1EM8A

Crystal structure of chi and psi subunit heterodimer from dna pol iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III CHI SUBUNIT
publication title Crystal structure of the chi:psi sub-assembly of the Escherichia coli DNA polymerase clamp-loader complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 46
structure length 147
sequence length 147
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04364 DNA_pol3_chi DNA polymerase III chi subunit, HolC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold DNA polymerase III subunit chi 1em8A00
3SXUA 1EM8A
chains in the Genus database with same CATH superfamily
3Q3EA 4ZCQA 2IHJA 3RC9A 1V16B 3JQCA 1GUZA 4Q24A 5BYKA 4M0FA 1L5YA 4P82A 1V2HE 1P1RA 5KKAA 2GA9A 2ZVDA 4C30A 4FGKA 2H00A 4RCYA 2HJHA 2DFVA 4QBTA 4C43A 1N9ZA 3CO0S 4X5OA 3HVKA 3BHMA 3TRIA 4Y6PA 3V48A 2X6TA 1WG8A 4MYRA 1RZVA 2PH1A 1UINA 1ZK2A 1T2NA 3VR5H 3AL3A 1FFAA 3BERA 4KR3A 1T5SA 3NEPX 1W4ZA 3OT1A 1WVGA 4N47A 5CDGA 4CIAA 1PL0A 4IVNA 5JADA 1M8PA 4S05A 4OBXA 4HYYA 1XTQA 3U7EB 3A27A 2CCGA 1U3FA 4D46A 3EEYA 1BA3A 2N3ZA 4G01B 2PMEA 5LBIA 4O4JA 3JASA 4W7SA 4L22A 3B7WA 4YQEA 4F97A 5JPCA 4EVIA 3ZWNA 3W5BA 3WYBA 4MX8A 4IGFA 1T4GA 1TD9A 1JKMA 2QVGA 3KJFA 2B30A 4Z8YA 4Z3KA 2K2QB 3EXAA 4B81A 2B8JA 1I3OA 4NCIA 4AN4A 1ECBA 4NLLA 3VO2A 4H31A 4AG5A 2JBWA 2JL1A 1O2DA 4A23A 1E2UA 1LW6E 1JAZA 2ZRDA 2ZUBA 1SXJB 2QN7A 4CF4A 2FZEA 3FCCA 2NYUA 2PYZA 5EP1A 1NBEA 2DCMA 1E77A 1ENOA 3GLTA 3MJCA 4E88A 3O7MA 4KQ2A 5EJFA 1VYUA 4CPDA 4LHEA 4CQLB 3K9GA 3MB8A 1G20B 1XKXA 2H06A 4EZBA 1JAHA 1OH5A 3BIWA 1SUBA 1O96B 1PEDA 1TT5B 1U7WA 2XQKA 2Y1EA 4GIBA 3T7JA 3UV6A 1ZCAA 2C77A 5IZCA 2B3TA 3X1KA 3E53A 4YMIA 5DMXA 5EWJA 5J5AA 3RAPR 4C01A 1JG1A 2ZQYA 3HJUA 4N9QA 3QVGA 3QVWA 1GP2A 4Q9DA 3R6TA 1C1XA 4GRAA 4JC5A 2Q8QA 1C7EA 3QUCA 1GZDA 3AV0B 4O0MA 2I4TA 5JS2A 3EDYA 4HQNA 5KAPA 3QELB 1N6IA 1E9SA 2PN1A 1OA1A 2WKRA 4IRMA 4EPYA 2WA1A 1GFSA 1FQJA 3BRCA 1YMUA 5JAOA 3GBPA 3S2FA 3BEOA 5JR3A 1YZGA 4B8YA 4C2TA 2OAQ1 1JYEA 2HTFA 3DT9A 2XDWA 1E3MA 1LTKA 4K6MA 3AY3A 4RANA 4K8RB 4V0RA 3CRMA 4MIOA 1SUFA 2B0JA 4UD2A 4TMTA 1KARA 4MOWA 4GF5A 3Q9NA 4EY5A 2J0SA 4X7MA 3I4LA 2YJ5A 3SU8A 4CNQA 1NLFA 3TF5A 2E82A 3LF2A 3O6VA 2G70A 2OGTA 4IILA 4J0GA 4LXHA 4P84A 1TAUA 1UDCA 4H3VA 4JSTA 2BFDA 1BVUA 3TFWA 4I3GA 3BN3A 2G09A 3H2GA 1IY1A 1C1HA 4N5DA 4IXWA 4R1QA 3ABOB 2AYXA 3OZCA 2QYTA 4LF8B 3A7DA 2BKLA 1IHPA 2WICA 2RAVA 4F1KA 3LC0A 4XYEA 4G8BA 3MBOA 3LUJA 1ADJA 1TQ4A 3PBKA 4TKVA 3UKOA 1ZGCA 2JFVA 1EKXA 2ZVJA 1HNWB 1HKUA 2MMGA 1U8TA 1Z5VA 5HR5A 4BVKA 2WIJA 4YAIA 3KR1A 5CFLA 2V4MA 2PZJA 3FZNA 4R41A 2AYYA 1I7QB 2IFTA 3EF0A 2BJVA 1CUXA 3AUTA 1XAJA 2HCRA 2HK9A 2I67A 1ZK1A 1E98A 1FQOA 3QYAA 4IQFA 3OOEA 5C1BA 1BHJA 1SBIA 2W2LA 1UJ6A 2WM2A 2H59A 3P9ZA 3V9AA 4JBHA 1MX1A 4ND7A 1N5KA 2CLOB 6GPBA 2CNKA 4RKQA 1CC1S 4N7BA 3ZVLA 4GYJA 3U6KA 5E2AA 4QDKA 1HQDA 1BD4A 2Z6VA 3BTSA 4KAAA 3EFBA 1SHLA 2C7OA 5K8LA 5G1NA 4O2AB 1LV7A 3ANLA 4GZ5A 1UOOA 2I62A 3TMYA 2WSMA 5A62A 4MV7A 4F5ZA 4AVYA 1JDTA 1UFQA 1X1EA 5TGTA 2YIMA 4TLDA 2D1YA 3FNFA 3OFSA 2X4IA 2HFKA 3ORFA 5D3QA 3KCNA 2OUKA 1J5XA 2DJIA 3UOWA 1YA8A 1Z6ZA 3PQ8A 1CVIA 5BN3A 5HRAA 4KKVA 2EBFX 1H3EA 3OLYA 4V3CA 5IUKC 3AJ8A 3EZ7A 3ZGLA 1C7RA 2JNWA 2ORVA 1KJ8A 3U7QB 4Q15A 1Z18A 3SD7A 1WDLA 1XCLA 3IQXA 3LQ1A 4FMDF 1T13A 4L57A 3CSDA 4DJAA 3S8YA 3I5XA 3WJ1A 3UAZA 3EIQA 1XIVA 1GV0A 1KFJB 1HY3A 4B3IA 2R8BA 5K3DA 5T64A 5I9BA 3I9LA 4IH9A 4OGFA 1RLTA 1GNVA 1D5WA 4LRSB 1R0ZA 5HBGA 4XVHA 5IFLA 1UBTS 2IBTA 1BC5A 2XJ9A 2QE6A 2PD6A 1MA3A 1G7SA 3FAKA 4DCSA 4FMCB 2IH5A 4BB0A 4RORA 3FMIA 2WIGA 3PR1A 3WIOA 1VJTA 2BSAA 5IANA 1QAMA 4O29A 5J4YA 1NZJA 5EZ5A 4F86A 4N0MA 1XRSB 5DEIA 1TZBA 2ZBUA 4KQMA 4GZMA 2YQZA 4LBVA 1I1NA 3UJNA 1TLLA 4KK4A 3Q7QA 1QYRA 4OI1A 5KYYB 4YO7A 2F4NA 2GVNA 2XGOA 2XBUA 4B3BA 4I9GA 4JGGA 3KJZA 4J7UA 1ZM9A 2GA8A 2QL6A 3E1KA 3QVMA 4JP1A 3KB8A 4ZQHA 1VPWA 2MR5A 1ZUWA 4MDYA 2VLIA 5ECYA 4X6XA 1T0BA 2DU8A 3RKUA 5LYJF 4BYMA 3VAYA 5ECGC 3K31A 1SCUA 1ZOSA 1C9YA 1YZFA 2QRHA 5BNTA 1EVZA 4XQ0A 2H2DA 3NU1A 2PZ8A 4WBXC 4DANA 2DUUA 1QHFA 2OCKA 4BWGA 4PIMA 5EUCA 3Q0EA 1T8UA 2J1LA 4QG3A 3HB7A 1M7HA 1BJTA 1XTIA 3UT6A 2DQYA 4HDOB 4AB1A 4R98A 3ZS8A 4V0MA 4MDFA 1TQDA 3C3XA 3R23A 1UJBA 3IT3A 5IZCC 5AW2A 1C3EA 1SVUA 2A7XA 4OUDB 2HQBA 4JI5B 4BO3A 4YMGA 1NRIA 3ECCA 2AT1A 3MIIA 1L4UA 4G0YA 2PVSA 3ILHA 3OQHA 1BXGB 1RKXA 4CTMA 4OLBA 1SWWA 3A4YA 4C2AA 3RS3A 4DOMA 4OHKA 2GM5A 3D1LA 1XWIA 1T9GR 4OXKA 4DBLE 2VTKA 2P65A 2FN9A 3GUHA 3EXEA 2JI6A 5E38A 3SZRA 1PNRA 2CNNA 5HRCA 2YWXA 2C9BA 3AIIA 4NYMQ 5G4KA 5C1OA 4DB4A 1H9BA 1XCMA 4J0JA 5IK2A 3A6GA 4OFWA 4QLAA 2NACA 1CHNA 3O8OA 4UBLA 5REQA 5ITSA 1V1RB 2X3UA 5TGDA 5C9ZA 3RBVA 1JR4A 1VB3A 1JR3E 4MHOA 1FDOA 4YACA 3E9MA 3RTCA 1ND6A 1DIRA 4Q34A 3TB6A 1VDMA 1F7UA 1Y6JA 1GDTA 1POXA 1G0NA 1T0IA 3GROA 3KBOA 3D6MA 4CT4B 4EA7A 3AF2A 3VSDA 3PGLA 3GP3A 2B7BA 5B7PA 4JOCA 4XWOA 3ZDCA 3DBLB 3LC2O 4V39A 2G36A 3B48A 1BW9A 1TMGE 3L41A 2WV9A 1E2MA 1U2QA 2C4TA 2WPDD 4G0PA 2XMPA 3OVMA 1A7KA 1S3FA 3DHYA 3SHVA 4WBNA 4ZMBA 3EPJA 4MKRA 2G8LA 3HTXA 2JFZA 3E22A 2QZ9A 2V7QD 3AEQA 5F1KA 4RTOA 1DQPA 1RWNA 2YWCA 2WILA 4FGWA 4HDMB 4A2CA 5AKHA 1RWMA 2NSLA 1GVHA 3O4HA 4JC8A 2BUCA 2EQBA 4L8VA 4DEVA 2LBPA 3FR7A 3WMWA 5C80A 4PPQA 1UFKA 3MELA 5ELXA 1EXWA 3JY6A 2OHVA 4KPUB 4BPBA 3ZXYA 4LISA 1O6FA 4MVJE 4KB5A 1DTEA 1V0JA 3RRJA 5B7GA 1LUAA 1NE2A 4F7WA 5JXWA 2HSZA 3O0DA 3TMAA 4LVNA 4YA6A 2C4NA 4WCDA 5C8YA 1HTWA 2YUIA 2CDRA 1XHEA 4D3YA 3NAQA 4UMVA 2QTFA 1MZPA 4S1OA 1YC2A 1NN1A 3DTVB 1PIWA 2O20A 3AF4A 4CEJB 4H7DA 4QXPA 4AN1A 1E58A 2WMNB 2R0QC 1YS4A 4KO2S 1J2RA 1Y4UA 1Z6GA 1E5VA 4X20B 2VKQA 1QKKA 2NUAA 2GUWA 3LBHA 1YZ3A 3O1LA 1TZMA 4QNMA 4YCNA 3A0UA 1C4KA 1U9YA 2VZ8A 1ZHHA 2DWOA 2ZRJA 4LGVA 3T6KA 4IOKA 3VDQA 4JLUA 1SK9A 4M37A 5ENZA 13PKA 1XEWX 3VNUA 1YRHA 1I2MA 2I54A 2PLWA 4M8SA 2F43B 4YXWD 3RB8A 2DP4E 1EK0A 2E7ZA 2KLBA 2XAAA 2DF8A 2Y71A 4Z9XA 5IKXA 1A9XB 5KNBD 3PLAE 4HHEA 4GSKA 1AMOA 2GRJA 1EWKA 2JARA 1RM4A 2H52A 1F8YA 4Y98A 1Z29A 3VNVA 1BXRA 3L6OO 3ODGA 4Q19A 2CXPA 5C81A 5E9QA 4ZVSA 4A27A 2Z5GA 3CVXA 2H1VA 3F2VA 3KD2A 3UJDA 1YOVB 3EQ7A 1AMNA 4UEQA 4NQRA 4ZZ2A 4XXHA 3GGGA 4EQ6A 1T10A 1N77A 2FPPA 3QGMA 4KNYA 4ZMRA 4L0MA 1HOXA 3FUUA 2HPVA 2XUKA 3FTNA 3PNLA 3JVVA 4FCWA 1E63A 3H2IA 2DH6A 3BGWA 3H5IA 1XYGA 1WPRA 2QS9A 4YJGB 1APBA 3AHFA 2HK7A 5IAKA 1I7DA 2XTZA 4KIGA 2DX7A 3Q5GA 5ADHA 4L5IA 3TTSA 4CLHA 4BV9A 3ZWBA 2P9ZA 3G9UA 5FP0A 3A6LA 1OGJA 1U1GA 2R48A 5F21A 3ZOZA 1BRTA 5E3HA 5KTPA 1L5SA 4G3XA 3TWOA 1C0KA 4J75A 3QWAA 2Y1DA 2I33A 1ZD9A 3REOA 1KMHB 3HCAA 3DXZA 3A1UA 4GRIA 2BSXA 4HV4A 3CKKA 5E6SB 2HK8A 1FMCA 3HWWA 2FSGA 1YRLA 2H48A 2OESA 5A7FA 2GJKA 2QPAA 3DT6A 4BAGA 2Y99A 2Q07A 1OBOA 4US1R 1EX7A 3LIPA 4PM4A 3GLHB 3T7RA 3WX0A 4KACA 5B3LA 3DHNA 5GZ6A 3IQZA 3E5RA 4U7TB 1G9XA 1FDVA 1L5FA 3V8EA 1LDMA 3YASA 1E5QA 1DKMA 4OJMX 4PLTA 2E5FA 5CT9A 3KYCA 5JNTA 2R1VB 2HT1A 3A6ZA 3EBLA 2O5CA 4R3NA 5IBQA 3A1EA 1E9BA 5A2QA 2WJAA 3QFCA 3T99A 4QHYA 2P1ZA 4Y0VA 4MR8A 1SQ6A 1JJBA 1U8CB 4URZR 5A71A 1GQSA 1M34E 1Y5NA 1ESEA 1ZPDA 2YYYA 3WDLA 7MDHA 1SD5A 2RJNA 4DMGA 1FJHA 3I37X 2CDCA 1OIXA 1LRJA 1T5BA 3OC6A 3VR2A 3WZMA 5FTMA 4M1EA 3LHFA 3UK6A 2Q0HA 4XEHA 2WR8A 3TUJC 4EJSA 3HBLA 1FW8A 2G7ZA 2HADA 5LMUB 4R6WA 5AVYA 5JZ9A 4MV5A 4LS3A 4R68A 1U7UA 1IVYA 1EK1A 3WNZA 4TZTA 1YB2A 4BBZA 3JVDA 1XTBA 2BP7B 5SICE 2B8WA 1IJKA 3O2SB 4ARIA 1Y1SA 3EQZA 2XY4A 2BLLA 4XTRA 5CB4A 1ZLYA 4INZA 1Q50A 4GWKA 4PAQA 4PXYA 1ONBA 5FXMA 3RUIA 5JWOA 1P31A 1FTNA 1TT7A 2Q4DA 3ROMA 2GBFA 1PV2A 1DNPA 2I5PO 5DH9A 4DV3B 4XFJA 1EUQA 1YS6A 5J23A 1T91A 1AIPA 2WUVA 3FUTA 4JYBA 3M5PA 2WP0A 4XX0B 2E5LB 4OK3A 4ERXA 2PUBA 5ES4B 4MKFA 3K6SB 2AJBA 2H6EA 3GRZA 2IJGX 1H4SA 2JBAA 3TPCA 2WJPA 3BC1A 5EMKA 5BRAA 3NBUA 1L5VA 1WLYA 1ZRMA 3R6DA 3ZWOA 3ADBA 1M2OA 1Q1ZA 2P4UA 1TUIA 3LY7A 4EMSA 3NYQA 3PGVA 3WLFA 1TKRA 2GR9A 4UULA 1IDOA 1R64A 4CBVA 5B3AA 3IBYA 4CKWB 5L3QB 3AB3A 1WMBA 1ITZA 3TTYA 3IVXA 3VH1A 2ZREA 3LD9A 1ATIA 1KK1A 1IBRA 1SCDA 1YTLA 3Q8WA 2EATA 3LPDA 1QCDA 4RXMA 3EGCA 4A8HA 2GKGA 4P4SA 3EA5A 3G1UA 4I55A 5DYYA 1EBBA 1Z7BA 2GCIA 4QQFA 2NV2B 4FIZA 1KFKB 4E21A 1D2NA 3FOZA 1RAEA 2EZ9A 3X1JA 5BQFA 5KTNA 5CDHA 5IRCD 4OQQA 3GFVA 1VMKA 5A0TA 3DVQX 2TSYB 2D74A 3ADPA 5A7HA 2FEAA 3OPYA 1UBKS 2FJPA 3ZXSA 5JSKA 2QM8A 3MLAA 1NPTO 2RKOA 1U8FO 4HYTA 3AYXB 3GOHA 4TV9B 3A04A 4CT5A 4DHEA 4D45A 4AQYB 4MWZA 4RZXA 3TLCA 1ZH2A 1PYOA 1GTVA 1S7GA 2XCQA 3MC1A 3AO0B 1ZXBA 3HS3A 2HRZA 5J2UF 1AQIA 3GUUA 2IXTA 1C3OB 5GOTA 4C2UA 5DLDA 4CIBA 4JJ6A 1PT9A 2XB4A 4YRBA 4YXFA 4RCVA 4AXXA 5HYVA 3ABSB 1CERA 2VYNA 2WSSD 1X42A 2NPOA 1Z06A 1Q57A 1YQ9A 3GYGA 3ETHA 3JRWA 3AV3A 3SKVA 4C7MA 7REQB 2D5LA 2WTAA 4CFYA 4EYGA 2VF5X 4C03A 2GZMA 1PNQA 1F5SA 2PPLA 4PLVA 1XMXA 4OIFA 4DLSA 1FP4A 3OZXA 1JLMA 1JAXA 3JD1A 2VJNA 3E2MA 2WJYA 4MRAA 3V8RA 2H16A 5K6TA 9ATCA 2P75A 1H2WA 4DLVA 3T5PA 1Z0DA 2WIKA 2Z3VA 3B85A 2X2EA 3GLRA 3OESA 4FFPA 4GVXA 4HS9A 2J9RA 3IO5A 5LMNB 2I4NA 2IZZA 3AUKA 1BRMA 3AF6A 3O83A 4MI3A 4XVCA 2H1FA 2G71A 2ZU6A 3IPYA 2IL1A 2D5IA 5EZYA 5F3RA 4MQ4A 2ENWA 1N5DA 2IWHA 1F38A 5AWFC 5KHAA 2VHWA 5LC1A 5BSFA 5BVHA 2O3RA 1YUBA 3O9VA 1BJKA 1M0WA 2XQFA 2AI2A 2CDAA 3CVYA 1O7JA 2VXBA 3P9KA 4L27A 3Q85A 4MJ3A 5CFNA 2FEMA 4DJTA 1OHHD 1V7CA 4Q4HB 1RS0A 3GIDA 3RRMA 1KRXA 4A10A 4YEDA 1JVNA 1PEAA 3LLCA 1A04A 3AVYA 1QV9A 3I39X 2LKDA 4CEHB 2VHTA 3WYAA 2H1LA 5BO5A 3HXPA 3HDQA 4YRMA 2FQYA 3VYRB 1QCYA 4ATNA 4JUDX 3MGCA 4RVFA 4HX9A 3QX8A 1PS8A 3CX4A 4YVFA 2X0FA 1OWLA 2I3ZA 1RXUA 3E9ZA 2FMFA 3L82B 3U61B 2BKAA 4L9RA 4DEYA 4I1RA 3K5HA 4JC0A 2RB4A 3ZZ1A 1FFEA 2OP1A 1D6SA 3A1WA 4R2HA 1J9EA 2NXEA 5B1DA 1FFCA 2GFHA 3I23A 4YAGA 4MR9A 3F5QA 4BTVA 4YC7A 2Z5FA 2QM3A 4PLYA 4Y6OA 5EQTA 5KTSA 2I8CA 3L8DA 5CAEA 1K08A 2HIAA 2WFAA 3M34A 3MGAA 5JVDB 1L6IA 3ETDA 2FCRA 2OLJA 4B3FX 3WGVA 4C9BA 2FY8A 4EJSC 4XWAA 3GVIA 3R0IA 3TX2A 1UEIA 2IHBA 2GI4A 2HX1A 3A2MA 2BYTA 1HLPA 2GPNA 3DAFA 3IE0A 1BWSA 1M3SA 1NQTA 2VP6A 1Z75A 2QN9A 4PNZA 1JLLB 4RZSA 4ARVA 1Z4OA 3H5VA 1ADCA 3OKPA 4Z3OA 1TK3A 2FZCA 3DWGA 1WU8A 1ESMA 1MO2A 1IUPA 5ETJA 1QGUA 3WBBA 2AX3A 3IPXA 8ATCA 4IW3B 1N92A 5EXPA 7ADHA 2Q6KA 1VB5A 3IDZA 4KQCA 5I4BA 4XGNA 4M6WA 3R9IA 2BCJQ 1E6EA 1NURA 4Q02A 3P9YA 2PZAA 4WHMA 2WE7A 3QU5A 1B16A 1SQ0A 4TN1A 1G18A 4BEWA 4NE7A 4YT5A 3W5UA 1SBQA 4RIGA 1XU4A 3TIIA 3T5GA 1B6TA 3BL6A 2C88A 3DGEC 3DPSA 3KKQA 5HK9A 4QDJA 1QFXA 1Y6GA 1E5XA 1YGYA 3E18A 3WJ2A 4E15A 1M1ZA 3AFNA 3AIOA 2P2ZA 2G4VA 1GT91 4Z51A 1YU6A 2GBCA 2QG4A 2CLSA 3AR4A 3QNUA 4P36A 4K28A 2DPXA 2X5OA 3ZU6A 4ASUD 3AT1A 2HL6A 5TC4A 4IWXA 3H2YA 3MGGA 2DFTA 2VDMB 2X42A 5K3OA 3VYTB 1THGA 2E89A 3HQ4O 3KSAC 4RVOA 1WY5A 3WWCA 2OM2A 5E0KB 5ED0A 2PUCA 4RMNA 1RT9A 1JHOA 1OC2A 2WIFA 5JDIA 1DC8A 3CISA 3K8QA 4OLJA 4UBJA 2G72A 5F5XA 5BR8B 3TEFA 3QWBA 4XDYA 2JGFA 1NHWA 4E2WA 2ENUA 5EUMA 3W4KA 1XELA 3AI2A 4RTQA 5LYJA 1JKIA 1ZIOA 3A9CA 3M9WA 1YI0A 4FC6A 3VC3A 4BTEA 3BBPA 4TZ0A 2OPBA 3V3KA 3QX7A 1NONA 2X9GA 1YAHA 4I46A 1P80A 4MB6A 5ESXA 4D99A 2VT2A 4BV3A 4I8XA 2Z2IA 1YL6A 3FVVA 1Z16A 3IX7A 1U9JA 2FDCA 2P4HX 1COWA 1R0RE 2RKWA 1A9TA 5E7MA 3CLVA 5AKGA 3T5CA 3ZQUA 3CPEA 3GFQA 2Q3LA 4AURA 2WIAA 4HVCA 3KE8A 2QT0A 2Z8XA 1QJ4A 4B4KA 4EKDA 1SVNA 3LCMA 4OHUA 4QT0A 3C6YA 4LX8A 1T36B 1Y3CE 3QEKA 1AT1A 4KDFA 4MPTA 4UHEA 3RKSA 2LWIA 1AY0A 7AT1A 3PUVA 4NXMB 1WXXA 5TF4A 4B31A 3M89A 3CNOA 3RASA 3LDGA 4YPFA 5SV2A 4EG1A 3GRAA 4KN8A 2OLKA 1YJQA 1T8PA 2H4XA 3D5QA 3JTMA 4G5HA 5GJCA 2JJ1D 3WGTA 4XR9A 3GPLA 1LWOA 5EZQA 2UYOA 3T54A 4E5UA 1XPJA 3E2PA 2C04A 2F8TA 1WPXA 2Q1XA 2WTMA 3L7JA 1L5LA 3OJCA 1UOEA 3ZV7A 3GDFA 1UEJA 4NMWA 1JR3A 1XDBA 1XXHE 2NV6A 2V54A 1U7TA 2KX7A 4RTPA 5J5CA 3CKMA 3GJSA 1F5NA 1K6IA 1Y1KE 3AJAA 3DBRA 3L6CA 3O95A 3CPHA 3UQYS 1FFHA 2REBA 3HJRA 4G4IA 4QNRA 2ZEJA 5CUQA 4FEAA 5CEJA 4HQOA 2OGSA 2HNKA 3UBMA 3HDGA 4PGHA 3FPGA 1DTWA 3HZZA 1FNCA 1HQYE 1G1AA 5F64A 4O0LA 4IDQA 4MB0A 3MINA 5HTKA 4C7VA 5FB3A 4HR7A 4EAQA 1RI4A 1T1JA 1VECA 3FMPB 1EH5A 1H6CA 1VMEA 3KUUA 1GSHA 2JIQA 2HUNA 4KFCA 3CH5A 5L3ZA 3AESB 3MERA 4HDQB 1VCIA 1NXPA 3OA0A 5JAHA 2DECA 1M76A 5K3CA 5I7HA 1XEAA 4J4BA 2M2IA 5K6RA 2HXGA 1Z6YA 4KIUA 4UW9A 1XTJA 4G09A 2B4AA 2FUKA 1DV2A 5IH3A 4HNHA 1SKQA 4FT2A 1J99A 4GNRA 4NBTA 3C98A 1WU7A 2DSTA 4DV4B 5KYWB 3SE0A 4I66A 4KGDA 3PENA 3N2GA 2GF2A 5FBVB 4Q05A 1ZWKA 5GZ1A 1V45E 4IINA 4UOQA 3QSGA 2HHJA 1NI4B 4WOBA 5EXTA 1BFKA 3LA6A 3WGHA 4TYYA 2VPTA 2ZATA 1V7QA 2PX3A 3BGDA 4G26A 4O3MA 4ND3A 2WNIA 2YINC 4N0QA 5AJHA 5H3LA 3NS7A 2VSNA 4LG1A 1XNGA 3X2SA 3AUFA 4NEGA 1P9LA 1ZYUA 1U2GA 2ID8A 4JI3B 5AIAA 4IG9A 2HYIC 1FTYA 4OJTA 1P5HA 4PX2A 2VBFA 5JNUA 1SIUA 2NQTA 4BKPA 4QM6A 4EEXA 1TRKA 2I2XB 5EUQB 4EPWA 4F45A 5IT0A 2XUPA 2VRCA 3CT4A 1B8PA 3D4NA 3LECA 4KLNA 4PPFA 4TWAA 1N32B 3IKTA 1SFRA 1PJRA 4EY8A 3KKPA 1L5ZA 4PQRA 3TLZA 3X2EA 5LLSA 4AMYA 3VPSA 4EGCB 1M7BA 2LZ0A 2PLFA 4F38A 3PX3A 4OV6B 3HPRA 1M1YB 4TWZA 4FNGA 5JBQA 3DKVA 5AM0A 5CCDA 2VHZA 2OILA 2YS6A 4G4GA 1TEVA 4ZEXA 2A57A 3A1SA 3HH8A 1Q74A 5KEIA 1Q1GA 2WP8J 4G5XA 4WN9A 4A0SA 1UXJA 5CLJA 2QK4A 4FW9A 4J07A 4LTDA 5JFTA 3G89A 3DEIA 2Q1WA 3AM3A 2ZYGA 3TSOA 1WBBA 3PTZA 4RABA 3KZMA 4X1YB 4PZDA 4QZVA 2X7XA 2G28A 3BORA 3QEBZ 5TPWB 5C18A 1IE3A 2J48A 4M1SA 5E2BA 1VLJA 3F6EX 3ND9A 3TXYA 3HXKA 2NX2A 3GJ8A 5CB8A 3AKCA 3UHOA 1QF9A 5JDIC 2RI1A 2H65A 3FCEA 1Z47A 4BB6A 1AE1A 1J8DA 4L76A 4EFLA 2Z3WA 3GLKA 5BSKA 1N25A 1DBWA 1QPGA 2WUEA 3B9PA 3KWFA 1Y3FE 4H1TA 3RS7A 5JJIA 3A1FA 2LPMA 4BE9A 4EG0A 2QTHA 3QU4A 4HN4B 2Z6QA 4P0PB 1P7VA 2IDMA 4IVRA 3B20A 4N1AA 3OFND 4R3WA 2L82A 5KCMA 4ES6A 4W8GA 2DERA 5LA6A 2ZPAA 1OJ7A 3RRZA 3W9UA 1RE0A 1RKVA 1S96A 1GILA 4EARA 5A4KA 2P41A 3RC3A 3QEMB 1L8XA 1SG0A 3C5CA 2OFFA 4NFYA 4WGGA 1NMYA 1PU2A 2XVZA 4L9AA 4UHFA 4CLDA 1NW6A 3ZVMA 4K6GA 4BYGA 3QPCA 5A04A 2COKA 2XMQA 2QAGB 4N3NA 3WYFA 4ED9A 1A9YA 3C6ZA 4II3A 3RF7A 4DBLC 2VHXA 1BG6A 1IY9A 1G8MA 2WD8A 2C2ZA 4PU0A 4CU5A 1Q17A 2XYQA 5CVJA 3H5OA 5GONB 3TL2A 5KYUB 1UBLS 2HMVA 3EBOA 3KHSA 4HWSA 3U3KA 2CVOA 1CK4A 1M34A 3HCDA 3HKDB 3Q3JB 4FFBB 1TMKA 3CLTD 3CWCA 4LFCB 4YCMA 2VAXA 3FHCB 1K2VN 3A6PC 5AW5A 3WB2A 2WF7A 1NW8A 1WCV1 3KL4A 1QDLB 4LXGA 4P83A 5K0TA 4LMBA 1UZNA 1T1IA 1TJ4A 2L42A 2GQ0A 1CULC 1G5TA 4KTTE 2FGJA 5KNBH 3LHKA 2BT4A 1V9LA 4DNPA 1XLWA 1DKNA 1JPJA 2JIPA 3AR3A 2HIHA 4WA8A 2EDCA 4MI1A 4BRSA 5EHIA 1L5WA 2W71A 3E48A 4TSFD 3SDZA 1UKCA 2BFPA 2O7VA 2P0EA 4JK3A 2Y9PB 2W8BB 3L9XA 4B3JA 2WAMA 4FBMA 3LVQE 4BCBA 1XVTA 3QBEA 3AUUA 3QI2A 3AXTA 5CX4A 1JQAA 1YQUA 1PDOA 2XKJE 2W2OA 3HRHA 1L9XA 2W11A 1CUVA 3PIIA 3U3XA 3ZOKA 1J0BA 4PN7A 2QW0X 3R8FA 4FPXA 5JS1A 2GNPA 1KVUA 2M9MA 2Y0PA 4JJ7A 2A1UA 3LCVB 2BMVA 2FVYA 2H07A 2QRGA 3GT3A 3MPOA 2Y1LA 3D02A 4F0JA 1CU1A 3IRUA 1AM4D 1AXGA 2X76A 3NXKA 5KTRA 4OQPA 4XJTA 3SIPA 4UTRA 1QYCA 2OY0A 5CM8B 2O4UX 4A82A 4DRXB 2GASA 3D7LA 5G3YA 2HDHA 3H16A 3WICA 3WWPA 4F4DA 5ITZA 3N6RA 1WP9A 4J2HA 1XMSA 3VBCA 4P3KA 5FPPA 4DNOA 4B82A 3HR8A 2RGBA 2OGZA 2ZTSA 2OCLA 1Q0TA 1US8B 1VHDA 1WKVA 2GZRA 3G2JA 5CVVA 3VYVA 1QTQA 3QG1A 2D1RA 1QK3A 3T4PA 1NTRA 1NVWQ 1AQJA 3OTIA 1XZFA 3FGPA 2EW8A 3HKBA 3OBIA 4LSZA 2GM9A 3C45A 1W8DA 2IIPA 2LIPA 3U17A 1SVLA 4HVLA 1M9NA 5FKJA 1U2GC 2QXYA 2GK4A 2VBCA 2Q3DA 2DTEA 2R5FA 1FE8A 3KLPX 3K2EA 1AVTA 1RAGA 4W5WA 1F48A 2XNSA 4N0EA 2WFMA 1O97D 3ZD9A 2JEOA 4UOEA 4QEZA 3BAFA 4H3KB 2X14A 2IPAB 2GBGA 3QXCA 5H81A 4CDRA 3VJMA 5IEJA 1KMIY 2OV4A 3H8SA 2EFJA 5DM2A 3K0CA 1PQPA 4UOZA 3LFUA 4CDNA 1OLUB 5KQPA 1M1XB 4ZI7F 3CB4A 1E60A 4E11A 1C3XA 1EVKA 1W75A 1WXIA 4YRIA 3GGCA 5J2UA 1A50B 2L0XA 3IJPA 2XDYA 4B3GA 1GDDA 5LCXA 3ZV3A 3HJNA 3UAVA 1NQWA 3HADA 3V3TA 3IELA 2ONZA 1WB9A 2RJ3A 2HQSA 4DNXA 3B82A 3UJ6A 5IC4A 4Z2YA 1QFSA 4PSCA 5KWIA 1XZPA 2FFAA 1M67A 1NXVA 1P0CA 1ZUIA 2FUG1 2GEKA 2IUFA 1QZ3A 2QQEA 3QOFA 3QUQA 1GNQA 1N2IA 4FCVA 4AYXA 1T1SA 1GCGA 3UVEA 3GMIA 4XJVA 3CZAA 3R8XA 4E7OA 3NJ4A 4OP1A 1SOUA 5KB3A 4RNDB 3WMRA 4W63A 4UD6A 4FOTA 3G1WA 4LXXA 2AS0A 1O1YA 1XRNA 1ZSVA 1SKYB 2BHRA 3I9V6 3VOTA 3OPVA 4DCVA 3OEWA 4L02A 4BPRA 4KLCA 3QFFA 4M1ZA 3WLIA 3I6ZA 4K6KA 4HBZA 1V37A 5DBFA 1XVAA 4RD1A 4BMYA 4D9EA 1L7BA 1SVKA 3QENA 3HDTA 2H4YA 2I7TA 5E7IA 5K45A 2GOYA 3NBYC 5ECWA 4IZOA 1E62A 2ZB2A 2VRBA 1M6VA 3PJDA 2FE1A 5DTEA 1QS0B 2VDJA 1EEXB 4NBNA 2AW3A 2H7VA 3PUIA 2YMPA 1NKTA 3CE9A 4OH7A 1G4HA 3KWMA 4EHNA 2XTAA 1IOWA 4ZHQA 1UBMS 3WP1B 5A9RA 3U60B 1YQXA 3U1TA 2BEVB 3MCUA 1BCRB 8ADHA 5L8VA 5HWSA 1PJ8A 3F71A 1CJCA 4C4SA 5E6RA 4J0CA 2DXIA 3PNKA 4XD7D 3VI3B 5B53A 3DOJA 1WXFA 3GJQA 1KTVA 2BKVA 5FL7A 5C52B 1QYDA 5EN4A 1MXFA 1YZTA 2RHWA 2YV3A 4IYRA 4B48A 4ZU3A 7ABPA 1T9ZA 2AQHA 5C7LO 2E5WA 2VF4X 3A6DA 3G2LA 3U7RA 3D6UA 2AQKA 2CL7X 2DYKA 3OC0A 1U9CA 3FSGD 4M0DA 5M3BA 3JZMA 4RQTA 1YI8A 1U65A 2Q5CA 4MRMB 1DZ3A 5L7TA 1AA9A 5F5NA 3SE7A 2CFTA 3RSQA 4XB6B 3BIFA 1DJLA 3MT0A 4W5OA 5JS8A 1WEKA 3FZYA 3DAGA 1H2FA 2HHLA 1VQ1A 2ZJ5A 3PVZA 3HVHA 5DW0A 5JXJA 1F51E 4X54A 4AIRA 2P1DA 1WP4A 1NVKA 5AUPB 1QE0A 3RROA 1G291 4OFXA 1S2NA 4BEVA 1CRWG 5FWAA 4GUDA 4QU9A 3SKXA 1UM8A 2ZZMA 5LZ5A 2M6RA 3NDBB 4O33A 3WLPA 1SCIA 4NPHA 5TQ2A 5ABPA 1CPYA 2X0KA 3JARA 3ROTA 4PTYA 4HNTA 1JG2A 1LNSA 2N46A 2PFKA 4MWBA 2A5YB 2RGDA 4QXRA 1P1HA 2JCGA 3CS3A 3DNPA 5LQKA 1XNHA 4EHKA 5CHYA 3OZUA 3ETLA 3ICCA 1XZMA 1Z0UA 2ZI4A 4J0EA 4K1XA 3FJYA 4ZOEA 3EIWA 1P5ZB 1QJCA 3RYIB 1KDOA 1YQWA 1RQRA 3DYIA 2IDZA 5F12A 3KPJA 3OQIB 4UPDA 3BMCA 2HGSA 4YRPA 1YDHA 2BCGY 5DTRA 1LPMA 3KVNA 3KKNA 2ZJBA 4BFTA 2A33A 4QASA 3L0CA 1CR2A 1HG1A 4QX6A 2IHKA 5EZSA 2QW1A 3OZWA 1U11A 3I01M 5GGXA 2EP7A 2I3DA 1E5DA 4GZ3A 5COAA 1Q7TA 3WL6A 3DAPA 4KSBA 5EYPA 4ZDWA 1M75A 4JLMA 2VUIB 2XCRB 3PDIB 1IBKB 1NI3A 5EEHA 5AJZA 3CC8A 1RAIA 1AUOA 2K7ZA 3OCVA 1L7VC 1XZIA 2MU1A 1NLZA 1OLXA 3DDOA 2H08A 5J58A 1V96A 1LC0A 2FPIB 3NQ41 2JJMA 3Q98A 3HBMA 1IOZA 1MZVA 1Z07A 2POCA 3B51X 2NU7B 5AJYA 3O8QB 3T1VA 4C22A 4CGYA 3FJOA 3EAFA 4KFTA 1V4VA 2RDMA 2RIPA 5FPSA 4CKZA 2CF6A 4LECA 2MYTA 5LB4A 3ZXXA 1F2UA 2WF9A 3FLEA 3IVAA 1KVTA 3LX4A 2IS2A 1I2CA 4DGQA 1HF3A 4CIVA 1N0UA 3F7NA 4JI0B 1HXHA 5IDYA 2P30A 2B1QA 3FIJA 1TZCA 2P0AA 3ZWKA 2FPUA 4JT2A 4EEZA 2DLCX 4AD8A 1P7ZA 1SCJA 1E6MA 3SIXA 1SAYA 4P38A 4IH1A 5KWEA 4JVMA 5JH7F 5FTJA 1K66A 3FTQA 2J45A 3EC2A 3C1OA 4YMTA 1SCKA 1VPVA 4GBGA 4H4EA 2IPMA 2C7VA 1T25A 3C3MA 3IB6A 2Q5EA 3RFXA 4CR7A 3C5HA 1OA0A 4DVGA 3K0CC 1NUAA 5L9AA 4F3TA 3CVWA 3N2IA 1POWA 4NJMB 2FFJA 4CQLA 2J0UA 5JQGB 1G20A 2C9ZA 1F3LA 2ODQA 3CZRA 5CH8A 1O96A 3IDAA 1W47A 3MTIA 5KBYA 3N39C 3GT4A 3G5AA 2GF9A 3L7BA 4W5TA 4TKZA 1D2RA 1TVMA 4GI2A 1MB0A 1HI9A 1Q44A 3GUVA 4YRQA 1OXMA 1TYEB 5DX8A 3QF7A 2BHLA 4AKEA 2ERYA 2H2HA 3I92A 4EOGA 4JQOA 1D2HA 1L3IA 4JVOA 3DR5A 1EWRA 5TARA 3ZD8A 2ORED 4CR8A 1ZJWA 2J41A 1CJBA 1D7OA 3W06A 4L6AA 3C6BA 3B70A 3BWDD 2PJUA 1SK8A 5P21A 3F4KA 5KU1A 3EZ9A 1OXSC 2FDRA 2C82A 3HUFA 1D03A 5HW0A 2BF4A 2PZBA 3Q7EA 3VU0A 2J3HA 4LF6B 5C8XA 5I9TA 1CZUA 3G9TA 3RHZA 4Z86A 2H5LA 1RYHA 2LRHA 3RYFB 5JZMA 1J33A 2JF0A 1IXYA 1NBAA 3V4OA 2GEBA 1XXHA 2Q29A 2VNKA 2QBYB 4R9NA 2LDBA 4IMIB 2X1VA 3C2QA 1CLUA 2R9VA 3D2BA 3R20A 2GKSA 1FUKA 2R4QA 3P5SA 2WIBA 4GX5A 1LU9A 2OV6A 4DXAA 3H6HA 1FDWA 3WYEA 4REQA 5L3VA 3R6GA 3IL2A 1WZEA 4AJEA 2RC6A 4F3NA 3FVRA 2J9XB 4W9RA 4JR1A 3PA8A 1IBCA 3H0CA 4BBAA 2JH9A 5IVKA 4DC0A 1IQRA 3OE7A 1X7HA 3BULA 1ZGAA 5TPZD 2QTVA 4MSUA 4BNJA 4LJ7A 2B34A 3BFKA 4C6HA 3O1JC 2VSYA 4J3FA 4RV9A 3RSZA 4C3VA 2HBZA 4XUEA 2GD1O 4QQNA 5DT2A 4DR4B 2O2XA 1J22A 3K2QA 4MW7A 4MUJA 1N7JA 2DKFA 2BTQB 2VPWA 3PC6A 1RIFA 2XNKA 5G1OA 4JQZA 3GNSA 4P7JA 5K4AA 3KV3O 1U94A 3HRKA 4QYIB 4AKTA 4BNYA 1DIOB 1RZRD 4XPIA 2IYTA 4E31A 4DQUA 5HF9A 2XVMA 1WULS 1Z36A 1ZY2A 3RVLA 3SC2A 1S9HA 1UUFA 2OEPA 1GUDA 4L5CA 3QOXA 4ENUA 5KTMA 1N36B 3NBKA 1E6WA 1NR1A 2O1EA 3I9MA 3K0FA 4WMLA 5HBRA 3RABA 1E3IA 5KTYA 2PL5A 2BFFA 3Q7TA 3TQFA 3TW8B 5HQTA 1H3FA 5EEGA 2O2HA 2QUAA 3T95A 2PGLA 3KKMA 1NMXA 5BNIA 2R85A 3IEPA 2C98A 3NR2A 5CB6A 4N39A 4Q6BA 1IBMB 1U2DA 2OYCA 4GBMA 1EWQA 4OXRA 2ZKIA 1G64A 4R83A 4KPYA 2VZ0A 3CB2A 3ENVA 4FT4A 2Q50A 4DSUA 1OH7A 5HJ2A 1NX9A 5UKDA 3B6ZA 5C31A 5EJAA 1N34B 5MF6A 4KOAA 1OREA 4HZUA 2HRDA 1KYVA 1ZMTA 3DP9A 3WLHA 2CK3D 3RLIA 3SLGA 3DEZA 1J1IA 1BROA 4LRYA 3CCBA 3R9WA 5HIMA 2PUEA 1BX3A 1VFNA 3RTEA 4EFKA 1YQTA 1PGJA 4NBRA 4K87A 5A0FA 2P79A 5KQMA 1QG0A 2YXEA 2GJ4A 3ENNA 4JLWA 4YGYA 3P9QA 1EQAA 1YWGO 1KZ7B 4PPYA 1Z6QA 5IC6A 5KYYA 5A9SA 1JU9A 4CMAA 1ZBDA 3CLSC 2ZOSA 4X92A 1GN9A 1CUZA 1U63A 1OWOA 2WZDA 1ZJJA 1DAEA 3H84A 4DCTA 1NVGA 2OO5A 2CBGA 3K8ZA 3PB3A 4FHDA 4ZT3A 1G66A 4BZQA 4HRAA 4M9UA 4BVLA 2VDOB 1PJQA 3D8RA 4O2LA 2HGZA 3EULA 4WXPA 2QI9F 2EP8A 4DA4A 1X8KA 2W2KB 1A9RA 3EOZA 1RYZA 3OY2A 1GZ3A 1X86B 4B5LA 2IC5A 1ZONA 2YY6A 3BJRA 3DAHA 1U98A 4IH4A 3U40A 5JYCA 1PWEA 3I76A 4X41A 3HLKA 4Q93A 1BQ4A 3SG0A 2CL0X 1K98A 2Q3MA 3H83A 3LLUA 3M6UA 1EUCB 1DIBA 2F8SA 2WPNA 1M0TA 4OUDA 5B2FA 3P0RA 4QWWA 4P80A 3PDUA 1BXGA 2R6CA 5K4GA 3MJFA 4IO1A 4TSKA 4DFDA 1JHVA 2QENA 4HEHA 1Q15A 4P9NA 4FWBA 3BQMB 1TZKA 2D0PB 1NL3A 2FW0A 4M36A 4O2BB 1K2WA 3EXG2 4PINA 2P77A 5EL0A 5IFKA 2Q4BA 3DL4A 3G23A 3OKFA 4KYIB 4OGGA 1D1PA 1IB0A 3JX9A 1E4EB 1Q3TA 4NH0A 2R7KA 4OQ4A 2IF0A 1YZVA 2GETA 2QG9A 1XVLA 1MB3A 1QBGA 2XB8A 4KNWA 3VTKA 3UGTA 3KKLA 5CNKA 2Q41A 1RAAA 3BICA 1V1RA 1VMAA 4GO1A 3C16C 3PVSA 3LP6A 1R9NA 2EQAA 4MRPA 4DLBA 1HURA 2VQEB 1ORIA 2REQB 2HZ7A 1PWZA 2VWHA 3AUAA 1A4UA 2QNIA 3WLSA 2H0AA 4ZZ0A 4FNOA 5EMNA 1L4GA 3A4LA 2RGEA 4GR5A 5DNYB 1TPYA 5CVDA 1H0HA 1WZNA 3ZDZB 1DBIA 3DBLA 3QOYA 2F62A 5B5SA 3VC2A 4I4NA 3UHPA 2NVUB 1X80B 2Y05A 3KVOA 5KKNB 1QF7A 1VI2A 2OD9A 4GDMA 1V5GA 1WY7A 3R7BA 3V1KA 1R10A 1UKEA 4LHVA 4PRYA 3H9GA 3RC8A 3FJ1A 3H3JA 3MCZA 2XQJA 1Y8RB 2N75A 3DE7X 4NICA 4TLEA 2VYVA 2MIIA 3EOBI 3KSMA 4ZQFA 1G8KA 4ZVTA 4DTIA 4YMHA 2Z5LA 3L43A 3T1QA 2EFCB 5E4TA 4J49A 3D59A 4E22A 3GYBA 1KY2A 1T0HB 4AMGA 4GYWA 1P0FA 4Q1FA 4YP5A 3Q11A 4J1NA 4YMUA 2WAXA 4G0WA 5CFQA 3RREA 5CVUA 1J20A 2QQGA 3ZLVA 8ABPA 1WB6A 1GXSB 4G84A 5EIWA 4NKRA 1HDEA 1Q0LA 3L0IB 3VKFA 4Q7QA 1O6BA 2J85A 4OI4A 4CEJA 3FX2A 4HGYA 4WKNA 1DG3A 3EQ2A 4BNZA 2DQKA 2GPWA 3ROEA 2Y0DA 5JNVA 3TSCA 2AVNA 1P9WA 2EX0A 3NXSA 3IUYA 4L2IA 3GAAA 4U7GA 1J90A 3B36A 3R0VA 4AUNA 3KKKA 4JLKA 1R4MB 2HJGA 1U2DC 1ECLA 3F7TA 2ZYSA 2OHFA 4JL6A 4R8RA 2H9YA 3NC1C 3A6EA 4ZOLF 4E03A 3E03A 4PGFA 1C2YA 3E15A 3EZGA 1USVA 1NRJB 1JEOA 1PX0A 1WLSA 3S0JA 4FSHA 2GZ1A 2BMDA 1LSSA 3O8NA 1G4AE 1KF0A 3UXHA 3KSBC 2P3OA 3ONVA 3NTRA 3ZXIA 2BMFA 4X7PA 4LFAB 2FWRA 2Z2XA 4ZI7A 3BRWA 4MUKA 1M2HA 4F06A 1VBKA 3A9UA 5HHTA 1M2VB 2JLYA 1BN7A 4KEAA 2COEA 2QDXA 3K05A 5ALJA 3GNTA 3I6IA 5FOSA 4LF9B 4MA0A 3PKIA 4GXRA 2PZLA 1RACA 3QPVA 5I9IA 4XZ3A 2ZYWX 5AHKA 2UZ1B 2I2CA 4RC9A 3K0AB 5EP2A 1YIDA 1E89A 4WVLA 4U4AA 4X95A 3M1IA 4YJGA 3NHRA 1WCYA 2P7IA 4UASA 3S2SA 4MMXB 4KXYA 2ZYRA 3NMUF 4G4JA 3CF4A 3WWYA 2VZEA 3W77A 3R44A 3FCOA 3SJCA 1QX3A 1C1YA 3A8TA 1JGTA 3HLTA 2DHRA 2FNAA 4RJLA 5EMJA 2OMKA 2WNSA 4MVJM 4OXXA 1QHSA 1CUWA 3K1ZA 3X1WA 2VOJA 3WK8A 3RYCA 2C95A 4EJ6A 2OO5C 3CNLA 2KW5A 1UDRA 4FYXA 4BQSA 1DJMA 4JYZA 5A0VA 3TUZC 4NZOA 4DMFA 4DSZA 1LBHA 4KODA 4XB2A 1VPLA 5E6SA 5GOZA 2AOUB 5DM1A 1KEZA 2WW8A 1J7KA 1DKQA 1NLMA 4EKGA 2DHCA 2Z1NA 1S89A 4H77A 3ZNOA 4IIGA 3FPLA 3MYYA 1KVRA 2BFAA 1OQAA 3LT1A 1ZKMA 1N0VC 1GUYA 1RKQA 3EXHB 1FFYA 5H68A 4QFBA 3PUJA 3LOQA 4LA4A 1QKJA 2JHAA 4O63O 4WCVA 4EB6A 4QVIA 5K05A 1DQRA 4DXDA 3A2KA 3WSVA 2NV0A 3B6JA 4IUCS 4K6HA 4L3VA 1M54A 4OHVA 4ZCSA 2R1VA 4EHAA 2NO1A 3OX3A 1IHOA 4PRLA 3DYBA 3OU6A 3VVCA 1YZUA 1KO8A 1SKAA 5SYMA 2O2ZA 4GXTA 5GONF 2QRVB 2BEKA 2X5XA 3PNOA 2G3YA 3UWMA 4RTSA 4IDPA 3J81A 3T9BA 4MH0R 5H5JA 2ZPTX 4E13A 5KU7A 1QO0D 1YBVA 3EUEA 3QIVA 1CJVC 4N6NA 2BM1A 4BLRA 2O14A 5I7RA 1V5EA 4ZN6A 9MHTA 1X13A 3ZWAA 4Q3KA 1UMKA 4B34A 2ODTX 4DM3A 1E7MA 1QP8A 3IXLA 3N28A 4CJXA 4L8WB 1N1MA 5JARA 3NB0A 1N6KA 1TIKA 3UANA 2C0CA 3DMDA 5CT4A 1P39A 4B35A 2OBBA 1W1UA 1GZ5A 2QRQA 3DEYX 3FPJA 4U2DA 4P3PA 2W2VA 3IAUA 2WY2D 5IS2A 4WX2B 2BZGA 3SKYA 3OIDA 3BILA 4UFNA 2OFPA 1JA1A 2ONYA 4KSYA 2I4MA 4QUEA 4B2PA 4QOJA 4ZCPA 2QXUA 3WHIA 3L8YA 1ODIA 3D7MA 3PFIA 2C7BA 2QQFA 4UEOA 1LB1B 5H83A 3QFSA 1C14A 3T15A 1OASA 2G83A 3OUTA 3Q2OA 3EMDA 5E3IA 4MKIA 4EF5A 3F0TA 2YCBA 1NVEA 5ERYA 1NF8A 2WJ3A 2YV5A 1FX1A 1AF7A 3EAGA 1L1FA 4BZZA 3TLXA 4P92A 1SIWA 4OHXA 3EY9A 4AF8A 1IULA 4XGKA 3FCSB 3C6XA 3KYDB 3BD6A 1V47A 4WY8A 2GHQA 1OYWA 3QBJA 4Z0NA 5AYVA 2PXHA 4C7JA 2AIRA 3GNLA 4DQ0A 5HQ3B 2CSUA 1VC2A 1KEUA 2CLCX 2JGRA 4M4SA 4QTUB 5DHUA 2I7XA 1AS0A 1WE2A 1GNSA 1U1DA 2RI0A 3BXFA 3WE7A 2GHIA 1GG9A 5GZ3A 5ALPA 5FLKA 1IUOA 1A8UA 3GU3A 4K2HA 5BSRA 3ZHQA 1GNTA 3AVQA 4G86A 4RLFA 3SQNA 3TFQA 5CXSA 1AOXA 1GQFA 4HFJA 4X65B 1QIGA 4B75A 1Z4JA 3GA5A 1JIKA 3KFVA 3WQSB 2JIDA 3K1JA 2XMCA 1KWKA 3TG8A 4KUHA 5LL6P 1UCFA 1KYQA 3GA7A 3D4BA 4XOUA 1E1YA 2DG2A 3DVSX 4MJLA 4B2IA 3GRVA 5EESA 1TK2A 4PFSA 1T2AA 2LUOA 1IG3A 2JFHA 3AUYA 1SQFA 4QOIA 1DINA 2ZWPA 5ALHA 1KJYA 1LDNA 1VZ2A 1FEZA 1ZINA 2V59A 3JWPA 4OAPA 3IBGA 4DARA 5JH7A 5DNEA 2O4CA 1U0JA 3RJMA 3VNRA 4AIIA 5HF6A 3PL1A 3THSA 4LVCA 1CYDA 1LX7A 1XWWA 2BFCA 2FW1A 3CYFA 2FQQA 4KE7A 4KUGA 4X7BA 1O95A 2J5XA 3WB1A 1O57A 4G89A 3RUDA 1C3OA 3THOA 3KDAA 3MTDA 2XYPA 2FZ4A 3BRSA 5JAUA 2JFBA 2HV9A 2C4UA 4JVSB 1E1NA 2F1RA 4X6YA 1E0KA 3H9JA 4E5YA 3F8WA 2QZSA 1D07A 3ZI0A 5BR7A 1WCIB 1YKGA 1UKVY 3INTA 1FMTA 4XSHA 2WZCA 2FPKA 2XUGA 1H2ZA 1I7SB 2A5FA 1X7XB 3W9YA 3C74A 4WTOA 1CJSA 1E5LA 2G8NA 2C3PA 4JR0A 4MROA 2Y6UA 3OPQA 3VSAA 4E6EA 5HJ5A 1TQ6A 3CJTA 2P4SA 5FO1A 2DAPA 2JVIA 4K2AA 2W6JD 1X8LA 1T35A 4RADA 2EZ4A 1T8YA 1TCUA 3K92A 1WZ2A 3SF8B 4EDHA 4NAUA 2R1TA 4PCAA 4RLSA 3KTAB 5BWNA 2YN0A 2A0UA 1I0IA 1GAWA 3FDJA 4CQJA 3Q8KA 1DG1G 2GPJA 1CUYA 4EUEA 3AIMA 1D2AA 1QQBA 1TA4A 1CE8B 3AVPA 1KZHA 2RAUA 3X43A 1XAIA 3P4XA 1NY6A 4B6SA 2PIAA 4P35A 2HA2A 2WU8A 4PHHA 4FIDA 4FINA 2EEPA 3CRW1 1IY2A 1R9MA 4PQYA 4B4UA 5LMZA 1NNLA 4Q4HA 3HV2A 1ESDA 2PBLA 4QBGB 2Y1OA 5DTMA 2O5EA 4LHYA 1TZ2A 1QRTA 5BV0A 1EBFA 4GPD1 4KXQA 4LBYA 4FMBB 2ALJA 4NY1A 2VA9A 4IDEA 1NUSA 3VU1A 1N2SA 3GN2A 2IP2A 4GWLA 5KPDA 1ZP6A 1R9GA 2AKAB 4R2LA 1N8TA 4YLGA 4NCBA 1K5GA 3NKLA 1A95A 4PSVA 2PLNA 5DXFA 5LZ2A 2CLIB 4D4HA 1JDVA 1ZMRA 2REXB 1MHPA 2DTXA 5I8WA 1BNCA 1DBVO 3N7AA 5K20A 2EFGA 1AV7A 1AX9A 5JXHA 4D4JA 4CCAA 3IOEA 2XUFA 5FUMA 4LYDA 1YS7A 4NEQA 3ENKA 2N0SA 3KYBA 4PZEA 4XYGA 3TI7A 2JFOA 5C5IA 2DPYA 4KFUA 4QSHA 3UXYA 1XTKA 3DCIA 4J1SA 4JCOA 3U4CA 4HLCA 2HQOA 1OWPA 4G67A 4NRDA 1E59A 1XJCA 1P2TA 3C3WA 4Y6QA 1EFPB 2VJCA 1DVRA 3OZBA 3RYTC 4J4HA 3HJCA 1SHTX 3GP8A 4YDSA 5FEUA 1AB5A 1RP1A 3HWSA 2IV3A 3T4EA 1WUIS 4BVJA 1UBJS 2W6PA 5JSYA 3HB0A 2TECE 2ZQZA 1L8AA 2GAOA 3IPCA 3EHEA 1KK0A 1Z8NA 4GWGA 4NENB 2O7SA 2QJFA 2XWSA 4U3JA 3DMTA 3OFJA 4K9KA 3RODA 3ZUGA 2NADA 2ZGVA 1MABB 4G63A 1PFGA 5E9JA 4DQXA 3KX2A 1BE1A 1Q83A 1GZUA 3INNA 1W87A 4R81A 4DM4A 3T7CA 2QHXA 4JKIA 2O3JA 3HRIA 4FX5A 3ZUPA 1VHQA 4FS8A 4RGVA 5C8VA 2QN2A 3P4YA 3RUEA 1RMTA 3OF5A 5I4KA 1G5PA 3N8NA 4ZC8A 3CLRC 2OGUA 2APJA 2O9JA 3KD3A 4F21A 1ZVVA 1TM3E 1EBUA 2NIPA 3F3SA 3LX5A 4FUTA 5HKOA 4TXJA 1I0LA 1JWLA 3JQDA 4MUFA 3HKCA 4DDWA 1Z8HA 2POQX 1RWWA 4BNUA 5FTWA 4WNYA 3JRNA 3LXMA 2UUPA 4JBLA 1D3AA 1JXAA 3CLHA 3JQ6A 5G0UA 2IV2X 3SYNA 3VRHA 4US2R 3JQ7B 1E1RD 2MINB 3QHQA 1AXRA 4R54A 3IE1A 1RWXA 2FUCA 5JSZB 1P75A 1NX6A 1R5JA 1PZFA 1CWUA 2C00A 4HAYA 1TTTA 1HGXA 3KAPA 3HL0A 3L1UA 4XDZA 3N05A 1E7YA 2CFOA 1K0UA 2J3LA 2PKQP 2WFZA 3NM6B 4UUQA 4X8LA 3WTBA 5AW4A 3NFRA 4WLNA 1CCWA 1E1KA 5D84A 2ZS8A 1I9GA 4FFSA 4QD3A 4U2BA 3K30A 1UJMA 1X19A 1JG7A 3PQ5A 3SICE 3NV9A 1JV2B 4YLEA 1CNMA 3WI7A 3HO1A 3IYLW 5D00A 1R0KA 2AG5A 1HEUA 3HYTA 1EK5A 2VQ6A 2EG5A 3EEFA 3G7UA 521PA 2Q6TA 3KR9A 4JUBA 3IILA 1H2YA 1H42A 3G2MA 3QUBA 4DLAA 2YHBA 1ODTC 1QORA 1UK8A 2OZLA 2VC2B 4FFOA 4FMPA 4WKCA 3QWHA 3R41A 2W2PA 2AC7A 4MRNA 4RF3A 3TTVA 5JQGF 2E4AA 1FDIA 4NAHA 4ZAFA 3RAFC 1HM5A 1O95C 6NULA 3DLAA 3P94A 5F52A 4E2ZA 1GPH1 2E6UX 2GZAA 3QJGA 1ODFA 1TUGA 3HYCA 4M54A 4BNLA 2Q2VA 2RKBA 3K0SA 4GM4A 4B7ZA 5B1HA 3ADKA 3I52A 2RBEA 4YUXA 5JY1A 1JE1A 4X63A 2W6QA 3WZLA 5KWVA 4D74A 1TAGA 3L7YA 1FJXA 1Y3AA 2P9HA 4GDFA 2B83A 3P2KA 2V7PA 4YIHA 3LWZA 4Y2SA 3FKSD 4HPWA 4MAFA 1I6WA 3CRNA 3WAJA 4PXSA 3X3HA 2WIDA 3B5JA 2Z8YA 5KQSA 4HH1A 4RDXA 4FR0A 2B35A 3ZHCA 5COBA 4YWHA 2G0TA 2IY8A 4WRRA 5G0VA 3SC4A 2HHHB 2H7CA 1JXQA 3I2GA 3SHOA 1A3CA 1HZZA 3RH0A 1XNQB 3LKDA 2WFLA 4YRKA 5M04A 1QRAA 3CBGA 2R7MA 4PV7A 4RWZA 1F9EA 3L6BA 5FBZA 4Q9IA 5K0JA 4KR0A 4C2BA 2D62A 1M2KA 3E23A 4WN3A 3A32A 1KERA 4D4LA 1O6GA 2WJIA 3QVOA 2D2XA 1O08A 2R3SA 4LJKA 1DAGA 4BLUA 3K9HA 1VE7A 3STHA 3D5TA 4K26A 3GAZA 5TSDA 2RIRA 3AJEA 4DIKA 3W2HA 1N1EA 3SFVA 3ZHVA 4LYYA 3GJZA 1J9ZA 5D5PA 1HDGO 5HFNA 1UBFA 4A5OA 1E2DA 4FR2A 5GJVC 3QLUA 2WPDA 1TM5E 5EGNA 1TZJA 1JSXA 2PBRA 3H42B 5BN5B 3HG7A 3RDPA 1WO8A 2FEWB 4GMFA 2PUFA 3UFXB 2HWUA 3KQYA 1NC1A 1GRNA 1JLHA 1HTBA 2Q3HA 1E66A 2Q0SA 3EIUA 1MCZA 1U0TA 2WM3A 3M6MD 4RPIA 4ZO8A 3S2UA 1CRPA 4RMIA 3OCUA 4M7PA 1RHUA 1XJ5A 4ZTBA 1NXOA 3HHPA 3I9JA 2DWQA 2QRJA 5HF8A 3EISA 3CF0A 1G16A 2Y9MB 2G9NA 4JHLA 4OA5A 4H27A 3EHDA 2BKUA 4QFMA 4EUSA 1YBAA 3ESAA 5KYWA 3ILYA 4RMJA 3GH3A 4MWSA 1S1MA 1U04A 1PT6A 2PG3A 4X0EA 2J7KA 4LGMA 1SVIA 3DFKA 2PKRA 2QN3A 3DV0B 3FBWA 2P3QA 4NJEB 4WDQA 3UC9A 1DQYA 4E07A 3GJXC 4GMDA 4CGZA 1CEQA 1SGWA 4AZVA 3KDSE 5KJCA 1O9HA 1LI4A 2B37A 4RM2A 5CA1F 3QUTA 4QEDA 3IRVA 1IXKA 1VRCA 2AUMA 3OIYA 1DELA 3BE5A 4JJAA 4PCVA 3B6IA 3LCJA 1YJCA 4BNDB 1FYFA 4G9BA 5DP2A 2D6FA 2Q8NA 3DMTC 4UHHA 3OQNA 2VDWB 3DDWA 4MTCA 2Z6UA 1Q21A 3LGAA 4IDOA 1PEYA 1B00A 2QP3A 4FQ8A 2GNAA 4IQ4A 4BO8A 4HDKB 1Z6AA 1AC5A 4G5GA 2P9CA 1AH2A 1ORVA 1MVOA 1FNSA 3PHIA 4OYRA 4KLRA 3F7MA 1J56A 5DGHA 4ZOLA 3ANNA 3PNQA 4KIJA 1Z34A 3GVCA 3OPXA 5LU9A 3BT7A 4MPPA 5KYGA 1GQRA 2AG0A 3SDSA 1QTNA 1REQA 2GCEA 2NO4A 1G21E 1K68A 4E7PA 1E61A 4ZI2A 1Z2PX 5GY7A 3A2NA 5KNBA 1NLUA 4ARBA 2QTLA 2ORYA 1QIHA 2GRUA 4O8ZA 1K7CA 1GARA 3HA2A 1XRLA 2N9UA 2OD7A 2YBEA 1PKXA 3Q40A 4MICA 3QE9Y 1EG7A 2HR1A 5E1DA 1KRHA 1FTGA 1OAOA 3QVUA 4ND8B 2JZOA 5BVGB 5F5LA 5LQNA 4FFWA 1J2TA 1XJWA 4JQSA 2CYCA 2H31A 3QHAA 4B6JA 1M73E 1O58A 1ARZA 4BNTA 1VL8A 5J1SB 2AFRA 2Q3JA 4K9MA 1DQSA 5TF0A 2FHSA 5FWXB 2LE0A 2WWFA 1Z4IA 2H5JA 1LRKA 3T4UA 3FF1A 3KRTA 4RH0A 1GTL1 1BKSB 2PRIA 4B46A 3I4CA 3LV8A 4CN9A 2QU8A 4BGDA 5I9LA 5K9ZA 3LQYA 4G4SO 4LW8A 3SQWA 6CHYA 2M32A 1D6NA 2G06A 3TLYA 2C4WA 3OURA 4OSOA 4G1MB 1LCIA 4QUAA 3I1JA 5ARBA 1QHIA 2OCAA 2VBIA 1YGPA 3OE5A 3OUZA 3UAGA 2FE4A 2XB9A 4KW7A 3OCXA 3CNHA 3GMSA 3Q72A 5DNAA 1RADA 4DE5A 1W44A 4EENA 2JIRA 1NYRA 3WWDA 5AM5A 2QI9C 1CF4A 1FRNA 3A1CA 4TTRA 2ZSKA 2XT9A 3X1YA 2EIHA 2QRKA 3H0EA 4L08A 2PM8A 4JLOA 1GEEA 4H6VA 4UUOA 5CT6A 4AT1A 2RCNA 5JZSA 1GGNA 1IB6A 4QQKA 1IONA 1R18A 2PLRA 5GV7A 4LY3A 3KELA 4AJ9A 4AJKA 2O7NA 5FAXA 3E7DA 3FWHA 4YRNA 2J3MA 5GTDA 1YB1A 2FQ1A 5AKJA 4LPKA 4F84A 2ZP1A 1K92A 2C2BA 3DFUA 3IALA 5GONA 4CG3A 3MSCA 1MUUA 1N3YA 1XCOA 5KYUA 2VQ3A 1QMPA 1UFOA 2QMEA 1I36A 3VPCA 1KAQA 1ST3A 2WYHA 1ZJ4A 3LBYA 4IIDA 1DI0A 1Q84A 4MZDA 2QNRA 3G13A 3UZUA 2I87A 4UTNA 2GLXA 3EVCA 1I6LA 4RSGA 3ZWPA 1ESZA 3MAAC 1SC3A 2F17A 4RBNA 4UVDA 2CXQA 5IHPA 5L53A 4MUIA 2VHJA 2NYVA 5DF1A 4XIGS 1ULZA 2AZ4A 4Y1RA 3E5NA 3QW2A 2VP9A 2H1OA 1B6RA 2BUAA 5AW8A 2EU8A 4AMVA 2G9UA 4QUHA 3LM8A 4U7PB 2QDKA 1A0OA 4C4OA 2QD4A 3N76A 4RD4A 4DR1B 2IBMA 2B4RO 2QUIA 3HJAA 3QLUC 3T7SA 3QYPA 5DU2A 4QXAA 3ZE7A 3ZCUA 1CQIA 1E5TA 3BE4A 1JAYA 2P5YA 4D57A 1A9QA 4FX2A 1W1IA 3AHJA 3LCUA 3LO5A 1U8XX 1BSVA 1RXYA 5EMLA 1JKJB 1A88A 1EWTA 4I6GA 3N3BC 3D8TA 5FWDA 2E2WA 1G5HA 1UMDB 3Q9LA 2R44A 1OZHA 1QOPB 4XOIA 4A4DA 1M8FA 4EUFA 1CUEA 1K7YA 3JQBA 4FEEA 2QEQA 1MB4A 3FNBA 4MV6A 4EUNA 4DRXA 4YDRA 3AW9A 4B2LA 1P9RA 4M1KA 1D09A 3IMFA 1IRXA 4FD3A 1JEJA 3K4QA 2LP4Y 2P9TA 2WD7A 3Q0TA 4PSDA 1J4AA 5KHOC 4GKJB 2CVQA 3KJHA 2V7VA 3C3CA 3OIWA 1TB4A 4BWYA 1C9KA 4W9NA 4BX2A 3GR6A 1N75A 3V1MA 3ZGVA 1RPAA 2X2FA 2B6NA 4UE6A 5JYBA 1UFVA 3TM5A 2HC9A 5I9MA 4LE0A 5K8UA 1FVFA 2A58A 3VZSA 2FPMA 5BT9A 5EKTA 4TLCA 3D7SA 4LDAA 4TMXA 1YZKA 5TXGA 1YFJA 1IMJA 4C89A 4YRGA 1P18A 4GZLA 1EFCA 2LCIA 3GDGA 4CM3A 4MQUA 2EDAA 2MMCA 4OHPA 1AGPA 3T9AA 2WTNA 1NQ5A 1RLJA 2YXLA 2E87A 3ICVA 4DMUB 2YFHA 3N7TA 5CBPA 4X3OA 4CMCA 3NOQA 3CH7A 1BDJA 1H5QA 4ETIA 1EXMA 1VI6A 2RHRA 2XE4A 4XB1A 1CZRA 1FJ2A 3GUZA 2I80A 4IVPA 4DJEC 1XDGA 1PTJA 2I4RA 2OENG 4FBGA 5SYAA 2HLNA 4B3TB 3EB9A 5JYEA 1OAOC 4PQGA 4ZA2A 5LZ9A 1RI5A 2VNSA 2VPPA 1KAHA 4QREA 3T52A 3WK5A 1E1DA 1FDTA 1L7DA 2ZBEA 1GTJ1 1UT8A 2UVQA 5JJKA 1W4AA 5T57A 1CY4A 3M81A 4FKBA 3UMCA 1AJEA 4J0IA 3TZBA 4DZZA 1R6TA 2F1KA 1OI2A 1PFQA 2ZROA 1D6MA 1PR1A 5CP8A 4EYQA 4YJFB 1USWA 1JSRA 1PRYA 2P6PA 2UYGA 3PSHA 3R3UA 2EEZA 4CF7A 5M2QA 4I6JA 3L4JA 1A72A 2D06A 3CVJA 3NWBA 4OXQA 3N0TA 1P72A 1JR2A 4G2TA 1HLDA 1W48A 2C9YA 3RRNA 3SHQA 3SX4A 4CQNA 1A9ZA 3FHLA 3I0ZA 5IW8A 3GB9A 3A3NA 2XGJA 1A1SA 3CM0A 3JQ9A 1QS0A 1JDUA 5EGSA 1Q92A 5AFSA 3ZGXA 3WFIA 4P3YA 2FZWA 2JS7A 3BYZA 5E6UB 3DQZA 4D3SA 1IN4A 5DX1A 5DLPA 1WSWA 2BEVA 3DV2A 5BMVB 5AI4A 1UBHS 3TRKA 5FUXA 3DO8A 3V4FA 1CB7A 3GLVA 2V0GA 3LVRE 2ZRFA 3P0FA 1XE3A 2WLSA 4Q9HA 4RKRA 3GGSA 2IZ5A 3U7JA 3EDMA 2EYQA 3RSFA 4OCZA 1N5IA 2GJ8A 3AK4A 3L06A 4OL0A 1IZYA 1S5PA 3OSZA 2ZJ0A 2IIBA 2I4OA 4ZV9A 2I22A 1G5IA 3PIDA 4TTSA 3Q8XB 4UJ5A 1TJ3A 5DI3B 1QX4A 3DMNA 3UTDA 3R7AA 5CITA 2E55A 4XDGA 3P9XA 4JLDA 2ES4A 3HBJA 1A9SA 2V7BA 5DM0A 16PKA 4OATA 3CGGA 4JGIA 4WLUA 1FVXA 2NZWA 1NW3A 2OK7A 3A25A 1TQHA 3F1KA 1HYBA 2IOYA 3UJAA 2BV3A 4K46A 5E4YA 3SHTA 1BVHA 3PZRA 1ZWLA 2XV1A 3EFHA 2OB2A 2CYAA 1IWBB 2FCAA 3I73A 3O03A 3QX3A 4I2NA 1A98A 2YWBA 5DXAA 2IHTA 1ZA1A 1DOAA 2UVPB 1Q77A 3LBNA 4LDNA 4I4LA 3FN4A 2B99A 3P0IA 1AN9A 2JFQA 3ZHUA 1EUYA 3VR2D 4E4RA 1EVLA 3CH6A 4L15A 4IJ6A 5FQOA 2R2AA 1SCAA 4LRUA 4B0OA 1M5UA 5J5VA 3FF4A 4AZ3B 2NAFA 4B47A 1OTXA 5CYPA 1AO0A 2PMFA 4BU1A 2B36A 2LVBA 4XSGA 3RYIA 3M6XA 2JAOA 3OQIA 3AB7A 2YMLA 3CU5A 5PGMA 3SF0A 4AJLA 1NPYA 3NTQA 3I9OA 1J8QA 2GDZA 2EKQA 3ITDA 4B76A 2R11A 4OHCA 3N2KB 1YFLA 3O91A 4EBFA 1V9SA 5B2ZA 5SY6A 1A2OA 1JBQA 4I9UA 1PGOA 4OEHA 4QAQA 5DYNA 3RJ9A 4POOA 1R4NB 4YRZA 3R9XA 4HPXB 2GEDA 2NZYA 2RH5A 5F4BA 1Y80A 2VDVE 1CY7A 3AP3A 4IV0A 3UCXA 3PDIA 1JH8A 2O2YA 4R2MA 4H59A 3JQBC 5ELLA 1EUDB 1U80A 4OXIA 4CG0A 4AZ0B 5IJZA 4CKEB 1Q7GA 1UBSB 3TZ6A 4OQFA 3INRA 2OXTA 1QHXA 2JGDA 1P0MA 5L40A 2FR0A 4N9WA 2FPIA 3NVMB 3KUDA 4KXWA 1KQPA 2X9NA 5CK4A 2RH4A 2IEYA 4CFSA 1RHJA 3IERA 3K94A 3O8QA 4W9NC 4ASUA 2NZUG 3ED5A 1XEXA 5AKLA 1DJQA 4MW4A 3OWOA 3HKEB 1V1MA 2PSHA 3SMQA 1ZUNB 5AM1A 3VNAA 3ZTWA 3F6RA 1SUIA 1WQ3A 3FB1A 3GFGA 5E1MA 1FJGB 1MIHA 5P8WA 5HIAA 2ZRBA 1F7VA 1RKUA 1DSSG 2D2FA 4HDNA 4OM8A 4NU6A 2QMZA 3NWJA 3LZDA 5JMPA 4BFXA 5HUJA 4RQUA 1XU7A 3IXQA 3TLKA 4ENPA 2I6FA 1HE4A 2WI8A 2FKNA 2ZSUA 5EMMA 4YUYA 3I0MA 2WD9A 3F67A 2A59A 4BLPA 2YVQA 1RHMA 2DPMA 1OX6A 2SECE 1OSNA 5J4VA 3AKZA 4U9HS 3DO6A 2Q4OA 2UAGA 3HP4A 1E9FA 3WLLA 5JQGA 2XZLA 5AM4A 4COOA 3L8ZA 4HNRA 5JCOC 4PZUA 5DTQA 4QVGA 4M76B 5G2OA 2HEIA 5M5BA 3PWTA 4OQNA 3U3MA 3WYNA 1PTJC 4RD2A 3CE6A 3R3VA 2DJ5A 3EPPA 5J2TB 4FDTA 2ZSIA 3JQQA 2YRFA 2OO3A 2QTCA 3QFRA 4C3OB 1JG6A 5EI5A 3VV3A 1XV5A 2ZRNA 3MVEA 4N76A 3EODA 4GH5A 1KZ4A 3L5KA 3VI4B 5LQJA 3IBTA 4C5CA 2Q3FA 2DR2A 4C0LA 3GVXA 3WJ7A 2ZETA 3K53A 4HZGA 1QAQA 3GGJA 3ICOA 3ZK8A 3ELBA 1BKYA 1VKRA 4TT3A 3UK1A 3DQPA 4ADSG 2KE5A 2VYND 4F9TA 5B4TA 4CCYB 4EVSA 3MCTA 1ZCFA 2FAXA 2JJ1A 3AM5A 4KE8A 4R8VA 3JCZA 2AMVA 1LPNA 5LVAA 1KTIA 3D0RA 2PDAA 2DBZA 2WOOA 1EPUA 3EW7A 3V7UA 4F5DA 3ZW7A 1SELA 1D8AA 2GPAA 2XD9A 3X1DA 5HK8A 4F3RA 3RYFA 1HSOA 1KP9A 1UP7A 2BFWA 2A0KA 1K9VF 2ECPA 1OTYA 3ANXA 2X3FA 2QBYA 1OU4A 3JQ9C 3ELYA 3SFTA 3FPSA 2VK8A 1TYAE 5CXXA 1C30B 1W94A 2PCJA 4NYJR 3HO6A 3UN1A 4H7PA 2P90A 3P2MA 4BZXA 3SC6A 3TQIA 4GOMD 4W9MC 1R4AA 3U9TA 5IT9A 1WUKS 2BFDB 2DT8A 4KVGA 1B76A 2WJVA 4KKXB 3GG9A 2B8TA 3U4HA 3LLSA 4YJ3B 1DZIA 1JS1X 2NSYA 1DPGA 1KI1A 2IOFA 1K9SA 3NGMA 1D8TA 1QXSA 3MQFA 4J1TA 3RS9A 2ZWOA 4GOXA 2WWXA 3GT7A 2GZDA 1GGHA 5KNDA 1CVLA 3I2JA 3A4MA 3E5MA 1I01A 3JZDA 2I6SA 3EQ9A 1WKBA 1J0XO 4QGGA 2EKZA 1JYSA 3HFSA 4HZIA 4N8EA 4J91A 2BTQA 3RS2A 3S1LA 3AY6A 4AN0A 3IFSA 1P7PA 4ZAZA 4CKBA 1U8EA 1P0IA 2V5UA 2UZ3A 2Q5QA 1VJ5A 1JW9B 4QYIA 4RY0A 2Q3CA 1QV7A 4NAVA 5FBKA 3WISA 4UCFA 2M6KA 2G82A 2B4YA 4ARCA 2FUG6 4Q3BA 1MNQA 2NTVA 4DY6A 3DEJA 3SPXA 3EA4A 2OBXA 4QBHA 3NHFA 4UEJA 5IN4A 2FZKA 4CN8A 1R8SA 5LUAA 2PS0A 4DJDC 1UBCA 3UPDA 4EI2A 4DR3B 2ZT8A 3LVFO 1GCIA 1KI4A 4I5GA 5CA1A 1CNEA 1YA4A 2H18A 2YHIB 1NNSA 4X90A 2IXEA 1Z5ZA 3OJ0A 2PXCA 3TLJA 3GJ6A 4XM1A 2FPGA 1WXHA 3R0ZA 3IPLA 4KXFB 4Q5IA 2PT9A 1X3SA 1JL3A 1SPXA 2QPTA 3A4IA 2ZTLA 1MW8X 4FNAA 2RGNA 2W6NA 1D2EA 3ELWA 4L8LA 4UDYX 4S24A 4CHTA 5BN3B 2R4TA 5DCUA 1ELOA 3RLFA 1KPGA 4PYMA 4D8YA 4TRJA 1DHRA 5K8JB 4BQNA 1G21A 5DX0A 4TKUB 2ZTHA 3HA5A 3G9XA 4TL8A 5JASA 1HC7A 5IDWA 5CD9A 3ZBTA 4ZICA 4E0BA 1Q22A 2KLHA 3MMSA 3OIGA 5K3SA 4NOMA 4ZEWA 3OT4A 1IBLB 4JNCA 5I7OA 1L7NA 5HE8A 1ZD4A 2EG9A 2J9ZB 4GMGA 3T4XA 2NVOA 2C31A 4Y1FA 5ALXA 3V97A 4F6LA 3INYA 2ID7A 3NC0C 1HSZA 4NPCA 1C0PA 4CCSA 1YR1A 4MLCA 3L0OA 1D4AA 1PYDA 1XTPA 3AHDA 3CUYA 4ZV7A 5H82A 4BFYA 4UNRA 2ZBGA 4KVZA 1PX2A 5CW1A 5HMMA 2WWRA 1DXYA 4RIIA 1BMTA 3L4BA 1SVMA 1ESNA 4AJ4A 4JN6B 4PYLA 1PW7A 3KBBA 1TO1E 3NIBA 2YWFA 4B17A 4X61A 1TGYA 1L1EA 4B4WA 5H3HA 1ODJA 2NPFA 3RT7A 2CLHB 4KJXA 1ACLA 3KUXA 3OCZA 4L4RA 2JFGA 3UIEA 3L40A 1N3IA 2RGCA 1GLGA 4LF5B 1UPTA 1L1QA 1TL7C 5JHHB 3GLGB 1O5IA 4DUZB 4WLOA 1DPFA 1LK5A 1Z25A 2I03A 1YK0A 2WM9B 4FZ3A 4EF4A 3CO5A 3D6JA 3O3OB 1HE3A 3LYAA 4AXBA 3IUPA 5HCNA 1O8BA 5JD5A 2JD0A 3HDVA 3OFNA 2XB6A 5C1PA 2AC4A 1JHQA 1SCUB 3HM9A 1VHTA 1DBRA 5F98A 4MUMA 3UAYA 4DR6B 3CHYA 5KIAA 3GEPA 4KVFA 4O02B 1YB7A 3DDNA 2GX6A 1J06A 3K1AA 4ID3A 4QXMA 2C1ZA 5CXQA 5K09A 2BWJA 3OBBA 1PWXA 3ICQB 3JQEA 1KBZA 4BNMA 4Z7OB 2Y92A 3G6KA 4D42A 3G2NA 2Y1GA 1P3JA 4R9VA 4U7HA 3TCXB 3T1HB 3AKDA 5LJIA 1GYRA 5BSMA 3PX7A 4TS4A 1X7WA 3KXIA 3A36A 5DHAA 2PRKA 2DBVO 3G79A 5AKZA 1Z0AA 1HZJA 3ANTA 4C0JA 2AEJA 2BR4A 3O1HB 2QLJA 4JX9A 3TD9A 5L45A 1FSFA 3EXEB 5L7YA 1T2DA 4NI5A 4KWTA 2REQA 3B3AA 5D8DA 3VVLA 3GLIE 1XROA 1DXHA 5G4KB 1R6DA 1YZHA 2PO7A 2Q5OA 2Z5VA 5CLHA 3VTAA 1JA9A 3CMCO 3PC8A 1UXOA 4HVAA 4L5YA 2CFIA 3LUKA 4MV8A 5REQB 3OOSA 2CHQA 4TSFA 1D2CA 2JCSA 1JNYA 2XT0A 4BLOA 3CTPA 2H8KA 4PGGA 1LBIA 4J4TA 4LJ5A 5CT5A 4DPMA 4YMSA 1KNXA 3I8XA 3IP3A 3W2FA 1GRRA 1AN0A 2XQGA 2IPOA 1NVUQ 4CTJA 3QZUA 2ZAGA 2HHCA 3BKWA 2Q4EA 3AC0A 3R40A 1R6BX 2EC5A 4C08A 3DOCA 1AZTA 1I14A 1PQWA 5DE3A 1TA9A 1Y8RA 4J1TC 4JP5A 5EUBA 3SNKA 3KYJB 3V6MA 1JIUA 1BW9B 2Q8PA 4IM7A 1U4SA 2AB0A 3VOBA 4IGKA 3FAZA 3Q3VA 1FZTA 1YJAA 4QXOA 1FS5A 4BKMA 1MT3A 4WBNB 2AEFA 4W99A 1W36D 2AZDA 4YHBA 1DCKA 4B73A 1FTQA 1OE0A 3E22B 1K8RA 1PG2A 4URFA 4DTCA 1UPCA 4IBOA 1KDTA 3DFMA 4TM7A 4W7HA 4FDAA 1PT5A 4AUKA 4R7ZA 1UC5B 5AOCA 2CMKA 1FX0B 1RMYA 3D7RA 3OFKA 1O94D 2X15A 1GXSA 3F5DA 4M9QA 1I3LA 4OKIA 3SJ7A 2PRJA 2HIMA 1VCMA 4FHFA 5MGNA 1O6CA 2ATCA 1I10A 4F85A 2Z8YM 3CSSA 4NZYA 3V34A 1JDPA 2YV2A 4MVJD 1Y1LA 4ZAWA 1X1SA 3U4GA 1DFIA 3KQHA 4RD6A 4OY3A 1EVEA 4Z49A 2B5OA 2EWMA 1KE1A 5C8YB 4IFBA 2VTBB 5B3JA 1R4MA 1DRVA 5D6OA 4UREA 1OWMA 2DVMA 3TE7A 5DHPA 2FFBA 1SURA 3ZE9A 5K8TA 1L5MA 4FFNA 3JAKA 1IIBA 2ZR0A 4C0HA 4D9HA 2A9RA 2RGNC 3EIHA 4RKWA 4M0EA 1UJ2A 4OI2A 3VTZA 1EXVA 3PYLA 3A0RB 4WUVA 1X3LA 2GM3A 4UM9D 1OWNA 2D2VA 2NUAB 3VR6H 1FS4A 1MJHA 1LY1A 1X38A 4X45A 1OXVA 1LLFA 5TEVA 4M0CA 2CV0A 2IEAA 2R7LA 2VA8A 4DQVA 2HM7A 4D26A 1NPDA 2VRCD 3LSTA 2J6IA 2QVZX 3HGMA 1Z7EA 2G4CA 3ACDA 2ZBDA 1XSEA 3EGDA 4YNBA 1GKKA 4BO6A 1YE3A 2KB0A 4PSKA 1T4BA 2GFIA 2UZ1A 4KO8A 2FWAA 3JWEA 5I7SA 2V4ZA 1FVOA 3DL2A 2XUQA 3K0KA 3K0AA 4RTRA 3DXYA 3PC4A 4BTLA 1XL0A 5JSFA 2JCBA 2W0SA 4NNJA 3GAFA 2XMBA 4Q1DA 2WHPA 3PD0A 1E7QA 1OFUX 1BXRB 5B6IA 4XFDA 2O8NA 5J59A 3ZDRA 1VGVA 5AKYA 1UFRA 3ZBPA 3F6CA 1GRQA 1X7YA 1KH1A 3L4BC 4N4AA 1KVQA 2FPPB 3C3JA 5HOQA 5ED4A 1M1UA 2NWQA 3VDRA 5IABA 1UBNA 1P19A 4PW0A 3COZA 1C9JA 4F7DA 3CRZA 3L1JA 3HVRA 1NWHA 4Q3OA 4U6QA 1OD6A 4EBBA 3FKJA 4BC0A 4WECA 3CR3C 1M2JA 2YMQA 4J0HA 4KE6A 3UJ7A 1GG5A 5IWCA 1UPAA 3BAZA 3UWSA 1MTZA 3GZNB 1MOPA 3HXTA 2AOUA 4EKEA 1KEEA 4AUEA 1C9EA 3W1WA 1H6AA 1TK9A 3FE2A 4R7TA 4BMCA 2DZDA 1MJFA 3Q9UA 3V2GA 1VBMA 3EBPA 2I2AA 1P91A 4UEWA 4NFHA 5EP3A 3U4QA 1UZAA 3AJRA 2GO7A 3EXHA 1JAIA 3CX6A 5LUBA 3TBHA 1H4TA 4BP8A 4EG7A 3MXTA 4O4LF 3PLNA 4J7AA 2YZGA 2I1WA 3UMSA 3LE8A 1CZOA 3NEAA 1TCVA 2WYUA 1JX6A 2ZYAA 1NHGA 4HGRA 4NCXA 2ZJ6A 4S2UA 1F2TB 5F78A 3M5WA 2WMDA 2I8LA 1XZCA 3FNEA 4KR9A 2QRVA 3RBXA 3FSGA 2XYHA 4JI4B 2DBRA 1S4MA 3THYA 2Y1CA 3ESBA 1MAHA 1TADA 5EJ8A 1KIFA 2DHQA 3FDZA 3MM4A 3PHCA 2BR3A 5B6JA 1DX4A 2BMWA 5GPBA 3MGKA 1S01A 3KU1A 3H4TA 5LFAA 5JMTA 4Q82A 1Q0QA 1N4AA 2XOKD 1Z2DA 1UWCA 5GV8A 3KYCB 3CLTC 1DJNA 4ETMA 1KDPA 1M2GA 5CNMA 2X8BA 4JBXA 3TQOA 1HE1C 1TU0A 2BONA 3IJRA 2VWPA 4MR8B 4ARUA 4D6PA 4WNIA 1WNFA 1XZNA 2FA9A 3EN0A 4JODA 2V6JA 3GRUA 1NZFA 1V26A 1W88B 5EIAA 3F49S 5JPIA 3PC8C 2F9LA 3I04A 1VOTA 3ILXA 2JI7A 1L4KA 2BHNA 4R8KA 5IDXA 1JECA 1S3IA 2ZIGA 3T3DA 4ZT4A 3HSSA 4NE9A 4XIFA 5EJMA 4U2FA 4J6FA 4DNQA 2VUUA 2QL7A 4P58A 4EJSB 1U3CA 2WJGA 2BOVA 4DV7B 3EJWA 2HNBA 3W6ZA 1VIAA 1RJGA 2HMAA