1EM8A

Crystal structure of chi and psi subunit heterodimer from dna pol iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the chi:psi sub-assembly of the Escherichia coli DNA polymerase clamp-loader complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
molecule keywords DNA POLYMERASE III CHI SUBUNIT
total genus 46
structure length 147
sequence length 147
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04364 DNA_pol3_chi DNA polymerase III chi subunit, HolC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold DNA polymerase III subunit chi 1em8A00
1EM8A 3SXUA
chains in the Genus database with same CATH superfamily
1T35A 2BGTA 1SIWA 1ZNZA 4YAIA 1Y8RA 2P91A 2JD1A 3KHTA 4X1KB 4WHMA 4ZT6A 2HZBA 5IT9A 4QM7A 3F46A 1A1SA 3E84A 2XCUA 4Y2RA 4BVEA 3WBJA 1YUBA 4ABYA 3OHPA 5EXPA 1EM8A 1GTRA 4KE7A 1ICEA 4N6GA 5D3MB 1NNEA 3CR8A 3KD3A 2IYPA 2XNHA 1UIRA 3L1JA 3OEED 4QTXA 5DMHA 4F4DA 3ET5A 4AJIA 4NY1A 3PPYA 3NOVA 7ABPA 2A1TS 2MYUA 2OAEA 1ECFA 2PBRA 3NONA 1G3RA 2C9ZA 2R5FA 4KNVA 3RBZA 3MJHA 3BQNB 2QTLA 5JASA 2V1XA 1XTSA 5JSUA 3AVVA 1PSZA 5I9IA 2EP7A 3ZE8A 2GAIA 1IU9A 2HCRA 5FWXB 3VM6A 4ZEXA 2V9ZA 4X3OA 2GYVA 3U2QA 3AUSA 5LWQA 2NU6A 1DRJA 4MUAA 3V34A 1VECA 4D02A 3WMGA 1YA4A 2CXHA 1T9HA 2BGIA 3K05A 1XEWY 3TW8B 4B84A 3IJ5A 2PEYA 4M76B 1R4AA 4CKBA 4LJSA 1L4LA 2WU8A 4JLSA 4J7CA 4B5LA 1L3CA 5AHXA 2C5AA 3HBNA 5FO1A 1V26A 2DPLA 3V8QA 1MORA 1UBUS 3L1KA 4MQFA 4RCYA 3HJRA 5I9NA 4S2UA 4P3PA 5JLAA 5CB8A 3COJA 4OMUA 1K97A 1P17A 3WFIA 4S3MA 1V8OA 3NNSA 4LJRA 1ELOA 1XCJA 2UAGA 3N2GA 2IXTA 3DYBA 4H7EA 5KQGA 4K2HA 2ZJBA 2J5RA 3FMIA 1ZRNA 1WDLA 2V0NA 3WLSA 2JLZA 4WBXC 1HRKA 3HV0A 3VKFA 2DFDA 2VSFA 2PT7A 4JR2A 3R3JA 3L7DA 3KHKA 1O4VA 4GYWA 1JR2A 3LOPA 1PQPA 1VLJA 1E8NA 1KFCB 3MCUA 3ZV3A 4RPLA 3IPLA 4DQXA 3KU4A 4JOSA 3GJ3A 2B0JA 2R00A 2NSJA 1PJLA 1X80B 2HK7A 1MJGM 4YRFA 2FMKA 4RJTA 3CEJA 3H0CA 4BP8A 1IQ0A 3ACBA 2QAGC 4U2GA 2QRMA 1BWRA 1QAMA 4JWKA 1KVTA 3R3VA 5ALGA 5C3UA 4IV8A 5CLJA 3QHAA 1OGJA 3VO1A 5IF9A 2EKQA 3UJPA 4UTVA 3IUBA 1BTOA 1DAHA 5C81A 1BDBA 5K3OA 1XZNA 1X80A 3LXXA 3MQ2A 5G41A 1XROA 3L8CA 1SUSA 3Q5EA 1HBJA 1G17A 4Q48A 3WISA 4WBNA 1GSIA 4BTEA 3RHTA 3D3KA 5CCBA 2QYSA 3EA5A 3FAZA 3JVDA 2ROQA 5AVOA 1U2DA 3UOWA 2AJTA 3SZLA 1M0WA 4I1SA 1KBZA 2H7XA 4EI2A 2JFQA 1E58A 2ZUDA 4W7HA 1HGXA 5LIPA 1O6ZA 3DA8A 2YWJA 4N5LA 1TYBE 4TLEA 2X15A 2PMEA 3R3SA 5K6AA 1DC7A 3LHFA 1C7RA 1AKTA 2B4KA 2H1VA 1J20A 2ZPAA 1I8TA 4KBGA 2V7BA 4I0WB 4ND6A 4HGRA 5H59A 1GAQA 4PQFA 2VSNA 1N3YA 3DMHA 2A3NA 1WCIA 2NZWA 4S1WA 4RPKA 3V1MA 4GOMD 4HDNA 4M8IA 3PNVA 2Q3LA 5BURA 4YLYA 4RJIA 2QX9A 1JBQA 2GBFA 4K6KA 3IE1A 3CT6A 3W9YA 3C1TA 2IZZA 4FCWA 2QTAA 4XAQA 1GQOA 1SOUA 4KSYA 2IYXA 3IQZA 3P9ZA 4IXMA 2NTNA 3OFNA 3F7NA 1N2CA 5T3UA 5DOZA 2C92A 3V2IA 4CKWB 3HSSA 5TQ2B 1HYGA 4P3XA 2CNNA 4V0NA 4H9GA 2VNKA 2XVZA 3IBFA 1EWYA 1R3UA 3TRJA 4ZQGA 2B8TA 1R4NB 3UC9A 5FJJA 3DHYA 5G4LA 1ZK2A 2QVZX 1R64A 4ID9A 4P92A 4Y6PA 5AKJA 2HU7A 3TO5A 3WLOA 4CKBB 4XGNA 1KTIA 3HVRA 4YQEA 1HYEA 3WV5A 4Q9AA 4RZXA 1PYDA 2PV7A 3I9NA 4EL0A 1XZQA 5LMCA 4G1EB 1XXHE 2PH1A 2RGDA 4FC6A 2AHOA 3LKVA 3VPSA 3ONDA 4FD2A 2DY0A 4C9BA 3CRZA 2CK3A 3IBTA 4OHPA 4J16A 4ENRA 2ABWA 4TWAA 3DMRA 1YA6A 3COVA 3AY7A 1XRMA 4C6HA 3U09A 5BSGA 3G88A 4D8XA 1A5TA 1UK9A 3ME5A 3VGJA 1YKFA 4YECA 1OH5A 2NVUA 3ROQA 3NXSA 4PTLA 4CM9A 4MDYA 1YE8A 3O3MB 4WZAB 4I1IA 3WL7A 4AJNA 3GPBA 2YCLA 3L93A 1XDBA 2B6NA 1LS6A 1P4SA 1NJ5A 4FFOA 1VYHA 2H1IA 1UJCA 3G2IA 3ZNNA 1SPXA 1RRFA 1I3KA 1F9AA 4KRYA 4DWWA 1R74A 5TGDA 3HLYA 1RHJA 3SXPA 1J99A 2G4VA 1ZCZA 4HX2A 1AQIA 4HDSA 4Z0HO 1R88A 4FNGA 2FHPA 3EZ6A 4Z7QB 5IN5A 4HD8A 3V8EA 3WHIA 1AK9A 4GIBA 4WECA 4UUPA 1Z0UA 3HXOA 3EPKA 4RO0A 4N41A 4YV0A 3E9CA 4ZT7A 3I2FA 2QVXX 3MRXA 3A6PC 4LQDA 1UKAA 3E5NA 2EJVA 2WIGA 3NHUA 2HZ7A 4YJHB 3SNHA 1TXGA 2Q6LA 4EY3A 3VPCA 3LDFA 1FTQA 1VCNA 1VGRA 1YS7A 3PNYA 3N05A 3I30X 3OQ6A 1LDMA 4H77A 5EI5A 3P9XA 2CE2X 3P9QA 1E3SA 3KSZO 3NPMA 3PC8C 4PTZA 1T9ZA 5CVEA 3GWZA 3AVOA 2PCLA 3HZRA 4GVLA 4I46A 4X93A 3TZHA 2JCBA 4OL9A 1T5LA 2J3IA 4I1VA 4ZDKA 1C7JA 1G8PA 3DEZA 3BSYA 3HYLA 5A7HA 4C3OB 2JC3A 1UDBA 2QM3A 3HLKA 4OXXA 3BRWA 4RIFA 3ILVA 3KOXA 4E33A 3AF1A 4PGHA 3DD5A 2D2IA 2JK0A 2PMWB 4AJOA 2JAOA 5LUBA 3TQIA 1WAMA 2GK4A 5KBYA 4JIGA 4CMBA 1YDFA 2QRZA 2AFRA 4OM7A 4DCGA 1W8IA 2H17A 5CLQA 4EHIA 1AHHA 2E49A 4BFLA 2ODNA 1RQPA 1CRWG 1S7CA 1UJ2A 2BMWA 4RIIA 2F9LA 3QOFA 1PNQA 4OBXA 4PCAA 4Z2YA 1K0UA 1D2RA 4MP3A 1OHHD 3ORSA 3R7SA 3UC5A 1JBKA 2OBYA 3F6SA 1S2DA 2EZTA 3QLTA 3ZHQA 2HHAA 3ZXXA 5CHEA 1WUJS 1IBLB 2VA8A 5M29A 3F6RA 3G5MA 2Y1CA 3LCCA 4RENA 3HHPA 5C80A 1TYZA 4QTUB 5CRIA 4O08A 3FHTA 3I2IA 2Z83A 4CQNA 1C41A 4X54A 3NM6B 4D1YA 3DZ8A 1RYYA 3ELWA 4IHJF 1NQ5A 5F33A 5KPJA 4NS1A 5C0OE 4BC1A 5LLTA 2FRXA 4ZN6A 2P62A 4YDRA 3BJIC 5DT9A 1EUQA 2OSVA 3DR5A 1OY1A 4JWTA 5DBEX 1PIWA 2O2DA 4D8UA 5THQA 2X6QA 2XYQA 1C14A 4UVGA 3KBOA 5A6SB 4OLBA 5C8VA 1XRNA 5L3QA 2X2OA 4JI6B 5HRUA 5HW0A 2FR8A 1QTRA 3LHSA 4LBWA 4C6RA 1KU6A 1U9JA 2PUBA 1EBUA 2CC2A 5HF9A 1L1QA 1QV6A 3BD6A 1T1RA 1J06A 3N6VA 2WKQA 1UODA 1Y1RA 5F78A 3BKWA 3D02A 4DT1A 3G0BA 1Z4MA 4DY4A 5BV2P 4DV6B 4X64B 2XNDD 1EDDA 3RS7A 5ISMA 3O9MA 4G2NA 5JAQA 2NXCA 1R6AA 2NU9A 4G5FA 1GPDG 1LPBB 3LT1A 4YQYA 2DEUA 1JHOA 2QAGB 1C29B 2DFPA 2J33A 3GPLA 2Q0XA 1NT4A 1E5XA 5LP6B 4B43A 5SZKB 3KEGA 3CRNA 2PQ0A 5LC1A 4A27A 4CJXA 1II9A 2WM2A 2O5EA 2ADOA 2VNHA 1NX9A 1R66A 4CF7A 3DD1A 3E58A 1ML3A 3G2JA 4BGEA 3HUFA 3EHEA 4DV7B 1I3LA 1XRRA 1LXCA 1JNXX 2GH1A 1LPAB 2NT3A 3GFVA 1KPHA 3N28A 4ALMA 3MD9A 2VDWA 3T3EA 3I64A 5DV9A 3RYCA 1ODKA 2HW8A 4HGOA 4N18A 2F4NA 4YN3A 4GNKA 5B2FA 3J80A 3ADBA 1LBHA 1HL3A 4XIFA 4QICA 1IEXA 3FYHA 3KUKA 1PBNA 4OMDA 5ER6A 1VBKA 4BNLA 1H0RA 4B09A 1W4RA 1TK2A 2XE4A 4MVYA 2GM9A 4NCJA 2PH7A 1PJQA 1V5IA 1PV1A 3B9BA 4RF5A 1OXBB 3OE4A 4GRAA 4YT5A 3K2QA 3FZQA 2OXCA 4DARA 4BNXA 1W88A 2EFCB 4CF5A 3ZI0A 3THXA 3TH5A 3DMDA 4NBSA 3AVQA 1FFEA 2YWBA 4I2VA 3M33A 5A9SA 5IABA 3C85A 4TTQA 4H1TA 4Q34A 5L7TA 1WA5A 2H7YA 1J7JA 3F9IA 3OOWA 5KVCA 2NLOA 1RZRA 3GRKA 5CFLA 1EFPB 2QSZA 2ZI3A 3T8YA 5FL7A 3H99A 4P4NA 4A1OA 3D43A 1Z2EA 4Q1EA 3HCCA 2WOOA 5CM2Z 1ZBDA 3W1EA 1FYDA 1OU4A 1X15A 2NQ8A 1JX6A 3TTYA 3EUFA 4QOEA 2C20A 2BM9A 3VR5H 1Y9DA 3KSMA 3CLRD 4Q7LA 5I9MA 4LRWA 2HAEA 3AIIA 3E2MA 2FZ5A 5L6MB 1ENYA 2I1QA 4DR5B 3S6JA 1MV5A 3S7TA 4KX3A 1G5RA 2IPXA 2V5UA 5AWFC 4EG6A 1Y3AA 3TRDA 3AHHA 4PXSA 3ZY5A 2DHDA 1OT3A 3B89A 1FFBA 1WOMA 4JT2A 4NENB 5EGNA 3UA3A 2UYCA 4IKOA 3PC2A 2OA0A 3PQ8A 2ODQA 1IE3A 2WF6A 1NUHA 3CEAA 2Y6UA 4AYTA 3R2JA 2PUDA 3TVYA 3R3HA 5FYDA 4L02A 1W1WA 2CLIB 3EXFB 3PU6A 4GE0A 4WBSA 2CE7A 5E7QA 3UWMA 1UL1X 3UW3A 4I6EA 3X0DA 5GJWC 4MWOA 5ALKA 1BEEA 1FQWA 3GIDA 2FSGA 3PHGA 2A9FA 3E3OA 1AGPA 4I8XA 4G3XA 1M7BA 4HPJB 3N8KA 1ST3A 1CXZA 1GUBA 2SECE 3FZYA 5F9MA 4J4BA 4BNTA 5JCPA 4LSZA 4CGYA 4NYJR 3M9WA 3MELA 3A70A 3DBRB 1VG8A 3UXYA 1E18A 1JYEA 4BC0A 2G8LA 3HRHA 1CF2O 3L41A 5B53A 2DX7A 4G0YA 1R9NA 4UBLA 2IE0A 3L49A 1RJWA 4RD6A 3S68A 3SJ7A 2LP4Y 1VYUA 3HCPA 2NUTA 1L4EA 2MDTA 1ZGJA 3JPWA 2IELA 1S4MA 4CM7A 3TXYA 3O8CA 5HCUA 1VI5A 2ATEA 4M1WA 1UMDA 1ONOA 1A95A 4LZNA 1CUGA 5IJZA 1Z5PA 4RXUA 1P5HA 3P9KA 1PJRA 1SVWA 3BJRA 3E35A 3EAFA 3N2ZB 5HMLA 4IS2A 3WLIA 2A7XA 4P80A 4WLFA 1BVRA 4MYTA 5MF6A 4EDFA 4DABA 4ARCA 4QLAA 3EGIA 1P62B 2Z2ZA 1QWOA 5KMGB 1T8SA 2XUOA 3EIHA 1Z6AA 3DFMA 4JYPA 1QU3A 1QQ5A 5BYJA 4BVJA 1Z56C 3K9GA 2QVBA 1K7XB 3OJLA 5D7BA 2WJJA 1MC1A 4QGSA 2I91A 2X5JO 4W8OA 2C9MA 2Y0PA 4CR7A 5KWJA 1SCJA 2H4HA 4D0SA 3NNDA 3KTAB 1TNDA 1I4WA 3MWEA 2W2PA 4MV0A 3DMNA 2M6LA 3CX4A 4YYEA 4D9IA 2XOXA 3H84A 4A0RA 1KO8A 3IMEA 1BQEA 5BWBA 3JYHA 3KQVA 2XHZA 3U7IA 3RD5A 4V0MA 1YQUA 1FPQA 4IHKA 1H2FA 1N2EA 4ENVA 2HMVA 3PFGA 3FKSA 3X1XA 4HLCA 1X7YA 2CL5A 4RABA 1XPJA 2D1SA 3URMA 2IEIA 2FJPA 1L4FA 5EWLB 4N0MA 1AN9A 4CKEB 3O1HB 4MIKA 4X1KA 3VTKA 2C1XA 1F8GA 4ZKEA 4C04A 3MYRA 1MNAA 4FN4A 5ED4A 4A0QA 1U7PA 3P52A 1ADBA 5DRTA 4K40A 5G2OA 1W0JA 1TT5A 2I22A 2X40A 1EG7A 1ZD9A 2Y71A 5E1DA 3RJMA 3FW1A 3G13A 5KNCA 4QODA 1VIMA 1ZDMA 1SZCA 5IK2D 5IWAB 1U80A 1W46A 1QHHB 1UJNA 4HWPA 3N5CA 5F1YA 3PFCA 2IV7A 3SGLA 3EPRA 3EASA 2G70A 3FY4A 4IJ6A 1YKSA 4TVKA 4CE6A 2O1WA 1E5LA 2ZVPX 4NMLA 2C4VA 4QNNA 3U3DA 5EJ8A 3NM4A 5FBHA 1XQ6A 5IARA 3RYFB 5I7UA 3TSZA 3ES9A 2PFSA 1EH5A 1VRVA 2G08A 3PGVA 1F4LA 4OHOA 3BAFA 1XE3A 3FCSB 4NPAA 1TM1E 4BVKA 1QHHA 3OT4A 5IEJA 2G0AA 2VJMB 1Q7RA 2BISA 1LLDA 2I2WA 2VXBA 3OIFA 1X39A 5M3BA 1T5TA 3HBFA 1E3JA 3HN7A 5JW6A 4LGCA 3R0IA 3FWZA 3UHJA 4QDXA 1XQVA 2FKNA 5D01A 5B57C 1X70A 2BI7A 2DC1A 4DWOA 4KPYA 1G1MA 2OO7A 1SN7A 1ZUNB 2PR2A 1NQAO 2GETA 2VJYA 5CYFA 5COAA 5JJCA 3WA7A 1I5EA 2QGFA 3EY9A 3MOIA 1UADA 5FBQB 4ZT2A 3N5KA 3SJCA 1E7YA 2VJMA 3CZMA 1M5RA 4AZ3B 2CHFA 5CVJA 3NRJA 1PI3A 4Z8YA 3VC3A 2UXDB 4HQFA 1U2ZA 2HYDA 5B58C 5KJCA 4HEQA 3K9CA 2QX7A 4X9XA 1G5HA 1VHQA 4HBZA 2NT4A 3FFBA 2YC2C 5DSTA 3K3PA 4AMVA 1US8B 5EHIA 1IOWA 5FI0B 2GRUA 1BMFA 1M2KA 1OXTA 3CX8A 3K53A 2HMTA 5EUCA 4DJ5X 1K98A 1ZM3A 2XGMA 3KBBA 4LFCB 5JD3A 2JFFA 1KQOA 3NHWA 4PNPA 5ALRA 4YJ2B 4RZHA 2IHKA 1S9HA 2JFXA 4OCZA 1X74A 4RF2A 4V02A 4FYXA 4UC0A 2FQWA 4MV9A 4ZVSA 1R6BX 4UJ5A 4HVLA 4NMHA 1C7FA 1VJGA 1RRKA 3IJPA 2K2WA 3IEKA 1T9GS 1XVUA 1VB5A 1SHZA 2GYWA 1OJ7A 2OHVA 2QXUA 2YFHA 3DXYA 4JLBA 4N39A 1PX2A 2CUZA 3A3PA 4YHHB 2X3YA 4AI6A 3TPZA 3AHDA 3MLBA 3WO1A 4DA4A 2VK4A 4I3FA 1HT2E 1AC5A 2VBGA 5U4QA 4MR8B 5B6JA 2P79A 1JRLA 1V8DA 1JKJA 2C7BA 2D8AA 3RS8A 1RZRD 4R2HA 5C8YF 4B3RB 3GN2A 3FCCA 4GX2A 3ILXA 3SZOA 1L5MA 1HORA 1QK4A 1V4VA 1I33A 3K9WA 3T12A 1TZ2A 4CKEA 5HIAA 1LV7A 5T4FA 3HEBA 1MZVA 1T5SA 1SHUX 3JW8A 2V7GA 1WULS 2HRZA 3VGPA 2KJQA 4MRNA 4BAZA 2XCRB 4Y6GB 3UXMA 1DE0A 3O2NA 2HF7A 1Z73A 1W75A 2ZRLA 3AERA 1TT5B 2WINI 4JKOA 5KDOA 1NRIA 1DKPA 3R5JA 1GO2A 1R15A 2C59A 2OENG 4FILA 2CHVA 3FNRA 1RQGA 4MMYB 3Q11A 2NXJA 1BJKA 2QE7A 2YY6A 3AUJB 5B3LA 2WJGA 1IZZA 1WHTA 4LG1A 5CIQA 5JWHA 3T99A 5K6AC 1V43A 1O9HA 4Q01A 1KL7A 4XCVA 2QL7A 1DHRA 5IJAA 1J7KA 3RE1A 1Q84A 2HMAA 2ZR7A 2ZZKA 3FETA 5IFKA 3K16A 2DHQA 3O95A 5EJ2A 2YN4A 1CRLA 4GL4A 3VC7A 3CF0A 4IQ4A 1WKVA 1E7WA 3RR2A 3RC1A 3CRRA 5GZ3A 1KK2A 5GTDA 2W11A 1GTL1 3FB4A 3KFXA 4D44A 4IQFA 2GVDC 3QFRA 4OI4A 2J9GA 5AI9A 1ISMA 2CUNA 3OY7A 4OYYA 2JCYA 2DPGA 3TSCA 4FSHA 5HR5A 2C8VA 5FBWB 2RGRA 4RNDB 2FXIA 2V98A 2NN3C 4DADA 4EJ2A 3AI3A 5CXXA 2J4FA 3ZS9A 1WR8A 3O21A 3B8EA 5EVJA 3REOA 1JSCA 1N2ZA 2D13A 1KPIA 3LECA 4ZCRA 1XEXB 1F0YA 1FVOA 2FPPA 4Q4JA 3OD5A 1AY0A 2GFHA 3LUKA 1OYVA 1Y82A 1H6CA 5FTNA 4OJQA 2VPZA 5KWEA 1E2GA 4DLNA 1H9BA 1ACLA 2RHCA 1N4AA 5ABPA 1YHZA 3A10A 4K2AA 4AMGA 3P2YA 3ZVKA 3LUCA 1YASA 3AYXB 1OFHA 4W8HA 3ZX5A 3X1DA 3LM8A 3ZDYB 2HNAA 3SZUA 4EY7A 2J0QA 2XI4A 4ZAFA 2EZ9A 3ZHVA 4HDSB 3E9DA 3PV0A 2Z4TA 2RMKA 1GPJA 2QW0X 3BN3A 2AI3A 2XNDA 4G89A 2ZIVB 1PVVA 3LDAA 3QKTA 3RAPR 4X62B 1RNLA 4H4DA 2P6OA 4B33A 4YP6A 3DDHA 1QHIA 2WABA 3GC6A 3UHOA 2QRHA 3K2EA 4A0SA 4TT8A 4EKYA 3U56A 3STUA 2SCUA 1LPSA 5CB0A 2UU9B 1IULA 5DNAA 3E7DA 1N8SA 1J5PA 4V0RA 2G76A 4JJEA 4LZJA 4Y6QA 1KI4A 1MD9A 1X7ZA 2XF2A 4OHFA 1CFZA 1YAHA 2PL1A 1MEJA 1P0FA 1R0ZA 3IT2A 1GNPA 4O4LF 4W9RA 4WEOA 3WGHA 2XJ9A 3T41A 4EM6A 1DEOA 3RK4A 3TZEA 4BX8A 4II3A 2P9YA 3ENNA 4I4CA 3EF3A 5J59A 5KOJA 2QIOA 3BTOA 2J4CA 3C24A 3IAXA 2C9OA 4N3AA 3EFHA 1GSHA 2BGRA 5EFOA 4D74A 3QEKA 4TN1A 3WIDA 3OJEA 1PR0A 2Y1DA 4L8FA 4EJSC 3GL9A 3K6SB 2PXAA 5EMLA 2PBZA 4W5NA 1ZLXA 3I9FA 4PYRA 5DGXA 4RZQA 5DB4A 2MINB 4I5IA 4NEHB 4EEZA 2LKCA 5EHQA 4AKHA 2OXEA 1QDUA 1G8KA 1D9ZA 2ZB8A 3UGTA 4IGKA 4ZAZA 3H5AA 1IZ7A 2I8LA 1UZLA 1HE1C 4WNAA 3VTZA 3RIMA 2FAXA 1FNBA 2RC5A 3CLUD 3M6VA 4QFCA 4EJSA 3FPFA 3JARB 4FOOA 1HE4A 4K7JA 3V2GA 2GD1O 2YW2A 4MV5A 1D6NA 4WZBA 3SM3A 4CM5A 1ECGA 1OSNA 1Q15A 1VGVA 2I3GA 3JYLA 4Z0NA 5C18A 5KYKA 1ULSA 3K0SA 4HGQA 4AECA 3VR5D 1YQGA 3O8QB 4U2BA 1NLFA 2J46A 2ZYGA 4BQQA 1EVQA 4TYPA 1PWEA 1J42A 3I73A 1T5HX 3QUBA 4PR0A 3V80A 1X77A 4PX2A 2DBRA 3VH4A 4Q3OA 1KXZA 4D9EA 1AKNA 1J22A 3CNHA 1A9RA 3AY0A 3N2EA 3NASA 2D4HA 5K8CA 2QDXA 2JCSA 1OR8A 3T95A 2MSCB 1GCOA 1VZ3A 3FZGA 2ONCA 3ZY3A 3N07A 3PX2A 2NZ2A 1RWBA 3RIYA 5AMXA 5K0CA 1ZK4A 3QXJA 5H5JA 4F86A 2FWRA 3ITKA 2FF5A 4IIVA 3WQRA 4P5DA 1KU0A 1WNFA 2IZ0A 2HSDA 3HSKA 4QGAA 4DNXA 5IU6A 3DAFA 3PF8A 5GJVC 1TRHA 4P3YA 4INZA 5DP2A 1UP4A 3BFPA 1GXSA 5LOVB 3M4XA 2R86A 3L0BA 5E7IA 3LHDA 3QFSA 1YCDA 1FE8A 2PBLA 1I2BA 2JG3A 4PYKA 2C5GA 3CKLA 3ADCA 4HDNB 2W90A 1Q14A 3R3XA 1SD2A 1RPNA 1ZY2A 4B3BA 3KP1A 3KR0A 4Z9XA 5ICEA 4AZTA 4KIUA 5ITZB 2IZ5A 5K3SA 1YQ9A 4YP1A 4PG5A 3LSYA 4G5OA 2Y1OA 4HUJA 1W8DA 3QPUA 3VPGA 1YFZA 2NPFA 3L40A 3U37A 3PGMA 2IZ1A 5EXEA 1R18A 4HT3B 3MS4A 1KDTA 2H1FA 5FB3A 4JP8A 3TSWA 3A58B 3IHLA 4RJ2A 3PL1A 4L8WB 1TJYA 4CEIA 3SEZA 1ZIDA 3A9UA 1RSZA 3HG7A 3QY0A 1Z5OA 2F00A 4ZOCA 4DANA 3DXFA 1PJBA 3PXXA 4ZI2A 5EL0A 2GEKA 2VDUE 4ZA2A 3Q6NA 3VJRA 3ZHZA 3PEEA 1RPTA 1TD9A 2JASA 3MERA 2ZYTX 4ZODA 1UPCA 2CJWB 4O6VA 1WXDA 1CUZA 1YZQA 4MCAA 3I76A 1GR1A 5DW3A 1ND6A 3A6JA 4IIDA 1W94A 3A6LA 5FOSA 1ZZGA 4WVLA 5AXBA 3IOMA 3X2FA 5A4JA 2Q7OE 4BNYA 2KQUA 3EXIA 5T4EA 4RTOA 4PQRA 1C9NA 1TKCA 2BCJQ 2XE8A 3C16C 1Z18A 4QSHA 3SFTA 3EGXB 2WJIA 1WHSB 3PDHA 4QECA 3UJAA 3H04A 2XWBF 3PPVA 4HB3A 2ZUTA 5A1JA 1L7VC 3RSCA 1DKOA 3AX6A 1O58A 1W36C 3BMQA 1F06A 4KQFA 4UM9D 2CY0A 2DMRA 1JXQA 2VUSA 2GOYA 4KI7A 3UHPA 2UZ0A 3NETA 3OJ0A 3UJHA 2KE5A 2NZVG 3LIPA 4UQOA 3X1YA 2Y1FA 3H83A 4RHCA 3IO3A 4C5AA 1JNYA 2AXNA 1M8GA 1N0WA 5EJEA 2POCA 5M7EA 2CNKA 1CBUA 2WM9B 3ZS8A 2GASA 2IT1A 3PA8A 3B48A 3AESA 2VZ9A 1DO8A 1GQYA 2J07A 4LDQA 4NVRA 3R6DA 3WNDA 3D7RA 3UAZA 1EE2A 3E23A 3OIUA 4J0EA 3TIIA 1O5TA 4LYDA 1WKCA 1XVIA 1A4XA 2G71A 4ZQHA 4CEJA 4MW4A 2DFKB 5DU2A 4CL0A 5JS6A 3MMPA 1CDOA 3FPAA 1BMDA 2HFJA 5TVKA 1FFXA 4L5YA 2N1MA 2OCYC 1ZR4A 4Q9LA 4YUZA 1M34E 3FUVA 4K1XA 3ZKWA 1RRGA 3O2JA 3MS2A 4X60A 3IVAA 4XTRA 1JGTA 1UBKS 1BN6A 2R25B 1AXRA 1A9QA 2VPTA 3NBYC 3OIDA 3PFFA 4X41A 4KR2A 3B78A 2J6CA 4L5JA 5J5AA 4XWOA 4C03A 4JI0B 4F2PA 5I01A 1FX1A 4H3KB 1H2RS 1OWPA 1X7ZB 5KINB 3DEYX 1NI5A 3KDSE 1P4RA 1WXQA 3RWOA 5IJWA 3R9WA 2AG1A 4U2CA 1NIJA 3QITA 2QUAA 1XN4A 5ITZA 1ZUWA 4WZAE 1AQNA 1IHPA 2O5RA 3DNMA 1MAWA 3PEWA 3EFOA 3TKAA 2JHPA 1T9AA 2G07A 3NYWA 3QLVA 4NZYA 4DSZA 1WPXA 3GF4A 1QHNA 4MGKR 2BVNA 3KO8A 1QGDA 5BR7A 1LBSA 4BNWA 1O08A 4HQ6A 2H4XA 1FF9A 3RRZA 5CB6A 3AV0B 4V2UA 5KJ1A 2AXPA 4LHZA 5TS3A 2Y4OA 8OHMA 4FFRA 2H8GA 4NZOA 5BRNA 3KYCA 4HFMA 4O8CA 5IX8A 4KH1A 4ARVA 5ITSA 3I6ZA 3OE7A 1OREA 3HO6A 3QG5A 4LYHA 3W2GA 2XB4A 1RYFA 5FFFA 4K6MA 3EEBA 1DEAA 4AP5A 5D3ZA 2GXAA 2GN6A 2VP2A 1YMVA 4HDKA 4YMHA 4Z0PA 3PUIA 3NRCA 3NFYA 2AG8A 4NV3A 2QD5A 4QEKA 4ZGBA 4UBIA 1LEHA 3LSTA 3JQFC 4EA7A 2JAUA 4MA0A 4Z4IA 3E9MA 1YAJA 1GTJ1 1I6WA 4HK4A 2G6TA 4EQ6B 5K8UA 1OI7A 1X1RA 1Y3IA 1ORDA 4DYHA 3MBKA 4Q18A 2AN3A 4ITUA 4R2MA 4YRIA 1ORTA 2GCEA 1E7SA 3BVPA 3HRIA 4Z9BA 3ONWA 4LQ4A 3NS7A 4EAAA 1VE3A 4O2RA 3IKVA 3RYHA 4BN5A 3KCNA 4BB5A 1QO0A 2HYIC 4K5QA 3NYQA 4H7IA 4RBNA 4EI8A 3FYUB 5A6VA 3IOCA 1NQVA 2CW5A 1DBIA 1L4KA 1K7FB 1NN3A 3B1KA 5J4VA 3AVXA 5EC8A 1UKBA 4K9SA 3V6LA 1GVHA 1AUVA 2EV9A 4JP1A 3WYAA 4E3ZA 3K9LA 2RE8A 2XUQA 1D3AA 4K8RB 5BNZA 5GINE 5H8WA 1JE0A 1AIPA 1MRSA 3COSA 3IUPA 3VYTB 3PQFA 1W9HA 3AJ8A 1W2GA 3JD3A 4U2EA 4DUPA 2MU1A 4HGNA 3AFHA 1JDVA 4QPJC 4KN9S 4D43A 3MTEA 2IDKA 4BMOB 3A9RA 2HA4A 1RFGE 2W6CX 4IMJB 4YUVA 1PS9A 3AXTA 3HA2A 1GNTA 3U1BA 2D0OB 4D8TA 4A8JB 2D74A 3Q3CA 3DG9A 1TEZA 4GXTA 4JN6B 1OVMA 3NG1A 4JBHA 3L4JA 4V0OA 4EYKA 1BDMA 4LZZA 3GEDA 4M2LA 1LWOA 1YULA 4MMXB 4Q21A 5D3KA 1TJ3A 1AS2A 2NU6B 4LGYA 2O54A 1FDIA 1J9GA 4IGEA 4BFUA 3CZ9A 1UH5A 4XEHA 2PWYA 2IEAA 5ECYA 3X1JA 2XKAA 1AURA 3L8HA 4PC1A 2QT1A 4K87A 3PQDA 4DMHA 2JIPA 4PHCA 3URKA 3O26A 1F5SA 1JH8A 3OQIB 5FR2A 3WYNA 1DEHA 2PAAA 3GAZA 2B7BA 1U3DA 1KZHA 4KWCA 3PUHA 2XB9A 1ZUHA 2AKYA 3OETA 4Q6BA 1T9BA 4YMLA 2I2FA 2ZU6A 2AJCA 3FMVA 4QOGA 1N2IA 4TMZA 3AUYA 3J81A 5JSFA 3EMBA 5DYTA 1N5MA 2XA9A 1U3TA 3ENKA 3PQ4A 4E22A 1UM9A 2A0YA 4QXQA 2QRVA 4WOJA 4XB1A 3VZSA 4A8HA 1RXVA 2V6BA 4ZZ1A 1F51E 2PQ6A 1GKKA 5H82A 2EQ5A 1F4VA 1BXRA 3WO0A 4BZWA 1KQFA 2AKEA 4RORA 4XWYA 2FFRA 1RHKA 1KRWA 1EHYA 1JJFA 1F2UA 3QUCA 2ZRGA 1YZYA 2B8JA 2LV8A 3CH7A 4MJXA 2A5LA 1MGPA 1N9ZA 1S7GA 2W4IA 3I6MA 5THXA 4DUGD 4ER0A 3P2MA 1UBEA 1W59A 3OCCA 5IVHA 3PD7A 4UEOA 3NVAA 5FPPA 1RC0A 4G0MA 1N2XA 5KTRA 4W5OA 2OOKA 2JJ1D 1E6EA 2JANA 4MKIA 2OV4A 1M5TA 3E82A 3B7PA 4KO8A 3DWEX 3FYUC 4CF6A 3HB5X 2X3FA 5C2JB 3TQTA 4JLAA 1TTQB 2PYZA 1UDXA 3RIEA 4F9FA 2DE0X 2VPXA 4WESA 5D3QA 3G0DA 2AIRA 3E7WA 3TTTA 2Z08A 3JCZA 1T3TA 3NFRA 2R4UA 5B1DA 5CB4F 2H16A 4F8YA 2V55B 3ZDXB 3C3YA 4D3DA 4O0MA 4UU0A 3F8SA 1U7DA 3N2YA 3B1YA 1CP2A 3F67A 1FSZA 4FFNA 4DJJA 1XVVA 1GZ5A 2YJTD 2Y67A 3EYAA 2UZ3A 3FYUA 1MP0A 3GG2A 3C3WA 2I0FA 2DWCA 2AI1A 4XYLA 3RLFA 4UREA 3N39C 2BFBA 5J2UB 2ZKIA 1LSJA 4DC9A 3V55A 1D2NA 1DV1A 4TLAA 2WF9A 1E1KA 2V45A 1RPZA 3FBWA 2IVFA 4NZZA 3CKMA 4NCIA 2R8PA 3HB1A 5G53C 1XVLA 4MCJA 2PX6A 4UVDA 4DG5A 1PGQA 2FP4B 4PXAA 1NXPA 1WW2A 1MQAA 2FN7A 3NOQA 2GRAA 4PSKA 5D85A 5C5IA 4LVOA 3G8CA 1Z63A 1AS3A 3AWIA 2M6SA 3QFTA 4UNIA 5DYIA 5K5EA 3AJEA 5EGSA 1Z4NA 1DOZA 4E0BA 1ZMRA 4B47A 1QC5A 1JZQA 4CKCB 4DC1A 1U2SA 4LE0A 3BFKA 2I34A 4UZSA 1Y7PA 4PPGA 4HL6A 1NSTA 3PEUA 1NNI1 3NHRA 5BSHA 3P94A 2QYHA 5TPWB 3LGSA 2X3UA 2YFYA 3TCXB 4W5QA 1PWHA 3THWB 3HPRA 1Q6ZA 1T3GA 3T4XA 1QVVA 2PZLA 2IV2X 3T1HB 3N3BC 4AT1A 4GYKA 5JAOA 1BCRB 3F73A 2EKBA 2PLWA 2ZAMA 3FKQA 3WGGA 2V58A 4DIMA 5LL6P 2YMPA 1KOFA 2V4MA 2CXXA 3NP9A 4HNAB 1RXEA 1X8KA 2GK6A 2XMRA 1IXZA 2ST1A 1JXAA 2ZRCA 1ZN7A 4KTVE 4OYHA 1ECBA 1ND5A 1YVUA 4RZ3A 2Q0SA 5BRJA 1WW3A 4JVSB 3GJSA 4UM5A 3KZOA 3GI1A 3S3TA 2IH5A 1R1DA 3ON5A 2ANBA 4K3VA 3TM5A 4I5GA 3VDMA 5T8KA 1E1CA 1PYGA 1ZM7A 3STWA 1GILA 2XMZA 4Q1BA 1PLKA 1JIJA 4KXQA 2R47A 1DEKA 1HL7A 4RVUA 3VTAA 1WVGA 2RJOA 4UKDA 3PHIA 2W6OA 3PXDA 1R0LA 2FSHA 3BXFA 3MCAA 4OSEA 3WR5A 2IBMA 1GTVA 3K0HA 4FGZA 3DVRX 4JJKA 2AFIE 1WP9A 3KUXA 4G1FA 2HUNA 4GBMA 2DY1A 3AB3A 1G66A 5BUSA 2Z56A 1QR2A 4ONEA 2JCVA 4QDKA 4F97A 1TECE 2AE1A 4EY4A 4FGLA 1WS6A 2N3ZA 2P8SA 3NDPA 3QVLA 3F4LA 4DCMA 1QB7A 4DV0B 4JUDX 2P0AA 4OQEA 1EDEA 5IDVA 1T13A 2VJLA 5E1BA 3I1JA 5EJAA 3SF0A 3EVBA 1VE5A 4IOKA 4PNHA 3BRCA 1DRUA 2V74B 3P4XA 1M1YE 4ZVOA 4D0GA 1JEYB 3SDSA 2V5AA 4R9UC 3U26A 4O1MA 5HGXA 1GTMA 2P30A 2WOJA 3G0CA 1QNFA 3AEKB 1RQNA 2OBXA 2QSYA 3H97A 3PVCA 4TV8F 1A9TA 3OZBA 4BGVA 2CVHA 5ITWA 5JAMA 1ZU5A 3LYUA 1CIPA 1MH9A 3FXAA 1M83A 2BKVA 2F2TA 2E48A 4NNJA 5E38A 3WFJA 2HSZA 3BJEA 4L50A 2ZJ5A 2BELA 4MKXA 1J23A 2VQDA 4TSFA 5GQSA 4NTZA 4TRRA 3MUFA 1KDYA 4CM4B 4F92B 4IQ8A 4TRMA 1XJ0A 4IUDS 4IIHA 4K6HA 1Q11A 4JJAA 1EM6A 3OP4A 3TUZC 3GMSA 4DLYA 5A3RA 2G9VA 1SBQA 2QZZA 1M6EX 2X2PA 1P74A 5I8PA 4HYQA 1DDIA 2QJRA 4DKJA 3OQNA 1F2TA 2ZI7A 4MRSA 3O9ZA 3L1UA 4XPIB 1KYYA 1LLFA 4OQLA 2UXCB 5DHPA 3L7OA 3VAAA 1YDMA 3MSXA 1I2MA 4IGAA 3JZIA 4U9HS 5G1NA 3Q8MA 4FFWA 4PIPA 1K6XA 3Q1LA 4RQBA 3QKWA 4TSKA 3KYCB 4Y2YA 1UXIA 1W4ZA 2JJ2A 5KAMA 3U49A 3D8NA 2MOKA 5KWIA 2LRHA 4PAGA 1W36D 2AE2A 3FIJA 3WYFA 2QK4A 1J8YF 1SH7A 2JIZD 3QOYA 1CRQA 3ZTWA 5ALUA 4DRXB 3QLUA 3TLAA 5KEIA 2DERA 1SXIA 3TJRA 2Q1YA 1EJ2A 3JU3A 1NURA 3TTSA 3WICA 4AMBA 4F5WA 4PPNA 2Q99A 3FTQA 2AF3C 2K87A 3GGJA 2P1RA 2AN5A 3L5KA 5IYZF 5LM3A 3D3WB 5JATA 3COZA 2VAPA 3ZCTA 2WKWA 4ESOA 1K7SN 2ASVA 4PRKA 2C7PA 3AVYA 1RE0A 2QKYA 1ESCA 2I6TA 5A1TA 1YFJA 1JDPA 4H3SA 2REQA 3D8SA 1J0EA 4LNHA 4AF8A 3RIGA 3G6WA 5EJGA 3RKRA 3WYCA 3RS4A 1SKBA 4IV0A 3MIZA 3WYGA 3T38A 4FT2A 4GQAA 2QTFA 4LVCA 1JZSA 2BBSA 3K2BA 3N87A 3P0RA 1UBCA 3IPXA 2INGX 4AYWA 2O8EB 4BN4A 4TYYA 1RWQA 1B43A 2ZS9A 1GOTA 2BEWA 3FHOA 3GRFA 2NGRA 1E7QA 2HOQA 4JC4A 3CRVA 1PS0A 1UC5B 3QWIA 4YLGA 4EMBA 3QPBA 3OO0A 4S0XA 4A3SA 5E2AA 1RLOA 4EF5A 2X1HA 4BIIA 1NYTA 2B4RO 2JHGA 3EXG1 3KZMA 4RGYA 4BQNA 1CC1S 1QV9A 2D0IA 2GX6A 1DJNA 5DLQC 3O8OB 5DTQA 1Q95A 4RY9A 2WKRA 3SI7A 3TBFA 3PVSA 2QMOA 4HWOA 1ZFNA 1ACJA 4BRWA 2UUCB 3OJWA 4KH0A 1B3BA 4LY0A 1D1QA 4L4XA 1N0UA 3ZWBA 4K9PA 5HTOA 3G9XA 4INPA 1RBYA 4OI2A 1FMCA 5FPQA 1QO9A 4QD3A 4JYZA 2BMFA 1Z36A 5CGZA 4D4LA 2CB9A 2UVPA 4UTOA 2H63A 3MWLA 2PL9A 4WZZA 1JA0A 1Q1EA 2BHNA 1NKTA 3HJNA 3ZD9A 2ZTUA 1F9EA 1U0OC 1E9EA 4ZCQA 2WAMA 3PT9A 1CY7A 3IX7A 2H4YA 2A9JA 1YBMA 3WGQA 3OPYA 4NULA 4XX0A 4LECA 1KJWA 5ALJA 1XD8A 2C88A 4M0CA 3R7NA 3TD2A 4A73A 2B8EA 4I4NA 3LP8A 4IZ6A 4PZDA 3RROA 4ZVNA 1GGVA 1D6SA 1SUEA 3LBHA 5C8DA 3QEMB 3ADPA 4HJXA 4JVMA 4KUGA 3T1OA 3W5CA 3KZXA 4X90A 1G8GA 4KFRA 5DISB 4WGGA 5AI0A 4U7FA 4L3OA 3PPIA 4LRQA 1CQWA 1NBEA 2J9YB 3OZEA 3KOMA 3AOEC 3L8ZA 4DCVA 2PMFA 4BVGA 5L45A 1PR2A 2PZMA 3NHZA 5ICCA 4YRMA 3GLGA 1NWCA 2R8XA 1QBGA 1NE2A 1YH3A 4RA9B 1MDBA 1U65A 4G36A 4LGVA 2Q3DA 1XJCA 2ZI6A 4NX2A 1GUFA 4YVFA 5KI6A 2A35A 4JQOA 3W05A 5BN1A 3PYXA 3RO7A 5HQTA 2Q0HA 4M7PA 2IV3A 2EFHB 2GNOA 2NPIA 2P7IA 4LJYA 2YS6A 5JBIA 2ZETA 4R8SA 2Q7DA 5LIRA 1Q20A 2OB1A 3FKSD 1CRZA 2OG1A 3WWOA 4AUMA 4KKVA 1THZA 1CTQA 1XPRA 2EFGA 1OVGA 3DF9A 1OH7A 3UAGA 2BGWA 4G8JA 1BH2A 1BRMA 2LW7A 4IUCS 2EP5A 2D2XA 4I36A 3RRNA 4ENQA 4HC4A 5CH8A 2LWIA 2PDAA 4G0WA 1GQRA 1MHTA 2VDQB 1A9SA 4OHRA 1ZQ9A 3UWDA 2C2KA 2DUMA 4NI5A 3DZKA 3M2PA 3LT2A 4MRAA 4EB0A 3WLMA 4JT4A 2OECA 3E3MA 4UZFA 5C8XA 5FBVB 3AR7A 1L7MA 4LYJA 2FZEA 3PICA 5AQ1A 3ZE6A 1NXOA 4MARA 1EVZA 4D42A 5FWNA 1KAEA 5I8ZA 5FUBA 4WZBB 3E48A 2YHIA 3O3CA 3U7HB 3PC7A 4XASA 4CN8A 3AP3A 2XQKA 1NOKA 4LMAA 4EGCB 1QO7A 1BS2A 4JD5A 4ZOEA 1T1JA 4F1JA 4L4UA 1GNLA 2WIBA 1AGXA 1VCMA 4JU9A 6REQB 4XQGA 3BWVA 5L95A 3MQ4A 1RXCA 1P9LA 2PCJA 4GLBA 3M5CA 5ALEA 3S27A 3SIWA 2CXTA 4IIJA 3EDQA 3L7YA 1NKSA 2H7VA 2VF8A 3M49A 2VQ6A 3A27A 1ORIA 1L4HA 1ENZA 3LPNA 1V2HE 4XJTA 2C54A 1YTLA 3C39A 4HSEA 2QG4A 3RUIA 3E6AA 4KQ1A 2CLOB 2W2LA 3EQ6A 4FJ0A 2RHDA 4IDFA 2F3UA 2REOA 1X14A 1H6BA 2ICAA 4AULA 1T3ZA 5EZQA 2HA3A 2WTUA 1ZVKA 2C57A 1CE8A 4XLTA 3E3AA 2GN1A 3FRHA 4JX9A 3OVMA 3QJ5A 2BKAA 5TX7A 3B2EA 5DHTA 5BMOA 3QG1A 2P1ZA 1J56A 2K7ZA 4FXOA 4NAHA 4Q3NA 2XDWA 3WWYA 1T4MA 4FX5A 4MPTA 3CSDA 1QVAA 2IK8A 3E27A 3FNEA 3O38A 3V4VB 4ZANA 3WX0A 5FRDA 1VPEA 5AKLA 2Z9BA 4TKLA 3K8QA 3ZH2A 1I2CA 1S01A 5B3JA 4C7OA 3F3MA 1JI0A 2IYVA 2OKGA 3HU5A 4CF4A 2FU5C 4DV5B 1D07A 1ESMA 5L3VA 1DOHA 1RM5A 4MV8A 2AYZA 2FMUA 1XD2B 2A1UB 3C3PA 3CXUA 4G9EA 1XTTA 2WMYA 1KJ8A 4IO0A 5EMJA 3E4CA 3UMVA 4ND4A 3W5DA 2QN9A 2Q1TA 2WFMA 3HY6A 1A7UA 3ZHTA 3FSEA 1U7HA 3ZGVA 4NABA 2JGMA 1PO7A 4WY2A 1IJKA 2JGFA 3S2ZA 3VH1A 1PTJA 2CLCX 2J5XA 2PD4A 4GE3A 4MQ5A 4NHOA 3UATA 3C5HA 3U44A 3BZBA 3DONA 2RBKA 3HR8A 1J2RA 1MIOB 3L8EA 2XJ4A 4KYUA 3IVMA 3BF8A 4N7JA 4Q1DA 5FNVB 3A1WA 2VF2A 2DGDA 1PQYA 3TFWA 3N2LA 1EE1A 5TARA 4V1CB 1J8VA 1JVNA 5T6MA 1ZSVA 2G9NA 4R0MA 3ZHUA 5DPMA 2NYUA 4IIEA 1VKJA 3GZJA 1KY2A 4WW0A 5DIFA 4C0WA 2GEJA 3CUYA 4M3NA 2EW2A 2SKDA 3UK6A 1W96A 3AFIA 5HPYB 2GVNA 4B34A 1NJ6A 4X6YA 4Z1OA 3H1AA 4MVJA 4KR6A 2RHJA 1K86A 2JGAA 1JU9A 2Q2QA 3V00A 3RHSA 3AEKA 1GPMA 5HJ5A 3OPMA 2N46A 4BQPA 2GZ2A 1MH1A 3HUEA 4H7FA 1TMOA 3FUUA 3SJZA 4DZRA 4UPDA 2DKNA 4J1SA 4N5NA 5SY4A 3RYIA 3V5NA 1FQKA 3WGKA 1Q5PA 1S89A 2PJDA 4C08A 4FUQA 3Q2KA 3NXKA 4E1AA 4CM1A 6PFKA 1WQ1R 4LFAB 4EKDA 3V48A 1ARZA 2FWAA 2XDQB 3P19A 1K3TA 2GA8A 1FP6A 4FP9A 2G3YA 4D9BA 5L51A 1W0KA 2VQ3A 4YS6A 1R8SA 3HCEA 3PUZA 3PGJA 5CM9C 2P5TB 2P6MA 3TKLA 4UBMA 1P0MA 1PVDA 1ISSA 1ATZA 1ZJJA 1B74A 3DYIA 4UHJA 4KQ6A 4PZCA 1H5QA 2NQ2C 5BV0A 4URFA 5K0TA 3K6KA 4X6LA 4G9BA 5HE9A 1YQDA 3UMYA 3PFBA 2ZJ1A 1G41A 1K7EB 5F98A 3A31A 2GJKA 2XDYA 3DZJA 4MAFA 4CODB 3G79A 4YT8A 4HGZA 5CFQA 3RANA 1U31A 5EINA 4P36A 4X44A 3H6GA 3KT6A 3DHEA 2ZJ6A 1NW9B 3INGA 1GUYA 1VRWA 1RM4A 1RWOA 1NP3A 3U3XA 4LN1A 2H52A 3F90A 3LQYA 2PX5A 4JKYA 2FZCA 5BSMA 2QTHA 1LK7A 2OD7A 2QP4A 1Y1QA 1XZHA 4TMXA 2IWRA 1I5OA 3C0KA 3W34A 2FI1A 1ONSA 2VDRB 2G77B 4AF6A 3ER9A 1P18A 2AN4A 2PZAA 5TJHA 3B1WA 5FBRB 3H7AA 4R6XA 1KKLA 1NBHA 4HZIA 1Z2OX 3SCZA 5FQOA 5TC4A 1KMMA 2ZUCA 2OCBA 3EZNA 1OHHA 2F6RA 5IUNC 2XWQA 5CB4A 3IUMA 3QPVA 7ADHA 1PQUA 4OATA 2X6TA 5EE5B 3G2HA 1BU8A 3F5FA 4QOHA 4KOEC 4L9WA 4FB5A 3OKCA 1FSPA 1RYMA 4I66A 3KEFA 3F6CA 5IAOA 2II6A 3HCOA 3LW7A 2NVUB 4TTRA 1AZSC 5JPDA 1U9ZA 5DBFA 2P4SA 2RHHA 2Z1NA 4ZC1A 4LF8B 2DWUA 4KR3A 1L7AA 3UOGA 3JATA 2J6IA 5DDIP 5JZVA 2FPRA 4O33A 4ZQIA 3K4PA 5B1HA 1MNQA 4FGSA 1L8AA 2MINA 3EVGA 3GMDA 3VV2A 3QUAA 3THWA 1P44A 4LRXA 4V3BA 1L8LA 1TVKA 3QZUA 4PGGA 4PNEA 5JISA 2ZE6A 1RAHA 4LWOA 4JX8A 2XZOA 3ZIAD 2HJRA 5EPEA 2NO7A 1L6IA 4IHJA 3CTMA 3ELYA 4DUGA 3MT0A 1KR2A 7AT1A 2L2QA 1LX6A 1KZ1A 3H3JA 4MQLA 2W58A 3E9YA 3FPEA 3DCIA 5KYUA 4BJ5A 5A4IS 3UJCA 2NXNA 4GECA 5AJHA 4GS5A 5DFAA 1QMGA 1W73A 3SE0A 2H1OA 3OTWA 2Z5VA 5KNCD 4KIGA 3W8FA 4J9VA 5LUAA 4CQLA 2J48A 1PP4A 3R3WA 1GDDA 2FPPB 2J9RA 2RK4A 4EG3A 1KI6A 4BJ6A 2A1IA 3ROKA 1EUZA 5EE3A 2HMWA 2I3AA 3IAM1 3EFEA 3T6KA 2AW5A 5DE3A 1HDRA 3EVEA 1HE5A 1YFKA 1ULBA 3C3MA 3LS2A 5YASA 4IW3B 2IFTA 3M8KA 3H1TA 3MJVA 4IIBA 3VNBA 2G83A 3OF3A 3U80A 4G4SP 3O90A 1OASA 4QYXA 1UCFA 2PZ8A 2ISQA 1U0NA 1DFHA 1KIAA 4FD3A 5CUQA 2R87A 4ACAA 2XXBA 3CJRA 4G56A 1XMSA 4XYBA 4NCHA 1PS8A 2W4QA 3TE6A 1QF9A 2KI5A 4PNZA 2EC5A 2X2FA 4HQNA 4JAVC 3DVQX 2GCPA 4U5XA 2WIFA 1AB5A 1GFSA 3DMFA 2YBDA 1XMOB 1YACA 3U4HA 2I2BA 2FQXA 1O2DA 3V46A 3SAJA 3V4LA 5JLJA 2PAFA 2VDJA 2XB8A 5KNDA 2FW0A 1C8LA 5LMUB 4HS9A 1FJ2A 2BMDA 3DPSA 5IKPA 2LUOA 1SUPA 3E9NA 5FL3A 3EQ7A 3AXSA 1NW7A 3SY8A 3ASYA 2D3TA 2EW8A 2YXBA 2PMBA 3JQEA 3KOYA 4BBJA 3FOEC 3ONNA 1OAOC 2WNHA 3P9RA 3VZRA 4DCNA 1EFUA 1R9GA 2XUHA 4P3KA 4Z3OA 2D62A 3MWKA 4HN4B 2YJZA 5ESXA 4Z4FA 2QLLA 4HNSA 3WKBA 2WB2A 1U0BB 1ZHOA 3IDFA 2W2KB 4RETA 3SD7A 4GP7A 2Q6IA 2P35A 2GBLA 2NV6A 2QTCA 3T15A 3WS7A 3UICA 4P22A 3SVLA 2FMTA 3TW8A 3EHDA 1GPAA 4H60A 2VPQA 2QRPA 3FDJA 1R0BA 4FE3A 4GI7A 3DQQA 4GX5A 4OHMA 3UANA 4C29A 2AF4C 2BFDA 4ZHQF 3I1IA 3SZRA 2DT8A 2VYQA 1RDFA 2YIVX 4XM1A 3ZJ5A 4DYVA 3AKCA 1G5IA 1C50A 1TZCA 3L1IA 3R41A 3RASA 2ZBUA 4DBLE 1DB3A 3GNTA 2VC2B 4UFOA 1PZEA 1UM9B 4AJHA 2FG5A 4ASUA 4RNCA 2Q5JA 2FVYA 5BVHA 2ECFA 2HV8A 4MS3B 4K9NA 4TX1A 2OZEA 4YJ3F 2GK3A 5EWJB 4BFSA 1LPMA 2A86A 4RD4A 3Q8WA 1OC2A 1Y42X 1Y1LA 3DNFA 3GH3A 5HBGA 3FNIA 2FW7A 3SU8A 1WDTA 1XEXA 3WJ1A 4C43A 1ZAYA 3CYFA 1K06A 1Y4AE 1S1CA 5DIZA 1IB6A 1BX1A 1MVNA 1QHFA 1VIVA 1XKTA 3RT7A 1R50A 4G81A 3AHCA 4NDZA 3PNMA 4N03A 5FBLB 2JVIA 4DSAA 4RE6A 1HKUA 4J0JA 1R3DA 3TLGA 1T15A 2AOUB 2XKBA 2IC5A 4MHOA 1Y5MA 1MO4A 4TROA 2J3LA 5C7YA 5I7OA 4MUEA 4UFPA 5UKDA 3M6FA 3EG9B 4G5SA 4J8PA 4U7DA 1I9GA 5B4VA 4MQUA 1NXTA 4YV7A 4BO4A 4G5GA 5FOQA 4FBGA 5BYBA 4F1KA 4G63A 1WXXA 5JZMA 1XEAA 2NG1A 5E4YA 5CP8A 1Z4OA 1SY7A 1U02A 4WKNA 2ZJYA 3P5BA 4AJ2A 1NBME 4KIWA 3MGKA 4LZLA 2DJ5A 4F38A 2P9FA 3H19A 4FB4A 3OQOA 2H57A 2PRZA 2RBGA 4U6QA 1YXMA 3OZAA 5LPNA 1QRTA 1XF1A 3WOVA 3G0OA 2E0IA 4KRXA 2W9XA 3DNPA 2BH9A 3IRVA 4E5DA 2CZGA 1XTUA 3KHSA 3RODA 3FMGA 4L95C 2JJQA 4P5EA 3QXGA 5I7AA 2BFMA 1PR6A 1PLJA 2IJGX 2V6FA 3KOUA 1VIYA 2QNBA 3HCRA 4GZLA 4ARIA 3ANSA 4O4HB 3N86A 2FQQA 1GYRA 3LDGA 5F51A 5KVSA 1T5OA 3ETNA 4KR7A 2HMUA 3OM8A 2YUIA 3MTDA 1U81A 4AK9A 4KVFA 2P4QA 5JMOA 2G04A 4NEQA 3BSSA 4PHTA 4C07A 3DP7A 2B1QA 4H18A 3RHFA 3SX4A 3O0DA 2OV1A 1KQPA 4LF5B 4N76A 1MVOA 2F1JA 2UVQA 5ALXA 4EHHA 4FHEA 5LQDA 3QXXA 3HJCA 1QS0B 3RGWS 1F7VA 1Z5GA 1MQ9A 2FW6A 3FTNA 3KLOA 1HPLA 5T5QA 2I1WA 1XWIA 4A23A 1VP3A 1M2VA 4BUZA 4C2AA 2QQFA 3ASVA 5T57A 1A2OA 1ZSNA 2R3SA 1WJGA 3K1JA 4CHTA 4S05A 2WSSA 2BBOA 2ZTMA 4EFDA 1N6NA 3KUDA 4JY7A 3B70A 1HURA 3VMMA 2GAFA 4YMWA 3A1FA 4R8MA 2OXTA 1J9ZA 1KP2A 1X92A 1VG9B 2CFRA 5ALFA 3DYVA 5I47A 4LTNA 3LW8A 5K0LA 4J3FA 3N2GB 3PCXA 2I78A 1SIBE 2XMCA 3UFXB 1V1MB 3ZJYA 1T2CA 4C4ZA 1LGYA 3F8WA 2I99A 2I62A 5JC1A 1AUOA 3RUDA 4CM6A 1QH1A 1SQ0A 5JBQA 5JSHA 2GNAA 3SXJA 4C0JA 4RDHA 4I5EA 5FPSA 4D3YA 5KOYA 2H5LA 2Y0EA 2O2IA 2OFOA 3UVEA 2ZUSA 4AICA 3P4UA 1M76A 4B80A 2JFPA 4E5SA 3ZDDA 3HBAA 4EZEA 4NJEA 4MJLA 4QHTA 1JG1A 1D5WA 1YJBA 1YZGA 3A06A 5F12A 4CL2A 3U4AA 3PSAA 4CMIB 2EFEB 3UB4A 3BKXA 3C6QA 2EQAA 4E12A 4FYKA 3B9RA 3OPQA 4G0QA 1SCQA 4U6NA 3BQMB 4B3SB 5BSVA 3DBLA 3HB7A 1KP9A 1JLHA 2R6FA 4LPKA 4ALLA 3VR1A 5JSZA 2F55A 4HRXA 4UJ3A 3FSJX 2PKEA 1TF2A 4ZO9A 4H17A 4JLMA 1H1LA 3ZCRA 2BGNA 2YR0A 4JXXA 4X00A 5AD1A 4W5WA 3HCBA 2Q4EA 3PGXA 4X97A 4CCYA 4NC9A 1PZMA 1RYHA 1YDEA 3B7WA 1KSFX 2WSIA 3K0AA 3QSGA 2WUEA 1L7OA 2FPLA 3E1SA 1Q7CA 2QRUA 1HFEL 2GKGA 4Q15A 2L19A 3A1SA 2FR8C 3M5DA 2CNDA 4M87A 3WQBA 4NE7A 3UTCA 4LSWA 4TTPA 3RC8A 1BN7A 3ZCSA 5IT4A 1UBOS 1OBCA 1YZHA 3O4GA 4MCIA 4ZCSA 4DLWA 1ZM2A 1DBWA 2GHIA 3VV3A 3D4OA 4L5BA 3IPYA 2BEJA 2I3ZA 4L85A 3TD6A 4G67A 2A78A 1DNPA 1D6MA 1Z5WA 3BTVA 1CUUA 16PKA 3GGDA 3NIDB 3BMXA 4Y0VA 4R2LA 3X3HA 2BGGA 3RI3A 3ABQB 4JKIA 3WZLA 1JFTA 3WRYA 4B32A 2LXNA 2P68A 4JQSA 3ROXA 2GAAA 4MYHA 1W0KD 3NAGA 3LRTA 2CL6X 3M6WA 3FDIA 5BYKA 3ONFA 1NVXQ 2XCLA 4DSTA 2E6KA 4UNQA 4BKOA 1HV8A 3S1LA 3VOTA 1POWA 4K6OA 1V25A 2Y0BA 4O0LA 5JTUA 1RIIA 4RM2A 4P7KA 2HSWA 1IM5A 5IDWA 4PXYA 4PZPA 3VXKA 3EIFA 3FI0A 2YV5A 5ECDA 4C4AA 3GUVA 3II6X 1T5BA 4EFKA 5JH7B 4CKCA 2FQYA 3AGQA 4MITA 3U7QB 2NSDA 3TLEA 1G9SA 1G4AE 3IT3A 3CU5A 5HK8A 1ULZA 2XNJA 3D2BA 1D2AA 2HF2A 2F1HA 2PUTA 1P8AA 3CW8X 3DTTA 3OPNA 4FHZA 3RUEA 4E5VA 5JXHA 2FKAA 3JWJA 3GZ4A 3GZNB 4DSUA 2ZB7A 2WZBA 1Z33A 1YQXA 2PUHA 4LNUB 3WGVA 3SF8B 4UUOA 1RLUA 4YT4A 4KU4A 1XTVA 2GHQA 1NNUA 2NADA 1ZS9A 3KZ1E 4JASB 5AJWA 5C1DA 5H4GA 5BPFA 1YVPA 4CMJA 2CZCA 3PL5A 4GXRA 1FJGB 1FSGA 1UWLA 4RYLA 1PN3A 4EEXA 2VP3A 5G0UA 4PQGA 1T26A 4GMXA 5AI4A 5B37A 1QH9A 3LXUX 4UHKA 1SCBA 1B2RA 1LC3A 3C45A 2X4GA 2IX9A 4LDPA 4DLXA 4EP1A 3RSQA 1PWXA 4CPDA 1R27A 1UK7A 3ZHCA 5BSWA 1OMOA 4JBIA 1DWPA 2C5HA 5GV7A 3ORFA 4C4OA 3EWAA 2B5WA 2D54A 2JH8A 4NEGA 2XMPA 4FFVA 4NBLA 3NBKA 5IAEA 3ZN2A 4F4CA 2C58A 4FFLA 2J45A 1N1DA 2ZYWX 3NBAA 4TZKA 5JT1A 3HABA 4AUKA 4L6IA 1I4OA 3NTXA 4L2IA 1K3FA 4Y1RA 4WBNF 4C0HA 1UMBA 2CWWA 5EQDA 5K0FA 3CNOA 5IUJC 1NP6A 1YK0A 4EJFA 2PGJA 1QVZA 1C9EA 4GSKA 2Y1KA 1DG1G 4AL4A 4YRZA 3VYSB 1A8QA 1CHDA 5BVGB 1WMEA 3HU1A 1DBRA 1JDSA 1J21A 5DM0A 1GPWB 3OMXA 2UUAB 1DAEA 2VEOA 1U0JA 1GAJA 4ISBA 1XA4A 4TXNA 5H3CA 5DHQA 3KQPA 3EIWA 4EHAA 3T7KA 4UBKA 1G5PA 4ER7A 5BUQA 4OX9B 3RS3A 2V0GA 3DTVD 2YHUA 1DIGA 4B46A 1DRWA 5LOVA 1HC7A 1U1EA 5BW8A 3D7LA 1W29A 4MRMA 1IXRC 3TR0A 3KQTA 1SAYA 3H2GA 3IH5A 1T4BA 2QJFA 4HFJA 3EAGA 1MA3A 2VPIA 3KWMA 4ITRC 2WHRA 4NYMR 3WGMA 3C8UA 1SVSA 4W5RA 5DX0A 1AJEA 2IDJA 2R65A 5ERXA 1LY1A 5NULA 4RV5A 2RHGB 2PGIA 2VP9A 5NLLA 5L9AA 4UCWA 3TR6A 1HDOA 4B9AA 1UUFA 4XXHA 3MAGA 4YAKA 2B4QA 1AUXA 1KR5A 3CLSD 4EABA 3AR8A 3SKYA 3ZHSA 2OXRA 2P27A 5FOUA 1K88A 5TPWA 4AG5A 3KTAA 4UAGA 5LLDA 5AW3A 3HP1A 1EXMA 2FDXA 1ATIA 1WDMA 4YRNA 4J75A 3VO8A 5JH7A 2VTDA 3RG2A 2VQEB 1WOYA 2NV0A 1BDIA 3UFBA 1AN0A 2AB0A 2E21A 3A37A 2H0QA 5DASA 2H59A 1C3OA 1UQUA 5CDFE 4CDGA 1PJTA 4PW0A 2RCYA 2JIQA 4X1IA 1EJBA 3U5ZB 5IW8A 3BD7A 5KYYA 4WXYB 1PQ4A 4C76A 2Q21A 1MC4A 3FUCA 4YI5A 5EHXA 3CZQA 3LBIA 2QQ0A 5HQJA 2G63A 1ZSYA 1OA0A 1F2UB 2L0XA 5KNBD 3DUFA 1NPYA 4O2LA 5EA2A 5EFZA 1T2UA 4WOPA 2DUNA 2FWJA 4ED9A 2PLAA 3EULA 2AQKA 1MB4A 1NOIA 1AQLA 4G4SO 1JQ3A 1XQ1A 2L42A 1KJJA 3F5MA 3F9CA 3C7CB 4YQFA 3A9TA 3H5IA 3K9HA 3ILYA 2HRQA 4DAEA 2X6RA 4FE7A 3WWDA 4OJTA 4CIVA 3PJDA 3UZUA 2R6AA 5JSZB 4X95A 1PG0A 4NQRA 3HVUA 1W48A 2VF7A 3M81A 1C1XB 2VPYA 4X65B 2QMHA 5DWDA 3SFVA 3WSTA 4AMZA 1H1LB 5HYVA 1UEJA 1H4VB 2WKPA 1UC4B 2RHTA 4P54A 3R8XA 2H4WA 4CT4B 3HFRA 4V0LA 3LUPA 2ES4A 4DYDA 2ZU0C 4EUFA 1FNCA 4MVJP 1U3VA 3N8HA 4IZOA 4K46A 5DCWA 2JFUA 3FWPA 3RGGA 1FRNA 2ZYUX 4WFJA 4JC8A 3BEOA 4FWBA 1N1EA 1NAIA 5GPBA 1A5BB 2B69A 3CJQA 3GT4A 2W6IA 5K3AA 3AY3A 4AKEA 3LZ6A 4ESEA 4YAWA 3LXMA 2XGOA 4X7MA 2NX2A 4L27A 1KTVA 4W4TA 3U48A 1T1IA 4AN0A 3MWGA 1K5PA 1G8AA 1JTVA 2UV8A 3ZLJA 1YVEI 1AXEA 2BCGY 4D4GA 2C4WA 1YI0A 4BO6A 1ISRA 4LXQA 1EFRA 1N2CE 1GGNA 5T7BA 1EDOA 1Z06A 2WPDA 2V8BA 1ZJ5A 4QGHA 2GB4A 1EIZA 3GA7A 4QASA 3TIXB 4C20A 4YMGA 3TZ6A 1AX9A 4CV2A 2JLCA 3A0UA 2IEDA 5DBHX 3MJ4A 1ZRSA 3ZTTA 3LO8A 3FVQA 4ILEA 4RX1A 4UW9A 5CGQB 5A3VA 1MHPA 2IXEA 3K30A 4HX5A 2QN8A 1JFSA 4D3XA 3EDRA 2VPWA 2VSXA 4HLDA 4PIVA 4X3CA 3PXGA 3TIFA 1K75A 1SCKA 1A1VA 3EGDB 5FCDA 2XDAA 3G8DA 1ZH0A 4JL5A 1B14A 4MLCA 3TQOA 4KIJA 3ABOB 4LYFA 3K2IA 5EIOA 3HJTA 5BT9A 2W0SA 3EGWA 3R6TA 4AURA 4MDFA 5E1OA 5HRAA 4YRDA 3RSHA 4OGGA 5BP7A 1T29A 1YB1A 3WZ2A 5GM1A 2QBYB 3ILHA 4NARA 4L0MA 4KMOA 5GOTA 4ZJPA 1D2MA 3GLIB 2XBMA 2FRDC 1B8UA 1W4BA 5EJ4A 3IXQA 1BKYA 3VPAA 1UKZA 1BJRE 1YMUA 2Y3IA 3O84A 5I9TA 2X0EA 4IX1A 1QCDA 3F3KA 1P2UA 1S2OA 4ZOLA 1HTWA 5FJIA 2HHJA 2QTMA 1LQ2A 1P4GA 3M6UA 3UCFA 2AXQA 1B26A 3EOBI 5EIWA 3SMQA 2PH5A 5A4DA 2CK3D 4XWAA 1KRXA 3BGIA 2BKLA 1SFRA 4DMKA 4PHGA 1PSDA 2DPYA 1VKNA 3H1PA 4DLRA 1NGSA 1RVV1 3PFKA 1U7OA 4J3JA 4QWMA 1I3OA 4ASUD 2XTZA 1Z5NA 3OLVA 1BGWA 4XDGA 4LYGA 4YH1A 1DT5A 2EW1A 2P3SA 2PKYX 1FSSA 3L5OA 1Y1TA 3OWOA 2ZI4A 2FV8A 1Y1SA 2VLBA 3B38A 5AM3A 1JDBC 1BMTA 4J76A 1N25A 4RTSA 2XTJA 5BN5A 1RYBA 4P9NA 5E6RA 1JWBB 3JZFA 5DYWA 4HY3A 2FY8A 2FSFA 3ND7A 4XVHA 3GMIA 2VDMB 2XQVA 3HDQA 4JJFA 1H3FA 2V6JA 3UKJA 4TMTA 1XNHA 2ZCVA 2P5UA 1JR3E 3KSAC 1GNRA 2J3DA 2ZJ7A 3Q0EA 2XIJA 1QG2A 4EELA 1X0XA 2VHZA 2HY7A 3TINA 5JI2E 2XRZA 2OWDA 2V4UA 2JRLA 2GD2A 2ZRFA 3EBPA 4N0DA 1U8CB 4Q7EA 4V24A 1H2XA 4ZAGA 3ZD8A 4JBWA 2G9UA 4PSAA 5EJFA 3IVXA 4EZIA 1ZAKA 2GYUA 3PFNA 3AONB 4WXPA 4RKFA 3OPVA 3OWHA 5KNDD 3ICOA 1DMSA 4UNNA 2YIJA 3IIEA 4LOAA 3BDAA 5IK2A 2I55A 3AINA 2FEKA 4O25A 2C2ZA 3BB4A 4M0EA 3GD7A 4DRXA 3MWFA 4F3TA 2A3RA 4KXVA 4YCSA 1IDN1 4KOAA 2WD7A 4R2JA 4TRJA 1QCYA 5HHTA 4URHA 4GVPA 3AHEA 3QV2A 5AJUA 3BXZA 4GMFA 4Z9YA 4C3UA 2O14A 4EBFA 1PEYA 4B3DA 3AW9A 3I58A 1SBYA 2VTKA 5COBA 2Q3JA 3KJXA 2AN1A 3RWBA 3SQNA 4P4SB 1CS0A 3LL7A 4R7GA 1A77A 3HXMA 1F1BA 4R1TA 3VQTA 2PH3A 1QE0A 1NUUA 2H5JA 4UM7A 4DPKA 4PN3A 2MIIA 1BC5A 1SBNE 1LF0A 3LQKA 1GSAA 4AJ9A 1YBVA 2H1LA 4RPGA 1LI7A 3GNSA 4CG1A 3NX4A 1E1YA 1O0BA 3O93A 5G0WA 3SEAA 3WMFA 3T34A 5DW0A 3LKDA 3S70A 2QBYA 4D4HA 1UZUA 4P4SA 2HLDD 1BXGA 1KP3A 2P9BA 1Z39A 3HV2A 5TMDA 3UCEA 2C2YA 1WPGA 1UJMA 4AN4A 2EL9A 4BO8A 4CQJA 2Q41A 3BWCA 4ZZ0A 1S3GA 3EEOA 3AETB 2BFOA 3DEAA 3RAJA 3PDWA 1SVNA 1T3LA 4RKQA 3WKAA 4Y2SA 5C4IA 2FSPA 3WIEA 1Y7LA 1QZ3A 2JL1A 3FGOA 4EW1A 1U28C 4PRLA 4X24A 4PBRA 3TM4A 3LJKA 4RDCA 4DCPA 3CVOA 2AWOA 5DSXA 4LJ7A 4DJEC 1YR8A 2WW8A 4EPTA 5LD2C 4EF6A 3ZIUA 1UXOA 5JXWA 5TPZD 3RS2A 5KMGA 3A36A 4FEEA 4TS9A 2ONYA 3ISJA 4LHYA 1PKXA 3P2JA 3Q7EA 3V42A 1T24A 5HKAA 2YHBA 2IXAA 3AFMA 2OCLA 3C3XA 5HM6A 1SPBS 3ZDAA 5F2OA 5JS8A 3K8OE 1JVSA 3RLIA 2DBQA 3R7LA 5FT9A 4DSNA 2PWPA 4WQMA 1DFGA 2IZ7A 3I8OA 3ML1A 4CMIA 3FFWA 3QELB 4JJGA 4LCEA 5L7WA 4GOLD 3SSMA 4EI9A 3JZMA 1CUEA 2XCOA 4ARZB 2CDAA 1XVAA 1KHTA 3ACCA 1FUIA 2XE6A 4DMRA 1PV4A 4JA2A 5FHRA 1OZ0A 3KVVA 4AZ0A 2R1ZA 4MV1A 4GI3A 1J5XA 3HPQA 3TLMA 2A94A 4OAPA 3HO8A 3LKBA 3OFSA 5B3KA 5WRFA 1HSZA 2IKSA 4BNHA 4MW2A 3SSOA 1S9DA 3GJYA 3LZDA 1G8JA 2W6JA 4MK4A 4NESA 4DIDA 1VSBA 1RQRA 3OOJA 4X3PA 5GONF 3DCYA 1Q0SA 2YZGA 4M1YA 4KHPB 4BLRA 4U2FA 1VBMA 2R7NA 5CX1B 4FYPA 5FPYA 3SSAA 2FUG6 3RVRA 4D6PA 1OPRA 3KJFA 2EG9A 4REQA 2DPHA 3EGDA 3GBSA 3BAZA 1RXYA 3FWHA 1Q1AA 3AL2A 4EFNA 2QR3A 2ANCA 1UPFA 2XCSB 4U5QA 3U9TA 4PZLA 5F23A 2AEFA 1AB6A 1I0IA 3IERA 5CFOA 2KS6A 1HX7A 2HBZA 4Y9TA 3UGKA 1IPHA 4CG2A 2NWQA 2ZJ2A 3GP8A 2WSSD 2QRGA 1MO2A 3QTBA 3VX3A 1GPLA 1WTCA 3M34A 4KO1S 4NATA 4Y18A 1G6KA 1E6KA 3COYA 3I1YA 1O94C 1NN1A 2A30A 1B0ZA 1VSQA 3IGFA 1GL6A 3QFCA 4F91B 3BGDA 1U8EA 1NMSA 1V45E 3U3KA 1M6YA 2D4AA 1P4AA 2GCIA 1XYGA 1KSGA 2BCEA 3AF2A 1ZD2P 3MT9A 4EUHA 3ESYA 3T3PB 4AWXA 4OYLA 1YR3A 3W04A 5BWMA 1QGAA 3N2KA 2D7JA 2R4QA 3O3NB 2ZRIA 2GEBA 1KZYC 1GDTA 1FDTA 2F3QA 1U2GA 3JVEA 4K88A 1YT5A 2JD2A 3L18A 4PZ0A 4PC6A 1OLXB 2V7QD 3ABIA 1LV8A 2ZBDA 4PG4A 4B6SA 1PEDA 3HDYA 3ZK9A 4QPPA 2C98A 3DZHA 3IA2A 4TWRA 1XAJA 2JD0A 1A7KA 1NZJA 1Q74A 1Y34E 2EFYA 3CEHA 3KG2A 3Q41A 4LPSA 3LWNA 4TPKA 2FPIA 4IF6A 2B8NA 2X9NA 3TZKA 4BJ3A 4N65A 1KC3A 3SLRA 1OXKB 4ZCTA 4RH3A 4J2HA 4GKBA 2CYAA 2PGLA 4Z0TA 2EJUA 3NDIA 1S3FA 1OZAA 2RJ3A 3DEHA 2UVDA 1VFPA 3EK2A 1EMDA 3GGOA 5ANRB 1N2HA 1IN7A 4IIFA 4QRIA 4YPOA 2E5LB 1YGPA 1CUWA 4BB0A 3OQPA 1H1TA 3EIUA 2RK3A 1DAFA 4V0QA 1LDNA 2C4MA 3KVRA 3EW9A 1EUDB 1E4VA 1WMBA 2E85A 4MX8A 1BOFA 1IXKA 2DM6A 1U8XX 2H7CA 2PJUA 1JFVA 3KD2A 4HMPA 5LU8A 2Q3CA 4AJ4A 4URWR 1EINA 4A82A 4LXUA 1I94B 3O73A 2DVMA 1P1JA 3PEVA 5JZBA 4UEJA 2WUFA 3KM0A 5KSYA 4HHEA 2FOXA 3EA4A 3TRIA 5AUPB 1Q1GA 4FWTA 1JQKA 1BHSA 4O4HA 4MQ4A 2EVWX 4E07A 3C8DA 5F2KA 5KQPA 4C4XA 1JQEA 4R05A 3LZCA 3BCUA 3P9YA 1P5FA 1T9DA 1ZMOA 2DQSA 2QLMA 4P4GA 5A5DA 1JUDA 1MQ8B 4NJMA 2R751 3WK9A 1QTQA 3HWX1 3UB2A 4B2YA 4IMRA 4YTEA 4NE2A 1Q3KA 4FZJA 5T64A 2NUBA 2TS1A 1ZH6A 4Q37A 4QC2A 5F52A 1CR0A 2XMGA 2ZBFA 1L8QA 1SB8A 2AFVA 2HHLA 3TZBA 1ZGHA 2NZJA 4QM6A 4XJVA 2VG8A 3MWJA 2BYTA 1N7IA 4BCCA 5ES3A 2CKDA 2HCTA 3H4TA 4Q02A 5KTPA 2NTYC 1IH8A 3DF7A 3IOBA 4YRBA 4EMSA 2BFWA 3RKSA 2JNWA 3PG5A 4UHEA 1C1YA 1NPTO 2C97A 2O0HA 3KQOA 1R0KA 1QHYA 5AJZA 4URUR 5E3IA 4O4IF 5G1OA 2ZIXA 4O5OA 4B81A 4QQKA 3IL2A 1PK8A 1E2KA 2RG1A 4KQCA 2VHYA 4LE1A 3HJUA 1VLVA 3SOPA 4F2HA 3TSOA 5KWSA 3AF5A 4OFZA 2N42A 1U63A 4JP2A 1H93A 4EYSA 4C7BA 3TOCA 4R8KA 4RELA 4X85A 4I6GA 5BV8A 2NV2B 4AY5A 3S7ZA 1E4OA 3LFTA 4HFRA 4RTRA 2C8LA 1JV2B 1L5FA 2GAOA 1N7GA 1EWVA 1XDGA 4IIJB 2Q5QA 3UBMA 2I6FA 4Q4AA 1H4QA 2W37A 3HCNA 4U8HA 1XLTC 2Y2UA 2V65A 2I5PO 5F7ZA 2PY6A 1B42A 3VVLA 1OLXA 2ONKA 5KKAA 1MXFA 2PX0A 1DXQA 1EX7A 3KC2A 5LDDC 1YR2A 5AW7A 4LY9A 3ZC3A 4YJ3A 4HDKB 2F1KA 2XWJI 4YROA 2NW6A 2IEGA 3C70A 4HV4A 1E2LA 5AVJA 1O6BA 1VHWA 4I08A 3FPBA 2YHAA 4PAOA 4L75A 3Q9UA 1L9KA 1RWMA 4OHBA 4DCCA 5AVWA 4FFBB 3BK2A 5HP4A 1U5BB 2A5FA 1QLWA 1OUMA 4D9CA 3N8IA 2PX2A 3NHFA 1H05A 5HDBB 4DZZA 1SWWA 3MCTA 1ADJA 3BIJA 4M99A 3AM4A 2OFWA 1JEQB 2RCNA 3TNFA 3IR7A 4J7AA 4Q03A 3GEEA 2GD6A 2OORA 1KO5A 1LVUA 1C2YA 4CLXA 2Z95A 4AZ0B 4KWTA 1P5RA 2PSJA 2W6QA 2AYYA 3ECSA 13PKA 4CDMA 1GQFA 3HN2A 1FXSA 1WXWA 2IYTA 1GU7A 1G0OA 2UZ1B 3NZEA 4PZUA 1LSUA 4RPIA 1WDWB 4XCQA 2PLFA 1OX4A 2JK1A 3N59A 3O8BA 1V4NA 4NYMQ 4UXJA 5CPFA 1MJ5A 2RKWA 1Z29A 3OJCA 1U3UA 1XL0A 1CEYA 1TMGE 4HYYA 1TYAE 4G86A 6GPBA 2CLLB 1P9RA 2YDXA 3AQ4A 3QVGA 4S1PA 1JAYA 1MENA 1E6MA 4C22A 5JPIA 1W4LA 4DR1B 5JPCA 2ORIA 1T5DX 4KQGA 5MN4A 1ZJ6A 1KVUA 2I67A 3MWDB 4OHUA 3GAMA 3PTLA 3KKLA 4Q4HA 4DNPA 4XSHA 3MQFA 8MHTA 1GAXA 3FVWA 4NLLA 1TEVA 3FCAA 2PYIA 3T9DA 2Q6KA 3FE2A 1Z12A 4ZYTA 1QZUA 1WLSA 3GDHA 4JZKA 4UVEA 1QIMA 4FYWA 5JZ9A 2VWQA 4GZ3A 2WPNA 3Q0IA 2HEIA 4QJBA 3H5TA 2G67A 1EHCA 1CJCA 4BGIA 2Q4OA 2WJAA 1MO5A 3PS9A 3T7CA 4R83A 2HQOA 1M6WA 2XV1A 2YJ3A 5IDQA 1AKMA 1LFDB 3UM9A 1U2EA 4PS0A 3P0EA 1LZLA 3NW9A 4QT4A 2FK8A 1MEOA 4YCJA 4DBZA 5EIBC 5EE1A 3BORA 4ZVQA 5KO2A 1Z45A 2PPLA 1J49A 3O2SB 3PQCA 1FU7A 5HFNA 1JT2A 4A4DA 3ED5A 2O8CB 1WB6A 1NN0A 1V37A 4OQFA 1KEVA 2OQ2A 1FP4A 1DX4A 2QPOA 1PE0A 4A6DA 3V4OA 4ITVA 2QN3A 2FPWA 3E70C 5AJTA 3MMSA 5EPOA 4CUKA 3SVTA 2JIDA 3TTUA 5JVDB 2NOAA 1X42A 1CWUA 3CW9A 3QM1A 5GIOE 2PMKA 1QOPB 3NTVA 4QVIA 2ZWIA 3U3MA 2PUEA 1L5NA 4UPEA 5H02A 4DG8A 3ZGZA 3HKBA 1B41A 3JQ7B 3H0EA 1OZGA 2ZUBA 2M32A 4PR3A 2B82A 5ILQA 2P6NA 3UG7A 2IYYA 4F06A 4CIBA 3KJGA 2VZEA 1DIBA 1NRWA 2XW6A 4P38A 4ARZA 3EUEA 3OX3A 5LBUA 2PD6A 4AJJA 5AW0A 1TM3E 4P5PA 1G64A 2WUDA 2VTEA 4TOIA 3ZZUA 4D0RA 3CVWA 4AYXA 1DTWA 2J7KA 2ZVQX 4H15A 2PGXA 3U19A 2IWHA 4DEXA 5B1YA 2FPUA 2H18A 2W2MA 3KR9A 3JV7A 4UTPA 4YRRA 3D3QA 3M89A 5AXDA 4YMUA 2ZVDA 2VWPA 1NXSA 3VZPA 1D1PA 2B94A 4GSYA 4IL5A 3IAM6 5LXTA 2W6JD 1XZGA 5IAJA 3W5JA 3LCJA 3KV1A 2ZSIA 3A32A 1PX0A 1YJCA 4XUEA 3ZWNA 4DDTA 1X9IA 1TAQA 4QAQA 4JLNA 4NV1A 5DTIA 4L3WA 3VC2A 1U11A 1G2QA 4B3MB 1SVLA 1LB1B 4N5HX 1U99A 2G8NA 1LI5A 4R5MA 3BGVA 3PNPA 1WABA 3F97A 2X2EA 2HXYA 1UKEA 2FPOA 1VJCA 4EG8A 1GA6A 2EKPA 1GZDA 3D8UA 1UPXA 2YWXA 3O6VA 4UZEA 3MHTA 4KI0A 4JB3A 5BXYA 4GGOA 3CLUC 4MJ3A 5JARA 4LJ4A 5DVZA 1ZWLA 1DFIA 2MMCA 3GVIA 2CMHA 4Y9DA 4AXXA 2H1HA 1D0SA 2PGAA 3AMVA 3AR4A 2DUJA 2IZ6A 2D00A 1QG4A 4C0XA 2CBGA 2RD2A 3U60B 2FZVA 2ZAOA 1N34B 3GUHA 4B3IA 4PG7A 3OT1B 4D6YA 5L53A 4PY2A 1T43A 3B6MA 4U3JA 4YAJA 4B83A 2QG9A 4F3NA 2QNIA 3EQ2A 3W6PA 4L5CA 2WTEA 1DIHA 1U3CA 5AIAA 2A9VA 3C5CA 5KCZA 3RF6A 1J1UA 4AJ1A 3GCXA 4EHDA 4HLUA 2LPMA 3IALA 2BFFB 5F77A 4JSYA 1DG9A 3CT4A 4YA6A 3D7KA 4Q4CA 1VDMA 4Y6LA 3ULKA 4L76A 3H7IA 2I4RA 4LJKA 4E94A 1T8PA 3VBEA 1XRJA 1Z35A 2LIPA 4F85A 4CRWB 1XZCA 1H2AS 1DXHA 1KF0A 1RBMA 2CFCA 1OTHA 2HA7A 4MQ6A 4ZREA 4UQLA 1ZK0A 2PWBA 4L7VA 4EARA 3UMMA 2CLHB 3UKOA 3EXEB 1IZ8A 1E63A 3H87A 3RVQA 1KVSA 3GYGA 2OK7A 3PUXA 3RU2A 3SYNA 4BNZA 1P2VA 2OV2A 5AKZA 2PS0A 3DZGA 2ORWA 3MTGA 1RP7A 2D5AA 4W9MC 5JWRA 2W2OA 4D8VA 1IMOA 2OXFA 4BLPA 4DC0A 1TU4A 2SBTA 4LXTA 3JAWB 4M54A 4NBUA 3W79A 4XVCA 3P0FA 2P4HX 5CT9A 4WAUA 2AEEA 2R2AA 4BLUA 5IAKA 1HFJA 4YP9A 5CDGA 4OK3A 2RGGA 2GNPA 5DEIA 3FOFC 3DFFA 3PDIB 4MP6A 2GQ0A 1PT6A 3G7NA 4UBNA 1E9FA 4G0UA 3IVGA 4DQKA 2FF7A 3HTXA 2XEXA 1UBGA 4LSMA 1MOQA 5A7GA 4UDOA 3ETGA 3ZE9A 2V7VA 3MB5A 2NU7B 3RJZA 5JNVA 3CZPA 4MA4A 5DZSA 3TCNA 3MJDA 2VO1A 5JADA 3GP3A 1F0NA 1P5ZB 2G9ZA 3LG2A 4HNRA 6YASA 3VU9A 2RSLA 1W4AA 2GPWA 3FGPA 1FYXA 4GPTA 4QQNA 2COKA 1VJ0A 1AKYA 5F64A 3WP0A 4KIFA 5AUOB 1IG3A 5JZOA 4FPXA 1TIPA 4YJHA