1ODLA

Purine nucleoside phosphorylase from thermus thermophilus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
234
structure length
234
Chain Sequence
b'SPIHVRAHPGDVAERVLLPGDPGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQTTGMGTPSAAIVVEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGRPYAPVPDPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRIGDPELAPPEVLQEGVRRMVEVALEAVLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
molecule tags Transferase
source organism Thermus thermophilus
publication title Crystal Structure of Purine Nucleoside Phosphorylase from Thermus Thermophilus
pubmed doi rcsb
total genus 83
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1odlA00
4TXJA 2AI3A 1TD1A 4TYMA 4DANA 4QASA 2I4TA 4BMZA 1Z37A 5K1ZA 1OV6A 4LDNA 1K9SA 2ISCA 4YO8A 4QEZA 3NBQA 4L0MA 4TTIA 4F3CA 1RXYA 1JDZA 4TXLA 4OGKA 3KU4A 3ODGA 4MCHA 4U2KA 4BMYA 3OOHA 3NM4A 3MMSA 3FUCA 3PNPA 4EB8A 3LGSA 1V45E 4D8YA 1SQ6A 1G2OA 5F78A 1Z38A 4MARA 4DA8A 1Z34A 1JDVA 1PR2A 5JPCA 4TXHA 1XE3A 1Z35A 1PR6A 1Y1RA 1SJ9A 2A0WA 2OECA 2I8AA 4G41A 4NSNA 3DDOA 1PR0A 5EFOA 4D9HA 2QTGA 3ENZA 4F3KA 2BSXA 1OUMA 5F7JA 4DARA 5C80A 2HN9A 4D8XA 3NM6B 5CYFA 1LX7A 3OOEA 1JDTA 1Z39A 4L5AA 1JP7A 4DA7A 2P4SA 3OZBA 4L6IA 3O6VA 1T8SA 1SD2A 1RXCA 1OTYA 4G8JA 4I2VA 4TTJA 1RXUA 4JOSA 4G89A 1T8RA 3OZDA 1JPVA 2Q7OE 4YMLA 1Y1SA 5B7PA 4DAEA 1RFGE 1V3QE 3F8WA 4WKPA 5CCEA 1T8WA 3PHBE 1U1FA 4DABA 1RCTE 3SCZA 4QATA 1NC3A 1A9QA 1JDUA 5EUBA 1V48A 4NY1A 2XRFA 5B7QA 5IU6A 1U1CA 4D8VA 4OGLA 1PF7E 2OC9A 4WKBA 2PGAA 3ONVA 1TGYA 4DAOA 1PK9A 1ODIA 3O4VA 1FXUA 5DK6A 1A69A 1I80A 3GGSA 1RR6A 1ODKA 3FB1A 1PW7A 3UAVA 3FWPA 1PBNA 4TS3A 3DJFA 4F1WA 1Z5PA 3UAZA 4P54A 4GLFA 4QAQA 3OZCA 1ECPA 4TS9A 1YRYE 3KVVA 1ULAA 3IOMA 4K6OA 5F7OA 4PNPA 4EARA 1LVUA 4OEHA 3OCCA 1ODJA 4H1TA 3P0EA 3E0QA 1QE5A 1CB0A 3KVRA 3KUKA 3EMVA 2IQ5A 2AI2A 1Y6QA 2HSWA 1T0UA 4R31A 3DPSA 2A8YA 5KB3A 3BGSA 4OJTA 4BMXA 5CXSA 2A0XA 3PHCA 1U1DA 4YNBA 1A9TA 5CCDA 4DA0A 1ODLA 3TL6A 2QSUA 3UAYA 3K8QA 3BSFA 4R2WA 4M3NA 2H8GA 3D1VA 4R2XA 1V2HE 1SD1A 4M1EA 1TCUA 5B7NA 3UAWA 1PR4A 3KHSA 4OF4A 4WKCA 1TGVA 2QDKA 1A9PA 2OXFA 4X24A 3FNQA 2B94A 3BJEA 1ULBA 1ZL2A 1NW4A 5F7XA 3DP9A 4BN0A 1B8OA 4L5YA 1TCVA 4DA6A 2OC4A 3BL6A 3OF3A 2AI1A 3U40A 4QARA 4KN5A 1VHJA 5EPUA 1PR5A 1A9SA 3LBAA 1YBFA 5F73A 3GB9A 4LNAA 1RSZA 3EUFA 4D98A 1RT9A 1Y1QA 3K8OE 1JE0A 1OTXA 1VFNA 3IEXA 1M73E 1PKEA 5ETJA 4WKNA 3P0FA 4IP0A 1T8YA 2GUWA 4MCIA 1JE1A 5F77A 3LA8A 1RXSA 1Y6RA 4TXMA 1A9OA 4UC0A 1K27A 3OZEA 3EEIA 4E1VA 1B8NA 3MB8A 3OPVA 4M7WA 4NS1A 1JYSA 4YJKA 3INYA 1U1GA 1PK7A 1A9RA 3FAZA 3QPBA 4PR3A 4LZWA 1Z36A 1Z33A 4L5CA 3EUEA 4F2WA 5FAKA 1Q1GA 4TXNA 4OY3A 1YR3A 3PNSA 3UT6A 4TTAA 1PWYE 5F7ZA 2AC7A 1RYZA 3DF9A 3E9ZA 3T94A 3KVYA 1CG6A 1C3XA 1K3FA 5F76A 1U1EA 1LV8A 1VHWA 5CYGA 2HRDA 1V4NA 4GLJA 1PR1A 4GKAA 1NC1A 2A0YA 2RJ3A 4LKRA 1Z5NA 1N3IA 4ECEA 2HWUA 1V41E 5IFKA 1OU4A 4JP5A 1WTAA 4GMHA 2QPLA 1VMKA 1JDSA 4JWTA 3E9RA 4LNHA 4RJ2A 1OVGA 1Z5OA 4QFBA 1YQQA 2QTTA 4WKOA 1YQUA 1ZOSA 1Y1TA 3FOWA 3C74A 2ON6A 4F2PA 3NM5A 5CXQA 5I3CA 4FFSA 5B7GA 3UAXA
chains in the Genus database with same CATH superfamily
4CGZA 3AJ9A 5M3BA 2EJCA 1H8HA 1CF9A 3QJ5A 1C7ZA 4EKYA 1OB5A 3KELA 2BSAA 3TFWA 3QKSA 4D81A 2D1SA 3FDZB 5DPMA 1DHTA 3KSRA 4TLLB 1IATA 3GA5A 4QZVA 4MQMA 2PBZA 3SEQA 2JLYA 1RYYA 3SC6A 4P1ZA 4MUAA 1M8GA 5L51A 3DUWA 2EJWA 4A5OA 1SMKA 3D4IA 3DE7X 1X6VA 1X1TA 1JAHA 1G20E 2OILA 3B3AA 3EDOA 3KD3A 3MGAA 3SKXA 1E2FA 1M6YA 1TX4B 1UJ5A 3KC2A 2HHCA 2OQ2A 3LUCA 4PZCA 1OBCA 1FRQA 2BZSA 2XNDA 2CXNA 3QX9A 4BO9A 3JR7A 5TMDA 3F0TA 3SK0A 2XNJA 4F5WA 3M3HA 5KDLA 3RIHA 8AT1A 4LJLA 2RAUA 4DA9A 2HSGA 1XP8A 1GD1O 2CBGA 1L5RA 2UVPB 2VCYA 1AZTA 1RMQA 3DAYA 2IF2A 3QSYA 4MWBA 1KZHA 2J4CA 2B69A 4G0QA 2XTMA 4F3CA 1AIPA 3G02A 2J3LA 3K94A 4TQUS 1AZSC 1BW9B 3LQYA 1P3DA 3ZJ5A 5KYYB 3FBGA 3C97A 1MQ8B 2W6MA 4RV5A 3ZCSA 2RD2A 2ZB3A 4WCFC 3BZBA 1DWOA 4GPEA 4U2KA 2NU8B 4C0SA 4ETWA 2Z43A 1SPXA 1ADBA 5IKMA 1MX9A 3BPSA 1R7RA 3L79A 4QGFA 1QV9A 3CA8A 3M1YA 3JQEA 2MYPA 2FUKA 4RELA 3JQBC 1NUPA 1R1DA 2DJIA 3M6MD 5CEEA 5CVJA 3P8ZA 2ZJ4A 2AUTA 2O4UX 1GZUA 4Q9DA 4MARA 1ULSA 3R40A 2O07A 1RWXA 1X0VA 2C59A 5AXCA 4AZWA 4G0VA 3OQPA 1GCIA 2O20A 1VI5A 5PGMA 3RE1A 3HJBA 4Z9YA 1Z35A 2OK7A 2OCGA 3FPLA 4EP1A 1WB6A 2VJMB 1MO2A 1U80A 2XGGA 4W1QA 4PVCA 1C4WA 3EQ6A 1BSVA 2DETA 1PV4A 1N75A 1TVCA 3UVEA 1ZVVA 3PIDA 4QXMA 3I61A 1H9BA 2VHYA 1PR0A 4CCWA 4EZIA 1VBMA 5DHPA 3FWKA 4ER5A 1LCIA 4XDGA 3ZCRA 5LN1A 3PJRA 1G8HA 1CZRA 3RJZA 4FNGA 1SELA 1AUPA 2QT1A 4NBVA 1TYAE 3BMNB 1UPCA 3KWMA 2BSXA 3AL0C 1JVBA 3OE1A 1FB5A 3DNPA 1OUMA 2BDTA 2RH8A 4DDWA 5CLQA 1EUCA 4Q7MB 1KSJA 2JD2A 4MKXA 5JD4A 4C0XA 4TTTS 1GZDA 3QKTA 1AHNA 2CSUA 2GAFA 2OEPA 5FJIA 4BX2A 4ZZ1A 4G1BA 4U2CA 3VPGA 2HYIC 2PKYX 4YP7A 4DA7A 3G0BA 2PRKA 4MWDA 1E5DA 5E1OA 3M5DA 2NUTB 5EZSA 4IG4A 1WPRA 4B2PA 3PEEA 1H69A 5B57C 4B8WA 1YR7A 2Q9AA 3DQZA 4HY3A 3TCNA 4B9AA 4ENWA 3MS4A 4K6CA 3HFRA 4MUYA 2F8TA 5F9HA 1IEXA 1HYQA 3OCZA 4PSDA 1ZL0A 5G3ZA 2HRBA 3F97A 4S2UA 2QN8A 2OK8A 4FJ2A 4N7JA 3SICE 5CLFA 2H1OA 3CFYA 1P0PA 2GHRA 4I2VA 4TTJA 4GH5A 1HQDA 1IHUA 1ZM7A 4OQFA 4OMUA 4R2IA 3A6EA 4TTVA 1NBWB 3FCCA 5CNJA 2XZOA 3NHPA 1FRZA 4UBJA 3RJ5A 2OV4A 2CLIB 3QOXA 4YMLA 4IY1A 2P5TB 1A8IA 4RDCA 3N75A 1IVNA 2GB4A 2JCYA 2FWBA 2WWFA 3E8XA 4HNVA 4KK3A 4L72A 3ECCA 3IA2A 4TLDA 4JFAA 4Q1CA 2X0JA 4WKPA 4C07A 3NLLA 1T8WA 2OQIA 1Z6ZA 2AMLA 2JCGA 1LPOA 2Q6LA 3OCXA 3PHBE 2HK9A 3PE3A 2ZU0C 2ZSHA 2PAFA 1BOFA 2JFFA 5H4HA 4R5MA 4HDSA 4R8LA 1UWCA 5BSWA 2VPPA 1XD9A 2JJ2D 4J6EA 2PVPA 2HY7A 2DPHA 4DWOA 2V1XA 1WV0A 3M9LA 5I9BA 3ES9A 1YK0A 2W22A 1MGOA 3GEEA 4H3VA 4KX5A 2P9ZA 4G37A 4NY1A 4NQRA 3SOZA 3IBTA 4UD2A 1CU1A 4OYYA 2C83A 3CINA 4C4XA 1W46A 1BXGB 1S01A 1NU6A 4LDQA 4ADSG 4HN4B 1BQ3A 5LOVF 2YR0A 4TKZA 2JFBA 2XZDA 3OOWA 3VC3A 3W9SA 1MH9A 1KDOA 3EMDA 3GJ0A 2CNNA 5BV8A 2PGAA 4Q3KA 3NB0A 1N4AA 1LY1A 1X1DA 1BROA 3JTMA 5CRIA 3K6KA 4L57A 3FMIA 1H0KA 2X58A 3AW8A 2VJLA 2WJZB 4ZDIA 3IKTA 4CMIB 2GXQA 1V11B 5EN4A 2QUJA 1PJTA 2QM0A 3IO3A 5KCZA 2OAGA 2VKTA 4QYIA 5TQ2B 1XVIA 2PWAA 1N8KA 2WMOB 1E6MA 1NVGA 3NJ8A 4DDVA 3GRRA 2AFVA 3IULA 3UAVA 1FDVA 4AO7A 2WMDA 3L0OA 4WERA 2LIPA 4JI7B 1L7AA 1P3Y1 2NPIA 2YJGA 4M76B 4PRZA 4OM7A 4XCQA 2K2WA 4YMUA 2AZTA 4DR2B 3QVOA 4LJKA 2PUEA 3A7DA 2I1WA 3B13B 3O91A 3OIUA 4NVRA 1QQ7A 3P9IA 4JEMA 4KXMA 2XTJA 4TS9A 5BT9A 4J3NA 2KJQA 3BB1A 4TM8A 3M3DA 3WL5A 4D5GA 1ISHA 4Y0VA 2BMVA 4IRXA 4RO0A 3THXB 4YMTA 3N59A 2YOFA 4KVAA 5H9VA 5BVGB 4B8ZA 3EX7C 1CK4A 3B6EA 3QHAA 1A2KC 4FXPA 4PLGA 3FFWA 4H1TA 2O8EA 1NBHA 1YBHA 1FYDA 2JLRA 1YB1A 1XLWA 3ETEA 3K9BA 5I9SA 5HF5A 4CIVA 5HZGA 2PQ2A 2IP4A 3EGCA 3RRFA 3R8FA 2H2HA 4UHCA 2F3TA 4F93B 2PMFA 1XTBA 3SBEA 4BP1A 1GSHA 1PDVA 2IPNA 4F8YA 4U0JA 5EMMA 1ZIOA 1TADA 4L9SA 4XWTA 4RY0A 1YZFA 4K9LA 1CRZA 2FW6A 3BA1A 3RFUA 5BYAA 3RAEC 3IUEA 3NRBA 1NQ5A 2VWGA 5JE8A 1WPQA 1CQIA 2AN5A 1RAIA 4LCJA 4YROA 1RKUA 4NPCA 3KQKA 2A67A 4RK4A 2A0XA 1Q0ZA 2GPTA 5EXPA 2VPWA 4Q9JA 1O97C 2FGJA 4M2LA 3EFOB 3UN1A 4LY6A 2C96A 2Y4OA 4OKSA 5AM4A 2GT1A 4DV0B 4Q3OA 5IYZB 3DTTA 4MR8B 3E8SA 4XGKA 4XZ3A 3PNKA 3TCKA 1IQRA 5JECA 5KINB 2IS1A 4N5HX 1OI4A 1RE1A 2Q99A 4IXNA 2A78A 3L8DA 4PBRA 2ZI9A 1SQ5A 3P9SA 4IXDA 2R7MA 4MW7A 4D9MA 8OHMA 1L5WA 1IE3A 3BXGA 4PPNA 2GTHA 1WD5A 1KBQA 4JWKA 5CLJA 3BXXA 1K2VN 5CCBA 2PUGA 4IOKA 3SIPA 3ZE0B 4KWCA 1RJFA 1SG0A 2VDLB 4Q4JA 3RS4A 4BO2A 2XXAB 3TINA 3D5TA 2ZRDA 2XWJI 1SXJA 3ELUA 3UXYA 3F4BA 2JIZD 2HA0A 4ZDWA 1BWSA 1XDBA 1PSZA 1KI9A 1OWLA 2QD3A 3N8IA 4UAJA 3GLHB 2JFYA 1L5QA 3I6MA 4AX4A 1HKUA 1B8VA 1ULHA 3HDJA 3X1JA 4ZDJA 4MW0A 3RIXA 3CW2A 3ZDFA 1NZJA 2X6RA 4DV2B 3KHSA 1FDWA 1QZ3A 3I5XA 2ODNA 4KQJA 1LDBA 2DX7A 4HGZA 4P0QB 2Q5OA 4LCEA 4CKCA 1BD3A 3CKMA 1JDBB 1TLFA 2IZ6A 4WN9A 4BRSA 4EEXA 1MR3F 3GK3A 2W6JA 3K4QA 5SZKB 3U3RA 4LVCA 3UMRA 2GHIA 5HUHA 3THYA 1WY7A 5AOVA 5FNVA 3P2EA 4WJZA 1NURA 2PCLA 2FPGB 2JJ1A 1MVNA 4HLQB 2VG8A 4BX0A 1JIJA 3HZRA 5MHTA 1AKWA 3FTFA 2VH5R 2XUKA 1XSEA 4GXTA 1SHZA 2MINA 1L5HA 5A05A 2R6JA 2B20A 2PU5A 1Z73A 3JQ8B 4IDGA 4ZQIA 2HIAA 4A0SA 1ZFNA 2A58A 2OGZA 3C70A 4L5YA 1CLEA 3IUJA 1K75A 5FWDA 2TSYB 1K9VF 3FRIA 3GRYA 3IAM1 2LIVA 1E1YA 3JQ9A 16PKA 2C94A 1K7SN 2IDZA 2N47A 3EWAA 1E8MA 2O6HA 4TYQA 4UUQA 3BXOA 2BR5A 3CBGA 4TVKA 3ME5A 3B6MA 2FSVC 4DIUA 1US8A 1FVXA 1VLZA 3QXGA 3BXZA 3IT2A 1VHJA 2PCJA 4YR9A 5KMGB 4ACAA 3LRTA 1JX6A 2EC5A 4Q93A 3T4EA 4C87A 1P1HA 4RABA 4V1CA 1YS2X 3WKAA 4OQNA 2DCMA 4EUKA 3SR4A 3FN4A 3AEKB 4FWTA 1NOIA 4OKIA 4Y30A 4W7SA 1CV2A 1MMFB 1YKGA 3QBJA 2PFSA 1BCRA 2BGJA 1MLDA 1P7PA 1Y1QA 3KR2A 1PGJA 1ADCA 1Y3FE 3O4RA 3KJGA 2ZTVA 4WKNA 5TS2A 1AQLA 4N54A 3U3JA 1CNFA 1WXWA 1YVDA 1Q21A 2A88A 2E5FA 2P9YA 1E6EA 1T8YA 2LXNA 4UEQA 4DR5B 2O8CA 1WULS 1J0BA 1B0AA 1WV1A 3ETGA 3TTWA 3I2IA 3V8EA 2EAUA 2P7HA 4LQ4A 4ZEOA 2X2FA 2HJ9A 3U4CA 2G9VA 1PIWA 3BGWA 1CX9B 1N5OX 4G5YA 4WA7A 4B3SB 1N2GA 4G85A 2AX3A 2HDHA 3AUJB 3UMJA 1XGKA 3HDYA 3WNBA 3VR2A 2L0XA 3GYBA 5B3JC 2FOXA 1YDWA 2PZFA 5AKLA 5HKAA 5IX8A 3OM9A 1TQ4A 1XDSA 3SJAA 2QV7A 3FCEA 3N8DA 2H3HA 3KKNA 3TQRA 4YRBA 5IW8A 4ND8B 3CLHA 3Q5DA 1FOEB 3QLJA 2NMVA 4FD2A 4L1KA 3WMWA 2OORC 2LD4A 1M5UA 3ZZ1A 5JEEA 5CDFA 2G88A 2PO7A 5BQXA 3PTAA 1PL7A 3HO8A 4GECA 1O0SA 1TVKA 1C8VB 5DCYA 3K1ZA 5ALXA 1PWZA 4IUYA 1E2GA 2G1AA 1I5OA 4NIMA 1GU7A 4PN7A 1Z5GA 3DV2A 3INYA 2QY6A 1DJNA 2B2XA 1XO1A 3PX3A 1PK7A 4FONA 5DU2A 1EKXA 3K0KA 5AXDA 2CLOB 1CT9A 2INGX 2PT6A 2AN3A 4QPNA 3R9IA 3TL3A 4BLPA 3A2KA 3FMGA 2FWAA 3AL3A 3GMSA 3HKDA 5J63A 1WUJS 5ILQA 2JBAA 2TRSB 3C1TA 2BF4A 1HOXA 1VG0B 1ENPA 4OLBA 1JSLA 2EU8A 1B6GA 4P7GA 1MJNA 3Q2OA 3M81A 3EZNA 4W5JA 4GNRA 1Z3CA 3PC6A 4KVGA 5ALGA 1U3TA 4CEJA 4YEDA 1G63A 1I24A 3DLPX 4KQMA 4N3BA 4Y9TA 1F9AA 4UM8B 4RIFA 4F86A 4WTOA 2ZETA 2ZROA 2Q3HA 1PJBA 3LCVB 4PQEA 5F1OA 3TEJA 3GLIA 3RUFA 3ZS9A 5LQNA 2AFIE 2O14A 3ON5A 3NBKA 1XTUA 2RGNC 5CM9C 2ZRFA 1K3FA 3CR8A 4B3DA 5E6UA 4CFSA 2XV1A 2P65A 5DXJA 1E2KA 4UULA 3FYSA 5IDVA 1BYIA 4BWYA 2V7BA 4N7RA 4CNBA 4JU9A 3MS7A 4EFKA 3ACCA 2PXXA 4JMLA 1GRRA 3FFXA 3ZCQA 1XDWA 3ADKA 1WNFA 4I7EA 4KX3A 4AJPA 1WJGA 1RYNA 3FHJA 1SXJE 2VYVA 1XDGA 3CG0A 4YCJA 3T8YA 3TLKA 2X5KO 1ZVMA 4J2TA 3BFPA 3Q3GE 4GZLA 3LAWA 4Y9SA 1Z5NA 5KYUB 3C3MA 4B47A 3WHLA 3H9UA 4LYFA 3T3OA 1WP9A 1W49A 4BP3A 1F1JA 5ICEA 4HB3A 3T38A 1D03A 1SZCA 4M6WB 1I1HA 1P6XA 1WKVA 4CQNA 4I1RA 4C2TA 1JKFA 1X7ZA 2IYWA 4AMUA 1BIFA 2BFFA 1JG3A 5CIWA 3KB2A 5E3HA 1BU5A 2XYPA 3KLBA 4HUJA 4C7JA 5ABPA 4TTRA 1LTKA 1Y4DE 1EE9A 3M2PA 2W6NA 1UOEA 1NE7A 2F43A 2PNJA 1Y8CA 2O8BA 3T7RA 1SCQA 1KR2A 4F2DA 1FEZA 1ZN9A 3DZBA 3V2UA 2J3EA 4HGQA 2J9FA 2JKZA 4YIKA 5DWDA 1Y1TA 2RONA 3MJSA 4CZ2A 1E1KA 1L2TA 5FPHA 1J0EA 3REFA 2IHUA 3LVQE 3CVOA 3T7JA 4LYJA 1W5SA 1SXIA 4GDMA 3FXAA 1RDFA 3KAQA 2HXGA 1BXRA 2NU7A 3T35A 2G77B 2JFQA 2PZKA 2H4WA 4LF9B 5DCLA 1CFZA 4EENA 3LRPA 3B1ZA 1RTTA 2Z56A 3GRCA 4IQ0A 4LECA 4A6XA 1XU4A 1YZHA 3RUEA 2CDNA 2EWVA 4DR3B 3OJOA 4TS1A 1E94E 4AD8A 3ISTA 3T7TA 5DLEA 3WGOA 2W2PA 3BTUA 4JCCA 3UMYA 1CZLA 1UZAA 2ZR9A 3EGOA 4MV9A 5T6MA 1X7WA 2PL1A 2QRNA 3NDRA 1L1RA 1ZHHA 4ME6A 4D79A 5TVKA 3SR3A 3NMUF 5KC8A 1CY1A 3QM1A 4Q6BA 1ENZA 1IZZA 3DDNA 3L4BC 3BMOB 4DCNA 5C8YA 2DJ5A 4ARZA 5UKDA 1DKRA 2YXEA 5L7YA 2ASEA 1RWPA 4EGCB 3ETLA 1GKYA 2C5AA 2PKRA 2XUFA 4DJ5X 3MT7A 3PFCA 4G23A 2ATXA 3IJ5A 2GF9A 2BMWA 5DCUA 2YHBA 1PJ4A 2QZ9A 2CYCA 4LHEA 2BI7A 1NVVR 4EYKA 4B79A 4INOA 5GAJA 3NFRA 1ZR4A 1GTL1 1KMMA 3QY9A 4FHDA 5J5VA 1WZNA 4YAGA 4X6XA 4MMXB 3JQGA 3M2TA 1NW8A 4R16A 1T5HX 3DTVA 1UKAA 5EZQA 4OQLA 3DLAA 5C31A 2CB0A 2ZCVA 5JZ9A 1G8SA 3AFIA 1C9NA 3D8HA 2HMSA 4IS3A 4K6GA 1SKBA 5ALFA 3TUZC 2VRBA 1NYTA 4NULA 5JBIA 3IGFA 4U8GA 1B3RA 8LDHA 2F8MA 1MVLA 2C61A 5D86A 2VHVA 3EVDA 3UGQA 2BSQA 1DIHA 1DUIA 2RIPA 3SOPA 2XJ9A 2WUWE 2GYUA 3L06A 4HNHA 4OUDB 2ERXA 5TQ2A 1KQPA 4WK0B 3NWPA 3RLFA 1JDVA 4MQ6A 4D4MA 2WTUA 2EJUA 3Q40A 3UJ8A 1WDMA 5TQJA 5LMZA 1GVHA 3PC7A 1PFKA 1RWWA 1Z68A 4URFA 3ABIA 3H17A 4JBLA 3RIYA 4TMTA 2A0UA 4CL3A 1Q7CA 4XUEA 4WZAB 1P73A 3ZCUA 4OGWA 3B85A 3E22B 3EVCA 4MPJA 4EF5A 5KZMB 3FR8A 1JZSA 1W4AA 1TAQA 1CY0A 2OBNA 1GSOA 4EK9A 4KHZA 1NLUA 5AW0A 3OQMA 1TJ5A 1DC3A 4JP1A 1J5PA 1GTRA 1SVWA 3QX3A 2FN9A 1P44A 2BL4A 5I01A 4X1KB 3HEMA 5BVHA 2IEZA 3ENZA 4ZPJA 1KY5A 1FS6A 2XZLA 5DI3A 1QH9A 2VHWA 5EUCA 3K0HA 3O94A 4RD4A 4F04A 4YCCA 3FZQA 1JT2A 2GM5A 3EG9A 1FFHA 4LDZA 4P83A 4XGIA 2ACEA 1Y8RA 5DYGA 4MROA 4Q01A 1W94A 4URUR 4EB0A 2R6AA 1M2WA 1VCOA 2DP4E 3AF5A 5K3EA 4IJUA 5C8ZA 5CITA 2PGIA 3DD5A 2FN8A 2JH8A 4ZVQA 1HXHA 4R40A 5GJVC 4AJJA 4H9GA 4D45A 1X77A 3EIQA 1QGOA 1PS9A 3O90A 4L85A 4CN9A 2XE6A 3DZKA 4R8MA 2C9MA 3NIBA 2XUHA 2VSYA 2E0IA 1HQKA 4NZNA 5ALHA 3HP1A 1FMFA 4KWHA 2A5GA 1H5NA 5JTUA 3JQFA 3MELA 1NUQA 4WADA 3F9IA 2OOSA 1PJAA 3WYEA 3WY9A 4Z3KA 1T3TA 3RRNA 1Z4LA 1WLSA 4FILA 1U7ZA 5FTKA 4XVUA 2H2WA 1BGWA 2QAGC 4QFMA 1T8PA 4MHSA 5GP1A 4A8JA 3BREA 1XCPA 1KMCA 4C2UA 3E7PA 3W4JA 2V5VA 2ZWMA 1KTIA 2BEVA 4B4VA 2O3QA 3RPEA 2WFMA 2P7IA 4ZZ2A 3U1BA 4BOYA 5I4CA 3HDVA 1IG0A 4P34A 2I4LA 4WLUA 3WBFA 4HGPA 4FT4A 1VKOA 5CT8A 3HY3A 4ZC1A 5I7SA 3FTPA 3AGPA 3INRA 1MA0A 4XJTA 3ZI4A 4LYYA 2OR3A 2RHOA 2OXTA 1NI3A 2JBHA 4Y2PA 2BBOA 4JSTA 4CDNA 4TMKA 2PMEA 5IH7A 1CDOA 4FGJA 4ZRMA 3K6JA 4L3OA 3DDZX 4COOA 5ED4A 4DMGA 2DM6A 1K06A 1R0ZA 4IKEA 3R6DA 1XPJA 5G1OA 4BFTA 5CPFA 3MZ0A 1XI2A 4I14A 2HD4A 1ZMTA 1YVEI 1XRNA 2V9CA 3RT1A 1GGMA 3M7IA 1EINA 4JLWA 4JUDX 4TYYA 1X8JA 4AIRA 1K3TA 5HE8A 5JTTA 3KE9A 4YCLA 5TQ0B 1QHIA 5BT8A 3X1MA 1JSRA 3ACDA 4NS4A 2Z8ZA 3KJEA 4L07A 1XJ5A 2Q9BA 3LDHA 5K8IA 4KPYA 4MPPA 2GJSA 3QXCA 3V5NA 2PPVA 4JYMA 3H04A 4R3UC 3N2NA 1C80A 1L8QA 2GQ0A 3HVUA 3PD7A 4FYXA 3RU9A 2QYSA 4CV0A 3G0HA 4B7ZA 3W5HA 2AN9A 2JLQA 3D81A 5DM4A 2OBYA 2FW9A 1QNLA 2VDQB 1NP3A 3AR3A 1RJDA 3EZFA 2VHCA 3GZJA 4LGMA 4PINA 5I51A 1CUAA 1KI6A 1WDKA 2H7VA 3G5UA 4KRFA 1EUCB 3FKQA 4OQZA 1NVVQ 3KYBA 4LZJA 3DFFA 3IDOA 1NU8A 4MVYA 2FQWA 4XPIB 121PA 2WBLC 4NK5A 4MRNA 1ZSVA 3GZ4A 2CE2X 1LNZA 2NVBA 3U80A 4Q9LA 1B2LA 3KG2A 3VYRB 2XE8A 1C7JA 1WVMA 3Q9LA 4V1CB 3G2LA 3UAZA 2C9OA 1ZR2A 2O7RA 5AVOA 1E60A 3K7EA 3PUKA 4D0NA 1GL7A 1ZKMA 2R8XA 1JMVA 1C41A 4FQ8A 5FKJA 1MB2A 1P8JA 3AOEC 1DXQA 1NT2A 4JGBA 4PPQA 1YGYA 1LVUA 1SUSA 1XYVA 3FKSA 3N5CA 3OT5A 5AVYA 1S6YA 3QVGA 4QQNA 3ZE8A 3GRUA 1PTKA 3Q6NA 1XEWY 2Z9CA 1Z4QA 4LWPA 1OBOA 2AW3A 1A5BB 1W9HA 4S0XA 4GIBA 2IZ1A 4QKQA 4TKVA 4E3WA 2D7DA 4X5OA 3GXBA 5JASA 1HFJA 1P9LA 3P9YA 4XLTA 3N2KA 2I71A 2VEOA 3DA8A 3JYNA 1CEXA 4FU0A 3W2IA 2OZPA 4YCAA 1E1DA 2HSWA 3NTRA 3R41A 1MOSA 2RI0A 3A6LA 3ZLTA 1CJCA 1JMYA 3LY5A 5KJ1A 1R4MB 3G2QA 3RRJA 2XIQA 1VCIA 1YZGA 4LGYA 3TW8B 3Q5EA 5C7IO 2CLFB 1K2WA 1X80A 4ZEVA 1TEVA 1U7HA 1XX6A 3VZSA 1FFBA 4AP9A 1K4KA 3NW9A 1E4VA 1KQFA 5IH3A 2G0TA 4HXFB 3IXMA 1GGEA 2VYFA 3PGXA 1H1TA 2OVBA 1AKUA 2ZIUB 2TECE 4YH1A 1ATIA 4DT1B 3P27A 3HCEA 5ISMA 5TMEA 3K8QA 1T36A 4MYHA 1P7WA 3QFHA 1QP4A 3QEKA 4I5IA 4RVFA 4GGPA 5LP6F 1E1QA 4BKMA 4A92A 1IHYA 1UBCA 2CJWB 1H6BA 1NQOA 2NTYC 5B53A 1L5NA 3K0FB 1O54A 1MG5A 4NECA 3U19A 3CH7A 3VH1A 4MNTA 5EHQA 2ODBA 4CL8A 4U3JA 5A5VA 4KQ6A 2QJOA 1C8KA 5DNEA 3WJAA 3WFIA 4BRWA 1YI0A 3E5RA 4QYIB 4DJDC 3D7MA 3OMXA 2K7FA 2EOAA 4RDHA 2PUJA 5FTLA 3O4FA 3QVVA 4FCTA 5LYYA 4LHXA 3V97A 4YBRA 1JSXA 3OFNA 4L27A 2PVSA 2P9QA 2XWQA 5L4NA 3GFQA 2R7LA 4LV5B 4Z4IA 4Z7OB 1M0EA 1GFSA 2DPLA 4AKIA 1ISJA 3MD9A 1TGVA 1P0IA 2RBKA 1NV8A 2ZB7A 3NU1A 4GR5A 3DXYA 4TZ0A 2G9QA 1P29A 2AOUB 4P0TA 4U2GA 4KVFA 3R7WA 2XOKD 5U1PA 4UUOA 2VPXA 2ZQ5A 3L7KA 2VAXA 1AUXA 4EPYA 2Y77A 4FFPA 1YDHA 3AIOA 3THXA 1UBEA 4KOEC 3VR6A 1WHTA 2DXIA 1QGED 4IFIA 1L5MA 5AKIA 1NW4A 3LFUA 1DARA 3TVYA 3VYVA 2RBGA 3CR3C 3AOGA 3BH0A 5AK3A 4ZALA 4CG3A 3HKCB 1O0BA 2J0QA 4JX8A 2FI1A 1T34A 2O06A 2WSSD 2NSHA 4FLFA 3V7FA 3DMHA 3FSGD 2ZYRA 4LE0A 3L0ZA 4H0CA 2XAUA 1N1DA 1GY8A 2A5FA 2ZQYA 1GFWA 2YJ6A 2OSBA 4MR7A 1GAWA 4M6WA 5TEWA 3WLEA 1L6IA 2KMLA 2VDWB 4KRYA 4B44A 3COPA 5TR9A 4CUJA 2R751 3PXDA 5J4KA 4LISA 5FOXA 3WMXA 1L4FA 1BDMA 1X7HA 2AI1A 4ER6A 2DERA 3MMNA 2BM8A 1DQPA 1ENYA 4FFNA 4AJNA 1ST3A 1MBZA 2E9SA 3PDCA 13PKA 4KAXA 1LUAA 2FE4A 5J3JA 5CK5A 3OHPA 2G6TA 2P30A 1L7VC 4G5OA 4PCUA 1J39A 1G6Q1 2QJTA 2X3FA 4BO0A 3TJRA 3SSAA 1BRMA 1VFNA 3IEXA 5TT1A 1P18A 3L02A 3O26A 1Z75A 1GYRA 1Q1AA 2EBHX 3TOZA 2ZUUA 3DXZA 1QP8A 3WWZA 4B82A 4G8BA 1R0YA 3BD9A 1IZ8A 1ZHFA 2E18A 3FDZA 4L0QA 4YQYA 5B64A 4PLVA 4P53A 1CRQA 1P9NA 1GKKA 1U9YA 3CLKA 2H1VA 4I50F 3VPDA 1PG2A 3ISJA 4HK4A 2FZLA 3KXPA 3SFVA 4BNTA 1E2JA 4FFWA 3R8CA 2W6CX 5G0SA 4ZU1X 3TMKA 5BN3B 2F1JA 1T0BA 1GKLA 1HMYA 2R6GA 5GVRA 3NUQA 1P6UA 3HG7A 2C54A 2VP4A 2D54A 3I9OA 4MP8A 1UK7A 1FFXA 3PC4A 4RHXA 1UPBA 3IE1A 3SKYA 3TI9A 1R88A 1JDJA 4P31A 3AHJA 4F96A 4HUQA 2A5DA 3X1WA 1OX6A 5AOAA 2CMGA 1QQTA 3CRZA 5DTRA 1SN7A 2CJPA 2REQB 4ZARA 2X40A 2DQ4A 4EHKA 4LBYA 2D1TA 3EZ7A 2XITA 3DR5A 3KP1A 1NLMA 3KT8A 4CG1A 4O4IF 3UMSA 5JNUA 4LZLA 1M6VA 1RC1A 4GAEA 3T5CA 4LJYA 1ZGJA 1RBQA 3NKLA 3NNSA 2WTXA 2GZAA 1CZNA 2JF0A 4LNUA 4MP6A 2XGSA 2GN6A 1QO0A 1SBHA 4PR0A 3SVTA 1Z36A 2BJVA 2X8LA 3DTVB 1GZ3A 4L6CA 5T4HA 3H6HA 4LV6A 2QZZA 1ZOLA 4RVHA 5IASA 2OAEA 2B3DA 2Q1UA 2B5WA 4EG1A 2C4UA 4ZOBA 1ISGA 2IPLA 1SXJB 4UHKA 3DVAA 4PZDA 3HADA 3GG9A 3UXHA 4R1OA 4G4IA 2IH2A 3H1EA 3PX7A 2ZJFA 2I8CA 3HMQA 5HOQA 1GA4A 3IE2A 1GL6A 2YMQA 2IL1A 3HU3A 3I4FA 2C04A 2IW1A 3H5AA 1ADYA 4I1VA 4EQ6B 1UPAA 3JD1A 5LQCA 2EDCA 1W87A 3JXEA 3OBIA 3AEKA 4QOIA 4L4RA 3G85A 4Q1FA 4TQ9A 3DKPA 3SXUB 4MDEA 3H5LA 2PX8A 5FUWA 1HFKA 1Z8FA 3BL5A 3KXKA 3QUAA 5JYDA 2ALJA 3AESB 2YWEA 3HJTA 5JAQA 2GJ8A 1XCOA 5AW8A 1U28A 4FUTA 2RJ3A 4HAOA 1CJUC 2BDEA 3KEFA 5DEOA 4AN4A 1JQDA 3IDSA 3KEQA 1U3WA 1ZIYA 2B83A 3VRHA 5BOSA 3FNFA 1XXHA 2P69A 4NPAA 2FPXA 4K1LA 3RRYA 6REQB 3EG5A 3E05A 4X94A 1WQ4A 3NPAA 3EA4A 2VF4X 2JFPA 5IFKA 1E9FA 2RHWA 2YZMA 2D2IA 4K6FA 2PLRA 5MN5A 1FQOA 4CTNA 3KB8A 4XFJA 2BFOA 2DEUA 3TG8A 2CJYA 2GLUA 3QV2A 5ECDA 1CUFA 2P6RA 3K9QO 3F6PA 4NCAA 5FRDA 3TXAA 5AK0A 3ZV6A 5EXDA 2PBLA 3C39A 2B34A 2HI0A 4LCBA 3T15A 4BEWA 3U6BA 1Z25A 1KRWA 3AP2A 1T5TA 1ZD9A 2BGKA 2EKLA 1Y9DA 3L0PA 3LUJA 4XX0A 3ZY5A 1OI3A 4YAUA 2DKFA 4TSFA 3TRFA 5TGZA 5K9ZA 2CVOA 4A15A 2HXSA 2YVAA 2V74B 2VS1A 3WL3A 3DE3X 3OIYA 4H7DA 4PU0A 1CUHA 3BAZA 1G21E 3DDWA 3TSCA 3V2GA 4YP6A 3UAXA 2LVBA 2BFDB 1EB9A 1E4OA 3E2MA 4IQFA 4YVFA 4ZZIA 1N0UA 4IRUB 2F8SA 3IIJA 5KJEA 1G5HA 2BTOA 4MHOA 1KEPA 2NPFA 3QMMA 4C6TB 2W6OA 3HGTA 3ND9A 3NRJA 4B4DA 1PL6A 3O5AA 4QASA 3ZPXA 4DMUB 1HEUA 1YOVB 2NT4A 2DBQA 2XPCA 2W2VA 3ZGYA 4UHHA 3ZV4A 3ZV5A 3LMKA 2YIVX 2DH5A 2YZKA 4XJVA 3SE7A 3ZIAD 1CEQA 1UZLA 5I4BA 5KSWB 1HT1E 3FF1A 3VR3A 4NR0A 3RF7A 1ZIPA 2VUUA 2XWBF 2XIJA 1C7QA 3DAGA 4C4OA 1A9ZA 1F8UA 1OROA 1ANKA 2GYVA 3GDOA 4KO3S 4MKHA 4IZHA 3L2OB 2JGDB 3ND5A 3MWDA 3ONEA 4BTVA 2IEAA 3WRXC 4YJDA 4QOGA 1VLLA 5KHAA 4EAQA 4AUNA 4JYZA 4IGAA 2NYUA 4RJLA 5E4YA 2PVCA 5FUBA 5JAHA 4DKJA 3GBPA 4G5SA 4LF8B 3MILA 4QU5A 3BAFA 4A6PA 3KKLA 5BXYA 3UMCA 4QT4A 1Y5NA 2PQ6A 3DWGA 3EGXA 1DBQA 3KNZA 4YP1A 4Z4GA 3KRTA 1CVLA 2G7MC 1L7OA 4NJEB 4NFLA 2DWPA 4OGKA 4RVUA 3F9RA 3PXEA 1VYUA 3D4LA 4MWTA 4ZA2A 4R7TA 5FPSA 1QK4A 5KAMA 3DZJA 3WMEA 3WYCA 1GG8A 1WCXA 4JN6B 3EZ6A 4KN9S 1J06A 1E5LA 2EP7A 3CJTA 1NPDA 1X1SA 4L2IB 4O4HB 3WZ2A 4EHDA 3DCYA 4YUYA 5EJ4A 3HKDB 3QKIA 2HPAA 4FHCA 4YXWD 4OVKA 3SZRA 3WMRA 1JS1X 3GPIA 3ROGA 2Z3ZA 1DE0A 4KDRA 2P2CA 1N77A 1V5GA 3D7LA 3FZNA 2C7VA 3EFEA 1R5JA 3FNGA 3G9TA 3IBFA 3LU1A 1U7TA 3D2BA 5F1PA 4X44A 3GP8A 4AROA 3VNAA 2GSDA 2JIQA 3GLGA 2B98A 4TL8A 1KE1A 2QE6A 3KJHA 2XA9A 1UBGA 3PNLA 3IJRA 4IGFA 5JMTA 2YINC 3IX7A 4OJMX 4D3ZA 3ND8A 4BJ1A 3UV3A 2A0WA 2WFZA 3L84A 4RTJA 2HRQA 4KOAA 3UMVA 4HT3B 3KFVA 5JS7A 3Q0TA 4YMIA 2NP6A 3PPIA 1L5SA 4CYMA 4BCCA 2FP4B 4FX2A 1MORA 3SNKA 4XSGA 2VP6A 3KHKA 3GJYA 4KO8A 1SWVA 4GPBA 4LWOA 2IX3A 2QV0A 2YNMD 3I1FA 4IV5A 3TSYA 1XF1A 2NNLD 4CKBB 4RZXA 2AA3A 3VAYA 1Y9JA 3B1VA 2Q49A 4XOUA 3DM9B 4EBFA 4BTEA 2FFJA 5CEFA 2XGMA 3V4FA 2R44A 1F60A 1NM5C 1A71A 1XEXB 3KTDA 3HHEA 4LF7B 2J33A 2UZ3A 3K71B 1XZEA 4TL9A 2OBFA 3GZNB 2VWPA 4J4BA 3IJEB 1QM5A 3H0KA 1DNPA 3KYDB 1O8CA 4A73A 5CAEA 4KZKA 3GQBB 2OAQ1 3AETB 2SNIE 4IYRA 1ZJZA 1OXVA 3H4TA 4WLVA 1F2VA 1NSYA 2HPVA 3A25A 1R6AA 3H2SA 4F9TA 3E18A 2NZYA 3EC1A 3W1EA 3OA2A 2WYVA 5KJCA 1XPUA 3HDQA 2WKQA 3G0GA 3PP8A 4HVLA 4YYZA 1M2KA 1F2TB 2CN1A 4HNQA 5EIOA 4U7FA 5F98A 5IWAB 5TXGA 4JBNA 3TB4A 3MLEA 1VYVA 3AR9A 5L9AA 3H6GA 3E4DA 2J1LA 2F3QA 3GRFA 2QG4A 5JPIA 4X1YA 5E4JA 5AHKA 5DBOA 5FI1B 1VLMA 1ZCFA 5HUQA 5A4DA 3AY3A 1WVIA 3LKDA 1X92A 4NCJA 1SURA 5K6TA 2QRGA 1L5ZA 1ZRMA 2B8EA 1TCBA 3DBRA 1IRXA 4KC0A 4IICA 3TX2A 2VDKB 4GMXA 3HYRA 5CYOA 5FI5A 3WNZA 3U61B 4HLUA 1U9ZA 3CSDA 3WJ7A 4IMJB 4NJMA 3W9YA 3GLKA 4W82A 4FINA 2P67A 3ZU5A 2YASA 2I3BA 3ETJA 3EY4A 1DFHA 4ZHQF 1M1YB 4M99A 4WL0A 1TJPB 3AEXA 2NZWA 1TA9A 3ROTA 2BTQB 5G4KB 4MEBA 4MO2A 2IS6A 2QN1A 1KYZA 4DABA 1QKJA 4Z0PA 4OIFA 4ZVPA 1ZH6A 3H1TA 4DC9A 4FS3A 4F60A 2NVUB 2X6QA 1QYVA 1OFIA 2B2CA 3MTEA 2ZT8A 4MS4A 3O0DA 4Z0NA 4UDNA 3V4RA 1POXA 4PLHA 4LBZA 4HMOA 3CTMA 4NCHA 2C4VA 1HNXB 2FLVA 2O2YA 3DEKA 4JI0B 3S2ZA 1T3ZA 3JQPA 3RVSA 1AA9A 1GGKA 2OBXA 4HG2A 4XGQA 2XZPA 3AP3A 4ISBA 2WJPA 5IJAA 1RYHA 1ZBQA 2EGUA 3ROMA 2RGCA 3SWWA 2PUBA 5LXTF 3X1ZA 1UM9B 3L0IB 2G67A 5LM3A 3II6X 5TY0A 3EG9B 1HZZA 4GOXA 1FTWA 1HSOA 1PK9A 2PH5A 2QRLA 2RCYA 4LRWA 4HYTA 3SBXA 1JAZA 1CIVA 4WOBA 1F5NA 5CH3A 2RAVA 3TZEA 4O2AA 2VFAA 1TECE 5JJIA 3C6BA 4US0R 3OZSA 4I8IA 1IRIA 1RWNA 2C00A 2DUUA 3HUFA 4GZ3A 3PPYA 3WL4A 3T12A 3I9FA 4GLLA 4NG5A 4CIDA 1DTWB 4DSOA 1Z4KA 2PUHA 3KUUA 2LDBA 5KWIA 2C7QA 1MRZA 1TTQB 3P96A 4R8RA 4DBLC 4C3UA 3R7BA 3NYRA 5IBPA 4Y2JA 3SNHA 3T9BA 4BX9A 4U8HA 3EF0A 5D5QA 3SZUA 2QQ0A 2VDRB 3PGMA 3CVXA 2O2ZA 3KJNA 1R8QA 3PZBA 1XV5A 3GL9A 3KOOA 1L1QA 5G1PA 1H93A 3WP0A 2IYAA 3WYGA 2AL7A 3LOQA 1O6GA 3AQ4A 3SIXA 2BGUA 3DVQX 2QVGA 1VMIA 4NU5A 4PZ0A 1LX6A 3QQPA 3VSCA 1SC1A 3E70C 4UW9A 2VCHA 5BMVA 1UANA 2Z4RA 1J7JA 1T3SA 3CX7A 4ML3A 1OZ0A 2M98A 5L7WA 4BHTA 3BWYA 2CCGA 4NYJQ 5BN3A 3ORSA 2G5CA 1Z4OA 1MFZA 3HCOA 4UQOA 2BH9A 3CUKA 4HNTA 2HK6A 3QYFA 4FE3A 2B5OA 4O4JB 3V34A 5I48A 4V38A 1V95A 1GPAA 2XQKA 2YOGA 1V16B 3OX4A 1X1EA 5P8WA 2I3DA 4D99A 3HBAA 1Y33E 4ZIRB 5HHTA 5JQWA 4Y98A 4DQ0A 4RJIA 1JIVA 1FNCA 4E5SA 2UUBB 1DJQA 2AXQA 1Q6YA 4XWAA 1J1IA 3J7TA 2QYHA 4QQRA 2DC1A 3K5PA 4M9QA 4OHWA 2JHPA 2C98A 1LEHA 1Q50A 4F6LA 2PZ8A 2F48A 1MO4A 5FULA 1J0AA 1WF3A 1ODLA 4Y6GB 1UXKA 1NFRA 1OX5A 3UK0A 3OPQA 2CHUA 1HE2A 3W8DA 3QI7A 4TWIA 1LLUA 2XCRB 1KK2A 4N5IX 3MAJA 4B31A 3DMDA 1KZ6A 1X3LA 2Z2XA 3EE6A 3MGKA 4FFRA 3IA7A 4OA5A 5DNVA 5CB0A 4GKBA 4AICA 2B7LA 3HEBA 3LT0A 5C7OO 2IYUA 3G9ZA 1Y37A 5L6LB 5EXXA 2QXYA 3HR7A 2G25A 3ASUA 5KWEA 3WOHA 1UDCA 4X62B 1O94C 4R71A 3CLSC 4NAVA 1Z9BA 2J41A 4QDXA 3GGGA 1AXEA 3C7AA 2NG1A 2YOHA 4W9NA 3F7OA 4R81A 4CM8A 3I62A 5BNTA 3ZDCA 1USGA 4QDZA 5EP2A 3ZHYA 3LNCA 2D6FA 1C9YA 1I9GA 3VUEA 4EELA 4YAEA 2ACKA 4G0WA 3NTLA 4P93A 1IM2A 2WNSA 2Z1MA 2H5EA 3HI4A 3LO8A 1A9PA 3A3YA 2FG6C 2XKJE 3RUDA 1JIUA 3DOCA 4LRSB 3VJKA 3QPCA 4CEHA 5GADl 1QG6A 5J23A 4MDFA 4CTKA 2CLHB 2WPNA 2NSLA 3GD7A 2C77A 4EB3A 4ASUA 1ML4A 5A6SA 2J0SA 5FR1A 4MQ5A 4JODA 5TSDA 4CQJA 5LL6P 3QW2A 1SQFA 1EK5A 2PSJA 4RM2A 4HN2A 2AG0A 4PX5A 5HWSA 5C35A 3DYVA 4I9UA 1GUDA 5LOVA 4C7BA 2WB2A 2QP4A 4F6RB 1O6BA 2QU7A 3ESQA 4DQXA 1BG6A 3OM8A 2GBLA 1D8AA 2W8BA 5AOCA 3DOUA 1V71A 1L5KA 1EP1B 1R66A 1K97A 1NVEA 2I4IA 3WNDA 4EVRA 3I83A 2I5PO 4F38A 4J0JA 1O9BA 1UPFA 4UXHA 2YZ7A 5AKHA 1TUBB 3GEMA 4HR7A 4W6ZA 1II0A 4E46A 4JOQA 1K8RA 3U44A 1YAJA 2Q0SA 2DYKA 2Y2UA 3DTYA 1PTJC 2OZLB 3SIRA 3ZUGA 4B0PA 3ROKA 3LGXA 3TDKA 2AG5A 3FRJA 5DHAA 5SYNA 1PAUA 3D6FA 1C1XB 1T3LA 2FSSA 4B6JA 1H65A 3GROA 4BLSA 4RGBA 2HBZA 3R5HA 2FN4A 3EUFA 1S02A 2J07A 4WH0A 5BORA 1LLFA 3OMLA 2C7RA 4ALLA 5LQKA 4GW3A 1TUIA 1THGA 3KQOA 1E1RD 1FVFA 1K8ZB 4R1PA 4LMAA 4HWRA 1ODFA 1YI1A 3R0JA 4DFDA 5DASA 3DVSX 1ND6A 4L4YA 1TT5A 4RFLA 4YJGB 2VXCA 3FHCB 3FUUA 4IDQA 5FADA 1RKXA 4KE6A 5KYUA 4ZQFA 5IKOA 4CFYA 3KX2A 4DNPA 2PE5A 4I4CA 2UU9B 3BQNB 4JHLA 4NPHA 4ZAFA 1P7VA 2VNSA 1XYGA 4D74A 5EWLB 5AJUA 2QYTA 4P22A 3UJPA 4DUGA 4INAA 1ZXXA 3B1FA 5FFNA 1ZMXA 5E95A 1TYBE 2LBPA 3FYHA 4TL7A 1E7MA 3PNMA 1UT5A 1Q17A 1VP3A 1NG9A 5TEVA 2FOLA 1KY2A 1OWNA 4ZI7F 1H3NA 1M6HA 3B5EA 4PC3A 3TECE 2VP2A 5C8YB 5K3CA 5FYDA 2P3SA 4UTZA 3V7WA 5IPFA 4NOJA 2E89A 1DJLA 1GN8A 4JLSA 3ZOKA 3HJUA 3JQAB 1A8HA 4HPWA 4HDNB 3D6HA 1A0OA 3CZ4A 1FYWA 3IBYA 3IB3A 4HAXA 4AG6A 1XDDA 4IJWA 2DHCA 1VLVA 3IVXA 2E1RA 4KFUA 2GEUA 2OCXA 2OP1A 3R77A 4PYNA 1GCUA 1JEYA 2V4MA 4B3RB 4YQEA 3QXHA 4ZO9A 3QPBA 3LQ1A 4BQPA 1R00A 1C3JA 3QFTA 3T3HA 1GAXA 1T25A 1MUUA 4ZVOA 4LSMA 4BIMA 2D5AA 2JASA 2IODA 2N42A 3KVOA 1T6YA 2ZBGA 5FYQA 1X42A 1IAVA 2RSLA 2PUVA 5AW7A 1Z0ZA 4KWIA 4UMDA 5JATA 1YR3A 4GU5A 5AVKA 1XVLA 3PWZA 3Q9UA 4M1ZA 4PQYA 4ATNA 4BVHA 1JW9B 5E7IA 2FPPB 2GRJA 1YB7A 4U2DA 3AKDA 4V3CA 3K2QA 2CVPA 3ZHVA 3N39C 2HUNA 3OSUA 4DIBA 2ERYA 2P9FA 1E7RA 1YSCA 4GRDA 4M0LA 5K0ZA 2W7TA 3H5TA 4HB0A 4XIIA 1RQPA 5F5XA 1F0NA 1GV1A 1HG1A 2D5IA 2GNPA 3NT5A 4I50A 5BQFA 1OLUA 1VJ1A 1OTHA 3GUYA 3TN7A 4G0MA 3WQQA 2HRDA 3WHPA 2ZCJA 1RRKA 3R23A 2EWMA 3EYAA 3PQ2A 3R20A 1HLPA 2HW8A 1MOQA 1ZM3A 2E6UX 2H1CA 5T41A 3TOXA 5K20A 1LI7A 4P98A 3LY9A 5IMBA 1YCHA 3HCPA 1VHLA 5F3DA 3NHZA 3ZVRA 1VJRA 1MJHA 4B3TB 4OH7A 4FBGA 1G41A 1KEUA 3FMPB 4KIFA 2XB2A 3Q12A 3RAGA 3ZBQA 2EIHA 1KNXA 4AO8A 1J2RA 2WMYA 4HNAA 3AKYA 3H16A 4WZ6A 2Z08A 1AN9A 3FHLA 4X8OA 1XEFA 1IPEA 1BDJA 2QPLA 2YV5A 3BIFA 4MV5A 1JWAB 3R0VA 5EJ2A 4F2HA 4D8UA 3A6DA 7REQA 2HXYA 4FKBA 4IFBA 4X71A 5EYPA 3AJEA 4QFBA 2O1XA 1MC1A 2QLNA 1WZ2A 3KQPA 4JI8B 2I6UA 3I04M 4UBKA 4ZYLA 4WZAA 4OBXA 3IKMB 4XLZA 5LQAA 421PA 5C0OE 1RBZA 1LBTA 1Q2XA 3CEJA 3C24A 2VAMA 3KFLA 3C5EA 1K0UA 2QW1A 3AF4A 2BR3A 3PT9A 3P97A 2KB0A 4YB8A 3GGPA 3TSWA 4C89A 2VQDA 3FW1A 1H42A 3INNA 2ZG6A 4TXJA 1WCIA 1TLLA 3WQBA 5JV5A 1Y0BA 2VZLA 2X41A 3JS5A 5FA8A 4DB4A 1ETHA 3DMNA 1X13A 3A4TA 3HC7A 2BHRA 4FZ5A 3KZOA 1JDNA 1IN8A 1KO7A 4IDOA 3T99A 2BHNA 3V42A 2ORYA 5CT9A 3LXXA 3B8EA 2AJDA 2ZSKA 3OQIB 4L76A 1FUKA 5ICCA 1MV8A 3SYTA 2ZRNA 4KQFA 1SKYE 3FI0A 2VK1A 4G4SP 4HH4A 2M6LA 1Z07A 1EM8A 2QD1A 3EVFA 1S2LA 3L8CA 3WO1A 3QLUA 4QGAA 4YP9A 3VH3A 4QRHA 3L4KA 1DXHA 2YMPA 5JIBA 4Y1RB 4MINA 3FVTA 4JVLA 5JZMA 3D7NA 5DXFA 4MA5A 3RC1A 1ELOA 4K9OA 2VSXA 2ZJ6A 3WB2A 5C37A 3EXHC 1N5RA 3DOFA 2Z5FA 3IQWA 1RWQA 1E2NA 1XVTA 1CJBA 2R62A 3BRWA 5REQB 3UB3A 3KU4A 5JG7A 2Y1LA 2B2NA 4RDXA 4O4LB 1ZM9A 4I8XA 4YIHA 2IA5A 4I1PA 4GBGA 5DP1A 3VU1A 4H0NA 1BE1A 3HB7A 2AVDA 4JC5A 1MQ9A 1YNOA 3L8FA 2WJ3A 1G3MA 3MMSA 2FXIA 2OXCA 4IVPA 3WLFA 1E4YA 5HA5A 2WOJA 1V4VA 3SS9X 3ZTWA 1BGVA 4EWLA 1JSCA 1WSWA 4O2BA 4EB8A 1Y63A 4P7JA 4D8YA 4BU1A 3PJEA 4EJMA 5FI0B 4YAIA 5GINE 4NBRA 4B34A 3I37X 4KP7A 1N2CA 4OIMA 1CNMA 4MLDA 3UW1A 4XDZA 3DBLB 4YDQA 3V1KA 4Q19A 3SS8A 1HK7A 4Y2SA 1T0JB 1LDMA 3KKQA 4N41A 3UJCA 5G1NA 3UQYS 4MUFA 1DWUA 5BRJA 2XHEA 3JTEA 4IX1A 1G5QA 1QCCA 1XE3A 3IP8A 1DL5A 1WAMA 1SY7A 4AKSA 1DWQA 1QHHA 1CJVC 4CT5A 3R9XB 1L7QA 1UADA 3ADPA 3GMDA 2WMNB 3Q7SA 4BJHB 5BUZA 1E6KA 1C81A 4G41A 4U02A 4ZGBA 5JLAA 2VC2B 3K6RA 3H4IA 3FDJA 4DCOA 4MKZA 1C0EA 5ADUS 5CDHA 1IQUA 1Z6QA 5LZ4A 3RANA 2I3GA 3WWOA 4EM6A 1CUYA 4QNMA 1LS6A 2PYDA 4DPKA 4INPA 4DLBA 4BE9A 2PG3A 4K81B 4QQ8A 1ONPA 2R7AA 2V97A 4ZMRA 1AKMA 3BK7A 4FIZA 1NJ5A 1J8YF 2Z8YM 1W6RA 1VG9B 2QQEA 1LC0A 3OVMA 1H3FA 3RSSA 4HNGA 4XQ9A 5A9SA 5AT1A 4ZTUB 2ZUTA 5IVKA 1QO0D 1FBNA 5CM2Z 4MAMA 3ZVKA 2XMZA 4LYHA 4ZJYA 5CA0B 4ZYXA 2DPGA 4MQ4A 2ZI6A 4DCVA 1REQA 1XMSA 5FUYA 5LCXA 4DLTA 4URVR 2HN9A 4Q7KA 5C1PA 1H23A 2BZ0A 3DDHA 4UJ3A 2BHSA 1T4MA 3E35A 2QLTA 3FOAA 3LF1A 4J03A 2FFHA 3OQVA 2BHTA 3OOEA 1LBHA 3SBOA 4BJ5A 3JQ6A 1OYOA 3D3JA 1XTTA 3OOYA 3BICA 3DV0B 5H59A 1EVYA 1DG1G 5C1IA 2RE8A 1QJ4A 1H4TA 1SCKA 1AMOA 4KU4A 2HA5A 2XQIA 2D0PB 3SX0A 4YXFA 4QSMA 5DYWA 3P32A 2PYIA 3AI2A 4Q16A 4ZREA 1CHDA 3ZD8A 3CLTD 5KSYA 3NXKA 4NH0A 5A0FA 5CB4B 3K6SB 3QTBA 4FMDB 2WB4A 4UQPA 2YVKA 3E9DA 3L8MA 4GMFA 1IMOA 1ISSA 2AZMA 3JD2A 5TGDA 3R5FA 3A3PA 1Q74A 3QHPA 3VV2A 2OMEA 4RTNA 3HBFA 5AHOA 1FFDA 5KVSA 1EQAA 5IFLA 4NOMA 3TRHA 1JLRA 2JG3A 2X8AA 2CY0A 2WM9B 3C7TA 3RK4A 5JWRA 2Q7OE 2O2DA 2E4WA 1NQXA 5K0NA 3ZY3A 5ERXA 1AQYA 3JPWA 1HE3A 5LP6C 4FFBA 4RL6A 3T7CA 1FFWA 1YJ8A 1ESEA 3EBOA 2ONYA 4JA0A 6CHYA 1KDRA 4QREA 3UOGA 3KZKA 4B6GA 1RYEA 1MN6A 2F9LA 1U9IC 2Q9CA 4RY9A 4B1FA 2R8EA 1BHQ1 4C21A 3IRUA 4TSFD 2XW6A 3BEOA 2JLAA 3RIMA 1JPUA 1RJEA 2IYFA 4YAWA 4MDHA 2ZAMA 3ZZNA 3P4UA 3KQMA 2ZJZA 5TF0A 1JQ5A 3EXHB 1HEYA 2H8KA 3CRW1 4MZDA 1N2EA 3X1YA 2BGRA 1E1MA 2BD0A 3HYNA 4X1IB 3C1UA 2BUCA 4D8VA 2Z2KA 3O2QB 2CYBA 1EX9A 1HDOA 1MOZA 4KQGA 1K7CA 1UK8A 2PQ0A 1SHTX 1ZNZA 4WGGA 1BZYA 5ALYA 2JIBA 3DW1X 3U0VA 3N87A 1DIOB 1Q7GA 5KCMA 5CB4F 3D59A 2IPMA 2NXCA 2X23A 3KLOA 3T9CA 2ZRLA 4YC7A 1COWA 3DT9A 4C6SA 5BW6B 4B45A 1O95D 2HV8A 1E79D 1QOZA 2BE7A 2J3QA 3HJGA 5AFSA 3BSWA 3C3CA 3MINB 2CNKA 2D4AA 1N2JA 4OL9A 4UCFA 5FHRA 3VSAA 1HORA 4RACA 2Y0CA 3MIIA 4TMFA 1AO0A 2J4DA 2BFMA 3JWJA 4X8LA 3THYB 3VHXA 2J31A 3W7VA 4M54A 5EAIA 1RXVA 3I58A 1ZNYA 2I6XA 3I45A 4GVLA 5HIAA 2IU6A 1KJ8A 2OAP1 1BA2A 1YDEA 3C48A 3H5WA 1SULA 3TZQA 2EFDB 2F1KA 2NYVA 1P1RA 2CKMA 1ZW1A 3IUPA 4G0YA 2GK4A 1Q44A 2J09A 3BRSA 1V7PC 2WI8A 1QDEA 3MNFA 3OT1A 4FFOA 4LA4A 5A62A 5LQMA 3UG6A 3ZY4A 2Q6OA 3BX1A 5C51B 2MSDB 3A37A 4MMYB 1BS1A 3ZDBA 4CMHA 2NV0A 4CCYB 1WXGA 4PANA 2WZBA 3L7CA 3GQVA 1T5BA 1R74A 1E0JA 3B1YA 1FXSA 1SEPA 3BCUA 1X7YA 1QFSA 2ZYSA 1JJAA 3K1YA 4PNPA 3G9QA 1KMNA 4FUQA 4F5ZA 1ATZA 2PYZA 3CEHA 1E6CA 4TGLA 1LLDA 5H70A 1XTZA 3RDPA 3SF0A 3VMMA 4ICIA 1M2JA 1ODJA 2E4VA 5CW2A 5FUXA 4YRJA 1KH3A 5EE9A 4DXAA 3PQ6A 1LK5A 5DBFA 5HMLA 1E4EB 1CUVA 1GDHA 1M7GA 4EFMA 4H1WA 5FDFA 2P8SA 3AUTA 1ZD3A 3HHPA 1N2HA 1F6WA 1WKBA 2KW5A 1ZU5A 3IPXA 4G56A 1UJBA 4P3KA 3QVXA 1DX4A 5E8RA 1GG9A 1NNUA 1M1YA 2DZDA 2W2LD 2O3JA 3AETA 3KDAA 4FSDA 4GE0A 2ONKA 5CA0F 4P4UA 3VKUA 5BV1A 3A4NA 4C4SA 5CD1A 4FEYA 2GHQA 4M36A 4CI9A 1N5MA 4Q34A 1MEJA 3QVMA 1YZQA 1DBPA 3BGSA 3MC1A 3PGJA 3AVYA 3PHCA 4Z7NB 3ZBTA 2OHFA 2OSVA 2J5QA 3JQAD 4DLNA 4UVDA 2EF1A 2OG2A 3UENA 4UHDA 3TNLA 3N7TA 2C84A 3QNUA 4TSKA 2VVTA 4EHJA 2O7SA 2GERA 3WA7A 5HEKA 4FHGA 4G4JA 3WL8A 4C43A 5A4FS 3QE9Y 1UFQA 1CR1A 1W4LA 1U0OC 3UAYA 2GK7A 4LRQA 5LXTA 6GPBA 3LV8A 2C0CA 3NJRA 1ZONA 1TO6A 3GUCA 5FEMA 3KR9A 4ZXFA 5FH9A 3S70A 1ZK2A 2IH5A 2NO7A 2ERCA 4DYDA 4QGGA 1TZMA 1IEWA 3NP7A 4Z9BA 3ROXA 3GEHA 2GAIA 1EX1A 3HCFA 3IFSA 2A1IA 4HNUA 5JEDA 1STOA 2H4XA 5DKFA 5D51S 2CFOA 3IQZA 1T2UA 1S5PA 3OX2A 1S8OA 5T4BA 3WLIA 6NULA 1IXKA 2JAWA 1XZNA 1DTWA 3C8UA 4P4GA 2WU4A 5GGXA 1N5JA 3CH6A 4NAUA 3TXYA 1PR4A 4EG0A 3GVXA 2PSFA 2PEZA 5KNBA 4I4LA 5DP2A 3WQHA 2CNBA 1TXGA 1UT8A 3R6GA 5BSRA 5KNCA 2A14A 2XDQB 2WSLA 2HRCA 4W1PA 4B7XA 3AF0A 3D8NA 1GA1A 3OKFA 4A0QA 1VJ5A 4ER7A 5BN4A 2GD0A 3GRZA 2R4TA 3I12A 4Z9AA 4QJ5A 3ZWVA 1K7XB 4W5NA 3LJKA 3KQVA 1WCWA 5EE5B 3A6ZA 1QC5A 3ZHCA 2OMKA 3DP9A 4EKIA 1Y5LA 4LNUB 3P0IA 1UBNA 4EB6A 1QTNA 2H0QA 5JAMA 1G5RA 3HUUA 3BC1A 3K0CA 4RS3A 3LPDA 3GLRA 4J2OA 4FN4A 3TW0A 3DMPA 1D6MA 4IIVA 1SCUA 1ULTA 4HV4A 5DNCA 1O87A 3ZH9B 3BIWA 3GVHA 2J7KA 2PH7A 1C9MA 1P4SA 2X7HA 4OMDA 3W6UA 5JO9A 1E5QA 2O3RA 3D3EA 4DV6B 4AECA 1W52X 4R98A 2X0EA 4RK7A 3FCOA 3E7DA 4UZFA 3VI4B 1LJ8A 3G8DA 1KQNA 1IN7A 5CBPA 4U5QA 3HY6A 2CHQA 4KQXA 3GB9A 2ADFA 1Q1EA 4NYMR 3DMGA 3OCUA 2VL7A 1E0SA 2I6QA 3ILHA 1N2XA 3H4VA 3G2PA 4CQMB 4J16C 1GGFA 1EVEA 2VSFA 1A77A 1EB8A 1TIKA 2OKCA 3BIOA 3IT3A 5U4QA 1KYYA 3V6LA 4UHJA 3CN9A 3Q4GA 5MGNA 4N48A 4UNSA 3WNQA 2BFCA 1H4VB 4MITA 3RQIA 4JOBA 3TAXA 3KJZA 1XCGB 1SZJG 1NJSA 2W2KB 4IJ6A 4G9GA 5EJIA 2JHCA 5IXYA 1SVLA 2NW6A 4JB8A 1VIDA 4UHBA 1L3BA 1XA3A 3MBOA 2GZMA 2F6RA 2HOQA 2WM8A 3BH6A 1FX0A 4RDIA 4M7OA 1C30B 1EM8B 5EP3A 4XPZA 3QFRA 1NVBA 3RLIA 5A02A 3ZJYA 3R5KA 4LK3A 1KHHA 2JBWA 4INZA 3JVIA 1KGDA 1VBKA 2V0NA 2R4UA 2QK4A 4TTQA 1T1SA 3F2IA 3AX6A 1GUYA 1WZIA 4XR4A 5KKNB 3KAPA 2J6HA 4IO0A 1GGHA 1ESDA 1ZRSA 2OWEA 1F4VA 5K0EA 1UM8A 1QRUA 1IZ0A 4M0FA 1H8HD 5EY5B 4EGJA 1T1JA 2YHAA 4EZBA 3H5OA 5KYYA 3DMYA 1SCJA 1KKLA 4DCSA 1TQDA 3TZKA 3VPAA 3O1JC 1XHFA 2BFBB 2HF2A 4XEHA 5JFOA 2VUIB 1VRVA 2WJJA 5KOYA 5A7FA 5EUMA 1JHVA 2Y05A 3JQ8A 2NN3C 1RJ9B 1O4VA 1VGRA 4KUGA 1UBSB 1BDHA 1FFYA 2EFYA 1QU2A 1M33A 2QZPA 3BF7A 4Q21A 4X41A 5T8KA 2ID9A 2IELA 4B6RA 2Y1FA 4KTVE 3TFQA 3NYQA 1NF8A 1GNQA 3FMOB 3WE7A 3ZYZA 2RG1A 2M9MA 2OV8A 3B48A 4EI7A 3AG5A 2JJQA 1YQWA 2AR9A 1G8PA 3VV3A 1F20A 4UE2A 2Q1WA 3M4ZA 4U1RA 2AC4A 2VT6A 3G8AA 4MPRA 1DDIA 4YRLA 3OJ0A 3HO1A 1ZJ4A 4EBBA 3P9QA 1BWQA 3TQFA 4KQ9A 2DULA 5IK2A 2C31A 2JVJA 5BQ5A 3RGWS 4OI2A 2ZUDA 1QH0A 2IIVA 3OZVA 1E3EA 1PZNA 2MWMA 3H42B 3OJXA 1TU3A 2O59A 3CEAA 4AUEA 1G20B 3DPUA 4PHGA 1N9GA 4TTPA 1U3CA 5FL7D 4AZ3B 1FDRA 5BN5B 4Y0AA 1E1CB 3L1JA 3IIKA 1W5FA 1ECJA 1LF0A 1G8KA 2PMBA 3P71T 4K6KA 4A26A 3V4LA 1JECA 4UM9D 2C3MA 1P81A 3N6XA 5LDGA 4DNFA 1AKTA 1LSOA 3VR4A 1H4QA 3BCSA 4YV0A 2UZ0A 3HQ4O 1B0PA 1VI6A 5F4ZA 4EG7A 4E5UA 3NVDA 1TW2A 4L2IA 4Z9FA 3RHFA 1Z18A 1MH1A 1OXTA 4ENSA 1CB7A 3K73O 3F71A 2ZYUX 3GFGA 5KJ6A 1QRDA 1V41E 3IIEA 2MJLA 3ZDRA 5HJEA 3F5FA 3G7NA 4XFDA 1CJTC 1CSEE 4A0HA 3KXDA 2G5GX 2XTZA 4EDFA 4G36A 3QYJA 4PVDA 4YRCA 3RROA 1WETA 1KPHA 1BMFD 2ROQA 4B4KA 2AWNA 3L7DA 3H9JA 2CV2A 2NQ8A 4XFKA 4L4UA 2QENA 1JFLA 3VPXA 1XCLA 4FKZA 3BWMA 4J6FA 5A7GA 1XALA 2WEKA 4N3GA 4YALA 1IY2A 4D92A 3VSDA 1QHEA 5A4IS 3ETHA 4Z99A 4ZC8A 4N3AA 4M1WA 5H3LA 4OB8A 5JDIC 2VJMA 1JAIA 1PUJA 2IPAB 1QB8A 1GNVA 1UZNA 2IHJA 3NM5A 4G4SO 4TKLA 5JROA 1PV2A 2P0AA 3E9NA 4KTTE 2XEDA 1MFPA 4H1HA 3HA5A 3THSA 2VJAA 5JYBA 1SBYA 1OT3A 2C1XA 1I7NA 2G7ZA 2NV2B 2ZRBA 1H1DA 2ZWIA 4FDMA 1BQ4A 4O2LA 3RBXA 1RAEA 3O2JA 3D54D 4ZQHA 3PLNA 3MJCA 4ZO7A 2WRZA 3FUXA 3OTIA 3CH5A 2H06A 1Z37A 2P77A 4ZEMA 1ZG3A 1UOPA 3QBTA 4ES6A 4WE3A 3BMCA 3TZ6A 2C1EA 1NBIA 4LF4B 1ZCAA 1K9SA 4Q3NA 3JYPA 1AF4A 7ABPA 1VJ0A 1K5PA 4DLWA 4IKPA 3PDIA 4OG2A 3ZGOA 4FFLA 2JGEA 3Q41A 3I28A 1KNQA 2GEKA 4GMKA 1JHUA 1NLYA 4UMVA 5G4KA 4MV8A 5THXA 1N2IA 4WDRA 3FB4A 4WFKA 1PCXA 4JLDA 2ZI5A 5AO9A 4BU0A 3O03A 4JQCA 1CEYA 3Q11A 5K3AA 1NATA 4MUBA 1Q3HA 1F5SA 1Z08A 2R2GA 3ZTTA 1WZUA 3PQ3A 3IDAA 3TQIA 2NUTA 3GLUA 2ZZNA 5BN5A 1KP3A 2RHJA 1GFZA 1N0WA 5FO0A 1G0NA 3IE0A 5ESRA 1PV1A 4GGOA 2ADOA 2YVUA 1EE2A 1SKYB 2P8JA 3P1JA 5EL0A 1C9JA 4WNAB 3ESRA 1E1RA 1G2QA 2VF2A 2WABA 4E5VA 4I1IA 1C7EA 5LBUA 2Q2VA 3Q5GA 5IANA 2BEKA 3MTBA 3WRYC 2GEDA 3QEMB 5CDGA 1SUIA 1Z6GA 4O4IA 5GQSA 2QAGB 1JLSA 3EVGA 4DDKA 1EA7A 1ZD4A 3NM4A 2WP8J 3OZXA 2W37A 1EHCA 1OYVA 5B1DA 3RYFB 4GUAA 4EFNA 4OCZA 4PX9A 3K0SA 1NTRA 3CF0A 4NMWA 4X9XA 4BQSA 1E9DA 2PRYA 3AMVA 5J2TB 5F78A 1CZOA 1DU4A 4PSUA 1VHQA 4Y67A 3MS2A 5I7AA 3IODA 2G9RA 5K6AC 3MGCA 1KE2A 4RMHA 2PSEA 4KFTA 4B71A 4TLAA 3ADDA 4PO1A 4FN5A 4OSPA 3RRBA 3QZUA 1PLLA 1MDBA 3A1EA 4MLZA 5FL7A 1E0KA 3WAGA 1HV8A 1B43A 1EQUA 4U5XA 4YI3A 5AVWA 1VECA 2C2WA 2BGIA 1PX2A 1T2NA 3DDOA 1BGXT 2COUA 5IK2D 2JIOA 3C4QA 5FO1A 3WYDA 1KGSA 1B73A 1Z2NX 2XZTA 3KOXA 4HJRA 4QTTB 5EKXA 5I9TA 4CWAA 5KTPA 1KQGA 3LZCA 4IVRA 2C58A 3TNYA 3TR5A 2HA6A 1U8UA 4HDCA 1GSIA 4ILEA 4NYIQ 2QTGA 3TE6A 3WQRA 2YUTA 2OHIA 4H59A 1LQ2A 4ZGGA 1KI8A 1J90A 3M1AA 3S99A 4A8HA 1AM4D 1EFCA 5COQA 1GZHB 3DZDA 1MIOB 1HDGO 1FFSA 2ZIGA 1PFVA 2VNKA 3DNMA 3P26A 4BFWA 4DBZA 1D1PA 2OXEA 2FJUA 3CZ5A 3ISVA 3Q88A 1I5EA 5FWAA 3G2HA 4ZCRA 2PQMA 3JAKA 4J1QA 2EXXA 3CG4A 1K0FA 2FY8A 3GXOA 4AMVA 2OCYC 1Z4MA 5YASA 3AB3A 4D8XA 5JS8A 4F1KA 8ABPA 3VH4A 4BZPA 3N28A 3FYUC 2PO5A 1YRWA 4HGRA 2YV3A 4L5AA 1S8NA 3BM5A 1U8FO 4HX9A 1QIKA 3V6MA 1P75A 1I4OA 4Q1EA 1SOAA 4PG4A 4EGSA 4OXYA 2C82A 4PHCA 1VKZA 3ZLBA 1IN5A 1R3UA 1IJKA 3GI1A 1X39A 3VDRA 4HF7A 3VVBA 5B1EA 2DUWA 4I1OA 3MM4A 1L0BA 1KZ9A 1PHPA 1OYWA 2OBMA 3N2KB 4KO4S 5D3MA 3E5HA 1RXCA 3K9HA 3TD6A 3DE2X 3FDXA 5FBHA 1WCIB 5A4AA 1JVNA 1QVAA 5L95A 4BV2A 1UBOS 4H4EA 3LT4A 5JSFA 2UVDA 4NV0A 1ICEA 3RC3A 2CB9A 3WGNA 1W9MA 1EBUA 2PD4A 2C2XA 4IIEA 3UA4A 4EJ6A 4CIXA 4PSKA 3RKRA 3PUHA 4BEJA 2BYTA 3O9ZA 3AKZA 4QBHA 5E7QA 5FOTA 3ZQ4A 5JYEA 4IWNA 4LQCA 1QGDA 1K5GA 1NDHA 3N7UA 1E63A 4P58A 2FX3A 2RHMA 2VYCA 3SS7X 4C76A 4ZZ0A 5A1TA 3SCZA 3H11A 3DAHA 3QKRB 5KREA 4DR6B 2R00C 5DGTA 4RV9A 3WFJA 2QI9F 4QATA 4RCYA 4D41A 3Q15C 1UMKA 2FPUA 1XLUA 1FUEA 4WLFA 3LVBA 4BMPB 5JALA 2C9YA 3EFOA 2EL9A 2R1TB 3CM0A 4YRRA 4CFZA 5CNKA 1E3DA 4EFLA 1SC3A 1IOWA 3AJRA 2F1RA 2D0DA 1BW9A 1MB4A 2J48A 4KV9A 2V5AA 4B5LA 3ML1A 4RY8A 3RVDA 4ENRA 2CXHA 2FDXA 1M1NB 2YNMA 3QVSA 1L7MA 4W7IA 4BQRA 1FL9A 3LHDA 2IU4A 2C2ZA 4ILKA 4O4LA 2UZ1A 1VJDA 2EDAA 2D8AA 5IUNC 3V8MA 2DHDA 4BLQA 1L7BA 4QDKA 5FF9A 2FAXA 1R0LA 1QGUB 1TGYA 4TTSA 4B6PA 4B7UA 4U2EA 1U5BA 3RBZA 4Y2HA 3W1WA 3JY6A 4Q4JB 2O19A 2R47A 1JHOA 3QIVA 1YS7A 2VYVD 2IYYA 1VDMA 3PU6A 1RYDA 4OO3A 4O29A 1KJJA 1W4BA 1Q3KA 2QORA 3GGSA 3RSQA 3SXPA 4C0KA 2QAJA 4ZHQB 2HDWA 3HXMA 1GGVA 2XCIA 3HYTA 1J8DA 4LN1A 2I4OA 1CJKC 1Z28A 5LA6F 1WU7A 3GAAA 3KKPA 5AKKA 1DX9A 1KI2A 1XEWX 4TS3A 1HZJA 4X6LA 5BUSA 2RKWA 2G28A 1QHHB 2I1QA 3R9XA 2B9EA 2PZGA 4LHZA 1O4WA 4V1CI 5L3VA 4KXVA 2WVHA 4J0FA 2BKEA 1PW5A 2WYWA 3MT9A 3W9UA 1CUBA 5BSVA 3AHDA 2AEJA 2BGLA 4RS4A 1EHYA 4D0SA 2P79A 5EMLA 2VQSA 4PIPA 4D44A 1T4CA 2GCOA 2C4HA 5JJ5A 1KXZA 5ELLA 2GRAA 2OCDA 2ANCA 4KLRA 5HKKD 2BFCB 1XXHE 3IAXA 4HH3C 4RGYA 4JVMA 2G71A 4B84A 3WLJA 3CLUC 1GPKA 4N5DA 1IVSA 3PLRA 4KQKA 1AV6A 4Z4QA 3G1TA 4TMYA 1Z0JA 3ZE9A 2O3SA 2AHOA 2VT3A 1XLTC 4IEFB 1RLJA 2R79A 1A7KA 1SG9A 2KE5A 3IDFA 3UNXA 4ZJPA 3P5BA 3B1XA 3WGKA 3O38A 3ZKWB 4FDLA 4YUVA 1Z45A 3JVVA 3FZGA 1M54A 1DCFA 4IIBA 3R7LA 1P0QA 2CBZA 3OQNA 4R31A 1SBQA 4EMTA 4BZQA 3ZIAA 3QPWA 5JDCC 3KPYA 3KKMA 3L4EA 3BL8A 4MV4A 1VXOA 1QSGA 4C3OB 3K4HA 3Q3HA 3AVQA 2EBWA 4A91A 3HB1A 1PVVA 2BP7B 1AO3A 3EXIB 3HN6A 4RUKA 5JMWA 1W36B 3KZNA 2R96A 2OO5C 1GAEO 1TTHA 2GARA 4GX2A 3UJ3X 3ROFA 4DRZA 4L5IA 4M0DA 1ILEA 2QSUA 5JPDA 3SM9A 3T7AA 3SYNA 1XD8A 4E88A 2N3ZA 2ZRQA 1NW3A 3AXTA 5K8CA 1AD2A 2V6GA 4TQGA 1V9SA 3ZJUA 2NSYA 4D2IA 5IJWA 1BWPA 4W5WA 1V8BA 2G3YA 1KWKA 4ZI2A 1WMSA 1F48A 4FOSA 1ZH4A 5H7XA 4PONA 4M1EA 4NFSA 4DWVA 3AEZA 2O2XA 3ND7A 4DDUA 2XYRA 1EK6A 4G67A 1QQ6A 3GN1A 1FYFA 1XL1A 2CK3D 4PLTA 3ZW8A 4N65A 5LMNB 1TCUA 4RLQA 3NVMB 2C5SA 4UOQA 3IPAA 2BEWB 4CF4A 3TD2A 5KOJA 2JVIA 1VJTA 1Z7BA 4KGVA 3CLRC 1QE0A 1ZXLA 2M1ZA 4UQLA 5EEHA 4FZRA 1DEKA 2CFTA 4EABA 3X1KA 3G1WA 2FRDC 4HOYA 1CEEA 2HA4A 4NBLA 2XGOA 2Z0MA 2H1IA 4GPD1 1CNEA 1SZPA 4OF4A 4NATA 1XZIA 4H0FA 1Q7BA 4BVAA 4WESB 4EGFA 2R6HA 4X90A 1IJEA 2H00A 5KSPA 3EISA 5BW5A 1TVKB 2VJPA 4KUHA 1LFAA 1FW8A 2C29D 5AVQA 4NOKA 5LQUA 1N36B 4KMOA 1HDXA 3FHTA 2WG2A 1NFQA 1KYVA 4U7JA 1V47A 1ZVKA 1A76A 4W99A 5AVTA 2JKYA 2YRXA 1AHHA 2HYDA 1WIWA 3PRJA 1VIVA 4MQUA 4I55A 4OTZA 2IKSA 4DYHA 3I9NA 1O95A 2VTBB 4D9KA 2Y2VA 4PWYA 1SBIA 1G7CA 2PGNA 3K2BA 1YI8A 4FOTA 4L3WA 1Z5VA 2BGNA 1BHSA 2OCIA 2W6ZA 1JKMA 4KLCA 4XWYA 4ARAA 4ZYUA 4ZTZB 2I65A 1KP9A 4LAFA 4WZZA 2DT8A 3QW4B 1RXWA 5JSKA 1T29A 3TKYA 1ZUD1 3OF3A 3UPTA 1XZHA 3EJ6A 5EOVA 4F1JA 1IM8A 3EXEB 1ZGCA 2B99A 4UPEA 2VJBA 1OV4A 3GX1A 2O8BB 1KDYA 2NAFA 3EASA 2W70A 2KHZA 3PFWO 1ZC3A 1KY4A 1F2UB 4UU1A 4QM7A 3O8CA 1Y6GA 1EGMB 1ESNA 1UKYA 4AYTA 1I01A 5EE1A 4RK1A 1JYEA 3R3XA 1FY2A 4RHUA 1QXSA 4JYPA 4X84A 3RTCA 2FYTA 2CXOA 4Z0HO 2WIDA 2ZYAA 4X60A 5JJLA 5E9WA 5ETJA 2AOXA 3AUSA 3I0NA 1W8DA 1K4YA 4WXYB 1OX4B 4RZHA 3AJDA 3R5JA 3MD0A 2I87A 1KSGA 3WVNA 2FN3A 2VHUA 3A26A 1PUIA 2CJWA 4GMGA 3TKLA 4MIEA 3LTNC 5L6MB 3PKZA 1PL8A 2AVNA 3IERA 5A3RA 1ONNA 2Z5LA 2H4HA 1YRLA 1TYEB 2VT2A 1PEYA 2GK6A 1VXRA 2O1SA 5BMVF 5ENDA 1G3QA 4IAOA 1XDZA 1SK8A 3E48A 5AK6A 1F7VA 4FP9A 1QS0A 1URPA 1JVSA 1V1RB 1RU3A 1JEDA 1Y6RA 2PS9A 3JALA 1A9OA 4F7DA 3COJA 3AP1A 3HXPA 1UL1X 1D0SA 2BFPA 3KJQA 2TMKA 1DCKA 4I36A 5CVCA 2XE7A 4ZO8A 5EPEA 3HVJA 3OZEA 4EHLA 3DZGA 4JLJA 3VC7A 2EKPA 2HBYA 3GVCA 5DWVA 4P5DA 2VDJA 2WJWA 4A36A 2F8LA 4PLCA 3C6YA 1KOFA 1RJWA 1IY9A 1X3SA 3MRSA 4M7WA 1WDTA 4MI9A 5DOVA 4LJAA 2WJAA 5SV2A 5CH5A 4UD6A 1Q7TA 1A5SB 1U2DA 3QE0A 4IG9A 1P5ZB 4JYBA 1PJ3A 3SAJA 1AMUA 2VZEA 3G17A 1Z0IA 4R4JA 3WWCA 1N6HA 4AY2A 2C20A 3I6QA 1TM2A 3RU3A 4P80A 5AW1A 3LWDA 4O4IB 4PZLA 5FBVB 1H0HA 1TCCA 4HZUA 4X3PA 1TUGA 1U9JA 3RRMA 1BKYA 3T4PA 3W6OA 2HQOA 4JCOA 3CW9A 4WKGA 2BF7A 1XQVA 3NTVA 3DLTA 4TXNA 1MAHA 4JOCA 4OY3A 4D8WA 3CO0S 4MV1A 1NYQA 3NVKI 1QIMA 2FCRA 4O2AF 3LHKA 2IJGX 1RVDA 4A2QA 3S3TA 2R85A 4FDAA 4FGWA 5BV2P 5MGBA 4LVOA 3LP6A 3OZWA 3QBEA 2KI5A 2BGTA 3EHDA 4NV3A 4B6EA 4NQZA 2VJDA 1NVDA 1Q0SA 4DR7B 2D62A 2RHDA 3E9ZA 2O3UA 3ICQB 1IONA 3ZK8A 2B6NA 1OXXK 1U5AA 4K86A 4NCNA 1RLTA 3WTCA 3NTOA 4B48A 1DAKA 1OXKB 4LDRA 4PLWA 5CT6A 5DISB 3V80A 1MG0A 2AK3A 2GTPA 1E20A 2RGYA 2WUVA 3AB7A 3E22A 3EF1A 3F4KA 3K0EA 1ZO8A 4LXIA 4RTSA 2CV0A 2HSDA 1BCRB 3HCDA 3EZGA 4V02A 5KHOC 1RZ3A 2QMZA 4EHBA 2FPGA 4MVXA 3CVJA 1HTBA 1EK0A 4TRRA 2K2QB 1OAOA 5KNDD 1OXSC 3T5DA 3PHIA 4UU8A 1XPOA 1CRWG 2MYUA 3ABQB 4LKRA 3HKEA 1ABEA 1RPAA 5FI3A 2ENWA 5K3DA 2PUWA 2CMKA 1G6OA 1KZ4A 1EDDA 2XD4A 2Y0BA 3ZC3A 1QNFA 4YPVA 2D1QA 3S1AB 4KW7A 1G3RA 2YVQA 4BKOA 2XAAA 4MYRA 2Q8PA 1JZTA 2WAYA 5CX1B 5LBTA 2Y9MB 1XU7A 3I3OA 4GMHA 1TB4A 2AH5A 3G89A 3QXXA 4I5DA 4IJMA 1US8B 4R8KA 1HE1C 3MYRA 1LGYA 1OVGA 1LV7A 1NWCA 4E5PA 4PM4A 1V39A 5AJXA 4BLOA 4DWWA 2FMFA 1ZW6A 5HZHA 5CK4A 4RORA 3T41A 3FD8A 5CBPB 7MDHA 1NDQA 5EWJB 4W5RA 1YQUA 4S3MA 4JSRA 1G66A 4NCBA