORA 4FCVA 4C3ZA 1W4AA 2VHUA 4NHOA 3RS7A 5IF9A 2OFXA 3KKPA 2QENA 1M8PA 2JDID 1P3JA 5HCIA 2WHXA 1QHXA 2GA8A 2JLRA 3NBYC 4ZIRA 5JJLA 3AVTA 4KVAA 1LW7A 5DYIA 1GSIA 3ZVLA 2H5EA 2KB0A 4YMSA 2QQEA 1S1MA 2QQ0A 3R7WA 2A5GA 4NL4H 1SXJB 4NYJQ 4TQAA 3TQFA 3I72A 4ZKEA 4ZDIA 1JEEA 2WKPA 3P4YA 4URXR 5JJIA 4O2LA 1A4RA 4H9GA 4NYIR 4QNRA 4PO9A 1Z5ZA 1I4LD 2IXFA 1Q1QA 4BLRA 2JJ2D 4HB3A 1ZCAA 1E1QD 5TARA 4OJQA 3B13B 4LV8B 1XP8A 4G0NA 2QPTA 2ZI6A 2JLYA 2H8KA 1MABA 3THWB 2QBYA 1LS6A 2GEDA 4B2PA 2GXAA 5FBLB 3WY9A 1ZD9A 1JQJC 4IDPA 4YMUA 5H8WA 1CS4C 3A1UA 5B64A 2ZRPA 1J7KA 1VHLA 2RGEA 2CVHA 4DLWA 4UNQA 3B8HA 4EPVA 1G8HA 1H8EA 2QMOA 5JMTA 5FTJA 1HQCA 1E0KA 1G3QA 3CRMA 2YC2C 3WMGA 4ON9A 3NWJA 1RJ9A 1Z08A 4BFXA 1IN6A 4GMXA 3AVOA 2ZRGA 2OLJA 2VPPA 4POAA 3WBKA 2NGRA 4UNPA 1SZPA 3NH6A 3QY0A 2REOA 1XB2A 3I61A 1I2DA 1M7GA 4YDHB 1C9KA 3HDTA 2CJWB 1NVVR 2J5XA 1HA3A 2FSGA 3SBEA 1FPMA 4DIDA 1Z0JA 3HPQA 2PLFA 3H1TA 2CLDX 3MD0A 2C96A 2GEVA 4OQNA 1DVRA 3CRQA 2WIBA 5KYKA 2O8CA 5DHAA 2VP0A 4M1SA 3GJ4A 3AP1A 3BBPA 3U3MA 3U7EB 2ZR7A 3ZDQA 5KTYA 4Q4JB 2BCJQ 4A15A 1PLLA 2O0JA 4LX0A 1U2RA 1XFAA 4FCTA 5DIFA 4Q1BA 3NHAA 2JLXA 4US1R 2R8RA 2ZRHA 3GJ7A 1ZNYA 4IDOA 2QMHA 2WSSD 1NIJA 2YJTD 3M4YA 3VX4A 2F7SA 1S3GA 4HLQB 4GBMA 3A37A 2QAGB 4AKIA 4LYJA 3QXHA 5JJKA 1BIFA 5EE3A 1NVVQ 3EWAA 2ONJA 4JSYA 2YWHA 3MG9A 4LV5B 4QKQA 3OF5A 1UDXA 3H86A 1Q1ZA 2VHJA 3GEIA 3OFND 1DO2A 2DFTA 1PV4A 5LD2C 1VCNA 3IIKA 2V6JA 3ICQB 4P0TA 3ZD7A 1W4RA 5CLQA 1OH6A 2AK3A 1P75A 3ZVMA 1DEKA 4ZO4A 1XJCA 1COWA 1OXXK 1ZM7A 5BN4A 1MR3F 3QQ5A 3CNOA 3E2IA 521PA 2YV5A 3Q7QA 3CF0A 2FFBA 2KJQA 5E7JA 2QEQA 1NKSA 4OK3A 4D0GA 3UG7A 3L0OA 1ODFA 4Q01A 2FEMA 2WICA 4KVGA 3SQWA 2ZTSA 4ASUA 5GJBA 1UEJA 2YC4C 4KBFA 2V1XA 3IILA 2NIPA 4IEEA 4OBEA 2OBLA 1VTKA 1X8KA 5H1YA 5KHOC 4I81A 3ZYCA 5L3SB 3FE2A 1WRBA 3A1SA 1ZNZA 4PC3A 4Q9KA 2FFAA 3ZH9B 5LD2B 1IN4A 1L2TA 4A0GA 4OQFA 1EWQA 3KXKA 1NI3A 1TNDA 3UWOA 2IUTA 3GLIA 2HYIC 1R2QA 2JLZA 3CLVA 1ZP6A 3S1AB 1OSNA 5TVKA 4YXWD 4FINA 2IYUA 3I32A 1BKDR 1ZINA 2J7PA 3CWZA 4DIEA 1E9RA 4MYHA 4N3NA 2XJ9A 1Z8FA 3OEHA 4URUR 1TU3A 4NE2A 5BXQC 1Z2AA 4PR0A 3PXGA 3THWA 2IF0A 4TT3D 4DCTA 2BBSA 2ERXA 2OM2A 1JR3E 1Z3IX 5FOXA 1XPUA 1F5NA 1NBME 4NONA 4P31A 3E5HA 1G7RA 3PEUA 1NMXA 2MMGA 5JSZB 4BRWA 2IHBA 1CXZA 2ZR9A 2OESA 3BFVA 1W7AA 3HYRA 5CLLA 1UAAA 2XNDD 1EX6A 2D2EA 3QKTA 2VEDA 3VHXA 3PG5A 1GAJA 4E09A 4JJKA 1DELA 1GNQA 3LFUA 3KUDA 2B21A 2VF8A 1CU1A 5JLJA 3FHOA 1Q1BA 3ADDA 4Q4HB 4OI2A 3CX7A 4B44A 1E94E 1G18A 1DOAA 4RD1A 1KI7A 1ZW6A 2WJJA 1RRPA 1G16A 1M7BA 2YWFA 2ZVQX 3KJEA 2WPDA 4XTRA 3N70A 1IY1A 4Q4LA 1U9IA 4KJZA 2C98A 5G3ZA 4QHYA 5UKDA 5CK4A 5DHFA 1D2MA 4DLTA 2OLKA 3EIQA 2WWYA 1GRRA 4ZPXA 5TMPA 3HR8A 4XVRA 5FUYA 1IONA 4RVCA 1E2NA 4NCKA 2FPMA 4JBXA 5DLQC 1E3MA 1MO5A 4QXAA 2J59A 2REBA 1CJVC 4L5BA 5J4KA 1N0WA 2FGKA 4LSGA 3EZ7A 3AF0A 1ANKA 2QAGA 4KCGA 1LB1B 3EA0A 3AVPA 3VFDA 4X8HA 4JJZA 1X6VA 5LPNA 1M1YE 1CP2A 2A78A 1R5OA 1I2MA 4DZZA 1S3SA 1IXZA 4R98A 1K8RA 2GVZC 3BORA 1VG0B 4AG6A 4QC2A 1E9DA 2B92A 2FSIA 2ZJYA 4WZAE 2CL6X 5JWOA 5E95A 4M9QA 1KJWA 1P2VA 3N2EA 2VHQA 1P73A 2EW1A 1N6RA 2PL3A 3CPJB 1TEVA 4P4UA 4XVUA 3DM5A 1NSTA 4CEHB 5J47A 1E2HA 2F3TA 2FH5B 3O8RA 2BBWA 3K53A 2Q3FA 3VR5A 2W0SA 3U3JA 3QG1A 3C41J 3LNCA 1HYQA 2A5YB 3AH8A 4TWZA 2CLCX 3KKMA 5FOUA 4M1MA 5G53C 3IEUA 3OEED 4PC1A 3FOZA 4G5RA 1SXJD 1P9RA 1FQJA 3LVRE 3NBXX 2DWOA 4ESVA 4RFVA 4XWAA 1XXHE 1N2CE 1LV7A 4JSTA 2P2LA 2PT5A 2FOLA 2ZRAA 3IO5A 3H0KA 1QVAA 4QM6A 2GCNA 1JI0A 4JYBA 4ACAA 2GTPA 4DSTA 3KKNA 4LOAA 1Z83A 2XJ4A 3L0SA 4R71A 1XD2B 2V8OA 2A3RA 1JPNA 1OKKD 5JWRA 4PX9A 3CW2A 3BH6A 1XZQA 1VECA 4LJ7A 1WMSA 2GJKA 1AK2A 4Q5IA 3ZZUA 3RC8A 2V7QA 4GP6A 1XMSA 4IDNA 1CJTC 5EP3A 2ZRNA 3PUXA 3L8YA 2REXB 2O8EB 5JEDA 3H2YA 5FUWA 3UKDA 2WAYA 1DAHA 1GP2A 1ZC4A 5KSPA 3AF2A 1E2GA 4UXJA 4DBLC 2AKAB 4D4KA 4QHSA 4V02A 1TAGA 1NNEA 3X1XA 1X8JA 4RFSB 3BH7A 3SJBA 4HDCA 2NPFA 3FPAA 3LAWA 2KI5A 2P6UA 5JWHA 3WHKA 5F9FA 3IPYA 3Q8XB 4Q4HA 5FPHA 4PHFA 2FPKA 1YZQA 4M4SA 5TDHA 4QGHA 2ZRKA 1RZ3A 2OFOA 3ZIAD 1WE2A 4AG5A 2ORIA 2ZE8A 2GZHA 4LPKA 2NG1A 4A1FA 4LYHA 4AY2A 2RH5A 4TZ0A 1GUAA 2XSZD 4LYFA 3VR3A 4F7WA 2ATVA 2D2FA 2DCUA 2IA5A 3MJRA 3W6PA 1CTQA 3Q7PA 3LY5A 1U94A 4IHQA 4K81B 4C2TA 5JHGB 2I3BA 3QI2A 3TLXA 3X1DA 4MH0R 3RS2A 4C4PA 4ZKDA 1W5TA 1J99A 3BWDD 2ZJZA 4B75A 3PCRB 2A5FA 4A6XA 1OFHA 2ZREA 1A2KC 4MRPA 4P4TA 5JECA 5AUOB 3THXA 3K09C 5AUNB 2O5VA 4OI4A 5FBRB 4Q7JB 1GKYA 2VSOA 5JS7A 4CDGA 2O52A 1YZGA 2Q0HA 3LVQE 3VAAA 2QT1A 1XXHB 2L0XA 3EWSA 3R8CA 1EXMA 4XWOA 2V1UA 1KOFA 1W1WA 1S1CA 4C0QC 1QF9A 5KOYA 4PHGA 2X2FA 1MKYA 1U8YA 3EARA 4W9MC 4CEHA 1E79A 2BM1A 2PZFA 1GNPA 3GLHA 3LQRA 5G41A 1JR3A 2JJ8A 5D3QA 3U6BA 3AEZA 4KSBA 3P20A 4UXHA 4NMMA 3EA5A 3KKQA 4D25A 4BEJA 4URYR 4V03A 4HB2A 1LF5A 1XD8A 1G8YA 3C15C 3P1JA 2LKCA 4RKFA 2Q9CA 3ICEA 2O8BB 3QPWA 1MO3A 2GDJA 1DE0A 1OYWA 1GL6A 2A30A 4RZ2A 3FMOB 2V9PA 1KDOA 1K5GA 3T06B 4CT4B 4X8LA 2ZXUA 2ZITA 2GBLC 2P6NA 4W5HA 3RDPA 3W6NA 3MWYW 4XSHA 1XD2A 4Q9HA 3GEEA 2O0HA 5HE8A 5FOTA 5L3VA 3D3QA 2FSHA 3LD9A 1E9BA 2VP2A 2VTKA 4XVQA 4RZ3A 3Q9LA 2FU5C 1W46A 2OBMA 1GRNA 3UATA 5CJPA 3HJNA 2GCOB 1AGPA 4LHWA 4M0LA 1OJLA 1Q3HA 5LB2A 4Q21A 3FGNA 3OAAA 5HZHA 3NXSA 2UZ3A 1ESMA 1PLJA 1ZU4A 5DE3A 1DAMA 3SNHA 2WV9A 2QU8A 2HEIA 4FN5A 1ELOA 2BMFA 4RFSA 5EXPA 1D2NA 2IK8A 4C9BA 1KMHB 2IYZA 3T1QA 3PJRA 4NCJA 4RKEA 3RRZA 3M0EA 1LFDB 2VL7A 3AQ4A 3EG5A 4DDTA 721PA 4FXPA 3VQTA 1A82A 4EKDA 4ABYA 5JBQA 3DKVA 3BH0A 2N42A 3PUYA 1CR2A 4LBZA 1GKUB 3W6OA 1NP6A 1TUIA 4JLNA 2PLRA 1SVIA 2C04A 2FV8A 3F8TA 4WAUA 4WW0A 4ZV4A 5ANRB 3AVVA 4PO8A 1XCPA 1ONBA 2MMCA 2AX4A 1E32A 1FX0B 1II8B 2OEPA 4ZDWA 1CJKC 4PAOA 3I5XA 5FPTA 5B2ZA 5J4YA 2ZUCA 4Q7KA 1ZVQA 4MITA 4RY2A 1PUIA 3U7HB 2PH1A 4NH0A 2B7CA 5L3RA 4DSUA 3QNUA 5CK5A 2BJWA 2P67A 3B1YA 4EUNA 2IL1A 1UBGA 4Q1EA 4KYIB 4DJTA 3WP0A 2QTHA 3LBIA 3R7WB 3EPJA 4A2QA 3DHWC 3DMDA 2AD1A 4JKIA 3F5FA 1U8ZA 2B6HA 3NKVA 4ZCMA 1XXHA 4PO1A 2JEOA 1W49A 5K8UA 3BS4A 2UVQA 2GXUA 2OCAA 2IYTA 4PZYA 5JZVA 1O3YA 4PSVA 4PSAA 3QE0A 3EXAA 4HLUA 1YRAA 2PX0A 3C16C 1Z07A 5FR2A 3GPLA 3RRYA 1OIXA 1M74A 3WMEA 1E79D 1PUJA 2DYKA 2QBYB 3ECCA 5CJ2A 1N0VC 1NJGA 1JR3D 1OV4A 5GVRA 5KSZA 2VBCA 1NBMD 5BW8A 3TAUA 1XEWY 2IS6A 1UPTA 1G8PA 3EC1A 3LWNA 4RD3A 2W6JA 4QBIA 3WBJA 2CBZA 5IK2A 3R9WA 2G0TA 1YVDA 4GZMA 3AP3A 4BFZA 2IF2A 1WP9A 2A7QA 2FEOA 3L82B 5P21A 2O8BA 1NL3A 4QBHA 1NG9A 3GLIE 2CE7A 5KNCA 4MKFA 1RJ9B 4Z54A 2HV8A 5CIWA 5AJXA 1FUUA 3V00A 3CBQA 4HAYA 1VYUA 2KBEA 2RGBA 4U5XA 1IY2A 1QZXA 4LK2A 3DM9B 1E2EA 4DLYA 1A2BA 2F43A 4DCUA 4BZQA 2WWXA 2OSBA 3GEHA 2RGAA 5EXTA 3WNBA 3RS0A 1JXMA 1OPXA 2DR3A 4P32A 2PZGA 3WYAA 4D26A 4EFMA 2QM8A 2WMNB 2ZS7A 2IYWA 3TKLA 5AJYA 4FMDB 3QXJA 3W34A 4C0JA 4M8NE 1T9HA 4TYNA 2H16A 2ZSDA 1T8TA 2XOKD 2ZETA 1ESNA 2O8CB 3OZXA 5DNYB 3L0IB 1ZCBA 2D62A 3KDSE 3OAAD 1OW3B 2F9LA 1HQYE 2A5JA 4HAUA 1P9NA 2WZQA 3QG5A 4Z51A 5C18A 1HE1C 4D6PA 3K9GA 3TSWA 1NY6A 1H8HA 4BLSA 1CR0A 4YONB 1E69A 5LB4A 4FMCB 3BE4A 3LH5A 1TMKA 3TK1A 4PFSA 3CWQA 1E4YA 4FWIB 1GL9B 4HZUB 4BQSA 2IS4A 3ASYA 4TZ6A 2WJHA 3L2OB 4F93B 1IN8A 1XMJA 4W5WA 1KDPA 3SJZA 1E1RD 1HTWA 1TQ4A 2ZJBA 3QVUA 4GT1A 3AKEA 2ZE6A 2CHVA 2BEJA 4MYTA 3KXLA 2ZVPX 2J46A 4RSGA 3BFXA 1XEWX 2G77B 3AKCA 4D0NA 1II8A 2ZJ5A 3AF1A 1Z0IA 4M21A 3TJZA 2IYSA 3THOA 3WNCA 1L8QA 2EVWX 1WCV1 4TSFA 1IXSB 1UBEA 2CNWA 5EZ5A 1G64A 1XZPA 3QF4B 1JECA 4GOXA 5L3QB 4U7DA 4HAZA 1M6NA 3BFKA 1JAIA 4JLDA 2EFCB 3AVWA 5EUQB 3BOSA 1VCOA 1CIPA 3BRWD 3SU8A 3EPKA 1OXSC 3CUEF 2FG5A 1G3MA 2NZJA 2ORWA 4QRHA 4TQUS 3GLIB 2QP4A 4DKXA 5AWFC 4WXPA 1FTSA 1BS1A 2BEKA 3M1IA 4TMVA 2N46A 5JRJA 2CXXA 2OAP1 3Q85A 2CK3D 2PEZA 3W90A 1EFUA 8OHMA 2QTVB 5J40A 2WWWA 4RZUA 3GMTA 2VP9A 2WBLC 2OO7A 2NO7A 5KPJA 5E7IA 1RW4A 3JVUA 2IYLD 2ZYTX 4QGFA 3CX6A 3K70B 1EESA 4FIDA 3U7FB 1KI4A 1UM8A 2C9YA 2W6IA 3B1ZA 3EASA 4HDQB 2WWFA 1KSGA 4QJ4A 2YWGA 3WYGA 3IUYA 3AVQA 2QE7D 2Q3MA 2W6JD 5IK2D 3VX3A 4JBYA 421PA 2GF9A 5A5GA 3IDQA 4ARZA 2NMVA 5KDOA 5CM9C 3FMPB 1P2SA 1XRJA 1UKYA 4LHZA 2AL7A 5JHHB 4OKSA 4NYIQ 3DZDA 3MRSA 3V9PA 2V4ZA 4P4SB 3T61A 5GADl 2HLDA 2I4IA 3FFAA 2FDCA 3PUZA 4PTLA 1XX6A 1Z2CA 3B9PA 2O0KA 1KJYA 2QMEA 4M9ZA 1R0ZA 5H68A 4F38A 4BGDA 1F2UA 1X8LA 4URZR 3EZ6A 4Z8YA 2AWNA 2QAGC 3IBYA 4R2HA 1QBKC 2XZLA 1KKMA 1ZMXA 3T1VA 2YWEA 3AVXA 4A8JA 2NZ8A 2GK6A 3SEAA 1E9EA 2OHFA 4DB4A 1Y3AA 2NOAA 3CONA 4IFBA 3MMPA 4IW3B 4OK6A 4TMXA 1KK2A 4RD6A 2WIAA 4HAXA 2BHRA 2C03A 3CPEA 3TIFA 3GJ3A 4NP6A 3TVTA 4DLXA 1BMFD 1KSFX 3EIEA 1RC8A 1AQYA 1TF5A 1NMYA 4AKEA 1SHZA 1RRCA 4JT2A 5KDDA 1R0XA 2HF8A 2Y8EA 3FKQA 1EK0A 1J70A 3CF6R 1VKJA 4C0AC 4HZUA 2ODEA 1K5DA 3ADBA 2PJZA 3RSOA 1NVXQ 5SZKB 3WNDA 2CE2X 2IUSA 4TTRA 3KJHA 2F55A 3UPUA 4Q9LA 1ZUIA 1P60A 4JZKA 4I1OA 1SKQA 4LJ9A 2GZAA 3MWJA 1KJZA 2RHMA 1XTIA 5EE9A 4DLRA 3BB4A 1US8A 2FFHA 2GXSA 3I4LA 2YVUA 3I5YA 1JQLB 4DEXA 5H70A 3K0AA 1YE8A 5C46F 4EFNA 2D7CA 2J45A 1J8MF 1YQTA 3P32A 1HV8A 5IDVA 2XB2A 3QF4A 3VNVA 1T6NA 4AKHA 2D06A 4BEBA 3TAHA 5L3QA 4LBVA 5HCNA 4ERNA 1RKBA 4L9WA 2NO0A 2WVJA 1WXQA 2FF7A 3A4LA 2OAQ1 4A9AA 4Q00A 6Q21A 1Z6XA 2ANBA 1FP7A 2IUUA 1ZC3A 2W83A 4PPFA 4UNRA 2FN4A 3LX5A 2ZRDA 4II7A 3RLFA 2QSZA 4CYMA 4Y0VA 1G291 4BE7B 4MYCA 2IWRA 1DAGA 4M9SA 4DWJA 1T3SA 2ZS8A 4CEJA 4Z8XA 2BMJA 4TMTA 5TV2A 1KK1A 1N6PA 2F3RA 3QEJA 3DVLA 1OHHA 3DMNA 4A82A 3Q5EA 3O8CA 4BLOA
chains in the Genus database with same CATH superfamily
2QTVA 2VXBA 2Y2VA 2XUFA 4L3OA 2ETXA 3TRFA 3CEAA 2HMAA 2XNCA 3ZU2A 1M33A 2YJ5A 1T9AA 2Y67A 3PF9A 3V32A 5CGQB 3E8XA 3GLHE 4BPBA 1VG8A 3DA8A 1G3UA 3VM6A 3H9UA 3ROEA 1HDZA 2CJYA 3RAPR 2HMYB 3RUPA 4JR2A 3TQOA 2G9VA 4W9RA 3TW8B 2CFIA 2FK8A 2KS6A 3M70A 1E3LA 2Q5CA 1A88A 2PNJA 3TG2A 1NUSA 2OE2A 3KVOA 4RH3A 3G9UA 4N3BA 2ATCA 4KIGA 2IYXA 4S1WA 1H8ED 4DQXA 1ZJJA 1DARA 4XX0A 5HILA 1G4UR 1SRQA 3MJHA 4EB3A 4YCMA 2R5NA 5AVOA 4MCJA 2XADA 3Q3JB 2Q1TA 3ND7A 2PE5A 2A7XA 1I7LA 1I3NA 2DY1A 4PQRA 1ENZA 4DMFA 4ZD6A 2AV6A 2WKQA 2BMEA 3UCEA 2P35A 4M1KA 1NFRA 4W5NA 1M34A 3PJEA 4FW8A 3R24A 1HOTA 2JHAA 4RCVA 3BKXA 1TTQB 4EB8A 3GXBA 3NHJA 2PV0A 3D3KA 2G6TA 2O50A 3P7MA 4GAEA 1VBNA 3TOXA 4F3CA 3GEMA 3NHMA 4ZAYA 1MNAA 2HRDA 3EFOB 3RYTC 2Q2OA 4GGMX 5LOVB 1JPJA 1JDUA 5CCBA 1FF9A 1JB9A 3PC8A 5DXAA 4NBSA 1TEZA 4IZ6A 5SZHB 5CGZA 3VR4A 4M1YA 1JXQA 2LR0A 2KHZA 2JBAA 1Y48E 5EP4A 1KI9A 4PZZA 5NULA 2ZQZA 3U3KA 4CF3A 4WINA 4EB6A 1SUDA 4LCJA 3K35A 1WHSB 3H8VA 1WB4A 3THXB 3WSVA 1PJRA 2Y0BA 3NWEA 4GYWA 2O2XA 3ET4A 4F85A 5BUZA 4YJ3B 4XDZA 1XCOA 1ZNXA 3HUEA 4M37A 5CNKA 2EP5A 3TZEA 4B2YA 3FNIA 3FHCB 3LDUA 2XWSA 3MNFA 1IEXA 1E63A 1Y8AA 5AR1A 5KNDA 1T13A 3O4HA 1OC4A 5EN4A 1RJDA 1P1CA 2Q4BA 4JIGA 4PHHA 1G9SA 5CD1A 2Q3JA 4C0SA 4MCAA 3L4JA 1UT6A 1ECPA 3UMRA 4XJXA 2LPMA 3NC4A 2GGSA 3PUKA 4C7BA 3K16A 3CJRA 3WGKA 2ZYRA 2GHTA 2ON6A 4AZTA 2YZ2A 1P77A 2F1KA 4NABA 3EXG2 5DXJA 2EJBA 3WG9A 3ILYA 1GNRA 3ZE6A 3V5NA 1T0IA 3TPFA 2CHEA 5EMNA 1OX6A 4NCIA 3R7NA 1PFWA 3AUXA 1DZ3A 3TZBA 1ESCA 2ZI3A 2H29A 2J3DA 4JODA 3KSUA 5IHPA 2CJXA 4EG8A 5ECWA 1ENOA 2X7JA 3N2GA 1YK0A 3FF4A 4RS4A 2IV7A 4F96A 1JSLA 1TKCA 5JD3A 3CU5A 2CCKA 3TRDA 4PLFA 1ZK1A 2CLKB 2O2SA 5K0GA 1KTVA 1TUEA 3SIPA 3IXLA 4N9QA 2WG1A 1TU4A 3IUQA 1EI9A 5JS1A 3GIWA 1ADYA 1GSOA 5AKIA 1NBAA 2HLHA 2XTMA 3SC2B 1FFSA 5L9AA 1RJFA 2YMQA 1ZX1A 4OUDA 2ATIA 2IC5A 3EH1A 5A4KA 2B61A 1GG5A 2FK7A 3GDFA 4F97A 1G1AA 2YJZA 4G1VA 1TC1A 2OHHA 1RXCA 4WBSA 1E2DA 1RPTA 5BQOA 4B3CA 3LA8A 4C1NA 1NMZA 3C6YA 2FQ1A 5LIRA 1UODA 4RVDA 5IKEA 3HA7A 5EMKA 3OEHD 3R3HA 4P3NA 2CKMA 2VC2B 4J0JA 2W11A 4KXWA 3LUGA 4LQDA 1EZ1A 2WJYA 2YKGA 1UINA 1O96A 2I78A 2DOKA 3K8OE 1FSFA 1WUYA 3GCGA 3AOEA 1TECE 1NOJA 2W2PA 3QWAA 1WHTA 1JHPA 3BAZA 4UEJA 1GTMA 1MPTA 4P98A 3T15A 1NN3A 2FPSA 3VXKA 1W5SA 1YZVA 3EXHC 4PANA 3QE3A 4ALNA 5AM1A 2LIVA 2QJTA 1R6XA 4GMHA 4KWEA 3UWKA 4C14A 1RHJA 4QTYA 2JCVA 5BPFA 3A26A 1GTSA 3R8FA 1QRSA 1QCYA 5REQB 3K1JA 1IQ0A 3NVMB 1N2IA 2TECE 3N39C 3NHBA 4JY7A 5AKJA 4RJ2A 4G5OA 3S7TA 5H80A 4YJFA 3G7SA 1XEXA 3PRKE 4YRPA 3C3EA 4I5FA 1JFLA 2IZ5A 3FH0A 1MC8A 3GH1A 3QUSA 3EQ2A 2VAXA 1JFVA 5DHRA 1M2OA 2MHCA 5A7FA 2P5TB 4P7KA 4BMOB 2HSWA 1PTJA 4EG7A 4RIEA 4Y1RA 4F9TA 3NKLA 3EZ9A 1UH5A 1LBQA 2WB4A 2Z1MA 2ZIWB 3A28A 4I55F 1QZUA 1T5SA 2NSJA 2WPDD 1D04A 5FUXA 1P29A 3ZBPA 1FNNA 1JSZA 1P80A 3MQ4A 4D8TA 1R9JA 2DGDA 7AT1A 3N1UA 1NZFA 3A4NA 5ALMA 1KO5A 3O8LA 3AYXB 3FPJA 2CVFA 1PFKA 2A9JA 3AV3A 3PXEA 5L4LA 5C52B 2CT8A 1N78A 3DZFA 1GU7A 1Z56C 3UFBA 1L4LA 4UUMA 3NCTA 3TLBA 1SOWA 2J87A 4X3CA 3A58B 1OREA 3VKWA 2VDLB 1Z5WA 4C4OA 1I13A 4HLUC 1K2WA 2UYQA 3TNDA 2C4NA 2PGIA 3GJ8A 3D0RA 3IGFA 1F38A 1IOZA 4LC9A 1GADO 2WINI 3DAFA 1RXWA 4V0KA 5HFJA 5LXTB 1SKYE 3EQ8A 3A4VA 3PRYA 4DXHA 4CIAA 1RPNA 2ZRJA 3AM5A 2XBMA 1VIVA 3AEUB 1AB6A 3OURA 3U3OA 4J2TA 4OLAA 3P27A 4XCXA 1G2OA 4IVRA 1P19A 5CVUA 2A2ZA 2WJVA 3A4MA 1F20A 1FRVA 2JGDB 2W6OA 1NW5A 3DKKA 2G1PA 3E1SA 2EERA 4FBGA 2DUWA 2OAGA 2GXQA 2I29A 2VHCA 1JXOA 1Q14A 2JGMA 3CQ9A 4P92A 4DSOA 4OUKX 4NF2A 2ODWA 3CZRA 5ADHA 2GEBA 2WD7A 4XIFA 1DUVG 3BQ9A 3VA7A 2DX7A 2YV2A 3JX9A 2XT9A 1IJKA 1L4YA 1DKQA 3OJXA 1HYGA 3T95A 6NULA 2X4LA 2FCRA 5LJIA 1TA4A 4QQKA 3NU1A 1R4ZA 2R1ZA 2VT2A 2ZIXB 4MVJF 1XJQA 2B3DA 3IVAA 4DNFA 5HTOA 3AINA 3OOSA 3S99A 1E3IA 2X6QA 3I3SR 4O2AF 1R9MA 4GPZA 2O6HA 3K3PA 5A04A 1TZJA 2BFNA 1F0PA 2VLBA 3LT2A 1D0SA 1RLTA 2QB5A 2OQRA 3KJFA 4BNXA 3TSOA 4E6PA 3UBTA 2ZR0A 1W0CA 3ONWA 5K3BA 4R1NA 4GXRA 5IKPA 3N8GA 2G83A 1KQGA 1GLNA 3MXOA 4UHFA 2Q3LA 5C37A 1JFFB 1XMVA 2QNRA 2VTBA 1NUPA 1S2OA 1A9PA 1A9ZA 1C4XA 2ROQA 3L0ZA 1GN9A 2C7BA 3B48A 1XDSA 3H87A 3IJEB 2PYZA 1R74A 3EN0A 4NIMA 1WQ3A 3QELA 5DU2A 5EP2A 2GO1A 4RQAA 2X4DA 3EZFA 5K6AA 1BOFA 3H5TA 2Q1WA 3E5MA 3FVRA 1RXIA 1ZIDA 3C5VA 4G4JA 5D7NA 5A7GA 4G0XA 3TBFA 1U0FA 3OA2A 1PQWA 5FLYA 5DV9A 4DV7B 1XTQA 1QM5A 3WFIA 3K1YA 1VRCA 5ETJA 3VC3A 2D5CA 2WWGA 2R00C 1HURA 1FU7A 4BFUA 4P2GA 3BJIC 1RI5A 2WOOA 4BV9A 1RRCA 3EVGA 3S6JA 1UKZA 2F48A 2ZRLA 2TS1A 4U4AA 2P2SA 2V6FA 1KO7A 4IIJA 3DLHA 1F6WA 1C80A 1E60A 3P8ZA 4H6WA 4AY4A 1WA5A 2PSEA 3R9IA 4EAQA 2PCJA 3O8BA 3NVDA 2GAOA 2GK4A 3WYNA 2QKYA 1NVMB 3PNBA 1MC5A 4MV6A 2RHCA 3LIPA 4IICA 1QWSA 1DKUA 3LZ6A 4YQFA 1O97D 4F0JA 1N6KA 1BDJA 1XGKA 1XQYA 2Q07A 1YBFA 2WG0A 1GUZA 3LT1A 3QK7A 4P5PA 4Z5XA 2XKKA 2XNKA 1U3FA 1NI4A 2NP6A 3CLRC 2RHTA 3MM4A 2HXYA 1G8SA 1CNEA 4HUQB 2JJ1D 2Y1CA 1EVEA 2RGNA 2BOVA 2OILA 4DA8A 4DBZA 1MJNA 1IM2A 1OFUX 1RBZA 2OB1A 1HH4A 1Y6ZA 3E22B 3GAZA 3RO7A 4C0BA 1IFXA 1R00A 3QQPA 3F4KA 2NO6A 3HWX1 2BTQA 5AI5A 2IPLA 3EIHA 4B34A 1BH2A 1FTYA 3O4GA 4S12A 2AMVA 1B6TA 2FE1A 1EVJA 2PNFA 5K3FB 4YT2A 2QPOA 3GVHA 3LQKA 1DFIA 1P5ZB 4UVHA 1DP4A 1TADA 3T5PA 3HGMA 2GPSA 4ZAFA 4BE9A 3ANLA 3B85A 1F2VA 4OHZA 2POCA 2WFZA 3AB7A 4OFXA 3H3FA 2MSEB 3H04A 4W6QA 1KSHA 3F46A 1E1NA 3QPVA 2NVBA 4M3NA 4PVCA 3WL6A 5L7WA 4RJLA 2RSLA 2VHEA 1NQTA 3NWOA 3OT4A 4MW7A 1JMVA 3GRRA 3FW1A 2B69A 2BHNA 2FWMX 4C0WA 5LMZA 4I4IA 4NRDA 3KZCA 5ALYA 2GUGA 1PJTA 2HCTA 5FPYA 1IJEA 2QRPA 4LA4A 1EFVB 4ZGBA 4JXXA 3P94A 2G4CA 3G5TA 1QANA 3P9YA 4IS2A 4PZCA 4BQRA 3ND6A 3PFIA 5LYJA 1M6EX 4IUYA 2F8MA 4BUZA 3GROA 3OQJA 3F8WA 1LNQA 1WIWA 2VF7A 3HE3A 5FBQB 4YFVA 3UTCA 3DO5A 1QFZA 1T2DA 4EPXA 4L9SA 4IDAA 3OQIA 1X1SA 1BZYA 121PA 2GD1O 2PTGA 3CN9A 4FBLA 1SK8A 2GWHA 5TMDA 2LP4Y 4MW5A 1SVMA 2XMBA 3M6AA 3TRKA 4F6CA 1VCMA 1BX0A 2DFNA 4Q66C 3ZQ4A 3MSXA 2C58A 3UANA 4QECA 2FZGA 4ENWA 2YVAA 5EKSA 1UK7A 6REQB 3IQXA 1BVUA 1ODKA 2XUIA 4L7VA 4N5NA 5FXMA 3A0RB 2NZVG 4F45A 5FNZA 2QTZA 5EUMA 4KE8A 1B7GO 1T24A 2I2WA 3K09A 2XT6A 5EZ6B 2BGRA 3A36A 3W9UA 4EABA 1N5MA 2R6JA 1AO0A 3AY0A 1E3QA 2DHDA 4FD2A 4M0DA 4RDCA 5EUCA 4E07A 2W22A 5AI0A 2FQXA 4OQMA 5BQPA 1ZSVA 2OV4A 4QDTA 4XWWA 2EJCA 4DLVA 4WACA 1NP7A 1LNSA 3OCUA 4C06A 2MSWA 2R1UA 4A26A 3WMWA 1NWCA 3L0BA 3QW4B 1AKMA 4V24A 1JLKA 1PLKA 2ENWA 1ZH2A 1W36B 2B0CA 2ZIUB 4RO0A 5AVSA 2IU0A 1R6VA 1RFGE 3RVOA 1XKLA 1DMSA 3RVLA 4K9LA 2X8WA 4LJ6A 4HQLA 2CW5A 1T1EA 1PZEA 4IMJB 4QBTA 4GLBA 3G8AA 2HMSA 5CVTA 1LTQA 3D0OA 3TM4A 1WCXA 3EDRA 4OU4A 4PCLA 2ZB7A 4A8JB 1W87A 2RK4A 2X9NA 3OWOA 2YWCA 3HY4A 4EITA 221PA 4EJSB 3TUZC 3KCQA 2FKNA 2YZMA 2OP1A 4XRRA 5EZYA 3VR6D 5HSGA 3KT0A 1P5HA 1LI7A 4RZXA 4Q1DA 1U2ZA 4LNAA 3QXXA 4RJTA 5JSUA 1H6AA 2VHYA 4FX5A 2FXIA 2XYRA 1R5JA 5CNIA 3CH7A 3GWZA 4R9RA 3UICA 2BSQA 1TAUA 2IX3A 4F4HA 4OM8A 4Z7QB 3PFFA 1E58A 4CKYA 4HH0A 2WHPA 1UMDA 3PTAA 5I5GA 3QH4A 5K20A 1T8YA 1VIYA 3DE1X 3L06A 4W63A 4YRJA 1ZXLA 1UBOS 4X3PA 3BXHA 3WLAA 4ARBA 3ZEAA 3QTBA 4TMFA 3USCS 4C5BA 3K2QA 4TLAA 4WLEA 5TPZD 5D5HA 2MSCB 2AE2A 2WIFA 1N2JA 1XCJA 4MV8A 1QVRA 2HA5A 4DLUA 2NVWA 2QGZA 2PXAA 2VRBA 3KLMX 5DYGA 1BEZA 1Y7HA 5K6AC 5DLEA 1SIBE 2QL7A 3PZRA 2YHSA 3NEJA 3U39A 2Z56A 1US8B 1KEEB 1GR0A 3SGLA 2WSSA 1XCBA 4GYYA 5I7SA 4ROSA 4IHAA 4IKEA 1XJ0A 2AG6A 1Z06A 2R6AA 1ZI8A 4K9KA 3MWLA 1KY3A 3D7LA 2ZPTX 4EO7A 3GMSA 4CGYA 1C30B 1C3OA 1K4MA 2B2XA 4HLDA 4M0FA 5A9SA 3LPMA 3WKEA 2R87A 1LDEA 4NESA 3ZHSA 1OLOA 2MYUA 3EULA 3HWRA 4LRTB 4WD3A 3LPDA 5DYYA 5LL6P 1YAHA 4WZBB 4GP7A 2OCBA 1UOOA 3ONEA 3SEZA 2HA4A 2CF5A 3HBFA 2Q5IA 4CWAA 3K70C 1QG2A 3I8XA 3D3JA 3OFSA 4KQGA 5B53A 1BS9A 1KYZA 4JJFA 3KR2A 4I50A 2GCPA 3VPAA 2BMAA 5I8ZA 4RAQA 3THYA 1NURA 4GYJA 1Z18A 3K8QA 1CIJA 4LK3A 2NU9B 4BVGA 3D2BA 2ES4A 2WZDA 3OM9A 3P0HA 4MYRA 1YA4A 3MYRA 4AZVA 3FIJA 4LY6A 4EY4A 1N5IA 4BJ1A 1Y5NA 3KUCA 2ZB8A 5JAQA 4EOGA 1FXWF 4EY5A 4Z7NB 5B5SA 3AHGA 3HBLA 1AS2A 1O89A 3BXXA 5KAMA 2MYNA 3BDVA 2FHSA 4MSUA 4Y18A 3FWHA 3TXXA 5AHOA 3GZJA 2A59A 5I51A 1MHPA 4CF7A 5C80A 4JKYA 3IVGA 5CJJA 2PGNA 2RGCA 3ANXA 3ZHVA 3WGIA 2J4DA 1W6RA 4PICA 2XD9A 3GJQA 3JS5A 4MRMB 2HU2A 4XLZA 3CZCA 2AVNA 3DR3A 1FDWA 1IK6A 2GZMA 1DAFA 2IP4A 5TQVA 4IWXA 1KH2A 3NCHA 4WKNA 4EY7A 3B1XA 4JLOA 4N49A 1L5KA 4LJYA 3K1AA 3S2GA 3P2JA 1VLZA 4ENRA 3OCYA 3EZYA 1I2AA 1IATA 3QGMA 1OFGA 2W6PA 1CSEE 2O23A 4LXUA 1KRXA 1N5JA 2GHIA 5I7AA 3KWLA 4HNHA 1HRDA 3BTUA 3K94A 4M36A 4Q47A 4CKBB 4EY8A 3RC3A 5I7RA 5IXYA 3F6YA 2UUAB 3ORQA 4QAQA 1O9BA 4QJ5A 5HK8A 3JQ9C 2ZYSA 4GZ6A 3LW7A 3Q0IA 1JJFA 4KMRA 2ZDHA 1IZYA 1R0YA 4EAAA 1CJBA 4X1YB 4JI5B 5HGJA 4KTTE 3V2HA 2PBRA 3D8BA 3WHLA 2O7SA 3VYVA 5K8TA 2PUDA 3RYCA 2P2CA 2CXNA 5C1PA 2ECPA 1XQ1A 4G86A 3V80A 3ZDBA 4GECA 2VJCA 3CX4A 3IKVA 4WK2B 5DKFA 2ORED 2ZE5A 3E27A 3EIXA 4MP3A 2I67A 4REQB 1Y5MA 1QWOA 4ALMA 1M2JA 1NUAA 2CVPA 4KO2S 4D96A 3G7NA 2BWJA 4D5GA 2ZT5A 1K0UA 1Q3KA 4OHKA 1XDBA 2Z5VA 3IELA 2A0YA 1CYDA 4X63A 3CPHA 4YJHA 5A6SB 4AQDA 7MHTA 3UMVA 4G63A 1ATZA 1C0KA 2CL5A 4FMDF 3UT0A 1DI0A 3C3BA 1VYTA 4RY9A 5EWJA 3TLYA 1NW7A 1Z7WA 5KYUA 2YUIA 4C6TA 3JZDA 3LHSA 5A0FA 2AZ4A 2V0CA 2R6R1 2VT6A 5DGTA 3LZCA 5ALFA 1SUIA 5FD8A 3VYSB 2JH9A 2R7AA 4NCHA 4GBGA 4CKCA 2VS1A 2WWVD 1BU5A 2AC4A 1SU7A 4EL0A 2C1XA 4BJ5A 4RVOA 4J0DA 4MW6A 1VMAA 1CQJA 2GPYA 2Q6TA 4WY5A 3I6MA 4GEKA 1EAYA 3B2EA 2Z58A 2RAUA 3OLVA 4DQKA 1PKXA 4F21A 3L7NA 2MT9A 4IIUA 1R6AA 1YIOA 1MRZA 1YZFA 2XMSA 3URKA 5M04A 4KQXA 1EFRA 3NVAA 3IP5A 5DWQA 1Y82A 4P0QB 3LUJA 4UM7A 2AI3A 4LQCA 5CIYA 2K4MA 2VAWA 2XUJA 4GPAA 4TSFD 3HCOA 2FTKE 2EQBA 2WF9A 3RFCA 1PYDA 2HUNA 2P79A 3JAKB 3K0CA 1L7QA 5E3HA 5AW9A 4DQVA 4RLQA 1MO6A 2BCGY 2D13A 2O7VA 2WAOA 5DASA 5EJ2A 3UJ7A 1E0AA 3ZHCA 4U1RA 4BLQA 3ABQB 4E1AA 2OCXA 2QTLA 5KYXB 4BY9E 1KVUA 3QNWA 4IOLA 2C77A 3HHEA 3L6DA 3QPDA 4B48A 2F17A 3P9QA 5KDLA 1J5XA 2QLNA 3RYIB 2C5HA 1PGQA 2VYCA 2GZDA 4A92A 4OHVA 4QSHA 3AHFA 1QIMA 2VRWA 3QBVA 3C1OA 4B45A 5ADWA 1GPH1 1GG9A 4TVOA 3GZNA 4WCFB 5EJ5A 4BAZA 1JQ3A 2C1EA 5K4HA 2JI8A 3I01A 2I22A 4OKNA 2ZP1A 4P4GA 4XJTA 5EAIA 2HMWA 2YRXA 5JSYA 1FMJA 3DDUA 4EMBA 1NVEA 2MSKA 1RLUA 2VDQB 3MWDA 4M8SA 3LLSA 1WG8A 4JP5A 4JLJA 1FUEA 5JAUA 5BQXA 2BAGA 4P22A 4GO1A 1P1HA 3TIXB 3VO9A 1X9IA 5T41A 3OZDA 4MWTA 3DMTA 1FDOA 2NW6A 1FRQA 4JC8A 4IFTA 3L8EA 1KE2A 1U1EA 4M8IA 2WUEA 2XCIA 4MLPA 4D0LB 5FNVA 1Q0LA 3CG0A 1O58A 2PWZA 1VC2A 1G4AE 1OAOC 2FPRA 2O2HA 1XROA 4LQ4A 5K0LA 3ZVNA 3EUWA 2PR2A 2RMKA 3VI3B 1KAMA 4YP1A 2QV0A 3EGXA 5GMOA 2Z4SA 3OICA 3UQZA 4K87A 4DQDA 3AEXA 1L7RA 1QONA 2PX2A 2AD5A 2XDQA 3VDNB 3BB3A 2AOVA 2JLUA 2OFFA 3ZDFA 1C0LA 2Q4EA 4CCSA 3C7DB 3GO4A 3D5QA 4L5YA 3VTFA 3FGOA 5EFZA 1NVKA 1A4UA 1J8YF 3QEAZ 2DT8A 4NYMQ 4IJMA 3RADC 3QBEA 2H1OA 1G7SA 2G28A 2NU7A 3KWMA 5G40A 4TS1A 1X7WB 3OQMA 3D6FA 2J0EA 3A1TA 4P7JA 2VXOA 4AS3A 1UIMA 2I6TA 2I4OA 4FWBA 4HRAA 2E18A 1BWQA 1VDZA 2WDPA 3ND8A 2WUDA 4X0EA 4FFPA 1A7KA 4C30A 1CKEA 2DHRA 2MSDB 3S8EA 3AJ8A 5LC1A 4D9CA 4EDHA 3HM9A 4UASA 3T7KA 2JHPA 4QL3A 2VUHB 3EGDA 1U99A 1Y8RB 1PR6A 1C4OA 4Z9YA 2FWIA 2B4TO 5C8YA 4XFJA 1NDUA 4LYGA 2WAAA 4ATNA 2YXNA 1F06A 2B82A 5I9SA 3BL8A 5DW3A 2AJBA 3QLVC 1H3NA 4AUKA 1GZ4A 1FFDA 1Y9ZA 1QCZA 1VG9B 4PG5A 1V5FA 1K0FA 3QJGA 3NORA 1L0BA 2HWWA 1T9GS 3BF8A 3IULA 4R0VA 4ZCTA 4MI1A 1K92A 4OMCA 1TB4A 4YEDA 1U7DA 2V3VA 3I9LA 4IXTA 2WUVA 1S96A 2QUZA 3EY9A 3R5SA 3RABA 4AMVA 4Z4EA 1XJWA 3GQBA 1M0EA 4KXMA 4UNSA 4U7HA 2C95A 1MTOA 1G8MA 2FN3A 1RQLA 3JQRA 3TTSA 3DKPA 5EIAA 4C4ZA 4E6EA 1NRJB 4LOJA 1S8OA 2CLLB 4MR9B 1A98A 4N0EA 3PZBA 2JF0A 2HB6A 2JGRA 1NKTA 2W9XA 3B53X 1GU0A 5ICGA 3WL4A 4Y6PA 5ALHA 4QASA 1ZPDA 4AU1A 2LTAA 3P4XA 4F3TA 2GA9A 4J16A 2TMGA 3U3RA 2GNPA 3WHPA 4EQ6A 1N8KA 3TIVA 5JZSA 2M2IA 3LLVA 4PNEA 2UYOA 1SKUA 5EQJB 5L4SA 1QF6A 1SBQA 2CNDA 1W35A 3OIGA 1QDUA 3STTA 4JUCA 1N5LA 4QUIA 1SPXA 3E9YA 2JEYA 2PGXA 3RYFA 1A3CA 4OGKA 3L7AA 4DLPA 3HSSA 2VJNA 3RT1A 5AVUA 3A2KA 4RPGA 3NT4A 3DYVA 1KIMA 4YTEA 5BSRA 1Z12A 2ZJ7A 1JG4A 3SFZA 3ENKA 4YR7A 2J9RA 3KEOA 1A9OA 1VHTA 4GL2A 1EG7A 5A4DA 4C4SA 5CA1A 1L5NA 3EPHA 4LMBA 3BXFA 4PSCA 5JI2E 3GW8A 1DJLA 1YR9A 1JDBB 4R1QA 3ND9A 2G36A 3DBVO 4UNIA 5GJVC 1G66A 1XZNA 2QD5A 4MVJI 1DC8A 3F5DA 3QI7A 4I1IA 5A05A 4DV5B 1QMGA 4C88A 1AGRA 3OTOB 3EQ6A 5AD1A 5JXHA 1N25A 1V35A 1U6IA 1YR7A 2JJYA 2QZZA 2WTBA 4Z86A 1IHYA 1CWUA 5E3IA 1D9XA 2E49A 2FZLA 4YV2A 4Q9AA 1D1QA 4YT5A 1G20E 2EL9A 4M2LA 1C0PA 3NOVA 3NOOA 3OUTA 2AUNA 2GHQA 5HJ7A 2PMFA 3ELUA 1EX1A 2P77A 1IZ8A 3H05A 5HG0A 1YS4A 4AZ3B 4BMXA 5IX8A 4FNMA 4I4TB 4GWGA 1P3DA 1UR5A 2HRBA 3TINA 2DZDA 3H2ZA 1YK1A 5K8JB 1TGYA 1J2RA 1R1DA 4Z9XA 4LXHA 5GOZA 3GJZA 1U3GA 5B12A 1E2MA 3M83A 3USES 5BNIA 3GI1A 1QG4A 5B7NA 2FFRA 2RONA 2WY2D 1GRCA 1GZSA 2NX2A 3DT8A 3M89A 5IBPA 8ADHA 1X1DA 1ZJ6A 2JI4A 2GLTA 5B3KA 3LYUA 4QUBA 3FCSB 4WFIA 4YRBA 5AM0A 4NMXB 5DTMA 1SULA 1WUTA 2I1QA 4LTDA 3FZEA 1E1YA 3WIDA 1HDGO 1GTVA 4ZQHA 8GPBA 5IVPA 1HLPA 1TUGA 2G80A 3MT8A 4YLEA 1EWRA 3MPUA 3MBIA 4OF4A 4AYWA 3CNEA 2QTFA 3L0DA 4RK0A 3GF4A 5AICA 5DVZA 5C3UA 3R0ZA 2JGNA 3NP7A 4CV0A 2HC9A 2R8BA 3MCTA 1L5OA 3QUBA 5DSTA 1FYWA 1V2GA 4DWOA 5DX1A 5TDHA 4E7OA 3EXFB 3GFGA 2H65A 4WKGA 3G5UA 3ANTA 3I01M 4NARA 4EGCB 1FYEA 4G09A 1LH0A 4GX1A 3FVVA 1W2WB 3TAXA 1CQZA 1WDKA 5D85A 3TQCA 2VDUE 1KKLA 4E1VA 2ZJ8A 5ESRA 3OQPA 2EW2A 4NBTA 2QUAA 4H4CA 4US0R 1FZQA 1P45A 4YYEA 5FL7A 5CAEB 2R1VB 3LLMA 4IJ6A 1TPZA 4OLHA 4RGYA 1SCJA 2R68A 3KS9A 5FR1A 4EYQA 1GAWA 1RKXA 4BFCA 4BN4A 1FTQA 1D9ZA 5GONB 3NHZA 4URFA 5CIQA 5ECYA 2D2XA 4JBWA 5G4LA 4CIVA 4DYDA 2GVNA 1ULAA 2IU4A 2QGFA 4M9UA 4BASA 3RGGA 2J0UA 2NT4A 4P81A 3FI9A 3TTTA 5C4MA 3GP5A 2EJTA 5CVJA 2OHGA 3TGPA 1M10A 1T0JB 2B98A 1OXVA 2P0EA 2JFPA 4DTCA 1W0KD 1BMDA 1XALA 2PIAA 1G5RA 5GJCA 3CRRA 2K2WA 2OXRA 2NUAA 3MTQA 4BS9A 4DMCA 3NJ4A 2JRLA 1LPBB 1T1JA 2Q8NA 3NBMA 4J0QA 4J9VA 4TXMA 2QD4A 3IIJA 4MJ3A 4UD6A 1VDMA 3ZZ1A 3DMGA 1L5SA 2F3QA 1T9DA 2PGDA 2Y6VA 5TMEA 3ETCA 3S55A 4BCCA 5JYEA 1ETUA 1T3ZA 1MMFB 4UEQA 2QDKA 1B8UA 2ZUFA 1I1NA 1QF7A 4EG6A 1NF3A 2PM8A 1JQEA 2E3JA 3HUUA 3M8KA 5MFPA 4PZPA 5LP6B 2MIIA 2YNMD 5HFAA 1PGJA 4EG0A 1SC9A 5ICMA 1VPLA 2QRLA 2PBZA 1CR1A 1U28C 3L0YA 3REQA 2PZLA 1FMTA 3RFTA 1IEWA 2XYQA 2OZVA 3CRZA 2ESRA 3GNLA 4BQPA 4AROA 2E4YA 3DTVB 3QMPA 1NI5A 5JJBA 1TYDE 1TMGE 1C0IA 1Q19A 3H4TA 2QUKA 1OBFO 2DWQA 1KS2A 1B0AA 1NLZA 5E6UB 3ROTA 2WWHA 1RCUA 1XNHA 2JIZA 3AC0A 4P3YA 3CA8A 2PZ8A 3T3PB 4AJ1A 3NIBA 4TV9B 1NBMA 4QGAA 3TD6A 4ZT6A 2W71A 3G02A 5EZQA 4GBED 2NPIA 4WZ6A 5JFTA 3Q5DA 3RC7A 3E7DA 4HX2A 4NU0A 3L79A 1XQ9A 3FKSD 4KBGA 4WGGA 2I54A 4J7XA 2ZYIA 3GIDA 5T4HA 4DPKA 4YRAA 2OV3A 1XKQA 3FA2A 3SSNA 2YY7A 4BO7A 4F1KA 4LJ5A 1CNMA 3GJRA 3EHDA 4KE9A 4U6SA 1AVTA 1O94A 2IPNA 3BB1A 5CTAA 3NATA 4YDQA 5HZMA 1FS6A 1SHKA 3UT5B 2H9YA 2NU8A 4JQOA 5YASA 1EGHA 3ICVA 4EJ2A 2B94A 2XWJI 1G17A 5JU6A 4KAJA 5CURA 3WFJA 2PKCA 2Q9UA 4NJEB 2KLBA 5ADUS 4FGJA 4XCVA 3A27A 1LGYA 4BUCA 4KSYA 1R4AA 3ICCA 5DHUA 3RTGA 5JQGF 4I1SA 4JVOA 4F91B 3H7AA 1LBTA 3PXUA 3N2KB 1DC4A 3U6KA 5KU1A 4KPFC 4TXNA 1CULC 4Q3LA 1JXAA 1DCKA 2R6CA 1ZVJA 4I66A 4Y7DA 4MRVA 1YZLA 2BHLA 5F64A 5IEBA 4DLKA 3PX3A 5FWYA 4GSLA 4JVLA 1EX7A 4QO8A 2FP4B 2QOEA 1UMBA 2IEYA 2J67A 2ZTMA 2EKPA 4H16A 3I5UA 4G4IA 2WB2A 4OFZA 5SYMA 4GI5A 5EKDA 4N7RA 2R5FA 2FMFA 3AUUA 2WJ6A 5AW8A 3DV0B 3ZVKA 2C1ZA 4RIGA 2C8VA 1HZJA 2DT5A 1BO6A 2HX1A 3DEFA 1VCHA 1M2VB 3CF4G 3JQBC 1BC5A 4I3HA 4DM3A 3DPIA 2NV6A 1C9MA 1XZEA 2DBVO 3NAGA 3MS7A 1CF2O 3IVRA 3LKBA 1ZCZA 4JB8A 3EUFA 1CVLA 3NYRA 4B3DA 1FFYA 3NHKA 3P5SA 4XA8A 3V4FA 4D4LA 2UKDA 3GJSA 1Y1PA 2J9GA 5BRJA 3X1WA 4BYMA 5AHRA 1GDTA 1QAOA 3DZKA 3QV1A 4NV3A 4XQCA 3ADPA 3CUVA 1CUWA 2DRIA 1NE7A 5AKZA 5TVGA 5BV0A 2NQ2C 3FWNA 3TSZA 5JAHA 1ZIPA 3PKJA 4PWZA 4YUYA 1I4EB 1K8QA 1ZOIA 3OCCA 4NSNA 4B6GA 3SJUA 5L6MB 1WCWA 2OZEA 3QMWA 4Y0AA 4AJ2A 1J6UA 5SZIA 1JAHA 1P0MA 3F8SA 2Z83A 2AFHB 1VSUA 1L6IA 4IL5A 2IELA 3WGUA 3RFVA 3IPAA 1CK4A 1FSSA 1GVNB 3KIPA 3MA0A 5IBRA 1TZMA 2HPVA 1O5IA 3QTLA 1XELA 4BFLA 4LGMA 1A1VA 4E2FA 4I1UA 1A50B 4GZ5A 3B8EA 2VO1A 3FBGA 1ORIA 4C4RA 4B35A 1PNOA 1XQ6A 5FA5A 3HP7A 3H5IA 5JH7A 1UQRA 3LGXA 4IXNA 3FTQA 5DTQA 4E51A 4L51A 4V0LA 1SKAA 4BTLA 4EJFA 5B55A 3X3HA 1T29A 1RLJA 4L4XA 1IAQA 1W36C 2WYVA 4LNHA 1E8NA 1XUOA 3JWHA 3D31A 2FZKA 2AW3A 2J1LA 1XF9A 2MCFA 1Z4MA 3UIEA 3ZE2B 2HBQA 1DX4A 1Z6TA 2I71A 2PMEA 1DIGA 2YVQA 4AVYA 2Q6VA 1JHVA 1Q95A 4A8JC 1PQYA 1ZAKA 4EJSC 5D6NA 3DO6A 2GYVA 2H0RA 1OT5A 3C97A 4ARSA 1YR6A 1MABB 4ZYUA 5JDCA 5HIJA 1Y4DE 4M1EA 3RHZA 4OI0A 1XU9A 4DDUA 4HLNA 2Z30A 1W5AA 1UF9A 4N9WA 2E1RA 1RIFA 2XUHA 3WA6A 1UBRS 3ORSA 3ER6A 3RTCA 1UBTS 1Z0AA 2QE7A 3KHUA 4OXYA 4P33A 2ERCA 3W2IA 5ALUA 1L4MA 2D7DA 4MB0A 5GV7A 5FOVA 1EWTA 3C70A 1K6EA 4FR0A 2GSDA 1YF3A 2YHBA 3F3YA 3RR2A 5EXXA 3GJ5A 2Q5FA 4AD8A 3EK2A 3RC9A 2Q5OA 5JNVA 3KZ1E 1OE0A 1Y3DE 4MTCA 5ES4B 4N03A 3BDAA 1HETA 3ONFA 5C1OA 3KM0A 2WMDA 3Q3VA 4P38A 5IT5A 1JLMA 2ID7A 5IBQA 4QUGA 3FDZA 1QCDA 1OXKB 4Y3UA 1C1YA 2RGUA 2UZ1B 5F77A 3DCNA 2OECA 3UUEA 1FU4A 3KL2A 1DTWB 2H17A 3T5DA 2OQ2A 3BE5A 1UBUS 5BSFA 4FYYA 3LYAA 2J48A 2VT7A 4OYLA 4TLMB 1P5JA 1KAGA 2PX8A 1TMOA 4UAGA 5LQDA 1E4VA 1VL8A 1PNVA 2WWIA 3E7WA 4OL9A 3PHHA 1GKKA 5LDHA 3ZNOA 3MRXA 1DXHA 1SCAA 5IYZF 3ZGOA 3LBHA 2OAEA 2X0RA 2VTDA 2QVYX 4R8RA 4B6RA 3K1ZA 1U0JA 2Y76A 2CYAA 1OY1A 4UMDA 3IA7A 1TM4E 4JBHA 4YV0A 1CRPA 1KEPA 2NVOA 1GQRA 4ECAA 2ZJ1A 1E1CB 2G6BA 3I4FA 4LDJA 5EPEA 4Z2YA 1XWFA 2C59A 4INJA 5I6DA 4I1RA 2HN9A 2V7TA 1A72A 1Z4JA 4EYOA 5ICFA 1VE1A 5J4LA 3RSLA 4PLPA 2BDTA 3MTJA 5IM5A 3EIOA 5KPDA 4N5LA 3T1NA 5C5CA 1CE8A 4TYPA 1OH8A 2A92A 1RYZA 2WSBA 4D92A 3LX4A 4JUIA 3T35A 5DRTA 4X8OA 3A4YA 2H18A 4D9MA 1SVNA 2ZJ6A 3AVYA 4HT3B 5BN3A 4C76A 4EBBA 4LVCA 3ED5A 2ZWIA 4ECEA 1ZUNB 4PIMA 4YRMA 1KP9A 2VSFA 1E4OA 1II0A 1Y6RA 2CHGA 3F1KA 3PPYA 1Y89A 2TMKA 3INTA 2LVBA 4QEDA 5DNWA 4BFTA 3CIFA 4DCMA 1NAHA 2JAWA 3H84A 4ZFNA 5B3LA 5KSYA 3KQUA 1TF7A 1L8OA 4KYVA 4YJ2B 2QK4A 1FX0A 3Q9NA 1ZO8A 1YBMA 3IEMA 4FCVA 3ANMA 5IF9A 4UULA