3W7AA

Crystal structure of azoreductase azrc fin complex with sulfone-modified azo dye acid red 88
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
210
structure length
210
Chain Sequence
TKVLFITANPNSAEGSFGMAVGEAFIEAYKNEHPQDEVVTIDLFNTTVPAIDADVFAAWGKFAAGEGFEALTEVQQQKVAAMNTNLETFMNADRYVFVTPMWNFSYPPVVKAYLDNVAIAGKTFKYTENGPVGLLEGKKALHIQATGGVYSEGAYAAVDFGRNHLKTVLGFVGVNDTEYIAVEGMNANPEKAQEIKEAAIANARELAKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of AzrA and of AzrC complexed with substrate or inhibitor: insight into substrate specificity and catalytic mechanism
doi rcsb
source organism Bacillus
molecule tags Oxidoreductase
molecule keywords FMN-dependent NADH-azoreductase
total genus 71
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 1.7.-.-:
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w7aA00
3NHKA 4C0XA 3QE2A 2HNBA 3W78A 3S2YA 3FX2A 3ESZA 2RG1A 1DX9A 2FDXA 4QOFA 3OWXA 2QX8A 2FZVA 4FGKA 3TE7A 4R81A 4CF6A 2QX9A 3F90A 5LBUA 2FVXA 1D03A 1T5BA 1AKRA 4QOHA 3W7AA 4D02A 2BF4A 1NNI1 1FLAA 1AG9A 3QFRA 2OYSA 2V9CA 4FGJA 5EMNA 2MTBA 5LVAA 1TIKA 3NHSA 3HR4A 1J8QA 1I1OA 1XT6A 2HPVA 2QX6A 2Z98A 4PTZA 1YKGA 2FCRA 3JSXA 2FAXA 4LA4A 3FVWA 4H6PA 1J9GA 2BPOA 2F1OA 4QOJA 1SG0A 5LLDA 2V5VA 3KAQA 4FGLA 4XDGA 2M6SA 3EDOA 5NULA 2M6RA 1XI2A 3FW1A 2QWXA 3NHJA 4QOEA 1AKVA 1J9EA 4DIKA 4FX2A 4LTMA 4PTYA 2N1MA 2MWMA 1FLVA 4M0CA 3ESXA 1CZUA 3U7RA 1AHNA 1D04A 4HEQA 1FTGA 2OHIA 2Z9DA 4S24A 4CETA 1RCFA 5LJLA 4GR9A 5LJIA 4N82A 1B1CA 4YAFA 4H2DA 1CZNA 3EYWA 4J8PA 1H66A 1WSWA 3UXEA 4QOGA 2KQUA 3NHPA 5TGZA 1V4BA 2XOEA 4PU0A 4NLLA 2FZ5A 4YAWA 1GG5A 1QHEA 1YCHA 3OX2A 3F6RA 4ZVLA 3NHUA 3GAMA 3UXHA 3OVMA 2W5UA 2XODA 3W79A 1VMEA 1OBVA 1XYVA 3TEMA 1BU5A 1AKTA 1FLNA 1H69A 1XYYA 2X2OA 3L9WA 3N39C 3NHLA 3B6JA 3B6IA 2MOKA 3F6SA 3N3AC 4ICIA 2BMVA 2ZKIA 1CZOA 1C7EA 2QR2A 2BN4A 3K1YA 1BVYF 4QOIA 4XDHA 5F51A 4BMOB 4C0WA 2GSWA 3GFRA 2OHJA 5FX2A 2AMJA 3L9XA 3GFSA 1OFVA 3K20A 2B3DA 3FNIA 1QRDA 1T0IA 1JA1A 3KAPA 3LCMA 4U7FA 2WC1A 4U7GA 1FLDA 5ULLA 4ESEA 5B3LA 3GFQA 1WSBA 3O73A 5EA2A 1X77A 4ZVNA 2QMZA 1AKUA 2QMYA 3F2VA 1AZLA 1YCFA 2FX2A 3OX3A 1KBQA 5F12A 2Q9UA 3OWHA 3P0RA 4ZVMA 1FX1A 1FVXA 3O2NA 3RPEA 3ES9A 5FA6A 5BUCA 1YOBA 4C14A 2D5IA 1DXQA 3NHRA 1CZHA 4LTDA 5A4KA 1ZWKA 6NULA 1AKQA 2HNAA 2Z9BA 4U7HA 2Q62A 1RLJA 3B6MA 2FOXA 1AMOA 2FLVA 2BZSA 2OHHA 3ESYA 3NFRA 3NHYA 4N9QA 3N3BC 2V5UA 3FJOA 4YAOA 4YALA 4HS4A 4DILA 3SVLA 3OJXA 5JROA 1OBOA 3HLYA 3LT5A 3QFCA 1RTTA 4Y9UA 3NHFA 4LTNA 3TZBA 2X2PA 4OXXA 4BMPB 4QODA 4YQEA 3KEGA 2A5LA 1F4PA 2KLBA 2QX4A 1ZX1A 1QR2A 1SQSA 1JA0A 1DXOA 2R96A 2R97A 4ZVKA 4N65A 4YAUA 2MT9A 3R6WA 5F4BA 3NLLA 1KBOA 1RLIA 1J9ZA 1AKWA 5EAIA 5LBTA 1TLLA 1YRHA 3B6KA 3KLBA 4NULA 5NLLA 3U7IA 3OJWA 1CZKA 2ARKA 1E5DA 1ZWLA 4DY4A 4Y7CA 3ZHOA 4Y9RA 4GQIA 4F8YA 1D4AA 1QBGA 2Z9CA 3OX1A 3D7NA 5B3KA 1CZLA 1YDGA 1CZRA 3G5MA 5LMCA 1YCGA 1FUEA 4GI5A 4C76A 5FUQA 4LAFA 3W77A 1C7FA 3HA2A 3NHWA
chains in the Genus database with same CATH superfamily
1NW4A 2C2BA 5FBVB 3E7XA 4PR0A 3VKGA 2NXJA 2PV7A 1JLHA 1NP6A 2BCJQ 4MZDA 1II8A 1XYGA 1M83A 2ZRKA 1LDBA 3EZFA 1XK7A 2XLBA 3BK2A 4WBXC 1RWWA 1OXTA 3EEIA 4EFNA 4JX8A 3DDWA 3E0QA 3U3MA 3C6KA 3G2OA 5JS7A 1B8NA 4YRLA 4HYTA 1TAGA 5BURA 3G2QA 5FOTA 3EGWA 1Z39A 1R9JA 1ICEA 4PZPA 5CDYA 5IUJC 1KYTA 1FOEB 4K2HA 4MTLA 4NFHA 2Y1LA 3E27A 5JW6A 3B1KA 4LY3A 3DKRA 2CZQA 3WGQA 3WRYA 2M32A 1RYMA 4INPA 2VXBA 4XIGS 3SZUA 4I99A 3TRIA 5KYYA 1GV0A 2ZSJA 3RK0A 2J87A 1WUKS 2HSZA 3E2IA 1ILEA 3PCXA 2ZEJA 4R2JA 3MS4A 2GYVA 2C2HA 1S8FA 1E63A 1U99A 1VZ2A 4XOUA 2BGNA 4G1BA 1XNQB 2VJDA 1H3FA 1Z5OA 3CKKA 2F43B 3QVTA 3NDBB 2QYOA 3VU9A 1RWOA 1T6XA 3IALA 4UMDA 1Y63A 4BNKA 5HOEA 3K70C 1KEWA 2DQ4A 4R7ZA 4CW7A 5JUWA 3GUYA 1QGOA 1ISJA 3WYFA 3E84A 3IXLA 4CR7A 3AHFA 1DHTA 1OBVA 1V1JA 4WXMA 1FLNA 3JYLA 1ID8A 2MSWA 4KVZA 2IOHA 2NO9A 1R3UA 2MOKA 2NT4A 1ZN7A 4LQCA 3AH8A 2YHSA 2X5NA 1MABB 1O97D 4IQ8A 2BMDA 4M87A 5AW0A 1H9AA 2E4UA 3LY8A 4H0FA 4JLVA 3UWSA 3VAYA 5K0BA 5D5PA 2QP4A 2IS2A 3LKDA 4QTUB 2INGX 2Q3FA 2BKLA 2HJVA 2AFRA 2PKYX 4HEA1 3ROGA 1PS8A 1E3QA 2KWIA 1BQ4A 3LCMA 4WZ6A 4X97A 3SC6A 2X77A 1XCJA 1IZ8A 1WSBA 2J4DA 2QMZA 1O77A 2IGBA 3IP9A 1J8MF 1E2QA 3EPKA 2JIQA 4PC2A 4GMFA 1N92A 5D86A 1FVXA 2VUHB 3TSOA 1GU7A 3KB2A 3KEFA 3CX7A 3Q85A 4QFBA 3PEEA 3YASA 5KDOA 2JLAA 1OLUB 5B7NA 1QVVA 3PYLA 2CHQA 2EGUA 3T1YB 4NCIA 1IBMB 1J2EA 4L5CA 1TGYA 1KJ9A 3GEDA 3TW4A 3X1JA 1R4AA 4FSXA 1QRUA 3BE5A 2C3OA 2BH9A 1LRKA 3M6WA 4FC7A 3FPSA 4RJ2A 2EG5A 4J3NA 1BS2A 4DW8A 4D4KA 4F5WA 3UHJA 3A1VA 5E6UA 4REQB 1RC8A 3A4YA 1YZFA 5FPTA 2QGNA 1NIPA 4GVPA 5AK6A 3D6TB 1VSVA 4K2AA 4OBXA 2WNHA 1PE0A 5LUAA 1KY5A 4ZA2A 5KJ1A 1WG8A 4LQ4A 2NU9B 2QJFA 1JFRA 4BLWA 2BMEA 1BKDR 1U4OA 1XZCA 2OZKA 4M1WA 2VUSA 3S99A 2OBMA 1Y8RB 3DOOA 3QUBA 2DFTA 4M49A 2LCIA 2BEUB 5FUYA 3ETJA 1CRPA 2OXTA 1UJBA 1D2NA 4HDSA 1JVBA 4MVJI 4NBWA 3WRXC 5AHRA 3BHIA 3HG7A 2HRCA 3EXG1 5FUQA 5ED4A 3FPFA 1G3QA 1T2VA 4QIHA 3BPSA 1XZ8A 4QHSA 3MUNA 3PIRA 4HUJA 3G5LA 2OE2A 2RBKA 1X7WA 2A9JA 2JCSA 2JB9A 3MERA 4Q66C 4O29A 1GVNB 4RIEA 2WZCA 4TTJA 3WGNA 2GLXA 2H2AA 1U2PA 1PX2A 2VN8A 1FQWA 4MMZB 2RGNA 2GOYA 2XYRA 4I6JA 4Q3BA 4ZAWA 4RJKA 3FOWA 1GUBA 2CLCX 1GGFA 2G1JA 1W1UA 3EEYA 2GHTA 4JYBA 5J1TB 3RVPA 4C7MA 1KEZA 3KV1A 1OH6A 3VVMA 3SDBA 1KFCB 1A98A 4PTZA 3REOA 1TADA 1JFFB 4RJIA 3Q2OA 4DLWA 1YRYE 2NZ8A 3A9VA 4JJAA 1P9LA 1CG6A 5ECYA 2HQSA 1PFUA 4Y2QA 4CF3A 1G7RA 3WXBA 4YMGA 2O3QA 3DOUA 2HWWA 5DYTA 3SX2A 4QDJA 3C70A 3G88A 4LGVA 3OKPA 4C29A 2PFSA 5I8WA 5I45A 4QEZA 4JLJA 1MC4A 3AEQB 3G2LA 3IC5A 3P7MA 4URWR 4WKBA 2QW8A 1U7HA 2QTGA 1O5OA 1HWYA 5KI6A 3UMSA 4D9HA 2MSLA 3PE4A 3QKRA 4AECA 2MYTA 3L1HA 3MWFA 2HRRA 1LQUA 3EY4A 4GI1A 4L74A 4G1CA 1MW9X 1WRBA 5CW2A 1JJIA 3RIHA 4EG1A 2AI2A 2C9YA 2PT9A 3IEVA 1PT7A 2C9CA 2ZSEA 5D51S 4H7DA 4LJRA 1T9ZA 3PXUA 1ISMA 1FXWA 3I6ZA 1DC6A 3QI7A 3P52A 3T3DA 1DDGA 3UYKA 1Y6GA 2GMWA 4TS4A 2QT0A 1V43A 3B1VA 1XDDA 3NRJA 3DF7A 2I2FA 3ZI4A 4XW2A 4UHBA 2Z8XA 2RB4A 3EUEA 3K1YA 1E3IA 1HGXA 4MA4A 2G5CA 2TYSB 4P4TA 3TQFA 2GKGA 4PTLA 3OLQA 3ZKWA 1AJEA 4EYGA 1EINA 5LYJA 2X9NA 3ED5A 4ZZ1A 3SKXA 2XTNA 3JV7A 2YZMA 4IDEA 1EHYA 1IOLA 1ZCZA 4QGFA 1L4EA 1LBTA 3LPNA 4ND1A 3TZHA 2NP6A 1YU6A 1TYDE 4HI0E 4JKIA 5DRTA 1IUNA 2CB0A 1IPEA 4IIDA 4DANA 3OF5A 3KOMA 3P5BA 2JIOA 4X24A 2Q2WA 3CNLA 5JSFA 1XJQA 2WJ3A 5G4LA 3QXSA 2HA4A 4R2XA 1EM8B 4C87A 3H9JA 3PLRA 5KWIA 1PK8A 3HXKA 2VSOA 1WV0A 2DZDA 3ANMA 2QN3A 3DMHA 4C4SA 4IUYA 1W36D 3PKZA 4PNHA 1ORVA 3RYIB 2YXDA 1A9SA 3THYA 3PHLA 5DP1A 2CWWA 1ZQ9A 2VQSA 1FRQA 3HN7A 1JKJB 4LUCA 2HADA 4HO1X 4ERXA 2VF2A 1GKIA 4TRNA 3OZFA 1E92A 4WCFC 3DB1A 3D8UA 1CFZA 2C99A 4QSHA 1QPBA 4LS3A 2DBZA 2QRMA 3R8CA 1LX6A 2ARKA 4J3FA 4J6FA 3AR9A 4F3NA 1JTVA 2XE6A 4OHRA 3BQNB 3HWRA 3AF0A 1XZQA 4GL4A 4HH4A 4GM1A 4C78A 5K8IA 5KBYA 3LPDA 2A5FA 4NZOA 3T9BA 4O2AF 3AB8A 3CKYA 5LOVB 1M2KA 3B70A 2PWAA 2Z2JA 3S1SA 1C4XA 1ZIDA 1C50A 4JVSB 2YMPA 1NYQA 3WQSB 5M7EA 4DNQA 2Z4TA 3PJFA 3C3PA 1Q7BA 4KXUA 1ZUNA 2CK3D 3KKOA 3VU3A 1Z6AA 3W5JA 5K3OA 4YDSA 4QDOA 3UO8B 4XJTA 1WCV1 1WHTB 3FYUB 4NJEB 1KZGB 5A9TA 4FFRA 3KFXA 2ZVJA 3RODA 4FHEA 2BELA 3C3YA 3JQEA 4I5EA 5L7YA 4GXRA 4UM7A 3UK2A 2R00A 1UBLS 2ZS9A 1QAOA 3C3KA 3O3MB 2G07A 4H1HA 1R0CA 3MJRA 2DQYA 3C7CB 4Q34A 4EHLA 5LLDA 3K0SA 5FUMA 2QYTA 3LHSA 4NPCA 4LJ8A 4PPNA 2O2IA 5B4UA 5BQPA 1JHVA 4ER3A 4BNDA 3DD5A 1P1IA 2B2NA 1D1PA 3TCNA 4JUIA 1MXFA 2DPLA 2BUCA 4BKUA 2LP4Y 4QHTA 4S24A 5L3SB 3ADOA 1ZXBA 3M4XA 3KKKA 2PSHA 4MYDA 3SX4A 2ZBRA 4J8PA 4MKFA 4XGNA 1J5XA 1E3EA 1FC0A 3TLGA 5JY6A 1FFCA 1J0CA 4YAWA 4ZV7A 1UXKA 4QNNA 1U3TA 4MB2A 4GP9A 1X42A 1AC5A 2W5UA 3FKQA 3OAAA 5LZ9A 4OL0A 3SHTA 5L4SA 4J91A 3T54A 4D96A 3NHLA 3ONDA 2FG5A 4G85A 4ZCMA 2WP0A 4BKQA 1RYZA 2VHWA 5DHRA 4LCJA 3RSZA 2DERA 4IIGA 1OUMA 3S5UA 4M2LA 1WUHS 1UC8A 2L19A 3NVAA 2REQB 3I39X 1Q57A 4UCFA 2UYOA 1CVRA 3HU5A 4QRHA 2K4MA 2X42A 4EUSA 3AGQA 2ZRQA 3EGXA 1TZBA 4KXMA 3EA5A 3H9GA 3DE4X 3MK31 3MSCA 4HZUB 3SHFA 2H1WA 3O4RA 2GGSA 4LDQA 1SPXA 4ZEXA 2EBHX 2YHAA 3RKUA 1Y8ZA 4BO7A 4C7OB 5EJ2A 3TSCA 4B8YA 4PNZA 4YHHB 3TZKA 1EDEA 1EX7A 4HDNB 4KN5A 4BJ1A 1KFJB 1T25A 4CIYA 4P5DA 3STVA 3UWKA 3HEMA 5IK2D 4LSWA 4Z0PA 3T7AA 3LWBA 3MEQA 2O4CA 4JJGA 3WE7A 1B8UA 3KXPA 2IDZA 2O1XA 1SVUA 1LB1B 4DBLC 1A8HA 4XFKA 1E5XA 2JVJA 3DAFA 1AKWA 3GEPA 2HPHA 7GPBA 2YMQA 3KFVA 3P9NA 3FCEA 2OO5A 1TCBA 3EXHC 3M1AA 2TMDA 1C4OA 1Z0DA 3DBRA 2B1QA 2V98A 3CZ4A 3FPAA 3MA0A 3NCHA 4ZOQI 1D4AA 1PT9A 3FNBA 3TPFA 1BQ3A 1KOLA 2WWYA 5BYAA 2WD9A 2AXEA 3MT9A 4MH0R 3O84A 4Q48A 3U9TA 4A6XA 1BMFD 2C77A 2ZT6A 2G80A 4MWEA 3DAYA 1E8MA 5C51B 3EPLA 4C6SA 4F2WA 2AFHB 3LUHA 1J56A 3QKTA 2O5VA 5JOQA 1JR3E 2EHDA 3AOEC 3IDAA 2PKQO 1P7WA 5KYYB 3J80A 2HCRA 3FPHA 4RF5A 4B75A 1CUXA 1PL7A 2XUPA 3FHLA 3NBZC 5F7JA 3T95A 1UXIA 2Q1SA 1VJDA 3U1VA 3WG9A 3E4CA 3A4VA 3PJEA 2DLCX 1YL6A 3FLMA 3GOHA 4CMEA 1NVKA 2ODPA 2F4NA 3U7HB 2RHGB 2P6OA 4GWLA 2KM1A 4JP1A 4L0CA 3ZBUA 1SPBS 1NVVR 2F1OA 2Q29A 3B48A 4O2BB 1EJBA 4URYR 2DSTA 4WN3A 3RU7A 4BGDA 2I6SA 3NBMA 1RXUA 3G89A 4YC7A 4AY3A 3B85A 3R3WA 2F55A 1IK4A 1YDEA 2BYTA 3LVQE 1UMBA 2WKRA 2R8EA 5EUMA 3EZ7A 1L5QA 5HM8A 1SUBA 5KVVA 4L4SA 4J1TA 1CF4A 3LDAA 4HQ6A 4B79A 1Y82A 1MGOA 3Q9LA 3MBKA 1RJ9A 2ZBPA 5IKOA 3UA3A 4IZOA 2NO6A 2JLVA 1K1EA 4X6LA 3IAEA 2GD2A 2AH5A 3MGAA 1RWXA 6REQB 4IGAA 5AHXA 1IIBA 3C5VA 4Y3UA 3MWGA 4DYVA 1N2ZA 5IAJA 4C30A 4GLJA 1DAEA 3BXPA 3KHSA 2OFPA 5E2IA 3PF8A 5TEWA 5MN5A 4UULA 2X22A 2YBDA 2IT1A 2X7JA 5KS2A 3I5XA 1ZN9A 1VRWA 1ZU5A 1Y3AA 2IYPA 4KGVA 2LUOA 4CMEC 1U94A 3BRWD 3GGDA 1I6WA 4L1KA 4S1NA 4CDRA 2AA3A 1QV7A 4OHZA 4MWDA 1B8PA 2Q3DA 3Q98A 4FN5A 3IEPA 2B4TO 3MT0A 1URPA 3ANXA 3MHTA 2VRWA 3DT6A 3KWMA 3LKVA 3NGLA 4MWCA 4C2AA 4BS9A 5CLHA 4ZFNA 4DCJA 4LX0A 1UMBB 3T9DA 3X1DA 1NN5A 2WHRA 2Y2UA 2BJWA 3CZRA 1VE1A 3IPLA 4Q4JA 2X1LA 3C97A 3EGOA 3OX3A 1Q7EA 1NM5A 1I2CA 3O1HB 4DG5A 4YAIA 5I51A 2Q6OA 2CL5A 5DLQC 2J9FA 2WMNB 5SZHB 1EK5A 1UF9A 3K1AA 3X43A 1CB0A 3ZHSA 4BQOA 3ZJTA 1OXXK 3LRXA 1CRLA 1CS0A 1KI9A 2OO5C 3I2GA 5FCDA 4CJXA 3VO1A 3NVMB 4JYPA 1SQGA 1Z3IX 2QSZA 4KYUA 4NJMA 4OUKX 3LUKA 5FYQA 3W34A 1YZKA 2P11A 5G40A 4ZV4A 4OEHA 2C54A 3AKCA 2HC9A 4FN4A 3M6LA 5BSVA 1XQWA 3BIXA 1GPYA 2NU7A 2JFFA 2AN1A 2UXBB 1MPXA 1CVLA 2FWBA 3AT1A 3PRKE 4ZDIA 5JYBA 4N7JA 5KQRA 2GBFA 3H65A 2IIBA 1OWPA 2R0QC 1YBHA 1IY0A 1IBKB 1H5NA 2ZRDA 3CUVA 3HPRA 1XFAA 1XRJA 3T1NA 3T12A 4RKQA 4LI3X 4BNFA 4OLAA 4G1UC 4W7SA 1JIKA 1VHJA 3L41A 2NZUG 3GBSA 5JJCA 3DTTA 3JQPA 3TIGA 1FQKA 2GESA 3AHIA 5JS1A 1I30A 1XAJA 1XWWA 1Y9ZA 3AO0B 1AZTA 1XZDA 2ZPTX 1GXSA 3IAM6 1KYWA 2PT6A 3FIJA 1MX3A 1NC3A 3HDTA 1TVCA 2E48A 2I4MA 4TRRA 4IIJA 4UMFA 1LVHA 1Z4IA 1QS0B 1QM5A 2AJ8A 2DVMA 3DWFA 4XA8A 4I4TA 2EJUA 3QYJA 1W9MA 1S2IA 5LBUA 5CD1A 3JZIA 4GMDA 3I0NA 1X80B 4XWYA 4PYLA 3IT2A 3MW8A 4PQEA 3TLJA 2J30A 1B7GO 2G1AA 2JIPA 5C7IO 3UH1A 1FB5A 1GCIA 3LNTA 1J8QA 1C9DB 2XMSA 5ER6A 5LBIA 5CDGA 1RHKA 1FYDA 2MYNA 2OZPA 3WLSA 4TLEA 4DYDA 5MN4A 3WXMA 1AMUA 2J5KA 4MRMB 2AN5A 1OQAA 3V6MA 2VLBA 4GE0A 4XJSA 4YPVA 3OQJA 4RIIA 4GT1A 3DLBA 1BE6A 1IHDA 1S89A 5JQWA 3HJFA 3H8SA 1YDMA 3HCEA 3FPGA 3GPCA 2VJNA 4GS5A 4D2IA 2BSQA 4KACA 3ZI0A 1E18A 2P78A 1NVAA 1GNPA 3AEUA 3X2FA 2DHCA 4IDNA 5T3UA 1E0JA 5THQA 1Y6JA 3T0GA 3FMPB 5JS8A 2X41A 3MCVA 2HDNB 4B09A 2W2LA 2G4VA 2CDRA 4AZWA 4AD8A 2P8SA 4NAUA 2JKYA 5C9ZA 1QNLA 1B8OA 1RWPA 3NH6A 2J9RA 2UZ1B 3OUTA 4KZPA 5EP1A 2JFZA 3H2YA 3HKBA 1H9CA 3GEEA 1F0YA 3U3ZA 2H00A 5F9FA 3RAGA 2G5PA 1NSYA 1XTBA 4IX9A 5F51A 3T1OA 3EGDA 1ODKA 4BWGA 3AFNA 4PLZA 5T8KA 2ZUCA 4RTKA 5B1SA 1JLSA 3ZTTA 1QVZA 2HD4A 3ZLBA 4F4UA 4ZHQB 5I01A 4NYMR 2I99A 1KSHA 3ESDA 3O4IA 4HCJA 4HH0A 2G7ZA 2WC1A 2WWHA 4QARA 4WD3A 3UNXA 3D81A 2C1ZA 3ODPA 1DNPA 3B1FA 2P6PA 3PENA 4M1OA 3W3AA 5AJWA 1MHPA 4R7GA 5HYVA 2C92A 3KCQA 2X8LA 1YS7A 3KUKA 5ALMA 3O8RA 4LFAB 1L3BA 4U2BA 2YASA 1GG9A 2AYZA 4OM8A 1EI9A 3DVQX 4P3OA 5DT2A 4QXOA 4LDPA 1Q0RA 1GQSA 4AP5A 4JVLA 2CHVA 3ASZA 4QU8A 1N75A 5FF9A 2H2HA 1XL0A 1SKYB 1Y6FA 1F4PA 2C96A 4L3OA 1JPJA 2ZYAA 5DBOA 3G2NA 3WGJA 4AG5A 4D6XA 1T3TA 2CFSA 2J32A 2TMYA 3ECAA 3Q9NA 4WOPA 3Q8XB 3V1LA 1EUYA 2AFHA 2ATVA 4NAVA 1SBIA 4G4GA 3U4QB 2O8BB 1YHYA 2ZREA 4MA0A 1IZ7A 3OJWA 5JZVA 1U81A 3N5KA 5IJ0A 1ENYA 3ABRB 4NCJA 5GONF 3ZHOA 3OQIB 2EIXA 2OXFA 3PXBA 2VUTA 1Q1BA 4F4HA 3QVOA 3BTUA 3ER6A 5EJIA 3K9GA 4WOJA 2VJYA 1FYFA 2NVUA 3LWZA 3N2ZB 7AT1A 1ZCJA 3CWCA 3TXYA 4DEYA 3A1NA 2FP4A 4Q1VA 1KNXA 2X5OA 4MDHA 5E7IA 4FDAA 5E1DA 3NMUF 2H51A 2AI3A 2NV2B 3QK7A 3D02A 1XTZA 4OK5A 3GROA 4M3NA 2VYQA 3ZWAA 2AYYA 5DXJA 3EEBA 2VBGA 4PAWA 4WMLA 5K2OA 4GEKA 3VM6A 1SD1A 2CKMA 2NQ2C 1L7NA 1L5YA 1HTBA 3FUWA 4R1SA 5DEIA 3WK6A 1PJBA 4CM8A 3QFRA 1E6MA 2BE9A 3NKFA 4DT1B 2BL4A 5LYJF 3V1NA 1JXQA 1T8TA 5IT0A 2FEOA 1GAEO 1E9CA 2H06A 1QQTA 3HXTA 1G3IA 1Z25A 3FYUA 1HNNA 4JC4A 1TD9A 2CXNA 3DV0A 1JJAA 4OAQA 4PRLA 2VQ3A 1PFKA 2VF4X 1UXHA 4IJUA 4LPSA 4Q01A 1OFHA 3SMQA 4BFWA 5BN3B 3EVFA 4G97A 3NPAA 2Z56A 4RCYA 1ZN2A 4W9NC 4WTOA 3NEPX 3TIFA 3GFFA 5LIPA 1QC5B 3RYHB 1FFBA 1RAGA 1XJ0A 3EFOA 1W96A 4MVJE 1X1CA 1NVFA 5ALJA 2I7XA 4K6FA 3EQZA 1PL0A 4G8DA 4KI0A 5EKTA 2X0FA 3RTBA 4D9BA 5FXMA 3OQVA 3SVTA 1RQGA 4QPCA 2QM3A 4EELA 1FDSA 4C4ZA 1V9LA 5HBRA 4EF6A 1X6VA 1GDTA 5H4GA 1EFVB 4D6YA 1HNZB 4WNCA 3C1AA 1COWD 4CM6A 1EAYA 1KFKB 4CZ2A 4GO1A 1Y7TA 2CHUA 2Z2IA 1ZUIA 3A2NA 3OA0A 3ISJA 4WASA 5KKAA 4BB9A 2QD1A 4QXRA 2RGNC 2I87A 2O0HA 1LPOA 3I9V1 2JBWA 3AUTA 2W8BB 1TVKA 1GKKA 3CJRA 5IJXA 3UJCA 3NXKA 1MA0A 5GJVC 3HPQA 1XRRA 2NO1A 3RU3A 5LFAA 1W29A 5B3LA 3OP1A 4Z9BA 3GFQA 4AZ0B 5KHOC 1RT9A 3OLYA 1ZA2A 3L4EA 3VPAA 4A0QA 1M7BA 1UJ2A 4DJEC 5JAHA 3OWHA 3RB8A 3AJRA 3FOEC 1TQ6A 2K2QB 3LCJA 3R6GA 1C9JA 1P1HA 3B36A 3GJTA 5FQNA 2CLSA 3ENQA 3Q10A 3UJBA 2ZTVA 2H4XA 1NJ6A 3CLUD 3HZHA 3JAMA 1NQOA 2L17A 4ZCRA 1CE8A 1NRXA 3LCUA 3EWSA 3FROA 2XEDA 2BGIA 4E5UA 1ZH0A 5FDFA 1E8NA 2ASEA 1GEEA 2CB9A 2G77B 4LCEA 4DZZA 4JI4B 3BSWA 1EFRD 3OZAA 4N03A 2QM7A 3SM9A 4CHGA 2BEVA 2NTVA 2YS6A 4A10A 4GC5A 4LWZA 4Y2TA 1RJEA 5H81A 1Z2DA 3KOUA 5EC8A 1VI6A 5IEBA 3R7WB 4Z8XA 4AQYB 3TMKA 3E9MA 4M76B 1G5FA 1YR1A 4EHKA 1RBMA 2HNKA 3WDMA 2BMWA 1SBTA 1XK6A 4RZSA 3CNBA 3TEFA 1VKHA 3EHDA 1Q12A 1M6YA 4MUKA 3TL2A 3S68A 3E70C 5LDDC 4HY3A 1UJNA 3KIPA 1U28A 2A35A 4WNAB 1N57A 3BH6A 4HL6A 1YDGA 2EV9A 1X1SA 5E4JA 3I53A 1Q1ZA 1Z0UA 1U8AA 5IVHA 1A7JA 3V48A 4E11A 4LQLA 1KQ3A 3DBRB 1UZNA 2ZIZA 4IOJA 4Y1RB 1JILA 3QTTA 1SBYA 4FYJA 4BMYA 1FFSA 2Q5JA 4LNUA 5EP3A 5JE8A 5TPWA 1AX9A 1H2FA 4US2R 1XQ6A 5ARDA 3S2GA 5E6SB 5B3JC 3DTVA 3DLCA 1LK0A 3J81k 1XJ5A 5CB8A 4M1ZA 5LQAA 2OOKA 3I64A 1P91A 1DOHA 3TTYA 5LL6P 4AURA 4Z0HO 3VTZA 5CDUA 2AOTA 3MS7A 1RYNA 4XSGA 1IG0A 5IKXA 4JFRA 3MJEA 4M83A 3D7LA 1YFZA 2J7PD 3K1JA 3HCFA 3NTOA 4WCDA 1CY1A 2CNBA 3I9NA 5P8WA 4X8OA 2R87A 3GEMA 2JD1A 2JI9A 3WJAA 4BVJA 1PG0A 1IHPA 1VSBA 2XT6A 2FFJA 2IBSA 2NG1A 2PH5A 3TTXA 4TTPA 5HF5A 5MN6A 1XWFA 2BGTA 4BBAA 4EHAA 5J47A 5MFPA 5ITZB 2XRZA 4J16C 4CYMA 5B55A 4ABTA 1T9AA 1JZTA 1S3SA 3CVJA 3IVMA 2Q4EA 2F1JA 4Y2XA 2BMFA 3U2QA 2FKAA 4HSEA 4Z1MD 1KEVA 3C7TA 5D01A 3GDHA 4OJKA 5FWDA 3TRFA 1JKIA 5KDDA 1EHIA 5JQGB 1FFEA 2MYUA 2RC5A 2WJWA 3C8ZA 3E4DA 3M34A 2CFCA 4JEUA 2D1SA 4MR8B 1SAYA 1PJ3A 2FF5A 4RTMA 2J45A 1A2BA 1T3SA 1QV9A 1WVGA 1XNGA 2DR3A 2E5FA 2XTAA 4TLBA 1W36B 2M9MA 5I5EA 1KZ4A 2PGJA 3LIIA 4O4JB 2PBRA 4TXNA 1XKQA 2DR0A 4CNQA 2JLQA 2BHNA 2VPYA 3E9RA 2QDKA 2GN8A 3P0IA 3JQ7A 5IC4A 3NC4A 5G1PA 5EVCA 4EZEA 4MJ7A 1YC2A 1GQFA 3A6LA 3DB2A 4IAOA 5HKKA 1B93A 3Q3JB 3HXOA 1FU7A 1Y7PA 2X8WA 3VR2A 4I1YA 1U8UA 3FA2A 3JWIA 1MA3A 1PJQA 3LIPA 1HEUA 2P9QA 2VKTA 3L0DA 2LKCA 4UTPA 3K9FC 4CCWA 4BP1A 1E2HA 1CZHA 2W4IA 4WUTA 1CKEA 1EVIA 2A0FA 3U3XA 2RJNA 2GN2A 4RM3A 1OPRA 2FN7A 2IZ5A 2QY9A 2OVFA 3ONNA 3CNNA 3NWJA 3AHHA 4BQSA 1GRVA 2AQIA 2H31A 4Z9YA 2RKOA 3OBIA 4D8VA 2FWAA 2YXNA 1OPXA 3COSA 3PE3A 2RARA 3H13A 3JQBA 5AK4A 5F1PA 5LYJB 1MVLA 2JDIA 1PFQA 1NBAA 2PLNA 2XMDA 4K46A 4UPDA 3QIAA 3FWHA 2HRQA 4V0MA 1GXSB 1K3UB 3DOCA 4FFOA 2WAOA 1QO0D 4GYJA 4Q3LA 2EEPA 4GPTA 5DJ5A 2BFEB 1X9GA 2C5LA 4JUFA 2PX4A 2W2KB 2O8VA 4QHYA 4BVHA 1L6IA 1IZYA 3P97A 2R6GA 4YUWA 1R66A 1ZWLA 2W7TA 5CB0A 3OTOB 4R9VA 3RVDA 2C2WA 4YRDA 5LNK6 3QG1A 4WLFA 1OA1A 4RPCA 1EFLA 1UKZA 2HFJA 4JV5B 3PQ6A 4GWKA 1OGJA 5J3JA 4RTPA 1P1CA 4PLVA 4MGYR 2O6LA 1TK3A 3TCXB 4DLRA 5BOSA 1EFCA 2OC4A 2ZI3A 3PPXA 3WFZA 1FVHA 1U3VA 2Y1CA 4FT2A 1R6TA 2HNBA 1VIMA 5EXPA 2N47A 1N6RA 3O0TA 4BMSA 1IY2A 4NPHA 4TYWA 2BGJA 3VTAA 5K03A 4CL0A 1T6NA 3ZBQA 2IYSA 4WDRA 2WWIA 3BWVA 2VP4A 3VKVA 1OI2A 1CT9A 2CDNA 2HK8A 4D4IA 5JALA 4KL8S 5LVAA 4IIXA 3UMCA 1B1AA 3F97A 3CVWA 1CUGA 1ULUA 4BPRA 2IYNA 2W2KA 3T3GA 3RC7A 2BPOA 2NTNA 3IRVA 4KGXA 2X76A 1PVDA 4HWOA 2GM9A 4NX2A 4UBNA 4UUNA 4FGLA 3UYLA 4P0QB 2YV4A 1KO5A 1NVBA 2RGRA 2LRHA 3TIXB 3QF7A 1A2OA 4MEBA 2AC2A 2R6JA 4V39A 4P3NA 4HXGA 2GVZC 3TWOA 1KJJA 5JBIA 3CONA 2RGYA 4PGHA 2I91A 3IELA 1EYZA 4P3YA 3KYJB 2YJ4A 1PD0A 1W94A 1Y7IA 3QTBA 2QTFA 2DULA 5JAUA 4UM9D 3MRXA 3RWOA 4HAYA 3ETEA 4MUXA 2PGOA 2V7TA 4J9VA 3WR5A 3HKEA 1QGUB 2A59A 1NNSA 3E35A 4RESA 4YV1A 3D5TA 5AVUA 2VPQA 4NL4H 4TL7A 4XIFA 2R7KA 1BWQA 1J42A 1U6IA 4IXDA 3UCFA 2I2WA 3UAXA 4ZMRA 1YZ3A 3P96A 2JJYA 1MEOA 9LDBA 1MJFA 4FLMA 1SK8A 1LQ2A 4CCAA 4ENQA 5JHHB 3DWGA 4XQ9A 4XJVA 3VO2A 1DCTA 4BNDB 3AM1A 1U9IC 3LQFA 3KQTA 3H2IA 4N0PA 1E1NA 3SF8B 1QJ4A 3ZTYA 4NONA 4TVOA 3DR3A 4L28A 3PITA 1R4NB 2C7PA 4C7XA 2PYIA 1U5CA 3VGPA 3ETNA 1NTOA 1T0IA 1UL1X 4DCOA 1QPGA 1Q5PA 4GKAA 4F45A 3BERA 5IJZA 1RQPA 3EGDB 1EU1A 4HMPA 4RFLA 3LDUA 2ANBA 3BB4A 4G0MA 1EVEA 4RKEA 1P60A 2IS6A 3L0CA 4E12A 3K5IA 2XXJA 4B3GA 5JMWA 2RCNA 1KL7A 4YMWA 2Y1OA 1BEEA 4JJ6A 1OAAA 2BFCA 1LNZA 2JBHA 3LQYA 3AR8A 2AWNA 5E7QA 3HGTA 1GKUB 1KR5A 4PHCA 1LNSA 5TJ9A 3V8MA 1KI2A 3GQBB 3T5AA 1XZEA 2OECA 4RSGA 4PZ9A 4DJFC 2XUZA 5B12A 1YIAA 1ZX1A 4CG1A 4O2AB 2WHPB 2BHSA 3D6AA 4Q1EA 4LOHA 3DZFA 5HIMA 4MQ6A 3WSVA 2P4UA 3PDIB 4AT1A 1P1BA 4Q21A 3UKJA 3ZYCA 4CLRA 4N8EA 5GZ6A 3OJ0A 5TQ2A 2HW8A 1MN6A 4MV0A 5I9TA 5HFNA 1YV9A 2OORA 2PIAA 5FL7A 3MTDA 1QIDA 1F12A 1BRMA 2F3PA 3FTFA 1UJ5A 2QYSA 2E1PA 2ZU0C 3AETB 3K09C 1HYEA 4LY0A 3A1WA 1QXSA 3LCCA 1I1HA 3ICOA 5FLYA 2IW3A 1TU3A 4UHHA 1JU3A 2I1VB 3NOVA 1FJGB 3KHTA 4B3FX 2CNWD 4EUNA 3ZVKA 3D4OA 1HL7A 2V7VA 3GEGA 3SOPA 3SBXA 1ZNXA 3FFTA 3KPJA 5FLKA 3SMVA 4M88A 1ORHA 4ZHSA 2QAGC 1DEHA 5E6RA 3AVWA 1MAAA 2EJVA 5ALIA 2QUZA 3L3BA 1G7TA 1ESCA 1T24A 2GLTA 3SICE 4EY3A 4EL0A 5TPZD 3ZS8A 4M1SA 2FEPA 2GASA 3RSOA 1NFFA 2R65A 2D5AA 3CZMA 1SCUB 2NXNA 4ZTBA 4MUIA 4Y98A 4DQLA 2DETA 2SBTA 4RHUA 1U02A 4Y0VA 3U60B 2X0DA 5JCOC 3F5QA 3S29A 3OZDA 1M1YA 4HNSA 2C2GA 2Q2QA 4RKFA 4Y30A 5ALZA 2EJCA 5GM2A 5JNSA 3GGSA 3QGMA 2CJFA 4S1PA 5JLJA 1ZK0A 2YNMC 3HMQA 4GDMA 4WJKB 3RYTC 1I24A 5LLSA 2WJVA 3C6QA 3VPGA 4EUFA 4JJ8A 4LVUA 4O08A 2DE0X 1AKNA 1QNFA 3CH7A 3RK4A 2TMKA 4CM9D 4IH9A 4ISBA 2QTLA 4HEQA 1E94E 2ZIXB 4BFVA 4WDQA 4CUJA 3EVAA 4RTLA 5ALQA 5DN6D 3EXAA 2FSHA 1BCRA 2UDPA 3DOEA 5EEHA 5BN3A 5L3QA 4K8RB 3EODA 1PQWA 3NBAA 3LUJA 2VZEA 1BJRE 1YZTA 1TPZA 4PU0A 2P3OA 4EK9A 2B0JA 3R76A 2G09A 3BKWA 1NJGA 1U5BA 2QLFA 2L18A 5JMTA 1LTHR 5IF9A 2ZBVA 3IO5A 4GW3A 2WIJA 3L8ZA 3K0AA 1LSJA 3EULA 4V1CI 3ZXYA 3AU8A 1R6XA 1H9BA 5J59A 1G3MA 4KWEA 1SBQA 1DPGA 1KP3A 1MV5A 2B2XA 2GKSA 2GRUA 3AONB 3JQQA 3CBGA 4HFRA 4WY2A 5EQFA 1BGWA 3LPMA 2ZW9A 3JARB 4ZIRB 3LY9A 4PC7A 2AMYA 4PBSA 4KNWA 4DSZA 1JA1A 4OM7A 5LZ5A 3QWAA 3RKSA 4DWWA 3HNRA 1NUPA 2YY7A 4DJDC 3EGEA 3BBPA 2WSBA 4DXAA 1AHPA 4BLVA 1XAHA 1X3LA 4D3ZA 2Y2VA 1FP6A 4NECA 1X8XA 1Y4SA 3ANSA 4KYTA 2XCTB 4UBIA 4FE3A 4R2WA 4S1VA 3KQKA 2G67A 4RZHA 4JT9A 4BMXA 2V5AA 5D87A 3RUHA 1G3RA 1W2WB 1NQ5A 1CUJA 4NFSA 2Q62A 3S7TA 1GQOA 5AW7A 3AI3A 5KYWB 3PR3A 4QNMA 4HAXA 4MLDA 1ENZA 2FMFA 3FH0A 3UWMA 1TC1A 3A6KA 4W1QA 2J9GA 3A0UA 3S40A 3IEIA 1IQ0A 3WLEA 2JLBA 1NNUA 2VWHA 4TT3A 4AJEA 2Y68A 1GA4A 2D0DA 3CMMA 4H6VA 3IEKA 2QX4A 1OR8A 2CFIA 4XDYA 4D9FA 4QUEA 1Y7LA 1R3DA 1SVNA 3N86A 2N3ZA 3OHMA 3IEUA 4Z9XA 1UC9A 4IWXA 3T3IA 1VLMA 4D82A 5EIXA 2J5BA 2VO1A 2X8BA 2R11A 3KR0A 5T5QA 1M33A 3I2KA 4G1EB 4DDWA 2UYQA 2VJOA 1E0KA 3FWKA 1UC5B 2BMJA 3VZSA 2A67A 2WSYB 4CUZA 4N5MA 1TEHA 2PU5A 3HBFA 2RAUA 4FMCF 1U11A 3QE3A 3OPXA 5SZIA 4YP9A 4KOEC 2AUMA 1N5MA 4CLOA 3HJGA 1BHJA 4HG2A 4J75A 1I1NA 2G4CA 4ATNA 1QHIA 5F3WB 4RS3A 1D0IA 1BNCA 2AXPA 1J2UA 4G89A 3F5SA 3SJ7A 3WP1B 4ROTA 3ZGNA 5I7WA 1TQ4A 3TO5A 5BSUA 3R41A 4KIWA 4FI3C 5EY5B 3OKFA 3GAFA 2FLWA 2QPLA 3G49A 2H7VA 1YC5A 3FI9A 4GI3A 1R50A 1SU8A 4TZTA 1Z8NA 3ENZA 1ZXXA 5K2MA 4Y1FA 3C4VA 2WJJA 3RM3A 3EG5A 1B14A 3GDOA 2WT8A 3GLGE 4IF4A 2J5RA 2NACA 1I6KA 1RBQA 5A62A 4ZOLA 1K7EB 1X7DA 1QS0A 3P9ZA 4OHCA 5DKFA 2CV2A 1SVWA 4JGBA 3RRXA 3IIEA 4MW4A 3VPCA 4DWVA 4Z1OA 1HQYE 2VJLA 4ZRNA 3ROQA 4F9TA 8ADHA 1QTRA 2NSYA 3HGMA 4N82A 5LJLA 3LJKA 3DHYA 1OZ0A 4KFSA 1D6MA 2KQUA 3DMPA 4WKNA 2J85A 1XDGA 1RFGE 4D99A 2VAXA 1H4QA 5EG5A 2VCHA 1IB6A 2ABWA 3LS2A 4HYQA 4NZ9A 3UW1A 1L5HA 1PUJA 3OA2A 3OECA 4BMVA 3TNLA 2DT8A 4KU4A 4KW7A 2QOEA 3ZC3A 2GYYA 5CG2A 4LFBB 1T2DA 3ZE0B 2G1PA 1QGZA 2QB5A 4KC0A 1W5BA 2YJ6A 1RDFA 1LV8A 3GRRA 4K88A 1R0KA 4J7UA 4Q1BA 3AEUB 2XSZA 2JIMA 5DM4A 1P0MA 3KLNA 2PR2A 3BSSA 3DOJA 5JMPA 2Y1FA 1UKEA 1VA4A 3HEAA 1Z3CA 4DRXB 3FMFA 1KYVA 3N70A 1FDRA 3AUYA 3NWPA 1E7MA 2X86A 3FLAA 3GRCA 4JD5A 1J2RA 1OV4A 2BTOA 3AHGA 3UFXB 2Z5FA 3MJ4A 4LYDA 5JAZA 2PA0A 2R6FA 4H31A 1U7OA 4DN6A 4RE5A 4YAGA 3W2FA 1RCUA 2JZNA 5KZMB 2JG3A 2Z30A 2JHGA 1LW7A 2ONJA 4Y6PA 4IOLA 5CH8A 4BV3A 2GRJA 3TK1A 4C6TA 4I9NA 1BQEA 5CNJA 4GKJB 5KOHB 2HR1A 5EPEA 4M38A 2O3JA 2ZAYA 2XX3A 3U4QA 2AG8A 3I6YA 1S3FA 3VR5A 3WQRA 4X8LA 3UEOA 5BWLA 1RRKA 2OSVA 4NWIA 2G17A 3TNDA 1CYDA 1Z35A 4FFPA 5ESRA 5T7BA 4LC1A 2ZLBA 3HY4A 2O8FA 4YLGA 1FVFA 4D4HA 4I55A 1QH8B 1GGKA 2UVQA 4TYPA 1SCQA 1V9CA 4PX3A 4ZAFA 1Z29A 5J2UF 3IA2A 1C1YA 1U6KA 1Z0FA 1OYVA 4YJHA 4HNVA 1J0DA 5I7UA 3ZHRA 1CZRA 1G8GA 4JOQA 2B4QA 1Y6ZA 3DCIA 4KPFC 1E2MA 1IG3A 1VBMA 2ILTA 4ALKA 3WLMA 4QU9A 1H8HD 3ABSB 3SYMA 4UQLA 1U4NA 3TQOA 4AX8A 3B5IA 4EJ2A 3KPVA 4BLPA 4UUBA 3DEIA 2XV1A 4REQA 3I4LA 5P21A 1T0JB 2W90A 4KGDA 3WLHA 1VJ5A 3HJUA 3IDSA 2ZYGA 3P4XA 5I8ZA 1ZJJA 1UPCA 2VZ0A 3QBEA 1KMNA 3BD8A 4RWEA 2CJWA 2RHOA 4ENSA 4Z7NB 1G8SA 2X0NA 3OO1A 1NVDA 1I1OA 2IUYA 4F8EA 2R7AA 1N4DA 3MOGA 5JMOA 3M6FA 2IXFA 2PZ8A 5DB4A 2POQX 4PW0A 1Y8RA 1V48A 3Q15C 1TI7A 3RYHA 3UH0A 4C6RA 3A37A 1LPMA 4B6EA 3H5LA 2X0RA 2D7JA 1V8PA 1OX5A 2ZCVA 2VPWA 3HQ4O 3PC8C 4FWBA 2N9UA 2B83A 3ST7A 3UM9A 4P6VF 5EE1A 1DIHA 5A71A 2F9FA 2HBYA 2XVYA 4BNGA 3HBJA 3GNLA 4LOJA 4FFSA 3F7OA 4AZ3A 4BO0A 3HFRA 4N41A 3JSAA 1UBRS 1Z5WA 4KAFA 2AR7A 2ZWAA 5AVVA 3W5DA 3M5PA 3WYDA 1WF6A 1CE8B 3T4EA 4I9UA 1ISGA 1E2PA 4KLCA 1APBA 1XXHB 1M5RA 2ADOA 3UF0A 3GUCA 1GYRA 3JRWA 2B2CA 2YICA 2I7CA 2H52A 3D31A 1UJMA 3X1MA 4HXEB 3IBSA 2ZRFA 2GTIA 2B20A 2NP7A 1ZRHA 1RQ7A 3E5MA 3S0JA 3VTFA 2IZZA 2J3MA 2UVPA 3FWPA 1GN9A 1WDMA 3B8HA 1QH0A 4U2CA 4AF8A 4ZREA 1GA1A 4LXTA 3LP5A 3BDAA 4FJ0A 4EY7A 4QRDA 5KTYA 4J07A 5IUKC 3P2EA 2J41A 2YV1A 1NUAA 1WE2A 1C8LA 4LOLA 4U7GA 3D8NA 5FOUA 3GEHA 4IVNA 3TVTA 3UJDA 5C7OO 2F1IA 1AQ6A 1IUPA 1JALA 2QUAA 2WICA 5TC4A 5B7GA 5K6AC 5K45A 4GXQA 4MJ3A 5DVZA 4DMLA 3GFTA 2EWVA 2HLDA 2RIPA 2ZB3A 5KPDA 1YNSA 2P5TB 3PRYA 1E7YA 2GHIA 5IFLA 4MQBA 1DQNA 3ELYA 1NBMD 4FOPA 2EZ9A 2Y0DA 4U2FA 2GAOA 1PTJC 2VTBB 2OK8A 1RHRA 2PRIA 1A97A 2H3EA 2NMVA 1ZDMA 3H6HA 4JITA 4H3KB 1QDUA 3DE7X 4MR9A 5KAPA 5L45A 4L0QA 4YQEA 1ZCBA 3DO5A 2VF5X 1C7QA 3B5EA 4UOZA 4DUYB 4CTKA 3LF2A 2VLIA 4I50A 3ANTA 1Y8AA 4BASA 1XTJA 4W63A 2FPRA 4L9WA 1NX6A 2PRKA 2EFCB 1OWNA 3P2JA 4MIEA 1NONA 4BO9A 2PZEA 3WYAA 1CV2A 3BB1A 4FIZA 4PLPA 4Q47A 3H2SA 4N49A 5IZCA 1ZH8A 4FYHA 5E2AA 4ZCQA 2OD2A 1ECGA 3CWQA 3TD9A 2GAAA 2PQ6A 4RENA 4BRSA 3KM0A 1Z2EA 4DCPA 1Z08A 4FGWA 3D4BA 3DBHB 4IWNA 3KTAA 1TJNA 2EHJA 1L4BA 1WA5A 4TV8F 4DUPA 1B6SA 3QMVA 3A14A 3R2JA 2OG1A 4AP6A 2HO4A 4HNTA 4ARCA 4QT0A 4PXSA 4RA9A 3K0CA 3RROA 1V7CA 4BLOA 4E08A 3KZXA 2ATEA 1RE0A 3C6XA 3PHGA 5IP5A 3VU8A 3K30A 1NYRA 4DMCA 5BQXA 2ZIFA 1GG8A 1YJQA 2DH5A 1W5FA 2AQKA 2KB0A 4FYVA 4LRYA 4YDHB 5D3KA 1MB9A 5FEUA 3FGPA 3PNSA 4GFDA 4JVOA 4XARA 4B3SB 2FCRA 2PZGA 4IQ0A 1WWKA 5I47A 5LOVA 2I8CA 3RSCA 5HF8A 3K6KA 3UXMA 1JX6A 1JHRA 2VH5R 2YIDA 5C3UA 2OXEA 1W6UA 1X7GA 3CUTA 3K9LA 1LVGA 5ARCA 1GNQA 4EMTA 5JYCA 4AICA 1CJTC 3MRSA 1YTUA 2AJLI 4B80A 5BSGA 2Z8ZA 2XOKA 3BMOA 4LY6A 3TECE 1ECJA 3EQ7A 3ZCPA 4D0LB 4C03A 4WOBA 2GK3A 4E21A 3EH2A 3INNA 1FFHA 1BXZA 2ORED 4A03A 3R6DA 4XB6B 3JZAA 4PLTA 2F3TA 4ZDKA 1Q1QA 5TGZA 3WMRA 1T2NA 2YZNA 3E3MA 4GXNA 4C88A 2UYHA 3D6HA 2QPOA 1STOA 3CGWA 2O05A 2LCFA 1EXMA 4UE2A 1YCHA 3ITDA 4N3NA 1W0KD 4BYGA 1F48A 4WWHA 1DTEA 1RR6A 1RQNA 3EAQA 1DLJA 4NU0A 5FV7A 5KQMA 3A1SA 1ZUWA 1VL8A 2HPZA 3L9WA 1K0FA 1ZSVA 4UM8B 4R71A 5HR5A 1W85A 4BGUA 5AM0A 2I8LA 3CVVA 2YY5A 5AVYA 3JWJA 4D9CA 5DSXA 3W5SA 4ARVA 4TSFD 2IBTA 3GCXA 2L2QA 3CLKA 4ZAVA 2ZYWX 4TKLA 4ZWNA 2XNKA 4S2EA 3ZY5A 4TQGA 2Z5VA 1L6RA 3UT0A 4MW2A 2IYXA 2QR3A 3AR2A 4M9RA 3IP1A 1OX4A 3EUFA 3DGFC 2IU3A 1N8TA 4UTNA 3QKWA 4M86A 4MVJM 4UOQA 3ZWMA 4BB5A 1Z9BA 1N5JA 1GAWA 1UMCB 1UWVA 4LQDA 4ZVMA 1ZGHA 3ENVA 2Y3IA 3CLHA 3FYTA 1H0HA 4KWHA 5CA1A 1I0IA 3UJ3X 5EPOA 4Q9AA 4Q4HA 1WCIA 2ORIA 3QVLA 2Q2VA 2ZJAA 3KHUA 4HAZA 2PS9A 4MP8A 1LS1A 4H0CA 2FLVA 5KYTA 3A4MA 3OEED 4KAJA 4YASA 3VXKA 1TMOA 3LD9A 3KB1A 1F51E 5DM0A 2H2GA 5AKGA 3VR6A 4C2BA 5FI1B 3MTIA 1L7EA 1QO9A 2EZ4A 1Z75A 2C3UA 4KGZA 1SH7A 5DHUA 4B74A 5IKMA 3TTUA 1JDVA 1JR2A 3CRNA 3AF6A 4H0NA 2XUIA 1SQ6A 2HRDA 3H5TA 5EAIA 5I4KA 2VOEA 1U5AA 4KSBA 4EPRA 1PTJA 2F1KA 3UOAB 4L0MA 3BSYA 1A7KA 4P92A 2A58A 1R16A 1BWSA 2EBFX 3I2HA 4Z9FA 3KBOA 3D0QA 1U1FA 2GD0A 3IA7A 2ZWOA 3UHAA 1ZS9A 3K31A 3UMRA 2W2NA 2VJPA 4BMZA 2VQDA 3G6WA 1J90A 4INOA 4E7OA 4CE6A 1CR0A 4ROSA 3T38A 1YBMA 3QE2A 3TM4A 1UODA 1G5QA 2V58A 1E2GA 3GO4A 4D92A 2P5UA 2YWJA 2E5WA 1BGXT 4K6KA 1ECPA 4UW9A 4HVTA 4KOAA 1IM8A 1P61B 1AF4A 1NKTA 2BKXA 3DV2A 5EWJB 5KC8A 4NOMA 1PZFA 3L92A 2O23A 2ZYDA 3BFXA 3RC2A 2B8TA 3NORA 4OHUA 3H1AA 5AKIA 5A04A 1QCCA 1LC3A 3CZ5A 2PZJA 4NEGA 2I2BA 4AZ3B 3OOEA 1TUEA 4E94A 3ANNA 3G79A 2WSSA 5ICFA 4BJ5A 1JHXA 1E1YA 3I01M 1G291 4R0VA 3KBBA 4PICA 4LK3A 1QG2A 2HMTA 2XMZA 3I30X 2GAFA 3QUAA 3CY6A 1T2EA 3M6UA 4NCNA 1R12A 2FQQA 3C3EA 3TR6A 1T34A 2FZCA 2X8JA 1A4IA 3R9KA 3L4BC 2G8NA 2VYVD 1E79A 4JK3A 4PQGA 3PL5A 3TKYA 3PFCA 5EZ6B 4D43A 1H2XA 2Q7XA 4AJJA 5G1OA 1C7ZA 5H59A 3MGCA 3ZJVA 3AXSA 1TO1E 3F6PA 1CPYA 1FP4A 1NSTA 3M5CA 4Q3DA 4TMZA 5SYMA 3G0IA 4ZAXA 1GFZA 3VI4B 2HQRA 5A06A 1A5AB 2XODA 2AZMA 5D6NA 1KGDA 3EGXB 2A9VA 4OHBA 1LBEA 1VPEA 4J2HA 1K5DA 1NVTA 1CJBA 3H5NA 3NOQA 5FFNA 5BN5B 5EZQA 4HX9A 3O47A 5F78A 5IW8A 4N01A 3I45A 5FOWA 5JSQA 4CKEB 1JF8A 3UUFA 4JNCA 3G9UA 5CYFA 3Q7TA 4XLTA 4DCGA 2COEA 2POCA 4PHHA 1CQWA 2BRUC 2II6A 4HEJA 1YQEA 4KSCA 9MHTA 3LO5A 1O95D 2XMBA 3VDMA 2CUNA 2HWKA 3E22A 3H19A 5JARA 2PWPA 4G0PA 1JIIA 4EPYA 2QTWB 3UJAA 5H68A 1AGRA 4X66B 4CR8A 3DCJA 2BDEA 3B1YA 4E5YA 1DOZA 4O4LB 1AKQA 1NXTA 3T7TA 2WU0A 4WZBA 3UMBA 2WF9A 2OO3A 3IDOA 2GR9A 3RNLA 2I54A 3FSGA 2FJ0A 4BQFA 2LE0A 1XQ1A 2OO7A 3BL6A 3RYCB 3W5CA 1X0XA 4Q6WA 2C4NA 4X71A 4LRTB 1N36B 2PGXA 3IQZA 3WLQA 1ZD2P 4NOJA 2P69A 3QLUC 2VPIA 2XDAA 1TIBA 2YWFA 2O7SA 5F64A 3W5AA 2RDMA 3CJQA 3WYCA 3IHKA 2CUZA 4YGXB 4FU0A 3WB2A 4B4WA 1AB6A 16PKA 4QLOA 3QF4A 1T8WA 3N2KA 5BR4A 1JIJA 3CX8A 3TL3A 4AUMA 4AS2A 1DADA 4L4XA 3H5IA 2ANCA 3KKNA 4IDDA 4IXTA 4LIPD 4BVEA 3TN7A 3OCYA 3U39A 1XZMA 4XYGA 3UGTA 2X40A 4S2UA 3D7NA 5A2QA 1SXQA 3AC0A 4F2DA 3GLGB 3BRWA 5L51A 5H83A 1OILA 2WM3A 2I6GA 3FF1A 3GRZA 3ZTWA 3DE1X 3ZD6A 1YUNA 4PG5A 3W9BA 5JFOA 1RHJA 2CYCA 4IEIA 1WX1A 3HN6A 5EXTA 3ZLTA 5CNIA 3ZG6A 3W78A 4EARA 5BW6B 4WKCA 3BX1A 2B8EA 2ZRPA 1U8YA 1IXRC 3R0XA 1I36A 4FOLA 5BN4A 2XRYA 1D8AA 2HREA 4R84A 1YTLA 1HV8A 1LTKA 1PZHA 2BFPA 5BXQC 2A9KA 1U0OC 221PA 4KMRA 4D02A 4ENUA 4F11A 5JSKA 3OE7D 4K9DA 1P2FA 1XU9A 5LYYA 1JJFA 4PZLA 3IMEA 4XUDA 1GZ7A 4EI8A 2QRPA 5F2NA 1GQQA 2J0VA 2IBMA 2PRYA 3QUSA 3TVDA 1ZU4A 2IEZA 3IERA 2I2DA 1ULTA 3VOSA 5H82A 3TLKA 2E4XA 1EEHA 3AF5A 3B78A 4Q1AA 3WK5A 4OGWA 2HTFA 1XMPA 2AE1A 4Q9LA 3CM0A 1I4EB 4TYMA 4B71A 3PC4A 4NG5A 1OCEA 5G0WA 4F5EA 3LGAA 2CNOA 1QQ5A 2I4RA 3DDNA 1TM1E 1F0NA 2NU8A 3JW8A 2OEPA 4RPKA 5ALKA 5IXJA 3PQ4A 4XZ3A 1UQUA 3Q0EA 2YBEA 3OT1A 1Y3CE 2GF9A 2UVPB 4FFBB 2NTEA 4TRMA 1PL8A 5E8JA 5KB3A 3E7WA 3EK2A 4O2BF 2VA8A 2A88A 3ACCA 3L8EA 3GIWA 2OP1A 4MW7A 1IBSA 2IDKA 4NFLA 4X1IA 4EVRA 4BWFB 1G9TA 3QKIA 4TUYB 3E5HA 3NHPA 1WXEA 2Q5EA 3O21A 4AKGA 3JQDA 4J6EA 4WZZA 4J7AA 3DLPX 3DPSA 3QLUA 4RWZA 2BIFA 5EMLA 4BY9E 1EDOA 4CCSA 1N5KA 3WLLA 1UZLA 4DCNA 3C6MA 4K3UA 1DKMA 4ENTA 2LBPA 2V96A 2J9FB 1HI9A 4PYMA 3GMTA 3MMSA 5J63A 3T34A 3VX4A 4BZXA 5JD4A 3CV3A 1VECA 1KIMA 3ZIDA 3HI6A 1GUZA 3SBDA 4NMMA 3MTAA 4Z2AA 3GOQA 4WZAB 2DQKA 2VJMA 4YMLA 4TLLB 3T0IA 4AIRA 3C98A 1WXWA 1C1XB 4GOXA 4Y18A 2AE2A 2D59A 4MA5A 1T0PA 2BRUA 1U0BB 1RQ2A 2X6TA 5HE8A 2W6ID 4B3IA 4KQ9A 1KAMA 5KX5B 2C03A 2JGNA 3D6JA 3MOIA 1K7XB 1SD5A 2P3QA 4W9MC 1VTKA 1CY7A 2ZB8A 4FBLA 3GRKA 2HA6A 1RM4A 1PJZA 1OLSA 2FQ1A 4LNUB 3D3WA 3GZNA 2V9PA 5K8UA 4B3TB 1P2SA 2HRBA 4BQEA 2OQ2A 2A3NA 4QBIA 3V2UA 2NN3C 1ESDA 1L7MA 2HEIA 3QWHA 1NMZA 1K7CA 1TCCA 1GFSA 3LDHA 3W9UA 4JBGA 3H9UA 1DC3A 2OA0A 3K2IA 4LYHA 3TCKA 2EQBA 3KLBA 4AYWA 4K9LA 4W8HA 4LBWA 1JJBA 5KREA 4OBWA 1U8TA 1YK1A 3IPYA 2FW9A 3EB9A 4JOBA 4MRNA 4E46A 2V7WA 1G8FA 3C39A 4Z7OB 4KVAA 4M0FA 4JP8A 1NASA 3U62A 1OROA 5FI0B 5LMCA 4MVJP 2ZUFA 1KJ8A 1UBJS 4LHYA 2C4UA 3I1IA 5AW3A 1ULZA 3MJDA 2QN6A 5FH9A 2CZCA 3R74A 2B34A 2QJOA 3OFND 3P9SA 3ZCUA 3DEZA 3QUCA 4JU9A 1NLUA 3DF9A 4U2DA 4IKEA 4B31A 3KQHA 1KTVA 5B53A 4N47A 1ZNZA 1ZSNA 2NSJA 4K9NA 4LE2A 4AY4A 4EMUA 1U7ZA 3SSAA 1BROA 2YN2A 3DA8A 4QXAA 1WCXA 1V35A 1QTIA 2SICE 3L0PA 5EHNA 1TF7A 3VYSB 2OKCA 4JUBA 2JCYA 4JJ7A 1QIFA 2BM9A 2NM0A 2HYDA 4P80A 4UMEA 3TJRA 3WL5A 4PSKA 4DMUB 2VAWA 4TMXA 4FYPA 5HKBA 1ISHA 4U0JA 1LTQA 5CCBA 1VPLA 1QIKA 2EAUA 1D9ZA 3R6TA 4L16A 4ABYA 4AMYA 1IZ0A 2P1ZA 3MTQA 4PPGA 4XM2A 3PGLA 1O3YA 2YN0A 1W85B 3IP5A 3TRKA 2VYNA 4CI0B 3ESXA 5B64A 4XSVA 5ALRA 3S2UA 3SC3A 4KWTA 5LPNA 2WWTA 4NZZA 2H4WA 4R9NA 3G5UA 2VCYA 4ES6A 2ZM6B 4ZVTA 2IXBA 4YAFA 2XUAA 5FTKA 4G0OA 2VF7A 4I5DA 3GLIE 2WTUA 1LK5A 4AKTA 3RS2A 2H17A 1QPZA 3C3MA 1EM8A 1FNNA 1QJCA 2B30A 1TJ3A 2DG2A 3WLIA 1LCIA 3KPWA 4EG0A 2B1GA 4AWBA 1G9XA 1Y81A 5H16A 1UMCA 2HDWA 2OV6A 1F5NA 3PX2A 3USZA 3VYVA 1TMGE 4DT1A 2F67A 3FPKA 1XCPA 3QLTA 1Y34E 4KWIA 1F8FA 3B1WA 1CEEA 3PFHA 1T5LA 3HB0A 4XDHA 4MGEA 4QG3A 1N1MA 2VNAA 1RPJA 4LMRA 1XIVA 5JWOA 3SWWA 1PG2A 2A0UA 4IUDS 1EM6A 2H18A 2I03A 2FHSA 3NUQA 4QT4A 4Q9IA 1L9KA 2PPLA 4HPWA 4CDMA 1USWA 3K09A 1IXSB 3MUOA 4LJKA 5CIYA 5HZGA 2Q9UA 2WM8A 4FOTA 4I6EA 2AXQA 3O2NA 3O4VA 3JR3A 4XH9B 2I34A 1HO3A 2HT1A 2C4VA 2ZRAA 2OORC 2IEAA 521PA 4YMIA 3O95A 4TTAA 2CMGA 2C42A 1LBQA 1YB2A 1LQTA 4Q1CA 1S8NA 3WHPA 3W8RA 3PGJA 4RZIA 5C5EA 3ZEIA 3BF7A 5AIBA 3LT1A 2H57A 4ZVUA 3CWZA 5KNDA 3CIFA 1OB5A 1XHFA 4I8IA 1DKUA 2QU8A 4J0KA 4G01B 2XRFA 1YBFA 2G1KA 5FWAA 2VBCA 3S8EA 2O1SA 4XR4A 2OENG 4AL4A 4OYYA 1BA3A 5J5CA 4N3CA 4OFWA 1QOPB 3GJ8A 5JY1A 1RD4A 3FZQA 3NC0C 1J9ZA 5I7EA 1EK0A 4ILEA 4PGMA 5K51A 1D2CA 5FNVA 3PHJA 3RBVA 3T5GA 1C2TA 1M8KA 4BUJA 2C2MA 4M8IA 2C8KA 1OHHD 1PJ8A 1P80A 1ONBA 1JYEA 2FR1A 3SU8A 1W8IA 1JR6A 2A1UA 3E9DA 3HY6A 3FTDA 4CM8B 4DCTA 3KNZA 2ENWA 4HGPA 5JXIA 2FR8A 1PJ4A 4GXTA 2WEKA 1D3AA 5F7XA 1DIGA 3THWA 5FBRB 3KQLA 3ZUPA 5IN4A 1ZNWA 3G13A 3SEAA 4F2GA 2CJXA 5AVSA 4C0QC 2NNWB 1SUSA 3AEYA 1OVMA 1T5OA 1UMDA 2O0MA 1VM6A 2WJ4A 2YZKA 2XI4A 3P71T 3NR2A 3OE7A 4FGKA 1WMSA 3A3NA 5DCWA 3STYA 2P3SA 3ZR4B 4TYNA 4YRNA 4OFXA 2YS7A 3VAZA 2QPAA 1DX4A 4ERNA 4LOKA 5BYBA 4D81A 3I9V6 1UT6A 3HYCA 1QP7A 3U4MA 4HDOB 2CLDX 5DXAA 1N0UA 1U7TA 3BS4A 3WK8A 1YL5A 4E1VA 1U04A 3FFWA 3LQ1A 5IDXA 3N0XA 4JL6A 3EOAI 3ELWA 1ADCA 1IQUA 4GGMX 1FFAA 2VYFA 4XDGA 3WOVA 3ICWA 1NXWA 4PNPA 3L4KA 1T8YA 3GRFA 5EERA 1HPLA 4ZYXA 5HJ7A 2IQ5A 2Y66A 3EIEA 3ROZA 3L43A 3TYXA 4CV2A 1BJKA 2EJWA 4NMHA 4QO7A 5AFSA 5EHZA 1PDWA 3H75A 4O4IB 1IMJA 1ZAYA 4DREA 1UOOA 1RAFA 4XEHA 3PGMA 4U39A 5TPWB 3SSOA 1MW8X 3GNTA 1AXGA 3OLZA 4XOIA 2FRVA 5T3YA 1V4NA 2AD5A 3LVBA 5AVJA 1RAIA 2XOKD 1MB3A 2XQJA 3UXEA 4MZXA 4B34A 3T5PA 1V4BA 2CCJA 5A4MS 4HGZA 4N5DA 1P6UA 1Z47A 3WGIA 4AY6A 4EH1A 3PWKA 3QELA 1SXGA 3F78A 3OY7A 4BGEA 1I2MA 3WWYA 1NJ8A 2GZ3A 3FPCA 1ZL0A 3LL7A 4FTWA 3KSAC 2W11A 1N2CE 2J0SA 5F23A 4OKIA 1E4EB 1HYGA 2CCKA 2QZ9A 4ICIA 1UBCA 2PFKA 2VP5A 3DFFA 3NT4A 4H1UA 4LE0A 4RFVA 1YONA 4QUIA 4DDHA 2J8ZA 1E1KA 3I4CA 3K73O 1Z63A 1PGOA 1X0VA 4P83A 5CLJA 1QG4A 4P4GA 4WJZA 1BS1A 1WDKA 5DGHA 3CU5A 4YCMA 1X1EA 3D3WB 2H48A 5EXEA 1Y5MA 5ES4B 1VI5A 3DXXA 3EMVA 4GYYA 3BRQA 1I6LA 1X77A 1CDOA 4HD8A 4JEMA 4KXWA 1AZLA 1QONA 4UEOA 3WLRA 4BKOA 4J0GA 2JLYA 4CL2A 1GLNA 4Q9HA 2VCEA 3LPAA 3VHLB 3PB3A 4KP7A 4OXIA 2JFYA 3VNRA 2B99A 4WADA 5D85A 1B4DA 4RBNA 4ZVPA 5H3HA 4YR9A 1G8KA 2OHHA 3HBLA 4RHYA 2FEMA 2H59A 2W2VA 3DHVA 1C30A 2Z2XA 3AFHA 3O75A 2JAHA 2Q99A 3OF3A 3H11A 4RF2A 1CUCA 1F2UA 2X19A 3TAHA 2HV8A 4L4ZA 3FWNA 2YRFA 3D2BA 5KCZA 1FTWA 1Z6XA 2BTQB 3ZLJA 4MUAA 3FMIA 1Z33A 5TB5A 3H0CA 4Y6LA 5FFMA 1G9SA 1FS5A 1GGJA 3BSFA 2TS1A 3C3WA 3IXMA 4M1YA 1WBDA 3M1YA 1SNYA 2Y0BA 4CEJA 2DP4E 4WW0A 5D84A 1AGXA 4P3XA 5CFRA 3VOBA 4RCVA 3BC1A 3G9QA 3SFTA 5E38A 3HN2A 4QSMA 2P7HA 3JY6A 3WMWA 4EA6A 4C05A 4YRKA 4K9SA 4Z53A 3Q5DA 3PC8A 4HX5A 4YY3B 1G8AA 4TL6A 3FJ1A 3IVAA 4JJIA 4ZODA 4DR7B 3OTQA 1EK2A 2HY7A 4C7JA 4HGQA 4NNJA 1EVLA 2ZSUA 1K86A 3NJRA 2ZIXA 1RKBA 4MX8A 4QVIA 4R9UC 3NT2A 1H3NA 1V1RB 2BE7A 3I3OA 1Z8FA 4TMWA 5GOTA 2D74A 1QH1A 1T1GA 3DT8A 3MRVA 3WTBA 4B76A 4GX5A 5JBQA 4M54A 1QFYA 1M73E 1M2WA 3OZRA 3N59A 3QPAA 4YJGA 4YRAA 2J0EA 5A5VA 3DLHA 3A3YA 4GLLA 3C1OA 3F3SA 4NNOA 4RZ2A 1FQJA 4PX5A 3WYGA 3M2PA 1G98A 1Q3HA 1VJ0A 1HORA 1K68A 1L4NA 2PUJA 2MYPA 5GIPE 5E1MA 4TV9F 3P20A 1VIDA 2JAUA 5TE9A 1EDZA 1Q0QA 1XT6A 4ZVSA 3RVSA 5AVRA 4IFEA 1YKFA 4HATA 2PY6A 3A9SA 1E61A 2A14A 5AJYA 3ZD8A 3OQ6A 4RKYA 4E3ZA 1V5GA 3H5AA 1SCIA 3EXEB 5KMGA 4D8WA 1H4VB 3M1IA 3PC6A 5KHAA 4B3RB 2XQIA 1EJ2A 1RBYA 4BYMA 1YJCA 5GP1A 1L4MA 1QIEA 3DMDA 4B9EA 1FLVA 2C82A 1FY2A 4IJVA 4XD7D 4NU5A 2XUDA 1TZKA 5JCPA 3T1HB 5AVQA 5J2TF 1XQVA 5CB6A 5DZSA 3BWMA 2NUAA 3HEBA 2QQ0A 5IWAB 5F98A 4DKXA 3EYWA 4TT8A 4E88A 4JI7B 5DNEA 5AVOA 2ISQA 2GK7A 1S2NA 3SG0A 3FN4A 3OU7A 4ZU1X 2AVDA 3WQQA 2IEDA 1DARA 1WV1A 3EW7A 4YWHA 5A4JA 1RQXA 4J03A 4JLOA 2F8TA 2IYLD 4RZXA 2QE6A 4WEQA 3U44A 3FM9A 4QX6A 1F2TB 5IASA 4CEHB 4YO7A 2PKQP 4EDFA 2Y9MB 4OJYA 4FWTA 3B7GA 4LKOA 3BWBA 1K63A 1WSAA 4IZIA 4QAJA 2CNWA 1OASA 1D4OA 1JEQB 2WI8A 3HJRA 2BLNA 3WLOA 1K08A 3LA6A 3TINA 1ADFA 2IU6A 4TQUS 4XWWA 4LJ9A 4YMHA 2RBEA 1POXA 3DW3X 4E5MA 4XGQA 4IDPA 1J1IA 1JG3A 1NLZA 5L4NA 1CQJB 4D26A 3O9VA 4OQMA 2H8GA 2QUKA 3Q4GA 1BH2A 4CQLA 4L5JA 1SVMA 2NZVG 3QQPA 5MF6A 1DLIA 4OGKA 2C2YA 2JZOA 2YJ5A 3WO0A 1JSCA 4G5FA 5HCUA 1AMOA 3Q5EA 3RUEA 4QGAA 2QZPA 2P6MA 1TZCA 4F04A 2PK3A 2QD4A 3K0BA 5EIHA 5CFQA 2CFTA 1GWNA 1Z62A 1C3OB 2XNHA 2I67A 3TPCA 2J7PA 5EMHA 1X80A 1GUFA 3IPXA 4EITA 1IL0A 4IHJB 3R4VA 3UJ6A 3LWDA 5CEFA 4RORA 1QDEA 2YHIA 3TQIA 3WMXA 5K0GA 1Y1TA 3JVDA 4C7BA 3GZNB 4J90A 3WNZA 2CMKA 2FWJA 3FCAA 4MW6A 4OGFA 4GPD1 4OLFA 4B47A 1Z37A 5AM2A 5K0SA 1O0CA 4D8TA 1CZKA 3HVIA 1ENOA 2E4AA 3ZCTA 3P2KA 1VCMA 4L95C 3WB1A 2W83A 4EDHA 1QQ6A 1WU7A 1E7RA 1VGQA 3DNFA 2OCPA 1QIHA 3HKEB 1P33A 4ALMA 2NQ8A 1CDEA 4BLSA 3NTVA 1AV6A 2X8JB 3TB4A 2ZT5A 3OTIA 4PYOA 2LIPA 2YWCA 1C7FA 4LYGA 5FV4A 4XB1A 1Q50A 4EQZA 1E96A 4M53A 1N2XA 5JYDA 3QPCA 3OLXA 1E1MA 1HQDA 4LHWA 1P31A 3F90A 2Q1XA 5C4GB 2NW6A 3U7JA 4MKHA 5EINA 3UWOA 4DDMA 4CTNA 1CYEA 3IQHX 5KNBD 2PD4A 3ESCA 2DUMA 1DUSA 3COJA 1E62A 1RZ3A 3BULA 2LXNA 1W73A 4DS3A 3WVNA 4PN7A 1G7CA 4FZRA 1XVUA 3LPLA 2DC1A 2I6XA 3B13B 2FMTA 4WKGA 1WMAA 1XD2A 1Q1GA 2P6RA 4ZQCB 1X1QA 2ES4A 1W0CA 1VLLA 2PG3A 1P1JA 3QELB 3C45A 1I2DA 4LXYA 4WXPA 3NHJA 1YKSA 1QF7A 3CURA 3VSBA 1MIOA 5IVKA 1ZLYA 3C24A 1JQEA 1L4UA 3NNSA 4FBGA 4GOMD 3KAKA 4OMFG 4FR5A 2NX2A 1PK7A 4W9NA 4LJ5A 4PZ0A 3RSSA 1N77A 2XH8A 1V9SA 3KUUA 4L7QA 4Y8VA 3T3EA 1SXJB 1DQSA 1R4NA 6LDHA 1AE1A 2WINI 1H5QA 3ILHA 1FYVA 1XZHA 4I4IA 4FT4A 3FYUC 2IDMA 2FZ5A 3EF0A 3TL6A 4BE9A 5JNVA 1PQUA 4UHJA 1K8QA 2O3SA 3ZWPA 3PNLA 1R2QA 3FOAA 4F2HA 1TFUA 3A9UA 3ONEA 4B4VA 1RS0A 4DGQA 4F91B 3JVVA 3M81A 3RBXA 4CLRB 1Q6YA 2I8AA 4LF5B 5FRDA 1PKXA 1WUJS 5E4YA 4B4UA 1MZPA 1P7PA 2HMAA 1YZVA 3ILXA 2VHJA 1C7EA 3KJGA 4L9SA 3LP8A 1JA9A 4KQHA 3UB2A 4OYHA 5TS3A 3GPLA 3P9XA 1PYDA 1Z56C 2CK3A 2P9FA 1PLLA 1UT5A 3EBOA 1FEZA 1GN8A 2IC5A 5LZ7A 1WPGA 3ZHUA 4D42A 3CVYA 2AFIB 4P86A 3VFDA 3V55A 3W79A 4I81A 2EJTA 5C4IA 5DWVA 4Q9NA 4M46A 4YJHB 5BQFA 3NWOA 1NWCA 2ON6A 4M6WA 4TX1A 3ZDCA 3ZK8A 1JB1A 2ZT8A 2CHFA 1JL3A 1P4HA 1QCZA 2B61A 2QN8A 2XPCA 2YFQA 4FW8A 4XX0B 3F3YA 1ETHA 4IXWA 3SLRA 3TUIC 1SKAA 3KETA 2IH4A 2A94A 5FORA 2HH9A 1V16B 4RY9A 4RXTA 1G66A 2A1UB 4IIVA 1CW2B 5C1BA 4LK2A 1L8LA 2ZJ3A 2JLUA 2BFDA 2AK2A 3LQRA 3ZDRA 3DO8A 5EHXA 5D5QA 1K8XB 2J0UB 1T1SA 3JD1A 5B6IA 4ZV9A 4I46A 1JDUA 5JSZB 3T1TA 2VDWA 3K2EA 4D7AA 1QR2A 3P45A 3ETDA 3AUSA 3PFKA 1Q84A 1R1DA 2ZU6A 2OGTA 1PQ4A 1QHSA 3L7AA 3G0CA 4MW9A 4N65A 1SHLA 2XGSA 4BFCA 4IO0A 3BWXA 3NHZA 4R9RA 1B3BA 2QUIA 4RW0A 3JALA 3S3TA 2RK6A 3NBFA 2XF2A 1KY3A 3C6BA 1IU9A 1S1MA 2PMCA 4EJMA 2IPNA 2LDBA 4R1MA 1MU0A 3OQHA 1IQPA 1JFLA 4GMKA 1ZPDA 2MR5A 4V0LA 4JC8A 2PBFA 1DCFA 2GERA 2W00A 5AKHA 4TMTA 1P5RA 1NP3A 1JHPA 2A4KA 2VHZA 3ADPA 3CGGA 3RYFB 3BGIA 4HWTA 3SEZA 2Z43A 2NO0A 1GO2A 2RGGA 1JEYB 2B8JA 1SUAA 1LUAA 2J09A 3F2IA 3NVDA 4FCTA 3ZE8A 3ET5A 2AG1A 5IZCC 2VQFB 4MQUA 1WM1A 1DAOA 5I7SA 1FMCA 1K9VF 3EPPA 3WGYA 1SUDA 1Z4KA 5HHTA 4N6OA 4BN5A 2JLCA 2VSNA 4Z49A 4FDTA 2RG7A 4L72A 4P4UA 2F7SA 1C0KA 2EQ5A 1CTQA 2BI8A 1GL3A 4L9RA 1TUGA 3Q2IA 5LMUB 1ZK3A 4AYTA 3BZBA 3PQCA 4G4SO 1K92A 4J0DA 4U7WA 1X1RA 1TECE 3JATA 1RABA 1YIDA 3UJ9A 4CU5A 3EX7C 1IE3A 1SCNE 3WNBA 4KXFB 1CBUA 5CVDA 2YYSA 4U2KA 1MFZA 3QPVA 4LYEA 5DGIA 3GBPA 2G4LA 3WGVA 4ZVQA 3NW9A 1UFKA 2WM9B 3RTAA 1U5BB 4OXYA 4B84A 2E4VA 1YUMA 1I4OA 3OEHA 4FGZA 3MBIA 1T43A 1YQUA 3T3PB 3FCOA 4AFNA 1X8LA 4HDAA 4D9JA 2EKZA 3C7KA 4PLYA 2HA0A 4WFJA 5DYYA 4X00A 3WIVA 1OFGA 3PNVA 4MQEB 3ADDA 1QZXA 2PVCA 3D8BA 4U2EA 4JSYA 1A7AA 4F5DA 4ENPA 3HDQA 5UKDA 4QPJC 3ILYA 4M37A 4E2WA 3NYWA 5DBEX 4RJLA 3O2JA 1LDYA 1A9TA 1RKQA 2DFLA 1ZISA 4IYRA 5I3CA 3UATA 4LDNA 3H9QA 1RI2A 1GPWB 3CEMA 4FDVA 3D3QA 1ZONA 4RJJA 3TKAA 4ZGBA 2X5XA 3AG6A 3D1LA 3ZLVA 3GA7A 2PANA 4X60A 3SE7A 2VJAA 2IYEA 5KPJA 2PKCA 3BUSA 4C0WA 3QMMA 1S7GA 2GETA 1YS6A 3W1WA 3NHMA 2DCMA 1UAGA 4C3ZA 4M1MA 3ZGYA 5CA0B 1AQYA 2XKJE 5CXSA 2IZOA 3O4HA 5EA2A 4CMJA 1Q1NA 5EKDA 4UZSA 5F7OA 2Q1TA 4GRDA 1CY4A 3D4NA 2DBRA 2UKDA 5JAMA 1E64A 1G63A 4F8JA 2UZ1A 2F9MA 4CEJB 3PFNA 1FSZA 1WB5A 4MITA 3N8IA 4A2CA 1O54A 3FTCA 5BV2P 3DBIA 1QB7A 4CT0A 3I6BA 1TKBA 1Y1PA 4S1OA 4DMMA 2ZB2A 4HRAA 3K8ZA 1RPAA 2OLEA 4RTJA 3D2CA 3N9IA 5TMDA 2B8NA 4NBSA 1RU3A 4DA9A 4CN8A 4WZAA 3TZBA 2KHZA 2Q4BA 3BDIA 4OQ4A 2NUTB 4NICA 3DBOB 2OFOA 5DBGA 4ZVRA 4EF5A 3EA0A 1AM4D 1RBZA 2RKBA 3RIMA 3FPJA 4DILA 1XNHA 1KI6A 1WD5A 4FYIA 4V0SA 2QLMA 4QBFA 1LGYA 1E89A 2F64A 1KARA 3EIWA 2KPOA 2X58A 4L85A 1DQRA 5BVHA 2Z5GA 3G2MA 4JASB 4U8GA 3A6ZA 3EW9A 4LHXA 1T5DX 5CFNA 1WBJB 5EZYF 3WLKX 3KOOA 3HFSA 3Q9UA 3QX9A 3LPCA 3I8SA 3U5TA 2JKZA 5A3QA 5TQVA 4XGIA 1VCOA 6ABPA 4MI6A 2YNMA 3EG9A 5ARBA 4HDKA 4A3SA 3NYRA 1PT8A 2ZUUA 1OH5A 4MUMA 3E0XA 1Y1SA 3LRTA 1EFHA 3PE6A 3NHWA 3H9BA 3OZTA 1M1NA 2V54A 4NG4A 2F3RA 4FFWA 2ZKLA 1D4ZA 1L7AA 2P0AA 5TARA 2YIVX 1SXPA 1QVWA 3BA1A 1HMYA 3CLUC 2VH1A 5DTMA 4WBNF 1HOXA 1H3EA 2HJGA 4BLRA 1JVNA 3ZKWB 1P9WA 1I8TA 1VG9B 3A9CA 3B9QA 3IAM1 4V0OA 5ITSA 1OIXA 2GSDA 3B3AA 5DGCA 2CVZA 1ZP6A 4JLAA 4OF4A 3F1LA 1T3ZA 4KFTA 1UK7A 1UOEA 5ALPA 3OEWA 2C84A 2KSQA 5A9RA 3AOGA 4N8DA 1UKVY 2WJIA 3NAGA 1QQ7A 2BEWA 5IG2A 2VJBA 1P3DA 2AZXA 2XHEA 4Y2YA 3WMEA 3ZVMA 2HI0A 2GWHA 1ES9A 4RVCA 2WIDA 3PD0A 3UPDA 4R8KA 3UXYA 1KIFA 4G5GA 4PAQA 3D8TA 4CKXA 3WL6A 2EC5A 3MLAA 2MSEB 3G9XA 5EQTA 1P17A 5FADA 2C7VA 3OI7A 4G4IA 1N7IA 4DLSA 1T2CA 3ETCA 2H29A 1YQGA 3KVRA 4RADA 1W76A 1PJAA 4HHEA 1W5AA 3DZHA 3TRDA 5DX1A 4RVNA 4RIGA 5I7OA 1E6UA 2WWXA 4XIJA 3UK7A 1G2PA 4FNOA 5BUQA 2YTZA 3VHRA 1GQ2A 4RKRA 2C83A 3O1LA 2R6CA 4UNIA 1P1KA 1P2BA 4DJJA 1MF7A 2F8MA 4PRYA 2QMUA 3HGQA 4P98A 3TTWA 1H94A 1DZ3A 2F1RA 2H0AA 2ZIGA 2Z09A 3TZEA 4B6JA 5BXYA 4ZO7A 1QK5A 2MDTA 1QYRA 1HYBA 5HZKA 4BOYA 2XVZA 3LC1O 1BH6A 4ZT5A 3V4OA 1GTL1 3AUUA 4AF7A 4EMBA 6YASA 3EGIA 3PTLA 3G5AA 1NDUA 1YB1A 1AZSC 4UCWA 5CLQA 3U13A 1R0RE 3KU4A 5C2JB 2W6NA 2H1HA 2ZATA 3KXLA 1JLKA 1SUWA 4TS3A 5DP2A 2M98A 4JXZA 2PWBA 3AW9A 4LTDA 2O8FB 4HUQB 4MAMA 4MQ5A 5L8VA 3I5UA 1N6LA 1X9IA 1RYBA 1B43A 1N2BA 5AR1A 1N8SA 3Q7PA 3P9YA 3R3JA 1FP2A 5AKYA 3PTAA 1TAUA 2E49A 2I2XB 3DKPA 3TH5A 4YK7A 4PC6A 1T2UA 1KO8A 3ZIAA 3ETGA 3AEKB 4MVJF 1V37A 5KNCD 3K6SA 4GI2A 3WIOA 4R2LA 1AXEA 3BJIC 5DU2A 5EOVA 3EQ9A 4RK7A 4UM5A 1JU9A 1X7HA 2XE7A 3M9LA 5TS2A 3PX3A 1XD9A 4EG7A 2HA2A 1PYOA 3N76A 2D4AA 4M99A 1QX4A 4F92B 5KINB 4J16A 1C9MA 2ZUVA 4OJTA 5DCYA 4REOA 4FZVA 3MJHA 5CB4A 2IA5A 1W0KA 1HH4A 1V45E 3K72B 4L8WB 4P08A 2E4YA 1MENA 2BHTA 4DDUA 1KQOA 4TXJA 2WOOA 3QUQA 3W77A 4F3YA 4IQ4A 1K0UA 2ZQYA 1Y1RA 3IL2A 1EZ1A 2RFLA 1G5PA 5E3HA 2DSNA 3NM6B 4WRRA 4HH3C 5HZMA 3M6MD 5L95A 1MIOB 4L8VA 5DEOA 1TGVA 4D3XA 3AVUA 3NM4A 4MINA 3TRHA 5AJVB 2IHNA 3U09A 4JUDX 3GYBA 4HEA6 5KKCA