4NMMA

Crystal structure of a g12c oncogenic variant of human kras bound to a novel gdp competitive covalent inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 64
structure length 170
sequence length 170
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4nmmA00
5A0FA 2BJWA 4F93B 4RCZA 1ESNA 4LJ6A 4JT4A 2G88A 1LY1A 4A0FA 3EPHA 3WNDA 2PMDA 2DPXA 1SGWA 3Q5EA 3KXKA 4Q01A 1ANKA 2GAAA 5KU1A 5CJ2A 1UBFA 4QHYA 2A30A 4B32A 3UWKA 2JASA 2YJTD 4D81A 3X1YA 5FTJA 1NMYA 3CONA 4NL4H 3FFAA 3QPUA 4YDHB 1GVNB 3IIMA 3CLVA 2FFHA 4O25A 5DI3A 3EPKA 2Z6VA 4URYR 2JJ8A 5JZVA 2OBMA 1PLJA 3ZIAD 3ZD6A 3MGCA 1K8RA 1M8PA 5JEEA 1GZSA 4TQ9A 4MRSA 2GWHA 4LK2A 4W7SA 4YDSA 4TTRA 3FTQA 5FOVA 2A5FA 2G3YA 1RRFA 4KI0A 1I2MA 3ZVMA 3AVYA 3DM9B 1IN5A 3LBIA 1GDDA 2J87A 3LX8A 5DHFA 3AEZA 2V55B 4C7OA 1F48A 1A5TA 4HDQB 3L8YA 5TXGA 3VAAA 1E9BA 3VKHA 1T8UA 3ZZTA 3K8YA 4Q21A 2XSZD 5G53C 3FHOA 1D2EA 1P9WA 2CMKA 4YXWD 1COWD 1G4AE 3IO5A 5SZIA 3AVUA 1FMJA 3A4MA 1GAJA 2MSCB 4NPHA 3AVXA 2RGDA 1SKQA 2W0MA 3QKUA 1W4RA 3O8CA 2RGXA 1FP7A 2DWOA 1E1QA 3OZXA 5TV2A 4LYFA 1B0UA 3PVSA 3S1AA 4A6XA 2NO1A 4Q1BA 2GJ9A 5JWRA 5AJXA 2CHQA 4B44A 2IUUA 3LWNA 4FD2A 2G1KA 1E98A 1S9DA 2VF8A 2GBLC 4PANA 2AWOA 4Q4HA 5L3QA 4QGHA 3KFXA 1KGDA 2FGJA 4G5QA 2NIPA 2ZE7A 2ZR7A 4EPXA 4KITB 4MQBA 3JZMA 4IXMA 3VU9A 3IO3A 2CJWA 3KKPA 4BZXA 1E0SA 4NCKA 4HB3A 2JATA 1B23P 2VHJA 5C46F 2QTVB 1JNYA 2DB3A 3M1IA 3N2EA 1OXUA 1P3JA 1F2TA 3R20A 4G0NA 4RD1A 1ZCBA 4JLPA 2ZSFA 2ANCA 3KQUA 1G8PA 4ZCMA 4EUNA 4M9SA 1GUAA 1OKKA 4A8JB 1A1VA 2A78A 3PFIA 4V0MA 3BE4A 4Y0AA 5A4JA 1KK2A 3GJ0A 2CK3D 1UJ2A 2ZRIA 3B1VA 4DUGA 1T91A 4AKEA 5LD2B 2NTYC 4LJYA 3A1UA 4PC6A 2QG6A 2AK2A 1J7KA 2ZI9A 1C4OA 1XZQA 5FBRB 3GMTA 4TYNA 1F6BA 3SC3A 3FMIA 4HB2A 3EW9A 2WJIA 3B8HA 4XIGS 2IYTA 5CM9C 2PBRA 5FL7D 2JEOA 4D4MA 4OHWA 4CEIA 5JFGA 4M8NE 4B3CA 5CJPA 2J7KA 4IDOA 1UADA 2ASEA 2MMCA 1TPZA 1LTQA 4A2QA 1JR3D 3SR0A 4CYMA 1O3YA 3KQLA 1IN8A 4PQFA 2QRNA 2WSSA 4BLTA 5JCPA 4JL8A 1DTSA 3LXXA 3CPHA 3TNFA 2HXSA 3QKRA 5KPDA 2P6UA 3KXIA 1NG9A 5EE1A 1T0HB 2O8CA 2J46A 1NIPA 4O2LA 4WAUA 1IHUA 2AN9A 1Y3AA 4MGKR 5EP3A 5FOXA 3K0AB 1P61B 2RHMA 4HDOB 1D2MA 1K6MA 2NO7A 3GEIA 3GJ6A 2WKQA 4IXNA 3P1JA 1N5LA 1KO7A 1QHYA 1RRPA 1UBGA 4PX9A 3EZ9A 5TARA 3H86A 4WXPA 3ASZA 4RFVA 3LFUA 4EFLA 1GFIA 2UVQA 5EUMA 5HTKA 1ZNZA 3W6NA 4Z1MA 2BHRA 1MV5A 2EW1A 1HT1E 5JLJA 3EAQA 1KDPA 3NBZC 1TF2A 4KU4A 2JLUA 5H8WA 1FNMA 2WSMA 4BFVA 2B8TA 2WIBA 2ERYA 2OLKA 3IIJA 4JLOA 4PC3A 1KKLA 3HP1A 3PQCA 4HYYA 3K0CC 2W6JD 1N6RA 1SXJE 3A8TA 2Z0MA 4BLSA 3BIFA 1HH4A 4ON9A 2QSZA 3BFXA 4FMDF 3QXJA 4QNMA 4KSBA 3B82A 3HU1A 2ZS8A 1W5TA 4FCWA 4NTZA 1ZM3A 3BFVA 1G6HA 4JMPA 4LJ4A 4HB4A 1WDTA 1CTQA 1YZLA 5L8VA 1FTSA 1XD9A 4IDHA 2BWJA 5DSZA 4RZUA 5JBQA 5KTYA 4E5UA 5BN5A 3GJ7A 3FKSA 3AV0B 3CRQA 2EVWX 1W0KA 4N3NA 4OQLA 2HF9A 2Q9BA 3A58B 3MUFA 4M9XA 3OAAA 1FMLA 4I81A 3CF6R 3IUYA 1ZAKA 4BASA 1J8YF 4AYTA 1N25A 1P7CA 1II8B 1G3UA 5G3YA 2D4HA 1CJTC 2VLIA 1AKEA 4PPGA 1SHZA 4M53A 2IEYA 3K0FB 1W44A 2DBYA 3ZS9A 1K5DA 2AFHE 4DLZA 1GG2A 2W83A 3EC2A 3L0OA 4OQMA 4URWR 4A2WA 1YVDA 3W90A 1L7VC 1UDWA 3LW7A 4WXRA 3GJXC 3EA5A 4C0BA 4Q5IA 2OZEA 3KJGA 4MRRA 4OK6A 1OT3A 3MD0A 2RCNA 3R8FA 5FOWA 4CW7A 4JSYA 4DSOA 1IN4A 4Z51A 5AR1A 2YWEA 1NNEA 4XVUA 2NO6A 3SFZA 3PUVA 5KSPA 3B85A 4IVQA 1MO3A 4HAZA 2F1RA 4JLMA 1UKEA 3ND8A 5DIFA 2QM8A 2O0HA 3AM1A 1EFRA 2XAUA 5HR5A 1G7RA 2A5DA 5KUTA 2E1RA 2D2FA 3K70C 3L43A 2QQ0A 1XNJA 3TH5A 4HUQA 2OCYC 3CRVA 2QP4A 4M1SA 1KO5A 2ODNA 4HUTA 4QG7A 3WXMA 2N1BA 1QHIA 4MRVA 3ZGXA 2J7PD 4RD4A 4QBGB 2OUKA 2IYLD 3ZDQA 4RCYA 1PLLA 3FWYA 1OIWA 3C15C 4FMCF 1D9XA 4XD7D 3I92A 4XJXA 1U8ZA 1X8KA 2X77A 3X1DA 3ZD7A 3Q5DA 3RS4A 5F98A 2BMDA 1Z29A 2N42A 5EQTA 3RYTC 1WQ1R 2VYFA 1ZP6A 3GD7A 4DLXA 3AB3A 3X1XA 2IXGA 4OK3A 3FMPB 3K09A 2WWYA 1QRAA 4QFMA 1MRNA 4M4SA 1DG3A 8OHMA 1DPFA 2X2EA 3CX8A 1E9FA 4LPKA 4KFSA 3T35A 2O8BA 4NCJA 1VPLA 2Q9CA 3A4NA 2XJ9A 1ZMXA 2ZUCA 3Q85A 5JHHB 1MT0A 1SHKA 4J0QA 1KNXA 1ZNXA 3C4JA 4UJ5A 4PFSA 2QAGC 4OI0A 3BB3A 5BN3A 4B75A 2ORIA 1AGPA 2IYXA 3QJYA 3I3SR 3SJBA 1TMKA 4JLNA 2O8FA 5GJCA 1P62B 3KX2A 4PHHA 4IDPA 3A1TA 3B2EA 4QBFA 4X8LA 4A92A 1VG1A 5IHPA 3VMFA 2FX3A 4URXR 3MAAC 1LNZA 1SVMA 4D2IA 2YINC 5FPTA 4WIAA 5F9HA 2QN6A 5E7MA 4NCIA 5AWFC 1RC8A 4EFNA 1KDOA 4QL3A 2PEZA 4L16A 4FI3C 5E7IA 4QGAA 2FGKA 4BQSA 3FYHA 4LWZA 3I5YA 5CIQA 1JAIA 5HCNA 5G40A 3GCGA 4CEHA 3WYGA 1ZU5A 4Z8XA 2X19A 1SXJC 4Q18A 3TQFA 3REFA 4EJSB 3WP1B 3E70C 2REXB 3RHFA 2ATVA 3ZLJA 3K53A 5JJIA 2IXEA 2FF7A 4Q1EA 1Y63A 2RGCA 4HAUA 2QENA 5C18A 5GJWC 1OW3B 3R7WB 3U4QA 4MYUA 1EWRA 5HKKA 3B7GA 2CLCX 1CXZA 4XVQA 1G8HA 2DHRA 3DKPA 3TJZA 5EZ5A 3W9YA 2F55A 5J4KA 1F2UB 2C95A 3TMKA 2NG1A 4TMKA 2B7CA 2H18A 4LYAA 1XMVA 4MUAA 4PZYA 4DB2A 2EFHB 2IUTA 2VP4A 1P2UA 2RGNA 5H70A 3RDPA 2GVDC 3DOEA 821PA 2BCJQ 3GFOA 2F1IA 4US0R 3T1OA 1LF0A 2Q3MA 3NVAA 1NY5A 3L0SA 4TL6A 4RFSB 1X1RA 1E2LA 3TVDA 2AR7A 2XTZA 1VIAA 4LPSA 1E1QD 1OXSC 4DLVA 1CR1A 1U9IA 2J0UA 4LV6A 2R65A 3JZAA 5L3SB 1ZVQA 2X2FA 4ACBA 3OFND 4LCBA 4C0QC 4PPNA 1XEXB 2WWHA 4Q7KA 4HB0A 5DGXA 4JLDA 2IXFA 2ZRCA 2CLSA 2CDNA 1XTQA 1M34E 1KJYA 1NP6A 1ZNWA 3U7FB 4DEYA 1MH1A 5JJLA 5GJVC 2ZI5A 4G5SA 3U7EB 1JQJC 3SU8A 4LHZA 2VO1A 1WCV1 4GOJA 1XPRA 4IRUB 2JLXA 1Q1ZA 4L8GA 2AXPA 3GQBA 3UMSA 4NMMA 5C2JB 1CBUA 2ZJ2A 3A6PC 4NYMR 4TN1A 2FSIA 3THYA 3QIAA 1OKKD 3CRW1 4OL0A 4KBFA 3U44A 2OLJA 1KI1A 1JALA 2Z83A 1GILA 4DUGD 1N3BA 4UXIA 4TYYA 2VL7A 3P4XA 2ZJBA 2AD5A 1II0A 1KO4A 5FUXA 4G1UC 1W7AA 2ZREA 3B1XA 4PXAA 2P67A 2GCOB 2DFKB 3PIRA 1Q1QA 2FSHA 3CO5A 1KI6B 1RFLA 3WRYC 2YVUA 5BW8A 3B13B 2PT7A 2V4ZA 3AVPA 3IPYA 5D3QA 2E9SA 4LBZA 4TZ0A 1W1WA 4MKIA 1E0JA 2EFDB 2ZJ5A 1A4RA 3GFPA 4LDJA 1E3MA 5FPKA 3U61B 1LVGA 1XEWY 2XITA 3TRFA 5BQ5A 2CE7A 4C0SA 5DNYB 2PZEA 1XB2A 1JPJA 4NONA 1ODFA 4G3XA 1ZU4A 2IWRA 4A8JC 4DCTA 5D3MB 1XPOA 4AYXA 2IK8A 1Q1BA 3BOSA 1HE8B 5LD2C 3O47A 3QUSA 3BWDD 2RGEA 3HJNA 5DYGA 4BFWA 3W6PA 3ZVLA 1U0LA 4CRWB 4DEXA 4EKDA 5LB4A 4LC0A 2Q3HA 4PO8A 1OH6A 1T5LA 2WOOA 3IIKA 4Z1MD 3VHXA 2FPMA 2IL1A 1DAHA 4KV9A 2GCNA 1A2KC 2JLWA 2ZSBA 3LH5A 4ZCIA 2VBCA 2GBLA 1E69A 3CZPA 2DCUA 4G5RA 1CJVC 2Z4SA 2VA8A 3P32A 1HA3A 1R6BX 4OJQA 3NKVA 1RYHA 2HT6A 3CIOA 2J45A 1N6NA 4Q7LA 1HEIA 4QBHA 1W4CA 4NZYA 3DOFA 3QVUA 3KUDA 2PX0A 3CZQA 1DAMA 3MWLA 3HU3A 4Q9IA 1G5PA 1S2MA 2BMJA 1NMZA 3GEHA 3LO5A 4NYJR 1ONBA 2PCLA 5J4VA 1F5NA 3FKSD 4Q4JB 1HURA 2IA5A 3TAUA 2J0SA 3MSXA 3W6OA 1E2KA 1Z0FA 2D2EA 3H1TA 4PO9A 2TMKA 3OAAD 1R0WA 4HAWA 4TL9A 4XSHA 1VG8A 3EZFA 4IEIA 4LBWA 4XOIA 3ZVRA 4F4CA 2ZUBA 2EYUA 1DBSA 4Z8YA 1MABA 3AKYA 3WHKA 3L0IB 4TLCA 4IOKA 1G1MA 4EIWA 3WNCA 1XBTA 2GAOA 4BZPA 2GF0A 3R9XA 2O8DB 2IYWA 4YQFA 4Q9KA 5JSZA 1JEEA 2XNSA 1XCMA 3K9HA 2OAQ1 5C4MA 1TNDA 4B2IA 1YZGA 1ZUNB 3AP2A 2IX3A 1P2VA 1DAKA 3SN6A 4B76A 3KB2A 2A5GA 4HZIA 1U2RA 1TUIA 5EUQB 1TUEA 4DDVA 2MMGA 4Q03A 2RAPA 1I4LD 5JI3E 5FTKA 4D80A 1Q12A 3THOA 3NTUA 5JRZA 1Q3TA 4KHZA 3U3OA 3GJ8A 2Q6TA 3FVQA 2ZU6A 1RE0A 1YRBA 5FUYA 1EFRD 3REGA 1XRJA 4RSGA 1KMHB 1G6OA 3SHWA 6Q21A 1W36D 4QNRA 3V4FA 4PPQA 4MGYR 1XEWX 4KXFB 4Q4AB 3BXZA 1E2FA 2WWFA 2ZRNA 2RGNC 3NDPA 4ZKEA 1BKDR 3ZH9B 2XNDA 1Z06A 1QF9A 2BM1A 2Z43A 4PC7A 1AS3A 1T3LA 2BV3A 3NXSA 5BWMA 2B21A 4Q1FA 2ZAOA 4P4SB 1D2NA 3OIYA 5FOTA 4BE7B 1GSIA 3THXB 1G8FA 1Z2AA 2Q0HA 5AUPB 2C96A 1Z8FA 1ZW6A 1L2TA 3MJHA 2VPPA 1KI6A 2H7VA 3K0CA 3SEAA 4KVAA 5UKDA 1G21E 3C8UA 2G0TA 2KB0A 2VIIA 1EFHA 2OSBA 1X8JA 3TR5A 4EDHA 2XXAA 4K8OA 1N5JA 3AF1A 3B78A 1VECA 3U3JA 4DDWA 2SHKA 2OXRA 5TB5A 1T3SA 1Q20A 1YJ5A 4GRAA 2QROA 4MGZR 5KO2A 5HPYB 3VR3A 3SOPA 1US8B 5KSYA 1GL6A 2VP2A 1KSJA 2CE2X 4B6FA 1EX7A 4MKFA 3UMFA 3NIBA 4L4UA 1FOEB 2JLYA 2H8KA 2ZJZA 1CR4A 2HYIC 2BVNA 3DKVA 3UATA 4JBXA 4K46A 4JKIA 3QXCA 4ARZB 3IQXA 1ZIOA 4WVFA 4TLAA 4PQYA 3QF7A 2C9CA 5J4HA 1IN7A 4U7DA 4EAQA 3FHCB 1E4VA 4LHYA 4YMUA 1YQTA 3D3QA 2ZROA 1N5IA 1U8YA 1ZNYA 1XD2B 1GKIA 4L9WA 2NO9A 4CEJA 2FPLA 5BXQC 4Q47A 4HAVA 5JJKA 1GWNA 1JBKA 2OAP1 5JS7A 1OLOA 2ZRDA 3TIFA 3QKSB 4WA7A 1VCIA 1JAHA 4CIDA 4RZXA 4M1YA 1T3HA 2FFBA 3LV8A 5B30A 4GMXA 4JL5A 3I5XA 1ZCAA 5SZHB 3THWA 3R9WA 1EWQA 3UKDA 4AD8A 3GLFA 2IC5A 2YNMA 4X8OA 4BPBA 4JLKA 3HPQA 1S3GA 1E2NA 2F9MA 4GZMA 4TTPA 5B2ZA 1TEXA 3LDAA 1E2PA 4V0KA 2QU8A 4ESHA 1UDXA 1Z6TA 1FUUA 2RHDA 3BB1A 4I1UA 5E95A 4JVNA 4A36A 4R7ZA 1GIAA 5HKKD 3OIUA 1KY3A 1M7HA 1SVLA 1UM8A 2ECKA 3CX6A 3SYKA 2RMKA 4F38A 4OI2A 5HE8A 4EPVA 1Z28A 3TBKA 5AUQA 2ZYUX 4YC7A 4BRWA 1QDEA 4GDFA 4G01B 2ZSEA 4LSGA 2PX3A 3RWOA 4Q9HA 4B48A 3AVTA 2QPTA 3VR2A 1T9HA 3OESA 2LWIA 1I4TD 2HCBA 1A2BA 2W00A 1CJMA 2CL0X 1R7RA 4DIEA 4KSCA 1FX0A 2I4IA 3DDCA 3OFNA 1NN3A 1VMAA 2I3BA 2V6IA 3BC1A 5FFMA 4EJSC 1E2GA 2KI5A 2R8RA 2HV8A 3U7HB 2ZTSA 3ZS8A 1DO2A 1DELA 3A36A 3TGPA 5EXPA 4G5GA 2BBTA 1C9KA 1UBEA 1Z83A 4TQUS 1Z6YA 1E2HA 2EFCB 3GLFE 2QT1A 2JLVA 2DWQA 3ZZUA 4CT5A 2WJHA 3NEJA 1QVAA 1XDBA 2ZYTX 2IYYA 2QAGA 2BBWA 3RANA 1ZYUA 3B60A 2L0XA 3KTAA 2ZRAA 1L8QA 2IEZA 4PPFA 1PLKA 4QXAA 1P72A 2XZPA 2ZQ5A 4GPTA 1QHNA 1YZKA 5JI2E 2PZFA 1P2TA 4LV5B 1GKYA 4ESVA 4DJTA 3W8NA 2FDCA 5CLQA 5B58C 5KSOA 1W2GA 3EXAA 4MH0R 3TUZC 2QT0A 2WJJA 4X8MA 1J70A 2QY9A 2WICA 5A5GA 2J3EA 5GVRA 4LJ5A 3VFDA 5FPHA 2DYKA 2GXSA 4A0HA 4M0LA 5J40A 1SXJA 2D7DA 3AKCA 1M6NA 4UKDA 3SI7A 1HQYE 3AUXA 4AK9A 4C2UA 1BO6A 4PR0A 4C0JA 1OJLA 2WOJA 2XJ4A 5H1YA 2WMNB 4US1R 1P9RA 2DR3A 1DADA 4LJ7A 4CF7A 1GP2A 2C8VA 4BZQA 2GKSA 1LFDB 1CLUA 2QP9X 1NVUQ 5JWOA 4GI7A 3Q8XB 1GTVA 1Z22A 2BCGY 5CITA 2CL6X 4JS0A 4P33A 3BFKA 3IDQA 2C99A 3KKNA 3VR5A 4PO1A 2KJQA 1RPZA 1M7GA 4PSVA 4GMDA 4DCVA 3KKMA 2ZETA 1FTNA 2I1QA 3NH9A 1ZD8A 1PJRA 3KJIA 3MCAA 3J81k 3I8XA 1JJVA 4JVSB 4Q1CA 3CX7A 4MGIR 2IF0A 4WZAE 1XZPA 2C03A 1RJ9B 1G9XA 2WMOB 3VQTA 2HUPA 4DBLC 2QBYB 4OHXA 3H4MA 4JLJA 2R6GA 3W34A 5AJZA 3M4YA 1YZTA 3AF0A 3P20A 4TMXA 2ZS9A 4KFRA 3UG6A 1DARA 1CJUC 4MUBA 1XU4A 1G3QA 2C77A 2V7QA 2XTNA 4PAMA 4YMVA 3MWKA 2X8AA 4OKSA 4TLDA 3TW4A 4D6PA 4BFTA 3SS8A 4II7A 1YRAA 1KI3A 4W5HA 5CK5A 2I1VB 1G41A 5C4GB 1KJWA 1KK3A 3WRXC 1DEKA 2NPIA 2ZIAA 2CVFA 3AUYA 2LKDA 1UKZA 5AK0A 2D74A 1TU3A 3TKLA 3PEYA 3M0EA 4C0HA 3GLGB 1OSNA 1JECA 2HCJB 3LNCA 2BEJA 4M9QA 1HT2E 3SJZA 4RD0A 2EQBA 1TU4A 1IQPA 1CP2A 2D7CA 1KIMA 2IYZA 4BEJA 3SBDA 4FWIB 4HZUB 1KZGB 1VTKA 1Z6AA 1EFTA 3GPLA 3RRMA 3SFVA 2LCFA 3LLMA 1CR2A 2WV9A 2FSFA 2OCAA 4BGDA 1IOZA 2FFQA 4PAQA 5DHAA 2E87A 3C16C 3AF4A 3CH4B 3WNBA 2ZJAA 4HATA 4A1FA 4AYWA 2PL3A 1NI3A 3AVQA 4DSNA 1XXHB 4TL7A 1VYUA 4RZ2A 5AUOB 2C5LA 2GXQA 2DFNA 5F3WB 4H9GA 5FOSA 4JBYA 1XJCA 2CL7X 3B9PA 1NN5A 3QEOA 4I1OA 4HLUC 2A9KA 1E0AA 2A5JA 2JJ2A 1GL7A 3F3YA 2QAJA 3FPAA 1G3RA 3A4LA 1OXTA 3TW8B 1G291 5IF9A 5E3HA 4A8JA 2UKDA 3AVOA 1LB1B 2GK7A 4DT1B 3VHLB 3NEYA 5JHGB 1CRPA 2H17A 4LBYA 3V4RA 5CIWA 2ZJ8A 4AURA 3RWMB 1U0HC 3CW2A 2XOKA 1QHXA 3LXRA 4XVRA 4KODA 2ZRPA 5FI1B 4QC2A 3WP0A 5P21A 4R2IA 2GEVA 3V00A 2WTUA 2WM9B 2FPKA 2RGAA 3CWQA 2ONKA 2XNDD 2VSXA 2ZS7A 3QKTA 1QVRA 1BYUA 3G5UA 1KY2A 1KDTA 3RS7A 1DOAA 3CNNA 1KSGA 3CPJB 2BMFA 4S35A 1AZTA 2GRJA 1SQ5A 2FOLA 2ZRJA 4LHVA 1VYVA 3L0PA 4XWOA 2XGJA 1QBKC 3RRYA 1NBME 2DFTA 1E9AA 4A82A 2DY1A 3FKQA 1AK2A 1ZM9A 3IKJA 2KSQA 3BAFA 2GXUA 2O0JA 3WYFA 4ZPXA 3T34A 1OXXK 4DDUA 4JYBA 1BOFA 1V5WA 4DWJA 2OBLA 4B33A 4FIDA 2JLQA 2GXAA 2O8EB 4A2PA 3K0AA 1AS2A 1OYWA 1P6XA 1TADA 4KYUA 2QMUA 4TLBA 4EPYA 2IS4A 4BFUA 1S1MA 2ZE8A 4TYQA 4QKQA 2IW3A 3PEUA 2H5EA 3R8CA 1U98A 2FZLA 2V1XA 4AKHA 2KE5A 3OIWA 4NU0A 1SVOA 3U6BA 3FB4A 3OE7A 4A0RA 4I4LA 1VG0B 1ZD1A 1OF1A 1E1RA 1X1SA 2ZEJA 2ZRGA 1W47A 2G77B 5LBIA 4Q9LA 3H0KA 4EPRA 1IM2A 1NL3A 2F43B 5FR1A 4IOLA 2A5YB 4M1TA 5AJWA 2D06A 3ADDA 1W0JA 4WBSA 1VCNA 5KHOC 2P6RA 2GK6A 2F1JA 3SDZA 1JQLB 4XTCS 3PITA 4UJ3A 3QXXA 1RKBA 3T1VA 1X6VA 1ZJ6A 5GVSA 2VF7A 2HYDA 4TMZA 3ADBA 2OILA 4OHVA 1SKYB 3RRNA 1G20E 4NKRA 2R2AA 3HR8A 1EFUA 2OM2A 1E9EA 1XWIA 2PZGA 5LB2A 1JJ7A 3K70D 2XZLA 4V0NA 1LW7A 3CRMA 1II8A 3EASA 2ZE5A 1G7TA 2X1VA 1PZNA 3TAHA 1XF9A 2FH5B 2Q3FA 5GJBA 1DAGA 1R0YA 1XJ0A 3WYAA 4LHWA 4YMWA 2CHGA 3K0FA 2EFEB 5FTLA 4B74A 1CULC 1IY2A 3K0SA 3X1WA 1MO4A 4KLZA 2FFAA 4AG6A 1KDRA 4B3GA 3IHWA 2AD1A 1HTWA 4LRWA 2A7QA 4CGZA 2FN4A 4B3XA 1J2JA 1EX6A 4A6PA 3QEJA 4Q1AA 3PEVA 2YKGA 5IK2A 1BH2A 4HAYA 3TE6A 1ZM7A 3F8TA 4ZI3A 3SJCA 1T5IA 1UPTA 4HSEA 4MDFA 4UNSA 3B5JA 2F6RA 4OI4A 2QGZA 2RGGA 4E09A 2OHFA 4ZI2A 2ZRFA 1HV8A 1RZ3A 3PUYA 1E32A 4B71A 4DT1A 2P65A 4JLBA 2ZE6A 4YMSA 3BH0A 1R5BA 3BJIC 1M2OB 2W2TA 3PUXA 4OHYA 1IY0A 3PEWA 2ZI7A 1YR7A 621PA 5HZKA 2BJVA 4N1AA 3EG5A 1Z0AA 1U8AA 3A1WA 3BD9A 4HI0E 1XCGB 2BOVA 1CU1A 1S1CA 2OG2A 3KXLA 1QG4A 4LJ8A 4C3ZA 3QXSA 2NGRA 4QBIA 3CF2A 3GLHB 3RVBA 1YR8A 1W4AA 1X86B 1ZUIA 3PJRA 1NVVR 3JVVA 3HYTA 4URZR 3CKLA 2GDJA 2ZR0A 1P5ZB 2GEDA 3B1WA 4BWYA 2HXYA 1JI0A 2HJVA 3B1ZA 1XXHE 3G0HA 1S0UA 5FTMA 5HE9A 5CM8B 3X1ZA 3CM0A 3AF2A 3GJ5A 2UZIR 2B8WA 2QE7A 2JJ1A 4AI6A 5KSZA 1N6KA 1XMIA 1RW4A 4V0LA 3QF4B 1G64A 3TVTA 5KNCA 5FOUA 2ZITA 4GOKA 4NHOA 4QJ5A 3EA0A 4ZDWA 4D0GA 1SXJD 3VKWA 2WPDA 1J8MF 4HLDA 3UANA 1R10A 1NIJA 1OFIA 2JIZD 5KPJA 2W6IA 3VNUA 2C04A 2OESA 4XWAA 3A1SA 3D7MA 2C2HA 1WXQA 4PHTA 3VR6A 3F0TA 3LQQA 3T12A 4TL8A 1RRCA 2V6JA 3RRZA 3I1FA 4ZKDA 3K0EA 3BORA 4B47A 1NSTA 4IVPA 4KCGA 3LW8A 2YHSA 2PJZA 4NYMQ 4KFTA 3QSYA 4D4LA 3L2OB 2VP6A 4LV8B 2CCJA 1E79A 4PC2A 1YZQA 2IYSA 2WAYA 4CZ2A 1TQ2A 1QHHB 2GJKA 4B2PA 4NYIR 2QZ4A 2OV2A 3CR7A 5EXTA 1R5OA 1T0JB 2O0KA 1OIVA 2GJAA 3K9GA 4U00A 1WP9A 3W5IA 3PENA 1TQ6A 4R9UC 4D4JA 1CRQA 2BEKA 3SJAA 1W4BA 4EJSA 3DHWC 5EXSA 4WOPA 1T6NA 2IS2A 2JLRA 1XJQA 2F3TA 4S2EA 1ZUHA 4OYHA 1G8YA 1J90A 5AJYA 3R7WA 1KK1A 2BBSA 4WW0A 5DE3A 1XCPA 4F4IA 1G19A 2V7QD 5E7JA 2PEYA 3PG5A 2MSDB 1F2UA 1LF5A 2A3RA 3AH8A 2ODWA 1N0UA 2QI9C 4R2HA 1N2CE 3W5JA 1U94A 1ZBDA 5FBVB 5LPNA 2IYUA 3I4LA 1R0ZA 2ZJOA 4HDCA 1LS1A 1Z0DA 4URUR 2JCSA 1JPNA 3HYRA 1T8TA 5DISB 1SVWA 1Z6XA 4JZKA 1S8FA 3C5HA 5DI3B 3AF3A 5K8UA 3KJHA 2AKYA 2HJGA 3UWOA 4RFSA 4DSUA 4BUJA 1WE2A 1BS1A 2GNOA 1GKUB 2G9NA 1W46A 5FR2A 2REOA 2YZ2A 4RVCA 1NJFA 4IDQA 3ONWA 5L3SA 1II9A 1Q22A 3U5ZB 5L3VA 2BC9A 4C9BA 1SKYE 1U99A 1G7SA 1NF3A 3DEFA 5F2EA 221PA 3WBJA 4QRHA 2J5XA 1XEXA 3ECCA 4PSKA 5AJVB 4MDEA 1IY1A 1NLFA 1NLYA 3BBPA 3BS4A 4P32A 4C7OB 4GBMA 2NMVA 2A2ZA 1KOFA 3QBTA 5HZHA 1NBMD 1WA5A 2GCPA 1SVIA 3X2SA 3EZ6A 1FQJA 2V3CC 2RKOA 1BMFD 4DVGA 3UPUA 4JJKA 3GLIB 1HUQA 2JJ2D 4NYJQ 3E2IA 2CVHA 2FEMA 1R5NA 4K81B 3VR1A 1A7JA 2KBFA 3S1AB 1E2JA 3UG7A 1XP8A 2XOKD 1NKSA 2XTMA 1QG2A 4Q02A 3DL0A 3TSWA 4TMTA 1GL9B 4D0LB 3RS0A 3C5CA 5L3QB 3WY9A 1KO8A 1W49A 4TQAA 2G1JA 2GCOA 2ODEA 1CKEA 1FQKA 2JA1A 4FW9A 4IHQA 2CJWB 4IJMA 3VU9B 2IYQA 1H8HA 2YWHA 1AS0A 2BIFA 3Q7QA 1FW6A 3EPJA 4R98A 5FI0B 1UKVY 1Z07A 1FZQA 1GNPA 1S9HA 4I99A 2XB2A 3IEVA 1KNQA 2BKEA 2Z5FA 2B7BA 2OCPA 3W3AA 4IFBA 2FA9A 4P4UA 2FU5C 4DXAA 5J47A 3AKEA 4DLRA 2QORA 2YOHA 1NMXA 2ONJA 4NE2A 4ZDJA 5CDFE 2ZXUA 2GETA 5D3MA 5KNDA 3SNHA 3ZQ6A 2PCJA 2QMHA 1N6PA 3DM5A 1ZD9A 4IOJA 4V03A 2W0SA 2W2XA 2P5TB 3GLHE 4EPWA 2HT1A 4QM6A 3QENA 4HLQB 4DCUA 1M1YE 1XMSA 2QM7A 2FMXA 3TLXA 3ASYA 3SBEA 5TY0A 3ETLA 4PTLA 3IILA 4LOAA 1AZSC 4CEIB 1Q3HA 2RB4A 1YR6A 1KSFX 3ZJYA 3OE7D 3TUIC 3CBQA 1KAGA 1P4SA 5K8TA 1E1RD 1E94E 2QGNA 4A0GA 2N46A 2OCBA 2OEPA 1LS6A 1TAGA 2GVZC 3AP1A 4F92B 1I4DD 3KQHA 4IKEA 4JVLA 1DG1G 2CCGA 3QKRB 1NY6A 2Q9AA 2ZRKA 3U60B 1VYTA 5JEDA 2O8CB 1ZM4A 5JWHA 3H2YA 1W0JD 3HU2A 2JDIA 3RNLA 3NDBB 1OYYA 1J99A 4F91B 3EZ7A 3C14C 4HLUA 3PV0A 1QZXA 1E2MA 2J59A 5JCZA 4D82A 2QTHA 5EE0A 1D5CA 2CHVA 1XD8A 3MWJA 1IJFA 1HE1C 4DLUA 1SVKA 1ZM2A 3BK7A 4PAOA 4Q4JA 1VDZA 2K5UA 3JVUA 2H92A 2RGBA 4P4TA 4IEEA 3U3MA 3U3RA 1IBRA 2QUZA 2IHBA 1GITA 2V54A 3AQ4A 5SZJA 3RC8A 2PH1A 1SZPA 1WBBA 1N6OA 3ICQB 3OHMA 5B64A 4RKFA 3KL4A 2ZAMA 4AKGA 4HEJA 2ZU0C 2VTKA 5CB8A 3MJRA 4RD6A 4XTRA 2O8DA 3HR7A 3NC1C 2FSGA 4MRPA 1E96A 2H1LA 3GEEA 1UAAA 2JLSA 2CBZA 1ETUA 1OHHA 4QGFA 3VNVA 3WMEA 5BN4A 3LLUA 4C2TA 3M6AA 1AJEA 3QY0A 2NZJA 1D6JA 5IK2D 1OH8A 3AGQA 3TK1A 1H8EA 1N0VC 4IW3B 421PA 1JXOA 2YC2C 1N6IA 1MO6A 1AA9A 1XTRA 2W58A 4GOXA 1Z63A 4P3YA 2G6BA 4I1VA 4NH0A 4ZDIA 1UEJA 1RYFA 2VSOA 1JXMA 3GLIA 1NG1A 1UF9A 3I32A 5IDVA 1MR3F 1YZNA 4L9SA 4OQNA 5KOYA 1IN6A 5DYIA 1EG7A 4M22A 1KMHA 1OPXA 3D31A 2AX4A 3O8DA 4RJLA 2J1LA 3RLFA 2CNWA 3QQ5A 2F9LA 2ZSDA 4ZCLA 4Q66C 1LV7A 2P5SA 3RS5A 4OK5A 3ND9A 4Q4AA 5CK4A 4TZ6A 3CR8A 1Z5ZA 1RRGA 2EWVA 1IXZA 1YU9A 1AGRA 1E2DA 1VG9B 4P4SA 5EJEA 4DDTA 2C78A 3THXA 4DLYA 1UFQA 5DH9A 1FFHA 2BBOA 3HDTA 5IRCD 3VX4A 5GADl 1FP6A 1YKSA 2R44A 2VEDA 1G4UR 5KDDA 3NHBA 4JT2A 4M21A 1P75A 1WRBA 2OE2A 2ZVQX 3BERA 1U90A 3VKGA 2ZVPX 1DO0A 3Q9LA 4DCNA 2ZYWX 1K5GA 2MSEB 1G5RA 3A37A 2WBLC 3EC1A 4MITA 3LA6A 4JLVA 3ZQJA 4BEBA 2YOFA 3CB4A 3LY5A 4KAXA 3VTKA 1US8A 4C0LA 1KK0A 3D8BA 3QI2A 4US2R 4U02A 1W36B 2QE7D 2VHUA 3MLEA 4HUQB 2JJ1D 2JIZA 2HEIA 5FBLB 3GLIE 4FWTA 4A15A 1PUIA 4C0AC 1W5SA 1WF3A 2AWNA 2ODBA 4YONB 5FL3A 2WPDD 3TR0A 4FCVA 3FDIA 3I73A 1AIPA 4ARZA 3TUJC 2J0VA 4TSFD 2W6ID 1G16A 2BKUA 3DZ8A 4Q4LA 1WBDA 5FH9A 4W5JA 1BIFA 2G83A 1F60A 4RZ3A 5CB6A 1KYIA 4DZZA 1XTSA 2YYZA 2ZRBA 1Q0UA 1IAQA 1U81A 3UK6A 1XD2A 4LGMA 4UNQA 1O87A 3LVQE 5LDDC 1RIFA 2CXXA 4W9MC 1Z6GA 2ZPTX 5FBQB 5EP2A 3U3KA 2IS6A 1E79D 4RD2A 4N0DA 3QKSA 1GNRA 1N5KA 3KJEA 3QPVA 2OXCA 4DCSA 2C9OA 2GF9A 2WJGA 4JBWA 3FMFA 4I1SA 5TMPA 2OFXA 2O8BB 1D9ZA 1RVDA 1CF4A 5DO9A 4C0KA 4TMVA 1P60A 4V0ME 4B35A 2EFGA 3NHAA 4QJ4A 1GRRA 2HDNB 3L82B 3CF0A 3U7GA 4ZIRB 1KI2A 1GM5A 1E2QA 2VQSA 4LY6A 4E22A 3NC0C 1P2SA 4DLTA 3T15A 2F3RA 1TF5A 4DLWA 2V9PA 2O8FB 3KKOA 1NVWQ 4M1OA 2IYRA 5KDLA 2QEQA 3OF5A 3EX7C 4GL2A 1OXVA 4Z54A 4A9AA 1KI8A 5G41A 3GFTA 2WKPA 1YZUA 1ZC4A 4MRNA 5FTNA 1E2EA 1OFHA 1DVRA 5H68A 3QVVA 1OH7A 3EIQA 3NBXX 4EQ6B 1H65A 2QQEA 2AKAB 4BFSA 3TQCA 4ILEA 4KFUA 2R6AA 1ELOA 4NCNA 4CEHB 3KQKA 2W2VA 3QBVA 4ABYA 1W48A 1TEVA 2ZM5A 2ORWA 1VCOA 4LX0A 3NH6A 1YR9A 2QMOA 4LZZA 4FN5A 4NCHA 3WMGA 4EQ6A 5DLQC 3NBFA 2WWWA 3QNUA 3U4QB 4NP6A 2ZUDA 1E2IA 1NBMA 3L8ZA 4F4JA 1OB2A 1IONA 1X3SA 2CEAA 3P4YA 1S3SA 4RD3A 3AKDA 2ZR9A 1XTJA 2ZSAA 3OEED 3IBGA 1PUJA 1BMFA 2ZRHA 4GP6A 3U6KA 4PQRA 4JIMA 1IJEA 3WBKA 4DHEA 4Q9JA 5KYKA 5G3ZA 2WWIA 3MMPA 2OT3B 1XFAA 3N5CA 3KZ1E 3KKQA 4DB4A 3OEHD 4PHGA 4JLAA 4YLGA 5J4LA 2YWGA 1UKYA 3P27A 3ADCA 2GHIA 3O8BA 1NN1A 2H57A 1XTIA 1A82A 4PHFA 2B6HA 3T5DA 3UMRA 1R8QA 2J0UB 2DWPA 2R6FA 2WKRA 4ASUA 3IHLA 2CLDX 1AQYA 3W8RA 1BYIA 1E9RA 4M1WA 2QMEA 3CNOA 1OIXA 4NDZA 4FCTA 1KMQA 3WHLA 4IOMA 4UNNA 2QL6A 4W5WA 3MWYW 1HQCA 2FE4A 2FG5A 3C41J 1AQUA 1DS6A 2Q21A 1H8HD 3U2QA 1TQ4A 4TWZA 1U0JA 4XH9B 3AGPA 3GJ4A 1AM4D 4L5BA 4KBGA 3G82C 2IHYA 3LBNA 4GNKA 1E9SA 1IXSB 5ELXA 1E4YA 1KJZA 4BFZA 3THYB 3QG5A 4FMBB 4MKGA 2C98A 4KO8A 4D25A 3P26A 5EE9A 1VKJA 3FFBA 2ZJYA 3U44B 4AIIA 2OBNA 5EE3A 1GRQA 3LVRE 4UNPA 4BLPA 4BLRA 1EXMA 2Z4RA 521PA 4JYCA 4EPTA 3B6EA 3HPRA 5DN6A 4ITRC 3RS2A 3RSLA 3N70A 2HLDA 2XEXA 2V1UA 4LBVA 1FNNA 1N6HA 1XPUA 3BRWD 1JB1A 3KB1A 1RJ9A 4TT3A 121PA 3SE0A 2ERXA 3B1YA 2KBEA 1NN0A 3EWAA 2YV5A 3W3ZB 4B2LA 4EFMA 2QBYA 1VIYA 4QHTA 5FUWA 1MO5A 2QP3A 4B6EA 1XMJA 3PXGA 4C30A 4BECA 1CJKC 3FOZA 1OFTA 2EU8A 1XEFA 4AWXA 4LI0A 4ZIRA 3UXMA 1OH5A 3F5FA 4O3MA 4O2RA 2NPFA 1DAIA 5JECA 5ANRB 1CS4C 2PLFA 1Z0IA 4ZDKA 1NRJB 2GA8A 1SVSA 2ZYVX 3LRPA 1C1YA 1KAOA 1E9CA 1V43A 2JDID 2WVJA 4LJ9A 4IFEA 3AVWA 1QHSA 3ICEA 1M7BA 1N0WA 3EPLA 3AP3A 5TDHA 2AFIE 5CLLA 2EYQA 4QM7A 5EZ6B 4U5XA 3GLGA 4PC1A 1UBCA 2IS1A 1KZ7B 2NOAA 3ZIAA 1G3IA 5J5CA 4TTQA 1MKYA 2GILA 4L15A 1I2DA 1Z0JA 2GJ8A 4HZUA 4XSGA 1TTTA 3EZ2A 3RABA 3DMNA 1D8TA 3PR1A 3V9PA 3FGNA 3SHFA 4POAA 4FXPA 2WJVA 5HCIA 4GT1A 2CCKA 3I61A 1NJGA 1XXHA 1L4UA 3EIHA 5JMTA 1OHHD 2XSZA 4OHZA 5K8IA 1P9NA 4YXWA 2R6DA 4AC9A 1COWA 2XB4A 2UZ3A 1VHLA 4PSAA 3KUCA 1H8ED 1P73A 2GZAA 4MKHA 4Q00A 2WZQA 4TLEA 2WIAA 5K8LA 3SZRA 1ESMA 1YHNA 4UXJA 4PZZA 5KDOA 4D0NA 5FUVA 2O5VA 3HWSA 4V0OA 4TYWA 1Q44A 3DZDA 2VHCA 3GLGE 4RKEA 1FPMA 1MABB 3DO6A 2QPOA 3SQXA 1TF7A 4AG5A 4LJAA 4UNRA 2CNWD 1OB5A 1NKTA 4M1MA 3IGFA 1G3MA 4IVRA 3T1QA 3FHTA 3LQRA 3R9IA 2ZANA 5JSZB 3LBHA 3QPWA 1S4QA 4Q7MB 4R71A 3RSOA 2WWXA 4DSTA 1FL9A 1TQDA 1Z2CA 4JVMA 2ZI4A 2P0EA 3DVLA 2FEOA 3AVVA 1KO1A 1TL7C 3LD9A 4BRUA 1EFCA 3T61A 5C1BA 4B34A 4JL6A 1VHTA 2XZOA 4KJZA 1MOZA 4B3DA 1WB9A 3O8RA 4DLSA 2CK3A 4H1VA 5FPSA 1G18A 1ZINA 3EIEA 2O8EA 3T06B 1KSHA 4GSYA 1CEEA 4XWKA 4KYIB 3I62A 2IYVA 3T5GA 1Q21A 2FJUA 5EP1A 4TSFA 2AL7A 2BM0A 1T4GA 3CPEA 4D4KA 3C7KA 2VHTA 1L4YA 2AHOA 5FL7A 2P3SA 3I72A 3H84A 1ZC3A 2G0NA 3PUWA 1Z0KA 4CT4B 3IQWA 5F9FA 1TX4B 1XTKA 2YOGA 3CH5A 3RC3A 4B43A 1JR3A 2YC4C 4C4PA 4JKYA 2C9YA 4FMDB 4Q1DA 4BFXA 2F43A 2GZDA 2QTFA 2ZRLA 3EARA 1NVVQ 2WHXA 3IEUA 1E99A 2EWWA 2VP9A 3SYNA 4YMTA 3WMFA 2XXAB 1Q1EA 4OQXA 3BH6A 2WSSD 4QGGA 5AUNB 2PLRA 3N2IA 2D3WA 2QA5A 5DI9A 2PJRA 1QHGA 2R6CA 1E9DA 2VHQA 3PUZA 2WAXA 4B3BA 1WMSA 1Z3IX 4TYPA 4LHXA 4AKIA 1UEIA 5SZKB 1W36C 2JAQA 1M74A 3VX3A 4JJZA 1X8LA 1DAEA 2J41A 1KI9A 1MRSA 5EP4A 2IF2A 4LYJA 2REBA 2AK3A 2VP5A 4URVR 1KHTA 4HLCA 4DRZA 2QNRA 5JS8A 3Q72A 4KLNA 3K9LA 721PA 4OJKA 4LUCA 4ZO4A 3E5HA 1G8GA 2AXNA 2BDTA 2W6JA 4M9ZA 4QJ3A 2LKCA 3GP8A 4MA4A 2J9RA 3UIEA 4CEJB 1JR3E 2GEUA 2ORVA 2P6NA 4A4DA 2KWIA 5BYKA 1SULA 3K09C 3QOFA 4QHSA 2PMKA 2FNAA 3GJ3A 3K9NA 4OBEA 1F3OA 1Z08A 3CWZA 3IBYA 2JGNA 3LAWA 4P31A 3FE2A 4M1KA 5EXXA 3MRSA 4NYIQ 3KDSE 4DC9A 3SQWA 2ZRMA 3VR4A 3EWSA 3THWB 1KTVA 2R9VA 4O0MA 3NWJA 1JR6A 5KNBA 3Q3JB 5EE5B 3GLFB 3TSZA 4JSTA 1DAFA 4KVGA 4N0EA 5IT5A 3KQNA 2FWRA 1DE0A 2FV8A 2GZHA 2B92A 2OFWA 3K70B 2DFLA 1VCMA 1G17A 1W0KD 1NLZA 2XX3A 1W2HA 3A1VA 2IWHA 3OEEA 4X8HA 3DPUA 3FMOB 2GTPA 3BH7A 4FMCB 4B73A 3ADKA 3QG1A 4Q48A 1AN0A 4Y0VA 4H1UA 4M2LA 3RS3A 4BLOA 1OFUX 2F7SA 1KKMA 3B9QA 4OQFA 5CDFA 3NG1A 1HY3A 3IPXA 5L3RA 1S96A 2VSFA 3OEHA 5BYJA 3CNLA 3SYLA 3T1TA 1NVXQ 2VRWA 4OI1A 1CR0A 4D26A 3GLHA 5CYPA 2OO7A 2D62A 4LC1A 3LX5A 2GESA 1EK0A 3DMDA 4MYHA 1JEDA 1PV4A 3QE0A 4E07A 1G5TA 3CRRA 1KI7A 1E0KA 4ACAA 4B3FX 2IUSA 1CIPA 1FX0B 5FPYA 4GP7A 4DIDA 4PZLA 2H16A 2RH5A 5J4YA 4UXHA 4Q19A 4MYTA 4Q4HB 4E03A 1ZRHA 2ZI3A 3D6TB 3RAPR 4ASUD 1PVOA 5TVKA 2QSYA 2ZI6A 3K1JA 4MYCA 1KI4A 4QOSA 4P0TA 3QF4A 1OE0A 1XX6A 3Q7PA 1E6CA 2J7PA 4NBSA 3ZYCA 2VH5R 4WZBE 3ZZ0A 1YE8A 2QAGB 1F2TB 1GNQA 2O52A 4XD7A 3KTAB 2F1HA 2QPAA 4ZV4A 2BMEA 2ANBA 4RY2A 2QRZA 3KFVA 3MG9A 2R62A 4GZLA 2IT1A 1G7CA 5FBWB 3TSOA 2JLZA 1HYQA 1GRNA 3QXHA 5M04A 5E4FA 3E1SA 1GOTA 1OV4A 4IDNA 3OIVA 2YWFA 4BLQA 2V8OA 3NBYC 4AY2A 2GJSA 4WZ6A 1R2QA 2P2LA 1Q57A 2Y8EA 5CYOA 4ERNA 4F7WA 1FUKA 3CUEF 4BFYA 1ZIPA 4CVNA 1NSFA 1R8SA 4DKXA 2FZ4A 1QHHA 1U9IC 3I8SA 5DN6D 3ZVNA 1R0XA 4HAXA 1R4AA 2HLDD 4GFDA 4TMWA 2J0QA 1EESA 4LYHA 4G5OA 4TT3D 2OFOA 2IBMA 1SXJB 4FINA 2HF8A 2NQ2C 1IXRC 2NZ8A 3PCRB 4UQOA 3BGWA 1EGAA 2WJYA 4V02A 1N6LA 5B57C 4Q7JB 1Z47A 5JRJA 1AKYA 2WWGA 2VP0A 2ATXA 4CDGA 2PT5A 3BB4A 3MFYA 2NO0A
chains in the Genus database with same CATH superfamily
4CM4B 4RCZA 3QVLA 4UVDA 3BXEA 1UOEA 2G88A 5K0CA 1E92A 2ZYDA 4TRJA 4A0FA 3ZQ4A 1UMBA 2JHGA 4BQIA 2W2MA 2PMDA 3K8OE 3WNDA 2IFTA 3Q5EA 4Q01A 2RBEA 5CYGA 1YKGA 1JSLA 4G9BA 3LPNA 1Q0QA 4RKYA 2QE6A 3I2JA 1DJPA 2A30A 2UYGA 3DOUA 3I2IA 2JASA 4P7BA 4Y2SA 3T5CA 3UWKA 4D81A 3X1YA 5FTJA 4HNGA 1NMYA 3CONA 4FWBA 3FFAA 2C3OA 3H11A 4IHJB 1YQGA 5HIJA 5ULLA 2FFHA 2EDAA 1PIWA 2FSUA 4G4JA 2PBFA 1VLMA 5CEFA 2Z6VA 4URYR 3WNZA 3EPKA 5JZVA 2HDHA 5AM4A 3AOEC 1RM5A 2GSDA 2GDZA 2W4IA 1M67A 4IIBA 4PLFA 4RTOA 1K8RA 4QLOA 2NT3A 5ALQA 5HUHA 4TQ9A 3AB8A 5BR1A 4LK2A 3OF3A 4TTRA 3WXBA 4TKVA 3C8DA 3L1IA 4UTRA 2A5FA 4OF4A 2I4NA 4BXOA 3AHCA 4KI0A 1I2MA 3CW8X 4FOPA 1Y4ZA 5CXUA 1JUDA 3BULA 3LBIA 3FR7A 2QWXA 3QE2A 3TB6A 2QZZA 2FDXA 2V55B 2BDUA 1F48A 4YP5A 5CNKA 2HWYA 4O8ZA 2P5YA 1Z68A 3DTVA 1J23A 3FD8A 3JQ9C 1T8UA 4FNMA 4G23A 1T24A 3FBGA 1UIRA 1NFRA 4F86A 2HSDA 1T5DX 4EF6A 1B76A 1COWD 5SZIA 4J0KA 4W1QA 1JEJA 1GAJA 3UA4A 3E9NA 3AVXA 4DQVA 4O4JA 4QYWA 1SKQA 3ED5A 4GPZA 1ORVA 3V8NA 3O8CA 3VSCA 1XZ8A 4RGYA 1B7GO 1E89A 1MLDA 3F90A 3V1NA 1QLJA 2NV2B 3RSCA 2JCBA 3PVSA 3S1AA 3TTWA 4GSKA 4A6XA 4ZI7F 2NO1A 5JALA 2JFHA 4DYHA 1CD5A 1JVSA 3O95A 4CQLA 1MENA 4YQEA 5K0JA 3ZXIA 1UAGA 1J0DA 1SBIA 1T8RA 2JCVA 1XCJA 2VF8A 4PANA 4ZOBA 4C2BA 2CNKA 5L3QA 4QGHA 3UBTA 1H9CA 4IM7A 3C4VA 1H1TA 3SP1A 2ECQA 2P62A 3VR0A 2JVJA 3RYCB 1NASA 2C9BA 4LVOA 5LP6A 3IPCA 3JZMA 2HRQA 1WNFA 2QOEA 4EX6A 4NCKA 2G1UA 2VHJA 5ADHA 2QLMA 4RC9A 2ZQZA 4BV8A 2GQ0A 3FNQA 1OXUA 4RD1A 1J2EA 3RASA 1NOKA 1ZCBA 4P35A 5LA6F 4F12A 3CNHA 2EERA 1QK5A 5I9IA 5CCXA 2ANCA 3MINA 1DEAA 2P9GA 3OTHA 1OKKA 1TTQB 4IS2A 4EUNA 2FEAA 2X23A 4EHFA 1TM2A 2DERA 3FYDA 4R1SA 5ALPA 2CK3D 3BM5A 3B1VA 4UTOA 4ZC1A 1RNLA 2G09A 2NTYC 4BO1A 2QG6A 4EKIA 1XZQA 3EXG2 5FBRB 3GMTA 1NVMB 2ISQA 3FF1A 3PRHA 1CETA 5LQJA 1Q0LA 1DB3A 4UPEA 5CBKA 3RC1A 3B8HA 5DCYA 3H5VA 4KO1S 2RHLA 3DYBA 4BNNA 3DAOA 5HRAA 1H0RA 5CM9C 3BCHA 3RAEC 3SIPA 2RH9B 4CDNA 4OHWA 5BQPA 1GFSA 4Z7NB 4XGIA 2GPWA 4B3CA 4RV5A 5CJPA 3AY6A 3COVA 4EHBA 5C5CA 2HUNA 2Q4DA 4EY3A 1TQHA 3OC0A 3WIVA 3CTMA 1NF8A 3NTXA 4CF5A 2MSKA 5CH8A 1NDUA 1IN8A 1L5FA 1R0CA 2QRNA 2WSSA 2XD4A 2V97A 1W85B 1DTSA 3BE6A 4XX1A 3V1KA 5JH7A 1JFSA 4HQOA 3CBGA 3QKRA 5KPDA 2P6UA 1NG9A 3KSRA 4ND8B 5EE1A 1TVMA 2ACEA 1P0PA 2P2SA 2J46A 4EA6A 1Y3AA 4MGKR 1JKJA 4MJLA 5FOXA 1T36B 2QK4A 2RHMA 4K9DA 1GTJ1 4GUDA 4HDOB 2NO7A 1Q14A 4RACA 2PGLA 4LHEA 2HHHB 5JRDS 3EZ9A 2GD2A 2P2GA 3PD0A 4YRGA 3ASZA 5C4IA 3LFUA 2DZDA 1YFJA 5IVKA 1WCXA 2UVQA 5LC1A 1IZYA 1TA0A 2PY6A 2BHRA 2O1XA 2P0AA 1EBUA 1RMYA 1U0TA 1KMCA 5JDIA 3OCUA 2JLUA 1TF2A 2HJHA 4NSNA 1VI2A 5EIOA 1FNMA 2HMWA 1QK4A 3D6NB 2B8TA 3D3WA 4BFVA 4BKMA 5F21A 4B6GA 3FPHA 3IIJA 3GB9A 1JLSA 3FOBA 1KKLA 3ILVA 5E4JA 2ZZMA 4GLLA 3PQCA 4HYYA 2YX1A 3LBAA 1CR6A 3PPVA 2UYOA 5KINB 4C22A 1T1IA 3SIWA 1HH4A 2QSZA 2VAWA 5DLYA 2J31A 4FMDF 3QXJA 4H2DA 4QNMA 1YDWA 4FQ7A 1E3WB 5ESRA 3S2FA 3B82A 4NTZA 2ZS8A 1W5TA 3SX2A 3ECAA 3HUEA 1G6HA 2OGTA 4AJ2A 1SK8A 4ZYTA 3MF4A 1YZLA 1FTSA 4IDHA 4GE3A 2PBLA 3ROFA 1N9GB 1PGOA 4ZTUB 3FKSA 3DGFC 2Z57A 4F60A 3F96A 3R7DA 2HHLA 2XE4A 4JV5B 4N3NA 4OQLA 1RAIA 3A58B 2ATEA 2AIRA 2PLAA 2F9FA 2Q2WA 3S0JA 3CF6R 1ZAKA 4N9QA 1YJCA 4DJEC 1KYXA 4AW9A 1II8B 4MQEB 1ZIDA 4X54A 1YRQA 2D4HA 1DKLA 1NXVA 4PPGA 3RU9A 1XALA 4LDQA 2NN3C 2WILA 1KWGA 3CSDA 2GTIA 3GZJA 3FOAA 2YVKA 4LCEA 1P18A 4P1ZA 3ZS9A 3KVVA 4N6NA 4KC0A 3L0OA 3TZ6A 4F21A 1EWTA 4A2WA 1YVDA 1L7VC 1IHPA 1E5LA 3LW7A 4GC9A 3OOHA 2O2YA 2O05A 4X44A 1FLAA 3CJQA 1D09A 4Q5IA 1SCUB 1XZIA 2OZEA 3KJGA 4ZTBA 1KBQA 1NI5A 1XTUA 2V6BA 1KS9A 1FXSA 1LQUA 4QRDA 4RANA 3NPMA 3RYFA 5BQ3A 4ZOAA 5TGTA 4F6RA 2IXTA 3NIDB 5FTNA 1EJBA 1ODJA 2BMWA 2YY6A 3QFFA 2VQ3A 3T7AA 4DSOA 4INPA 3U26A 1DKPA 4Z51A 3ABSB 4REOA 4IZOA 3AEQB 3ANXA 1TJYA 4NARA 2BHLA 1YSCA 2F1RA 2G06A 3HEBA 4RZSA 8MHTA 2RSLA 4ZRNA 2CZQA 2FZGA 4QICA 1A3CA 3JVDA 3OPYB 5DIFA 3WJAA 5DM0A 2PMWB 2XAUA 4JBIA 4X1YA 1G7RA 3DZGA 5KUTA 3L92A 1RYDA 2D2FA 3JSAA 4JFAA 2XNKA 3KYIB 2VUUA 3CRVA 3NIWA 4ZMBA 1WU8A 1FMTA 2PJUA 3B6ZA 3Q6NA 4L8YA 4PWYA 1SZCA 4FXOA 4HGQA 3ZGXA 4RD4A 3D1LA 4QBGB 2BFPA 1ZIYA 4KR2A 1KYQA 4O59O 3K72B 1OIWA 1DJMA 1E3DA 4PFKA 5COAA 3U7QB 3OTWA 1U8ZA 4GYYA 1BX0A 2IXAA 5C80A 3Q5DA 3I04M 4OQZA 3RS4A 3QEAZ 5F98A 2A0WA 4HVTA 1ZOSA 3IEXA 3GUVA 4QT0A 2F62A 1IUPA 2HMAA 5EQJB 2X7JA 1N0IA 3DBHB 1B0PA 2LIPA 2W2QA 3I2KA 1YQXA 2GF2A 1FRNA 3K09A 2WWYA 1CIVA 3UFBA 4QFMA 3VVCA 4MP3A 1JQEA 1NP3A 3OHPA 3IUMA 5ITVA 5KVVA 4NAHA 1P0IA 3DPIA 4TVBA 4YEDA 3ZDBA 1GTSA 1R4ZA 4C01A 1TJ5A 2HTEA 3AY7A 4JHXA 4QFCA 4FGSA 2J5KA 4KO4S 4YMLA 1ZMXA 4PFQA 5HK8A 2C3MA 1ULZA 4CIBA 1VBFA 1HZZA 1QAQA 4TWBA 3HKEB 3IMEA 5C1IA 5EIWA 1GJRA 3HP7A 5BN3A 1MU0A 4LZPA 1AGPA 3SJBA 3I3SR 1N57A 3ZE2B 1TMKA 5BSWA 3W5UA 3JX9A 1U1CA 3KTOA 1NC3A 4JLNA 5CFPA 2GTHA 1HDCA 3KX2A 1ZGAA 3BKXA 4GYJA 1K8XB 3LJKA 1MIHA 4K9KA 4PHHA 3ETNA 3DP7A 4IDPA 2ZGVA 4CLEA 4ETMA 3U56A 1VG1A 1B8NA 4FLMA 3RFTA 3MAAC 5FXMA 3CN7A 3I1YA 5LMCA 1OI3A 3G0DA 5FPTA 3CLUC 2GKGA 2P9ZA 5JADA 5F9HA 5GOZA 2FX5A 2QN6A 3D7KA 4Z86A 4H15A 1N34B 2BGGA 1C4KA 3QHQA 5AWFC 3MFQA 4EFNA 2AQ8A 3MPUA 4QECA 1KDOA 3AM4A 2IPAB 4MHOA 2JFWA 4D3SA 4QL3A 4RTMA 3BIJA 4L16A 4Z0HO 5E7IA 3L4SO 2B36A 2BFDB 1LDYA 2V6MA 3E05A 4IUDS 2AGVA 1EFVB 4LWZA 4NENB 2Y1WA 1K8YB 5ECWA 1JAIA 4TTAA 4XIYA 4M6WB 4A5OA 1WUJS 3FWHA 4YPVA 2FDRA 2RG1A 2X19A 1N4DA 3TQFA 2OORA 3REFA 4EJSB 3H2SA 1N8TA 3M83A 3O2SB 1KEWA 3TLEA 3N7TA 3SOZA 1Y63A 2WKWA 2GBCA 3LKVA 3R09A 4QARA 1B41A 1P1RA 3VZDA 5JDCA 1H3NA 1OW3B 4CM1A 2OC9A 4A6EA 4YMHA 2H1SA 2VSQA 1VLHA 1C30A 3GYGA 4L8VA 7REQA 2CWDA 5C53B 3PNPA 2DHRA 2RH4A 5AT1A 1JHAA 1XLTA 1ZW1A 3W9YA 3G0BA 4CMCA 2Q46A 3Q0IA 3KQPA 4BCDA 4EF4A 2NACA 3OY7A 4G56A 4TXHA 4AMUA 2ZUWA 2JGFA 3ER9A 5BP7A 3K16A 3TSCA 4WX2B 1P29A 3C6XA 1A2OA 5EXEA 3T3GA 1J1ZA 4V1CI 2VTBA 1U28A 4ZQHA 1LEHA 1I5RA 2V7PA 3OA0A 3ZBPA 4WJLA 821PA 2R8PA 5K0BA 3GFOA 1FXWF 3D6FA 4F11A 2EWMA 4Z49A 1E64A 2M1ZA 4US0R 1UJBA 1LH0A 4DQDA 4AQYB 3DAFA 3ZLVA 4MR9B 3G85A 3NVAA 1NPTO 3RUDA 1IB6A 4TL6A 2VHXA 2HA5A 1E2LA 2QRHA 4H7EA 3MXOA 4RFSB 4B7ZA 1BE6A 1NGSA 1DRKA 2J07A 5H83A 1EGHA 4J9UE 1VIAA 3F5SA 3TVDA 3UMJA 4C6HA 1CR1A 3GXOA 2E4XA 3MJVA 4HR7A 4HQ6A 5L3SB 3CE9A 2X2FA 3IKVA 4IUYA 5ENVA 5M7EA 5I9TA 1D2GA 4O02B 2IH4A 1Q16A 4R1PA 3ZWYA 3LYLA 4G8JA 3FPJA 3OEWA 5DGXA 1BMTA 5AOBA 5IJ9B 2DPYA 2CLSA 1NP6A 2N0SA 3DMYA 1ATZA 5E7QA 4AJ4A 3U7FB 1MH1A 2HHAA 5GJVC 2ZI5A 2E85A 1V95A 1D6MA 2OZLA 4KQMA 3TR6A 4JUFA 1DBWA 2VO1A 3HYNA 3C3YA 3OD1A 2NYUA 2A6PA 3WE7A 4IRUB 4C03A 1UL1X 4IO0A 1CVRA 4L8GA 3GQBA 4PYLA 2XKBA 3AZOA 2B5WA 3DXZA 1O0SA 3F3MA 4NMMA 3OM1A 2B1RA 4MHSA 5C2JB 4TN1A 4P54A 4DBZA 7AT1A 4UUAA 3P2YA 1GA6A 1BRTA 5C1PA 4RVUA 3QIAA 3THYA 3L0YA 1ZGBA 4OBBA 4R9VA 1M1UA 2BFBA 1DUVG 2WC1A 4IIEA 1PJZA 1JALA 2Z83A 4E7PA 4RULA 2WYOA 1CQIB 1AVTA 1JL3A 5BUSA 2XI4A 1N3BA 4HOYA 3PNSA 2RK6A 2PXCA 2VL7A 4G0YA 1E5VA 2PSDA 1YCDA 1WNTA 4QPDA 2K2QB 2I7DA 1EUCA 5LVAA 1EDBA 2FSHA 3WGYA 3WLRA 1ZI9A 4H7DA 3WRYC 4KBYA 4C7KA 1MX5A 2PT7A 4Y1FA 1XDZA 3IPYA 5D3QA 4UVGA 4D96A 4TZ0A 4W6QA 4HSGA 2EFDB 2ZJ1A 1A5BB 2GO7A 2ZJ5A 4LDJA 4A0SA 3KKZA 5FBKA 3U61B 1XP5A 2EX4A 3ZHTA 1ZN8A 1XEWY 3OO0A 4ZGWA 1OC4A 1GZHB 4N5IX 1Z7BA 5LZ5A 4CV1A 4GVLA 4NONA 3DE2X 4A8JC 4G3XA 4JR1A 4OFXA 3CUYA 5CEEA 3HA3A 2IK8A 3JQBA 5EI5A 1Q1BA 2H1OA 3QITA 1AH2A 1M2JA 1HE8B 2BUBA 5KDDA 3IOYA 4N6OA 3PBKA 3O47A 1LK7A 3TXAA 2GUWA 1OYOA 1YBFA 3DOHA 2XADA 5BQOA 4L74A 2DR2A 2WUGA 3E81A 4PO8A 4Z9XA 5F9MA 1L8AA 1U7HA 1TEHA 1OBFO 4I4NA 2GLUA 2PWPA 1DAHA 5TNXA 2C84A 2DULA 3PHIA 4AJIA 4ESOA 3H1AA 2JLWA 5AOAA 1SEPA 1HWYA 5B1HA 1IL0A 1Z8HA 3DT8A 1C0KA 1FFGA 2GI4A 2VDQB 4N03A 4HMOA 1CQWA 5CDTA 1E69A 1PWXA 5JZMA 3IHKA 5IU6A 2PGIA 5AJHA 5GY7A 5H3LA 5M3BA 3GBSA 4JQOA 1IY8A 1QGUB 1R0KA 3KAKA 3P32A 2BRUC 2ZCJA 1KRXA 1HA3A 1R6BX 2NU9A 3SMQA 3NKVA 2H54A 3CIOA 1HGXA 1N6NA 4JEHA 5EYPB 4QBHA 3ZCRA 5LA6A 4JJEA 2V65A 1ZXLA 4NZYA 3QVUA 1R64A 2I78A 1SUEA 4WNIA 4CIVA 5A3JA 1DAMA 2JGKA 4KDCA 2BMJA 5JMWA 3LO5A 1ESZA 1TK3A 2GA9A 1GPBA 1I3CA 1PJ8A 2X7XA 4GPEA 4S0ZA 3X1JA 3ZW7A 4LJKA 3ZHQA 3GGDA 1RJDA 1HURA 5B1IA 3OT1B 5LQUA 3GYBA 5EN4A 2IA5A 3KTFA 3WGZA 5CA1B 2J0SA 4Z2YA 2JZOA 1J33A 3PGMA 1J8QA 3VH1A 4W5TA 2I7TA 4IWNA 2ILVA 1SFRA 4CTNA 4C2AA 4TL9A 2OHHA 1DMSA 4RKWA 4MO9A 2XUZA 3EZFA 4IEIA 4YRBA 1PGPA 3COJA 3RRJA 1TJPB 1EGMB 1MBZA 1KERA 4E5SA 1ZH8A 3TNYA 3L0IB 3KC2A 4IOKA 4MAAA 3RVMA 1OBHA 2IZ7A 4DNFA 2PFKA 5EJ2A 2GF0A 3L4BA 2DT5A 2G71A 2IYWA 1Y6FA 2CXUA 2XNSA 1XCMA 3WWDA 2OAQ1 4WY5A 3WWYA 5C4MA 5K03A 2LBPA 3KZMA 1YZGA 4F9FA 4D7AA 2IX3A 1RHMA 1P2VA 2BLNA 3OPXA 3PZBA 1AQIA 2HY7A 5BN4B 3KB2A 2O2DA 4J4BA 4MI9A 3ROMA 3ENWA 5ALMA 4F4HA 5BV8A 3IVGA 5KKNB 1RLUA 4MCAA 1JIXA 2XR1A 1SWVA 1XLUA 2IXDA 1I4LD 5JI3E 1FFCA 2Z9DA 1ZLXA 2HIMA 2BZGA 2WP8J 3GAMA 4KHZA 1K88A 3K5PA 2Y2UA 3OKAA 1M1XB 3RHSA 2Q6TA 2O8NA 4C5BA 1LSJA 2MWMA 3L9XA 4JB8A 3FZYA 4RSGA 3DA8A 3TAXA 1G6OA 1K3TA 2HMTA 4RO0A 1RJEA 3V4FA 5KNDH 4K9OA 3DCNA 4W1RA 4MGYR 3DBRB 3DB2A 1H2BA 1QJCA 1K8ZB 1F3LA 3L07A 1NU6A 4CMIA 3M4NA 1VIVA 2GEBA 5LXTF 2JGDA 5SYAA 4ZKEA 4N76A 3TMYA 3L7LA 1XAGA 2EZTA 1VP3A 2H9IA 1AS3A 1W19A 2BV3A 5BWMA 3NV9A 2G5GX 2Z1NA 3L8HA 3EGIA 4CNQA 1D2NA 3OIYA 1GSIA 2NXCA 3THXB 2I7CA 2VUSA 3Q9NA 4J3FA 3IV7A 5CLJA 1QYVA 4BKQA 1Z8FA 4L76A 1TO6A 3SEAA 3K0CA 4V2IA 1BGWA 1WXDA 4GI5A 4X6LA 5UKDA 4EGFA 2L2QA 3TM5A 2H4ZA 5JPCA 3W77A 5D2CA 5HS4A 1N5JA 2PRKA 3FCCA 2LXNA 1U2TA 2NZWA 1HNXB 1VECA 1KOJA 2SHKA 2VP3A 3AJEA 3Q7IA 1T3SA 4LC9A 4HYEA 5D86A 4NU6A 1YJ5A 5TQ2A 2H07A 3VNSA 4GRAA 4MGZR 3WMRA 1O96A 1PGQA 3VR3A 5FEUA 1US8B 5KSYA 5A62A 3NM5A 3AILA 2PVSA 3ZGOA 4XQ0A 3GNTA 5JPDA 4UUQA 1ZX1A 1LK5A 3NIBA 4L4UA 1SG9A 2YN2A 3TL3A 4BU1A 2ZJZA 1CR4A 3D02A 2BKXA 4I19A 1XQYA 2BVNA 3DKVA 1MQAA 2QDXA 2KLHA 4FKBA 4JBXA 3UATA 3ZIUA 2VPWA 2DQSA 4D97A 3QF7A 3PPWA 2C9CA 2VPIA 3NHWA 3PC7A 1X39A 2YV3A 4TV9B 4YAFA 1XEAA 2HWWA 2WU8A 3C3JA 1PEDA 3EVNA 1FSGA 3D3QA 1N5IA 4N48A 1DJOA 2O2XA 5HJ7A 1DCKA 2BPOA 2CB0A 4L6AA 3HKCB 2NO9A 4L9WA 2FPLA 2YHUA 4N0PA 4RSHA 1KEUA 1IVNA 1ZGCA 3WL8A 1OLOA 3IMKA 5EIAA 2RJ3A 3TIFA 5B5SA 3ZWNA 4R1QA 4GBJA 4GX0A 1S2LA 1H1LB 4YCAA 4WA7A 2O20A 1MN6A 1Y8QA 3GBVA 5DV9A 4IBOA 4M1YA 3WL3A 3AETA 4LZWA 2FG7C 3MD9A 1UK7A 3LV8A 1I6WA 2CLOB 3I5XA 3DQPA 3PYMA 3NBAA 4PG7A 2FQYA 5F5XA 3VDMA 3FOWA 1C4WA 4E3WA 3FWPA 1EWQA 1T5OA 3AR6A 5FR2A 4AD8A 2BR5A 4M9CA 2YNMA 3WZMA 5JATA 4JLKA 1S3GA 4NMXB 4RNDB 1ORHA 4XRGA 1E2PA 1T9CA 4LFCB 1ZI6A 1HYBA 1T9DA 3M82A 1GRCA 1UDXA 1FUUA 1UKCA 3H1GA 4I1UA 1ZXXA 2V0CA 3HJRA 4JVNA 3E5NA 4KI7A 4BYMA 5HKKD 2UZ4A 2QYHA 2RK3A 4OFZA 4DV2B 2MINB 4MGEA 1L3BA 2DU8A 3CX6A 3CW9A 4F38A 3OUZA 4OI2A 1RAFA 5HE8A 3X1MA 5L4SA 3VZCA 4BRWA 2E21A 3EEQA 2WI8A 2PX3A 5AVRA 3NBMA 5A7FA 2ZJ4A 3WTBA 4Q9HA 4GKBA 3QGMA 4XJSA 3CNBA 3WYDA 4E4YA 3KXDA 1T9HA 2TSYB 2B2CA 5H9VA 4I36A 3LUAA 3FSGD 4KFCA 1JJIA 2CL0X 5BWLA 1VJ0A 4DIEA 1JFRA 2VK8A 3D6UA 4G07A 2WAAA 4GUAA 4HPXB 4BCBA 5I7HA 4F3TA 1NN3A 2V6IA 3U7HB 1AU9A 2KI5A 1SIOA 4KB5A 1BCSA 1PW5A 4OOEA 1DO2A 4HNAB 1BQ3A 1GPJA 5EXPA 2VPZA 3TGPA 4XWWA 1C9KA 2COKA 1UBEA 1Z83A 2FPIA 2EFCB 2NW6A 1KR2A 4Q7QA 2AFRA 4L72A 1DJQA 8ADHA 1V37A 4WXYB 1QMPA 2JLVA 3ZZUA 2FCAA 2FPUA 2WJHA 5IS2A 2VZEA 4N3CA 3NEJA 4GMGA 5IM5A 1J0BA 3PLRA 3GO4A 1XDBA 1EZ4A 2IYYA 3C3AA 1ZYUA 4F5WA 5AVZA 3KTAA 2IEZA 5T5QA 1G5IA 1HKUA 1KYWA 5KYNA 2V7EA 3TBHA 5A2QA 2HRZA 1XZGA 1FDWA 1XQXA 2FPSA 2H2IA 4RK5A 4Y2YA 4DARA 1G5FA 1PFVA 1QFJA 3JQFA 4JNCA 4RF4A 4EELA 4ESVA 4ZAVA 4PNZA 3FW1A 3UVEA 4KGZA 3IOCA 2R79A 5KSOA 5ITZA 3NRCA 1ABBA 4MVCA 5C5IA 3CVOA 4WZAA 2QT0A 3UKOA 2YV4A 5J58A 2WJJA 4AJ1A 3HVIA 1JIVA 1JQBA 1YRWA 5EKTA 1R0LA 5HUQA 3RB8A 1CQJA 2NYRA 3NIFB 1JQ5A 5A5GA 5GVRA 2XWBF 2I2CA 4HAOA 3ZJ4A 5EHZA 1QNLA 3QPDA 4QDOA 4L0QA 1SXJA 4HC4A 4BQPA 4I5EA 4JYMA 4UMDA 3D7LA 1HQYE 1PN3A 3AUXA 4UKDA 4UVIA 3SI7A 1BO6A 3KYDA 3AUKA 1E7YA 3HDGA 2B2XA 5CVVA 2WOJA 4PCLA 1UXIA 4JP5A 1FP4B 3D4BA 2VK1A 4LJ7A 1GP2A 4S3MA 1LFDB 1KP2A 4KQHA 5D7NA 3DKKA 3TLBA 3MEQA 2GWRA 3KXPA 4EYSA 2CL6X 2GN6A 4JS0A 4P33A 3E9CA 4QASA 1T26A 2BSAA 5CM2Z 1XJ5A 3BFKA 3KKNA 2C99A 1F1BA 3VR5A 2A9PA 1SM4A 2KJQA 3DLHA 2AZMA 1LC3A 5ALIA 3AO0B 2EJCA 3KKMA 3RIYA 3QNMA 4GR9A 2JAHA 3KT3A 4X7MA 4YDRA 5DM60 2GZSA 3RHTA 3P45A 1WVMA 3C43A 4I8DA 4Q1CA 2X58A 1B6RA 3GQVA 3OX1A 4KLRA 5IX8A 3LBYA 1RM3A 3GGJA 1DCFA 1Z5NA 2WD7A 4NEQA 4X7RA 3V33A 3PF8A 2C0QA 2QN8A 2WMOB 4QU8A 1EFPB 2AFHA 3UM9A 5BUZA 3NKFA 2NNLD 4JLJA 2R6GA 3SNKA 1R6VA 4LF6B 1ZJ5A 3MAJA 1TVKB 4NOLA 5FLYA 1FC0A 1YZTA 3M4YA 3WLNA 3PYXA 4KFRA 3PNMA 3OC6A 2HRCA 3HRIA 4BNIA 3BREA 1QWSA 3DMPA 2DG2A 1VIMA 3QJ5A 2XTNA 3WK8A 4D1YA 3PIDA 5HIAA 2PX6A 5CA0B 2BI7A 3JD2A 2WJ3A 4KQ6A 1L0BA 4PYRA 4BFTA 3HRHA 4R0NA 3GVXA 3SS8A 4ZEVA 3WB2A 3NVKI 4O1IA 2QYSA 4N39A 1DLJA 3DDOA 2EW2A 2B34A 1X9IA 1G2QA 3KPVA 1ZK4A 3N6VA 4MYSA 4QVIA 1GFWA 4D46A 2ZIAA 3BKWA 4W9NA 2OCIA 3R3SA 1XZAA 2JFGA 2F8SA 2FPGB 3LC0A 3WTCA 2IYNA 1H6AA 3G13A 3FDZA 3I01M 3VAZA 5B12A 3ZWAA 1WP4A 5IDWA 4CLOB 1QKIA 3ZXUB 4PZ0A 2H1VA 3I9V6 3K1TA 4YRRA 1R12A 1SA0A 2Q8PA 4WESA 4WDRA 4Y2PA 4KTVE 4RD0A 1YB2A 2EEPA 1TU4A 4LWPA 3T5AA 1HE2A 2D7CA 2QTWB 3I6ZA 3PWZA 4NBTA 3SBDA 3AR3A 4U7PB 1GV0A 1M2VA 4P38A 4CIXA 3MWGA 2JIOA 1M1NA 5DYYA 4IMIB 3JV7A 5IJXA 5MDHA 3SFTA 1CR2A 1ZZGA 1LDNA 3HB0A 1T1GA 3E03A 4DMRA 2FFQA 1TMOA 1C0LA 2WA1A 2F64A 4PAQA 3AF4A 3QK7A 4RABA 4AO8A 1V9CA 4DSAA 1SIBE 3FMGA 1SY7A 4R1NA 4DV4B 4O3FA 4DSNA 4DY4A 4PRLA 4TL7A 2H85A 1DTWA 5BURA 1R37A 1KJNA 1NUQA 2QTVA 2WYVA 2ZR8A 2BFCB 3U4MA 1KDVA 5KTTA 1XJCA 4FIZA 2WUDA 3ODGA 2V3WA 1KIFA 3QBDA 4GBGA 4HLUC 4I1OA 2A9KA 3HB1A 1T1EA 3P9SA 2QZ9A 4JI1B 1GVHA 1DQPA 2JJ2A 4F2PA 4PGAA 3P9KA 1IB0A 4EH1A 4ZOLF 5IF9A 3RVPA 2YWDA 1KAEA 4FJ1A 2UKDA 4L8FA 4OX9B 4CI9A 3HB4X 4ZV7A 4LBYA 5CIWA 1OAOC 3H05A 1IATA 2KYRA 4ILKA 4FNGA 1IRIA 2R1VA 3JAWA 2G08A 1KEVA 2XOKA 3E22B 3KWFA 1QHXA 3ZDFA 3LXRA 4JHLA 1AB5A 1I51A 3O8OA 4PLPA 3UFXB 2BW0A 4LZJA 2FR8A 4KODA 1GCAA 3NS7A 3N2KA 3PT5A 4UBOA 5JYEA 2QB5A 3PQ8A 3GZNB 3JY6A 3L41A 4ZMRA 5P21A 3IUNA 4HVAA 1Q0SA 5JBIA 2IEDA 3DDUA 1YIAA 3JD3A 4PZ9A 5IYZB 3UJ7A 4EG5A 4IR7A 1RAGA 4WLOA 1ODCA 1OTHA 4MVJH 4BTVA 3EY4A 1J25A 1HZJA 1WXWA 1DOAA 1E59A 3CNNA 4JUIA 1UMKA 5JO9A 3RS7A 4Q37A 4O2BF 1IM5A 2GRJA 1SQ5A 2H2GA 2ZRJA 3L0PA 4LEIA 2BFFA 3WLMA 1QBKC 4WFJA 4FFPA 1QVWA 4AS1A 2B8NA 2H0AA 1UDRA 1N3LA 3FKQA 3VPXA 6REQA 2B37A 5JXJA 1VFPA 2O7QA 2PLNA 3R3JA 4XWYA 1KJIA 1WV0A 5ILQA 4ZHSA 5CBPB 3FPGA 2FW7A 3IAS6 2GXUA 4X6YA 3TEFA 3D7NA 2ZWPA 3WQQA 1W96A 1J5XA 2ZB7A 2AR0A 4JZYA 1HG0A 1UZLA 2G5TA 3P2KA 4Y2UA 4DWJA 2JLQA 3W5VA 1OLXB 5J43A 1VM6A 4OM8A 1P33A 3UMMA 2RHOA 3CJTA 3GT0A 4QOGA 1L7EA 3L5KA 1P6XA 1TADA 4KYUA 5T8KC 4EPYA 4BLVA 4BFUA 1PVOA 3N8GA 2Z04A 4UTZA 3ISJA 1OXBB 1WULS 2ZE8A 1VOTA 2IX9A 1L7NA 2P90A 4JU8A 3FTDA 2H52A 4PG5A 1U98A 2FZLA 2V1XA 5KQRA 4AKHA 4LFBB 2H9YA 1QNFA 5KTRA 3HVUA 4NU0A 1IIBA 2OZVA 2BTOA 5MN6A 1ZD1A 1RM0A 3BDIA 1ZZEA 3D4NA 2AYXA 4I50A 1G42A 1R66A 2ZEJA 4FHZA 2VNKA 4H7IA 3ZDYB 4G6ZA 3K2EA 1JDZA 1ILEA 2ADOA 1Y5LA 2XV1A 2F43B 3R7FA 5MHTA 2ZT8A 1YO6A 2NQTA 4G1EB 1QIDA 3IB6A 2HA7A 1RQGA 2D06A 4O4HB 1G8AA 2VZLA 4ZO7A 2QX4A 3VSDA 3IDSA 1SXGA 2F1JA 2ZOSA 4PLZA 1JQLB 4K2HA 4N8SA 4PINA 4EITA 1ACLA 3P71T 3LFTA 3T1VA 1X6VA 3A3NA 2DAPA 4QZVA 3O2NA 4D9HA 3HR8A 3QTLA 2GBIA 4U6QA 2OM2A 1DKRA 1YOBA 1LLUA 4J6EA 4I66A 1XWIA 3W7VA 3VU1A 3JU3A 2NZVG 4L5JA 3T7JA 5LB2A 2ECOA 4BCCA 4C7MA 4OQQA 4Y6RA 3K70D 4V0NA 2XZLA 4IY1A 4ZVVA 3ITDA 2FQXA 2R87A 3AL2A 1NVFA 2X1VA 4I4TF 4HNUA 1VRCA 1PZNA 2J6BA 2D5CA 1XF9A 5GJBA 4MVJE 3MIZA 3WYAA 1AQLA 3BZUA 3KP1A 4CCYB 1KOGA 1IU9A 2GNPA 1PAUA 2O0MA 3K0SA 3X1WA 3F6RA 4KLZA 3T3DA 1KDRA 3LQFA 4B3GA 2AD1A 4LRWA 4CGZA 4E4RA 4B3XA 1J2JA 1E6LA 1GTL1 1JA0A 2UYYA 4J43A 4A6PA 4CLHA 1BH2A 2R8XA 3FJYA 1IPEA 1JLMA 3H13A 3TE6A 3WWEA 2DFPA 2BZ1A 4EDFA 4I1PA 2P1DA 1QQ6A 4TKUB 2QLNA 4MX8A 4IKPA 4AUKA 3AUAA 5K1ZA 4OI4A 5IAKA 3AHHA 1TFRA 2D2XA 3W6UA 4K6KA 4UATA 4E09A 4GM0A 2Q7OE 2QR2A 1RZ3A 4YCDA 5A4IS 1XFDA 2B2NA 4WBNF 4YMSA 1K08A 1R5BA 4AJLA 1RWNA 1SHJA 2W2TA 3G5LA 3PUXA 4FP9A 5DFAA 2BHSA 1GZ7A 2VNIA 4L5AA 2Q2NA 1YR7A 5HZKA 2CKMA 2BD0A 2QTTA 1HEUA 2F8MA 2W43A 2Y1LA 3EG5A 3H16A 3BD9A 4N1AA 3S2ZA 3VPAA 2WV7A 3TM4A 2G04A 1CU1A 2XUFA 4LDZA 1S1CA 1FRVA 1N1EA 4G37A 3SQOA 4JYAB 1FA9A 1FYEA 3KXLA 2ZIXB 4LJ8A 4QUHA 2FXVA 2NGRA 2WLTA 4FYPA 3GLHB 1ITZA 2YRWA 4L07A 4UCWA 4XFKA 5I7AA 3C5EA 3LDHA 1W4AA 1X86B 1ZUIA 2VSNA 2HJRA 5TQ0B 3HA2A 3R8XA 3SDSA 2Y1OA 4EG0A 1T10A 2FP4B 4FHFA 4URZR 2ID8A 5JANA 2QXTA 4AN4A 2JZNA 2IUYA 3ENNA 3B1WA 4I08A 2HXYA 1JI0A 2HJVA 2NYVA 3UOGA 3B9BA 2YWXA 5E9JA 3CM0A 3BGDA 1G4HA 4OH7A 5E1OA 5AVJA 3TOVA 1E4OA 3J7AC 1QYIA 3GJ5A 3G5MA 2CFOA 1Y4DE 2QE7A 4NF2A 5ALGA 3UAXA 4AJNA 5AI0A 1M6VB 3KE8A 4AI6A 2X9GA 2I2BA 3D54D 2G6TA 3L6DA 4V0LA 4OX9Y 3OJEA 1RMQA 4HS9A 3TVTA 5FOUA 3V3KA 5GM1A 4AB1A 3FUXA 3L7CA 1OLUA 4JB0A 4HLDA 3G59A 3UANA 4XQCA 3VKWA 4ZRMA 4RKRA 1RYNA 1WDWB 2HQSA 2JIZD 3LQ1A 5KPJA 3PX2A 1UKBA 4RF5A 1JYSA 4H0CA 3A1SA 4WWHA 3HKBB 5D6OA 3IALA 4MUGA 1NXTA 1F06A 1G8SA 4MS4A 4Y6LA 4FFLA 1J8DA 5KTNA 2M2IA 4MNTA 4GZ6A 4LE1A 5AW1A 1ZMTA 1PX2A 3V4PB 2JH8A 4FEGA 4QAJA 3WGUA 2HL6A 4IVPA 5A4DA 4KCGA 2YHSA 2J3IA 2PJZA 3SLRA 4YCLA 4CM8B 4D4LA 4L9RA 3L2OB 4Z5XA 1PS9A 4FR0A 2Q99A 4ZD6A 5TIIA 3IJ5A 3WLJA 3FSEA 4RIGA 3GGPA 4IYJA 3OQ6A 2IY7A 2O4UX 2OD2A 3AF6A 3P0IA 1QHHB 4B2PA 1MB2A 1H69A 2QZ4A 4TLLB 2O50A 2OV2A 3LHFA 3TN7A 2BSQA 3CR7A 3RS8A 1QTIA 3QP9A 4K1LA 3OZWA 4U00A 2FPPB 4DAEA 2ES4A 4FLFA 4RVHA 3PENA 3AEKA 4ZO6A 1DC7A 4G0OA 3SJAA 5DHQA 3OZUA 1EKXA 2BONA 2XQGA 2Z1DA 4QATA 1SIWA 5DYWA 4D42A 2YZMA 1QLHA 3W9BA 1HYGA 1HYEA 1ZUHA 5F33A 3R5FA 5DNVA 4S1WA 4MWCA 1TKBA 2UXBB 4DV7B 5H4GA 2QVYX 5A4MS 4WW0A 4N65A 4F4IA 2JEYA 1CERA 1RWKA 4MI3A 3DOIA 4BMOB 3INGA 1NQUA 5E7JA 2HW8A 2XWPA 3PG5A 3R40A 2J30A 1JR4A 1LF5A 1Z16A 1UMBB 2A3RA 2I62A 2BF4A 1N0UA 1EVQA 3PGXA 4GMFA 2B1IA 4R2HA 4M46A 1AC5A 5I3ZA 1U5CA 3C45A 4I55A