4NMMA

Crystal structure of a g12c oncogenic variant of human kras bound to a novel gdp competitive covalent inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 64
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nmmA00
3B6EA 3NDBB 3VMFA 3QKTA 1G41A 2H18A 3F3YA 4TMZA 2OFXA 1KK1A 4LYHA 1QHYA 3D6TB 3IIMA 1XXHB 3EXAA 1ZUIA 5KSYA 2O8BA 4JYCA 4F91B 1Q44A 3LW7A 3PFIA 4AKIA 2VSFA 2PEYA 4BFXA 3U6BA 1CR2A 5GADl 1NVVR 4P4SA 5KDOA 3GLFA 1E99A 4B3CA 2BC9A 4LX0A 4Z51A 1JPNA 3TH5A 1VHLA 1H8HD 2DWQA 2P0EA 1Q1EA 1H8HA 4G1UC 2G0NA 3M4YA 3TQFA 1CJTC 4OL0A 1JR6A 4QBIA 4XSHA 4IJMA 2HYIC 3RWOA 1F60A 4NYMR 3KJIA 4B6EA 1AQUA 5JBQA 4LK2A 1HE8B 4Q9LA 3MGCA 1JECA 5KDLA 1KI6A 1IJEA 5DN6D 2CXXA 5DN6A 2ZE5A 4A4DA 4O2RA 2XXAA 2WWHA 5EE9A 4DZZA 4OBEA 5KTYA 3K9HA 4PQYA 1TNDA 5EXTA 3VR3A 5EJEA 2ZI5A 4LHZA 1KO7A 5DI3B 2N46A 5FOTA 3K0SA 1ZAKA 2C95A 1EFCA 4H1VA 2J46A 3NBXX 1CRPA 2GA8A 4DDUA 1BO6A 4ACAA 3AVQA 4M1MA 1XZPA 3VX3A 1EXMA 221PA 4MGYR 1PUJA 3CW2A 3ZDQA 1GG2A 1SXJA 5J40A 3GQBA 1VHTA 3KJGA 4URYR 4ZDJA 1FUUA 4DLRA 2FF7A 1E2GA 1DAEA 1G9XA 3Q5DA 1U81A 2ZRMA 1F6BA 4KFRA 4LV6A 4B6FA 1RC8A 4BFUA 3CRRA 2AD1A 3R8CA 1YZTA 5FUXA 4HLUA 1Q3HA 2HF9A 1XRJA 2QQEA 4TMKA 4HB4A 2XZLA 1T8TA 3I1FA 2IUUA 4ASUA 3U3JA 3L8ZA 2OM2A 3S1AB 1P3JA 5KUTA 1M7HA 3IQWA 3K70B 1HA3A 1H8EA 3KKPA 3LNCA 3LQRA 2YWFA 3OFND 3BFXA 4PAOA 3OFNA 2K5UA 3IEVA 3TRFA 4TT3D 1G19A 4OK3A 3EAQA 5FBLB 5DYIA 5G53C 1IXRC 2XJ9A 1W36B 2O0HA 4KFSA 4L9WA 4JLBA 5FTJA 2OG2A 2Q3FA 1KJWA 4WZ6A 1IN6A 4M1TA 3FFBA 1Z08A 4C0KA 5L3SA 1UPTA 1SVWA 1JXMA 2QTFA 3BB1A 3THOA 1S8FA 1YJ5A 4LBWA 1KI2A 4E09A 3PENA 4JT2A 4QG7A 3QVVA 1XPOA 1E0KA 3L82B 2BIFA 1GITA 2AWOA 2IK8A 1YZQA 3UANA 2CEAA 1P2VA 3FB4A 2GWHA 1J8MF 1FTSA 2JIZD 2IYZA 1SGWA 3PIRA 1YRAA 2JIZA 1W49A 5J4KA 2AWNA 4Q7KA 4QJ3A 3IIKA 4QGAA 2QL6A 2P6UA 4NZYA 1N6LA 3M1IA 3VFDA 1EFHA 2O8DA 4LY6A 1NBMD 4OQNA 1X86B 1MO5A 4GNKA 1XZQA 1U0JA 1GILA 3TK1A 3OHMA 2D74A 3TUZC 2CLCX 1N5LA 3SDZA 2J7KA 4V0OA 2XNDD 4M1SA 4MUBA 2XNDA 4V0LA 4B73A 1VIAA 3FPAA 4P31A 1ZBDA 1IN4A 4B2IA 3LWNA 5HTKA 2PLFA 3THYA 2ZS7A 2Z43A 4EPYA 1E96A 1P75A 2CK3D 4PHFA 2CK3A 4EIWA 4HB2A 4DWJA 2QG6A 3GLFE 4TLDA 3TSWA 2ODEA 1DOAA 2NO6A 4MRVA 2QE7A 3LVQE 4LC0A 4OKSA 4A8JC 2GRJA 2N42A 5BN4A 1HH4A 1KK0A 5HCNA 1ZINA 2QEQA 3I8XA 4D4KA 4TYPA 3C5HA 4LYFA 2BVNA 1DADA 2ZI7A 5J4HA 4G5SA 4RD6A 1YQTA 1Q12A 4KV9A 2GVDC 5BXQC 3IPYA 5HE8A 3H1TA 1S4QA 5AJZA 3KL4A 4URZR 2VP9A 3K0EA 3BGWA 4JVNA 3SJCA 1P61B 1E9DA 1G6HA 2W0MA 1E9SA 2IBMA 1UEIA 1ZUNB 3LA6A 1E2IA 2YOFA 2NPFA 1G5TA 4ZIRA 1G21E 1DAHA 2V6JA 4QJ4A 3QSYA 2C2HA 1KSJA 2PMKA 2IWHA 5JFGA 2D4HA 2B92A 2XOKD 5FL3A 3W5JA 2XOKA 1NP6A 1XEXA 4Q00A 1CLUA 3RDPA 1MABB 4EFMA 5H8WA 1UDXA 2ZRAA 4FMBB 4LC1A 5C18A 3RRMA 2L0XA 4Q4HA 1R4AA 1XEWX 4B3BA 3KDSE 1HEIA 1JJVA 5L3QA 1LY1A 3OEHD 1PUIA 1E9CA 4V0KA 4MQBA 4P4TA 1N6OA 4D82A 5AUPB 1KI8A 1MKYA 4IDOA 4HAUA 1CJMA 3OE7A 3ZYCA 4ESHA 3ZVNA 5DIFA 2GETA 4PAQA 4B33A 2JLVA 1R0WA 4AIIA 2BJVA 4TQUS 4KXFB 2F9MA 1A2BA 2RGCA 2WSMA 1Q0UA 4A0GA 3C8UA 5JEEA 1EESA 1NMXA 3R7WA 4DBLC 4DSOA 1E79D 4ZV4A 1QF9A 3MUFA 3FMFA 1W4BA 4NP6A 4ZI2A 2GK7A 1MRNA 2ZM5A 1S0UA 5B57C 1R0YA 2HUPA 1Z06A 1KK2A 3AP3A 3VNUA 1VKJA 3CPEA 1T6NA 3KQNA 4LYJA 1TEVA 4UKDA 1UBEA 3RVBA 3A1SA 2ZYUX 3QOFA 4IXNA 2IC5A 3LBNA 4Q7LA 1J99A 2G0TA 4FW9A 2AN9A 1W47A 2BBWA 3KQHA 1W4RA 2F43B 3LO5A 1FPMA 3DPUA 3CZPA 1L4YA 3ZLJA 5FH9A 3C5CA 5JCZA 3G82C 4M21A 3ZS9A 3FKSD 4US2R 1NLZA 1W5TA 2CL0X 3LD9A 2QY9A 3EWSA 2QTHA 4A92A 2VP4A 1KI1A 4GRAA 3SYKA 1ZVQA 4BFYA 4DIDA 3QI2A 4NYMQ 5JSZB 3BERA 1AK2A 1OT3A 3NDPA 2W2VA 4RZUA 3T12A 1NBME 3T34A 1U8ZA 1KTVA 4G0NA 1I4LD 2JJ2D 2GAOA 2ZAOA 4Q9JA 1VCNA 1J7KA 4Q4AA 2VSOA 4HLCA 1VMAA 1IY2A 1HQYE 3NKVA 2FEOA 2NQ2C 3BORA 3W8NA 1XJQA 2RGNC 4Q47A 3AVXA 2ZRLA 3LY5A 1Q22A 3NG1A 5AJXA 1TF7A 2XB4A 2FGJA 2FFAA 4NCKA 3ADKA 2GXSA 2ZYWX 3DKPA 2ZQ5A 2V8OA 1A82A 2AK3A 3O8DA 4DIEA 3RSOA 2JATA 3SBEA 2GCOB 2FFBA 2WKRA 2AR7A 3ETLA 4BLTA 2ZRCA 1ODFA 2DWOA 1TF5A 1VIYA 5JI2E 2F1RA 3A36A 1JQJC 3ADBA 1MO3A 1CTQA 4P3YA 2P5TB 4Q18A 2WHXA 1NJGA 2XTZA 5KSOA 1V5WA 2PEZA 3HDTA 3SJZA 1Z63A 1Z6AA 4WOPA 4XVQA 3V00A 1NSFA 2CBZA 1N5KA 1W2GA 1Z6XA 4BUJA 3CZQA 4DUGD 1YR9A 1LFDB 4CYMA 4DUGA 1D9ZA 4PTLA 1W44A 1KKLA 4Z1MA 1TQ4A 4RD3A 4BLQA 4II7A 1OIXA 1GRRA 5DI3A 4HZUB 1H65A 4FCWA 2A3RA 4F4JA 4N0EA 2VA8A 4ZKDA 3VX4A 1NJFA 1NG9A 1RPZA 3AVTA 2EFDB 4QC2A 1NN1A 2P2LA 3IO5A 3G5UA 4G3XA 4JLPA 4LYAA 4LWZA 3C4JA 4XSGA 5JLJA 4NCHA 1JQLB 4AKGA 3X2SA 4CT5A 3PEVA 4M9ZA 1U8AA 2CVHA 5GJCA 3B1YA 4BQSA 3BD9A 5SZKB 2IL1A 1RJ9A 2ZRFA 4CW7A 4DSUA 2GJKA 2RAPA 1EFUA 4ZDKA 3LRPA 1S2MA 5FUVA 4C7OB 4LBZA 2ZANA 1TU4A 3LW8A 3MFYA 4FCTA 1VG0B 1HUQA 1NKTA 1N0UA 1KGDA 3PG5A 4YMSA 1G3MA 4YXWA 3S1AA 1XCPA 2H17A 2ONJA 3K70D 4IFBA 2CVFA 4NCJA 2XTNA 1YHNA 5AJWA 3LLMA 4GL2A 1T8UA 4R71A 2A2ZA 5C2JB 3EZ9A 1Z47A 4E03A 1W36D 1YKSA 4NYJR 5EZ5A 3UG7A 1DAKA 4IDNA 5FR2A 1P9RA 3RS3A 4PQRA 3WMEA 1HT2E 4JMPA 2IF0A 1E98A 2PCJA 1W46A 4PHGA 1D2NA 1ZD8A 4C0QC 2W58A 3QBVA 5FR1A 2GXAA 3CNOA 2KE5A 2EYUA 1Z2CA 2GBLA 2QP4A 4X8LA 1I4DD 2C9OA 3H2YA 1EWQA 1NIPA 3H0KA 4DEYA 4LJ9A 1PV4A 2QRZA 3SEAA 1AZSC 1II9A 2Q9CA 5BQ5A 4OHXA 3MWJA 1DPFA 3I3SR 1P6XA 4UXJA 1RYFA 2VHTA 4JIMA 3PJRA 1U99A 4MRNA 3B1ZA 5F2EA 3TVTA 4NL4H 2HLDD 2P6RA 4QGGA 4QHTA 5F3WB 2HLDA 4EUNA 4CEIB 3AVUA 2J0VA 4QJ5A 5DISB 2FDCA 3TNFA 2O0JA 4QNMA 4RFSB 3I32A 1Z83A 4GOJA 4Z54A 2GKSA 3UMSA 3K1JA 1E2JA 3L0PA 4XOIA 2GJ8A 3D3QA 4RZ3A 1G8YA 5JHGB 1W4AA 1CP2A 5CLQA 1ESMA 3TLXA 1Z07A 4NE2A 1R7RA 2WWXA 4JLOA 1YRBA 1XEWY 2ZJ5A 1XB2A 1JALA 3K9GA 2ZRPA 3PEUA 3CH5A 4NPHA 1LVGA 3FWYA 1K5DA 3QPUA 4LJ4A 1DE0A 1YVDA 5JJLA 2ZJBA 4TQ9A 4XTCS 1XD8A 3QXSA 4X8HA 3ZQJA 2YC4C 2JLXA 2ZSFA 1FUKA 3K9NA 4URWR 5FUWA 5B64A 4NYIR 2IYLD 2CE2X 3EX7C 1IN7A 3MWLA 3GLHB 4B35A 4TSFD 1SVKA 3T5DA 1HE1C 4TSFA 4XVUA 2VL7A 4PHHA 1MOZA 2PX3A 2H7VA 3BAFA 2IYQA 5E7MA 1D5CA 4I81A 2XZPA 4NTZA 2X8AA 3OEED 3SHFA 4PO8A 4TYQA 3ADDA 2Z6VA 2A5DA 3OEEA 1N6IA 3P4XA 2GHIA 4IEIA 4Q7MB 3WHLA 4ZCIA 4YDHB 2AFIE 3P26A 5TVKA 8OHMA 1IY0A 4D4JA 3CRQA 3GLIE 1QHXA 5AWFC 3GFOA 4MKIA 1UBFA 1J8YF 2ZI6A 4OQMA 4DLTA 3CO5A 4HB3A 2Z0MA 4FN5A 3NWJA 3SQWA 1BS1A 5FFMA 3KJHA 1OB2A 2TMKA 4HDOB 1CULC 4LDJA 1US8A 4DLSA 4D4LA 1W5SA 4D0LB 2IF2A 4A2PA 2PZEA 1OYYA 1MABA 1EX6A 2A5JA 4MRSA 3MAAC 4ZI3A 2ZIAA 3RYTC 2XSZA 2B7CA 3I5YA 1IHUA 4TZ6A 3TUIC 1UAAA 3ICEA 1AN0A 4MYUA 1IXZA 4Q9HA 4TL8A 1P62B 1T5LA 1ZRHA 3HP1A 4I1UA 2ZSAA 1SVIA 1Y63A 721PA 2ZUBA 4TL7A 3H84A 2RGDA 4F38A 1T3LA 1OH5A 2GCPA 2ZE8A 4Q66C 2JGNA 2RGEA 1Z0KA 4RZXA 3W6PA 2FOLA 3T1OA 1IOZA 1UFQA 4UNSA 3V4RA 1G7TA 4JLVA 1R2QA 1M74A 4YMUA 1GFIA 1U0HC 2X77A 4C2TA 3U44B 2FMXA 3B13B 3CIOA 3FDIA 3JZMA 4POAA 5JS8A 2ATVA 1M34E 4M9QA 2FG5A 4UNRA 3GCGA 1LS6A 4FINA 4EPWA 1M7BA 1YZGA 2ZRJA 2JLRA 3SJAA 5FPSA 4U02A 1Z22A 1WF3A 3KQUA 4BGDA 2WJIA 1QVRA 4G5QA 5DO9A 3RLFA 3UMFA 5EE1A 4NDZA 1Q21A 1U9IC 1AQYA 1DAGA 3KX2A 2F43A 1FOEB 3B60A 2VTKA 4OI4A 5IK2D 3LBIA 1XPRA 5IK2A 2RGGA 1TQ2A 3EC1A 1E9EA 2GNOA 2Y8EA 1VYTA 3QPVA 1XJCA 3DO6A 1QG4A 3LV8A 3CRMA 3VHXA 3X1YA 2HT1A 1GKYA 5BYJA 121PA 4HUQB 2NO1A 1R0XA 4TLCA 1AS3A 2O8CB 4WBSA 4KODA 1CRQA 1E4VA 3RS2A 4F7WA 2VH5R 3GEEA 4KU4A 5JSZA 1N6RA 3P32A 1N3BA 4DJTA 1KK3A 4JT4A 1FP6A 2IYYA 2PJZA 3SYLA 4FD2A 2D7CA 5JECA 2YWHA 3TGPA 1XDBA 4Y0AA 5FBWB 1OH8A 2QAGC 2VF7A 2KSQA 1E3MA 2V6IA 2J0SA 2ZPTX 4IKEA 4B74A 2EU8A 4H9GA 3CWZA 3ZJYA 1IBRA 5FPYA 3K53A 3THWB 1BH2A 2WBLC 4TLAA 3BIFA 4DLZA 1SVSA 1P7CA 2ZEJA 5CIQA 1G18A 4ESVA 2Z5FA 1KJYA 2GCOA 1S96A 4LJ8A 5H1YA 1Z6GA 4EQ6A 4XD7A 2OAP1 1WCV1 3A4LA 2MMCA 3NH9A 6Q21A 1WBBA 5EE0A 4TMWA 1QHGA 1P2TA 4GZMA 4A6PA 3HU3A 1XMSA 1YR8A 3RWMB 4B76A 4QHSA 1GL7A 3AVWA 5E3HA 2OAQ1 3Q72A 1OXUA 4A0FA 4DLVA 5BYKA 2C77A 2J5XA 5LPNA 4NKRA 3QKUA 2EFCB 5SZHB 4KFTA 4JBXA 5GVRA 3EW9A 5FOUA 5CYPA 1W48A 4FMDB 2J0QA 2ZRIA 1L8QA 4LPKA 2P67A 3FVQA 2A9KA 2HJVA 3GJ7A 2G9NA 1XEFA 2UZ3A 1TTTA 1FQJA 2FH5B 1B23P 1A7JA 4AYTA 1ZD1A 4HZUA 3CONA 4YLGA 4WA7A 4YONB 2ODNA 4M1OA 1G4AE 2HXSA 3VKGA 4LUCA 1E9BA 2F3TA 4QKQA 2A30A 5JJIA 1DVRA 1HT1E 1OH6A 3FHCB 1R10A 3X1XA 3OIVA 3Q85A 1XBTA 1ZM2A 1F3OA 4CEHB 3SHWA 2F55A 4KI0A 3PUZA 4A2WA 4DCUA 3W6NA 4QM7A 2JLYA 1RKBA 1F48A 4EJSC 1MO6A 1NVXQ 1T3HA 4M1KA 5JI3E 4KVGA 1G5RA 3A6PC 3QVUA 3TIFA 1Z28A 4HAVA 3SQXA 2OILA 4OI1A 1S1MA 2AD5A 2G1KA 3B7GA 1N5JA 1CJVC 4C7OA 1AS2A 3NH6A 1PVOA 1TADA 1JEDA 4Q5IA 3QBTA 2W2TA 1Z0JA 1SXJD 2VRWA 4QHYA 5JEDA 3A4MA 1XMJA 5FBVB 1WXQA 2QI9C 2CCKA 3VR1A 4UNNA 1RRCA 4LOAA 3TSZA 1T9HA 3SBDA 1E2NA 5FTKA 4F4CA 3BH0A 2DYKA 4ASUD 5KOYA 4ARZB 4NYIQ 1E0AA 3QUSA 3T15A 3K0CA 4RJLA 4B43A 3PUYA 1H8ED 4LBVA 1VPLA 2I1VB 3QXXA 2O8EB 1ZM3A 3QKSB 4DXAA 2BJWA 2IXEA 3EIHA 5F9HA 5F9FA 2NOAA 2B8WA 2ZITA 1I2DA 4KLZA 1Z3IX 2ZRDA 4XJXA 1NIJA 1PZNA 5HR5A 3U7HB 2WJGA 2WAYA 1OXSC 4PO9A 4L9SA 1SKQA 5IF9A 2JJ1D 4Q02A 4TWZA 2JJ1A 2WM9B 4C0SA 3BRWD 3UPUA 4CEIA 4QNRA 4A0RA 5K8LA 4D25A 1UBGA 2WZQA 4RFSA 4EDHA 5C4MA 3G0HA 2XAUA 2D3WA 2JLZA 3N2EA 1RRFA 3P4YA 1OIVA 2GJ9A 4P4UA 5H68A 3EPKA 1G3IA 2Q3MA 3PQCA 4MGIR 4DEXA 4URXR 2IWRA 2JDID 4J0QA 2JDIA 2QT1A 1QHHB 4PC2A 1B0UA 4IXMA 2RKOA 3AP2A 4B3GA 4IW3B 2RGAA 1XX6A 2D06A 2GTPA 2NIPA 3VQTA 4TYWA 4OI0A 5FI1B 2JLSA 4GSYA 4R9UC 2WJVA 1N6KA 1G5PA 2YOHA 2YNMA 3SJBA 2IS1A 3MRSA 3RRNA 1SZPA 2E1RA 2J3EA 1J70A 2EFHB 5AUQA 2QNRA 4AURA 1A1VA 2FGKA 4IVQA 1E2MA 2GAAA 2OLJA 3P27A 4WVFA 4AKHA 2IHYA 2J9RA 4R7ZA 1N0VC 4IVRA 4C30A 2OFOA 1XD2B 2WIAA 1KNQA 3PV0A 2C78A 4KSCA 1DO0A 5LB4A 2QE7D 1W0JD 4ZO4A 3T06B 1FP7A 3C41J 1KHTA 1W0JA 3U6KA 2GXQA 3CF2A 1FL9A 2UZIR 4X8OA 2G77B 2HF8A 3CRVA 3VR4A 4YMVA 2C96A 5DNYB 4JKIA 4PXAA 1DELA 3GJ3A 1WE2A 2QENA 3ZVMA 2KJQA 4EAQA 2O0KA 3WNCA 2AKYA 4NBSA 3TE6A 1TL7C 1AZTA 2WSSD 3CR8A 3KFVA 3EA5A 2WSSA 4L4UA 5LD2B 1X8LA 2QAGB 4B2PA 1TU3A 2GZHA 4BEBA 4IOJA 4X8MA 4Q03A 5C1BA 5DYGA 4WZBE 3CF6R 2OHFA 4UXHA 5A0FA 3QNUA 3QXCA 5D3MB 2NTYC 1RZ3A 2E87A 2I3BA 3KZ1E 4F4IA 1DARA 3LDAA 2J87A 2F3RA 4EFNA 1KI7A 1VCMA 1YZLA 1W0KA 3A1VA 1GM5A 4YMTA 4Q1AA 2P3SA 3MWKA 1JR3D 4S35A 1HY3A 1LS1A 1JR3A 3U61B 2IUSA 2B6HA 4HB0A 1Z5ZA 3THXB 4L5BA 4PAMA 1SXJE 3TJZA 3LX8A 4Q1BA 3D8BA 1KSHA 4UXIA 3B1WA 4YQFA 4HLUC 2OEPA 3OE7D 4RFVA 3IUYA 4Y0VA 2R6CA 3OIUA 1N6HA 2R2AA 4BLSA 5JMTA 1UBCA 1ZD9A 2OUKA 1UKZA 5SZIA 4IDHA 4FIDA 1K5GA 2JEOA 1M8PA 2GZDA 1LNZA 3KUDA 3W90A 2YC2C 3AVYA 5HPYB 5FTLA 4RD1A 1ZNXA 1QBKC 2YZ2A 3C14C 4UNQA 4JLDA 3TW4A 2VO1A 4N0DA 2ZSBA 4Q21A 3KKQA 1C1YA 1XMIA 4RZ2A 1M1YE 2GEUA 3U3RA 2F1JA 2OE2A 4LRWA 2GF0A 3QG1A 1FNNA 1PLJA 5JJKA 2V7QD 2V7QA 3HU1A 1W4CA 3ZQ6A 2YHSA 3WBJA 3AH8A 2WMOB 4HUQA 4GDFA 1BIFA 2YWGA 1XU4A 3NXSA 4JJZA 1JB1A 2VBCA 2ZYVX 4PX9A 2XGJA 4OJQA 2IYRA 1K6MA 2A78A 1TEXA 1JJ7A 2J45A 3M0EA 2YVUA 1G17A 3W3AA 5JRZA 5CM8B 4CVNA 5C4GB 4HUTA 1A2KC 4W5WA 1FX0B 1NVVQ 2R6FA 3A1WA 3H4MA 4GOXA 4D2IA 1A4RA 1JNYA 2G88A 3DZDA 2GESA 2KBEA 3DVLA 1G8FA 4KSBA 4QFMA 5GJVC 1OHHD 1D8TA 5DH9A 2WAXA 1OHHA 3GLGB 3B78A 2J0UB 2ZTSA 3AKYA 2RB4A 5E4FA 1BYUA 4GMXA 3VR5A 2QQ0A 5CJ2A 3NBFA 1VECA 4MITA 4UQOA 3PUXA 1DG3A 2A7QA 2EVWX 4U00A 5LB2A 3RAPR 2FPKA 3UXMA 3WHKA 2CJWB 1UKVY 2JAQA 4H1UA 2AKAB 2OXCA 4P33A 1KDOA 4FMCB 2ONKA 2JLWA 2ZRGA 2VEDA 1ZC4A 1XJ0A 2AFHE 4JVSB 4OK5A 4WZAE 5EE3A 1TUIA 5HZHA 3NTUA 1P2UA 3OF5A 3GFTA 4DC9A 1GSIA 2ZE6A 1P9WA 2V4ZA 3IILA 4GOKA 2KBFA 2QM7A 3UWKA 3BWDD 3TAHA 1ZC3A 3WYAA 4PZZA 1W2HA 3A58B 1R5NA 3ASZA 3LXRA 4C2UA 3MLEA 4UJ5A 1XXHA 1PJRA 3O8BA 4OQFA 5HZKA 3RSLA 4QGFA 5FOWA 3UMRA 2W0SA 3SNHA 3AF1A 1WMSA 4IDQA 1II0A 2C03A 4PPNA 3ZVRA 1OKKD 2C99A 1G4UR 2QAJA 3N2IA 4JL6A 1OKKA 2OBNA 2BCJQ 3A1UA 3EC2A 3R8FA 3EA0A 3OZXA 4XTRA 4AG5A 3A37A 3LQQA 4Q9IA 521PA 1Q1BA 3CNNA 3CKLA 3M6AA 4B32A 2Q3HA 5KU1A 4FMDF 3CPHA 4GMDA 4WXPA 1G16A 3FFAA 4KLNA 3HWSA 4BLPA 3CNLA 3EZ7A 2CCGA 3TKLA 3MJRA 1QG2A 1JR3E 2UKDA 4CEHA 4OI2A 3NHBA 4DVGA 5KNBA 2QP3A 5CK4A 4Z1MD 1LF5A 4HLQB 2ZETA 4Q01A 3U3KA 4BFZA 4TYYA 2BBTA 1KO4A 5FOXA 3TQCA 3KXIA 2R6GA 2BEKA 3PVSA 3QKRB 5L3RA 3BH7A 4DLWA 4RY2A 4P4SB 2JLUA 4CDGA 3ZD7A 3UATA 1Q3TA 4RCZA 1G8PA 5JRJA 1ZNWA 5CLLA 3EZ2A 5TXGA 5CB6A 4B71A 4HAZA 5J4YA 4B34A 1RE0A 4KYIB 4A8JB 1S3SA 2WVJA 1KAOA 2OFWA 2FPMA 3GJ4A 4OHVA 3DM5A 1QHIA 4Q1EA 4Z8XA 4MKGA 4QBFA 4DSNA 1U94A 4GP6A 5B58C 1OJLA 3EIQA 3IQXA 5TB5A 4TL9A 2H16A 3GJ5A 1HTWA 4ARZA 4YXWD 2XXAB 3UG6A 5TARA 2PCLA 2ZJ2A 1IJFA 1KO5A 4RD2A 3DL0A 1E2KA 4JSTA 5FTNA 4OQLA 1O3YA 3VHLB 3QKSA 3BJIC 3ASYA 4GPTA 5DHAA 4DLYA 4M9XA 4PR0A 3VNVA 5F98A 3SC3A 1TMKA 4C3ZA 4IOMA 5EQTA 3NEYA 2YOGA 3SR0A 2DR3A 2C9CA 2AHOA 4M22A 4XVRA 3OIYA 3J81k 4BPBA 2D2FA 2H5EA 2PL3A 1MR3F 5AR1A 2F6RA 4NH0A 4IEEA 5CK5A 3SOPA 1Q1ZA 3Q3JB 4M53A 1P73A 1NY6A 2F7SA 3DMNA 4BZXA 1K8RA 1E9FA 2HXYA 4Q7JB 5M04A 4QGHA 1EFRD 4DRZA 1EFRA 4BRUA 2R9VA 3O8CA 2ZI4A 5C46F 2W6IA 3QE0A 2XZOA 4CF7A 4LCBA 1Z0FA 1T91A 3CX6A 4FWIB 2WWGA 4G5OA 1QHHA 4DHEA 2FSIA 2Q0HA 2QPOA 1QHNA 1E2DA 3AB3A 4E22A 1KI9A 3AGPA 3QF4B 1E0JA 2C9YA 4PQFA 3SS8A 3R9XA 1GTVA 4YDSA 4HDQB 3BB4A 3TR0A 3U3MA 3X1ZA 1SHKA 5FOSA 2X19A 3JVVA 5FI0B 4QL3A 2V55B 4PPQA 2HCJB 5K8UA 4A1FA 1XXHE 4DCNA 4O25A 5LDDC 1KKMA 3VKHA 4IOLA 4URUR 1YZNA 2VF8A 2X1VA 2WKPA 4LZZA 4QOSA 3B2EA 4GBMA 1XD2A 3QEOA 2PX0A 4B47A 1OB5A 3R9WA 4RD4A 4GZLA 1I2MA 5G3ZA 3T1QA 2IS6A 1X8JA 1CF4A 2RGXA 2OCBA 2QBYB 1WB9A 3AUXA 1MH1A 3KUCA 4BECA 2BM1A 2WWFA 3Q7PA 4WW0A 2LKCA 3MG9A 3RABA 3T5GA 3DKVA 1GKIA 4GFDA 4DCVA 4PZLA 3U4QB 2VHUA 3LLUA 4JS0A 1ZNYA 1G1MA 1AIPA 1JBKA 2WPDD 3GFPA 1W7AA 2WPDA 2ORIA 2V3CC 3ECCA 2FN4A 5CYOA 5KYKA 2XITA 3K09A 1F2TB 3NEJA 1YR7A 5JZVA 2O8FB 4FWTA 3TSOA 4RKFA 4ON9A 3IKJA 3AVVA 1XF9A 4WAUA 5EXPA 1FMLA 4KAXA 3LX5A 2EFEB 4WIAA 5FUYA 2BMDA 3CPJB 1ELOA 1HYQA 3W34A 2ZSEA 4XWAA 3NBYC 5KNDA 1WDTA 3BH6A 3WYGA 4DCTA 2XSZD 1GAJA 5E7IA 3UK6A 3RS0A 4AD8A 1XFAA 2ZJ8A 1FNMA 3THXA 3WMGA 2A5FA 3ADCA 3QXHA 2XB2A 3ZZTA 2OESA 3L8YA 1UDWA 5FL7D 3IPXA 5FL7A 4D6PA 3A4NA 1NL3A 4QRHA 3KB1A 2GDJA 4V03A 4LHYA 1MRSA 1XTQA 2BCGY 1KO8A 1NN5A 2JLQA 2P5SA 1E9AA 3MD0A 2JJ8A 4C0LA 4L15A 5FOVA 3HPRA 3E1SA 3K70C 4M1YA 4AG6A 1YR6A 3GP8A 3D7MA 2DB3A 5P21A 4OHYA 3CUEF 1CJKC 2Z4RA 1W36C 4HSEA 2PLRA 1U98A 2MSCB 5BN5A 2C98A 4YC7A 3VU9B 3CX7A 4KJZA 2FA9A 4PANA 2ZJOA 1E4YA 1KMHB 4Q48A 1XEXB 4A0HA 2FZ4A 4DCSA 2GBLC 3K0AB 1ZP6A 4OK6A 3SYNA 1JAIA 2LCFA 4PSAA 1V43A 3CR7A 1O87A 1NRJB 5BW8A 1VG1A 3IDQA 3KTAB 1UF9A 3DMDA 1NF3A 1P2SA 2OV2A 2QPAA 3BK7A 3L0SA 2W00A 1XTRA 1EG7A 1TX4B 2WICA 4XIGS 2HEIA 1WA5A 2QZ4A 3AV0B 2NZ8A 1F5NA 3TW8B 1FX0A 3MJHA 4Q4JB 2BM0A 4A6XA 1EK0A 2O52A 2OO7A 4D81A 3R9IA 3MMPA 1DAIA 4XH9B 1GUAA 4DB2A 3VKWA 5CM9C 2VSXA 3W5IA 3GLGA 1KZ7B 2J0UA 3U5ZB 2X2EA 1NLYA 5A4JA 1XD9A 3C15C 4L16A 1GNRA 4DB4A 4AK9A 1E69A 5J5CA 1D6JA 3UKDA 1I4TD 1LV7A 2ZJZA 1D2MA 1DG1G 1QHSA 3LBHA 4NONA 1U2RA 4F92B 3X1DA 5EE5B 1R5OA 1RFLA 1BOFA 2AXNA 2DFNA 2BMFA 4I99A 3AVPA 4PZYA 2X2FA 3AF2A 4JLNA 3WP0A 2XNSA 4JJKA 4OHWA 4FCVA 1KMQA 1MT0A 2ZS8A 5JWRA 4V0NA 4PPFA 2ZS9A 2GILA 3A8TA 3WBKA 1SVMA 2DFKB 4FMCF 2F9LA 3WRXC 1DTSA 4D0NA 4XWKA 4U5XA 3X1WA 5GVSA 2WOOA 1W1WA 3NC1C 4XD7D 2ANBA 3FYHA 3N70A 4AC9A 5KNCA 3CLVA 3VR2A 4MRRA 1IM2A 1IONA 5IDVA 3QG5A 2OT3B 4MDFA 2IS2A 2ZI3A 3IIJA 3SFZA 2WV9A 1CEEA 3V9PA 3RC8A 1OPXA 2QROA 3RRZA 2WWWA 3BE4A 2LWIA 2ZAMA 3JZAA 5KSPA 1COWD 4TTPA 3QXJA 5EP4A 1COWA 2FSFA 2ERYA 2NZJA 4PC1A 1OYWA 1VYUA 1ZYUA 3RNLA 1J90A 1II8B 1OXTA 3CRW1 1U8YA 1VCOA 2PMDA 4CGZA 2FPLA 1G3RA 1KZGB 1GOTA 1KNXA 1OFIA 1PLLA 4NYJQ 4MH0R 3SN6A 1GNQA 1HV8A 1JEEA 5LD2C 4RD0A 3WP1B 5KHOC 2RH5A 4TTQA 5DGXA 1CXZA 3GJXC 1RYHA 1YU9A 2DY1A 3EZ6A 3U2QA 4DDVA 4DT1B 2W83A 3B82A 4W9MC 3BC1A 2XJ4A 3H86A 5FBRB 3OAAD 1OSNA 3OAAA 3QKRA 4QXAA 4FI3C 2C04A 4C0HA 5JHHB 5KDDA 4ZCMA 4DDWA 5AUNB 2A5GA 2NGRA 4M1WA 1KSFX 1NI3A 2QGNA 2REBA 4M0LA 5DI9A 1Z2AA 2ZR9A 3E2IA 3CWQA 1E32A 1S1CA 4LHXA 4ZPXA 1N0WA 4A8JA 3LH5A 2B7BA 3EPJA 3K0FB 1OLOA 4G5RA 4C0JA 1CJUC 3WXMA 5EUQB 2VIIA 3GLIB 1GNPA 2YYZA 2ZJYA 3I73A 4ACBA 2P6NA 2ZR7A 2ZUDA 2WIBA 2HV8A 1CR4A 2QP9X 4MGKR 3EWAA 3U60B 3SFVA 2DBYA 3I62A 2FV8A 4CT4B 2ERXA 4BFSA 2QGZA 4A36A 3PEYA 1L2TA 1E2QA 2GJSA 4KBGA 4G01B 5G41A 1XCGB 3BXZA 1XTJA 3Q9LA 4PSKA 3RS4A 4I1SA 4Z8YA 3U7GA 4OQXA 1ZM9A 5GJWC 3CH4B 3Q7QA 2ORVA 1GRNA 2OLKA 1FQKA 3GLGE 3PEWA 2NPIA 2BBSA 1CIPA 1E2HA 3F0TA 1KJZA 4BRWA 1E94E 1Z6TA 1E1RD 3GJ8A 3HYRA 1RJ9B 3QQ5A 3ZIAD 1E1RA 3ND8A 3ZIAA 4BLRA 1U0LA 3A1TA 4IFEA 1VTKA 2GXUA 4MRPA 2ZVQX 3GEHA 2ASEA 1KSGA 1GL9B 3RS5A 5B2ZA 4B3FX 1R5BA 4XWOA 4JLJA 4RVCA 5IRCD 2R6AA 3IBYA 4KCGA 1DBSA 4LSGA 2J59A 2E9SA 3DM9B 3U7EB 1EFTA 4OJKA 2IYTA 4BASA 1CR0A 4TTRA 1SKYB 3CM0A 3MWYW 2IX3A 1ETUA 1ZCBA 3L43A 3QF4A 4PC6A 1T4GA 4IDPA 3WYFA 5J47A 3DEFA 3GD7A 2QTVB 2VP2A 4TT3A 1CKEA 3PUWA 1NVWQ 5KSZA 1TPZA 4V0MA 1TQ6A 3FKQA 3BFVA 2ZI9A 1UEJA 4AWXA 3IHWA 1WQ1R 2RGBA 2PBRA 3CF0A 3B85A 1ZCAA 4A15A 3VR6A 1G20E 3LFUA 1SQ5A 1GL6A 1VG8A 5SZJA 1IAQA 5TY0A 1AGRA 4CEJB 2H8KA 2IYVA 4RKEA 2EYQA 1QZXA 1QRAA 1KDRA 2Z4SA 1JXOA 3GLHA 1WRBA 3I61A 3EARA 5A5GA 1C9KA 2QBYA 1OFUX 1E2EA 2DPXA 4NCNA 2OCYC 4HYYA 1E2PA 3B9PA 1VCIA 3EIEA 2FWRA 4K8OA 2GJAA 2IYSA 3U4QA 1CU1A 2R44A 1D9XA 2AK2A 3MCAA 4N3NA 3RC3A 3IBGA 4FXPA 1TUEA 3PITA 4JL5A 1G7CA 1NBMA 1RW4A 1GWNA 1NMZA 1NSTA 2V54A 2DFTA 3WNDA 1F2TA 1ZIOA 2O8FA 3TR5A 3HR8A 4NU0A 2O5VA 3ZVLA 4KITB 5L3VA 3EPHA 1UM8A 2PH1A 1ZUHA 3KFXA 2MSEB 3W3ZB 3B1XA 1UADA 2SHKA 3NC0C 3C16C 2IYUA 3QENA 2V9PA 2RGNA 2IA5A 3KJEA 1TQDA 3QY0A 1VYVA 1ZIPA 3AGQA 1OFTA 1BKDR 1LB1B 2V1XA 1A5TA 4N1AA 3AM1A 3DZ8A 2BEJA 3FHOA 4LI0A 2ATXA 3SU8A 2QSYA 1W0KD 2CE7A 1SXJC 5KPDA 4LJYA 5CIWA 1TAGA 1N25A 5EZ6B 3DHWC 2H92A 2ZE7A 2ZROA 4ERNA 3LVRE 2OCPA 3DOEA 5FPHA 3L0IB 2CL6X 3AF0A 3PCRB 5JS7A 1XP8A 4E5UA 5J4LA 4A9AA 3IEUA 4BFVA 3KXLA 3LAWA 3NHAA 1X1SA 2NO0A 5EXSA 2RMKA 1XNJA 1PLKA 2OBLA 1T5IA 4A82A 1OF1A 2CCJA 4JBYA 2WTUA 3U44A 2C5LA 2IEZA 2R65A 3AVOA 3ZZ0A 4B44A 1RIFA 1US8B 3K0CC 4KO8A 3VU9A 1LW7A 1ZU4A 1KMHA 1T3SA 3WNBA 2H57A 5EP3A 3RHFA 3ZS8A 4BEJA 4EPRA 1XTKA 4B48A 3K0AA 2GF9A 2RCNA 3BBPA 5G3YA 1ESNA 1FTNA 4W5HA 2IHBA 1Z8FA 1SHZA 4DDTA 5CB8A 2HT6A 3WRYC 5H70A 2D2EA 1HQCA 2UVQA 3KKOA 3KTAA 2DWPA 3OEHA 2FSHA 1F2UB 3I4LA 1NG1A 2WWYA 2MMGA 2PT7A 1J2JA 4D80A 4Q4JA 4QM6A 1ZMXA 1OV4A 2ZU0C 4Q19A 3U7FB 2N1BA 1E0SA 3PUVA 1JAHA 3O47A 2R8RA 1GZSA 2IUTA 3ZZUA 2BMEA 2CHGA 3TUJC 1DO2A 1YE8A 2O8CA 3FOZA 4MKHA 4JSYA 1E79A 2CHVA 2FFHA 2VP0A 2XX3A 4RCYA 2ZR0A 4D26A 5DHFA 1NN3A 2HJGA 2IXGA 4O2LA 2FNAA 4EJSB 4KHZA 3DOFA 5E95A 3TVDA 1SULA 4HATA 3NIBA 1NMYA 1Z0DA 2JCSA 4LGMA 2CL7X 4V0ME 5DLQC 4URVR 4TMVA 4Q4LA 2Z83A 3CX8A 2GZAA 1X1RA 3ZGXA 3FMIA 5BN3A 1Y3AA 1D2EA 2H1LA 1G291 1DAFA 4BZPA 1Q1QA 3FTQA 3O8RA 2GEVA 1KI3A 2EWVA 5CITA 2J41A 421PA 1E2LA 1G8GA 2CLSA 1DAMA 2QUZA 3GLHE 3KKMA 1R8SA 2QPTA 1ZJ6A 3Q5EA 4EFLA 3THWA 3B5JA 1P5ZB 2MSDB 3I92A 1S3GA 4M9SA 1GDDA 3L2OB 1OIWA 2QRNA 3FKSA 2HDNB 4JKYA 2RHDA 1KIMA 4LJ6A 4Q9KA 2OSBA 2OCAA 2YJTD 1G7SA 1OXVA 1NY5A 1XPUA 4LJAA 4LV8B 5JWHA 1U90A 1E9RA 2C8VA 5FPKA 1M2OB 1P4SA 1IY1A 3QJYA 2QA5A 4TL6A 4B2LA 3TBKA 1E2FA 5HE9A 2JJ2A 1FFHA 2QSZA 4ZCLA 4C9BA 3F8TA 4B3XA 5TMPA 2XTMA 1GVNB 4IRUB 2YKGA 4IOKA 4C0BA 3E70C 4UNPA 2JA1A 1II8A 4PFSA 4BE7B 1KAGA 2CHQA 4NMMA 3TAUA 1CR1A 1G8HA 2QN6A 5J4VA 2R62A 2KB0A 2PZGA 1Z0IA 2P65A 2FZLA 2QT0A 4OYHA 3FMPB 2IXFA 2BKUA 1KY3A 4MYHA 4DT1A 1G6OA 4E07A 1N6NA 1S9HA 4AKEA 1CS4C 2Q9BA 4EQ6B 2D62A 3B9QA 2BWJA 4TYNA 3PR1A 3AQ4A 3IGFA 2EWWA 3AP1A 4MUAA 5TDHA 4TLBA 3UWOA 4EPVA 3UIEA 4PHTA 2WJHA 4S2EA 3EPLA 5G40A 1YZKA 5DSZA 1T0HB 5EP2A 2VYFA 2OXRA 2QU8A 2O8BB 2IYXA 2VP6A 3FGNA 5CDFA 1SVOA 4K46A 3K0FA 3GLFB 1N2CE 1OE0A 4M4SA 3IO3A 2NG1A 1ZW6A 2EQBA 1AM4D 2WOJA 1JPJA 4JBWA 5K8TA 3GLIA 1DEKA 4I1OA 2NO9A 4LHVA 4DSTA 3GPLA 3GEIA 1ANKA 1RVDA 1NKSA 2GVZC 1L7VC 1E1QD 2Q21A 3D31A 1E1QA 2ECKA 2QORA 3MSXA 4R2HA 4ZDIA 1BMFD 2DFLA 2QMOA 1BMFA 2VHQA 2V1UA 2ZREA 4PO1A 1KI6B 4R2IA 1FZQA 3OIWA 3HR7A 3AF3A 2ZRHA 5FPTA 5HKKD 5HKKA 3AEZA 3KQLA 3EG5A 3I5XA 4R98A 4KYUA 4GT1A 4BWYA 1X8KA 1LF0A 2O8EA 2LKDA 5AK0A 1OW3B 3LXXA 2IYWA 3KB2A 1OFHA 4A2QA 2AXPA 2YV5A 1IN8A 1KY2A 3BS4A 3HJNA 3BOSA 3T61A 1QDEA 2QMEA 2XEXA 1FMJA 3QEJA 4YMWA 2BKEA 3PXGA 3REGA 4JL8A 1Q20A 2GEDA 4US1R 1G3UA 1NVUQ 1SXJB 2ODBA 4TLEA 1G7RA 4ZKEA 3QIAA 4ILEA 1QVAA 2DHRA 2ZRKA 4LV5B 1VDZA 1KYIA 2Q6TA 2W6ID 3HPQA 2F1IA 1KOFA 2AL7A 2FFQA 1EWRA 2ZUCA 5KO2A 5ANRB 1GKUB 1M6NA 1RRGA 4M8NE 1AA9A 2WWIA 4I4LA 4AYXA 1XTIA 4CRWB 2BOVA 1MV5A 2D7DA 3RANA 3V4FA 2W2XA 4JZKA 1P9NA 2FJUA 3P1JA 1P72A 3QF7A 3SE0A 4F93B 4CEJA 1XTSA 1R8QA 1XMVA 2BBOA 2Q9AA 4HAWA 1GRQA 2YINC 2G83A 2ZVPX 1U9IA 4JVLA 2VHJA 3VAAA 1NLFA 2RHMA 3ICQB 1AJEA 1RRPA 3QPWA 1C4OA 4CZ2A 1L4UA 1KO1A 1ONBA 2BDTA 3OESA 5L3SB 1IN5A 3Q8XB 1M7GA 3GJ0A 4QBHA 3C7KA 4V02A 2ANCA 2WJJA 1Z6YA 2ZYTX 2NMVA 2G1JA 1HURA 2BHRA 4BZQA 2FSGA 4GI7A 3VTKA 1R6BX 1ZU5A 5HCIA 2REOA 2FEMA 3I72A 3T35A 4JLKA 2A5YB 2GK6A 2W6JD 1R0ZA 2PT5A 2W6JA 5K8IA 4BLOA 4RSGA 1OXXK 2ZU6A 4W5JA 4IHQA 3W6OA 2EFGA 3ND9A 2O8DB 4TMXA 4IVPA 1MO4A 4PC7A 4PPGA 2QAGA 2FE4A 2CLDX 1P60A 2CNWD 2CNWA 4ABYA 4BFWA 5AUOB 2WMNB 2EW1A 3TMKA 2WKQA 4KBFA 2VHCA 5D3MA 2FX3A 3E5HA 2IW3A 5JWOA 3HU2A 2IS4A 4TMTA 3W8RA 3K9LA 3THYB 5CDFE 4ITRC 4B3DA 4EPXA 1NN0A 1KDTA 3HYTA 4HEJA 3R20A 5B30A 3FE2A 1GIAA 4AY2A 2CDNA 3DDCA 3CBQA 4B75A 1IQPA 3SZRA 1YZUA 1UKEA 3WMFA 3B1VA 3WY9A 2VPPA 1XCMA 4L8GA 4MGZR 4Q1CA 1N5IA 3N5CA 5E7JA 4DKXA 4TZ0A 5BWMA 1IXSB 5IHPA 4GP7A 4MA4A 1OH7A 3ZD6A 3KQKA 3REFA 4ZIRB 4KFUA 4US0R 4ZDWA 5AJYA 2J7PD 2VQSA 1WP9A 1F2UA 2J7PA 4LPSA 4HDCA 5CJPA 4BFTA 3KKNA 1X3SA 5KPJA 2KI5A 2QMHA 1EGAA 3RRYA 2WJYA 3KXKA 2GCNA 1NNEA 2BMJA 2G3YA 2R6DA 4DLUA 1GP2A 3L0OA 3F5FA 2CMKA 3I8SA 4G5GA 4P0TA 4Q4HB 2B21A 5D3QA 5UKDA 1DS6A 1VG9B 4D0GA 821PA 4MDEA 1CBUA 5L3QB 3GJ6A 5AJVB 2F1HA 1S9DA 5FTMA 4UJ3A 4JLMA 4JYBA 4C0AC 1SKYE 4U7DA 4O3MA 3CB4A 4HLDA 4Q1FA 2NO7A 2B8TA 4EJSA 3AKCA 4HAYA 4P32A 1G64A 4MYCA 1EX7A 2HYDA 4PC3A 3R7WB 1WBDA 4LHWA 4D4MA 5EUMA 2ZSDA 4AI6A 1KI4A 1FW6A 1ZNZA 2JASA 2VP5A 1AGPA 1ZM4A 2IEYA 3EZFA 1TF2A 3ONWA 4JLAA 2CJWA 1Z29A 1AKEA 3AKEA 4NHOA 3FHTA 4TN1A 1BYIA 2QMUA 2J1LA 2BV3A 5LBIA 1KDPA 4EPTA 1Q57A 1SVLA 2PJRA 4LBYA 1ZM7A 3GMTA 3K8YA 2DCUA 2OZEA 4JVMA 5FBQB 3NVAA 2I1QA 2I4IA 3NBZC 1T0JB 2IT1A 5IT5A 2OBMA 2AX4A 1E6CA 4M2LA 5L8VA 4EKDA 4O0MA 2ZRNA 4HZIA 2VLIA 5GJBA 4WXRA 4MKFA 3RS7A 4PSVA 1AKYA 3T1VA 1LTQA 3W9YA 2QM8A 4I1VA 2PZFA 1G3QA 4TQAA 4DLXA 5EXXA 2HCBA 4HI0E 2YWEA 4MYTA 1UJ2A 3BB3A 2ORWA 3EASA 4NCIA 3ZH9B 2FU5C 3JVUA 5ELXA 4K81B 5JCPA 1N6PA 3AKDA 3K09C 5DE3A 1X6VA 5EP1A 4AYWA 2KWIA 4OHZA 3T1TA 4KVAA 4C4PA 5TV2A 4QBGB 4W7SA 4LJ7A 3B8HA 1UKYA 2ZRBA 3FMOB 3BFKA 2ODWA 3P20A 4Q4AB 1AS0A 3U3OA 3AUYA 3IHLA 4HAXA 1XWIA 3AF4A 2ZJAA 4LJ5A 621PA 4CIDA 2G6BA 4Q1DA 1JI0A 2REXB 3SI7A 2ZXUA 1Z0AA
chains in the Genus database with same CATH superfamily
3B6EA 1WS6A 2FPUA 4JOQA 1KSGA 3ROMA 5AQ1A 3USES 1G41A 1YS2X 3I34X 4MV6A 4ZOAA 2C5GA 4EARA 4ECAA 2ZDGA 3FXAA 3PC7A 1BA3A 1PWZA 1WEKA 3LT5A 2PQ0A 2C5BA 4DQXA 4BJ1A 3IIMA 2X1MA 1XXHB 1ZUIA 1FDVA 1SPBS 4G1CA 3AOEA 5CDYA 1L5LA 1WW3A 3LW7A 3R6LA 4CHGA 4I19A 1I9GA 2AZXA 4WMLA 4AKIA 2GEFA 2JLCA 4FNAA 3WC4A 2PEYA 3B51X 4H4DA 5I7EA 2XQVA 1AV6A 2QLJA 1GEGA 4WASA 2C1XA 3PWSA 1TA4A 4B3CA 3M4ZA 2PKQO 4WPGA 2I2XB 1ZFNA 1LD3A 3VMMA 2ZDHA 4W99A 3OLZA 1Q1EA 1QH1A 3BVPA 1H8HA 3G23A 4G1UC 5AT1A 3TQFA 4DDKA 4E08A 1HDIA 1JR6A 1UJMA 2PL1A 3AM4A 4IJMA 4XSHA 4S1OA 5BQXA 1WMBA 3I42A 4MIYA 5TVGA 3KJIA 1Q0SA 5PNTA 4Q9LA 1IG0A 2GN2A 4Z3DA 1QYRA 1YWGO 2X2OA 3A32A 4KWEA 3OQIA 4YN3A 5DN6D 5GOZA 3P97A 3TQSA 4U2DA 3IQDB 2Y3IA 2ZE5A 4L4YA 5DHPA 4O2RA 3EXHA 4A4DA 1DSSG 3TEMA 3UGKA 3ZHTA 1D2GA 4NRDA 4UVHA 4DZZA 5HSGA 1F1BA 1AHIA 3K9HA 4JP1A 3KSRA 4ODIA 4PBRA 2B78A 5CA0F 1PJ8A 4CMCA 5EJEA 2MR5A 3NGXA 1KC1A 2QN3A 1ZK4A 1TJ4A 5WRFA 4J2TA 5I48A 2PUGA 5GV8A 3FZYA 1NVDA 2XUZA 2IXTA 2XYPA 2N9UA 3AUTA 3L7YA 1M6VB 3Q7SA 2XRFA 3NBXX 4KO4S 3TEFA 1VLMA 3KZVA 1YFLA 1CRPA 4Y30A 4DDUA 3T3HA 2AG1A 4P5PA 4M1MA 4A2CA 4ZEWA 1EXMA 2H8GA 2PZAA 5A1TA 2PSJA 2FZ5A 2X9NA 2X6QA 1UXIA 4O4LF 3TLZA 2RDMA 3ORYA 4OHOA 4E13A 1SXJA 4V1CI 3P0RA 2HTFA 3L41A 4AZTA 2PZBA 4FSXA 1EKXA 1CLEA 1U7WA 2FZWA 3D1LA 4ZDJA 2FF7A 1Q0ZA 1DXHA 2HA4A 3EULA 4DIMA 1U81A 2YS7A 4KFRA 3RW9A 1M10A 3IAS1 4G25A 2AD1A 3V7YA 4C4XA 4G0OA 1YZTA 4O1IA 3KYCA 3PDIA 5FUXA 1Q6YA 3BKXA 3QLVA 2XD9A 3GJQA 4FFWA 4YCLA 5ITZB 3M6MD 1XRJA 2QQEA 2XYVA 1TPYA 4HB4A 2C1ZA 1W5EA 1R74A 1EUDB 2WC1A 3SZ3A 3H5RA 5EC8A 1E4EA 1Z9BA 3K8QA 4G23A 2DQ4A 4HH0A 4MEAA 3S1AB 3WIBA 3IQWA 3ZW9A 5KUTA 5KYYB 3K70B 2D4AA 4P35A 1CRLA 4C4TA 3BFXA 3V4ZA 3OFNA 2K5UA 2O7NA 5K5EA 4TT3D 1M34B 4OK3A 3EAQA 3FUVA 3CF4G 2M6KA 4R3WA 5G53C 1JZSA 4LRUA 3ZWVA 2O0HA 1Z26A 4L9WA 3LT2A 2VJDA 4PGFA 2GPJA 2H06A 4YLYA 1NR1A 3TMAA 1LJUA 2WPNA 1RWPA 2QMZA 3L77A 4YRTA 5HBRA 4HNVA 1EVJA 3TNJA 5TEWA 4PYQA 5AHWA 4XYEA 3TW6A 4EG5A 4UEJA 3THOA 4ZI7A 1YJ5A 2QR2A 1C8BA 2IOFK 3BRWA 2IP2A 4FTWA 1GSOA 1SFRA 3FY4A 4OAQA 1KI2A 4ROTA 5A02A 4JT2A 1Y3HA 4RV5A 2YICA 3F9IA 3UZUA 1GITA 4JLUA 4TV9B 1VHWA 2W8BA 3UANA 3UK0A 5EMNA 5K3CA 3FB4A 3GHYA 1J8MF 1FTSA 1FU8A 3HWWA 1RHKA 1SGWA 3OF2A 2JIZA 3LQKA 4RSRA 1YFJA 3TQQA 5C7IO 4JT9A 1T3ZA 2FWJA 2H08A 2Z2IA 4QGAA 3FFTA 2PANA 4PNEA 1ML3A 2QL6A 5KJEA 3RBXA 3TLJA 4NZYA 3D0QA 1N6LA 1FTQA 2HB6A 2FPPB 3FSEA 3SR3A 3VFDA 3EXG2 2WAMA 1CZUA 3JQ8B 1N1DA 3TOCA 3N0VA 5JJ5A 2CEKA 2AI3A 3PD0A 2VDQB 2GPYA 3U80A 1GA1A 2VCEA 1WCIA 1MO5A 1X86B 1XZQA 4GNKA 3WGKA 3NOQA 3DL2A 3ECSA 1QYDA 2D74A 3DE3X 2QUKA 3OHMA 3WWOA 1E58A 1VA4A 3N39C 2HREA 3TUZC 2CLCX 1H05A 4LGYA 1CD5A 2ST1A 4G0QA 4M1SA 4FOTA 2X9GA 4MUBA 2XNDA 4V0LA 3FPAA 3D6MA 1U2DA 4O4HB 2EJCA 3LWNA 1UBOS 2WR8A 2ZS7A 4Y1EA 5CT4A 4D3SA 1E96A 1KORA 3ZU6A 4PHFA 5LQUA 3ZNNA 4A27A 3WLOA 5DPMA 3BM5A 3O90A 1CHDA 3FRHA 5JSUA 3P0HA 4PFJA 2R4QA 2F3UA 2R47A 4Z9BA 4LC0A 4A8JC 5BN4A 5HIJA 1XSEA 3OT4A 3UENA 4HWGA 5I4KA 5D6NA 1ZINA 2NACA 1M6YA 4Q15A 3I8XA 2DOKA 2QYHA 3AR7A 3C5HA 3K4PA 4LYFA 4D4KA 2COKA 2ZCVA 4EHLA 4NATA 5J4HA 3ZGYA 5MGBA 1YQTA 3BWXA 3UUFA 1Y3FE 2GVDC 1F2DA 1XCOA 4JB0A 4D5EA 4OXYA 1RE1A 1S4QA 3OX1A 1NATA 1CQIA 2VZ9A 3BWVA 2I2DA 4URZR 4XFJA 1LLQA 2DHQA 4FC7A 4P82A 3LA6A 2YR0A 3FLEA 4MTLA 2IBMA 1ZUNB 1UK7A 3EPHA 2NPFA 3TCNA 3R3ZA 4R83A 2QS9A 1DAHA 5B3LA 1X70A 4AF8A 2PMKA 4R8KA 2D4HA 1R37A 2OLEA 3L7CA 1N2ZA 2VT2A 2XOKD 1MU0A 3W5JA 3TECE 3CVYA 1D8AA 1X19A 1U4OA 2FP4A 1NBAA 1JFRA 3PQDA 3TSCA 3LF2A 2XLBA 1EWTA 1PX0A 4KQKA 4LOKA 4PWZA 4YAEA 4EFMA 2PX5A 4DYVA 4LSZA 2ZRAA 3QEKA 3ELYA 2QUAA 4BV9A 4COKA 4LRSB 3H6HA 4OM7A 5FLYA 3EDYA 3KDSE 4B3IA 2C3YA 3JQDA 3SQOA 1BEUB 3OP4A 4MQBA 1MKYA 2R6JA 1FRQA 4ESHA 3LECA 5DIFA 2DWUA 1G8JA 3LKVA 3AR2A 3R5TA 3ZVNA 4F12A 1SXQA 4NBVA 4C07A 2VF2A 6REQA 4KXFB 5CVDA 4KGVA 5J2TB 3A05A 2UYQA 3LYHA 2WSMA 5EFOA 2AMJA 4D5GA 4P38A 1Q0UA 4QODA 4A0GA 3ZCVA 2AG8A 4AN1A 4D8UA 2JCBA 1E79D 4I8DA 1WCWA 1EI9A 2BELA 4IKPA 3K35A 2ETXA 5FUMA 5I9SA 1DTWB 2JKYA 4FDMA 4G37A 4AZ0A 5LZ7A 2GWRA 4BN0A 3I45A 4RBNA 1FLNA 3DZFA 3UJNA 1XO1A 2VDKB 3CEJA 2P11A 5BN5B 2YCBA 1LBHA 3M9WA 5AI4A 1UT5A 5KZMB 5L9AA 5I7OA 4OLBA 4XX0B 2V3WA 1UBEA 2AFVA 4JUAA 4YO8A 3DTTA 3RVBA 4C5BA 3HGTA 4B0OA 4UM9B 2FXVA 2J4DA 1KOLA 4FWBA 2BBWA 4IH4A 1AE1A 4LRTB 4MS3B 3RUFA 4CKEA 3LO5A 2F43B 1FPMA 2FKAA 4R84A 3ZLJA 1L4YA 3IEPA 5DASA 5FH9A 3X0DA 1A5SB 1WAMA 4UVEA 4YV2A 2AMLA 2CLLB 3S27A 2BH9A 3D3WB 3H7AA 1KVRA 1QO0D 1P7YA 3F6YA 2WIGA 3HY3A 3QEMB 2AN5A 2A33A 4MZXA 3FKSD 3T4EA 3BF8A 2P7HA 4HXYA 4DMCA 1Q95A 1NQ5A 3VHXB 4UFNA 2CL0X 4TM7A 3LVFO 2WQZA 3K73O 5JW6A 4WY5A 1R27A 2VP4A 3HJUA 1UZNA 5J23A 2P6PA 5CB4F 4DIDA 4L74A 4NYMQ 3PC3A 4FB5A 2Y4OA 1PQWA 3T12A 5FHQA 3BWMA 1QAMA 2OZLB 4NJEA 4BBAA 3O8OA 5LP6C 1U8ZA 1D5WA 1KTVA 2IV3A 3TZBA 4E1VA 1I4LD 4F0JA 1TMYA 2JBHA 2CXSA 4Q9JA 1VCNA 4Q4AA 3N8DA 4ZYTA 3G9QA 3H9BA 2KW5A 1WZNA 4XUDA 3D1JA 4KMMA 4AS3A 5IAJA 1VMAA 4IQGA 3AOGA 1U2QA 3BORA 5DGIA 2RGNC 3G8YA 1X1QA 1MDFA 1Q22A 2XHEA 2BUBA 1IEQA 1PZFA 1TF7A 2XB4A 3TXYA 2ZYWX 3AG6A 3TKYA 1WNFA 4CDRA 3G8CA 2V8OA 1C81A 5SY6A 1CX9B 2AK3A 5KOJA 3UKOA 1MVOA 4YJFB 4DIEA 1C8LA 1YFKA 3FGOA 1IBSA 1W2WB 4RESA 1CNEA 2JATA 1P5HA 4TLMB 2FFBA 2PTHA 1PF7E 2AOXA 4Z4HA 4BLTA 3QVJA 3PRHA 3JZIA 1S2LA 1AT1A 2VK2A 1FYXA 4RORA 4DAOA 4Y9UA 1TF5A 2YXDA 3BGVA 3JS5A 5JI2E 3A36A 1N7IA 2FQXA 4P3YA 2P5TB 3DBOB 1B3BA 2FK7A 1C1DB 1YGPA 1OZ0A 4N39A 4P86A 3MGGA 4PIVA 3VSAA 4D9HA 3KOXA 1Y81A 4EGAA 5KSOA 3W7VA 3K92A 4L73A 3PXCX 4IIUA 1RABA 4O8ZA 3FCSB 1EINA 2LP4Y 1Q16A 1HEUA 3AETB 2XDWA 1WEHA 2DQSA 3C7DB 2VSNA 4ZQHA 3TB4A 3RRBA 2JEYA 5EZYA 1RXUA 2H1CA 2NTNA 4NG5A 3A2KA 1N5KA 3KQMA 2OCDA 4LXHA 1PFQA 5GWXA 3OZGA 4BP3A 2DTDA 1MV8A 4DUGA 1GPAA 2JFOA 3V1KA 1YZ3A 4CLRB 2E4AA 1W44A 2V6FA 1EHYA 3OOWA 5C1OA 1FK8A 1TB4A 2XODA 4YHHB 5FDFA 1EGQA 1SCAA 1FRFS 3PHBE 4HZUB 4GPEA 4DXDA 5C9ZA 1O54A 4FCWA 5EQDA 1GPJA 4IUYA 1NDUA 2VA8A 2HSGA 4KR0A 1H1LA 1NJFA 1RPJA 3DZHA 4JROA 1RACA 2PMEA 3VX4A 4C3VA 1NG9A 2EFDB 1XYYA 3QYFA 4QC2A 1ZLYA 3UCFA 3WGYA 2FFJA 1NX6A 1BHQ1 2FUKA 2WDPA 4K87A 4LWZA 4PLPA 5JLJA 4WKBA 3X2SA 1EVQA 1Q7EA 3GG2A 4M9ZA 2CVHA 5DHSA 4AF7A 5ENVA 4CT5A 4ZC8A 1RBMA 4XQEA 5A62A 4OA8A 3NNSA 1CVIA 4EH1A 2NUTA 4Y7DA 4WCFC 2ZRFA 4UTRA 2NV6A 2RAPA 4ZDKA 1QS0A 1IC6A 1PDWA 2INGX 1EB8A 4KAFA 3EVZA 2HMTA 2QE6A 2P1RA 1F0KA 4ZT7A 1TU4A 4JUCA 4CV3A 4E14A 1Y8QA 4YV1A 7REQB 1JJAA 1BFDA 1KGDA 2FZGA 1C0KA 2PD4A 2VP3A 2WFMA 3G5AA 2HZ7A 4PLCA 2WD9A 4YQEA 5LYJA 3TN7A 3HP4A 4IYJA 5C7YA 1J2YA 4EYOA 3DLHA 2O3JA 5L4SA 5IXJA 1O7JA 1Y9DA 3U3DA 4NCJA 4KDRA 3ZCRA 1RHMA 1YHNA 2IEDA 4QO7A 4CLEA 5AJWA 3BSWA 3LIIA 2D1FA 3CINA 2Q3LA 3TD2A 1EZ4A 1Z47A 4E03A 3KAJA 3LSYA 5FAKA 1ILEA 1W36D 2EKLA 5FR2A 4BLQA 1XZAA 4EG6A 2QR3A 1HT2E 1E7WA 2ZTUA 2H7CA 1W46A 4FEYA 4N3CA 3NHWA 4PHGA 3ROXA 3SQDA 2UZ4A 1ZD8A 3Q6IA 4QLAA 2A57A 5FR1A 3WFJA 4ZJZA 1LSSA 1OV6A 2KE5A 1RM4A 4MR7A 1FFXA 2H5LA 2BUCA 4X8LA 4JDPA 4HMOA 1M1YB 3FCEA 2VNAA 2C9OA 4WGGA 4L0DA 1OLUB 2YVAA 1EWQA 4ZQGA 4DEYA 2H1IA 5H3HA 3AX6A 4GXTA 1J0DA 1PV4A 4F45A 1CY2A 2P6MA 3U4GA 1DPFA 1F6DA 1HF3A 3IAAA 1RYFA 4I08A 4MV1A 3D3JA 2VHTA 3OU7A 4JIMA 5IC5A 5A3JA 5C1DA 2AG5A 9ATCA 2FLKA 5JAPA 5CG2A 4L4ZA 4Z7OB 3PQ3A 4UASA 3WDSA 2FDCA 1GGJA 3PNOA 3Q4GA 5IM5A 3C3YA 3TNFA 2O0JA 1LDYA 1WUKS 2K6GA 3K8ZA 4WESA 3DYVA 3I32A 4YS6A 5JARA 1YL6A 4GOJA 3CUWA 3GV0A 3ZWNA 3K1JA 1G63A 4KAAA 4RZ3A 2AT1A 2O0MA 5E2AA 4OB7A 5CDTA 3DW3X 1BVUA 1F12A 3INNA 4R5MA 1W4AA 5C0OE 5CLQA 3K6JA 1Z07A 4UBKA 2FR1A 5AVKA 2WWXA 1WDMA 1C4XA 1XB2A 2QTLA 3K9GA 2ZRPA 3GC6A 3GP5A 4PZEA 5JJLA 1XD8A 3QXSA 1P3Y1 1J9GA 3E9EA 3F98A 1NW9B 4EKNB 2GM9A 3S1SA 2B99A 1O94A 5D5PA 4URWR 2SBTA 4KH1A 4F11A 3ZJUA 1NXTA 1IN7A 1QX4A 5IMBA 1KHHA 4JUDX 3PXBA 2ATEA 1B76A 3ZLUA 3PE4A 1HE1C 3TQTA 4NENA 1RM3A 2VL7A 1C5KA 1YQXA 1JF8A 1Z7GA 1K27A 2H7VA 2WJWA 3FNBA 4UUPA 1JSZA 5E7MA 2AOTB 4XDHA 3HN7A 4B09A 1MGPA 1TT5A 2X8AA 4FNGA 1Y33E 3DQPA 4TYQA 3OEEA 4IEIA 2X0DA 3SHFA 3ZTYA 4CWAA 1YMUA 1T36B 4ZOLF 1WJGA 3BF7A 4UTVA 2H1HA 4ZVKA 3P26A 1DAOA 2OPHA 3WLTA 4HO1X 3UAWA 2G0AA 4ZT4A 4TKZA 3GLIE 3FUUA 3GFOA 4NSNA 2ZI6A 4DLTA 3CO5A 1YC2A 1CVRA 2CFSA 3SQWA 2LZ0A 1C9YA 3EJ6A 3KJHA 5DK4A 4DXHA 2D1RA 2HBZA 1US8A 4KNVA 1J5XA 4L28A 4BWGA 2R8OA 4BQFA 3T9DA 4QPJC 5DBHX 5E6RA 4RKYA 1XQXA 4RTSA 4A2PA 2BGMA 5AM3A 1OYYA 1E2BA 5EIBD 2A5JA 4MRSA 3A26A 3QPDA 4UU0A 1K66A 1T2FA 2ZIAA 4MQ5A 3VO9A 1WUTA 2XSZA 4FBGA 2B7CA 3I8OA 2ACKA 1WPQA 1H1TA 1NQWA 1Q7CA 2GN6A 1AN0A 2VUTA 2WHQA 2YFQA 3KWFA 4MYUA 4EBFA 1L9XA 2X15A 2W7TA 3PICA 4M55A 1IXZA 4MV8A 3WHPA 4Q9HA 3BZUA 4CMHA 1N5OX 3BXXA 1ZVVA 3OZBA 4YRPA 4I1UA 4O4JF 1SVIA 3EIXA 3K6SB 3LCVB 1LLFA 721PA 4F38A 3H84A 4M3NA 2HWXA 2J67A 1K98A 1KEVA 5DNVA 1SXIA 2IKQA 2GCPA 2R2GA 2AE2A 2DY0A 3DKKA 3HHPA 3O8QA 3QX9A 4Q66C 3RVLA 4FU0A 1Z0KA 3SIXA 3GT4A 2RARA 3T1OA 5GQSA 3KM0A 4OHBA 1W6RA 3MD9A 4ND1A 5EKXA 5F73A 2WVAA 2R1VB 3KV3O 1G7TA 1FX1A 3HJGA 4JLVA 3IQGX 3W8DA 4D6XA 1R2QA 3ITDA 1M74A 3JRNA 3NANA 1H2BA 1U0HC 2X77A 2ZYGA 1O08A 1W5FA 4LE2A 4FZJA 4MAAA 4RIEA 3U44B 3H8SA 3WWDA 5CX1B 5JS8A 2ADMA 3G9UA 4M9QA 4EB3A 4B6GA 3JAMA 4M9CA 4QQRA 5EKDA 3JTMA 5CT8A 1GGNA 4RPHA 1MQ9A 4EPWA 2PRKA 1YZGA 5F64A 2GNPA 4ZEOA 2E4ZA 5K8CA 3KQUA 1GG8A 3RLFA 3B2QA 3CSDA 1AC5A 3N87A 4NDZA 5T4HA 2AV6A 1MG0A 2GBPA 2QV7A 4RZQA 5JSFA 1BCSB 2VTKA 3EXIB 4IAOA 4ZT3A 4BB9A 4Z7QB 4RDCA 1WSAA 1GKKA 2PD6A 5AKIA 1NOJA 1FPQA 1RAHA 4Z4QA 2RGGA 4KX5A 1P2FA 1TQ2A 3I39X 3CZ5A 1I13A 1RPAA 2XMDA 1VYTA 1W9HA 4IX1A 3RC2A 4I6EA 1T1JA 1OWMA 4R1PA 3ULKA 1IZ9A 4KTVE 4JC8A 2ZXEA 4NOLA 2IU6A 2IDKA 2N3ZA 1Z37A 5T64A 3A6ZA 1S8AA 1WLSA 1SHUX 4YR9A 1G1AA 2VPTA 1J8FA 4F4DA 4MWSA 2O8NA 4OYYA 4KU4A 5CB4B 2NV0A 1N6RA 2JBAB 4R05A 5BOSB 5JSZA 4DUZB 4DR2B 3I4FA 4EO7A 1KK3A 2IYYA 3Q3VA 1QV6A 4DCCA 5BXYA 1UBRS 1Z74A 1AF4A 4D96A 1FDWA 1M2NA 4FGLA 1XDBA 1OH8A 1DG9A 2KPOA 1DV2A 3FM9A 3D7RA 4E5MA 3RQSA 4FPXA 4UBOA 3AF6A 1E3MA 2V6IA 3LYUA 2C3MA 3HHEA 4B74A 2A0XA 2Q28A 3GHHA 4YAIA 3REQA 1WKVA 4XM2A 5FPYA 2P2GA 3ACBA 5D8DA 1PZHA 4R0VA 3FH0A 4YK7A 1G38A 2WYHA 3QLEA 3IL2A 3U3ZA 1QLJA 2HI0A 2CUTA 3SXUA 1TOAA 4ZRNA 1P7CA 1FB5A 4G0ZA 2XDQB 4L5CA 5CIQA 2EZTA 4RH3A 1RWNA 1VSBA 2Z5FA 1KJYA 1MZPA 1S96A 3T3DA 3TZEA 3OCVA 2GD2A 3CG0A 5FWYA 1OA1A 5ED0A 2YMQA 5FA5A 3LUKA 1SKAA 1YB4A 1TM5E 2FUCA 2I7VA 1ZD2P 2NADA 3BCHA 3PC8A 4FX5A 3RLIA 1QHGA 2ACEA 3ZBUA 1ORWA 2WJZB 4JEHA 4CF5A 1MNQA 5IMSA 1ZG3A 3HU3A 1XMSA 2Y71A 3OZTA 1ARZA 3PPVA 2FEXA 3R7BA 3V1MA 3GA7A 5J2UA 4B3RB 2F62A 3Q72A 4FYMA 5JZ9A 4CL0A 5LIPA 3NJ8A 3DOCA 4OLFA 2VTDA 4KIUA 1PFYA 1RCTE 2C77A 1WQ4A 5BYKA 6AT1A 4CIAA 1DKRA 3KV1A 4JBXA 3EW9A 2YVQA 1A4XA 4NI5A 1CJBA 5I9IA 3H1EA 5LMUB 1IZ8A 1ONSA 3IV6A 1UWVA 3QE2A 1MIOA 1RAGA 1OYVA 2P67A 4JI1B 5JYEA 2XUFA 5DT2A 4E0BA 2IPLA 2LIVA 4HWPA 1AKMA 5DM1A 3ZHRA 1OROA 3SSNA 4TTJA 4DMLA 4BGVA 1J07A 1TTTA 3MJEA 1THMA 3BFPA 1P4JA 3WVNA 2OO5A 3NO4A 1I8TA 3RVQA 2ES4A 1VMDA 4YLGA 5G4KA 2HIAA 5M3BA 4NQRA 4M1OA 5IVHA 4ZVQA 1SBIA 1KP2A 1W8IA 4XDYA 3KBBA 3A2NA 2FWNA 1KAQA 1MLDA 5KOHA 3FHCB 1OH6A 1I4EB 1THTA 2HU8A 3OPYB 3KEQA 5IF3A 5JPDA 2GT1A 2OCIA 3QFSA 4JQYA 4KI0A 5MN4A 4A2WA 4Z1OA 4QM7A 3R3YA 3ABSB 1RXVA 4MVJF 5JANA 4WLNA 2BAGA 4B4VA 3VOBA 4Y7CA 1NVXQ 1T3HA 2B1GA 4K1LA 1NBEA 1G5RA 1OVMA 4KVGA 4MI1A 3IUBA 5ALJA 1A0OA 2ADOA 1Z28A 3BBLA 4J7XA 1YZHA 1J0EA 3DUFA 3W7BA 4AO7A 2FCAA 3ONEA 3B7GA 3CCFA 4PW0A 1JZQA 1ZONA 2M6SA 1QKIA 1ZGBA 3NH6A 1TADA 4C4ZA 4GWGA 3P9ZA 5KI6A 3M83A 1QRRA 2HWUA 3RTCA 4JJEA 1Z0JA 5KTNA 1ZQ9A 3PQEA 2O6HA 1IZ0A 2W70A 4IGKA 4XWGA 1R0RE 3OLYA 2DPHA 3AO0B 1WXQA 4Y2PA 2OZVA 1USVA 3HMKA 4U7FA 4P0QB 3SM3A 4J4TA 3VR1A 2AJTA 4OGGA 2DBQA 3IBCA 1Y42X 5B12A 2C7BA 1PO7A 3G85A 3RE1A 3LDHA 5K0EA 1IYZA 3OT1B 2WIKA 4DDHA 5JRDS 1H94A 1NYLA 3EDQA 1BXRA 4FYXA 3GG9A 5AW8A 4OEHA 3T95A 3I4CA 4HQLA 2QL5A 4GVXA 1WPGA 4ZOEA 2A58A 3AHHA 3T15A 4B43A 3WGIA 1F3LA 3MQFA 1FIUA 2XPCA 3WJAA 2X41A 2BJWA 2IXEA 3DAYA 3EIHA 1J2EA 2Q5EA 3ABQB 3HMQA 5ILQA 1AQJA 4MWTA 5F9FA 3AY3A 3RSSA 2ZITA 1I2DA 4P6VF 4KZPA 4Z0PA 3WRYA 4IZIA 3ASVA 3HCWA 4RYDA 4E33A 5HR5A 1Z34A 2XCLA 3CC8A 2OXFA 1TVEA 3WQSB 5C81A 2WJGA 2WAYA 4PO9A 1VMIA 3TCKA 1GTG1 2BZGA 4CR6A 3B6JA 4ERXA 1NQVA 3ESAA 1LX6A 5DMXA 4QNRA 3C6MA 2AS0A 1IWOA 1XT6A 2F1OA 3LKBA 4K7JA 4J4BA 1TD9A 1KAEA 2L19A 5ELMA 1KGSA 4EHDA 1E1DA 2WZQA 4LDZA 2BUAA 2VSYA 4JUIA 4KOAA 4R8SA 5C4MA 2XAUA 3UXHA 1VLQA 1B00A 1C2TA 3N2EA 1RRFA 2Q2QA 1SU4A 3DMTC 4BKMA 1FTYA 1WV0A 3DDNA 3DDUA 1G3IA 4GWKA 4MGIR 3OTWA 4X94A 3WLJA 4DEXA 1ISMA 3DMPA 3KKKA 3C74A 2IWRA 1VP3A 3G8BA 2W8ZA 4IXWA 2H0QA 1M6WA 3ET5A 4P4LA 5TQ2B 2Y0EA 1T6YA 1DJPA 4G6ZA 4PC2A 1B0UA 4UMDA 2RKOA 4B6RA 1UZLA 2JGIA 3U4MA 4JC5A 4OI0A 5BPFA 1SHJA 4A5OA 5LR6A 1RBQA 1XTPA 3EEIA 2IDJA 2WJVA 1M1XB 3G9TA 2JEZA 3AOEC 3SJBA 2YRFA 4NS4A 5DMHA 2VJMB 4IO0A 4M86A 5HHTA 1OX5A 2E1RA 4YRNA 1J70A 1PYGA 2EFHB 4TVKA 3WOHA 2QNRA 5HQJA 1BX0A 3V33A 4JT8A 1OVGA 5DX8A 1E2MA 2AFHA 3P27A 4J1NA 3QBDA 4UBMA 4WVFA 4C0WA 4DMHA 2IHYA 4EK9A 4AKHA 3LGXA 1N0VC 3DTNA 4GX1A 4J3FA 4N5LA 4RTMA 3JALB 2R1TA 4X84A 1XD2B 2UXBB 2Q5HA 1VLLA 1T0BA 1YFZA 2B5VA 2C78A 5F3RA 4BY9E 2C2MA 1E1CA 4YIKA 3ZDDA 2QE7D 1W0JD 2N0SA 1HRDA 2OL4A 4ZO4A 3T06B 1I94B 1U7HA 3WL4A 1FL9A 2W2LD 3KOOA 3ZLBA 4KQMA 4RHEA 4D9FA 4BLWA 2JH9A 2JD2A 2OAEA 2X40A 3EXHC 1JHDA 3L8EA 3LTNC 4EAQA 2O0KA 3VISA 3WNCA 2AKYA 2YIMA 4K0RA 1XKLA 1ZGHA 3TE6A 1SOVA 1RKUA 3IOMA 1CQJA 4ZD6A 1PT5A 3UJHA 4AVYA 5LD2B 3DLBA 5CT9A 1RR6A 2GB4A 2WT8A 4R51A 4K6MA 1E7YA 1NI4B 4Q03A 3DP9A 1E77A 2I7CA 3H5OA 4UXHA 3WYNA 2O2JA 4P8RA 4CQLB 4LNUA 3D5TA 3NLLA 5JO0A 5KTSA 2NTYC 1RZ3A 1ODTC 2I3BA 2BEVB 5LP6F 1FDUA 3LDAA 2J87A 1GGKA 5DTEA 1N2JA 5ALDA 1W0KA 1ULHA 4KXXA 5JZOA 4K9NA 3H3FA 2P3SA 2PKWA 4Y2GA 3H8JA 3PXDA 1LS1A 4KE8A 4O5AA 1N7JA 1U9YA 2YV4A 3N0XA 4PAMA 1SXJE 1VE9A 2J3KA 5DBFA 3ES9A 3S2SA 3TJZA 3VPAA 3TSAA 2UUPA 5EHQA 5EJGA 3D8BA 3QLVC 4UXIA 3NQ41 1ZH2A 3OE7D 2X4GA 1GNVA 3JQAD 3LX6A 3P9YA 3WICA 1LUAA 1MC8A 2TMGA 2R2AA 5JMTA 4I55F 4YWJA 3T4XA 2I67A 4PYNA 4C0XA 1HNZB 3FCXA 2D7JA 3L93A 3QVTA 5SZIA 4KPUB 3VM6A 1FP1D 3PSHA 2AA3A 4FIDA 4QJIA 3A7EA 1UC8A 2R87A 2YIJA 3C2QA 3HUDA 5BQOA 1LNZA 5L3ZA 3W90A 2YC2C 3ZXYA 3GGCA 5EIEA 1QOZA 2P9HA 1ZNXA 1L5QA 3HP7A 3EMKA 4OP1A 4Y6LA 2RB5A 4G89A 2XD4A 3QU5A 1XV5A 3TW4A 2TMDA 3OZSA 3LCRA 3NDIA 5I9NA 2BZ0A 2PBFA 2VYNA 4BJ3A 5FF9A 4IY1A 5JPIA 1XMIA 3AF5A 3GZTB 3FOEC 1WW2A 1Z5PA 2F1JA 3KIPA 3MWFA 5K3AA 1NYRA 2QX8A 5JCXA 1NBOA 2GF0A 3RYCA 3SX2A 1FNNA 3FLAA 5K0SA 2V7QA 3LVBA 5IJZA 3HU1A 2PH5A 3G5TA 5IKOA 4QT0A 1FC0A 3TINA 4HUQA 5BT9A 2ZYVX 1V11A 4KXMA 4NY1A 5CGZA 2FMUA 1AMOA 4IJWA 3S68A 3M70A 2XRYA 3C3DA 2J5RA 1V7QA 4TWIA 4U6QA 1I4OA 4Y1FA 1FX0B 4ZN6A 1NFQA 1NVVQ 4EMUA 4GOXA 1A4RA 1JNYA 4G1FA 3DVLA 4BQEA 2C94A 2NLOA 2BFCB 5J5VA 4U4AA 1A8QA 2YN0A 1N36B 3GLGB 1OHHA 1T35A 2PUVA 2ZTSA 2H11A 2GRUA 4P7BA 1AGNA 3PNYA 1YJBA 1ZMRA 4GMXA 2UDPA 3FUTA 3L7MA 5EPEA 1UK8A 4NV1A 5A6SB 2GAFA 1OWNA 1MAUA 4MITA 2YZNA 3HUFA 1P7WA 1TUBA 4U00A 2P69A 5KTOA 3A3OA 1M2FA 1U2DC 2FPKA 3N0RA 4ZGWA 2BJHA 2I4TA 3PC6A 1MW8X 3VDNB 5B6PA 2ZIWB 1N77A 1K92A 2J3IA 1USKA 2VHWA 3ENZA 1K7FB 2ZYRA 1H2HA 3OH8A 5CMLA 4CI9A 1TC2A 1ZC4A 4BU1A 4GOOD 4JVSB 5ALOA 3UBTA 2XF2A 3B6ZA 1GSIA 2B4TO 3K94A 4Z6KA 4D9MA 3PGVA 4GC9A 2QJWA 4JX8A 3BWDD 1BGVA 5FNVA 4OIMA 3CN9A 3WOVA 2XQFA 3DEIA 3VSDA 1YIOA 4PTYA 3D8RA 4C21A 5ITWA 3SS7X 1XWWA 4JFRA 4L8YA 2OFPA 4FGZA 3O8BA 1CUZA 3SC4A 4BOYA 5C52B 4QGFA 5FOWA 6PFKA 4AY3A 1NJ2A 1E6UA 1R9NA 1SUBA 2WSYB 2GN0A 3PCTA 2WTBA 4N12A 1TC1A 1WMSA 5KTTA 1U4NA 2PR7A 5IU6A 4DV1B 4PPNA 1OKKD 1ORHA 1G4UR 1FNDA 3ESXA 4JL6A 4JNKA 5GP1A 4ZEXA 5JYBA 2BCJQ 2XQKA 4ZQEA 4WH0A 3EC2A 2G06A 4EUKA 5K3FA 5CFRA 4PYJA 4AUNA 4DM3A 3LY7A 4DQDA 5CNIA 1ULTA 5CBKA 1LEHA 5HNKA 2V58A 3DPSA 3ZY6A 1VSTA 4JELA 4DLPA 1P91A 3NETA 4Q9IA 4YP0A 5FI3A 3JU3A 4LF7B 2ACVA 4MQ4A 5DWVA 1OWLA 2FEAA 3ZXXA 2Q3HA 5KU1A 5LQCA 4MR8B 4PICA 4AJKA 2JFPA 4UMFA 3DMGA 4WXPA 4Z49A 4Q4DA 3GLKA 4J6EA 4BLPA 1UBSB 3CNLA 3EZ7A 4YRJA 1IZYA 1QG2A 2JGLA 1JR3E 4RTJA 1U04A 4ZICA 2RBGA 4DTIA 4Z1MD 2P5UA 1UOPA 4BATA 4RH1A 4OA5A 1MX1A 3A9UA 1R4NB 4TYYA 1E3WA 1QYCA 3EEFA 3RRFA 4CIYA 4AY6A 1M5UA 3NUGA 4MW7A 5FOXA 3GFRA 1VE3A 1BA2A 3ED5A 2YN2A 1YK1A 4UU1A 3UAVA 5JBNA 1E1KA 2GPWA 3N8IA 3PVSA 3UWPA 5CDSA 2P68A 1DCTA 3V46A 1E1NA 4LG1A 4DLWA 1JKMA 4P4SB 4RY2A 5BW5A 2JLUA 3BHIA 4CDGA 1T5TA 5JZBA 4OXQA 4MWDA 5JRJA 1AKRA 1GG9A 4EZIA 2Q4TA 5KAPA 4CKCB 3ZU4A 1JLSA 1ORVA 1NQUA 2C7PA 3LY8A 4UUNA 1QLWA 3EQ7A 4A0SA 2QPLA 4JJ8A 4A8JB 1JP7A 2Q62A 4OHVA 5ALSA 2VUSA 1QHIA 2GH1A 4MKGA 3MQ4A 4QBFA 1QR6A 4DSNA 1U94A 4YMGA 3EIQA 1MORA 2VN8A 2YY7A 2H16A 3Q15C 4OHPA 5TB5A 4Q9DA 2PCLA 2QX7A 2C84A 5IKEA 5IANA 5EESA 4KREA 1I01A 4JSTA 4MNTA 3D7SA 2PSEA 3DLAA 4KFCA 3V8RA 4GMHA 5BV2P 2NXWA 4DLYA 1P0CA 3FI9A 4M9XA 4IX9A 3IS3A 4UW9A 5TQVA 1H6BA 1YH3A 2EP8A 3VV2A 3OJOA 1TMKA 3PLRA 4FS3A 5AW1A 3KZKA 5BSHA 4CBVA 3INGA 3NEYA 2YOGA 3SR0A 3DYBA 2P3OA 4XVRA 1QQTA 3A9VA 5GONA 3HABA 1GZDA 1VLJA 1QANA 4BPBA 1TM3E 1MR3F 3OLXA 2IZ0A 2RD2A 3RK0A 1SB8A 3Q3JB 4M53A 1VKZA 5LA6F 5JVDA 3BYZA 4O2BA 4S3MA 1ZMTA 2OHVA 4BZXA 5M04A 4MV9A 1G42A 1O96B 4DRZA 4LMAA 2R9VA 1Q84A 3PXEA 3WKAA 1A9OA 2RHLA 4TTTS 4ZEMA 2XZOA 1ORIA 2XAAA 3ZE6A 1CFJA 3LQ4A 5HG0A 1XNGA 2PRJA 1QHHA 5F1PA 4DHEA 5HKBA 1UMBB 2Q0HA 2QPOA 2BLNA 3L7BA 3AGPA 3NRCA 5DXAA 1L6IA 3QF4B 2FQQA 4C1BA 4NNJA 4UMEA 1V96A 2C9YA 4PIMA 4HDMA 1EVKA 1GTVA 2DHCA 4LXQA 4YDSA 3U3MA 3X1ZA 1HLPA 2X19A 1KBQA 1RTTA 1KYVA 1XHLA 2V55B 3AERA 4GOLD 4LX8A 3YASA 4PPQA 1XN4A 5JS1A 3RUHA 4A1FA 5BVHB 2IFTA 4X7PA 5EQFA 4Q7QA 4PLYA 5FIUA 1R6VA 2H2IA 4MV3A 2C0CA 2Z2YA 1KKMA 3D81A 3NUZA 3OOSA 3T7EA 4D9BA 3VKHA 2JD0A 2GERA 4LZZA 2CUNA 4WJLA 4UTNA 3G1TA 3B2EA 5ENZA 1OB5A 4E2WA 1X7ZB 2H2WA 2ZP1A 3NGMA 1I2MA 3KT6A 3QFFA 2NN3C 5HEKA 1X8JA 3T1QA 1JYFA 1QYWA 1XLUA 5ARCA 1LZLA 2CLHB 4ZAFA 5HRCA 3V4PB 4BECA 3MRVA 4CLDA