1EM8A

Crystal structure of chi and psi subunit heterodimer from dna pol iii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
147
structure length
147
Chain Sequence
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords DNA POLYMERASE III CHI SUBUNIT
publication title Crystal structure of the chi:psi sub-assembly of the Escherichia coli DNA polymerase clamp-loader complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 147
sequence length 147
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2000-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04364 DNA_pol3_chi DNA polymerase III chi subunit, HolC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold DNA polymerase III subunit chi 1em8A00
1EM8A 3SXUA
chains in the Genus database with same CATH superfamily
3JQGA 4CF5A 2P0AA 1VJTA 4YI5A 3WC4A 3G17A 1X1QA 1DL5A 1GZHB 3MQFA 5LFAA 2Q9BA 3DKPA 2IYZA 2MSKA 5T3YA 5JW6A 3NC1C 3W7BA 2G06A 2QYHA 3L1IA 4F21A 5L6MB 4ZFNA 4XIYA 4BFWA 2OV3A 4E2FA 5HOQA 3GGCA 1LQ2A 3RJMA 2JH3A 2W00A 4DA9A 4YV1A 4CQLB 3NH9A 1U0BB 3IUQA 3DM9B 4PO9A 4JI1B 2GVDC 2QW1A 1LX6A 4ETMA 3BB1A 5DE3A 2RK4A 3MRTA 3NALA 4FGLA 4NOMA 2EIHA 3H5NA 3LWDA 4GYWA 3V32A 4ZHQB 2ZR7A 5FB3A 1D4ZA 3ELWA 1VSVA 2C54A 3GPIA 3S1AB 4HAIA 1XDGA 2D3WA 5F4BA 4H6XA 4AF8A 3W8RA 1D2AA 4Q1VA 1F2TA 2W2OA 4HLCA 1QGDA 3D8NA 5E9JA 3TSOA 3H13A 4TKLA 1ZK0A 3LHIA 4JY7A 1KWGA 5LB2A 1G0NA 4KCGA 4UTNA 2JLYA 3OWOA 1C7JA 2PMCA 2UZ3A 3BCHA 3C3CA 4XDGA 3TLMA 4CMBA 4Y9RA 3T5PA 2C8LA 3KR9A 2W70A 2EFJA 3UJPA 3R24A 4V3CA 1V1MA 1VC2A 3CF4G 1O9BA 2LVBA 2PSHA 4LS3A 1NV8A 1RYZA 4M0UA 5FRDA 4OA8A 3W06A 5CX1B 2DRIA 5B4VA 1N3IA 1GADO 3QNUA 2FUG1 2GZSA 4HBZA 4Q3CA 1T8WA 2JI9A 2XEDA 2ATVA 3BE6A 4C6HA 1G55A 2G71A 3AIKA 3MZ0A 4WK0B 2P3SA 3H0CA 3JAWA 5DM1A 3KAQA 1Z28A 2HAEA 3CRQA 1UEIA 5HDQA 4QSMA 4II3A 2CGEA 5FBKA 1C9MA 4Z9AA 5K3EA 2NU6A 3C70A 4X6YA 3TMAA 1FZQA 2C7BA 4LY6A 4OMFG 2AZMA 3DZJA 3GQVA 4FNGA 1UKYA 4O4LF 4RLHA 4NH4A 3ZDAA 5CGZA 3P26A 4OM7A 1TLLA 5B1YA 5MFPA 3FUTA 3HUDA 1DEXA 4LG1A 2XGMA 3CISA 3GIDA 4OGLA 4ZI3A 4K9NA 1PQUA 3CKLA 5ICSA 4RVCA 2QJTA 1L4NA 2EF1A 1QQ6A 3OQPA 4NZYA 2MTBA 2PG3A 4U2FA 1M1YB 5HX7A 4TLMB 3W1VA 4L78A 2DBQA 3EA4A 4ZAGA 5LZ8A 1Y1KE 2QN7A 3IVAA 2PMKA 2VT2A 3MUOA 2HV9A 3O5AA 4RVDA 3QLVA 5JSUA 4UFNA 1P29A 3DAPA 3EYAA 3R3VA 4UUMA 3RC3A 4HFMA 4L2IA 3WJ2A 3V7UA 1SWWA 4MW1A 3RJ9A 4EY5A 2PL5A 4MYHA 4F85A 4CNBA 4J91A 1GO2A 1T35A 3AG6A 1TAHA 2EJVA 1OFUX 1RD4A 3DW1X 3HFJA 4WFJA 3EHDA 1QHHB 5H1YA 3SJCA 4X6LA 2YL2A 2KHZA 3K92A 2G9RA 2XECA 1M76A 4R2IA 5KTRA 2X9GA 3GUVA 3TAHA 2HZBA 4R7ZA 3EAFA 2RG7A 3OX1A 4TMXA 1DRWA 2W90A 3I04A 3TECE 1BU5A 5CJJA 3COSA 1Z15A 3UA3A 3K1AB 4HTFA 3AHJA 1E9CA 1ECLA 2YKGA 3ZHRA 1FY2A 1VLQA 3II6X 4DA7A 1E92A 3CS3A 1YRQA 5CA1B 3D59A 3HDYA 3CRVA 5H59A 3EVTA 4XPZA 5AK5A 1CB0A 1INLA 4ECEA 1DO0A 1KMHA 1TUEA 1FXWA 2HF7A 3FMFA 3I6QA 3IIJA 3G0HA 1ZSNA 4EYOA 2QUAA 5CM8B 5FD8A 4XPIA 1LWOA 1OPRA 1O0SA 3I2GA 4EKDA 1ODSA 1KYWA 2Q99A 3GROA 3O84A 4MI1A 5JWOA 3NGXA 2O05A 3DL2A 2IKSA 3VU1A 4KE7A 1X39A 1TKRA 4KGZA 5KYXA 1SH7A 4ZKDA 1DBSA 1JAYA 4NATA 1X7YA 2FJUA 5TMBA 5M04A 4K6KA 3U16A 2WQ6A 1J2YA 1U0LA 3LX5A 2XCLA 3GCGA 3O9VA 1Z7WA 3KR2A 4HR7A 3T41A 1PJQA 3FFBA 1NP3A 2JBAA 1DQZA 4PWZA 4KQWA 3O83A 5HA5A 2V7XA 3ZKAA 3H5TA 5AJVB 5ENDA 3EOAI 2PLAA 3V1TC 1VYHA 2QZ9A 2GM5A 4HGRA 4EMUA 2C2XA 3BKXA 5LN1A 3R5FA 1RBYA 2QTLA 3E9CA 4JLUA 4U7JA 1W29A 1ZJWA 1AA9A 3VOAA 1YK1A 4KODA 4EJ0A 1VA5A 3N6VA 3T1HB 3QKWA 1ORHA 3Q6IA 3ZBTA 2JHPA 4ZI5A 4HZGA 3U37A 4CLDA 2DKNA 4CR7A 4ID3A 3CCCA 2IEBA 4LTNA 3ZWXA 5GPBA 3WKEA 3B85A 1A95A 2WHQA 4YYZA 1PEDA 4LDRA 5BV2P 2WKSA 4RX1A 3VYRB 1B6SA 1G98A 1WKVA 5TSDA 3RVLA 2WTNA 2FSPA 3WQHA 5CEEA 1TE2A 3BTUA 1KJJA 3KVNA 1H65A 5H02A 3WISA 3W1WA 1YDGA 4AO6A 2I4LA 1TM1E 2A1IA 2Y0EA 2Y1WA 5TARA 1S0UA 1ZWKA 2AOVA 1Q15A 4DWWA 3VJRA 1P2VA 4FHZA 5D85A 4FDMA 3DEYX 1IQUA 3EIWA 1OXMA 3QY0A 1BXRA 1YZQA 4GOND 4QWMA 1JJFA 4AB1A 1NSFA 4C08A 2CJWB 1ACMA 2YXNA 2QL9A 4O4LA 2X5NA 3P0FA 5JU6A 3WMFA 1E60A 1IUKA 1ZIYA 3DF9A 1E1YA 3M70A 2ZBQA 3NM6B 1TMOA 4RQBA 1C81A 1HKHA 1PQYA 1QV9A 1TM3E 3FIJA 4RD2A 3WMWA 3K72B 4IFIA 4MR9B 3C39A 1MZPA 1GL6A 1JPVA 4OQ4A 1THGA 3UM9A 3DTTA 4DIFA 1GLNA 3KJGA 1LRJA 3AHGA 2Q1YA 1EK6A 1EGQA 3DMYA 4TUYA 3ZDRA 1V7ZA 4EYGA 4ZMBA 3IJEB 1Y4AE 5K7SA 1KAGA 3UJAA 4P4SA 2B1IA 1IM8A 5EE0A 1K7EB 3NYWA 1G9TA 4P31A 5IFKA 2V0GA 5KU1A 4Q4HA 3EQ2A 3EEOA 5C0OE 4A6EA 1EEXB 3EGOA 4JSRA 4Y2JA 5BOVA 4CFZA 3TR0A 2Q6LA 4W5JA 2IZ1A 1P80A 1QF7A 2H7VA 2ZRDA 4EHLA 1GTL1 1EVIA 2OGUA 1DB3A 1PQPA 3KJHA 3N2EA 1B93A 4WNAB 5KOHA 2ZANA 2HHHB 2PMFA 3QWIA 2BHRA 4IAOA 4EVIA 1RI4A 3K3PA 1YH3A 1YULA 1NUUA 1SIUA 4MWSA 1ZI6A 4Q9KA 3PQ8A 3IALA 2ENUA 4IJ5A 3BYZA 4P2BA 5ELMA 3ZH2A 4AG3A 3KYJB 4QU5A 5MGBA 4GUDA 1JBEA 3ZWCA 4B85A 1RWKA 1DEAA 5A2GA 2ZFUA 2DECA 2X8JA 1NLUA 2XUIA 1JIJA 4TTPA 2NT3A 4XD2A 4Q03A 3WHKA 5AUPB 2Q1TA 1CY7A 3KCQA 5CFRA 1YT5A 1JQAA 1Y5IA 2HA0A 1RAIA 5CYFA 2I66A 4JLNA 1LNZA 3UA4A 4A0SA 3DZBA 4MQUA 2ZJ8A 4DJ5X 3JQBA 4MHSA 1G7TA 4K9SA 2IH4A 2YWHA 3IIEA 4UBLA 4X1OA 3GFGA 1L5RA 2QDXA 2WFLB 4MP6A 2W4QA 2R7AA 1CS4C 2KB0A 1LBSA 5AI9A 3QIVA 2Z98A 5EVJA 5FBHA 1CQJA 1DAIA 1WZNA 4EMSA 3OUZA 1AUQA 3AK4A 3X1KA 3WQBA 3ITDA 3C3WA 3CX7A 2VJAA 1ULHA 2ZEJA 1VXOA 5FFMA 5KNBH 3T3MB 2Y68A 4KBYA 1TKAA 4WBXC 1L7RA 1T8SA 3UFXA 3A8TA 3GJQA 5ADUS 1FMTA 3OZSA 3ELDA 2ZKLA 2P6PA 2PL9A 2GYVA 5HK9A 3G8YA 2OG1A 3UENA 3F97A 3D6NB 1QP0A 4GP7A 1TCBA 3IP1A 1FS6A 5LD2C 3ZWBA 2K7ZA 4HLQB 1N7IA 5G1NA 6REQB 3M6LA 1KXJA 1ZMRA 2HQOA 1N0VC 2IE0A 1ZGGA 2JFYA 4ZVVA 1TVKB 1CE8B 1H9CA 5KOIA 5JI2E 1NYRA 5AVRA 1WPGA 1Z39A 4H16A 2VJPA 3DUWA 3A3KA 3FWKA 1ONBA 2ZAGA 3L7LA 4JIMA 3E23A 3VNSA 5LJIA 5KDOA 2DF8A 5KNCH 1QF6A 5HPYB 4WINA 1XQYA 2WU0A 1TZJA 4HNUA 4EB8A 2RAFA 3BXGA 3G2JA 1QIMA 3AY6A 1LPOA 2O2ZA 3HU5A 1TKCA 3K5PA 3PJEA 4OYLA 3DQQA 5CBKA 2G6BA 3NKVA 2RHJA 3WFZA 1MX5A 3D4LA 2PTHA 1PZNA 3BAZA 3MWKA 4HLDA 4JUDX 5FKJA 1JXQA 1YR7A 4NV1A 2O59A 3X1MA 1NRIA 4WJZA 3GX1A 5A5GA 1LNSA 3MQ2A 1O1YA 4PAWA 2OXFA 4E88A 4KOAA 3WDMA 5LQSA 4A03A 1HM5A 3OIUA 3OTIA 4W5NA 1CQWA 1D7OA 3EW7A 3UMBA 4BVGA 4TLDA 4F4CA 3PU6A 2P2YA 3W2FA 3DMFA 5CURA 3W4IA 5IFLA 2O2GA 4CG2A 3PXEA 3J81A 1UAAA 1OGIA 4EARA 5AVJA 3HR7A 2E85A 1L4EA 1W96A 3BFXA 3E61A 3V4SA 5I7SA 2REBA 3FBTA 1U0SY 1UPXA 2IPLA 3A0UA 3TNDA 3ITEA 4HD8A 3REOA 4NPAA 3J80A 4G0YA 1H1DA 4PXAA 1X1SA 2V74B 3GXBA 1HZZA 4NH0A 4CM4A 1JA0A 2XI4A 3LRTA 5A6SA 3LY9A 4OQYA 2VCYA 1HNXB 1XVVA 4B5LA 3CLVA 2QM8A 3KR1A 1IJKA 3ZIDA 3G9TA 3ANMA 1JGTA 1VL5A 1DAKA 1CJMA 4Z2AA 2I76A 4LKRA 4S24A 5EMKA 3GRPA 1QFYA 4NESA 3EVAA 2DTEA 2BFPA 4G1UC 2ZJ6A 4I50F 1V16A 4OHKA 5JRDS 5TIIA 2I91A 4WLVA 3VVBA 3VZRA 2LRHA 3B1KA 3PR1A 4KXNA 4LI0A 4TRMA 1T2AA 2HRQA 2P9TA 1NTOA 4O2BB 1EJ0A 1E98A 4JJ8A 4KYUA 4Y7DA 1B15A 1ML4A 2GM3A 3USES 4RFVA 5JNRA 1FUIA 5JZOA 1EWQA 2BHSA 2EEZA 1I4TD 2XUZA 1CCWA 5IAOA 2Y66A 1KJQA 3I37X 4BYMA 4YBZA 5J4KA 2OCGA 4FDLA 1FU8A 4OOFA 3V46A 5LYJF 1MAUA 1P31A 1FP4A 3R7BA 3UNXA 2BKUA 2CMHA 1QG4A 5J3JA 1C7ZA 3T34A 4CF7A 3QE0A 5FV7A 1B6RA 1SVWA 2YWGA 3KD2A 1JLMA 3R9IA 3M2PA 4ARUA 4DTIA 2V7UA 3Q3EA 1EX7A 2FPKA 2GB4A 2VPWA 3ASZA 3JWGA 3AIMA 3UHJA 4EZIA 2XB9A 4KZKA 4CVNA 4BFCA 1QXSA 2VDRB 3HLKA 3QEMB 4OQEA 4W7SA 4AF6A 4PLVA 4Y3UA 3VDQA 3FUXA 4R1TA 4EY6A 3PZBA 3EXAA 1T36B 3THSA 4DLVA 2W2TA 4G0UA 1GKKA 5AD1A 1C1DB 3WKAA 1JLRA 2PIDA 2O8FB 2OP1A 2VDOB 1NW5A 4JUIA 2C42A 1FNBA 2CLMB 1I4EB 3VUEA 4WUVA 1NVDA 3MHPA 2ODTX 4FCWA 4AD8A 2J41A 1L4KA 1QR2A 3R3WA 4CGYA 2N3ZA 2Z43A 4HDNB 1NP7A 4QLAA 2RGAA 4CEJA 1YC5A 2O07A 4WZBB 1ICIA 2Y93A 3E6AA 1M9NA 2CHQA 5AOVA 4WLUA 2OUIA 1TM7E 4FUQA 3TLGB 4C6TB 5ALJA 5BSEA 5LMNB 1Z7BA 2SBTA 1I4OA 3TAUA 2BGNA 3KFXA 4M9ZA 2NP6A 4X66B 1D2CA 3OJCA 2EWVA 1LW6E 1WVGA 4CCYB 1X2BA 4BE9A 2VQ6A 4QVKA 5TR9A 5A9TA 1NF2A 1X6VA 1Z07A 2YUTA 3ZU4A 1VJ0A 3K6RA 4L6CA 4J49A 1MENA 4RPIA 1NXOA 2IHJA 2ZIAA 4H15A 4J03A 4QECA 2J07A 2W2PA 4WCDA 3V7FA 4ZYYA 1BU8A 4D0NA 2CF5A 4ALKA 1EQ2A 4ZARA 3E22A 1Y89A 1F17A 4FYWA 4HRVA 5F1YA 1SQ6A 3PHGA 4FS8A 4MGZR 3OX4A 1JVNA 3KKNA 3ZG6A 4AJKA 4PFJA 1NNLA 2M6SA 4KV9A 4ND8A 5AVUA 2AC7A 2NUAB 1LGYA 2IDJA 3SYKA 4CL8A 4DJDC 1XIVA 4EG4A 1D0VA 3LDHA 1M75A 1RM0A 4MRMA 2VYVD 3AQ4A 3M9LA 4KH1A 4UDXX 1TZ2A 5F5XA 1A8HA 2OO3A 3LY7A 4NE9A 3PTAA 2JAHA 4W63A 2OOKA 4RIEA 2CT8A 1FLNA 4JYMA 2BCEA 2Q3FA 3OJFA 3IBGA 4JZKA 4MQEB 4IIDA 3LXRA 1PCXA 5FXMA 3S2ZA 1WULS 4AZSA 2FPLA 4CLRA 5CT5A 1N78A 1P1RA 4UHBA 3SS7X 1R9NA 1UJ4A 1FUKA 4IJMA 3UMVA 3ZWWA 4KPFC 1CS0A 4PTYA 1ENPA 3B6IA 4HDAA 3W6UA 3WGGA 1XDZA 2X1HA 2XX3A 1MUUA 1LLDA 2Q7XA 1E7RA 3KAKA 3OT1B 4JVNA 3T1NA 1KBZA 1F6DA 1KFJB 2J85A 4ARVA 3Q7SA 1BIFA 3S68A 3TCKA 1I2DA 4W5RA 3EXG1 1WJGA 1TQ6A 4TTRA 4XLLA 5E8JA 3LWZA 5GM1A 3BICA 2QQ0A 2OFWA 3F8WA 3IQFA 4D3ZA 2HC9A 2ZBFA 1RAFA 3B7GA 1OZ0A 3Q72A 2BR4A 4IQ8A 3OCJA 4PC1A 3IOBA 5ITSA 1M8KA 4J2OA 4W9NA 2Z4SA 5LLSA 1SVUA 2C8KA 1TEXA 5LOVF 1UBSB 2YJNA 3TUIC 2QM7A 1UCFA 2WMNB 2YH2A 1S2MA 2BBOA 4M1TA 4Q18A 3ROXA 1WETA 4LJ8A 5SZKB 3R8CA 1O8CA 3FW1A 2HL6A 4TM8A 2YZGA 1CERA 1BZYA 3K6KA 3NTXA 2GT1A 4K9LA 4UNPA 3RVBA 2O8CB 4V0KA 3FM9A 4JFRA 1FE8A 1PR6A 3OZVA 3I0MA 4BNDA 4B17A 5K3SA 3QVKA 4FOOA 2GOYA 3GNQA 3UK0A 4IJQA 1B43A 3HGQA 1JFRA 3HJNA 4JJ4A 3LT2A 3TRHA 4MW5A 3G5AA 5JSKA 1YK0A 5AVVA 1XJCA 2D1TA 2XRYA 1UBGA 2WSLA 3DHVA 5GINE 2W6QA 1YQEA 3LNTA 4FCCA 1P60A 4X63A 2NTYC 4PN7A 2J87A 1XT6A 2GK6A 1OB2A 4IM7A 5EJ5A 1ZOSA 1RMQA 3M6MD 2Q7OE 4BVAA 1ZK1A 2FZGA 1NW6A 3MTBA 5JR3A 3F5SA 1DBIA 2G40A 5ALEA 1KEZA 1I7DA 4C76A 3EHEA 2IV7A 2EERA 2VAMA 1EE9A 5MGNA 1E9EA 4BKRA 3SU8A 4FM9A 3DYVA 3BCSA 2FPXA 1KYZA 3IKMB 3BIXA 3ZYCA 7ADHA 5EXEA 5SZIA 1XZKA 5U1PA 5KVQA 1MT3A 1MRSA 4I8IA 5AXDA 1CRLA 3NDIA 3F6BX 2APJA 4M46A 3SLGA 2ZM5A 3ZE0B 3F46A 3HVUA 2Z57A 3SHOA 2V5UA 3DEIA 3WICA 4IRUB 4XB6B 1FJGB 1ODCA 2XSZA 1VL8A 4ZAWA 4G5HA 1AV7A 1P7VA 3DAYA 4RORA 5KI6A 3ROQA 1R9JA 3U7JA 2P9GA 3OUTA 1JA1A 3U48A 1V1MB 3BUSA 4DHWA 3TN7A 4C4YA 1AUVA 1OWMA 2QNBA 2OLJA 5EMNA 1Z35A 3OHSX 3NPAA 3WGQA 5EUQB 2Q5OA 2ZJYA 2OFFA 1EDZA 5E9AA 4PQRA 4X3PA 3RTGA 3R4VA 3SSNA 1EX6A 2HZ7A 3P9CA 4E15A 5HNKA 1Y7PA 5JVDF 1AQ6A 3PRKE 1TM2A 2H1HA 4A0RA 4A92A 3VZDA 2FZWA 4BMVA 3VR3A 4FBMA 5JROA 4I1UA 4LEIA 4YAGA 3A4YA 5F23A 2B98A 1VLHA 2RKWA 2YRWA 1C1XA 4Z4HA 3KTAA 5K6TA 2B0JA 1NJ2A 2NU6B 3JAKB 5FIUA 1WG8A 4AQYB 2SCUB 2BCGY 4KVFA 2LIPA 3OFJA 5FO0A 2TS1A 4DSAA 2JBWA 4N4AA 1W93A 3SIRA 4JB0A 2VI5A 2FFAA 2E21A 2UZAA 2J6HA 2ZWPA 1TB4A 2GEVA 3KK0A 4UCXA 3M5WA 4KMSA 2BBTA 4DLZA 3S27A 4JLPA 5CYOA 3DGFC 4R0NA 2HQRA 3VPCA 4BTEA 3IUYA 2ISSD 3EEYA 1ODTC 2I3DA 1YB1A 2OYSA 3G2PA 5L7YA 1D07A 1UWVA 2IYXA 2L17A 4HDSB 4B32A 5JAIA 4J7AA 2AQHA 4QATA 3KELA 4PGAA 1AO0A 1ILWA 1O6FA 2Y6UA 2FHSA 3ZX4A 1P2UA 1ZINA 3BTOA 4N9QA 4P3KA 4CM9D 2I54A 3ICCA 1W75A 4RAOA 4V1CI 4GBGA 2HNAA 1RYHA 2FK7A 1TCCA 5DDIP 2P6RA 5AKEA 4L2IB 1L4UA 2GJ9A 2Z8YM 3D3WA 4YROA 1J1IA 2J6BA 4OFZA 4ZYTA 1WDWB 4TL6A 4RA9A 1N6KA 2HMWA 1Z47A 3EDMA 1WHTB 1RRPA 4MA5A 5DYGA 2WD9A 1QRTA 4DBZA 4HPJB 3QTLA 1F8UA 1U9IA 2NM0A 2FR8C 4BO9A 5ALQA 1JQEA 1CVRA 4A8JB 2QOEA 2YTZA 2PGIA 2VYFA 1BVUA 4LX0A 3PNKA 4MAAA 4NR0A 5EJ2A 5GZ6A 2GJSA 1QPZA 3JCZA 1W34A 4P4UA 4CIVA 1VA4A 3AVPA 3T7AA 5SYNA 3LF2A 2ZRMA 2QYOA 1N0IA 3EH1A 4FOSA 3QKSA 5D84A 1ZC3A 4R8SA 5KDLA 1JH9A 1R0YA 1NVBA 2B9VA 2HK8A 4EIWA 2XWJI 5BWLA 4XB2A 1K3FA 1RMYA 1MN6A 4NXNB 2ODBA 1U0JA 4NG5A 1CRQA 3T7JA 1DUSA 4K5QA 1KMHB 2QD4A 3L1HA 4IFEA 5SY4A 3T5DA 3UWPA 3G1TA 5BR7A 1AO3A 2P2SA 4JK3A 4OQDA 4CT0A 3TUJC 3E1SA 2WAMA 3QU5A 1C0EA 4OIFA 4CIXA 5HFJA 3AKDA 3CXRA 1VTKA 5K4HA 3MRXA 4GRDA 4YR7A 1D0IA 2VXCA 1JJVA 4UUBA 1CB7A 6PFKA 3ILHA 4OY3A 3BIOA 3UMCA 5HQTA 1K8XB 2JK1A 2JKYA 3R6LA 4LYHA 2VKTA 3K70B 1PV1A 3OCCA 2JLWA 1OI3A 2RH5A 5JS1A 3L0OA 4E07A 4OFBA 4K81B 4IMRA 4JCOA 2JBAB 3LHFA 2XZTA 2W9XA 4P2GA 4LYAA 3BG5A 5IT5A 3CGWA 1CR4A 1B0UA 1FLDA 4FYYA 3S29A 2NNLD 1JW9B 2PLNA 4QPPA 2Y3IA 3LDAA 5EZ6B 3MD9A 1YVUA 4U6QA 5HYVA 2Z8XA 5BWCA 2CBZA 2O3SA 2QT9A 3CF6R 3R3HA 4LMAA 1DOHA 4ISBA 2R6ZA 2RONA 4REQA 3TL3A 3V00A 3QQPA 4JI7B 3HZRA 2YYZA 2CDBA 5AOAA 3ZVRA 2AFIA 2FF5A 3S8EA 1EXWA 1AG9A 1LWNA 4E31A 1M5RA 3EFEA 3PKJA 1CFJA 1FPQA 2WD7B 4IIXA 1ISPA 3EPRA 1JQBA 3A1UA 3OLXA 3OZ7A 3IO5A 4HDMA 4K6MA 5FTNA 1L5HA 3ZHOA 4DEXA 1ZNXA 5BRAA 5JBNA 2NAPA 2CNOA 4QULA 5D87A 3FPGA 1H6DA 4DCNA 4E5MA 3R3XA 1Z75A 2WVJA 5DN6A 5G41A 2QX7A 4LYYA 1AN9A 1J8YF 4ENRA 1G0OA 3D54D 4I6EA 3URMA 5JFGA 1HNZB 1Z12A 2BFFB 1R50A 2E87A 3EEQA 3IIMA 5DI9A 1P91A 1NLMA 2UVDA 4GLJA 3DZKA 3EX7C 1XPUA 3HGMA 3U60B 1Z2OX 1CP3A 4MYUA 1SU6A 4QBHA 1M2HA 1B41A 1ND6A 2IUYA 3OKFA 1BXRB 4NJMA 3OEYA 1TCUA 3JATA 4GQBA 3L7KA 3RRYA 3PLRA 5EJEA 4O4LB 2W98A 4MI3A 1HGXA 1MABB 2JLRA 3DOOA 5K8CA 2W6JA 3KWLA 4PWYA 4FCTA 1QGED 2GSDA 1JQDA 3QLJA 3EBOA 4NFSA 5IKEA 4UXIA 3R7FA 2V6JA 1JIKA 4ND4A 3KT0A 3L02A 4PAOA 3VKVA 1XMXA 3RWBA 4N0QA 1FTGA 1GUAA 4S12A 2FFQA 4TUYB 1SBQA 3M33A 4YCBA 2Q3MA 1XLTC 4AKSA 3WTBA 3N3BC 1C0PA 3AUFA 4P4SB 3NGLA 4XDYA 2OFOA 1N77A 2X6TA 4ZK2A 3VH2A 1IK6A 4QT4A 4Q4HB 3OQIB 2P5UA 4WKGA 2YNMA 2JIOA 5G0TA 4ITUA 3A9UA 1XHFA 2X5XA 4FI3F 5M5BA 3SX0A 4H7PA 5C51B 2ZIXB 5C8YF 1F0PA 1MV8A 1DMSA 3AHCA 4CKCA 1NNUA 3FKJA 3G5UA 1KNXA 4QYWA 3QF7A 5CVJA 5KOHB 4UC0A 1QE5A 3ETCA 3TAXA 1ELOA 5F9HA 1SIOA 1JI3A 3KD3A 2OB2A 3WDKA 5HUHA 1J42A 3RTBA 2ZOSA 3G88A 4FLEA 4FZJA 3U9TA 2RIRA 3QJGA 4DA8A 3T1QA 3V8MA 2L69A 1F8FA 1PJ2A 3RYCB 1DQPA 1GPAA 1IRXA 2X8JB 1RXEA 1JDZA 2IW1A 3AR8A 3OFVA 4IIYA 4YRJA 3QXHA 5A3SA 2JI8A 5KQLA 2YJ5A 3SP1A 2OGTA 2Q0XA 1SA0A 4F3YA 1ULBA 4HB4A 3NCTA 3NTLA 1JT2A 4NZ9A 1EZZA 1KDTA 2O7NA 4JVSB 1WP9A 4GKKB 1VJ1A 1X42A 4ZYZA 2AA3A 1MC5A 4XWAA 2NYVA 1SOWA 2V5AA 4NE2A 4CQNA 1WNTA 3O90A 1V71A 2QVZX 2YOFA 1C4XA 1TTPB 1WD7A 3O4HA 3QYPA 5COAA 1X7XB 3WB2A 2GWHA 2AWOA 4EB6A 3FD8A 2XMRA 2IX3A 1ZK4A 1J22A 5ALPA 4YT4A 3RW9A 1KJWA 2ADOA 5DOZA 5J2UA 1Z5GA 2YW2A 4UHKA 2O2DA 1K7SN 4TOIA 5IT4A 4LFBB 3BEOA 3T7SA 4HAWA 5B4TA 1KAHA 1UJ6A 4B7AA 5T4HA 5KWEA 3NMUF 3T3IA 2FDRA 4C05A 3AG5A 1EHYA 3BXXA 4MQ6A 1XCPA 1UBFA 2PS1A 4Q1CA 5EIBD 1FX0A 1ISSA 3DWIA 3TJMA 1UC8A 3FHLA 3RIXA 2CLEB 1KO7A 1MU0A 1WDLA 1K8RA 3I01M 4YECA 3QKUA 1R8JA 3JAMA 1Q0TA 5JAMA 5HJ7A 1OKKA 1BFUA 2QT0A 4Q5IA 3P2YA 3ZLVA 1KQPA 2JHAA 3QVMA 2QNRA 2QZJA 2BGUA 1V5WA 3INNA 4HUJA 4PBRA 2RHMA 4U2CA 3UWMA 1IBKB 4KI7A 3GOHA 1E2IA 1SOVA 1HY3A 1IPFA 2QL6A 3KKQA 4KVGA 1KIMA 4KXFB 5JNWA 2RGXA 4GSKA 1GTJ1 2JZOA 3R5KA 1HDOA 2AJBA 1RYEA 4MP3A 4OQXA 3G9ZA 4B87A 2PQ2A 5HSGA 2PKQP 4OYRA 5JCOA 2LW7A 1O95C 2CXQA 1JDUA 3LP5A 1GFSA 2Q1XA 1XRJA 4H1VA 2BDEA 1CQPA 3I8XA 4PAGA 1WZCA 4JMLA 1L4GA 2PANA 2Y1FA 1W9HA 4WN9A 1VE3A 4TYNA 2VP0A 2QTTA 1DIHA 3TYXA 3KWJA 2WR8A 4QSHA 3GLUA 1FFEA 1VLLA 3BL8A 4S1NA 5JCJA 2AZ4A 1PO7A 2Q4TA 2VNSA 1JYFA 3HYNA 3KUDA 2WUEA 4G4JA 3RVKA 3U4DA 2AX4A 4MXDA 3N8GA 3ONWA 3L9XA 4MV5A 4PZLA 5DBGA 3Q2IA 1ZA1A 2FZKA 2ZTHA 3W6OA 4HMOA 1VHWA 2CL5A 1DRKA 3CN9A 2HJWA 3OPVA 2V97A 3WP0A 1CEYA 1MVNA 2R47A 3PD7A 4B09A 3RS4A 4IV5A 1LSUA 3HKCA 3I2JA 1NHGA 4F93B 2G6TA 4A6PA 1RZ3A 4C0LA 4B80A 3W9SA 4HO1X 4XEHA 4CM4B 2WUFA 2PR7A 3L0YA 1R7RA 1XZEA 5HF5A 4A73A 3AM5A 2MJLA 3OO0A 2F1RA 4XGIA 4D97A 4HYEA 1NR7A 3C85A 3R41A 3W5DA 3JPWA 3RSGA 2RGBA 1UXKA 3QBDA 2XZDA 4JEUA 1YA6A 5DI3A 2HHCA 3I42A 4OP2A 2Q41A 1XROA 1ZGAA 1QJCA 4L8GA 4AVYA 4PLWA 3C3EA 4PLYA 2YYSA 3AB3A 1HRDA 1H2FA 1XHLA 3A70A 2GN2A 2QLLA 5DT9A 3SZRA 3FSGA 1V16B 2ICAA 4PRZA 2VNAA 3P5BA 4BMSA 2P9FA 3N2GA 4B3IA 3AILA 4PIMA 2EJUA 1YS2X 5EY5B 9ABPA 2WY2D 3RLIA 2FMXA 4RKWA 1UPUA 5E0OA 3C3KA 1M2EA 1EESA 4QASA 2VP5A 3PRYA 4K88A 2G82A 4F8YA 3EGDB 1XTQA 3VSBA 3I5AA 1ESDA 3OHMA 5KYWB 3D0KA 4MDEA 3K9CA 1A82A 3BHJA 3GLSA 5E7MA 3NBQA 2IPOA 2Z8ZA 2HA4A 1Z13A 4QAQA 1OFUA 3L7OA 3LT4A 2NPFA 1B23P 2J1LA 3BKWA 5AKIA 1ZH4A 4XQ0A 5DMHA 5E1MA 3W2IA 1M1NA 3TRFA 2P9CA 2PGXA 1AUXA 1PI3A 1Q0RA 3IKTA 3G2OA 2I2AA 2JC3A 4YRZA 1QYIA 3RK0A 3MSCA 4WX2B 5TJ9A 3VFDA 3W3ZB 1XKLA 3BMNA 2C58A 2JASA 4H59A 4B9AA 1WMEA 1UDXA 4WAUA 5J4LA 4C4RA 1K5PA 2R1ZA 2YXEA 1K2WA 1R4MB 5JALA 3IPYA 1CR2A 4Y1RA 4JJ6A 2CLCX 1SC4A 4F1WA 1S3FA 3PE3A 3RS5A 4M36A 3AV0B 4E2ZA 3D8SA 4BU1A 2V7GA 1XXHE 1Y4SA 3KKZA 4MSUA 1RZVA 1TQ8A 5C31A 4BQOA 4F9EA 8GPBA 5KINB 3PEWA 4WNCA 5AW6A 2R8EA 4YWJA 3SNKA 2R0QC 2QG9A 1P72A 1OV6A 3NHRA 4G0PA 4WLEA 1Z45A 4BO3A 1U9IC 3SM3A 1SXJC 2J7PD 4UE3S 4ENUA 2ZB4A 5IUNC 4KIUA 1G8AA 4HXYA 1KYVA 3KJNA 4CMEC 4AUNA 4CZ2A 1ZDMA 4ZJZA 3FYDA 4Y2PA 1K7FB 2UZ4A 4KQMA 1W0JA 5B2FA 1IULA 4LNHA 1KP3A 4P0QB 1P5ZB 5ALYA 5F33A 5LXTF 4LHXA 3CH7A 4M7RA 4O02B 3H9EO 2EZ9A 3M81A 4DXHA 1C0LA 2YWDA 3G59A 3IX7A 3MLBA 1OH5A 1V8DA 3GLGE 3E9RA 3SJZA 1SUDA 4LRQA 4DPLA 3L1UA 4H2DA 4UM7A 1R88A 2FU5C 1ECFA 1T29A 2ZJ3A 3FNHA 3HMKA 5B2ZA 2I8AA 4PQGA 4CT4B 3QX9A 3CZ9A 3D6JA 3R8XA 1WB9A 5JC1A 5IDYA 1N2BA 3D7KA 5JEEA 4WD3A 2ZLBA 1VE6A 1SXQA 1M0TA 2FPWA 2YIVX 2NUTB 4X8LA 2Q6KA 5LDHA 1G16A 3LQKA 3AZQA 2C00A 2OCBA 4ETNA 2Y99A 5A5FA 2B6HA 3EPJA 4MRMB 4DPKA 5C8DA 1NE7A 4R5HA 2IXEA 4DV3B 4GGMX 1ZESA 3CH5A 1CVIA 3TCNA 2R4QA 2CHVA 5K0SA 3PC2A 1E5TA 1R5JA 5IBCA 3BD6A 1CDZA 2ZVJA 3FTNA 3SBOA 2P9QA 1E9SA 3E8SA 4CLRB 3O4IA 4MCIA 3RC7A 3EGCA 1KO5A 1YBMA 4ROSA 1ONSA 1OCEA 2VHVA 3SXJA 3SYNA 1COWA 1ODJA 1VZ3A 2DFDA 2X8LA 1CS0B 4YNBA 4PYJA 5IJ0A 2CVOA 3D4OA 4Q4LA 2OTCA 3K7EA 2HSDA 2G9ZA 2HWWA 3PF8A 1ZIXA 3LV8A 2OPHA 4LUCA 1A9YA 4FDAA 5BWOA 4JI5B 1JILA 2HRCA 3QU2A 5F1KA 1CUDA 5IXYA 1U3DA 5AM3A 2JIQA 2DR0A 2HLDA 1KOFA 1YC2A 4I50B 3W79A 3CR8A 4ZOCA 3WLJA 1JMKC 1Q0QA 2J32A 3FVTA 3LPMA 3L6UA 2J48A 1OLUB 5CW1A 4HH0A 4IGKA 3WVNA 2O2EA 3PFKA 3V1LA 1X0VA 3L8DA 1XI2A 3JD3A 4H7KA 2O3TA 2EL9A 3FGNA 1C41A 4LOHA 2COUA 4NSNA 3TW8A 4EO7A 2AZXA 1R0CA 3VAZA 4LF4B 4B9EA 1RQLA 1XFAA 1YIOA 1A1SA 4NMHA 3HJFA 1TEVA 1AB5A 4OXKA 5LYJB 2IP1A 1CU1A 1EK2A 2FTKE 3AESA 4I6GA 4JL8A 4XJTA 2FSVC 4Y1EA 1ILEA 4I9FA 1M0SA 4IUBS 3W4KA 4BNDB 5HHTA 1Z4KA 4FU0A 3ZX5A 2HBYA 3BIJA 3QVOA 2P3OA 2VJOA 4DA6A 4E5NA 2FP4A 3M1IA 4AMBA 3WJAA 2I34A 1FTQA 3TZLA 4RV4A 4YT5A 5DRYA 1P7CA 3EW9A 4ME6A 4UTZA 2A2ZA 5T57A 3UUFA 2F3SA 3DT9A 3UJNA 2WB2A 1ZN8A 1OX5A 2QT1A 1A2QA 1SQFA 2NU7A 1V9LA 4RF4A 1E7QA 5JXHA 1NJFA 3SR4A 1JDBC 4F86A 4MS3B 3JQPA 3QI7A 5D7NA 4BEBA 4EPXA 5F51A 3LXUX 2F8SA 1WF6A 4BC0A 1KYTA 3S28A 4ZO8A 2D2IA 1XFDA 2OHHA 1TW2A 2ZUVA 3PIRA 3NAMA 4QBFA 3SLRA 3QKRA 4D46A 4WT7A 4EW1A 4V0SA 5JAUA 4TMZA 1E66A 3KALA 4P3XA 4BQPA 4XWKA 1N5IA 4XSGA 1T26A 1V1JA 4UEJA 3F3YA 4QEDA 4Q7QA 4KO8A 4PSAA 1MA3A 4L9WA 4KFSA 3M83A 2EHJA 3N75A 1WF3A 4PX5A 1XQWA 3L40A 3GRYA 4J7XA 4N49A 1SO8A 2VAXA 5E7QA 3DVAB 2DQZA 2FETA 2AVNA 2G17A 3DCIA 3PCXA 3UT0A 2GJAA 1Z9BA 1BJTA 1E3TA 3DDSA 4MUMA 4MYDA 4U7TB 5KHLB 2ZUBA 1ES9A 3EIUA 3EXFA 5CYPA 3P9SA 4IIUA 5K09A 3HFSA 3FCUB 4HGNA 4HNGA 4Y9UA 1FA9A 2O6HA 4H4CA 3ZZNA 3MJFA 1BGVA 3OP1A 4BNYA 1C50A 4GZLA 1H5UA 3UVEA 4ZYWA 1GPBA 2C2BA 4MW9A 5J5VA 4D9CA 1JFTA 3BTVA 1O94D 3EEFA 4QVIA 4Q39A 5THXA 2AV6A 4GNKA 4ZMRA 3EPHA 4J0GA 1IZ0A 1DJOA 4LWQA 2PVCA 1MB4A 4LFCB 1QIDA 5IH7A 2J08A 1TYCA 4KQ9A 3VVLA 1RJDA 3TOZA 1F6BA 3L7DA 2DPLA 4WACA 1AMUA 3KTAB 1PL8A 2A1UA 3ABOB 4KFRA 1EHIA 3OURA 3TL2A 4K87A 4GI7A 1EI9A 1US8A 1QRUA 1NDHA 4EJ2A 3DE4X 4O5OA 2WWFA 4HRAA 5K0EA 1O57A 2H1SA 1Y33E 3AU9A 3GZTB 4JHXA 4MQMA 2Q3DA 2I80A 2JIZA 3FOCA 4P86A 3ZXIA 4CODB 1LJUA 3NV7A 1CZOA 5TVGA 1YONA 3RVOA 3SS9X 4RVNA 1CUJA 3JQ9C 3QVJA 1HO3A 1YU9A 1FMJA 4R84A 1NONA 4YQFA 1NFQA 2NVBA 2B25A 4FMCF 4YJHA 3F8SA 5IBRA 2PK3A 4H4EA 4B7CA 2IU3A 3RUFA 2WYWA 1PT7A 2J67A 5T4BA 2OVBA 1SZJG 3JRWA 3C5HA 3WE7A 5JSZA 4H7DA 4ZZ2A 2X9NA 3WYDA 1GQ2A 2VA8A 3D3WB 4PYNA 4ALJA 4X94A 4UTVA 1PG5A 1O2DA 2PWPA 4G5SA 1Q1EA 4RS3A 4D3FA 1NN1A 1QNFA 2CLFB 4JD5A 4RA9B 4O5AA 1EG7A 1YA8A 4GD3Q 4M37A 2PWYA 5DP2A 1O97D 3SHTA 3TDNA 4PLPA 5FTLA 1I13A 1P0MA 3Q11A 2JJ2D 4U5QA 3AB8A 2R2AA 1DC3A 1RAGA 4GG1A 4DADA 3ORSA 1YDMA 4NG4A 1E2MA 2OC4A 1G4UR 3CLSD 1EZ4A 3O74A 3DEHA 5FWDA 3PDWA 1Z8HA 2VK4A 2D7JA 5AKKA 2QPOA 3OU6A 1S3SA 4GEKA 4MUEA 1Z6GA 4OLAA 3PL5A 2OV2A 3QKSB 1CBUA 4M83A 4EKNB 5JAOA 1E6UA 2ZAYA 3L84A 1XCMA 4WDRA 3K0BA 3ILYA 5TS3A 3WK5A 5BMOA 1DTEA 4KXWA 1XYGA 4XQ9A 4HX5A 1CUGA 3EWIA 1OFGA 1IOWA 2LGJA 1OSNA 3KXLA 5JYDA 5JAHA 5BSUA 1OA0A 4D8VA 1DSSG 2WJ3A 1IN1A 1TEZA 3HB7A 4MWOA 1RYMA 1UWLA 3TQCA 5ED0A 2I6SA 4KAXA 5CCEA 2CYCA 4DY4A 2E4YA 2JI6A 2C04A 5JBIA 3A6GA 4Y67A 5CG2A 3JWEA 4Q21A 5FWYA 3I6ZA 5H3CA 3CIOA 4N8DA 1JJAA 4JX8A 4NZMA 3WL3A 2JFPA 1UAYA 2JRCA 4CCAA 2GZAA 2ZB3A 3OC0A 2WUVA 1P2BA 1KGDA 1K7YA 1KK3A 3ICVA 4NNOA 3WNCA 3DCJA 1Z7EA 2J5RA 4I7EA 2C9BA 4REQB 1BH2A 1BWPA 1VL1A 3VR5D 5JSQA 3MTQA 4MW6A 3AIOA 3LY8A 2YXLA 5KJEA 2AFIB 4G37A 3UB4A 4JQSA 3TQRA 1UFOA 1G20A 4YIKA 3CY6A 3DAGA 3E2MA 5L6LB 3FHTA 1IEQA 1P62B 1KKLA 2QTVA 3ZZMA 4BQRA 1SURA 2QN8A 5I9NA 4ZALA 1L5HB 1Y48E 1XO1A 2FN3A 4ZCLA 4KLZA 3U13A 1B0ZA 1U2DC 4F5EA 1NQTA 4YLGA 2XWQA 1OX4A 2H51A 3IHKA 4JI4B 1TL7C 1DVRA 3HV0A 4HDCA 4POOA 4OSEA 1I51A 1U1DA 2FZ4A 2WAXA 4WXMA 3RFFA 4DBLC 2IT1A 4RPHA 5IM4F 2ZBPA 3THWA 2O57A 4KWHA 2XUPA 2FVYA 1H69A 1C4KA 3BBLA 5HUJA 1GNRA 3ORHA 1U2RA 3PXDA 3Q9UA 2YN4A 3LL4A 3R7NA 2EX4A 5EXSA 3O0TA 2OESA 5GVRA 3JATB 3U4HA 5I01A 1VBFA 3KEMA 1PDVA 1ZUNA 1D2HA 1XNRB 2H4JA 4LF9B 4JLJA 3WDSA 1OAOC 1R18A 2ID7A 4GICA 4C7MA 3TQTA 1X3SA 1XL0A 1EKXA 4M89A 3A2KA 1U94A 4OK3A 4OUKX 4GPAA 2CEAA 4QELA 1KE2A 5A5EA 4P3PA 5K03A 2EXXA 1OMOA 2I33A 1IHXA 2IDKA 2R25B 2ABWA 1IOLA 1GSAA 4IZIA 1FMLA 4IDHA 4WL0A 5E38A 3U4CA 2ETVA 1JT9A 1QMPA 3AF5A 2Z9CA 3KL2A 2X5JO 4N1AA 4B0OA 5IDQA 2VPZA 1XP5A 2NO6A 4EBBA 5T5QA 2WJGA 1Z0JA 2WT8A 3SSOA 3OKCA 4QEKA 3T6KA 2FEKA 4LZNA 1SOAA 3N05A 2A5JA 3NEAA 3DTVA 2FWRA 3NDRA 2VDMB 3T3DA 1BVYF 4NEHB 1A7AA 1VHDA 2YYAA 3ZQ4A 5KVCA 5KPJA 1HNWB 1M6HA 4F11A 2FWPA 4PTLA 4CKCB 3H84A 5MHTA 2BGTA 2A5FA 4ER3A 1AKNA 2VBFA 4FD2A 2ZE6A 2Q9AA 3RUIA 5HZMA 2RJOA 3GGPA 3O38A 1VBMA 1QIFA 1O6GA 4QTXA 1DBPA 4IRXA 4DCOA 1T6ZA 3EZXA 3ZS9A 3F7TA 2Q0QA 4PFKA 3ZWDA 4KQEA 5FOVA 1JHRA 2OHFA 2C4HA 3IP8A 4WFQA 2IEIA 2WP0A 2PS3A 3QITA 4KWIA 1WTCA 2A3NA 1XMIA 2D5AA 3CRNA 4LE2A 4EHKA 2H31A 2ZJ0A 4X64B 1C8KA 1UQRA 1SA0B 4EAQA 2ORWA 2W2KA 3MCWA 2CNDA 3KQLA 1D2RA 2ATXA 1GZ7A 3ROZA 2BGKA 5FLXA 4IDPA 1XNGA 5H3HA 2CXXA 2Q4DA 3ECSA 4ZAFA 2IC5A 3UHPA 2BH9A 3RARA 4YPVA 1XPOA 1T13A 1UMBA 4EB6B 3THYA 4IXMA 3IRUA 1I4LD 2QTGA 1YQTA 1BMDA 4UQPA 4W9MC 5BR8B 4OAQA 1VP3A 3NW9A 4E6PA 2NYAA 4IKEA 5HBRA 3O4GA 4Z6KA 5K3FA 2J46A 3EVEA 10MHA 1DAPA 3IAUA 3LY5A 4GE0A 1NT2A 2O48X 3D8HA 2VFAA 2VP2A 2I4OA 3ZCSA 1EVLA 4MWCA 5CG1A 5EP4A 3AH8A 1FQWA 3FDJA 4Z0PA 2A9QA 2W93A 3ETGA 1CZRA 4RA6A 2GN1A 1NX6A 2ODNA 3J81k 1CY0A 5EKDA 2GDZA 5A9SB 1XZGA 3R6GA 3MWFA 4YRSA 4KK4A 3R23A 1AHIA 4IP0A 5F2KA 5EI5A 5JOQA 5KOJA 3PCTA 3DJFA 1GPH1 4ZYXA 1U9JA 2IRWA 2KQUA 2C3PA 2I7VA 3KTDA 3OLWA 4HSEA 4WNIA 3EG5A 5TS2A 1C29B 4GEGA 4L4ZA 3B70A 1FDIA 1ULZA 1CZKA 3U7RA 3C43A 2H9YA 3RH0A 3IPRA 3DPSA 3PNBA 5GIPE 5HQ3B 4HJXA 2Q6VA 1QH1B 5BT8A 1GQYA 3GNTA 2IKQA 5IU6A 4WN9B 1CG6A 4JXZA 2YV3A 1IOZA 4BMDA 4JVLA 5C2JB 4R01A 2XLCA 1NJSA 2R5FA 3EOBI 4MKFA 3ZHZA 2WABA 1H4TA 2R6FA 3NTRA 5ECYA 2PUTA 5DYNA 3T4EA 3T5CA 4G9BA 1LBEA 4MP8A 2ZRGA 1Y3DE 2ANCA 2FR0A 4FOTA 2RGYA 2QENA 4QGFA 4N6OA 2XV1A 3ACBA 5BWMA 3UPUA 3O8BA 1VLVA 5KNBD 2ZULA 3N0XA 2RGGA 2Y1CA 2QWXA 2XCQA 3W5AA 1O6BA 1PWZA 3JWJA 2V6MA 1S96A 4ZC1A 1QZTA 1TK2A 4AN1A 2FX3A 4DUPA 5KSOA 4JL5A 4JT8A 3N8NA 4PPNA 5K4AA 5GOZA 3HDQA 4RTQA 1XD9A 5LQRA 1YVPA 2ZIFA 4YMTA 5JXJA 2P9EA 1OIXA 3SDZA 3HCEA 1E9DA 1G21E 4BLPA 1WHSA 4QGHA 4QNMA 1VLZA 5DI3B 3JVIA 3SXUA 4UE6A 2ERXA 2W2LA 3I0ZA 3M5DA 4HQOA 1I14A 3KP1A 1JQKA 5DZSA 3W77A 3UK2A 5TRTA 1PFWA 3U40A 4K28A 4NHOA 3L9WA 4G56A 5M2QA 1BX0A 5AW3A 1EM8A 4RNCA 4GMGA 1HDEA 5ADWA 3OPQA 1VLJA 4B6JA 4PW0A 1EP1B 3QV2A 4ZTUB 2PKXA 1YZGA 4ZJYA 4J0CA 3K0CA 4PZUA 3VNRA 2PH7A 2K87A 4TTVA 2A9KA 2FSFA 3JQRA 4RZQA 2A9OA 3CN7A 3B6ZA 3LQQA 2ZJ7A 1V39A 1QFJA 1T2VA 1KVUA 3P19A 3GN1A 4NPCA 3ONFA 3SBEA 4DLWA 1J1ZA 1DBQA 4WA8A 1OXKB 1YQUA 3ECCA 1F9AA 4LK2A 4Z0TA 5FO1A 4BRWA 3HGTA 3MJTA 3VISA 1RNLA 3U7GA 1IFXA 4H9GA 4GOMD 2IXGA 3DT8A 2EJCA 4KFTA 3WK9A 4FHCA 3A1NA 1I3CA 5ICCA 3TSCA 5IX8A 2X3YA 1QQBA 1KR2A 3RQIA 3BMNB 4G26A 4QOEA 3IQZA 2G9NA 3BHMA 2BYTA 3KSAC 4KWCA 2WWXA 3KV1A 4CPDA 3QFCA 3GA0A 4UW9A 1YCGA 2ONCA 4ZZ3A 1PZMA 4Y1RB 3KQOA 2QLJA 4MWTA 1UFVA 4H60A 3S1SA 4ZQCB 4ZU1X 3OLZA 4BO5A 1YHZA 4B2LA 2OG2A 1BCRA 1WY7A 2A1TR 2LCIA 2YXDA 2QX8A 3ZNPA 1WCWA 3AR9A 1BGXT 4WZZA 2HXGA 4KBGA 3PEYA 5CDFE 4C20A 4QUJA 2VYCA 4AN0A 2AW3A 3L7MA 4DLRA 1N6LA 4ZXPA 1B2RA 5AUQA 4AY6A 2HJVA 2NU8A 1KC3A 3K2IA 3LCUA 4RHYA 4J9UE 1IBCA 1W2GA 2QVGA 3DH0A 5EWMA 3ZI0A 4MUAA 3PZRA 2FCAA 4XUGB 3VR6H 3WAJA 2QF7A 5J1SB 3EIEA 1WVMA 3E3OA 3TKLA 4HWTA 1IBMB 1FDWA 4OU4A 3UAVA 1PLKA 621PA 1GRNA 3BE8A 2QMQA 3UKOA 1WD5A 3VR4H 4BO8A 2NV6A 1GPDG 1U7DA 3P2OA 1LFDB 4RZIA 4Q3KA 1LV7A 1G63A 3JQ6A 4NHEA 3UMRA 5F52A 4C6RA 2OCAA 1H8EA 2QU8A 2HFJA 4O1IA 2GA8A 4X9XA 3V9PA 2JAXA 1RM5A 5J4VA 3SVTA 3Q7PA 4I3GA 4P4LA 2Y9MB 2WUWE 1IJEA 4TM7A 5FPPA 5JPDA 4ND1A 4Q7JB 5FWAA 2UYOA 4EG8A 4OKNA 1XYVA 5HJ2A 1TAUA 1PL6A 3GARA 4F4FA 1HT3A 1HLGA 4FFWA 1TZCA 2H06A 2P40A 1M66A 4MO9A 1T6BY 4RWEA 1IJBA 1QIHA 2P4SA 2ZDHA 1Q21A 1XF1A 3A7EA 3D6UA 4JI3B 3RRNA 1Y3IA 2IYSA 1K4MA 5L3RA 3TOVA 1ITZA 1NE2A 3JV7A 5EJ8A 1RRFA 1UQUA 3OESA 4JYBA 1LDEA 4H1HA 4TV8F 4BBZA 3IESA 3HCBA 4FWIB 3KSUA 2EBWA 3QRWA 5FPYA 2B8WA 4ZCIA 4B3GA 2ZQZA 3HN7A 4HDRA 4MOWA 3E9EA 4NQZA 3R7DA 4PSCA 3GL9A 2QJFA 4QL3A 1JTEA 1RLMA 4MDFA 4DR6B 5C4IA 2FWIA 4DLNA 1GUZA 4UVIA 2CJXA 1XDUA 5BSMA 3WMRA 1IXKA 1O5OA 1UP4A 6Q21A 5KNDH 3VSCA 3L8MA 1W88A 3I39X 4X24A 4Z7JA 3TW8B 1Y9DA 3WB1A 3VBCA 13PKA 1VKHA 2EW2A 4RLFA 3IYLW 1K88A 2GX6A 4R3UC 2QP4A 3ESRA 3IJRA 2UU9B 1X1AA 2F9FA 4UHJA 2O14A 1M34E 3CTPA 1RWBA 4CMCA 1JEYB 2XMQA 3AESB 1DBWA 3L6EA 1JWBB 5G2OA 3RB8A 4NECA 4OATA 1AF4A 3JQAA 5DK6A 3RREA 3EGWA 3FFWA 1FFXB 3CZCA 3KSZO 4M8SA 2Q8QA 2J5KA 2YHAA 2XLBA 4RSHA 1M83A 1WW2A 4F97A 5B1HA 4X7BA 2I67A 1GYQA 1N2CE 2KW5A 3K9FC 4LJSA 4BXOB 3DLCA 3ZJTA 5SY6A 5AO9A 2WWYA 5KQRA 1ETUA 4H1WA 3C87A 4QUHA 4KLRA 1UMDA 2B1GA 2NU7B 3B7WA 3D4PA 4QE3A 5JNVA 3D3NA 1LF0A 1H22A 3EUFA 3K8YA 1CKEA 1FTWA 4FMDF 1WXQA 2WUGA 3R9XA 5KEIA 3ZVLA 5TQ0A 1II8A 1TUIA 2ES4A 4KPYA 3QKIA 3HVRA 1EXDA 1BD3A 1FSGA 1JHZA 1Y81A 3MUFA 1TKBA 2G70A 4L5AA 5EXXA 2FMKA 3C5CA 2J5QA 1AKUA 3IAAA 3STWA 4RENA 4CR6A 2V1XA 3QY9A 4QJ4A 3KQHA 1T8YA 3UT6A 1R00A 3WYGA 5KQPA 1LNQA 1VPEA 2AR9A 1K6IA 3L4BA 5ECGC 5HK8A 3OE7D 3SE7A 2Q07A 5EIXA 2FRDA 3LBIA 4II7A 2R3SA 2JCXA 3P20A 4L0DA 1GNSA 2IZ5A 3DCNA 4MPRA 5GIOE 4AY2A 2ZROA 1SQSA 2OAP1 4EHHA 3MCAA 4JNKA 5BOSA 1I36A 1N9GA 1T8PA 2DUJA 1CUHA 2GFQA 4EDHA 1ZITA 4GDMA 5CVTA 1YMUA 3BSYA 4RM2A 4HUTA 4KPEC 1OU4A 3EXFB 4ASUD 3SZOA 3KVRA 3N9IA 1H4VB 3HA5A 4G4GA 2OV1A 3RSOA 2Y2VA 3YASA 2COEA 4NBRA 4EL0A 3ZS8A 3GEDA 2X4LA 3PHCA 2N47A 3RVNA 4CQMA 1LH0A 1LLUA 3H1FA 2JW5A 4BO4A 1J8VA 4ZCTA 1DKMA 2FE1A 2X76A 1DPFA 4KQCA 4M9CA 1GGJA 3K1JA 5DF1A 4AULA 4UFPA 2CV0A 5C3MA 4BVHA 4CEHA 3W8DA 1CIPA 5LVAA 3EC1A 4KUHA 1UUFA 1NWHA 4CL3A 3HN6A 4ZO7A 1IAQA 1W35A 1G2QA 3M6IA 4CU2A 4TLLB 5ITVA 5JRZA 3UQZA 4B3MB 1CPYA 4GYKA 2DLNA 2JGMA 2RBGA 4HI0E 4WY5A 2Q45A 4NKRA 2A1UB 2AOXA 3AEQA 2EHDA 4JX9A 4AL4A 2XUQA 5AKXA 1KE1A 3S0JA 2JCYA 4A8JC 2XOXA 4EA6A 1JFLA 1FXSA 2DWPA 4F38A 3UGJA 1E96A 2VG8A 2VJQA 5I8ZA 5KNBA 4GXNA 2AB0A 1E2GA 1OYWA 2QVCA 1P1FA 1QHSA 2AF4C 2D4AA 2TMGA 3GUCA 3JQFA 3P4UA 3QUBA 2D8MA 4UOEA 1OH7A 1XZAA 1VFPA 2I8CA 4RK4A 1N1DA 2B0CA 4B3SB 3HEMA 4FW8A 1EINA 2EGHA 1KY2A 1BGWA 3OWHA 1O03A 2Z2JA 3GLGB 2RD2A 1GRQA 2AFHE 3T95A 4EABA 3T3NA 3THXA 3KU1A 3VR0A 1SCUA 3V4RA 3HFGA 3JZDA 3FKQA 4R0VA 5IJAA 1UPBA 3DE7X 2FWAA 1TGVA 1SKUA 1JHVA 1X14A 1YR6A 3OA0A 2HIHA 4R51A 4ZOLA 1P4AA 1J0EA 5EJMA 1W6UA 4JDPA 5IZ4A 5FWXA 4ZZ1A 1VIDA 2JIPA 4YMLA 1XQ6A 5KNCA 3RD5A 4MARA 3ZDYB 2PEZA 2O8VA 1T2FA 1EWKA 2YUIA 5LBUA 2GD6A 1GQOA 2DVMA 3I5UA 4GVXA 4JWKA 4EAAA 3M49A 5BW5A 4FFDA 1DWQA 5AJWA 1PFGA 1JPJA 5LJLA 4M7WA 1U2TA 2OMEA 4DM7A 3H8VA 4F4JA 3NV9A 5JCXA 1VKOA 4P84A 5TEWA 4M1SA 4KR2A 1ZM7A 1CZHA 4MUYA 1GL3A 3ROGA 421PA 4EUNA 3AY7A 1MLDA 3AM3A 1PBNA 1N7GA 3V55A 4YYEA 3PDCA 3T5TA 5BVHB 4IDAA 2BZGA 3VV3A 2WIJA 2FAXA 1BQEA 1R64A 2C2KA 4PLGA 5A4MS 3GNLA 1VCNA 1ZN7A 2CCKA 2EKBA 2R8YA 2PSDA 4Y6RA 4ZANA 5FFNA 5IN5A 4A8PA 1E4VA 3PFWO 1W2WB 3QTTA 4DR7B 3A58B 3SJAA 1GPYA 2ZQYA 1ZH8A 1TFUA 4WWHA 4ARSA 4BVLA 4C4AA 1L5NA 4Q9NA 1U80A 1E0JA 3O2QB 3OT4A 1V7CA 1ZI8A 3OIYA 4V03A 5CLLA 3RGGA 4M6WB 3L7AA 4GI5A 1HX7A 1L7DA 1KPGA 4YRPA 1AKQA 3KQMA 4D9HA 2PYIA 1HOXA 5EUCA 2BJWA 5JZBA 1I1OA 5JBQA 2BZ1A 4TYPA 1D1TA 5AHXA 4D6XA 4AZ3A 2RGNA 5FWYB 4JC8A 4NBNA 4KR3A 1KK0A 5K8VA 4EJMA 1P4SA 4QJIA 1V0JA 1NOKA 2FZEA 1Q7BA 4XR9A 2VUUA 4NMMA 2FW9A 1KDZA 3U3ZA 1WSBA 2G1KA 3O8DA 4OBXA 2MT9A 1JUDA 4JELA 4RJ2A 2GEDA 3RUDA 1JSZA 4GRIA 5IARA 1P9NA 2SHKA 1GNPA 1H94A 1I1HA 3WGTA 4KFUA 2B8EA 3CZAA 3TKYA 3TTSA 4EFDA 4I6JA 1CR6A 3DFMA 1VIAA 2H48A 4MB0A 4XVUA 2YCLA 1G41A 1H2ZA 5D3ZA 4ZEOA 2ZZKA 4JS0A 4TMKA 4W5TA 5AM5A 3VHXB 3B1XA 4Z1MA 1GLVA 5GJBA 1T3SA 3E35A 3CZ4A 1YGPA 2TSYB 4M76B 4P38A 4ER7A 4RTPA 2YFHA 2D5CA 2QQ5A 2QTVB 2XKAA 5T3UA 1ZJ6A 2BSQA 5IF3A 1GUYA 4RESA 5ESWA 2O8EA 3B52X 5C81A 3H2SA 5K6RA 4C4ZA 3DZIA 2OQVA 1OX4B 4KXLA 2QW8A 2VPXA 1AHNA 4MROA 2ZATA 4RUKA 1DV1A 3EGIA 1M2FA 2IXTA 3DULA 3K4QA 3KUXA 3A1EA 4FNMA 4TN5A 5EFZA 4CIDA 2FR1A 5F9FA 1CUXA 3PXUA 3THWB 1OR8A 5B37A 4UD2A 4ENTA 4HXEB 2WF6A 4M8IA 1CJTC 3ZWVA 3O9MA 3FMGA 3ONEA 1LPSA 3QELA 4TWRA 3SFZA 5AUNB 3F4KA 3AEKA 3A4VA 3WS7A 3GBSA 1O54A 3DJYA 3OSZA 1WB6A 1JR4A 4BP8A 2R66A 3HTXA 3ERCA 1OLSA 3PNMA 5LCXA 3VPXA 1I3MA 4I1IA 5EAIA 2PGJA 5THKA 5K2OA 4CR8A 1F48A 4K9RA 5EQJB 1NU6A 2Y4NA 2HHLA 4RWZA 5IDWA 4D26A 1VSUA 3OOJA 3C0KA 4HN9A 4A8HA 2A0XA 5I9LA 1PW7A 1ZW6A 4ZODA 3D8UA 5EERA 1Y8RB 3IMKA 3MB5A 4WOKA 3VVMA 3QLEA 4FMCB 4YXFA 3W2TA 1U3UA 3ZI7A 3DV2A 4OI2A 1SUPA 1NKSA 2OD2A 4BFTA 3R8FA 1TK3A 2E0IA 4UU1A 3G82C 4CTOA 2ZRFA 4L7QA 3ETHA 3KKMA 5FQNA 1SD1A 1SCQA 1BH6A 1OZGA 1YMVA 2WKPA 4PLFA 1CJKC 5B30A 3UHAA 1OTYA 3N0WA 1RP7A 5EJ6A 5K8JB 2NZVG 3DAOA 3WJ1A 2D1RA 1EP2B 3T9BA 1FFCA 4N0EA 5D6NA 3W9BA 3R3YA 3VPDA 2HMYB 4L74A 1E2UA 5BYKA 3UMFA 3ZE2B 3A1SA 4BLOA 1ZJ4A 1LDBA 3CNHA 4EEXA 1TIPA 3K1YA 3SX2A 3V48A 2BMJA 2WM2A 3D7MA 4WBNF 2FZLA 3IOMA 2NPOA 3H04A 4IIHA 5IK2D 2MWMA 3BH7A 1GFZA 1MO3A 1R37A 3JYLA 3R77A 3TCXB 4BEJA 1X80A 3ZZTA 3DLPX 4EUHA 1EFCA 4RJTA 4HK4A 3HNPA 4RMHA 1IATA 5DTQA 5ECDA 3FWZA 2AFHA 1U3WA 3QNWA 1GYRA 3F4LA 3RKRA 4QDJA 2RGEA 4FWTA 1PJSA 4EQZA 2XAUA 4GP6A 2FQ1A 4DCSA 2PL1A 1CNMA 3HM2A 3F6CA 4U39A 3ZHVA 4BLUA 1MXFA 2JA1A 1UMBB 3O94A 4OMCA 3U7FB 3QLUA 2ZB2A 3WYAA 5AVQA 3H2GA 3A2MA 4M8LA 3UUGA 3O3NB 1OFVA 4EYKA 2IYLD 2HRRA 2EW8A 1YASA 1NA5A 3C4JA 5CHEA 4ACAA 2K4MA 3RVSA 1J5PA 2WILA 3PQ4A 1JHMA 3BVPA 4X1IB 6AT1A 1Y8QA 5JH7F 1QE3A 3M6XA 1FJXA 3PNYA 4YMIA 4HAZA 1BMFD 1N0WA 2IF2A 3A9RA 5K51A 4RA6B 1MJGA 4MRPA 2QPAA 3FDZA 4DR4B 3FHOA 4GPTA 3COZA 4H3SA 3AZPA 4X00A 2ZI9A 5CM2Z 2ZRKA 3AINA 5E3HA 3NTVA 1QKJA 4QZVA 4OX9Y 4OQNA 2OC9A 2VDQB 3OE7A 4KL8S 4X44A 2XB4A 4GLOA 1LX7A 3GBPA 3HCNA 4FYIA 4PS1A 3UAWA 3D5QA 1E99A 2QGNA 4N9WA 5IXJA 1J2UA 1PEYA 3DKRA 3SIXA 2IK8A 2NVUA 1FL9A 4Q4JA 2QMEA 3I4FA 1V8BA 5JD5A 1AY0A 3COWA 2C57A 1KAQA 1NPDA 3ZHXA 3PUWA 1PZXA 4O2LA 4UJ5A 4HGOA 1B8VA 4HX9A 2RKOA 1G64A 3FCAA 5H70A 2IZ7A 1KPHA 1YRYE 2AMLA 1UDAA 3JQCA 5DHRA 3P52A 1T0UA 2GFHA 3RU2A 1X1CA 3NT5A 2XE6A 4KRXA 521PA 3S7TA 5I7AA 1XMPA 2J9FA 1E2LA 1V1RA 1KEWA 4YJ2F 3ROPA 3IUBA 4ARBA 1YI0A 3GMIA 3QYFA 2IQ5A 5KJ6A 4OX9B 1DV2A 1SCIA 1LVUA 3G2MA 1IN6A 1XMOB 4UU0A 4TL8A 4IJKA 4A10A 3UOAB 2LDBA 5AMXA 2OBNA 3I2KA 2R6JA 1W5EA 1RJ9A 1ZGCA 1YJQA 2JS7A 3OFNA 5EMJA 2CNWD 5YASA 3WA6A 4HF7A 1C5KA 1WBJB 4JP2A 4RVFA 1VBNA 1K27A 3TB4A 2FHPA 4TV9F 5J40A 1SELA 3FRJA 3GRVA 1E9VA 3NKLA 4GZMA 1ZEJA 2YJ3A 2EWWA 3C3DA 1A96A 1KEPA 2ZUTA 2B7BA 3WIEA 3L6CA 1YJCA 1PZEA 3RYFA 4PG5A 1H9AA 1I2AA 3U7IA 2WMDA 3CUEF 2ZB8A 2QZ4A 4PVDA 2GLTA 4PSDA 3RFVA 2HJ9A 1CK4A 1PD1A 4MV4A 1M1XB 4PBTA 4V0QA 4C7OA 3BXFA 2G3YA 2OZLA 1M2OB 1XD8A 3MJVA 3PPYA 4U1RA 1DJMA 1QDEA 5JD6A 3IUNA 1G5PA 1C2TA 4JLKA 2UVPA 4FS3A 4NYMR 1NJ8A 2NG1A 2QQGA 1HA3A 1U0TA 2AOWA 5AI8A 4LYGA 3KTFA 3KUKA 4F9FA 4L50A 3ILSA 2VSNA 1BE6A 5LA6A 4F3CA 3CLUC 1G6HA 1X87A 5REQB 3N28A 2QTHA 2BGJA 4R69A 4LJAA 1YZ3A 2XUOA 3GJ4A 1HYHA 1U2ZA 4H7FA 4JASB 4FZVA 3ZY6A 2WYIA 5CXUA 5CDGA 4DT1A 4CKWA 3IKJA 2DFKB 3MELA 4NMXB 1GT91 2IF0A 2J0EA 2RI1A 3DLAA 4WBNA 1UC9A 3MMXA 3LRPA 4JBIA 4KAAA 4A0QA 2GESA 2KLHA 4IYRA 2R8OA 5JAZA 4G5RA 4UM9D 4KMRA 2YMQA 4EX7A 1NQ5A 4EYSA 2D74A 4HX2A 3BS4A 3DE1X 4OSPA 2AJLI 4MWDA 3WHIA 4DWJA 1OBFO 2PV0A 1U4SA 3JZFA 4AZVA 4EHFA 2GBGA 5JLJA 4P0PB 3A9WA 1FFHA 2OOSA 1U1EA 4RHUA 1BC5A 3KC2A 3O3OB 1L0BA 4BNTA 2JD1A 2PWBA 2VSXA 4WXYB 2PUAA 2F67A 3QX7A 4EY3A 1EFRD 2DLCX 3KPJA 4M54A 4DDMA 3LU1A 4MUJA 2KX7A 2ERCA 3L0CA 4TVBA 3SVLA 3U17A 4AJ4A 2H0AA 3I2FA 4GXQA 5EIHA 4MUIA 4O4JF 3TSWA 2OV8A 5KTKA 2AW5A 1XEWX 4AMYA 4G2NA 3IKVA 3HU1A 2C5FA 3EVZA 2IHVA 4PNPA 1ZY2A 4WCFB 1UBKS 1EJ2A 3RO7A 3RVQA 3W5IA 3AHIA 1C9NA 2FN4A 2C2GA 3AETB 3PGXA 4JH0A 4KGVA 5IVHA 3TXYA 1Q7TA 3QWBA 2QLNA 1E9FA 1T5TA 1ZCZA 2KYRA 2CB9A 3EF3A 3HG7A 3UJDA 5B6PA 4OI4A 4QGGA 4BGVA 5EJFA 1O5IA 4V0OA 2O8BA 1KZ1A 3IE2A 1BCRB 5BW4A 2PS9A 2VUIB 1C7IA 4XJXA 4R2WA 4TSFD 5K0TA 4N5HX 4EKEA 3E2IA 3LYUA 3H0KA 4OLJA 4FX5A 1QM5A 1VKNA 3NHYA 3OHPA 4HVLA 1USKA 4WASA 2C4TA 5GV8A 5LYYA 2NU8B 2IDZA 4QUKA 4E09A 2FGKA 4HYYA 4K6OA 3FOAA 3FVQA 3BZUA 5CFOA 3I05A 6NULA 3P9YA 3ISTA 3OEEA 1FVXA 5LLTA 4UBNA 1PJAA 3DZ8A 1B1AA 2A5GA 3EYWA 4JJZA 3V1UA 4BNMA 3P4XA 1GZUA 3L0SA 1OAAA 1Q1GA 1P2FA 1BOFA 1C1HA 1YQXA 4IIJA 3RKSA 2WTBA 1P33A 4WZAE 2DYKA 3HHEA 3D3JA 3OAAD 3L7JA 4MVJD 2NXCA 5B4UA 2OORC 4GMDA 4H6VA 4E5SA 3CNQS 4K7JA 3WGZA 1WV0A 5L7TA 4R1NA 3L8EA 2GHRA 4R8VA 3W7VA 2ZSDA 1OBCA 3T7IA 4DNFA 4Y2UA 2GN9A 5JWRA 1WXHA 2WTAA 3H2HA 4MQ5A 4C3OB 3KSDO 3DOUA 4EHIA 4HWPA 2DT5A 2F7SA 5KTSA 3ZBPA 1C9EA 1ISHA 1UK7A 4A27A 2PFSA 1VJDA 2P6MA 3E1GA 3F78A 4HL6A 2EFHB 5G0WA 4D9EA 2IHNA 2IS2A 1VJCA 2W48A 3WYEA 1ODKA 1JDVA 1P9OA 4UCQA 1L7NA 3DMRA 4JFAA 2WHYA 1JAIA 3NX4A 2W2XA 1GITA 3GUYA 5IJWA 2CBXA 1SG0A 2CNLA 2IOHA 3UG6A 4LWZA 4V0NA 4X60A 5FR1A 4CMJA 3TIIA 1K5DA 2XUAA 3NNNA 4TRJA 1PUXA 1VSTA 1ZXLA 3EASA 4JEIA 3I45A 4XD7A 4MV9A 1NBWB 1ZD3A 1QVVA 3GH1A 2P69A 4I1OA 2B4TO 4PEVA 1N2IA 5CTAA 5SYMA 3D4IA 5J9FA 1WCIA 2D4HA 2A78A 4HDRB 3CUTA 3TLBA 3WYFA 3U5ZB 1YCDA 5K01A 5MN4A 3N8HA 3RAJA 1YF3A 3CEJA 1FTSA 2PKRA 3K0AA 3M9XA 4GR9A 4FT2A 1ZVQA 2B37A 2C5SA 2IOYA 3VR1A 3WNVA 4YJDA 3CH4B 2GYUA 1W88B 3E9NA 3E4CA 4Q66C 1UJCA 5KTYA 8AT1A 3GEIA 5D8DA 3WMGA 3FMIA 1Z18A 2EX0A 2FQWA 1KOGA 2ISQA 4LN1A 3S81A 1UXJA 4DV1B 1JQJC 3P9ZA 2HPAA 4KHZA 2QROA 4ZVRA 3ZK9A 5H16A 5KJ1A 5HUQA 2WMOB 2HU8A 3JQAB 4BU0A 1K6MA 1QAOA 2Q29A 1YUMA 1NVEA 2BKLA 4Q4CA 1SXIA 3AI7A 2ZJ5A 4OKIA 5FUYA 4C88A 1LRKA 1Y80A 2MU1A 3AW8A 3TTVA 4LF7B 1DX9A 4KJZA 5FJIA 1IRIA 2CK3D 2VZLA 4RL4A 1XP8A 1GU0A 3PWKA 4LBVA 4AJJA 4ESVA 2ZXEA 3OPYA 4LJ4A 1ZVVA 4LK3A 1UMDB 3E2PA 3EDQA 2W8BB 3SC4A 3T5GA 3T8YA 3G9QA 3JY6A 5BV7A 3NUZA 3R9XB 3REFA 5DISB 2JLSA 2PLWA 4IEFB 2VF5X 5TQ0B 1II8B 3C8DA 3TZEA 3WLOA 5ALZA 2R7NA 3RSHA 4ER6A 2IEDA 1P2GA 4LHVA 1DZ3A 4QPJC 3X1JA 1BWRA 1YZVA 4JLWA 5CYGA 1XWWA 1VKJA 2EU8A 2HA7A 3DXXA 4IDOA 2PUCA 1A9TA 1CRWG 4MVJE 2FLWA 3LCCA 2DH6A 1ESCA 4D02A 2ZGVA 1U81A 5ESDA 5KBYA 2WWIA 2VNJA 4V38A 1SU8A 3L4EA 3DV0A 4XEUA 4EPYA 1XZQA 5JFTA 4FINA 3HVIA 1HDYA 4EVQA 1PZGA 2DLDA 3KLOA 1SUCA 3NWBA 5BOSB 1Q92A 1UP6A 3CW2A 3T9CA 4KUGA 3LQRA 2OK7A 2CN1A 3RASA 3TMKA 3ZHQA 1LTKA 4HDOB 3ILXA 4CV2A 4YMVA 1WLYA 1FBNA 2BMDA 3KWMA 4LOAA 3NVDA 5MF6A 4MQFB 2XB2A 2C5AA 2QTWB 5JXGA 2HDHA 3P9KA 4FDUA 4RQUA 1EYZA 1RBZA 4CEHB 3CT6A 2ROQA 4RK0A 3D31A 1FUUA 3NBKA 2ZAOA 1SCDA 2VF4X 2W6NA 4IO0A 2W2NA 2E1PA 1BSVA 1SY7A 2ZYWX 1UBLS 2W37A 4BMZA 5HZKA 4MVJF 4KQ6A 2BZ0A 1V43A 5EKXA 3OZBA 4GKBA 4KXUA 3DO6A 1K06A 3I9V1 3KO8A 3D02A 3Q8MA 2IBTA 1ZOPA 4UEKA 4MVJP 5KC9A 1SC1A 5CPFA 1OROA 1JXOA 2H2FA 3AEQB 3C3JA 3GF4A 4HQNA 3U5TA 2W22A 3KSBC 1RPNA 2RHDA 3TSZA 2WHXA 4C7VA 3GYGA 3HZZA 2GRJA 4RLQA 5G0VA 3KZXA 5CCDA 3B5IA 2F43A 4NCBA 2DQKA 2CNWA 2OCYC 2BTQA 5AI0A 4XIFA 3AOEC 3I5YA 3PUZA 2LBPA 5EA2A 3OZCA 2YC2C 3CNBA 2Y0CA 4H4DA 4OVKA 5GJVC 3NR2A 2CXNA 2WLSA 3P9NA 2AG1A 2MHCA 4JOBA 2HKIA 3U31A 1AX9A 4TV8B 1T3ZA 3V4LA 1ICEA 3G8CA 3W9UA 4BJ3A 3THXB 4WXRA 1NNEA 1SCUB 2Y0BA 2V8OA 3GNSA 1KSFX 1V9CA 2HPZA 1DQYA 4YUZA 4JC5A 2SKEA 3VYUB 4NZNA 4I81A 1KEEB 4J2TA 1XAGA 3T9FA 2X0EA 3RU3A 7REQA 4AG5A 5FWXB 3UUWA 4M86A 2UXCB 5JMPA 3T1VA 3TEJA 3IAXA 3I3SR 1SKMA 3GAZA 3F9RA 1AXRA 4AC9A 2SECE 4MHTA 3ZCVA 4DF3A 1CJCA 3ZJ5A 5FUMA 1RHMA 1J90A 1HQYE 3HSSA 2O5VA 2PDAA 4P8RA 3HVKA 1PGJA 4TS3A 3GEMA 5BQ3A 1USUA 4MYCA 3M4JA 5AI4A 3WLHA 3IBYA 2PPVA 5KSWB 4CMAA 1BG6A 4YJGA 1G8GA 3JVEA 4PZYA 2JJ1A 3TSYA 4ERNA 1GD1O 1XV5A 4URHA 2BZSA 1MTZA 3HBLA 2IPMA 3KU4A 4AS1A 1HTTA 2DX7A 2EV9A 3N74A 4YDSA 3VNBA 3I1YA 1JL3A 2PLFA 4GKJB 3V8RA 2FN9A 4MK4A 1WDMA 5FQOA 3GBVA 1B4DA 1F3LA 2P2LA 3HRIA 4IMPA 3RS0A 3L4SO 4XIGS 4FDTA 1A7KA 4E4YA 2XTZA 4YCMA 1QUFA 1LK5A 3PDIA 3AR7A 1RP1A 2GASA 4LXTA 2QI9F 2ZJ4A 1QRAA 1GU7A 2GF0A 4FMDB 1VJGA 1UC4B 2JI4A 2XYGA 5E6SA 4UHHA 4M2LA 3H8WA 5K2MA 1JFFA 1EG2A 3EZYA 4RK6A 2X0KA 2A5YB 2FUKA 3Q8KA 4J75A 3LKVA 4XUDA 4KXYA 1AQUA 3HYCA 2AQIA 1UEJA 3BQNB 5DMXA 1OOEA 2B94A 2DY0A 1P5RA 1U6JA 1CP2A 4JSTA 2AMJA 4YAEA 5TY0A 3E3LA 4RH1A 3H6HA 1DNPA 2RFLA 4AKGA 3DLBA 3TTXA 4N0DA 1P1JA 5IRCD 4F96A 3B9PA 4Q7LA 4BLVA 1MDBA 5HCUA 3NI2A 1Z4IA 2ZUCA 4ADSG 1F4PA 3OQJA 4XW2A 2Q6IA 3R3UA 2A33A 4QUIA 1G3RA 3L6RA 2C84A 1A8SA 2FG7C 1P2TA 4KK3A 3NU1A 3LOPA 5DM2A 2O19A 4L5YA 1RR6A 3AEXA 4QODA 3PS9A 4ZV7A 3DWFA 3HWWA 1IIBA 2QRMA 1L8AA 3M3HA 4M88A 4PZ9A 5DASA 3RNOA 3VTAA 4ZEMA 5LQKA 3FPFA 3O3MB 3NRBA 1VG9B 2HT1A 3CNLA 4MRRA 2H17A 4G0VA 4UNRA 3BF8A 3U3RA 2QMZA 1QU2A 3P4YA 4ZOEA 1G2OA 4DQUA 1N2OA 1QO7A 4MAFA 1I30A 3VHRA 4UOZA 3D6VA 4PPGA 1JIXA 4BNJA 2DFLA 3LC7O 4TLBA 1OHHA 3ACDA 4XOUA 5FF9A 1TC1A 4U2DA 3FHCB 2F1OA 2VQDA 3F7MA 3M4ZA 5JDCC 1ZQ9A 5JPCA 5IT9A 4HLUA 4NNPA 4OIMA 4QHSA 2BRUC 3AEKB 1TTTA 4XYEA 2VDUE 3PQ6A 3R5HA 1Y1QA 4I4TF 1QWOA 1Q84A 1JR6A 1R0BA 3EUWA 1G5RA 1RC1A 3M1AA 2FPSA 1AKVA 1OLSB 4BQFA 4DVJA 2RKBA 4FJ1A 4MKZA 2O8NA 1TRHA 1THMA 1ADJA 2I0FA 1WXIA 4IEEA 5F78A 2FY8A 3TFQA 2I4MA 5AKYA 4QJ3A 1QIGA 3EIHA 1BS2A 3PA6A 4JJAA 3JYOA 2BR3A 4AJIA 4MKIA 1QHFA 3PFNA 4HWKA 3TLXA 2CXOA 3L8GA 3AUJB 3MOIA 3WK6A 2QX6A 3DF7A 2GYWA 4H3VA 4OGWA 2BMFA 2AXNA 2PH5A 4HEA6 2V6GA 1EUCB 2F3QA 4OXNA 2QN3A 4PZ0A 4TYQA 5B6IA 5JNUA 4TQ9A 2QAGB 3RIYA 4EUSA 3OVMA 1L5WA 2CB0A 3OCXA 2XNDD 1ECBA 1NMEA 4IHKA 2CDAA 3K94A 4DMKA 1IEWA 2G09A 3G02A 1DXYA 4ZVMA 3HB0A 4YRLA 3W5VA 4DV4B 5ALFA 3EWAA 1XCJA 5IULC 2EJBA 4UMEA 3LUKA 4KO2S 1ST3A 1ZAKA 3RSCA 1VHJA 1H2EA 5LXTB 1NXXA 3EY4A 1UH5A 3QU7A 3RSQA 2B4RO 1XZ8A 2XT6A 2HNKA 1T3GA 2OKCA 3R44A 4LOLA 1PX0A 1TADA 3TS1A 3TRIA 4BHTA 4MVCA 1M72A 4HQKA 4R9SA 5DSZA 5C1DA 3FUVA 1EVKA 5A3VA 5LDGA 2HGZA 3LSTA 1LC0A 2OKGA 3VNVA 4ALMA 3RYIA 2NGRA 1QDUA 3IP7A 4MWGA 4UBIA 3I2IA 1JKFA 1X80B 2ZVDA 1B26A 3KDPA 5G1OA 2QORA 3TFOA 1I2CA 2VIIA 4KRYA 4PNZA 2BM1A 2OSVA 2A0KA 4PXYA 2AFHB 3PXXA 2ZSBA 3E0XA 4XX1A 1KBOA 2BJVA 1AZWA 4N01A 3KAJA 1YHNA 2PX4A 4P5EA 5AI6A 3PL1A 4Y98A 5CB6A 2IYAA 1D7AA 3VU0A 3ESDA 3ER6A 1RWPA 1YU6A 4ND6A 2RJ3A 1RKUA 3KOWA 3RS8A 3TVYA 4US2R 1JXAA 1AHHA 3MC1A 1MJFA 2ARKA 3MBKA 3SC2A 2QBYB 4UREA 3ROMA 3V34A 1VRCA 2JGAA 4X8MA 1WP4A 1N9KA 5H4GA 1XRLA 4UHEA 3GD5A 3WBBA 121PA 1D8TA 3CC8A 1X0XA 1CIJA 4IH4A 5LZ7A 5EIAA 1BNCA 1WMFA 2C94A 3E9YA 3G2LA 1Y8QB 4KPGA 1KNQA 3DYBA 4Q9IA 1NIPA 5DHUA 2HSGA 2IITA 2JJ8A 2B82A 3GZNA 2PRYA 2QN9A 3AEYA 4R2XA 3KYDA 1LKZA 4RD3A 4DQDA 5BN3A 4IDCA 3AF6A 1PFKA 3H5IA 5DTIA 3OIFA 5DWQA 5FL7D 3MS4A 4B4OA 3JD2A 2DWOA 4S1OA 2CV1A 5CDSA 4IXNA 1SVLA 4EVSA 1X86B 1TMKA 1RM3A 2IIVA 2NVUB 4DIDA 2BFDA 3G79A 4WFKA 3T3HA 5ESXA 3SMQA 1LPNA 4XWTA 2FSUA 3KX2A 1E58A 1EBUA 1KI2A 2WMYA 2ZE8A 2YOHA 3AOGA 3FSEA 4GMKA 5BRNA 1RXCA 3OSUA 4K26A 4EEZA 2AXEA 4KACA 3EAGA 3RTDA 3EIFA 4FI3C 1V3QE 1S1CA 2G4LA 5JANA 4L8WB 3LGSA 2V96A 4N7JA 3ZHUA 4Q37A 1QRDA 3NIWA 3CH6A 1MJNA 3OKAA 4BZWA 4B0PA 3SF8B 2RBKA 2WNHA 2J9FB 5EEHA 5EGNA 2ZR0A 2WYVA 1V1RB 2YR0A 1SK9A 1T9AA 1DTWA 4JVMA 1N92A 3IDSA 2XJ4A 3G23A 4KXXA 1GQRA 2AN4A 4I4TA 4ZKEA 1ULSA 4HNRA 1TFRA 2XVYA 5UKDA 2QTNA 3QKTA 4YUYA 4F91B 1NAIA 1OXVA 3GN2A 3R0JA 3LW7A 4C06A 1YRWA 5DV9A 3DE6X 2GAIA 1ESEA 5A5DA 4XOIA 4PFQA 3FR8A 1JTVA 2BM0A 2BI4A 3HBFA 1KZYC 4G67A 4PAQA 1S5PA 2D0DA 2QYTA 5DK4A 5KAPA 1KQFA 1GDTA 1JS1X 3RYFB 1XHEA 2M1XA 5ICMA 3HYLA 2QX4A 2AJTA 1NZJA 3PPWA 1DFGA 2X9LA 1UANA 4E5DA 5FX2A 1RYDA 4C7OB 2OBMA 4AYXA 4LHYA 4P35A 1J4AA 3KZCA 3NHFA 1KQOA 4GOLD 3KT6A 3WLAA 1KZGB 1UM9A 1KFEB 3DKKA 4C21A 4RBNA 2UVPB 4BX0A 1D2NA 1RWMA 1Q17A 3VPHA 4FFLA 2WZBA 3R7LA 4MYRA 3D9QX 3ON5A 3VU9B 4ZQIA 2C3UA 5LA6B 1GNLA 1LUAA 2NNWB 5F21A 2OCIA 1AUPA 3MJCA 4J4TA 5FOTA 1FNCA 3QMWA 2IHTA 2GM9A 4F45A 1W36C 3FUWA 2QTRA 1W4CA 2NZXA 2DBZA 3A6EA 3DMTC 4XE5A 1UZMA 5EE1A 3VR2D 4CKWB 4DT1B 4DQXA 4ZHQF 4ZI7A 4EJFA 4W9RA 4WBNB 3MSXA 2OGSA 5LWQA 3AJRA 4X85A 4WY8A 3P7MA 3P2EA 1JU3A 1O58A 3A11A 2OHJA 3FX2A 3KHSA 1L5YA 1GDHA 2PQMA 3UAGA 4FEEA 4OXXA 5B3KA 4LGVA