1ODLA

Purine nucleoside phosphorylase from thermus thermophilus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
234
structure length
234
Chain Sequence
b'SPIHVRAHPGDVAERVLLPGDPGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQTTGMGTPSAAIVVEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGRPYAPVPDPEVFRALWRRAEALGYPHRVGLVASEDAFYATTPEEARAWARYGVLAFEMEASALFLLGRMRGVRTGAILAVSNRIGDPELAPPEVLQEGVRRMVEVALEAVLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Crystal Structure of Purine Nucleoside Phosphorylase from Thermus Thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 83
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1odlA00
1YQUA 4BMXA 5B7NA 1A9SA 4OJTA 4H1TA 4TS9A 3EUEA 4DAEA 3D1VA 1TGYA 2QSUA 1V3QE 5F7XA 1B8NA 4L5CA 1ZL2A 4WKOA 4X24A 3O4VA 3BJEA 3DPSA 3ENZA 1Y6RA 4DA6A 1VHWA 4L0MA 3NM5A 4DARA 1VHJA 1OV6A 4LZWA 4OGKA 3OZBA 1YR3A 4D8VA 4KN5A 1N3IA 1JDSA 1PR1A 1Y6QA 2GUWA 3SCZA 4TYMA 4QEZA 4WKPA 1PK9A 1K3FA 4MARA 4F3CA 1K27A 4FFSA 2OXFA 4UC0A 1YQQA 2A0YA 4TTAA 1Y1TA 5F7ZA 1LV8A 2I4TA 3KVYA 4WKNA 4DA0A 3FB1A 4M3NA 3P0FA 1PR0A 5F76A 5F78A 1Z37A 3UAWA 1U1CA 3BL6A 3P0EA 4JWTA 1JPVA 3IOMA 1PKEA 3PHBE 3OZDA 5CYFA 3KHSA 1RXSA 3OOHA 2A0WA 4D98A 3E9ZA 4DANA 1T8WA 4R2XA 4GMHA 3O6VA 1V2HE 4TXNA 5EPUA 2QTGA 3EMVA 4NY1A 4WKBA 5F7OA 4GLJA 3TL6A 1ODJA 4G8JA 1Y1QA 3EUFA 4BMZA 3OZEA 1NW4A 3UAZA 2XRFA 5B7GA 2QPLA 4I2VA 3DJFA 5IU6A 3LBAA 1RT9A 4L5AA 4QAQA 1V48A 4E1VA 4D8XA 1PW7A 3LGSA 1C3XA 4OY3A 2AI2A 4JP5A 5CXSA 3OZCA 4RJ2A 1K9SA 1NC3A 1PR5A 3KVVA 4TXHA 5FAKA 1JDZA 1T0UA 1RXYA 3OCCA 4K6OA 1JYSA 2HWUA 4WKCA 3ODGA 1OTYA 1ZOSA 5F7JA 3OPVA 3K8QA 1ULAA 1LX7A 3UT6A 1PR4A 4D9HA 1A9PA 1I80A 4NSNA 4EB8A 1Z39A 4F3KA 3KU4A 2OC4A 4L6IA 4YNBA 1V4NA 5F73A 4DA8A 3FUCA 4OF4A 1PR6A 3NM6B 1A9TA 1WTAA 2ON6A 1Z5PA 1JE0A 5B7PA 4TS3A 1TGVA 4L5YA 4DA7A 5DK6A 3U40A 3QPBA 1PBNA 4R2WA 1V41E 1ODKA 2B94A 1FXUA 3KUKA 4OEHA 3FOWA 4LNHA 1TD1A 1NC1A 4TTJA 3NM4A 2HSWA 2H8GA 4QFBA 1ODLA 3PHCA 5CYGA 2RJ3A 1RXCA 1ULBA 4JOSA 3KVRA 1JDUA 1Q1GA 1OVGA 1XE3A 3GGSA 3E0QA 4PR3A 3K8OE 5I3CA 3UAYA 4TTIA 5CCEA 2A8YA 5F77A 2IQ5A 4MCHA 4BMYA 1Z38A 1V45E 2QDKA 1Z5NA 3FWPA 1RSZA 1Z35A 2OECA 2HN9A 2I8AA 3PNPA 5KB3A 1OUMA 1SD2A 1TCUA 2AI1A 3C74A 4G41A 1YBFA 1CG6A 4YJKA 3INYA 4D8YA 1PR2A 1Z34A 4R31A 4LNAA 3MMSA 1PWYE 3FAZA 3UAVA 2A0XA 3ONVA 4U2KA 1T8RA 2PGAA 3EEIA 1G2OA 1ECPA 4ECEA 4MCIA 2Q7OE 4OGLA 2BSXA 3F8WA 3OF3A 1VMKA 4F2WA 3MB8A 5B7QA 1PF7E 1JE1A 1RXUA 1A9OA 4DAOA 4QASA 3FNQA 5EUBA 3DP9A 1U1GA 4LKRA 3T94A 4QARA 1RYZA 4EARA 5JPCA 5C80A 1SD1A 4NS1A 4F1WA 1Y1SA 1CB0A 1RCTE 2AI3A 4LDNA 4IP0A 1Z5OA 4TXLA 3LA8A 1SQ6A 2HRDA 1B8OA 4GKAA 2ISCA 3BSFA 4G89A 1VFNA 5CXQA 1RR6A 2AC7A 3OOEA 3UAXA 1A69A 1LVUA 3DF9A 4QATA 1M73E 1Z33A 4P54A 1OTXA 5IFKA 5K1ZA 3GB9A 1A9RA 1A9QA 1TCVA 3BGSA 5ETJA 1RFGE 1JP7A 4BN0A 3DDOA 4PNPA 4TXJA 1U1DA 1SJ9A 1OU4A 1U1EA 1PK7A 4GLFA 1U1FA 4DABA 5CCDA 3E9RA 4M1EA 1QE5A 1ODIA 1JDVA 3NBQA 1YRYE 4F2PA 4YO8A 1JDTA 4M7WA 4TXMA 4YMLA 1Z36A 3IEXA 2OC9A 1Y1RA 1T8YA 1T8SA 2QTTA 5EFOA 3PNSA 2P4SA
chains in the Genus database with same CATH superfamily
3TG8A 4EPRA 2JJYA 3IT0A 1EXVA 2HZBA 4CUJA 4H1TA 2VATA 3HNOA 4RXTA 1TF7A 5K6TA 3RWBA 5A1JA 2QRZA 5F2EA 3DOIA 2AQKA 3PS9A 3Q7RA 4G2TA 5I5GA 1NOJA 1YIDA 1YHZA 3DQZA 3B3FA 3CBGA 4HDKA 3KRTA 4NV1A 2JCSA 2OD9A 1UMBB 1BX1A 1P5FA 1A8SA 2VTEA 3OQBA 1QANA 3ROEA 4EHLA 3WGTA 2A86A 3OE4A 2H1OA 3D2LA 4QYTA 1VL0A 2YFYA 1NBME 1O5IA 2XXAA 1PX0A 3W7BA 1R0ZA 1NF3A 3DTNA 3GRKA 5CD9A 3DE4X 2P35A 2OAQ1 3EK2A 1LK0A 4MX8A 3UXYA 3VPHA 5KYKA 1OX6A 3P9RA 4GI2A 5K8JB 2R8PA 2IOHA 3U62A 3OTWA 3WDMA 3H9QA 3KPWA 4ZZ0A 1HDEA 1P5RA 4ZCPA 4E30A 3NONA 4IIJF 4J1TC 1M5TA 4JCOA 4LXTA 2EU8A 3DNMA 3MCWA 3RRNA 3MWJA 4KYUA 5HZKA 1H93A 2X23A 4YMGA 2VSXA 4DARA 3O8LA 4PYQA 4C5BA 2PH3A 2DSTA 4G5HA 3HM2A 5D84A 5KQPA 1PNQA 4GC9A 2Y99A 1IEXA 1XJ5A 2X8JB 3NPAA 2VFAA 5JR3A 1V5WA 2O6HA 4F9TA 5B30A 2ZETA 4PQGA 3VZQA 3ZLUA 4D4LA 1RYDA 2G67A 1FDWA 3O4FA 2AE1A 2Q0SA 2ZRNA 3C2QA 4M8LA 1O6GA 1L4NA 2JC3A 2Q9AA 4H3VA 3WX0A 3SFZA 5H0IA 1Z2CA 1J7KA 1I2AA 4O5AA 1BA2A 3U3MA 4ARBA 4DRXB 3QYJA 4YPFA 4F3CA 3DE6X 2QIOA 3ABRB 1HM5A 4AC9A 3L7KA 1RQXA 3HU2A 1W7AA 4H60A 1D1SA 2VS1A 3REFA 5K0LA 1K0UA 4XLTA 4IXMA 1NI4A 1DO2A 3RIHA 1YOVB 1BMQA 2CDNA 4DIEA 5AUPB 2O59A 3PJEA 2HWXA 3DWFA 5F3WB 3D8RA 3VR4D 4IDOA 3KCQA 2ODBA 3DTYA 2R1TA 5J59A 2EQBA 3IBGA 1GZVA 1UZUA 2PRYA 3SC2B 1V6AA 2QX6A 3MC1A 4DC9A 1Y1TA 3TE6A 2B21A 4NONA 4M0PA 3IJEB 4ZU3A 1A7JA 3GZ4A 2CXUA 4XX1A 4BECA 1R8SA 2F62A 2ZSDA 1II8B 3EGCA 4WLEA 5E7MA 4JT4A 4Q9HA 4EJSB 1L4EA 4DA0A 4DGQA 4EW6A 5E6RB 1OA1A 2I0FA 5JVDB 2W8BB 3QLVA 721PA 3HI4A 2O2ZA 3L8CA 4ICIA 2ZSAA 2NO5A 3QXJA 3B2QA 1J8QA 2FG7C 5A3SA 1JPVA 3N8NA 2H1VA 3DBLA 1GQOA 2PMCA 2PLAA 3FPLA 4Y2UA 2DECA 1PEAA 3NYIA 1UT6A 2ZB4A 4J0DA 4ZPXA 3VYTB 3GT7A 3ISVA 3KS9A 3TFWA 4B85A 5B5SA 5EJEA 4UBNA 4TX1A 1NVVR 2QRJA 2P0AA 5TY0A 5K4HA 1JKIA 3CNLA 3FG9A 3JD3A 2FKNA 4BXOB 1IOZA 1GLNA 1OC2A 3MFQA 3O4GA 5IUNC 2J67A 3ZDRA 3E70C 3B1KA 3K0AB 3SX0A 1EAMA 4BMVA 4D4HA 3D81A 4D98A 3ILSA 2YJGA 2B5VA 1KDPA 1T1JA 3GWGA 3DAYA 1N0HA 3ELYA 3HCRA 2CMDA 3MBIA 4L8WB 4R1PA 5KSWB 5C37A 1QAQA 4JLDA 4QRIA 1Q7RA 1N2OA 5NULA 3QHPA 1G5TA 2JFYA 5FB3A 1W73A 4PNHA 3V9AA 1M1ZA 3FKJA 1L3CA 2OGTA 1KR5A 2WM2A 1P1HA 2XVYA 3BL5A 3RWMB 5AW4A 4YP0A 5IAAA 2R44A 4KBGA 5DKFA 5TT0A 3WWDA 1NYLA 1F2VA 2QIPA 3VU9A 1TT7A 4F3NA 4NU8X 5KDOA 4PZEA 1B1AA 3DV0B 5EIOA 3N8HA 1CHNA 1P17A 2IDMA 2W2XA 4ACBA 5A06A 2KQUA 3NBUA 3L7MA 4J7UA 1JG1A 5K9ZA 2BMFA 3G0BA 2L19A 4X71A 4ZO7A 3C6YA 5EP1A 5IH7A 2CB0A 4XYLA 1WNTA 3BE6A 5EI5A 1DQSA 3VGPA 5K03A 3VKHA 4LVUA 2R8BA 4YRCA 4ZMSA 3H9UA 2IHKA 3K6RA 3LC7O 4P3NA 3THWA 5IU6A 3QKSA 2P9YA 1TM1E 4QJ3A 1QWOA 1Z5WA 1P19A 1UODA 2X7JA 3PD1A 3KKNA 4QAQA 4QOSA 3QEMA 1C3OB 2DB3A 3FXAA 4UUQA 4NBRA 4YJHB 3A26A 2IXFA 4G8BA 2HA3A 4N65A 3VYWA 2A5YB 2AW3A 1D04A 1RRKA 2ZRBA 4NC9A 1C3XA 4OY3A 3OJLA 4C4YA 3IAXA 2CBZA 4BLRA 2ZIXB 4PBRA 3WWCA 4YRSA 3OJ0A 2FMHA 1VJRA 5D01A 3Q3HA 2XDQB 2WM9B 1YA8A 1X7WB 3TRDA 1ZW1A 3CVOA 3ZK9A 4YRRA 3L7IA 2P79A 4BZXA 2V98A 3KVVA 4I1SA 1IN4A 2HEGA 1FFWA 3B2EA 4UKDA 5CVJA 5DN6A 4F3RA 5REQA 3DL7A 3KOOA 5B1IA 3UIEA 2WKQA 3R40A 4JB8A 3RAGA 1RXYA 1PYDA 1ZK0A 5JSUA 1M9NA 3QNMA 1P1IA 1WSDA 4BQRA 1SVWA 5BNTA 1XZAA 2A0FA 3GLTA 2AF4C 4MVJH 2OHVA 5F2KA 2F8TA 2JFZA 1MV8A 4CQMB 3IJ5A 3DM9B 3L7NA 5CFPA 1Q22A 4RBNA 3I42A 1G3RA 1JFLA 2XSZD 3NVAA 4KQJA 1RQNA 3RAPR 2GXQA 2XADA 4A91A 4CODB 4FFVA 1F48A 1LX7A 3AR4A 1AUVA 4F3YA 2RG1A 1Q2XA 1X7HA 1YC2A 4UDXX 3L93A 3HADA 1UMBA 4PC1A 1WW2A 4HBGA 5DYIA 3R7NA 2NWQA 1L4HA 2GM5A 3ETDA 4IJVA 1CVIA 4H31A 4MIKA 2Z95A 1ZL0A 4FN5A 1QTQA 5HCIA 3K4HA 5K0JA 3HLYA 4H9GA 5YASA 1H8EA 3A10A 2X2FA 1XSEA 3BB1A 4HFNA 4L1KA 4MO9A 4KPFC 4X6YA 5BY2A 2QN3A 1E2EA 1I3CA 1YRHA 5BQOA 4PLZA 3NM6B 2ZYDA 3AW9A 4MQLA 1G7TA 1W5EA 3AJDA 3GAFA 3TNYA 3VOBA 4KG7A 4ZTZB 1PTJC 4ZT2A 4O2AB 5C52B 1WXHA 2NZYA 1TYDE 1HOTA 1VJCA 2YASA 3I30X 1G5RA 2WDPA 3FJ1A 4DB2A 3KJIA 4Z5XA 5I7VA 4A6PA 2QLLA 2WD9A 2X8JA 4OYHA 4UFPA 4B2LA 5BPFA 2JAHA 1N0WA 3NJ8A 1OGJA 5BYAA 3O2QB 1JGTA 3OLZA 1FXUA 3E53A 3RHZA 3WWYA 2P4EA 1L1FA 2C9CA 1JLLB 4P3OA 4UMDA 1QQ6A 1ZJ4A 4NESA 4C4XA 2NSJA 1S9DA 2ZBEA 4EB3A 5AFSA 4DRXA 2DETA 3LUKA 2JCGA 3DMRA 1VCIA 2M6SA 4FYJA 3RU7A 2NVOA 1HBJA 1WQ1R 1H5QA 4GU5A 5EXTA 1IBRA 4MVYA 3F3SA 3IUJA 5JRDS 1Z7YA 1JH8A 3AYXB 4K9NA 4HPWA 1YOVA 4YMHA 5GPBA 4BY9E 1X39A 3U4CA 3EZFA 3TTXA 1HEUA 5EJ8A 1SUPA 2UUOA 3O8CA 3S3TA 4C2TA 5E1BA 1NWCA 1U3VA 1U0FA 4RQBA 1F0NA 1C80A 1Q1GA 3CXRA 1E8DA 3RS7A 5K0FA 2PKCA 2G25A 1P5ZB 3UK6A 2BKAA 4MRVA 3LY7A 3V7NA 1M0WA 2C95A 2PH7A 3GBVA 4JU8A 3USCS 3K8OE 2QN2A 1II8A 4G65A 4LK3A 2X77A 3ILYA 3MK31 4MDHA 4X62B 4PGMA 3TDMA 5CCEA 4ZQIA 1YOBA 5JD4A 3VQTA 3L18A 4EJSA 3EBOA 2R96A 4GPIB 4YUVA 4JFRA 3RE1A 4C9BA 5JVDA 2W8BA 4MA0A 4B7AA 4QYXA 4JEHA 2GJSA 2IQ5A 4QREA 4HVCA 2JA2A 5KWEA 4PO3X 4H27A 5KSPA 1MTZA 1BWSA 4MW7A 4HEA1 4ZT4A 3NP9A 2VP5A 2VC2B 1XCBA 2RHLA 2WG2A 3VKUA 3B6IA 3WMFA 1AO0A 4UHHA 2DHEA 3CZ9A 4AKSA 2A88A 4MGZR 4CVNA 2H1WA 3JX9A 3Q7IA 1QTIA 3QQ5A 3T3DA 2FFJA 4YRPA 3GN1A 4BO6A 3T5GA 3OQJA 3GL9A 3R5FA 1JFFB 1HFEL 2HN9A 4X84A 4AT1A 1F5SA 5ERYA 2XMQA 4BXOA 1CE8B 2CMFA 1QRUA 2W11A 2Q2QA 3A1TA 2HPVA 4LRYA 3RUIA 2ZTSA 3LUFA 4BP1A 3Q85A 3PNKA 1DBSA 2E87A 2IZ7A 5EQTA 3RQSA 1YFJA 2RFLA 4CQLB 4M1MA 3ROMA 1BTOA 2IEZA 2VPIA 1KDOA 4MCAA 1EK1A 1N8NA 3EA0A 4CLOB 1OSNA 3MJFA 4P08A 4QLOA 4FDTA 4XWOA 2CEKA 3R23A 1MQAA 2BD0A 2VBCA 2IS2A 3C4VA 4YT4A 3I62A 5LLTA 3PQ6A 2PFSA 4WLUA 2OOKA 3KSRA 4ABYA 3QTLA 1NW6A 3O8BA 4FQ5A 4LNAA 5AM1A 5BNZA 1BVYF 3DV0A 3DWEX 2ZUTA 3LXRA 4KGDA 1NUHA 5AQ1A 1DADA 1ILEA 1HI9A 2ILTA 1H4VB 1EFDN 2W98A 1YNOA 5EVCA 4B2PA 1G98A 2CVOA 3C3AA 5DM60 4CU2A 3TIVA 4QPZA 2A0XA 5TGZA 2ZWAA 3RARA 4FJ2A 1FYVA 2PV7A 4R8MA 3IKLA 3GFBA 4R01A 2NPOA 2ZBQA 3PTLA 4LFAB 4DYVA 4TS1A 2VUIB 1YTLA 4U2KA 4AW9A 2C4UA 3QFTA 1POXA 3MNFA 1BS9A 1YA4A 4EYEA 1PU2A 2XE7A 5IEBA 4DDWA 1U0TA 1NJ1A 4M9ZA 4YT5A 1C3OA 2J5BA 1X1CA 5ERGB 1CEYA 4YJHA 2F7SA 4MB0A 3H8VA 1H3EA 2GM3A 1ZXLA 3MZ0A 5IXYA 4ZCTA 4DLAA 2RHOA 1E7YA 2GAFA 2ZIXA 3VTFA 5KNLA 1X7GA 2VHCA 1ZISA 1NDHA 3BIFA 3IUEA 4O6VA 4V0LA 2RH4A 4M0KA 1I6KA 3VVCA 1XZCA 3F8WA 2XDQA 2CJFA 3PR2B 3BKWA 3IO3A 3WL7A 4B71A 1X7WA 5ESDA 1UZNA 4B48A 4BE7B 3IEMA 1N2BA 3GW8A 4ZWNA 4OSPA 1OYVA 3BWCA 5HFAA 1PJZA 1OKKA 2Q6VA 3A06A 2EJVA 3AVOA 3EGOA 5KEIA 1QVAA 2FZWA 3TBHA 3ZEAA 3LFHA 3SNHA 1XMIA 2PA3A 1YMQA 4TOIA 5J4KA 3DP9A 5F1PA 1JG6A 3EB9A 3KT0A 3KCNA 3IC5A 5C7YA 4BASA 1QZXA 1ZIYA 5G4KB 1GU7A 4N7BA 1DUSA 5CYOA 1DC6A 4CQMA 2YWGA 3EA4A 3NNSA 1RADA 1Q16A 3G68A 2WWVD 4DCTA 2ZT8A 3KOXA 4L50A 1PEYA 2KMLA 4YJ3F 1AV6A 4RF5A 1RNLA 1S7GA 1CV2A 1Y3BE 3ZE7A 4BATA 1GVHA 2D5BA 4M89A 4OHYA 3F9CA 3J81A 1FP2A 2CYAA 1AKWA 2IOFK 3BFVA 3NKVA 4E3ZA 4GFDA 4JVMA 1NJFA 3C70A 2YFKA 4EA6A 3M3DA 2RGCA 2AT1A 5GM1A 1AKUA 1QKJA 3JQAD 1GQYA 2PRIA 4EFMA 2QWXA 1ADFA 4JR1A 3RD5A 2MSLA 5BSVA 3LP6A 4XKJA 1YKGA 3K0SA 2Q5OA 2I2BA 4JLOA 3VV3A 3ESBA 1BS2A 5AVRA 3KQVA 2VHXA 1SMKA 4DDUA 3SVTA 3KB8A 4GWGA 1D7OA 3LPAA 4O02B 3I83A 2ZYWX 5JD3A 5KJCA 3CGWA 3C0KA 3BQ9A 4FNAA 4G0YA 4HEHA 4UTXA 1SCBA 3O8DA 4QXRA 5K1ZA 3IDZA 5A4AA 2C9ZA 4O2AA 4DIDA 5AK5A 4LRWA 5CDFE 3AINA 3GLRA 3OEYA 5ALMA 3PXGA 4AJPA 8MHTA 5TIIA 1I2DA 3JD0A 4N8EA 5EKUA 3BBLA 2FPIB 1KYYA 1OXXK 4MGIR 4YHHB 2NO6A 3FLMA 1WPXA 1N2XA 2JRLA 4RMGA 2P9HA 3V2UA 5HCNA 1H2XA 2JKZA 2OO5A 3HJAA 4YLYA 4G5OA 1KNQA 4EELA 1OV4A 1K8XB 2O7RA 1JLLA 1KAMA 1WZ2A 1WPGA 1J42A 2PFGA 2QGNA 1NIPA 5AKZA 1ZLYA 3U4DA 3A6DA 3F6RA 2Q5IA 1JWLA 4P0QB 2GPBA 2B25A 4IV0A 4F60A 2WHEA 1BX3A 2P75A 1OFVA 3ZHVA 4PSAA 2F64A 3T1NA 1J23A 3UHAA 4LYDA 4QU5A 5EMNA 2O8EB 1JDTA 1GUZA 2CB9A 2ADMA 2B6NA 1NX9A 2D1SA 4IQGA 1KJ8A 1VPDA 5FOXA 3TN7A 3L49A 3T0IA 2Q4OA 4YTEA 1E64A 3K92A 4GZ6A 5EFZA 5BUZA 3CRVA 3IOYA 2VZ9A 3V8QA 2DHRA 4RMHA 3WBBA 1GAEO 1OTHA 2DBVO 1T8SA 2DM6A 3GD5A 3LUPA 3M7IA 2ZTUA 3GBSA 4MUXA 1G64A 1NXWA 3HY6A 4IYRA 2ZTHA 3TVYA 2JAXA 1JS1X 2XB6A 2YZ7A 1NE7A 1FTYA 3A6FA 3H97A 4TV9B 4JC4A 4MJ3A 4ENVA 3GA7A 1K3TA 4MVJG 4WFIA 5TARA 4HNGA 2QLNA 1H0SA 2YVUA 1GCOA 3QM1A 3H18A 4EB0A 5CFRA 1G8HA 2EL7A 1UPCA 4MS1B 1ZWLA 2XTZA 3KKEA 1D4ZA 3CCFA 3LWNA 4R1MA 3FYUB 2VYCA 4BO5A 1JHDA 2OVBA 2W93A 1SN7A 3S8MA 4OREX 1UJ5A 1ZH0A 3VC1A 4AU1A 1U3TA 1V11B 3BTSA 3WLKX 4HNRA 1Z4NA 2HT6A 2I67A 2OQVA 4ETIA 3B5IA 5C1IA 3UJ8A 1KKMA 3C48A 3NKFA 2IEDA 5DSXA 1V3QE 1R6UA 2G06A 3FSGD 4L5CA 1ORTA 5TPWB 4A9AA 1IVSA 1KH3A 1V25A 1RRFA 1MPXA 2ECQA 3JZIA 4CV3A 4PCUA 2P65A 5HDBB 1JVBA 3EGDB 2MT9A 4BWFB 3KLOA 3TPZA 1WD7A 1JKJB 1ULZA 3K35A 3ND7A 4J16C 4YRFA 5MGNA 1JFFA 1XNHA 1D1PA 4E1BA 1FC0A 3WDLA 3SJAA 1CE8A 3I2IA 2Q7DA 1N34B 2P4HX 1Y34E 1MO6A 1I3LA 5ICGA 2YJ3A 1BHJA 3WBJA 5FCDA 2DY1A 2NYVA 4EP1A 1UP4A 3TQQA 4G1FA 1G42A 4PANA 1YONA 4CQLA 1ISIA 1OV6A 1PL8A 3UO8B 4RELA 4R1QA 5A7FA 3DCJA 4IQ0A 4F6LA 4HYQA 1UZMA 4B46A 4CLOA 1JH9A 1BOFA 5K05A 3BSYA 1YL7A 2GVNA 4RK7A 3OEED 1U8AA 3QFHA 3RVSA 2JBAB 1KL7A 4IOLA 2IXAA 3ETEA 1VI5A 2ZRIA 5BQFA 4H6VA 3CA8A 3C6MA 3NGLA 3PGA1 1QOPB 4J3JA 1TYAE 1AHIA 1RI2A 3SZOA 1MOSA 2XNDA 4FYVA 4G26A 4RGQA 2VUUA 5U4QA 3C4JA 2H11A 3SYLA 1HX7A 2BV3A 2HCJB 3R8XA 1ORRA 2INGX 1DP4A 1EG2A 3ZKAA 1N3LA 2FK8A 4OTZA 3B60A 3PNLA 2FR0A 2OXFA 3GU3A 3LOUA 2PTGA 5C8YB 5TS2A 2Q5QA 4HLUA 1JALA 4EGAA 4I46A 3N53A 1FVXA 2JJ1D 4FE4A 4NATA 2IS6A 3S8YA 1YCFA 4CV2A 3KBOA 3KXIA 1EXDA 1DWOA 4EYSA 1I30A 2XQVA 4ZC1A 3KJXA 3UJBA 1IHPA 3GCWA 1JSXA 3GRUA 3NIDB 4HRVA 4II2A 4ND4A 1A4RA 1MDBA 4ZI5A 4A0RA 3I5XA 1ND6A 2IH5A 7ABPA 2CXQA 4YS6A 3CRRA 2FMUA 3WLAA 5FWDA 1VCNA 5IUKC 1YB4A 2WSMA 3K2BA 4INOA 5AXDA 1YDFA 5JS7A 2BH2A 1WSBA 2ZIGA 1EK6A 3H5AA 3LCRA 3OQIB 2BWJA 4L9RA 3U7JA 3K0KA 2CUTA 3DUFB 2DJIA 1XN1A 1ND5A 5FP0A 2FRDA 4TL8A 3WRXC 1FB5A 1N5MA 4JV5B 1U9IA 5ENDA 2P2NA 4TZTA 1YRLA 2IDZA 4Q7EA 4G86A 5CTJA 4G5GA 1OH5A 1U0GA 1Z68A 1XC7A 2WV7A 3MINB 3P27A 4CKXA 1WW3A 3OZDA 1BZYA 5G4KA 1SXHA 5LQNA 3W04A 1I01A 4FFLA 4EPYA 4B0OA 2CFSA 1IJEA 1RMTA 2AB0A 4DR3B 3EZGA 4W4TA 3K31A 2QDXA 5EC8A 4C4SA 3RGWS 1P45A 1L5RA 2C61A 2V7QD 3HQ4O 5KJ1A 5JC8A 3ABIA 1KI2A 1T2NA 4R9UC 1Y1LA 1Y5IA 3HJCA 3T5TA 3VI4B 4LWPA 5LQCA 3SXJA 3HA5A 3HYNA 5F98A 4BKOA 2IYOA 4QDUA 2VF5X 1LS1A 1E9EA 2YZNA 5KBYA 3SQNA 3PHGA 2IYLD 4KO2S 4IFBA 4YAFA 5E2IA 4TXNA 2HB6A 4NY1A 2GCGA 1VMEA 4A23A 1B6GA 4U02A 1G60A 2HRBA 1RQGA 5CBKA 2OZLB 3RRXA 4MWZA 4V0OA 3KOUA 4ROTA 3S44A 5K3OA 2FLWA 5KVAA 3LQYA 3S5JA 1CERA 1Y7IA 3L6DA 4RK6A 1Y37A 4JUCA 1RBQA 1V8PA 2XZPA 4G25A 3TVTA 1E1LA 3BFKA 2PXCA 1XD9A 4FXOA 4GICA 3NBZC 1HMPA 3KUXA 4OLHA 5I5EA 1N6PA 4UBMA 2W90A 2Q4DA 5DHAA 5EIWA 1SVIA 2R6JA 3EG9B 5JWOA 3C1TA 4WY5A 1EG7A 4XA8A 1VSTA 1V9CA 2QPLA 2RHBA 3N59A 2FPIA 5H4HA 1QGAA 5FULA 3LBAA 5K3SA 3S6JA 3K7EA 2WYHA 2ZYAA 1IK6A 5M04A 4OXRA 4FDLA 4DCNA 1WXIA 4Q9JA 2E3JA 4MW9A 5DASA 5JAHA 5G1PA 2DWOA 2W2KB 2Y4NA 4FQ8A 4Q3DA 4Z9AA 5AIBA 1Q77A 1U31A 4UEOA 4A2QA 4AN1A 3TOSA 1QZZA 1E3TA 1KU0A 2OXIA 4I7EA 4JSYA 4WGFA 2C4HA 4U7FA 4N47A 3D6NB 4W5NA 3B2NA 4CTMA 2O8EA 3L7YA 5B1HA 1IBLB 5K01A 1KPIA 1PR5A 1SEPA 1J07A 4S0ZA 5L6LB 5C1OA 2YMQA 3NWBA 2JKVA 4IY1A 4YXFA 1PFWA 2I6QA 2I2FA 1WBBA 4A0FA 4YREA 3FUVA 3C3PA 3WMRA 4BFWA 2JCXA 2GF0A 3I3SR 3GMDA 1LC0A 4K87A 4BFUA 1C7QA 2YOHA 3RC2A 4GKBA 4I9UA 1CY2A 4UZFA 1QSGA 2C5FA 2WFMA 4TV9A 2IYFA 1JXAA 1THMA 3ODGA 4LE0A 3GPIA 1PG2A 1D2CA 1Y9AA 2AMYA 2ZIZA 4FB5A 5J3JA 3U56A 4AKTA 2Z30A 1E4EB 3ZYCA 1FDSA 2VYND 3ECAA 1TM3E 2V8BA 4MS1A 4PIMA 1ZNXA 1GQFA 1XA4A 5E7QA 3FYUA 3U3XA 5BXQC 3WXBA 5JTTA 2R4QA 4BO7A 4DLPA 4IO1A 4ENQA 3H9EO 2E5LB 1M6HA 1V11A 1GRQA 2DEUA 4XH9B 2ZI5A 3D9QX 2WKSA 3NEPX 5JCPA 2PXAA 4F7WA 3U39A 4AO8A 4FFMA 1T8TA 1YV9A 1QTRA 5CIWA 5TPWA 3RANA 5JBQA 4O59O 1OXVA 4KFUA 3KU4A 1T9BA 1FNCA 4KXWA 3C14C 4Y6GB 1M6EX 3SYMA 4X66B 3EGDA 1ZD5A 4RH0A 1QGOA 1JKJA 1V4NA 5HIIA 5ENVA 4CMEC 4ER5A 4FMPA 2O7QA 4Z4HA 5ICEA 1NWHA 1K5HA 1JHPA 5GQSA 1FNSA 3L01A 1H3FA 3GYGA 2ON6A 1Y5MA 3I64A 4CXMA 1U0NA 4TS3A 1POWA 3ZJYA 4WOKA 5K20A 4QTZA 2EYUA 3GRFA 3MTBA 5E6UB 4ZD6A 3LDAA 3TRIA 2J4DA 4COKA 3TGLA 3Q0EA 5CG1A 3T1HB 2P2SA 2C5GA 2WTAA 3EMDA 4ZODA 3IHLA 3B13B 1JA1A 4I14A 4R2WA 3WGMA 1V41E 1W4LA 1MFZA 2CUKA 2JBAA 3N76A 4JVNA 1XQ1A 2G9VA 2P40A 2FW7A 2PAAA 3FE2A 2O2GA 3FJOA 4JR2A 4O8CA 4OYRA 3T34A 1D8AA 3T5DA 3W5HA 1L4YA 4BGVA 5AKJA 4BJHB 4ZDJA 2APJA 1KJQA 2RI1A 2NT3A 2IHBA 1F6BA 1HE8B 1XQ6A 2WJVA 3D3NA 3SYRA 3UW3A 3N2LA 4KDCA 4M9RA 4I4TB 3QLTA 2E4WA 4JAVC 3UWPA 3HR7A 5DGIA 5DCYA 3R0VA 3C39A 5CLLA 3TO5A 3CNEA 3OG9A 3TJMA 3FD8A 1B7GO 1M75A 3JZFA 5HUQA 5C8YA 3TM5A 3WK6A 2R85A 1YJBA 1RJFA 1S8NA 2PANA 4RFLA 1QF7A 1KI1A 2I62A 4OX9Y 1GYQA 1ZZEA 3O0DA 3R4CA 4TV8B 4KW7A 4DIKA 4RAQA 4HCJA 3PUWA 1JMVA 5EJMA 3DFZA 1TIKA 4RZQA 3VOAA 4JBGA 4JIGA 2ZLBA 3OUTA 4IZHA 4MSUA 3WLQA 1LC3A 4KREA 5EEHA 3C5EA 1QFXA 1ZKMA 4TTIA 1E0DA 1U5BB 2E4ZA 3C3BA 3HWX1 5I9IA 2O19A 4OBXA 3CRZA 1QHHB 2PT5A 1TLFA 4RKWA 3EARA 4GLLA 4A5SA 4D0NA 3U4MA 2XCUA 3OQIA 2WU1A 3NIWA 5FA6A 4GZ5A 4WADA 3K2IA 4RO0A 3ZS8A 3ZZ1A 4C03A 2M1XA 3DUFA 4C3OB 5L40A 2BMWA 2PX6A 3RTGA 3F5MA 1T9CA 4G0WA 2W6ZA 1NQOA 1JDBC 1MB3A 1NBEA 1RSZA 3FLAA 2ZJAA 2W48A 1A50B 3MINA 4BB0A 4V0KA 5HNKA 4NDNE 1O89A 4L2IB 3I34X 4FBMA 1FFCA 1KK2A 1NDUA 1NVGA 2WSSA 2C0QA 3REOA 2VQ3A 4UNIA 2GTIA 3ZU3A 2YZKA 3RHFA 4JJGA 4GSKA 1BQEA 5HZMA 4PGFA 1RQPA 2VCYA 1N6IA 2C03A 3L07A 3T7SA 1YQXA 4X8OA 4U7WA 5KKCA 3GPBA 4L9AA 5AW3A 3DHVA 3E9EA 2V7UA 1O94D 4ESOA 4ZGGA 5IVPA 5I9LA 1NMZA 3ANSA 1VL6A 3V1LA 3K70B 3LX4A 4OHMA 1UF9A 3FTDA 1ZI9A 3T1YB 1UBOS 3LHSA 4KRYA 4PFJA 1VRVA 3LPLA 3QKWA 1GTL1 1K7CA 1Z4IA 3RKUA 3WGJA 2WWFA 2X5JO 2OZLA 3KAJA 4R31A 3FMFA 3IEKA 1TA9A 1W4CA 1TJ4A 4EO7A 3PNQA 3QPDA 4CL8A 1M1YB 2Z2ZA 3DVSX 1PWYE 3D8HA 5H9VA 3QPUA 3TNFA 1J49A 4KFSA 4NABA 1I7PA 3ZHCA 2H06A 1NURA 4BPBA 3A1WA 4O4JF 2YOFA 2PVSA 4QHTA 5DM1A 3EG9A 3ECSA 3EGEA 4FHDA 3W05A 2NQTA 1J9GA 2EXXA 3JQGB 1PD0A 3NVDA 3F96A 2EGGA 1Q1EA 1B0ZA 1JPNA 1CY8A 1B42A 2GYVA 2IPXA 2NLOA 3NDIA 1XQVA 3OT4A 4L8VA 3GXBA 3L1JA 4HS9A 2VPPA 4BV2A 4B6FA 2IHNA 5EKXA 1AF4A 1WKVA 2W2KA 3M6UA 4RADA 5G1OA 2NVBA 1KTVA 4ZO6A 1I32A 2QRLA 4FS8A 3KFXA 1ISGA 4WLVA 4CLXA 1B0AA 4J6FA 4C7OB 2UUBB 3WS7A 1DRKA 3DZHA 2Y92A 1JMKC 3D8SA 4I1IA 1B76A 4ZFNA 1HEYA 1Z6AA 4IBOA 2HLHA 2WWHA 4Z0HO 4PHCA 1DT5A 5HHTA 2R7MA 4KACA 5LKRA 3KHUA 3QNWA 4QM6A 1T2DA 3BXOA 1C1DB 2UYCA 2BZ0A 2NV6A 3ND8A 3KDAA 3TB6A 2E0IA 3FBGA 2CLFB 2XRYA 3R3UA 4PYNA 1WMSA 3D6UA 1H22A 1SKAA 1VJ0A 2X8LA 5HK8A 3PCRB 5K6AC 1JB1A 3P9NA 5E7JA 3I04A 1N36B 4EI7A 5HKBA 1USVA 3KL2A 4M88A 4MV3A 1YQWA 1SFRA 4CG0A 5HZHA 3OH8A 2L82A 2OP1A 2XX3A 3VBCA 3HDTA 3HJGA 3ROXA 4GQIA 1E4EA 3DZJA 3KSUA 4ZAGA 5JI3E 1SXJC 2JFUA 2DULA 2JIZD 2PK3A 3D2CA 4I36A 4MTCA 3PSAA 4UEWA 3GJ0A 3LQ2A 1OZGA 2PEYA 3OETA 2WILA 3TZLA 4EX7A 4ZVKA 2OQ2A 3I39X 2Z5VA 5BSWA 4IP0A 1H4QA 2UUPA 1GAXA 4KE7A 2SECE 4GOKA 4MUKA 4N12A 4KXMA 4NBTA 4BLPA 5HUJA 2QTBA 4FHFA 4N7RA 3IQGX 2DWPA 4EH1A 3H4MA 2OZPA 2WPDD 4I55B 4W9RA 3D2BA 4H6PA 5IXSA 1K1EA 2H7CA 3N75A 3B70A 5AI0A 5FWNA 5TQ0B 1PI3A 3F9RA 5LFAA 3OOSA 4AZSA 3LP5A 1PG0A 4TTTS 4F1JA 3B7WA 2OAGA 4ZMBA 3SJUA 3JAMA 3EIUA 4ND3A 2ZIVB 5LXTB 2Q21A 2FMIA 2PSSA 3L41A 3DE7X 3HXMA 1VHDA 1CFJA 1TAGA 3R0JA 2C42A 2ZBRA 2HA2A 2H8KA 2Q0HA 3RVRA 1FYDA 1UOPA 4NH4A 1FMLA 1ODCA 1VPTA 5E6UA 3TM4A 5BR1A 3QA3E 5JY1A 3ZJVA 3WI7A 2P4QA 3RC3A 2WJZB 4CIVA 3D7LA 4CHTA 1UP6A 3PF9A 4UVHA 4C78A 2W6QA 4CMIA 5C53B 2OV1A 3G2HA 1TIBA 5ARCA 1TMKA 2WSLA 1HFWA 1CUVA 1I24A 4PHHA 4RD0A 2A78A 3K6SB 2ADOA 1WLYA 1XI2A 2ABWA 3LX8A 4NICA 2NU8B 5IJWA 4NCBA 1OZ0A 8OHMA 3ZCXA 5IKPA 1MJNA 4B3RB 1OI2A 4I4TA 4RY0A 4U5QA 1KK0A 3FYDA 3FUUA 1NSYA 3QMPA 1Z29A 3R3XA 4UAJA 4GMXA 2GERA 4F85A 4YBRA 1NXOA 2JIMA 3QVWA 3IAHA 2CJWB 1NMEA 3C7CB 2QXUA 4JBYA 4O2BF 4DG5A 4P86A 1J2YA 4YMLA 1GGNA 2HZ7A 2IUYA 1N75A 3IEXA 3WLEA 1R6TA 3SEAA 3DDSA 1R4ZA 2E5FA 4K6CA 4LJSA 4PBSA 1BE1A 1XDSA 5ELLA 5J1SB 1JQDA 1CC1S 1TPZA 4TV8A 2E5WA 4UASA 1RWQA 1Q44A 3FFBA 4KKXB 5ADHA 2WUGA 3AI2A 1ECGA 4HVTA 4L3WA 2G9NA 3C98A 2D4AA 4GPAA 1Q7BA 5IC5A 2HGSA 1U5BA 4NF2A 1SHJA 2B36A 3L8MA 1A9SA 1UK8A 4ATNA 3BXHA 3SBXA 1FNNA 1QHHA 4YCCA 1KMNA 1EFTA 5EIXA 1PDOA 2Q28A 3SXUB 3R0IA 5FTWA 5IVDA 3MPOA 5JAMA 4WEOA 4ZT6A 4BLUA 3H84A 2PVPA 4YRMA 1H2BA 1UMCB 2RK4A 2BSQA 1F4PA 1Q83A 2ZSBA 1V1JA 5AVTA 3VPSA 1RHUA 5A03A 3KALA 4EY8A 4JC0A 4PIPA 1EVEA 4CI0B 2X3FA 1HV8A 5KKNB 2WTXA 4LRQA 4L2IA 1KI9A 1XTTA 1TEXA 1E9RA 1RQRA 2B2XA 3H2KA 3ZQUA 1KC3A 3RSOA 3IUBA 5HF5A 4HN4B 3G9QA 3TZ6A 3KPJA 3V2GA 5SICE 4NMHA 1DX6A 1ENZA 1R9JA 2N1MA 2FZVA 1VLLA 4IGEA 1PO7A 2H63A 3PD7A 1J8DA 4AZ0B 4K0RA 5HS4A 2BMDA 4YUYA 4HFMA 5IAGA 4ZEMA 2MYUA 2OGSA 5EVJA 1EDBA 1VB3A 2X0NA 2DUJA 4IEFB 1GG9A 4BVBA 4BZPA 1IY9A 3Q72A 5GTDA 3BS4A 2P6NA 1FDRA 2Q8NA 2YJNA 4NBUA 2GYWA 3D7KA 1TCBA 4XCVA 1XZIA 3CX6A 1M1YA 3I6BA 2G1JA 2CXTA 3MELA 2UVPB 3HDVA 2IOFA 4JKOA 3IAM1 4OA5A 4XFDA 2QUAA 5JSFA 2KS6A 4WT7A 4ZAYA 3WFZA 1J56A 1LLDA 1W0KD 4PXSA 2P6MA 4RA9B 3KO8A 5CFLA 2AJDA 3QOYA 2BKEA 3LPCA 3B52X 1G8YA 1VFPA 2DTEA 2RGGA 3JQGA 1SBYA 3PRJA 4RLSA 3WG9A 4DNXA 1R0CA 2IYSA 4BV8A 1Z8FA 2QQGA 3EOBI 3I9MA 3QOWA 5LOVB 3UW1A 3KLBA 1Z45A 3QVKA 5DEIA 3KYIB 2D2EA 2ZRJA 5AKGA 3FDZB 2QUBA 1W5SA 5CFQA 3JY6A 2V9CA 2GD2A 3ZD9A 4C7OA 4ZEXA 5F7ZA 1S2IA 2I4IA 4GW3A 4D9IA 1BIFA 5AJTA 4WKNA 1SCDA 4AJ1A 1X1AA 2J5KA 1AN9A 1C1DA 1L9XA 1D03A 1ZK3A 2QB5A 2QLBA 2OVFA 3EODA 3PQFA 4YRTA 1U1CA 3RJZA 2KPOA 2C5SA 1CZLA 1P3Y1 3USES 3MYRA 2J30A 4X00A 5D3ZA 1GDTA 2ZUBA 2FW0A 1YAJA 3V1KA 4EB6B 4DV5B 2YV3A 4FYKA 2I2WA 1MT0A 4WSOA 1WG8A 3ROZA 2MJLA 3TLAA 2P9ZA 2FWNA 3DB1A 4EUFA 1BE8A 4OI4A 1MRZA 1SR8A 4ZOEA 1TNDA 2VA9A 2XBLA 4F45A 3JWEA 4HSGA 1ZK2A 3PQ2A 1VQ1A 2HDNB 1RC8A 3E7PA 2ZRFA 2QT1A 2X13A 2FGJA 1AGXA 4ARAA 2Y71A 3LC1O 1A82A 1MX5A 1RYHA 3VTAA 1NNSA 3ZG6A 1XP5A 2Q2VA 2NXNA 4KIJA 5KVSA 3RUCA 1RYYA 1VLJA 7GPBA 4S1VA 1APBA 4KR2A 3LX6A 1USKA 1QK3A 3TCKA 4I55A 1T6NA 1TMOA 3UICA 4R8RA 5K3EA 4BBAA 5E0KB 1QRDA 2QMHA 2XCIA 5TQ0A 4TKMA 1OIVA 1JT2A 2B5WA 4UQPA 1EEXB 4HDRB 2IXDA 3VVLA 2VCHA 1X7XB 4ZT7A 4WAUA 1WF6A 1QB7A 1Y4SA 5A4DA 5LXTA 4J0HA 2H6EA 1BMFA 1E9DA 1VHQA 3BORA 4KV7A 5HE9A 4JT9A 4TRJA 2H59A 3OLQA 3HFRA 1PK8A 5IPFA 2NW6A 3O47A 4F0JA 4HV4A 3UJAA 1ESNA 1HFKA 1ONNA 4BAZA 4LTMA 3U1TA 5KCZA 3BWYA 3ZDEA 2XOXA 3F8TA 3FZEA 4CKCB 2AE2A 1R9NA 4R83A 1GGFA 2D00A 4HO1X 1Z4KA 1YDGA 4L5AA 2Q1SA 3HCDA 5K0ZA 1A8HA 4QPDA 1W36B 1ESZA 2QUJA 3ED1A 3WV5A 3RVLA 1W96A 4DCOA 3K6SA 2JJQA 4Z51A 2JD1A 3GGCA 4QHYA 2NU8A 2QD4A 2DRIA 2NM0A 1KK3A 2C94A 3EZ2A 1XEWY 2G04A 3E7XA 3ZNOA 1M34E 4LHYA 4CM1A 1GQ2A 1PGJA 4KK4A 2PX3A 3NORA 2K5UA 3OLYA 4OHXA 3A6KA 2AMJA 3QPVA 5KWJA 2CJWA 1V3TA 4Q93A 2QU8A 5H70A 1NAHA 2HL6A 1NC3A 1KTIA 1FRFS 3GRVA 3TR6A 4GDFA 1ZJWA 1ZS9A 3EWSA 4LDRA 1T0UA 1FFEA 1IPHA 2VHZA 3KD3A 1JJFA 2YMPA 3QEJA 3NNDA 4KWIA 4E51A 1U6IA 2EZTA 3U31A 1WE2A 2Q27A 2ZTMA 4DG9A 5I7AA 1N4AA 5HKAA 1KMCA 2O5EA 2CLDX 1Q0ZA 3OKAA 4K0KB 1R6BX 3V42A 2I1LA 2ZE7A 3E1KA 3BMOB 4DMGA 3MIIA 1K86A 1W49A 4TT8A 4Z54A 5B1SA 2XT0A 3SXUA 4BVAA 3AL2A 2NQ8A 4QTTB 5F9FA 3PDWA 4GT1A 3OECA 4AURA 3AIOA 1AQ6A 1H3NA 1R6AA 1UMCA 4N03A 4S2EA 2DX7A 2GR9A 1RYNA 3NHUA 3L8ZA 3K9HA 1SU4A 3HBAA 4JUFA 4P7KA 3C5HA 4QD3A 4D9HA 2RH9B 1G8AA 4GBMA 2IU4A 3H5RA 3W6NA 4YT8A 3NXSA 4CLHA 4JWKA 3KZMA 1XAJA 3BK2A 3ZC3A 2WJJA 1FPMA 4RKRA 2FUNB 2B4KA 4YNBA 3D02A 5EKDA 1BMDA 4Y2GA 4MPPA 2C98A 3NH9A 4GI3A 5JNTA 4OF4A 3N86A 4IRMA 1KFKB 2VJYA 5DGCA 2IPAB 2ZJYA 4LMAA 4X6UA 4CCYB 5KTPA 2YUIA 1LBTA 1XZMA 3EEOA 5DXAA 3EJWA 1WO8A 8ATCA 5JVDF 4M0EA 2JAUA 3WIUA 1G6KA 4LWOA 4MRNA 2BHTA 5LSAA 1DQPA 2BR3A 4AMBA 3FCOA 4PRKA 5DN6D 2GBIA 4AZ0A 5ED0A 2UZ3A 5IW8A 3PRHA 4DA7A 2HIMA 3AR7A 4XSVA 3H86A 1LUAA 3RRZA 3OZVA 1YBAA 4EVSA 1ZZGA 3BF7A 3SFTA 1K5GA 1IJFA 1ODKA 2OR3A 2V7BA 4HL6A 1JIXA 1R0WA 3RQIA 4FNOA 4AIRA 3RREA 3H99A 1YS1X 1L7AA 4Q48A 5HJ7A 2HI0A 2DAPA 3FOWA 1M1YE 5DI3A 2AFHE 5BV0A 5F9HA 1NC1A 2WWXA 2UVPA 3HL4A 4I81A 2WF9A 2PSHA 2W6JA 5B4VA 3C6XA 2FN7A 3TE7A 5KNCD 1A88A 3K8ZA 4RA9A 5JMTA 1HYBA 1K8ZB 4AMYA 1PS8A 1X70A 1SUSA 3EJ6A 3VSDA 2WIGA 2YL2A 2PCJA 2IUUA 1UDCA 2IRWA 2K6GA 2Q3CA 1SUDA 2QUZA 1KJYA 4YCAA 5TGDA 4FX5A 1LTKA 1Q7EA 3ZDCA 5LOVA 1WVIA 2VSFA 3A28A 4AM8A 3KWMA 5IMBA 1H8ED 1XE3A 3FDZA 1V9LA 1YVPA 2GPWA 3ON5A 4LXYA 3D3KA 4BAGA 3MQ4A 4TMFA 1BJTA 1U8FO 1QU3A 2GLXA 5CDUA 2VNSA 2FLKA 4LGMA 4DLNA 2W6MA 3D6HA 3DCNA 4O2RA 1GAWA 2PSEA 3CUKA 3R5TA 3DHYA 4NZPA 4R0MA 4E11A 4PBTA 2FZGA 1JZSA 4M7RA 1EESA 1T2VA 4BMYA 3EPKA 1Q92A 5GJVC 2C4WA 3RRBA 4DSTA 1XF9A 1RM5A 4LCBA 3UG6A 1R0YA 1T29A 5JQWA 5DLYA 3AFMA 4BNJA 4EB6A 4UEKA 2EYQA 4ZVOA 1P5HA 3HU5A 4DJJA 5KC9A 2Q99A 5LCXA 1GY8A 3K9BA 5ICMA 4G07A 4X92A 1Q0TA 1Z35A 1J4AA 5DXJA 3CPHA 1A1SA 1I3OA 2PRZA 4P8RA 4C4OA 1LLUA 1ZQ1A 1ONBA 3GFTA 3CVUA 5FL7A 3LQQA 3RUFA 1RU3A 2IJGX 2XMBA 3F6EX 3AT1A 1NRWA 2CF6A 3PNPA 1LPAB 4QBIA 3UT0A 5B55A 1OAOC 2R8YA 1XLUA 2VT7A 1W19A 1YB5A 2F1JA 4HF7A 3VZPA 2J4CA 4AD8A 5I47A 1XCLA 2IA5A 4OK6A 4PYOA 3A4VA 3PWKA 5THXA 5CFOA 5L4SA 2BOVA 2AI1A 2BCGY 2G9ZA 3QKIA 4RV9A 5LQAA 1VJTA 1J99A 1P2UA 1P0QA 2DHCA 3OY2A 3PPVA 4ZVTA 4NBVA 5C5EA 4Z0PA 3JZAA 3GG2A 2X5OA 1KYVA 2LDBA 1TL7C 4ZAWA 2QLTA 4HDRA 3C4QA 4EABA 3NP7A 4JVOA 3WKAA 1QG4A 1X7XA 2G3YA 4NJOA 2JLZA 2Q3BA 4PSKA 3BTOA 1BYIA 1B8VA 3WQSB 1JHYA 2XZDA 3L6CA 3B6ZA 4W5RA 3MAJA 1TIPA 3KKMA 1I1QB 2QQ0A 4PSDA 4ROSA 1PQPA 4N9WA 4RVNA 4UOZA 4F4CA 1NHGA 2UYQA 5LWQA 1G0NA 4DXDA 4KYIB 2WM3A 4BVJA 1CUBA 2J08A 1EXWA 1YVEI 1Y4ZA 2Z4SA 4CKCA 2Q8QA 2R25B 5KNCA 2Z6UA 1R16A 5BYBA 3PD0A 3II6X 3FPAA 3TRHA 2GT1A 1GGVA 3OSZA 1ZVQA 4HB4A 4QWWA 3N8GA 4N1AA 1IHXA 1X13A 3B7GA 4R69A 1J39A 4ECEA 1E79A 4H7JA 4TLAA 5GAJA 1G2QA 3RF6A 4KHPB 2XNCA 4GBGA 4QGFA 2QMYA 4BCCA 4O2AF 2QD5A 4C0LA 5AH0A 2BUAA 3MS2A 4OBEA 1AMNA 1M2EA 3GPCA 3EIHA 4X8LA 3AUJB 5EQJB 1NJGA 3H0CA 1LNSA 2H5EA 3N5KA 2O1XA 3IELA 4MV6A 3VO9A 1PF7E 4BLWA 4OXYA 1UOEA 3CW8X 1BXKA 4XD2A 1AD2A 1KEKA 4Y6LA 2EP8A 1E9CA 1YK1A 2JKYA 3EXG2 3IOEA 3V3TA 2B0JA 2PO5A 4MKRA 3DD1A 2NO7A 4Q3CA 1S89A 5ECDA 4QUHA 5H3CA 3VZRA 3UK0A 3HTXA 4YBZA 4IQ4A 3I1IA 5KYWB 1T2AA 3OJEA 4KAXA 2YV4A 3G8BA 5IDWA 1E4YA 4YUAA 3BMOA 3BULA 2P77A 4BNDB 2ONCA 4MGEA 3EULA 1UXOA 3QYPA 3WB9A 4NQRA 2ISQA 1Z5UA 4G9EA 4LZZA 3LO5A 5A5VA 3U3RA 4N01A 1J2JA 3K20A 5DB4A 1EIZA 4D99A 5KWVA 1H65A 3ZKWA 1UXJA 3SOPA 1PGOA 2QG4A 3HCCA 4N7MA 3TQIA 5DCLA 2V5VA 4RYLA 5J2UB 4AP5A 1GNVA 4HP8A 4RMJA 3W3AA 4I6JA 1IWPB 3QPCA 1ZN9A 3LQ1A 2VXBA 5IJ9B 4TUYB 3OQMA 1RR6A 3OOEA 4MYHA 4P92A 5DNDA 4B6SA 3GYBA 3FDJA 3NHKA 4DR2B 3ADPA 4HWKA 2UZIR 1KAHA 3PUYA 3PVZA 4BCBA 4CCYA 1M73E 1LK5A 2IODA 1OTXA 3T5MA 2GJAA 3G8CA 1MAVA 1DAMA 1ADBA 2I03A 3CKKA 4KXVA 3QW4B 2IYNA 1DC5A 1VJ5A 3OFJA 3NAMA 4KE9A 5AW1A 2W0MA 3G85A 4FYIA 4O4IB 3PXAA 1SXQA 1QIGA 4TMKA 1OKKD 5D1HA 2BC9A 1EZ1A 4BN0A 1IOLA 1ZWKA 2ZDGA 2OBFA 1VYHA 2YINC 1OJ7A 4B7ZA 1WABA 2OSBA 3LF2A 3PC8A 1M2WA 4QSMA 2BGWA 3PQ3A 2FZKA 4DUPA 2WAAA 1J20A 3FPHA 4V3BA 4S3MA 1U1EA 2XIJA 3WZLA 3ZUPA 4EKDA 1G20B 5DULA 4CL0A 3CZMA 3FPFA 3QITA 4G4SO 4WLFA 4XVRA 4U9IS 3ZWCA 4CQMD 4L75A 1QE5A 3G5MA 3VU1A 2YVLA 4P0TA 2F4NA 3RVPA 1NM5A 3EAGA 3F4LA 4OO3A 4KH1A 3JYPA 2QAJA 2Z4TA 2VDJA 4FK8A 3R7LA 4B43A 3F6SA 4G84A 4NBSA 3QLEA 4H7FA 4GL2A 4KO3S 4JLBA 4KN8A 1V8BA 2CXPA 3CCCA 4YC7A 5AVVA 2WQ6A 3ONFA 3F46A 2GK6A 1USGA 3FPCA 2Q1UA 1NQVA 3ZXUB 2Q9UA 2R8EA 3DW3X 2OPHA 3WAGA 3RW9A 3L06A 4Z9YA 1M6YA 4Y2JA 3ZXSA 3SPXA 2OCBA 2IH4A 2CVPA 3JYOA 1MT3A 5T4EA 4FLMA 1D4OA 1YU9A 2RHTA 3W2EA 3LPDA 4YV2A 3H2ZA 4LPSA 1CUYA 4O5OA 4OJNA 3VR5H 4CKBB 1QLHA 2NZWA 3DWGA 3TKAA 5I7EA 1RHQA 1TTQB 2G5TA 2SCUB 1KSGA 3SVZA 1SU7A 1V26A 1NSTA 4OJTA 4HAVA 5FLEX 5CT9A 5IAJA 1ZH4A 4H4CA 1TF2A 1N7HA 1MO3A 1QCDA 2DOKA 4KL8S 2AR9A 1L7OA 4KLAA 3RO7A 4XVQA 2CSUA 1W52X 1L4FA 4E5NA 4DXHA 2YJ4A 1HT0A 5P21A 2AOXA 1Z26A 2QL5A 4QZVA 1EX1A 2PUAA 4D9KA 3R0XA 3OX1A 4GR4A 2QNRA 1Z0IA 3LUCA 5B4TA 3H5OA 1UADA 4Y2RA 4Y9UA 3AWDA 1IUKA 2V9PA 3S4YA 2QX9A 3TUIC 2WG0A 3Q5GA 1P5JA 1U5CA 1U7HA 2Q46A 4ALJA 1QIKA 3IAAA 3QVXA 1EJBA 4FGKA 4JQZA 1P60A 3SQXA 3ZXIA 3WC4A 4NWIA 3FFWA 2ASEA 3QVOA 3BA6A 4JUDX 3DEHA 1LXCA 3MUOA 1HDZA 3VC7A 4BKQA 4K8RB 1ZVKA 2Z57A 1ZGJA 1SC4A 2FFHA 2Y8EA 3KV1A 1GZ5A 3RVOA 2D1QA 3E4CA 1HC7A 1Y6QA 2VDLB 4KI0A 4MWGA 4UXIA 3GARA 3UH0A 1MFPA 5F21A 3L4BA 4UUAA 3PSHA 3AI1A 5C5IA 3A11A 1EVQA 2GZHA 2G5GX 1E99A 4MRRA 2C92A 4MVWA 3VPDA 4HH3C 4UTOA 1B00A 1HDIA 2QXYA 2ZREA 2WTUA 2HQ1A 4W5TA 4FGSA 4POAA 1AS0A 4QUIA 5I4BA 1E6MA 2O2IA 1IHOA 2XUDA 1NV8A 2E4VA 1E3IA 3MXTA 2YWHA 1GV1A 1T4CB 2QYSA 1QU2A 2AJCA 2ATIA 3KOZA 3KEMA 1NVKA 2P0EA 4K5QA 4UC0A 4YIKA 1EB8A 1NU6A 1KO5A 3PYXA 4RFSB 2G1AA 3EGIA 4R68A 3LF1A 4HC4A 3DC2A 3QIVA 3DNFA 2YRXA 3L4KA 2GDJA 3CO5A 1CEQA 1P0IA 1PRYA 3AVQA 3N0XA 5BSFA 5ESWA 4RESA 5BOSB 4MV4A 4JXKA 5DBOA 4QLBA 2ODEA 1NKSA 3AYZB 2YV1A 3GDWA 3L77A 3C16C 3PFIA 2A1UB 2CLCX 3ZYZA 2I4TA 1SM4A 3COYA 4JB3A 2PZMA 1T91A 3TR5A 3CTPA 3GLFB 2JLBA 3KEQA 4KO8A 4M3NA 4IQFA 4PY2A 3F5DA 3UYLA 5MHTA 1IVNA 4BQNA 3AVVA 5KAPA 4C76A 4JB2A 5DEOA 1X2EA 4X3CA 3FMOB 3HE3A 4X3PA 2XOKA 4N5HX 5CDYA 3S1SA 4KWHA 4HB2A 1GARA 4OYYA 1LPPA 5HIMA 2O3SA 2HU5A 4Z99A 1DHRA 4BMCA 2VHYA 3N70A 4F96A 3SEFA 2GN4A 6NULA 1BU5A 4OHUA 5DNYB 3PFWO 4J8PA 1EFRA 5KYWA 1KRHA 4HAIA 4MTLA 3WK4A 3M1LA 5CYFA 4B7XA 5B4UA 1P18A 5AVOA 2YBEA 3VYUB 4WXHA 4LI3X 4BNDA 1M2NA 1VE5A 2XNDD 4GR5A 3H7AA 1NVAA 3ASZA 1CD5A 1PUXA 4NK5A 4CUKA 1RRCA 3BICA 4IR7A 4ZQBA 1OT5A 3N6RA 3M70A 3PBKA 3CGGA 3VHRA 1ONPA 2HGZA 2NXCA 4GUAA 4UCFA 5FR2A 2JL1A 5PGMA 1G8MA 1YQEA 2E55A 2Y1EA 3RFCA 4CKZA 5J2UA 1PWXA 1DXYA 2BFCB 4NH0A 1CQXA 2GM9A 3C7KA 3OC0A 3RSGA 3DQPA 4TUYA 5IJ9A 4DMLA 4TL6A 4DFDA 2GI4A 4NDZA 2DZDA 4NMMA 5F7OA 2CEAA 2G72A 4BBZA 5JT1A 4EL5A 1XROA 3FNHA 3I8OA 4FMDB 4P93A 4BN4A 4RXMA 3QE2A 2QTHA 1Z6TA 3OTIA 1M7BA 1H0KA 2GKOA 5ECWA 3A2MA 1O0BA 5B3JC 1ZM7A 1YAHA 1I8TA 4C4TA 3WR5A 5DIFA 4O4IA 4EG5A 1YCDA 1K8RA 2XECA 5SYAA 4XQEA 1UBFA 1PV2A 3E82A 1U81A 1XMJA 2DCMA 2Y1GA 121PA 2DBYA 3KP1A 3UQZA 3H7IA 4B87A 3WO0A 1BHQ1 2CN1A 3BMQB 3ND5A 1KAOA 3KZCA 4NYJQ 2X6RA 1JMYA 4XFKA 5AESA 1JBEA 1VE6A 1G20A 3INGA 2XNHA 3WTCA 3TLKA 3L9XA 2QJTA 2LKCA 2P7HA 4WN3A 4JBHA 3OOJA 3TB4A 4D80A 1NI3A 2JK0A 1ECLA 2XWJI 3PRYA 2J3EA 2YWCA 5AYVA 3ZE2B 4D3XA 1A96A 3EWNA 4M1YA 1ETUA 1RW4A 3KQSA 4KLRA 2XEDA 4Q7LA 9LDBA 5HIJA 1BRMA 2COKA 3EXAA 4DPKA 1H9BA 4FEYA 4IXNA 4PC7A 5G0SA 4BUZA 1NLMA 2HC9A 1A1VA 1ZM2A 1BJKA 2FSFA 2PKQO 3EXHB 2XMSA 3QVUA 1S4MA 3TDNA 1RKVA 4B2IA 4L5BA 1H2AS 4CMAA 1E5VA 4X20B 5EHGA 3V1TC 3KXKA 1J2UA 1JSZA 2WC1A 3OPQA 4LMBA 2WTMA 1JAHA 1JILA 5C4GB 4CKBA 1M74A 2BEVB 3EIEA 3A36A 2GZ2A 3LFTA 4DADA 5A4JA 1Q19A 1R66A 2SCUA 4V0SA 5F7JA 4D79A 5C4IA 3C3WA 5JWRA 3P52A 3D3WB 5I4KA 4Z6KA 1XQWA 1D2EA 1PZXA 1W0JA 2GA9A 3NW9A 2FPWA 3NOXA 3PE4A 1EFHA 2D62A 2YY7A 3GEMA 2OT3B 3I58A 3EGWA 1JG7A 5C8YF 5JAZA 2Q62A 5LNK1 5TMBA 4UOQA 3AOGA 1YKFA 1OYWA 2IUSA 4CN8A 2ST1A 3NUQA 3AILA 3GVXA 4NSNA 1IY2A 1QRRA 1QMPA 5K2MA 3VXKA 4V1CI 1CBUA 2VWHA 1DAOA 3FWHA 2GX6A 1L6IA 2IL1A 2W4IA 4RSHA 1E3QA 2X19A 3KQYA 1N8KA 2C5LA 4DW8A 1GTSA 1NXXA 4M36A 3D1JA 3MHPA 2RB4A 4MLDA 3QEKA 1GLVA 2JLRA 4GPBA 5LMNB 1QHIA 4ZVPA 1W93A 3OTQA 4RNDB 4XTRA 3TRKA 1U9YA 4MO2A 1Z5PA 5F7XA 2O20A 1HQCA 4LYYA 2HSZA 2OWDA 4QDZA 2VF4X 2FW6A 4Q02A 5AOVA 3EVZA 4NENB 2QP4A 1TGVA 3PNBA 2NU9B 3L1KA 3EN0A 4D82A 1N5RA 4LKOA 2XIQA 5HEKA 1H6BA 2CK3A 2P8JA 1HE1C 3QU9A 4H77A 1OB2A 4OKNA 3HDJA 4EUNA 2X7HA 1V7QA 3I01M 3KJFA 4PQYA 3AKEA 4O4LB 3EQZA 4QOJA 4CM6A 4DM3A 5JCJA 3BFJA 5LIPA 4LNHA 3Q6NA 4B34A 5J5CA 4F97A 1T8UA 4IDGA 4INJA 4AUKA 5F52A 1GADO 2FWAA 3KJHA 2HIGA 1KO8A 3DHEA 4M98A 4HUTA 2JA1A 1KI6B 1O94C 1KZ6A 2RI6A 2GN1A 3H9JA 2I2DA 1Z12A 2VK2A 3G2IA 1T4CA 1BMTA 2QAGC 1KZ4A 4X1OA 4DEXA 2QTMA 4EDHA 4RFSA 2BHLA 2AFIB 1YUBA 2VK8A 2X1VA 3CM0A 3Q4GA 5BR4A 4QOGA 2FRVA 3PEYA 5J4YA 3PLNA 4H7EA 2OAP1 1KYIA 2GVZC 3KQHA 3NT4A 1IQUA 2FUCA 5BOSA 3GT3A 9ATCA 4II3A 3R74A 3PXUA 5KTSA 4G1UC 5BURA 2A1UA 3EF1A 1U3GA 1QYIA 1YH3A 2P2GA 4LZOA 4M0MA 1ZKDA 4RK5A 5FTNA 3GLFA 4S1TA 1U2EA 1L5GB 1FS5A 2G82A 3F74A 3O8QB 4NAUA 3B6MA 1KQPA 4AMGA 3R3YA 2FX5A 2VQ6A 3QXXA 3PPXA 1T5OA 2HMVA 1VCMA 2HIAA 1USIA 3ANTA 1TQHA 3S1LA 2ZVJA 2ZJ7A 3ZGOA 1VSUA 1W4BA 3OE5A 4ID9A 3RPEA 4AULA 3U37A 2HA6A 2Y66A 4ZQEA 3UUFA 2FDCA 2H07A 3R7FA 1B0UA 2GILA 4M9QA 3QE3A 3KYJB 1KVQA 1WU8A 2VKTA 3INNA 4HXYA 4BNHA 5IWCA 4QUBA 3RUDA 3WYAA 2PEZA 4CM5A 5HIKA 4FUTA 5E4TA 4FM9A 2AZXA 2XUAA 2JK1A 2C07A 2Q3FA 4XWWA 4Y6QA 1L5HB 3N5CA 4C4PA 4OXQA 4O3MA 2B9VA 3QMMA 5IK2A 2PJUA 1M0TA 4BCDA 4LA4A 3GIWA 3SIWA 4LVNA 2C3OA 1CUCA 1LI4A 2C8LA 3BBPA 1U65A 1Z25A 2HMTA 3LLCA 2WF8A 4FWBA 3U81A 1XLWA 2Y1XA 4XIIA 1JW9B 3STXA 2WHPB 2QD2A 2DHDA 3C3KA 4ODIA 4H7DA 1YGPA 1N2IA 1U9CA 3V8MA 5C3MA 5K4GA 3LV8A 4MKGA 5FTMA 3U3OA 1LLCA 1L7NA 2BFCA 1WY5A 4DV4B 3HB7A 3P9PA 5GM2A 1EGMB 5L3SB 1ULSA 2PX5A 4NU5A 3ZUGA 1PZEA 3QG1A 1RVV1 2XVXA 4M86A 3UUWA 3LI2A 2AX4A 2I9PA 4IDAA 3HXOA 4ERXA 3KL4A 1Y6GA 3IP1A 2PIAA 3HSYA 2AOVA 4RCVA 1R8YA 1WRBA 4BGIA 4YMSA 5K0GA 5DISB 2YQ5A 1C7ZA 1OZHA 1SCNE 4B3MB 3L8GA 2X0FA 3EX7C 1OQAA 1TE2A 5JDCC 1I9CA 3HEMA 5F35A 5JD5A 2V0GA 3NTOA 4MWEA 1PWHA 1ENPA 2PUGA 5FLYA 1I51A 2RG7A 4MA5A 1WDKA 3NBXX 4XUCA 1KSHA 2C7BA 4Q3LA 3BMQA 1Z0AA 3ZW8A 4DQXA 1G20E 2QQEA 2CY0A 3GDHA 3NB0A 1YSCA 4FFNA 2ZRGA 4S24A 1GPKA 1E1QA 2WSSD 2PL1A 2ZAYA 3FUTA 4FDAA 5C7OO 1IU9A 1VJDA 2JVIA 3H42B 4CJXA 3UHPA 3A14A 2DFNA 3FRIA 1AZLA 2OK7A 3EVFA 3RS8A 5T64A 3RT9A 1XKLA 1J2RA 1ZO8A 5A0TA 4LCJA 2ECOA 3KYDB 3CLUC 4FXPA 4WQMA 5SYNA 2AZTA 1VP3A 2ZYTX 2HQOA 3EXHA 3DMFA 3ZV3A 3KBBA 1FL9A 1IAQA 2QKYA 3OZWA 4B4OA 9ABPA 4Z53A 2AW5A 1HZZC 4X20A 3O26A 5FOUA 4JENA 1DI0A 2IP4A 1OAKA 2Z8YM 3DJYA 3ORFA 5EE1A 2VJLA 2WZCA 2HQBA 4XDYA 3ORQA 1YB6A 1WXGA 3SJZA 2BEVA 4E6PA 3PE6A 5BNWA 5IFLA 4YFVA 5KX5B 4CL2A 1QE0A 2NZJA 1FLVA 1U4NA 4GS5A 4I4TF 1Z7BA 2C4TA 2P9BA 3IAUA 4PSUA 1PDWA 3F5QA 4ZOCA 1N3YA 1QQ7A 1TZCA 3D3WA 3OAAA 4Y1FA 3ZHTA 5JROA 2MTBA 5JDIC 2WHXA 1WIWA 3K9LA 4GI5A 2C77A 3LK6A 3UMBA 4CDRA 1RXIA 2HV8A 4UREA 5JWHA 3STWA 3SHFA 1KOGA 2GF9A 2VTBB 4OUKX 5JXGA 2MSWA 3LA8A 5EESA 1JF8A 1MABB 3ORRA 3GFRA 3M1IA 3V2IA 3VR6D 4E2FA 4TV8F 4Z8YA 4CM9A 4HTAA 1N6NA 1XZNA 3AFNA 3M6IA 3ZXXA 3WFIA 2XZTA 4JEMA 1LJLA 2GOYA 3QKTA 2ZRAA 1N6HA 2HA5A 4G85A 2CZQA 5BQXA 2H16A 5DYGA 5GZ1A 3DLBA 3CT6A 4B8ZA 2BMVA 3MJCA 3OHPA 4C04A 1BHSA 4MS4B 1Y5RA 2OL4A 3PGJA 2MOKA 5CVVA 4H4DA 4KRGA 5DBHX 1YACA 4EA8A 4NENA 4IGFA 4F71A 3FHTA 1IFXA 1Y3FE 2NU9A 4KXXA 3GI1A 4G23A 2AN5A 2EFYA 4MV7A 4QUKA 1MG0A 3N8KA 3PHIA 3P2OA 4RM3A 3O74A 1Z4PX 3BJIC 3QU2A 3KX2A 2QN6A 2DT5A 2TSYB 5JISA 1QYVA 1S7CA 3H11B 1E20A 1KS2A 4O4LA 4JUAA 4C30A 3WHKA 2AG5A 1OU4A 3NVMB 4GYKA 4GDMA 4OGWA 1JUDA 4DABA 5TQ2B 1F0KA 5CCDA 1E69A 4FSHA 2H7YA 5TR9A 4M1EA 1OLUB 3DC7A 2KYRA 1FEZA 2E21A 3M1YA 2WVHA 4HRYA 4MVJP 4B3TB 1K66A 1GKKA 1KI6A 3VR4H 2BLLA 4TXMA 5F33A 4IPTA 1KDZA 4PVDA 3FMPB 2YJTD 1YDMA 3DGFC 3SJCA 2E37A 5CVTA 2ORIA 3TX2A 1VOTA 2AFIA 2Q2OA 2HPZA 4KQWA 4YWJA 5LDDC 4ES6A 2FUG1 3BFPA 1H2EA 1DCKA 3BM5A 4IX9A 4L15A 4YI5A 2WIAA 1NV9A 2P69A 2WUEA 4EWLA 1ZY2A 3T3PB 5D6OA 5IJXA 3R9KA 1I1OA 3LT4A 5EHIA 3T1QA 5GZ3A 3GLFE 2RHJA 3LYLA 5DIZA 5B7NA 1F6WA 3QG5A 3C85A 4IICA 1PT9A 2QW8A 3TJRA 1SHKA 2O4CA 3T7AA 5AVXA 1NMYA 2YZMA 4Y7DA 4YDRA 2JFQA 3IDFA 2P68A 3KYBA 1N1EA 2DQKA 1XNJA 3O8QA 1K9VF 3ACCA 4JJ7A 3IESA 4Q3NA 4Y30A 3KJQA 3R7WB 4UUNA 4PQEA 3Q0IA 4BO2A 1YL6A 3LXMA 3D1VA 4M99A 2D3WA 4Q5IA 5EIAA 1D9XA 5BQ3A 1TJNA 3G5AA 4PLTA 4Y1GA 1L5NA 3QU7A 4DWOA 5JY6A 4YX9A 2QSUA 1P6UA 1GKIA 2MHCA 4GZ3A 5AXCA 3S1AB 3IIKA 1Z83A 3TXAA 3L7DA 1T10A 4BNKA 3IDAA 3MUFA 4WKOA 3OM0A 3RC9A 1YL5A 4WCDA 3CB4A 4MXDA 3B3QA 4MMXB 3L0IB 1VCHA 2GBCA 2YIJA 4B1FA 1H9CA 1GSAA 1I5OA 1LBQA 1FDOA 4IH4A 1L5HA 4DJAA 1VGQA 3TINA 3KQNA 1WCIB 4EG7A 4N4AA 3KTOA 5H5JA 5C8DA 4L07A 1ZI6A 3A1NA 4UM9B 4AJOA 4XDHA 3KC2A 1O0SA 1C3VA 1Y33E 1X7DA 1YB7A 1ZI8A 4RH3A 1LPBB 3QY9A 1CZRA 2GFQA 3BIJA 2WHPA 3KB2A 4B5LA 4Z4GA 1AGPA 1RAIA 3NZEA 4J3NA 3G7SA 1DTSA 1OBFO 2Y05A 3FLBA 1FP7A 1YJAA 2PJZA 3I2JA 4KN5A 4TSFA 3ROKA 2GUWA 3SMQA 2IXGA 2N47A 3C45A 4CNBA 5L3SA 1YRBA 5KTNA 1BDBA 4LJKA 3CVYA 3LCUA 1GPLA 2OENG 1SC6A 3A7EA 3GUVA 3HBLA 1W5AA 2FG5A 3ND6A 4R2MA 1K3FA 1KQOA 5JPDA 1P7VA 3GNLA 2AH5A 4M9SA 4WZAB 1A2BA 1XT6A 3A04A 3R5SA 4MGKR 1TMYA 4R8KA 3ZU5A 4TPKA 5HOEA 1C41A 5IP5A 3MPUA 2IP2A 2HNAA 4EFDA 1H6DA 4QRDA 3WJ1A 4B33A 4CCWA 4D3FA 4Q01A 5DX0A 4LJLA 1G0OA 5ALVA 2COUA 2VHWA 2Q2NA 4EGJA 1W88B 4Y9DA 4OSOA 1SUBA 4I55F 4RD2A 3N07A 5IDXA 1S9HA 1DEXA 2A0YA 4UAUA 1HDCA 4QJBA 3S68A 2XQJA 3W6PA 4CEIB 4W1SA 3HU3A 2FMKA 4LISA 2AHOA 3GVHA 2PBFA 3AU8A 4GI1A 5AHKA 5JANA 2AA3A 1W30A 3EIFA 1KYZA 1OWOA 4IYJA 3QLVC 1J5PA 3OUUA 4KXFB 1XRMA 2Z5LA 5LXTF 1UJ6A 2QE7A 3WK9A 4B6OA 3AZPA 3QEOA 3ECCA 2CDCA 4L02A 621PA 2XTJA 2PQ0A 5DLQC 3KYDA 1C2TA 5JEDA 2HHHB 2PL5A 3BL6A 3DL0A 1IWBB 1G291 1OFGA 4L51A 4UJ5A 1LZKA 4NJMB 3K70D 1OB5A 1U8CB 1DDIA 2GK3A 2UYGA 2Q1TA 3FGOA 4Z9BA 1N3BA 3E2MA 3L04A 5J43A 4WGGA 1JQ3A 5IRCD 3CNBA 1K5PA 4FZ5A 4RL4A 2B82A 3SBEA 4CFYA 5KX5A 1KWGA 3DTVB 4EZBA 2QNIA 2LE0A 3E6AA 3T9CA 3VAYA 3H3FA 4WOJA 3GRZA 3U6BA 3IT3A 1R18A 2Y1LA 3Q0TA 2A0WA 3E3LA 1GKYA 1JR4A 2WU8A 4KOEC 3X2FA 1O3YA 3C8ZA 4NBLA 4FU0A 4LGYA 1WB9A 2XYHA 3MT8A 4OB7A 5C2JB 1Q0PA 1Z88A 4MI3A 4PZLA 2VTBA 3CF4A 4C4RA 3N2KB 3O1JC 4OM8A 5ES3A 5M5BA 3B1JA 5FTKA 3FW1A 4ID3A 1X6VA 2RGXA 2WYOA 3RSHA 4CLEA 5T4HA 2VDWB 3F6YA 4KGZA 5EWLB 3SY8A 3RS9A 1DWPA 1ZXXA 4R41A 2VLIA 1F1JA 1UPXA 2Q45A 4GBJA 4HUQB 4KR7A 2D0PB 2OV3A 1AIPA 5A6SB 2QMOA 1JI0A 2I4LA 5LD2B 2B3TA 4N5IX 1Z56C 1S0UA 2EP7A 2WYIA 2XITA 2VNAA 4G8JA 4MS4A 2EFJA 3P71T 4R05A 4MP8A 4B5KA 4W9MC 2PYZA 3ZZ0A 4BMNA 5A2QA 1L7RA 4OQNA 3F3MA 2QZ4A 3GJQA 4EY4A 3EIWA 2VJKA 4ADSG 1UJ2A 1WB6A 3LNCA 3AVUA 1J8FA 3M6LA 5D00A 3T3NA 2PGXA 4P5EA 4AWXA 1VP9A 1CWUA 1Q0UA 1O6ZA 3CNQS 4EHAA 4RS4A 2QUHA 2FB9A 3H11A 5JE8A 1E5XA 5L3RA 1F7VA 2EFCB 2AEEA 2F9FA 2JGRA 1TAQA 2QYHA 4L16A 3ZE0B 4IUYA 2PWPA 4MQ5A 5TQ2A 2F3QA 1VYVA 3LKZA 2QXTA 1FTWA 2B4RO 1AXEA 1Y80A 2MSNA 2VP3A 4QFMA 1OLUA 2PYIA 4FYHA 4HGNA 1XB2A 4KH0A 4URZR 4EYOA 2XCQA 4V1CB 1LBSA 2ZYRA 3LAWA 4B74A 2B35A 2FFBA 3PKIA 3H19A 1LRJA 4R0VA 4RTRA 2FWMX 1F06A 2WYVA 1B0PA 1YZNA 3A1DA 3B85A 3CNHA 1F0YA 4QIHA 1I3NA 2H4HA 3N7TA 1XZFA 4TXHA 5AXBA 5C9ZA 4TZ0A 1JDZA 2AFIE 1HDGO 3OX2A 5KSZA 3OPYB 2ETXA 3D5EA 2NTEA 5FBWB 3VMMA 4K6OA 1I1HA 3UJ6A 3KVOA 1EX7A 4AWBA 1K2VN 4XQCA 3UMGA 3ZY3A 1GL6A 5KJ6A 3R7AA 3W7AA 3GK3A 4IXDA 1JQLB 1FW8A 4TMWA 3KSBC 3ZW9A 1UMDB 4AJ4A 1GLGA 3IUYA 2G40A 1CZHA 1F3OA 1RYEA 2H2WA 1HLPA 2H1LA 3G2OA 1VSVA 4MLCA 3HKCB 1MD9A 4RZSA 3ZV6A 2JG3A 4LXHA 3R7WA 2XGJA 2LUOA 2XEXA 3GEBA 3BRSA 1X1QA 1HSOA 3LG2A 4FOTA 4P4LA 3SK0A 1OYOA 4Y3UA 1M83A 2LR0A 4YAWA 3V1MA 2ZEJA 3EWAA 3S1AA 4A6EA 3MTIA 5BQPA 5EYPB 4IIJB 5AT1A 1XNGA 5IJAA 2OC4A 4B3IA 4Q3AA 1DZIA 1AN0A 3UA3A 2VT6A 1U98A 2WB2A 5ECGC 1PR6A 1KDVA 4DSAA 5BMVB 4R81A 4KWTA 1PW5A 1WCIA 4LBVA 2ODPA 4KX3A 3KR9A 5FRDA 2FSPA 1FY2A 3Q9SA 3WZ2A 4DS3A 3A3KA 2PGJA 5L9AA 5CXXA 1VYTA 3C43A 2CJXA 2YWFA 1ABEA 1YFZA 4RDHA 5K6AA 3TSAA 4BTLA 1IBKB 5HWSA 2WIJA 2JLVA 2WM8A 2PUBA 5DBFA 4EG4A 2G5PA 3ETHA 3QPBA 1L8QA 3B3AA 2E48A 1IZ9A 4JP3A 2A14A 1AKEA 1MW9X 3J7TA 2VR1A 1O6CA 1YZYA 1N5LA 2WNHA 2ZAMA 1ZIXA 1HQYE 2P5TB 2PL9A 1E2HA 2YWDA 4HD8A 4KNVA 5FTLA 1Z06A 1TD1A 3LDUA 4YMIA 4Z0NA 3SXPA 4EYKA 2HU2A 4WZAA 2ZGVA 3IPLA 4KZPA 1GGMA 5E3IA 2IUTA 1YBHA 1R8JA 3VISA 4EK9A 1OZFA 2VDPB 3CJQA 3PUZA 3GGOA 3UMSA 1AKTA 4G0NA 4K6FA 1WOMA 4MQUA 1G4UR 4JI2B 1XF1A 4L74A 1T4GA 2NO4A 1I3MA 4BV9A 1W88A 1K4KA 1E9BA 4RVSA 1NU8A 2B7LA 3VRHA 1J22A 5E38A 1ZJ5A 3SWWA 4CEIA 3N3AC 4IUDS 1NBAA 1IZ0A 1D0SA 3PXDA 5A2GA 4P32A 2FQQA 4E12A 1B1CA 4Q4AB 3BXXA 4EJSC 4PR3A 3X1DA 1GQQA 1YRWA 2AG8A 1Z2DA 3AM5A 3DAFA 2NQ2C 4WXPA 4D02A 2IELA 3TPCA 2F55A 3R77A 1GCAA 3WIDA 4EY7A 1IN5A 1XZPA 2VTVA 3HUTA 4GOXA 4L4YA 3N9IA 4Q3OA 3R1IA 4XJTA 4TZKA 4BAUA 5K8VA 2RIPA 1QYWA 1JV2B 1YR2A 4HX2A 4DTCA 5LQMA 4FX2A 1NAIA 4DRYA 3ZX4A 1LPNA 1JAZA 2IGBA 4HYYA 4MR7B 3PQ5A 4NJMA 4XR4A 4ALKA 2EGHA 2JGNA 3OKFA 5ALXA 2VJBA 4HB0A 2W2QA 3S2GA 1EHYA 4H3HB 4PZ0A 4CU5A 2UZ1B 3LL4A 2IV7A 4YCMA 2R62A 1SCQA 3R7BA 3OTOB 4E1AA 1J8MF 3KD2A 4JS0A 1ZU4A 5F51A 5HJ2A 4JLMA 3DTVA 2G83A 1SGWA 4HFJA 3CLHA 1T9ZA 4A8PA 3E9YA 1FTSA 1VRCA 2E4AA 2W6JD 1WXQA 2GEVA 3S7TA 4D5EA 5JO0A 1WXFA 4C1NA 3V00A 1MO2A 3NTVA 3M9LA 1JLSA 3BTUA 4G0XA 1V39A 3V3KA 3Q2OA 2HPAA 4MI6A 3LZCA 5DF1A 3UJ9A 4EEKA 2BFNA 4G5RA 4K9QA 5B36A 5CCXA 3CPEA 3LNTA 3N2KA 1EX9A 1H6AA 1UXIA 2ZAGA 4GM1A 5CGQB 5DOVA 2I4NA 4G41A 2P9QA 4WJLA 5J9FA 4BE4A 4WX2B 5LZ7A 4BUCA 3FI0A 2QI9F 2VDWA 4GWKA 2FSSA 2WINI 4MNTA 5EWLA 5FL3A 4DGSA 1UEIA 1SPBS 2IHVA 1EI9A 3D4OA 1TB4A 1SCJA 1DJQA 1ZUHA 4HUQA 5A6SA 3EG5A 4IWYA 2DFKB 2FQ1A 2Q2WA 4HXEB 2VAMA 5I9TA 4D46A 1Z63A 1AGRA 1XA0A 2WSIA 1NG1A 5CFMA 2WQ7A 3NMUF 2X9GA 4KMSA 4CN9A 2C2GA 2BM9A 3G9ZA 2FNAA 5HRCA 1XAHA 2G08A 1WP4A 3QBVA 4LV8B 1QX3A 1CZKA 3TW0A 3C6KA 3W8DA 1S5PA 3KOMA 3Q3JB 4OHZA 4ED9A 3PXXA 1QFJA 4WFJA 3ZDAA 2R2AA 3BWBA 3E23A 1XXHB 1NF8A 1ZHHA 1N2ZA 3SZRA 4FI3F 2AMLA 3L6UA 1RRGA 3SR3A 2J32A 1IMOA 4OQQA 5C4MA 3I72A 3NHPA 4GEKA 2JH8A 2V03A 2GHRA 4DZRA 2ZJ1A 3ZH2A 3ETGA 2BUBA 5FBLB 5D2CA 3E7DA 4CT5A 3TOVA 4YDQA 2BGRA 3ZJ5A 4BNLA 4M0CA 5C32A 5FL7D 3AL0C 3NWOA 1FNMA 6REQB 1ANKA 3M6VA 4JZYA 1P72A 4RZUA 3K96A 5IBRA 3EUWA 1VL8A 4V1CA 1DBWA 3FZYA 5KJEA 4RQUA 1F9AA 1U3UA 2P5SA 1J33A 2G70A 3GA0A 3MGCA 4NOKA 1VHTA 1G21E 2HRQA 4D57A 1PL7A 4EFLA 3AI7A 4BKUA 2GTHA 3T0GA 4KITB 2BFWA 2C3PA 4LW8A 1UAGA 4AFNA 1EWQA 4RZ2A 1ZC4A 3NETA 1ECCA 4N6GA 2OCYC 1PJRA 4WXEA 3WNCA 3DMTA 4L22A 4QXQA 1XVAA 3OPYA 5F2NA 4AG6A 2DBZA 2WU0A 3R20A 3LL7A 2QTZA 3K73O 4DPMA 1LPMA 3ETJA 3H6HA 1GITA 3X3HA 1RQ2A 2BLNA 2PD3A 4K1LA 5BSHA 2QBYB 2LCFA 1IL0A 2XTAA 4P38A 1T3ZA 2FMFA 4EARA 3HXQA 1J1IA 2ZXUA 2Z5GA 1UMDA 3DS8A 4MGYR 4KPEC 2P5UA 6YASA 2NTVA 2ZVPX 4E13A 4OQLA 2ZUFA 3HKCA 1US8B 1II9A 4UCXA 2AYXA 3FB4A 4PS0A 3KSMA 1ZVJA 1IG0A 2V6MA 3O1LA 3WJ2A 3UB3A 3JD2A 4AI6A 5AUOB 3E03A 4Y2YA 2IYEA 3F1KA 2ISCA 4ND8B 5EYPA 2IEGA 2K87A 4IIJA 1W36D 1N5OX 4IOMA 2ANCA 2BI7A 3FRJA 4QYMA 4LZPA 1BE0A 3CEAA 1D2RA 1QYXA 1VKZA 2YIMA 3FN4A 1E79D 2VBFA 1LVUA