4L9AA

Crystal structure of smu.1393c from cariogenic pathogen streptococcus mutans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
b'ALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLPDSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVHSIGGFAALQIMNQSSKACLGFIGLEPTTVMIYRAGFSSDLYPQLALRRQKLKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRQLNDVQSLPDFKIRLALGEEDFKTGISEKIPSIVFSESFREKEYLESEYLNKHTQTKLILCGQHHYLHWSETNSILEKVEQLLSNHEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Smu.1393c
publication title Structural and functional characterization of a novel alpha / beta hydrolase from cariogenic pathogen Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 98
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l9aA00
4X92A 1LZKA 1XRMA 5DYWA 4AO6A 1QIJA 3D2CA 1WB4A 1TKRA 1AX9A 1H2ZA 1ZGCA 4X97A 1CUWA 1GGVA 2GYWA 1ACLA 5ALJA 1N8SA 4QEKA 3QYJA 2DR0A 2PUJA 3FNBA 3W9BA 5DYTA 2HDWA 2H7YA 2I3DA 4FTWA 3K9BA 5ALZA 1SC9A 3ZLVA 1EVQA 4UBMA 1JMKC 4X6UA 1C4XA 5AJHA 5FOQA 4IO0A 3D7RA 3RM3A 1TIBA 2LIPA 5AKZA 2C4HA 2JEYA 4HVTA 3AUKA 2OPHA 5JANA 4DMFA 4BATA 1CUJA 4KEAA 2OGSA 1CUXA 2C58A 5E4YA 4OSEA 5CW2A 1TK3A 3PF9A 1MAHA 3FWHA 3EBLA 2YASA 1CUBA 4IH4A 1J1IA 3G9UA 4KR0A 1XLVA 3HEAA 4MWSA 1A88A 1EK1A 1BCSA 3R3ZA 3FVTA 3FBWA 5AM5A 5LP1A 1IUPA 1QZ3A 3R3WA 3JWEA 1CQZA 5AK6A 4B0PA 3DDUA 2IX9A 5DYYA 1UK9A 1I6WA 2E3JA 5IKXA 1Q83A 1W52X 1XKLA 2Y6VA 4UFOA 4Y2UA 3F67A 4QDOA 1BN6A 1BEZA 1OXMA 5FPPA 5D3KA 3KWFA 1E8DA 3FOBA 2QJWA 4KRXA 1ORVA 4Q05A 2QJRA 2QVBA 4N8SA 1AGYA 1VA4A 3STYA 3ZWQA 1GT6A 3DD5A 1ODCA 1JT2A 1YAHA 1W76A 4JH0A 2P8SA 1E8MA 2VAXA 1O6GA 2Y6UA 3K6KA 4QDXA 3HZOA 4H7HA 4Y2VA 4Q34A 5I7UA 4BC1A 2WQZA 3I6YA 3BJMA 3PDCA 1YAJA 4H7DA 5ALGA 2WFLA 1RP1A 4UFPA 3A6ZA 2QR5A 4DMCA 1CV2A 1UZAA 4Q3OA 4YPVA 2XMRA 2AJBA 5ALDA 2QUAA 1QIDA 5ALRA 2ORYA 4S0XA 1MJ5A 5K3FA 3R0VA 1FSSA 2RAUA 1QONA 1U65A 5LLSA 3G0IA 5CT5A 3WWCA 1TAHA 4Y2SA 4TPKA 4W1RA 3BXPA 4EUSA 3VVMA 4BYMA 3BDIA 5LZ9A 2FUKA 3BIXA 3D2AA 3DS8A 4INZA 4BTLA 4I4CA 1XLUA 1D07A 4KE9A 3H04A 4Y2JA 1H22A 2PSFA 3FAKA 2QRUA 4GW3A 2O2GA 5K3EA 1YASA 3F8SA 4M0EA 2DSNA 1QJ4A 1UOOA 4U2CA 3BE8A 3IIIA 2WIJA 1MTZA 5AP9A 4ROTA 1DWPA 4Q3KA 5AM2A 4ZRDA 3STVA 1VXRA 1A8SA 1B41A 1ODSA 1DT5A 3D5EA 3MGAA 3ICWA 1QFSA 3LIPA 1UOQA 3C70A 2VT6A 1P0MA 5K3AA 3DEAA 4HRYA 3EIOA 3WKEA 3SX4A 4X3CA 3CN7A 4DMKA 2HU5A 5AI6A 1DX4A 1CLEA 5JZSA 5K3BA 1GPKA 2OG1A 4K2AA 4C87A 5JD4A 5EHZA 5ALVA 2WFMA 1FJ2A 4KAAA 2XMCA 3IULA 3KWJA 3PFBA 5CRIA 4JYMA 3DKKA 4WJLA 1K63A 4U2EA 3G02A 1YA8A 4G9EA 5T4EA 4C4YA 4MXDA 4A16A 2WLSA 3AJAA 4C4XA 2G5TA 2EEPA 1ZD2P 3CCBA 4LKOA 2AJCA 3H2KA 5T4FA 4ARAA 4CIAA 1Q0RA 1DX6A 3H19A 3JW8A 1EB9A 2WG1A 4J0CA 1J07A 5LKAA 2B9VA 4H7JA 1QE3A 2WJ6A 4DM7A 1U2EA 1OILA 3R3XA 3EF3A 1QIFA 5ALLA 4CCYB 1TQHA 3ESCA 5JZBA 4AZ3A 5AK3A 4BE4A 3S8YA 1ZGBA 2EDCA 3WK8A 5IVHA 3LCRA 5AM1A 5ALXA 3LP5A 3I2GA 4BVKA 1CUFA 3MVEA 2ZJ6A 3OURA 1E5TA 2AJ8A 4OUKX 4KE6A 5KREA 1Y7IA 4AO8A 4QE3A 5DLPA 3WA6A 5AKGA 2VT7A 3F96A 5JADA 4DSZA 1G42A 5CT9A 2HFJA 2X8BA 1JJIA 1BROA 3AIKA 2WU3A 3WK9A 2ZSIA 1VJ5A 4Y2YA 2WHQA 5AM3A 3FSGD 3HSSA 1YSCA 1JMYA 3G9XA 4TGLA 4UHBA 2UZ0A 5CT6A 3WIOA 4IH1A 4C88A 1H23A 2OGZA 5A6VA 2FJPA 1EVEA 5AI4A 2WHRA 4DIUA 3L1HA 1J2EA 4NS4A 3I2IA 3OG9A 4IH9A 2C7BA 5FUMA 2CZQA 4LIPD 1XRLA 2XB6A 3T52A 3NOXA 3V1KA 4W1PA 5AI8A 3G0GA 3WIBA 2XMSA 1IMJA 2XUFA 2XLBA 4EZIA 3P2MA 3PF8A 2W22A 3ESBA 4BP9A 4AN0A 1CFJA 3OM8A 1EH5A 4QNNA 5JARA 1BN7A 4E14A 5AKHA 3R3UA 5J3JA 2NW6A 3LS2A 4UBOA 5ISMA 4J7AA 3C8DA 4PW0A 5FRDA 1G4HA 4Y2TA 4FLMA 1FFEA 3G9TA 5ALWA 4P08A 1XQWA 1UFOA 2VJAA 3KSRA 4X93A 1UK8A 1W1IA 4MWTA 4KAJA 3ZLTA 3WKBA 1ZI6A 2W6CX 1KU6A 4B82A 3KOOA 1LPSA 3QITA 3CXUA 2OCGA 4ZV9A 1RWQA 5T4BA 2VF2A 2XQJA 3S2ZA 5D7BA 1BU8A 5E4TA 2GBIA 5IVIA 4QWWA 2JBWA 1QO9A 5C7YA 4PSUA 2XI4A 1PFQA 2G5PA 3LIIA 4B9EA 2XE4A 3A2MA 2QM0A 5DTIA 1EINA 1TCCA 4UHHA 3PUIA 1DT3A 3O4HA 5D6OA 1Y37A 1Z68A 3C43A 3WWPA 1EDEA 4E46A 5DTJA 5ALPA 4UBNA 5DWDA 4QZVA 3PUHA 2WIKA 4X85A 4X00A 1LBSA 2PPLA 1HPLA 1UOPA 4K6HA 4ARBA 1VA5A 5D3ZA 4F21A 1HKHA 3AIOA 4H7FA 4UHFA 4B0OA 4AX4A 1GQRA 1CUCA 5EIHA 3G0CA 5K3DA 1UK7A 4YK7A 1JJFA 2HM7A 2FX5A 3B12A 3C6BA 1WPRA 5AI9A 5A7GA 2Y2UA 2J4CA 4OYYA 1Q84A 2DQYA 4BZWA 1CUEA 4UBKA 4EA6A 4UBLA 4C89A 1R4ZA 3O4GA 4J0KA 4F60A 5IVDA 1MNQA 3D0KA 2PSDA 3G8YA 1NU8A 1NU6A 2RIPA 3KD2A 5HKBA 1U8EA 1F0NA 2XUAA 3GROA 4BDSA 2PKYX 3DLTA 4YX9A 2BFNA 2AJLI 1S8OA 2Q0XA 3M81A 1ODTC 4Z49A 5CH8A 1E66A 1XRNA 2ECFA 1U4NA 3AZQA 5AHXA 3W2TA 1A7UA 3H2GA 4DLNA 1TRHA 2WTMA 3EQ8A 2JGJA 2WUEA 3UUEA 1YS1X 3IUQA 2BUCA 1J06A 4W1SA 3SC2A 1RYYA 5ALUA 2RGUA 4EY7A 4KYVA 2PBLA 5CURA 5ALHA 2JGIA 2O2HA 1DTEA 1WM1A 2WJ4A 2XQIA 2VA9A 4FWBA 3D2BA 1MT3A 3W9UA 4NZZA 1ZD4A 2QOEA 3H1AA 1WOMA 1CUIA 4CG3A 4CI9A 4QDUA 1DWOA 4BCCA 1HLGA 2XLCA 2V9ZA 4BRZA 1KEZA 4GLBA 1UT6A 1ORWA 2O2IA 1GZ7A 1VE7A 4X91A 3AZOA 1VOTA 4N8DA 4OYLA 3X3HA 4QDZA 4DGQA 1X2BA 3WYNA 1QIKA 5I8PA 4GBGA 2HRRA 5AKEA 5LZ2A 5A62A 4FDMA 2BUAA 1CEXA 5BWCA 4P9NA 5KBYA 6YASA 3UMJA 1YB7A 3V9AA 1WPXA 1GQSA 1QIHA 2XMQA 4KAFA 2HIHA 4K5QA 4CIBA 5JAUA 1AMNA 3PE6A 2CEKA 3V1LA 4RE5A 2IIVA 3ZLUA 3HRHA 5CH5A 4AZ0A 5JATA 4GI1A 2QZPA 3HACA 5BWBA 3E0XA 3H18A 1X70A 1AZWA 2QT9A 3IVMA 2V98A 5AK4A 4GWLA 1QGED 1XZGA 3WKAA 2J4FA 5HK9A 4G8CA 5AK5A 2WUFA 5CBKA 2I03A 1R50A 1XZCA 4ZWNA 3DJYA 2XQKA 2BUBA 2PU7A 4X71A 2OAEA 4EB0A 4G5XA 2ZJFA 4L72A 2ZYRA 4J0JA 4EBBA 1FFAA 4FBLA 2DQZA 3B5EA 5HCUA 5JASA 4FHZA 3NUZA 3DKRA 4JUIA 5AM0A 5BOVA 1HL7A 1XQVA 2WSLA 5K5EA 1EHYA 2VSQA 3BIWA 3MUNA 5A2GA 1CRLA 3WL8A 2WU4A 4WDRA 5ALFA 5T4HA 4ZXFA 5AI0A 1THGA 4BAZA 3DOIA 3HC7A 4XIIA 3BJRA 4UBJA 5C8VA 4QDTA 4OB6A 2OAGA 5AOBA 1DQYA 4Q82A 3E3AA 4GECA 5CXXA 3IBTA 2QS9A 2B20A 3C6XA 4L9AA 4N8EA 1SCIA 4U2DA 3DQZA 2R11A 1HDEA 4JYPA 2C5FA 2JGFA 5JIBA 4B6GA 3G0DA 2PU5A 5EGNA 3WWDA 3YASA 3R40A 2OQIA 4LYDA 1P0IA 4P92A 1QIEA 1MAAA 1LNSA 3BDVA 2HU7A 1R9MA 1LPNA 5ALYA 2RI6A 4W9RA 4DSAA 4BC0A 2WIFA 1CUYA 3I2KA 1H2XA 5HF5A 1GPLA 3CN9A 5ESRA 5JAPA 2DHEA 4MQMA 1W6RA 1CUUA 1C7JA 1L7AA 3MUOA 4WDQA 1LGYA 1XZDA 3STUA 2HA2A 3I28A 3H1BA 2H7CA 5CT4A 4BCBA 5FV4A 1AQLA 3QMMA 2ZVDA 3E1GA 3ANTA 4AXBA 2HRQA 3HXKA 1EK2A 1ZD5A 5AKKA 4H77A 4E11A 1G5FA 2CUTA 4WY5A 2Z8XA 3FLBA 5JYCA 4X95A 1IVYA 5C8ZA 3ESDA 4U2BA 4PSCA 3F98A 3WKDA 5BV7A 4C01A 4WFJA 5H3HA 5I9IA 4BDTA 3DNMA 2XUGA 3W05A 4GDMA 2AJDA 3O4JA 1USWA 2WJ3A 5DNVA 1O6FA 2I78A 2ZYIA 4RGYA 2GZRA 3HYSA 4BTVA 5EHNA 1XZAA 4A5SA 4XVCA 4HXFB 4LXIA 4TVKA 3I2JA 4A23A 1JI3A 3IURA 3Q8WA 3IB3A 2RHWA 1EXWA 3C45A 3RK4A 3BF8A 2XUDA 5A7HA 1E3QA 1IUNA 3R41A 1JFRA 1LLFA 2BKLA 4AN1A 3QPAA 4AQDA 2QXUA 2Z3ZA 2VATA 3FLAA 1FFDA 4KE7A 2PX6A 3K2IA 1LBTA 3HI4A 3FYUC 4I3FA 4QLOA 2ACKA 3ZV7A 5ALSA 1P0QA 4AMZA 5IVKA 1WHSA 3WK6A 3IUMA 4HZGA 3A2LA 3C6ZA 4FFWA 2JGMA 3WI7A 1SCKA 3GA7A 1EX9A 1VLQA 5C8XA 3VISA 5LZ7A 1QTIA 4V2IA 5SYNA 4O08A 4OB7A 5FKJA 1DWQA 4UBIA 1MO2A 3JYHA 4W1QA 3SWWA 2BGNA 3R3VA 1X2EA 4NVRA 5AIBA 5EIEA 3M82A 2HA7A 4OU4A 1P0PA 2GZSA 3I1IA 1SCQA 5HF6A 7YASA 1HQDA 2PL5A 3N0TA 3I1YA 3FYTA 4BVJA 2K2QB 2ZYHA 5EFZA 3V1MA 3I2HA 2VEOA 4DYHA 1SFRA 3AINA 4G8DA 1R9NA 2BCEA 2OCKA 4OCZA 3C6YA 5LZ8A 4EY4A 4QA9A 5EIAA 4MEAA 4UFNA 1GXSA 3FCYA 2G63A 4XWGA 5CT8A 2HFKA 5HKAA 1XZIA 4ETWA 3GZJA 3AZPA 1ZJ5A 5JALA 1K4YA 3FCXA 5A7FA 5K3CA 4BB0A 2H9YA 3TGLA 5AO9A 3ANSA 2DCMA 2HA5A 5AH0A 2XMGA 2FJ0A 5KWJA 3IUNA 1TCBA 1UK6A 3NWOA 1CQWA 5JAOA 4AB1A 3H0CA 2HA6A 3HLKA 4FMPA 1Y7HA 3O9VA 3CCCA 4G4GA 4YASA 5HK8A 3WWEA 3WZLA 4BVLA 2XUOA 3D3NA 3OOSA 1MX9A 1XRRA 5AKXA 4IHAA 3O4IA 1VZ3A 2B61A 2G4LA 4FLEA 1PJAA 2WTNA 1XRPA 1MNAA 1QIMA 3VJMA 2WUDA 3U1TA 3QMVA 1EI9A 1R88A 4UHEA 3TRDA 3L1JA 5E2IA 5DNUA 4LXHA 1CIJA 2GYVA 3FLEA 4CG1A 4K6KA 3M3DA 1T4MA 3O9MA 3EQ9A 5AOAA 1CUDA 3C5WP 4HTAA 3H2HA 1MU0A 4ZV7A 2XQGA 3IDAA 3G7NA 3C8HA 3R3YA 1DQZA 1VKHA 2XUQA 4GXNA 2WG2A 3F97A 4AO7A 4BBZA 2VJBA 2WFZA 1Q0ZA 5LKRA 1PV1A 3GUUA 1ACJA 2OXEA 2ROQA 1JU3A 4GEGA 1WCYA 3IUJA 4Y2RA 4FOLA 4Y2PA 1EDBA 2WUGA 1IZ7A 2GYUA 4UUQA 5HZGA 2PSEA 2V97A 2GBGA 5FLKA 2DHDA 2PSJA 3DYIA 2HHAA 1L7RA 2AXEA 5EHXA 3WQHA 4H7EA 3PFCA 1M33A 5DNWA 3V48A 4EHBA 4EY6A 4H7KA 5FDFA 4D9JA 1CVLA 4G8BA 1F6WA 1MX5A 4RNCA 5AICA 1AC5A 5ALNA 3O0DA 4B81A 5LYYA 2OLEA 4LYEA 3EQ7A 2Z3WA 1BEEA 4H0CA 2WM2A 4F5ZA 3A70A 2VJDA 3D59A 1K8QA 2VTVA 2ZYSA 2WHPB 2PSHA 4BP8A 3RARA 1LZLA 5ALMA 2XDWA 1H2WA 1A8UA 4H35A 3WL7A 3O95A 5ALOA 3ZPXA 5HQ3A 4MQLA 1R1DA 1QTRA 3OTQA 2OGTA 3QVMA 2O7RA 3A2NA 3VDXA 2WILA 4RE6A 3KXPA 4WFKA 4K6GA 4J0IA 2CBGA 2JEZA 2B4KA 4C6HA 1XZEA 4MYSA 2XT0A 1N5MA 1YA4A 4CFSA 2ZSHA 3ICVA 4BAGA 3ILSA 2VQ6A 1CUAA 5AKIA 5KWIA 1ZJ4A 1WB6A 4LXGA 3TEJA 3B3QA 3WJ1A 2DFPA 2VAVA 3DYVA 4OPMA 4DNOA 4X6YA 5LIPA 5JZ9A 4PNZA 5ALTA 1G66A 2I3ZA 1QIGA 1MPXA 3WL5A 5AM4A 4FNGA 3M83A 2ONCA 3VJKA 5JD6A 4BAUA 3QPDA 4QWMA 1WB5A 1IZ8A 1CUSA 2ACEA 3QPCA 3BL8A 3ESAA 2V96A 3E4DA 1QLWA 1UKCA 3I2FA 1CUGA 1XQXA 4FKBA 1W4LA 2OCLA 2DHCA 4MYDA 5EHQA 4XX1A 2D0DA 4MEBA 1UKBA 1XZHA 4I19A 5LZ5A 4PQEA 1ZI8A 4HXGA 1XZBA 2J3DA 4B84A 4B83A 2JIDA 3Q0TA 4Y9SA 5HFAA 4H7IA 3AILA 2JGLA 3STXA 3AFIA 3G9ZA 4OB8A 2QXTA 3IA2A 1XQYA 4DNPA 4KACA 2C5GA 5SYMA 1F0PA 2GBFA 5ALEA 2QUBA 2XUHA 4W63A 4B9AA 3FYUA 5IH7A 1ISPA 1IUOA 2EDAA 5CXUA 4CG2A 1R3DA 1LPMA 2QMQA 2WIGA 3VVLA 3UUFA 4M0MA 4DTCA 4OD0A 2HL6A 2H7XA 2Z8ZA 1FFCA 2H1IA 1XZLA 5HF9A 3GFFA 5HFNA 2HADA 5DJ5A 5YASA 4B85A 2ZJ7A 4HRXA 3WLAA 2R8BA 4C4ZA 1BS9A 3WMRA 1ZIYA 1E89A 5AI5A 3WK4A 1N5RA 1DU4A 4KE8A 4CCWA 1BRTA 5EI5A 2PVSA 4G4JA 1N1MA 2BAGA 3DL4A 2WHPA 2JGKA 1XZJA 1C7IA 2D5LA 2VJCA 2PUHA 1XFDA 5ALQA 4BE9A 1DINA 4H18A 2HA0A 4PSDA 3VKFA 5A71A 4DMHA 2BGRA 5ALIA 2WIDA 1QIIA 3W04A 2QKYA 4FBMA 1LPAB 2Y1KA 4P93A 1MX1A 5F4ZA 3PICA 4IQ4A 5AKYA 1FFBA 1W75A 4GHWA 2OCIA 3STTA 4Q3LA 4DNFA 4L0CA 4HS9A 2X5XA 1T2NA 1HBJA 1ZIXA 4FFVA 1GKLA 4ZREA 3FVRA 4EY5A 4UPDA 3C5VA 4BCDA 1YCDA 3BF7A 3WL6A 4ZI5A 3U0VA 1ZICA 3KDAA 1CUVA 4JEIA 3GBSA 2XQFA 1UKAA 1WHTA 1LPBB 4WFIA 4QLAA 1XRQA 2GBCA 1E8NA 2CJPA 4X90A 4UHCA 1EDDA 2CKMA 3SK0A 2HA4A 1CPYA 3NGMA 4Q1VA 1VE6A 4G4IA 4L3WA 1BE0A 3I6ZA 1UWCA 3I6MA 4FLFA 4E15A 4JNCA 3H2IA 4KRYA 1KU0A 2CMFA 2XMBA 3FSGA 1MN6A 3QMWA 4X7BA 5JD5A 1UXOA 2HA3A 4X94A 3QM1A 1CR6A 5LZ4A 4HAIA 1GKKA 5AOCA 1GPNA 1XZFA 1JJBA 4ITVA 1BCRA 4OU5A 4Y7DA 2RONA 5AKLA 4G9GA 3QH4A 2YH2A 1AUOA 4HXEB 1CUHA 1A8QA 3H17A 1JU4A 5FP0A 2XMZA 4FNMA 4PO3X 3HJUA 3WZMA 2PM8A 1XKTA 4J0GA 5FXMA 3WJ2A 3VJLA 2XUIA 2XUKA 1K6EA 4WY8A 4UHDA 3W06A 4DNQA 1YS2X 3DL7A 5HQ3B 3DOHA 4N5IX 3TJMA 4KJXA 1ZI9A 1NX9A 1CUZA 1VZ2A 1F8UA 4J03A 4BZZA 3WA7A 1B6GA 3BWXA 4RPCA 3C87A 2OQVA 4WCVA 3VXKA 4ZGBA 3RLIA 1EB8A 4EY8A 4LHEA 2ES4A 3RKSA 4Y2QA 4AMYA 5AIAA 1EA5A 4J0HA 3WWOA 3OC0A 3QBJA 2J3QA 1K5PA 4XJVA 3V1NA 1QOZA 4M0FA 4NMWA 4J0DA 5E4JA 3PI6A 2IITA 1VXOA 1QFMA 2JGEA 3ED1A 4F0JA 4PV7A 3GELA 3HABA 1LPOA 3N2ZB 5CH3A 2JF0A 4N5HX 1ZOIA 2Y2VA 4BRSA 2BJHA 4B7ZA 4U2GA 5JAHA 3L1IA 4J3JA 2WKWA 3QZUA 3T4UA 3LLCA 1XLWA 2YXPX 2XMDA 4U2FA 1H2YA 5AKJA 1SOMA 2XUJA 2C0QA 1AKNA 5ALKA 2X76A 1OCEA 1AURA 4B80A 1TCAA 4X6XA 5HF8A 3WYDA 5CMLA 1THTA 3F9CA 2WFLB 3WK5A 1XROA 4CCYA 4Y2XA 3G0BA 3DCNA 2XUPA 5CTAA 3AIMA 4MJ3A 2CB9A 1ETHA 3WKCA 2O7VA 5K3FB 2C0PA 2QTBA 2YYSA 3H2JA 5FPQA 2WG0A 1XZKA 1YR2A 1JKMA 1XZMA 3WK7A 1LPPA 3D4LA 1L7QA 3OPMA 2Z5GA 2HU8A 3ZI7A 1ZD3A 2RHTA 5C81A 3FYUB 1QO7A 4G1FA 3STWA 4PF1A 1YB6A
chains in the Genus database with same CATH superfamily
2R4QA 2NU6B 3FCOA 3D7MA 3L8YA 4MB2A 4D9KA 4ZDJA 1PR6A 4YRAA 5B3JC 3D2CA 3TD2A 1KZ9A 2IE0A 3VR6H 1ARZA 3HKDA 3WZ2A 3RS0A 4F6RA 3HHEA 4CIDA 1E6EA 1NE2A 3DEJA 1XDBA 1JHUA 2GYWA 2X9QA 3OKAA 1W0JA 2J6BA 5ALJA 3ZOZA 1XU9A 4QTYA 3QA9A 1L5QA 5AW2A 3ISTA 1LTKA 3ZBQA 2O5CA 2VF5X 2X23A 1NASA 3IMEA 4AJOA 4CCAA 2DX7A 1PT8A 1CDDA 2CHEA 1ISFA 2H4ZA 3AC0A 5EG5A 3RFUA 2CL5A 3A4IA 3QG1A 3K9HA 3E3LA 2ZUFA 4KLCA 4ZVUA 3LUDA 3DBRA 1NUPA 4C3ZA 5M7EA 4KX5A 3FMIA 2XD9A 4LSMA 4UUAA 3DXYA 5HXAA 1XC7A 3DULA 3W9BA 1Z5OA 3L40A 2I3DA 1FMTA 3CEPB 3CUWA 2GCGA 3QF7A 4FTWA 4BXOA 2VHWA 1JVBA 5ALZA 4MA5A 1CK4A 4XCVA 3ZLVA 1CT9A 3IP6A 4PSAA 1ZNQO 3KJGA 4DQXA 4E13A 2COEA 4C4SA 1MIOB 5JYBA 3KVVA 3GWZA 2F8SA 4JP1A 4NBLA 3N6VA 1I30A 4LCEA 3ZX4A 5K09A 3D7RA 3KTOA 4G5SA 1ULBA 1RI3A 1YZUA 3I4CA 3O8QB 2VAMA 1BJRE 2J7PA 5E0KB 1XEXA 4BS9A 2C4HA 2JEYA 2IF0A 4HWRA 4PQYA 1NXWA 2RD2A 2BR3A 3EIHA 1IMOA 3AUKA 3CA8A 4OO3A 1PX0A 4BLQA 3L7MA 1DCMA 4U7PB 3KQHA 5FO1A 1KZ6A 1I4EB 4DMFA 4BATA 1NZJA 4N0MA 2QW0X 1Q95A 4GMGA 5KYYB 1IBKB 1B93A 4L28A 4G01B 4GBJA 1T10A 4S24A 4XJXA 3B9QA 1SUCA 5E4YA 3EJWA 1K6MA 1YDEA 1OV4A 2WNHA 1YBMA 4Q9KA 1RADA 3RHSA 3GGSA 1EFDN 4XCXA 2WRZA 5CYFA 3B1VA 3ZY4A 4BV3A 2GWHA 1C3JA 4J0FA 5DOVA 3EBLA 3FIUA 4QXAA 1NL3A 1Z6GA 2YASA 2VNJA 4RHTA 1JPVA 4G07A 3UCEA 5A1TA 5IJ9B 2PIAA 3VKGA 2VF8A 2X19A 4CIVA 2UAGA 1SVNA 1BCSA 4G9BA 1KAHA 2F9LA 2P75A 3DMDA 3R3ZA 4FEYA 5TXGA 1Y8QA 1ZL0A 3IQZA 5IXSA 5LP1A 3GT3A 1N9KA 2J9YB 4CUZA 5FYQA 3I9V1 4BNFA 4QM7A 2DFNA 4M4SA 2DFTA 5L7TA 4B0PA 4C76A 4GZ6A 2O8CB 2R7LA 3DDUA 1ADCA 2BGMA 1Z88A 4DBVO 2IP4A 4O3MA 4YMTA 2AC7A 3X44A 4WUTA 1FTNA 4LCJA 4R54A 3RCBA 4X8MA 1YJ5A 2GUWA 2B2CA 3GEMA 3VSDA 3NBQA 4B3TB 2C77A 1RDFA 5DXAA 4DJEC 3IEVA 1POXA 2WAOA 1SBHA 1OFGA 1O08A 2BJVA 1AV7A 3L7KA 4Y67A 2G4CA 1Q91A 2O07A 3S1AB 1AV6A 2OOSA 2FV8A 4S1TA 1OXMA 3VU9A 2DG2A 2V45A 5D3KA 1F2VA 2J6HA 5MF6A 1I4OA 3ABIA 4KRXA 2UXBB 3BZBA 1F2TA 2N75A 3NFRA 1U1FA 3QOXA 4WXEA 3X0DA 1NRWA 2YZ7A 4MP6A 5KQRA 2O2EA 1NW5A 1U5BB 2QJRA 3VVBA 2QVBA 4N8SA 3T06B 1VA4A 1NN0A 2A35A 2CSUA 2OV4A 4TT3A 2MTBA 1W46A 2H3HA 1GT6A 3PX3A 4B6JA 1JR2A 2QDKA 3EOBI 1ODCA 1YAHA 3D8HA 5JR3A 2J4DA 1ISGA 2D1RA 4JH0A 2JFBA 2MYUA 3OQ6A 1T29A 4Q3BA 1E8MA 5GAJA 3USZA 5DP1A 4BMXA 1QWSA 3PLAE 1O6GA 2CXUA 3D6FA 5LLDA 4BFWA 2NOAA 1WXQA 1PQUA 2PS9A 4M37A 3IAFA 2AOTB 3CG0A 2I2AA 4QUEA 3VH3A 3PEFA 3QE4A 4KUHA 2QRKA 1ZJ6A 4UEWA 2K5UA 5HZKA 3FA2A 4Q5IA 1TMGE 3RNLA 5JDCA 1OX6A 4P4GA 3CLKA 2X8WA 3F2IA 3HJNA 4LBVA 4ZN6A 1BX1A 4AXXA 1UJ4A 1SEVA 4IWNA 1P29A 4KAXA 1MC5A 4KFUA 1RP1A 5ALGA 3PX7A 3AERB 1VRWA 3N2GB 4HTFB 2BFDA 4JC8A 4ZICA 2J9FA 2XMRA 3VZQA 1OT5A 4DIDA 2FLVA 5BN3A 1C50A 4YUWA 3KQOA 1NUTA 2CNBA 4QOSA 3B85A 2WWYA 1D04A 3KHKA 3FZQA 1TZBA 2PGLA 2FPMA 2ID7A 3BK7A 3Q8XB 4DQKA 5HIAA 1MJ5A 3LVFO 3TL6A 4UCXA 1PGOA 2CVFA 2LIVA 3JR3A 1YBFA 2ACVA 3LDUA 3R0VA 1KE1A 2X1HA 1PYDA 2RAUA 4REOA 4I1OA 1AS3A 4JP3A 1GA6A 3G0IA 4IQ0A 4LZNA 4LY9A 3F7NA 1UJCA 3CONA 4IQ8A 2EBFX 4WN3A 4EQ6A 1U8TA 1C14A 5CX1A 5HS6A 4HDKB 3IX7A 3O3NB 2YS6A 1HNWB 2R8RA 1JUDA 3BEOA 4O2AB 3O4RA 2GAIA 2JANA 5G2OA 1Z16A 2O9JA 1JDUA 3SLKA 4D7AA 4TROA 4F96A 4DBLC 3MWEA 4B5KA 3VVMA 5H59A 4AJ2A 1HETA 1I4TD 1A95A 1CVRA 3Q2KA 4OM8A 3BDIA 3I34X 4F9TA 5HSGA 1YUMA 3VZDA 1UMBA 3H5LA 3LHIA 1Z8DA 2BFFA 3BBLA 3UJBA 1CQJA 2QUJA 3QIAA 5IP5A 4RQBA 3KTAA 5ES3A 2PUAA 1ZW1A 3A1DA 3CIFA 3FAKA 2UYOA 5DZSA 4ZAVA 3ZU2A 2CNNA 3LC7O 7GPBA 3F8SA 2VDPB 3HYLA 2BHSA 4ZD6A 1FNSA 1BIFA 3DDWA 4M6WB 3EE6A 3NYWA 2AG5A 1KVRA 2BZSA 2GD6A 2I7TA 2Y67A 2NZYA 3PQCA 3ADKA 1JIQA 3IIIA 2CFSA 4WEQA 4X8HA 3B6MA 1P2FA 5KSYA 1EUCA 1K68A 4UEQA 1J0BA 2FG6C 4ROTA 4CM4A 4E07A 3E03A 1DWPA 4YPFA 1NF2A 3D02A 1TT7A 3KLMX 1A8SA 4G0VA 1NSTA 4R1QA 2RGAA 3AR6A 3ZEIA 3ROPA 1SQ0A 3ZV6A 3D5EA 3MGAA 3NO4A 3ES9A 4IXMA 4RLQA 3TW8B 4QSMA 4DCPA 3L8ZA 3ONDA 2VH1A 3DEHA 1RACA 3C70A 1LK0A 1TQ2A 3TD9A 1TVKA 2VT6A 4FKMA 3I05A 3VV2A 1KL7A 3ZGNA 2UVPB 3GT4A 2O8EB 1XTIA 3B3FA 4NG4A 3DE4X 2IXDA 3RRBA 1P7WA 3DEAA 3DOFA 1ID8A 1M5RA 2XGSA 3AIIA 4HRYA 4V0OA 3UCFA 2EJUA 4U3JA 1IJKA 1V11A 2ZYTX 3JAKA 2FMHA 3TSAA 3DGFC 1JA0A 4FNOA 5EWMA 2Q1WA 4D9CA 1M34B 3CN7A 3SJAA 2NVWA 2XCOA 1LDBA 2B4AA 2CVPA 1DX4A 2CLLB 5JZSA 5AXCA 4EJSC 1Q1ZA 1F4VA 1GPKA 1Z18A 2OG1A 2VDKB 3O21A 3PR2B 4CMCA 5ITSA 3GLHB 5JD4A 4CPDA 1Z6QA 4FDLA 5E0OA 5ITZB 3AJEA 4DARA 5C4GB 5T64A 5UKDA 3H9QA 2C4UA 5ALVA 4EY3A 5F1OA 3SYTA 1B74A 1OQAA 3AI2A 5EP1A 1I80A 1QKIA 1VJ0A 2LV8A 4JBWA 2RMKA 3RIYA 3FZGA 2XMCA 4JVMA 4L2IB 3DE6X 1WDLA 1NW8A 2ZRFA 4HP8A 2W8BA 4KPUA 2HUPA 4MUFA 2C29D 1XTRA 2M6RA 3KHSA 3LLVA 4G1EB 4H6PA 5CNMA 4JYMA 4EW2A 1K63A 4V38A 3QOYA 4LY6A 1JXAA 4QRIA 3IPAA 3D1JA 1XU4A 4BMVA 1E3WB 3LQ1A 2R00C 1HFWA 3AVWA 4PINA 3VNVA 2A0KA 1SRRA 5HP4A 4A16A 4KQ1A 3M1YA 3F1KA 2XIQA 2WLSA 3I9V6 4PZCA 4C7OA 1PG2A 4XUGB 5E6RB 5LB4A 4UTXA 3LA8A 1NW3A 2G5TA 4II7A 1IQ0A 2EEPA 4Q9IA 4C4XA 2OLJA 2FMXA 1OH5A 1ZD2P 3J7AC 1QS0B 3CCBA 4L4RA 5I5GA 3PDIA 4H1WA 3PEYA 2Q8PA 5IFLA 1CY1A 4TVOA 3RFFA 3CH5A 3E35A 4JQSA 3E81A 4E5MA 4M9RA 1OAKA 2I7VA 4RJJA 4B2LA 2HGSA 1OXKB 2R60A 2XGOA 1W5EA 1NKTA 2EBHX 3KHUA 2B1IA 1JS1X 1RBYA 2FQWA 2PZMA 2X2EA 3H2KA 4EX6A 3ZGZA 3BD6A 3QNUA 2O06A 3W4JA 2FZ4A 1H9AA 3EXFB 3A4LA 3NM6B 3F6BX 3PHJA 3F2VA 4NZMA 2AXPA 2P27A 3ZXIA 4BO3A 2C92A 2XSZA 2VYND 2E55A 4GVXA 2IH4A 1MZPA 4C03A 4GE0A 3DDZX 2F3PA 3LUBA 4ZYTA 2AH5A 2B9VA 1LD3A 4FXOA 3WIDA 5HYVA 4US2R 1RC0A 3EVBA 2QTWB 2WWIA 3AR9A 2ISCA 2IH5A 3E7WA 3PX2A 4A6XA 3I5XA 3IGFA 4S2UA 3SR0A 4DLPA 4AZ3A 3WWYA 5AK3A 4D97A 1PBTA 1JQEA 2HNKA 3UAWA 1ZGBA 4BWYA 2OORC 3EMVA 4JYCA 4EJ6A 4G1UC 3ZQJA 2EDCA 3R5KA 1GZ5A 2D1SA 3IR5A 5E9AA 4ZT4A 4AF7A 3LOUA 4V1CA 3OO1A 3ZTWA 3S4YA 5IVHA 1SA0B 4DIFA 1UBLS 2OZLB 1HI9A 3O8OB 2ERCA 4HEHA 1MDFA 1GUAA 4GRIA 3GG2A 2ZJ5A 5E6SB 3N6RA 3G85A 4WINA 2Q9BA 1FTGA 1KK0A 1VPLA 1MJGA 2NQ2C 1B1AA 2YHAA 5D00A 3RVKA 2BP7B 5BVHB 1E5TA 2BMDA 2BCGY 2YZMA 2QX6A 1XJ0A 3DEIA 3PRYA 4ZOCA 4M38A 4DC0A 1E94E 2ZXEA 3GO4A 2WWVD 3VUFA 4QE3A 4U2KA 5KDOA 2QL7A 3GVIA 2X6QA 1OZFA 3JTEA 2Z5FA 2C0CA 4J90A 3SLRA 4DB4A 4XUCA 1QG0A 5FBRB 1Z7WA 1K0UA 1M2OB 1U6JA 2LTAA 1QRRA 2C61A 1NKVA 3CWZA 4U00A 1DELA 4MUJA 5H1YA 2B92A 1P0CA 2D2EA 3B5JA 3T1TA 1S3SA 1XD9A 3P4XA 3CVUA 5D5PA 3T7IA 1G42A 4DR1B 1CE8A 1XNGA 4DJ5X 1UQUA 3G5AA 2PAFA 5SYAA 3MT7A 4G09A 1BOOA 3FDZB 1ZSYA 2Q5EA 3JY6A 2IJGX 1NFQA 2R6JA 3ULKA 1VPTA 1B3BA 1BW9A 1T3ZA 1YQDA 3OCJA 3Q85A 4O3FA 2WWTA 2JL1A 1EFVA 4CV3A 2O7QA 1REQA 1VJ5A 4GR9A 2J08A 2WB4A 1TYDE 3HR8A 4MW6A 4EI2A 2R5WA 4ZYXA 3HCRA 3UZUA 3DFIA 5GTDA 1DSSG 2PUWA 2CJXA 2AKYA 3L0YA 4XVUA 2PUVA 4ZOLA 2UZ0A 1MQSA 1SB8A 4PG6A 2AYZA 3JVDA 5TQ0A 1DG1G 1JP7A 1WVMA 3HXPA 3LUJA 3PC3A 3DMTA 3QHQA 1TU0A 4ZARA 2PX5A 3MJTA 2OGZA 4MR8B 2WF6A 4YO7A 4AKHA 1UDCA 2B30A 4ROSA 3VHXB 3IS3A 2FJPA 4LQCA 5KTKA 4W5QA 3UJDA 4JB8A 1WF3A 1DTWB 2A5YB 3DQQA 3PQ3A 4MIKA 3QQ5A 4DQ0A 2WHRA 4LJ5A 1F14A 4S04A 1DJMA 1U9IA 3CLRD 5JNVA 1J2EA 3NIWA 1RWVA 4BFSA 5BT9A 2C7PA 5AW9A 2A0WA 1NFRA 2NXNA 3ZDBA 1ZBDA 2QZZA 4BGEA 1O94C 2VHXA 4IHJB 4YCSA 3CM0A 3E05A 4QU5A 1PSWA 4D98A 4GU5A 4BX2A 2XB6A 1N36B 4R51A 3KUCA 3T52A 1VSQA 4E33A 4DDWA 1K4KA 5IHPA 1KVSA 5J23A 5LOVA 3EPLA 2PH3A 4MV5A 4UNNA 2C84A 2PQ2A 3RADC 1D6NA 1UC8A 2ECQA 1R15A 3G0GA 1IMJA 3OEWA 1I7PA 2XUFA 2Z1DA 3P2MA 1AHIA 1U8ZA 2ADOA 3PF8A 7REQA 2UYHA 2G1PA 4HUQA 2VUSA 3EXEB 1HNZB 1BD3A 1E6CA 4ZZ0A 3LYHA 3UB2A 3EBPA 1OI7A 5K0NA 1EXDA 2PMKA 3DE3X 3HCEA 1IB6A 4JBHA 2Q3FA 1CZOA 2PGOA 2D06A 2GS9A 3M33A 4S35A 1CFJA 3OM8A 5B7GA 4JYZA 2PG3A 4DIEA 4IIHA 4QNNA 1S7CA 4P81A 3GH3A 3A7DA 4BV2A 1FFXA 5JSYA 2CMKA 1E2GA 3NT2A 3R3UA 4QKQA 5J3JA 2J0UA 1NI3A 3LS2A 4LNHA 4UBOA 4UM7A 3OCUA 3ZXUB 1J2RA 4IJVA 2PE5A 3H84A 3LBFA 3TTTA 1EG7A 3LWNA 4RTLA 1EQ2A 4YJDA 3W2GA 2BPOA 2IUUA 1P1KA 2XZOA 2ZSUA 3FPAA 1NY5A 1RKVA 2ZWIA 1MHPA 3NAQA 2QL6A 1W581 1FFEA 1L5MA 4GM0A 4BMSA 2CFTA 4P08A 1IHYA 1XQWA 1NJ5A 4CDMA 3K70C 1GGJA 2I5PO 3ETCA 1JHMA 1XJ5A 1HE5A 4PSKA 4GZMA 2CBXA 3DMFA 1ZOLA 3TYXA 3FE2A 3HHPA 3AF3A 4Q6WA 1E6UA 4M8NE 5SZJA 1W1IA 4W5OA 4MK4A 2QRPA 3WLNA 3RC8A 4G5RA 2ZRBA 3EWNA 1Z5ZA 4PC6A 2VZ9A 5DFAA 1G64A 2MINA 3CY6A 3B70A 4B82A 5F7OA 2JJ2D 1A9ZA 3G2OA 3G23A 1OHHA 3IAS1 4D3YA 2WC1A 2C8JA 4RXTA 2WVAA 1X38A 2C2OA 2C1ZA 2OGWA 4YAJA 1YZFA 4YT2A 2O3SA 1KDRA 2PS1A 1D9XA 1JDBC 4QOEA 4YRZA 2YMMA 3DWGA 1OZHA 5DLEA 2VI5A 2O8DB 2P3LA 2PL9A 5FWXA 2XQJA 2H1VA 5D7BA 1QRDA 1J56A 1BU8A 3W5DA 5EJ6A 2O5EA 1GG8A 4PZPA 3ZY3A 5IVIA 3OA0A 2F64A 3LF1A 1IM2A 1E5XA 5DM1A 1AE1A 2YYAA 2WMYA 3LZ6A 4DL9A 1QO9A 4Y0NA 1FB5A 2XI4A 3AY0A 3MILA 4OKIA 5TARA 1AG9A 4JYAB 4L1KA 8ADHA 4K9DA 5KQMA 4EGQA 2WDZA 1FU4A 2A7QA 2NZUG 4P7JA 1Y1TA 3EA4A 1GLVA 3OE5A 1JHRA 1QYWA 1QP0A 5DT9A 5HIJA 1W87A 3ODPA 1LV7A 3LQFA 4AKIA 3ZCXA 4X20A 5ADHA 4CODB 4OKNA 5E95A 5HKOA 1HNXB 2JLRA 2XA9A 2AK2A 5EIXA 1WP9A 4IOLA 1ECJA 5H9VA 5KSZA 3AF1A 3B52X 3ANYB 1JLMA 1OIXA 1MQ8B 2VT3A 2XRFA 3OJWA 4NBUA 1Y37A 3OLCX 4JX8A 4YP9A 3UNXA 4DCVA 4F7DA 2RGRA 4LDAA 4GXRA 3L4EA 2C5BA 1A9XB 3U9LA 5ALPA 4CKBB 3FRIA 3WAGA 2OQRA 4IIFA 4D4KA 1PZFA 1K98A 1XXLA 5FNVB 1L7VC 4X85A 3ZIAD 4DR2B 2B82A 2VNSA 1LBSA 2DVMA 3WBBA 1U9ZA 2Z9CA 2PPLA 4FHDA 2QVLA 3ZCRA 1PJTA 4L4XA 4U4AA 4XQCA 4HB0A 4KNYA 1UOPA 1ZLYA 1UL1X 4K6HA 4YJ2B 4ARBA 1O57A 3I53A 4KSBA 4R2XA 3HS3A 4RHEA 3Q7TA 4B6QA 2P6NA 3GMDA 5DE3A 3PGLA 3U2QA 5GGXA 2ZM6B 4UHFA 5HCNA 4B3RB 3N58A 4G97A 3JXEA 4NV1A 3HJGA 2A7XA 1MENA 3FZEA 5IT0A 2BELA 1UK7A 2L18A 4YK7A 1EK6A 3E8MA 1XTUA 4I1SA 5I8WA 2HM7A 2ABWA 1FP2A 2HK7A 2OXRA 4MW0A 1LW7A 5EJGA 3WYEA 1RM3A 3EDOA 2M98A 3K16A 2XCRB 1GTMA 3EWSA 2POQX 2ZR9A 3ZW7A 4U39A 3SFZA 3HO6A 2NLOA 1Q84A 2GZMA 3A9RA 4W9NC 1G8PA 4PNHA 4BZWA 5JCJD 1EFTA 1Q3TA 2RHMA 4N7BA 3RUEA 3Q10A 4EA6A 2IC5A 3FG9A 4UBLA 4C89A 1N2IA 3EEFA 1M6VB 5HRAA 2A2ZA 4EVIA 3X43A 1MNQA 3D0KA 3OZTA 5FHQA 1ZLXA 2PRSA 3EYWA 3URMA 1YI0A 5AVTA 5IAGA 1NU8A 5G4LA 1IFXA 4UD2A 4FGJA 3B7GA 4OLHA 5BN1A 4D8TA 3KD2A 1LSUA 3BZUA 5FTJA 2PO5A 5HJEA 5CDFE 3H1FA 3PNYA 3JQ7A 2BFCB 3B9PA 3ZDZB 1G3UA 4URHA 3W7VA 1SCUA 3WGYA 2ZSJA 3R9XB 2PZBA 5HKLA 2YJ5A 2VXCA 4ZYUA 2N46A 1M2EA 1T8PA 4WZAB 1QF6A 1SB9A 1G5HA 3INTA 1N0UA 1Y1SA 3C16C 2Q0XA 3ETNA 3PHIA 4LMRA 3QRWA 3TR6A 1FL9A 4OGWA 4FT2A 5LSAA 1GGHA 3X1ZA 1H3NA 1M2WA 4DLLA 3SVTA 4O0LA 1ODTC 1X1EA 3AKCA 2OBMA 3UICA 1CP2A 1E66A 3CKKA 3PNBA 4KVGA 2ECFA 4KITB 1JILA 3AZQA 3BHJA 4CKEB 1WCIA 1AUVA 1Z13A 3N2IA 4BEBA 5I3ZA 5E9QA 2PVPA 1II8A 2Y1EA 3H05A 1SHTX 3HP1A 5LC1A 4JEMA 1ZU4A 1TRHA 4DLNA 2NT3A 2Z83A 5FI5A 1TF5A 5J47A 2HRBA 3PC8C 2WUEA 4EG8A 3UHOA 5CXQA 3OPYB 3UUEA 3CCFA 3EEBA 1C7EA 1HQYE 3JD1A 4IG4A 4AJKA 5GMOA 4E12A 4F86A 5CLJA 5IJ0B 2RC6A 1JAHA 1MAUA 2ID4A 2NXWA 4PC7A 4XPIB 2BLLA 2BUCA 4XTRA 3GWGA 5F3DA 1MEJA 2C83A 4H1VA 1A0OA 4W1SA 2ET6A 2FE1A 3RC3A 1JW9B 1IJBA 1RZVA 2PKQO 3HYCA 3MINB 4KXXA 4UDNA 3WQSB 2BZ1A 3EC2A 3C3DA 1XGKA 2RCYA 4KYVA 3HU2A 4WLNA 3ZQ4A 3ND6A 2VJMA 4CUKA 2AXQA 3ROZA 5HQTA 2JGIA 3H8WA 3SKVA 1E1LA 5J4LA 2AKAB 1R4MB 3SG0A 3FSJX 5CM9C 5AQEA 2WJ4A 1CHDA 2Q5JA 4DCTA 3T3NA 2VQEB 2VA9A 4CQLA 4YLYA 5JG7A 2GTIA 4G0XA 4RD3A 3W9UA 1QH9A 2JZCA 3WY9A 2WICA 2PYIA 3B3JA 3P4YA 4NZZA 3PFGA 1ZD4A 5ESWA 4YT4A 2YHIA 4YAWA 3IESA 3KP1A 3HI6A 1KOLA 2V6FA 4AKTA 1ZGHA 2C4TA 2MJLA 3WRXC 5DM4A 4D1YA 5BSGA 1C9NA 4ZOLF 3PPYA 5E3IA 3L7IA 5FL3A 2I4MA 4LYGA 5H5JA 4CI9A 4CVNA 4BCCA 1WW2A 1RT9A 4CTMA 3FPBA 1MCZA 4LJAA 1HLGA 2QN3A 3FNQA 4ZZ3A 1U98A 2O2CA 3NNNA 4GLBA 3UYKA 4IKEA 5CVTA 2LW7A 3IAS6 3QUBA 3VNSA 4JHLA 1ORWA 4DA6A 2BMVA 1NLMA 3OF5A 1VE7A 3BXOA 5AYVA 4DWOA 2VDRB 3FZYA 3G1UA 2JVJA 3AZOA 4MW9A 1N9GB 4HGRA 5DNEA 4Z9XA 4DY4A 2H07A 4EJSA 3BTVA 1IEXA 1NP7A 1X2BA 2ZYVX 3FWPA 3PL1A 4FMCB 1KYQA 1AQIA 2X3UA 1XDSA 2UZAA 3NV9A 4RPJA 3WYNA 4F3KA 2WYVA 5I8PA 4P31A 4FXPA 5GONA 3LPNA 4N7MA 1D2HA 5DXFA 1QMPA 3L05A 3HR4A 1YVDA 2FPPB 1UADA 1EX7A 1IAVA 1S2LA 3P71T 3FMFA 5LZ2A 4FDMA 4Z9FA 1IK6A 5LOVF 2HT6A 4HEA6 4JLVA 1D6MA 4MVJE 1XHFA 3RG2A 4D8YA 1NRIA 1PK7A 3ML1A 2WVJA 1HH4A 2Q5IA 2PGJA 4UEKA 5BWCA 1LCIA 3CBGA 3K9NA 1HOXA 2CNDA 3LT2A 9LDBA 4P9NA 4DV1B 4Q4JB 5EIBC 1I2BA 1YB7A 2R00A 1BJTA 2PH5A 3BWEA 3V8EA 2UDPA 1RWXA 4PZYA 1SZPA 1P81A 1M54A 2GXUA 1GRRA 3ANXA 1QIHA 3KL4A 4MYRA 4BV9A 3TKAA 3IBSA 1U2QA 3H11B 4MRVA 1AMNA 1Z3CA 4M9UA 5DLYA 1QUFA 4DBLE 5B1YA 2O7SA 2O8BB 3DLCA 4YN3A 1FRQA 1FLDA 2C4WA 2PV7A 3CX7A 3OMXA 1U9JA 1OLUA 2AFVA 1AA9A 1CG6A 3HRHA 4WW0A 3HDYA 1E3DA 1IZ0A 1ZNWA 5K0LA 4BQIA 3TLKA 4EA9A 3FH0A 3JQGB 5EHGA 1OKKD 2FHSA 2D59A 4F5DA 1GILA 3ZE6A 3ZKWB 4RHYA 2COUA 3KR9A 2WYUA 1C9JA 4FEAA 4UULA 1JI0A 4LRWA 2O1XA 2QT9A 1NG1A 2WIAA 4NQZA 5FA5A 2LCQA 4EHDA 2AX3A 2G88A 3NM5A 4HNGA 4I3GA 1SUIA 4MQ6A 4P34A 3S0JA 3TDKA 9ATCA 3ILYA 4WFQA 1N2BA 2EAUA 3D3KA 2WF9A 4GWLA 3BC1A 4YYZA 3BCRA 3O2QB 3PFFA 3BXHA 3P9IA 4Q01A 1NUHA 4EH1A 2II6A 1Q15A 1X1QA 2W2PA 3IMKA 4D6PA 4Q7LA 3KB1A 3RTCA 4JU8A 3MTQA 1K97A 2OORA 4WLFA 3KPVA 5BNFA 1DAMA 3ETLA 2ONJA 2PLRA 1GL6A 3QEOA 4GP9A 5TX7A 1EVYA 2JFYA 1YRWA 3AFNA 1AUXA 1NGSA 4QELA 4FFPA 4BNLA 2Q49A 4DR5B 1L4GA 1N1GA 1N4DA 1UIMA 1ZOSA 2WT4A 3IBFA 3L6RA 3N87A 3OQVA 2P35A 2PU7A 2VTBA 3ZDDA 3SYNA 3HO1A 3JQ9C 3SYRA 4EHNA 2RHLA 2V9PA 2XUZA 3PCRB 4NFSA 4D4MA 2I9KA 3AP2A 2Y1WA 5D7NA 1NBIA 4PG5A 4RGBA 5M3BA 2ZYRA 3HMKA 2PT6A 1PNOA 5KAPA 1RJEA 4L4UA 1A7AA 4Q7EA 4US1R 2DQZA 4UVGA 5A3RA 1BXRA 3PWKA 1TYEB 4G0ZA 4NEHB 5IT9A 3ER9A 2PH7A 1V48A 4O4LB 4FHZA 1ZD9A 4LFBB 3AY6A 1GGFA 3ZE7A 3DKRA 3DDSA 3BE6A 3ZHTA 3SZ3A 1P1CA 1KARA 4A73A 1QE5A 4D6XA 2WSLA 2X0RA 3GCWA 2AMLA 2XZLA 1C7ZA 1PFVA 1PJ8A 2QRJA 1U3WA 1ZM9A 1L5NA 5A2GA 1TJPB 3GRRA 2YVLA 1H94A 5JTUA 2PL1A 4IJ5A 4JQYA 1EE1A 1F51E 2BR5A 4PYRA 2JDID 3GP8A 5FEMA 1ZOOA 2WMDA 1UFVA 2ZRJA 3AT1A 4L27A 2W93A 4R7TA 4UE2A 4WN9A 4EO7A 2B6NA 3I9OA 5JYEA 3HGMA 4WDRA 3HPQA 5C8YA 2ZS9A 2PY6A 2VP2A 1IOZA 1ZVQA 4DJDC 1U3FA 5LA6B 1NYTA 2CE2X 5DCYA 1ZZEA 3B1WA 5AI0A 3K6SB 3ZJUA 2ZT5A 4JLSA 2UXCB 4YLEA 1HURA 4BAZA 1ZD1A 3BCHA 1YQXA 3OEED 3CG4A 1SD2A 2V1UA 3K0FB 1NMEA 3N9IA 1Z0AA 221PA 3TXYA 2AOUB 1U2PA 1V2GA 1AKMA 1TXGA 1UJNA 4UBJA 1HL3A 2D2IA 3ESXA 3UMCA 4OB6A 1KWGA 5AOBA 4E4RA 1DQYA 4BNVA 3KPYA 1QRSA 1PWEA 4QNRA 5EQDA 2CLOB 2PZ8A 1O94A 3C4VA 2D1FA 1T5SA 3IBTA 1I4DD 4GMKA 2PV0A 1K7XB 3M6XA 3NTRA 2D1YA 3T1YB 1GYQA 4N8EA 2BMAA 1JYFA 5LMCA 1JPJA 2JCSA 3VU0A 4NJMA 2Y0BA 1EFHA 4AZVA 2F8MA 1Y6QA 1P45A 2HC9A 4DPMA 1U2RA 4EW1A 4DDTA 1GKIA 4PFJA 3MIZA 4XWWA 3DL0A 2KI5A 4TMYA 1YL5A 2A78A 5JIBA 1YNSA 3CR8A 1DCFA 1WDTA 1Z4OA 4DLSA 3R8FA 2J41A 4NENB 1E1RA 4MUHA 3UV3A 4KQKA 4Z9AA 3T5AA 1XAGA 3DTVD 4HHEA 5BW4A 3X2FA 1SVMA 1CFZA 4HVCA 5IJXA 3OQIA 4L4YA 5F51A 4OA8A 4MRRA 3GUYA 2OQIA 4INJA 3WJ7A 4LYDA 1DFGA 1DJNA 3KVOA 1P0IA 1ZYUA 2BLNA 2I4RA 2R1TA 2XE6A 2GK6A 1KP9A 4G0QA 4IF4A 4OY3A 4U8HA 5DNDA 4D74A 4P0QB 1WW8A 1MJFA 1EE9A 1PG5A 2ZVPX 2PWYA 3MT0A 4OXYA 3TNFA 2BTQA 4Q1AA 3ZW8A 2A4MA 1XQ1A 1LNSA 2QTVA 3FUXA 3K20A 3PJGA 4MVJF 4XYMA 3SR3A 2XHZA 1OLOA 3SZGA 4BBPA 5JI2E 4TLAA 3RAJA 4WAUA 3ZGOA 3ZHOA 1I4LD 4QGGA 5CJ2A 5TQ2A 4YV0A 2H48A 2VUHB 2YZNA 1W1WA 3IT0A 3WNZA 5B1EA 3VZSA 4ALMA 5C46F 3MTEA 5KYGA 1KYIA 1QYXA 3JS5A 1OFIA 1LPNA 4UATA 4UXJA 5DEIA 4YCBA 5TGDA 1NQOA 2CWWA 1ST3A 5ED4A 1GAJA 2AB0A 3IAUA 5ALYA 3QLEA 4NBRA 4CN8A 4D3FA 6ABPA 1U0FA 3IR6A 4O2BA 4DSAA 2AW5A 3C3CA 3G2IA 4BC0A 3BM5A 3AB8A 3BPSA 4YHHB 4QHTA 1JKJB 1FUUA 3SHQA 1KSGA 3CN9A 2Z4TA 2DHEA 1YHYA 3F3KA 5DHQA 3FGPA 3FWZA 3GVXA 1M6WA 4FHCA 4ERXA 1T1JA 4RWZA 3BHMA 4D4HA 3F1LA 4TSFD 5G0VA 1C7JA 2BI7A 2BD0A 1OWOA 1U02A 1UM8A 2O2JA 3E7PA 1USGA 4G4SO 3A6EA 3HJBA 3NBZC 4WBNA 4BY9E 3U4IA 1L7BA 4JC5A 4EQZA 2C2GA 1M8PA 2OZPA 4J1NA 4IZIA 4BMPB 1NFFA 2AC2A 3C5EA 1PR2A 4NH0A 4R1LA 3SBXA 5IKMA 5GADl 4RZSA 3N1UA 3E1GA 1YE8A 3ANTA 4AXBA 5IJWA 2CXPA 1PHPA 1G1MA 5H3CA 2R97A 2I2BA 1O9GA 4F97A 4KN6A 5AKKA 4M8SA 4LY0A 4CMJA 4F92B 5K0JA 4NCAA 3BAFA 3JD2A 1TUBA 3ORFA 4OK5A 4YAEA 4ECAA 1MW8X 2MU1A 1G5FA 1SWWA 1F20A 4NC9A 2WI8A 2ID9A 5EE0A 2EW8A 4QODA 2X41A 4LAFA 3VR5H 4HVLA 4QJ3A 5JYCA 1NVKA 5C8ZA 1GU7A 2P69A 4KBFA 3EPJA 2ZCUA 4U2BA 1V41E 1YGPA 5AVOA 3SKYA 3F98A 2MSLA 5EVCA 4DAOA 4LGMA 4C01A 3P97A 4CEIA 1NN5A 1HMPA 3RABA 3M6WA 1RXIA 1TIKA 1LSOA 2GJKA 2HIGA 2I2DA 2RK6A 2XUGA 4IX1A 4L7QA 4URVR 3A04A 1LA2A 3DR3A 2V3VA 3DT9A 2QPLA 4JJ8A 3R75A 3DZ8A 3M4JA 4TKZA 4GDMA 3O4JA 4TLCA 1KXJA 5JXHA 1D2RA 2IVZA 1IN8A 3D8UA 3SXUB 3RAPR 1O6FA 2ZYIA 3UAVA 4BJ1A 3ST7A 3KJXA 2D2VA 4LXQA 1CF2O 1ZN7A 4M3NA 5EHNA 4A5SA 4HXFB 4LXIA 3LCUA 3DWFA 4IWYA 3EIQA 4DG9A 1JI3A 5J59A 4NYJR 3RJ5A 1ECGA 5I47A 3C1OA 2RHWA 4RVCA 2GN8A 1WBDA 3PXCX 5GONF 3BF8A 3KTDA 3C3KA 4WCFC 2AZTA 3ZGYA 3MHTA 1V3QE 3A25A 2NT4A 1DAOA 3IELA 4BYGA 1J0AA 2BKLA 5EERA 4CM5A 2QTMA 2CMDA 1E7MA 4KWTA 3F9RA 5LMZA 1KO4A 1FFDA 4ZVTA 4NYMQ 3VRHA 1MB4A 1TJYA 4B17A 2WJJA 5IXYA 4AKEA 3K2IA 4NZ9A 3ZZUA 4PZ0A 1G63A 3RS9A 5BUCA 1LBTA 3HXMA 4H31A 2Z4RA 1JDJA 1NYRA 1PFGA 1FDSA 3ILHA 4HYEA 1THZA 4QLOA 4RC9A 3OZCA 2IBMA 3HJAA 4PM4A 3VUEA 1SKMA 2NP6A 1JG2A 4EA7A 2JB9A 4KMRA 3NKVA 4WESA 2OG2A 1KHHA 3RBXA 4W9NA 2ZJ2A 4LSGA 1UBTS 2X3FA 3WSTA 3JATA 4YROA 1PCXA 3EGDB 1KYXA 4QVGA 5C18A 1C2TA 3T7KA 3X2EA 3AQ4A 3DEYX 8AT1A 2D2XA 2OMKA 1EX9A 1HDIA 1M1ZA 4DVJA 1CLUA 5K6AC 4FDAA 2XHEA 1QTIA 4GYYA 1QYCA 2GLTA 2GZDA 2NVUB 2DCUA 4LNUA 1NBOA 2GCIA 4DHWA 3L02A 5FKJA 1DWQA 4UBIA 3FROA 1FQOA 4JVSB 1CIPA 4W6ZA 1KYTA 1EK0A 5EMNA 4LF8B 4AY2A 1GARA 1K8YB 3G8CA 1PUIA 1X2EA 5D01A 1UBCA 1Y9DA 4B7AA 4MV3A 4XYBA 1EWYA 3BMCB 3Q7QA 2RHOA 5CVJA 1IXRC 1XXHB 2MSCB 1IXZA 3DMGA 3HWRA 5H4HA 5EIEA 1HOTA 1JSXA 2HA7A 2H8GA 4MUEA 3I1IA 1AZSC 2PDAA 1M76A 3P9CA 5HF6A 1ZUD1 2C2HA 2C4NA 4N0EA 2VBGA 3V2UA 2C5SA 3KJEA 2PL5A 4L4ZA 3I1YA 4MJLA 4ZVMA 1KRWA 4LYJA 3KVYA 4TYNA 5BQFA 5EFZA 3V1MA 3I2HA 3ITNA 3IOCA 1KDTA 4FGWA 3KAQA 1QU2A 4D57A 4TLLB 4WZ6A 1OBCA 4ZKDA 2Y0DA 3T5BA 1G7RA 2PNJA 3LBAA 1Z83A 4RD0A 3T9AA 2NAFA 3PC8A 1W2WB 4CMBA 1O8CA 4DYHA 2EFHB 2R6HA 4KIWA 1J7JA 4IOMA 4RVDA 2OZKA 3T3MB 5CB4B 4B3BA 4M0KA 3AINA 3PKZA 1JQ5A 2ZAOA 3GFSA 4G8DA 4B3FX 1FYXA 2VP9A 3RFCA 2FSGA 2WINI 3Q40A 3BIJA 4RPIA 1N5DA 1LNQA 1NP3A 3V8PA 4OTZA 4U7WA 1GFWA 1K2VN 3NDPA 4PRLA 4MB6A 1EM6A 4AYWA 2YWCA 3DKIA 3MMNA 5EIAA 1RCUA 1QFYA 4N6GA 4H27A 4OAPA 2HNAA 3JSXA 2DSTA 2ZJYA 4QXMA 4KN5A 5BWOA 3HP4A 1ZY2A 1DIRA 3OECA 3AF0A 3WTBA 4EW3A 4DR3B 2ZIUB 2W2QA 3CV3A 4IDDA 1NVMB 3E82A 3FCYA 2EHDA 4MLCA 3PJDA 4TV8A 5KYXB 1U7UA 2G63A 2YQ5A 1CXZA 4HPJB 1KVUA 2ENUA 1VMDA 1OMOA 5AW5A 4A6PA 1FSZA 4GM1A 4OHCA 1U3TA 2ZW9A 1NBMA 1DC3A 1XZIA 3THYA 2VN8A 2DLNA 5EWJB 2HDHA 4DA7A 3H2BA 1JA1A 3ZGVA 2IUFA 3RAGA 2JFNA 3SE7A 1JVNA 3AZPA 4ETWA 5A2QA 4AP6A 1ZJ5A 5C8YF 1OFUA 3AF4A 4LF9B 2H4YA 3QWIA 3EXIB 2BFEB 2QYOA 4JJ4A 3SBOA 1KXZA 2J46A 2KQUA 2O2YA 4HZUA 3AI7A 3KXIA 5JXGA 3VSAA 2W6ID 1JR3D 1YKGA 1JLRA 3CZ4A 4OBBA 2XADA 3EZ6A 3AVYA 5AO9A 4KX3A 4C2TA 3GPBA 2Q6KA 1QP4A 4OBXA 2DCMA 3WBKA 5AH0A 4U7JA 1EBFA 1KQPA 5KWJA 3LJKA 3A6FA 3DUWA 2FMKA 3MOSA 5KPDA 4X5OA 2BFBA 5ER9A 4EG3A 5CFPA 1T3HA 2D62A 2Y0PA 4KWEA 5F2KA 3EW7A 4EDFA 2OKGA 3FOZA 5JAOA 5L4LA 3EDRA 4YHBA 4ND8A 2HA6A 2IIPA 4ZI2A 5TPZD 3DA8A 1T1EA 3OZEA 1L7MA 5H83A 5FUQA 3DMHA 1V7QA 1YI8A 1XMXA 5IVPA 3KB8A 2I2CA 1F3LA 2ZUUA 3BICA 3KQUA 5K7SA 1XQ9A 2B0JA 2BH9A 2FETA 3FPCA 3V3TA 1H5NA 2QRVA 2ZWMA 1ONBA 3DT8A 4F4JA 3FTFA 4U5QA 2XUOA 3OT5A 2G8LA 4HGQA 2INGX 5AKXA 1F8FA 4E3ZA 3KE8A 3M4NA 1FX1A 2WZCA 4MVXA 3WHIA 2BBSA 2IL1A 3DZCA 1E60A 1XMPA 2NXJA 2B61A 3DDNA 2JGAA 3FUUA 4IXDA 4CL3A 5CG1A 4FLEA 3A1NA 2G28A 2WTNA 4TMTA 1VIYA 1XRPA 2VPXA 4TLBA 5C7YA 4UAUA 4MHSA 1VPDA 3KQPA 5DYNA 4E7OA 2VDNB 3NYQA 2ZATA 4JKIA 5GOZA 1QIMA 1NMYA 1TJ3A 4RV5A 2RGWA 2ZIVB 3T4EA 1AMOA 3U1TA 3NBFA 3CPEA 3K6JA 1EI9A 4B46A 1Z39A 3TRDA 4ESEA 1R27A 4WERA 3L0CA 3L1JA 2R44A 1SBNE 4RY0A 5DTEA 5FBZA 3QX8A 4LXHA 5T3UA 2KS6A 1OH7A 3M3DA 1N32B 3FTEA 3O9MA 4DKJA 3EQ9A 2F3SA 5IMSA 4H3KB 3BTSA 2HW8A 4CMKA 4EF6A 2ZUBA 1A4XA 3H2HA 2GFIA 3ITKA 2Z2IA 4N49A 1N3LA 2RKBA 2XQGA 1KRXA 1VI2A 1NSFA 4MKRA 3PUYA 1JKXA 4P0TA 2JLBA 1L8XA 1KP3A 1KMIY 1L5KA 2G1JA 3SSOA 3MFYA 3ZZNA 5ECYA 2VDLB 3C8HA 5EYPB 2AVNA 1PNRA 4YJHA 2B9EA 5IS2A 1NBME 5F3RA 4B4KA 3HSKA 1RZRA 3K6RA 4HDSA 1Q1NA 2BEVA 2V5VA 2YVQA 3OZGA 1Z0FA 3F97A 4AO7A 5F1KA 5K6TA 1PI3A 2WFZA 1C9YA 3LK7A 5LQMA 1Q0ZA 4Y6OA 5LKRA 1Q57A 3GUUA 5D2CA 1ACJA 3IAXA 3UB3A 5EWLB 3GAAA 3HXOA 1NNEA 5DBEX 2OXEA 2AR7A 3AR7A 3JQ9A 2AN3A 3ROXA 1VI6A 2GI4A 3FTDA 1FNBA 2O6LA 3EY4A 3FR8A 5J5CA 3INYA 1C8VB 4G1VA 3AHEA 5DSTA 5REQA 4MRAA 2FP4B 2Z57A 13PKA 3AHJA 5F9MA 3QX7A 2NV0A 2RE8A 5HR5A 2V97A 3GA0A 5TGTA 3RROA 3K1JA 3CEJA 2X22A 3PCXA 1JNXX 1W88A 3LZDA 3HKBB 2AN5A 3I62A 1D09A 4GR5A 1J00A 1PQ4A 3M4ZA 4HV4A 2PZKA 2XVXA 4OX9B 3FKSD 1BHQ1 2AZDA 4I5GA 3UATA 2P68A 1MP0A 1M8KA 1U2ZA 2BE7A 3B7PA 1M33A 3PFCA 1D7AA 4QOGA 4X3OA 2QW1A 5SICE 1ZK2A 5MDHA 1P2TA 2IQ5A 4X63A 2R68A 4A2CA 2A9PA 4HDRB 1C3LA 4D9JA 3IJ5A 4DDUA 2QIOA 4EEXA 3UIEA 3KZVA 3M5CA 1CW2B 1AZLA 4CMGA 2B8TA 6ADHA 5JCPA 4RPGA 1K5HA 5ALNA 2VS1A 1UQTA 3TIFA 3HCWA 1ZM7A 2OLEA 5A0TA 2NMVA 4X1OA 4S1VA 4YRRA 1XZQA 1TEHA 2P9HA 3K8OE 4HSEA 2YWFA 3REQA 4C21A 5ENVA 1EM8A 2JIPA 3KPUA 1GSOA 5KVSA 5KYVA 4JKOA 2C3UA 3A6JA 3LSYA 4FYJA 4L8WB 2NTNA 4J2TA 4NCKA 5HIIA 1Z0SA 4CLOB 5J2UA 4YQYA 1WXDA 2DUWA 4EARA 3HFSA 4KHPB 4PBRA 2F62A 3RARA 5ALMA 3AM1A 1H2WA 5AJWA 4EKEA 3NTQA 4G23A 4MRNA 3WHKA 2XOXA 2YXNA 3GBVA 3PITA 1YRAA 5I7SA 2D5AA 4B6FA 4OJTA 2QG4A 4GVLA 5A03A 5BSKA 2EFDB 3O95A 5DX8A 1Y9ZA 4L5JA 3TLEA 1U0SY 2A1IA 3ZWDA 4UM9B 5HQ3A 3AKZA 1MRSA 1R1DA 2WV9A 3M6VA 4NFYA 3QU4A 4RVFA 5LQJA 4YDRA 3QVMA 3WLOA 1IZ9A 4TSRA 4Z9YA 4QYIB 4DR7B 4FYMA 3RVQA 3Q98A 3A4NA 4YMVA 2W42A 1R37A 3QGMA 2GNOA 4J0IA 1FS5A 2RG1A 3ZC3A 2YMLA 3WNDA 2B4KA 3QK7A 2CYBA 3JZMA 4XW2A 4C6HA 3DE2X 5CNKA 4AN4A 2JIBA 2X7XA 1ZCBA 3CYFA 3LBHA 3KDPA 3FUWA 4N9WA 1MC1A 5J1SB 2XT0A 4JUDX 4EYQA 1NWHA 1E96A 2NUTB 3IPYA 2ZYAA 1LXCA 2DOKA 1QORA 3QE3A 5K8VA 4Y30A 4MLDA 3INGA 2E9SA 2L0XA 4YBZA 3QLUC 4LWOA 4OGKA 3GFRA 4JOSA 1J49A 3VZBA 3B78A 2C2MA 1HEIA 3INRA 3FIJA 5KWIA 3PGMA 4M1YA 3L6OO 4FN5A 1GA1A 1ABEA 2X6TA 2Z95A 3B1ZA 1TTTA 2HTFA 1OAOC 4GICA 1ULUA 4N9QA 1UODA 3B3QA 3OE1A 4TXHA 2VAVA 1WR8A 2IY7A 2N47A 3A06A 3QHPA 3F4BA 1Q1BA 3WO1A 3T5DA 4HDQB 1GLGA 5H4GA 5LIPA 2PKXA 3LGSA 3NBKA 4PNZA 1FYEA 1GSHA 4L73A 4A03A 1S1MA 3KQNA 1DAPA 1WY5A 3ZJVA 2C9OA 2NP7A 2VAPA 2IGBA 4COKA 3DAOA 3EX7C 3F74A 1OA0A 2GPTA 4M76B 4IIVA 3T8YA 4ATNA 1ISRA 4MIYA 3GEDA 1EFPA 2L19A 3Q2IA 4N76A 4DA9A 4MQEA 1RLIA 1LWOA 1RSZA 4MV9A 5JDIC 3PPIA 1M7HA 3R76A 3HUUA 5FADA 5AVVA 1AQYA 1ZESA 3ZI0A 2FRVA 4IDGA 3LMKA 4MO2A 3LI2A 1X39A 4TRJA 2BEUA 4B8WA 5JPDA 1H3FA 3WGMA 1E2IA 1R10A 3QPDA 3LX6A 5FB3A 4KR2A 4ARCA 3CH6A 2ARKA 2CLFB 1P4GA 2I62A 3IIMA 1OYVA 1R74A 4ODIA 4LYHA 2OWEA 3E15A 3L0SA 4GZ3A 3VX4A 4TV8F 4W7HA 3VZRA 1D1QA 4DUGA 2IX3A 1LTQA 3PVZA 1ZCJA 1PR4A 1OI4A 1XTSA 2ODAA 2V96A 3CX4A 3E4DA 1QLWA 3F6SA 3LV8A 5IEBA 1VLHA 4BMZA 4DJTA 4MTLA 1J0DA 1IOWA 1OBVA 4U6QA 4DCGA 3SVLA 1M7GA 1SVIA 2PMWB 4JL8A 4PTZA 1XEFA 3K1AB 3OHPA 2OCLA 4JLAA 4QJIA 5CDYA 3DBIA 3K0CC 1UXKA 4ZCQA 3UK2A 1AD2A 4B71A 5CFOA 1EESA 3QLJA 2WQ7A 4NCJA 5KNBD 1GUZA 5JEEA 2CLDX 3B53X 5IXJA 1CB0A 4XX1A 3TPFA 3T3EA 4PYNA 1QYVA 3KXDA 1UKBA 4JHXA 1QAMA 1YE3A 1PS0A 1Y7TA 4G6ZA 4I19A 2V7VA 4OEHA 3S8MA 4BFTA 4ZJUA 4YCNA 3EPPA 1C80A 4BO7A 1ZI8A 1R0YA 3DDCA 1USVA 1QUEA 4BRUA 2Z30A 5EINA 4KOEC 4YMSA 3WWZA 5I7OA 1XZBA 4B84A 1DADA 1I1HA 3EUFA 5IULC 3PFKA 3QTBA 5KNDA 3I9LA 2W6ZA 3I4FA 5E7QA 3V4VB 1K9SA 1P2VA 1H9BA 4OHMA 3VNUA 4H7IA 4WCFA 1DFIA 1KJIA 1L4NA 2QMZA 1QG6A 2ZIWB 3CZCA 1SU4A 4PYLA 3G9ZA 2BGGA 1KZGB 1JZSA 3PHLA 2HHLA 3WGVA 3U3OA 2QXTA 3IA2A 2Y1XA 3QVLA 5JQGA 5SYMA 2ZB7A 4Z4IA 3PIRA 3RYTC 5LQKA 2OQ2A 2EWVA 3TCXB 5KX5B 1R5BA 3HG7A 3K1ZA 3H5NA 1DJQA 2CV0A 2EX0A 2X5OA 4CLEA 4CDRA 1NT4A 4B9AA 4F4IA 3Q9NA 8MHTA 2PKQP 1ISPA 5GJVC 5BV2P 3D6NB 4FCWA 3E2MA 1QK5A 4DDHA 2AA3A 2NU6A 2BDEA 2D0PB 1O0BA 1M73E 3B51X 1GL7A 5GP1A 4BEJA 4DMRA 1ADYA 2W11A 1S1CA 3E9CA 1NE7A 1RIIA 2XNDA 8GPBA 2VWPA 3GJ4A 1G2QA 3F8TA 4E88A 4ZHSA 5A4FS 1OYOA 1Z47A 3VPBA 5K6AA 3DWIA 2AQ8A 4G56A 1V4NA 4M99A 4AWBA 4DTCA 2F43A 3ZV3A 5HKKD 4YAGA 3DP9A 2H7XA 3L9XA 3A1SA 4QU9A 2YNMC 3CLTD 3NIGB 4X54A 3AVTA 2BRUC 3TOCA 2UYQA 1ZMOA 2JHFA 3DP7A 2HTEA 1TLTA 2VP5A 5F76A 2R2GA 2RB5A 5HF9A 4Y9UA 5EZ5A 3TB4A 1E1MA 1Z28A 1RKUA 1FDIA 3GLQA 2IZ5A 3UHJA 4ARZB 4D26A 1IU9A 3DVAA 2GPBA 2HAEA 5A3SA 3SJZA 1AKEA 2ZJ7A 3OKPA 2G06A 1MJNA 4A8HA 1ZCFA 4RM3A 5JCZA 2OESA 2C95A 2YIVX 2V7BA 1ZIYA 3CKYA 4GX0A 4IXWA 4NPCA 3WMRA 4YCDA 1TU3A 4QXOA 3FOAA 5AESA 1PT6A 4QUDA 3DHNA 3D6HA 5ILGA 1DU4A 3RI3A 4KE8A 1W25A 4CCWA 2ZTVA 5CCEA 1SUFA 4X6LA 2IELA 5ESDA 4OFZA 1N1MA 2XBUA 1KKLA 4Z9BA 4EHJA 6GPBA 4HNUA 3GVPA 4Z2AA 1W96A 4TUYF 2IU0A 4GOMD 3W6OA 2X0JA 4EATA 4KYUA 2GAOA 4TWIA 2JJ1A 1Y6GA 1QRTA 1YQEA 1K86A 1KBZA 1OZAA 3H6HA 2FZKA 3DO6A 3H9GA 4R1NA 1C7IA 3F6YA 2I2WA 2CF6A 2XEXA 4IEFB 3RYHB 3O8QA 1Y4ZA 5LR6A 3KYCB 3L7OA 3SHTA 5JNWA 4G81A 5FBVB 2Y68A 2IEBA 4YT8A 3R0QA 1U4SA 1ZONA 1JQBA 3HDVA 5E6UB 4EF4A 4EJMA 1KFCB 2BFWA 1AQJA 2RAVA 3KE9A 3DH0A 4BNMA 1B73A 3U3RA 5IPFA 4OJKA 1RRVA 4MI9A 3PDJA 3WRXA 5KYYA 3LQ2A 1I32A 3O03A 1IJFA 2YHUA 1Q0UA 5LUBA 5I4CA 2AXNA 3OX2A 4TZ0A 1VYVA 4FHFA 4RAQA 3GU3A 2WIDA 2GN0A 1WY7A 1IIRA 1D2GA 1TZMA 3NUGA 3OT4A 1M9NA 2QKYA 3BXEA 4PHTA 3DLPX 4B2IA 5ERYA 3E48A 4GPZA 4UTNA 5KOIA 4P93A 3SD7A 5IJ9A 3BUSA 3LOQA 5F4ZA 5A6SA 4NI5A 3PICA 2QNRA 1C2YA 5AKYA 4YC7A 3NQ41 2EP5A 3E58A 3RVNA 5L3SB 4B6OA 1FFBA 1W75A 2OCDA 1F1JA 5B1DA 1NJFA 1GAXA 2CHFA 3TTSA 3LXXA 2ZIEA 3RC1A 1E4VA 2IEAA 2BL4A 2R8EA 2X8JB 3EEYA 1EWRA 2IA5A 3OE7D 2F17A 3QU5A 4L0CA 4M1SA 1DV1A 2H2HA 4MW1A 4ZCTA 1CX9B 4RDXA 4DV3B 2ZZNA 2O8CA 1ISHA 3KUUA 2FQYA 2VHCA 4OQNA 4E21A 4ENRA 4DXDA 2X42A 4LYYA 4OI2A 5JROA 5JNTA 3IBCA 1GKLA 1SVUA 2HWYA 1FNCA 3ZUPA 4C7JA 2FSIA 3H65A 4EY5A 5IEJA 1RVV1 3QVXA 3ZE8A 2C00A 4G0PA 4OHBA 1IHOA 1DIOB 4CKBA 3ORSA 2BTOA 2PJZA 5G4KB 3D8NA 2AN4A 2R6CA 3W6NA 2OYRA 5IX8A 2IBTA 3GZNB 3WL6A 1WMDA 2BOVA 2CFRA 4WKPA 3EEOA 4Q3EA 4WKNA 3UOAB 3LPLA 3VR2D 2VHVA 4ND1A 1VIDA 4BFVA 4GXQA 1NOJA 2C9MA 2EP8A 3H9EO 4ZI5A 3S1AA 3TOZA 3OETA 1QTQA 2EVWX 5D8DA 1NVXQ 1GGNA 1CUVA 4IHQA 4JEIA 5CFQA 2F1OA 1UKAA 1WHTA 3AR8A 4I6GA 4QLAA 3ZK7A 3CKLA 2HHHB 1E2BA 3CZMA 4F93B 1JQJC 1ORDA 2Q1TA 5BW6B 1KI9A 1GTG1 3ONEA 1MDBA 2VQSA 4BO9A 3OZBA 4X90A 2EZTA 2QX9A 5WRFA 4CMHA 1TD9A 2WTUA 4I55B 4PFQA 3LYLA 3OTGA 3PE4A 3U5TA 1T1IA 3NT4A 4ZQIA 5IKOA 3NTUA 3M1LA 1TUIA 3QMPA 1ZDMA 4L9SA 1GGKA 2XR1A 4R9UC 3ZVLA 2FR8C 1Z34A 2B8NA 2W9XA 3SX0A 3PJRA 4YP0A 4NRDA 4PXSA 1KOFA 4DCUA 1UBJS 1E7RA 5AK0A 2XGGA 4BVFA 5JMWA 2AOTA 3VDRA 5JJIA 3NHYA 1DPGA 1Y1LA 3BWDD 4G41A 4LX8A 2WWRA 1I24A 4QFMA 4HN2A 2QYTA 2H54A 4L3WA 3RSSA 2W2KA 1BE0A 3OO0A 2WAXA 3ZDFA 2O3TA 3VH4A 2N1BA 1LC3A 2YYYA 1YZ3A 5CXSA 4YRIA 4TWAA 3ZZMA 1AN9A 3ZQKA 2ISQA 3VAZA 4JJEA 2PGDA 4F6RB 1R0SA 2YWGA 1GL3A 2R751 2ZTSA 1YK1A 4J6FA 3U6KA 1I7QB 4FOOA 1DKPA 2G7MC 3FSGA 1H2HA 3O8LA 3WFJA 1C29B 1QAOA 3TAXA 3NDRA 2PLNA 3H1TA 4U0KA 5T57A 2LE0A 3IJPA 1NPYA 4IMJB 3A1TA 4B3JA 4YRSA 2H5LA 1EUZA 1ACMA 5BN4A 4MHOA 1B8PA 4GF5A 2YJTD 2VIIA 4Q12A 4F4UA 1R8QA 3LUKA 4AY6A 1NN1A 3FMGA 3QKWA 3QUCA 3MAGA 4X66B 5LZ4A 5IC4A 2F3UA 2EFCB 4FUQA 5HJ2A 2HCRA 4BNKA 3HB0A 5ANRB 2M6KA 3ELDA 8OHMA 1HK7A 1MMFB 1XZFA 1K89A 2JJYA 4HDKA 4FSDA 4DF3A 3UH1A 5B6PA 1SXGA 4E03A 2ZWOA 1UBKS 8ATCA 4FFRA 5J4HA 1VLMA 1LQUA 2BI4A 1TF2A 2HJWA 1HE8B 4OU5A 4TXNA 2IYTA 3AEQA 4IFBA 5EP2A 3KR0A 3BRCA 4ZC8A 8ABPA 5L53A 3IR7A 2OP0A 2XXJA 4BMDA 2VO1A 4NR0A 5TF0A 1TKAA 3DGEC 3ZEAA 3QLTA 3QH4A 5JO0A 4OXQA 3AHFA 3D4PA 4R1UA 5TS3A 1ZAKA 2PX4A 1GNPA 5KC8A 2XMZA 4PO3X 4UD6A 3W5IA 5EQJB 1W73A 1FDTA 2WDPA 1MOZA 4E94A 1TB4A 3KALA 2WTXA 2BGKA 3VJLA 3T7JA 3VKVA 1DE0A 5AUNB 1XEXB 2C4MA 4DR6B 3DZKA 3O3CA 1Z82A 2NPOA 3Q0EA 3NIDB 3E70C 4TLDA 2EU8A 2D7JA 2FZGA 1YQQA 3A27A 4M53A 1GZVA 4N5IX 5KC9A 4ID9A 3TJMA 4EO4A 1DAIA 3W6PA 3ZQUA 3K8YA 1N7IA 2NYVA 2QZJA 2UUOA 2JI9A 3NHWA 2OENG 3BGWA 1H4SA 1IVNA 1CY2A 2ZKLA 4ASUA 1L7NA 1UEJA 3QE0A 3VPSA 2X2FA 4I8DA 5KMGA 4BO4A 1VZ2A 2R1UA 3LT5A 2P2LA 3TW8A 4A36A 2QRQA 4DRXA 1RAHA 5EP4A 3RU2A 3PHCA 3WA7A 4X1KA 9ABPA 4NZNA 1B6SA 3SIPA 2OQVA 1V8OA 5FUVA 2WPDA 4RVGA 3VXKA 4H17A 3TLXA 1Q77A 3PT9A 4ISCA 3NC1C 1C0IA 1J33A 1DFHA 2W6MA 3FSRA 1M66A 3IKTA 4Y2QA 4D3ZA 5F5NA 1Y8QB 2PH1A 4TTJA 2BKUA 4G4SP 3AB7A 4Q39A 2AOXA 5CLHA 1E18A 1M34A 5JQGF 2FDCA 3VKHA 1W0KD 3RSHA 2EZUA 4LGYA 3AO0B 2QDXA 3AL3A 3L2OB 3QFRA 3GEHA 4F4DA 4ZT3A 1QOZA 3ZUGA 2V7QA 3NATA 3HJRA 4B87A 3QKTA 4EECA 5AHOA 5E4JA 3S2YA 5ITZA 1NWCA 3O1IC 1WU7A 7AT1A 1SHLA 1I2MA 4HLUC 1VXOA 2QD5A 4I7EA 1J39A 2JGEA 3VI3B 4BZXA 1STOA 3EVDA 1G8MA 4L2IA 1VM6A 1TM1E 4PV7A 2ZBUA 3WVNA 4L85A 2E82A 1P91A 3F5FA 4MGKR 1F7UA 3RQIA 4YVFA 3BWYA 3I6IA 4MGZR 2G25A 1LV8A 2B1RA 1QH8B 2OBBA 2YMQA 3OZ7A 1L9KA 4YP7A 2RFLA 3PSAA 3ENNA 3I01M 5BVGA 3R44A 2R48A 2YV4A 1QDLB 2ZRHA 3TECE 5B7PA 1FSFA 4KVAA 1F2TB 4CKCB 3HVUA 3RODA 1ONSA 3FYCA 3V3KA 4B7ZA 2C8LA 1GNRA 4RVOA 2DR2A 3L1IA 5F7ZA 1TZJA 5EIOA 5JFGA 2CMGA 2Y77A 4RS4A 4ZZ1A 1FLAA 1BA3A 3ORRA 3SXJA 3KNZA 2YC2C 3QLUA 4ALNA 1B42A 3I30X 2H1FA 2PLFA 3G2LA 2GBLC 3LLCA 4RTRA 3PRKE 4RTPA 5BRNA 4YREA 1SQGA 2J0VA 2I8AA 3BGIA 2Q3CA 2Z98A 4R9VA 2XMDA 4FE4A 1Y6FA 2VTKA 4PVCA 2FW8A 1H2YA 1E7YA 1SOMA 1N2JA 4HYQA 3A0UA 2ANBA 2QN1A 1PR0A 1SM4A 1OAOA 5ALKA 2X76A 4MPDA 2GD2A 3T7SA 1TCAA 3BGSA 4X6XA 5HF8A 3KZMA 3OM1A 2P6RA 2FEOA 4LXTA 2IY9A 5CMLA 3R6DA 3G8BA 1THTA 2AZ4A 2I8LA 3GLFB 3F9CA 3UK1A 4LTDA 3VHRA 4HT3B 2BSAA 2QRMA 3DKPA 3R5FA 1YL6A 5L9AA 4IIUA 2UZ1B 2BFDB 3TCKA 4IQGA 2OAQ1 4ZCPA 5LBIA 2FW6A 3MGGA 1UBNA 3ZK9A 2YXLA 5CTAA 3FCAA 5DX0A 1KVQA 1PJBA 1QV9A 4AURA 1BXGB 2FKAA 3WKCA 3JVUA 1Z8FA 2ZTUA 4X41A 2GK4A 2QTBA 3ANLA 4O2RA 1SA0A 1JEAA 3DF7A 4LZOA 3EB9A 3K8QA 3UWSA 3WBFA 4Q03A 1I5RA 2QRHA 1VIAA 2QENA 3HUTA 3KOZA 5E6SA 2SECE 2F90A 2IYXA 3H2JA 3OFSA 3OZFA 1QGZA 1S2OA 4KH0A 5AHRA 3T1QA