4NMMA

Crystal structure of a g12c oncogenic variant of human kras bound to a novel gdp competitive covalent inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
b'GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 64
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nmmA00
3NG1A 4FMDF 1Q3HA 1S3SA 2B92A 1VG1A 2G83A 2P5SA 2VPPA 4XVRA 2OE2A 5AJZA 5EE1A 4PZLA 4JBWA 3TUIC 3MSXA 5KDLA 1R10A 2HYDA 3OEHD 4JLPA 3U4QA 4LDJA 1IN7A 3CWQA 2FFBA 4GT1A 5FTKA 1PUJA 5FTJA 4MGKR 1XDBA 4WOPA 2BJWA 1TQDA 3GLHB 4AG5A 3LWNA 4IRUB 1OPXA 1A82A 1H65A 1VIAA 2BC9A 2RGXA 2W2VA 3Q85A 2ZRCA 1TX4B 5HKKA 1T91A 4D4JA 2OFWA 3BWDD 4IOKA 2PMKA 3NBYC 1KMHB 3UXMA 4IDPA 1QHIA 1K5GA 1SKQA 1Z63A 3AKDA 3ADKA 2W2XA 2A3RA 3WNBA 3BRWD 5FPHA 4MUAA 3HPQA 2HLDA 4EQ6A 2F6RA 1MABA 2ZSDA 1FOEB 2FX3A 1BIFA 2O0KA 2WSSA 3T5DA 4B44A 1DE0A 4PC7A 2ZR9A 4M1OA 1YJ5A 1KI6A 2RGNC 2D2EA 1TF2A 2V1UA 2GZAA 2VHQA 4IVPA 2HDNB 4RSGA 2GXAA 2CDNA 2CL6X 5GADl 3ONWA 5H70A 3L0IB 1OIVA 5FOUA 3NVAA 5EJEA 2WV9A 2ZJOA 1U94A 4F4JA 3BB4A 3HYRA 4URVR 2UKDA 1RRPA 4RKFA 4FN5A 5JEEA 2GESA 4A0HA 1V5WA 2H5EA 1AKEA 3AKCA 3KFXA 2OILA 2ZE6A 3ZD7A 4RFSA 3TW8B 2EFDB 1E9RA 4FI3C 5JSZA 4C7OA 4ZKEA 3JVVA 4QBHA 1S9HA 1YU9A 3TQFA 1YZLA 4H1UA 3DKVA 1LY1A 2IHBA 4X8LA 5BN5A 4Q7JB 4PPGA 5HZHA 1OXTA 3VX3A 3GLFB 4FCWA 1HTWA 2C9YA 4KJZA 4QNMA 4MGYR 3X1WA 3X1XA 4HUTA 2O8EB 2GBLA 1EWRA 3TVTA 1E9BA 2PX3A 4ZIRB 4Q4HB 5JJLA 1ZW6A 2GVDC 3I8XA 4LHYA 3DOEA 3QVVA 3G82C 2QEQA 1E2KA 1XTQA 2EQBA 5CDFA 3QOFA 1YZQA 1G3QA 1E1RA 2A7QA 3T5GA 2EYQA 4I1UA 5FR1A 2ZAMA 4RZ3A 3K53A 3WP1B 1I2DA 2QAGC 721PA 4ACBA 3WXMA 2JLQA 1G17A 2ZI9A 3CR7A 2FJUA 4RCZA 3AP1A 3AP2A 1KI3A 2JJ2D 2RHDA 3SFVA 4WAUA 1CJVC 2V54A 2V4ZA 1IN5A 3NXSA 4BE7B 4KO8A 4Q7MB 2V7QA 1ESMA 4JLVA 5TY0A 2IC5A 4LSGA 3OEEA 2O0JA 1COWD 1DAHA 4OHVA 2YV5A 3LXXA 4EJSB 1CRQA 2IX3A 4PXAA 4XWAA 5G53C 4B2LA 3T1TA 2C98A 4NMMA 4OBEA 3L0OA 4TYQA 4RD3A 1NNEA 1KAGA 3E70C 1G8PA 2I1QA 1LF5A 4URUR 2BMDA 3ZD6A 5FBLB 5BYKA 1ONBA 1H8HD 1Q12A 4MGZR 1E99A 3U7FB 2JLRA 1YVDA 1ZCAA 4TT3A 4OK6A 4UXIA 4MUBA 4ZDWA 4TLEA 2ZRLA 2QQ0A 1E2EA 4UJ3A 4Z54A 1TEVA 2XZLA 1N6NA 3AUYA 1S1CA 3ZVRA 1KO5A 2G1JA 4JYCA 3L0SA 4EPRA 1KMQA 4DDVA 4YONB 1NVVQ 4LJ8A 3N70A 2BCJQ 3P32A 4EPWA 2EU8A 3MJRA 1R0XA 4LX0A 1CULC 1N6RA 2RGDA 4QBGB 5KYKA 1FTNA 4DCVA 4EIWA 4QL3A 5CM8B 4OQMA 2OLJA 3IPYA 2ZRPA 4LRWA 1OHHA 2NZJA 4Q4AB 4Q9HA 2RHMA 4DXAA 5CITA 2AR7A 2CLSA 3GFPA 1Z0FA 4MYTA 5E3HA 4TMXA 3EASA 3CBQA 2E1RA 5JJKA 2FSHA 2ZI6A 5KNDA 4HDCA 2IYYA 1G5TA 3LQRA 4MITA 4OI0A 4TLAA 5EQTA 5KSZA 3QEJA 1ELOA 4BLQA 3X1ZA 5AK0A 1KK1A 2GJAA 4ZKDA 4IOJA 4QG7A 4ESHA 2ZRKA 4UKDA 1N0WA 4LBYA 3CR8A 5G3ZA 2XJ9A 4BFWA 4KITB 2QSYA 2MSCB 4PO8A 3EC2A 1Q22A 1E2PA 1UEIA 5J4LA 1E3MA 4QHSA 4L8GA 4PANA 2D06A 3B6EA 2R6CA 1R4AA 3WRYC 5LPNA 1N6IA 4CIDA 3OFNA 2GXQA 3KJHA 3TLXA 3BB3A 3THYA 1WRBA 4JVSB 4URWR 4DSTA 1IN6A 2JCSA 1W44A 2JGNA 3FMPB 4C0HA 2YC2C 4HLQB 2QMEA 5DSZA 4L16A 3CRMA 3I5XA 1HA3A 4R2HA 3LLUA 3C5HA 4MKIA 3FHTA 2EYUA 5EE3A 1XP8A 2BBOA 2W00A 2HXYA 1NJFA 1N2CE 4F38A 1G4AE 2GAAA 4IVQA 1SZPA 2ZU6A 4X8HA 3W6PA 1XBTA 4US1R 2JJ1D 4D4MA 1IM2A 4LI0A 4LJ7A 2RGAA 2GCOB 2D74A 2EFHB 2G77B 4ESVA 1AS2A 1MOZA 1Z29A 5FPYA 5H68A 2ZSBA 4B73A 5FR2A 1FP6A 4GP7A 3VHLB 1DEKA 4OKSA 3UPUA 4N0DA 3H84A 4W7SA 3UIEA 3VR2A 3T61A 1HURA 3B2EA 2JLXA 3K70C 1NKSA 3M6AA 4LY6A 3K9HA 4BLPA 4TQ9A 2DY1A 1CR1A 5AUNB 4QJ5A 1WMSA 5C46F 3J81k 2XNSA 4WZ6A 2ZJAA 1IXZA 4Q18A 2YJTD 4U00A 4ZDKA 1YZUA 4DIDA 3P1JA 2B7BA 1E9DA 1XTSA 4M9QA 3EPJA 2Z0MA 3BH0A 4YDHB 4B3GA 2QAGB 3QVUA 2BBWA 4UNSA 3DM5A 4L5BA 3RVBA 2OHFA 5FI1B 5LB2A 5A4JA 3R9WA 2GK7A 2ZRBA 1JAHA 4J0QA 2ZRAA 4ZPXA 4C0LA 2WSMA 4B6EA 2GZDA 2WM9B 3THWB 1XJQA 1JALA 4NDZA 2FNAA 2WWGA 5H8WA 3ZLJA 2JLYA 4PO1A 3O8CA 3CNOA 4B34A 1XMSA 3LD9A 2JLVA 1PLLA 1XPOA 3TAUA 1KO8A 1W0JA 4B3BA 4I99A 5J4KA 1S1MA 3PUXA 1UAAA 1AIPA 5EE5B 4BFUA 1X1RA 3VR1A 3BFXA 1LS6A 2XZPA 3FGNA 2WJIA 2ZUDA 3DDCA 5KUTA 1QHHA 2FGKA 1KSFX 1XXHE 2R44A 4URYR 2EFCB 2CBZA 1P2UA 4AIIA 4MGIR 3I8SA 1KSHA 2OAQ1 4Q1BA 2F7SA 2ZYWX 1KI9A 3QBTA 3MG9A 2JJ2A 3HPRA 3PEVA 2GBLC 3AKEA 1G8GA 4IFBA 4AURA 3QKTA 1E1QA 4PZYA 4CEIB 5CB6A 3AVVA 1R8SA 1W4AA 3EZ9A 3X2SA 2AL7A 4TL6A 2GRJA 2ZVPX 1G3IA 5DYIA 2NO9A 3LXRA 3B1YA 2ZU0C 4JL6A 5FOWA 3GFTA 1J99A 1NF3A 2BMFA 4W9MC 1D9ZA 4L15A 4HYYA 3RS7A 3LA6A 4DT1A 1S9DA 2J0UA 3KQLA 2O8DB 1WDTA 1OLOA 2QY9A 3RABA 1LVGA 3RNLA 1ZC4A 3UWKA 6Q21A 2V1XA 2VLIA 3QNUA 2GF9A 1NN3A 5AJYA 2OESA 2A5YB 4RZ2A 4C4PA 2Z43A 2AWOA 5EUQB 1G8YA 2E87A 2CJWA 5CK4A 3A58B 1VHLA 2ZE8A 4C30A 2GTPA 2G88A 5C18A 1GILA 4QM6A 1E2MA 1MRSA 3W34A 1MO5A 1E69A 1GFIA 2IW3A 4PHFA 2CLCX 1SXJC 1LB1B 3QKRA 2CEAA 1U90A 2OSBA 1JQJC 3TJZA 2XOKD 3B1XA 2RMKA 2BMEA 4POAA 1F2TB 3HP1A 3K8YA 4JMPA 1YQTA 2GCPA 5EP4A 2QM8A 5DH9A 4P31A 3PEYA 1NIJA 5GJBA 1ZIOA 3KQUA 1GITA 1K8RA 3CPHA 2ORVA 2VTKA 3K0CC 2F1JA 1ZU4A 2DPXA 1P61B 3RSLA 1KO4A 2IYRA 2QAJA 2CCJA 3CIOA 3NEJA 4QBFA 3AP3A 5L8VA 4TYPA 3U4QB 4UNNA 1XD2A 1BKDR 1XEWY 2NOAA 3BOSA 4TMVA 1OB2A 1RC8A 3R9XA 3VR3A 4OQLA 1N5KA 2JLSA 3NC1C 4B2PA 3K70B 4CGZA 1X3SA 1S8FA 2ONJA 1BH2A 1D8TA 4DLVA 1KSGA 1ZM3A 1Q44A 1LV7A 3U3JA 4LJ6A 2IEYA 3GP8A 2C77A 4BFXA 4CRWB 3A4LA 3PFIA 2X1VA 4DLSA 1LTQA 1DO0A 2FOLA 4WZAE 1HT2E 5J4YA 3K70D 3BXZA 2YINC 5CDFE 1QG2A 1EFTA 3TRFA 5IK2D 4XWOA 2NO0A 4Q1DA 4B2IA 1FMLA 2W6JA 4JLJA 4PR0A 1N5JA 5H1YA 2RGNA 1R7RA 2FN4A 2PJZA 3EXAA 4EQ6B 2H8KA 2WWYA 1N3BA 1MABB 1GKUB 3LQQA 3Q72A 4GP6A 4BECA 3N2IA 4TMTA 4F93B 4HLDA 4JVNA 2JJ1A 3VAAA 2IYZA 4A8JA 2ODNA 1KI6B 4BFZA 5JEDA 2JLZA 2HLDD 1KKLA 4KFSA 2GAOA 2Q9BA 5K8TA 1XWIA 2WSSD 4V0NA 1OH8A 3D3QA 3SBEA 5FTNA 1AZSC 3TR0A 4TLDA 1W5TA 1FPMA 1L4YA 1UEJA 3CUEF 5JHGB 1ZNXA 1KTVA 4XOIA 3AF3A 4GZMA 1Z6GA 1IJFA 3PITA 1TTTA 1P72A 1Y63A 2GEVA 1QHNA 2AN9A 4JT4A 1QDEA 3ND8A 4C2TA 2C8VA 1JR3D 4RFSB 4Q7KA 2ZJYA 4G5GA 5LB4A 3TUJC 2OCAA 4ZO4A 5JSZB 3GLGE 4HLUA 4C7OB 1II0A 4F7WA 1G6HA 1KJYA 3P4XA 5JWRA 2OCPA 1P62B 2VP5A 1J8YF 1IXRC 1DAEA 2P6NA 4QRHA 3ICEA 5E4FA 4URZR 1UJ2A 1RPZA 2FF7A 5EE9A 2C04A 2PLRA 2R62A 2V6IA 1XMVA 3NH9A 4FINA 3CF6R 1NIPA 5KU1A 2OUKA 5CB8A 1M74A 1NMZA 1E98A 1TUEA 1VCIA 2OXRA 2DFNA 4Q21A 4KVAA 3UATA 1JECA 2A5JA 4ABYA 1WQ1R 1BO6A 1W36B 3CONA 5BYJA 1E2IA 2CL7X 3GPLA 4OI1A 1TUIA 5EZ5A 1G1MA 2XTZA 2YVUA 1S4QA 4OK3A 2GEDA 2L0XA 2NO7A 4C9BA 1GRRA 1GOTA 2ZSFA 3KKQA 4DDWA 3QSYA 3IPXA 1KI7A 1RKBA 4AY2A 4MKHA 3AEZA 4PAOA 4DKXA 1KOFA 3EPHA 1W4CA 1KNQA 1MH1A 1XMJA 1Z0IA 2FZLA 3D31A 4IDQA 1B23P 3EWAA 2VO1A 1ZC3A 2WOJA 4HAWA 4FMDB 1S0UA 2J59A 4N0EA 3P27A 2O0HA 3VMFA 3PEWA 3K0SA 1E2DA 4XH9B 2ANCA 4XVUA 3KB2A 4CF7A 3O47A 3OEED 3NEYA 3BFVA 3DOFA 3NIBA 4HB3A 3WYGA 1UADA 4M4SA 1DOAA 1GNQA 4TQAA 4D81A 4AG6A 2QI9C 1YRBA 4QGFA 1G7SA 5KNBA 1XEWX 2OXCA 3IGFA 1BOFA 2J1LA 2RGCA 3KXIA 1QZXA 3W90A 2PEYA 4GOKA 2IXEA 3H1TA 4B48A 1NSTA 1P6XA 1G8HA 4A2WA 3GEHA 5B58C 3E1SA 4M21A 2FDCA 2ZR7A 1DARA 4KYUA 1SXJD 1L2TA 2RGGA 1U81A 2NZ8A 2QA5A 1CP2A 3AF2A 3CRQA 4JSYA 1MKYA 1XTRA 2O8CA 1XCGB 2ZPTX 3BGWA 4JKIA 1CJUC 1PLKA 4D26A 3ICQB 1FQKA 4WIAA 4B3FX 3F3YA 1P60A 2ATVA 1E0JA 3EA5A 5TMPA 3T1OA 2XNDA 2WAXA 4EDHA 2XEXA 2YYZA 5HE9A 2W58A 4Q4JA 2FU5C 1OHHD 1QHSA 4QC2A 4KBGA 2JLWA 3IQXA 1ZNZA 1NVWQ 1QBKC 4QXAA 3L82B 3ZQ6A 2ZJ5A 3SNHA 2QP4A 4JJKA 1RVDA 2XOKA 1Q21A 1X86B 1Z28A 1XZPA 3W8NA 3ZZUA 3MWJA 1LF0A 4HAXA 2IL1A 4B3CA 5JWOA 5J40A 1E4YA 5EXTA 3T1VA 1NP6A 1L8QA 2RB4A 4L4UA 3FOZA 1A1VA 4YMTA 3QXJA 3THYB 1ZMXA 2VA8A 1U0HC 3RRZA 2NTYC 4QGHA 3OZXA 1S3GA 4UNRA 4IFEA 2ZIAA 5DNYB 2C03A 5F9FA 1CS4C 1L4UA 2GCNA 3FB4A 3IIMA 1HEIA 1B0UA 4B3XA 3RDPA 3OFND 4KODA 5J5CA 3CRRA 4HAVA 4FMBB 4MRRA 5HTKA 2FEMA 1Z6AA 1SVLA 2CHGA 1CKEA 1E0SA 4PTLA 2P0EA 1KJWA 2P5TB 3AH8A 4HDOB 4Q9KA 3FKQA 5JFGA 2E9SA 1ZNWA 3SOPA 1EX6A 3K0AA 4BEJA 4KHZA 1SHZA 5JCPA 1YR7A 1MO6A 1OKKD 3THOA 4MA4A 2J0QA 4B32A 4C0KA 2FA9A 5IK2A 2OCBA 3KQKA 4JVLA 1DPFA 2QTHA 4OK5A 4P3YA 3T15A 4EPTA 4GDFA 1XJCA 4B47A 2GVZC 3AVPA 4P0TA 4CZ2A 3B13B 3PR1A 3LVRE 2VSOA 4LOAA 4MYCA 1LNZA 1M6NA 1Z5ZA 4MDFA 3HYTA 3QKUA 4LPKA 3TMKA 1SVWA 3ZVLA 1SKYE 1MV5A 1T4GA 3NBZC 1Q1ZA 4UNPA 2H1LA 3KZ1E 1G16A 3FMFA 4LC0A 3KQNA 4HB2A 1KAOA 1K6MA 3VR4A 4EFMA 3C16C 4DCUA 1OXUA 1TQ4A 3ZQJA 1N0UA 1W2GA 3KL4A 2PZEA 5AUQA 4NL4H 3FFAA 3FFBA 4FW9A 1OB5A 3EZ2A 3PV0A 2P65A 3WBJA 4GBMA 2ZI4A 2VHTA 1KZGB 4A92A 5FTLA 4OQNA 1KI1A 3VQTA 1Z22A 2QTVB 2NG1A 1W1WA 1JR3A 2WMOB 4IVRA 3WNDA 4A8JC 2XSZA 4DEYA 3D7MA 1RJ9A 1PZNA 3QUSA 1WBBA 3AF0A 4KSBA 2GJKA 1II9A 2JDID 1E2HA 3CH5A 3PUYA 3Q7PA 4Q1FA 5G41A 4DC9A 1UKEA 1RYFA 4RD6A 3KDSE 1FX0A 3QF7A 3RANA 5C1BA 4JBXA 2IWRA 3I72A 4A2QA 2VHCA 1XPUA 4GMDA 1VMAA 3QIAA 1N6KA 1Q20A 3AV0B 3OIVA 5BW8A 1N5IA 1A4RA 1CR0A 1XFAA 2AFHE 2QRNA 3L0PA 2QL6A 3KUDA 3NH6A 1IONA 2HUPA 3QF4A 3QXSA 5JS7A 2WIAA 3AF4A 4HZIA 4ILEA 4DCNA 4GFDA 4HLUC 1QHXA 1QHHB 1W0JD 1EXMA 2HT1A 4C0QC 1IAQA 2AKAB 2GETA 4D0LB 1HQYE 5FPTA 1E94E 5L3QA 1AS3A 1SKYB 3BK7A 4E09A 1DTSA 1U9IA 3KXLA 3B8HA 4D2IA 1PVOA 2CL0X 1FTSA 3WNCA 3AUXA 1P3JA 2IYWA 5JJIA 1MR3F 2YOGA 3N2EA 3PG5A 3KKPA 1BMFA 4GZLA 2ANBA 1GG2A 3KJIA 2LCFA 2ZJ8A 4NHOA 3GJXC 4M8NE 2J41A 3I92A 4IHQA 3T34A 4KBFA 4C0BA 1JR6A 4AKHA 2Q9CA 5FUWA 5EP3A 1E1QD 2GWHA 2IYLD 1W48A 1YRAA 4DT1B 2IK8A 3ECCA 2J0UB 5HR5A 4HB4A 4D82A 1Z06A 4A6XA 1G5PA 2EW1A 2WAYA 4R2IA 2XB4A 3HR8A 4RJLA 3X1DA 4M1KA 4JLBA 2JASA 5DHFA 1Z2AA 4EFNA 3IO5A 2JATA 1E2GA 2QGNA 2J0SA 3AB3A 2CK3D 4LHWA 3FMIA 3FTQA 4NCHA 4WXPA 4CT5A 3KQHA 4X8OA 1R8QA 3ZIAD 5BN3A 3RC8A 2YC4C 1DAKA 2C95A 1SXJA 2CJWB 3AVYA 2O52A 3GLGA 4EPVA 5JCZA 1DBSA 2AXPA 3KB1A 1ZUIA 3NDBB 3B7GA 2J7PA 2B21A 5L3SA 2GXSA 2W83A 4RD4A 2WVJA 1AS0A 1RFLA 3QKRB 4QGGA 4PQRA 1RRCA 1Z0JA 3GJ5A 2R8RA 1Z0DA 4M1MA 3RS2A 2KBFA 3DHWC 1E79A 1ODFA 2CVFA 4QM7A 4E22A 3RHFA 3K0CA 2CVHA 4P4SA 3CNNA 1PV4A 3EA0A 1E2JA 1TF7A 4PHHA 2DR3A 4TYWA 1KDRA 2OBMA 3C15C 2ZI5A 4IEEA 5EXSA 3GJ3A 3QKSA 1Z6YA 5DO9A 3WMGA 3C14C 4KSCA 3CH4B 3FHCB 3VHXA 3LBNA 2Q9AA 2QPOA 1EWQA 5HPYB 1WBDA 3QEOA 4IOMA 4QHYA 1EK0A 1GL7A 3LFUA 3W5JA 1RRFA 1XD2B 2WWFA 3SE0A 5KSYA 5IDVA 3FDIA 1R5OA 4PQFA 3LVQE 4B71A 8OHMA 4TMZA 2ZI7A 1XNJA 3MFYA 1XD8A 4QGAA 4TLBA 3TR5A 1VG0B 3CO5A 1M7HA 2QTFA 2FGJA 3W3ZB 1VG9B 2IBMA 4O0MA 2FE4A 3K9GA 4Z8YA 1G3MA 1T0JB 2IT1A 4KYIB 3BC1A 4LYHA 2X77A 1XB2A 4PHGA 2P6UA 3OHMA 3GLIA 1N5LA 1RIFA 4H9GA 4LHXA 4M9SA 4M9XA 5KSPA 3SN6A 4DVGA 1Q1BA 4Q66C 3AVUA 3K0FA 4PHTA 4KLNA 2IF0A 4B74A 1X8JA 3C8UA 5ELXA 1OH7A 1CF4A 4NCNA 3DO6A 3ADBA 4TYYA 1NLFA 4A8JB 3WY9A 1G4UR 1VYVA 2W6JD 4ZI2A 1OKKA 3IBYA 4S35A 1N6HA 5DI3A 3G0HA 3QXHA 1ZINA 4DWJA 1NL3A 2LWIA 3SS8A 2RCNA 5AJXA 1ZIPA 3NBFA 1TU3A 2O8BA 1W0KD 1TU4A 2CMKA 1HYQA 2D3WA 2G1KA 1OV4A 2W0SA 3T12A 4NZYA 521PA 4UXHA 3RLFA 4GSYA 1Q1QA 5JI2E 1Z3IX 5TXGA 3IILA 1TL7C 4BZQA 1I4TD 3B85A 3WHKA 4YMUA 2NPFA 2F43A 5TV2A 4CW7A 1KY3A 5UKDA 2NGRA 3BS4A 2BHRA 3P26A 1XCPA 3Q9LA 4AKEA 4A4DA 1JPJA 5IRCD 1YR8A 4LHZA 4AWXA 1KJZA 4DHEA 2WJHA 4HI0E 2HYIC 3VKWA 2IWHA 4KFRA 3GJ0A 4R7ZA 1UPTA 1NMXA 1G5RA 1VYUA 5CLLA 1P5ZB 4FMCB 3A37A 1K5DA 2PLFA 1CXZA 2Z4RA 4Q4LA 5E95A 3KXKA 3W3AA 3UG6A 2VP2A 4TTQA 2KI5A 1UKVY 4M53A 3RRMA 4LJ5A 1AA9A 2R2AA 2V9PA 5C4GB 2JDIA 1H8ED 1ZD8A 5KDOA 1P7CA 1WP9A 1V43A 2FPKA 3B9PA 3EZFA 4BASA 1NVXQ 1II8A 2IYVA 4LWZA 3CZPA 4A6PA 1OYYA 1OFIA 1QVAA 4FD2A 4Q00A 3ZDQA 4GNKA 4Z8XA 4AD8A 3DMNA 4IDNA 3ZZ0A 2OV2A 1UBCA 3NHAA 4G5SA 2IXFA 4IXNA 2C5LA 2IEZA 3K9NA 2QORA 1ZUNB 3CB4A 4RZUA 1IY2A 1T9HA 4TL8A 2Y8EA 1US8A 2JLUA 1I4LD 1C1YA 2ZUCA 4JZKA 3REFA 1EFRD 3OESA 1KK3A 2XXAA 2BBSA 4XD7A 3KUCA 2VP9A 2VL7A 4K46A 4JLMA 4KFUA 3SZRA 1Z8FA 2ODEA 3CWZA 1Q3TA 4LBZA 3Q5DA 5DYGA 4CEJA 1ZM7A 5FL7A 4Q01A 4PQYA 4US0R 1UM8A 4ZV4A 1VTKA 2ZRIA 2ZUBA 1OJLA 3GEEA 2DWQA 2ZS8A 2QZ4A 3TH5A 2ZI3A 3OE7A 2ZRFA 2QU8A 1IJEA 4PAMA 5HE8A 4DDTA 1U9IC 4ERNA 3TVDA 2QMUA 1U98A 5IHPA 3BE4A 4Y0VA 2O8CB 5JMTA 3H4MA 4OQXA 4US2R 4B6FA 2CK3A 3DL0A 4TLCA 1UBGA 4TQUS 5D3QA 5A5GA 3WHLA 1JBKA 1Z83A 3ZIAA 3TUZC 1ZD1A 1E4VA 2J46A 2F1RA 1E9AA 3A4NA 3LBIA 1E2NA 4Q4JB 1KI2A 1KY2A 4DRZA 1W5SA 2TMKA 2AWNA 4FMCF 5FBVB 3AF1A 1AQYA 1CU1A 2PT7A 2NPIA 1Z2CA 2VHUA 1G8FA 4XVQA 4Q9JA 2VP4A 2XNDD 1A7JA 2C9CA 2CXXA 4NONA 2I4IA 5GVRA 5P21A 3UG7A 5AUPB 5FOSA 2CHQA 2DWPA 4TL7A 4BGDA 1Z0AA 4Z1MD 4F4CA 2FH5B 3CF2A 2W0MA 2PT5A 3P20A 4ON9A 2Z4SA 3QPUA 1NRJB 3B9QA 4MRNA 1XXHB 3A1WA 5JI3E 5FL3A 1D5CA 2QBYA 4C0AC 1NLZA 5TVKA 3AM1A 3SHFA 2WHXA 3QXCA 2GK6A 1JR3E 1P9WA 2H7VA 4JLDA 4BRUA 1G18A 3SR0A 5JZVA 1CTQA 2EWVA 4DLZA 3FYHA 2ECKA 3I4LA 2HV8A 4V02A 3LNCA 5LDDC 1XRJA 2VRWA 2CE7A 4NYJR 1KIMA 2N42A 1JJVA 1U8AA 2IUUA 2FZ4A 3FPAA 4MYHA 4KCGA 1KZ7B 2IUSA 2OLKA 4NE2A 3SJBA 4CEHA 2ERXA 3K0AB 4PPFA 1SVSA 4D25A 5TARA 4DIEA 2HJVA 1E96A 1GDDA 1GTVA 2CNWA 1XTJA 4B43A 2J7KA 1FNNA 3CX7A 2YWGA 2V8OA 2HJGA 4OHXA 4BEBA 3QY0A 2OBNA 1IQPA 1G291 5AJVB 2ATXA 4Q1AA 2XX3A 3R8CA 4BLSA 4D0GA 4W5WA 5IF9A 2NO1A 5F9HA 4S2EA 4AI6A 1IHUA 1U2RA 1UDWA 2A5DA 2H92A 4O2RA 4RZXA 1P9NA 1HE1C 3AVXA 1NJGA 3UK6A 1R6BX 1ANKA 1JNYA 2MMGA 3RS5A 2V3CC 2JA1A 1FP7A 4BFTA 1F60A 1YZKA 1VPLA 4K8OA 1ZP6A 2JAQA 1DAGA 2OAP1 1GAJA 2OG2A 3VNVA 5FBQB 3EIHA 4Q7LA 4PPQA 2AX4A 3S1AA 2BBTA 1E32A 1OH5A 1N6OA 5TB5A 1YHNA 1W0KA 2EFEB 3X1YA 2ZRGA 3OIWA 1JXMA 2Q3MA 3OF5A 1IOZA 1J70A 4PC1A 5SZJA 3TE6A 1NG1A 1UBEA 1G7TA 1DS6A 1T5IA 1Z07A 3IBGA 3KKNA 4PPNA 1XX6A 5SZIA 3WYAA 1NKTA 2A2ZA 2CCKA 2OZEA 3WMFA 2ZJBA 4NKRA 4ZCMA 1RJ9B 1OIXA 1YKSA 1VDZA 2WKRA 2IXGA 4HAUA 1ZBDA 1G21E 4OHWA 3EPLA 3N5CA 4HLCA 1FX0B 2WJVA 2G0TA 3QG5A 1VIYA 121PA 1SXJE 2XSZD 1O87A 2H17A 1Z6TA 4LUCA 4NBSA 2F3TA 4CT4B 1GKYA 5CM9C 2WICA 4JLAA 1MT0A 1U0LA 4WZBE 3C4JA 2AXNA 3QF4B 1IY1A 1J2JA 3L43A 1XU4A 2QSZA 2R9VA 1VG8A 1TADA 4EKDA 4A36A 5HCNA 3EX7C 1H8EA 1A2BA 5FOXA 2QUZA 3CRW1 5FUYA 3IIJA 3LY5A 3QENA 4G01B 4FCVA 1AGPA 2ZRNA 3SYKA 4PSVA 5JLJA 2XZOA 2YOHA 5AJWA 5EXPA 3W6NA 4E03A 4Q1CA 2GF0A 5L3QB 3VX4A 4NTZA 2J87A 3WMEA 2ODBA 4EPYA 1OF1A 4PSKA 1YZGA 2MSDB 4LJAA 2KJQA 2QROA 2HEIA 1C4OA 4OQFA 4NH0A 3VU9A 1XEXA 4QOSA 2I1VB 4AYWA 3I1FA 1GUAA 1O3YA 1CIPA 3PUVA 1QVRA 3U5ZB 3QE0A 3A1TA 1QHGA 5K8UA 1VCNA 1BMFD 5DI9A 2OEPA 4CDGA 1EFRA 1S2MA 3TBKA 2WJGA 4NYMR 3HU3A 4I81A 5BXQC 3DVLA 2AK3A 1JI0A 3PQCA 4DBLC 4Q03A 4XTRA 2WKQA 2ZANA 3SHWA 5L3VA 3GLIE 2DWOA 1P2VA 4LGMA 3QI2A 1SXJB 4M0LA 1P75A 5L3RA 1Z08A 3SDZA 3GLGB 2NIPA 3ZJYA 4P33A 2Q3FA 1Q57A 2VP6A 5L3SB 4IW3B 3VKGA 4TL9A 1DADA 1T3LA 3U3OA 1ESNA 1ZAKA 2YOFA 4MH0R 3T1QA 1XMIA 3P4YA 4NCKA 2BM0A 4U7DA 2J7PD 1NG9A 4JIMA 1NY6A 4P4SB 2DYKA 2YNMA 1DG3A 1TNDA 1C9KA 4BPBA 4ARZA 2VQSA 2ZS9A 1T3HA 2ZJ2A 2BOVA 3KFVA 1E79D 3QKSB 4O2LA 4DB2A 1AJEA 2UZIR 3B1VA 1P9RA 1G20E 2FWRA 5CIQA 5SZHB 3IEVA 4LJYA 1D2NA 4HUQA 3GCGA 4F91B 1JEDA 1NN1A 1NBMA 4Z1MA 4JLNA 1X1SA 1AKYA 2REBA 1KO7A 2VYFA 2FFQA 5KDDA 3ADDA 1FL9A 2LKDA 4LPSA 4ZCLA 4QJ4A 5KO2A 3RS4A 1GL6A 4NPHA 4R71A 1MO4A 2RAPA 1Q1EA 4YXWA 3SJAA 1A2KC 2NQ2C 2ZEJA 2DFLA 1JEEA 3AQ4A 2ZRHA 2X8AA 3RRNA 3A1SA 4A0FA 3L2OB 2AKYA 3A1UA 3UANA 4R9UC 1G7CA 1XJ0A 2YHSA 2Z6VA 4FWIB 3GLIB 3BAFA 3LRPA 3ADCA 3U60B 2QM7A 1EFCA 3FWYA 3GEIA 5LD2C 3CX6A 3PEUA 2PZFA 3AVTA 1E2FA 1JB1A 2X19A 3KTAA 3K0FB 1T8TA 4Q9LA 4A82A 4PC6A 4CYMA 4JYBA 2BMJA 2GJSA 5B57C 1S96A 2OCYC 3UWOA 2ZSAA 3PCRB 1R5NA 2REOA 3HJNA 4XSGA 5DI3B 2QE7D 4DEXA 4YLGA 1FFHA 3U7HB 1G64A 4HZUA 3MGCA 3LAWA 2QP9X 2AFIE 2Q3HA 2C2HA 2N1BA 2WPDA 1ZCBA 3GJ7A 3CLVA 1WCV1 1F2TA 4M1WA 1GIAA 2O8BB 4TZ6A 4BRWA 4BFVA 1GNPA 2FSFA 3M4YA 4NYJQ 2G9NA 3NHBA 5GJWC 3GFOA 4BLTA 1Z6XA 4OJKA 2A5FA 1GWNA 2Q0HA 2F43B 2PCLA 3GJ6A 3ND9A 2GJ8A 1BYIA 5DISB 1HT1E 1KK0A 3LBHA 3TIFA 4A15A 3GJ8A 3BD9A 4QNRA 2ZS7A 4P4TA 5J4HA 4W5HA 3W6OA 2R6GA 2V55B 2VSFA 4MDEA 1W7AA 1ZJ6A 3LW7A 3EZ7A 2Q6TA 3GLFE 1DAIA 2WTUA 1QF9A 2F9LA 1KDOA 2CLDX 2PCJA 2J45A 3DZDA 5F2EA 3LX8A 3O8RA 1I2MA 3MWKA 1IN8A 3EIEA 4MYUA 1P2TA 4A0RA 5EE0A 4ZI3A 3FKSD 3V4FA 1CLUA 1ZNYA 2GEUA 2QQEA 2EVWX 2HXSA 3TAHA 3AGPA 1U8YA 3UMSA 1AK2A 1EFHA 4IKEA 5M04A 2YWEA 3LDAA 1ZRHA 5CK5A 1F2UA 3MCAA 1II8B 4B35A 4M2LA 2WJJA 2Z5FA 4PZZA 1VCMA 3SJZA 3IHLA 4MKFA 3RWOA 4U5XA 3AVOA 5FH9A 1PLJA 1QHYA 2WBLC 2J3EA 2HT6A 4JLKA 2AD5A 1E2QA 2FFAA 3HU2A 4PC2A 5G40A 5JECA 3H86A 3SBDA 1GRQA 1FMJA 2D7CA 4NCJA 3CF0A 1US8B 4U02A 3SQWA 3WP0A 1T6NA 3VNUA 2QMOA 1XTKA 5C4MA 1KK2A 2BM1A 2XXAB 3JZMA 2GA8A 3OIUA 1VHTA 4DLWA 2QT0A 4PO9A 2IS4A 2H16A 3EW9A 2ZREA 3K09C 2OFXA 4CEJB 4LCBA 1IN4A 2ODWA 4ZDJA 3MD0A 4LJ9A 1R2QA 4I1OA 3U6BA 5HZKA 4XD7D 5DN6A 2FSIA 2WJYA 3RWMB 4G5OA 5D3MA 2UVQA 1E9CA 5DHAA 5FUXA 4URXR 1WB9A 4PAQA 1KI8A 4QBIA 2DBYA 3I5YA 3U61B 1XZQA 2C78A 3QPWA 4KVGA 1R0ZA 5DLQC 2W6IA 1D2EA 3KX2A 5FL7D 2YKGA 3U3MA 3NWJA 4TN1A 4GMXA 3ZZTA 5K8IA 3AGQA 1U8ZA 1HY3A 1HV8A 3GD7A 2QGZA 2PMDA 5AWFC 1KDTA 4HAZA 1AQUA 1DELA 4AC9A 1E2LA 5BWMA 2QPTA 4TZ0A 4QFMA 3OE7D 3R9IA 2R6DA 1M8PA 5JS8A 3TW4A 2Q21A 4M1YA 1XCMA 3FVQA 2W2TA 4DSUA 4JL8A 4DLUA 3PVSA 1NI3A 5DIFA 5EXXA 4M1SA 4HATA 4RD2A 4JJZA 3D6TB 2F1HA 4AK9A 1OT3A 1OW3B 4PC3A 3RC3A 2R65A 2YWFA 3F0TA 4DDUA 3ZVNA 3V00A 2BDTA 2XTNA 2GJ9A 2GILA 2IS6A 3OAAA 5DGXA 4NYMQ 1OIWA 1W4BA 3C7KA 1UKZA 1CJMA 4OI4A 3TQCA 3TSWA 3REGA 3THXA 3LO5A 2KSQA 2NO6A 1J8MF 4B33A 2IS1A 2BIFA 5LD2B 4R98A 1E9SA 2ERYA 221PA 4JKYA 4YMVA 5FPKA 2J0VA 5AR1A 2LKCA 2QP3A 1E9FA 4V03A 1YZTA 2JIZA 2QBYB 1L7VC 4LYAA 1VCOA 1T8UA 1KYIA 3FHOA 4NCIA 4L9WA 3CPEA 3K0EA 1W49A 3Q8XB 4MRSA 5KOYA 2WWWA 4OI2A 1JXOA 3VR6A 3CM0A 4M9ZA 2C99A 4QKQA 4ZCIA 1E9EA 1TAGA 2AK2A 3EARA 1AGRA 1P2SA 1U99A 1M7BA 1W47A 4YQFA 3GMTA 2DCUA 1KGDA 5FPSA 1OYWA 4CEHB 2O8FA 3CZQA 3EAQA 1VKJA 1OXVA 2A9KA 2XJ4A 5FBRB 5E7IA 2EFGA 3R7WA 1HE8B 3A8TA 4I4LA 1JQLB 5FI0B 2IYQA 1RRGA 3KJGA 4BZPA 1LS1A 1TMKA 3F5FA 3C5CA 3IUYA 4HSEA 1FUKA 1SGWA 2B8TA 1N0VC 5GJVC 4HDQB 4FCTA 1G3RA 4PX9A 2KWIA 2IF2A 2QENA 3BERA 3TNFA 2GNOA 1F5NA 3MRSA 2CNWD 1NVUQ 2PL3A 4Q19A 1MRNA 2ZM5A 5DE3A 5JHHB 5KPDA 2X2FA 3U44A 2WWHA 4GOJA 2ZE7A 4TMWA 4CVNA 4DJTA 3BH6A 3M1IA 2OFOA 1DO2A 2ONKA 2YWHA 2QE7A 2QRZA 4KFTA 1JAIA 1RE0A 1R0YA 1SULA 2D62A 3SYNA 3S1AB 3GQBA 2ORIA 1NLYA 3VR5A 1FNMA 2WOOA 5ANRB 2A5GA 1SHKA 5C2JB 5TDHA 5GVSA 3U7GA 1LFDB 5BQ5A 4E07A 4UNQA 2F1IA 1T0HB 4AYXA 2PZGA 2ZRDA 3ZH9B 2BKUA 4A1FA 1DVRA 1ETUA 1KKMA 4ACAA 3TSOA 1M7GA 4BFSA 4TSFD 2BCGY 3OEHA 3KKMA 2CCGA 3JZAA 5CYOA 2DB3A 2F55A 4I1SA 3TSZA 5FTMA 4DLYA 4DSNA 3MWLA 5CYPA 4FWTA 3I62A 2NMVA 5AUOB 4Z51A 4NYIR 4C2UA 1IBRA 2DFKB 2OBLA 1P4SA 1XTIA 3CKLA 3QXXA 2J5XA 3HDTA 4RD1A 5KTYA 3WRXC 4FIDA 1KO1A 1Z47A 4MRVA 4XTCS 2HCJB 1OH6A 3FE2A 3A36A 4UXJA 3IIKA 3FKSA 3O8BA 2FSGA 4A0GA 2FEOA 4GRAA 2PX0A 3DPUA 5KSOA 1XEFA 3GLHA 3D8BA 4DLXA 4EAQA 3A6PC 1XD9A 4OHYA 1MO3A 4LBWA 4RCYA 5JRZA 2DHRA 4A9AA 4QHTA 1YZNA 1E0AA 2B7CA 3Q5EA 2D7DA 1W46A 1SQ5A 3SU8A 1UF9A 2AHOA 4V0OA 4K81B 2V6JA 1G3UA 1KMHA 3EG5A 3F8TA 1TPZA 1F3OA 3LH5A 1TF5A 3SYLA 2G0NA 3H2YA 1Y3AA 2FFHA 2VEDA 3IKJA 3VU9B 4M22A 1XEXB 1A5TA 3KJEA 1M1YE 3LW8A 3K9LA 4V0ME 1FQJA 1GRNA 4WVFA 3LV8A 1NBME 2VBCA 3QBVA 4MRPA 5CJPA 2VHJA 2WZQA 3EZ6A 1KHTA 4EPXA 5G3YA 1CRPA 2ZYVX 1GSIA 1W2HA 1NY5A 2FMXA 4RY2A 4DCSA 2VF7A 4IEIA 2P3SA 4AKIA 2D4HA 2K5UA 4II7A 3IDQA 3BORA 4Q1EA 4DSOA 1M2OB 1YR9A 2HF9A 3JVUA 4C0SA 1CEEA 2ZXUA 1NN5A 4WA7A 3QJYA 2IA5A 4A2PA 1YE8A 4F4IA 1TEXA 3R20A 4GOXA 2RKOA 3ETLA 1OSNA 2WKPA 5B30A 1UFQA 5JBQA 3V9PA 3TK1A 1RYHA 3IHWA 2IHYA 4TTPA 4DLTA 3LX5A 4W5JA 3HU1A 4TTRA 5FOTA 2ORWA 4V0LA 4IJMA 4HB0A 1P73A 4V0KA 4WXRA 3B1ZA 3EC1A 4P32A 1X6VA 4JVMA 2F3RA 4WW0A 3PENA 3RS3A 5CJ2A 3W9YA 3ZS8A 621PA 3GLFA 1DG1G 2ZROA 2O8EA 2BEJA 1J90A 5J4VA 5IT5A 3ASZA 4ZIRA 3NTUA 4Q4HA 3I32A 3NBXX 2J9RA 1GVNB 1ZVQA 3FMOB 5CIWA 4ARZB 5B64A 3SQXA 3O8DA 3RYTC 1Z0KA 3PIRA 3U3RA 1UBFA 2C9OA 4Y0AA 4EUNA 3BFKA 1N6LA 2MMCA 2QPAA 3L8ZA 4FXPA 3OIYA 2XGJA 2QT1A 4E5UA 5EZ6B 1SVMA 4DB4A 4D4LA 1COWA 4DZZA 4HUQB 4RVCA 1BS1A 1G7RA 2PH1A 3B82A 1TQ2A 2WIBA 1W36C 2IYUA 2OO7A 4KAXA 3UMFA 1RW4A 1ZYUA 3BBPA 4UQOA 1U0JA 4LK2A 1GM5A 4XWKA 2DFTA 5J47A 2BWJA 2YZ2A 1PUIA 3T06B 3TGPA 2GKSA 1H8HA 1NBMD 4EJSA 1KDPA 1ZD9A 1QRAA 4YMSA 4OL0A 2FPLA 1OFUX 3PXGA 1IXSB 4ASUD 1IY0A 1AZTA 1T3SA 2Z83A 3CW2A 2ZE5A 4P4UA 4PFSA 4H1VA 4YXWD 4OHZA 3ZYCA 2KBEA 1JPNA 3KTAB 2SHKA 3WBKA 3W8RA 1WF3A 1ZM9A 3MWYW 4BFYA 4TYNA 3GJ4A 2X2EA 2XTMA 4TWZA 1OXXK 2P67A 3B78A 3RS0A 4G3XA 2B8WA 2IYSA 1J7KA 4HZUB 4DUGD 2H57A 3C41J 4DCTA 1CR2A 2JEOA 2QN6A 1TQ6A 5E7MA 2A78A 1OXSC 3I73A 3E2IA 5EP1A 4IOLA 3SFZA 2RH5A 1CJTC 4LV5B 3DZ8A 3U3KA 4D4KA 3BH7A 4Q5IA 4C3ZA 5A0FA 4Q4AA 1WE2A 2WPDD 1ZM2A 5KHOC 4JLOA 5K8LA 1EESA 1QG4A 3IQWA 4O3MA 1D6JA 3UMRA 1ZU5A 2ZVQX 2ZITA 3Q7QA 1WA5A 2BJVA 5JRJA 1XF9A 2IYXA 3LLMA 4BLRA 4OYHA 4KU4A 1FW6A 1T5LA 1EGAA 1GNRA 2A30A 4LZZA 1HH4A 4O25A 5BN4A 2GDJA 3MAAC 3RAPR 4Q47A 2CE2X 4X8MA 3UKDA 4JL5A 4BZXA 5SZKB 3ZS9A 1DAMA 2IYTA 1F48A 4TSFA 1UDXA 1EFUA 1ZUHA 4C0JA 1NSFA 1PJRA 1KNXA 5B2ZA 3B5JA 2GZHA 2BEKA 2WWIA 5EUMA 4RKEA 1F2UB 3IO3A 4IDHA 1G19A 5EP2A 2RGEA 1SVOA 3PJRA 1YR6A 4MKGA 5HKKD 1OFTA 1W4RA 4WBSA 3U6KA 1NMYA 3U7EB 4G5QA 3VTKA 2N46A 2ZJZA 3L8YA 3QQ5A 5FOVA 5CLQA 2R6AA 4D0NA 4XJXA 4IDOA 2F9MA 3BJIC 1Q0UA 4GI7A 4YMWA 2P6RA 1CBUA 2PEZA 3R8FA 4LC1A 3NKVA 4YC7A 5HCIA 3DMDA 4KXFB 2G3YA 3CNLA 1G6OA 1GKIA 3K09A 2O5VA 3T35A 2ZTSA 2D2FA 4MQBA 5KPJA 2GCOA 4NYIQ 2EWWA 4Q02A 2QG6A 5F3WB 2C96A 1DAFA 4UJ5A 5LBIA 4JSTA 1JJ7A 4D80A 3MLEA 4IXMA 3HWSA 4BUJA 1XPRA 5D3MB 5FBWB 1CJKC 1FUUA 1D9XA 1EX7A 3KKOA 4LHVA 4LYFA 3K1JA 2QMHA 3U2QA 2G6BA 4GL2A 2OM2A 5DN6D 3IEUA 4L9SA 2ZAOA 1F6BA 2QAGA 3I3SR 1E6CA 4HAYA 3SJCA 1KI4A 1VYTA 2ZRJA 2ZRMA 1UKYA 2W6ID 3SI7A 4D6PA 5GJCA 2VH5R 2VP0A 2FPMA 2PBRA 4F92B 2BV3A 421PA 1HUQA 3THWA 2FG5A 2KB0A 2ZSEA 3QPVA 2VSXA 2ZR0A 1N25A 1E1RD 3NC0C 1W36D 3ZVMA 4LV8B 4B76A 2VIIA 1G9XA 4PSAA 4QJ3A 4HEJA 3THXB 3TKLA 4RFVA 3ASYA 3A1VA 4XSHA 2FV8A 1WXQA 4JBYA 3CRVA 4BQSA 3AVWA 2V7QD 1AN0A 2REXB 3OAAD 2ZETA 1GP2A 2IUTA 3M0EA 3EWSA 4B75A 1D2MA 4I1VA 1FZQA 1NVVR 4JT2A 2PJRA 5F98A 3EIQA 1EG7A 4G1UC 3ZGXA 4LBVA 1E0KA 3MJHA 4LYJA 2ZYTX 4TMKA 2JIZD 4JS0A 2CHVA 3NDPA 4NU0A 3CX8A 4ITRC 2XITA 3PUWA 3Q3JB 1M34E 1RZ3A 4CEIA 2QNRA 4TT3D 1GL9B 5JWHA 3B60A 3W5IA 5KNCA 3SC3A 1HQCA 2ZYUX 3MUFA 2WWXA 3AKYA 1CR4A 1I4DD 1X8KA 2P2LA 4V0MA 2O8FB 2ZQ5A 4N1AA 4AKGA 1AM4D 2KE5A 5FUVA 3CPJB 1GZSA 3BIFA 3R7WB 2RGBA 4ASUA 1R0WA 1VECA 5E7JA 4BLOA 2HF8A 3VKHA 2XB2A 2IS2A 2O8DA 2GHIA 3HR7A 1ZM4A 4G0NA 3RRYA 3GLHE 2B6HA 2MSEB 4G5RA 4XIGS 2H18A 3U44B 2XAUA 3BB1A 4EFLA 4M1TA 2HCBA 1KSJA 4KLZA 4RD0A 3G5UA 821PA 3QG1A 4EJSC 5FFMA 3AVQA 2WMNB 3SEAA 3A4MA 3I61A 1N6PA 2JJ8A 2I3BA 3DM9B 3PUZA 4DUGA 2UZ3A 2BKEA 2GXUA 1G41A 2R6FA 4KV9A 4BWYA 2OT3B 4N3NA 1BYUA 3B1WA 2AD1A 4DLRA 3DEFA 4LV6A 3MMPA 1R5BA 1OFHA 4Q48A 4B3DA 3EPKA 4LJ4A 3H0KA 4OJQA 1NN0A 2ASEA 4AYTA 1SVKA 1XXHA 3DKPA 4GPTA 4NP6A 4Q9IA 4YDSA 3WYFA 2VF8A 4KI0A 3V4RA 3RSOA 4ZDIA 1SVIA 3E5HA 1X8LA 3VFDA 1OE0A 2BVNA 1LW7A
chains in the Genus database with same CATH superfamily
3IDAA 1RHQA 1EU1A 1Q3HA 3H5RA 2H07A 2VPPA 3LHDA 3LK7A 3LUHA 4XVRA 5KCMA 1IHDA 4D9MA 4PZLA 3R24A 4JBWA 4K2HA 5ALVA 3ESYA 3MSXA 1X1QA 2HYDA 2PL1A 3B70A 3GBPA 4JLPA 4JR0A 3OQVA 4PG7A 4RIIA 1DKUA 3L18A 1QK5A 1JE1A 2J6CA 3T7SA 1PEAA 3M9XA 1RXUA 1I4EB 3TNJA 2YXBA 3VVLA 1XWFA 2BFOA 4GT1A 3TEJA 4C08A 3K4HA 3ZDXB 1KS9A 3NEAA 2G1AA 3G5TA 4ETIA 1A5AB 2VDVE 5K6AC 1EHIA 1EM8B 3RODA 2BUAA 2LIVA 4YUYA 1QVWA 3OM1A 1NVFA 1OPXA 1OLXA 2JGKA 1YQGA 1MFZA 3O3CA 4JQSA 5CNMA 1H2ZA 1O89A 2W2VA 1SQ6A 1TX4B 4ZQGA 1YB5A 2FRDC 5IP5A 4IDBA 4WQMA 4BRSA 3PFNA 1T91A 3DMPA 5HKKA 2M98A 5MDHA 4I3GA 1H2XA 5A0VA 5EQJB 2AFRA 2GB4A 2GEKA 4IJVA 4MVJG 4UEWA 2BZ0A 3NHUA 4FBLA 3K5WA 2WA1A 3IFSA 1BX3A 3PLRA 1PDWA 3NETA 4EQ6A 1E1MA 1NDUA 2HJ9A 3BWVA 1BIFA 3NWPA 3TSAA 4YRAA 4YRNA 3SF0A 4DIBA 5BSGA 3C5EA 3N0WA 4M1OA 5ALWA 1YJ5A 5TQ2A 1W36C 1Y7IA 1KI6A 2J67A 2RGNC 3ASUA 4Q3DA 1TF2A 3CLUC 2GZAA 3ZBUA 1GGEA 1GV1A 2GXAA 1QB8A 2H52A 3GXOA 1APBA 2WYVA 4MTLA 3V1KA 2X8BA 1GFSA 4BVGA 3IE2A 1W0CA 2GFHA 3K1AB 3QH4A 5GGYA 3M6IA 4YJDA 3A6FA 1S89A 5EJEA 3D6MA 1CZOA 1GQQA 2VJLA 2ZJOA 3IVMA 4F4JA 2UKDA 1KQ3A 1DTWA 3COJA 3NJ4A 4PGGA 4EMUA 5BT9A 2JKVA 3M2TA 1L5VA 1ZD4A 3PVZA 4C0XA 1V5WA 4I1RA 4EECA 2BZGA 3M5WA 2IIPA 5KMGA 2ZE6A 4O29A 4R1OA 3VDMA 3TW8B 1LU9A 2EFDB 2RI0A 3GRPA 2C94A 1SU4A 4M9UA 3QP9A 4ZKEA 2K7FA 4QBHA 1S9HA 1YU9A 4YJHB 2EZ8A 2X0NA 2I7TA 3AHCA 4UVIA 4X8LA 3ILYA 1T3TA 4Q7JB 2G5GX 3BZWA 1MN6A 4BPRA 2JCYA 3VX3A 3WNZA 3GLFB 4FCWA 3NGLA 1WULS 2VT2A 4HUTA 3IMCA 2GBLA 2SCUB 3TVTA 1E9BA 2PX3A 2C59A 1JHRA 1ZW6A 3I8XA 4LHYA 3QVVA 3PNYA 4R8LA 1Z36A 1E2KA 3CUWA 4BNVA 4NEHB 1XTTA 5KYTA 4C7MA 1UMKA 2DECA 2XA1A 4HWPA 1ONOA 2B3DA 1IZYA 1FTWA 4R9SA 1DXQA 2EDCA 3QU4A 3USCS 2NW6A 4RX1A 4RZ3A 4M7WA 1P1HA 1Y89A 3DW1X 4PGAA 1I2DA 1Z6QA 4I9UA 4RK4A 721PA 4WINA 4XYGA 2EXXA 1A2QA 1G17A 5LQNA 3NTRA 1FJXA 1UKAA 1ZHOA 3AP1A 4KX3A 3FF4A 1C5KA 5AKIA 3TB4A 3WGVA 3VZSA 2ATIA 4PGFA 4YRJA 4BE7B 2G1PA 1GKLA 1VSQA 4KO8A 4LOJA 5JLAA 1ESMA 1GGVA 4R6WA 3QEAZ 4I9HA 3DH0A 4JUIA 5TY0A 2CUKA 4RQUA 1P17A 2O0JA 3R77A 5IM4A 4OU5A 1YHYA 1V25A 4TN5A 3UGQA 2FEAA 4F3NA 1CVLA 1HZZA 1B6SA 1BEUB 4GYYA 4J90A 4AF6A 4B2LA 3NOVA 4O0LA 3HP4A 3IOYA 5MFZA 3D0RA 3NXKA 5DLPA 1P2FA 1D04A 4RD3A 1NNEA 4BX9A 4WACA 1KAGA 2D5CA 3LK6A 3E70C 5CMLA 4EHKA 3U09A 5EPEA 2Y76A 4OOEA 2BMDA 1ZGGA 5I9NA 3GMSA 1ACJA 2P40A 2QTLA 4IVNA 4BP3A 1VGVA 4P54A 3ED5A 2CLFB 2JLRA 3U7FB 5JARA 1PS8A 3KO8A 4UXIA 4MUBA 4YALA 3D02A 1U1GA 3AG6A 4AZWA 3VJLA 1QQAA 4N8DA 1IE3A 1CS0B 3BT7A 4Z54A 1N6NA 6PFKA 1S1CA 3SF8B 3COPA 4NV3A 5B53A 4EATA 3K2QA 1N33B 4JYCA 3L0SA 4EPRA 1HRKA 4BAZA 1MENA 5B36A 2BYTA 1NX6A 2BCJQ 3QGMA 5FI5A 4NOMA 2Q46A 5DZSA 3RBVA 1RXVA 2HNKA 4ARVA 2Y2UA 1CE8B 3KU1A 1YB7A 5IARA 3WRWA 5KYKA 3A6EA 1T1JA 1VKZA 2XKBA 3EXG2 1P0QA 1RXYA 2I3DA 2V45A 4G8JA 1UJCA 1WKVA 2WU0A 3HA5A 4JB3A 1R37A 4F9GA 5C8VA 2PBLA 3PUHA 4OQMA 4Y3UA 5GONF 2Z8YM 4PPYA 1O0SA 3OQOA 3DMTA 3ZNNA 2RHJA 1FB5A 3KIPA 4JBHA 4LRWA 3USZA 3SAJA 2JFQA 2RJOA 3GLIE 4U7TB 1JMVA 2RHMA 4ALJA 2AR7A 5LQDA 2BEVB 3SSMA 3EZXA 4TMXA 1Z4NA 4ZREA 3VPAA 3OOEA 2ZI6A 5KNDA 1L5WA 1PG0A 2RH9B 3OSZA 4MITA 3TGWA 4TLAA 4CCYA 3VO8A 1N3IA 3QEJA 1ELOA 3RS8A 4BLQA 1KK1A 2PXAA 1N7IA 2FQXA 3I64A 4MR8B 4QG7A 4ESHA 2ZRKA 3LCCA 4LBYA 4BFWA 3MELA 4KITB 4N5IX 4DRYA 2NNLD 3EC2A 2EATA 3OJXA 1RAGA 4PVCA 1UEIA 2EGHA 4TRRA 4AFNA 3ACBA 1R4ZA 1CC1S 2OP1A 2OZLB 4N49A 3G9XA 3K92A 1N6IA 1R4NA 3RG8A 3RSQA 3SEQA 5LPNA 3OFNA 1P4GA 5EINA 2ILVA 3KJHA 4H18A 4IHJA 4L8LA 1PGPA 1ZITA 2EQ5A 5DRTA 4FE7A 4DSTA 5B12A 4ALKA 1CIVA 3EVBA 4J0GA 4Y18A 3C7CB 3AILA 4V3CA 2YC2C 1WDKA 2QMEA 4PEVA 2UAGA 5A5VA 1QH1A 2CT8A 1I3MA 3Q40A 2G09A 5DLYA 2RD2A 4X7PA 3N2GB 5BT8A 2H0QA 5F5NA 1LLCA 4YCDA 4CUJA 2VTVA 2EYUA 3AZOA 3D1LA 1IAVA 3ELBA 2BBOA 2NUTB 4LXQA 1U9ZA 3FDZB 2CWWA 2HDOA 5E1BA 3CZ5A 5KINB 1WXIA 1NJFA 1XI2A 1G4AE 5HA5A 1DJMA 4X8HA 1V11B 1XBTA 2WT9A 2UUOA 4PFKA 3HCOA 4CG0A 2DHQA 1V9SA 3CT4A 3HGQA 1XSEA 3GVPA 4LI0A 4LJ7A 5EL0A 2JRLA 1YE5A 2D74A 2C5FA 5ERXA 1MOZA 2HXGA 2Z57A 1FP6A 2YW9A 3L05A 4GP7A 2QZZA 3DGEC 4OKSA 4DUZB 4B8WA 3UIEA 2WIKA 2A14A 3VR2A 2IPXA 4CM8B 2TMYA 2NU8A 2V3VA 4LY6A 4X3CA 3GHYA 4ND8B 4WLVA 3M81A 5LN1A 2XDQA 4FYXA 2HHAA 4KQFA 4DIOA 2VTBB 4B6PA 4QJ5A 4EI2A 1KE1A 4Y2HA 4OPMA 2YVLA 1HEUA 1QBGA 4Y9SA 2ZJAA 1EBFA 3ANSA 2YJTD 1LNQA 2OYRA 3VI3B 3LYHA 2B94A 1PI3A 2DU8A 5K0SA 1L4EA 2LNDA 3CZ4A 4O3FA 3ZE9A 4DIDA 1UDRA 2G17A 2A94A 1E3QA 1IIBA 3ZWDA 1A71A 2FF5A 4M9QA 3CUVA 2YZGA 2Z0MA 3UJ7A 2I67A 4YDHB 1FBNA 2BBWA 5ULLA 3O2SB 4OFXA 5FI3A 3THSA 4F5YA 2IZ6A 3SVLA 5FI1B 1J5XA 2DULA 2EZTA 2O59A 1BHJA 4J0QA 3TMYA 4C0LA 2PQ0A 3SZLA 2XLBA 3PXXA 2GZDA 2WM9B 1Q6ZA 3UICA 3THWB 4B40A 2PWBA 2ZWPA 1Z4KA 3W7BA 4CKXA 2QVBA 1MJ5A 2FNAA 4P2BA 4TKMA 2WWGA 1BDHA 3DDUA 4EGQA 4PX5A 4BBPA 3AF5A 3ZLJA 1M72A 4PO1A 5IN4A 5E6UA 3O8NA 1FSZA 2ZSIA 2JLVA 2WM3A 5JQWA 2QMZA 1J8DA 2XIJA 1AHPA 3AEKA 1PLLA 3TAUA 1KO8A 4BQPA 4B3BA 1RKXA 4I1PA 3OP4A 2ZUTA 1YVRA 3U1VA 1UAAA 1Z37A 2QUBA 1BS9A 3IAAA 4TWRA 1Q0HA 1D2HA 3VR1A 2EKZA 4JOBA 1LS6A 1H0SA 4LXHA 2H7CA 1L7BA 3TNLA 3H6KA 1QHHA 4MARA 4XGKA 3S1LA 5IUJC 2R44A 1L7RA 1VYHA 1ZSYA 4EF6A 4EI9A 5KSWB 1ZA2A 1FJHA 1S01A 1P2UA 2A59A 2FRVA 1O2DA 5JOQA 1Z9BA 2QYOA 2MJLA 2OAQ1 3H7AA 3P0EA 4O1IA 2ZYWX 3HG7A 1KI9A 3MG9A 3EQ7A 3ANMA 1QS0A 2GBLC 1G8GA 2FZWA 4N0PA 4RJTA 2XUKA 3FCCA 1NA5A 1E1QA 2Q1XA 1U28A 3TLZA 3AVVA 3MT8A 4I1IA 1YWGO 1C30A 3GPCA 1JZSA 2QLBA 2GRJA 5DFAA 1YIDA 1FE8A 3FY4A 5JAIA 1HO3A 2NUBA 5SICE 1BQEA 4GX1A 2NO9A 2NU7A 3LXRA 3RM3A 1QYWA 1K8YB 1J99A 4TV9A 4B9AA 5JD6A 1MIOA 4KPEC 1P1KA 3WWCA 4CLDA 1LQTA 3LDHA 4L15A 4MI9A 2CYCA 3RS7A 3F3MA 3LA6A 4HEQA 4TXJA 1Q0RA 4YRLA 2G25A 4KO3S 4D9FA 3LA8A 1WDTA 4E4TA 1I51A 4JJGA 1OXKB 1HLGA 1SD1A 1U6JA 2Y9PB 1EFPB 3RABA 3HJGA 3ZQ4A 1T4MA 1E61A 1FK8A 5MN4A 2WNIA 4KQ1A 2ASVA 3R7FA 3EBOA 1TJ3A 3UO8B 3P0RA 5HX7A 3KQWA 5CEFA 2OESA 3A9UA 2A5YB 4RZ2A 2Z43A 4RTRA 1R6XA 4YTEA 1Q1NA 2CJWA 3RC9A 4BMOB 2RKBA 3AR2A 2WHYA 1CETA 2EW8A 2CV0A 3BWXA 5AJTA 5AW8A 4J1SA 1E2MA 3WGUA 2AFHA 4EKIA 3I5UA 3KZMA 3MWFA 4IV0A 3TXAA 2BGNA 1LSSA 3M5PA 3O5AA 4FD3A 2QRGA 3GNSA 5A3RA 4JQZA 3WGJA 2H1SA 2P3QA 2W11A 4RIEA 1S2IA 1T25A 2OSBA 5AHXA 1BU8A 1O6FA 3D81A 3ROMA 3AWIA 3TJZA 4CKEA 2XOKD 4G4JA 4GQAA 1Z6PA 4ZYVA 1KE2A 2OC9A 3ZCSA 4AJJA 1F2TB 3K8YA 4JMPA 2WM8A 1YQTA 4UTRA 4W1SA 1GQYA 1F17A 2GCPA 2QTWB 4PCAA 3ROXA 5EP4A 2G82A 4UBOA 1QH8B 2J4CA 3DOUA 4QDJA 1FDOA 1V26A 3PPIA 4BMVA 3VNRA 2NZXA 3HLYA 4NMHA 3FWNA 4UHBA 4KJXA 4QVIA 1Z0ZA 2VTKA 2F1JA 1AKTA 4OYRA 1B74A 4UMVA 2D13A 4WXHA 3CG0A 4FKBA 5FLYA 3U4QB 4M55A 4JA2A 4UNNA 3L9XA 2Y1CA 4H0NA 4TMVA 2DEUA 1CT9A 1PRYA 1XQVA 3G9UA 5LZ5A 2Y1WA 3PF8A 3KWJA 1EFDN 2DTEA 4UUOA 4RQBA 3MUOA 2ONJA 3NVKI 4RACA 1WMEA 1NW8A 1NPYA 1SCKA 2CXSA 3OMXA 5K2OA 3OICA 2G6TA 2JHGA 5CGZA 2JGMA 1YVEI 2CNNA 3ES9A 5DM2A 4J9UE 4BFXA 1NAHA 1LV8A 2AXEA 2X1VA 2WUWE 3H9EO 4EUHA 5EKSA 2CL5A 1H2WA 4KR2A 3IELA 3BXZA 2CXNA 1ZI8A 5IK2D 3LPLA 5K01A 4MPTA 1G55A 3NCHA 3ZXYA 2NO0A 3HVRA 1FMLA 4RIGA 4QQKA 2J9XB 4PR0A 1L9XA 4UHHA 3HJHA 2R1VB 4R3WA 5E4YA 3SICE 4L08A 3PS9A 5JZ9A 1PQ4A 1XZGA 4QXMA 1MABB 4NBRA 3GCDA 4BECA 1CZLA 2HGZA 1DC5A 1UOPA 1YD7A 1YQUA 4M0FA 4TMTA 1FW8A 2CF6A 3R4CA 4JJAA 1QGOA 3ZQUA 3INRA 5DYYA 2UYHA 2PG3A 1DWQA 2JLZA 3UC5A 4TM7A 1IEXA 3R40A 1V1JA 4GMGA 5EQFA 1JIUA 4N6GA 4PQGA 1XWIA 2JK0A 2HRZA 3GGSA 3TR0A 4TLDA 4R0MA 5CBPB 4J9VA 3BWEA 4ZO7A 3T7KA 2HKIA 1EGMB 4BNKA 4WUTA 1FPMA 1LI4A 1Y0BA 5TQ0A 4TQGA 4XOIA 2DFPA 1T36B 2VQFB 1NONA 1O58A 3C4QA 1QCDA 2XGSA 3PITA 1TTTA 2H1OA 1LWOA 1P72A 3MGBA 1Y63A 2GEVA 2NUAB 3S1SA 1P1JA 2H2GA 4JT4A 2C8VA 1JR3D 2VJYA 1ZMBA 4L95C 2ZJYA 3AJRA 3WLRA 1P7VA 1N2XA 1P1IA 2OCAA 1F8XA 1U1DA 4HHEA 4NDNE 4JJ4A 1Y82A 3ZW9A 3ZUGA 4C7OB 3C87A 3VPSA 3R75A 1KJYA 4JXJA 1M73E 3GLQA 1X74A 2OCPA 2MT9A 1ILEA 1IXRC 4HQ0A 3ICEA 4ND6A 1S02A 3H9CA 4URZR 5E4FA 3TSOA 1RPZA 1FUEA 2EL9A 1VJRA 3ECSA 4X44A 3OUZA 2PQ6A 5H3CA 3L6UA 1XMVA 2JBAB 1WHSB 3SC2B 4IUCS 5F5XA 2O2IA 1Y8CA 4HTFB 5CB8A 2YFHA 1PQUA 1L5NA 3SR3A 4R2KA 4KVAA 3PC7A 2XRZA 1Y5NA 2XT6A 5AVZA 1WQ1R 1BO6A 4H0FA 2O1EA 4YT4A 2AUTA 3GPLA 5KAMA 3G5MA 3QHPA 4OI1A 1GGHA 4BNNA 3UCEA 1H05A 1PS0A 1S4QA 4DUYB 3RYHB 4HFJA 1EK2A 4DM4A 1DXOA 2C9MA 3JD4A 1GRRA 2P9BA 4C9BA 3KKQA 5MN6A 2EZ4A 4KO2S 4D9NA 4O02B 1WB4A 3R5XA 4X71A 1PL8A 4QGSA 3ZC3A 4KRXA 4R2XA 3H0EA 1UMDA 3RHTA 3M3PA 4BKPA 4LNUB 5CVUA 4TS1A 1A88A 1TE2A 2VO1A 2OMEA 1RHJA 2SKDA 4N12A 1QPZA 1CDDA 1QIHA 1LWNA 1U6KA 2HWYA 4NU8X 5PNTA 4LF6B 5JYDA 3VMFA 3OX4A 4LZLA 3N2ZB 1NQUA 4D74A 2Q28A 2WJAA 3OEED 4GQBA 5LXTA 1DLJA 2ICAA 4B4WA 2FUEA 2X86A 1JDNA 1A9ZA 1CV2A 1UADA 1GNQA 4N4AA 4XQ0A 1VPWA 2PSEA 5HS6A 3WYNA 4EO9A 4FFBA 1QVZA 1XEWX 3MXTA 5KNBA 3SG0A 1EQAA 2LD4A 3KXIA 4LWPA 4PONA 3DE6X 1ZS9A 3NKLA 4U9HS 4A2WA 2AX3A 2HIGA 2GLUA 4M86A 3WK7A 2FDCA 1B6GA 3NTOA 3ZHRA 2FPIA 5C7IO 1XZEA 3JASA 1PT6A 3RC1A 1A9QA 1A8HA 5KQPA 4F96A 1T2DA 1GU0A 3TEFA 5LP6A 1K7CA 1QP4A 4A10A 3VPGA 5EJ2A 3MHPA 3AF2A 4HVLA 4EEKA 5EQDA 4YPVA 3VV3A 4EEZA 1MKYA 1NOJA 2ZPTX 3O94A 1F8FA 3WE7A 3BGWA 1JEQB 2UUBB 1Y8RB 4BVHA 4QTTB 2WVGA 5FO0A 1QV9A 2B9VA 2QX8A 2VDWB 3I52A 4YFYA 1MFPA 1U2SA 4B3FX 1JIJA 5CLFA 3N0TA 3NTQA 5AW5A 2C7OA 3W4KA 5TMPA 3T1OA 2QUAA 4EDHA 4B4UA 4E4YA 1USGA 2AMYA 2P9FA 4D9BA 2FU5C 1NAIA 4GWGA 3A3YA 1NXOA 3N1UA 4CLRB 3A04A 1TI7A 3OZSA 3G2MA 1QBKC 4D97A 2DHCA 2CGEA 5CT4A 1YVUA 2ZJ5A 3ZQ6A 3GRUA 2QP4A 3I9LA 3SNHA 1EKXA 1E1YA 3IP6A 4WCVA 2XOKA 4AJ1A 3LE8A 2XCQA 5KI6A 1KGSA 3TZCA 1M1NB 3UK1A 1H4SA 2IL1A 4GR4A 1XQYA 5J40A 2Z1NA 1BXGB 2PS9A 3T1VA 1HOTA 3IHTA 3KSZO 2AN3A 2OD2A 1RADA 4NS1A 3UK2A 3V32A 4ZOQI 3FOZA 2NT4A 1ZMXA 5TQJA 1IVYA 4UNRA 3N2KB 3S6JA 3OLVA 2PKQP 4FZ5A 3T5TA 4BO0A 5JY1A 1NP3A 3WFZA 1P44A 2Q1UA 3CLTC 4TKZA 2B0CA 3EUAA 1JIQA 1GUFA 1X1CA 1B0UA 3BJEA 3MOGA 3DDHA 3RDPA 4B3XA 2NM0A 1P91A 1J42A 3HZHA 4Q3OA 3C6KA 4XJVA 4MV7A 1U31A 1GV0A 4FMBB 3A05A 5TLSA 5BQXA 2FEMA 4XFKA 3UJ6A 3DEYX 2P4SA 1E0SA 2UYYA 4AN4A 5BNTA 4C87A 3RTBA 3FKQA 3GJSA 2F2TA 4MWGA 5JFGA 1EX6A 3EXHC 1XDZA 2JAWA 3O4GA 2B4YA 3HBLA 4JA0A 3WL7A 3H8WA 2HA4A 1CUWA 1TVEA 2RHWA 4E5SA 3L7BA 2X6RA 2B4TO 3EMBA 4KUEA 3RSSA 1P9LA 4MA4A 4B32A 1R18A 3GEGA 5IK2A 1HNNA 2OCBA 4CIXA 1DINA 3H75A 5EGNA 4C5BA 3I76A 3TEMA 1J0DA 4OK5A 1Y7LA 3GGPA 3HKBA 4P3YA 4I9NA 5DB4A 3WDLA 4B47A 4CLXA 2GVZC 4CZ2A 2Q2WA 1VE5A 2PZBA 5FHRA 2VSOA 4LOAA 2JVIA 3F5MA 3KQSA 2EBUA 1QGUA 2FP3A 2QW1A 3HYTA 4G63A 1SVWA 4LPKA 4QYIB 4NU5A 3ZVLA 2B6NA 3FYDA 3NBZC 1Q1ZA 4UNPA 2XD9A 1LPNA 2H1LA 3DGFC 2C07A 3PC8A 3FMFA 3N8HA 1JEOA 2Q29A 4LTDA 3VO9A 4HB2A 1KAOA 1QOPB 1K6MA 2Y1LA 3F4BA 4XJTA 3DAPA 4ZD6A 1YMUA 3LHKA 4CQMB 3C16C 4EFMA 2P9GA 3ZQJA 1K8XB 4LNAA 4MMZB 4UVDA 3LPMA 4W4TA 3RU2A 1WY5A 3FFAA 1NNI1 1I6MA 2CUZA 3G59A 3PV0A 4JP3A 4BGUA 4D0SA 3D64A 5IUNC 2FPUA 3GV0A 3ZDRA 4BV8A 4HXYA 4UASA 2VHTA 2ZR8A 4ZHSA 2XWPA 1JLMA 2EIHA 2QTVB 4ZGGA 2JZCA 1E3TA 1JR3A 2WMOB 1MG0A 4KDRA 4DBZA 2FFRA 2EEZA 3R74A 1H1DA 3IOMA 1CUZA 1RJ9A 2EL7A 1NQ5A 2ZIXA 4Z4FA 1RRVA 4WI1A 3EZLA 5ALUA 1SOMA 4MW0A 3HJFA 3CH5A 5G41A 1QG6A 3FHJA 5KWVA 1UKEA 4DV5B 4QEKA 3QF7A 1FX0A 4DDMA 4MVJH 4OGKA 2VWGA 3I72A 2IWRA 1LUAA 5BVHA 4GMDA 1U3FA 1WY7A 2OA0A 1N6KA 4MV6A 5DP2A 3AV0B 4BRZA 3HZZA 4R16A 1E60A 1XFAA 2AFHE 2XUIA 3QXSA 3NH6A 2HUPA 3QF4A 3NBQA 2OPBA 2YJNA 2G9UA 1QH0A 2WIAA 2IPLA 1FDUA 1JBQA 1MIHA 2YWDA 4BC0A 4GL4A 3O92A 4AJLA 4PV7A 2HT1A 3QWAA 2PH5A 1PV1A 2PUHA 4FVTA 3C3EA 4WZAA 1PNVA 2PT6A 3E6AA 4BN0A 5KTKA 2QOEA 3QFFA 1E94E 2QXUA 4JUFA 4H7EA 1ESZA 4E09A 3PSHA 1AGYA 1V8OA 2IYWA 3LF1A 5JRDS 2WAMA 5JJIA 3WSWA 1MR3F 4FYJA 4EL0A 1FMTA 2I76A 3KKPA 4MX8A 5E0OA 4BBJA 5MGBA 1JBEA 1YE3A 3EW7A 4AY4A 2CMGA 2FZGA 4O4LA 4HY3A 2YIJA 1D6NA 4NOKA 4XM2A 4D1YA 1H3FA 1W48A 1Y6QA 2PMBA 1QB7A 4DT1B 3HCNA 1JTEA 2J0UB 5EZYA 4FFLA 1ZKMA 1Z06A 1RHKA 3WB0A 2D1TA 3GEPA 2EW1A 2YBDA 3F74A 2W8BA 4TV8F 1Y1TA 1Q0LA 2OLEA 3HR8A 3N0RA 4GDMA 4RJLA 3V1UA 4IM7A 4QPZA 5DHFA 1Y3CE 2H85A 1HORA 4CETA 4BMSA 3KQTA 1E2GA 1T6XA 2BPOA 2QGNA 5CXXA 2J0SA 4ZEXA 3SDBA 3AB3A 1G21A 4LHWA 2HI0A 3O38A 3FTQA 2ZAIA 4L3VA 4WXPA 3RIHA 4B6QA 3KQHA 5TJHA 2CLHB 3ZIAD 3RJ9A 4AP6A 3DPSA 4RXMA 1DQZA 2JIBA 5BN3A 3N8NA 2C95A 3RC8A 3K5PA 4O4HB 2O52A 5JY6A 3W1EA 1D3AA 1H9AA 4XI9A 1AKVA 1ZUIA 3B7GA 5BWBA 4JBLA 3ZBTA 3LBAA 3Q9UA 1ABFA 2GXSA 3FNBA 4ZEWA 1EGHA 2CEKA 1Z2OX 2PGLA 4F2WA 3QKRB 1AS0A 5EN4A 1YBVA 3CCBA 5BXYA 2B20A 4Q4CA 2IH4A 3OUUA 4EYGA 1Z0DA 3J80A 1TM1E 3DHWC 4X1YA 4BL5A 4HVAA 4RPLA 2J31A 1ODFA 1PWZA 4QM7A 1RR6A 1X1DA 4U2BA 1L5YA 4F97A 3QXGA 4BNDB 3CNNA 5AW6A 3CG4A 3JQGA 4YT8A 1XELA 4KKVA 5C8YA 1KDRA 5EMJA 2OBMA 3C15C 4IEEA 5IAAA 5LP6C 2O0MA 5CTJA 5EHIA 2KYRA 3WLEA 3MJSA 1Z6YA 1PD1A 3WMGA 1CF9A 1FS5A 3FIUA 4BN4A 1VE3A 3H2KA 4N8EA 1HRDA 3FHCB 3VHXA 4JNCA 4X1IA 3A26A 1BHO1 3RF7A 3QEOA 4FHZA 4OLFA 5IASA 1SKMA 5KYUB 3R9XB 4YLYA 5B1SA 3DFIA 5G0VA 1ML4A 1V71A 2COEA 3C74A 3RTAA 1XNJA 4M6WA 1NBAA 1H4VB 4Z4GA 4MINA 5T64A 1UT8A 4TLBA 4QUEA 1UP4A 1DBPA 4EG6A 1Z2DA 4HNUA 4OHMA 2FGJA 3L04A 1VSUA 1DGQA 4YIKA 4Z8YA 1DUSA 2EERA 2FE4A 4NVRA 4YI5A 3V4PB 4V1CA 4R9RA 2UUAB 4C29A 3AR5A 4M8IA 1PW5A 5DK6A 3GPIA 3GLIA 3QBDA 3ROEA 4M9SA 2BP7B 2P11A 3H3JA 4NFSA 1CUGA 1TVKA 1GFZA 4Q39A 2QD5A 2CKMA 4KWIA 4RZHA 1PWYE 4S05A 1KPHA 4KLNA 3NBMA 4UTXA 2IF0A 4UE6A 3UAXA 4MULA 3UB3A 4FDAA 2KQUA 4O4JA 4KRYA 1XA4A 3W2IA 5IDXA 3ADBA 5EVJA 1NLFA 4TYYA 3TVYA 3VO2A 3WY9A 1L4FA 3NBUA 3IQFA 2IE8A 2RGRA 4UEOA 2Y1XA 3IBYA 4S35A 1RBMA 4BO4A 3H5IA 2YUIA 5BOVA 3ZZMA 3O75A 3OQ1A 3Q0TA 1E3LA 4ABTA 4R40A 2C29D 5CU7A 4AN1A 2JVKA 5AJXA 2TSYB 4Q7QA 5FWXB 4G0QA 1B6TA 3ZDCA 3NBFA 1XT6A 3JYLA 1HYEA 2D3WA 2VSYA 4CPDA 2G1KA 2PLWA 4O4HF 1OV4A 2PZAA 3OM8A 3T12A 1JJIA 1QF6A 1H9BA 1Q1QA 2V7GA 1H6CA 2X8LA 4GP9A 1QAQA 5TXGA 3TZQA 1HT3A 3WHKA 4I4IA 5TV2A 2H2IA 4CW7A 1J20A 1G20A 4PBRA 2V7WA 5B3AA 3JWGA 2NGRA 2GF2A 4HEA1 5AW4A 2IQIA 2WP0A 4A73A 3P26A 4KPUB 5ALTA 1WVGA 3FVTA 2HWWA 4XIJA 1HL7A 4LHZA 4PYOA 4AWXA 5JXGA 2PYIA 1QTRA 3VKWA 1ZESA 3F3KA 2VZ0A 3VJMA 3VVMA 3GJ0A 4R7ZA 3DHEA 1RHMA 5E3JA 3ZHQA 2YY6A 3NUZA 4MQUA 5CLLA 3K2EA 4J3NA 4NE7A 5G1NA 1TK3A 3KB8A 2Z4RA 1OVMA 3FCEA 5E95A 3W3AA 3ETDA 3UG6A 2WR8A 1UOQA 2ZZNA 5ALZA 1F06A 4HQLA 2AI3A 1XTPA 4DPLA 4UFNA 2V9PA 3EFBA 5C8DA 3BE8A 5C4GB 3WQHA 1H8ED 2HU5A 1ZD8A 4NRDA 4B7AA 4C4TA 4CTNA 4Y98A 2H1RA 1V43A 3GNLA 4HNAB 4X3PA 1WV1A 2FHSA 1NVXQ 3NP7A 1II8A 2BGMA 3AIMA 3DNPA 1PFYA 3HJTA 4RTPA 5C1OA 3GBVA 2XNJA 5LVAA 1WPQA 4HVCA 1J9GA 4NY1A 4F21A 3TTXA 1LLUA 2PVCA 4FE3A 3BAZA 4RJKA 1TCAA 3RVQA 1XP5A 2C5LA 1EVLA 2F00A 4Q6WA 4F71A 3NTXA 2QORA 1ZUNB 3CB4A 1J39A 1SELA 3JYHA 3R1IA 4GI5A 4TXHA 3ZLUA 4TL8A 1PNRA 2PGDA 5LL6P 2JLUA 1UBKS 3VU8A 4WLOA 4A5SA 3ZGZA 2OHXA 4JZKA 4X65B 6YASA 3ERCA 1H3EA 3I5MA 1RMTA 2R7MA 2HEGA 3RVSA 3Q41A 1A8PA 2VSQA 3B3AA 2NP6A 3HB7A 4C05A 4Q3BA 4K6FA 4ZU6X 3HZRA 1QFSA 3L6CA 1TT5B 5FL7A 3RQSA 3BVPA 1FVOA 4ZZIA 5JBNA 3HSYA 3GYGA 2BHLA 1VPEA 2ZRIA 1OJLA 2H0AA 2LDBA 4EA9A 2XUHA 5F7ZA 3UFBA 3PC6A 2Q8PA 1IZ7A 2IY7A 3E4CA 1GRCA 3F5DA 3L0CA 2ZI3A 3MTDA 4NQRA 4ZOCA 3TH5A 2ZRFA 1EK5A 2QU8A 4ZZ0A 4KIJA 4ERNA 3TVDA 5CPBA 1E5VA 2BR4A 3JAKB 4J0CA 3FLMA 4IIHA 1G8JA 5T6BA 1VP9A 4ODIA 2E4WA 4OQXA 3VBEA 3K0BA 4R1NA 3WA7A 4CL0A 3DL0A 5D3QA 1JVNA 2F3QA 3BIXA 2C4TA 4QXPA 4ZXPA 3BHMA 4UM9D 3ZIAA 4H17A 2EWMA 2Q5EA 2J46A 4K3VA 4C01A 1E9AA 1SB8A 4K9QA 4LJKA 2E3JA 1XMPA 3FOAA 4M8KA 2PE5A 5EPOA 2XCRB 2AE1A 3LFTA 4C06A 4ZV7A 4DRZA 2TMKA 5KVSA 3R5SA 2DR2A 3AF1A 1CU1A 1NI4A 3EAGA 3ONEA 3C1AA 5ELMA 4K6CA 2VXYA 1Y81A 3H5WA 1K5PA 1G8SA 3I9OA 4RMNA 1Z12A 4NONA 5GVRA 4MQFA 2ODQA 3A3NA 1XKTA 5FOSA 4D6YA 1ZCFA 1RLOA 1ICEA 1AMUA 5AVKA 2XQKA 4Z1MD 5CH3A 2FH5B 4RENA 1WUJS 2W0MA 4F4CA 5F35A 1SA0B 3ZZ1A 1EUZA 2JFYA 4BZZA 1S2GA 2HJHA 4K6HA 2AQ8A 3K32A 2YWCA 4MQ6A 4RY8A 1QIMA 3D4LA 1LDYA 3TOCA 1P8JA 3ZCXA 3QXCA 2GK6A 1JR3E 1P9WA 2H7VA 2M6RA 4MVWA 2JGDA 4GM1A 2JFOA 4TYMA 4C14A 4R1PA 1OI3A 4GHWA 5HRCA 5HXAA 1YZFA 2EWVA 3FYHA 1GTMA 3WO1A 2HV8A 2Q7OE 4BUZA 5ALYA 3QE2A 3M4JA 1A9XA 1QG0A 1XN4A 1YJBA 2P41A 1I13A 2CE7A 2VRWA 3EF1A 5E9WA 1DRWA 2N42A 4CM1A 3Q8KA 3PZBA 2AZTA 3EVZA 2IUUA 4AAYA 5ITWA 5BV2P 1EP1B 3EDOA 1DXHA 4KCGA 5ESWA 3RADC 2PGAA 1C8KA 1Z16A 4KE6A 4HO1X 1V6AA 3MD9A 1A95A 1GY8A 1E96A 2RH4A 1GDDA 4ZI7A 4ROSA 2R84A 1XTJA 1M9NA 4JQCA 4XUGB 3S2YA 3OJFA 1LDMA 3DP7A 1Z74A 4FGZA 4M9RA 4OHXA 3UMGA 2PGJA 2OBNA 3QY0A 3UWMA 1G291 3FVVA 5EJ8A 4BLSA 3H11A 2QRUA 2XX3A 1YBHA 4H7PA 4D0GA 4XLZA 1Y6FA 5F9HA 4HOYA 4EHIA 1U2RA 4MS4B 1KYTA 3GC6A 4TVKA 4Y1GA 1NF8A 3RYIA 3I0MA 2WU8A 4HDNA 3IEKA 4LIPD 1L1FA 1QKIA 4Y1RA 1NXVA 3R7BA 3JQEA 3LP5A 4LCEA 2OBYA 2V3CC 3S7TA 4MW6A 5JJ5A 3CF4G 5JXIA 1VPLA 4ZOLA 3LBYA 4GYJA 3TLAA 2JEYA 2OG2A 3T5MA 1PT8A 2BT4A 3ORSA 4GOLD 1QRTA 2Z1MA 3LUFA 4JB2A 5KWSA 1QYIA 2DWUA 4AB1A 3G0OA 3F1KA 1GNTA 2BGRA 3OY2A 4XSVA 1N6OA 4X97A 2HK6A 5TB5A 1NRIA 4RGVA 1SKUA 1BW9A 2EFEB 3X1YA 1ZGHA 3NBKA 4EUEA 4WKGA 1TIBA 1QZUA 3FF1A 1UP7A 3AEUB 1RM5A 1NVBA 3SP1A 4J1NA 4MZXA 4KGZA 3IBGA 2YJ3A 3WYAA 4KQGA 1NKTA 1DFGA 1DIAA 2A2ZA 2CCKA 3FIJA 5A2QA 5A02A 2ZJBA 5IVDA 1V1MB 2R5WA 2WINI 3L01A 1USKA 4OHKA 1WPGA 4HAUA 5AI0A 2HLNA 2IXGA 1ZBDA 2OK7A 1G21E 3M89A 4E2XA 1QNLA 2Y1GA 3H2SA 3S3TA 2G7ZA 4R9VA 2WJVA 3D3NA 3MWGA 1OPRA 3EGIA 2K4MA 3G2QA 3HY3A 1N1GA 1Z6TA 2O6HA 1WKCA 3Q6NA 1PVVA 3FROA 3K20A 4LUCA 2QX7A 2WICA 5NULA 4OX9Y 4JLAA 3GOQA 1T2CA 3MMNA 3L43A 4BYGA 3M3DA 2B3TA 2QSZA 2R9VA 1TYZA 4A36A 5HCNA 1H8EA 3A7EA 2GO7A 5K6TA 2QUZA 5FUYA 4LYYA 3DAHA 3IIJA 4BEWA 2QRKA 3LY5A 3QENA 2VQ6A 2WF7A 1FFDA 2O3RA 3JAWB 4FCVA 4G01B 4PSVA 2RC6A 2XZOA 4G8DA 3U40A 2D00A 3P9YA 2UYOA 3BTVA 3F7OA 1ORTA 3VX4A 4LYDA 3NHSA 4OL9A 4U6QA 2VNHA 3KZOA 2J87A 1N0HA 4UVEA 1U6IA 3JYPA 4IIXA 4TVBA 2UZ0A 3V46A 1TU0A 2MSDB 1QPBA 3CF4A 2HREA 1E8NA 2N3ZA 1SXIA 1S4MA 2QROA 3QV2A 1C4OA 5AHKA 4NH0A 4PAGA 1XEXA 4QOSA 2I1VB 3LKBA 5BUQA 5KNBH 1ODCA 4GVXA 1BGWA 3ZU4A 1CIPA 5DLEA 3H13A 2A1IA 3H05A 4CIVA 2DBRA 2H1IA 1K1EA 1PP4A 1FRVA 1QHGA