3W7AA

Crystal structure of azoreductase azrc fin complex with sulfone-modified azo dye acid red 88
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
210
structure length
210
Chain Sequence
TKVLFITANPNSAEGSFGMAVGEAFIEAYKNEHPQDEVVTIDLFNTTVPAIDADVFAAWGKFAAGEGFEALTEVQQQKVAAMNTNLETFMNADRYVFVTPMWNFSYPPVVKAYLDNVAIAGKTFKYTENGPVGLLEGKKALHIQATGGVYSEGAYAAVDFGRNHLKTVLGFVGVNDTEYIAVEGMNANPEKAQEIKEAAIANARELAKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FMN-dependent NADH-azoreductase
publication title Structures of AzrA and of AzrC complexed with substrate or inhibitor: insight into substrate specificity and catalytic mechanism
doi rcsb
source organism Bacillus
molecule tags Oxidoreductase
total genus 71
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 1.7.-.-:
pdb deposition date 2013-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3w7aA00
3S2YA 3B6MA 4LTMA 1JA1A 2QX6A 2R97A 2Z9DA 3EDOA 2MTBA 4Y7CA 4N65A 1VMEA 4YQEA 1D03A 1GG5A 2HNAA 2V5VA 1QBGA 1CZUA 3B6IA 4HS4A 4ESEA 4GQIA 2M6RA 1RLIA 4N9QA 4YAWA 4C14A 1SQSA 4Y9UA 3B6KA 2KQUA 4D02A 1C7FA 4YAUA 5TGZA 1ZWKA 3GFQA 1CZLA 2FLVA 1AKRA 2HNBA 4FX2A 5EA2A 3G5MA 2BMVA 2Z98A 4Y9RA 2XODA 2AMJA 1FLAA 4DIKA 2A5LA 1J9ZA 3O73A 3ES9A 1I1OA 2KLBA 1YCHA 4H6PA 2WC1A 4GI5A 3OX3A 2OYSA 1J9GA 3O2NA 3OVMA 5F51A 1RTTA 3KEGA 1OBOA 3U7IA 2QX9A 2N1MA 2Z9CA 5FUQA 5LMCA 2FDXA 4FGLA 1RCFA 3LCMA 1NNI1 3FW1A 4LA4A 3JSXA 3LT5A 4ZVKA 4C76A 3HR4A 1KBOA 1AG9A 5NLLA 1FVXA 2QR2A 1WSWA 3K20A 3QFCA 3NFRA 4GR9A 5FX2A 3NHFA 3NHWA 4LAFA 1OFVA 1CZHA 1J8QA 2BZSA 2OHJA 4CF6A 3NHLA 1KBQA 4DY4A 4U7HA 5JROA 1YDGA 2RG1A 1DXQA 3NHYA 4QOEA 1XYYA 3F6RA 3U7RA 1DXOA 2F1OA 3W79A 1J9EA 3QE2A 3W77A 3NHJA 2FZVA 3OX1A 2BPOA 2ZKIA 2FZ5A 1H69A 4U7GA 2BF4A 1AMOA 4QOIA 4LTNA 1AHNA 3F6SA 4R81A 1X77A 3SVLA 4J8PA 3K1YA 1CZKA 2B3DA 2QX4A 3B6JA 2V5UA 3F2VA 1AKTA 3P0RA 4ZVMA 5B3KA 6NULA 1WSBA 1T0IA 2V9CA 3NHPA 4N82A 4U7FA 5F12A 3OWHA 3N3BC 4QOJA 3GFSA 1FLVA 1FTGA 2X2OA 1AKQA 4DILA 1ZWLA 1YCGA 2D5IA 5LLDA 5ULLA 3GAMA 3NHSA 5LBUA 4OXXA 3F90A 3KAQA 3NHKA 3FVWA 3NHUA 3KLBA 3OWXA 2R96A 5FA6A 1BVYF 4BMOB 4ZVLA 3L9WA 5LVAA 2ARKA 1AZLA 4PU0A 1RLJA 4H2DA 1XI2A 1CZNA 2HPVA 3N39C 2MWMA 1SG0A 4XDGA 1YRHA 2MT9A 3W7AA 3FNIA 2X2PA 2QX8A 1ZX1A 1V4BA 3NLLA 1YCFA 4C0XA 2GSWA 1QRDA 3W78A 2MOKA 4YAOA 4ICIA 3L9XA 3OX2A 4C0WA 1TIKA 1FX1A 4YALA 1CZRA 2Z9BA 3D7NA 4M0CA 4YAFA 1AKVA 3TEMA 3OJWA 4CETA 5F4BA 2Q9UA 3ZHOA 3UXHA 3FJOA 1D4AA 1YOBA 1XYVA 5EMNA 1B1CA 2W5UA 3KAPA 1E5DA 2QMZA 4NULA 2QMYA 1AKWA 3HLYA 1FLNA 1TLLA 2OHIA 3ESYA 4BMPB 3N3AC 4QOFA 3UXEA 3TZBA 1QHEA 4HEQA 4QOHA 4QODA 2BN4A 4FGJA 4NLLA 1DX9A 5LJLA 2Q62A 2FX2A 1AKUA 1FUEA 4XDHA 4QOGA 5BUCA 4F8YA 2OHHA 3ESZA 5A4KA 3RPEA 1FLDA 3R6WA 4PTYA 5NULA 3GFRA 3ESXA 5EAIA 1C7EA 1QR2A 1F4PA 2FAXA 5B3LA 2FVXA 3TE7A 3OJXA 1CZOA 3QFRA 4ZVNA 4FGKA 4S24A 3EYWA 3FX2A 2FOXA 3HA2A 1BU5A 2QWXA 5LBTA 2XOEA 1H66A 1OBVA 4LTDA 1D04A 2M6SA 1YKGA 1XT6A 5LJIA 3NHRA 4PTZA 1JA0A 2FCRA 1T5BA
chains in the Genus database with same CATH superfamily
2VA8A 3NWEA 3NYRA 3MRTA 2WHPA 1NTRA 1P6XA 2XCQA 2Z8YM 3KTAA 4HTAA 1F3LA 1NT4A 5L9AA 2P69A 1X1TA 2YIMA 1ST3A 3EZGA 2NZ2A 1VSVA 2M9MA 5CA0A 1B3BA 2IC5A 3WHLA 2D0OB 2IXFA 4ND8B 4W4TA 3NT4A 3QLVA 2B4RO 5LA6B 3PHHA 4ZTZB 1ECPA 1U2GC 4JEHA 4ZTBA 1WHSA 1H2HA 3SIRA 4ZMRA 3DKIA 4EB8A 2H1IA 2JH3A 1HOXA 3D59A 4OI1A 2QL9A 2IOYA 1XKTA 1R5BA 3NUGA 4HNAA 3HCOA 3EWAA 3PJDA 1BSVA 1C50A 2DMRA 2GO7A 2R1ZA 2ZCVA 4PLGA 4NXMB 1NMSA 3A1WA 4NU0A 1MC5A 4HNRA 3R4VA 3DLTA 3KLNA 5D3ZA 2R79A 2D3TA 4Y9UA 1GITA 2VHCA 4DUGA 3ABSB 3M89A 4OK3A 1VLJA 4RVUA 3SX0A 2KQUA 3B3AA 3M6XA 5K8UA 1KVUA 3ZBTA 2GA8A 3HHPA 3MAAC 4QG7A 3NRJA 1OKKD 1PJTA 1RPJA 3BIWA 3UT6A 3IXLA 4I55A 5FTNA 1RZUA 3U4CA 3ZU4A 2G1PA 1UINA 3GVPA 3IAFA 4E70A 3B2QA 2CSXA 4D02A 5ER6A 3EBPA 3L49A 4AVYA 5EFZA 4F8EA 4JC5A 3WYFA 3TJRA 4DMUB 2JFYA 5E9AA 1JAHA 2EVWX 3WAGA 2A0FA 3QRWA 2XZTA 1BVHA 3DMHA 3IALA 3EEFA 3PZBA 3GEEA 2EZTA 5AKZA 3T12A 4BV3A 1OPXA 4CNBA 1B6GA 2QY6A 1G5PA 1U1CA 2WNHA 2YR0A 4FUTA 4MQUA 4TMXA 5G4LA 5ITZA 5GADl 1Y3DE 2VH1A 3PHJA 5DULA 4U5XA 3K4QA 3NH9A 4E5DA 4QUAA 5JCJA 1Y9ZA 3G3EA 4XPZA 3THWB 2XODA 4UUNA 5EEHA 3IQEA 3UWOA 2FRDA 4RY8A 3S8YA 1KPGA 1LWOA 3LBIA 5FOXA 2A33A 4X0EA 4F8JA 3B85A 3R3JA 3HDTA 3H9QA 1LD3A 5KJCA 3T0IA 1RWVA 2UUBB 1GSIA 1Z22A 4KMRA 3OEED 2XKBA 4RF4A 3BGVA 2HH9A 3S99A 1N6RA 1TTQB 1EZ1A 1WW3A 4CTJA 3T7RA 1QIEA 2JJMA 5EI5A 3ZLTA 3DV9A 4L4ZA 2ZAOA 3JD4A 1JDPA 1SQGA 4MUXA 4YGXB 5G41A 5C51B 3UC9A 1ORRA 1EFPA 4PV7A 1L5LA 4IG4A 1GIAA 1XDBA 1GFWA 1T29A 3NRBA 3D4BA 4H08A 3WTCA 3HJCA 1E20A 2QPTA 3ED1A 1HG0A 5EKTA 3HTXA 3NTXA 2PUCA 4RMNA 4B8YA 1R5NA 3Q9SA 4KN5A 2AWNA 3BCRA 4MR9B 1E32A 4ZJPA 2GN0A 4IXWA 5L53A 5HVNA 1RTTA 3C5EA 2O4CA 4BBAA 1J4AA 2GPJA 3U44B 3M82A 4JOCA 1F2UA 1Y3CE 2P1RA 1G8FA 4D80A 2O8DA 4MCIA 5FADA 3LY9A 1DRKA 4L50A 2GF0A 1Z56C 4OB8A 2D1TA 1E1CA 3B60A 5KTNA 4HX2A 4C3ZA 5D1HA 1RACA 1B8UA 3FRHA 3TZ6A 3OWOA 2HDWA 2RC5A 2VPIA 2GDZA 2GYVA 3HN6A 3ROXA 1NDUA 2R5NA 4RZUA 2WF8A 1EUQA 3G2IA 1DJMA 1DCKA 1WDMA 4RH0A 3WLLA 4YQZA 5G0UA 1ZH0A 1ARZA 3OPYA 3KJEA 4Q21A 3UEOA 5E4TA 2AI2A 2G25A 2EBHX 3HV2A 4LJ5A 2O5EA 1JA9A 3UMCA 1I10A 1K7SN 1UWCA 2BRUC 3IKJA 7REQB 2R8XA 2PX5A 3B7WA 2Q7DA 4W5RA 1H9CA 4RHCA 3AIMA 2WJAA 2Q5OA 4OM8A 1E2IA 1SFRA 1AS0A 2AWOA 3B1FA 4P3XA 4EYGA 5GIPE 4KBYA 1VCIA 2GN4A 3PWZA 1PUIA 3QKIA 4HB4A 4OQPA 5B6JA 1YZNA 1AGXA 1Z47A 2YC2C 1KU0A 3OLCX 5B7PA 4DBLE 1P1BA 2HO4A 4ZKEA 4TV9F 3DW1X 1JSCA 4OLFA 4QUEA 1G21E 2Y27A 2IEYA 4ZEWA 1YF3A 1E7RA 5KUTA 2CXSA 1SVNA 2VEOA 4GLBA 5IXSA 2PLNA 3QFCA 1LFAA 2M2IA 2PIDA 4RZXA 1PGOA 4PO1A 5JRZA 2ORWA 5B1YA 4Q4HB 2X5KO 2ACVA 3B6ZA 3NFRA 3WP0A 3W34A 4ZDIA 4CF3A 1EP1B 1NXVA 3K53A 1Z8FA 4JC0A 2X8JB 5IHPA 2ZYAA 1C8KA 3PXEA 2XZPA 3Q85A 1ESNA 4DDTA 3LL7A 1X8KA 3FZQA 5C9ZA 3CLTC 1CK4A 3GJZA 4JR1A 4ZU1X 4BNGA 5T6BA 4HGZA 3LPNA 1UKCA 4IYRA 3OIWA 3RF7A 4BKUA 3LUHA 4OTZA 5GOZA 4TXNA 3AB8A 4B1FA 1NULA 2JKYA 3I42A 3RYFB 2XVZA 4RZ3A 1WOYA 2ODPA 2GTHA 2AZ4A 5JXJA 3CLSC 3IMEA 3L1KA 3GP8A 1DKUA 2R00A 4RKYA 4TM7A 1W96A 3PCTA 4I3HA 2O8CB 2F1OA 2XCSB 4HQFA 4IMPA 4G9EA 5CXXA 5DI9A 1Z0FA 4A1FA 2GPNA 2ROQA 4BPBA 3HFJA 3IB3A 1KQNA 5AVSA 3QVLA 2I99A 4F5YA 3G2NA 5G02A 4L15A 2BFPA 2M1ZA 5EMMA 3ZZ1A 3WBKA 1CRWG 1D2GA 5IWAB 3HRKA 4X24A 3AY3A 4R8SA 3LY7A 4GVLA 4XR4A 2K87A 4CM3A 1DB3A 2FX5A 3QE3A 1XZHA 4KR2A 3NKVA 3TCNA 3CA8A 2XA1A 4M98A 2JGNA 3G1WA 3C98A 3AHDA 4J90A 2Y76A 4GBJA 1AU9A 1VZ3A 1QG6A 3AOGA 4M1EA 3WNBA 1TUIA 2DQ4A 5EAIA 4WBNF 3WLTA 1DEKA 3R0QA 5IAJA 1GLVA 2GARA 1F60A 5L7WA 3ZV4A 1BDMA 2ZTMA 1WDWB 3U7EB 1U9CA 5JH7B 4B3TB 2JA1A 2XYVA 5CH5A 4IHKA 3ANMA 3F74A 2QVBA 4LWQA 1BRTA 1Z16A 4Q05A 3URMA 4CMEA 1GTSA 5F1KA 4X84A 3HN7A 3HXPA 2ZFUA 4M7RA 2Q0SA 2IT1A 3I83A 2QZSA 5KPDA 2G0AA 5LP6F 3A27A 3WK9A 4EZEA 2XTZA 2ERYA 4R83A 1GQYA 4PF1A 3VZDA 4QOJA 1ZMXA 4J7CA 1Z25A 4FFSA 5DE3A 2GM4A 2DCUA 4U4AA 1UFVA 1Z4PX 3EZYA 1SKYB 2UKDA 5B3JC 1HFKA 1Z0KA 3I64A 4A73A 2GUWA 3HRHA 1EFVA 1JIJA 1L9KA 1IEVA 4LECA 3ZJ4A 4A4DA 1WZUA 1GXSA 2BLLA 2ONKA 1PZEA 3R3YA 4UQLA 5DNUA 1ILEA 4ANFA 1T4DA 3KSRA 2Y4OA 4UOZA 1TMGE 4QBHA 5DLYA 1XMOB 4XYBA 4AJLA 2IPNA 2J46A 3LUFA 3MGCA 3UJHA 2DB3A 5JSUA 3DBLB 3GRKA 2BH9A 4HH0A 4EENA 1TNDA 3JVDA 4CNQA 1Z33A 1QDUA 2K2QB 3ROFA 5A3QA 2FVYA 3S2FA 3C3EA 4RSGA 2FY8A 3CPSA 3TG2A 2FK7A 2UXDB 5GVSA 3THSA 5GZ3A 2DY0A 2W48A 1M1YB 2WKPA 1JHMA 2GN9A 2POQX 2RK6A 3C6BA 4Y9DA 3WGMA 3LSYA 3CC8A 3G49A 3PEWA 4OI2A 3BRSA 1P2DA 6AT1A 4X7MA 3GAZA 3JQQA 1W35A 3ET4A 4BO5A 5DT2A 5T8KA 2WJWA 3WJAA 1ACMA 1N5LA 3VM6A 1TJNA 2BTEA 2GBGA 2IYFA 2WJJA 1WB4A 4EJ2A 3X3HA 5JAZA 1SVIA 4D25A 2H1OA 2IYWA 3GGSA 2QJTA 2PSHA 4WBSA 1ESDA 3KB1A 4IZ6A 1OZ0A 1S2OA 4ZXFA 4BQSA 4AECA 7MHTA 3EVNA 3PD7A 1KSHA 1DFGA 4D8WA 1ODIA 2ZJOA 3L4EA 3RQIA 1JFRA 3CVJA 3HGMA 3ITNA 3QGMA 3FKQA 1KI3A 4WLNA 2VYVA 1RRGA 2C98A 1LPOA 2G7MC 4M4SA 2J8ZA 1UM8A 1EMDA 3CLRC 4JQCA 3STWA 1XTKA 2XUQA 1W0KD 5BVHA 1LBHA 1L5YA 3VTZA 2WVJA 3W7AA 3KVNA 3FMPB 2C5AA 4QTTB 1P4SA 4HV4A 1TQ6A 4LBYA 4G0XA 4INZA 5KYVA 2DKOA 4JX8A 4PSDA 4A23A 2CDBA 1EDEA 2GO1A 4IXMA 2EIHA 3HCAA 3IUEA 3HP1A 2OD9A 1P0IA 4AX4A 3NJRA 3WFZA 4HPWA 4F72A 3LZDA 3NV7A 3SQMA 3B9RA 2N1BA 4C4AA 4FQ5A 3CIFA 4YJ2A 3KBOA 4FDAA 4TZTA 4DWOA 1DPFA 3ND6A 1YBHA 1KK1A 2PUFA 1UDRA 2V59A 3RS9A 1BJTA 3GCZA 4WY5A 3UV6A 1M1NB 4RF3A 5B58T 1MX1A 4E30A 5T7BA 3ORRA 4ZTUB 2C7RA 4HDMA 2OP0A 4M9CA 3GO4A 4M22A 5J4KA 3E7WA 5IN4A 5HBRA 3UCXA 4DV1B 1L5HB 2BHTA 3FLMA 4YR7A 1T0UA 2NO7A 3E7XA 2GEDA 1II8A 5F1OA 1YVUA 2A5YB 5H3LA 4LGMA 2YOFA 4IV8A 4ISBA 4Q93A 3S2IA 2DUJA 1U0FA 4BNZA 2Y0CA 3MWDA 1VMDA 5D5HA 1RQRA 1F0PA 1ZC3A 4DV2B 5BW8A 3T0GA 4YUWA 5JU6A 2IYQA 3PXAA 4Q3LA 3JASA 4HI0E 2DSTA 4I8XA 2C4HA 4ADSG 4BVFA 1GUBA 1X7YB 3JWIA 3SJBA 3UHJA 2B35A 1BAPA 1KP2A 1G8KA 2HWYA 1NVFA 3DYIA 4M0KA 2JFQA 4KLZA 1XLVA 3HVIA 4WCFB 1R6UA 1YZVA 2FYTA 3HKCB 3H5OA 1R6VA 1G2PA 1FX0A 2VHYA 4DPMA 3KAPA 1E79D 4FBLA 4HN2A 4LPSA 3NIWA 1QHIA 3OOJA 3E27A 3K0KA 1LVHA 1L4LA 3A1CA 2QD5A 1EFKA 4A2CA 5B5SA 5CFNA 5JXIA 3OFVA 5DDIP 1P0MA 1U0HC 1UJBA 2Q3EA 1VCMA 2YIJA 3HLYA 1UZLA 2W2MA 3NBXX 4M0MA 4O25A 1Z4NA 4IQ0A 3AQ4A 1B7GO 2XE4A 3GGCA 3MXOA 4GT1A 3HWWA 3A4LA 2CD9A 5CVEA 5JZMA 1CEEA 3WRYC 4DVJA 4DUYB 5LB2A 1YQ9A 1SULA 3LT1A 3LDUA 4FE3A 2VRWA 1DBRA 3U7GA 1NW3A 3UXEA 1DC7A 4QOHA 3HJFA 5ER9A 3NVDA 1RJ9A 2VHTA 1FA9A 1JYFA 2P68A 1FFEA 1ECFA 1JU4A 1XDUA 2XVXA 2Z30A 2ZIFA 3H9UA 2HHHB 1EX7A 1U5CA 4MGZR 4QGHA 1T25A 1G3MA 3SS9X 4NLLA 1RWNA 4V3CA 4ALNA 3C5CA 3WYEA 1YQWA 1PSDA 1SD2A 3UTDA 3GIWA 1QH1A 3JS5A 4U39A 3H9BA 3H2YA 3PJGA 4K6FA 4OJKA 3V8PA 4BMDA 4YMHA 1X1SA 5AKLA 4XDHA 2PX3A 1FFSA 2DZDA 3C1UA 4FNGA 3THYA 1AN9A 4JLKA 2HBYA 3AHHA 4LGVA 1ZD9A 4UHEA 4G8CA 1IN1A 1TD9A 1HYBA 2DFTA 2QMOA 1E0AA 4GMHA 3S2SA 1OLUA 3RVOA 4CKZA 4DQVA 5C7LO 1C4XA 1VSQA 3F71A 1FLDA 3R6WA 3AU8A 5KNDD 1GT6A 4B3RB 2HMWA 1E1RD 3O2SB 2D1RA 3SXUB 1L2TA 1AC5A 1X7WA 3OM1A 3IO3A 1MA0A 2P27A 3FPGA 2QRVA 1C81A 1ZVQA 3CNBA 3LP8A 3ND5A 2VJQA 3IUJA 4P5DA 4CL3A 1ABBA 3I2HA 1VHLA 4GBMA 3MTJA 4NY1A 1I5RA 3RSFA 1C5KA 3QX3A 2A1UA 4IIBA 5JCPA 2VSXA 2JBWA 3ROTA 1CIPA 4BX8A 3K9WA 1TYAE 3VR6H 3FPHA 3TE7A 2JFWA 3COYA 4BX9A 3ZLBA 4F5DA 4K8OA 4WZZA 1XHLA 1ADYA 1CQIB 1NN1A 3VQTA 4YCMA 3WGQA 1LU9A 2NZVG 2WWFA 3DE1X 4LQDA 4GAEA 5J5VA 2NXNA 4A92A 4BMXA 3PQ8A 5L51A 3K96A 1A3CA 2NX2A 3ER8A 2HWWA 2R4UA 3GA7A 1LNZA 4HK4A 2H16A 3LX4A 3GELA 3QFRA 4GXQA 4MVYA 4OQDA 4RYLA 3ZNOA 3A25A 2FW9A 3CUYA 1QFJA 1XPRA 4RHYA 1EVLA 3M1YA 1JNXX 2QE7A 5CNIA 5MFZA 2CV0A 5M2QA 2QYHA 4EK9A 2VJDA 3K32A 1V8OA 4WASA 4W5TA 1T3GA 1Z35A 2Q6KA 4CVNA 3FYUC 3KXLA 3U7JA 4Q02A 4BB6A 2JGLA 1M83A 3BA1A 3DQPA 2IU6A 3O74A 2BDTA 3RTAA 1Z06A 3DOJA 4JBWA 4URYR 3HVKA 3JXEA 3LCRA 3QWBA 5D6OA 2H31A 1C4KA 1R8YA 4CUKA 1Q7GA 4WN9B 1QSGA 1TD1A 1XDWA 2FFAA 3GT3A 3ZW9A 5CG1A 1KMQA 4L73A 2V7WA 1TVKA 3E9YA 2A57A 2JAHA 4MR8A 4MYUA 2OBXA 1TQ2A 4UEKA 4EABA 1AQJA 2W6OA 1ZRMA 2N47A 4Q3BA 2UYOA 621PA 5KSOA 5GIOE 4RYDA 4MDFA 1HX7A 3O91A 1W0CA 4BNXA 5TPZA 2JGIA 4JA2A 3ZE1B 4CIWA 1CY8A 2M6LA 4L8YA 2N42A 3WL3A 3ZY5A 1Q57A 3DZIA 4K9SA 4L22A 2CLMB 4WK0B 3VKVA 4X20B 3NBMA 1CUYA 1Y8RA 4H4DA 3ZWQA 1WG8A 2R7MA 1D03A 3HA5A 2X13A 1JDBB 2OG2A 1OLSB 3ZDYB 3CQ9A 3ZGYA 4A6DA 5FPPA 4IGFA 4XJTA 5FPSA 1UC4B 3K94A 5AK0A 1LSUA 4HGNA 4YA6A 1D9XA 2AZMA 2C1XA 2D06A 2VHQA 3F7OA 3OZXA 4QEZA 1O7JA 3HZHA 4IUDS 3MBOA 4TV9A 4TZKA 3RF6A 4YXFA 5MN6A 3I72A 1W44A 1JHYA 2HMSA 3OZUA 3B6KA 4BTEA 2P9BA 4MQBA 3NDIA 4ZC1A 4DF3A 3OSUA 8ADHA 5TEVA 5KMGB 2AD5A 3N2ZB 4HWOA 3UJAA 1FBNA 1SXJE 1BGVA 4Q6BA 2IS6A 4PIVA 3TEFA 1KI9A 1SU8A 1SIWA 3OC0A 4RV9A 1JT9A 1T5OA 3A05A 3SG0A 3TUIC 1Z08A 1GGVA 1JRLA 4IWNA 1C1XA 2NQ8A 3G5AA 1T9GR 2HCRA 1JP7A 3IERA 1LVUA 3EULA 3QNUA 2PV7A 3C6KA 4GWKA 2Q46A 4MWDA 4KPFC 1YTUA 4W6QA 2I1WA 3PPYA 4I50F 4RPKA 3FAKA 4DNPA 5KYGA 3BCUA 2FGKA 5K3EA 2IP2A 5INTA 2FG6C 3UMSA 3GXOA 4RTSA 1G8GA 2XGGA 4B81A 3MN1A 3DCNA 3GY0A 3ONWA 3QPCA 4ETMA 5D84A 1UKEA 1YVDA 3QG1A 4ZAFA 5JMWA 1D09A 1P2GA 4NV0A 2XIQA 5MDHA 4FFVA 4JCOA 5EJ9A 2EG5A 2I55A 1LJLA 1YB7A 2H1RA 4YMIA 3USES 1EM8A 1HYEA 1L7PA 1YZHA 2A4MA 1SK9A 3AJ8A 4ZYWA 4LV5B 4M9SA 2O8NA 3LUKA 1F8XA 4CQNA 4PRYA 5FV7A 5BW4A 1ZA2A 3MWEA 1CE8A 1PSWA 5C7OO 1PQYA 4F93B 5HNKA 4NJOA 2J7PD 3BD8A 1HYQA 3ZK7A 3U61B 1FDTA 2E37A 2EZ4A 3A3KA 5BY2A 4OREX 3Q6IA 5DK6A 1NZJA 1GYRA 4QOSA 3BD6A 1MABA 5EWJA 3RSZA 1WTAA 5T3YA 1Q17A 5E7QA 2RD2A 4XIJA 4M0DA 1QTIA 2XYHA 1K9VF 4GMKA 5F51A 4WBNA 2JD2A 3MJHA 3VJLA 4ARBA 3WLKX 2ZT7A 4IR7A 4BFWA 4BMCA 1T2UA 3G2MA 3TYXA 4QM6A 3Q2IA 4LRTB 3H0KA 4LMRA 5GONB 4FHZA 2QAJA 3AI2A 3ZVMA 3C15C 2QMEA 4MV8A 1QKKA 3JSAA 4XD2A 4J1NA 4XDZA 2NP7A 3TQSA 3MEQA 4QXRA 3SGLA 3V8MA 1FSPA 5BSUA 3L7JA 4KXUA 4Q9AA 2GCGA 2IX9A 5D3KA 3DWGA 2KJQA 4LHEA 5DHPA 4ZI7B 1J2TA 2XJ9A 1YUMA 4A8HA 1NN3A 4KQGA 4TUYB 1DTSA 4ZKDA 5LP6A 1T0HB 1KO8A 1MQAA 2HA3A 3BD9A 4Q39A 4V24A 4YBRA 2QMUA 3I5AA 1SQ0A 4Q3OA 3TSAA 4UTVA 1WY7A 2CKMA 3L79A 5DYTA 3SC2B 4EB6B 4NENA 4YJ2F 1NNI1 1ETUA 1QLHA 1T24A 4HJRA 2GA9A 3V1UA 4D46A 3H4MA 2VPQA 4FHCA 2Q6LA 3E9EA 1XU4A 4IJ6A 5DGXA 4EVIA 2VDWB 4ESVA 2PUDA 2JCBA 3BE5A 1NVAA 1VE5A 1V1RA 1GLGA 3WYCA 3KTDA 3IULA 5FBQB 1YO6A 4UBLA 5BYKA 3WKEA 2EDAA 4FONA 2QQ5A 4OLBA 1KI8A 2ZJ4A 5LZ5A 1WSWA 3EQ8A 3I53A 4HEA1 1VMAA 4P08A 3KKLA 3ISJA 1A88A 2W2LD 3ZWYA 1UXHA 4BC0A 1U5BA 5FX2A 1QE3A 3NHFA 4E4YA 4GD3Q 1QKIA 1XK7A 1QC5B 2GASA 4GI7A 1EK0A 4MUHA 1JFFB 2BFNA 3KOXA 4QZVA 3FMVA 1SBCA 4ZHQB 2BGWA 3L84A 5IKEA 1UP7A 3ESRA 1WHTB 4WTOA 4URZR 4G4GA 1D3AA 4YJGA 3T5DA 2C7GA 4OBBA 5EWMA 1C3LA 4JOSA 1WW8A 2H5IA 2QXUA 1NU6A 2XUZA 3DE4X 3KKPA 3NEPX 4PAOA 5FFFA 3N0VA 1WO8A 2ZAYA 2FWMX 3AV3A 3U13A 4RY0A 3BN3A 3U9SA 2YV4A 5HGJA 1G9TA 5GVRA 3OMWA 2GGSA 4ARZB 3QUCA 4QOEA 1PK7A 3O8OB 4E5UA 2I4MA 4PHGA 1N3BA 2V7EA 1T6NA 3V7WA 2CWWA 2QRZA 4TTTS 5DT9A 4BN0A 4CHGA 3W79A 4DLUA 4DVGA 4Z7OB 2FZLA 5F9HA 2VNAA 3GEHA 5IM4F 2DUNA 3VYVA 5JPCA 1TYDE 2W93A 3G17A 4BV2A 3IP7A 3NNDA 2VNKA 2EEPA 2O8BA 1UAGA 2XOXA 5B1SA 4DCJA 5FBVB 2ZJ0A 4MRPA 2G07A 4WY8A 3RYCB 1LWNA 2XF2A 3K09A 5K8JB 3GLGA 3OX1A 3GUVA 3WQQA 3I1IA 5JY6A 2Y0DA 4HAZA 1IIRA 1C8LA 4LZPA 3TKAA 1KP9A 1ZRNA 4U7GA 3SZLA 5J2TB 1ISPA 3H5AA 4N03A 4OMCA 3KUDA 4YY3B 5BN4A 1JHUA 1ILWA 1Q22A 2DYKA 221PA 4W6ZA 4B43A 4O3MA 2FRXA 2PVSA 4YO8A 3DLPX 4J8PA 5CB6A 1KWGA 2CNOA 1HR0B 3ADKA 2RCYA 3CKYA 3C3CA 4LJAA 1A2KC 1Y1LA 2XR1A 3L5KA 4P2BA 1DC8A 1RNLA 4GLOA 4C4SA 3UM9A 2PG3A 3U5ZB 1DKMA 3QIAA 1YR8A 3BB3A 4BLQA 4C4ZA 4Y30A 1RYZA 5C4MA 2F8LA 4YO7A 5KNCD 3S1SA 4QU8A 2OZKA 5BWCA 4DV5B 1HA3A 3RJ9A 5J5AA 4HQLA 2IDKA 3PDHA 4DSUA 3BJZA 3K6SB 1BQEA 3S29A 1SB9A 4OX9Y 3BH0A 5E4JA 4O02B 3TOXA 3D6MA 3BMCB 3NHPA 5J43A 4C43A 1R0WA 2DQSA 4MYCA 4QREA 3QVSA 1P81A 4X1KA 4E08A 4ALKA 2ZCJA 3OCVA 1VRVA 3K9FC 4Q9IA 3SQWA 1FNNA 3IP3A 3B36A 5EXDA 3QJGA 3H3XA 4BATA 3NNSA 1TU3A 2FFHA 3IR7A 5AI5A 1H9BA 2DLCX 1J8MF 4D4HA 3K9GA 2WJIA 2JHFA 3WGUA 2JKVA 2WG2A 1F20A 1OXBB 3I6IA 2IYRA 4PLYA 4UCQA 5EZSA 1PWXA 1Q95A 3T3HA 4KIJA 3WO0A 2HCTA 3LCJA 2J3KA 2XBLA 3BWVA 1YQQA 5EVJA 3UWPA 1NUTA 1Y7TA 3V8VA 2NU6A 4PXAA 1NLMA 2B1GA 3OEEA 3O8NA 1UIRA 2XTMA 3JYHA 1KEWA 1OW3B 3KSMA 3O6VA 4R51A 1PG5A 3G82C 4R1NA 5ALIA 2WZCA 4A91A 4NCKA 4BECA 3U4QA 2OCPA 2H7XA 1DVRA 3EFBA 5FRDA 4P3NA 2HTEA 1NDQA 4MYTA 1ZD3A 4K9DA 3R9KA 3AJRA 3KLBA 2ZRBA 4TV8F 1BVUA 3U3XA 1WQ4A 1YZTA 1IATA 4HNHA 2F90A 1KR5A 1W2HA 1Z3IX 3WKAA 1W59A 1E6WA 4Z4HA 2WLTA 4B4OA 3C5WP 5FUVA 1XKXA 1GGJA 3DYBA 2ZJBA 5JAQA 1NVWQ 3D3WA 3DUFA 3IOBA 4G0YA 4ZOLF 3DDOA 5ENZA 2JK0A 1UBKS 2QBYB 3L46A 1P45A 1JB9A 1G6Q1 1A7KA 1CNFA 3BL5A 2JFHA 3SPXA 3ZY3A 4EECA 1W76A 3LHIA 4PO9A 5B36A 4MVJE 4RLQA 4F04A 5BRAA 2C58A 4AFNA 1R6XA 1AZLA 1Z2CA 2IVFA 3MD9A 5J4YA 3RYTC 5FWNA 4LF4B 2NAPA 3BIOA 3K6KA 4DREA 4H3VA 4Q18A 4QBKA 4PNZA 4FYJA 5AICA 3HO8A 5I8ZA 2B61A 2PRYA 1Y3HA 4BASA 5JRJA 2HQRA 2HPVA 2JLAA 3N39C 1HLPA 3N0RA 1ZL0A 4IL5A 1RJDA 1IHXA 2YYZA 1CPYA 1P4RA 2IEDA 3CJTA 3CV3A 1XD2B 2WIJA 3RBVA 4F3NA 4YP9A 3D0RA 1WETA 3E9ZA 2H1SA 4GKAA 3HSSA 2YDYA 4G2NA 3VPAA 1JXMA 4HKTA 4Q9KA 2QY9A 2VH5R 1ODSA 2VJLA 4AZ0A 1RHKA 1XMSA 4MQMA 2HRRA 3VO2A 3MERA 3OCUA 5HKKD 2RKOA 4RK0A 4WIAA 4O4LF 1ZM4A 1A71A 1NXPA 2Q1UA 4HWPA 1WCV1 5EQDA 4B0OA 3LBYA 1JG4A 1QRDA 3HKBA 5A04A 1CXZA 3FB1A 4QECA 2X0KA 4CODB 1K8RA 2B4KA 1NRIA 3KCQA 1AUOA 3VDMA 1VLQA 1QORA 3AUXA 1WXWA 1X0VA 3PEEA 4A16A 3GDWA 3OU6A 1GUFA 1CZRA 2EKDA 2VUHB 2EFEB 2Z9BA 3ZHYA 4RVSA 4B79A 2A4KA 3M6UA 1J8DA 1UT5A 2YWXA 3WB0A 2P6OA 3KHUA 2D5LA 2IHYA 1FS5A 4FEAA 2QJRA 2XUFA 3NONA 2CY0A 4MWOA 2XH8A 4EI2A 5HUQA 2FE4A 3UGQA 4BVKA 4NNOA 2VSNA 1YOBA 5C53B 1T9DA 1OY1A 3DEFA 2AHOA 2ZDGA 1RKBA 2V98A 4TYNA 5C7YA 1N0HA 2OZEA 4J43A 2QYOA 1YJAA 1JFTA 4QLBA 2XWSA 3PWSA 3TB4A 3EXEB 3I5YA 2Y1FA 5F1PA 4D9IA 2WLSA 3IL2A 1R2QA 2W5UA 3HFSA 4XQEA 2H7VA 3BMQA 1STOA 2G36A 4UQPA 4EA6A 1CY0A 4OM7A 1FFDA 4CLXA 2LD4A 1RVV1 3B20A 3HJGA 3Q3VA 3P94A 3ZDZB 2QQFA 4XUDA 5JW6A 4URUR 3TECE 1I7DA 1JSZA 2JK1A 4CMBA 5I6DA 4PPYA 5AQ1A 4WGFA 4W9NC 4CFZA 4Z4GA 4E3WA 4URWR 3UZUA 2FZCA 4AZVA 4D3DA 3LPMA 1IAQA 5A9SA 1IJEA 1NNSA 2PZAA 3M6LA 4FHEA 3PPIA 3QBTA 4GOOD 1ZMOA 2DFLA 3K16A 2J1LA 1QHEA 5K4GA 5CYFA 3JQ6A 3MUOA 1AMUA 3DBVO 5ILGA 3T34A 3WNVA 3ZUGA 1IJKA 4RPGA 3PDWA 5WRFA 3L7BA 5ARBA 2QMQA 3UV7A 3UOWA 1GV0A 3E7DA 4P1ZA 1P7VA 3GF4A 2PUVA 2IPXA 1B76A 3KEFA 5CEFA 1FJGB 1IVNA 1IN4A 3KJHA 5EQJB 4FYKA 3YASA 2HNKA 1I2BA 5A9TA 2P3QA 5CFPA 4L9AA 1WE2A 5KBYA 4ZZIA 1XZIA 1G8AA 5DN6D 3RS4A 5FJJA 3OBBA 1KMIY 1U9ZA 2NXJA 4EO9A 4KZPA 3L93A 4BQNA 4ZOQI 5K1ZA 3MA0A 2Q3BA 4HHEA 3R6GA 3TD9A 1O96A 4ZV4A 3QLTA 3ESZA 4ZCSA 1L5OA 4P5EA 1I2ZA 3G0DA 4ZPXA 1KDYA 3W0LB 3NWPA 4AW9A 4F9FA 4MHOA 5AVUA 3DS8A 1BYUA 2FHSA 2P9GA 3I9KA 2JGAA 3NBAA 4I50A 4TL8A 4URHA 1NYQA 4BNKA 1IBKB 4EKNB 1UT8A 3Q98A 1SJ9A 4R1PA 3RYHB 1HFWA 5JQGB 5THQA 2A0XA 3G9QA 3KFVA 3LKZA 4UW9A 3AKZA 2OQ2A 1EIWA 1F4PA 1QH8A 2IOQA 3FCCA 3ENWA 3IAS6 4L8WB 3IILA 2EYUA 3MMPA 3PL5A 4YUAA 2HPHA 2ZTHA 1KAHA 4FZRA 3TLZA 2Y1OA 1XKQA 3TTXA 4G81A 4XGQA 3U9LA 1QHFA 1ZEMA 3WG9A 4EQ6A 3FH0A 4NOMA 1AA9A 1DADA 1GCUA 3PSAA 1CUGA 1D07A 4R1MA 4OXRA 2W37A 3TEJA 4F06A 5IC4A 2PL5A 2OGZA 1RHQA 1O6CA 3Q8LA 4P4LA 1THMA 3EVCA 3N59A 5HK8A 1V39A 5K3AA 2W6ID 1K3FA 4AJEA 5BUQA 2NO6A 2XOEA 1Q0LA 3KZNA 1AGYA 2SCUB 4J0GA 4DC1A 1YA8A 4D26A 1L3CA 1BJRE 1B8OA 1PEAA 3GEGA 3IA2A 3WL4A 1S2MA 1X9HA 3A1EA 1AV7A 2O8VA 5LXTF 4PHHA 1WBDA 1CF9A 3QU7A 3ZC3A 3LE8A 5D7BA 1T2FA 1TRHA 2F17A 1ISGA 1Y6RA 1EWQA 1HI9A 1ZUWA 1V8DA 3JQBA 1A9YA 2X5XA 4IRUB 1E6EA 1W0KA 1XCBA 4NFSA 4OHRA 3HN2A 3PGVA 5FBWB 3CLTD 3TAXA 4D1YA 1FQJA 4K8RB 4XX0B 2CKDA 4DLBA 5A4IS 2E4XA 1Z28A 1U2DC 2Q6IA 3ZQJA 2NSHA 3NPAA 4KPEC 3B78A 1P1RA 4RMGA 3HZOA 2I8CA 4Z1OA 1YFZA 2DBQA 4RD3A 3BTVA 3F3KA 4JEMA 4ZVPA 1RP1A 2LRHA 2WWHA 1VIYA 2P79A 2Q5QA 2R84A 3AESA 4JT2A 4N65A 2C9BA 4Y7CA 5HFJA 1FNMA 5ALDA 3OCJA 3H04A 3EW7A 3UMJA 3CLSD 4MUJA 1IFXA 2ADFA 4BWVA 1BMTA 2C3YA 3PT5A 3NDJA 2YTZA 1TLFA 3KJXA 1G42A 3D7RA 4PR3A 4NCAA 2EFGA 2M6RA 3ANTA 3DE6X 5D3QA 1A72A 4G5QA 4FHDA 4YAWA 3TINA 2JLXA 1TJ5A 2WMNB 521PA 4QDJA 2XE8A 1J56A 4NJEA 2CHVA 2V7QA 2CJXA 4DUPA 2R751 3RNLA 3HJTA 4HF7A 2PT6A 2GAAA 5YASA 3P2OA 4L2IA 1PBTA 1TO2E 4QGBA 1XF1A 2WFLA 1KZ1A 5DGHA 5EXPA 3TNLA 2ZUFA 3HNPA 5F2KA 4YT8A 4B4UA 1UWKA 2NVWA 5HXAA 1CUFA 4RADA 4ZQBA 1X2BA 1UT6A 1QV6A 2O3QA 2Q5EA 3G7SA 1NI4A 4R31A 2QTAA 3K6JA 5LQJA 1GL6A 1KIMA 1T4CB 1XZGA 2PS1A 3I6MA 2QJOA 4JB2A 4Q0MA 4UVEA 5FWAA 4GRDA 5I9BA 5TGZA 1HPLA 3DVAA 2Q2VA 1A50B 2CDCA 4L9SA 2FLVA 2QUHA 3JATB 2OGTA 5CA1A 2H08A 3JQ7A 3QELB 2O2CA 4JP2A 3ZD9A 3C1OA 2C00A 3H2IA 5C5DA 1YI1A 4MR7A 4V3BA 5BWBA 1Y3AA 5D86A 5HZMA 3P0HA 3AJAA 1TC1A 3QA3E 2Z98A 4XIGS 3U7QB 1E3IA 2XUHA 2V7XA 1E79A 3AR7A 5GOTA 1ORHA 2WIBA 4MAAA 5C7IO 3KT6A 4LY0A 3LCUA 1R1DA 2XUGA 5IM4A 3AERB 1KZ6A 1BS1A 1VJTA 4MUNA 4P3KA 4X7RA 3PTZA 3O73A 4EGAA 2PMBA 3OU7A 5HIMA 5HWSA 1GEGA 3PVZA 5JADA 1LK5A 3N2YA 1IY1A 2CJFA 3SC3A 1P5RA 1CCWA 2XUOA 4Z51A 4N7BA 1MRNA 2H1HA 4HC4A 1Y6QA 2EX1A 2FP3A 4BE7B 5EHXA 3FPJA 4IINA 2ZXEA 1U2EA 2I7DA 2WDPA 2IYAA 3WGGA 4GFDA 4RFSB 3PC7A 1U02A 1ID1A 5FOVA 4CM4B 1VBFA 1JLRA 4FCWA 5CK5A 4DIUA 2D6FA 5JS1A 4DAEA 2X4DA 2Y1GA 2WSSA 5JXWA 1TKRA 2ZR0A 1EFDN 3DMDA 5LCXA 1ZN9A 2J9FA 4BV8A 1OD6A 1OBOA 3R7WA 3WWYA 4ZEMA 1S2GA 2F1RA 3DDWA 4NFLA 2R3SA 4NBNA 4ND1A 2BEWB 2J0UA 2EXXA 3G8CA 4G37A 1U31A 2WHEA 2B8TA 3ZE6A 4GIBA 1RZ3A 5A5GA 3VX3A 1LJUA 3O4IA 3KLMX 5KNDA 2A58A 1EE9A 4JVNA 1WDKA 5ICSA 3UHPA 1CY2A 2AQ8A 3PWKA 4CL2A 4MVXA 3KETA 2EQAA 4GI2A 1WQ1R 4KHZA 4OGGA 3CCBA 1MB3A 1F3OA 3F1KA 3GZ4A 2GK4A 2WJ6A 1RYEA 2BFBB 4NEHB 3RS8A 5H59A 4ZEVA 1K0FA 1WPQA 1R5JA 5DO9A 4GZ3A 5IT5A 5GQSA 2CDNA 2O3RA 3EFEA 4WHMA 2NTYC 2QG9A 3S40A 4XCXA 4R8VA 1S7GA 1C0LA 2EQBA 2G71A 5HPYB 3R9XB 2G88A 3UOAB 5EZ6B 3V8QA 3P2MA 3ZWAA 5FBZA 2G06A 2CYCA 3A1NA 2YHAA 3EIOA 3QTTA 3SMQA 4CQJA 4EHFA 2GB4A 3HP4A 4PX3A 3RABA 4S05A 1JWAB 3GRFA 4FR0A 4AF8A 3OUUA 2RBKA 1R50A 2FW1A 1JTFA 4TV8A 1GDHA 2VG8A 3LYHA 4R9SA 1EVJA 1XQYA 3DGEC 1QO0D 1KMCA 2PS0A 3IOEA 3IT2A 3KZOA 1KE1A 5HP4A 5BNIA 1MPXA 1ZN8A 1X3LA 4QYSA 3HYTA 3V1NA 1QHHB 2CUZA 4F3KA 4Y1RB 3BXHA 5A3RA 3ERCA 3LFTA 4LYAA 3VZPA 3VX4A 1C1DA 2C7PA 4BN4A 2PZKA 3L4BA 2OEPA 1UMDB 3AL2A 4LZZA 4ZOLA 5A71A 4CF4A 4NMHA 1IRIA 5DB4A 2C99A 4MCJA 4U2CA 5IM5A 1AS2A 2QLNA 4GYKA 4IDFA 4EYEA 1JKJA 1C8BA 1V6SA 3LLMA 3FCYA 3QKUA 4M1MA 1VCOA 3QPVA 4JP5A 3WIVA 4DGQA 2O8FA 1XYYA 4FEYA 2HA0A 4YLGA 3F6RA 4JI0B 2HXSA 3LC2O 4E5MA 2P5TB 3GK3A 3ORFA 5E6UA 3W77A 4CIVA 4J4HA 2IXDA 2A5JA 4FJ2A 4HDSB 1VHWA 2EZUA 3E3OA 3F67A 4X62B 3GFOA 3ZD6A 1ZUIA 4RANA 2CNNA 2Q2OA 3F8TA 3X1JA 1ELOA 4RVDA 5TV2A 4CCAA 3AETA 2J3MA 1M2NA 4WZAA 5L7YA 2PH3A 2YWHA 2I7XA 1U94A 4H1WA 5AOVA 3OZ7A 4JYZA 3DOUA 1OROA 1T91A 2OQRA 1TZBA 2CEKA 2BEKA 2IYNA 2AR7A 3E9RA 3EPRA 2BUAA 3T61A 1L8OA 2ZRQA 1E8DA 2DBRA 2AR9A 5EIBC 3NI2A 1SXJB 4KXXA 4WESA 3VYTB 3CSSA 4O4LA 1Q11A 3CCFA 3H3JA 4KGZA 2PPLA 2SHKA 1C3XA 1Z17A 2Y1WA 3OE1A 4XJXA 3ZHBA 1I7PA 4JUBA 4PSUA 5ITWA 3FZYA 3PXXA 1W2WB 3QU2A 4RCVA 3FM9A 1JALA 3CJQA 1GTZA 1A0OA 1Z5OA 1TT5A 4LJ4A 2IH4A 4YYEA 3OZBA 1GAXA 3R5JA 2C4WA 2O50A 1BHJA 2BFFA 3AXTA 4PZYA 4DOMA 3ER6A 5HHTA 3IKTA 1LNSA 1YD7A 2Y1CA 1GZDA 1Y4AE 3D3EA 3HWX1 4F5ZA 4C7OB 4Q1BA 4ROSA 4GX1A 1EAYA 3VGPA 1X7XA 2O05A 4ARVA 4DV7B 4OAOA 1HE5A 1P4GA 1JPVA 2R2GA 3CGGA 4LSZA 5TX7A 2FN9A 3KSZO 1ZVKA 1PR3A 2X9VA 3FMFA 4HZUB 3RODA 5D3MA 3F2IA 4NMMA 4RULA 1Q12A 2A6PA 3QENA 4WZBE 2P41A 3P9NA 5F78A 1GILA 3TQHA 4DMHA 4TXJA 3RU2A 2DEUA 1DEHA 4PQFA 5C1BA 3WRWA 3JQ8B 2PY6A 3TL3A 5HIIA 1I9CA 4MVJD 2RGRA 5DSZA 5H1YA 2EOAA 3QVGB 4HDKB 2Y9MB 3JX9A 1WUYA 3TQOA 1E4EA 3JQDA 4IP0A 3WGYA 1WXIA 1EGAA 1X7DA 1BHO1 4YUXA 4HTFB 1XHEA 3F4BA 2WJ4A 5L3SA 4M89A 2G67A 1UEJA 5SZIA 1MO6A 1Q50A 2SKDA 3F78A 4G89A 3TZLA 5ECDA 4RD2A 1L6RA 2OORC 3QVKA 2CFSA 4EUNA 2GSDA 1BXZA 4MWEA 3BHMA 3TX6A 4YFYA 1RRPA 3A6ZA 1MENA 2AFHE 3NEYA 1QS0B 4G1FA 1GUYA 4BE9A 3ZWVA 5DW3A 3K8ZA 3KKKA 1I3MA 3LYUA 5JSZB 4MA0A 3FDZA 3Q7EA 5JO0A 2INGX 1Z7WA 3LXXA 4EWLA 1UEIA 2DTEA 3LT4A 3DOFA 4MKRA 3PJEA 4R2MA 4YUYA 3B3FA 3MMZA 4Y18A 4BO3A 2H6EA 5AKHA 3I6QA 1JQEA 2B37A 4N47A 1BVYF 2YJ6A 1TECE 4DSTA 4DNOA 3SYKA 3GJ6A 1YUBA 3QQ5A 4G6ZA 4FINA 4PWYA 5DNWA 1V5IA 1O1YA 3CO5A 2R8EA 5A6SA 1TFUA 3P96A 5E7MA 3LQ4A 3ZYCA 3IXMA 2CCKA 1KO1A 3SMVA 3I8SA 4M1ZA 1GTL1 1TEHA 4JLAA 1CZNA 3QVTA 3CZ5A 2MWMA 2CLKB 4KJXA 4QRIA 1AQIA 4RVFA 1F6DA 5KNLA 2BP7B 4RGVA 5G0VA 4XYMA 3LOUA 4IKOA 4AZSA 4K81B 4V39A 1P8AA 2WA2A 1W6UA 1YQEA 3H19A 3JR3A 5L45A 2C92A 1EA7A 1SK8A 2F8TA 1UBCA 2Q4EA 1Y33E 3RFCA 4LXUA 3TDKA 4DTCA 5CURA 5DHRA 2EARA 4PC6A 1IXYA 5K8CA 4JLNA 1PO7A 2AFIE 4BX0A 4R40A 1T36B 4L9WA 1SY7A 1Z15A 4FFWA 4F92B 3DFZA 1NBHA 2V0NA 3EC7A 4CG2A 1QZZA 1XG5A 4QIHA 4NYJR 2BFWA 3E5MA 4A8JA 1XZMA 2QTLA 3SDSA 1LBEA 2FPXA 2PZBA 2WA1A 2XX3A 5TVGA 2QT0A 4WPGA 3E15A 4YNBA 2AX4A 3I01M 2B8EA 5E8JA 1CP3A 2J0VA 2C2KA 4H0NA 4YAGA 4MO2A 2W2QA 3LP5A 5EJGA 2VWQA 3CLVA 4FCVA 4N7RA 1VL0A 3ETHA 4MW7A 3NTUA 2VHWA 4MVCA 5AVRA 4BFYA 3TSWA 3MYRA 4KK4A 5FAXA 1Y80A 5KOJA 1N25A 3QFHA 2ZSUA 3MG9A 5D7NA 1M9NA 2CVPA 4OA5A 1CJMA 3UXHA 1RLTA 2VZ8A 1OLXA 3FJOA 9MHTA 2CUNA 3OZFA 1UBLS 4GMGA 3AEUB 3P4XA 5LXTA 3GEDA 2RGNC 3CR7A 5JCOA 3TUZC 1VYTA 1ZJ6A 1KAEA 2XKKA 4HYQA 2VN8A 1DELA 1NQOA 1WZNA 2IK8A 3I3SR 4D4MA 4R0MA 3L07A 2UXBB 5A4MS 4FP9A 4RUKA 2C4UA 1M33A 4MYSA 1QYDA 4TT3A 4XGRA 1NF2A 2O52A 1W9HA 1UZNA 2OZLB 1KAMA 3G7NA 4TLMB 2LDXA 3EIWA 3QNMA 1ZBQA 1RRVA 4LDJA 1GDDA 1GQFA 1NYRA 2O6HA 1UMCB 1ZVJA 2X0RA 5CIWA 4C6TB 3DCYA 5FL7D 4PAWA 1O5IA 2NUTB 4IH9A 5EZ5A 5AIAA 4RFVA 2R44A 1UEXC 4QLAA 1QZUA 4CT4B 5EJ7A 1P4HA 1L5SA 2M32A 3KZKA 1YB5A 3L7OA 3O4GA 1UBJS 4H1TA 1SHUX 3U4IA 4XEUA 3L04A 1ODKA 4RKWA 1DQSA 3DNFA 3BJRA 5ESDA 1G16A 4QVKA 1OH8A 1P7CA 3CNHA 4BXOA 2XHZA 4Y2TA 3TPCA 4BGVA 2O4UX 1RXYA 2PL3A 2C04A 4DNQA 1R00A 2PGAA 2RMKA 4DJEC 5CH8A 4GOMD 1R6DA 2WEKA 4LE1A 4BB0A 1DKQA 1Z0SA 1X9IA 2BM1A 1AIPA 2R5FA 2PUGA 1JEYB 4HXEB 4YWHA 1TO1E 3EGWA 5LA6F 4C7VA 1IHYA 4QRHA 5FP0A 5H9WA 4L5JA 4BU1A 3K70B 2FX2A 3LOPA 1K8QA 1QMGA 1U2ZA 3A6KA 2QP9X 3OOWA 3K9QO 4H1UA 1M2WA 1FUEA 4II3A 5CT8A 1I32A 2VCHA 2PGLA 2OLJA 1Q20A 2MMCA 1CRZA 4CDRA 2GR9A 4RTNA 3FYCA 2A7XA 2FW8A 4LOKA 4ND5A 1LRLA 3AM4A 4GLLA 5L6MB 3OE7A 2BSQA 3OBIA 1WZCA 2BWJA 3H11B 3OZTA 4JUIA 4TMWA 4UCFA 4D79A 4HFJA 4EI7A 2NIPA 4EG7A 4H35A 3ZDBA 4WGGA 4F4JA 3ESAA 2WDZA 4M55A 4ND6A 1U65A 5F7OA 5EIWA 4CU5A 1SCUA 3BERA 3LUBA 3WAKA 3MQ2A 5J47A 1SPBS 4Z6KA 3H9JA 2QK4A 2J0QA 2VVTA 2ZJ5A 4TYPA 3ADCA 2XCTB 3L4KA 2R68A 3N2LA 4NBUA 2QTGA 2RI0A 5HF9A 4E1BA 3K73O 5BQ3A 3KQHA 1U63A 1M2HA 2GPWA 3KHTA 1GPUA 2VKQA 3TKLA 3I0NA 2Q7XA 3OCZA 2PMKA 3WMGA 1UODA 3FPAA 5IMSA 4JLPA 1XP5A 3UUWA 2GBIA 1Z5ZA 1GKKA 1YONA 3ENKA 3WL6A 4AJ1A 1K9SA 3UTCA 4BYMA 3B1ZA 4FB4A 1K7YA 4K6HA 2PX6A 5BVGA 4B44A 3C97A 2WM3A 1JEQB 1X1EA 5REQA 3ICEA 3M6AA 4X1IA 1VYVA 2NO1A 1OI3A 3HE3A 3GD7A 4N7JA 1GL9B 2NNWB 4H9GA 4U6NA 1A8IA 4GZLA 2WPDA 4DV0B 1DIHA 2GZ3A 1OASA 3SIPA 1FB5A 4F0JA 4WCVA 2J9XB 5B1HA 4DEVA 3MS4A 2CZCA 2I65A 3ISTA 1B1AA 4KMOA 3IEKA 4L4YA 4MUGA 2IW3A 2JRLA 3GGGA 4F5EA 4EO4A 5DBIA 1N6LA 1QIMA 3HJRA 3NHRA 4FGWA 1GGNA 4W5OA 1Y1TA 4CEIB 5BYJA 3LO8A 3Q15C 1RS0A 5JHHB 3IOCA 5ECYA 3PI6A 3AXSA 4KBFA 1DAMA 4PYKA 1GGEA 5AUQA 4MQFB 1CUIA 2H2IA 4YRAA 4ZIRA 2AC4A 2IXTA 4PZEA 4BBPA 5MGNA 4ESHA 3SM3A 2Q0QA 1O3YA 4Z0NA 1I80A 3FOCA 4FDMA 3V9AA 3DMTC 2IDJA 2R97A 3ABIA 2ASVA 2D1FA 3DM9B 2HJSA 1TA9A 2QV7A 4P31A 1HT2E 1XZLA 5HCNA 2ZUTA 5I3CA 4EJSA 1OCEA 4UD2A 4CM9D 4EBBA 3NALA 4YQEA 4B2YA 1ZJ4A 1K6XA 1NG9A 2XUAA 1T6XA 3O1HB 5JECA 1RU3A 1ZI8A 1D2MA 1FP7A 2PRZA 3KSAC 3LMKA 3E18A 4Z0PA 1CR0A 3EAFA 2CNWD 4RHTA 2G1KA 4E88A 1Y8QA 3SIWA 4CCYB 2IKSA 4NOLA 3C4JA 2SNIE 1M2KA 1U9JA 3FD8A 3Q8KA 3LKVA 3ZGOA 4L1KA 2P9CA 5AVVA 1DUIA 3VPDA 3TOSA 2C5LA 1TCUA 1Q7TA 2DKFA 2VJKA 1HUQA 1U2GA 2FWRA 3NHZA 4MSUA 5A7HA 1UK8A 1Z6GA 4M6WA 2F1JA 1G8JA 1O0CA 1KU6A 4L5CA 1AH2A 2WILA 4J1TC 4J6EA 4JGBA 1SO8A 1PTJC 1Z7YA 3BQNB 2O7QA 2GWRA 3EDRA 4OLAA 1HV8A 4G1EB 5AVWA 1O6ZA 3GPCA 1P2FA 3FNBA 4MJ3A 2Y0EA 5T57A 3HYSA 1V26A 1VJ5A 2WKSA 1FZQA 1DJQA 4BE4A 4YYZA 4D9BA 2NO4A 3HCNA 3N8KA 3K1AA 3MW8A 1FP4B 3MAJA 3VU9A 4D43A 1KWKA 3VU1A 4QUKA 1TKAA 2P75A 2WHRA 3A11A 1L5KA 3WQHA 4ZAWA 5LQCA 3ND7A 3O93A 4M86A 4TTQA 4R98A 3G8BA 3QKSA 5EP1A 1BXGB 4X66B 2ATXA 1E2FA 1U1GA 2MSNA 3FSGD 4GM1A 3O2JA 4QTYA 2PMDA 3E0XA 3RT7A 1KO7A 4DDHA 3JTEA 2EX0A 4PZUA 2FJPA 4RMHA 1OX6A 4G25A 2G1AA 3FPBA 1WUTA 2A5LA 2RHJA 3MIZA 3E1SA 1NNEA 3LBHA 4RPCA 1VTKA 2FEWB 5IPFA 1FNSA 1KIAA 2HJWA 4JDUA 3UYLA 2PTHA 5FTMA 1AUQA 2A1TS 3MF4A 5HFNA 4B5LA 4BTVA 3FDXA 4DA8A 5JS6A 4RA6B 1WS6A 4CIBA 2DY1A 3V8RA 1T8SA 3K7EA 3VH2A 1RWWA 3BB4A 1Q19A 4GYJA 4XYGA 1N5OX 4IGEA 3RVNA 2AYZA 3L8FA 5U4XA 5GAJA 2O07A 1R74A 4GI1A 3F4KA 1DRJA 3AEKA 3FZGA 3MOIA 4WN3A 1N1GA 3T7JA 3NNNA 3Q7RA 1DAEA 3ILHA 1RLUA 1Q74A 3BAZA 3RKRA 4AZTA 3FG9A 4IDHA 2CEAA 1IUPA 1OJLA 2CVOA 1EZ4A 1U8EA 1VLMA 1XQ6A 4Z7JA 4I1PA 4B7AA 1P29A 2WSLA 2Z9CA 5ALMA 3MSXA 3OESA 4J1QA 3RTBA 1FYXA 3HDQA 3GC6A 2IOFA 3ZIAA 4DRYA 1M6YA 3EIHA 3NTOA 1N9KA 3R4CA 1YKSA 3DKKA 4IS3A 4ALMA 4BCBA 5G0SA 4EW2A 3OQOA 3KB2A 1W5FA 3NC0C 4UBIA 5DLEA 2RH8A 4NZPA 1ESZA 2G5GX 1Z7BA 1N8KA 1NJSA 1NX6A 1QTQA 4PAGA 1E6LA 1DMRA 1KZYC 2HJHA 2X9QA 2AG6A 1JYEA 4IM7A 5KU1A 4CV2A 4CEHA 1NR5A 3U2QA 1R0CA 4D9NA 1TB4A 3D7LA 1QZTA 3MCWA 3QXCA 4AKGA 1KBOA 2GZAA 3ORSA 2CLDX 1X13A 4UTXA 5BWMA 5CCXA 3QUAA 2JH9A 2QVCA 2ZU0C 5TSDA 2GD1O 5JD4A 1F5NA 3ASUA 3PYXA 5CYPA 3OP4A 1X9GA 4IIXA 4KGXA 3EZNA 4AZWA 1Z63A 2BRUA 3UT0A 1MV5A 4WK4B 3IHLA 1YK0A 3IE0A 5DYWA 2EFYA 3MHPA 1UPUA 3IVRA 2QRPA 3EZ2A 5SZKB 2VF2A 5LQDA 2J41A 2B9EA 1TYZA 2J6BA 4FU0A 3A0UA 3FFAA 2ZIUB 1XNJA 4NG5A 1CUUA 1SUWA 4IIJF 3NIBA 5CCEA 3QEAZ 1WMFA 3RWMB 2BZSA 3QTLA 4PZDA 1GJRA 4EHIA 3EVZA 2YHIB 4MINA 1GTMA 4CKWB 2R6R1 5EE9A 4DT1A 4FGSA 4ARCA 4WLUA 4GM0A 2SKCA 1ECJA 4J9UE 4K9LA 3C2QA 3OQVA 1QGDA 1NQAO 2HCBA 4X92A 1I2MA 3LUCA 2C88A 3O31A 1CW2B 2ZYIA 1M1XB 4TKLA 3CZRA 4V0SA 2ZOSA 3B38A 5EERA 1E9RA 1JQDA 2J9RA 4XLLA 4AT1A 1ZGJA 1NP3A 2AFRA 2IZ0A 3UKDA 5HZGA 4UFPA 1YTLA 4EFLA 2CMDA 1KAGA 3S5UA 5BT8A 1KQGA 1JIXA 4URFA 2TMYA 3HO6A 3KWFA 2X8AA 3BFKA 1KORA 4N40A 9LDBA 1P60A 3UG7A 5JJBA 1EHYA 2B34A 1D2HA 2LCIA 3THXB 4OJNA 1N9GA 4U3JB 5LQAA 4URXR 1OYWA 5EYPA 1V9CA 2IYUA 2VP6A 1QCZA 5DGTA 1N0UA 3RO7A 3RSOA 4AJIA 3C45A 3C43A 1KYQA 4FKMA 4JP8A 4KJZA 4RIGA 2VI5A 5AH0A 2I4RA 3I9FA 4MLCA 1M6VA 1T8PA 1W75A 2R60A 3EXHC 4A82A 3AO0B 3QPAA 4IJUA 1W5AA 2JFUA 2ACWA 3RU3A 1T10A 2BF4A 2AXEA 1U0SY 1VSUA 3WGKA 4I99A 5BV8A 2PL9A 1T9ZA 3FSEA 1FYEA 4L0QA 1DUVG 1PQPA 2QN8A 3F6SA 2NO9A 4HNSA 4IH4A 1X77A 5JO9A 2ATIA 5EINA 3GIDA 4MVJI 1GPWB 3K1YA 3JYLA 3CZCA 4K9RA 4BNTA 1V3UA 4L78A 3S8EA 1YCDA 1OYYA 1P9WA 3HFGA 5CIQA 2BMEA 2B2NA 1XJWA 3DBHB 3KDSE 2ZYTX 3P20A 3QPDA 4AZ3B 4RDCA 2J9ZB 2X5JO 3K30A 2DQKA 5I9MA 3UF0A 3R1IA 2PD4A 2V6BA 4XRRA 1LXCA 5E2IA 1VKOA 4R5HA 5A1JA 1KGSA 5IU6A 1TAUA 3JAKB 2JLSA 3CNEA 3PVSA 3BGDA 1YRYE 3BX1A 2OMKA 4J76A 4TZ6A 5HE9A 2Q27A 3GFSA 3LV8A 2B6HA 4L3OA 3L4JA 3RE1A 2D2EA 1ZU5A 1GP2A 1ORTA 5L8VA 1XZPA 2TS1A 4ACAA 1RSZA 1DEXA 4FCCA 2AN4A 3CY6A 4XLTA 3V2GA 1JEJA 3G2HA 2OO3A 4RTLA 2C82A 4XSVA 2CV1A 1ZUNA 1FK8A 3EZFA 2RHMA 3WWEA 1R16A 2D5IA 1ZK4A 3DPIA 1PZGA 2L18A 1GTG1 1OGJA 1ZD8A 1NOKA 2CLLB 2JLRA 4YJHA 1VLVA 3BTUA 4D3FA 3HJAA 3CH4B 4UPVA 4RJTA 5IARA 4BQFA 1C41A 4UULA 3CEPB 5F5NA 5B3JA 5FWXB 5KEIA 3PGMA 5JD5A 2OBNA 2PR7A 3GA5A 3CH6A 4KQWA 1CV2A 3L0ZA 3KO8A 3U3DA 1BD3A 1TZCA 4CLDA 4CLRB 4JQZA 4YV1A 4Q00A 1Q83A 1P2BA 1AV6A 4X60A 3LP6A 2HADA 1K97A 4LYGA 3KHSA 5E3IA 3KT0A 5EWLB 1XNRB 5KDDA 4DRXA 4JC4A 1U0OC 1W48A 1A4RA 1MH1A 3B1VA 3JWPA 4FYXA 3CFYA 1MN6A 3DV0B 2FSHA 4KN6A 2IY7A 3RR2A 3UIEA 1FFXB 5BNTA 4FYMA 4P4GA 1QYCA 1GCAA 2OAP1 1CQPA 4A0QA 3QX8A 4JNKA 3H18A 3VMMA 1RRCA 4ZC8A 2QZ4A 4DTIA 2GAOA 4F5WA 1JNYA 2X15A 4ID3A 5LA6A 2ZAGA 2H0RA 2JIZD 3P5SA 2GJ9A 3BWYA 2IXGA 3K9BA 3TZHA 3DEKA 2OV8A 5KU7A 2IBMA 2XRMA 3SEZA 3CH7A 5DNYB 5H8WA 1J07A 2PKEA 2VDKB 1ZD5A 5F7JA 3WAJA 4ZEXA 4JNCA 2NZJA 1PWYE 2FNAA 4RS4A 5CMLA 3M2PA 3A2MA 5E0KB 1AUVA 5AKEA 2QLJA 5CR9A 3TVTA 3U19A 3QE9Y 4N3AA 1XAJA 3ZHZA 2B99A 1LPSA 4M38A 4Q82A 4JL6A 1PKEA 3OTIA 5EZYB 1YI0A 3ZXSA 3ZTYA 3N2GA 3QUBA 1T4GA 2DXIA 4B3FX 4E2YA 1LTQA 4CR7A 2HDHA 1K3TA 4TMKA 2X1MA 1VKNA 3NIFB 4WE3A 2HK6A 2JAUA 2SBTA 2Q3FA 1U7PA 2ZG6A 3QLVC 4FFPA 5AW3A 3UPUA 3FPEA 4DDVA 5EP4A 1EVEA 4NRDA 2R65A 3A6JA 4MJXA 4X8HA 2IBSA 4JT9A 4QL3A 4DXDA 5GINE 4CKXA 2YY7A 2RB5A 1XQ1A 5AM5A 3UYKA 2X9NA 4QWWA 1NRXA 5FEMA 1C80A 3JD1A 4YALA 3ZCUA 2XCUA 2YXPX 5KYWA 2BY4A 2BYTA 2AIRA 3GGJA 1QO0A 3MTQA 1T35A 4TMYA 3VH4A 2YVUA 3THWA 1R10A 1OXKB 3HXMA 3RBZA 3G0OA 3HLKA 3EGIA 4CN9A 4C4RA 1EA5A 1SOAA 3WGLA 4G0UA 4QPNA 3DVSX 1I5OA 1Y6GA 3UWSA 4F97A 4RESA 2Q9UA 2D7JA 1XCMA 1WXFA 4UUMA 3IPYA 5A05A 3TLMA 3KXPA 1NVXQ 3NBYC 1MOSA 3IOMA 3PUWA 4HDNB 3NT5A 3HFRA 4C04A 1Q7EA 2W00A 3H17A 1XCPA 1IMJA 3BGIA 4XJSA 1V5GA 2C3OA 2PQ2A 4QJIA 2OAQ1 5DP2A 3LU1A 3UJCA 1J21A 4JIGA 4OQLA 3UFXA 3VSAA 3QM1A 1XEXA 1TK2A 3CF6R 3OT1B 3PV0A 4XCVA 1U4SA 3BGOS 4X63A 4OO3A 5EXTA 3V32A 1TVCA 3U3ZA 3MWJA 5ES4B 3K6RA 3L7LA 4DIMA 5KKNB 4UMDA 1TVMA 2GPBA 4H3SA 4TRJA 3R20A 2IEIA 4ENSA 2FRDC 2OV4A 3KUCA 1ZBDA 4E6PA 4RHUA 4LFBB 1X2EA 3L77A 3BSWA 2QG6A 5FR2A 1GZHB 3RS2A 3OKPA 3H99A 4QOFA 1UJ5A 3BXXA 2XQGA 3X1YA 1TM4E 2WAMA 4WXPA 3C41J 3TZBA 3O5AA 4QUGA 5B1DA 4OHZA 5CDYA 4MYHA 4DIEA 2JL1A 3PR3A 3T99A 2VUUA 1B23P 2OAEA 4FSDA 3CBQA 3I9V6 5JC1A 3EEBA 3LM8A 3PFIA 3O8BA 5HQ3A 4WZBB 3VR4D 3H5TA 3DD1A 3GOQA 4BVGA 3IESA 1EZZA 1MVOA 3EDMA 4MKZA 1CVRA 4Q9DA 4G8BA 3KAJA 3WRYA 5B57C 4BBZA 1JN0A 1Q2XA 2QYSA 3B1JA 3JYOA 4PS1A 3RC8A 2XVMA 4GZ5A 4UXHA 3KR1A 2QGZA 2J6HA 3EUEA 4KFRA 5BUCA 3V1KA 2A9QA 2ZRFA 3T5BA 5IAAA 5F2EA 4D8UA 3QFSA 1Q1BA 4DL9A 2C8VA 2VSQA 5DMHA 3V97A 5EJMA 3SFZA 1Z9BA 4GYYA 3KDPA 3I2KA 4LRSB 1GT91 1CRLA 5KZMB 3KEOA 2O20A 5H68A 1WXDA 2ADMA 2RBEA 3UY4A 3WL8A 4ARSA 1PL0A 4XM0A 1D9ZA 3AF1A 4TVOA 1H2YA 4LRXA 2OK7A 5I5GA 4Y6OA 4ERNA 2AFHB 3FUUA 3PICA 3EVBA 1EPUA 1UZUA 5H7XA 1QRSA 4QDZA 1XAIA 4ARUA 4US2R 2P9EA 3B7GA 3TMKA 1B74A 3RKUA 4P5PA 1I7NA 4IVNA 5CFQA 4YCLA 1KSFX 3D5QA 3EF0A 3OG9A 1YSCA 2QORA 2ZWMA 3FCOA 3Q5GA 1OC4A 5E1OA 1EJ6A 1PEYA 2W2VA 3CZMA 4WA7A 3UK0A 4Z4EA 4INJA 4PO3X 2PTGA 3Q8WA 4BZWA 4B75A 1OWPA 3SQDA 3TOCA 5B2EA 1PDWA 3TKYA 2O8CA 4DMMA 1PSZA 4J0EA 1JZSA 2H85A 5L4LA 2R7AA 3CO0S 1RXEA 1FCJA 1XTQA 1QYWA 2CE2X 2DF8A 2J30A 3O7WA 3PD1A 4FK8A 3VZCA 1JDVA 1NUSA 4AY5A 3VNVA 2C07A 2WOOA 1P7YA 3ZU3A 2NU9B 4MW6A 1UPCA 4TTPA 3OOSA 3PHIA 3CNOA 1WL8A 1Z12A 4KXWA 2H5LA 5CB4F 1BFDA 5DSXA 1O5TA 2ZYWX 5KHOC 4J0HA 3UH1A 4E94A 1Q92A 4ALJA 4S1PA 4X94A 3KPUA 5JAOA 1BWRA 1FSFA 1LC0A 1YK1A 4U2EA 1E1KA 3MJDA 3AYZB 2YWCA 1MV8A 2E3JA 1PNOA 2A9FA 2AFIB 4WXMA 5GGXA 2C3PA 4O4HB 1M7GA 5BW5A 1T6YA 2B2CA 3BMNA 3AJDA 1QQ5A 5GONF 4YUZA 3CM0A 3CRVA 3HXQA 3GPDG 4OK6A 4QUJA 5M3BA 4BLWA 2VP9A 1R0BA 2UUAB 4F3TA 2YXLA 2FUNB 4HWTA 4YAJA 4KDRA 4FC6A 1MAUA 2XMDA 4DMGA 5IRCD 3GLIE 1T2CA 3CE9A 2V5VA 2EKBA 3HI4A 4Q6WA 2GN2A 4UTNA 3CGWA 4N76A 1FOEB 4ZVUA 1JLKA 1PGNA 2IYOA 3HU5A 5E2AA 5FHRA 4ESEA 5B7NA 1JAXA 3DO5A 1RLIA 4BUJA 1CY6A 2BKXA 3G23A 3PFWO 1J39A 2VJOA 4GHWA 3M1LA 2RSLA 1XA4A 2EBFX 1E3TA 1HE2A 1MH9A 2E5LB 4DGSA 1XPOA 2RGWA 4ZO7A 1NPDA 3O3MB 1GPH1 5C4IA 3U09A 2IYLD 1FMFA 5EY5B 3QOYA 3ZH2A 1N4AA 2C7OA 1I4EB 4YHHB 2JIDA 4F38A 1YL5A 3KB8A 4G4SP 1JVNA 1W4RA 4KRYA 2E4UA 2X4IA 5EIBD 4A6EA 3RADC 4QUHA 4IIJA 4CMGA 4UU7A 5BR8B 1XWIA 5ALEA 2PRJA 4DJAA 3EUAA 3L1IA 1YBAA 3VYSB 3IQDB 1J1UA 2PK3A 1EDDA 2XWPA 1PT9A 1M1YA 3P2JA 4XAQA 3R74A 1QLJA 3SS7X 2WMDA 4WSOA 4DSOA 2VSYA 1LBTA 3PTLA 4JVOA 3ILVA 4IX9A 4TLCA 1EEXB 4HAUA 3UBMA 1VYUA 3V48A 3HY3A 3KPWA 1M2VB 4BP9A 2GEJA 5AW9A 5I7EA 1Z34A 3IEIA 5MGBA 2FFBA 1YI8A 1I36A 2VT2A 2VYQA 4O2LA 3UA3A 2RHWA 2J4FA 1H6BA 2E4ZA 2O0HA 3KQWA 1GA6A 4C0BA 3PCXA 5P8WA 3ZDFA 2VK8A 1X1AA 1DDGA 2YW2A 3D54D 1T1GA 5KVAA 1RYYA 5C3MA 5FL7A 2EQ5A 4OXIA 5GM2A 3I04A 3ICCA 2GD0A 4R2JA 3VV3A 3VZSA 2HJGA 4LYFA 2CSUA 2YW9A 1QOPB 3RTDA 1E64A 4TWIA 2D7CA 2Y1DA 1SQFA 3DEZA 4KYUA 4R8MA 3QBEA 4PQEA 3W1VA 1J2UA 1XJCA 1HQDA 3KFXA 2EFJA 4IJVA 1J9GA 2JGJA 3TVYA 4GF5A 3HL4A 2AJLI 4K1XA 4KTVE 4RW0A 3RG2A 2IU0A 1U3UA 4R1TA 1XTZA 3N8IA 4RXUA 5HKAA 4KPYA 1L4UA 1USWA 3GRVA 4DIBA 1U8CB 1E60A 2C84A 2CK3D 2H4YA 4JENA 5BRJA 2QN2A 3ZE8A 3D1JA 3K1TA 1UDAA 3VR5D 4Z2YA 3WB2A 3R3WA 2C7VA 3ROEA 1OGYA 2KMLA 3CUKA 3MT0A 1WMSA 1RJWA 1JHQA 3MCZA 4FE4A 4JUCA 4MS3B 1ICEA 4UE6A 1E2UA 1VIMA 1N2JA 4JLJA 2F4NA 3GEBA 3I2YX 3R2JA 2XMQA 2QL7A 4MV4A 4BJ1A 2XGSA 1A9XB 4RJ2A 2QN7A 1PWEA 3DBRB 4FCTA 4LJLA 2GAFA 2I22A 2EBWA 2LR0A 5K6TA 1ISMA 1KEUA 2AZTA 4I19A 4J2HA 3M4XA 1VSTA 4NPCA 4LGYA 4KODA 2FKAA 4HQ6A 1ZOIA 3IR6A 4D6XA 1NP6A 4LA4A 5COBA 4DLVA 4B6OA 1XN4A 1DJPA 1FJ2A 4PG7A 1YMQA 3HA7A 3P2KA 1BEEA 4NYMQ 4BEVA 2VDNB 1QRUA 1NJ6A 3P2YA 1DAOA 2VRNA 1PYGA 4D0RA 2ZK7A 1IYZA 2RB4A 3U60B 2O2GA 4LDZA 3C1TA 4YDHB 3N53A 2O14A 3SDZA 1KE2A 3RIYA 1GGFA 1DOAA 1X7YA 2IUYA 2GHQA 3FPFA 2CNBA 1TM5E 3OSZA 2X1LA 3NW9A 2OGWA 4MB0A 3NHWA 4WCFA 5DNAA 5HOEA 2Y3IA 2AHRA 1O58A 3HKCA 4FR5A 1IE3A 3IELA 4BVHA 1CHDA 4N18A 4DZRA 3W9UA 1EGVB 1BN7A 3DDHA 5KCMA 1JMYA 1AGRA 2I54A 2Y1EA 4GPEA 2REQB 5EUCA 1KERA 5I8PA 3ETDA 2F59A 3ZXIA 1MRZA 4GMFA 4XB2A 2W6JD 1KOFA 1J5PA 3EZ6A 3HBMA 4M21A 2GCIA 1U7DA 2QM3A 5G40A 1FIUA 1GNPA 1GQRA 1TCCA 3NGXA 2WRZA 1PHPA 3V9PA 1LPMA 3M6IA 2I29A 4PHCA 3ZGXA 1JDNA 1CYEA 4E32A 5K0JA 2C5BA 2PH1A 4OJMX 1ZHFA 3WGVA 1I24A 4KCGA 1PZXA 2FPMA 4W1QA 5DYNA 3G0HA 1LBSA 2Y9PB 4HGYA 2LPMA 4CMHA 3REOA 3H4TA 2ZRJA 2JI7A 1EINA 3I76A 1P7PA 2NZ8A 1US8A 4Z9FA 5C8YB 5A4JA 4WRRA 1W4CA 2VJMA 1GN8A 1VPWA 1PFQA 3WFJA 3O03A 1B00A 5HJ7A 4CM9A 1HRDA 4KMSA 1P8JA 4LOLA 2BISA 1OZGA 4LWOA 2DHQA 1N8NA 5C1DA 1V1JA 4ZP1A 1VG8A 1H4VB 4HFNA 3RSQA 4B85A 2O54A 4YASA 2LKDA 2Q5CA 3RRBA 1ZNXA 4J7UA 4KU4A 1LTHR 1GNRA 4KWIA 4CUZA 3MHTA 2PH5A 2CNWA 1E9DA 3P9XA 1T8YA 4PLTA 4QOIA 4IHJB 4G56A 3OIYA 2AC7A 1IY2A 4RWZA 4QYIB 4S1OA 3FVTA 2RGCA 2R6HA 4G85A 3B1KA 4GPBA 3RHFA 1IY8A 1E2KA 5DM60 4FQ7A 1X39A 2P67A 1PJ3A 3PPVA 5AK5A 1GSOA 2ZYUX 3I9JA 4QASA 1F0NA 1K6IA 3D8UA 4XVRA 3L7YA 4ZREA 2DFDA 3V3KA 1LUAA 1W87A 3P0RA 4AUNA 2VRCD 4Q01A 1F51E 4AYWA 4NIMA 4EF5A 2HJ9A 4FW8A 3DG9A 2JLZA 4WQMA 1NW8A 3Q7QA 5ABPA 1GRVA 3QXJA 2MMGA 4QJ4A 3AC0A 4V1CI 2PAAA 2B1RA 4OHBA 5E1DA 1T0IA 3OZVA 1Z4LA 2ZUWA 4Z4CA 5JMTA 1ZFNA 3PT9A 5ALOA 4RE6A 1YAHA 4IVQA 4E21A 2OBBA 1MF7A 3N8NA 4U63A 3KEMA 5A0FA 1CQIA 1A95A 3WOVA 3A32A 1WZ2A 1GAQA 2XNJA 2GJ8A 2NM0A 4TGLA 2WSBA 2XCOA 4DV4B 5KJ1A 1CC1S 3FMOB 1KHTA 2O0KA 3FSGA 3SC6A 1SU7A 3VTKA 3PD0A 4PLVA 1HH4A 4IH1A 2GYWA 1N32B 3SEAA 3LTEA 5F23A 3UNXA 2HSJA 3C7AA 4KZKA 4Z3KA 4RTPA 1EWYA 3RS7A 3LCCA 5TT1A 1E9CA 3UW3A 3P26A 2XZLA 3HVJA 4N01A 3WNDA 2JHAA 3MFQA 1BW9B 1J2RA 2AUMA 1F6WA 2B0CA 5DLQC 3QH4A 5JI3E 2BJVA 1DCFA 3MOGA 1YZQA 6ADHA 5BURA 1QANA 1H2ZA 4BNFA 2WM2A 4DHEA 4E5YA 1K4KA 1N75A 3D8RA 2XXAA 3JQEA 5KWIA 2HPAA 2QI9C 2Z56A 1DWQA 4WN9A 4ABYA 4NH4A 5A9RA 1NOJA 1M75A 1WABA 2ANBA 2XHEA 3A3OA 3LK7A 3A0RB 2QRUA 1B93A 1RHRA 1TQ8A 4LOJA 5JD6A 4PYJA 1V2GA 2ZS9A 4QHSA 1L4BA 1LCIA 2EZ8A 2IYVA 1ZHHA 4CM7A 3WGIA 1JFVA 3FOWA 1U11A 1QFMA 4JUDX 4TWBA 5AHRA 4J6FA 2FN3A 3U49A 4P7FA 4FYWA 4QGFA 2AK3A 1NJ1A 2XCRB 1TMKA 1NM5C 2BGUA 1NVMB 3IGFA 1YZKA 4R05A 3M33A 4RQUA 2F2TA 4X20A 5ECGC 3PPXA 1S4MA 1RI3A 2LCQA 4R71A 1NN0A 3GRZA 3LFHA 1OLSA 5CLGA 4MS4B 4RVHA 3ZHSA 5LVAA 1H3FA 5IK2A 1JEEA 1FDSA 1W25A 4OHOA 5LZ8A 1PNRA 1DAHA 1Q0PA 1YS2X 1VM6A 2JI9A 3WLEA 1OFUA 1PLLA 1CR2A 3N6XA 1BX1A 4Q24A 1PL7A 2IYTA 4JZKA 1G2QA 4ZVOA 2P91A 1U0LA 3ND8A 4A0HA 4FWTA 4I1VA 1W36C 3I12A 2Q5HA 4Y0AA 4WH0A 1B3RA 3NS7A 2F62A 5A5DA 3SWWA 5IJZA 4JB3A 1G98A 4OQEA 2VYND 3CPEA 1PP4A 3HHEA 5DISB 3W5SA 1XNQB 3UQZA 1BVRA 5JJ5A 3I1JA 4C0QC 4XWOA 4IUYA 4BVEA 1ZX1A 1PV1A 3GEMA 2RH4A 4OJQA 5JS8A 4MV6A 3KR9A 5B1IA 3UC5A 1OXTA 1DEAA 1S01A 1VJCA 2GN8A 3O3OB 3W6OA 1QZ3A 1X94A 3VPFA 1WKBA 1IPHA 3IS3A 4YP7A 2TMGA 3FXAA 1Z2AA 3DAHA 5KYUA 2I87A 2FWIA 2H1WA 2NADA 2HY7A 3HBNA 3L9XA 1H93A 4QX6A 4S1NA 3R7SA 3TQFA 4C0WA 3O82A 3RTCA 2RI6A 4N0DA 4CKBB 3IUPA 1R4MA 3KQSA 1P72A 2V03A 2JJYA 4QPZA 5DNEA 1MW9X 2CLCX 4ZQIA 5IT4A 1X15A 2HU8A 3FDFA 3Q2KA 3KYBA 4HS9A 4QPCA 5HKLA 4YAFA 1O95C 1XEWY 3AUTA 2YOGA 4ZANA 3VVMA 2HQ1A 4RENA 1PW7A 4KIFA 3K2QA 3UATA 3CINA 2WUGA 5CB4A 1CETA 4KE7A 2BFEA 4NOKA 4RHEA 4P93A 4BGDA 1D6SA 2H9YA 3BG5A 2Q5JA 4MRAA 1P1CA 3SSAA 2EEZA 4K9MA 3BHNA 5TJHA 1LDMA 4D92A 1U98A 5JR3A 3D5TA 2C97A 2H92A 2JGRA 2C2HA 3AR4A 3CSDA 2WJPA 4UHHA 1N2CA 4V2UA 1G0NA 3ZJTA 4HO1X 1H0RA 1P44A 1CIJA 2JDID 3BORA 2YHSA 5CNKA 2WWGA 5CW2A 3F4LA 2Z6VA 1Z5GA 3LRPA 5DTRA 2CLEB 5DX1A 5KINB 1AKWA 5GONA 4DS3A 1U8YA 2BGTA 2FMXA 2O06A 2Q4BA 3CRNA 4R6WA 3NG1A 5IJ0A 3H75A 4AJPA 2ZZMA 2J5XA 4MV7A 1Y1QA 4I81A 1J5EB 4QU9A 2HDNB 1W88B 2NV6A 1TVEA 4B48A 2YOHA 2PZFA 1E5TA 2AR0A 3VUFA 1H2RS 4S2UA 4C22A 1ND5A 1O57A 1W49A 4AIRA 1U2QA 1W47A 2W6QA 2A30A 3FLBA 3MD0A 4JAVC 3I6ZA 5FWYB 2BN4A 1TQ4A 4I6JA 1JH8A 1WXHA 3I09A 3SC2A 1EP2B 3GNSA 1ZSNA 4EB6A 3FHTA 1VI2A 1K4MA 3V6LA 4JFRA 4JJIA 1KYVA 3JAWB 3QOFA 3UXMA 2P65A 1DX9A 2IHZA 1U8FO 3TLYA 4B17A 1MIOB 5KTSA 5AM1A 2DC1A 1GA4A 1M34A 1WVIA 4L0DA 5GZ6A 3R8CA 2BEVB 1BGWA 1Z07A 4YVFA 3K9LA 2I4TA 3UT5B 3O8QA 4CZ2A 5EIEA 1U8AA 3B8EA 2FMIA 1EH5A 2H8KA 2J4CA 3IUQA 1VPTA 2WOJA 4WADA 3STYA 2C2ZA 1POWA 1VB3A 1JIUA 4EW1A 1EB9A 3JQGB 4DR3B 2XBUA 4EYKA 1CBUA 1YR9A 2Z08A 1RYNA 5A03A 2IP1A 2BGKA 4E2XA 3EGVA 1V95A 4QVGA 5LP6C 4WLOA 2WU0A 3FMGA 1EFUA 4OHMA 1ZNQO 1A97A 1C7RA 2O0MA 3A3NA 1FDIA 1DJNA 3CUVA 1LPPA 2F43A 4NZOA 3OZSA 1LLCA 5H16A 1HE3A 2PWBA 4KQ6A 1OXMA 3AI1A 3CT4A 4O08A 4JUAA 3KL4A 3OMXA 1U5AA 2OV1A 2ZRIA 3TD2A 4BJ6A 2C2BA 4B73A 4JJ7A 1R18A 4NBWA 1KYTA 1Y5LA 3LECA 1Z7EA 4ETIA 4EX7A 4IDQA 3ZZMA 1EESA 4P58A 5HBGA 4XEHA 1ZXXA 1K27A 2A9JA 1ZR2A 4D4JA 2VWGA 1Y1SA 5A3JA 1JHZA 4XWTA 4QA9A 4YROA 1HETA 4DWJA 5H81A 3CIOA 3UJDA 3G88A 2AOWA 2D0IA 5KNCH 3KB6A 2GEVA 1KJYA 4RK4A 4PX9A 5FULA 2HYIC 2JJ1A 4PNPA 1OBVA 3CVWA 2LUOA 5TF0A 1DP4A 2JIZA 1C3EA 1RD4A 1GU7A 2O5RA 4YT4A 2VJNA 5FNVF 1BYIA 3KV3O 3KQPA 3M1IA 1I7QB 5E6SB 2QRGA 2AJTA 1UFOA 4IDBA 3SR3A 4C7KA 2A9OA 1LTKA 1PS0A 4QPPA 2EATA 4Y6GB 4IZHA 4BWYA 4JU9A 2QYTA 4KSCA 5C8DA 1K5PA 4ND7A 4F60A 1QGUA 4BWGA 2GNAA 1OGIA 1P4JA 3PUIA 6LDHA 1A96A 1LV8A 5LMZA 3W8EA 1NE7A 2ZBDA 3SP1A