1ODLA

Purine nucleoside phosphorylase from thermus thermophilus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
234
structure length
234
Chain Sequence
SPIHVRAHPGDVAERVLLPGDPGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQTTGMGTPSAAIVVEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGRPYAPVPDPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRIGDPELAPPEVLQEGVRRMVEVALEAVLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Purine Nucleoside Phosphorylase from Thermus Thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
total genus 83
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1odlA00
1JDUA 1A9QA 4TXMA 5CXSA 3KU4A 1LV8A 1JYSA 3FOWA 3EEIA 3OF3A 1TCUA 4BMZA 4WKBA 4BMYA 5CCEA 3IEXA 1RSZA 4QARA 1U1CA 2HWUA 1M73E 1RCTE 1G2OA 4YO8A 4WKPA 2P4SA 4QAQA 1V2HE 5K1ZA 3OOEA 5F7JA 1OTXA 2QPLA 2Q7OE 3GB9A 3P0FA 2AI2A 1Z36A 1TCVA 4DABA 1ZOSA 5B7QA 4FFSA 1U1GA 1OV6A 1Z5NA 5IFKA 4DA8A 1B8OA 3DJFA 4EARA 1TGVA 4L6IA 1ULAA 1QE5A 4DA0A 3EUEA 4TTJA 1TGYA 4DAOA 1Y6QA 1Y6RA 4M3NA 1A69A 1CB0A 4MCHA 2A8YA 1NC3A 4D98A 4F1WA 5EPUA 1SJ9A 5FAKA 4I2VA 1PR6A 4LZWA 4UC0A 2I4TA 4GLJA 4TXNA 3NBQA 3DDOA 3E9RA 3OZEA 1Z34A 3ENZA 1U1EA 4TYMA 1JDVA 2GUWA 3KUKA 3OZCA 1VHWA 1Y1TA 3P0EA 1T8SA 4F3KA 2ISCA 3LGSA 4NS1A 1RXSA 4QFBA 2AI1A 1RXCA 4U2KA 3PNPA 3OPVA 2QTGA 4L5AA 1ODIA 1ZL2A 3FB1A 3EUFA 1OTYA 2XRFA 3PHBE 2H8GA 1JE0A 4H1TA 1JDZA 4L5YA 1RXUA 3C74A 4K6OA 4OF4A 1ECPA 3TL6A 4D8VA 5EFOA 4BMXA 4R31A 1PR5A 3KVYA 5CYFA 5CYGA 1V48A 5JPCA 5F73A 1OUMA 3KVRA 1A9PA 4R2WA 1T0UA 3D1VA 1VMKA 1YRYE 1ULBA 2OC9A 4TXLA 1A9OA 3BGSA 4X24A 3MMSA 1N3IA 4LKRA 3K8OE 4DAEA 2BSXA 1K3FA 1A9TA 2I8AA 3KHSA 5F77A 4OEHA 2A0XA 4OGLA 2QTTA 1V45E 1RXYA 4KN5A 4WKCA 4MCIA 1V4NA 3PHCA 4OGKA 1Z39A 1PK9A 2A0YA 2IQ5A 3UT6A 3T94A 1CG6A 1V41E 3NM6B 4TS3A 1JE1A 4JP5A 4TTAA 4LNHA 1RT9A 5CCDA 1Y1SA 1K9SA 3DPSA 3UAXA 5DK6A 1YBFA 1T8YA 1Y1RA 5B7PA 5C80A 2OXFA 4QEZA 1Z35A 1ODLA 2HRDA 2AC7A 1Z37A 3ONVA 1JPVA 1C3XA 4MARA 3MB8A 4G89A 4F3CA 3OZBA 4BN0A 3DP9A 1ODKA 1T8RA 4F2WA 2A0WA 3OCCA 4NSNA 4G8JA 5ETJA 5F7OA 4QATA 2HSWA 1RYZA 1NW4A 1PR2A 3ODGA 1XE3A 4WKNA 4M7WA 1PF7E 3FAZA 2ON6A 5B7NA 1Q1GA 4R2XA 1Z33A 4LNAA 4OY3A 4GKAA 4QASA 3NM4A 2AI3A 1Z5PA 4EB8A 2RJ3A 1SD2A 4F2PA 1JDSA 4ECEA 1OVGA 5I3CA 1PWYE 4GMHA 1JP7A 1SQ6A 1RR6A 2QDKA 3GGSA 1PR0A 4DARA 1V3QE 1YR3A 3UAYA 3LBAA 3E0QA 1A9SA 3O6VA 1T8WA 3UAVA 3OZDA 4PNPA 3SCZA 3OOHA 2QSUA 4D8YA 4RJ2A 1RFGE 4YMLA 3UAWA 3QPBA 4LDNA 4D8XA 1U1FA 4TS9A 3FNQA 5IU6A 1FXUA 1U1DA 4TXJA 1LX7A 4DA6A 4M1EA 3FWPA 1PKEA 5EUBA 3PNSA 3NM5A 4JOSA 1YQQA 4IP0A 4WKOA 1I80A 1K27A 1OU4A 4OJTA 1PW7A 5B7GA 3K8QA 1PK7A 4YJKA 2OECA 4GLFA 3BL6A 1Z5OA 3BJEA 4DANA 4DA7A 2OC4A 3INYA 1SD1A 3U40A 3EMVA 3IOMA 1Z38A 1WTAA 4D9HA 4TXHA 1Y1QA 3E9ZA 3DF9A 3BSFA 1LVUA 1ODJA 1A9RA 1TD1A 3LA8A 5F7ZA 5F7XA 5F78A 4NY1A 4JWTA 1YQUA 3F8WA 1JDTA 2B94A 4L0MA 2HN9A 3O4VA 4PR3A 1VHJA 3FUCA 3UAZA 1PR1A 1VFNA 5KB3A 4L5CA 2PGAA 5F76A 4G41A 1B8NA 4P54A 5CXQA 1PBNA 3KVVA 1NC1A 1PR4A 4E1VA 4YNBA 4TTIA
chains in the Genus database with same CATH superfamily
1NLUA 2QD3A 3ESAA 2ZIEA 2HA3A 1BX1A 3ED1A 1GKIA 3EGIA 4HDOB 4HTAA 5JXGA 1N3BA 1X0XA 1GPWB 3KOOA 5U9CA 1JI3A 1P0QA 3K5HA 4XLZA 4BS9A 3RT7A 2ZR8A 2NSDA 4B7ZA 3ZU4A 5CB4B 2DH6A 5CT4A 1H0HA 2YUTA 3E27A 5EQJB 1J0EA 3AR7A 4Q7LA 3WYDA 4DV4B 4J94A 3A4TA 2FGKA 2CCJA 2A1UB 2QRVA 1FOEB 5HZKA 2XBMA 2O8CB 3UM9A 2B2NA 1L5YA 1B76A 3DVRX 1HBJA 3LKDA 3CVVA 2FOLA 2ZSAA 1NP3A 3HCWA 4DLPA 4FYPA 3IDFA 2DZDA 3KEQA 4IH4A 1E7WA 1XZ8A 5JDCA 4TV9B 2RGUA 1E0JA 2ZJBA 3KWLA 4YJ2B 3A26A 1U2GC 1U7ZA 3Q7IA 2QX7A 4R1OA 4RF2A 5FBRB 1KY2A 1EJ0A 1PJBA 1QDUA 2FQ1A 3KHUA 3S2ZA 2AC2A 4DLVA 1DKUA 1X14A 2H65A 2QJWA 4MQEB 4OAQA 5JAUA 1UAAA 3ZCPA 2B1JA 1OFVA 5K1ZA 1KDOA 1QRDA 1M2KA 1JZSA 1U4OA 721PA 1CR6A 2ZZNA 1WW8A 3TW0A 4C4YA 1CUCA 3GCGA 2WJ3A 3HB0A 2DY0A 2IHTA 3EEQA 4EQZA 3P0FA 1Y9ZA 1GITA 2G63A 5ALYA 3AY0A 1RXWA 2WZDA 3H13A 3WGYA 4F9EA 4LS3A 3SQOA 1O96B 2ZUCA 4K6MA 4M46A 5JZBA 5CA0B 2BFBB 5CRIA 1WXGA 3KSZO 5EJIA 1L9KA 4QBIA 4LDJA 4KE7A 4G5RA 4MLDA 1R12A 5TE9A 5E1MA 2O05A 3BDIA 2H2IA 3KFLA 5JPIA 4AT1A 3WIDA 3F1LA 4CNQA 2MSCB 3F47A 1MB2A 1SXJD 3AC0A 3CZPA 3EIQA 3PYMA 2ZWAA 1B3BA 1FPMA 2CD9A 3CC8A 4HFJA 4ILKA 3TW4A 4O25A 2ISSD 4PYNA 2H4JA 4FBLA 4UAVA 2IDZA 2XUPA 3QBVA 4YFYA 3EWNA 4I9HA 4B7XA 4HBGA 3S7ZA 3NHFA 1W96A 2RB5A 3HHPA 3R7NA 3EFOA 3W6ZA 5GZ3A 4EW6A 2Y4OA 1FU8A 4Q9LA 3P1JA 1OAKA 1Q1NA 2WP0A 3OMXA 2H6EA 1YCDA 1YDFA 1YKSA 1JX6A 2PRSA 4US0R 2PBFA 2I2CA 3K7EA 4OSPA 3DSRA 1ZIOA 3HYNA 4IG9A 3VPDA 4HADA 1Z73A 3A2LA 4I2VA 4HK4A 2H18A 1EFKA 3K73O 4MVWA 2C3PA 2ODNA 3VC7A 5LWHA 1JAYA 2XDQB 3B3FA 3ROFA 5C2JB 1EP9A 3QBDA 1DT3A 1JDVA 2P7HA 3O75A 4P4NA 4ZDKA 5I8PA 1YD7A 5KQRA 1NXPA 2H9IA 4NKRA 2IX3A 1PTKA 3H9UA 2QYHA 3L5KA 2WAOA 1G291 3OZCA 4MDFA 4FHCA 4DBLC 4XVCA 2QMHA 4NDZA 3DWGA 4X8HA 4R7GA 4A8PA 3WL3A 1JFTA 2CV0A 3ER6A 4DR7B 4TMYA 1QGZA 3MSCA 5GZ1A 1VP9A 3JYQA 3ZDEA 4ZVOA 4L4RA 1NVUQ 3JQAA 4KR9A 3LY7A 3JYPA 3WQSB 1YT5A 2G07A 2YWXA 2Y3IA 2ZYVX 2D06A 5ICGA 5DTMA 4ALMA 1WEKA 2J9RA 4LIPD 4QLOA 3VPFA 1NBOA 4GBJA 5AM3A 2N9UA 2Y1EA 5I4KA 5AXBA 5BRAA 2ZIFA 4GBED 4U2KA 3PNPA 3RPEA 1PJZA 5BRJA 4B3HA 3HRKA 3A0RB 2I91A 5EINA 1UBCA 1WULS 5BQOA 2O7RA 4P33A 3UBMA 2NVOA 4ND8B 4XVRA 3WZMA 3X1JA 2IBSA 4KR2A 2PKWA 3HNPA 1XVIA 4TLEA 4XYBA 3SQMA 4E2YA 4Y2PA 1TC2A 2ZRJA 2C5HA 1XQ9A 4YMWA 4JBHA 4X1KB 1SR8A 4L5YA 3V4RA 1FSGA 1SH7A 1BVRA 1OIXA 3LXUX 2PXAA 3L49A 3B12A 2LUOA 1RIIA 3RS4A 3F73A 2RK6A 2GN0A 4RXUA 2C83A 4DDWA 3FHLA 3R3VA 1JIIA 4K2HA 4RABA 3FVRA 1N1GA 2PWYA 3TTWA 3Q9LA 3QQ5A 5C8DA 1L4BA 4NBLA 4C2UA 1AGRA 3IKMB 3KKZA 3CE6A 3DE6X 3W2GA 4L8VA 2VTKA 3D4OA 3SSMA 4FYMA 4ZIRA 1KYYA 3NVDA 3C1OA 3OJLA 1YHYA 3ASUA 1G3UA 1JB9A 1RI3A 4OA8A 5IDYA 5JCJA 4TRJA 2EHJA 4V0OA 1QFYA 3LKBA 5JRJA 1KSGA 1GADO 1T6ZA 2B21A 3NDPA 1AT1A 1I7PA 4IEFB 3RF6A 3ZZUA 3JTEA 2FZKA 1HEIA 4BWVA 1SUCA 2I7CA 2QV0A 2BF4A 2R2GA 5FL3A 4AIIA 5KU1A 1PE0A 3UMYA 1FC0A 1J1UA 5FBKA 3B2NA 3W0LB 1XMJA 2BFDA 2WOOA 4JI1B 1P80A 3WL7A 2BGMA 4Z4HA 2FN3A 4X24A 3NBKA 4JDPA 3LL4A 5EXTA 4DMRA 4X1KA 1LPNA 1N2SA 2Y1XA 1KI1A 5JLJA 5JS8A 5M7EA 3W6OA 2W93A 3EUWA 1QJ4A 1S02A 2PBZA 3EASA 5UKDA 1EFTA 2MWMA 3P9NA 4GZLA 2NGRA 1YB1A 3ORRA 4II2A 3UVEA 5BWOA 3WBKA 4BJ1A 5KCZA 2Y92A 3ZU2A 2W6JD 1KFJB 2H57A 2H5EA 2POCA 3UHOA 5KTSA 1PHPA 3K3PA 3GCXA 3L0SA 3ELYA 5D3MB 5FPTA 3E81A 2XWQA 2WU8A 2O1EA 4QGAA 2AE2A 4R6XA 1YL5A 5CYOA 3UANA 2FPIB 3V8EA 1ZXLA 2ONYA 1L7XA 5ER9A 1P2SA 4ALLA 3GRYA 1HYGA 4L50A 2CVFA 4BXOB 4DGSA 2JBWA 1V4NA 4IX1A 2D1RA 1T13A 4RORA 1ZGAA 4TLDA 5M29A 3SMQA 2WF7A 1YQGA 4M9XA 2QP9X 4OPMA 4J75A 4A15A 1LV7A 4Y2XA 3BD6A 1HE3A 1ORRA 1SUEA 3GGGA 2VPIA 1V41E 2FMXA 1TMOA 3D8SA 4K26A 2QHXA 2XMZA 4KO4S 1BRMA 2D2FA 3B6KA 4JP5A 4GX0A 4MQMA 1PNOA 2BEWA 3SDZA 2XEXA 3HCDA 2WE8A 4FNMA 4YWJA 3HDJA 4P0TA 1XCOA 1UXJA 3PIIA 3FPEA 1G2IA 4OAPA 4HSEA 2B69A 3DE0X 5KDLA 2F3TA 4BASA 3DPSA 1UAGA 3ZV7A 3KB1A 1TAGA 4ASUD 1QH9A 4KO2S 1IN7A 1YJBA 1P4AA 4WXHA 3IEVA 1T8YA 4LJYA 3TLGA 1NXTA 3HSSA 1ANKA 2YZ7A 4HWOA 1G19A 2ECKA 3H5LA 4LHEA 2P8SA 4MS1B 2JA2A 3EQ2A 2HNBA 4QEZA 3AX6A 3PU6A 1L5RA 2AOWA 2QN7A 3Q40A 3U4MA 4KQXA 1LRKA 2Q3EA 4DVGA 4M36A 1QYRA 1I3KA 2AN3A 4A4DA 5ITZA 4JYAB 4YRZA 3EZYA 3IP7A 4CM5A 4XD2A 3CKMA 4FILA 2CJPA 2QSYA 2BZGA 5EZYA 1C1DA 1IVNA 3HMKA 4P4TA 4PEVA 3RWBA 4HXYA 1R0SA 4LQ4A 1X2EA 5HF8A 4LBWA 3B7WA 1C4XA 1KMHA 1L3IA 4W9RA 4RTMA 2HYDA 2EFYA 3C7KA 3EIEA 3TM4A 3A4YA 2C7OA 1CWUA 1LNSA 1ND5A 4F2WA 4ZMRA 4UTVA 2G82A 1XAIA 4FMDB 4QATA 3S99A 1STOA 4B3MB 2I87A 2PT7A 2HSWA 2IQIA 4IIDA 4OX9B 2PMCA 5GP1A 4DT1B 3J80A 2NACA 1AG9A 3C7TA 3CEAA 3G7UA 5A1JA 2YYYA 2HHHB 3ANXA 3B6IA 3KOYA 4W9NC 3UJAA 2R5NA 1FJ2A 5DTIA 5HZGA 5K3DA 3VI4B 3ZW7A 4OQDA 1FLDA 2B9VA 3F1KA 4AUMA 2GEDA 4XUGB 2YJ4A 1SKQA 2IK8A 4LNAA 3RVRA 3EN0A 5A0TA 2P9EA 2HQSA 3AOEA 3OM8A 3LHIA 3PNLA 2OFFA 2BY4A 1CQJB 2VDKB 4CMBA 4YRGA 3IV9A 1Z4NA 4MUJA 4GKKB 1NKVA 1K9VF 4U4AA 4JI3B 1NJFA 2VPXA 1ACJA 3DMRA 5AHRA 2W58A 4JR0A 5KTOA 3THWA 2UUCB 5A9SA 1U3VA 4JV5B 5E1DA 1OU0A 3I9MA 3KZMA 2IYSA 1BVUA 4LBZA 5HF9A 3OE1A 1R4ZA 3CLUC 4GMHA 2FP4B 4MR7A 2BAGA 1RRFA 2YWRA 4XB2A 1SQ6A 1UP6A 2JJYA 1O0SA 4TVOA 1PLLA 5IUNC 4DXHA 4FX2A 1M8GA 1U98A 1TM3E 5IYZF 1Q57A 1ZM3A 5K05A 1O5OA 3KKOA 1A4IA 2YDXA 3H5AA 4HDAA 4REQA 1HPLA 1V9SA 2XGJA 5JJLA 1RM0A 3G0OA 3MTAA 3DDHA 1G20A 3OBIA 3QOFA 4EHDA 4HV4A 5AW4A 1VG8A 5D3ZA 3BRCA 3GGCA 1KJYA 1CJMA 5HK8A 1YB7A 2OLJA 3R9KA 3PXDA 1FMTA 4FHEA 1CC1S 5SZIA 3TMAA 3C1AA 1O6GA 2MU1A 2X8JA 2O52A 2CGEA 2M6RA 1AS2A 1H6AA 8OHMA 4G0PA 5HSGA 3Q7SA 2VSNA 5DM4A 3AO0B 1FFAA 2FDRA 1QTRA 5AW6A 5EGSA 3CZQA 2Z5FA 4YMLA 3NDBB 3S5JA 1U0OC 5FOQA 5BUQA 5KIAA 4C7OB 5J9FA 2TMDA 4A0GA 1XN1A 3AEYA 4WERA 3ZVNA 1U3TA 3C14C 3HWX1 4GSLA 1QIDA 2PUBA 4KXFB 5JMWA 1XZQA 1N2XA 4JZKA 2UVPB 1U1DA 2WUWE 4TZ0A 4KU4A 1BVYF 3I64A 1LBQA 4ZVUA 4BZPA 1MP0A 2EKBA 4QQFA 5DMHA 5EE0A 2E4ZA 1UBEA 1E2FA 4EATA 1T4MA 1ZNQO 3CEPB 1Y81A 2GCNA 1ZITA 3EZNA 4X64B 1DAKA 4KKXB 1I2DA 5EUBA 2FXVA 3PQEA 3RSLA 2QEQA 2QVLA 4FE3A 3M1IA 3PPYA 1YNSA 5TSDA 3TD9A 1QYIA 1ORIA 1QGUA 3NC1C 2E7ZA 4HH4A 3DTNA 1OLOA 2WV9A 2QD1A 3IXQA 3LIPA 3RVNA 1K8YB 3W1EA 1KY5A 1QZXA 2J9GA 3BMQA 4LZNA 3KLPX 2ZS7A 3NNNA 4MQEA 2NV0A 4D9FA 2X1MA 1HDYA 3DQZA 4BIMA 2W7TA 4EG4A 2ODQA 2EJWA 3BK2A 2ATCA 4D0GA 1T3ZA 2JCYA 4L4UA 3ZCVA 3KQLA 1VZ3A 2H1RA 4DQKA 1TM1E 3X2SA 4PTLA 5HPYB 1G66A 3WGIA 4KIGA 5D1NA 4EFKA 3CE9A 4C2TA 1SPXA 5IRCD 1P7VA 1RQRA 3EBLA 5C37A 2OYSA 3GDOA 4OUKX 1P1CA 1H69A 2AC4A 2O2ZA 3A3PA 1MQSA 3E53A 5EIWA 4YRMA 5JBNA 3AP2A 4XJVA 1RHQA 3OPMA 3OQMA 1ZFNA 3KSMA 4OXXA 3WNBA 3A2NA 3I1FA 2W8BA 4HFNA 4YP0A 2V7PA 1YUBA 1V5IA 2HCBA 3WTBA 3U40A 2QNRA 4FFDA 1KARA 3HJHA 1AKEA 2JFWA 3IQWA 1Y1QA 2JIZD 2J48A 3D8HA 3W8EA 3ZWYA 5IJ0B 1S4MA 3AOEC 1GNPA 2Y0BA 4HZUA 4K46A 3ZWBA 4OHYA 4TYWA 4JITA 4IIVA 4UAUA 3PJDA 3QVGA 2R44A 3OAAA 1KXZA 4BO4A 3HDGA 4JJKA 3DOJA 5IJAA 1QNFA 4W1RA 4QGSA 1RJDA 3QEAZ 2UUAB 1D5CA 3RUFA 3URKA 3PVSA 3IBGA 4XYGA 4H0FA 2BH9A 4O2BA 2QAIA 4EHLA 2GFIA 3EODA 3GQBA 4UD6A 2IWRA 4JA2A 1ZK2A 2DR3A 2JHPA 3IIMA 4OP3A 2YYAA 4QBGB 1DAMA 4GZ6A 4D9EA 2A5FA 1UK9A 2XSZD 4KBYA 5AI6A 4ZHSA 4W5NA 1IWPB 5JCZA 4KFRA 1DWUA 5J4LA 4OXIA 3C70A 3WB1A 5I7VA 1N9KA 1RKUA 3ZHOA 4PR3A 2ZKLA 4RTNA 1J7JA 4LXGA 2UUBB 3LE8A 1N6IA 4MHOA 4QXPA 1FNSA 5BVHA 2HFJA 4TMWA 1IY9A 1VFNA 1R6XA 3VMMA 2AFVA 3ZHVA 2VUHB 5KU7A 5DSTA 3TG2A 1FK8A 4LYEA 1U2TA 4O33A 2MSLA 3AEKB 4I99A 4KNVA 4LGYA 4Q9NA 3RSHA 5E95A 3VVBA 1PG2A 1BFUA 4LHYA 3JZDA 4V2UA 3UB2A 4LJAA 1M1NA 3MWJA 4P82A 5KWSA 3PNMA 5TF4A 4ND5A 1QRTA 1M2VB 1VLMA 2QVXX 5F4BA 5HF6A 2FSFA 4FMCB 1JUDA 4HGOA 5CURA 1XZBA 2QU7A 3GEEA 3L18A 3GLUA 4X44A 1CRPA 2Z6UA 1UBTS 4DKJA 3MJVA 2I80A 4KGZA 4XSHA 1H0SA 4A23A 3M6WA 4I8XA 4Y1GA 2PL1A 4DXAA 3GLGE 3O1IC 3RVDA 4DMUB 3A6ZA 3RRMA 4D9KA 3K5WA 2YWGA 1XVVA 4J07A 1FUKA 4X7MA 3SHVA 2NU6B 4HFRA 4DSTA 3ZPXA 2R9VA 4TRNA 2D5BA 4Z51A 4WZBE 5AVQA 3MOIA 2D5AA 2ZRKA 2QRPA 5J1SB 4NTZA 1L4UA 2P3OA 5EKDA 1YBAA 1FPQA 1U7DA 4Q1DA 5AVZA 2P0YA 1E3EA 2QRMA 4KWEA 4Y1RA 4Y7DA 4DIOA 1UZNA 2FFJA 3GEDA 2FB9A 1J1IA 1JIQA 1LSSA 3AB3A 3KXKA 1HYBA 1M1NB 4IHJF 3UGQA 1TQ4A 1U9JA 2LBPA 4D9NA 3EHEA 1P0CA 4AZ3B 4X1YB 4JR2A 4HAXA 3FWKA 1KGDA 1UC5B 1X1RA 3WGUA 1RCTE 2FEOA 1QGYA 3GLGB 1QK3A 3EFEA 4BKUA 3IQXA 4L78A 4QWMA 5BXQC 3ICWA 3HGTA 4TGLA 2X9LA 4FEYA 4YO8A 3TAUA 4LNUA 1QVAA 1YIDA 2QL7A 3I23A 1TK9A 1W4LA 2ZE7A 4E51A 3ZQUA 4QODA 1F5SA 1IJKA 5BP7A 5F9FA 1RIFA 2KJQA 2Q50A 4I4LA 3SJAA 1QMPA 4FDMA 1MA0A 4E4TA 1XYGA 1PAUA 2KSQA 3T0GA 3WKBA 2Z5GA 2JGAA 5AJXA 4R83A 3RVBA 2MMGA 1XMSA 3SEFA 3GRPA 4QBKA 5KHOC 3O8OB 2GPNA 1U8CB 2P6UA 2ZCVA 5CFZA 4JLSA 3SPXA 5F33A 2NUAA 1U1GA 3A36A 3AJ8A 4GGPA 1MC8A 3LPAA 3QKRA 4N03A 2GEUA 1Z5NA 3UMBA 3PDIA 2ZYWX 5IFKA 5HKLA 1P19A 4YIHA 3WLOA 3A2KA 1EBUA 2D62A 5K8LA 3F74A 2BFBA 2HF2A 4ZALA 3CVOA 3RRFA 4PX2A 1Y8RB 3G9ZA 3Q9UA 1CR0A 4CV0A 1SRQA 1Z06A 4KRGA 4AROA 1X1DA 1WEHA 1J06A 2QAGC 1DBSA 1AKNA 3RROA 4M3NA 3RJMA 4TWRA 5CM9C 4WXRA 1A1SA 5FL7A 2F3UA 4DCJA 2JGDB 4N3BA 5BWLA 4GWLA 4U0JA 5H83A 1X19A 1ZGJA 1QV6A 4UBLA 2C96A 2J3HA 4KXVA 3L79A 1P2FA 2BT4A 3ENKA 2OO5A 2GWRA 3K6JA 4ABYA 4CR7A 4TTPA 2YY5A 4G0VA 5IM4F 2AOUA 2W2OA 5BN3B 4RCYA 1XZIA 3AGPA 2HO5A 3WVNA 3TFWA 1FRZA 5FQNA 1TQDA 1GGEA 5EY5B 3HUFA 3LX4A 1NN5A 1BYIA 1P1HA 2JJ1D 4HWSA 4NABA 4RXMA 3ENZA 4L85A 1GVHA 1W4BA 3A4LA 2FK8A 3JAKB 3VYWA 3WGMA 4YX9A 2XRZA 1AHIA 4EY5A 2EBWA 3ZI0A 4HWGA 2OCLA 3I8OA 1XB2A 1ZNXA 3WV4A 3HXOA 1ZIXA 4RMHA 1U1IA 4BNXA 4BCDA 3NW9A 3QF7A 1N2HA 2B82A 3NHUA 2A9VA 5L40A 1H94A 5J3JA 1JKIA 3OEEA 3TSCA 4JL6A 5WRFA 3GNQA 5K2OA 4J0KA 3THOA 3WDKA 4XPIA 5I51A 3AVWA 3NGMA 5CG2A 1HC7A 4MVJI 2TSYB 5BSVA 5E7MA 1N2BA 1B1CA 5AKIA 1QCYA 1GYRA 1YGYA 3PQ7A 4MLZA 3IXMA 1D1PA 5DRYA 4ZVKA 4FLFA 3NZEA 4GOMD 1NIJA 3QUTA 5LZ5A 4URYR 3FZEA 3RM3A 3LT2A 2LP4Y 3LC7O 4B6RA 1Y6GA 5TJ9A 4AW9A 1LX6A 2GUGA 3WRWA 3FVWA 1P61B 2VDNB 1ZN9A 2PX2A 3DHEA 1OWLA 2WJWA 5KI6A 3IQDB 1XTSA 2H2WA 2CLFB 4CCYA 5K0NA 4LOKA 1BCRA 2ECOA 2X5XA 1F8XA 3HKDA 3N0VA 3RABA 1PS9A 1RXUA 1XA0A 1K63A 1O57A 3C74A 3CZ9A 1RRVA 4BX3A 3AUUA 1L5WA 4AIRA 5IDXA 1U7WA 3CZ4A 1HY3A 1X1QA 1O1YA 5I48A 5KBYA 1NUAA 2BFWA 3QLJA 2IGBA 1R6VA 3DMNA 3LW8A 2HPVA 3AW9A 3MEQA 4MRPA 4XQCA 3GOHA 4C4XA 2HW8A 2JF0A 2Q3DA 3T0IA 5IASA 3Q6NA 2Z30A 1ONOA 3DKIA 4EZBA 1YQXA 5CYFA 1RBMA 5K7SA 1K4KA 3T5AA 2OGSA 3O0DA 3O1LA 1V1RB 1CR4A 1JR4A 1SURA 1IQPA 2Q5IA 1P8AA 1NRJB 1U94A 2OCAA 3QV2A 5H9VA 3EG9A 2PSDA 5T5QA 3OUUA 5JLAA 3S2SA 5F1PA 3UOWA 1GNRA 1SXQA 2PLFA 4IV8A 1DJNA 2OVBA 1QK4A 1ECGA 3RVKA 1Z0SA 2OLKA 2WTMA 2QTCA 3B85A 2VHTA 3NHKA 4RSGA 1JFVA 3GJ8A 1GJRA 3A6DA 3DCYA 4KPGA 4O4IF 3RUHA 3UB4A 5AI0A 5J2UB 4LVUA 1D04A 4KMRA 2R1UA 3OTIA 5C31A 3HL0A 1KKUA 3M0EA 5I9BA 4K9OA 4OM7A 1IUOA 3A9CA 2HIGA 4JKYA 1GQ2A 4MVJE 4HNTA 1NSFA 1XMPA 2PPLA 5IPFA 1KTIA 1WCXA 4R1MA 3DNPA 2ZJ4A 3MWEA 2PKEA 3C3EA 1WMFA 4C78A 4W5OA 3UMJA 3KTDA 1NJGA 1SUAA 1JAIA 1FS5A 4TWBA 4OEHA 4ZEOA 1E59A 1T4CA 3CZRA 4RD4A 2QTTA 4INPA 5G4LA 4O2AF 2JAHA 4WKCA 3QBJA 3HCFA 2IZ0A 5A3SA 3ZDQA 1BQ3A 1EEXB 1FX1A 3VSDA 4M38A 3NT4A 2REQB 6ABPA 1L5HB 1GGKA 1Z7EA 4TMVA 3KX2A 1VMDA 3DXZA 2O2JA 1EKXA 1ZD2P 3KYDB 3JRNA 3BB3A 4I5GA 4EB0A 3LYAA 3RCBA 1AKMA 2IQ5A 2JIRA 1J5PA 4I2NA 3K8ZA 2DHRA 4Z1OA 5EMJA 4F92B 1RYDA 2GJ4A 2GA8A 3HDVA 4Y0NA 1QP0A 4R81A 4ZVQA 3I53A 5FV7A 4OIMA 3D8NA 1J8MF 4LY9A 4RV9A 1NDUA 4MTLA 4E5UA 2Q2QA 5B6PA 5L3SA 9MHTA 4K87A 2AQHA 2PS3A 1DG1G 5FUXA 3DO8A 3WIOA 2DFNA 3KEFA 2IU4A 3X1YA 5ALVA 1A76A 1BMTA 2HNKA 2UVPA 2D4AA 3Q5GA 4ZICA 3CUVA 3NUGA 3PDJA 1KK2A 5DK6A 2OBFA 1Q77A 5ES4B 1A72A 1K0UA 2B8WA 3GO4A 5DBFA 5IW8A 4ZDJA 5EC8A 3FWYA 3SD7A 1BQ4A 3H5WA 5A0FA 4P93A 4YGXB 3GLFB 2LGJA 1FDUA 1QGDA 4HEA1 4JS0A 5DNAA 3SJCA 5IVKA 2J0EA 2JBAB 2G1AA 4GYJA 1MEEA 1VKJA 2WHYA 2YN4A 4YRPA 1VIVA 5GAJA 3I5YA 2CE2X 4QUGA 1KQ3A 4KAXA 4LDRA 3U0BA 2ZTLA 3HN6A 3UA3A 3QYAA 1CLEA 2WSYB 1ZD4A 3DLCA 4LJKA 2C8KA 4JELA 2PH7A 3CW9A 4M4SA 2BGTA 2WTEA 2PRIA 3K6KA 2PMKA 5DVZA 4UBNA 4G85A 4BAUA 3LUAA 4OXNA 1XMOB 1LU9A 3BGDA 5EHNA 2MSEB 2R6CA 3UMVA 2FPWA 1CX9B 3R2JA 3KJNA 1GV0A 3F5MA 5EZYB 2VJOA 4IMJB 3C6ZA 2XB2A 2F3SA 3F6SA 4ZV7A 4GXQA 4J76A 3M5PA 5EI5A 2YYZA 2O2CA 4AMGA 3S8EA 2JGRA 2D00A 1ONBA 1MXFA 5CMLA 2ZIZA 4W9MC 2HY7A 4LWOA 2XIJA 4OTZA 4W1QA 1TVKB 1H2FA 3D6TB 3ZG6A 3VR4A 1OQAA 3R7WB 4C43A 2D1SA 4FKBA 3ROQA 1OYYA 3OKCA 3MFQA 2P0AA 1XE3A 3ETCA 3DZHA 1TPYA 2XKJE 3OU6A 4TZTA 3HUTA 4YY3B 4DB4A 1GR0A 3I6IA 2YJ6A 3QX9A 2J8ZA 5ARCA 3D43A 5F3WB 2Z8YM 3KQSA 3MJEA 2O2HA 2BZ0A 3KU1A 4PX3A 2DKNA 2GHRA 4WT7A 4BNMA 4ER5A 2Q2OA 3LQKA 1W59A 5DJ5A 4K9SA 2I6FA 2VF8A 4BCCA 2NU9B 2VHEA 1YR2A 1YE3A 2ONCA 1QRSA 2OZLA 1B3RA 1YS2X 1ZW1A 2DWUA 5LYYA 4ZQGA 3Q6IA 3WNCA 3ZUGA 4FB5A 1MOPA 2PWAA 1RKVA 2UVQA 2XYRA 5IXJA 4OU5A 1A82A 2C4UA 4YCDA 4OHKA 4PO8A 2CB0A 3EW7A 1JZQA 3GJ7A 3VR6A 5AHOA 1B8UA 5E4FA 3CRW1 4Q4LA 1X70A 4B83A 1A5AB 3DFUA 3LM8A 4CFYA 1WCV1 4I5DA 4HATA 3NOVA 1NJ5A 1Z6PA 4WDQA 2V3VA 2WK1A 2ZWOA 2JHAA 3B9QA 3TGWA 5BUCA 4DIUA 3GJXC 5LC1A 1SWVA 1NMSA 1U3WA 2NQ8A 4YAUA 4BU0A 2A7XA 3MFYA 3L43A 2QAJA 4GYYA 4WTOA 4HVLA 4BO9A 2X7XA 2WFLA 4DQXA 4P3OA 4EPWA 3AQ4A 2FDCA 1H0RA 2QB5A 2H17A 5KTPA 3SHOA 1XJWA 3NORA 4ZT5A 1J2JA 1Z5GA 1A3CA 3KKNA 3TJRA 4MV1A 4E11A 5HR5A 2ZE5A 5JCXA 4YCJA 1BHQ1 3RHTA 3HNRA 4O4HF 2OA0A 4JLPA 1MF7A 4LWQA 3OZDA 4YQFA 5JHHB 1QOPB 4HWTA 5HRAA 1T15A 4I6JA 1CT9A 4P4GA 4CIAA 4BGDA 1WR8A 1M7GA 2PGDA 3BM5A 1F51E 3OLXA 3BXEA 1PTJA 1JDNA 5AICA 3GP8A 4M9CA 4PFKA 4QDUA 3QTLA 4LDNA 4D97A 1JEYA 3CHYA 3KXLA 2GXUA 5CB8A 3KR0A 1Q22A 2C9YA 1N6OA 4UEKA 3R41A 5EZQA 1N2GA 3IP8A 3SLGA 3G8YA 5A9RA 4PXYA 2ID7A 4MWBA 3C85A 3VYTB 4ECAA 1OA0A 2CL6X 4V1CI 4ZAGA 4MK4A 1FXUA 3P8ZA 3FX2A 4Q6WA 5DWQA 4NJMB 3R09A 3GH1A 2IIBA 4TRRA 5HGJA 2FSHA 5BNFA 2AHRA 2W11A 1T6NA 2YFQA 3SC2A 4LXTA 4EB3A 5T6BA 4B3GA 1NFFA 4BAGA 1QQ6A 1CTQA 3BGIA 4FYXA 1M33A 4X85A 3W9YA 4DA6A 1GQQA 2O2IA 1V7QA 3CPHA 3GLSA 2XMSA 4UTZA 4X8MA 5ESWA 2OV8A 3RFVA 2FQXA 2AX3A 1V6AA 2LKDA 2LPMA 2NXJA 5AM1A 2VK1A 4JOSA 2CUNA 5IXSA 3AILA 3I6MA 2C3MA 3FNHA 3I83A 3I5MA 2ODAA 2BFAA 4YYEA 3EH2A 2XWPA 4DCTA 1JJVA 3TZ6A 4F4IA 4YJKA 1AQNA 1GU1A 4NHEA 3DBRB 5A6SA 3S4YA 1E20A 1TB4A 4G1MB 3SS9X 4Z0PA 3HV0A 1LB1B 1M66A 3DM9B 3LYLA 3MUNA 4JYBA 3TKYA 1SGWA 1T5DX 4NZNA 1F2TA 4ZK2A 3JZMA 4EUFA 1G55A 1USVA 4EYKA 3D0RA 3HBAA 4JP8A 3COPA 3AONB 4LUCA 2C9MA 4FYIA 1CZLA 2EJBA 4N7BA 3W9UA 1FY2A 5ALXA 4D2IA 1U8EA 1F4VA 2OG2A 4DR2B 3BWVA 3ILSA 4DUGD 1I3MA 3CY6A 1Z75A 4C05A 3CH4B 3M7IA 1N9GA 1TEVA 3F0TA 4MV6A 1N2IA 1RQPA 3KD2A 1BVHA 1T3HA 1AC5A 1KY4A 2GLXA 1SUBA 4MQFB 4FC7A 3VSEA 2P68A 5AUOB 2XHEA 1GQOA 4GGMX 4JC8A 4TXHA 5FOSA 4YMVA 2YH2A 3DBRA 1ODJA 2FPLA 3ZGVA 1A27A 4CF7A 4KQMA 1IPHA 3N8KA 4M53A 3ZZTA 8ATCA 3IQZA 2EKZA 3L1KA 1IOLA 1YAJA 2QZ4A 2XVXA 3HA3A 1ND6A 1B0PA 2DSNA 2XE6A 4FI3C 1ZD5A 1FTGA 1QC5A 2OBXA 3OFJA 2Y76A 2JGFA 2OFWA 3SBDA 5B64A 4UUBA 1JDTA 2Z98A 2CKMA 2WWFA 2OXTA 1D5WA 5GV8A 4RKWA 3OT1B 2F9MA 2WJ4A 4DYVA 1JXQA 1ZQ9A 3A6FA 4GHWA 4BB0A 4KXUA 1JPUA 3WJ7A 1IZ7A 3PG5A 1WBDA 4KTTE 2BR4A 3USZA 3HZZA 5GWXA 3W78A 5ED4A 2F2TA 2PZFA 3TTSA 5ALGA 4L5CA 4ESHA 5K8VA 4CEJB 2Q1UA 5FAXA 1T9CA 1QYDA 1BKYA 4JENA 2JD0A 1KOJA 4GOXA 4KODA 3W2EA 3LUJA 2NSJA 4V0LA 1BA2A 2BFDB 2WHRA 3WX0A 3K1YA 2GHTA 1F9EA 2GK7A 4WN9A 3WQRA 2IZ5A 2H1IA 2FG6C 4CEHA 4O3MA 3WKDA 2V7UA 3JX9A 3A37A 3LX8A 4Q24A 1JRLA 4TTTS 3OQBA 3W3AA 2EBFX 1OFIA 3FBWA 1BE1A 2B3TA 3FYHA 4XX1A 4GEKA 1YB6A 2XYPA 1U3CA 3AV0B 3MUFA 5TC4A 2RKWA 3R20A 1NWCA 4TTQA 1FTSA 4RQAA 3UV7A 2LD4A 4A0RA 3ABOB 3F9IA 421PA 4EFLA 2FZ4A 3QEBZ 5TQVA 3VA7A 1QWOA 2HRQA 2OORA 4B34A 1HT3A 1PJSA 1RBYA 1XRMA 1MX3A 3DMTA 4MUEA 1QU3A 2F9FA 4B43A 1H8HA 3LWDA 3WB2A 2G08A 2HF7A 1JQDA 3QFHA 2DLCX 3T7RA 1I7LA 4IO0A 2OCXA 4ER3A 5DTQA 4XM1A 4ZVMA 3KU4A 5B3KA 3TLBA 3PL5A 1X15A 1XR3A 1I4WA 2QG9A 3TYXA 4CM4B 1PNTA 1N6HA 2G80A 3AL3A 4MUIA 4O5OA 4X94A 1TA4A 4UU1A 5EZSA 4IGIA 2QX9A 3U16A 1CXZA 1XJCA 3KLOA 3T95A 1X92A 1J2TA 3A1WA 1GGHA 3TTVA 1DAGA 1MNQA 1NVKA 2NO5A 3E1GA 4ZK6A 1GNLA 5CVCA 1J24A 1G0NA 3NTVA 5F21A 5CCEA 3HXMA 1H2EA 3NKFA 5JYDA 2JGMA 4YXWA 1OOEA 4NFHA 1A2BA 2P62A 3QYPA 3QHPA 2YOFA 4AKGA 3PVCA 4GKVA 2O5CA 3RJTA 2QW1A 1HMPA 3VC3A 1G8KA 3ZHCA 1SVNA 3TM5A 3T3HA 3FBTA 1P1RA 2QM0A 2W70A 3KQPA 2GNOA 3S2EA 4ZEMA 5KQMA 1B0ZA 3OQPA 1IN8A 3ABSB 3C7AA 1JQLB 1TRKA 3GVPA 2O3SA 3KKPA 1AKVA 2IYRA 3C5CA 2I3DA 3OAAD 4P92A 1NM5C 4CZ2A 2X0FA 2AX4A 4B8WA 2V6JA 2XNJA 4UNPA 1T29A 5KQPA 3DE4X 3ILVA 5DHFA 4DABA 4O1IA 2JIZA 2PSFA 3T35A 3L8DA 1IONA 3F3KA 2HSDA 2R62A 4PO3X 4ZAFA 3DZFA 5FL7D 1T1GA 4PLPA 3FSRA 3SOPA 3Q10A 2J9ZB 1N57A 2W2LA 3L4EA 2PXXA 3JW8A 3PV0A 1P1FA 4QOEA 4NR0A 3KDPA 4V0RA 4L6IA 2B78A 3EXFA 1RI5A 2FH5B 1Q3KA 5MF6A 2O19A 4BQNA 1XWFA 4JJEA 3PB3A 2GO1A 4BX2A 1AHNA 3TQTA 3V46A 2XZTA 3DYIA 2BRUA 5LDHA 3QE3A 2OT3B 1XNRB 2BHTA 2OXEA 1E3JA 2Q3JA 1ECBA 2EW1A 4HVAA 3RAEC 1E64A 2UZ3A 3GLQA 3ZGOA 2ZYTX 4LXUA 2HF8A 4WUVA 2B20A 4ZYXA 3C1UA 3P9ZA 4PAQA 4GM4A 4F45A 4C06A 1N4DA 3N70A 3OLVA 1VKNA 4BZZA 2BUAA 3CA8A 3OHSX 4DA9A 3WIEA 2V3CC 4JLBA 2VAXA 3K2BA 3LLUA 2CFOA 1OFHA 2NUPA 1JA1A 3IDZA 4QXRA 2BVNA 2ZJ8A 3L7MA 5IF3A 3CF4G 4EY4A 2DUUA 4PONA 5IJWA 1DUIA 1HLDA 4GX5A 1IZ9A 5L3ZA 3CR3C 4O4LA 5AVUA 4PTYA 1LS1A 1HEUA 1KVSA 3MCUA 3VDRA 4Q9KA 1QUEA 1U28A 2OHVA 1X13A 3BK7A 3OU2A 4N0EA 4Y1FA 3ZWWA 2O2XA 4HGQA 2JLZA 4L7QA 2L19A 2FP3A 3P4YA 4KW7A 4J3FA 3V6LA 2HQBA 4X6YA 4Z54A 3RU2A 2HU2A 2YHIA 3HP1A 3M6IA 3CSSA 1IK4A 1BEEA 1IEXA 2OOKA 4URFA 2JASA 5F4ZA 4P2GA 2C98A 3TKLA 3ENNA 3FNEA 1A7UA 3P9RA 2ZI3A 4CMIA 1S1CA 3KUDA 5CFPA 2V55B 1PT7A 2RIPA 3WIBA 4PX5A 3S6JA 2DTDA 5ITVA 3AIKA 5DM60 4MEAA 2ZDGA 4W99A 4KH0A 4N01A 1U5BB 3I01A 3CLSD 1ZUHA 3LP8A 3MPOA 4UJ3A 4YXFA 2GM3A 5F52A 4H3HB 5ALUA 2ZUFA 3Q0TA 3WRXC 1FNBA 4GKJB 1E9VA 1N2CE 4JUAA 1TM5E 4TQGA 3I32A 4ONEA 2R2AA 4GT1A 1NDHA 4JAVC 3LQ2A 4WEOA 3R7WA 3TL2A 3VH2A 1LW6E 1GZ4A 2IEYA 4U39A 4CM3A 1NRIA 4OF4A 1XALA 2GB4A 1X7ZA 4I55B 1CJTC 1W88A 4IHJA 4J0QA 4MR9B 5F98A 5EUMA 1OX4B 3SFZA 1I2BA 1K7XB 2H1WA 4W1SA 3IMEA 2GBGA 2HJSA 2VDOB 3I2JA 1LD3A 2FSIA 4ZU1X 1U31A 1YJ8A 4WXPA 2SKDA 3EAFA 3U6BA 4IR7A 4EA7A 4ENUA 2F00A 3T06B 1G1MA 2QMZA 3IESA 5IMSA 1OUMA 3PSAA 4HDMB 5E6SB 3VR0A 3I4FA 1ZG3A 1CRZA 3WGVA 3PIDA 4OQEA 5JJIA 4I4CA 1U99A 2O0HA 1E62A 3N7AA 1WS6A 3HJTA 3LF1A 4KFTA 4EW2A 5FI0B 4B6PA 1CRQA 2JGNA 2P2LA 3FPHA 2V5UA 3PX2A 1XWWA 1DEAA 2YFYA 1I2ZA 1I3NA 2VWHA 3EQ7A 4A27A 1FQJA 2XSZA 4FIZA 5T4EA 4M49A 4MP3A 3T5DA 3L6OO 3VTAA 1TVMA 3RVJA 1LDGA 3MMSA 3SEZA 3CSDA 5IXYA 1F17A 5JTTA 2RH9B 3DOIA 3FPFA 1HQKA 5A7FA 3AFGA 2AB0A 2AG8A 2Q6OA 1RHRA 3HBJA 3ES9A 3VPGA 4UHJA 2C2OA 2E55A 4B47A 3LH5A 4Q39A 4E33A 3KHSA 2VAVA 1ISGA 2G83A 2PXHA 3EC7A 4IDPA 4MQ5A 3I45A 2F6RA 1IDOA 1VE9A 1XDWA 3U19A 2O5EA 4DYHA 4ZYTA 2FEMA 5LSAA 1ZA2A 5GONB 1V45E 3B1FA 4LX0A 4CTJA 2DUMA 4IFBA 2DPLA 5THQA 4Y9TA 1ZJZA 3JSXA 3BXZA 3KSRA 4B85A 1CRWG 4LF4B 5MGNA 1W76A 2HHJA 2ARKA 3V3TA 1EPUA 3UQYS 4ROSA 4NPCA 3LXXA 2QM3A 5E3IA 1XSEA 3UT6A 1RZUA 1W30A 1YI8A 3LMKA 3NTRA 3PK0A 5A9TA 4RANA 4JCCA 3OTQA 3RC7A 1JLSA 4M0PA 1R4MA 2FZ5A 3FUXA 2NU6A 3ACCA 4JSRA 4IGAA 1R64A 3FNIA 1KI3A 1SHZA 2WD9A 4MPDA 2OE2A 3KO8A 5D6OA 4RMIA 3N76A 1NJ8A 3ICPA 3VPSA 2BI7A 4KX3A 3BXOA 1KU6A 1QZ3A 2PIAA 4V0KA 2OD9A 3BQNB 5JD3A 3C6BA 2EWVA 2E4YA 3PI6A 4H0NA 3EF0A 1BDHA 2JB9A 5DGTA 3EC2A 4AS1A 2NZVG 4RVOA 4MKZA 5EKSA 5BW8A 1H1DA 1RZVA 4WWHA 1QHSA 5BOSA 2P30A 2X9QA 5CHEA 1V3UA 1IOZA 1KR5A 3T3OA 4C4PA 1GA6A 1IBLB 1XZPA 3D4IA 1UQRA 4Z6KA 2RMKA 1H4QA 1OC4A 2CNBA 5TDHA 4LG1A 3IQFA 4O02B 2PU5A 1OTHA 3IP9A 4U7WA 1MRZA 4MKHA 4JGIA 1DXOA 5DE3A 4BQOA 5B6JA 3OLZA 1OZFA 5JXJA 1WOMA 2GCOA 4J0GA 3JAWA 1G16A 2LNDA 2R8XA 4Q82A 1UKYA 4WGGA 5K0BA 3AR2A 3DP9A 3O95A 1GPAA 3G17A 5KKCA 4Q48A 1XMIA 1SELA 4IMRA 3BN3A 4II7A 2HQOA 4G5YA 1VI6A 2PRJA 4CIWA 2C77A 4KN9S 4NYMR 2XY4A 4M76B 4MS4A 2GPTA 2WAXA 5CH5A 3T1TA 5CT9A 4HB3A 2BL4A 1M2HA 1QYCA 3PDHA 2VPQA 3C3AA 4FFVA 4KWTA 4MMZB 1ENZA 1G7RA 4MVJA 2Z56A 4H16A 5CJJA 1XTZA 2GHIA 4QXOA 3VPAA 1N5OX 3TIFA 4CLDA 4YUZA 4AZTA 1VJDA 3A10A 4HH0A 4BLPA 1KZ1A 5FQOA 4DR1B 4Z1MA 1L7AA 4C2BA 3FSGD 3SFVA 1RLMA 5PNTA 4HN9A 3BE8A 5FNVB 1UDRA 1ZJ6A 1NSYA 5SICE 2WQ6A 2ZUVA 3EZ9A 3SKYA 2VPZA 2H4ZA 5TIIA 2I99A 3LPCA 4I5IA 4ZO9A 1K4YA 5EIBD 1TO6A 3H9EO 1YV9A 1Z2AA 4YR9A 2HJHA 1BO6A 2IUTA 5LPNA 5EN4A 2G17A 1OR8A 2WPDD 4M1QA 4F2PA 1WHTB 3VJKA 2Q3CA 3MA0A 4RD1A 4EI8A 5MDHA 3VI3B 1WCIB 2V0NA 1U63A 4QJBA 1E4EB 1ZXBA 4FQ7A 2ZROA 2AJ8A 2VHWA 5MN4A 4J16C 2QDKA 3GG2A 2XCTB 4LV8B 1G9XA 3KE8A 1UMDA 2IUFA 5CFRA 4ZAYA 2ZUWA 4PCVA 1C7IA 1DOAA 1JS1X 1ZHFA 2PWBA 4CEJA 3PNBA 2PCJA 1Z2PX 1RM3A 3MWDA 3QVTA 2ZVPX 4FYVA 4F9FA 2R68A 2MOKA 5ALTA 1BXRA 2IE0A 1H9BA 1IBSA 1V96A 3I2YX 3D59A 1UINA 4NDAA 1GZ5A 1CSEE 1VMEA 3ITDA 4XX0A 4Z49A 3GLKA 1JBKA 2CFSA 3OIFA 1WHTA 2DC1A 2UV8A 3USCS 2TS1A 3VZSA 1EUQA 5KSYA 3ZDDA 4QBTA 3GJ4A 2I33A 2VNSA 4U9HS 4I5EA 2Q0XA 1KI7A 5HQTA 4JODA 5JSHA 3GGDA 3T5TA 3U7IA 1G5PA 3KKLA 4OJQA 4C0JA 3VVMA 1SBIA 2ZU6A 4XIIA 1O94A 3RTEA 4EUSA 3IBFA 3AVYA 5DBIA 4Y67A 4RAOA 1F1JA 1TU0A 3AI2A 2FSSA 2VR1A 3N2EA 3QPBA 3TSYA 1AXEA 2G88A 2F8TA 3OIWA 1XUOA 2Y0DA 1RTTA 4K88A 4LDAA 1NQUA 4MV5A 1FIUA 1J2YA 1GCUA 4ZC8A 3DOOA 4JXJA 4UAJA 4MVJM 2WAAA 4ARIA 2AZMA 2CSXA 2RARA 2IH4A 2IUEA 3CVJA 2RGBA 3X1ZA 3TSAA 4M54A 3QX8A 3MINA 1H4SA 4MW5A 1G6HA 1OBOA 1IHYA 1LX7A 5IM5A 4XX0B 1CJCA 3L7YA 1NE2A 2HA5A 2P4QA 4NH4A 3PPWA 3D7RA 3ET4A 4GDMA 4QDOA 2ANCA 3D81A 2FPMA 3EVFA 2G5PA 3MJHA 1WPGA 4NZ9A 1MOQA 3FFTA 3MUEA 4GPTA 1I80A 2DQSA 4EHBA 3RHZA 3F7OA 1ZRHA 1GPJA 1RVV1 1RYHA 3GAMA 1U2SA 3FZGA 1PK7A 2AF4C 4PFQA 4LRWA 4QECA 3Q0IA 4QYTA 3LDFA 2FPIA 4RKRA 1X80A 4KB5A 1IBKB 1C8VB 3B3GA 4X84A 3G49A 4TYNA 4XD7D 4XYLA 2WRZA 4EB6A 2OAP1 3G8AA 2AIRA 3MCWA 5EE5B 2FE1A 4RGQA 1D4FA 4F96A 4LI0A 3ZBTA 5CFOA 3BIJA 4RKQA 2AD5A 2PQMA 4GNKA 5G2OA 3M6VA 3ZQKA 1JHUA 5ECDA 1UC4B 3MINB 1OXUA 4JB3A 3FLEA 4OHFA 1MFZA 1LQTA 3U7QB 4FMBB 5D5QA 4ZU3A 2C2BA 2PHZA 3OSUA 3D54D 4DSOA 3ZKWA 1CUIA 3ZJVA 1NFQA 1OYVA 3UMMA 4YJHB 1PT6A 3E3NA 1WBJB 2IYQA 4HJXA 4L8LA 4D9HA 3J81k 1ZNYA 4FQ8A 1XL1A 5EJFA 4B2YA 1BOOA 4BNUA 3IR6A 5DW3A 3CT4A 5I45A 3GMSA 3CF2A 1L1FA 3P2MA 4RLQA 3VH1A 3FWZA 4NCXA 2VPTA 1P77A 3MGGA 5H80A 1Y37A 3U4IA 1A04A 4ZN6A 4D3DA 1ECFA 1TT5B 1EFRD 4G26A 3H5TA 2QYOA 3EPKA 4EB6B 3DOFA 4Q00A 3RS9A 5KOHB 3J81A 4DR6B 2F43A 1BJTA 3PEFA 4R3WA 4UOQA 1W6RA 5I7FA 5L6MB 1GXSA 3Q8MA 1K6EA 4LSZA 3WHIA 3RUCA 1W7AA 3SQXA 4A26A 2XGSA 2CN1A 5JHGB 1ZW6A 3ZI4A 1QVWA 1KSHA 4PZYA 4PG7A 2Q46A 3Q7PA 4MRVA 3DWEX 1KMHB 2X0RA 1WUJS 2NIPA 3VU9A 3B9RA 2RH5A 1UPAA 4LTNA 5HJEA 2CK3A 1KQNA 1C1DB 1WM1A 3IMCA 4IZHA 4B7CA 1VHJA 1Q2XA 2EWWA 4X66B 1W0JA 1WMEA 5JO0A 3NVAA 3R23A 3V2HA 5JJCA 1HNZB 4KP7A 3SK0A 4OGFA 4G41A 1ENYA 1PFVA 4XWOA 4IDDA 5M34A 3AF4A 2I4LA 3PFNA 3O8NA 4IXDA 1JT2A 2YV3A 3DCIA 1IATA 2EIHA 4JBYA 1EDBA 4RENA 1GXSB 2LCQA 3ZHZA 2J4FA 4CQMA 2C2KA 1SRRA 2W42A 3T4PA 1D0VA 3C5EA 2X7HA 1C4KA 4L4XA 3AKYA 2ZYDA 3DV0A 4Z3KA 1QBGA 1JHZA 1SVUA 3A0UA 4Q16A 1J49A 1Z83A 3VKFA 5EXDA 4A2QA 2QT1A 4LFCB 5JD4A 1KP3A 3G89A 4OP1A 3I1YA 2WJJA 3S2YA 4DEVA 3G85A 1Y7LA 5CGQB 1UJBA 2C3OA 3Q3VA 1N5KA 1U2ZA 2R7LA 4O1HA 3I4CA 4H9GA 1VCHA 2DR2A 1PO7A 1PGQA 2IPNA 1ZP6A 5AM5A 3U4QB 2OKCA 3EWIA 2E87A 3GROA 1H23A 2J45A 4UBMA 4N5NA 5CK5A 3ZBPA 2IIQA 4DDKA 2CXTA 2BBTA 4FFWA 1VECA 4YP9A 1G3MA 1YDWA 1HEYA 4XGQA 3VR4D 5ABPA 2WMOB 3BMNA 1PJ4A 3QLVA 3R3XA 5K20A 3IIIA 4BFTA 4COOA 4DW8A 1X7WA 5G0UA 2DF8A 4NMMA 2WDZA 3D4NA 5FADA 4EYEA 1H2RS 3HY4A 3R6TA 2PBRA 2PFKA 3KV1A 4L6AA 4BMYA 4KR3A 3L7OA 1B6TA 2FZVA 1I0LA 2XT9A 5JVDB 5C3UA 5LZ4A 3TX2A 1X87A 1MZPA 2R5FA 1JGTA 1I3LA 1QJCA 2I67A 3E9DA 3LCCA 5HNKA 1QZTA 3D02A 2X8BA 3HCEA 2DR0A 4ND7A 2PD4A 1EA7A 3UTDA 2CF5A 3VNBA 1H1LB 4CHGA 4ENTA 1RXIA 1D3AA 4H6VA 1Y4ZA 3BREA 2C42A 2I55A 3JQBA 3VOSA 4PFSA 5FKJA 5G3ZA 3WL5A 4DT1A 5H16A 4HUQA 3OTHA 3CG4A 4DQUA 3LNTA 1RYBA 4RX1A 3ZZNA 2B5OA 1R4AA 4C0HA 4X00A 1XMXA 4H3SA 4WVLA 3E7DA 3UYLA 4HMPA 5B7QA 2YQZA 4YJDA 2O1WA 4UTRA 1R3UA 4WBNF 5KPDA 4AO7A 1B23P 4U9UA 2VJBA 3OBBA 4PHFA 3N53A 1OV6A 3A14A 2WHPB 2P67A 3JQCA 1R74A 3OEED 2UUOA 4P4UA 2AN1A 1XFDA 3OJCA 5FF9A 1ULAA 4GZ3A 4JB0A 3BILA 1QR6A 3RD5A 1HE8B 2XOXA 5CAEA 1HE4A 3UH0A 1G9TA 4C2AA 1I6MA 4MMXB 3FYTA 4IFIA 3ND8A 2EIXA 2P9HA 1S1MA 3FCSB 4FSDA 4GX2A 3DBVO 4KPUB 3WNVA 1PG5A 1KYWA 1U0NA 3KYCB 4ALJA 4W9NA 4EX6A 2OV1A 3NHJA 5JG7A 2VK4A 1DDIA 4IKOA 4E3ZA 5LQJA 2GWHA 1F9AA 1NGSA 1OX6A 2ZREA 3QELA 3RT1A 1G0OA 2NMVA 1YQDA 2AMFA 1NC3A 4UARA 3A6HA 4E12A 1E63A 1U6IA 4OXYA 1JMVA 2C4MA 3GVXA 2QK4A 3SIXA 4D26A 4Q02A 1C9JA 3QKSA 4H27A 4HC4A 4KYTA 3FLMA 3WOHA 5I7AA 3L7NA 1G4AE 1HE1C 5JASA 4RW0A 1QHEA 1LJ8A 3K96A 2GPAA 3ZCSA 4WOPA 1DEOA 1HG0A 1YCFA 2ZRLA 2WFZA 4TYMA 1YZNA 3P0RA 4UNQA 3W7BA 1XPRA 1RZ3A 3KHTA 2BV3A 2W0MA 5CT5A 3O83A 3EIUA 2CMKA 4KXMA 3TLYA 3KQVA 5JAPA 1Q0PA 3T3DA 4UDYX 1N6RA 2PUJA 3LUPA 4KIWA 1EFAA 3ROMA 5CJPA 2DY1A 1L7VC 1XZCA 2V8OA 5FBZA 2VYVD 5HE9A 1E8DA 3K9GA 3A05A 1P1BA 1RHUA 1TCAA 5GADl 4JI4B 1Z16A 5FI5A 4IVRA 2ATEA 1KERA 1N6PA 3CR8A 4LC0A 3UHFA 1G64A 3HYRA 3V1NA 5BNTA 3K05A 3KS9A 4PRKA 2ZT5A 4FDTA 3UHPA 1Q19A 1JSLA 3EFBA 3JWGA 3CKKA 1RXCA 3PPXA 5C8YF 4OFWA 2GYWA 5DNWA 4I1YA 4WLNA 3SMVA 4DBZA 3IJ5A 1XZKA 2VT6A 3AK4A 3OPVA 1YS9A 5CNJA 4Y30A 1ZL2A 3PQ4A 3LQ1A 1NW6A 2WSSA 3UFBA 4D3FA 3BH0A 1N9ZA 1FXWA 2GYVA 2YV4A 3BERA 3G2PA 4HDRB 5GONA 2OYCA 3W3ZB 4D1YA 3JQFA 4KK4A 1OI2A 2JARA 3PA6A 3SQWA 4ZFNA 2Z2YA 3CZMA 4RK4A 2O8DA 4ZT4A 3GK3A 5DOZA 2DRIA 2XW6A 1P4JA 2WYUA 2E48A 1DG3A 2AEEA 2IPXA 3ZZ1A 1EFLA 4XSVA 5J40A 2H1LA 2OVFA 2CJYA 1JEEA 3AIOA 1XRJA 1T8TA 1UBHS 5I6DA 2WSSD 4TUYA 4ZHQF 2HZ7A 3L4BC 2CMDA 3O8BA 2XA1A 2ZITA 4OXRA 2V6MA 4R1LA 4WCFC 2DU8A 5I4BA 1EXVA 2LWIA 1WW3A 1NNEA 1XVUA 1U4SA 5EUCA 5DI9A 3IOCA 1C7JA 3RFUA 3RKSA 1WQ1R 1S5PA 3F8TA 3QMMA 2V0GA 2VDJA 1ZH0A 4M9RA 1VLLA 5F73A 3SZ3A 1FLVA 1HDZA 3KVRA 1ZKDA 1P9WA 2Q2NA 4UQPA 1VMIA 1IWBB 4XUEA 2Z6VA 5ALPA 3VJMA 3TNLA 1M7HA 3VNQA 3T7IA 3WL8A 2PUEA 2I2WA 4I46A 3KJGA 1WXXA 1ULBA 1KQOA 3N6RA 3Q7RA 2OEPA 2NPIA 4HQRA 4R8LA 2EFDB 2VDPB 3WWEA 2EGUA 5DI3A 4X3OA 1A8HA 4CV3A 2WTBA 3RE1A 3UY4A 5FT9A 1R6DA 4H4EA 2I8LA 3QITA 4UUPA 4D4GA 2F1OA 2FZWA 2KM1A 3P2OA 4RMNA 4V39A 4M0KA 1N5IA 4RLFA 3KQMA 1LXCA 2JJQA 1ECJA 1L7PA 3MPUA 4GKBA 4XFKA 5EIHA 4W5RA 4Y2JA 4LJ7A 4GF5A 4Y6LA 3UBTA 1BTOA 4P7GA 1IYZA 4H17A 1N2CB 1X1TA 5I5EA 2BYTA 2GESA 5CLGA 3FH0A 3Q88A 4PSKA 2CL7X 3SJBA 1WMSA 3C3WA 2MTBA 3EA0A 3H0EA 1NNSA 3UC5A 3DVAA 4DLUA 2QX6A 1JG7A 3PHCA 4WOCA 2WU0A 4KSCA 1K5PA 2OMEA 2XWJI 1VLZA 3ZX5A 3PRJA 4CODB 2H2DA 2JCBA 3GL9A 4C5AA 4NP6A 4TMFA 3Q3JB 1AS3A 2YVLA 3OWXA 5GONF 4FD2A 4DDVA 2VYNA 4DZTA 4KQGA 1ZU4A 4HRXA 4YRTA 4BFSA 2OHHA 1RAGA 3K2QA 3QVOA 4E7OA 2GZDA 3VPXA 2QUZA 4C4SA 4IEEA 1EWYA 1C9YA 4RV5A 1SHKA 4Q3EA 2FR8A 2C0PA 5AKEA 4R69A 5KTRA 2VUUA 1RMYA 5CDTA 3KLNA 2XUOA 5JDCC 3QOYA 3MD9A 5H1YA 1MX5A 5B1SA 5CTAA 5C80A 2WTNA 2FPXA 4E94A 3OJWA 4RY2A 5B4TA 4C0AC 2QL6A 5EWMA 1J5EB 1XK6A 2IXEA 1HTWA 1NYTA 4MRRA 6LDHA 3E70C 1SC3A 3I5AA 5COBA 2A9OA 5IMBA 1L5LA 1UZAA 3TTUA 3WA6A 4E2ZA 2YWBA 4LSGA 2Z2JA 4JZYA 3KAKA 4HRAA 1TE2A 3SM9A 1RADA 1SAYA 3TLEA 2O3QA 4M55A 4CQNA 1X7DA 2WSBA 4GPBA 1NAIA 4NECA 4R5HA 1SIOA 2ZQYA 3H9JA 4M7RA 2XGGA 3QPCA 1DIGA 1XPUA 2RCYA 1V3TA 1KDYA 2JAOA 2DE0X 1SOMA 4JOCA 1KPIA 3WYCA 3AR5A 1YH3A 4K6CA 4Y9RA 3QWFA 4QGGA 3Q41A 4A8JC 1TK3A 1YONA 2PZMA 2IYEA 5HUQA 1D2NA 3PQ2A 3TCNA 4C7KA 2HL6A 3NDIA 4EVIA 5DHRA 4UZSA 2H92A 1P39A 1BD4A 1NW4A 4AG3A 2HDOA 3AFMA 1XX6A 3QPAA 4LVOA 2GZHA 4EG6A 3JAKA 4YUYA 4RELA 3PQ5A 1FNMA 1UBRS 4TV9F 4LSWA 4M7WA 1M8FA 1B41A 2Z95A 3GLVA 4FONA 3CB4A 3WJ2A 1ORHA 1I32A 4KC0A 3QX3A 4C89A 4RVUA 1FU7A 3ISTA 3NYIA 3ONFA 2WF6A 1TM2A 4WBSA 1S3SA 5DLDA 5CX1A 3WLQA 3EYAA 4B0PA 2CBGA 2GXAA 4ZYLA 3N6XA 3QXCA 1QB7A 4FE7A 3S29A 3L1UA 1MMFB 4BCBA 3UC9A 3DXFA 1Z7WA 2LRHA 5JC1A 4GI5A 2BHLA 1KKLA 2X8AA 1ZNWA 2LW7A 1E7RA 1FFSA 3P4UA 4I0WB 2XDWA 3VDQA 4YRBA 4HF7A 3E03A 1E1QD 2IITA 5KNBA 1PS8A 1JAXA 4DL9A 1FFBA 3BB1A 4M2LA 4ZVRA 2FZEA 4LRYA 1DDOA 3HPRA 4NEGA 4CT0A 3K6SA 2GSWA 3VPHA 1Y7HA 2NTNA 1XQXA 3GFGA 3L3BA 4LBVA 4AL4A 4C7JA 5J2TB 2A14A 5AQ1A 3GFFA 1IPFA 3G1WA 4AY6A 1TIPA 1KS9A 1SUSA 4QGBA 3FMFA 5HOQA 5ICMA 1UWVA 4RY8A 3SNHA 5ELLA 1T24A 2F1JA 1EDZA 1LPAB 2Q3HA 1NN1A 1UMCB 4QJ3A 5K6TA 3TI7A 4MEJA 2BFEA 1BIFA 2EP5A 4EO9A 4YMTA 2UYGA 4IZOA 4WDRA 4OK6A 5JECA 1PWXA 1XZDA 1A5BB 2HLPA 2JHFA 3EZGA 3FMGA 3I9OA 3KLMX 4LYJA 1V5GA 2O3TA 4NIMA 4B6EA 1CERA 2SECE 1C29B 1PU2A 1IFXA 1QO0A 2A6PA 3E9MA 3K9QO 4U7JA 3L46A 3R3JA 2CCKA 3M6XA 3TDKA 2XQIA 3QTBA 2X0DA 4BJ3A 3P9IA 3AMVA 2PUCA 3JD3A 5C46F 1XLTC 4JT9A 4F4JA 3TWOA 3KDSE 4OKSA 2TRSB 4FOTA 2FUG6 3HC7A 1CEXA 5JMOA 2O06A 1Q0LA 1ZM9A 3QW4B 4XPZA 1C2TA 4M8KA 1TF7A 2VTBA 3LYUA 1PLJA 3ORQA 3AUAA 2IOYA 3KYIB 1IJFA 4RXTA 4DWWA 3IDSA 4F9TA 1NVVQ 4P36A 1XCBA 1SB9A 1YDMA 4IXWA 1EINA 1NBME 4FFLA 2VT2A 4ALIA 4DWVA 2EX1A 2Q9BA 5FYDA 3R5FA 4CG3A 5AK0A 1XL0A 3L2OB 2QRHA 1APBA 2RHOA 4QNMA 2E82A 3I6YA 4IIJF 1JR3E 2QRZA 5DGHA 4BX9A 4G07A 2XQJA 1MD9A 2GZSA 1ZS9A 3E1SA 4XDZA 2JJ2A 3R0XA 2D74A 4CI0B 5KNDA 1KDZA 3SN6A 3M6LA 1E3WA 2GSDA 2V45A 2P35A 4R1UA 1PKEA 4TVSA 2ZXUA 2CJWA 2F1HA 3REOA 1L6RA 1GR1A 4NDNE 1GL6A 3MWLA 3OC6A 4DHEA 5JH7A 2H7CA 4M37A 1G18A 2LV8A 4XB1A 5EIFA 3OIVA 3PC8C 3VYRB 4A0HA 4F5EA 5BV2P 5B7GA 2IV7A 1KEUA 4US1R 1VHDA 1GTRA 3AUKA 1N78A 1XHFA 1JNXX 2QVYX 1QTQA 2PZBA 2R8BA 5JS2A 3NT2A 4AKSA 2FW9A 5K9ZA 5AHKA 2FPGB 4L5IA 3G7NA 1ACMA 1CJUC 3RU7A 1SU8A 1HSZA 1J25A 2ALJA 1X80B 3E3AA 4XR4A 1EDEA 1GQSA 4YBZA 3FTDA 4DTIA 4CTMA 1PS0A 1FFGA 1P17A 4HLCA 2B92A 1C3JA 2DKFA 2PK3A 1NF3A 4REQB 3D3QA 1CW2B 4R1QA 3TQOA 1FTWA 2C57A 2X23A 3BSWA 2OFOA 2WJZB 5JH7B 4JYZA 5L3SB 2ABWA 3C7CB 1MB9A 2F9LA 4EHKA 4Y9DA 1QP4A 4MV7A 3DF9A 1J21A 4G1BA 2XOKA 1VG9B 1MU0A 4MP6A 4B2IA 4LFBB 1XVAA 3WGQA 1ZGZA 1PZXA 2GNAA 4K9NA 5HUJA 1E96A 4AO6A 5ALDA 3N59A 1XD9A 4WSOA 3JU3A 2CLIB 5DXJA 1GN8A 4PM4A 3BIFA 4JU9A 3ZWKA 2Z83A 1F6DA 3H18A 3MGKA 4B40A 1HETA 1RTKA 3UKJA 4CKBB 5EJ8A 1TMYA 1UJ5A 2E3JA 3BTSA 1UXIA 3CZCA 1WNTA 3EIXA 4GLLA 1JPJA 3GNSA 4YI5A 4DLBA 4I36A 1QG6A 2FRDC 4N47A 2FN7A 2VO1A 4ESEA 1SC1A 4GPEA 4XGRA 3MJDA 2ZZMA 3DEYX 2LXNA 4IIBA 3LLSA 4K9QA 2FMTA 1ZD3A 1FYVA 3ZTTA 3Q2KA 4Z8XA 1FFXA 4BX8A 5BXYA 1YE5A 1XZLA 4NZZA 4P53A 5DEIA 4M9QA 4B3FX 4F1KA 5ESDA 4MX8A 4QOHA 1JR2A 5DTEA 4CG1A 4HJRA 1X8KA 5KJCA 1RAHA 2CXXA 3FHCB 1CHNA 2ZQZA 3TAXA 4B4WA 2FF5A 1SXJC 1YVUA 3PL1A 1G21A 4TVKA 1IEQA 1TZMA 1DV2A 4MRSA 5HKOA 2V7QD 1SVMA 5MFZA 2ZWIA 3FPAA 1V26A 2X0IA 3PTZA 3DFKA 3AYXB 3IEIA 4WW0A 1OB2A 1W52X 5HOEA 1EFDN 5AM0A 3UJCA 5A4IS 3VR3A 4BU1A 4J1TC 3SHTA 3AM4A 4I5FA 3WMRA 4CBVA 3BSYA 1E2JA 1JVBA 1PR4A 3R3YA 3H6HA 3CLUD 4HYQA 5CVTA 3N2IA 1W581 3DBLB 1RJFA 2IEDA 3R3UA 5JANA 3OG9A 1Q74A 4CF4A 1ZUWA 1V16A 2VF2A 4Q18A 5HMMA 5LA6A 2YIMA 5A7HA 1YZTA 5AVOA 4CVNA 4X1IA 5ICEA 1EM8A 1DNPA 2OK8A 1JB1A 4F3YA 1ID8A 4JUCA 1ODTC 2BKLA 2C54A 3PPIA 3QMPA 5BWCA 3EXHB 4BEBA 4C3ZA 3SWWA 2FOXA 1FP2A 4AF7A 2HKIA 1JYSA 2JZNA 2AMYA 3TJZA 4TPKA 1TL7C 1DEKA 1OKKD 2D0DA 1TAQA 3KOZA 4I50A 1ZI6A 2HM7A 3SIPA 3NC0C 2FCRA 4RHUA 1ZH8A 4HTFA 3GG9A 3N7TA 3IEPA 3NH9A 3NQ41 5I47A 4ZEWA 4JA0A 1Q0QA 5DCUA 4BQPA 2WA2A 4GL4A 2BI4A 5HGXA 3UGJA 3HJBA 3QEJA 4E4YA 1C81A 1DDGA 3G2NA 1AE1A 1NA5A 1QHYA 2CMHA 1X39A 1Y8QB 2JI9A 4J16A 4OFZA 4Q12A 1NUUA 2ZRCA 5EOVA 3WIUA 1R7RA 2XKBA 4KK3A 2NXCA 3FI9A 3DKPA 4BIIA 1EVEA 2Q21A 4Y2VA 3UCXA 5CVUA 2C5EA 4O0MA 1AGPA 3ZIAA 4S1TA 1M76A 3WLAA 1P3DA 3TS1A 2A9JA 1LY1A 3C45A 5HTKA 3RANA 1JHRA 2O3UA 3DYVA 4YRJA 3R6DA 1NF8A 2W6QA 1EM8B 3WK9A 4CNBA 4Q4JA 1ULUA 3K0CA 4DWJA 3UWPA 2WZBA 1HX7A 2ZWVA 2VJCA 3PWTA 3IB6A 1I7NA 4KNYA 1QAQA 3ZV5A 2R11A 4L3OA 3D5TA 2XYVA 3NS7A 1YVDA 4EK9A 3C16C 4X3CA 1IM8A 1TKBA 2G9VA 4LXHA 1B8OA 1CETA 1Y1LA 2AG6A 3CV3A 2GM9A 5A6VA 5GIOE 3WDMA 3ADDA 2J6HA 2KMLA 2XWBF 4B3IA 4EI7A 3O21A 1JG2A 1C0LA 1NASA 1RBQA 4CF5A 1E66A 1TGYA 2R79A 3BXHA 3CUKA 1NWHA 2X3UA 4DPMA 1XTRA 5CAEB 4B32A 1F06A 4ZCSA 4QGHA 4WBNA 1Q3TA 1QYXA 3PSHA 3IL2A 1DBIA 4DA4A 3O82A 4URVR 1OJLA 2RD2A 3BWBA 2DFLA 4Q3BA 3U44B 4QUDA 3C3YA 3DE2X 3QMWA 5K0JA 3SZMA 4ON9A 5F51A 3ERCA 1H5NA 4K9DA 5EPUA 2QZSA 5IVIA 4QPCA 1VJRA 2VAPA 2AYXA 5G41A 3EAQA 5AWFC 5DYTA 1MJFA 2Z3WA 4MUMA 3ZHRA 3JWIA 3CRRA 3HVRA 1UJNA 2X2EA 3DDOA 4DMKA 1C9KA 2PX0A 3QBEA 1JIUA 1GKLA 1ZCAA 4KVAA 5KKAA 1OD6A 3WWPA 2Q4EA 3HRHA 3LG2A 3PNVA 4G23A 4MJ7A 4WESA 5E1OA 5KYXA 1IAVA 1TRHA 1PHRA 2IHNA 2PXCA 2QENA 4I55F 1Y7PA 1D9ZA 2AOUB 3NEJA 3TF5A 2ZP1A 4TT8A 3PRYA 2AJTA 2X5JO 3CN9A 2VCHA 4JLWA 1TUGA 4AURA 3LDUA 2YFHA 3EISA 3KZKA 1EXNA 4OI0A 2RJNA 1UEIA 4G5HA 1BEUB 1LTHR 1XI2A 4HYEA 5DF1A 2FZGA 2GS9A 4DRYA 4CF6A 3LGSA 2Y9MB 5E3HA 1Q7TA 4J1TA 4QU8A 4CI9A 5TLSA 4OD0A 3OICA 1XYVA 4G0XA 4MDYA 4HGPA 1AB5A 2L17A 1NNI1 2PZJA 2W2XA 4OLJA 4CIVA 2I9PA 3WLJA 3PKIA 3BULA 3Q1KA 3M49A 4P4LA 3JZIA 4JLOA 5LDGA 2A59A 1XTIA 3PT9A 1ZY2A 1PNVA 1QANA 1YQEA 1ODIA 5AW0A 4N7MA 13PKA 1ZVJA 4J2HA 4CU5A 4WPGA 3DW1X 5FEUA 4YCNA 2DWQA 1P9LA 2HK7A 3M4JA 4P9NA 4PXSA 4S2EA 5M3BA 1YBMA 3H9CA 3B78A 2QF7A 5FH9A 2YR0A 5L7WA 1KO8A 3UPDA 5AW8A 4QDJA 4CM9A 1KI4A 2Q29A 4WESB 1L8XA 1JWLA 1JR6A 2QTVB 1WXQA 1DXQA 2IYXA 2XT0A 4JJAA 1GLVA 2CMFA 4YUXA 1PZHA 2HJGA 2OGZA 2QX4A 1BH2A 1YJQA 3KR2A 1JVNA 3N0TA 4MTCA 3TRHA 3OY7A 2V8BA 2C2ZA 5CIQA 1ESNA 5EFOA 5CX1B 4ND4A 2I7DA 2NVUB 3KVYA 3W7VA 3JZFA 2XJ4A 3VU8A 5CEEA 1RI4A 1IK6A 1OZ0A 3N8NA 4Y9SA 1PW5A 5L6LB 2P91A 3ADBA 5I7OA 5DNUA 1PR3A 3MJTA 3P94A 4EYSA 4ZJUA 5EWLA 3V34A 4I1IA 3T99A 3ZEIA 3T4XA 1HT2E 3CH7A 4OO3A 4YR7A 1D2EA 2ZT7A 1UKCA 1FYFA 1QWSA 5C51B 3K0EA 5A06A 5FOVA 1V11B 1EVIA 4G5XA 4HH1A 1X1SA 4RH1A 1WDWB 5P21A 3R7DA 5BMVA 2P5YA 1EB9A 3N8DA 1B43A 2C0CA 5T3YA 2W2PA 4UE2A 2D0IA 1B6SA 2FFBA 4NJEA 4HG2A 4D9CA 1CHDA 1W4AA 3KJZA 4NJOA 3U4DA 2I8AA 4PIMA 4X7RA 1BC5A 2OWEA 3UWKA 4J0HA 1ETHA 5A4DA 2ONZA 1UXHA 2R7MA 3BIOA 2R00A 5LD2B 3JD4A 5L53A 2PZGA 4U1RA 4YAFA 3C3JA 1HXHA 2NQ2C 1V8OA 4KN5A 2HT1A 1R8YA 1WU8A 4RSHA 3GMIA 5LUAA 1XVLA 4MGZR 3QOXA 1VYUA 4YJ3A 3T9CA 1CBUA 1DX4A 4OMFG 1XCMA 1E5DA 3PNKA 4TUYF 4DR3B 1B2LA 4OGKA 3ZD7A 3GN1A 4U7TB 4YJHA 1PK9A 2IEAA 4UOZA 2NQTA 3GFQA 2HWYA 2GLTA 1F0YA 5ADHA 1OYWA 3T94A 4Y1EA 1XN4A 5EL0A 4RDXA 1CG6A 2QZJA 1XYYA 3NC4A 4TS3A 4DLKA 2XF8A 2GASA 3KPJA 3RF7A 1G8YA 4UTPA 4ZMSA 1D4AA 4UHEA 2ZE8A 3OY2A 2JIDA 5LJLA 2WJAA 3N2GB 2A3RA 4WZZA 4DCUA 2PJZA 4AD8A 4ND1A 1J0AA 2Q1TA 4GPAA 2FSVA 3D7LA 2A1TR 5LM3A 4MWEA 1XK7A 3UV6A 4PZAA 4BB9A 3IHWA 3ZDFA 5I3ZA 5L51A 5F2OA 4M0LA 3DE5X 4C03A 1QZUA 1NVGA 2R6AA 3DVQX 2Q3BA 2L82A 1KORA 1ULHA 1DP4A 3DEZA 1L7QA 4HNVA 3ZY2A 2ROQA 4OMUA 3OJXA 2GDZA 4O4HA 2RGGA 3WYFA 1G8AA 5A7GA 4QVKA 5AVTA 3FBGA 4NCNA 2ZPUA 1JMKC 5FNVF 3U7GA 5SZKB 3L8GA 3Q3CA 1ZZEA 2XIQA 2GEVA 1MN6A 3PUVA 1KVTA 2DBYA 1KYTA 3AT1A 4NU0A 3DOEA 4GEGA 1D6JA 3DONA 4Q4DA 2X9GA 4UVDA 5AFSA 4MUXA 5HW0A 5IX8A 1F7VA 1DC4A 1Z4JA 1ISIA 1DCMA 1ZGBA 4NARA 8ADHA 4B80A 2A9QA 3KXIA 1CIVA 2G8NA 3PRHA 4D9BA 4ZI7B 1T8RA 1FMFA 2A0WA 2I29A 3RG2A 4RDCA 3RYCA 3FMIA 4ARCA 4N49A 4M9SA 5SY6A 1T36B 1B73A 2GZMA 2IUYA 5ICCA 3OLQA 2XOEA 2E4WA 1F38A 2JAQA 2HEIA 2OHGA 1EU1A 4PYKA 2R85A 4WINA 1N6LA 1QHNA 2GPJA 3FCOA 1O6CA 3G3EA 2WI8A 3FDZA 4E5KA 1XKTA 2AK3A 5BSFA 3M81A 1M0TA 3E8XA 4GYWA 4BO8A 2OO3A 1LK0A 4U2EA 4AQDA 2BKVA 3QLEA 4UFOA 3V1LA 1C4WA 1MEJA 1QG0A 2PAFA 2XECA 4IIJB 4MUHA 3T7EA 2OO5C 3B82A 2NT4A 2W2LD 1GSAA 3K53A 1VIMA 3K32A 2WSMA 1EG7A 1Z5PA 3JVDA 4EB8A 3DLAA 1KAHA 1FTYA 4IQGA 2YZNA 2PM8A 1L5GB 2QJRA 2BH2A 4MVJG 5EWJA 4FCVA 4LF6B 2HUPA 3SGLA 1WF6A 3CLRC 5KNLA 4C88A 1RQ2A 4MRMA 5C8VA 5E6RB 3BXXA 3HVIA 2ZEJA 3G9QA 1ADBA 3LVQE 3SKXA 1E9CA 2FWNA 5EG5A 4F5WA 4MI9A 3T7DA 1X9GA 3I3SR 1MB4A 4GFDA 3VUFA 2KLBA 4GBGA 1D2MA 5JVDF 5LP1A 3OC0A 4S1NA 4C6RA 4CGZA 3WDSA 1ST3A 2J9FB 2PV0A 5GVRA 5B3JC 1V3QE 1KSFX 3HCRA 4X95A 3WY9A 4A0FA 3EA5A 2AUTA 4CYMA 1RLIA 1MABB 2ODPA 3H9GA 3MRTA 4N18A 2WJ6A 4UDNA 3VR5H 3ZEAA 4C08A 1NHGA 3CO5A 5IH3A 1JEDA 1OWOA 3P26A 4GR5A 4EJSA 2XCIA 2QD5A 1Q7RA 3RQSA 2H1OA 5I4IA 2C7BA 1NQAO 5ENDA 2ZJ5A 4BNTA 5JSZB 4CDRA 4DADA 5LQAA 3ZD6A 2QUBA 2YXLA 4FDAA 5C1PA 2BLNA 2RK3A 4PNPA 4HKTA 5BW6B 1K66A 1NXVA 1UFKA 3ND6A 4FYKA 2PKQO 1U0RA 2AEFA 2WD7A 4D8YA 4LRXA 1Z5ZA 4ZTZB 3HV2A 4L4SA 4M7PA 1OFTA 3VKUA 5IC6A 5IVPA 4MKRA 1ZR2A 1E5XA 2ZM5A 4F5ZA 2Y66A 4BEWA 1C41A 3HUEA 1Y4DE 5E6UA 3H2GA 3W1VA 1RLUA 4CDNA 2FSVC 4PR0A 3G0GA 3O4HA 3N74A 4UFNA 2FCAA 5EIAA 3RSQA 5KJ6A 1KZYC 2VYVA 5PGMA 4E5MA 3DPIA 4RTRA 3I12A 3AL0C 5CH8A 3A6GA 1GPH1 3QU4A 1IOWA 1JEYB 1UM8A 4AN1A 1EVLA 2JK1A 1PCXA 2ZRQA 3IT0A 4X6XA 4CMKA 2JL1A 1CYEA 3NVMB 4PZDA 1ZUNB 3L04A 5KEIA 4DMMA 1O6ZA 1PNRA 1S8NA 2QPAA 4ENVA 1KH1A 1ZX1A 3Q7EA 2VDUE 5AKYA 3UK0A 1G20B 5JSKA 5JC8A 1IBCA 5CDGA 4ZCTA 2C1ZA 3D31A 4FHDA 5FUWA 2CLSA 4UBIA 4WEQA 4KREA 1DQYA 2JHGA 3U26A 1YA6A 1FSFA 1GTZA 1PRYA 1ZK3A 2B4AA 2H4FA 3BJZA 3H11B 3REFA 4ACAA 3UATA 5K0EA 1LPMA 1UJCA 4RD0A 1A0OA 3DHNA 2O5VA 2H0AA 2RGXA 4IO1A 3PZRA 1T1EA 4XM0A 1VDZA 3MCTA 2GGSA 4R1NA 1VL0A 3ZLUA 2O7NA 1V6CA 3IR7A 5CFQA 1CNFA 2J07A 2HK8A 1RAIA 3OQVA 2GBIA 2VHXA 5EMNA 3QE0A 2QP4A 3L4SO 2I4IA 1PJQA 1G21B 1VI5A 1X42A 4EJFA 2YNMD 1TYEB 3LBHA 5AVKA 2HX1A 1SZPA 3W77A 2A57A 4DMLA 3AEKA 5JMPA 5BSRA 1PVDA 2FU5C 1BWPA 2E89A 1U9IA 3BJEA 2ECPA 1K6IA 3L02A 1ZC3A 1D0SA 2QN3A 3INYA 4QGFA 2Z04A 2ZRNA 1P4HA 2I7XA 4MV0A 1E2EA 2I1VB 3H11A 1YRLA 2R6JA 1DWPA 2R751 4KLAA 5IM4A 2EXXA 3MAAC 4GZ5A 2C78A 4KOAA 1F14A 1X38A 3AU9A 4GUAA 1RWMA 4L28A 1I6WA 3ZE6A 2C2YA 2IC5A 4MR8B 4S24A 3MSXA 1US8A 1ULTA 4DLAA 1O58A 1WD7A 2VPPA 4COKA 4CKCB 1P5ZB 2FAXA 1SU4A 3O7MA 3I1JA 1MDFA 4KZKA 1NPTO 3ZGYA 4JWTA 1Z17A 1YQUA 5HG0A 4YUAA 3MCAA 4D99A 5EJ2A 2C3UA 5DLYA 1H8EA 3T9EA 4PBTA 4QUAA 1JQBA 4HO1X 5CNKA 1URPA 4PC6A 3ESYA 1UKAA 2POQX 2PN1A 4KQ6A 4R41A 4ZQFA 4DNFA 3FPLA 1E9DA 5BSUA 4C20A 4NAHA 3GEGA 4XE5A 3GA5A 4G86A 3UAZA 4LMAA 2QJOA 2WIJA 3O2QB 3OZAA 4ZYUA 1FZTA 2NVBA 4WJKB 3COVA 1JR3D 1B8NA 1G5RA 1Z8DA 3UT5B 5FJJA 4JUFA 3QXJA 4NPHA 3I92A 5B3LA 3TKAA 1TVEA 5J47A 3FNBA 3V1TC 2P9CA 4M88A 3SZGA 1P62B 3HHEA 3U5TA 3T3NA 1I9GA 1YFJA 3FHOA 3OKPA 4FGJA 1TUEA 1LWOA