1EM8A

Crystal structure of chi and psi subunit heterodimer from dna pol iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
b'MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III CHI SUBUNIT
publication title Crystal structure of the chi:psi sub-assembly of the Escherichia coli DNA polymerase clamp-loader complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 46
structure length 147
sequence length 147
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04364 DNA_pol3_chi DNA polymerase III chi subunit, HolC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold DNA polymerase III subunit chi 1em8A00
1EM8A 3SXUA
chains in the Genus database with same CATH superfamily
3OLVA 3E1KA 3VDNB 3WQQA 5IAEA 2IP2A 4OX9Y 3N8NA 1ZMTA 1UXIA 2XUKA 4GKAA 4RF4A 1RZ3A 2FTKE 3FOFC 1JAHA 1JH8A 2G07A 2ST1A 3MQ2A 1UFQA 2REQA 1M2VA 1ZSNA 3FUWA 5FBVB 1IBCA 3RT9A 1IOVA 4WOCA 1E7QA 3W2FA 3SR3A 1N6PA 3Q12A 5IBCA 3UMFA 5FP0A 5B7NA 3PNSA 2X3FA 2BCGY 4Z3DA 2FZLA 5C1PA 1AT1A 1NXVA 2DKNA 4C3OB 1F8XA 2CXOA 4UFNA 4JLWA 4TQAA 2Z09A 3DUWA 1GKIA 3PXEA 4YP7A 4C21A 1XV5A 4N65A 2F3TA 1P74A 3UATA 2W43A 2VK2A 4FR0A 1HKUA 3LA8A 4G9BA 1I9CA 3T9EA 2PMBA 5AVKA 5BPHA 4YB8A 1S2DA 1R0KA 4KFCA 4OHPA 1G2QA 4CLXA 1WE2A 4PG8A 5BUCA 2RGXA 2PM8A 1W87A 4FE7A 3E05A 4G8DA 3PI7A 3EAQA 4D9NA 2CLFB 2ENWA 2IYNA 2AG8A 3LX8A 2Z04A 2PX5A 3G88A 4HDAA 3JATB 2OC9A 1QCZA 2VPYA 4JELA 1MC1A 4A2QA 3O75A 4K5QA 1EM8B 2N47A 2Y0EA 3LVFO 5AVXA 1U6JA 1O3YA 2Q1TA 5FJIA 3WFIA 5K0CA 4RTSA 1K8XB 4QYIA 2A86A 5FA8A 1QGED 1O5TA 1Y7PA 1G3QA 4ZAYA 4KWCA 3RIHA 2N9UA 2FPLA 2AI3A 2EOAA 3AEQB 3KOMA 9ATCA 5I7VA 2BI4A 4EA7A 1QIMA 1Y7IA 3D3QA 4UNPA 2XDQA 2IDMA 1SQ6A 3DZGA 3H2JA 1DMRA 2GRJA 5BSRA 1WPXA 3H7AA 5DBEX 4W8HA 1F2UA 4YRFA 1F1JA 4EKEA 2RGRA 4CEHB 5TEWA 2OB1A 2VWQA 3MAAC 4Q1EA 5FCDA 4G1CA 3V80A 4DLNA 4ZVPA 2HA2A 5HDQA 3D81A 1BJTA 4B8YA 5CLFA 3ACDA 4W6ZA 1WMBA 4NX2A 2XMQA 3H0EA 2G3YA 5M2QA 2YW2A 2NUAB 1BXZA 1AQIA 5DCWA 2Q41A 3TCKA 1EEHA 4ZRDA 3BL8A 4UMEA 1R3UA 1VKRA 2FUCA 1F6DA 2GN8A 2JJ2A 2NAFA 2BM8A 4HLUC 1SG6A 3OOHA 4MLDA 3INRA 4K6MA 4CDMA 1VBKA 1M6VB 3T9DA 4ODIA 3BH0A 3SD7A 4D96A 3EAFA 4M86A 4S05A 4AJ2A 4C2BA 1FYVA 3ZDXB 2QUAA 2A88A 1E7YA 4RL4A 1SJ9A 2G70A 3EGCA 4G85A 4ZVVA 3BREA 3FVTA 4ASUD 4B8ZA 3EIFA 1Z15A 3AGQA 4BO0A 5A4FS 3GD5A 4BGEA 3LAWA 2ECQA 1C3LA 2SKDA 5D00A 4TYNA 1T3SA 2RHWA 4QYTA 1P2UA 1QGZA 4X62B 1Y89A 3JQAA 4GG1A 2IP4A 1UBJS 5EAIA 1A1VA 3EHEA 2QMHA 1QIDA 1A9RA 2LUOA 4MROA 2Q1SA 2OXFA 3AF0A 4O02B 2REQB 1M2VB 1W5SA 3H9GA 2Y3IA 2CC2A 1DTWA 2FE1A 2NZ8A 4FUQA 1X13A 3Q0EA 4DIFA 4GRAA 3BAFA 3ZBTA 5FOWA 3PVZA 1Z0AA 4ZDIA 5J4YA 5JYEA 3FM9A 4XIYA 4KZKA 3ZD6A 2BFBA 1I6WA 1QHNA 3L4BA 2BKUA 3CLSD 2ZK7A 3B6MA 3F6CA 1P4RA 4YAEA 3K6KA 4HGPA 1OASA 1NAIA 3C39A 1VFPA 3MERA 4AROA 4BMSA 1KYXA 4GLBA 3AEUA 1ECFA 2O2JA 3SJ7A 1RWPA 3N6XA 2BGRA 1DAPA 2BRUA 3H7IA 3VDMA 1GUDA 3VOSA 3V1YA 5HM6A 4EJ6A 1RJGA 2C3UA 1VIMA 2XDYA 3EVEA 3O95A 5K0NA 4GP6A 1J0AA 2IUSA 1SQ0A 1A2BA 4RSHA 3VOBA 4RM3A 4E0BA 5EGSA 5I7WA 3ZS9A 5JW6A 1U9ZA 4G8JA 1XVAA 3NAQA 5ARCA 3C3YA 1QFSA 1F0YA 1JXMA 4FUTA 3RJ5A 1QONA 3C41J 1CB0A 3IPYA 3N2EA 3EVFA 1MPTA 2NU9A 2PZBA 5AHXA 1NU6A 5IMBA 4QYIB 4A8TA 3G59A 2E6KA 2ISSD 2CMHA 2IXEA 3SVTA 4WLVA 4A1FA 2CHGA 2GZMA 2JVIA 3UEOA 4JL8A 4MIEA 2E5LB 2P7IA 4EJFA 1O4WA 1D2EA 3B3QA 4L6CA 4OQYA 4AMZA 1ZLXA 1ODTC 2OCBA 1L7BA 2XDQB 4OIMA 3QRWA 1JKJA 4BS9A 1ZM7A 5E2AA 1D8TA 1F2UB 2WSIA 1Q6YA 2UUOA 4DYDA 3M4NA 1IXZA 2HU5A 3QLTA 3U1TA 5AUOB 2JGAA 1Q7EA 3QU7A 1MXHA 1IZ9A 2W2LA 1H2WA 1W76A 4JMLA 5IW8A 1X7GA 3BB4A 1YI1A 2XCUA 1DTEA 1LSJA 1Z26A 4HAUA 4RVDA 1NXSA 4RZ3A 4ZQEA 3CGGA 3WKCA 1NE7A 1RU3A 4NCAA 4Q18A 2ODTX 4DEYA 5KTTA 4EL5A 1JAYA 1NJSA 2RHDA 1KDZA 2VQSA 4QBIA 5JNUA 3HVRA 3AFNA 4UEOA 1E4VA 3EG5A 3NDBB 3NIBA 1JV2B 1OA0A 1MVOA 2HWYA 2JARA 2VQ6A 4RPGA 5DT2A 3RRJA 1SRQA 4UVHA 1JEOA 5JZVA 3EPJA 1GM5A 4UHKA 2GAAA 2O1XA 2P5UA 3IBGA 9ABPA 2YVLA 4KGDA 2UVPA 4CMEC 3KZ1E 2ZB4A 4MV0A 1ULZA 1EFKA 4R4JA 3RW9A 1EI9A 4TSFD 1W5AA 4FFBA 4DC1A 2FLKA 3MMNA 4J0DA 4M6WA 5ALKA 4ZZ2A 1R2QA 4M9ZA 3WLKX 2D3WA 3RUEA 4XX0A 1KDPA 3BMNA 1G5HA 2VSYA 4BZXA 1R4NA 3N6VA 3UF0A 3JQAB 1VB3A 1ZN8A 2ZRGA 4R5MA 3FPAA 1P9NA 4LJ6A 4XVUA 2BF7A 4FKMA 2QPAA 1BE0A 4I6EA 4AXBA 4QKQA 1DTWB 1M2GA 1LK7A 1VJ1A 3C70A 5CNMA 1EVEA 2FEAA 4JB2A 5BSHA 3DAFA 1IWBB 3IDFA 1KQFA 3MA0A 2Z8ZA 2G28A 3IALA 4Y6QA 2BFBB 3VGPA 3UWSA 7GPBA 3PFIA 4KITB 2R5NA 3IPRA 1T3ZA 4JP8A 4JITA 4K26A 3PNQA 4I99A 3EUFA 5AOCA 1OB5A 1IB6A 1LLUA 3HJTA 5DDIP 5E1MA 5TPWA 2P75A 1X7WA 2GDZA 3AEUB 2CV0A 4ADSG 1KY4A 1DKRA 1YRAA 3JTEA 5FBLB 3HZRA 1CQZA 2HK7A 1GSAA 4QGHA 3KQKA 3HWRA 2B20A 2QSZA 4B6EA 4HLNA 3SC6A 3WLIA 3FMIA 3ZCXA 1U0HC 3U16A 3IDSA 2V74B 3GZ4A 4EARA 5IM4A 2RIPA 3B89A 1P45A 4A36A 3LY7A 1FNNA 1V5WA 4JOCA 4JZKA 2DSNA 4JYBA 2BEKA 2NU9B 2B25A 2QOEA 4FGLA 3NYIA 4L75A 1XQWA 1LY1A 1JIQA 1PWEA 5JH7A 2Z3ZA 1P7VA 3OT4A 4G0XA 1L1FA 2D2EA 2IBMA 4IPTA 1XD2A 1YNSA 4C2UA 1QE5A 2ZB8A 4MW4A 5E9WA 1SCBA 1F8GA 4Q3EA 1JKJB 3WRYC 5BUZA 3A9CA 2DQSA 2I3ZA 3ORQA 3OQBA 4I4TF 1NBMD 1I6MA 5EI5A 3RANA 8LDHA 1GXSB 2UZ1A 2FKNA 2EJBA 3TLZA 2IE0A 1WY7A 2C5BA 2RIRA 1HDCA 4V24A 2ZJ1A 4KC0A 3ABSB 1JAIA 1NMZA 1XRLA 3IA7A 3MGGA 4RY2A 4XA8A 4GWGA 2PT7A 4E33A 4YRMA 3UKDA 2YJ4A 1UINA 3CONA 5AP9A 5H83A 3PXGA 1RI1A 1BVUA 3LWDA 3U26A 4M8IA 3LQKA 1AX9A 1N3BA 4CT5A 3NVKI 5EGNA 3K0BA 1G16A 4ZAGA 2GWRA 4LIPD 1Z6YA 4D45A 4HB0A 4JQYA 1W94A 4HQKA 1C5KA 4WCFC 4W7IA 3S6JA 2FPUA 4Y6RA 2R1TA 4LHVA 2ONKA 3PD0A 4LRXA 1UK8A 3FGZA 1T0JB 4II7A 4ZAFA 3URKA 2UVPB 2BDTA 3JX9A 4BQFA 3AXSA 2B5VA 1KXJA 5B1IA 4LECA 3TXYA 1WU7A 4FFBB 4CIYA 4NATA 3BICA 4EK9A 1NQWA 1P7CA 2F3UA 3K05A 3VZRA 3WISA 1XZBA 3SVLA 3D3KA 2KI5A 4QJ5A 2A57A 3BMNB 1BDMA 4XX0B 3KB1A 3E22A 1V0JA 1Z2EA 1R4NB 1IEQA 1QX4A 2XXBA 1DZ3A 3EDYA 4PIPA 1SM4A 1Z2OX 2VPXA 4KLRA 1U98A 2C5SA 2J5KA 3CHYA 1NIJA 3F9RA 4RHCA 3MMXA 4YAFA 5JMWA 1RAEA 4L57A 5DN9A 4MA4A 4ACBA 2CYBA 4IZOA 4ZOAA 5LP6C 3WGUA 4P4GA 1FUYB 3ITNA 3MWEA 1NY5A 2PA3A 3GCZA 3TFOA 4EX7A 2EHJA 3R3YA 1QAOA 3WWOA 1IC6A 2XUJA 1CJTC 3PGXA 5FUWA 1CUFA 1LWOA 2I1LA 3QBDA 4MUYA 2OPHA 5TPWB 1X7WB 3UBMA 2TS1A 2OV1A 3ZHTA 2HTFA 3ZWYA 3DOCA 4PS1A 1JB1A 1AU9A 4YRCA 1ZJ5A 2OLKA 4TLEA 1Y7HA 2X5JO 4ZPJA 1JPVA 5K2MA 1GWNA 1RXEA 3NTOA 1TUEA 5CT9A 3PHIA 3IP1A 3I8OA 2G9UA 4IJMA 5KNBD 1RZRA 1DQSA 1I10A 2A9JA 2YCBA 2PWAA 2OXRA 3OF3A 4YT8A 4RJKA 1ONSA 2P1ZA 3DV0A 2PBZA 2OGSA 3P19A 5IN5A 2ZI4A 4EMTA 3U19A 3I5XA 4JC5A 2C8KA 5HZHA 4HADA 4BNXA 3WGHA 3ZWMA 3DVLA 1K6IA 5BSWA 5JH7B 2RBGA 3R23A 2VWPA 5KYVA 4NSNA 4NBRA 3D6MA 4HXEB 1XD2B 1Y37A 1K6JA 3TI7A 2XB2A 4XD7A 3DE0X 4QGBA 4PFQA 3QE2A 4XWTA 5CLHA 5NULA 1E2PA 1YQGA 1QANA 2OGUA 3D7MA 4C89A 1AMNA 1H3FA 3EF3A 4KRXA 3DE5X 2J9FA 2UZ1B 2GT1A 1Y5NA 1SVIA 3IQDB 1UQUA 4DV0B 4L74A 2LW7A 3MEQA 3PXCX 1QQBA 3AHEA 4L78A 1P4GA 4LRTB 4QECA 4TX1A 2BFOA 3STTA 4U2FA 3FOEC 1T2VA 4MWOA 4AMUA 4N9WA 1MW8X 3RV4A 2AWOA 2Q50A 2WG1A 4FC6A 3LT0A 1HL3A 1E20A 3GXBA 3ESQA 4RVCA 1XWWA 4N3CA 4BYGA 4ZARA 5JLJA 1E9SA 1ZR4A 2JJ1D 1SKBA 4L8LA 3VR4D 2V65A 4L22A 3IMGA 2PT5A 3TM4A 4HFNA 3V3KA 3U56A 2R1TB 1NW8A 3VPSA 5FTNA 3EWIA 4TYPA 2PS0A 5BYKA 5K8VA 5KJ6A 1EGQA 2QZ4A 5KTMA 5TPZA 4KGZA 1DAIA 2ZSBA 3LO8A 4XIGS 3OHSX 1DZIA 3W90A 2EQBA 4DDKA 1CYEA 3P4UA 3USCS 2NGRA 5CEEA 2P90A 2XECA 5G1NA 3HB0A 1T5BA 1VHTA 1W35A 4U2EA 4H3SA 1PZGA 3E22B 3OIVA 1I2CA 1E64A 2R7AA 2VFAA 3GLSA 4FJ0A 5B53A 2DPLA 3BXPA 2VDQB 5TXGA 4X61A 3KYIB 4D4HA 4JCCA 1E1RD 4MRPA 1USIA 2VSFA 3D5QA 3JVVA 1OYOA 1WG8A 2TYSB 2C7QA 3FBGA 3AM1A 1CBUA 1VYTA 3M2TA 3MWEB 1M6NA 4NBTA 4TL9A 4KGVA 2Q5HA 5JNVA 1THGA 2JAWA 4QFMA 1JLKA 3I2YX 2QXTA 4M53A 3EDRA 5EC8A 1RQ2A 3GLFE 2GFIA 1PN3A 2HLPA 3LUPA 1XXHE 4J49A 4D80A 3U7HB 2DBZA 3PGMA 4HNRA 4JB0A 4EG7A 3EMKA 3PJFA 1P1KA 1TEXA 5JAZA 5JDCA 1UPXA 5CB0A 4CIVA 1CNFA 4ZHQF 2CXPA 2DCMA 2EAUA 4BWFB 5IPFA 3ZG6A 3IQXA 1GILA 1QYVA 3G5UA 1M34E 4KB5A 5AJUA 3RSSA 5DYTA 4A92A 3RT1A 1SUAA 2RHCA 1Y63A 2FZKA 2JCBA 3F2VA 4LVUA 4M99A 4R01A 3VKUA 2IXTA 4B80A 2Z8XA 4HNQA 4AUMA 5KMGA 4Y1RA 2BYTA 5CG1A 4JXZA 1BH2A 3QVSA 1U1EA 1KNXA 1NYRA 1E2KA 1PDWA 1WXIA 2IUYA 1TMKA 2IZ0A 5IX8A 3DV0B 4C0LA 1Z7BA 3I3SR 3AONB 3R3JA 3T35A 2ZROA 5FTLA 2D13A 3HGQA 2DSTA 3REQA 3J81k 2BFNA 3IV7A 1HQCA 1SURA 2F9LA 3KKQA 2P69A 5FOVA 1M9NA 2JIQA 1W5TA 1YJXA 3E84A 3QW2A 1RFGE 3DDNA 4WPGA 5CYFA 1E9RA 1B6TA 3RIGA 2IYZA 2XVAA 1FTGA 1U9IA 2CXQA 1ULTA 2IF2A 2YVAA 4KP7A 4URHA 5GGXA 2IRWA 2Q6LA 3PXBA 2J9FB 3OP4A 2FF7A 2I3DA 4M1WA 3JZDA 4PBSA 2OQVA 1XI2A 1X9GA 3ZYCA 4RDXA 1T29A 5AHWA 3NRJA 4OJNA 1N25A 4MR9A 2QYSA 1TU0A 4JWTA 2FWRA 4HL6A 4CZ2A 1D6NA 1XMIA 2BF4A 3KYBA 1N6OA 2C03A 3CT4A 4P4LA 1MOZA 1I1OA 4P0PB 4QUBA 2YYSA 2WMNB 4IH9A 5DT9A 1DEAA 5IZCA 4HB2A 1Q3HA 1MUUA 4IFTA 2Q7DA 2F7SA 2PU5A 3EF0A 4JA0A 2VUSA 3F4LA 1GY8A 2VPTA 2QN3A 3FB4A 4B79A 3IO3A 2WVJA 4KIUA 2IIPA 4IDGA 4CLRA 1B93A 2ZYTX 3H42B 3JQ8A 4J0FA 2W2XA 4JBGA 2P6UA 3B82A 1UZAA 1Y9AA 2I6UA 2ZIEA 3L1VA 4QUGA 4X60A 1T1SA 2PXCA 1S2GA 1Z0SA 3WJ7A 3IBCA 4P32A 3DP7A 4YROA 1ZD9A 5TIIA 5TMBA 5C1BA 3CV3A 5LWQA 2WFZA 3HVJA 3I4CA 1XMVA 1NPTO 4V2IA 1ZNZA 2YHIA 4C5AA 5LNK1 1LQUA 3R2JA 4CKCA 1C8VB 5HZKA 3N2LA 1A27A 4PZ9A 5F2OA 4F3YA 3UUWA 2OO3A 4XR9A 3IGFA 4X6UA 2Y67A 1M2JA 3CBGA 4H31A 2ZRDA 1L9XA 4LN1A 2XMPA 3GDGA 3ZVKA 2BKEA 3ZY5A 3LCJA 2ZJFA 3EIOA 3FMFA 5FTJA 4D79A 3N7TA 5F2EA 4L8VA 1C9MA 4CT0A 4DMMA 2PMDA 5EJ4A 4E2WA 1UUFA 4LGVA 3G89A 2Z0MA 4DHWA 4R83A 2B1JA 5FO0A 3EW9A 2WTBA 3BAZA 4AO8A 5THXA 1SRRA 5I7AA 2YC2C 1PGOA 5FXMA 3W6NA 4D8YA 5CT6A 4WXPA 3S2GA 1PR5A 4YUWA 5KINB 4O6VA 1Z39A 3WBFA 4LJ5A 1KYVA 1GQQA 1NF9A 3KYCA 4B46A 4PE5B 1QIKA 3BTVA 3EIXA 3M6FA 3Q3GE 4TZKA 5KMGB 4Y1RB 1HX7A 1KGSA 4OPMA 4RA9A 1CRPA 3ZBQA 1TAUA 3BHJA 2W4MA 2XZLA 3DPSA 2C42A 3HSSA 3MBIA 1K3UB 4AMVA 1ETHA 2IYAA 4NYMR 5DCUA 1PL7A 1P81A 3K35A 1P44A 1U2RA 4PBTA 1XLVA 3REQB 4EY7A 3VO2A 3AESA 1BW9A 1LI7A 5F51A 1ABFA 2OORA 2FSHA 1BRTA 4KJZA 3RKUA 1L4FA 4CWAA 3NEJA 2AQIA 2PIAA 1TJ5A 3GY0A 1M6HA 3O2NA 3SBOA 5E6UA 3L1HA 3DNMA 3L6DA 1WQ4A 3W6OA 3OCUA 1GD1O 2FZCA 5AM5A 4RAQA 3G7SA 1T91A 3TMYA 3TECE 1F60A 1OBOA 3JZMA 1RYDA 3AHDA 3KAKA 2ZRMA 1KY3A 3KJNA 3QHPA 5AHRA 4F8EA 1QU2A 2NSYA 2QUJA 4L4RA 4MR9B 1CX9B 2PMFA 3LBAA 1W9MA 2AXQA 3B1JA 1D4OA 1ZOOA 2B8JA 3A1CA 3EG9A 1FRZA 1GP2A 4LDPA 4YAJA 5EMLA 3TGPA 5ESXA 3JPWA 7AT1A 4MI3A 1PGPA 1UMBA 4D56A 4F3RA 1Q7TA 4ZI3A 2V5UA 4B45A 2FF5A 1CUBA 1T43A 1N6RA 3HCNA 1UM8A 4JJKA 3VDQA 5BT8A 5DLPA 4TV8F 4TS1A 1W46A 1EFVA 4CLRB 3K0SA 1XZGA 1X8LA 1XVVA 1GARA 3JQ8B 3CVOA 4PSUA 4YMGA 5JSUA 1IH8A 3WGNA 2VNJA 3QYFA 3RH0A 4L4XA 2YRWA 3ESAA 2CLOB 4GEKA 3ZZNA 4EDHA 3LY9A 4QJIA 4ZVSA 4P08A 4HN9A 4UATA 4DPLA 1NPDA 3O0DA 1JFLA 2IKQA 4JSYA 4I3GA 1B8VA 3WIEA 2YHIB 1JEJA 1DUSA 2ZVPX 4B6PA 4E5KA 1GCIA 2F90A 1XU4A 4MW1A 5ALTA 2EKPA 1GSOA 3CEHA 4D4LA 2Z2XA 5I7HA 3ABQB 5AVTA 1IN5A 1H8ED 5FI0B 3HR8A 1KDTA 5F2KA 1RPJA 2RKBA 4EUHA 2YXEA 3QKSA 3RBAA 4RGQA 3EYWA 2I4TA 4GP9A 4E4YA 3D0KA 1VLHA 1X7DA 1SC9A 2HHAA 3TCNA 3NIFB 3L5OA 1K8RA 1F7UA 2ZI3A 2IS2A 5LCXA 4HRAA 3RHZA 3RJTA 2HHLA 3VI4B 4GKJB 2GAJA 2H5IA 2YWEA 3GGOA 7ABPA 1A98A 2W71A 3IUYA 4IBOA 4C76A 1SCJA 3WQBA 2NYAA 4II3A 2QVCA 4ENWA 4J7CA 1QKKA 2Z2IA 3I73A 3M8KA 3S0JA 4CHGA 4E5MA 1M8GA 3TZEA 2R0QC 1NQVA 3KYCB 4A8PA 4MINA 5DCYA 5FUYA 2IVZA 5K05A 3KQYA 2MT9A 3IAUA 1VE7A 5HTOA 3QM1A 2NXWA 4MMZB 4RA9B 5EHXA 2OKGA 4L6IA 2W2KA 3IOBA 4OI4A 3X1MA 3DCJA 1D5CA 1S5PA 2AMFA 2B3DA 3QELA 2COUA 4LHYA 5IC5A 2FR8A 1HEYA 1KZHA 3UFXA 1EVKA 1H9BA 4D8TA 2QUKA 1I7NA 2YJ6A 4TRMA 2HN9A 1CW2B 3NHJA 1NBMA 4LQLA 2ZUTA 5CFMA 4M2LA 5HSGA 1T8UA 1VI5A 3FF4A 4ON9A 2A84A 5BORA 3AESB 1BW9B 1T2EA 4WY2A 4FR5A 1EUDA 3V9AA 4GZ5A 3B9RA 3FDJA 1OCEA 2D54A 1HT3A 4JIGA 4I8XA 3C7TA 3ILSA 2V6BA 4ARAA 3TNDA 3CC8A 2X5KO 2WHXA 3OAAD 4TYMA 1YR9A 1FYEA 1R9MA 3C16C 2EYUA 1JLLA 1CJVC 4FN5A 3QU2A 5KJEA 1QH1A 3ANLA 1VMAA 2UYOA 1F06A 1Y4ZA 3CPJB 2OBFA 4KZPA 4P31A 4RIFA 4R2IA 3EG9B 2ZM6B 1Z3CA 1GZ5A 3G0DA 5T4BA 5JAIA 1PS9A 1P5HA 1C4WA 1UMBB 4BNVA 1JA9A 4J2OA 2PUAA 3IDOA 4OQ4A 4ZVNA 2IITA 2B21A 5HW0A 3Q3EA 1S8FA 3H2IA 1EFVB 2R79A 3KIPA 4PPYA 1N34B 2HCFA 3SKYA 2DPHA 2VBGA 2EEPA 2GCPA 1YZTA 2R5FA 1WZEA 1OXTA 3OO0A 3BZWA 1P61B 4Q7LA 4HDCA 4BP1A 5KX5A 1VHLA 1CUSA 2OILA 1JAXA 3IDAA 3NKVA 4ZO4A 4AP6A 4I4IA 5AI6A 4AY4A 3O8RA 2G1AA 2WAMA 4RGYA 1CJMA 1M1UA 1PJRA 1UPAA 2NT4A 2ZIXA 3FVVA 3HEMA 2YIDA 4O1HA 4X7BA 3AF2A 3OIGA 4PCVA 2NSDA 1SBNE 3DLPX 3ZV3A 1ZQ9A 5JQWA 2EX1A 3OFSA 1DIRA 4YA6A 2EFGA 1NN1A 2R8EA 3EW7A 1E62A 2J67A 4PC6A 4B9EA 4EGJA 1E99A 1C7FA 4HYQA 4NMXB 5LR6A 1FMFA 1E61A 1TRHA 4OHCA 3AUYA 3QKSB 2GH1A 1N5JA 1C3XA 4OBXA 2LE0A 3BIJA 1KEVA 4DNXA 2I87A 3KOWA 3RE1A 3OQJA 3UMVA 3ABIA 2Z8YA 5IM4F 4K88A 2Q07A 4KK4A 4OA8A 3S99A 4XKJA 4IYJA 3WR5A 1T8YA 1KL7A 1NSTA 4EGCB 5DNAA 4ZJUA 5KNBA 1OUMA 5JNLA 4L3WA 3LDUA 1FBNA 4QG3A 4E4RA 3W5CA 1Z5WA 5E7JA 1J09A 5CYOA 2DC1A 2J9ZB 2TECE 2J3MA 5JH7F 5EKXA 3I6MA 1XDDA 2EL7A 3EIUA 3RG8A 3QWIA 3L02A 5K4HA 2E5WA 2ZWPA 4R9NA 5HUQA 1SXIA 2WZBA 3ZGXA 4R71A 1G4AE 2W2KB 1X19A 4XXHA 5LQNA 1GTVA 4IOJA 5LSAA 3EGXA 3LP6A 3QELB 4JJ7A 3I64A 3UFXB 3ZEAA 1B0PA 4GX1A 2OXTA 1RQPA 2X23A 3ESRA 1KJIA 4EGFA 1J90A 1XCJA 4GVLA 4PR0A 3IKLA 4X85A 1Z9BA 1U2DA 4QVGA 1EUDB 4RDHA 3RFFA 5ERXA 3GYBA 4EI9A 3I45A 1UBFA 3U3KA 4XGNA 2O8FA 1PFWA 2C5LA 3EVGA 4MW9A 4BFWA 4Z0PA 1JI3A 2CDBA 3C85A 2H9YA 4MGKR 3BA6A 3DDZX 3OTGA 1FDWA 3AHIA 4LBZA 3A70A 3LKBA 4GPAA 5DGXA 4YT4A 3WDKA 2VJKA 4BGIA 4BUJA 1JLLB 4PG7A 1OH8A 1TA4A 3VR4A 4NHEA 4REOA 1QH1B 5FTWA 3L7BA 1DCMA 1EG7A 2HO5A 3FWNA 2G04A 5GIOE 4F1KA 5K3EA 2NLOA 3M83A 1C0KA 2GSWA 3BHNA 1WHTB 1M1YA 4L5IA 2A59A 1DAMA 2IF0A 5KVVA 4B83A 3QOWA 4AYWA 1TA0A 2HO4A 4A82A 4KQFA 3K70C 4OLFA 4XB6B 5HF9A 3TL3A 4M9CA 1NX6A 2NZ2A 4J3JA 3S3TA 4FLMA 5DZSA 4ZAXA 1K98A 2WNSA 1NN0A 4DG5A 4EGQA 5FUVA 3NRBA 2W2NA 3VR4H 4BEVA 1BHJA 5T8KC 2O2ZA 4I66A 2RAFA 4RTLA 1KO4A 3INGA 1BNCA 2E9SA 4FCVA 5HR5A 1KI6A 4LDNA 1E1RA 1J20A 5I6DA 2SCUA 4G4JA 1SH7A 1EDOA 3KG2A 4JEHA 5A4MS 3HRHA 3KWJA 2ZIXB 3KZCA 1G59A 4MYSA 2VK4A 5DX1A 5EMNA 4K6KA 5LQJA 2XWJI 1FXSA 2J9XB 1TCVA 3MFQA 3N2NA 5IRCD 3T1QA 1E0SA 2A5LA 10MHA 1BX0A 3MWDA 3QFCA 5T4HA 1UDCA 2WTAA 2VWGA 3DBOB 3EVCA 3F6YA 4HK4A 3K92A 3DDWA 3VRHA 2VLBA 1FFAA 4OGLA 3WHLA 2B98A 2RGGA 2BDUA 3ZOKA 4HLCA 5C8YF 2Z9BA 1DRUA 1M5UA 1O2DA 4KW7A 2NIPA 5FPTA 5JYDA 1K3FA 3KSBC 5ECWA 2D7JA 4OSPA 5FLEX 1D1QA 1PHPA 5A5EA 4COOA 3C3PA 4Q9LA 1SCKA 5AVZA 3OPYI 1VPVA 1UOEA 1NXOA 2V1UA 1QV9A 2ZR9A 3V8NA 1A2OA 3LHKA 8ATCA 2FJPA 3B1XA 3KSZO 1C9EA 1MAVA 1NVBA 3QLUC 1IBMB 4DSAA 5K09A 5JZ9A 4ZVKA 2X0KA 3INNA 1Q2UA 4OBWA 1VJRA 4QOIA 3V48A 3WE7A 3G13A 4DA9A 3VAAA 1JFTA 1XAIA 2PUDA 2P4EA 1U9JA 3ASUA 3AR9A 1E5LA 3EGXB 2ABWA 1CVIA 1YZYA 2J5QA 1CV2A 3GRCA 3NDJA 3KTDA 3WICA 1R15A 1SBIA 4ZQBA 5DXAA 2Q46A 2IVFA 1Y7LA 4Y2VA 3SM9A 3P71T 5FWNA 1J8YF 5KTSA 2VRNA 3NW9A 1T36A 4FS3A 3E9YA 2G17A 4QTZA 2OUKA 3EN0A 2O8FB 4ETMA 1C7ZA 4Q48A 2H1LA 1YS1X 3U4DA 2OWEA 4OOEA 4MPTA 5BWMA 3BWEA 3OEED 3QZUA 4OG2A 4YAOA 5HOEA 1ESCA 4GOKA 4LEIA 4RETA 3I1FA 3WGZA 2QMYA 1SR8A 1DJLA 5ETJA 4W8OA 5DGDA 1SVNA 4JVOA 3M6XA 4GLFA 4MQLA 1WSWA 3V1NA 1LGYA 1QM5A 3NTQA 3NI2A 2A7XA 4ZYZA 4HUQA 1KVRA 1X2BA 3RTGA 2JDID 2HDOA 3CZ4A 3C5CA 1E9AA 3M5DA 2XBLA 3V2UA 2G06A 1GEGA 2J3IA 4ZOLA 1YZFA 1QO0D 4RWZA 1VKJA 1WAMA 2PUVA 4FYXA 4J8PA 3WSVA 2FU5C 5AOAA 1RLMA 4MRNA 2JJYA 3AG5A 2G40A 4Y2QA 2HRQA 4RDIA 3PEYA 2ZUCA 2O5CA 2D5LA 1KI6B 3L46A 4WIAA 2MHCA 3AERA 1FUUA 2HF8A 2SCUB 3OESA 5SYNA 3DCNA 1QZZA 5C1OA 1QTQA 2G77B 3ZR4B 2WFMA 2Z6VA 4HYTA 4Q9NA 2GM9A 1IZ8A 3PUZA 3OCYA 3W5IA 2QSUA 2JKZA 3H1GA 4UHDA 1L5YA 1YRQA 3CNLA 1QFJA 2IZZA 4BHTA 2I4IA 1J2JA 3MWDB 1LBSA 3KT0A 4JGBA 4AD8A 2XGJA 3SSOA 1PEYA 4C0AC 3C87A 1E1KA 1HKHA 2C83A 2V7TA 4M1TA 2ZZNA 1V2GA 1RMYA 2VP0A 4FYKA 4QRIA 3SJCA 4LHXA 1J8DA 1TW2A 3VPCA 1Z4IA 4UD2A 4J3NA 5KDOA 4XFDA 1SQSA 3DOOA 1DMSA 1OJ7A 1P5FA 2C4WA 2YHUA 3BIFA 1EXNA 1RS0A 2IYXA 4NE7A 4XM0A 5FAKA 5MFZA 2O23A 1TTTA 3R40A 4UQOA 1U7TA 2O2DA 3BC1A 2XUZA 2Q3HA 5EWJA 3WADA 4L8YA 2WUEA 4HV4A 1QVZA 3WP0A 2B82A 2RG7A 4RZQA 3BRSA 1N2ZA 3VR5D 5JXHA 5L3QA 3ZGZA 2IXAA 5FR1A 3IVRA 1KYIA 2YNMD 1H0SA 1U4NA 3M6AA 1KDVA 1E0DA 3OLWA 4GSYA 3ROMA 3I3OA 1DV2A 3JYPA 1AHIA 1VECA 1SOVA 1GG5A 2CE7A 2G5GX 3EQ9A 4LDQA 3LHFA 5G3ZA 3ACCA 4Y0NA 3R3HA 1WQ1R 5JNRA 3N87A 1S9HA 1ZCJA 3B85A 1OXUA 2XQVA 1C81A 2QTVA 2ZIZA 3BIXA 5FL7D 4EI8A 1RPAA 3MF4A 1T36B 3TTVA 1MJGA 5FL3A 4H16A 3WK5A 3CF0A 1TVCA 2PL5A 4BQSA 1GZ6A 1Z73A 2PGDA 2PQ6A 3SZRA 1UBLS 1K5DA 3QU5A 3OE7D 4HMQA 5L7WA 1KEEA 4QARA 2XNDD 1XN1A 1UDBA 1ZN2A 2XB4A 1S1MA 2I7VA 2UYQA 3EXEA 5AHKA 4HRYA 5FNZA 5GJVC 3GRZA 2C96A 2XCTB 1GPKA 2JFNA 2RI1A 3WP1B 4G36A 4BO1A 4I08A 2I1WA 2IL1A 1L8OA 1XEWY 3E4CA 4IIJA 1GNRA 1Q12A 5ALSA 1JJAA 1LLCA 2PVSA 3LPCA 3WV4A 4HUQB 2QU8A 4ID3A 4AFNA 4F4DA 1XCMA 4KV9A 4Z9XA 1O97C 1P8AA 3IUBA 4PSDA 1BEEA 4MWBA 1U63A 1GUYA 3AOGA 2IX9A 2Q3FA 2VBFA 1Q1QA 2XMSA 1NKVA 3R3UA 1YQEA 3LO5A 1NDHA 3R5SA 4ZOLB 4A0HA 3UPTA 1MBZA 1N6HA 3CWQA 4K9QA 4QWWA 4R2KA 4B3FX 4EA9A 4ER5A 2MU1A 4KUGA 1PTJC 4K9LA 3NVMB 4GOLD 2DZDA 3UMRA 3KUKA 4KXXA 3STVA 1OZ0A 1EFPA 3AERB 4B7UA 1W36D 1IHXA 1HOXA 3LQFA 1YRWA 4V1CI 2YKGA 4J9VA 5K0LA 1FX1A 1HLGA 5CUQA 4M46A 3FE2A 4DC0A 3R5HA 4JJIA 3QYAA 1QBGA 3PCTA 5FWXA 3QJ5A 4KH1A 1W0CA 4ENQA 4E1BA 2X6RA 4C7MA 2AJTA 5K9ZA 1CY6A 4YDHB 4KQ1A 2OK7A 4FT4A 1PK9A 1YD7A 1F8FA 1GA1A 5CAEA 5C4GB 2CMGA 3MPUA 2J1LA 1K8YB 5BSEA 4DDWA 1GQOA 5KVSA 3ZKWA 1CEQA 1NTRA 2YZGA 4IGKA 1PJLA 5FPSA 3P0RA 4D9BA 4DEVA 4ZAZA 2ECPA 3FDIA 1PKXA 1TW3A 3ZX4A 4DIMA 4DXDA 1M74A 1I3OA 4K9PA 1ZLYA 2XOKD 3PR2B 5KJFA 1F9EA 3JQBA 4LC0A 1ABBA 4RS3A 4MV4A 2ATEA 2F4VB 4U9UA 2WF5A 3OU2A 4POAA 4P7GA 1USKA 5I9TA 4QO7A 5EWJB 1I7SB 1AGYA 4GDFA 4G0VA 5MGBA 1GPAA 1RI5A 1T5TA 2IPNA 5F7ZA 5L3QB 1PTKA 3EVZA 5JNSA 5DN6D 4PGHA 4NEHB 3LUGA 2X1HA 3CRZA 5DFAA 4PHGA 1HWYA 5T64A 2WV9A 1E2QA 3TZ6A 5CDFE 1E89A 2PU7A 3G2KA 1WBDA 2CF6A 3GRYA 4CQNA 4D8VA 2A9RA 3M33A 3H4VA 2NM0A 2I03A 4GGOA 1ZH4A 4MB6A 2QTVB 3L5KA 4ZRNA 1T2FA 3TRHA 2COEA 4JJEA 4DWVA 2PMCA 2LR0A 3KHUA 5JRZA 1YR2A 2XAAA 3HLYA 3WGYA 5DHTA 2VHTA 2IGBA 2NXJA 3LBIA 3USZA 1KEEB 3SI7A 2PZEA 3UJNA 4M8NE 4B17A 3B53X 1KAQA 3B1YA 3EXEB 1P72A 3LT5A 1FF9A 1Z18A 3ROEA 2BFFA 2ZJOA 1GKUB 2I7CA 4ATNA 3OU6A 2E4VA 3OUZA 4WADA 4IIJB 5EXTA 4NCIA 4NCBA 1PK8A 3L7LA 3ABRB 4BL5A 3W79A 2O7NA 3K8YA 4QDJA 2JBWA 4HD8A 2Y0BA 4ZDWA 5GONF 2D5IA 4C08A 1PE0A 2NVBA 1VE5A 3Q72A 2CHUA 6ADHA 3Q7RA 2MSLA 5KVQA 1E69A 1Z06A 5B6JA 1YE3A 3PTLA 2DR2A 2VHJA 1L7PA 1ARZA 2QM3A 2XTMA 4U7TB 2X4IA 4RKFA 3X1XA 1EFPB 4Q7JB 2XB6A 3LECA 1CZLA 1IM5A 1J97A 1E3DA 1WPGA 3A6HA 4KL8S 4MW5A 4RK6A 4A73A 4ESOA 2FK8A 2OCGA 1Y8CA 4Y6LA 1YQTA 4Q4JA 1GUAA 2FSPA 2QPLA 5FWXB 1UJ6A 4R1QA 1UKBA 1CZKA 1L4HA 2IUFA 3I9NA 4BNLA 5K8UA 1XYVA 1M0TA 1XG5A 1EFRD 1WP4A 1VPDA 1LQ2A 1YCHA 3CJQA 4J0EA 3WK7A 5A5GA 2MTBA 4P80A 5KCMA 4FX5A 1HC7A 2X2OA 2VZLA 2QRQA 4KFTA 3E9MA 3G1WA 2XQKA 1P75A 4JLOA 1Z4LA 4UJ5A 5CAEB 4EYSA 3P4XA 1KI7A 2HSJA 1JE0A 4OA5A 1SVWA 3WZMA 4D98A 3S68A 4Z99A 1GRNA 4TMYA 3ZKWB 5K6RA 2R48A 3DAGA 4MKFA 4XVRA 3W8EA 1GKKA 2H16A 2P1RA 4CGYA 1EINA 1IE3A 4MLPA 4RHUA 4TMKA 3U4QA 3CZQA 3SY8A 4ISCA 1NY6A 1T5HX 1DPFA 4HDKA 5FBHA 4DQKA 4OXNA 2JIZD 4FYVA 3T3GA 5TMPA 3THSA 4E51A 2G67A 3CN7A 1Z3IX 1DQPA 4FDLA 1KR2A 5KU7A 2QAJA 3I30X 5FPPA 5CXXA 4BO2A 3PC8A 1RPTA 1U9CA 2NSLA 4XEUA 4H6XA 3ZWPA 5HUJA 5BW4A 3V4OA 3FKJA 3IIKA 3C8MA 4CCAA 4XJTA 2GXAA 4E11A 1LPNA 2V4ZA 2AW3A 2NTEA 1ZBQA 1NFRA 3AB3A 4XLZA 1JIUA 3EQ6A 4MPRA 4OX9B 3CCCA 4L5AA 5I8ZA 2ZPTX 2DBYA 4BC1A 2NUTA 1X86B 1CEXA 1Q0LA 3IB6A 1GGMA 3K20A 1I36A 1T1IA 1ADFA 1ZNWA 2HKIA 1QAMA 4NDZA 4YDQA 1Z5NA 2B5OA 4I5DA 4Z51A 4YLEA 1R6BX 2VTBA 3MILA 4HEHA 3EEFA 2B1RA 3GRAA 2WF9A 2Y4NA 2BFFB 1HR0B 3FGOA 3IVAA 2JVJA 1ZW1A 1WB4A 3AHFA 4BN0A 2B94A 2ZXEA 4X8HA 4PAQA 4AI6A 5KX5F 1FSFA 3SXUA 1CJUC 1GTG1 1RDFA 5AJHA 4KLAA 4EPRA 1UKVY 1SU6A 4B33A 3VDRA 4X1YA 1YB2A 3T41A 4RK4A 2GEVA 3E35A 2V0GA 1O94A 1CIPA 1JECA 5K8LA 1YZVA 3F9IA 2PSSA 3UG7A 1NM5A 1DO8A 1XHLA 2E4ZA 3I9V6 3C6KA 3G8AA 4IHKA 1JU4A 5E3IA 3VNSA 3X2EA 4DCSA 2IHKA 5HJ7A 1HOTA 5TC4A 2CLHB 4KGXA 3C3KA 3IAM6 1J5EB 1KQNA 1BKDR 1LDMA 1AZTA 2PRJA 3WLJA 1OQAA 4FI3F 2E49A 3FGNA 5IVDA 5JCZA 3MXTA 4F0JA 4Q4JB 4QDTA 3GO4A 2YS6A 2I8AA 2O3RA 4DCMA 4YX9A 1RXVA 1DQRA 2P3LA 3EDOA 4MI6A 1R6TA 2GN6A 2OEPA 1DAFA 1H6BA 1I5RA 2GASA 5F35A 1XVIA 1EWQA 3SHOA 1C0PA 4W7HA 3FHTA 4BEWA 3KV3O 2X2PA 3PC2A 3DL2A 3FPFA 4WLOA 1T2NA 3UT6A 5FV4A 3D3WA 3FFXA 3WNCA 2Z5GA 5KBYA 1I2DA 3U4QB 1NUPA 2OLJA 1M2KA 4ZVUA 4JBHA 4YUZA 4ZEOA 2REBA 1X7ZA 4CR6A 1TEZA 4HDKB 4NFSA 3ZZMA 1RWBA 1V43A 3LCCA 1IEWA 2IYEA 2YY7A 3BL5A 1HDZA 4L5BA 1ORDA 1P9WA 3CYFA 4WA8A 3QEKA 3UHPA 1NRJB 1M8KA 3KLOA 4FCCA 1DC8A 2OD2A 3E7PA 3SR0A 3B60A 3D4BA 3HRIA 3VA7A 1QGDA 1KJWA 1FRNA 1O0SA 1T6XA 2FX5A 3LTEA 1E1YA 5K6AA 5KPDA 3DOUA 4FD3A 1UADA 3ROKA 2J9GA 2QVZX 4W5OA 2WKQA 3QSYA 3EBLA 4LVNA 3VISA 3OEEA 2GN9A 1YQXA 3WQSB 2J8ZA 3U9SA 2NUTB 2FG6C 4DDVA 5JZBA 3DW1X 2J3QA 2ZSUA 2QE7D 5CJJA 1FFHA 1W7AA 3KUCA 1FFXA 5AM4A 1YDWA 2EZUA 5HIAA 2BDEA 2GHQA 1VTKA 3ND7A 1FDRA 2BJHA 5G1PA 4CE6A 2VTBB 1MHPA 1KFCB 1V8FA 2HSEA 2JDIA 2PR2A 3AVPA 5AXAA 4E5NA 1VSUA 4DILA 1C0IA 1E5VA 2IXDA 1UZNA 4HAZA 3R8CA 2HMVA 4F2GA 1QO0A 4A0QA 3EGWA 2GEKA 3MIIA 3R20A 2Z2ZA 3R6GA 4H4EA 4HQFA 2HMSA 5EERA 4D57A 1ZESA 1WWKA 2VRBA 3JZFA 5KQSA 3SXUB 2VNIA 4LFAB 4QOEA 4RM2A 2Y77A 4A5SA 4X1YB 5JMPA 2R751 1T9DA 2CYCA 2FRDC 2BZ1A 4JA2A 5DXFA 4BGUA 1Y8ZA 1MO2A 1Z5PA 1VLVA 4B2IA 3G5LA 1ZUWA 1GOTA 1U8YA 3IUQA 4BLTA 1KERA 3HY3A 2YINC 4AJOA 3C3JA 2B8NA 4A91A 4BASA 2OZVA 2V6IA 3V1KA 5JASA 3AG6A 5LQKA 1JWAB 2YVUA 5CGQB 1U94A 4CI9A 2C2KA 3CMCO 4G4SP 4KAAA 4B85A 4DLBA 3PDWA 3COPA 2WWYA 1R18A 1EK0A 3MQFA 4D3DA 1J06A 3H0KA 5EXXA 1P3Y1 4M7WA 5ENVA 3CLKA 5ADHA 1SN7A 2G8NA 2NV0A 3A11A 1XJ5A 4WSOA 1GL3A 3IKVA 1HYBA 2QX9A 4PF1A 4R40A 3W5SA 4B4WA 3HV0A 2WSSD 2JD0A 3IE2A 3UNXA 4PNHA 2GBLA 1J9EA 3O8NA 4EVQA 2FUKA 1AG9A 4QEDA 1YNOA 1JHZA 3D3WB 4JNCA 3L93A 4E2XA 4QVIA 1U2TA 1LV8A 1OOEA 4YALA 4FT2A 4L08A 1TK9A 4EJMA 1LSUA 4OM7A 1X1BA 1SUCA 1X7ZB 3AFGA 2B2XA 4JP3A 1TUGA 2P0EA 4HH3C 3VR5A 3EXHA 4LJ9A 1PNOA 3DZCA 3BIOA 3I0MA 3KXDA 4XWWA 3ACBA 4M1YA 4R68A 1E1NA 1F2VA 2JD2A 2JLWA 5KVAA 2PX4A 5JJLA 1VA4A 3H8JA 3MWFA 1ISJA 4LOIA 3UV7A 1N8SA 4WBXC 3UWPA 4B7AA 5GP1A 3VGJA 4DLAA 5AM0A 4F7DA 3GJ3A 3VSCA 3HZHA 4B0PA 4YQYA 1O77A 2IXBA 3BTOA 1WV1A 3FG9A 3OMWA 5AKKA 3JWPA 1OD6A 3E6AA 3OE7A 1ML4A 5HS6A 1PQ4A 2XNDA 3CU5A 3DGFC 4C4PA 4FXOA 2JGJA 3PHJA 1JHRA 4YC7A 4AMBA 4BE7B 2FMTA 4KR2A 5EWMA 3EUEA 1NUTA 3ZWQA 4P5PA 3BRCA 4D4KA 1PUXA 2W48A 3RG2A 5A3SA 3ROPA 2KYRA 1FFXB 1LPPA 2C9MA 4QFBA 2PUTA 2H63A 1J4AA 1FB5A 1TB4A 2PVPA 3LFTA 2Y2UA 4QEZA 1WCWA 4R0NA 2W4QA 2DUUA 3F73A 2I67A 4ZOLF 3MZ0A 3M9LA 4YMUA 2PL3A 1EVZA 3DH0A 1PLLA 1OX4A 1ZK0A 4L5YA 2O8BA 2B34A 3CA8A 3NBXX 2BMDA 1MT0A 1RYFA 5JVDA 5FOTA 3V4PB 4RTOA 1UKYA 3IOEA 3QYJA 4FSXA 2Z2JA 4LE0A 5SZJA 2PTHA 5BUSA 1QHEA 1RKBA 1D6SA 1DQNA 4EW3A 4OXYA 1T6YA 1XROA 4WERA 3RIMA 4Y3UA 4JHXA 1QK4A 2IGTA 3A6JA 1XZKA 4N7BA 1W1WA 3KX2A 5A4JA 3Q6NA 5C35A 4RVGA 2F8LA 1SBHA 2QZPA 5I9MA 4PRLA 3A4YA 3K96A 3DHEA 2BMWA 1YKFA 1ZONA 5D3KA 1L4UA 1QZ3A 2XNKA 1R16A 2Z95A 3L40A 4LYHA 4MDYA 5JLAA 4M7PA 3O8DA 4B6JA 3RK0A 2QA5A 2ZCUA 1EAYA 2EFHB 3V6MA 3ZWDA 1G9SA 1IQPA 4QAQA 3DAYA 1UP6A 5EA2A 2BMVA 5EP2A 2R00A 2OHIA 2Q21A 3SYKA 2G08A 3H04A 4O4HF 5TVKA 3ANTA 2Z43A 3KKZA 1ZDMA 4GR4A 1WO8A 2XQGA 1T3GA 1K68A 3L84A 1IHOA 5JHHB 3Q5GA 1Y3HA 5CM2Z 2B6NA 1J8VA 4BY9E 3DHVA 4BV8A 1KQOA 1B6SA 1NI4A 2C4NA 5K3BA 4B3DA 3ID6C 2R96A 4UOZA 1FW6A 1GRRA 1XNHA 3EXHB 1LZKA 2BUBA 2QNIA 2R7MA 2QD4A 1ORHA 1EGMB 1GRQA 3FOAA 4XSHA 3QKWA 3TLCA 3O1LA 4JEIA 1DJMA 3DLIA 4JEUA 1I4DD 2GZSA 4WXEA 5H68A 4R2MA 4JYZA 1T6BY 5CJ2A 2HBQA 3OIDA 4PRKA 1OIWA 4KNWA 5JTUA 2J4FA 2HA0A 3PGA1 1HMYA 1G42A 4JV5B 3GAZA 4J1TA 2D1FA 3AVUA 2LIPA 3JR3A 2RAPA 4MPPA 3THOA 3A1EA 1YDMA 3DXYA 4KRGA 4DIOA 3LUDA 4N3NA 3TJZA 3QXCA 4IIJF 5EWMB 4DIBA 4PX2A 4ZU3A 4FLFA 1BG6A 1OFHA 3IDQA 4I8IA 3UW1A 3WMWA 4KN9S 3UAOA 2YBDA 2JFVA 1T0PA 3MC1A 1SXQA 2WT4A 4FC7A 4UVGA 4NWIA 5DMXA 2IU3A 1DVRA 3E18A 2ERCA 4XLLA 3FR8A 1OX4B 2FP4A 3A9WA 2O8BB 2W93A 4BFSA 2YZNA 4JHLA 1U80A 4I2VA 4Q82A 4WXYB 4YPVA 3QBTA 5JVDB 1VL8A 1WMEA 3NLLA 5FBZA 4BTEA 3TTWA 2WJYA 1NW5A 5EIHA 1D9ZA 3FI0A 1QHHA 4I8DA 4HQ6A 4QLBA 4NARA 4QBKA 1W36B 1HH4A 4CGZA 2P78A 2YIMA 4QOFA 2PRZA 3A9UA 3TR6A 1ZOIA 1H9AA 2FMUA 4GZ3A 1T6ZA 4J0QA 4F5WA 4PX9A 4E6EA 5HE9A 1C7QA 2FMXA 3V8EA 5BOVA 4KQEA 3HABA 3U3JA 1L4MA 2VRCD 1EFRA 2JFWA 2NZWA 3F46A 1TAHA 3H9QA 1KAOA 5DM1A 1C9JA 1D07A 1JKFA 3AGPA 3PRJA 4X20A 1U31A 5C81A 3HGMA 1GTSA 2ZTSA 1P29A 5AESA 2HR1A 1VXOA 221PA 5E9QA 1DJOA 5C32A 4G24A 4UHBA 1AO3A 3E9RA 1D2CA 3LFHA 3B6KA 3UCXA 4WEOA 5DHFA 5IYZF 2EJCA 5K99A 2BD0A 1OGIA 1ZVMA 1WMAA 4W5QA 9MHTA 2CMFA 2JIZA 2VPZA 2WVGA 4UPDA 5K3FA 2Q5JA 5MDHA 2RBKA 4F6CA 3QMVA 3S2FA 2HUPA 5AVRA 3IDZA 1NI4B 1ZUD1 3GLGA 3UUFA 1SK9A 5CXUA 4IDPA 1IXKA 2E1PA 2NZUG 3GDWA 4BO8A 4OO3A 1MQ8B 1OWNA 3OZEA 5DNEA 3PYMA 3IR7A 5JAQA 1VIDA 4NCXA 1HT1E 3AUFA 3ZN2A 1CDZA 1J99A 1QRDA 2I4RA 1PR2A 3HPQA 3H65A 4FGWA 1JEQA 1VDMA 4YN3A 4KSYA 1E7WA 1MP0A 3BQMB 4ILEA 4N4AA 2D4HA 2F3QA 4RKQA 4RGVA 4UDXX 2ZTUA 2VQEB 1JTEA 1XMJA 3E9NA 4C4AA 1SA0A 1M6YA 3AU8A 3L8ZA 3PQ2A 4LJAA 3VTZA 4D9MA 4NAUA 4DR4B 1LDEA 1MCZA 4JJ4A 2B4RO 5DTRA 1N5DA 3R0ZA 4ZEXA 1B2LA 4DUPA 2CVZA 1E7MA 4JUBA 4FN4A 4XASA 1ZICA 5T5QA 3RS2A 5IAJA 1TCUA 2G9NA 1ZINA 3MS4A 621PA 1Y6FA 3G8YA 2JHAA 4LWZA 2OQIA 1Q95A 4BMZA 3NBYC 1LLDA 1P7ZA 1IOLA 2HBYA 2PEZA 2J6IA 4RTQA 4PXAA 4TTQA 1WMSA 3VYUB 1XZHA 2X6QA 1NUSA 3W5HA 3OG9A 2HK9A 4H7EA 2J0EA 5H80A 2FP4B 4GBJA 5EMKA 3U4IA 3QEJA 1SBYA 1HDYA 2OMEA 3JYOA 3W2IA 4IMJB 4F12A 4WL0A 5I8WA 2PGJA 3R0XA 2ZSFA 3I9FA 4GYYA 4FDVA 1VL5A 2RGWA 1QHHB 1MG5A 1P8JA 1XJCA 2ZIWB 1DS6A 1VE1A 1R5OA 3ZBPA 4KREA 4OHMA 2O57A 2YDYA 2JHPA 1PJCA 1PDVA 2C7OA 2X0DA 1AA6A 3I1JA 4Y8VA 4Z3OA 4KQWA 4RVHA 2R11A 3NRCA 4KE7A 2G1PA 1BVYF 3EVNA 1N8KA 1TPZA 5F52A 4Y1GA 1DIOB 3I28A 5TV2A 4BVHA 4X20B 4QVKA 3KLMX 3C15C 2OBBA 5EUCA 4QOGA 5TS3A 1XZFA 1YO6A 3OEHD 1Q0TA 4NEGA 1IMJA 2VK8A 4FFRA 1POWA 2PH7A 3L4BC 1VKOA 2GYYA 2HHJA 3EY4A 4EHDA 4Z53A 3B5IA 1EVLA 2FW1A 1JBEA 1QF7A 4IFBA 3IBYA 3SZGA 3W2HA 2J6HA 4HAWA 3ZEIA 3EPPA 2GPJA 4F21A 2DGDA 3QFFA 3ELUA 5AKYA 5JTTA 2OHJA 5K3FB 1B73A 1JNYA 2QXYA 1J1IA 1PJ3A 2QI9F 4G1EB 4N0MA 2BEUA 3DLTA 1W5BA 3MRSA 1LTHR 3D9QX 3ZXIA 1A50B 3GLGB 3QJYA 1LC0A 4I46A 1N78A 2WWHA 1YJAA 4KCGA 3WMEA 1EX7A 4CI0B 1TTQB 4RENA 3T99A 1NJ2A 4C05A 4BATA 2KLHA 5CX1A 4DAEA 3FNGA 2M6RA 3A1WA 1QHXA 1J1ZA 1MGOA 3R09A 1ZM4A 4Q9HA 4YAWA 5EP4A 1A8UA 2CUZA 4G56A 1PD1A 4KYUA 4E5UA 5AUNB 1RXWA 1HDEA 1PW7A 3BIWA 3NG1A 3TLBA 2X86A 4JP2A 2QE7A 1S96A 1Z7WA 3WL8A 2FSVC 2V6MA 1DO2A 1SA0B 2X19A 2H17A 4LF8B 2W8BA 4RACA 4EUKA 2XYHA 1YU9A 2JFOA 1N2CA 2AH5A 4WZZA 4KMMA 1S0UA 1X1AA 4MUEA 3SZLA 3ZE7A 4BOYA 4US2R 5JI3E 4O08A 1KBZA 2IYLD 3KJEA 1KXZA 2GHRA 4K6HA 1X3SA 1E8NA 3T1HB 1OXSC 1OTXA 3MLAA 4RD4A 4QG7A 1GTRA 1SVKA 3AUSA 1E0AA 2B8TA 4MO9A 2DR0A 4XQ0A 4FOSA 2NQ8A 1WETA 2WB2A 3NEYA 4H4CA 3T3IA 4YMVA 1WUHS 1R9NA 3OJXA 3R0VA 4M9UA 2M9MA 3OZCA 2IQ5A 3RFUA 5A4KA 4C1NA 1CUWA 2OBMA 5J2TA 3GFTA 2RAVA 2C2WA 2TRSB 4PO1A 4YEDA 2VPPA 1LRLA 3WQRA 2HSDA 4EZEA 4PAWA 2BW0A 5LPNA 4O25A 5P8WA 1KK0A 1W85A 1Y81A 3IODA 2CNWA 2EZ9A 3MGKA 2BGJA 4LC1A 2WWIA 2FR0A 2ANBA 1J5PA 3RS7A 4DJTA 3D43A 4HPWA 3GLRA 5ICEA 1P1IA 1N2GA 1AKWA 3RWMB 4P0QB 1RMTA 2QLTA 2C8VA 4LVOA 5AW9A 3QQ5A 1E3WA 2O52A 1VP3A 1W8DA 3W1VA 4FGKA 2F00A 5E7MA 2IV2X 2WSSA 2GM4A 2H3HA 2POCA 4UAJA 5EWLA 2EJTA 1GTJ1 1PSDA 4YJFA 5FPKA 2D0OB 5KPJA 3CJRA 5EIXA 3KCQA 1QG6A 1VRWA 4MAMA 4I1IA 4C2TA 1EIWA 5DBGA 4QTXA 1RCFA 6REQA 3R3VA 1YTLA 2R8XA 3A06A 2J46A 3WNVA 5KOJA 3Q87B 4ZANA 2H2GA 3T5TA 4I1UA 1A7UA 2BEUB 2VHEA 1MB2A 2ZRQA 3GX1A 2AX3A 4PYQA 4WFJA 3M6IA 4KR6A 4X1KA 3SK0A 4BQPA 3Q7PA 1ZW6A 3GEGA 1XZNA 5DWDA 2FX3A 4M98A 1PUJA 1GEEA 4MW7A 3HXOA 1ZAYA 5BR4A 3VFDA 3BD8A 2OPBA 1RQGA 4JJZA 3V7FA 1RBZA 3WBKA 4D0LB 5CX1B 5BQ3A 4GYKA 4IGEA 4JMPA 2Z5LA 1E63A 2QXUA 4BYMA 3EZ2A 4XSVA 1H6AA 4RMJA 4RPLA 5FA5A 1Z2PX 4YMSA 1EQ2A 2CVOA 1RWNA 3JCZA 1KOJA 3GNQA 5GVSA 2NQ2C 4TSRA 5HUHA 1AQYA 4RJJA 2C3PA 3L0SA 4M9QA 2I9KA 4IVNA 1RE0A 2DFTA 4EFNA 3FNFA 2W8BB 3GFBA 1E6WA 2PH5A 4JBWA 3VJMA 1N2CB 4GMKA 4U2BA 4O2RA 1FA9A 2YV1A 4XH9B 4WKBA 4ABTA 4PCAA 4OH7A 3B52X 4GRDA 5I3CA 4Q03A 4LJ7A 1AKVA 5AJWA 3ICWA 2ZJZA 1FTQA 1Z82A 5SICE 1T15A 1VPTA 3ODGA 3E23A 1KO7A 1LK0A 2FN8A 3L06A 3LP8A 3MW8A 4GAEA 3O4JA 5CW1A 4B3BA 4NE2A 5JCPA 4FGJA 2GK3A 2D2VA 3QX8A 2E4WA 2PMEA 2CJWA 3QPVA 2GF2A 3KOZA 2G72A 3UCFA 4AKSA 4B3JA 3DBHA 1PD0A 3VSDA 1KYTA 4UMVA 2PFGA 2ZBPA 4WKPA 1KYYA 5EFOA 4FZVA 5LVAA 4DMHA 3H9CA 1J7KA 2ZU0C 3R7AA 3GK3A 5TT1A 2HPZA 2O0MA 5J2TB 4M9XA 3K9QO 3ZHUA 2GETA 2ZQ5A 3UH1A 1MA3A 1TQ4A 1FNDA 2AS0A 2VAVA 3RHFA 1W85B 4BNNA 2HDNB 3ZU6A 4AYTA 1ZNYA 2P27A 4HHEA 4DR2B 2R5WA 2HHHB 2O3UA 3B2QA 3RHTA 5BWCA 2BISA 1P73A 3UG6A 2QDKA 3NH9A 4R7GA 2VTDA 4MRVA 5BNZA 4KI0A 1E3WB 5EJ6A 3L92A 3L82B 1JX6A 1PLJA 1IK4A 1EFTA 1W9HA 2H11A 3DYBA 3KRTA 3P94A 3P9RA 5EWLB 3UWOA 4AS3A 2OGTA 4YJFB 5D3QA 5EOVA 4LG1A 3RVRA 4GVPA 1TZCA 2AR0A 5LL6P 4FHZA 1JDPA 3AVTA 1JJ7A 1ILWA 4D44A 4QJ4A 2Y9MB 4L6AA 3EPHA 1SC6A 5BNTA 3GJ0A 1JDNA 4Z9YA 1VLMA 1QTRA 5KOJB 4DGQA 1HFEL 1SVMA 1VCOA 2G0AA 3DOFA 2NUPA 5A06A 1QPGA 2K6GA 1NUHA 1J2RA 2AJDA 3BHMA 4X1KB 4F45A 3TD6A 1NU8A 2IEDA 2KM1A 1KFEB 4CYMA 2DWCA 1KOFA 1XP5A 2VHZA 3IV9A 1NFFA 4MKHA 1XZLA 3TPCA 3GZJA 2FFQA 3GIWA 3WWCA 2JGDA 3U2QA 4D6PA 1I01A 1F0NA 5KC9A 2I8LA 2HREA 2Q9UA 1QHGA 1TYEB 3A27A 3TL2A 2AR9A 1I2BA 3SX4A 3CVWA 3EXAA 1KHHA 1GA6A 5L6MB 1OXMA 5DNDA 4AL4A 4BAUA 3BQ9A 4BDTA 4ENTA 1B8PA 3O3CA 1N1GA 3NTXA 1EWYA 5CDUA 1NOJA 2X3UA 2C2MA 1RJFA 3N8KA 1K08A 2AJLI 5EJ8A 2JZNA 3IAEA 4M1KA 1PQWA 4RKWA 4ZVTA 3GRFA 2IEIA 3OLYA 1BRMA 3F6SA 3LXRA 3B12A 2QS9A 1KIMA 2XCOA 1GGFA 3HJAA 3TO5A 4DJFC 4B44A 2ACEA 4BIIA 3ADPA 3G2JA 3K09A 4DR1B 2H8KA 5JY6A 1U7UA 2VAWA 3O5AA 3DMYA 1Z08A 4C7BA 1IRXA 4WCDA 5AOVA 2CJWB 5GY7A 3T12A 1P4JA 2FH5B 3DBHB 3DO6A 4PVCA 3OQIB 3UT0A 1AZWA 1Z0FA 4WNYA 1HEUA 1NAHA 1ECCA 3ZS8A 4B3CA 4BGVA 2C7PA 1F8UA 1CLEA 2JHFA 2Q5QA 2XW6A 3BMOB 2HFJA 3DF9A 3F4BA 3HYNA 2KWIA 4IR7A 4P9NA 1VG8A 4MIKA 4D02A 5BMOA 3KBOA 1QOQB 2QN2A 3T9CA 4FFNA 2VRCA 4TS9A 1UZUA 3V1MA 1NNEA 3HLTA 2HD4A 2FEKA 3DZBA 3QFRA 4Q47A 2W8ZA 4QSMA 4RIEA 3QVJA 1V7QA 3FTFA 4BWGA 1BMDA 2WR8A 2W6MA 4RKEA 3IMFA 5E8RA 3KVVA 4CMKA 5E8JA 4PFSA 3ZDFA 3KXKA 4Z8YA 1A0OA 1NBME 4U8HA 2CBXA 5CVUA 2V7QD 4A5OA 3ZZ0A 4RHYA 3QA9A 5F3RA 5H0IA 2FPWA 2I6GA 4BLOA 4P4TA 5EHIA 5B3KA 1EX9A 4IEEA 3HA5A 4R16A 3UAVA 3KJQA 3MD0A 2R4TA 3RFTA 2PANA 1LPMA 1IIBA 2PUWA 2RSLA 3DQQA 2PFKA 4WINA 1EFDN 3IYLW 3KVYA 3LJKA 1X7HA 1AK1A 4PC1A 4JBNA 2PD3A 1IATA 4YMTA 5DTIA 5JDCC 3UK6A 4KQ2A 3A25A 3C3CA 3C7DB 3P45A 4HDNA 4RL6A 2ZXUA 4M1SA 3V33A 1E0KA 4FYYA 3ZWVA 4TTPA 1LNSA 1C29B 2AEJA 5AYVA 2PBFA 1KDOA 3HKCA 1NBOA 1T8SA 2V9ZA 2VJDA 4O1IA 5ECGC 3RJ9A 4M0DA 2V8OA 1GFZA 4QPNA 4G0WA 3LVRE 2H1VA 5A7HA 3TAUA 1DJPA 1G60A 4KQ6A 4L16A 1U7PA 4WKNA 3TIFA 4F1WA 5L40A 3CLRD 1KZYC 4M0EA 1SB8A 2XZDA 4QUJA 1JBKA 2BONA 2JGDB 2P67A 1BE1A 3O8OA 4XFKA 4CEJA 1KEUA 1W2HA 3KJFA 4LMPA 3T0IA 5DWQA 1DG3A 1CJKC 2IE8A 3D8SA 2D7DA 3TRDA 1XJWA 4WWHA 3I2IA 4D9KA 1JQDA 1EVIA 2J3LA 1CZUA 4G1BA 4II2A 1XTIA 1ZOPA 3O0TA 4PFKA 1QJ4A 4EVRA 3HMQA 3BILA 4KO1S 3A6DA 2PFSA 1U9IC 1V25A 1V11A 3DZ8A 1OI7A 3OM0A 4H60A 2C29D 3V34A 3TQTA 2WU8A 4CMEA 1DCFA 3E27A 3HB1A 4GQBA 3KKPA 2N1MA 4J4TA 1LUAA 5D84A 3ZHYA 4GXQA 2XKJE 1YC2A 4RSRA 3H5LA 4G0NA 4Q4LA 5CD9A 2P4UA 2Q0SA 3JRXA 3KELA 1L5MA 3IUEA 2A9VA 3IV6A 2HWXA 3IE1A 2GSDA 2QX6A 4X54A 3VSAA 4F5DA 3CB2A 5IZCC 3KVOA 3ZLJA 1G5IA 4X8OA 1A72A 4WCVA 3H86A 4HN2A 2IDZA 3SMVA 1EBUA 1JF8A 1DWOA 2ZI7A 4GBGA 1TK2A 2JZCA 3L1UA 2H48A 3R5JA 4DABA 2GNPA 5CM8B 3RK1A 3RYCA 4U8GA 1K6XA 2M1ZA 4R1TA 4EWLA 3C4JA 3PQ4A 3IP5A 1CTQA 1G8MA 1Z4MA 3BE5A 2IY8A 1E3IA 4V0LA 1Y3AA 4A23A 1LBQA 2G36A 3IFSA 1XTQA 1EXVA 4FNMA 1G5PA 2JGFA 4S2EA 3OTOB 3CLSC 1EJ2A 1AZSC 2FX2A 2H54A 2FLVA 3PDHA 5JI2E 2VH5R 3EE6A 2P79A 3LPAA 5AWFC 4HWOA 3RIYA 1JDJA 2ONJA 3Q8MA 4Y1FA 1U0BB 4Z8XA 3RYIA 3SFZA 4BQOA 4UU8A 2P5SA 3KD3A 3LS2A 3K0AA 5B58C 3A4TA 2CZGA 1Z6ZA 4EITA 4EW2A 2IHNA 4KO2S 4H15A 5ANRB 5JFOA 2XJ9A 1RZUA 2IEZA 2WF7A 5JSYA 2Q2VA 4HDNB 1TA9A 2DQYA 2FZ5A 3OZAA 1FRQA 1RWOA 2NO5A 4MRRA 3UB4A 2ERXA 4M8LA 4CDRA 5F33A 3R5FA 3P96A 2A0YA 5IBQA 3Q3IA 3QWAA 3HKCB 4MV7A 3MGBA 4QX6A 1M1YE 3E7XA 1L8AA 3HR4A 4MJXA 1SG0A 4J4BA 3WRYA 3AR4A 3LSYA 5A4DA 1MX1A 4HGOA 2ACVA 3KVNA 2NO0A 3GT4A 3N53A 4XCXA 1ELOA 1K2VN 2QP9X 3VTFA 1NVFA 3IT3A 2CKMA 3O8OB 4CEJB 3M70A 2B4KA 2ZAGA 1YMQA 3SYMA 4C2AA 4F2WA 3QI7A 4I36A 3BRWA 1MV5A 1YGPA 2G1UA 1Z56C 1LBTA 2B69A 2OORC 1AKRA 4PYJA 1ZD4A 3PFNA 5LKRA 1N6LA 4G1VA 1TQ8A 3L0PA 2CSXA 5JNWA 3FSJX 5AOBA 3J81A 4RD6A 3DPIA 3HACA 1MABA 4PZAA 3GDHA 4KR0A 1V11B 5ITSA 4WKCA 2EZ4A 4XUEA 2X1LA 3TF5A 3RUCA 4QWMA 2Y1WA 4UUNA 1KOGA 3G8BA 4MEBA 3O1IC 4PWZA 4ER0A 1L7XA 1UBMS 3IPCA 2VIIA 4YUAA 4XDYA 1HNNA 8ADHA 5FWAA 1K7EB 3LX6A 4GPEA 3DYVA 3TWOA 4DUZB 3O2JA 1QQ5A 4DAOA 1T9AA 2DQ4A 3F7NA 4JZYA 4GH5A 2YCLA 1TCCA 3A4LA 3KPWA 5L3RA 5LB4A 3PDCA 3UO8B 4ZDJA 3C8DA 5KOYA 3KXPA 2NZVG 3K9HA 1UOQA 3KVRA 3HMKA 4KQMA 3WV5A 5DW0A 3ZYZA 1YCFA 4M0LA 1LBHA 3MT9A 4EUNA 2FSGA 1GPJA 2HDHA 1R0RE 1ZD5A 3RYCB 3PEFA 3WB9A 1GNSA 4XVQA 1GTL1 2GA9A 3RVOA 4AKHA 4QUHA 4I14A 1CQIA 4U7FA 3MS2A 1C4XA 2N1BA 3D5TA 1AS2A 3NGMA 5GQSA 3QPUA 5TLSA 4KQXA 4Z6KA 4DKJA 1RHJA 2QM0A 4IGAA 1VLLA 3THRA 1ECLA 1V9SA 1IYZA 1HG0A 4FNAA 4G5YA 4S0XA 3H2ZA 1FFYA 1I4OA 4KXLA 5J9FA 5B1DA 2OV4A 4JU8A 5HM8A 1IXSB 3ZV6A 3PQ8A 1RKUA 1C9NA 2VS1A 2Y92A 3ETEA 3ICPA 1JHYA 2ZVQX 3UJ9A 4MV3A 2EDCA 4FXPA 3RYIB 2O2XA 3KS9A 2WNHA 4O2BF 3K0AB 3X44A 5B37A 1FS5A 1TLTA 3IQEA 2EKLA 3I9KA 3PQ5A 2AT1A 4UHHA 1XKLA 5ITWA 1VI2A 3C1TA 3HU1A 3I9V1 3WOHA 2R6HA 3F98A 3U7EB 3R5KA 4TVKA 4DWOA 3P9KA 1X42A 3DFIA 2OFWA 3FA2A 1JBQA 2AUTA 2AR7A 3IAM1 4MYUA 3ZGLA 2H2WA 2RI6A 4H6VA 2D59A 3DXZA 4FEYA 3U6BA 1GFSA 1TC2A 2FZGA 4MHOA 4DSTA 3CNQS 1G2IA 1E1MA 1YR8A 2VEOA 3C6YA 1DSSG 1RP7A 1CJCA 2WLTA 1QVVA 3P0EA 1OFGA 4I1VA 2CXTA 4GR9A 3EUWA 1FP6A 1GSHA 1RWKA 2FR8C 1UDXA 3H2YA 3H5WA 4P38A 1VL2A 2YDXA 4V0QA 4CL2A 4I3HA 1A2KC 3KZNA 1OILA 3SJZA 1REQA 3I6IA 4O59O 1WBBA 4N9QA 3I1IA 1E5DA 3MVEA 4EPWA 2J31A 2GCIA 3KOXA 4KEAA 3NPMA 1FRFS 1BQEA 5BQOA 4ESEA 1TF7A 4XPZA 3DPUA 3RCBA 3KLPX 3PUIA 3UMSA 2FJUA 1MABB 2VA9A 4HYYA 4DYVA 3S7TA 2GM3A 1WW2A 1S2NA 1FVOA 4R9SA 1GFWA 3C3BA 4N6NA 1UXGA 4YDRA 4Y2TA 1E1DA 1I6KA 4JBXA 5A4IS 2PLAA 1DOAA 3PZBA 4FBGA 4CJXA 1ZIYA 2CBGA 4YO7A 3SVZA 1W29A 1CR4A 2CNBA 1NYLA 4YGXB 4AQDA 5IDVA 1DWPA 3KKNA 5AICA 1S3FA 3HJUA 2HA6A 3O4IA 1JQJC 4OYHA 1YT5A 2EXXA 3HHPA 1I94B 4S2UA 4WEQA 3GARA 5DV9A 5DNWA 3TTUA 5FWDA 1B00A 3GP8A 1P91A 4ZOBA 2VDLB 4TWZA 1RJEA 4DR5B 3NFYA 2PT9A 5DHQA 1S3GA 3N7AA 4UKDA 3EXFA 3MLEA 3HDHA 2X14A 4C3ZA 1JDZA 1CQIB 2Q62A 1O03A 1VG1A 2OZLA 3TX6A 1QUEA 3WL4A 2E89A 3U62A 1CUXA 5FYDA 4KV7A 3X2FA 4X0EA 1ZVQA 4OXRA 1SKYB 4HZGA 4JVNA 4L27A 4CG3A 2XKBA 5FBKA 4CMGA 4V1CA 3W7BA 3C8UA 3NHPA 4N8SA 3FWHA 3SYLA 1J8MF 3FH0A 4LNUA 3ZTWA 3OA0A 2BJVA 3QGMA 2O54A 5I45A 3RARA 4N7MA 2OC4A 3U3RA 1TD1A 5IUKC 2P68A 4S3MA 2WABA 3W5VA 1V39A 3HFGA 3K53A 3M2PA 3ER8A 2EDAA 4FI3C 5DOZA 3RSQA 2PDAA 4JBIA 3OTHA 5LXTA 4ZAVA 3A3OA 5L8VA 1LPSA 2J33A 4QBTA 4DV2B 4B75A 4AJKA 3IEKA 4MWZA 4DCUA 5K0ZA 1KQGA 3VU0A 1QHYA 2OBNA 1AF4A 2RAUA 3D54D 2C2GA 4FHCA 2NSHA 1SQFA 5T57A 1TVEA 2QROA 3FZNA 4G9GA 5EHNA 3X43A 1QLJA 1VHQA 2AV6A 3CH6A 4MV9A 2CV2A 1JSCA 2CLDX 2OCPA 2H1OA 2ZJAA 3F6PA 4MCJA 4Y9TA 2W2QA 4LOAA 4S24A 4GDMA 1XVUA 1WBJB 4JGGA 1C1YA 5IP5A 5KTYA 5AI0A 4E5YA 4FSDA 1KO1A 4R8LA 3WO0A 2DHCA 1FNCA 2Z1DA 2AX4A 1Z6QA 4I2NA 3R7SA 3DZJA 2MMGA 3CF4A 4RHTA 3GH3A 3BXZA 3TLAA 4JOBA 2UUBB 3B20A 3ICQB 1REQB 2CHEA 2RGYA 3JYNA 3UJPA 5FR2A 3DA8A 3VC3A 4BVEA 3X1JA 1GPUA 4RIHA 1NMXA 2I2CA 3IP7A 4DCOA 2PGXA 1DG1G 1XNJA 3FRJA 3DT9A 4JLJA 3OQMA 1AGNA 2FEMA 2DY0A 1NN3A 4PQEA 3AR2A 4JI6B 3K1ZA 1UL1X 3T9FA 3VKVA 4DCVA 4GMXA 4J7XA 5KUTA 1IVYA 3OWOA 4QUKA 3T3OA 1L8XA 1RQRA 1V7PC 4DRXA 2B1QA 3LQ2A 3GUZA 1QS0A 2Z4SA 2VEDA 2G25A 1ZPDA 4BX9A 1GU7A 1AKYA 1MA0A 1LNQA 2HEIA 3WDMA 2FW6A 4EHFA 4YRKA 4GIBA 2R65A 3WVNA 4FW8A 4HEQA 5LQRA 2XGGA 1IUOA 3MBKA 2JFUA 4JCOA 3L0DA 3VU8A 4GI5A 1DXQA 2B4QA 1ZL0A 5GTDA 2QVXX 2HPVA 4BJHB 4BX3A 1ZGGA 3H1TA 2QZSA 4UUPA 2QMUA 3WNZA 3TG8A 2I3AA 1E66A 1F4VA 4P35A 3EXFB 4HNAA 4F6LA 2HCJB 1UXHA 4OHZA 1TUIA 5FQOA 1PLKA 2V7QA 5GMOA 3W2GA 4XCQA 1N1DA 4N39A 1N5LA 3QFTA 4HSGA 1G4HA 1JVSA 2AOWA 2P5TB 3E7WA 1TYZA 2P77A 2XVZA 4IWYA 3SDSA 2OZLB 1UH5A 3ZVNA 3OQOA 4C6HA 1E6LA 3HY4A 4ALJA 2BLLA 1PI3A 1ONBA 2W4IA 3R6DA 2BY4A 4IV8A 4YBZA 1ISFA 4V1CB 4DJ5X 3FVQA 1U7XA 4I81A 1CUUA 2WBLC 3RVKA 4G1UC 2QG6A 1FFCA 3UB3A 4LNUB 4PPFA 4TYQA 5AVWA 5LQSA 3GGPA 3IT0A 3AOEA 4DCCA 1KETA 2P2LA 2ZREA 4MW6A 3W04A 4ARZA 1AF7A 4LZAA 1OB2A 1TLLA 5SZIA 1A76A 1YE5A 1ZN7A 3OZFA 5B30A 4IO0A 1GV1A 1D0IA 4LOKA 4ZCMA 5M04A 3KR1A 2OVFA 4LUCA 4GF5A 5KNCD 4LYAA 3VZDA 3BFJA 4BFTA 4OL0A 4UQLA 1WXQA 5LZ2A 2M6KA 5A0TA 3PB3A 3OTQA 1FMTA 1PQYA 2UUCB 3MJSA 1W48A 1WKCA 2EKZA 3CUKA 1E3TA 2WPNA 3AT1A 3JWGA 3VR2D 2CDAA 3NT4A 4YP1A 3LPNA 1JTFA 3WLOA 3FJ1A 1WR8A 3U60B 2QJRA 5HJ5A 1DBSA 1N7GA 2LCQA 5EMJA 1W6UA 5G41A 3OLCX 2NN3C 2HWKA 3Q5DA 2FCRA 3ZDBA 4FINA 5LN1A 1II8A 2E37A 4EHNA 5IABA 1K63A 3CZCA 1E2LA 1XZAA 1E77A 2WT9A 4YLGA 3MD9A 3ZGVA 4R3WA 1T4MA 2I8CA 3RAEC 1FZTA 2NXNA 5JD6A 1RVV1 2R1ZA 3PHHA 4M87A 3ZTYA 1Z0JA 3GEDA 5TRTA 2VNSA 4ZRMA 3U40A 2EEZA 1E3JA 3P0IA 5CLQA 1G5FA 3CUUA 4GUAA 4S1PA 1NF2A 3IA2A 3LA6A 2FFRA 1A9OA 2V98A 3GVPA 3VC7A 3W3AD 4W7SA 1UFKA 2EKQA 5FFNA 2WILA 1P1FA 4K1XA 5K3CA 4C7KA 2WUVA 2IELA 2IHBA 3O4HA 1PT6A 4TWIA 4BO3A 2HXYA 2O2YA 1YZHA 2F6RA 1L4KA 3SZOA 4DRXB 5F12A 1O97D 2AQHA 2ZB7A 5JD4A 4JI0B 1QS0B 3N07A 3DP9A 3QXGA 2H57A 3B1VA 3DZKA 2JKYA 2QD3A 5D6OA 4ALKA 4F1JA 2PV7A 3II6X 4EPXA 4FDTA 4QC2A 2Q0QA 4PLFA 4XGIA 2I91A 1N6KA 3UM9A 1T26A 4H6PA 1KOLA 3R75A 2AC2A 4TLCA 5H59A 3BCHA 5C5EA 2EW8A 2O5RA 1EVJA 3BKXA 3PYLA 4IO1A 3DHWC 1B16A 4RZXA 2OV3A 3RJMA 3QVVA 3RVDA 1DWQA 1R6VA 3HYCA 3TIIA 4IX9A 2A35A 4J0KA 3PU6A 4HNAB 1UEXC 3IPXA 3LG2A 4JN6B 5IJXA 3GLVA 1M66A 2XD9A 3EYAA 1OT5A 4XWOA 2BE9A 3M9XA 5CXSA 2CBZA 2G1KA 1IOZA 1NUQA 2XV1A 1O6CA 2IOFK 1B14A 1Y5RA 1LFAA 1JAZA 4BKQA 2O0JA 3O90A 2CFSA 1WVMA 3HYSA 1YR6A 4J4HA 5ADUS 1YIDA 1V47A 3PTZA 2A6PA 3J80A 1ZA2A 1GL7A 2VUUA 3UJ6A 1YK0A 3PRKE 4NP6A 4Y1EA 4G97A 2JFHA 2FDCA 4PZZA 4UZFA 3SX2A 4M88A 4ARZB 5DRYA 2ZPAA 4E09A 1NKSA 2ZUSA 3SZ3A 4FR2A 1TZJA 1CZNA 1AXEA 1XLUA 3GYGA 3BD9A 4FFSA 2Y8EA 3ONDA 4EFLA 5AUPB 4R9RA 3L4KA 2GZRA 2O8VA 3EEOA 1I3KA 1SMKA 1G8JA 1SEVA 4ND4A 5C7YA 4GPIB 3PNKA 3RVBA 3SKVA 2NYRA 3ZCPA 2FQWA 2FFJA 1KE1A 4QXQA 4F4FA 2O8DA 3C3DA 2GO1A 2JK1A 1SVUA 4BB6A 1LLFA 4CM5A 5JXWA 2PX8A 2GX6A 1II8B 4XQEA 2O2HA 2YC4C 2R7LA 3NBMA 3P27A 5FULA 4ZJPA 2R6R1 3D4NA 2HRZA 3COWA 1PT5A 3AR5A 1ST2A 1DCKA 3GGCA 1M6EX 3PHGA 4XLTA 1CD5A 1MRNA 3IBFA 4JUCA 4CM9D 5BSUA 1W0KD 3N8IA 1NBWB 5IT0A 2BGGA 2HSGA 1KI8A 5EUBA 1L7QA 4P2GA 4BV2A 3TW0A 3ZQKA 5K8TA 1LW6E 3PICA 2ZJ8A 3PPIA 4TT8A 2OSBA 1UPBA 2G5TA 1H23A 3ESCA 3GUHA 4J6FA 1T5IA 2QP3A 3I5YA 2EFDB 2PLNA 3CSDA 1MTZA 1NBIA 2HCBA 3L1IA 3A10A 2WVAA 1RTTA 3R8FA 2Q2OA 1ENZA 3EA5A 1NRXA 4I1OA 2J0QA 1X1DA 5CH8A 3GROA 2ZS8A 4FLEA 2QTFA 1XALA 5DHSA 3ITDA 4CMBA 1QG0A 1GJRA 1L7NA 2O48X 4D74A 3U44A 3PGJA 4JC4A 4LISA 2H5JA 4H1WA 3HVIA 1GL9B 4HDOB 5FTMA 4PGMA 1FUIA 2E87A 3LQYA 3M1YA 2JA2A 2HJRA 4UCXA 4V3CA 4ZYLA 4V0OA 5ITVA 1PR4A 1R8YA 1VJCA 1NVAA 5T6MA 2RHTA 4D6YA 1KAGA 5EIWA 5JPDA 3G8CA 4L8FA 1NZDA 1YB7A 2ZKIA 1KO5A 1KPHA 2W37A 3QVOA 4YDSA 1OJLA 4X93A 4ZCIA 2HQSA 1ENOA 1Q2XA 1CDDA 1TAGA 3DQPA 1V16A 1E4EA 1WXFA 4FHFA 4NOKA 4P81A 4R41A 3RUHA 5C9ZA 1IAQA 1QGYA 1U1CA 5LDHA 1UQRA 2GI4A 2Z30A 3S2UA 2YVKA 3VNQA 3WOVA 1YQUA 3RWOA 2BBWA 1C1XA 4HPXB 3B70A 4QPJC 4WVFA 1IG3A 3E3OA 3I42A 4OYYA 3DE4X 4CN8A 1KORA 4DGSA 4JGIA 1A5SB 4NBNA 1DCTA 1EWKA 3AHGA 2Z2KA 1WV0A 3GLIA 4BXOA 3I05A 4BMOB 1QIEA 3UA4A 2UZ3A 4D3SA 4F86A 1GADO 3BSSA 2ZYRA 2ZJ3A 3TOSA 4AZVA 2XOXA 4TTSA 4ZVMA 3NWPA 2X7JA 3DZFA 2FOIA 4JLAA 1FVHA 3O9MA 2B92A 3M6MD 4IAOA 4PZEA 3ZY2A 3L4EA 4L07A 3L8GA 4W6QA 4YT5A 4PICA 3WLHA 2GRAA 2H08A 3T0GA 1T2DA 1LI5A 4JYPA 2C5FA 4UW9A 1Z75A 3DBVO 3JVDA 1NONA 5HK8A 1Z7YA 4XWAA 2CNDA 4YVFA 2J87A 2RJOA 2YBEA 2PSDA 1TLFA 2KBEA 2VYQA 4J7AA 5DRTA 5AKEA 4ARVA 2B6HA 1Y5LA 5KTOA 2VOEA 3ANYB 3PHLA 4JYCA 4AULA 1FK8A 1P0FA 2WZDA 3S27A 2O8DB 1KJNA 1ORWA 3GHYA 5I47A 5FT9A 4XX1A 1F9AA 1UPTA 2ZM5A 2R8RA 1O0BA 4PSVA 1G291 1JQ3A 2MR6A 3EZ6A 2E55A 3DE1X 1NMEA 3PITA 3QXHA 4PSCA 3SQNA 3ZW8A 1NQOA 2C1XA 3WLFA 4OBBA 5DTQA 2KB0A 5L3SA 4D4GA 5HRCA 1Y82A 2WJ6A 2OVBA 2YJGA 5E1DA 3U48A 4BNWA 2XCIA 4HQLA 4OOFA 3MELA 1E3QA 2WJAA 3NETA 4U5QA 2C2XA 4WLNA 3DV9A 4WUVA 2RK3A 1EH5A 5AIAA 2VPWA 4NR0A 5HIKA 2PXHA 4RS4A 1A7KA 4P53A 4EBBA 5JHGB 4N7JA 4O29A 3A7DA 4C22A 3EEQA 2BWJA 1JB9A 4R2LA 1AKUA 4KFRA 4X3OA 2C00A