3W7AA

Crystal structure of azoreductase azrc fin complex with sulfone-modified azo dye acid red 88
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
210
structure length
210
Chain Sequence
b'TKVLFITANPNSAEGSFGMAVGEAFIEAYKNEHPQDEVVTIDLFNTTVPAIDADVFAAWGKFAAGEGFEALTEVQQQKVAAMNTNLETFMNADRYVFVTPMWNFSYPPVVKAYLDNVAIAGKTFKYTENGPVGLLEGKKALHIQATGGVYSEGAYAAVDFGRNHLKTVLGFVGVNDTEYIAVEGMNANPEKAQEIKEAAIANARELAKRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
publication title Structures of AzrA and of AzrC complexed with substrate or inhibitor: insight into substrate specificity and catalytic mechanism
doi rcsb
source organism Bacillus
molecule tags Oxidoreductase
total genus 71
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 1.7.-.-:
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w7aA00
3KLBA 4C76A 2MT9A 1YKGA 3NFRA 4XDGA 2BN4A 3ESYA 2V5VA 4U7GA 1JA1A 3F6RA 3O73A 1TLLA 3GFSA 4DY4A 1AMOA 3U7IA 2QX4A 1YOBA 5LLDA 6NULA 1YCHA 2BPOA 2FLVA 3QFCA 2HPVA 3B6KA 2Z9DA 5LJIA 2V5UA 4FGJA 4NLLA 3FX2A 2XOEA 1V4BA 1CZHA 2MTBA 3N3AC 1H69A 3NHWA 1XI2A 4N65A 2BMVA 1BVYF 3NLLA 3NHUA 4DIKA 1YRHA 3OWXA 1YDGA 3NHJA 4QOJA 3HLYA 4C14A 2FOXA 2ARKA 2Z9CA 4XDHA 4HS4A 1VMEA 2BF4A 2OHHA 1FX1A 2GSWA 3GAMA 3GFQA 3ZHOA 4LTDA 1KBOA 2AMJA 1J9GA 4ICIA 4R81A 3TZBA 4ESEA 1KBQA 2V9CA 3OJWA 5F4BA 4D02A 5LBTA 2FDXA 3LT5A 2HNBA 1FTGA 4OXXA 4S24A 5LVAA 3TE7A 1C7EA 1J9ZA 1D03A 2FZ5A 1FLNA 5ULLA 2F1OA 4PTZA 2QX6A 1ZX1A 2M6SA 1FUEA 4Y9UA 2OYSA 2D5IA 1I1OA 2R96A 1CZUA 1T0IA 3ESZA 4C0WA 3N39C 3TEMA 3B6MA 3KEGA 5FX2A 4CETA 4LTMA 1OFVA 1WSBA 4QODA 1C7FA 3N3BC 1FLDA 2FCRA 3JSXA 2R97A 3QE2A 4YQEA 4FGKA 4BMPB 1AKQA 1OBOA 1CZOA 3FNIA 3ESXA 1ZWKA 3HR4A 3OJXA 1F4PA 1QR2A 3OX3A 3D7NA 2QMYA 3HA2A 2M6RA 1FLAA 3OX2A 3OVMA 1D4AA 4Y7CA 3G5MA 1FVXA 1SG0A 2BZSA 4QOFA 5FUQA 4QOHA 4ZVNA 3OX1A 1CZLA 4ZVLA 2KQUA 4Y9RA 1YCFA 4U7HA 1FLVA 4H6PA 1J9EA 2X2OA 4PTYA 5BUCA 5NLLA 1GG5A 1RLJA 1RLIA 3W77A 4YAUA 4GI5A 4J8PA 2Z98A 4N82A 3NHPA 2HNAA 3OWHA 1AKRA 1AKTA 3FJOA 3R6WA 2QX9A 2Q9UA 3KAPA 4YALA 1XYYA 4FX2A 1X77A 1CZKA 2FX2A 2OHIA 2FZVA 3F2VA 3NHKA 1DX9A 1OBVA 1WSWA 2W5UA 2WC1A 3W78A 3B6JA 4M0CA 5B3LA 4YAWA 1TIKA 4CF6A 1DXOA 3L9WA 3FW1A 3O2NA 5F51A 3EDOA 2FVXA 1JA0A 1H66A 5NULA 2FAXA 1SQSA 1AKUA 1DXQA 1XYVA 4ZVKA 4ZVMA 4N9QA 4FGLA 2KLBA 4BMOB 2N1MA 3KAQA 1BU5A 3FVWA 3UXHA 4F8YA 2A5LA 1RCFA 3QFRA 4LTNA 2Q62A 1ZWLA 2RG1A 4YAOA 1QRDA 1AKVA 5LMCA 3F90A 4GQIA 5F12A 3B6IA 4PU0A 3NHSA 1B1CA 5JROA 3K1YA 1YCGA 2MWMA 4DILA 3W7AA 1E5DA 2X2PA 3K20A 1RTTA 4GR9A 2OHJA 3W79A 1QBGA 1J8QA 2QX8A 3GFRA 2XODA 4YAFA 4U7FA 4QOGA 3U7RA 3SVLA 5FA6A 3EYWA 4HEQA 2QMZA 3L9XA 1AKWA 5EA2A 1T5BA 4LA4A 3F6SA 2QR2A 1AG9A 2QWXA 4NULA 2B3DA 5TGZA 4C0XA 3P0RA 1XT6A 5A4KA 3NHLA 3NHRA 4LAFA 5EMNA 4H2DA 3UXEA 1NNI1 4QOEA 4QOIA 5LJLA 3S2YA 5LBUA 1D04A 3LCMA 1QHEA 3ES9A 1CZRA 1CZNA 3RPEA 2ZKIA 3NHFA 3NHYA 2MOKA 2Z9BA 5B3KA 1AZLA 1AHNA 5EAIA
chains in the Genus database with same CATH superfamily
1E61A 4ZGBA 4MIYA 4R2MA 3S7TA 1KYIA 5B1SA 4ETMA 4DUYB 1W85A 2PA3A 3T41A 4RESA 3B5JA 4IS2A 1MO3A 1WCIA 1KIMA 2R25B 4TXNA 3PC6A 1N6OA 2MINB 4KR3A 3K9WA 3G2JA 4B80A 1V96A 5L7WA 1N8KA 5JNVA 3N28A 1BYIA 3U6BA 1TQ4A 3SD7A 5MGBA 4HNGA 1I13A 3O73A 3RUFA 3REFA 3PEYA 1R0KA 2HCFA 2V0GA 4QYIA 2GPJA 3ZCQA 3A32A 3BIWA 3TRHA 1J06A 1XKLA 4OEHA 1D2RA 2PXXA 4P4SA 4BKRA 3K5PA 2BIFA 3N2EA 1TO1E 4V3BA 5DM1A 4D80A 3E5HA 4OHOA 2FDCA 1N3LA 2FWIA 3CKLA 1YZHA 3JZFA 4TT3D 2GPNA 3Q7SA 1H8EA 1UJMA 2IZ0A 1SVWA 1FMTA 2GOYA 2HXSA 2OBBA 3CISA 3DXZA 1JEJA 2O23A 3GAFA 4RACA 2G9NA 2JLWA 1O5IA 1O97D 2Q3BA 2QTMA 4PO3X 1HQCA 2BTEA 2GEJA 2I80A 3ENWA 3FNGA 1CW2B 3MCUA 1XX6A 1YL7A 5JS1A 4F60A 4KNVA 4BFVA 1ZMBA 4FEGA 3S2SA 3KDAA 2GYWA 3OEED 5LNK6 2NVBA 2ODBA 4X85A 4U3JB 3OPYA 4K2AA 5DEIA 3KJFA 4YJ3A 4A7PA 5IJWA 4JBNA 4OHCA 4BFYA 5ALPA 4KI0A 3ZUPA 1YNOA 3AP2A 3O4HA 1BVRA 2RAPA 2DVMA 1YVPA 3VVLA 3H0CA 5IXSA 5DM60 1YBVA 2HI0A 2H9AA 2QRGA 1E2JA 3CUWA 2O6HA 3NXKA 3R77A 4XEHA 5H0IA 3H1PA 4Z51A 4WXYB 4KVZA 3GLRA 4OKSA 4LNHA 2X9NA 5BV1A 2G6BA 2EW1A 3C3CA 1DXYA 1YRHA 1XLUA 1W30A 2GXUA 2IHJA 1QYDA 3ISTA 3DMHA 3P9ZA 4OU5A 4P81A 3ZDQA 4A4DA 4F3NA 1YBFA 3F8SA 4C14A 2Q28A 2NYRA 2GZ3A 2WV7A 4OYLA 2P27A 1K0UA 4NZPA 1CXZA 2H92A 4HS4A 5KNBD 4M89A 3PQFA 2H3EA 4Q82A 3AUTA 2YBDA 2ZP1A 1GGJA 1U7WA 3KQSA 1GPNA 3NKLA 4GWKA 1E7QA 4J1NA 3BWEA 5CHYA 5H3CA 5A4DA 3DDWA 4FUTA 2VHCA 1U0NA 4FJ2A 4P3XA 5CIWA 1MAWA 4OQXA 1OFUA 5BMVA 1I7LA 2CLCX 5D3MA 4JUAA 3HMKA 1Q0SA 3OCXA 4HPWA 4MUNA 3U80A 2BEVB 2X0RA 4YQFA 3LUGA 4QGGA 4ZYZA 3ZJTA 1MAUA 1GCAA 2FMHA 3NJ8A 3DAOA 1OH8A 3JZMA 4OV6B 2OKGA 2X4DA 4YP0A 3HY6A 2EFYA 5AM3A 1X7HA 1OZ0A 3T1TA 4ESEA 4MQ5A 4G5YA 3W5VA 1M6NA 3I5UA 3VR5H 2AV6A 3IJ5A 3HCFA 3E9EA 1ZR4A 1KVRA 4MWDA 1TFRA 2JAQA 5H5JA 4RS3A 5A6VA 4CG0A 3P9IA 4RQUA 4DR4B 3GPCA 2HNBA 3MPOA 4Z9YA 4XQEA 1WE2A 1CFZA 3VYVA 1NNSA 1R4ZA 4GP7A 4H77A 1WHTA 1A5SB 3DE1X 3IAM1 3JYLA 3PITA 1QZ3A 2DYKA 2ZPUA 3S2ZA 4PRYA 2Z6UA 2Y1FA 3DV0B 1I5EA 1MB0A 1U4SA 3BSWA 3LRXA 2GAAA 4JJIA 2XJ4A 1P7WA 3D1JA 4GWGA 4QQKA 1YS9A 5HZKA 2H11A 1ZD2P 2PYZA 3VHXA 1A9ZA 3FPLA 3PUIA 4F5WA 1E62A 3N2GA 4WOBA 4ZYLA 4U2DA 2XCLA 1SIUA 1XTRA 4R40A 2DBYA 4XOIA 5I9BA 4CFZA 3EG5A 2IDZA 4GICA 2IDMA 4KWEA 1BU8A 3H5IA 3L84A 5FULA 3TW4A 2JANA 1WBDA 2IH2A 4NCJA 2REQB 1JWAB 1KI8A 4BY9E 4XQ0A 3AUJB 1U99A 2O9JA 5KX5A 4J4TA 4NG5A 1MORA 2K2QB 3KVYA 4H6XA 5ARCA 4UCXA 3I04M 3M0EA 1X9IA 2EAUA 4L0CA 4AJOA 1Z63A 4O8ZA 5AKXA 1ZGGA 1W46A 4R01A 2AFIE 4MEJA 2AQHA 3DEIA 5DNYB 2ZSJA 4YP5A 2VAWA 1OYVA 2JFVA 1ULBA 3WZMA 1VKJA 1TEVA 1WSBA 4PTLA 4QODA 4H7JA 2B5VA 4Z86A 2RHDA 3A9RA 2FPPB 1H0KA 1ZUNB 3PXBA 5H70A 5H9VA 5CHEA 2DPYA 3WGOA 4ECEA 3G59A 2MYUA 1HO3A 4L78A 5AOVA 4BVFA 2MSEB 1TADA 3DFMA 1NMZA 2W2TA 3UVEA 1SVIA 5ER9A 4Q37A 3TLKA 1UFKA 4KK3A 4LYFA 2VHXA 2HKIA 1U98A 3I76A 2ZEJA 4NECA 2HFJA 1Z0SA 1QJ4A 4H6VA 1ZWKA 1D0SA 1BKDR 2DKNA 2WWGA 4ENPA 3FOZA 1L5QA 3FPHA 1WD5A 1NKVA 4GVLA 5BR7A 3K70D 2R1VB 2O8BB 1XKTA 4JOCA 1E89A 3LYHA 3BTSA 1NPDA 5CYPA 3JAKA 3RTBA 3KKMA 1ZIDA 3I6YA 2O14A 2WV9A 1LB1B 1YRLA 1KTIA 1L8LA 4I6JA 2OFFA 3ZGNA 3FD8A 4EEZA 2QQFA 2IV3A 4KQ9A 5K8CA 3AVXA 1Z6PA 1SAYA 1JZTA 3AP1A 4JBHA 5CBKA 2C99A 2I2XB 2ZM5A 1H42A 1JDSA 1HKHA 2EJCA 3BTUA 4LE2A 4BCDA 2D0DA 4JLKA 5LU9A 4MLPA 4DKXA 4YHBA 1MIOA 4LXUA 3IQXA 5JXIA 3B52X 3LVQE 1Z26A 1SCIA 1HFWA 3D7KA 3SKXA 3GZNA 4E13A 1EFAA 5LQCA 3H2GA 2C5AA 3QX3A 3R9WA 5JISA 5LUAA 1PFVA 1N8SA 2FY8A 1T6YA 1Z5NA 5CH8A 2DZDA 1T8RA 1V1MA 1ZXLA 3HB4X 3U3RA 1CUEA 1EP3B 3RS4A 4ENSA 4UFPA 2IC5A 1R6VA 3WIDA 3U19A 1EVLA 3C6BA 2FMTA 1K9SA 3X1KA 4Z5XA 4UBJA 2R60A 1UMCA 3MPUA 4W1QA 3OQOA 2PH1A 1MD9A 1WTAA 2X7JA 4UTPA 3VU3A 4ZVLA 2XRZA 3FCCA 1JJ7A 4ZDWA 1YZNA 1D4OA 4G1UC 3UIEA 2ZK7A 2WSMA 1J7KA 2AW3A 5A9RA 2Z8YM 2DFVA 5L3QA 1PZHA 1FRFS 3SZ3A 1SBTA 4GZ6A 1K7XB 3WSTA 1NLFA 4U6NA 1EBFA 1P33A 5IVPA 1ECCA 3ZIAD 1WQ1R 4TZ0A 4J8PA 4P36A 5DNWA 3T5AA 3SSNA 4C3UA 1X7WA 2JKZA 3VBEA 2E4XA 2B8EA 2XQJA 3ONNA 3QE9Y 2UZ1A 4KGXA 1S96A 3SYLA 1G9SA 1YULA 2QUIA 4RE6A 4LHSA 3TF5A 4DMKA 4MVJI 2PO7A 1UKYA 2JEZA 3INTA 1X38A 2M1ZA 1OLSB 4H27A 2Q3FA 5B1YA 1QK3A 3VZQA 4WPGA 3CTPA 3J81A 1G4UR 5J40A 4ZHQF 2I78A 3ZUGA 3JQ8B 3NVAA 4F4DA 4AYWA 4KOEC 3KAPA 4CL0A 1NYRA 4NFYA 5FUBA 1FP2A 4MVJG 2DP4E 3KJGA 4J0QA 1E96A 5B1DA 2JFBA 1C1YA 2Q2VA 3NANA 4KJXA 1EGVB 3AEQB 2ERCA 1ECGA 3DE3X 1W19A 2PK3A 2R62A 3TFWA 1OXSC 4RK5A 1Q3KA 2VVTA 3T1OA 1U9CA 5AICA 4RTQA 5AVWA 2ZZMA 2DR3A 3F2VA 3WGHA 2OEPA 4OHWA 2W71A 3P9PA 4JVNA 3T9FA 1ZEMA 4B3JA 2YUTA 3KKQA 1JKXA 1PT8A 3CTMA 3UGJA 3D31A 3AW8A 3FTQA 3PL1A 2PCJA 4OPMA 3E9NA 3W34A 4RDXA 1UXHA 3IXQA 4DVJA 3GVHA 3V8BA 2BGKA 1RAHA 3OURA 2ZBVA 3ZTTA 3ITDA 2ID4A 3PC2A 3P8ZA 4AJ1A 4IEFB 1TMKA 1J24A 3QU5A 3RH0A 3KOMA 4EJ0A 2V9ZA 4F3TA 3SNHA 4G2NA 1SQGA 1ZK0A 2VKQA 4V03A 1H0RA 1PJ3A 1W6RA 4CTNA 1U7TA 2G8LA 3AJ9A 1RRGA 4OFZA 3VRHA 4EL0A 1FW8A 1LV7A 3L0ZA 2FSPA 2CCJA 2ZT6A 1K5DA 3DS8A 1NJ5A 1ZGHA 3QUQA 4FJ0A 1GPH1 2C7VA 1VIDA 5LZ7A 3PJGA 5DN6A 5ALOA 3G0DA 1LV8A 2CZGA 3GUZA 5E3HA 1JHAA 1W4BA 5HF6A 3ZCRA 2NYUA 3DM5A 3HBJA 4E4RA 3Q6MA 4KGDA 5DBHX 4GKBA 4L4SA 1AKUA 1YS1X 2HRBA 1C81A 5E38A 2QSYA 3FHJA 3TAHA 2BGWA 5JWRA 2NP6A 3BWMA 3SZMA 3C5WP 1XJQA 2OBYA 4JQZA 2AZDA 3E22A 4B71A 3LPCA 1V11A 2KLBA 1XA3A 2OT3B 3NRCA 5SYMA 2Q9BA 2FQXA 2GB4A 1BA3A 3WYGA 3ZJVA 4AZ0B 3ZZ0A 1Y5RA 3VI3B 4TLBA 2Z8XA 1OX5A 2C4MA 1IY9A 2GSDA 3AYXB 1DT3A 2HLDD 3KOWA 4JP3A 5DM70 1YGPA 1ZBQA 2PS0A 3L93A 3NCHA 3PUYA 4GRAA 5CM9C 2PIDA 1R10A 4PIVA 3NUGA 3KBBA 5EMMA 3H7AA 1DKNA 2VHUA 5DNUA 2RGGA 4HLNA 3DZJA 1QDLB 3S27A 3SJ7A 1TJPB 1XTZA 2Q45A 5J2TB 2IYAA 2OD7A 1ZGBA 4ABTA 3OPXA 1DRJA 4MKXA 4GX5A 4RK6A 3H42B 4PXSA 1FFHA 1CEEA 1BYUA 3JQRA 4MTLA 4IVRA 2QTZA 2ZSAA 4EF4A 3QF7A 4Q1EA 1Y3HA 5C1IA 3OZFA 3UJAA 621PA 3JYQA 1XTSA 4KLRA 2PE5A 4L2IA 4NXMB 1TZ2A 4YV1A 5IVDA 4ADSG 1M2KA 1JKJA 2REBA 5CVCA 1YU9A 2BHSA 3PYXA 4H35A 3WOVA 1R6TA 1RTTA 3H5TA 3RU2A 1CUCA 4AJHA 4ND2A 5EJ4A 1Y7IA 4NOLA 1CR1A 1M2WA 3WIEA 4ER6A 2PWBA 2HO5A 2GM9A 3R40A 3LCVB 3HACA 1UPUA 2D00A 1Z0FA 2Y77A 4RM2A 4TWRA 1PKXA 4ZDIA 2AVNA 5K3FA 5AK4A 3MT7A 4XYLA 2ZI3A 4OXNA 5REQA 1RJDA 4JBGA 1HQYE 1TRKA 2CD7A 5DXJA 4RA9A 1CPYA 3TJZA 2GWHA 4II7A 2P2LA 1EX7A 3EWIA 4YJ2F 1NUHA 3HJUA 2QKYA 2QN8A 2H16A 3WK6A 4B6JA 2OGWA 2ST1A 4XUDA 5CPBA 5I4CA 1NTRA 3PFWO 5HJ5A 2AMFA 1BO6A 2F3RA 1FDTA 5E7MA 1QS0B 5I5EA 5JIBA 3DJFA 4RBNA 4R41A 1BGVA 5HUHA 3OOYA 5TGZA 4YAKA 1KQFA 4LRTB 1UPFA 1SCDA 1F2DA 3HCWA 4HN4B 4C9BA 4ZCIA 4F84A 5IKEA 5ALQA 4U7TB 4G9BA 1YFZA 4RHYA 1SB8A 3SSMA 3BDVA 2B3TA 4MV8A 5CT9A 1NATA 2X58A 4HRAA 3LF1A 5KCZA 5KYWA 1ECPA 2AC2A 1UP7A 2BFDA 2I1VB 2R6GA 4CM8A 2PBRA 4WY2A 2I3AA 1UBJS 5DIFA 3TL2A 1B1AA 4PEVA 4Q1VA 5A71A 1N36B 3BB1A 2JIOA 3SC6A 2JASA 1QFZA 3Q72A 4AMGA 1RDFA 4DG9A 1Q57A 2AR0A 5FOVA 1GL6A 4JR2A 4X8LA 1G6Q1 4QVGA 2CXOA 2I65A 3EQ6A 3SG0A 3R9XB 1AMNA 1GSAA 1U1FA 2C2XA 3C4VA 1UPXA 1YJBA 2Q5FA 4XX0A 5JRJA 5ED4A 4FINA 2DB3A 1WW2A 2C5HA 1BROA 3B1YA 4ISCA 3RUHA 3TBHA 3WWZA 1IBRA 1E64A 1HYEA 4TTIA 4ZT5A 5CT8A 1VL5A 1H2AS 5HP4A 4HWPA 2H57A 4OVKA 1PG0A 3ZLBA 5DPMA 4G84A 3K0BA 2YWGA 5ALEA 2NZ2A 2YIVX 1EESA 2XECA 1IXKA 2Q3MA 3FY4A 5BUQA 2B8NA 4LMPA 2TYSB 1DWOA 3DT9A 2VTBA 4EW6A 1KY4A 4OGKA 2P2GA 4F3CA 3S1LA 3AXTA 4KB5A 2UYGA 4NS1A 3MWEA 1P7CA 4M1MA 1OX4B 2CFIA 2W6NA 5EAIA 4WKPA 2IVZA 5DI3A 3TQCA 2NXEA 5AI4A 3A3YA 3TLJA 2QROA 4FOOA 1B6RA 1LDBA 1G98A 1VKNA 1AQIA 2UYCA 4ME6A 5B30A 1CEQA 2ISSD 4OAOA 1YKGA 2D7DA 1OAKA 4O25A 1EVIA 4KITB 5DRYA 3W1EA 3LI2A 2W4QA 2HGSA 3GBPA 3WZ2A 2VDWA 1XVIA 2YHIB 1WETA 1H9BA 3PGMA 3P20A 4CMBA 1FRVA 3L8GA 3LCJA 4CF3A 2JL1A 3SEAA 1VBFA 2HBZA 1UM9A 1Q7GA 3AJRA 2WHQA 3NJ4A 4DV2B 4GM1A 4NYIR 1UC4B 3GOQA 2FB9A 5JVDB 2PSFA 3KQLA 2W6MA 3MMZA 2YL2A 1HYGA 1QONA 1T0JB 1NXQA 1ZUHA 2NU7B 4R8VA 3BXFA 4DQUA 1WB9A 3OE1A 4MJ3A 5DN9A 2EEZA 5F7ZA 5JSZA 1KS2A 3FM9A 5LQRA 1LBSA 3UFXA 3TRFA 1UEIA 4E2WA 4GAEA 2XYQA 1OROA 3BERA 1Y3BE 2BM0A 3HP4A 3IE1A 2QBYA 1BH2A 4DE5A 2VRCA 4KQMA 3FLAA 4WACA 2L69A 2EJTA 1Y37A 2UYQA 4U9HS 3NCTA 5IKXA 3TX2A 3ON5A 1R0XA 1DAOA 3QKTA 2W2LA 3DEZA 3S55A 4F92B 2O07A 3K9QO 5B4TA 4EJFA 4NQRA 2PWPA 1EFDN 4HWSA 1IWBB 1FRQA 3HDYA 3DR3A 1KJZA 2DPGA 3I64A 4KXVA 3OG9A 4GMFA 4PPGA 4YUAA 3KKLA 1DCKA 1TKAA 1RXYA 3HWX1 3RVOA 4B9AA 1Y9EA 1ZQ9A 1KO7A 2PV7A 4WOCA 1FJHA 2E87A 1HE4A 2XVMA 4O5OA 1U1DA 1TUBA 3TI9A 2X7HA 1OHHD 4MMXB 1IQUA 2P75A 5E95A 1NLUA 1VDZA 2WWHA 3TTVA 3CNHA 4KK4A 3AHGA 3NGXA 2Q1SA 3IGFA 4YC7A 4NE7A 3T5CA 5DV9A 3FDFA 3P9KA 4UVGA 5J1TB 1XG5A 4OJKA 1DBSA 1IY0A 1JI0A 1QGYA 3AHEA 1IJKA 2D13A 4H1WA 4MGIR 3U3ZA 3NWPA 2D0OB 5H7XA 5SY6A 4UQLA 3DC2A 5I7AA 3VPXA 2BSAA 5AVZA 3M1AA 4IXNA 1EGHA 3TQSA 4BNWA 1T3SA 2V6GA 3R8FA 1ZIYA 4J2HA 3QEJA 1A9XB 2A0YA 1A04A 1ZD1A 2CMDA 2B83A 2C2BA 2ZJ4A 3O84A 4LUCA 2IU3A 2E5WA 4K03A 4FLEA 2FW7A 5DK4A 2ODQA 1M5TA 1JT2A 6LDHA 4ZZ1A 2P7HA 3WHKA 2IOFA 2GLTA 1N1EA 2G5PA 2VDVE 2WIJA 2OD2A 3D3WA 3KSDO 4OKNA 5BUZA 4DQVA 5AKKA 1QZZA 4DXHA 2EKBA 1P31A 3TUJC 2XKAA 4IZOA 1E9CA 4NPHA 2P90A 1YA8A 3L6EA 1J2TA 4FMCF 4L3VA 4S1TA 3TOXA 1EHIA 2FU5C 1J21A 1TVKB 4G86A 3N07A 4HSGA 5DP2A 1GY8A 4ZCSA 4ARSA 2Q1YA 1TB4A 1NJGA 2CF5A 1KBQA 4FE3A 2RGAA 4I55F 3X1XA 2D2VA 2XNHA 3OJWA 5CUQA 4CMEA 3W04A 3NRJA 2B94A 4Q12A 1Q3TA 1RWMA 1Y3DE 3H5OA 1FFYA 3I09A 5HE9A 3PENA 5C8DA 4GL2A 2IYFA 1KAEA 2HUPA 1KWKA 4KQKA 1Z17A 4FYIA 1HDZA 2PRKA 1F0YA 2L0XA 1FEZA 4I4CA 2PL3A 4E21A 5TARA 2X86A 1XU7A 1IB0A 2CBGA 3QHAA 1OILA 2NU6A 5G1NA 1RWWA 1HE8B 2VDMB 5DGHA 4V0OA 3L7YA 4YCDA 5DGDA 3ZDZB 2CXPA 3IIMA 3QLUC 4HAUA 4K8OA 3ZWBA 5I01A 2X14A 1TPZA 1PFGA 4J75A 1E2IA 1F60A 1RI2A 4GYYA 4IJWA 5ES3A 1CB0A 4RJJA 2CMKA 3DFIA 1NMEA 3UHAA 2DUUA 4XYEA 3UJPA 4DCMA 1JT9A 1UODA 1S0UA 1DB3A 2O48X 2X15A 1KQNA 1MC1A 1JQKA 3G6WA 3MT0A 5F3RA 3ENQA 3BWCA 4GDFA 3QW4B 4M9ZA 1GR0A 3FFBA 4GE0A 5D84A 3QIAA 1U7XA 4XGNA 2DRIA 3T7JA 2VQSA 2NXWA 4OFWA 1JZQA 4YT5A 3R8XA 3IUYA 3W2IA 3Q40A 4UBOA 4B2IA 2HXGA 2WMYA 4K8RB 3S40A 4A36A 2YY5A 3F71A 3DYVA 1EVQA 1U7HA 2OV2A 3NP9A 3H8WA 3SHWA 4IIJF 1ZH6A 2WSSA 1XZFA 2EFHB 4RE5A 3U4HA 5TEVA 1WIWA 3F7MA 5FOSA 2GBGA 3FOAA 3BTOA 4QJ4A 3V33A 4D8UA 3LUCA 2C1EA 3DM9B 1IN4A 2J5QA 3OZ7A 2O2JA 1L7DA 3TE6A 1SBYA 4M88A 4Z3OA 3PR1A 4FYPA 2XITA 1B93A 2OQIA 5L3ZA 3E15A 5KQGA 3FWKA 4WW0A 4MVJE 3GEHA 4LJLA 4PX9A 4BVKA 1EZ1A 1TZMA 4M38A 5K1ZA 1Y4ZA 2FLKA 2QUJA 3IEPA 2QLNA 3VSEA 1Z7WA 2HK7A 2X42A 2CWWA 3S5JA 1PVVA 4GMHA 2O0HA 3GCXA 3EFBA 5TT1A 3UPDA 4D82A 4RQAA 3GG2A 1HWYA 2PN1A 1DTSA 5T7BA 5BUSA 4HDSB 3KCNA 4WN3A 3LO8A 4LGVA 3FCUB 3NORA 1C8LA 3H99A 5IM4A 2A67A 3L6BA 1GA4A 1V39A 4NFHA 1L5ZA 2HQOA 3VDNB 6ADHA 5BNTA 4O2BF 3OHSX 4EQ6A 5DSZA 2FX3A 5FL7A 1KK0A 2NU9A 4HWTA 5K03A 1WCIB 3GNTA 3KJIA 2YN0A 3O8CA 1Z06A 4JGGA 3GXBA 4PZ9A 4TROA 1A8UA 4U2EA 4H0NA 2Z08A 1XC7A 2H06A 3A10A 1MB2A 3ND7A 3OVMA 3PICA 4JFAA 4NU6A 5C1DA 1NNEA 1AHIA 1FCJA 5LYJF 4OY3A 4IDHA 1Q15A 3MWJA 1MH9A 3ELYA 3ROQA 1SUWA 2YDXA 3QUAA 4CKEA 3MB8A 3PNMA 4KIWA 4M36A 5DU2A 1DLJA 2GEVA 1CD5A 1DSSG 2B20A 1V7QA 4JS0A 5F23A 5BWNA 1COZA 2NX2A 5HQTA 2G72A 4MW9A 3P9CA 3V42A 1P2SA 4NZYA 3VA7A 1PYDA 1XTJA 1FLVA 3BMCB 1JEYB 2GJ9A 1G18A 1UWCA 1G38A 3PQEA 2WNSA 3CG0A 4CLOA 4JB2A 3B9RA 4AKGA 3PKZA 3WG9A 4GKJB 1DARA 1R27A 3MAGA 3EXG2 4GPD1 4KRGA 3IPXA 3QK7A 1FFAA 1Y33E 3AL0C 4PG5A 2YYAA 1KI4A 3HP7A 1N7JA 3M5CA 3B5IA 4E08A 4MVCA 4BGUA 3ASYA 4DWVA 3PI6A 4KTVE 1X0VA 5F3WB 3I62A 5I48A 1X70A 5KTNA 2BI7A 1BEEA 3MINA 3SX4A 1EHCA 2X3UA 3VV2A 5CYOA 1E18A 2GRUA 3SS9X 1UXIA 4NOKA 2OQVA 3AVVA 1P2UA 1M6YA 5DHSA 1N77A 3CZMA 3LP8A 4HZIA 4LHEA 4LS3A 4YJ3B 1EZ4A 1RYFA 3G5LA 5DCWA 2BFFB 4OYYA 4NVRA 2EP7A 3RBZA 3W9SA 5BRAA 3ITKA 2W6CX 3EGVA 2O0JA 5FLYA 3W4KA 1RP7A 1M67A 2FX2A 4L4YA 4PWYA 1WP4A 4AF8A 1S8NA 3WLHA 4NBNA 1KFEB 5CH5A 4ZQIA 1FJGB 4GD3Q 4TQUS 3SZGA 2IHZA 2ZUCA 2OAQ1 1EFPA 5EZ6B 2BZ1A 2PV0A 4DYHA 1NN0A 2ET6A 4LF5B 1G2OA 2VJOA 3CF4G 1EI9A 2DHDA 4C5CA 1Z0IA 3TPZA 1NDHA 3JU3A 3L7OA 3J81k 3ODGA 1I4DD 2W6ID 4IQ8A 4BQQA 3DKKA 4MWCA 1O94D 2RB5A 3D3JA 3GROA 2CV1A 1M1ZA 5L6LB 3OZBA 1H23A 2H1HA 2RHJA 5U4XA 4AP5A 3JQAA 3EA4A 3V4VB 5CEJA 3ICOA 2FN3A 3PCTA 1G42A 3A4LA 1W75A 3OUZA 2XY4A 1XNGA 3PNBA 1XP8A 2FR8A 3QXSA 1DIOB 3DEKA 3O38A 3R20A 4GMXA 3AJEA 4HYTA 4UU7A 4PCUA 1UWLA 2PX8A 3AV3A 2JHPA 4Q6BA 1ZK1A 5ERXA 4X93A 3SBOA 2YJGA 4A0HA 4B09A 3N0VA 2D06A 4TL9A 3ZGZA 2ZROA 4ZRMA 1N0UA 3FUXA 1M0TA 4DR5B 4A2WA 2A7QA 3KLOA 3M8KA 2BDTA 2QRNA 1W5EA 2ZRFA 3LBYA 1VB5A 2CK3A 2R4UA 1JA0A 1E2GA 4JVLA 2IIVA 2ZBGA 4L1KA 3AX6A 4EFNA 4FT4A 1FFXB 3LTEA 1GGEA 1Z5UA 2IWRA 4EY5A 4R0NA 5JBIA 4TV8A 3SMVA 3R3VA 2I91A 3T94A 2I66A 3IKLA 3LLVA 3V4LA 4X1OA 2Y71A 4LHZA 4K88A 3CZ4A 2CXRA 2P0EA 4G4GA 4RVGA 2JDID 5KQRA 1DOHA 2AVDA 1ESEA 1ONSA 2G1AA 2OCLA 2R68A 4XQCA 2VHYA 1KZHA 3OZGA 4FD3A 3KAQA 3T54A 2WSLA 3W5SA 4AY5A 2GBLA 1P3JA 4BVBA 1PDOA 3ZQ6A 1WHTB 3SBEA 5JS7A 4N3CA 4JJ6A 4Z8XA 1NKSA 3CW9A 3G85A 1BDHA 1GVHA 2Q5OA 1TDJA 4KXQA 4GLBA 4YFVA 1QHNA 1XELA 1OQAA 4UNIA 4ILEA 3R5TA 3WBBA 5K0GA 1SO8A 1VJTA 3VNBA 1GPBA 1IVSA 5COQA 3BMXA 1AVTA 4JYCA 3N0XA 2WFAA 5E6SA 1YFJA 1TFUA 4EHAA 2JCGA 4DF3A 5KX5B 2ZRLA 4J6FA 4CTKA 1F17A 2JNWA 2NACA 2QLMA 2BGNA 5IN4A 1ZJ4A 5CD1A 2P6PA 5DTRA 2YY7A 1JLRA 1YVEI 3ROFA 2X1HA 3GEBA 1P7PA 3HJFA 2V96A 1D1SA 1T4BA 4L7QA 2JI7A 1LX7A 1VZ3A 4HDMB 1OF1A 4FDLA 1I7NA 2ORWA 4M46A 3V8VA 3L4BC 3LK7A 1LPPA 3F98A 3D8BA 2CXSA 4GR9A 5SYNA 3VBCA 5L40A 4KGVA 4KG7A 1YQQA 2NTYC 3EH2A 2BMWA 3GGGA 4G5FA 4KO2S 3ORHA 1YV9A 4GOXA 3ZLUA 5TR9A 2FTKE 3PV0A 2OO3A 3RB8A 4ZAWA 2QD5A 2P3OA 4CMEC 5BV7A 4RY2A 2UZAA 2JPDA 5FWYA 4L08A 5L95A 1BWRA 3D6FA 3DZHA 2HLHA 3NWOA 3ZHYA 1MAHA 1U81A 4RULA 2VK1A 3GLGA 3RAFC 4FYJA 3H9QA 1K63A 1OBHA 4WESB 3EZYA 4G9GA 2VJYA 3WLRA 2QHXA 2WJHA 3MM4A 3ZXUB 2IXEA 1QHIA 3ANXA 2QB5A 4ZOEA 5BYJA 5DLPA 1KHHA 1JTFA 4US2R 5I8PA 4IIYA 4KE8A 3JAKB 1IM5A 2XWQA 3FOEC 5FR2A 3SR4A 2VOJA 2QQEA 2H1LA 1JIIA 1L1RA 1PWXA 3A04A 3E58A 4N0QA 1ORDA 2I4MA 1SURA 1YQXA 4DCNA 2O7NA 2D5AA 3G0IA 2AKYA 2BTQA 1C8KA 3V2IA 1BCRA 1MIOB 1KAOA 1ZW1A 3I9FA 2P11A 2G9QA 3B38A 3SX0A 2BC9A 3TM4A 2P7IA 3GZNB 5J4YA 4Q48A 4EG8A 1J5XA 3CVOA 3OP4A 3ECAA 3QVMA 5ALHA 3ZD6A 1MENA 3FMOB 4TL6A 5FTJA 3KG2A 1PG5A 5TEWA 1HEYA 1V1MB 2OFOA 4QLAA 2IOFK 2VT6A 1IXYA 1AN9A 1FRZA 2O8NA 4FM9A 1E79A 3RUAA 1EYZA 3ZDAA 2JVKA 9MHTA 3OU2A 1UMCB 2WJYA 4QULA 1U5BA 5DX0A 4NNOA 4LVCA 1HZJA 1E9DA 1UK8A 2V6JA 3H19A 1BX1A 4GZ3A 4X3CA 3ZNNA 4ZGGA 5LD2C 1ZCJA 2IYRA 1K8XB 4IEEA 3HJRA 3WDSA 2R2AA 2IYNA 2O8FA 2DWQA 3V34A 4EPVA 3DMFA 3ILHA 1AGRA 4WVFA 5AXDA 3X1JA 1D6NA 5L3QB 3B48A 4BBAA 4RGQA 3A27A 5LXTF 1NVBA 3BHMA 4LGMA 3PQ2A 5I47A 5HMLA 3CPEA 3NTUA 3MS4A 2MSNA 1K7EB 1IG3A 1Z4PX 5C46F 4ZVVA 5KYYA 5DRTA 2A0UA 2BFNA 1IEVA 1PEDA 4CEJA 3DMGA 3BT7A 5E6UA 3IPCA 2UZ1B 4P34A 2QZ9A 3EIOA 3HTXA 4LN1A 3LBAA 2PMEA 3RFXA 3GZ4A 1CS4C 2Y27A 5K8TA 4XW2A 1DCTA 2PCLA 3A6HA 4G5XA 2QRJA 3OIDA 2MT9A 1XDWA 5DK6A 3PRYA 3EOBI 3HSYA 4J9UE 3F9IA 1P8AA 2CXXA 3E9RA 2JJ8A 3BFVA 3THOA 1F6BA 2GAJA 4P86A 4S3MA 3RHTA 3S2GA 3DEYX 1IUKA 4BNYA 2H65A 2X9QA 2E82A 3QE3A 5D5HA 2ZUEA 1CJCA 3DE0X 1DWQA 1JX6A 4XWWA 4N3BA 4G0ZA 5CT4A 5GMOA 3MQ4A 5JRZA 2W9XA 3ABZA 2WVHA 4P4LA 3EK2A 1ZMOA 3R74A 5AI8A 2VNIA 2FPOA 3A3PA 2RHRA 4TYWA 3BPSA 5LP1A 1I4LD 2VSQA 5ELLA 4E1AA 3EG9A 3RYHA 4C7OA 2IQ5A 4PRZA 3OOSA 4ZYTA 3OJCA 3QXHA 3L7JA 1E1NA 1GSOA 2YV5A 1WRBA 4I5FA 1UBOS 4IIUA 4ILKA 3ETJA 4RZ2A 4UAJA 1U63A 1C0LA 1GSHA 2JH8A 2PKCA 3L40A 3KXKA 3QW2A 4H17A 4LWZA 3RSCA 3JALA 5JATA 1QK5A 1UBSB 2NSDA 2GQ0A 1Z75A 4MWGA 5FBZA 3QFCA 3OTQA 2GH1A 2WPDD 1PT6A 1TZKA 2AJ8A 4GYJA 3USES 2I4OA 2GMWA 5EVJA 2ATEA 4BB6A 4DW8A 1ZU5A 2X0KA 1KZGB 1GA1A 2FW8A 3CF6R 5HQJA 4NMHA 4BTLA 4J7XA 3F97A 3IA2A 1W36B 1RWBA 3NBFA 4XFJA 4BAZA 4P3YA 1N2JA 2XOEA 3NHBA 3IPRA 3M5WA 4KUEA 5FT9A 3WNVA 1MJHA 5HTOA 2W00A 3COVA 3DEAA 2WQ7A 3INRA 1Z08A 1PT5A 1M6HA 2JJYA 2I62A 2XHZA 3BXXA 2OWDA 3OJEA 2FZ4A 4AL4A 3WLSA 3FHCB 4D57A 2WWTA 3CLUC 4FW9A 3EF1A 3SF8A 4OQQA 3ROXA 2B82A 2PPLA 1SFRA 4RV4A 1LXCA 2B61A 4OG2A 4IXDA 5CIYA 4ALLA 3FPSA 5IAAA 3ETGA 4D9IA 2PUWA 1GNRA 3N74A 3E22B 2PGAA 3S1AB 2GASA 1VKOA 1V11B 2BLNA 3I53A 4HK4A 2BAGA 2NT4A 2Y4NA 1QFJA 4MWSA 5KVQA 1Y6QA 5BW8A 1ADFA 3OA2A 4AC9A 3TSAA 4ER3A 2QZSA 4Q0MA 1R4MA 1RHUA 4QOJA 3KEQA 5JG7A 3RSOA 1IN1A 2FLWA 2YYSA 1QIMA 4WNIA 3C7AA 2F8SA 2XRFA 2PX6A 2BHTA 4HWRA 4L8FA 4TVKA 4EA8A 2B99A 4O08A 4DIMA 3BEOA 5F12A 2XCIA 3HSSA 3GLHB 3TOSA 3JQBA 5CX4A 4YQZA 3LW8A 1J0EA 3EVAA 2EIHA 4MW7A 2A9JA 1IRIA 1U94A 2ZXEA 3MQ2A 1W59A 4D1YA 3ZZMA 3RVNA 4LNAA 4Q7MB 2X4GA 4OGLA 5F35A 3ZLJA 1Y7LA 1QFYA 1JYFA 2Y2VA 3OCZA 4LXIA 1W48A 4RPJA 3GJZA 3BA6A 2AOTA 3NNSA 4MKIA 4AY4A 1J5EB 1PNRA 1HY3A 4MIOA 3GF4A 3OP1A 4G0YA 1Z6GA 2J67A 6GPBA 4H60A 3RS3A 5DHRA 4XLZA 3HB7A 4F6CA 1D2GA 3D3KA 3NTLA 3SKVA 1X86B 2OCYC 2M6LA 2FR8C 9LDBA 5KNBA 2Y6VA 3R9KA 1DAEA 2IYLD 3L1VA 4UTZA 1T2FA 2JI9A 4AJLA 3N5KA 1W1IA 4B32A 4L2IB 1LX6A 1R3UA 5C35A 5AJZA 4LJYA 2HMAA 4HQRA 4TMZA 4QT0A 3WADA 1LPAB 3WSVA 2C31A 2I0FA 3EWAA 1MRSA 3LNCA 4EHJA 1CX9B 3I45A 3DOEA 4LGCA 3TCNA 3B85A 3H9BA 1PZXA 2J3HA 2QPTA 4MYDA 4WADA 4DMHA 3D4OA 2B9VA 1WV1A 2QE7A 1C7EA 1P1IA 1RWOA 3DKVA 2D59A 3GCDA 3GQVA 4LYDA 1UDAA 4M1WA 5E2IA 2Q3JA 3EDQA 4IMIB 2I4NA 2O0MA 4RA9B 1ISMA 2HIAA 4B6OA 4EG0A 4EHLA 2W2OA 1UFVA 5IJ0A 2Y67A 5KNCD 4KPYA 3RC8A 2QRQA 4LF4B 2ZYDA 3JQ9A 1ZNWA 2GBLC 2D7CA 3JYPA 2Y93A 2H1OA 2UUOA 3EGDB 3OI7A 4IMJB 4MQEA 1QK4A 1FUEA 2XUHA 1WPGA 3VYTB 1C3EA 4P58A 3RRMA 1LTQA 4UU8A 5AFSA 3ICQB 1OXBB 2YCBA 3SC2A 4BV3A 1MB3A 3TIFA 2VK2A 2FWPA 3AR2A 1DAMA 2R96A 3H9UA 3FKSD 4KXFB 3VO9A 4LK3A 4KTTE 3UATA 4LY6A 5CG1A 2CBXA 2DX7A 4PE5B 3O8QA 4P35A 1XZEA 2NNWB 3R7AA 4JCOA 3UJ3X 5HS4A 1NVGA 3YASA 5AW6A 3WKCA 3BYZA 3TZCA 1V7CA 2JHGA 2VYVA 5KYWB 4CM8B 2BFDB 2JI6A 4JX8A 2JRCA 4J4HA 3QSYA 4NNPA 3PXXA 1NFQA 4JK3A 4P5DA 4BX8A 1SXIA 1G0OA 4OP2A 1Z5ZA 1V8PA 5AJHA 3ZK9A 5EJ7A 4IJQA 2EYQA 4BVLA 5EUCA 4KLCA 4G8DA 1Z2AA 5ADVA 4G97A 3KRTA 1X14A 4NWIA 3ZHBA 4MO2A 2OZVA 4G0WA 2H51A 3KSAC 4FGUA 3PUWA 1QB8A 1CUVA 4WOKA 2INGX 4KN9S 4XX0B 3G02A 1DVRA 4EPTA 3Q7TA 4RF5A 1RE1A 4ZO7A 2Q0SA 1WMDA 3DZ8A 3T9AA 4EX6A 5LSAA 3DONA 3OE4A 3HXKA 4AP6A 4OHXA 3CZ9A 4ZQGA 3U61B 4QTYA 1SELA 1XYGA 5KNLA 5AW0A 1MVLA 4OAQA 2VJBA 4MVJF 1MJGA 4NABA 4RIEA 2BFMA 5U9CA 1C2TA 1KMNA 2P2SA 3V8RA 2GKSA 5I7RA 1TAHA 1E58A 1A4RA 3DWIA 4MZDA 5EXTA 2XQVA 4Y1EA 2X5KO 2VTBB 3DNFA 3K0CA 1DQYA 1R8SA 5LQNA 1EIZA 4WNCA 1F6WA 3DGFC 2IYWA 3T1YB 1U3UA 1DEXA 4A16A 5C5CA 3MWEB 2DEUA 1DAKA 4N01A 3JVUA 1YMQA 1AF4A 5KWJA 1XZIA 3MIZA 4OSEA 2QENA 2J3EA 5DI3B 4YTEA 5GONB 1P8JA 1TCCA 2HSJA 3MAAC 3F49S 1G8FA 3I9KA 4GX1A 1X1QA 4PZYA 1IRXA 1Y48E 1YGYA 3WLJA 4QT4A 3LOQA 4WKGA 3NOQA 3A0RB 4RZXA 1CF9A 4REMA 3RVLA 1MCZA 2JLCA 5TSDA 3CN7A 3CRMA 3AEUA 3KPUA 3N6RA 4ZPXA 3T7CA 2PAAA 4JP8A 4M7PA 3WP0A 5A04A 1P7YA 4FDTA 2VDWB 2WUGA 3WGNA 1CS0A 1WCV1 3LLMA 1Q7RA 1M54A 2XKBA 4TOIA 5DM4A 5C80A 3F67A 3WJ2A 4JV5B 5AVYA 2IEAA 4QU5A 1SXJE 2PVCA 1UM9B 4ZMRA 1IBCA 2P79A 4YIKA 1EGAA 3AMVA 1E6UA 2KBEA 1RXUA 4WK0B 1AXEA 5SZIA 3FCOA 3RV4A 5CITA 1GPUA 1R6DA 4RKFA 2BZ0A 2VDNB 4G81A 1H2ZA 1D5CA 1Y63A 1G3QA 2GZ2A 5TF0A 2ZIGA 2JLAA 5IUKC 3E9CA 7GPBA 3L41A 4J0FA 3IUNA 3R3YA 3IV7A 1R18A 1SCUA 3QTTA 4JVMA 1XFAA 4Y9SA 5FOWA 3UFXB 5A3RA 1HUQA 4Q5IA 5K09A 2C00A 3MUFA 2RAUA 1G6OA 4QDOA 2FFBA 4Y8VA 1DEAA 1QO9A 3D6MA 3Q2KA 4Q9DA 4WCDA 3R7SA 2QBYB 1RYEA 5H3LA 3WB0A 4C4XA 2H00A 4H1UA 2FOLA 4UD6A 1T1GA 3L0DA 3SIPA 3M6XA 1SC4A 3UB2A 2CV2A 4LF9B 3VTKA 4JI3B 4NENB 1N25A 1QBKC 3B1FA 2H8KA 2WLSA 2Y66A 4MDYA 3R75A 4B6GA 1BFKA 3DW1X 5LLTA 1K5PA 2VRWA 3RTAA 1FY2A 1AX9A 4C3VA 1BJTA 5AXAA 3TZ6A 2VT7A 3SIWA 3KYJB 3L92A 4IJKA 4RVDA 3V8MA 4BVAA 1RLUA 2Y1OA 1V6SA 3FR7A 4BO5A 3EUEA 3NTVA 1V48A 2RBGA 2HA7A 2W90A 3P27A 3UJ7A 4NP6A 1BRMA 1V3QE 1W4AA 2FR1A 1UBRS 4ZALA 4C7BA 2DTXA 5FQNA 3LK6A 3LWDA 1Y82A 3UHJA 3GJ6A 1OBFO 2QRKA 4RJTA 3VOAA 3PGLA 1KC1A 4RDIA 5AW3A 3S7ZA 3OAAA 3O95A 1H4SA 1MC5A 3QNWA 4GZMA 5K4GA 1SKMA 1WSWA 2V1XA 4QVKA 4Q01A 4WBSA 2X77A 2X9GA 3G2KA 4FKBA 3CGWA 2TECE 2J7PD 1ZJZA 4JITA 3C45A 4BVHA 2F8TA 1KR2A 1MT3A 3W78A 5D3KA 1NW3A 5AW9A 5KVCA 2H7XA 1ISJA 2C83A 1JXQA 2NO6A 3PHIA 4AJ2A 4CF5A 5BQFA 4FVTA 2A4MA 3L4JA 1NBME 4QBTA 1CNFA 1ONNA 1BEUB 1MRZA 1ZL2A 2ECFA 4FLFA 3WL4A 4KHZA 5AK5A 4X8OA 3TMYA 2OZLA 3JV7A 3PPXA 2F48A 1HYQA 3SBDA 4H08A 2CKMA 1TIKA 2H5LA 3FPJA 4J29A 1NN3A 4GFDA 3LOUA 3M2TA 3ZOKA 1KGSA 3RC1A 4D79A 3OLZA 3D3WB 3H86A 1YASA 3OD5A 2GA9A 2QV7A 3DHVA 1JHQA 4W1SA 1OTYA 2V8BA 3A2LA 3W8NA 2AFHA 5I9IA 4DXAA 2V3WA 4DEYA 3IALA 3SYRA 4BQOA 4WERA 4G0MA 4Y2VA 2DQSA 3GYBA 2ZE6A 1XA0A 2ZRCA 4UDOA 1JLKA 3S2UA 4PLTA 4RJLA 1XYVA 2I2FA 2DWUA 3WYEA 4WFJA 5IBRA 3AZPA 3LUKA 4J1TA 5ALUA 3GLUA 3F4LA 3PGKA 2EYUA 3AUUA 4YI5A 5E1DA 3CEPB 1ZISA 3BUSA 1UMKA 5ENZA 1KP9A 3MBOA 4NQZA 5JALA 1MFZA 3NZEA 4ZU6X 5GV8A 1IJEA 1K3TA 1O0SA 3DLHA 1O97C 3GRRA 1O77A 3LUAA 2X23A 1KEZA 3QHQA 3THWB 1I0ZA 5DSXA 1L1EA 1W1WA 3I05A 4OBWA 5B4VA 4RD2A 3IOBA 5FR1A 1XDGA 3DTVD 1XUOA 3A6ZA 3QOFA 3R5FA 1YT5A 1JJFA 4B73A 3G8AA 2R00A 3HDGA 1NBAA 1DWUA 5CB0A 2WSBA 4AJKA 1FC0A 2AYXA 5BSFA 3G79A 3JQPA 4R1MA 3JQBC 2V1UA 2ACWA 2Q46A 2G5TA 2JGDA 3DZGA 4UMDA 3BICA 3E05A 3TRIA 2ATXA 1Y8ZA 4RVNA 1KOJA 3UB3A 1NRJB 3TLEA 4WLEA 1ZMRA 4MHTA 3NNDA 5LD2B 1PTKA 4JJZA 1E2UA 5FHRA 3GJ3A 2R11A 4OSOA 1WX1A 1B8PA 5KNDA 4JNKA 2BH9A 1WWKA 2AJLI 1VPWA 3LIPA 4EG3A 3AF6A 1SY7A 3TLYA 1YJ5A 2JLZA 1KHTA 3ZU4A 5TNXA 4C6TA 1VBKA 1J8QA 3VZPA 1JJVA 4R5MA 4WQMA 3HUDA 4DIBA 3KU1A 3H7IA 1C14A 1N5KA 2I99A 4HEHA 5CLQA 4ZKEA 1T3TA 3TSCA 5HJ7A 4B4VA 1V8OA 1EUQA 1UK6A 4ZZ3A 3ETEA 5KYKA 4YCLA 3SXPA 1L5WA 5FA6A 2VUTA 2R8PA 4KVFA 3CZQA 5DW0A 3GJ8A 4JSTA 4K6MA 3ZDCA 1CRPA 4TKZA 2ZVDA 5J2TF 5CXQA 5ARDA 1PR0A 1NBWB 5E9AA 2GAOA 1F9AA 4W1PA 1MB4A 2B0JA 3NT2A 4Q02A 4BXOA 3WGLA 3JS5A 4BJ5A 3DF7A 5HKLA 4LOIA 1R8QA 4M0PA 1SULA 2KS6A 2NUTA 2QWXA 1N34B 3I6BA 1JWLA 4YECA 1ZLYA 1UOEA 1XSEA 3JQ9C 5TS2A 3JTEA 1ADBA 3CSUA 1EXDA 2C2ZA 3HN2A 2H59A 2W93A 1T13A 3W8RA 2HA4A 1IONA 4EQ6B 2V4MA 4AN4A 4TXJA 2IKQA 2Z5LA 4GI7A 2AMYA 1Y1PA 4GH5A 1KPGA 3LYAA 1YR7A 5BNFA 1T8YA 1QIFA 1M8FA 2D74A 3TCKA 1YAJA 2I03A 2CNLA 5K0NA 5L7TA 3K71B 1QZXA 2OPHA 3ZW7A 3KB1A 4M98A 4Q9KA 3ZWAA 4CKCA 3N8GA 3BFXA 1TKRA 3CXUA 4WXMA 5BWBA 2JGLA 1YZFA 2BFPA 1ENYA 2EDCA 2PDAA 3BK7A 3Q3EA 3R5HA 4S1PA 4BASA 4CKEB 3MSCA 4JUCA 4DUZB 1SHZA 1TW3A 2VZEA 2DT8A 3MSXA 4MPPA 3OEYA 4BMZA 4DLAA 4E2XA 2BDEA 1Z73A 4D3FA 4I3GA 4KBFA 5EEGA 4RHXA 5KYXA 4R9VA 1E9SA 5H83A 4BQRA 1KEKA 2I7XA 2C95A 4JI5B 1NX9A 4K0KB 4NE9A 2PMWB 1ML4A 4CLOB 2D6FA 1VJRA 1NI5A 1O3YA 3X1DA 4CM3A 4E5PA 3RPEA 4D4MA 4CIWA 2DETA 1US8B 3C5CA 3O47A 4B4DA 1HLPA 2EP8A 2YN4A 2WJZB 3BD6A 4NU8X 4PGFA 1CNMA 3FHOA 1KFCB 5LZ4A 2QN6A 5HNKA 1Q1QA 1X1BA 3L7LA 3IR5A 4LEIA 5HIKA 2PBLA 4G85A 4HAXA 2A59A 2SKEA 3VOSA 3AJ8A 3P71T 3P4XA 3MINB 4UZFA 3KE8A 1QF9A 1GAXA 2P6UA 3UEOA 2H7YA 1F0NA 1ABBA 4IQFA 3TPCA 2OXEA 4QTTB 4QAQA 3RIXA 4RF2A 3BQ9A 4RY0A 3CINA 5CJ2A 5IWAB 4PYMA 2QVXX 3FSEA 5CVDA 2RKOA 1SBNE 2AR7A 3L8YA 4XWAA 5HCUA 3WK7A 3AFNA 3GOHA 1LBQA 2DM6A 1KEPA 1KDTA 2DU8A 4WBXC 4I50B 4PFQA 1K6JA 2B1GA 3K70C 2OZPA 4RMNA 5BR8B 2ZE5A 4IV5A 1EFPB 4MV7A 3RJMA 5JASA 1LPMA 4CI0B 3QOXA 1UMBA 3PPIA 1C4WA 1NWCA 2HOQA 2C4KA 1TJNA 3NKVA 5EJFA 1Z5WA 3BRSA 3KJEA 1QUFA 4R8KA 4V2UA 1ONBA 1YL6A 4QYMA 4CM6A 2VWHA 1VLHA 2BPOA 4MDHA 3QU4A 3BKXA 3NGLA 1DWPA 2PRSA 4QBIA 4UNPA 2WY2D 3VPBA 3AHHA 3A6EA 1JJBA 1UCFA 2FMXA 2EX1A 3CWZA 1E20A 3IOEA 2P77A 1ODJA 3B6KA 3JQAB 4PGMA 5COBA 1JR6A 2HJHA 2OO7A 2XWSA 2ZAOA 3A6JA 5A9TA 3QEKA 2WR8A 3OEWA 1UBMS 4DHEA 1AT1A 2IELA 4W63A 2R7MA 1O6CA 2FNAA 1Y42X 3AI2A 3CUVA 4MUMA 1QAQA 4FHEA 2YVUA 2IIQA 2C2HA 2OMKA 1K0FA 2B9EA 3V4PB 5JAQA 3MYRA 3RT7A 3GO4A 3T3IA 2XWJI 3I5MA 5LKAA 1U1IA 3UUFA 1RPJA 2HJRA 5BW6B 1JW9B 1YQEA 2CZCA 3BD8A 3FNHA 3PHLA 3GLSA 3K9BA 3RHFA 2OG2A 3DDSA 1HE1C 2C2WA 3MUEA 3OLYA 1QP7A 4V0LA 2O6LA 4MTCA 2IXDA 1SUSA 2P9YA 4OQDA 4BZQA 2ZULA 4ZI7A 4HEA6 2RGUA 5BQXA 2EQBA 3IP3A 4ZV9A 4A92A 2IBTA 5AHRA 4BVEA 3D6JA 3QH4A 4PS0A 5JVDF 3OCVA 1A4UA 3SHFA 2FE1A 3SZRA 1CFJA 3GJSA 4F7WA 2CLLB 3HVUA 4RYLA 4Y6QA 3C15C 1AQLA 2DPLA 2IYZA 3PNOA 4EBFA 4KQFA 1WXFA 1E9FA 4MDEA 2C7RA 3KKOA 4ON9A 4GKKB 3SQXA 4E14A 4NR0A 3WLPA 4BNIA 3IB3A 1JQ5A 3V46A 2BGJA 1FX1A 2VPTA 3O5AA 4FTWA 4C78A 3R5SA 3W8DA 4N8DA 2CMFA 3ETNA 3EEFA 4TL7A 3V1KA 4G1VA 3VU9A 3EZ6A 2OQRA 3T7AA 1N33B 3T1NA 5E6SB 3TJMA 3GR6A 5C3UA 2YVLA 3IDQA 2BMJA 3DMDA 4QO8A 3FCAA 1RMQA 4QSMA 3USCS 1SUPA 1L7VC 5TQ0A 3UT0A 2ORED 5EINA 5IKMA 3BIXA 2AF3C 3G8BA 4R05A 4UUQA 3HNPA 1OXUA 1U4NA 4BMVA 2A78A 2NZJA 4ZC1A 1N5OX 1JIVA 4JMPA 3AIIA 3A3KA 2J45A 4LBWA 2NO9A 3RS0A 3E5MA 2CW5A 2XUGA 1E2FA 1T9DA 3JQ7A 3O21A 3ZDEA 5JYEA 3PPYA 1I2ZA 2HF8A 2YY6A 3EIEA 3GLHE 1FP6A 3TPFA 3R2JA 1M33A 3ISJA 7ABPA 4AKHA 4YRCA 1SH7A 3IEXA 3HKCB 4K1LA 1G20A 5CNMA 3KKKA 4UOZA 3FFXA 3RCBA 5EKUA 4J1TC 1U90A 4K9PA 1KMQA 4BQEA 2C78A 2WFZA 2ZT5A 5DISB 1FL9A 1PK8A 4CL3A 3IKMB 2G63A 1U2QA 1QYRA 3BCSA 3IUJA 4RO0A 3GRUA 5FBKA 2NPFA 3SQLA 1EJ6A 1IDOA 2QX6A 2WIFA 4DHWA 2ZXUA 4ZQEA 1XZDA 5KMGB 4CCYB 1XZQA 4Y1FA 3CLKA 4IXTA 4Z4GA 2OAP1 3DB1A 5ESRA 2E1PA 1X1RA 1SB9A 3LP5A 2BKVA 4LCBA 3W4IA 5EXEA 4HDNA 2FR0A 1SBZA 4Z7QB 4DLPA 1CRLA 1UDWA 4FCVA 3QUBA 3TEMA 3EPLA 4ZQCB 4F21A 5E8RA 2YOFA 1E2BA 5AK0A 3L6RA 1L4HA 2VTVA 2X13A 7REQA 2GT1A 1YZYA 5LA6A 1M1XB 3MF4A 5B57C 2QU8A 4Q7JB 5JLAA 3S4YA 3VKVA 3VDQA 2VO1A 2VDKB 2HD4A 1PWHA 1E3SA 2G9RA 4KHPB 1G59A 2XDQA 4NCKA 2VT2A 4B79A 1OAAA 2QUAA 2CZQA 3INNA 1H65A 3OQPA 2WMOB 1U5BB 2OG1A 3U56A 3UQZA 3T7KA 2C9YA 2I2AA 1DHRA 1CKEA 1QAMA 1XEWX 4HXFB 4MKFA 3ZI7A 4DQKA 4DSNA 2OBLA 1TF7A 5J59A 2H2GA 2O8FB 1YJ8A 3TB4A 1FS6A 1MVNA 4NBUA 5DXAA 4JBIA 5DHPA 4L0MA 5LLSA 3GL9A 4KWHA 1CVLA 4ECAA 4AQ7A 1Z6AA 4P2GA 3UCXA 1U0SY 3I1JA 4EG7A 3L4EA 3UTCA 4QXOA 1KO8A 1JFVA 1QO7A 2JZCA 3BGWA 4KAAA 4NY1A 4QC2A 3A4TA 1NQTA 2WHXA 3GLIA 4NCHA 2F2TA 1L5OA 5KYYB 3NAMA 3B2QA 4CEJB 2DCUA 3GGCA 3IT0A 5E6UB 5BQPA 1JHPA 2AUMA 4ND5A 4L5IA 1X87A 2NTJA 1VRCA 1GDDA 5IKOA 1SVMA 2EX4A 2YQ5A 5G3ZA 2XLBA 3QWIA 3M3DA 3L79A 2SKDA 2BMFA 1BX0A 2FSVA 2UUBB 2QRUA 2WVAA 5A0VA 4MR7A 2R79A 3NEJA 1JKMA 2BOVA 1H0SA 4P53A 2OOSA 2VP0A 4DA9A 1PHRA 4W5WA 2YWJA 4MGKR 2UUPA 3PSHA 3FAKA 5HA5A 3STYA 4L74A 4UDXX 4F2HA 5CDHA 4KPEC 4YRMA 2F9MA 4Q03A 2GN6A 1E2QA 1JMVA 3QXCA 4N5IX 4TWZA 2GM3A 5KJEA 3T7DA 3ZVLA 1JAZA 2Q4RA 3ZIUA 3KKEA 2C7BA 1I4OA 4A5OA 5CTAA 3AO0B 4Y2JA 4BECA 4QXQA 1UAAA 4FYKA 4EYOA 4Y9DA 1R0ZA 3DKRA 4MVJD 4UBIA 1SKYB 1PN3A 4FXOA 3C3DA 1ZA2A 4NICA 1IMOA 3W5DA 1C9DB 1V37A 3QITA 3GXOA 4F6RA 7YASA 2B6NA 4KX3A 4PBSA 1NQUA 1CNEA 5DHFA 5LL6P 3PKJA 1RLIA 1N8TA 1HYHA 4I2VA 4YCBA 5EXPA 2QY9A 1ODCA 2G4CA 3KYBA 4X7BA 1SOVA 2HA3A 5AVVA 1NUPA 4I9FA 6PFKA 5JNTA 1TJ3A 4G8BA 4XPIB 1QU2A 5CGQB 1Z8FA 5CCDA 4IH4A 5SY9A 1KP3A 4JI7B 4LC1A 4NAVA 3DQQA 1Q16A 2FEPA 1I6WA 2B8WA 2Z5GA 1GZHB 1VBNA 5D1HA 2PUBA 2XXAA 3O3NB 4C0QC 2XB8A 3SF8B 3VZSA 5JCJD 4PQFA 1E6KA 1R66A 3Q5GA 4BJ1A 3N8IA 4J0DA 4KQWA 4IG9A 4C22A 3E3AA 4XVQA 1GQQA 2G06A 5DLYA 1ZGCA 4G4SO 2GETA 3A4YA 1J23A 1AGNA 2GFIA 4C6HA 4O4IB 2RJ3A 3V1MA 4CQJA 2IOHA 3H1FA 3M89A 1RSZA 4DNXA 3WXMA 1T2DA 1R4MB 1JHYA 4M9QA 1DX9A 4QQ8A 4D25A 1VG9B 3LGSA 1IM2A 4JLMA 3VNQA 4DV6B 3VQTA 4P3PA 3PNYA 3JRWA 3LNTA 3QBDA 4NZMA 4DZRA 3M6LA 1N4DA 4JROA 1RVDA 2Q3HA 3ENNA 1QTQA 3BEDA 3BC1A 3DL0A 2GD6A 4JJGA 3WE7A 2O8EB 2XTMA 3H84A 4K9LA 4P7JA 4OAPA 1PUJA 1WBJB 2A9KA 1R4AA 3N05A 2HGZA 2ZB3A 3D6TB 1AS3A 4HB4A 4LOAA 4A0GA 1DIHA 3ETDA 4QGSA 4WBNA 5KSYA 1XLTC 3IP5A 5EUMA 3H1AA 3RNOA 5G41A 2AOTB 5LJLA 3WFZA 3MILA 5ENVA 1EFRD 1LS1A 3F5SA 3M7IA 1BMFA 5D5PA 4YJ3F 3EULA 4XR4A 1ZS9A 4UXHA 3TD6A 1O94A 3MUNA 3QVUA 3R0JA 4GSKA 4L8YA 1N0WA 1EX9A 1GEGA 1SUFA 2HMUA 2VIIA 1RAAA 1E5LA 1JNXX 3HL0A 4IIHA 5HHTA 4FOSA 2IS6A 2XDYA 2J3MA 1J42A 4BKOA 1RM5A 3ANTA 4ZCMA 1X2EA 3L7CA 3LY7A 2VUHB 4I4TA 3QENA 1HBJA 4BHTA 4EUFA 3HG7A 4YLYA 4ZVMA 4F3KA 4GG1A 2JFQA 3OU6A 4B43A 1MN6A 2DH5A 1E66A 3NIFB 4E07A 4ZHQA 5A6SA 2JBWA 3H4MA 3HBFA 1XRNA 3JYNA 3L7KA 4J4BA 4DWWA 5KU1A 4EKDA 4V39A 3EWNA 1GKYA 3D2AA 2WF8A 3NBXX 4MGHA 1GQYA 3CX4A 1T34A 3E0QA 4UEOA 3KLPX 3DOOA 5ITZA 4UHBA 1ZJ5A 1W0CA 2YH2A 1EH5A 2BISA 2HIGA 5E1MA 5ALKA 5T5QA 5EHZA 1PNVA 1U5AA 4TS4A 4JC4A 3STTA 5IJ0B 4BN5A 1A9YA 2WKSA 2ECPA 1RRMA 3AKYA 4GT1A 2IWHA 3TM5A 4DTCA 4WY8A 3FGZA 3CONA 4OP3A 1KS9A 1MQ8B 1YWGO 4MQEB 4NFSA 4ETWA 5BMVF 4FI3F 1P77A 2JDIA 3FYCA 2DC1A 3NAZA 4MQBA 3PFKA 4G5SA 4W5QA 1CYEA 4UPDA 421PA 1A9QA 1UWKA 1P4RA 2UDPA 1ZITA 2XB9A 4J6EA 3SC2B 4MINA 3W1WA 4ERNA 3K05A 1RHKA 1FDOA 3VSAA 5JFGA 5DNEA 3ONVA 1CR0A 2ZWAA 3B2NA 4XFKA 1A71A 3DHWC 5DTEA 2C9ZA 2R86A 4KPFC 2W6PA 4L4UA 5D00A 3SJZA 3WKDA 2LW7A 1XA4A 4ZANA 1OMOA 3T6KA 1EG7A 4XPZA 2CDCA 2VJLA 5JROA 1PGPA 2ORVA 1J0XO 5IBCA 4CM9D 2FXVA 2F1KA 1PLKA 1Z68A 1GN8A 1PS0A 1BJKA 4QJIA 3IQZA 4CQMB 1AO0A 1KIFA 4QG7A 5M34A 1ZCFA 1T5LA 2I2DA 3B6EA 3UGKA 4CU5A 4DY6A 2A33A 2F8LA 1YZ3A 2RI1A 3GT4A 3P0EA 1BDIA 1G5PA 5F9MA 1S3IA 1GITA 4BEJA 1ESMA 4DUGD 2V7PA 1V6CA 4NAHA 3VC7A 2EARA 1N7IA 4MW6A 4QEZA 2DUJA 4YLEA 5P8WA 3UV6A 3AZOA 2J0QA 2OUIA 1X39A 1VMKA 3F7NA 4KREA 2F1HA 1QCDA 1ZSYA 4XUGB 3O3OB 4G1MB 5EKSA 3T3MB 1ZM3A 4E2FA 3PEEA 5KJCA 2QRMA 4DLUA 4RAQA 4A82A 3MJSA 5KPJA 4GMDA 1HT1E 4C1BA 4DB4A 4CQNA 4QBHA 5KX5F 1OASA 4GEGA 3I5XA 1C41A 4KGZA 4EMSA 3KQHA 1WW8A 4ND3A 1J6UA 4Q19A 2I67A 5E0KB 5F1PA 5IJXA 2MCFA 4EKYA 1E1LA 1Y5NA 2Z43A 2JB9A 2VCHA 3LQKA 3M6IA 3M9XA 4MKGA 2VHVA 1YA6A 3AVWA 3C16C 2Y1XA 3H5VA 3NHLA 2MIIA 1AQNA 1E6LA 1YO6A 3UWPA 4EF5A 2G0TA 4KP7A 4Y30A 4ZAYA 3CMCO 2ZI9A 2P40A 2RKWA 3BRWA 3CWQA 2Z4RA 3AEUB 4RSRA 5A03A 1RU3A 1VCHA 4D0NA 4G5HA 4ROSA 5BV2P 1T2UA 5DGTA 1Z6TA 1PJZA 3O1IC 1CS0B 1Z2OX 5G0SA 5K0ZA 2EEPA 3EN0A 2RE8A 3FYUC 2PWZA 2XOKA 3CYFA 3LO5A 1ZCZA 1SBIA 2AEJA 2OV1A 2ZAGA 1XTBA 1PR5A 3PHGA 1ZUD1 2CCKA 2WRZA 3NJRA 3QYFA 3EZ9A 3IHKA 4RF3A 1ZOOA 4DARA 3DMNA 4LXYA 1UDCA 1GTZA 2QTHA 2GDZA 4HVCA 4DUPA 5IDQA 1H4QA 4DLSA 1FP1D 2O52A 2OCIA 2A5JA 1NJ8A 4G65A 4XIJA 3SGLA 4C03A 3BJIC 3LY5A 2WIDA 1BS1A 4H1HA 4DGSA 2WILA 4KBGA 1LJLA 4LXGA 4QUGA 4CMIA 3U0VA 1PR3A 1NOJA 1SCUB 3ZWXA 4UHCA 4BV2A 1K7SN 1CZNA 4DYVA 2I4RA 5BXYA 4HVTA 4YYZA 3WKAA 1Q14A 3ONFA 2WWIA 1E2EA 5CA0A 3KR9A 4JP2A 3L4KA 1MNAA 3NHFA 3A1TA 3HEAA 3MXTA 4K9SA 4NE2A 1N9ZA 4C4ZA 4QAJA 5EJ5A 3L18A 4JA0A 1P2DA 4YJ2A 1AHNA 2YW2A 4DSAA 1RQRA 1V8FA 5HF8A 3D6HA 3QOYA 4BU0A 1J00A 1QIDA 1EFHA 4IHJA 1TZJA 1B14A 1R6UA 2MYPA 3FNFA 4QGBA 1E8DA 1G9TA 2GBPA 2I76A 4P4UA 4MKZA 2JC3A 4QBKA 3FOCA 3CVXA 4JXZA 4QPCA 1G8KA 1BXRA 1YTLA 2WUDA 1LF5A 4CCSA 3H04A 3Q3JB 2FSVC 2PX4A 5AKGA 1AA6A 1QH9A 3G82C 5BPHA 3WWCA 4NZNA 3F6RA 1A50B 1Y89A 5HJEA 3QMWA 2VJMA 4CEHA 1ZH2A 1X6VA 4IEIA 5AD1A 1XWIA 5IUNC 3VNUA 3JRNA 4L8GA 4GP9A 5C1PA 5GJBA 1ZK2A 1XZLA 5CCEA 2R5WA 1PS8A 1NZFA 3H9JA 2X1VA 2P41A 4FN5A 3SC3A 2V7UA 1L4GA 4ZICA 3HJTA 2WJWA 2HTEA 4NYJQ 3RRXA 1O95A 3T4PA 1QGDA 2VLIA 3RKSA 4DLVA 1PT7A 3CKMA 1LPBB 2XIQA 2WFMA 1F2TB 5LLDA 1LSOA 1CB7A 1YCHA 1B3BA 1GZ7A 5JJCA 3BDAA 4FFDA 5JD4A 5HIAA 3K0FA 4HEJA 2BTOA 2WOJA 1H2RS 1KVTA 3BXOA 4LOHA 4M1EA 4M0UA 5I4KA 1I51A 4OQEA 3EBLA 3D3EA 2XMPA 3O03A 2I6XA 1VE1A 5BSUA 4DLZA 2C4TA 2OZLB 1A7JA 5FUVA 2V5UA 3BB3A 4FGJA 2TMYA 4GECA 4IG4A 3I58A 5TPWA 5HKKD 1VLVA 5FWNA 1DOAA 1F8FA 1T5DX 1TK2A 2XCOA 1E3WB 4IDOA 4QFCA 4RMJA 3WMGA 3LC7O 3U4CA 4BNFA 1PJTA 1JHDA 5DTQA 3SVTA 1EINA 1ZMTA 4OUKX 3SHQA 5A4JA 5C8VA 1XNQB 2PYDA 3QU7A 3KB2A 3RG2A 3BZUA 4G1FA 1U8YA 1QG4A 1V41E 4E4YA 3HA5A 2P9CA 1NM5C 3R6TA 4XIYA 4ZZ0A 1H94A 3BBPA 4TMTA 2WDZA 5EMHA 4JU9A 2PJDA 5CTJA 4EELA 2BKXA 2ERYA 3W9BA 5CCXA 2P4EA 1L7EA 4NBRA 1I80A 3PJDA 5CJPA 4Q05A 2A58A 3KVOA 3ET5A 1EFVA 4ANFA 3L8MA 1Q3HA 1U3FA 2RDMA 3I83A 3PDHA 5GZ6A 4E5DA 4EG1A 2NV2B 2P6NA 4XUEA 1QLHA 3QX7A 2ODWA 1NFRA 2C97A 2WQZA 1SJ9A 4LI3X 5HMMA 2ZUSA 3SE7A 3EPJA 3ELUA 3EASA 1N0VC 1JDVA 2ZJBA 4MOWA 1FMCA 1GYPA 1A9OA 1SEVA 3O4FA 4Q9AA 5FTKA 4PNPA 2VHJA 4AURA 3DLIA 4B3DA 1RYZA 5K5EA 4YUVA 1N6LA 2PR7A 3HGQA 1BCSA 3AFHA 2XCSB 1AU9A 1JU3A 1B42A 3PZRA 4FEEA 3STXA 3JTMA 3UK0A 3ZHVA 4IDCA 4TM7A 3SE0A 5EJ6A 1ISFA 2QTVA 2V97A 5EXXA 2JGDB 1TVMA 3EXAA 3RRZA 3TLBA 2HK6A 3KTFA 3FUUA 4ZJPA 2ZSHA 5CEFA 4RHCA 2AQ8A 4WXEA 2ZBUA 1LLCA 2AMJA 2PANA 4ICIA 5G4KA 4Z3DA 1N6PA 4EPXA 3GFFA 1Z2DA 4I1SA 1A5AB 1KMCA 1J4AA 4GWLA 3TI7A 3W3AD 1FTYA 1GTJ1 3QELA 2YWEA 3ODPA 1O94C 2HJVA 4BBZA 4C7XA 1LU9A 4BYMA 4AN1A 3KX2A 3FCEA 1E7WA 1XZGA 2A5FA 4GOJA 3SU8A 2EG9A 3DHYA 4A5SA 1MJ5A 2IHBA 4YJHB 4RX1A 2EU8A 4W9NC 4D45A 4OHYA 1DBQA 1QFMA 3GFTA 4IXMA 4HP8A 3ABIA 3ESRA 4AMUA 1TM7E 2QVCA 1IUNA 2VKTA 3LUDA 3RIGA 4B4KA 4PHFA 3D8UA 3IBGA 1E9BA 1VGVA 3OM1A 4C05A 1USKA 1ZW6A 4BXOB 2WWWA 2NUTB 2GDJA 1MZPA 3C6MA 3IE0A 3CKKA 1TZBA 2VLBA 4ARUA 3EZ2A 1YQDA 2ZE8A 1L8QA 3QI7A 4KX5A 3E70C 1GAQA 1U2GC 4JWKA 1PX2A 2UZ3A 3ESZA 5C8YA 3AP3A 2DBVO 4HFMA 4PYJA 3VO2A 3FVQA 4MS1A 4UEQA 4ETIA 2O1XA 3MCAA 4J7UA 3PHCA 1SCAA 4EY4A 1OFIA 3L6DA 3QY0A 2PQ0A 4DNQA 1H2FA 2M1XA 2VXYA 4X7RA 3BFJA 1OB2A 2OCBA 4CKCB 1II8A 1CJUC 3I6ZA 3EGWA 2ORIA 4DIUA 3GDHA 4U7DA 4IHAA 3IVCA 1GUBA 3VJKA 2ZREA 2QNRA 3TD9A 1V1RB 3EODA 1VXRA 4PC7A 1I1NA 4MO9A 4C29A 1LRJA 2G9VA 3KQQA 5CFMA 2Z5FA 3V8QA 4I55A 1DIGA 1D0VA 2D2IA 4JBLA 3UAWA 1AKQA 1U3GA 4E5KA 5JLJA 1GGMA 5KYXB 4RADA 1ZK4A 5E1BA 3ITNA 4GPAA 1C3XA 4D4KA 5IJ9B 1V3VA 2XWBF 3C7CB 4Z7NB 3C6YA 2B4YA 2WG2A 4A2PA 4DWOA 4G5OA 5CAEA 2Y0BA 3ZU6A 1RXEA 4P22A 3MBIA 1L1QA 3TZHA 2IYUA 4B6EA 1FJXA 5HILA 1RJ9A 3KQWA 3K1AA 4ZYVA 1KORA 1F51E 4WK6A 1QHYA 4D8VA 4G63A 4YR9A 2QOEA 1QXSA 1E0KA 2SNIE 3EWSA 4CQLA 3O8RA 2PMCA 2QSZA 4S1OA 5BWOA 2YZMA 1I8TA 3IPLA 5KIAA 2J0UA 3PUHA 3RVDA 2OCGA 2FPGA 1YMVA 4WCVA 2JGRA 4M0KA 1UKCA 2K4MA 4ROTA 2VFAA 2AX4A 3CNBA 1FX0A 4LMRA 2IPNA 1CY1A 2XT9A 3GJYA 4GYWA 3LVBA 4WXHA 4HJRA 5AOCA 1SG0A 3EGOA 3S29A 1WZCA 1Q0RA 4WCFA 2PQ6A 5K9ZA 1G1AA 5EQTA 4Y0NA 1L6RA 2JKVA 4L4ZA 4KQEA 2AFIA 4Z1MA 1MJFA 1A3CA 1UMBB 2Z1MA 5SZHB 1JILA 4J49A 4RJKA 2P6OA 3PUKA 4FQ5A 5EPEA 3TQQA 4Q3DA 5AUOB 2WM9B 1XGKA 4H6PA 3UV7A 1NW5A 2WA1A 5KDOA 1VHLA 2DWPA 1YIOA 1GGKA 3CRRA 2X2OA 1L7NA 3U3DA 5F98A 2Q3DA 1M5UA 4HUQA 2D1TA 4IJ5A 4JT4A 4X92A 2Z2IA 1VXOA 5AM4A 5F33A 5NLLA 3W06A 4B7ZA 4ALNA 2W58A 4H59A 3UJHA 3T15A 3M1IA 4AY6A 3WB1A 2WJIA 2HW8A 2ZDQA 2YQ4A 1KKUA 3AEKA 4JLNA 4UVDA 4N82A 1Q0UA 4ZYXA 3UH1A 4KKVA 5GONF 2V3VA 2Q5LA 1RQXA 4B81A 4BX3A 4A8HA 4UEWA 1GGNA 5IAOA 1N5JA 3WDLA 1JYEA 1OXVA 2FSFA 2ZXFA 4PM4A 1NR5A 2QXYA 4EY3A 1NAHA 5KQSA 5CT5A 4YK7A 5FPSA 1J97A 1I3CA 3QUCA 4ZOBA 4JI2B 4M0LA 1VJ0A 2BM9A 1LBIA 3ABOB 3MBKA 4HBZA 4FX2A 3A0UA 2PEYA 2B2XA 3KPJA 5COAA 4ZI7B 1YSCA 5FUYA 1SG6A 4O2BA 1PJCA 4FSHA 1SKYE 5A4IS 3K6SA 2EV9A 3W3ZB 4D8TA 3ONDA 4S12A 2IXBA 3K2QA 1KDYA 2QTNA 1KFKB 1OA1A 2H1SA 3JPYA 4E46A 1ZPDA 3KDPA 4L02A 7AT1A 5HXAA 3L0YA 4FYYA 1CDEA 2FFRA 3MJ4A 2ZT8A 1DBPA 4DL9A 3WAJA 3DO8A 3ZE7A 2I6SA 1RYHA 1Y1KE 4W5NA 1DE0A 5DCLA 2RJOA 3FETA 1NOIA 1PD0A 1NIJA 1W52X 1GARA 2HQ1A 3IOYA 2LXNA 1IHXA 3NOXA 3EGIA 3IV6A 4RH1A 4IJMA 1LBTA 2P2NA 4JLSA 1XPOA 1OVMA 5KHLB 2UVDA 2WPNA 1E2NA 1O95C 3LH5A 3HZZA 2V6BA 1LTHR 3BJEA 2SKCA 3CHYA 3I8SA 4LYAA 1A7AA 1AKMA 4CWAA 3UWMA 4JJKA 2QRVA 2LGJA 3NALA 2EW8A 3OFSA 3PIRA 3BG5A 4C4OA 4RV9A 1YC2A 3NG1A 3L0IB 2J7PA 3O2NA 2VDPB 3WGIA 1T6NA 5TQ0B 3HJBA 1W5AA 5FCDA 2A4KA 5LZ5A 4MI3A 3V5NA 1QCYA 1KFBB 1Z5OA 2GBCA 2ZKLA 3C7KA 3WRYA 4POOA 3A1WA 2GKGA 4JUIA 2VAMA 3Q0EA 1RQ7A 2OXRA 5EIXA 4XB6B 1JXOA 1UDRA 1E6MA 1G7RA 2FSSA 4FOLA 5JE8A 1WA5A 2OB1A 3LV8A 5AKEA 4CKBA 3JQ7B 5HZGA 4GPZA 4E33A 5LP6A 1JLLA 4E22A 2AG5A 2P30A 2QGNA 3IHLA 4Y2QA 1ADCA 1IQPA 2XDAA 3QYPA 2YC2C 2XYHA 4BFLA 4NKRA 3H2BA 3JD1A 4FS8A 1H8ED 3R7BA 4RKYA 2EF0A 4PX3A 3TBFA 1G20B 3B70A 4ZCLA 1QWSA 3DCYA 1WDLA 5LKRA 1C1XA 1K89A 2FMFA 3IRUA 1WUIS 2PZBA 3U09A 4TYYA 4RCYA 2R1UA 3WB9A 1Q0LA 3C70A 1UZUA 1ZC3A 1L4MA 1FF9A 5FF9A 2A9FA 4XCQA 3R9IA 1NBMD 1XALA 1CETA 3TJRA 1GQ2A 3TZKA 4E88A 3IE2A 3UMBA 4LBVA 4R0VA 1C4XA 1PU2A 3T5BA 2AC4A 1BWQA 4DIOA 1ID1A 2J0EA 4KXWA 2XGOA 4MV5A 3SYMA 5ALRA 2WT9A 1NVVR 4F12A 2GPBA 1YS2X 2W6JD 4D4GA 1XTVA 3HPRA 4PS1A 4HDNB 3SEQA 1GO2A 1QV6A 1UDBA 3DAFA 1XEXB 4WLNA 4O3MA 3LM8A 1XR3A 2HB6A 4ZJYA 4XVHA 3IJEB 2YYYA 3HKDA 1DJLA 1SHKA 2XE6A 4HGZA 1ZAYA 3UJ6A 1ZFNA 4Q3LA 2ES4A 5GM2A 7REQB 1K6MA 1V6AA 1XIVA 3K1YA 1YCGA 4AKIA 3TSWA 4TT8A 1YRQA 2YWHA 2WZCA 1TA9A 2C1XA 2CLHB 2ZS7A 3G7NA 3PUZA 4HS9A 2HSGA 4AF7A 1PD1A 3OZAA 1N4AA 4NCAA 1M74A 4I9GA 2WD7A 1QBGA 4JCCA 1HI9A 2LIVA 4HB2A 3VSDA 3ETCA 3X1WA 3VYUB 4HDKA 1M6VA 3OFNA 3DBVO 1DQNA 4RK1A 4N47A 3LW7A 3EPHA 2HEIA 1TQ6A 4AUMA 2VA8A 1B6GA 3NKFA 3KP1A 3EAGA 5BSGA 3CKYA 4JP1A 5DP1A 1R0WA 1BW9A 2AQKA 2Q50A 3BXGA 4GQBA 4BS9A 2O0LA 1E3LA 1IEXA 3O9ZA 3CUKA 4TXMA 3UF0A 3F9RA 2P5TB 1JHUA 1YH3A 2FWBA 5BSEA 2GK7A 16PKA 1FTNA 3I28A 4KKXB 4MUKA 1E4OA 1NF2A 2HMSA 2QN7A 3TOVA 2HJSA 1ZHHA 2QD2A 1QOZA 1FXUA 3L0BA 5HE8A 1QHXA 4NV1A 1DKPA 1QGUB 3RYFB 1FSFA 2DTDA 1ONPA 1VIVA 3BXPA 3BCHA 4NBKA 4RFSB 2FI1A 2RARA 1TX4B 1KGDA 1BIFA 4MR7B 2GHTA 4NCXA 3ZVKA 4AZVA 1NL3A 4JQYA 5FPQA 1N2HA 1WDMA 4CLRA 1SCKA 2QY6A 3KL2A 3NMUF 4DBLE 2FMKA 2IP1A 3D5QA 4QQNA 1WXIA 3K32A 3LXXA 4LRXA 4MUXA 3GN1A 4U7JA 5CXXA 2IU0A 5CA1A 5HM8A 1NPTO 2NOAA 2FFAA 1XEWY 1C5KA 4IFBA 3QWFA 4KNYA 2CDNA 3G8CA 3QRWA 5HKKA 2JD2A 4YRRA 1MQSA 1OC2A 3ZU5A 1XZAA 4EAAA 5LBUA 1M9NA 3OLCX 1IY1A 1M6WA 1HNNA 1HURA 2WEKA 4KYVA 1G8YA 4IDEA 2G1PA 4IYRA 5HF5A 3RAJA 3ZXSA 1U11A 1G9XA 1C4KA 3GLQA 3GRKA 5FLKA 3ZU3A 4ZI2A 1AKEA 1OCEA 2EG5A 4UUPA 5KOJA 4F6RB 1U1GA 4C4PA 3WMXA 5B58T 1ZN9A 2JLSA 4O02B 4BP1A 5AM5A 3LY8A 4DIDA 3EDYA 3UA3A 4TYPA 3RS2A 3V3KA 5FBHA 3FMGA 4IDPA 4YFYA 3KZKA 4BB5A 5C34B 4AMYA 2I7VA 2O2YA 3EIXA 1WULS 2FP3A 2MOKA 3NHYA 1UK7A 3NIGB 5B1HA 5IM4F 4RL6A 4JLWA 5KC8A 1DIBA 5A7HA 1KOGA 1W73A 1JIXA 3IVXA 3TAUA 3I23A 1CCWA 4DCJA 4TKMA 4HV4A 3FWYA 4FW8A 1WKBA 4ASUD 4DDUA 4YS6A 3F73A 1Y3AA 3ZI4A 5BOVA 1E1CA 1GLGA 3I9NA 4KO3S 4Z2YA 2XXAB 3FBTA 1HF3A 1NSYA 1XLVA 2OXCA 3ZKWA 3ZCPA 5BSHA 1LS6A 1F8YA 2B34A 1E1KA 3PGA1 3I0NA 3I5AA 1MA3A 4TTPA 9ABPA 2FF5A 4MULA 1WXWA 2QQ5A 4ABYA 1EDDA 3RSGA 4DOMA 2GN9A 3LGXA 2KW5A 3KZVA 1JA1A 3P0JA 1E69A 2IP2A 3TVDA 4M0DA 3CLHA 5IW8A 4JUBA 1F6DA 3QUTA 5HW0A 5EKDA 4BLVA 4I19A 3EY9A 3IO3A 1JLSA 3IOCA 4RFVA 1E5XA 4YWHA 1MJGM 3VPAA 2P3QA 2BWJA 1RVV1 2PKQP 1CC1S 1HMPA 3T7TA 2PGIA 5LOVF 2J08A 2A3NA 2O1WA 1EJBA 1YOBA 4IGEA 2IDKA 5DGXA 1MDFA