1EM8A

Crystal structure of chi and psi subunit heterodimer from dna pol iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III CHI SUBUNIT
publication title Crystal structure of the chi:psi sub-assembly of the Escherichia coli DNA polymerase clamp-loader complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 46
structure length 147
sequence length 147
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04364 DNA_pol3_chi DNA polymerase III chi subunit, HolC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold DNA polymerase III subunit chi 1em8A00
3SXUA 1EM8A
chains in the Genus database with same CATH superfamily
1XLTC 3T3GA 1QPGA 1ZRSA 2VCEA 5I7UA 3LY8A 5EZYB 5LD2C 2WTUA 5IYZF 2B83A 1J42A 1RNLA 2RKOA 2XUHA 5U1PA 2R65A 5BW4A 1PGJA 1HDYA 3UJCA 5CFOA 4C3ZA 2VHCA 1O94C 1WCIB 2PSJA 3VH1A 2DAPA 2GD6A 4TS3A 4WOCA 3A1EA 3GJXC 5EQDA 3QEBZ 1HFKA 3GARA 3KUXA 1XEXA 3TSYA 5KPJA 1GGEA 1CF2O 1X2BA 2GCIA 1LLCA 2A33A 2JA1A 2RFLA 2HPAA 4XQCA 4KQ6A 4ZAVA 2WIJA 1XF1A 3I52A 3JR7A 1HPLA 3EMVA 4WLVA 3Q2IA 2R7MA 2O2JA 4OBBA 4RGQA 4D3DA 5E7IA 1TVMA 5C8DA 3C6XA 2O3TA 3UK1A 2P0EA 1CHNA 2O05A 4JC4A 3HV0A 5E4FA 5FLKA 2NNWB 4HAYA 2JZOA 2W6QA 3M6VA 4XARA 5DU2A 5CHEA 1RU3A 3SBXA 4C78A 4DT1B 3OC0A 4Q82A 2NXEA 4JA2A 2IYQA 4DJJA 1ML3A 1PD1A 1QX4A 4RDIA 3S44A 3JQAD 1PK9A 3E7WA 4JNCA 5K1ZA 4MNTA 3ADBA 4AJPA 1VG1A 4MZXA 1G21B 3THSA 5I7RA 3FKJA 2VDLB 1IHUA 1Y48E 4BCCA 4FD3A 1NNEA 4IIVA 4NBSA 1KDRA 1MC5A 1VTKA 2PMCA 3D4IA 1JIKA 4IICA 5HQJA 3TE6A 2VJCA 3VI3B 3K0FA 1ZR2A 5IVHA 3TS1A 1KZ1A 1W2WB 4G63A 4JLPA 2GF2A 5F2KA 2J32A 3QOXA 4UOQA 2OORA 4EPRA 2NV6A 1RRFA 3K72B 4U9UA 1YJCA 1B8NA 4I2VA 1DADA 4BQRA 2RE8A 3F49S 2A92A 4L74A 5DBIA 2I1QA 4DUZB 4IOJA 1XRRA 2V7GA 4TWIA 3TTSA 2WZBA 5D7BA 1G3QA 4NG4A 3SJUA 1MF7A 5FOUA 3RFTA 4DMLA 3ZCPA 1US8B 3RC1A 1BXKA 2R2AA 2O8BB 1ST3A 2VK1A 2ALJA 3EXG2 3GG9A 3ITKA 3E5HA 3R41A 5C31A 1J39A 4MDEA 2A0FA 4AJEA 4HO1X 4UBLA 2R11A 3OIUA 5IFKA 1SOUA 4M9ZA 2GDJA 5H8WA 3UF0A 1T8YA 1X70A 3MAJA 3D4BA 4YS6A 3HA5A 3UAWA 1UXGA 2N3ZA 2X19A 3AF3A 4Y9UA 3OY2A 3IXQA 3D7MA 1X1RA 1KJ8A 2RHHA 1Z6AA 4JBYA 5KNDH 1P17A 4KR3A 4K9RA 4OGFA 2HSDA 3W6OA 4TQGA 3X1YA 5D1HA 3SEZA 3EWNA 3ZTYA 4M2LA 3GWGA 3PEYA 3DZIA 1C29B 4RTOA 1LWOA 4QDXA 1GDTA 3WKDA 1JLLB 3IO5A 2Q3JA 3I9MA 1J1UA 1T2DA 1RACA 1KJQA 2DTDA 1XTPA 2ADOA 1Y9JA 4QLAA 3N2LA 4X24A 3AKZA 1QNFA 2MYPA 4TTAA 1T9DA 3TLYA 1JHOA 3TBHA 4L4SA 5DZSA 4ND4A 4OG2A 3M3HA 3LO8A 4K2AA 1XDWA 3F8TA 3RPEA 1RZRD 1EZZA 2XSZA 3EG9A 5KDDA 2P3QA 3CLSD 4XYLA 5EIWA 1IJKA 1J0BA 4EZEA 5A4IS 5AW3A 1PX0A 1T8UA 1VG9B 1Z15A 4H7JA 2V58A 1AS2A 2FKNA 2VNHA 1YJ8A 3GV0A 1ORDA 3JWJA 4JU9A 1V16A 4FMBB 1ZWLA 3W6ZA 2XTJA 5CXQA 3G8CA 3R0ZA 3QU4A 2I4LA 3LYLA 2QUJA 2BTQB 3CVWA 1E3DA 3Q5DA 1HE5A 3I3SR 2OYCA 4YY3B 2R9VA 4UPEA 4QXQA 1HYEA 4D4GA 4FDUA 1UP4A 5F9FA 2IIVA 5FTWA 4W8GA 3W2IA 1L7XA 1EXMA 4P33A 4C6SA 1L1QA 2E6UX 2WOJA 4CR8A 4D9GA 4TYPA 1C9YA 3GDGA 3WYDA 1U1FA 1B6TA 1UAYA 1VA4A 1A9ZA 4FJ0A 2PFSA 4FWBA 5G0VA 3N2GB 5JCOA 4QEZA 2X9QA 1PLLA 1CQIA 1YOVA 4B7AA 1H1LB 1T29A 2R48A 3TVDA 4ZEVA 3O0TA 4RLQA 3OCVA 2VSYA 4RD3A 2AGVA 5AR1A 3OOJA 3HRIA 4N9QA 1MT0A 4PO3X 4AJHA 2DLCX 2IYTA 2GT1A 1QDEA 3MGBA 3QGMA 3IB6A 5D86A 2C9MA 5KNDD 1GG5A 3AR4A 3E8SA 3PEFA 2YVLA 2J9ZB 1IPFA 2VSNA 1TM5E 1V8FA 3GUUA 4AZVA 3NYIA 4UULA 5BW6B 4F71A 4Y2QA 5I6DA 1U2GC 2HK7A 2OHGA 2VLBA 1G3RA 3I39X 5F78A 2NU9B 3V1LA 4JL8A 2XDQA 4O4HB 2ATIA 3C16C 2ZAYA 5AVZA 1CNEA 1V1MA 1YK1A 4ZC8A 5C4MA 1OMOA 3CHYA 4R5MA 1ZIPA 3L93A 2VJAA 2IYUA 3FCEA 3JQBA 4QECA 1X1TA 3RVRA 2GHQA 1ZJZA 4JIMA 5FWXA 4M99A 4KO4S 3O0DA 4DUGA 5B7GA 1V1JA 4QXOA 421PA 1ZVKA 1J22A 2PBFA 4YRPA 2QYTA 2ZU0C 3ZBUA 4FMDB 4I46A 4PU0A 2WU3A 3KWFA 2WFAA 3LBYA 3H11A 3K8ZA 4B48A 3X2EA 1DARA 1C1DB 1TVCA 3ADKA 3IAUA 3QYFA 1FP4B 2IP2A 3ZKAA 1BKSB 2OHXA 4FMCB 2OO3A 4X6XA 2DZDA 4MK4A 2XUKA 4IEFB 4Q3KA 2VSQA 1XTTA 2VYQA 1SCUB 3MOSA 1OFTA 2C8JA 3O47A 2JGJA 3EQZA 3RS0A 2PUJA 2YICA 2CCKA 1OZ0A 4RWEA 5TF4A 1XRSB 3MRVA 3WK8A 2IY8A 4JOBA 1ZSVA 4QUJA 3NT2A 4BEVA 4EELA 3OAAD 5IT4A 3KL2A 1HDZA 1SHLA 4PZDA 4W5WA 1JFTA 5CDFE 1ZMOA 4RK1A 5A7HA 3G23A 2BPOA 2KW5A 4B17A 2JAUA 4LDNA 3NHPA 3NTLA 3QEJA 4OQYA 5A1JA 3B7PA 1C9DB 1G20B 2DYKA 3BSWA 1BFKA 3JYLA 3HXTA 1YE5A 2O7QA 4WADA 4MYCA 5CW2A 4YGXB 4BUZA 4A1OA 2VDQB 4XD7A 2Q3HA 4ERXA 1YZUA 5GJBA 3A4NA 1P0PA 1T36B 2Q5QA 2PX5A 2ZRNA 4DJAA 2O50A 3PS9A 4RLFA 3PYXA 4OBWA 2QP3A 2UVPB 4O2AA 2P5TB 3DPIA 5HZMA 1EUDA 3KYCA 3SIRA 1M67A 5LD2B 4BPBA 2GILA 1Q5PA 3GO4A 1D2EA 4L9SA 4S0XA 5YASA 4CM5A 3T7IA 3X2SA 3UWDA 3VSAA 3AIMA 4BLWA 3T9AA 5LJLA 1FYDA 3BREA 1HQCA 3OZRA 3SXUA 3C24A 3AJ9A 4HB2A 1KI6B 1NN3A 3IV9A 3STTA 2R5FA 1AUQA 1HT1E 2QF7A 3KZXA 3L5OA 3U9TA 2G9VA 1Y6ZA 4WIAA 1BS2A 2WUVA 1R0LA 5ALEA 5AVUA 2G1UA 3BWYA 3SDBA 4G2TA 1UKVY 1DC8A 3THRA 2OEPA 2CNWD 2QGFA 2Y1FA 4WY8A 4O2LA 1CERA 1N6RA 3ZPXA 1JSZA 1Z5VA 3UM9A 1WDTA 2YYYA 1FBTA 4K87A 3NBZC 1EVZA 3PD7A 1GILA 3GJ7A 4IV8A 4ZALA 2OHJA 1ZD3A 4ZRMA 1E58A 1NLFA 1VRWA 3RHFA 2GZAA 4IGAA 4IDCA 5SZIA 1FDVA 3Q4GA 3TOZA 5T5QA 2PRYA 3RRMA 2FWAA 1KFJB 3ANMA 4AB1A 4Q1VA 9ATCA 4MV4A 2BFDA 1UQUA 1DKQA 4IDOA 1P0QA 2H31A 3J81k 2JGKA 1XG5A 4KMRA 2BT4A 4MRPA 4QPZA 2VAVA 1C4KA 3IEXA 4RC9A 4HZGA 2HU2A 2YZGA 5IM5A 1W4LA 4IG4A 4GZ6A 5TQVA 4D2IA 3JQEA 1DQZA 1M2WA 2QLMA 5AOBA 2OAP1 2NPFA 2PQ2A 1RIIA 3IJRA 3DE1X 2A1TR 2BC9A 4X44A 2B6HA 4Y3UA 4PFKA 1UCFA 3Q8XB 1W49A 1E69A 3L79A 4I4NA 3NGLA 3CZ9A 2W48A 2OECA 1EDDA 2JJYA 5C7LO 3GLFE 1NXWA 4PY2A 3UHJA 1WX1A 4JLWA 4EEZA 1CB7A 2CUTA 2D0PB 3CY6A 3BPSA 5J2TF 1H93A 3RHSA 2OESA 5CEFA 1S2IA 1DXYA 4FHEA 1DP4A 2WSMA 4MUHA 4R84A 1VMIA 3RTBA 1RI3A 3CR8A 3SGLA 2C4VA 3MJCA 3UQZA 1GZHB 1GFZA 1JDJA 1BGXT 2IEAA 2ZQYA 1JWBB 5TT0A 1KDOA 3OIVA 3VFDA 4OU4A 4NXNB 2COEA 1EK0A 4AMYA 1I1QB 4TMKA 3VTZA 4A2PA 4ZPJA 5KTPA 4D4MA 4QUHA 4QLBA 1N6LA 1RI2A 2F3RA 3CEPB 3VKFA 4D96A 1CQJB 3PVZA 2VYCA 3MEQA 4DUYB 3OBBA 4BMDA 4CIVA 5KQGA 4Z0PA 3ONEA 2ZLBA 1VHTA 1JDVA 5KHAA 4OKIA 1G9SA 1J21A 1C30B 1DIHA 2Y1CA 1IQUA 1FFWA 1X9HA 3RBAA 1JXAA 2UUPA 5KSZA 3TXAA 3V6LA 2I3DA 3O8BA 4FCTA 2JL1A 3ABZA 4B40A 1ZC3A 1C2YA 3RRFA 4J2HA 3KPVA 1VM6A 2YXLA 2J0EA 3GMIA 4LJYA 5K3CA 3WK5A 4BU0A 4OHPA 5BO5A 2A5FA 3AG5A 2BYTA 3JX9A 5D3KA 2WP8J 4ZGBA 4AKHA 3L18A 2CFTA 2VOEA 4D3SA 5KYGA 5G0WA 4LF6B 4H3HB 3BWMA 5IMBA 3RODA 3ZU3A 3WRYC 4JBXA 2AUNA 1WDWB 4WFJA 1OI7A 2EJUA 3I5YA 1TRHA 3KZNA 1QRUA 1XX6A 1TVKA 1Y7PA 4DADA 2HJHA 5FNVA 4ENQA 3VNUA 2BMAA 1QGOA 3TLCA 3BM5A 2CJPA 3P0EA 2X58A 1Z18A 3TGLA 3MMNA 3OQJA 1Q44A 3FRIA 4NEGA 4CM9A 1V4BA 4IZIA 1LSUA 3U7HB 4JI4B 2P75A 3SFVA 3TLJA 3RRBA 5KHLB 3ZWPA 1XTKA 1OLSA 3VOAA 2WYIA 1H0SA 1NATA 2D54A 2Q1XA 5HEKA 1OB2A 2O52A 4EJMA 3EDOA 4TTRA 1W5EA 1AZLA 2C57A 1Q92A 1Y34E 3A6DA 3ZHYA 4HFJA 5EXDA 1H22A 4HEA6 1VIDA 2CC2A 1TGYA 2GR9A 4IHAA 2GFIA 3UK0A 4AWAA 3TECE 1E7SA 1Y9AA 3BMQA 3BXXA 3ORYA 5BSUA 4Q4DA 2EJTA 4NMWA 1QYCA 3OMXA 2FN3A 3QWIA 3TZKA 2A0UA 2CWWA 3DTVD 2JF0A 5C52B 1A1SA 1A5SB 1R5NA 1E1MA 1SCNE 1VL1A 2D7CA 1U0TA 1BW9A 1L9KA 2FPMA 3HBAA 1I5EA 1M2FA 3HE3A 3PENA 3NBUA 1J9GA 4ID3A 4QYTA 2R79A 3GF4A 1JH8A 2OV6A 3K0HA 1OXMA 1I0LA 1HO3A 3PLNA 4L8YA 2IRWA 4YMWA 5EJMA 1UBTS 3T06B 3E15A 2CXQA 1IMOA 2G88A 3I2FA 4EJSC 4FJ1A 1PV4A 2H1IA 3SS7X 2X9VA 4RHXA 2DTXA 2YTZA 4BQNA 2VWQA 5FEUA 4LFCB 1J8MF 3O8OA 2BFWA 4TKLA 1N9ZA 4BNLA 1AXEA 3D6UA 1JSXA 3KQUA 2H48A 2C95A 3I34X 5EE1A 1P4SA 4IXDA 4PVDA 1GN9A 4M9SA 3BHJA 3CH7A 3AXSA 3CRZA 5E9WA 1KBZA 1YKGA 2GZ3A 3IQFA 2I7VA 4GNKA 3GJYA 1D3AA 3RV4A 4E14A 4RQBA 2XYGA 4Q4AB 4DY6A 5LIRA 2OV4A 4CZ2A 2PMEA 1KPGA 1X87A 2PBZA 5FRDA 4Y30A 2JLVA 1KO4A 4QU0A 1F9AA 3TLKA 1MOSA 5K8JB 1Z26A 3M8KA 5C1PA 5TV2A 1KTVA 4UBJA 3HR8A 3BH7A 4Q18A 4YHBA 4NTZA 3EZYA 3G1WA 4ENRA 4MKFA 2CKDA 4ID9A 4XDZA 5IPFA 2Q7DA 1GTVA 4MW2A 2XNCA 2MMGA 4F0JA 1SOMA 4YT5A 3NUZA 4XDHA 1Q0HA 1QG2A 3GOHA 3UT6A 2ZVQX 1T10A 1N5LA 3TB4A 4EF4A 5H02A 1MVOA 1L5VA 4Q6BA 1TJ3A 3TIGA 3UEOA 4HB0A 3HYLA 4J8PA 5CB6A 4XSVA 3UB2A 1RKQA 1WVIA 5BN5B 1GNTA 1NJ1A 5TGZA 1K8XB 2ZW9A 1N9KA 5HJ7A 3BWVA 5I8PA 3R8XA 1UT8A 1BN6A 2YFYA 4E5MA 2PRJA 1MV5A 1U2DA 5CDUA 4FYMA 5E7JA 1EVQA 1XA3A 5D6OA 1E3SA 1QANA 4HLUC 2R7AA 2PVCA 4MW1A 4ZO8A 2FEOA 3H8VA 3N8IA 5J5CA 3LQ2A 1UT5A 5JV5A 3ZNOA 4BGVA 1IXKA 1HEIA 5GIPE 3AB3A 4YMVA 2Z2JA 5E38A 1C9EA 1NI3A 4BKRA 4CMEC 4DLVA 4E13A 3WY9A 4EKEA 2CLKB 2J9GA 2G36A 4MEAA 2CYCA 4ZWNA 4WN9B 3NYWA 3SYNA 4JSTA 3O03A 1MKYA 3ANTA 4AFNA 5BSGA 5EIEA 4KITB 2AFHA 3QPWA 2ENWA 1Y3AA 1RE1A 4EF5A 3NO4A 1P91A 3QLVA 3ZE6A 1Z2CA 5A4KA 4R7GA 3UCEA 3NRCA 3OIGA 4DWWA 5EIBD 2BEUB 5TS2A 4H6WA 2E4YA 4CHGA 4LRQA 4EQ6A 2H4WA 4Y1RA 3T1QA 1NG1A 1W44A 4F3YA 2CLFB 1TKBA 4AW9A 1ZA1A 1T3HA 3PBKA 4GZLA 2WKPA 3PXCX 1V0JA 1KJNA 3X1WA 3IX7A 3ESDA 3PXBA 2ZROA 2HNKA 5EIHA 3PFFA 2OPHA 4LY3A 1RXCA 1TF7A 3OTGA 3NH6A 3V34A 2WZDA 3WL6A 1U28A 1T2FA 5DM1A 1R0KA 4KWIA 2C7GA 3R40A 4BLTA 3GEMA 5LLSA 3CEJA 1HZZA 5F7XA 3JW8A 4NK4A 1JW9B 1MX3A 1SURA 3MWDA 1Z16A 1T9BA 3FVQA 4Q03A 1IHYA 3LM8A 2WIBA 1DAGA 3CW2A 5MFPA 3JV7A 1AK9A 2JAHA 2Q21A 1QF9A 1Z75A 1U1EA 1XMPA 2QAJA 2W2OA 2FMKA 1FYWA 1NI5A 4X5OA 1JJ7A 1OI2A 1OWPA 2EIHA 5AMXA 5FPSA 5LZ4A 4R40A 1FLDA 3BHMA 1X1EA 2XEXA 1XAIA 3DT9A 3B70A 3V8VA 5HTKA 4GOJA 4KQ9A 3GRFA 1S4QA 2DX7A 5FWAA 3A2NA 4BLSA 3VO8A 1PJSA 2FG5A 1SA0A 1K98A 5JHGB 3ERCA 3THYA 3ZIDA 1F1JA 2AOXA 2CL0X 2EW1A 3DA8A 4Q3BA 1U8TA 4XEUA 3OZIA 2QAIA 3WRXA 1P7PA 3EK2A 1KRHA 4BMPB 1HKUA 2ASEA 4I66A 4KWCA 1SVWA 5B3AA 5BT8A 1NVFA 1U8ZA 2IA5A 3U5ZB 1O4VA 3GA5A 3HYNA 3B1WA 3IAFA 5FI3A 2ZCJA 1DRJA 4RL6A 2MINA 3HI4A 1EM8B 3GZ4A 3K92A 3SSNA 3UW1A 2IEBA 4IM7A 2G1KA 1O7JA 3VAAA 1FP2A 1H3NA 1M6YA 5FTJA 1KFKB 3QPVA 4PYMA 1QRTA 2F4VB 2BR4A 3VNBA 3W1EA 4D8YA 4XQGA 2OZVA 1T0HB 4AO6A 2L18A 2Q5HA 2DSTA 3A9RA 3H5OA 3PZBA 2NWQA 2QQ0A 3VR2A 1FP7A 4RTQA 4EW6A 1M1YE 2WT9A 5I7HA 2UYCA 5CVDA 1H05A 2VDVE 2ZZKA 3THOA 3W5SA 5DF1A 3PX7A 4AKIA 1E0KA 1GADO 4DCTA 3PWSA 4LJ5A 1B8OA 2QU7A 4CQMA 3L6OO 3LH5A 4GBMA 4Q24A 5AIBA 3GR6A 1DJLA 4X3PA 4RJKA 3GNTA 2WVAA 4WVFA 3ZGOA 2G5PA 1NHGA 2CV1A 3WFIA 3ZIAD 1KPIA 2LCQA 2INGX 5B4UA 2Z9CA 2WV7A 3IPLA 4MVCA 4ENUA 4ZANA 1EFPB 1BDMA 4H0CA 5K0TA 3IIEA 1L4MA 2GTIA 4ZOBA 1EX6A 4DWOA 3MWEA 4PZZA 3ITDA 1WMDA 3ANLA 4G1FA 4LHEA 1JBEA 1YRAA 1ZDMA 2Z6VA 3O73A 4HDQB 4LXYA 3VSEA 5BN1A 4C1NA 5J23A 5M2QA 3PC2A 3CUSA 4ECAA 4CDRA 3C3XA 1Y7LA 3OZDA 1RTTA 2PL5A 3IAS6 3BG5A 1N1DA 4JZYA 3WGOA 2C2OA 3OHMA 1W30A 3UTCA 1AN0A 1OH7A 3ETDA 3X44A 5IM4F 1DRVA 4G24A 2WFZA 1NU6A 1HLDA 1WXDA 5IK2D 3MOGA 3M9XA 2H1FA 3DZKA 3G02A 4CMAA 1IOLA 3ZTWA 2P68A 4RAQA 1KQFA 1SQ5A 1Z17A 3JVEA 1NDUA 2WSLA 4LSZA 3HJNA 4DBLE 4E4RA 1NUAA 4XFDA 1BAPA 1HE1C 2Z98A 3EH1A 4FGJA 2ZTVA 4JB2A 4GGPA 2CBZA 2B4KA 4B4VA 1BQ4A 1P61B 4B31A 1LVHA 3P9RA 3ANSA 3D5TA 3AT1A 4EYKA 1E8NA 3FWZA 2ZITA 2IBSA 1QJ4A 1YR8A 2OB2A 3G2JA 4LWQA 3U7GA 3JD2A 2QRLA 2H2FA 4E22A 1U2EA 5BR1A 1B16A 2I54A 5D7NA 4EJSB 1A5BB 4LX0A 3IDFA 2YJ5A 4A82A 3T3PB 4UW9A 5F3DA 4CTKA 4F86A 4AUNA 3DTTA 1TLTA 1YD7A 1PNOA 2X8BA 5CB0A 1LFDB 2W6OA 2FN4A 4QTZA 3IIJA 3NKLA 2P2LA 3OWHA 3WL3A 3PNSA 1VJ0A 3DCNA 3EY4A 2YV1A 4PC1A 2YWGA 1BDBA 5L45A 2QVZX 4JKYA 4FFBB 4UAUA 3ZHXA 1YRBA 1SG0A 2V0GA 4LCEA 3WYGA 1I0ZA 3W1WA 1X92A 1QIDA 3DLHA 3WK6A 4ZYZA 1KL7A 4HEQA 3SQMA 4AP9A 1Q1GA 3LWZA 3P2KA 5K01A 1N2GA 2VRNA 1Z07A 3G7UA 1CETA 1N6PA 1SAYA 1Z0AA 1Z5PA 3A0UA 3H0KA 3JWIA 5ED0A 4XWKA 2A2ZA 2XAUA 2CEKA 2DHCA 3H0EA 4JMLA 1T6ZA 4KCGA 4KIJA 3NBAA 4X1IA 4E5NA 1D03A 3Q0IA 5CD9A 4S05A 1DTWA 4HC4A 4M1QA 2QR5A 1NWCA 3TCXB 3IJ5A 3QF7A 5ANRB 1T1RA 3DTNA 2BBSA 2Q3DA 3RYFA 1R0SA 2DHQA 4TQUS 5DHRA 2W8BA 3ESCA 1EINA 1GSHA 1WHTA 3FHLA 3UWOA 2R6HA 3L07A 2EKDA 1MMFB 3ETLA 2JAPA 3ANNA 4BKUA 1A8UA 1WZNA 1AKVA 2IUUA 4JV5B 2AW5A 3N05A 4KXYA 1ORTA 3IA7A 5AHXA 3GP5A 4BNDB 1YA4A 3M6WA 3AF2A 5T8KC 4R1PA 3ABSB 5EKXA 4QLOA 4R1LA 2YIMA 3MD9A 1E66A 1EUCA 1SIUA 3CM0A 3Q2OA 1K8QA 1VDZA 1ZUNB 1TMYA 5A0FA 1ZY2A 3FGZA 1BD3A 3KDAA 2J6HA 4ZHSA 1I4WA 2JAOA 3JAWA 5LM3A 1MVNA 2VRCA 3L04A 4IJUA 5FBRB 2H16A 5HYVA 4PXAA 1R0ZA 2XCQA 2HSEA 4KXMA 3RYHA 3WHKA 3X2FA 1EBFA 1Z4QA 4MUJA 4BTEA 1O9GA 1TZMA 2V7QD 4UKDA 5AJXA 4TROA 3KZOA 3HYCA 2HMUA 3ZLJA 2D0OB 2C9DA 1C3EA 2BP7A 3WR5A 4G0YA 4YDRA 3LLUA 2R6CA 2HI0A 1QPBA 2X8LA 3EWIA 1U6KA 4JL6A 1H3EA 3LRTA 3RFFA 2HZ7A 3CLHA 3ZWOA 4TWBA 2XZOA 4RTRA 4F4HA 1Z5OA 3W5DA 3OBIA 1JALA 1V41E 5LA6B 1M2GA 2HSZA 2VBIA 3ETGA 5AKZA 3N28A 4DC9A 4ZK2A 1VIAA 3QPCA 3K2BA 2QM0A 2I1LA 3D1VA 1OKKA 3N59A 3ZE2B 3NRBA 2JFOA 3EA0A 3KXLA 3LCJA 1QV9A 4J3NA 3ND5A 4U3JB 1SBYA 1VKJA 1QHHA 2GZSA 3AX6A 2GCNA 1DCFA 1JFFB 3ADDA 4IIFA 4BX8A 4CIYA 3FUCA 2XNSA 4KRGA 2WY2D 2Q5OA 4EKNB 1Q84A 1Q0SA 1TEVA 2Q0XA 2HA4A 2XDAA 2XA2A 5EJIA 2E37A 3B78A 2PX0A 3D3EA 4NJEA 2A5YB 2BFPA 2YW9A 3BC1A 3DMYA 4TKVB 5FR1A 5FQOA 3LPCA 5JMPA 2L19A 2X22A 2CLIB 2IHNA 3A4YA 3VJRA 4J49A 1I1HA 2D1YA 3ZD8A 1R50A 3G8AA 3TW8A 2Q0QA 2ZOSA 5LZ7A 1X1BA 4CEHB 4MAMA 1YA8A 2BKAA 4RJLA 5EESA 4A6DA 2EATA 3FOAA 1C14A 2FOIA 2IBMA 2GPBA 1RFLA 3Q7EA 3QWFA 4IFBA 3PG5A 1USVA 2ZRHA 1W75A 3CVOA 5GJCA 2X2OA 2Z4TA 5EUCA 3WE7A 4R2LA 4CL2A 4XB6B 2FX5A 3LNCA 1PRYA 3E2MA 3NDIA 4DQ0A 2B36A 1QO0D 1UINA 1XTJA 4MCJA 3TKLA 1JLKA 1H23A 3DFMA 3ODPA 3FB4A 3CZQA 1MO2A 1XKTA 4MVWA 4YP7A 4AO8A 4HX5A 3W9UA 5FAKA 3FVWA 2V7WA 4NXMB 4QOEA 4KXXA 3HRHA 1JI3A 1B73A 1SHUX 2WIDA 3IR6A 4EK9A 4XGRA 2O0HA 3DSRA 3IUBA 1V48A 4BL5A 4O2BB 1UMDB 4DMMA 1KYQA 1NW8A 5KMGA 3U1BA 5ALUA 1FFAA 4C4XA 3JATB 4P4TA 3R5SA 1ZIXA 3RKSA 5I48A 3HXLA 1YQXA 4ERNA 1MDBA 3T3NA 1RQXA 2X0NA 1UFKA 4GVLA 2KS6A 3FAKA 1H5QA 2OPBA 5DTIA 4BWFB 1GGHA 2B8JA 2GM3A 1NY6A 4IBOA 3WIUA 3GN1A 1F2UB 4MWZA 4NMMA 3WQHA 4H6VA 4WCFA 4G5YA 4HP8A 4V0SA 1UBMS 4WNIA 2BDEA 5BQXA 2QRZA 1K8ZB 5LYJA 3ZV5A 2RMKA 4OSEA 1U02A 4M9XA 4XEHA 1BMQA 1P2BA 2XOXA 4B8ZA 2HT6A 3BXGA 2ZBEA 4CQMD 3NVKI 1VIYA 4JX8A 4IJWA 2AX4A 1DINA 3L82B 3QJGA 2EJCA 5ALGA 3IQEA 1VL5A 1THTA 3D02A 4INZA 4WNYA 4K9NA 4KO3S 1W2HA 5FOQA 2QPLA 3CSDA 3LFHA 4B8WA 1XVLA 1NC3A 5HVNA 4A5OA 2JVIA 4Q1CA 1LC3A 4XPZA 1Y0BA 2VT7A 3KLNA 1J49A 1G7SA 4KWHA 3KKKA 5CXXA 3EF1A 3L0BA 2FSGA 4BX2A 5EGNA 1ZJYA 1FOEB 3OQHA 4RLHA 4L2IA 1QFXA 3PICA 5AKLA 5A7GA 4PRYA 5GADl 3QFCA 4BKOA 2D13A 1T26A 2WD7A 3EGDB 2AIRA 3A4IA 4WMLA 1GD1O 1SZPA 2BHLA 2O8CB 1U7DA 3RS2A 3WWCA 2HPHA 5EHIA 1HRKA 1A9RA 3WKCA 1KYVA 4DREA 2BFFA 4F2DA 4RBNA 3EAGA 5KWJA 1NURA 1XHFA 1COWD 3Q7RA 2BI7A 2NZ2A 5JAUA 4X60A 5JRJA 4JWTA 3ZDZB 4HDAA 1PE0A 3LPNA 1EWRA 2JIDA 2RCNA 1U7XA 4UNNA 3EIXA 4ZI5A 1V3TA 3V3KA 5EERA 4NR0A 2H4XA 4GLLA 4ND2A 3WNDA 4PYQA 3MGGA 1HEYA 2HWYA 1WMEA 2AUTA 4PLGA 3PWTA 3ZK9A 3C97A 1J24A 1IQ0A 2Z4SA 3ENQA 3GVIA 3NMUF 1RQPA 3GRKA 5C1DA 2GD2A 1FP6A 2JK0A 4K9OA 3ZKWA 1N32B 4AZWA 2WZQA 4LXXA 4QWMA 4C04A 1J70A 4J0FA 3VX4A 4TMXA 3AW9A 1C3XA 1L5MA 4Z1MD 1ZNWA 1DIOB 4QVKA 4BY9E 3A11A 1E1CB 6YASA 4DR7B 2DFVA 4KXNA 2BFEA 4EG5A 1ZICA 1FRFS 4ITVA 4Q4HA 3RABA 1A71A 1H8EA 3FMOB 5B58T 1E5DA 3BMOA 1Y5IA 1GSAA 1HTWA 1TO6A 4EG4A 1EZ4A 4EFLA 5BWOA 3ASZA 3LOUA 4E07A 1PGOA 3HZZA 1HI9A 3VA7A 3DM9B 4BAZA 1P33A 1FZQA 2OK8A 2Q9BA 4D9BA 5ER6A 4DM4A 2I65A 4IVRA 4IDNA 2VTDA 4K9SA 1XYYA 2CJWB 2D06A 3BGIA 1YVUA 3I9V1 3V8EA 4ROSA 1O89A 4BZWA 2WWXA 1K7CA 2FRXA 1WXGA 2IUEA 2XMSA 3GEGA 4N7JA 2D1QA 3EPJA 1NP7A 2C2ZA 4CL0A 2AD5A 2B1RA 1I6KA 3H2GA 3DV9A 3K3PA 3L7OA 1QV7A 1RIFA 1T3SA 3OCJA 4GYWA 4HXYA 4ZEXA 1ESEA 1JJBA 5L3ZA 3REQB 2EJWA 1A9YA 3I2KA 5JJIA 3QJYA 3SBOA 5KSPA 3CNNA 1K7FB 1O97C 3BXEA 4GD3Q 7AT1A 2QMQA 3B36A 1R64A 4M88A 1CHDA 3Q1LA 3AUYA 5B5SA 4HZUB 1NXXA 3FJOA 2GVNA 2I7DA 5I5GA 1ENOA 1W25A 1X7DA 5AOAA 3P71T 4AJNA 4YI3A 4LXIA 1JDSA 3QLUA 2YV2A 4FZ3A 4RXUA 1TD1A 5IVIA 3VYTB 5C53B 1V3VA 4D6YA 3BA1A 2ZIXA 2ECOA 2DH6A 3HACA 5IUKC 1NBME 1QQAA 4BECA 2CJFA 4MWCA 1E6CA 721PA 3WK9A 4Y6QA 3STWA 2O1XA 1XELA 3ZDBA 3TLGA 3VDRA 5FL3A 4DLPA 3IE1A 4XSHA 4EI9A 2QMOA 4LFBB 3QFRA 4IS2A 3GRVA 5F52A 2HLPA 1KYWA 2WMDA 2HQBA 2FFBA 2ZSFA 4RSMA 3VDQA 4F85A 4F4CA 4QOGA 1AO0A 2B21A 1P9LA 3GD7A 1TT5B 4FINA 5JIBA 2Z8ZA 1JB1A 1JP7A 1O6BA 1TMKA 2FOXA 4D3YA 3U61B 3WNVA 3F2IA 2QMYA 4YRJA 4YUWA 6CHYA 2VPTA 4N01A 1IXZA 1XWFA 2KSQA 3CURA 4I6JA 2C54A 4P0QB 3NUGA 3H97A 2ETVA 4L51A 4ZVPA 2J9FB 1SUBA 3L6UA 1JVNA 5SZKB 2IWHA 1ZD2P 2XV1A 1NR7A 2AG0A 2X6QA 1CP3A 4W9MC 1U0LA 2OCDA 3GGGA 4YAWA 3DMGA 2NT3A 2P11A 5JJLA 1OI4A 4DKJA 4V0LA 4W1PA 3G2IA 3ZI4A 2P9ZA 2JLAA 3I6QA 3DVRX 1DB3A 4XTRA 5M3BA 3OT4A 2YC4C 3W8RA 1F7VA 1V3QE 2YWJA 1SUAA 1JSRA 3RSHA 1KI4A 3WDMA 4J1SA 1QDUA 1QZUA 4F7WA 4YC7A 3WGVA 5AVTA 3FWYA 1YGYA 4LC1A 3MMPA 5CA1F 4OQZA 1MOZA 4YCJA 1EGMB 2XVAA 3KPUA 3C2QA 4GM1A 4L85A 1PCXA 1E8DA 2HBRA 5K4HA 2DMRA 3LGSA 2OBLA 2H4JA 4NZ9A 4LGMA 1GPDG 4RVNA 4CM1A 2KE5A 3EOBI 1E2KA 1W5TA 1YMUA 3AI3A 3DBIA 3ZI7A 3JR3A 3VPSA 3QI7A 4QQFA 3FBTA 3GRZA 2WA2A 4R1UA 4Q3DA 2HUPA 4NY1A 4YRBA 2R44A 1BHJA 4CHTA 4NQRA 4IJVA 3W8DA 2OO5C 1G8KA 3K8OE 1QHXA 3ZVRA 5CB8A 5AKIA 1NXOA 3C39A 3OZWA 4L8GA 4ZQHA 3VJLA 3KPWA 1L4UA 1GGNA 1FFCA 2OWEA 4UFOA 4CKWB 1DDIA 2BELA 5LYJF 5F12A 2PN1A 1LVUA 1NZJA 3PFWO 5TPZA 1GUAA 1XAGA 5AVOA 4AT1A 1T4GA 4TRMA 1UM9B 2AW3A 4NBNA 5E1MA 3STHA 1YS6A 3FJ1A 3KOXA 2QN7A 3N2NA 3UWSA 3EYAA 3B6EA 4G1UC 1U9IA 3K2EA 3L6DA 1XQYA 4YAFA 1XU9A 1H2FA 2Y6VA 4N5IX 4YIHA 1HMPA 3NM6B 4I4IA 5AW0A 3QA3E 4OXQA 1X8XA 4QDTA 5CCBA 2OCXA 1X7XB 4LBZA 2UDPA 2X6TA 4MKZA 1B74A 1MH1A 3T7EA 4EWLA 3AP3A 4X90A 3CNBA 1W4AA 5AOVA 3K9LA 1C3LA 4QDZA 4LV6A 2EKLA 4PYRA 1A7JA 3VR1A 1JVBA 2ZI7A 1PNVA 2QWXA 3TRJA 1WOMA 4YUVA 2Q2NA 3EGIA 2PH5A 1EUZA 2C97A 2RGCA 2Q4BA 2E4XA 1LCIA 1A50B 1MEEA 4GICA 4WLFA 1H42A 1L5NA 4FWIB 1E1KA 1Q57A 4Q37A 4EVSA 2G7ZA 3R4VA 1ADFA 3V55A 4F4DA 1E9EA 1IN6A 2A14A 1WPGA 3COPA 1ZN7A 3ZDFA 4DHEA 4EYEA 4ZA2A 5LNK6 5MFZA 2BWJA 2BSXA 2PGIA 2NZ8A 1KWGA 3RIGA 3G8DA 4GP6A 4G5XA 3HCWA 3H18A 4EBBA 5E3HA 2EX0A 4DQDA 3GXOA 1QYWA 1W73A 2WFLA 3DHYA 3F4BA 2Y1OA 2BMDA 2JGFA 3NOOA 4NOJA 4FX2A 2CF6A 5L51A 1FJXA 4PQEA 4L9RA 4TS4A 1E3IA 3JWPA 1L4KA 4MKIA 3ZWQA 2W6ZA 1NX9A 1Z6XA 4PHTA 4EO7A 2BCGY 3C3DA 4YLYA 1Y98A 3FNGA 1GTG1 4HGRA 3F74A 5ARDA 4WBXC 5IKOA 4GZMA 1GOTA 1OE0A 2IV3A 5B6PA 5JSQA 4ZVVA 1C2TA 4BLPA 1TQ2A 7ADHA 1XK6A 2FLKA 4MYTA 2Q2VA 4RJIA 3PR1A 3K20A 3J7TA 2IQ5A 3L7DA 4RFSB 3GDWA 1N4DA 1EYZA 4I5DA 3SI7A 4UXHA 4I2NA 3AKCA 5K3FA 2HY7A 1PG0A 3G5LA 4HEHA 3K2IA 1U8XX 4BNIA 4EF6A 3UBTA 2CXUA 1TJYA 4KUEA 4B85A 4IWYA 4V39A 4GBGA 1MJHA 1R16A 3LOPA 4EB0A 4GT1A 5B4VA 1VMAA 2ZS9A 3CSSA 3FD8A 3T7SA 1J20A 3ZLVA 1F3LA 4B3JA 5E6SA 3RC3A 1P6QA 1KOFA 1OFUA 1SHTX 4HH4A 5COBA 1E9FA 1I9CA 4JYMA 4HH3C 1T1EA 3C98A 3BDIA 4J9UE 5BV8A 3CE6A 2IZ1A 3C6BA 4JLNA 4TTQA 3GG2A 1U65A 3PJRA 3O3OB 5BRJA 5IJZA 3QKSB 4B6QA 1ABBA 1AS3A 1ZR4A 1JL3A 4JC5A 2R2GA 3NHRA 4ZMSA 4GWGA 5EZ6B 4KVAA 4CV0A 4YR7A 5IDWA 1YB6A 3PNQA 2Z3ZA 2OAEA 5BSFA 3N2ZB 1FLVA 5AICA 1XMIA 3A9VA 5KWIA 3MELA 2H52A 1R5JA 2GQ0A 3PNYA 2CT8A 2O8DA 4ILEA 3SM9A 2JGDA 2OZLB 3AUTA 1L1EA 1P2GA 2M1ZA 3A9UA 2FSFA 4G5QA 5C35A 3ZJUA 4J7UA 4LDJA 3PB3A 1GTMA 4LHSA 3WB0A 5HCNA 4F2GA 1KY2A 1R4MB 1JIQA 5E9AA 3M3PA 3FHTA 1ILEA 3CGGA 3HCFA 3W5BA 3NWEA 1Z8FA 3BD6A 1GPMA 3CFYA 4QXMA 4QYXA 4TUYB 5LWHA 3OQNA 4L5JA 2HF8A 4WY2A 3SNKA 9GPBA 2BFAA 4URFA 1VJ1A 1JPVA 2PGXA 3SXPA 1VPDA 1OFGA 4EARA 2H2IA 4HQ6A 4ZT4A 1TAHA 1AV7A 1J23A 3IUQA 5FO0A 1RCFA 4DAEA 2JLWA 4MJLA 4FM9A 1GGFA 1ECPA 1LGYA 1NYRA 1P45A 4RX1A 4DSTA 4RHEA 1ZCJA 4EYQA 1N8KA 1PIWA 5B7NA 3DDUA 4AMVA 4LF4B 5ESRA 4YCCA 2O5VA 4PAOA 4AQ7A 3AOEA 4GR4A 1VZ3A 4DXHA 4KQCA 3TRHA 3HKCA 3QVJA 1N3LA 3G6KA 5SY9A 4M22A 2AEFA 1L5OA 3E9CA 2J48A 3ZY2A 2X13A 3F9RA 1YQDA 4B6RA 3C3AA 2G3YA 3EGCA 4WESB 3P0JA 3CZPA 2CBGA 2EZ8A 2J1LA 4M6WB 4TLCA 2JIZA 1KOJA 5JRZA 4MTLA 2IYVA 3KD3A 4P54A 5FX2A 3QOWA 4N7RA 2QE6A 4JLVA 4KI0A 4MA4A 4G26A 2J6BA 5JSZB 3BILA 4XLLA 3OHPA 3WQRA 4FBLA 4I6EA 3VHQA 4F9GA 2Q3MA 4QATA 4TMVA 1RCUA 3HJUA 1YBAA 1IY2A 2V6BA 5DHQA 1Z34A 4N8EA 4GSYA 4YXWD 2R1ZA 4OIMA 1W0KA 1YHZA 1F0PA 3PUYA 1ANKA 1P80A 5DYGA 1U2ZA 3DBLB 3HH8A 2OV8A 3BORA 2O2DA 3D54D 3TLMA 4TLAA 2BAGA 2GEUA 3AJ8A 3D7RA 4HF7A 2AJBA 3L02A 3PQ5A 4MVJE 1U0JA 3LBIA 1RD4A 4OHKA 4N5NA 3EA4A 3H65A 4MQMA 1V6SA 4TXHA 3TXXA 3VZRA 5BVGA 5LZ2A 1SKMA 4G97A 2F8MA 5HUQA 2PSEA 3E3AA 3CXRA 1LQUA 1NMSA 1U2RA 3NW9A 3FWPA 4XTCS 5JCJD 5SY4A 2OSBA 2X8JA 4ND8B 3FNEA 4LBYA 2BRUC 4YUXA 2J0UB 4ZO7A 5BMVA 2J33A 5BPFA 1PZMA 2I9PA 3ZDRA 3TTVA 4B5KA 1U7HA 5HKOA 3K7EA 2BUCA 4AO7A 5DGTA 1ISMA 4QJ4A 1XZQA 1Z22A 3CMCO 3W05A 3L4BA 4BAUA 4IRMA 1IIBA 2P0YA 3EOAI 4B2IA 3GELA 1JHMA 2JS7A 4AP5A 1SXQA 5BV1A 1FLAA 1DLJA 3DVSX 5B7QA 3ABQB 1NZFA 1M5UA 1PT5A 4KHZA 5DI3A 2MYTA 5JSKA 4DEYA 3IXMA 3M7IA 3UZUA 5JPIA 3A1NA 5K6AA 3CUYA 1Z88A 4R7TA 3B3FA 1SU8A 1CJCA 1QGYA 4BRZA 4E5DA 3UGJA 1OH8A 2LDXA 3NKFA 4N8DA 2ZI6A 4JT8A 1RE0A 5DPMA 5JSHA 4RZQA 3H86A 4KE8A 4QXRA 4KPYA 3L0CA 3BQMB 5JECA 4RETA 3K9WA 5ALHA 3S1AB 1N34B 2H5IA 2A67A 3L4SO 4A6EA 3KO8A 2WD8A 5HF9A 2AR7A 1H65A 1XJQA 3P2MA 3U62A 1ZEMA 2PYDA 3PTAA 2IEDA 1ZJ6A 4TWZA 2XKJE 1DOAA 1R4ZA 2EARA 2XTMA 3VTFA 2P8SA 5BSMA 1PFYA 5BQPA 4FI3F 2IZOA 4PZAA 2AEMA 3IO3A 5JD6A 5CDFA 4TSFA 4Z3OA 3HO1A 4IIJA 4GX1A 1VJCA 4K6HA 2QVGA 1QBGA 4UDYX 2OK7A 3OLQA 1Z0FA 3WQBA 2GCOA 3UK6A 3SYMA 1ODFA 3H19A 3RFUA 3S5JA 3K0SA 2WICA 3MWGA 3UA4A 3S40A 3TRIA 1RJEA 1P3DA 4KPUA 4P1ZA 3CZAA 5GAJA 2H1LA 5CCDA 3H1BA 2VAMA 5A9RA 1DZIA 2ZXFA 3KKLA 3E8MA 4KBFA 4L08A 1QU2A 1TUBB 5HK9A 1E79D 4Y9DA 4FGZA 4Z8YA 3AF5A 3UFXA 3G9UA 1KZ6A 4KH0A 2F7SA 4RE6A 2UYQA 5DEOA 1KBOA 2R7LA 3HDGA 3IMKA 4G5GA 2FMHA 1LFAA 3RT9A 4RCVA 2H0RA 3R20A 2PUAA 2OCAA 3O4IA 5ESWA 1FK8A 3KYIB 2GFHA 3SY8A 2E89A 2X1HA 4HFRA 2YS6A 4FFNA 2NYRA 4ESEA 1BX3A 1KZ4A 2EFEB 4J0EA 4ZGGA 1MV8A 1BX1A 3EGXB 5CVTA 1EAMA 3WGGA 3ER8A 1G21E 1XA4A 2RGXA 1RQRA 3EZNA 4BCDA 1KFBB 1KKUA 1VBFA 1C4OA 1YJQA 1OLUA 5CFMA 2RH4A 1RHQA 3IP1A 4NFYA 1D5WA 4B7ZA 2PRKA 3L05A 1N2EA 2FOLA 2Y1XA 4JS0A 4PGMA 1QKKA 5ENZA 4EI8A 3NV7A 4FGKA 3F78A 2FTKE 4IDHA 2XVZA 5KYNA 1ZOIA 2AXPA 4G5HA 2VPPA 3LDUA 3KRTA 1R6UA 3ASYA 4HH1A 5K0FA 3FE2A 4F5ZA 1ZOPA 2LCIA 5HIAA 3L7CA 4MPTA 9MHTA 1N6KA 3L1IA 3QTBA 5DP1A 1ZEJA 2FA9A 2WJVA 3BK1A 1K6IA 4PLHA 4TV9F 3RSFA 2QT0A 4UDXX 4V02A 2AK3A 3R5FA 4WBNB 1WM1A 1E6WA 5AK0A 2V4UA 4CG1A 1CIPA 2G63A 1KVSA 5L3SB 1R8JA 1UXHA 3AU9A 1DV2A 4G5SA 1CUXA 3DMDA 1GAWA 3TINA 2V0CA 4DYDA 5DV9A 5L6MB 2OGUA 2FZCA 1F51E 4XIIA 3S55A 4YN3A 3EVAA 3GRRA 3I2GA 3IMEA 1G66A 3I9LA 4GI2A 3K53A 2PYZA 1MABA 1RBQA 3FIUA 1GEGA 4IH9A 2O1SA 4C6TB 1TLFA 3ZWKA 2H2HA 3BRQA 3KU4A 3HMQA 3GLFA 2PT6A 1KDVA 1OVGA 4PZUA 3DP9A 2HWXA 1ZK3A 3IIKA 3OLVA 1SUCA 3QVGB 4WXRA 4D8WA 4JYAB 2ZTLA 1II8B 1OXTA 1Z0JA 3BCUA 1JECA 2PZMA 3EIOA 4QDUA 3V3TA 4ZYXA 4YJFA 1Y9EA 4HMOA 4YFYA 3IERA 1O54A 2OAGA 3H9JA 3FBGA 3LYAA 4BDSA 2QV0A 4YVFA 2WP0A 3LECA 1NUPA 1PJLA 5J2UA 1QOQB 1UXOA 3C6KA 4FZVA 5IP5A 1AQIA 5CX1A 3THWB 2E0IA 2AG6A 1OHHA 1OPRA 4KFUA 2SECE 3GXBA 2WWYA 4XWTA 5CH3A 2FE1A 4OI0A 4FKZA 3GYGA 3MCTA 4YP5A 1ZL2A 2XLBA 3KT3A 3TQQA 1R2QA 4TPKA 2HU8A 3ZEIA 4DCGA 1GGVA 4E51A 5IH7A 3KYDA 1IIRA 4LK2A 1XKXA 2IYAA 1Y1PA 3VSBA 2XADA 2CDRA 1HOXA 2JATA 3PNVA 4TZTA 1UBRS 5AKYA 2BGJA 5H7XA 2CJYA 1C50A 3RNLA 5HDQA 4DXDA 3DL0A 3QLEA 3HJCA 5HJEA 2GJ4A 3W5UA 1RAEA 4R5HA 1FC0A 1PT9A 1AKNA 4URYR 5ECWA 1YL6A 2VWPA 3RC7A 2ZT5A 5A6SA 5CTJA 3E5NA 1VLZA 4PGHA 1G16A 3BDAA 1N6IA 2X40A 2OG1A 2RB5A 3Q5EA 4LOHA 4MLPA 1V8OA 4IJMA 1GLVA 1OX4B 5H1YA 5HIJA 1FLNA 4G85A 1WXWA 4Y6RA 2PA3A 3QX8A 5DHPA 5BMVF 3WLFA 1H4TA 1PW7A 1RW4A 4KI7A 4WUVA 5LQSA 3ZXXA 2FK7A 2W6IA 2XB6A 3TNFA 1ZYUA 5E3JA 2BKUA 2JW5A 4ZTUB 2NQ8A 1CB0A 4YO8A 1WMSA 3ZQ4A 3KJFA 4N1AA 4MUIA 1YCDA 2NTJA 4RH3A 1TT7A 4KQJA 5D84A 2PXAA 3R7BA 4D81A 3JZIA 2HWWA 3CU5A 3DEKA 1UPUA 2E4UA 3JYOA 3RIMA 3DOOA 2I9KA 2WAMA 2YNMC 4Q3LA 3F96A 1H94A 1QR2A 1TMGE 1IHPA 3CNHA 4HUQA 1JTVA 4NZYA 4S0ZA 3OPQA 3DKIA 3KKOA 4IRUB 3TH5A 2HA6A 5TF0A 1WD5A 3PA8A 3WRVA 1NXPA 4WKGA 4X1YB 3ES9A 1LNZA 1JKJA 2WVGA 2V0NA 1WU7A 5DYIA 1CQPA 1SZDA 1TF5A 3N9IA 1QYDA 4X7BA 3HUUA 2VYVD 3K0AB 5LQAA 1ODLA 2EKQA 4GM4A 4KYTA 1XQ1A 4MGIR 4YRSA 2FQXA 3FKSD 3ZS9A 1JA9A 5AM2A 2ERXA 2UYHA 4IDDA 5TMDA 2J7PA 2Q5IA 3E53A 3K96A 4MYSA 2LW7A 4H17A 4XVQA 3WLAA 1ZM7A 3JQ7B 1GU0A 3H5NA 4GI3A 5ILOA 3VNVA 4MPJA 4F7DA 1IWBB 2PRIA 1L4FA 2PJZA 4L4YA 3K70B 3HCBA 1WW2A 2HL6A 3V2GA 4FOSA 1T5IA 1YXMA 2Y27A 3CVJA 3Q3EA 2HEGA 1HYGA 2IOYA 1BS1A 1ZCBA 1EX9A 1GXSA 2ACVA 2F1HA 4OOEA 4EG0A 3QH4A 2GBLC 1YZHA 4QQNA 4YTEA 3Q9NA 5B1DA 1L5GB 3ZQJA 4BX0A 3N3AC 2FFAA 5TRTA 1HFWA 3LXRA 4PSCA 2J3IA 5J4LA 3EZFA 4W5RA 5HSGA 2X23A 4IOMA 3F67A 3IUMA 4G9EA 4JEUA 3X1JA 2WU4A 4GLOA 2I3BA 2QQFA 3HWRA 3NOXA 5KYVA 1G20E 3KR2A 4OAQA 3RRXA 4QFCA 3M82A 2G5GX 5JVDB 1IE3A 2X0RA 1YDGA 3DMNA 3GA7A 3IAXA 5GZ3A 6LDHA 3ON5A 4ZC1A 3CXUA 3MXOA 1KDTA 2AMJA 3E9RA 1PTKA 3IAEA 4HNAA 4L73A 3G8BA 5EWLB 1NVXQ 4ZEWA 1OFHA 1Z2DA 1RI1A 3O9ZA 2Z95A 2D62A 4V1CB 1HQYE 3KV1A 5DGDA 3IH5A 1X9GA 1V39A 3FETA 3AHJA 3FHCB 3I1IA 3HRKA 4M9RA 4L78A 5FLYA 1SD1A 2EW8A 4GBED 1I6LA 4QUEA 4RJJA 2GAOA 4US1R 4NKRA 2BEJA 2E4VA 2OYSA 5KBYA 5BR7A 4V24A 1WVGA 2GZRA 5A0TA 2XUZA 5DGIA 2PKYX 1UBUS 3LIIA 1KHHA 2F90A 4FDAA 2FJPA 1JHPA 2LDBA 2CXTA 3I5MA 4DMCA 3HTXA 2M1XA 1NP6A 4ITRC 1CUFA 1P2SA 1PDOA 3WJ2A 5LDHA 1Y8RB 5K0LA 1R66A 2QL6A 1I7NA 4D8XA 2AFIA 2PY6A 4MI6A 4NPAA 3LSTA 5DTRA 2MJLA 2VUTA 5T57A 1WNTA 4JR2A 1K27A 1WQ4A 2ZR0A 1NVMB 3IR7A 3E8XA 3MTAA 4ARZA 3U16A 2GYUA 1L4HA 5CT8A 4BRWA 3WL8A 2IC5A 3PC3A 2FHSA 4DTCA 1SK8A 2YQ4A 2ZUCA 3K30A 3PGKA 2QNBA 2Q4RA 4H35A 1JLMA 2XT6A 2AL7A 4OI4A 1NW3A 1JHXA 2BUBA 1SHKA 4P5EA 4J94A 1WLYA 3M81A 4KV9A 4X45A 2V4MA 1DAMA 1VYVA 2GO1A 4QFBA 5JDCA 1DJOA 3PQ6A 3LBAA 4BO1A 4RNCA 1TU0A 3L8YA 1PFWA 1ZGJA 1RYZA 4MQ5A 4XCVA 5AI8A 4GX2A 4EJFA 5F21A 1JR2A 4LVCA 2I2CA 3G5UA 2BN4A 2R8ZA 4MICA 3KKEA 1Q7BA 2WJPA 4PLFA 5FXMA 3CO0S 4REOA 4RIGA 5TX7A 4R2WA 1H66A 1RXYA 2OZPA 5KYUB 4DQXA 4B6FA 2VHTA 4Z53A 1Z5NA 4QDKA 1IZZA 3RJ9A 4MRMA 2HMTA 2IE0A 1JI0A 3A4VA 1AB5A 4PNPA 4Y2VA 1FS5A 1V8BA 2GFQA 4OAPA 1JHUA 3RBXA 1LB1B 1XIVA 3T52A 2C84A 5BNZA 1ESNA 3O8RA 3K1AA 3LT5A 4ZVKA 4RF5A 3CT6A 4L3OA 4YP1A 3ER9A 3U40A 5EJ7A 2HHCA 4N41A 4B80A 3KT6A 4Y6GB 4DDVA 3SR3A 4IP0A 3RJZA 1GQRA 3AFOA 4B7UA 5AW7A 1J00A 2WEKA 5IJAA 2PZFA 3BA6A 4FSDA 1IL0A 4KTTE 5LQCA 3C7KA 4DR5B 3AH8A 2N1BA 3OCCA 3GCDA 2XMDA 2XUDA 3I83A 1JKFA 3WBFA 4ZVLA 2JCVA 4B1FA 1WZIA 2ZYSA 3BCRA 1QKIA 1V4NA 2B37A 3E5RA 4RMJA 2GESA 3BWBA 2G71A 3GJ8A 3T38A 3PDIB 4LX8A 3ZH9B 4D4KA 4RA6A 2Z6UA 1UKZA 4JELA 1ZXBA 2A58A 4EHLA 1QC5A 3WLEA 1VHWA 5DT2A 1JBKA 1GG9A 1Y82A 3W6PA 4Z51A 2EL7A 3QKTA 3BE8A 1CEEA 3E2IA 4ZICA 5KOHA 3B9PA 1WEKA 2CUZA 3EEIA 2WMYA 3S5UA 2VDWB 4FYKA 4EVQA 4ZZ3A 2R6ZA 4LECA 3S99A 1IM5A 3OFNA 2FW8A 2IPXA 4DQVA 4BBZA 4O02B 5EA2A 4EY7A 1DQNA 1ONNA 3K09C 4KAFA 2PUDA 3V97A 3ACBA 3IVGA 4I9UA 4LBWA 1P39A 1KQNA 2QN9A 4U7DA 4ANFA 1E3TA 4RKFA 5EKTA 3JZDA 1HDOA 1OWNA 1YB2A 5JMWA 4J91A 5BN3B 1KY4A 1YNSA 4AI6A 3EQ2A 2IWRA 2AXNA 1AZWA 2NV2B 3FBWA 2H85A 4DMRA 5JRDS 2PJRA 1PJ2A 4YH1A 3V4RA 2HXGA 2FJUA 3OZEA 4MMZB 5IHPA 4L95C 3TQRA 1NF9A 4DFDA 3IV7A 4QT4A 1B23P 4LOJA 3P9SA 1S02A 2WK1A 3JZAA 4K9LA 2PSDA 2IYPA 4Q9IA 2WF5A 3QPDA 4BU1A 4RVSA 821PA 3LF1A 2I5PO 4N4AA 3E0XA 3GUYA 2BHRA 1C4WA 1NW4A 3R9IA 1SCQA 1GAEO 4EY5A 3V48A 3LL4A 3UMMA 3H8JA 5HWSA 2YXDA 3U26A 2AKAB 3V2IA 3IL2A 1W1UA 4K9DA 3WKBA 2AE2A 3GB9A 2V5UA 1Z2PX 2W6PA 1Y7HA 2XE8A 3DQZA 3MRSA 3EC2A 3ELBA 4LSMA 3D6MA 4Z0HO 3NCTA 3UVEA 3H2IA 3O26A 1D1QA 5CYPA 2CDAA 3IS3A 4J16C 5AVRA 5JAPA 3KZVA 4FR2A 2M6LA 4IF4A 5AVKA 1UDCA 3QFHA 2QG9A 1LLFA 3WWEA 2XMCA 4BZZA 3A06A 3IT1A 4MCAA 1TI7A 1VIVA 5EQTA 1E1NA 2KPOA 3UGQA 4E2WA 2HRRA 1PL6A 1QFJA 4LTMA 2GRAA 2ZUVA 1EVEA 3W8FA 3K1ZA 3WWZA 1FRNA 4I3HA 4BQSA 1SCBA 3L7MA 3NORA 1XFAA 3MCVA 3OQ6A 4M98A 2FY8A 4R01A 4BO9A 1XPUA 2VJBA 5JWRA 2QROA 1P74A 1S2MA 1YBHA 2OCKA 2P4UA 4E30A 1L8XA 1CF9A 4YCLA 3AP1A 4MSUA 1V5GA 4CRWB 2AEEA 2BMJA 1QCDA 3FPHA 4K6CA 4BLOA 2Z3WA 5LUBA 3VJMA 2P67A 4ZI7A 5TJ9A 1FFXB 3GJZA 4KXQA 1AO3A 4MAFA 2KM1A 3TM5A 2XUJA 1M0TA 3I8XA 4JGBA 2V7BA 2ZE7A 5JZMA 1Z8NA 10MHA 4B3MB 1QP8A 4LXQA 3P0RA 1V8DA 4LI0A 3SZOA 3TD2A 5JALA 3CT4A 3QI2A 3RSLA 1KEKA 1OW3B 4EGCB 2IHKA 1Z73A 2I3ZA 2JNWA 2WNSA 4YCDA 3CJQA 4JCCA 5TARA 1QVRA 5FB3A 1DC3A 2AVNA 3D6NB 4M0KA 5K09A 2GN2A 5LBIA 5JU6A 2EZUA 2H7YA 3M5PA 4KQHA 1SELA 1YRYE 4H6XA 1EA7A 2MHCA 3UCFA 4NCNA 2OD2A 1MB4A 2XQJA 3ZHZA 3CLSC 4X71A 4KPFC 3ZZNA 1P31A 5K8TA 4NX2A 3RWBA 3NR2A 3PWKA 4EEKA 4Q3EA 4UXJA 4AY4A 4JLBA 2I78A 4ZT5A 3DZDA 1OYOA 2MR5A 3BHIA 3NWJA 2FH5B 3DOJA 3PQDA 1KVRA 2GZDA 1PGNA 1DXQA 1MQ8B 1YC2A 1T4CA 2IP1A 2OMKA 4GKVA 4BNJA 5KNBA 3L4JA 1UDWA 4BXOB 1M6VB 3IAM1 4MEBA 2BM1A 2F3QA 4OGKA 5KDLA 3WLNA 3G2LA 1ZJWA 2ZKIA 5IAOA 1CUAA 4QDJA 4GP9A 3AM5A 3ROZA 4E7OA 5EXTA 2H2AA 3DW3X 1RWKA 1M2OA 3NAZA 3VGJA 1E5LA 4EVRA 1RHMA 3HVUA 1DKMA 2CE2X 1CKEA 1E2QA 2YXPX 3R2JA 4F3RA 1UMKA 1QGED 4PC3A 2RARA 4GBJA 3ZCRA 1LI4A 1HT2E 1JPNA 4RD4A 4Y6OA 4H16A 5KTYA 1DEOA 4KQKA 3LX5A 1Z2EA 2ZRFA 3D31A 2KLHA 3DE0X 4EECA 1O96B 4GLFA 4OMFG 2ASVA 2IOQA 2A9PA 2ZDHA 1M7BA 1Q0LA 2OENG 1TUIA 3BSYA 1AHHA 1GPKA 1ZBQA 3G0IA 2JGIA 2F6RA 1CE8A 4Z99A 1VCMA 3HCRA 1TPYA 3KKQA 2QGZA 3UB4A 1EWVA 1HRDA 1XN1A 1PL8A 2ZSEA 2E49A 2A7XA 4YDQA 5AXAA 4G8DA 2ZE6A 4J2OA 2BM9A 4QQ8A 4WLEA 1M8PA 2WG2A 3NBYC 1YOBA 1ORHA 4P32A 4HDMB 1BRTA 1Q83A 1GFSA 2F9LA 2PUWA 2R00C 4IUBS 3VNAA 4CETA 1P5RA 1ZM4A 1ODTC 1UKYA 3HKBA 2UVQA 5I9MA 4IIUA 3PK0A 1FYVA 3CJRA 1SVMA 4H9GA 4NYJQ 5IAKA 4UUNA 3TLXA 1IATA 4BMZA 4RTNA 3V5NA 5KSYA 1WCXA 3WWOA 4BVHA 1LDEA 2B1QA 3DEZA 5TQ2B 1X2EA 4C3UA 4CT0A 1QFYA 5HKKD 3BE5A 5FUBA 4HNUA 2JLUA 4RPHA 1KEPA 3EJ6A 1I9GA 3KPYA 3JQDA 4HEA1 1KMMA 4LNUA 2D0IA 3UJPA 3WMFA 2FRDC 2PJUA 2YIJA 4IHJB 2ZM6B 3OF5A 3PNKA 4B3TB 2WJHA 4P3YA 4RORA 1DEHA 2QX7A 2R66A 1W4RA 1DEKA 3JALB 4NABA 4DIUA 5JH7A 3EGOA 1MT3A 2ZR8A 2LNDA 1L0BA 3I9KA 2XNDA 3BGSA 1VKHA 2HM7A 1BN7A 2FZKA 2Z2XA 3ID6C 4G37A 4J29A 4UPVA 4UQLA 2XE7A 1CVIA 1MB0A 4Q3AA 4UZFA 2PEYA 3W6UA 1BDIA 2BGTA 3QJ5A 3DAHA 2B4AA 1QTNA 3BKWA 3W2EA 1SKUA 3R9KA 3SJCA 2Q3LA 4NYMR 5A5DA 1F12A 3FX2A 2PGJA 3OJEA 4FFWA 3G0CA 3UXEA 4Q9LA 4V0QA 3TRKA 1NW5A 4BNMA 1AQUA 1A3CA 1RRKA 5CX4A 3VGPA 4CFZA 1GM5A 3CLTD 4W5TA 3DC2A 2H3EA 1OBFO 2R6DA 1ORIA 3LZCA 2P1ZA 2P7HA 2UZ1B 2ZPUA 4OXXA 3VOTA 3ISTA 1UOQA 3PFCA 2ZYAA 4L9WA 4COOA 2FSUA 3AUKA 4DSUA 3FMIA 1P2FA 2R8RA 3U5TA 3DEJA 4BB9A 3GIDA 4RVUA 4DCMA 2R96A 4UDNA 4C2BA 3UATA 4DXAA 1XCMA 3O4FA 1EIZA 2OQ2A 5JROA 1T2AA 2ODBA 2VPIA 1I3MA 5JS8A 3QVKA 1YE8A 3C8ZA 3PUXA 2AYXA 1PR2A 4ZOCA 2X5NA 4QM7A 4OL9A 4LMBA 4ZQFA 1MOQA 2JASA 1M6HA 2VP0A 2E7ZA 3V4OA 3VH2A 4A6PA 3AUUA 2D7DA 4AJOA 3DPUA 4G4IA 4F45A 5IKXA 4MW5A 3R76A 1T5OA 2XZLA 2PFGA 4NPCA 5E9JA 1PS0A 4NHEA 3DW1X 4LPSA 2FQWA 5DHUA 5JDIC 5EJ2A 1OXUA 1YK0A 1Z0KA 2C8LA 3AERA 4N5HX 2XJ9A 5ALTA 2V97A 5FTNA 4ZV7A 5FD8A 3W7VA 4BFLA 1PO7A 1BZYA 4G23A 1A8HA 1CT9A 3UAOA 4AJJA 2O19A 2R1TA 3NZEA 1WEHA 3FG9A 3N76A 2REBA 3JQAB 1B41A 2ZRBA 3C5HA 3O95A 1P8JA 3Q0TA 5TSDA 3K6RA 4A0SA 2AF4C 1MNAA 3OLYA 3O8NA 3LC7O 1TA0A 1M6EX 4U2BA 1KAEA 1DJQA 1QB7A 2HZBA 2P2CA 3H1EA 4X1KB 5IYZB 3N0RA 3U4MA 3IQDB 2XKKA 1Z0DA 1DC6A 3P9PA 1XOIA 4QBKA 4CG3A 5KYWB 1RWBA 1F4VA 3L8EA 2B98A 5LQUA 1UBKS 3SMVA 3WWYA 4OEHA 2DY0A 4UDOA 2IYRA 1XTVA 2D2EA 3AKEA 2OR3A 1YAJA 1HYQA 3NI2A 4I1VA 1TCVA 2GK4A 1ZGCA 2Z2ZA 4JLSA 4A03A 1U4OA 1YU9A 5ABPA 2GOYA 4ILKA 3ADCA 5EXXA 1L1RA 4AK9A 1J9EA 2A94A 3QG1A 3AL3A 3S28A 1RVV1 2UZIR 1XXHB 3PPYA 3LUKA 1Z4IA 1FSGA 4F8EA 1TFRA 3K5PA 1B0UA 2B3DA 2VHWA 1GZ7A 1Y6GA 3AP2A 3MJEA 5KNBH 1UBSB 3ONWA 1BYUA 5IJ9B 3N2KB 4J0GA 5F73A 3PI7A 1SQSA 2PS1A 2DR3A 2QJTA 2ZBGA 1MQ9A 3G88A 4M0FA 4Q6WA 4LZJA 3HL0A 3LRXA 4ROTA 4Y7CA 5JD3A 1XD2B 4H3KB 5LC1A 2B8WA 3TSWA 4DJ5X 5I01A 4D0RA 1BA2A 4EAQA 4YAGA 3EGEA 1GTSA 5FWYB 2C4WA 3U49A 4BQOA 1AHNA 4EY3A 1M3SA 4UXIA 4WNAA 1KO7A 2GD0A 1UQRA 2PX3A 4KQ1A 5EHNA 3V7UA 1CZRA 3N5KA 2ETXA 1OTXA 1ZBDA 2V1XA 3G1UA 2NVUB 5A4FS 5L3QB 2VH1A 2QZSA 4DRXB 1K3FA 2PZAA 1EA5A 5D3QA 3KVYA 1IHDA 4IX1A 5AHKA 3ZWCA 5F7OA 4QNMA 3GNLA 1QHFA 3H6KA 121PA 4MVJM 1RKXA 5TE9A 3RRNA 5BNTA 5IZ4A 3TBKA 1KO1A 4HQLA 4NCJA 2EEZA 2EGUA 3DPSA 1RPAA 1VBNA 1V95A 1QF7A 2FMFA 1NVKA 1J25A 3KEQA 4R2KA 3VU1A 3U44B 1PQUA 3R0JA 5FFFA 4IQFA 4QKQA 3MINB 1VQ1A 4KQWA 1D2NA 1DHRA 1E3WA 4MGEA 1U0HC 3GRUA 3CCBA 3GJTA 3JAKA 1X39A 4HNQA 5CLHA 4GIBA 2PWPA 3BEOA 5ITZB 1QE0A 5FA6A 1WUKS 3IEPA 3S2GA 1RM4A 1KS9A 2JK1A 3VPGA 4EITA 5FUXA 2RG7A 3ILYA 4F6RA 1VMDA 3E9YA 4DANA 2YRXA 4JOSA 3CS3A 5ALXA 4KR2A 1T9GR 1SG9A 2VP2A 4NE2A 2XD9A 5AM0A 1JQAA 3C5EA 2B4QA 3C1TA 5KNLA 3E1KA 4A27A 3ZWAA 4I9GA 3K1TA 4L0DA 3MGCA 4UBOA 4WERA 4MP8A 4AN0A 1PD0A 1A8PA 2ZAGA 1NBMA 2C5GA 2YMPA 3GLHB 2FPPA 4XPIB 4YJ3A 4X6LA 4CM8B 3HP7A 3L0IB 3KFLA 3VVLA 2P4QA 5KKNB 4TT3D 4QPCA 1HLGA 1NASA 1UH5A 2AZ4A 3S3TA 2ODWA 3G5AA 3G9QA 4X7PA 5COAA 1PK7A 5BSTA 5JANA 1HLFA 3BMNB 5AKGA 5I4CA 2QRQA 3Q8WA 3PUIA 3LXMA 2GAAA 3TQIA 2AN4A 3VNQA 2A9VA 4S24A 2D3TA 3G5TA 1OOEA 3TNLA 3WL7A 3PFBA 2FMXA 5JCOC 2AE1A 3LYUA 4JOCA 1OXXK 1EWKA 1E9BA 3BGVA 5TS3A 3WDKA 1Y3FE 3SC2B 1SMKA 4EL0A 3SR4A 3AKYA 3MAGA 2I2AA 3PX2A 2GBPA 1C3OB 3H2KA 2NXJA 1Y6RA 1EVYA 4MR9B 4GR9A 3HXKA 3RSOA 3ZXUB 1HKHA 2R5WA 1X3SA 1V96A 2OKGA 3HI6A 1P5HA 1Z29A 2EKZA 2HADA 3WISA 5ADUS 1BFDA 1QRAA 2VPZA 1OT5A 2VYNA 4FNOA 1FZTA 1EXWA 3N39C 1X6VA 1DSSG 1I14A 5E1DA 5ICFA 5CVUA 1JAIA 4CCYA 3FHJA 1PFQA 4UCWA 3RF6A 1T6BY 2WM8A 1AUPA 2R6GA 4J7XA 4TKUA 3CUUA 3IMGA 1MFPA 3JQBC 3ELDA 1TCAA 3ACDA 1MA3A 1GUFA 1A9SA 3DAPA 3FPLA 3A10A 2QRHA 3OF3A 3QM1A 1ZVVA 1R37A 4G25A 4PG4A 1G2QA 5GWXA 4F93B 1R4NA 3HY4A 2R1VA 4HWGA 4KO8A 3ZWBA 4L28A 1GZVA 2ZYGA 3N0TA 5IG2A 3GCZA 1V26A 2GPTA 4RVDA 3JPYA 3A2MA 3RSQA 3TR0A 1EEHA 1XQVA 4WZAA 1PJ4A 1YFJA 1EE2A 2QV7A 1XU4A 2CNKA 3V4LA 4II3A 1TTQB 1DRUA 4ND7A 1OGIA 3RD5A 1XR3A 3KX2A 1PJZA 4TV8A 4D79A 1CDEA 5JHHB 3DP7A 1M33A 4QM6A 1FS4A 1GGJA 1LBQA 4TMWA 4P84A 4NFHA 3OFVA 2O2XA 2JGRA 5C18A 2EX4A 2WVHA 3HCCA 3KQWA 3F5SA 4J0DA 1IJFA 4NARA 4DE5A 2QE7A 4M7RA 1DAKA 3L8MA 2QRVA 2MDTA 2PBRA 4JYBA 4PSDA 1KK0A 1Q21A 5IN5A 4AVYA 3X1KA 3RGWS 3TPCA 3FSGA 3GAAA 4ZCQA 5AJTA 1WSBA 3FZNA 2FZVA 1YJAA 1NT4A 2PD4A 4HDNA 2HQ1A 4O8ZA 3PUJA 5BOSA 1GVNB 1LNQA 4RTLA 1T9AA 4U2FA 3BMCB 1P1CA 2IZ6A 4Q5IA 2PIAA 3L1VA 3VU3A 1N78A 3V8PA 1RP7A 3OHSX 3BF8A 3KOWA 3OTHA 3D2CA 3P7MA 4EG3A 2VJYA 4D6XA 4FT2A 5T4BA 4JASB 3EZ7A 4EX6A 4F2WA 5CM8B 1E3QA 1IVNA 1W34A 2VNKA 2WG0A 3TIIA 2QTZA 4A73A 1QVZA 4NBUA 1L5KA 1C0LA 2ZRLA 3TW6A 4EMBA 2IDMA 5JEDA 1A7AA 4G0OA 4OFZA 5AK6A 4JB0A 1RZ3A 1XEXB 4IIBA 1RKVA 2JAQA 4ZOQI 1ZONA 3ROMA 4M49A 2XYHA 5KZMB 3VKWA 5JAHA 3KR9A 3OKCA 4EQZA 5A02A 4HAWA 5GV7A 3AVXA 2GJ9A 4FE4A 2W2MA 2V6FA 1C7ZA 1GV1A 1HG1A 1S8FA 1RYHA 3HY6A 1XYGA 2X9GA 3OCYA 3ZCQA 3L8FA 3S8YA 1TQDA 2RK4A 4RW0A 3KV3O 5HQTA 2VUHB 2C98A 2ODNA 3L7NA 3D4LA 3QMVA 3T7JA 2QT1A 3FCCA 5GONA 1KK2A 4EA8A 3F1LA 1OD6A 2YJZA 3B6IA 3OWXA 4JP2A 2WMOB 4DWVA 3D8UA 1TL7C 5BRNA 3CX7A 3DE5X 5AI4A 1T1IA 3KTAA 5HFJA 1UZNA 4Y6LA 1CEXA 4DYHA 2ZU6A 3QKWA 3K0FB 1NAHA 3VBCA 1W87A 4F4UA 3T5BA 4O4IA 1P5JA 4A8HA 3RVOA 4LE0A 4OP3A 1YRQA 4I55A 3E1SA 1E0AA 2C2HA 3RJTA 2B99A 2JI8A 3TN7A 3DBOB 3HBNA 5BSEA 2Z58A 2EFDB 2EDCA 2DPMA 2FAXA 3BFPA 4EI7A 1K66A 1O6FA 3DBVO 3KSZO 1Z6ZA 1KE1A 5CEEA 3FXAA 1FNDA 2FSVA 4Q9KA 3PRYA 4C29A 4DV5B 5JI3E 3KAJA 4JYCA 1CZKA 2Z9DA 4F9EA 5K3OA 4IINA 1PJQA 2I4TA 2W83A 5CB4A 3KQLA 4EHFA 3HJFA 3CWQA 2OZKA 1GRQA 4C7XA 3O3CA 3G8YA 2ON6A 2Q9UA 2XOKD 4XUDA 5JDIA 2FZEA 3PF8A 4JDUA 4WK0B 2ZIVB 4DM3A 2RC6A 4DIMA 3JQ9A 3QELB 5D51S 2O8FA 2KJQA 2YWXA 2JPDA 2EZ9A 4WACA 4I5IA 1PWXA 2PHZA 2X1VA 5AHOA 4LI3X 1R4AA 2YDYA 2IJGX 3PQEA 2DP4E 1Z0ZA 3I2YX 1MH9A 4G4JA 1ONSA 3E84A 4KFTA 3GRPA 5F33A 4UNRA 1GV0A 2CB0A 3ORRA 4ND1A 2FW6A 4A5SA 1HORA 1GRCA 2HJVA 2XGMA 3FOFC 2D1RA 4Z9YA 3DKVA 2HIGA 2IVFA 4OKNA 1OAAA 1WSAA 4RM2A 4X93A 5FIUA 2WWVD 1SC9A 3W90A 4NCBA 1FJGB 4AJ2A 2RK3A 4CVNA 5I9LA 3KDSE 1MIHA 3FCAA 3R5XA 2NU7A 5ALLA 2ZUFA 2PLAA 1D9ZA 3KJQA 5DBOA 3R8FA 1SVUA 2GS9A 4YJ3F 3I1JA 3O83A 4Z86A 1ZLXA 3PEEA 4W8HA 5IJ0B 1FFHA 5J2TB 4OX9B 1KRWA 1U3VA 4RMHA 1FSZA 3MTQA 1A9QA 1K5PA 3I9JA 4CKBA 1IEVA 5JZOA 2WC1A 4GVPA 5E0KB 3DDCA 5FOTA 2O3QA 1XUOA 2F3UA 3K94A 4G41A 4FW8A 4NAVA 3T4UA 5KQRA 4B3GA 2RGYA 1GT6A 2IXDA 1M6NA 2YWCA 3DEAA 4D1YA 2JLSA 2D74A 1M1NA 4EY6A 1TIKA 1Q7TA 4X6UA 1V16B 2HK6A 2R4TA 4OFXA 3KQQA 2QKYA 2NSDA 2IZZA 4G0NA 3R6GA 4PWYA 3A4MA 4KUGA 2HYDA 1OH6A 1FY2A 2NSLA 3D1LA 3HHPA 2EFYA 2I55A 3EASA 3B3AA 3ZZTA 4LDZA 3CZMA 4TXMA 4DIDA 4ER7A 3H6HA 4MGYR 3BICA 4NYIR 1KI9A 2ZJ8A 3K9HA 1A1VA 2F8LA 3MERA 2C2BA 1MBZA 3L0DA 4HLDA 2IHYA 3M4NA 1E59A 3PIDA 1ZM9A 4RV5A 1XMQB 1KR2A 1YDEA 3JSAA 1MB9A 1CQIB 1N2OA 2Y0CA 4G3XA 3MMSA 3I6MA 5DASA 4EY4A 4JI5B 2FFHA 2YC2C 3L8GA 3CF2A 4HN4B 1NULA 1FS6A 1IOWA 3U7QB 3FLEA 3NKVA 4C7MA 4YT4A 3F2VA 3PIIA 3RYCA 4BYMA 1A8IA 2GM9A 3KBOA 4D3XA 1F5SA 2DBQA 4XB1A 2RI0A 3DTVB 3S6JA 1NUUA 2EJBA 3AUXA 4MS3A 2XKBA 1XLVA 2C1XA 4Q4JA 1I1OA 4UM9B 3DFZA 4D44A 3PQFA 5A5GA 3Q9LA 4CLOA 4KPGA 3RSSA 2NZXA 4W7IA 4M7WA 1S8OA 2HDNB 2QA5A 5DBFA 3ZH2A 2D0DA 5ENVA 1V1MB 3L1UA 1EFCA 5EP3A 3TLAA 2Q29A 3LPDA 2C9ZA 3PPVA 2A0KA 4KQFA 2O7RA 1NJ6A 1EJBA 4R8RA 5JJ5A 5KQLA 2ZE5A 2VTBA 4TV8F 4JH0A 2VBFA 2B35A 4MVJA 4TLMB 2RAVA 4U02A 1KJ9A 3BYZA 4L16A 3IUJA 3ISJA 4FEEA 4Q0MA 2E4WA 2FUKA 3R5HA 2JZNA 3L9WA 4OF4A 1B0PA 3CG4A 3DE6X 2AR9A 2YHAA 5IXYA 2PZ8A 4OQ4A 2J08A 2BFOA 2C7VA 1EJ2A 1Z8HA 2JJ8A 5D8DA 5U4XA 5B12A 4E09A 4CFSA 1YQWA 4BP1A 5F1YA 4JGGA 5IWAB 4C4ZA 3ZBTA 2AN1A 1H0HA 2WW8A 4RELA 1TM7E 2RBGA 3HN7A 3AEZA 3E7FA 1O95A 4RZUA 4B3CA 1L8OA 1ENYA 4GDMA 2CNBA 4JX9A 3Q72A 5LQRA 4EYOA 4QL3A 5CA0F 4D4JA 1MU0A 1KP2A 1AXGA 1D8AA 5JPDA 3M33A 4BO0A 5DWVA 1IB0A 1ZH4A 1UQTA 2XWPA 3LAWA 3ZV4A 2WJAA 4LDPA 1FQKA 2QUAA 4L6CA 2XT9A 5JY1A 1FQOA 2P27A 4KX5A 4FHZA 3RTDA 2F62A 2EQ5A 2ZG6A 3KLBA 2ZYDA 4TT8A 4IO0A 2YUIA 1RAHA 3UAVA 4JUBA 3RWMB 1J99A 4CMJA 2W2LA 3JQGB 3ZXYA 1KAOA 1YB4A 1CZHA 2WKWA 2FF5A 3MMZA 3TTXA 4ACAA 4LV5B 4KODA 1T8SA 2DWUA 3IYLW 4PEVA 1BU8A 1FXWA 3NP9A 2EX1A 2YL2A 4FTWA 4F8YA 3IBFA 1CR0A 1EUDB 3KYCB 4ZU6X 3SS9X 5K4GA 4HS9A 2GNOA 4I9HA 2R60A 3T5DA 2IYNA 3CKMA 3UT0A 4S2UA 4UNPA 2QY6A 3EXEA 2F55A 1HNNA 3HZHA 4CT4B 3CRVA 1E9RA 1Y6QA 1U3CA 2NUPB 2FB9A 3D6HA 3OKPA 4X3OA 4P4GA 1L4BA 1S5PA 1SUPA 3QVUA 3O3MB 4YJDA 3C15C 3DD1A 3O4VA 1MGOA 2IDJA 4KQXA 5EE5B 5DK6A 2YY7A 4D6PA 4EPYA 1U0EA 1A9XA 2Y1WA 4LWZA 3A32A 5B58C 1T2CA 4G36A 1LA2A 1JIJA 3QLVC 5F35A 3MJDA 3VU9B 2CZCA 3VX3A 4M8KA 1CY7A 1CVRA 3JQFC 1EQ2A 3A37A 3EB9A 3N6VA 4O4LA 4DDUA 5BURA 2E6KA 4BUJA 1AD2A 2DPGA 3FOBA 1INLA 4OATA 1QS0A 2ZWVA 4CT5A 3GUZA 4Z2YA 4PE5B 3W2HA 2PSSA 4QBTA 2AQKA 1OBCA 4FGWA 4D0NA 3IP8A 4IL5A 3KYBA 1N1GA 1U90A 4EYSA 3WIOA 3STUA 4EEXA 5IBPA 3UJBA 1R6DA 1U28C 4N39A 4O3FA 1P7VA 1SEVA 1Y89A 3DBHB 5DIFA 2BFDB 2CLDX 5A9TA 4G4SP 4QARA 4UBNA 3FYHA 3LVFO 4YEDA 2V03A 3B52X 4EMUA 3CX3A 1G21A 3VPHA 1OWOA 3IUYA 4TLBA 4G0XA 4ISBA 1Y33E 2WTXA 2VDOB 2PS0A 4BVFA 4JOQA 4OXNA 3UJNA 1UFRA 5T3UA 1YI1A 1HNZB 3WYBA 4U8GA 1RTKA 2I71A 1L7MA 2QZ4A 4B87A 2XY4A 1Z47A 5E7QA 3IHTA 3LFTA 2VPYA 4RKWA 1LLQA 4XLTA 4C5AA 5AKXA 4FVTA 1NE7A 1FX0A 4C7VA 4CV2A 3AF1A 3N2EA 4TZ6A 1OVMA 2AX3A 2OM6A 3ASVA 5JMOA 1SIBE 2JFBA 2BGMA 3T54A 1HDXA 3CNQS 3DB1A 3HBJA 4IDBA 2WF9A 4WDRA 5J3JA 1JR3D 4RD1A 5B1YA 5KVAA 4RK7A 5FV7A 4HAXA 1US8A 4C20A 3DCIA 2FG6C 4NOMA 4R2MA 3WRXC 5M34A 2O8BA 3A58B 4P7BA 1O6GA 3EF0A 3U4DA 2ECFA 1FFDA 1JZQA 2EBFX 2RK6A 3OKAA 1SKBA 2QQGA 5IVDA 5KQPA 1VI2A 3JWHA 4IQ0A 2XRMA 1BRMA 4XWGA 3KVNA 3GZJA 1IK6A 1MLDA 2CL7X 4OTZA 4N40A 5C0OE 2Z2YA 1EGQA 1NPTO 2IU4A 4DB4A 1GDHA 3MQFA 1ZUWA 4NBVA 3SIXA 4HWPA 3ZWYA 5HGJA 3T0IA 3V7YA 3TNDA 2ZZNA 2ODTX 3RANA 3AFIA 5HBGA 4CIWA 1UK9A 3W7AA 3ET4A 1RSZA 2HFKA 1H2EA 2CDNA 2FXVA 1TFUA 4HEJA 3DL4A 2QN2A 1YC5A 2Y05A 4K8OA 5AUQA 5NULA 2H2WA 1XU7A 2R85A 1OQAA 4H3SA 4B76A 4EUEA 4K7JA 2CV2A 1U4NA 2P9BA 1O08A 1G4HA 1OAOA 3DEIA 3OZXA 5TC4A 4D02A 4DILA 5KX5A 2AF3C 4TL6A 5CVJA 3S2IA 4AC9A 4L0QA 3PT9A 3QP9A 5REQA 1W96A 3T1HB 1DKUA 2QAGC 3QWBA 1WDKA 2WJIA 2MWMA 2NO5A 4A15A 3WGQA 2VQSA 1RQ7A 2D2FA 1GPH1 4PX9A 4ENTA 1GJRA 2DUJA 3U9SA 1BROA 4IFIA 4R68A 4B46A 4LVNA 2AJLI 5IVPA 4BDTA 5SY6A 2Y71A 1GPNA 3OWOA 1E2MA 4ZYWA 1Z12A 2W6MA 4CODB 2AHRA 3ESXA 3QU5A 1W6UA 1XHLA 1PR1A 3VYRB 3PR3A 4WDQA 5FFNA 2BTQA 2C4KA 4Q7JB 3CUWA 3NBQA 2HQRA 4NFLA 3WS7A 1FQWA 1BXRA 2GXAA 5JAMA 3I6BA 4LRYA 4CQJA 3KIPA 1Z7EA 1ZD8A 2WZCA 5HZHA 1JIXA 1YZGA 1RJDA 3R9XA 1HT3A 3N2GA 1D1TA 1E92A 2ECQA 4NSNA 1JFSA 3LK7A 1TAQA 3EMKA 1H1LA 1GNVA 3LDAA 1Z6QA 3C8UA 5E9QA 3VM6A 1E32A 1P19A 1USUA 5IBQA 2ZGVA 5IS2A 4LS3A 4M1KA 3IIIA 4B3XA 3VKHA 4BVAA 5CH8A 3H42B 3JASA 3OOWA 5EZQA 3AB7A 5LKAA 2NTYC 3UA3A 2ZM5A 2P77A 2VJQA 2NU9A 1RYEA 4O4HA 3SEAA 4LZPA 3BTUA 1XJCA 2OG2A 3M6FA 5CJ2A 1E18A 2XGGA 2ZKLA 2NUBA 3H9BA 3SYKA 1UBCA 4AXXA 2VZLA 3FOWA 1IDOA 2ZBFA 2BJWA 1L5RA 1IZ7A 2ISSD 3KAQA 3K9QO 3KKMA 3IT0A 3AY6A 3BD8A 1ZESA 2GEKA 4ND5A 1YFLA 1KVQA 4J76A 1ZH6A 2LKDA 3R9WA 1D6NA 2C3OA 4HLCA 1IQRA 1F17A 1K7SN 2BKVA 2ADMA 3C7CB 2FX3A 1YHYA 4DDMA 2BE9A 1OIXA 4NQZA 5GP1A 4I50A 3WNZA 2YHSA 3NIFB 3ICCA 4C0HA 5LMCA 1P3JA 2FZLA 4NAUA 5LYYA 1RPZA 4W5HA 1RQGA 1G6Q1