4L9AA

Crystal structure of smu.1393c from cariogenic pathogen streptococcus mutans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
ALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLPDSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVHSIGGFAALQIMNQSSKACLGFIGLEPTTVMIYRAGFSSDLYPQLALRRQKLKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRQLNDVQSLPDFKIRLALGEEDFKTGISEKIPSIVFSESFREKEYLESEYLNKHTQTKLILCGQHHYLHWSETNSILEKVEQLLSNHEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein Smu.1393c
publication title Structural and functional characterization of a novel alpha / beta hydrolase from cariogenic pathogen Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
total genus 98
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l9aA00
2OGSA 4CI9A 5ISMA 5ALXA 1R88A 1UK8A 3BE8A 4WFJA 1W6RA 4DNOA 1CUGA 1UOQA 1B6GA 2PVSA 1VZ3A 3Q0TA 5DTIA 1U4NA 4EHBA 1LPSA 2ES4A 1J2EA 3PDCA 4J7AA 4U2BA 1G5FA 2DHEA 2C0PA 5C8ZA 5AP9A 1SOMA 5FRDA 5ALUA 3F9CA 3FVRA 4L0CA 1G42A 3RLIA 3HI4A 1UFOA 3O4GA 2XDWA 4W1RA 3WJ1A 5HFAA 2DCMA 1VXOA 1WOMA 4Y2QA 2G4LA 5C7YA 4BVKA 2BJHA 3FLBA 2DR0A 1AKNA 2IITA 2OGZA 4CIBA 1P0PA 4DGQA 4Q05A 3VXKA 1EB8A 1MNAA 3WYNA 1ZI9A 2WJ3A 4ZGBA 4LXHA 1XZAA 4W1QA 5EIAA 3GROA 1QONA 3HYSA 5CMLA 5F4ZA 5ALJA 4M0EA 2AJBA 4E15A 1NX9A 2QZPA 5E4JA 3RM3A 4C87A 5CBKA 2XUPA 4KE8A 2Y6VA 2EDCA 3EIOA 2V9ZA 4KEAA 3QMMA 3EQ7A 1QIHA 4J0GA 1IUOA 1QFMA 4GEGA 1QZ3A 4MWTA 1DWQA 4OU4A 2WKWA 5FUMA 2XMQA 2UZ0A 2PBLA 3C6ZA 1ODCA 4CG1A 2WJ4A 4LXGA 4N5HX 3WL8A 4N8DA 5HF6A 2DSNA 3I6YA 1XRRA 5ALRA 3C6XA 3DOHA 5SYNA 2VJCA 5HFNA 1E3QA 4U2FA 4ZV7A 1XQXA 2J4FA 1LNSA 1LZKA 4G8DA 1MT3A 1ZIYA 5AHXA 1ZD2P 3WZMA 5LLSA 5CXUA 4LYEA 4H77A 2ZJFA 3GFFA 3RK4A 3WIBA 5DYYA 1CVLA 4F21A 4WJLA 3BDIA 3PI6A 4PO3X 2FJPA 1CV2A 5CH3A 1QIFA 5ALNA 1CUDA 5FPPA 2D0DA 4UBJA 3R3VA 1TCBA 1YS1X 3M81A 4X85A 4K6KA 5K3FA 1DINA 1LPMA 2QJWA 4TPKA 1GXSA 5BV7A 4GWLA 5CT5A 4PNZA 2X5XA 2OXEA 2QMQA 3IURA 2PSEA 4P92A 4K6HA 3IUNA 3FNBA 5EI5A 4DLNA 1IMJA 3AZPA 1VE6A 2JGKA 2QM0A 5LYYA 1BN7A 1CPYA 4UHEA 4KE7A 3LS2A 3STWA 3SK0A 4KRXA 3A6ZA 4BVLA 1LPBB 4DYHA 5I9IA 4BP9A 1WM1A 3N2ZB 1IUPA 3D2CA 4MEBA 5HQ3A 2R8BA 2WU3A 3H2IA 1E8MA 2OPHA 2V98A 4IH1A 1HPLA 3DOIA 4UFPA 4Y2XA 4N8SA 2BUBA 2OG1A 5A71A 1C4XA 3WK8A 4MXDA 3DKRA 3B5EA 3DQZA 4X6XA 4Y2UA 4C6HA 5FOQA 2WFMA 5DYWA 1EVQA 1WHTA 3E3AA 4B80A 1LBSA 1QO7A 4OB8A 3IVMA 4JH0A 5FXMA 5DNVA 4WCVA 1HLGA 1JKMA 5I7UA 2OCLA 1UK7A 1ZD4A 4HVTA 1CR6A 1MX1A 1MAHA 2DHCA 4UFOA 4B85A 3RKSA 5AKGA 3WL7A 4K2AA 2ONCA 3FCYA 2XQJA 2Z5GA 2HIHA 5JYCA 3IUJA 5AKKA 4H7HA 3O4HA 2G63A 1EHYA 1MTZA 5AKEA 3PF8A 2I78A 4Q3OA 3R41A 4QDXA 3C45A 5AI5A 1R3DA 3FCXA 1VKHA 5FKJA 1Q84A 4C4YA 1FFBA 1XKLA 4C4ZA 3FWHA 2RAUA 3C87A 5LIPA 2CZQA 1VA4A 3PFCA 2GZSA 5HF8A 2H9YA 3STYA 4ZRDA 1FFAA 4X92A 5AKJA 4TVKA 1XZLA 2DQZA 4M0MA 4WY5A 3PFBA 4YPVA 1WB5A 3WA7A 3MVEA 3K9BA 5A7FA 5LP1A 3O9MA 5AM3A 4H7DA 1UT6A 3OPMA 4U2GA 3AIKA 3O95A 3L1HA 4GECA 4QDOA 4K5QA 5JZBA 5CH8A 3QMVA 1HL7A 5EIHA 3H19A 2WSLA 4FNGA 3ICVA 3WK9A 4V2IA 4A23A 4X95A 1W75A 1O6GA 2HU8A 2WU4A 3R3WA 1W76A 2HFJA 3KD2A 1NU6A 3STTA 3I2KA 3ICWA 4FBMA 4FKBA 3V1MA 3EF3A 1LPAB 5EHXA 4H7EA 5KWIA 1U2EA 2HL6A 3W04A 5A62A 2WLSA 3W9UA 4H35A 1DU4A 5I8PA 3LCRA 1ORVA 2V97A 2WIFA 1IVYA 5ESRA 4WDQA 1USWA 4XVCA 1GT6A 1UK9A 3OTQA 1A7UA 4B81A 3P2MA 3WK7A 1JJFA 3I28A 2WM2A 1QTIA 4JYMA 3PF9A 5AI6A 4F60A 1KEZA 2HRRA 4X3CA 3AUKA 5ALFA 1CUVA 5JD6A 2HA7A 3QPCA 4Y9SA 3HXKA 2HHAA 3ZPXA 1MO2A 4J0IA 4G4JA 3I6ZA 4H7FA 3D3NA 1FSSA 2ORYA 4AO7A 3LIPA 4QEKA 4KAJA 1WB6A 3AINA 1EINA 1J1IA 3WQHA 3ILSA 1CQWA 3G0BA 5AKLA 3I2JA 4AZ0A 1QIMA 2LIPA 1LZLA 4LHEA 4W63A 2AXEA 2Y6UA 4DMFA 3NWOA 4HRXA 4BZZA 2BAGA 2JEZA 5AM1A 2P8SA 4NMWA 1H2ZA 1AC5A 4AXBA 5EHZA 4ZI5A 1CIJA 1EDDA 3GELA 3V9AA 1CUJA 3A2MA 3H2KA 5AK3A 3WL6A 1S8OA 3QZUA 4BVJA 4KJXA 4X6YA 3OM8A 5ALHA 3D5EA 3LLCA 3R3YA 5AI8A 5ALYA 3DCNA 5JD4A 1A8SA 5AIBA 2QXUA 4FLEA 3C6BA 4UHFA 3UMJA 5JALA 3DYVA 3V48A 5BWBA 1SCQA 5JANA 4YK7A 4Y2YA 4F5ZA 4BYMA 1GPNA 1VLQA 1ODTC 1ZJ4A 4UHCA 2GBGA 3B3QA 1ACJA 5EHQA 3VJKA 5K3FB 3HSSA 3TJMA 1JFRA 4LIPD 5BWCA 3GZJA 1AURA 2JGMA 2XQFA 1Y37A 1CUIA 3STUA 1YA4A 3WKAA 1QIJA 3S2ZA 2QOEA 3HJUA 4NS4A 5AOCA 3D4LA 2E3JA 1TAHA 4BRSA 3H2GA 3BWXA 4CCYA 1OXMA 1XQWA 3D59A 3DJYA 1QIEA 4X93A 5AJHA 3BXPA 5IH7A 2YASA 5K3CA 1IZ7A 2OCIA 1Y7HA 1BN6A 4B83A 5ALZA 4GDMA 1XZDA 1CEXA 2JF0A 1R4ZA 3HLKA 1CUBA 4DNFA 5HQ3B 1L7RA 2JGFA 1PV1A 2PSDA 3JWEA 4EZIA 1YSCA 2WIKA 5K3BA 1O6FA 4Q3LA 4FWBA 5HZGA 5JD5A 1UKAA 1R9MA 1XRMA 2C0QA 4UBMA 1DT3A 2PKYX 3KSRA 4WFIA 3FAKA 4B82A 4W1SA 4G8CA 2BKLA 1YAJA 2CKMA 4KR0A 3D2BA 3IUQA 4HS9A 2WIJA 2WQZA 2WFLA 3UUEA 4C89A 5HKBA 4W1PA 3W2TA 4FDMA 3HACA 3FLAA 1UZAA 5LZ8A 4LKOA 1Q0RA 1VXRA 4EUSA 1EB9A 1LPNA 5HK8A 3NUZA 3I1YA 3IUMA 2O2GA 4ITVA 4G9GA 1ISPA 2C5FA 4G4IA 2WG2A 5JARA 4CG3A 4HZGA 1E89A 4U2EA 3W06A 4JEIA 1G66A 4RGYA 2PUHA 4DNQA 4FLMA 3EQ9A 3FBWA 2QKYA 3I2HA 3O4IA 2CMFA 5EHNA 3CCCA 3U1TA 1H2XA 3QMWA 5D3KA 4B9EA 5DJ5A 1H22A 4L9AA 4B7ZA 3OG9A 3EQ8A 5AKIA 1WB4A 4OYLA 3QH4A 5HF9A 4FNMA 5T4BA 5AM5A 3STVA 1GPKA 3H2HA 5SYMA 3VJMA 5K5EA 3VKFA 4BZWA 1TCCA 3HABA 2WHQA 4HTAA 5ALPA 3WWPA 2JGJA 5JAOA 2AJLI 4PV7A 4XJVA 2ZJ7A 1YCDA 1H2YA 3I2IA 2B20A 4A16A 2G5PA 2J3DA 2BGNA 2WIGA 2RIPA 4BDTA 4INZA 4DMCA 4HXEB 4H18A 4BP8A 4UBLA 2Z8ZA 3TRDA 1LPPA 3G0CA 2VSQA 4AQDA 2O2IA 4BTVA 2H1IA 4BRZA 1F8UA 4WFKA 2B9VA 1UOPA 1N1MA 2K2QB 3L1JA 1CUHA 1WPXA 2XUDA 1Z68A 5AOBA 2GBFA 4FLFA 1YAHA 5K3EA 3H17A 3ZLTA 1E66A 1W4LA 5AICA 1L7QA 2CEKA 1K63A 1E5TA 2XUQA 1RYYA 4IO0A 4ARAA 4P08A 5IVHA 4ARBA 1Q83A 3C5VA 4BDSA 3H2JA 3PE6A 2VJDA 2Q0XA 4Z49A 5JIBA 4PSDA 3WI7A 4PSUA 4X90A 1E8NA 3HZOA 3GBSA 5DNWA 4BCDA 1HQDA 3WK4A 4P93A 5HK9A 2HA6A 2IIVA 3ZI7A 5A7GA 1XKTA 2ZYHA 3O0DA 5E4TA 1BE0A 1DTEA 4ZREA 2JIDA 3JYHA 3G9TA 3ZV7A 2AJCA 4QDZA 4B9AA 5HF5A 2WG0A 1RWQA 2ZJ6A 1UK6A 4AX4A 2JBWA 5A2GA 5ALQA 3OC0A 1TKRA 1CFJA 3WZLA 2WHRA 4FFWA 1CUFA 2Y2UA 1HDEA 3GUUA 2JGIA 5FV4A 5AM0A 5HCUA 4CCWA 5AM4A 4Y2RA 2OCGA 3CN7A 2XUGA 3BJMA 4Y2JA 2EDAA 2XMCA 3WYDA 1X2EA 2XMDA 3FYUA 3KWFA 2OAEA 4H7JA 1SFRA 1F0NA 1MX5A 1AMNA 2B4KA 5JAPA 1VJ5A 3FVTA 4E46A 5CURA 4X94A 1VZ2A 1EA5A 5ALDA 1ZI8A 4AN1A 4UBNA 1XZMA 5AM2A 5K3DA 2B61A 1QIIA 5ALSA 4JYPA 1AZWA 3BJRA 5AOAA 2ACKA 2O7VA 2ZYSA 5ALGA 5AI4A 4AN0A 4EY6A 1AUOA 2CJPA 1IUNA 3WJ2A 1PFQA 2W22A 1M33A 1ZOIA 5FLKA 3R3XA 3FYTA 2RGUA 3R3UA 1P0MA 1MPXA 1GQRA 5LZ4A 3KXPA 1J07A 2VQ6A 2OQVA 3WIOA 4AMYA 1JT2A 5CXXA 1A88A 1QGED 2BGRA 4J0KA 4GI1A 1QJ4A 5JAHA 4OB6A 1AQLA 2BCEA 1EH5A 1ZJ5A 4CCYB 1CUSA 3ZLVA 3WA6A 2HRQA 4HXGA 4X71A 4ETWA 3JW8A 1X2BA 1OCEA 2XUKA 3AIOA 5D7BA 4FOLA 3W9BA 1A8UA 4MQMA 4Y7DA 2JGLA 2V96A 5JASA 4KRYA 2BUAA 4DNPA 5IVDA 1C7IA 1CUWA 2Z3ZA 3G9XA 2PM8A 4H0CA 4CIAA 1RP1A 1DQZA 4Q3KA 4QWMA 1YB7A 1QFSA 4DSAA 4EB0A 3VDXA 2XMRA 2OQIA 1XZGA 1BCSA 4O08A 3WKDA 2WTMA 3U0VA 1YS2X 3MUOA 4QA9A 1XLUA 1LLFA 3I6MA 2XT0A 3DD5A 4Q82A 3UUFA 5EGNA 2I3DA 2OAGA 4FTWA 2WFLB 1DX6A 3G7NA 1K6EA 2XMBA 4MYSA 1YASA 3D0KA 3HEAA 4OD0A 1ZICA 2RHWA 5CH5A 5ALEA 1QIGA 4Q34A 4UBIA 1MN6A 3E0XA 3WLAA 3O9VA 2OLEA 2CBGA 5AH0A 4DSZA 2WG1A 1QLWA 1TIBA 1XRNA 3DNMA 3HC7A 1FFEA 1XZCA 2XMZA 2G5TA 3G9UA 2J4CA 1CUYA 2ZYRA 1XZBA 3DYIA 5AK5A 3WWOA 1XZHA 2OGTA 4RE6A 4X91A 2WFZA 1D07A 1XLWA 5DLPA 4NZZA 3F96A 3KWJA 3AFIA 1XZIA 2WIDA 4IH9A 4W9RA 1XZJA 2QT9A 1EX9A 1ZGBA 3G0IA 4C88A 4U2CA 1MX9A 2WUGA 1XRQA 1XFDA 4TGLA 5YASA 1BS9A 4BAZA 1ZIXA 1AGYA 1TCAA 3SC2A 1DWPA 1ZD3A 5T4FA 2H7CA 4OSEA 3VVMA 5ALWA 1W1IA 5C81A 1H2WA 3NGMA 3KOOA 4FBLA 5K3AA 1LGYA 3ESBA 4ROTA 3WKBA 3BIXA 1AX9A 2JGEA 2C58A 1BU8A 5KWJA 1BRTA 5A7HA 3V1NA 1DQYA 5LZ2A 4I3FA 1EXWA 5FP0A 4I19A 3QITA 1XZKA 2VAVA 4PW0A 3AZQA 1CUAA 2O7RA 1A8QA 5D3ZA 2FUKA 1N8SA 1EDEA 3G02A 4X97A 2HM7A 2GBIA 1DWOA 1R50A 3A70A 5E2IA 1QIDA 3GA7A 5JAUA 1CQZA 5C8VA 3DL4A 4GXNA 2C7BA 4EY7A 1FJ2A 1UXOA 3R0VA 4LYDA 2FJ0A 2PSJA 4C4XA 3IA2A 4GW3A 4X6UA 4BATA 3C43A 1L7AA 2ZVDA 4ZWNA 2VJBA 2ACEA 4J0HA 4BAGA 1EI9A 3C70A 2WTNA 3E1GA 2DQYA 5DWDA 4H7KA 2H7YA 4EA6A 4KAFA 2HU5A 3WWEA 1K8QA 5KREA 4QDTA 1CRLA 1JU4A 3I1IA 4BBZA 2HFKA 2BFNA 5DTJA 1U65A 1R1DA 4BAUA 2PUJA 4MWSA 2VT7A 3H0CA 5AI0A 3F67A 4KAAA 3IULA 5JZ9A 3IIIA 3VVLA 1CUZA 4QZVA 1SC9A 3O4JA 1U8EA 3TEJA 3FYUB 2IX9A 3M83A 4QE3A 3AIMA 1Y7IA 3B12A 1J06A 2VATA 2DFPA 2WUDA 2VTVA 1CUXA 1PJAA 5JADA 3ANSA 4MQLA 4CFSA 2C5GA 2C4HA 3WKCA 1QO9A 2VJAA 3HRHA 5LZ9A 2XMSA 1I6WA 2J3QA 5AKZA 4QLOA 5ALLA 5CRIA 4J0CA 2QVBA 1ZD5A 4DIUA 3K6KA 3SX4A 1KU0A 5DYTA 1N5MA 4DMHA 3CCBA 3A2LA 2ZSIA 1T4MA 2QJRA 1WCYA 5ALMA 3FSGD 3V1KA 4U2DA 3ED1A 2XUOA 3AZOA 2QRUA 4XIIA 1ZGCA 4EBBA 4UUQA 1XROA 2XQIA 5AKXA 3F98A 1IZ8A 5JATA 3DEAA 4QDUA 4AO8A 2VA9A 3I2GA 4K6GA 3CXUA 1QE3A 3WK5A 2HADA 1GPLA 4KE6A 3H1BA 4Q1VA 4OUKX 2QUBA 3R3ZA 2GYWA 2XI4A 2CB9A 1QIKA 3KDAA 1NU8A 2AJ8A 1YR2A 1XZEA 3ESCA 1H23A 3ESDA 2VAXA 4IHAA 2JEYA 3EBLA 1MAAA 1JMYA 1VA5A 3IB3A 2PU7A 3ANTA 2X8BA 1N5RA 4RPCA 4J3JA 3V1LA 4FMPA 3YASA 4ZXFA 3K2IA 2WHPB 4IH4A 4BC0A 5ALVA 1YB6A 5LKAA 3QM1A 3QBJA 3QYJA 1BEEA 5AO9A 1G4HA 2QR5A 4M0FA 3IDAA 4UHBA 2QTBA 4BE9A 5H3HA 2PU5A 3QPAA 1JI3A 5LKRA 4EY5A 2GYUA 3ZWQA 1QOZA 1VE7A 4EY4A 1F0PA 5ALKA 3D2AA 1BROA 2YH2A 2WUFA 5T4EA 3DLTA 3FOBA 3QPDA 4BCBA 1TK3A 3C6YA 1T2NA 1CLEA 3FSGA 4BCCA 5AK6A 4BE4A 2HA0A 3F97A 1UKCA 2YYSA 3BF8A 4HXFB 4J0JA 3A2NA 3NOXA 4H7IA 3WMRA 4N5IX 4UPDA 3G9ZA 2H7XA 4AO6A 1DX4A 2XMGA 3AJAA 1MU0A 1P0QA 1F6WA 4KYVA 4IQ4A 2PX6A 2RI6A 1VOTA 3OOSA 3DS8A 4HRYA 5ALTA 1TQHA 4NVRA 4G1FA 1UWCA 4AZ3A 1JU3A 4BC1A 4EY8A 1BEZA 1EK2A 5AIAA 4MJ3A 5EIEA 4D9JA 4Y2TA 2PPLA 1EVEA 3W05A 1YA8A 1BCRA 5IVIA 1X70A 4GLBA 4X00A 2VEOA 5LZ7A 1XRPA 2WUEA 4UFNA 5T4HA 1K5PA 2HA2A 2PSFA 3F8SA 1SCIA 3T52A 3MUNA 5CW2A 2QUAA 2QXTA 1Q0ZA 4Y2VA 2VF2A 2XUAA 4L72A 2XLCA 2HDWA 2XB6A 3LIIA 3M82A 4OB7A 2XUJA 4DM7A 2Y1KA 3C5WP 4B0OA 3X3HA 1W52X 3TGLA 4DMKA 2GZRA 1JMKC 1LPOA 2ROQA 4QWWA 4Y2PA 4GBGA 2CUTA 3I2FA 1XLVA 2EEPA 4J0DA 3H1AA 2R11A 1THTA 4E11A 3WL5A 2AJDA 1XQVA 3L1IA 5HKAA 1GQSA 5DNUA 1CUUA 2GYVA 1XQYA 4YASA 2DHDA 3DDUA 4G9EA 4L3WA 2Y2VA 5CT4A 2VT6A 4JUIA 4FFVA 3BL8A 2HA3A 2Z3WA 2RHTA 4PF1A 4UHDA 1JJBA 4WDRA 5C8XA 1FFCA 1HKHA 4B0PA 1EK1A 3H18A 3SWWA 4QLAA 1GKLA 3ESAA 5CT8A 5J3JA 2D5LA 3M3DA 3G0GA 3E4DA 4UBOA 5AKHA 3AILA 1WPRA 2W6CX 5CT6A 3BDVA 2OCKA 1TRHA 3N0TA 4LXIA 2XQKA 3WKEA 3CN9A 3WWDA 4HAIA 2HA5A 4OYYA 1ETHA 1E8DA 4C01A 1SCKA 1FFDA 4WY8A 3VJLA 5ALOA 4AMZA 1THGA 1EDBA 2WHPA 3S8YA 3G8YA 4ZV9A 1QTRA 1K4YA 1UOOA 1OILA 5AI9A 4B6GA 2YXPX 4E14A 3C8DA 6YASA 2XUFA 2Z8XA 4AB1A 4CG2A 1MJ5A 1XRLA 4XWGA 4I4CA 5AK4A 2ZYIA 3RARA 3C8HA 2WILA 5LZ5A 3R40A 4KE9A 1KU6A 2PSHA 5BOVA 4OCZA 1ZI6A 4UBKA 5EFZA 2RONA 4QNNA 1JJIA 5CT9A 1HBJA 4JNCA 4UHHA 1DT5A 1GGVA 4MYDA 4OPMA 2PL5A 4DTCA 2QS9A 3DKKA 1R9NA 2XUHA 3DL7A 2XUIA 3LP5A 3BF7A 4PQEA 3QVMA 4PSCA 3H04A 3IBTA 2O2HA 1B41A 1GZ7A 4YX9A 2HU7A 4G8BA 1WHSA 1CUCA 4G4GA 4GHWA 5FPQA 4RE5A 4B84A 2GBCA 3D7RA 5IVKA 2XLBA 4BB0A 4MEAA 2ECFA 3FLEA 1P0IA 4A5SA 2BUCA 3BIWA 2I3ZA 5D6OA 5A6VA 1CUEA 3PUIA 3G0DA 4OU5A 4Y2SA 4FHZA 5AKYA 3T4UA 5CTAA 3STXA 3PUHA 4XX1A 4F0JA 4G5XA 3Q8WA 3WK6A 1UKBA 4N8EA 2WJ6A 5IKXA 2X76A 7YASA 4KACA 3PICA 1GKKA 3ZLUA 1ODSA 2NW6A 3FYUC 2FX5A 3OURA 2ZSHA 2XQGA 5JZSA 4J03A 1C7JA 1MNQA 3VISA 3WWCA 4S0XA 5KBYA 2HA4A 4RNCA 5ALIA 1ACLA 3MGAA 1XZFA 5FDFA 1ORWA 4BTLA 2XE4A 5E4YA 4P9NA 1LBTA 4X7BA 2I03A
chains in the Genus database with same CATH superfamily
1W93A 3W6OA 2WMDA 3T99A 1SUDA 3CF4G 3ELBA 4TM8A 3P9CA 1VG8A 4PRKA 4BNHA 1PQPA 2VP5A 4MV5A 1BNCA 1E2NA 1OFTA 1UK8A 2X6RA 1V26A 3KJNA 4GUDA 1KYTA 3C4VA 5E8JA 2BLLA 1P7PA 4AKGA 4P31A 2D0IA 3JTMA 4DNOA 4NAVA 1WF3A 4DMMA 2WFAA 3B85A 1KDOA 3H9UA 4L08A 3SFVA 2XHEA 3FTQA 3TB4A 5I8WA 1BX3A 2XMPA 1F0KA 5IABA 2A94A 2I34A 3WB0A 2NO5A 4IBOA 4JP1A 5AWFC 1BJRE 3PBKA 3SLGA 1FQOA 3AKCA 3LY7A 2HMYB 4IGAA 3KTFA 2CLFB 5AW4A 3ORYA 1FXWA 2ATEA 1PSZA 2JJ1D 1PI3A 2ES4A 2OE2A 2X9VA 5KQGA 4JC8A 1FLNA 1FP4B 3OZVA 1PRYA 4J7AA 3IE1A 4TS4A 3AEZA 2F62A 3M6XA 1VIYA 1X1DA 3LUDA 2CD7A 1JSRA 4FYIA 3TPZA 4NU0A 4JWKA 2C0PA 2CD9A 4OHBA 5C8ZA 3NVAA 3ILVA 3L0PA 5AP9A 2V6JA 5ALUA 2CC2A 1T1EA 3F9CA 3PSAA 5EE0A 1MC8A 2R84A 3TINA 3DGEC 3TNDA 1NJSA 2ZJ1A 4MOWA 1KI4A 1WUTA 3UTDA 5CFQA 3M6VA 4P7FA 4ZIRB 3DDNA 2A9PA 4Z4FA 3WJ1A 3KPJA 1CE8A 5HFAA 2AOTA 3BHIA 3U81A 5A9SA 2VN8A 5KYKA 2NU8B 2M1XA 3V5NA 1WOMA 2F9FA 3VV2A 2QN8A 1B42A 3DOFA 4NBTA 3EXG2 1A4UA 4R7GA 2PJRA 3M6WA 3W1WA 3AVVA 4FPXA 4EHHA 5BMVB 4FONA 2BR3A 4BVKA 2JJQA 2OCYC 3K31A 2QN7A 3FLBA 2C7PA 2DR0A 2GTHA 1WDMA 4NENA 2I54A 2OZPA 1VFNA 2IITA 2PV0A 4R68A 4WA7A 5WRFA 4RK5A 5EXDA 4Z3KA 2J41A 2NNLD 2P6UA 3F9IA 4LY6A 4DGQA 4Q05A 4A8JB 3O26A 4B32A 4W5QA 5I4IA 3LGAA 4MRSA 3EGWA 1ZM3A 1NUHA 2AFHB 1ZI9A 3FPAA 3DKPA 4NBWA 2WJ3A 4GZLA 1IEXA 3IFSA 1TEXA 1KDRA 4R2IA 5EIAA 5SY4A 3OZDA 1HFJA 2AEFA 1UJ4A 2UXCB 3M7IA 2V7UA 3A6LA 4QYTA 4OHFA 3RODA 4IYRA 2Q5JA 4Z0TA 3O75A 3B1FA 4CFZA 2O2JA 3IUEA 3H2YA 1P72A 4M49A 4M0EA 5BQ5A 1Q0LA 1E77A 1QHFA 1WHTB 4Q1CA 1XG5A 3JX9A 4C5AA 4E15A 2IS2A 1UBNA 3PSHA 4UPVA 5ECGC 4IIJF 3DZGA 4WJKB 5CBKA 1POXA 2H2FA 3CHYA 2OR3A 3QPBA 4KE8A 1P29A 1SUAA 1H66A 2WJAA 1AD2A 1KVSA 1OBHA 3FSRA 3AI2A 2QZZA 4B71A 1AY0A 4J0GA 2J87A 3EPPA 2KBFA 4IIYA 1QFMA 5K6AC 1SVLA 4JBWA 1I51A 1M1YE 4ZCRA 2Q2WA 3DFKA 5DEOA 4OF4A 3V32A 3QRWA 5IHXA 4YRNA 5HW0A 1JWAB 4B44A 4HRAA 4OK3A 3DT6A 3UJBA 3L4SO 4MHTA 3ZHBA 3D5QA 3HBNA 1PX2A 1E0DA 2QSUA 4GOXA 4M1EA 3DSRA 2QTRA 4MKIA 1YR8A 1OAOC 2C8VA 2D06A 2XMQA 4LDPA 4CL2A 5EERA 2B8EA 3DZKA 1ANKA 3BHMA 5G3ZA 4ZTZB 4JR1A 4XLTA 4IMRA 4PTZA 4MQEA 3UWPA 4ALMA 3ZWOA 1SHTX 3OJ0A 2PDAA 5EKSA 4MVCA 4AICA 2X5OA 3HO8A 3LUKA 4MS4B 4LXGA 4CDGA 2DUUA 3CW8X 4N5HX 3T38A 2Y67A 3OO0A 3V4VB 3F6EX 3WL8A 4NCNA 3QE2A 2GF0A 2CLMB 1UBLS 1L4GA 3LPLA 1VYHA 3E3MA 3O7WA 3TJRA 3JRWA 5K0EA 5KNCD 2C7RA 3A6EA 4AIIA 1REQB 3FMGA 1P33A 1D7AA 1XP5A 2B0JA 3QENA 2A4MA 2IU0A 3SHFA 4AMUA 4Q47A 5IYZA 4TLAA 1XMJA 3LI2A 4K81B 1E79D 3QUQA 1CETA 3DOHA 2Z5VA 1TCVA 2WYUA 1FDWA 1QYVA 2FMUA 1F9AA 1ONPA 2PHZA 5JPIA 3B48A 3G6WA 5AQ1A 3VSAA 4AG5A 1PNVA 2E87A 3EUWA 3P97A 1NNEA 4O3FA 1XWFA 5LMCA 2FE4A 3U19A 4A0FA 1QYIA 1LNSA 1LZKA 1X7WB 3ZWDA 4ZYYA 3PC3A 4GZ3A 3REOA 1KK2A 1MT3A 2EF0A 5HXAA 3BOSA 3A26A 1UPAA 1G20B 2G6TA 3K2BA 1DVRA 4IDDA 3PE4A 2H00A 1G2QA 4DBLE 1RM4A 2QLBA 2CK3D 3GFFA 3H2SA 4L02A 3EPJA 2ZS9A 3CJTA 3GLIB 3B6MA 1J0XO 1P17A 4N47A 5JY1A 4I50A 1JJ7A 4RJTA 4ACAA 3LQ2A 1WXGA 2DXIA 4D82A 1N57A 2FPSA 3JAKA 1I9CA 3BDIA 4N5DA 4EW6A 5KVAA 3QELA 4KO4S 3MTAA 5FWYA 1GDTA 2XSZD 1KKUA 1YDWA 4PO3X 2WT9A 4E6EA 5CH3A 1VBNA 1LI5A 1YQWA 1Z3IX 2YVLA 1SXIA 3OT1B 4FZ3A 3WHPA 4CETA 5EZYF 3AI7A 1R8JA 3RUDA 3TL3A 3TOSA 3PCXA 3CEMA 1R5NA 2NTNA 3WP1B 5JNVA 4PQGA 3B8HA 3M9XA 4TL6A 3ZE9A 5J4KA 5K0SA 1JIUA 4P38A 4RF2A 4UVIA 1UEIA 5HBGA 1P1RA 2D0DA 521PA 3VR4H 1XCPA 2QD3A 1BXGA 3KBOA 5DHPA 1P77A 3D3QA 4C0QC 2K5UA 5E7IA 3OY7A 5K4GA 2H0RA 1H2HA 2BLNA 4PYOA 2IV3A 1TCBA 1CULC 1YS1X 2VQDA 2C3OA 1JG3A 5LIRA 4X85A 1YF3A 1VFPA 2YYAA 3DBIA 5LA6F 3QLJA 1JIVA 2C4WA 3DULA 4H08A 3R23A 4EUFA 5KTNA 2AVNA 3VU1A 3PYMA 4Q93A 1FNMA 3HE3A 3DYBA 3N0WA 1GPDG 1XXHB 4PC2A 2I8AA 3WRVA 1GXSA 2C95A 2J08A 4FE3A 5BV7A 5KOHA 1P2TA 2G76A 1GZUA 5DM4A 1RQXA 3WY9A 3A4MA 2QMEA 2E2WA 3MUEA 4D9KA 1O03A 1DADA 3OEWA 2WMNB 3OMLA 3IURA 1QDEA 3K9CA 5L4NA 1VIDA 3GW8A 4XYGA 3PC4A 1A9SA 2PUEA 2IYSA 3JV7A 4X6LA 5KNBD 2QNIA 1JZTA 1ADFA 4D9MA 3IUNA 5JYBA 1K68A 4QYIA 4F04A 5EI5A 1KDYA 4DLNA 1EFPB 3DF9A 4MV1A 4NH4A 4RMHA 1HDGO 3WLPA 4QTZA 1HK7A 3EWSA 1G8HA 1IMJA 1JAXA 1YQEA 3ETEA 3HTXA 2FPOA 3L8EA 4R1QA 2DFTA 4TTQA 3TDMA 2X0JA 5JS1A 3LS2A 3ZY2A 3G23A 4YJ3B 4PZAA 5D1NA 1L1QA 1C4OA 1W1UA 1LC3A 2II6A 3E05A 5LQDA 1RQ2A 1Q1NA 2P4QA 2Q3CA 4E2WA 3AFGA 5GIPE 1G4UR 3A6ZA 3ZWWA 4CVNA 5JTTA 1YA6A 3A28A 1FRZA 3HWX1 4YHBA 4C4ZA 3TDKA 4DYHA 1K2VN 5JI3E 1V8FA 1C80A 2CFRA 2H1VA 3KQTA 4BP9A 1SZPA 1TEHA 2D1TA 2WYIA 1W1WA 2KSQA 1C3OB 1GD1O 3BULA 4FILA 4P35A 5HUQA 3N2ZB 3EEIA 4UM9B 3LLMA 3HCCA 1U8AA 2R66A 4Q3NA 3T6KA 5C1OA 3TMKA 2RGEA 2OVFA 3FHJA 4TL7A 4LHWA 1ZXBA 1GKUB 4NBVA 4KQXA 3RS7A 5I51A 2ZJ5A 4JDPA 3A9VA 1N8TA 4EUHA 3EDRA 4C03A 1P2FA 3DOIA 1FNBA 3QWFA 3JY6A 4EATA 1Y6QA 2JASA 4BUJA 2NXWA 5A71A 3TRHA 4HEA6 4EEXA 3OZXA 3WK8A 4MXDA 3M49A 4FBGA 1V71A 5BMVF 1SPBS 4O1IA 3DKRA 2IQ5A 4LNUB 1U7UA 2RGCA 3QFCA 4GP6A 1SWWA 3ZQJA 1G2OA 2EFJA 3GDHA 4R71A 4ZK6A 1GCIA 5FOQA 1VSVA 1N7JA 3C4QA 2J07A 4EL0A 1WHSB 1IIRA 1K4KA 4DDWA 3KYDB 3DO5A 3OX2A 4U39A 1VM6A 4ZVVA 3U26A 4BGUA 2C9CA 2PZBA 4KIGA 4OB8A 1Y6FA 3IVMA 1DHRA 4ZCSA 2BMDA 4R31A 3B60A 5DNVA 4MW6A 2X8JB 5EOVA 3NRJA 2PQ0A 2EG5A 1DAEA 1JKMA 2ZJ3A 3SIPA 4A3SA 4HMOA 2WVJA 3QBEA 3EVFA 1D4FA 2IC5A 1LC0A 1AUVA 1TKAA 3D8SA 3A6HA 1UK7A 2WM3A 1ZD4A 4JX8A 2JLUA 4HGPA 1HOXA 4UOEA 1TZMA 1OXKB 2Q5CA 3A4LA 1BDMA 2IPMA 1NPYA 4WKPA 1M2VA 1G5HA 1RAHA 2DHCA 4RD0A 2JLZA 4A4DA 3Q8KA 1B1CA 4RK1A 4WXPA 3H5LA 4C2BA 2FEAA 1LXCA 5EKTA 2Z5GA 3OQBA 4N0EA 1UDAA 4YI5A 1WBBA 3QE3A 4ZO9A 1E2KA 4ZO8A 2HIHA 5JYCA 2IDJA 4YP6A 2X22A 3B1ZA 4S0ZA 4JFRA 2ZIEA 3CSSA 1MXFA 1JI0A 2HJGA 3R5SA 3S27A 5CEJA 3KJQA 3DDSA 1AXEA 2FEWB 1QGOA 3H8SA 3W2GA 4GSYA 5IKEA 3TQHA 5AUQA 1MJFA 2XKBA 1E1NA 1VG9B 1KPGA 3R41A 3SHTA 4BPBA 1YQQA 1DC3A 3VKWA 3CVYA 1DG9A 5GZ1A 1E1RD 1JDUA 5AI5A 2Q6LA 4ZAXA 2QZ9A 1EFRA 2FRXA 4WOBA 4Y67A 5KCMA 2DR2A 1AN0A 3I92A 1KH3A 3E23A 2ODEA 3UHAA 4LGVA 5BNWA 3GFQA 4C4YA 1FUYB 3UWSA 4CKEA 1KI6A 1GZVA 1C8KA 1P7VA 2FW6A 1E1MA 3N2KA 3FFBA 4W5HA 2A92A 1VPLA 2DFDA 2CCJA 2YZGA 3A9TA 5EIOA 1CRQA 2C54A 3FDIA 1NW9B 4YJKA 3F1LA 1LUAA 3LO8A 1OX6A 4B35A 4D3ZA 4MVJH 4G1CA 1P9LA 2VQSA 3PFCA 5K8UA 3A1FA 3JQQA 4EVSA 5BVHA 2XKKA 3HVHA 3IAM6 4E94A 3U4MA 1JEJA 2QUIA 2QUKA 2H9YA 3GLSA 2YDXA 5HKLA 2JLYA 1OXTA 4ZQCB 2Y1LA 3HRKA 5B1IA 1E58A 1RZRA 4LWPA 3FN4A 3GJ7A 1BKSB 2AYXA 2OO3A 2Q3DA 3EXEA 2EKLA 4N3BA 2UKDA 4P58A 1IVNA 5AKJA 5KYUA 5TR9A 2ISQA 2F8TA 1DAOA 1XZLA 2C84A 6AT1A 2O23A 4DBLC 2C4KA 3LT5A 1NQ5A 1E92A 3MS2A 5FI5A 3K09A 5K1ZA 4KN8A 1TJNA 3KXLA 3ZOKA 2RHBA 4PY2A 2MSCB 4WNAA 2WZQA 2X4GA 3CLRD 3ZQ4A 4TYPA 3K9BA 4RJKA 5F33A 3D0RA 4HVLA 1EESA 3ZWXA 2Q9AA 4DS3A 4RYLA 2BKEA 3O9MA 2OBXA 2QDKA 1M6VB 5LQMA 2WPDD 5IBRA 2JEOA 2RBEA 4UXJA 3TFQA 3BMOB 3OPMA 3ZTYA 4U7DA 2VP9A 3AHIA 2YIJA 4B3IA 4COOA 3I5XA 1P3Y1 4Q9AA 4AUNA 3GEGA 4K9LA 4QDOA 3VYTB 5CH8A 4GU5A 5JH7F 3HDGA 1MH9A 2JL1A 1SVKA 2OBMA 2CWDA 3L49A 5B58C 1P31A 3H19A 4OK5A 4B4KA 2ZCVA 1YB4A 4JQZA 2JKYA 1Z2CA 4PLCA 1L1FA 3ABRB 4ZRMA 4XUGB 3EXIB 4FE7A 3GJZA 1O6GA 1KSHA 2V7WA 2MYUA 1WVMA 3CLUC 3ZWCA 2A6PA 2MMGA 1W76A 3E5NA 2HHLA 3R3WA 4BJ6A 2HFJA 3ETLA 1ZITA 2B98A 2X0KA 1GGFA 3KG2A 3STTA 2GZ3A 2R8YA 4ZOLB 3T1OA 2BC9A 1VG0B 4BQOA 4ZPXA 4DR3B 1Z15A 2ZR0A 2FE1A 4FBMA 1CY6A 4F8EA 4O2BB 3V1MA 1NM5C 1VL2A 1N6IA 2QD2A 3F6CA 4O8CA 4H7EA 3ZZ1A 3CNQS 2BMAA 3E27A 3I9OA 4CM8B 4R8RA 1GG2A 4DCVA 2OYCA 4BNIA 2PUBA 1TOAA 1ZQ9A 4H35A 4N6GA 3DXYA 3P0IA 3UCEA 3N86A 2YKGA 1BRMA 2VPXA 3V00A 3VAZA 2P6RA 2DP4E 2X2PA 2V97A 1IK6A 3O2JA 1EX6A 2DBQA 1IVYA 1C41A 1VB5A 2C5AA 3LC0A 2JKZA 4XVCA 2BHLA 4YMHA 1ZISA 5CYGA 1W96A 3CV3A 3I5AA 1UK9A 3WL4A 4CTNA 4HYQA 4J07A 1XQ1A 1NUTA 1U1CA 2EP5A 2B0CA 3H2ZA 1FU7A 3V7NA 5BSFA 3D02A 3KTAB 3WGJA 3UA4A 1W5FA 3OT4A 4PZEA 2D3WA 4XM1A 3U5ZB 3CRVA 1RAAA 1C9YA 1G0OA 1QTIA 1YTLA 1D6NA 1E32A 2FGJA 4G0QA 4MUJA 4V0NA 4BZQA 5EJEA 3VH4A 2R6AA 2VJQA 1NI3A 3E0QA 1TU4A 4EL5A 2R8ZA 4BFVA 5K6TA 4J2TA 1R74A 1R0ZA 1W87A 4G1MB 1WPQA 4HLUA 5F1KA 1ZUNA 3AY0A 3AHJA 1D9ZA 3OZEA 4HWSA 3TW0A 2XOXA 5TPWB 2HA7A 2GPTA 3QPCA 2R4TA 3ZHZA 5F76A 4EBFA 4V03A 2XZTA 2O3RA 5SV2A 3D6JA 2QTVA 2VSXA 4Y9SA 3CW2A 4OHZA 5B6IA 4MLDA 2ODPA 1NF9A 4HK4A 5AW2A 2CMDA 2Z6VA 2TYSB 1QQ7A 1SC1A 5IAAA 4G26A 4J0IA 4PVDA 2BR4A 4YAWA 4CV3A 2JBAA 4BV3A 5D3MA 3CQ9A 2RGGA 3O3CA 3TIVA 3L8MA 4FFPA 4FINA 5E8RA 4A1FA 2C9OA 5MN5A 4NICA 1SVNA 1SHZA 1VSQA 2KWIA 5TF0A 5CVTA 4AO7A 1Y5IA 2IXGA 2W0MA 5TQ0B 2ZSJA 1P6XA 1LBHA 2ETVA 4GFDA 3L84A 5ITSA 4DA0A 4KAJA 1U63A 4PAQA 4D4IA 1IATA 3DM5A 3AINA 1GPAA 1NBWB 1PKXA 3IALA 4P82A 4NYIR 4KW7A 4WLOA 2WHEA 3EFOA 3CNNA 3ILSA 4D79A 1IY1A 1Q20A 4ZZIA 1GR1A 2GNPA 1U11A 3GCZA 4ECEA 1T0BA 4M8IA 2NVUB 1NLUA 4Z4CA 3I2JA 1ZR2A 1QIMA 4KI0A 4ZCQA 3K0SA 1NC1A 2XDQB 2Q1YA 5DLDA 3MOSA 2BGKA 2WZDA 3KKNA 4TSFA 3KVRA 5B58T 3FKJA 3W8RA 4BIIA 1KWKA 1ADGA 3IL2A 4MP6A 4J9UE 1O6ZA 1V7QA 1LDNA 1KYYA 5AVOA 3V8BA 4EARA 3K5IA 2HAEA 2IIQA 3DP9A 1NVAA 2BAGA 5TT0A 1PSWA 1M0WA 2WTEA 3NM4A 3Q6MA 3USCS 3EOZA 4FMDF 4YAJA 3E03A 1YD7A 1V8ZA 1EFHA 5B30A 5H4GA 2WVAA 4G25A 1JSLA 2AZTA 2H65A 3U0BA 3EIEA 2G04A 1IOZA 3SD7A 3V9AA 1XRSB 2QROA 5J40A 1P81A 4LPKA 2CNLA 2DPMA 4GXQA 1B00A 4MRVA 3VI4B 4QQRA 2ZG6A 3A2MA 2W2OA 1G5PA 3ZDXB 3H2KA 2LPMA 2QRVB 2WD7A 4A82A 4O63O 4A2PA 1B73A 1L8OA 1E1YA 3L04A 2WINI 4KJXA 4XGIA 2B5WA 2KS6A 2NZJA 3LY8A 3MT8A 4YLEA 3D5EA 3LLCA 5ALHA 4E7OA 5K0BA 3JATA 2C2KA 4Q39A 3ND7A 5ENZA 4PHTA 1K7EB 2DEUA 2X23A 3EOAI 3JZFA 3TTTA 3DDZX 4E2YA 3K0KA 5TRTA 5JHGB 2LZ0A 4L3VA 4QUHA 1RHUA 1A8SA 2FTKE 1T2DA 3ZGZA 1AV6A 3BGWA 4LAFA 5AIBA 2QXUA 4RKFA 4AW9A 1OVMA 1H8HD 2YN4A 3H65A 3KR0A 3NFYA 4FLEA 5LU9A 4HSGA 1BX1A 2AGVA 1LU9A 4B7CA 4EFMA 4QHTA 4RLQA 4EPRA 1DJMA 1HXHA 3CWQA 1VPDA 4LC0A 2GN6A 3WIEA 3INRA 4UW9A 4ALKA 3UMJA 5C1BA 4O4IB 2H3EA 1SCJA 3QOFA 3I76A 1FSPA 4YK7A 1GPMA 4MNTA 1H42A 5JSZB 5AR1A 1WS6A 3PQ8A 2QTLA 4KC0A 3LBYA 3AY3A 3PR1A 2CXSA 1GNVA 4EI8A 4G0OA 3MWEB 3K6RA 1QHHB 2WF8A 4EB6A 3B3QA 1CJSA 3ETJA 4J8PA 4TYMA 3HM9A 2IE8A 1N4DA 3I9V1 1OU4A 3QWHA 5K3FB 1A9OA 3VJKA 5JRZA 5H16A 3DVSX 1ZNXA 2DSTA 2M6KA 1A1VA 121PA 4KXYA 1JFRA 2VDJA 5TB5A 5BV1A 5T67A 2CLIB 3FDZB 5EUMA 1WRBA 1AURA 2C77A 3R3HA 2P90A 2PNJA 4ZARA 2H54A 3C8ZA 2QV7A 2BZSA 4NATA 1VE1A 5EKUA 5A5DA 3FUUA 1YA4A 2BRUC 3S2ZA 2YJ6A 1SKUA 5AOCA 3D4LA 4D8VA 1OGYA 5BXQC 4PAOA 4FSDA 2Z08A 3I9V6 1WQ4A 3PZRA 3BFJA 3UAVA 5AT1A 4HJXA 4ENVA 1PL8A 4C2UA 4GOMD 3F4LA 5BW8A 2CLDX 2WHXA 4H9GA 3P9PA 4B3HA 4EK9A 1COWA 1RQPA 4MAFA 4DLWA 3D59A 4F84A 1M9NA 3DJYA 5CFPA 2VJNA 4LJ6A 5AJHA 1RHMA 4X93A 2IEZA 4BO5A 4JUCA 1Q1AA 1G7SA 4A7PA 5IH7A 1RABA 4PC3A 4KR3A 2L18A 2IHTA 1NUAA 1TF5A 2H57A 4OHUA 4XFDA 5C32A 5C5DA 4EELA 3EZ2A 3QUTA 3L4BC 2RB5A 2P2SA 4F3KA 3HKCA 5TJHA 4EJ6A 3CZCA 4KXXA 3DBOB 3V33A 2E4ZA 1WLYA 2J0VA 2Q3JA 4CG0A 4B6JA 2R6GA 5ALZA 1Z4JA 4JLUA 1CEXA 3AVQA 3CZ9A 3I52A 1HT2E 4L07A 1CUBA 1AK9A 1GTVA 5FJIA 1MAWA 1QMPA 1PTJA 3EUAA 4TWAA 1U98A 5ECDA 1SQ0A 1B2RA 2IEYA 3IRUA 3ZGXA 1XEFA 3ITDA 1YV9A 1MXHA 2YMPA 5CDUA 1YSCA 2WY2D 3U31A 2R6HA 3DBRB 3A3KA 3RVBA 1NOIA 1Y1QA 4DE5A 1BOOA 1PJLA 3U3XA 3QVGA 1AGNA 2IZ1A 2JS7A 3UJ6A 1LLDA 4GXTA 5CUQA 5HZGA 1M1ZA 3PEEA 2ZB2A 1JZQA 5JD5A 3U7IA 5AW0A 4N65A 3IAHA 2HXGA 4NJEB 2DJ5A 3GYBA 2CFSA 1O95C 2JBHA 2C0QA 5DGTA 2G07A 1DT3A 2Y8EA 3T9DA 2V03A 1KGDA 2H1LA 2NXCA 4Q7MB 3KT0A 4GLOA 2REOA 1BE8A 5LQKA 4ML3A 3I83A 3COZA 5EQTA 5LOVB 3IUQA 4BXOA 1U2GA 2Q4OA 5DYGA 1LDYA 1X42A 2WIJA 3QIVA 4D92A 1W2WB 3DFMA 3BILA 3E9RA 4S3MA 4DVJA 5HKBA 1RSZA 3W2TA 5KU1A 1SBZA 2J31A 4FDMA 3MERA 4GPEA 3FLAA 4DA6A 3DEYX 1P2GA 3WGLA 4JLDA 3U7FB 3ZD7A 1U6KA 1A04A 2BM9A 4JQYA 4G0NA 4E03A 4EYQA 1TLFA 2VT2A 3CZRA 3JZMA 3GLFA 4XOUA 3HO1A 1TO1E 3QTBA 2ATCA 3OTGA 5H3CA 4CKBA 2HKIA 4IMJB 1FC0A 1H6DA 2JJYA 4UEQA 2VUTA 2RHRA 1P1KA 2VP0A 1KAOA 5KJ6A 1D5CA 4ZTBA 1C9NA 3TNFA 3SVLA 4RFSB 1YU6A 2JD2A 4PE5B 3OTHA 5IJ0B 1KFKB 2RKBA 2YZMA 4ITVA 5EWMB 1HC7A 2HREA 4PSAA 4ZAWA 1ISPA 1Q3KA 2C5FA 4FOSA 1X15A 2FK7A 2XA1A 1K2WA 3KJHA 4CG3A 1VJRA 5F77A 4XH9B 3NANA 1O57A 5J9FA 1N75A 3WNCA 4P7KA 1KYIA 2HBZA 3A3YA 1PLLA 4RGYA 3A9SA 4D6XA 3PRHA 4FLMA 4QBIA 4LHSA 4DNQA 5KTYA 3PZBA 1JLMA 2PE5A 2TMKA 4MDHA 3I2HA 3KT8A 1Z39A 3O4IA 1NYLA 1P4GA 4X24A 1L4NA 1NJFA 5EHNA 2ZRGA 4EDFA 4H3KB 1H2XA 2V0CA 3W6PA 1P2DA 3FOWA 2GFQA 4L9RA 2R00C 1M1NA 1FB5A 2HV9A 2CHGA 3GPLA 1L5OA 3FCEA 4CQJA 1OH7A 2Q4RA 3ZV4A 3B6ZA 4XWTA 3IAAA 3WXBA 3N75A 4N0DA 3IKVA 4HGQA 3W8FA 1S1MA 2GM9A 2EBWA 2O8VA 4FCTA 4PX3A 3ROKA 4FNMA 5FL7D 5T4BA 3STVA 4E5NA 5K0CA 3LOQA 4COKA 1FTNA 5FHRA 1GPKA 3RS8A 5B7GA 3VSBA 3WFZA 3EGDB 1RZUA 3JD4A 3RBVA 2RE8A 1OVGA 1G3MA 5JSUA 3HZHA 2O8DA 4HTAA 2VBGA 3R4VA 4R8SA 5ALPA 1EWQA 2QL5A 2NSDA 2O14A 4JL6A 1P1FA 4F1JA 2BR5A 4KLRA 3GNTA 5BWOA 1QAMA 1A2BA 3OHPA 1QRRA 5PNTA 5IFLA 1ZVMA 2YFKA 4KHPB 3AVTA 1JEEA 1E96A 3A1SA 1OR8A 1JMVA 1JA9A 2FPUA 1RC1A 5DM1A 3D6MA 3WOHA 2O8FB 2RIPA 3R7BA 4JFAA 1XNJA 8ABPA 1NXWA 2AMJA 1NP3A 2FEKA 3PS9A 1ZMXA 3SQDA 3E5MA 3TLZA 3GARA 4INAA 5E9AA 1JQBA 2A3NA 3TQCA 3UYLA 2HY7A 4HXEB 2BFAA 1ZBQA 2FMKA 2Q6VA 1A82A 2E85A 2Z8ZA 3HKEB 4PWYA 4UBLA 1ISMA 5EJGA 2I1QA 2JFHA 1E1KA 2ZAMA 4V0RA 2JDIA 1NBIA 2ZQYA 1W5TA 2XHZA 1MPTA 3CPEA 4FEGA 4Q00A 4YMSA 4LJ8A 5SICE 1XPUA 3LT0A 4N6NA 3QY9A 1S2IA 1XBTA 2XRMA 1R8XA 4AQDA 1XJ5A 3BJZA 4HDKB 4YJFB 1DV2A 1VHTA 3AXTA 4N0PA 4BRZA 1CR1A 1KMHB 1WWKA 1J97A 1YZGA 2ZPUA 4CM4B 4FMBB 3FPGA 1UOPA 3DCYA 4QJ3A 3I4CA 2I2AA 3C3KA 1O7JA 3L1JA 1KEKA 3FZQA 3H9EO 2XUDA 2QJFA 4ZT6A 2OHOA 2CVOA 1N3BA 5CVUA 4FLFA 4ZCLA 5D86A 1W85B 1PK9A 2QPTA 4KH0A 3ZE1B 3ZLTA 2OHVA 2PEZA 1KQNA 3ZXUB 1E66A 1G21E 5SYAA 3VC3A 1B43A 1CBUA 1O08A 4X1YB 1P7YA 3PA6A 4P3XA 1P1JA 4Q0MA 5AICA 4CGYA 5KTMA 5F9HA 2CEKA 3VYUB 2P4HX 4JAVC 3PNPA 1ZK1A 2J9XB 2NT3A 2WPNA 3GH3A 4IO0A 1E7QA 4P08A 4TXJA 1IUKA 4WNIA 2V74B 4S12A 3AR5A 3VGJA 3ZD6A 3GPBA 2AOVA 2OL4A 5GY7A 2ZQ5A 1QPZA 2GEVA 3C5VA 3ZXYA 1WZEA 5FL3A 4BDSA 3F2IA 3RWBA 3W5UA 1GGEA 4JVMA 4O6VA 2QX8A 3UH1A 3I73A 1KP3A 1OHHD 3JPWA 3H2JA 4BZPA 3PE6A 5IASA 1TYBE 4H59A 5EIBC 1XQ6A 4GPD1 2Q0XA 2HSZA 3KKPA 4BMYA 4QYMA 4TTJA 3T9EA 4RWZA 2W6ZA 3JWGA 1MV8A 4Z7OB 3GJYA 4YWJA 2V7EA 4EB3A 3WI7A 1PN3A 2XZDA 1SUBA 4CT0A 5FLXA 5BRNA 1Y3AA 1OAKA 1SOUA 2I76A 2JGDA 3HUUA 3BK2A 3KUCA 2UZ3A 3IGFA 2XNDD 4BCDA 2H06A 1FP7A 4O4JA 3FKSD 5HMMA 3WK4A 1FJXA 3J81A 4YV2A 1ZHHA 2GBLC 4I6GA 1CIPA 5FNVA 2X0EA 3PVZA 4AN4A 1R8QA 4I66A 4TQGA 3WNVA 2H51A 2IHBA 4DDKA 4Z0HO 2O8CA 4LFBB 1J0AA 4YCBA 1XKTA 5TS3A 4AZWA 5BV0A 1DTEA 3O8BA 2C5EA 4ZREA 2JIDA 2BEJA 5KSYA 3LU1A 1RMTA 4XM2A 4I55F 5IHPA 3RTGA 4B73A 2ZB8A 2NG1A 5BN5B 2AJCA 1FLVA 4B9AA 2HHCA 1KQFA 5IWCA 2IHYA 1L5ZA 4ESVA 3MBKA 1FYFA 4IICA 3DNPA 4CKXA 4LWQA 3KSBC 3VNAA 4H1WA 1KIAA 2JBWA 1MO3A 2XQVA 1HM5A 2YC2C 3DZFA 4L2IA 3OC0A 3MTJA 3ET5A 4Q4JB 2A88A 3UO8B 3VNUA 1CFJA 3U7RA 1XOIA 2D59A 2EZ8A 3WZLA 5IC5A 3ZU3A 4HAXA 3FYSA 1CUFA 3N87A 4NEHB 2OKGA 4PRZA 7ADHA 5JXWA 3PGLA 5ITZB 1DHTA 4IDEA 2B8JA 4DLSA 4MJXA 1C29B 1Z2DA 4WEQA 3BMCA 3D0OA 3O8CA 4TMYA 2NZ8A 4XYLA 1MOPA 1SD1A 3IBCA 1JTVA 5HCUA 1ZU5A 2P9ZA 4NCHA 4P1ZA 5MHTA 4UMVA 4TLLB 2W6IA 4H1TA 2OCGA 3A14A 4MLZA 2VFAA 4HVCA 2XUGA 3GLTA 2ZIXB 3KQWA 3M1YA 4HEHA 4KR9A 4PM4A 2P7IA 1TT5A 2PKWA 3B1WA 4LSGA 4XR9A 4ZVTA 4ZI7B 3BIFA 2VNIA 1I3LA 2QIOA 1JFTA 3RIHA 4BQFA 3BK1A 3EYWA 2QSZA 4EI2A 3FMPB 2HMVA 1SKBA 4CEIB 3KWFA 2IU3A 4UHJA 1RRKA 5KC9A 1SFRA 3DMTA 1T6YA 3AP2A 1F0NA 1LB1B 3NBZC 5AFSA 3DM9B 4OHWA 4F4IA 3GA5A 1MX5A 1G7CA 4TRJA 4XLLA 3VHXA 3JWPA 1CHNA 4QGFA 1RM5A 1L4BA 1DIHA 1YQGA 2GN9A 2SICE 3BFPA 3IMCA 5HJEA 2PRSA 4C7VA 5BUSA 2E37A 4EYGA 2TECE 2YBDA 2ZJ0A 1U2SA 3PEWA 4DHWA 1VZ2A 2DAPA 2VWQA 3CF4A 1CJUC 4OLFA 4PLFA 4Z9BA 2Y0PA 3V6MA 4ZEMA 1X7YB 4XLZA 4TV8F 1MQ8B 4JC5A 2ZDGA 1PU2A 3PLNA 4H2DA 1F3OA 1T24A 4PXAA 3ICOA 3W79A 3ZI0A 4CQMD 5IDQA 1T8TA 1GGJA 2CHVA 3GEEA 1JKIA 3OIYA 2VJKA 1Z16A 2I2BA 3TIXB 4LDRA 2B30A 4JI7B 621PA 2H8GA 3B6JA 2NUPA 1G5RA 2B61A 1QIIA 2IHJA 4BECA 2XPCA 5ALSA 1C7ZA 2FPLA 1KI7A 2OXFA 2P3SA 1AZWA 3CRNA 3SYLA 5A6SA 2TMGA 1A69A 1UQUA 5I7EA 2VYND 1ZL0A 4M9QA 2HPHA 3FF1A 1R00A 1H5QA 2J30A 4PQYA 5DNEA 5JWRA 3MJEA 5ALGA 4BQEA 5KWEA 3ONNA 3RAJA 2W11A 2XA9A 3IXMA 3X43A 4AN0A 3U7JA 1P3JA 2HOQA 4Y8VA 2BKVA 5GGXA 2QTTA 4CUKA 4KR2A 3SQLA 2FG5A 1BD3A 2XCOA 4KOAA 3AETB 3TB6A 3HV2A 3ZHYA 1C81A 1IUNA 4BRWA 1MDFA 2W22A 1KE1A 1E1CA 2JCSA 2NSHA 2YZNA 4TS9A 2A1TR 5EXTA 3FYTA 1OU0A 2RGUA 5BN3B 5LQRA 4I7EA 4IM7A 1P0MA 2PKXA 1LRJA 2KPOA 3DA8A 2HSDA 2Z4SA 5BOSB 2O20A 4PN7A 1QB8A 2PT9A 4HH1A 1EQ2A 1XCGB 3NTUA 1NW7A 4JBLA 4NNPA 4XIJA 3RFFA 5LZ4A 2JFZA 2ZB7A 1DQPA 1YXMA 5C53B 1QR2A 2Q3LA 2PT5A 3CTMA 5BWNA 1E18A 2VQ6A 4GYWA 4N7MA 1I0LA 4JKIA 4YB8A 2IZ5A 2UYGA 4MA4A 4LZOA 2OQVA 1RI2A 4XJSA 5B1DA 1GILA 4XKJA 1DAIA 1JT2A 2V3WA 1I6MA 3GBVA 1S7CA 5CXXA 2HW8A 1RLJA 1A88A 3MPUA 1QGED 4FHCA 3MMZA 1DXQA 4HBZA 1MENA 2HO5A 1QJ4A 4EYEA 1GL3A 3EIQA 4OI2A 2XYVA 2V54A 4HYTA 1SUSA 1FLDA 2LRHA 2XR1A 3IBGA 1M0SA 3KVOA 3O83A 1H6AA 3HB1A 4L8LA 4OFXA 4JN6B 4Z1MD 3TW4A 4BGDA 1V6CA 4II7A 2XCSB 2ICAA 2ORED 2I29A 1SELA 1Z2NX 2ZYAA 3WO0A 4B6PA 1T5HX 5JQGA 3ZXSA 1XVLA 4DLKA 3DW1X 3MMPA 5D7BA 3PDIB 2J1LA 1U0TA 3OIDA 1XU4A 3VH3A 2RB4A 3OJLA 5ES3A 3T7SA 1AT1A 2B6HA 4MAMA 2JGLA 3KDSE 1V1RA 4P7BA 5JASA 3T7DA 4B76A 1Z36A 4UUBA 4DNPA 8ATCA 4BQSA 2OECA 2Z3ZA 4QDJA 2IU4A 4DAEA 5DTEA 2WVGA 1CQJB 4JL8A 4QSMA 5MGNA 1SCUA 5AMXA 1I4EB 4KOEC 1RI5A 3H0EA 1RP1A 3JASB 5K09A 1DQZA 4BY9E 1N2CB 1SC4A 4X0EA 3FCSB 5DULA 1T0JB 3H1TA 4CLHA 4Q3KA 1OTYA 4QC2A 3SQNA 5AW6A 3DBLA 4LFCB 4QWMA 5K8IA 4RHCA 1QYCA 3I12A 1NUPA 1YBVA 2ZSBA 3CKKA 3OWOA 4RKEA 5AHOA 5J4VA 3THYA 4B75A 1RWBA 1EG2A 1OPRA 3EG9B 1A4RA 1PGOA 3SSAA 4E5VA 6ABPA 4E4TA 1H1LB 5C0OE 2DUJA 5ARDA 2Y0DA 1YRBA 3OEEA 4O8ZA 1XKXA 4D46A 3LNTA 3MQ2A 1Z0JA 1A4IA 1KP9A 1VCMA 3LQYA 2C5BA 3O8OA 1L6IA 1DAGA 2FWMX 3Q9LA 4W99A 1U7HA 1XLUA 2B82A 4PEVA 3T9CA 3PXAA 3WRXC 2R8PA 4NEQA 4YRKA 1LLFA 1WEKA 3BXGA 2YOGA 1M8PA 4WECA 1NXVA 3R7WB 3CO0S 2QR2A 5ERGB 2XT0A 2YR0A 2ZE7A 3DMFA 4HWRA 4LHVA 4X54A 4ZQFA 1XCBA 2ERCA 1ELOA 2BKAA 2OCAA 1L7VC 3E3NA 1YOVB 4FTWA 5BN4B 1Q0TA 3L6CA 4A0HA 1YVEI 3H16A 3EGVA 4MK4A 4IJVA 4QT0A 1K6EA 5LUAA 3DTTA 3TLEA 5D00A 1R6DA 3N6VA 3WGOA 4JJZA 2JIMA 3LK6A 4QGSA 2AD1A 1CCWA 2C2XA 3PUVA 3HEAA 5IMBA 3PJEA 1TJ4A 5B2EA 5ER6A 3BD6A 3DEZA 1NY5A 3B9BA 3K32A 3VZQA 4EGFA 4ZYZA 2IBTA 4CKWB 4XPZA 3WYBA 2Z2YA 4KG7A 2WT4A 2XEDA 3SF8A 3WLAA 3AJEA 4MA0A 4WLVA 2ZJBA 4DJFC 2J7PA 1GL9B 2WG1A 1UJ6A 1RLUA 1QLWA 2F1OA 3R3JA 5SY6A 3QVLA 2H11A 4PC7A 3HVRA 1F1JA 2ZIGA 1TIBA 5F21A 2AI2A 3UMVA 1ZJYA 4LVUA 3DAOA 5JQWA 1QSGA 2UVQA 1WMSA 2YVQA 3EEYA 1KORA 3C8UA 3DCJA 5CLLA 2YXEA 3LVQE 4A8TA 3DEKA 3BMQA 3JU3A 3PNOA 4L6IA 2ZWPA 1CUYA 3B1YA 1XZBA 4TT3A 4TRRA 2UZ4A 4HN2A 2JLRA 1E9VA 2WP0A 4HUTA 4FKZA 2ZRMA 3THWA 1ORIA 3RIGA 4X91A 2ZTSA 4C0AC 4IGKA 2P11A 1BIFA 4RZQA 1FX0A 1U90A 3ER8A 2HMTA 4LZLA 2P5YA 4WEOA 5TXGA 5J2TB 2WFZA 1D07A 2O0JA 1KOJA 2VSOA 3VOAA 1CJCA 5DLPA 1IIBA 3R8XA 2JFNA 3KAKA 3QE0A 3Q10A 3QEMB 1VMDA 4YDRA 2IUSA 2X4DA 3AFIA 2WIDA 3EWNA 2QT9A 3P2KA 3P1JA 4RHUA 1ZGBA 2LXNA 3LQKA 3DEFA 2WM9B 4J76A 3WXMA 4DYVA 3G0IA 4QPDA 4Z5XA 3NLLA 1RHJA 2CFCA 4N7RA 4FB4A 3HXMA 5BURA 2I6QA 4C88A 1XX6A 1ECFA 1AO3A 2H92A 3WMEA 4G2TA 4JUBA 4BMSA 4EPVA 2G36A 1VQ1A 2WKQA 1XFDA 2A86A 2AG5A 2K87A 2WTAA 4HSEA 5FWXA 3RHZA 4GI7A 1OWOA 1BS9A 3GFGA 4I5FA 1ISHA 1CX9B 3K9FC 1USGA 5IJWA 5TX7A 3HXTA 2IWRA 4BLQA 4LECA 2CL6X 2GFIA 1DWPA 5TGTA 5U4QA 1KJ9A 4YJGB 5T4FA 1RADA 1YKFA 5EJ5A 1GG8A 3VVMA 3IDOA 2FSPA 2G28A 4HADA 4ARZA 2FFAA 3CISA 5BQOA 5SZJA 1EK6A 4C14A 4EGCB 3TW8B 1V8OA 1IONA 2YWGA 3JRXA 5L45A 1F9EA 3X1WA 4EG4A 3OKFA 3R4CA 4FBLA 4TWRA 5FLYA 2JJ8A 3B78A 3NH9A 1ZIPA 3PPXA 4M99A 4MUKA 4QFCA 1NI4B 1YMQA 5JPCA 4RHEA 1DS6A 5JZOA 4ROTA 1K9SA 1HDCA 3TFOA 1AX9A 1T4CB 3EBOA 5KOYA 4FZVA 1MB4A 3EISA 3JSXA 5BV2P 5KNDA 4PG6A 2JGEA 3BJEA 1GGMA 4MYRA 2OB1A 4RA6B 1Y63A 1V8BA 1YJCA 4IOMA 4PGMA 2AN4A 1TAQA 2ALJA 1KO1A 1SUPA 2VJMB 2FGKA 4KHZA 2RH9B 4MS3A 2KI5A 3M89A 3SDSA 1F17A 4ENQA 5H7XA 1BGVA 4DM4A 1U5BB 3RTAA 1Z7GA 2IYRA 3ICQB 4ER6A 2VUHB 4DCOA 1QZXA 2VP3A 4Y7CA 1UDCA 3FUTA 2VAVA 1KHTA 4MVWA 2HZBA 5IYZF 2EGHA 4UEWA 1YVRA 4N82A 4J3FA 4DXDA 4Q37A 1SUCA 3G88A 2GAOA 1JPVA 2I6UA 4UAGA 5GVSA 2O7RA 2EIXA 1QG2A 3RSSA 4X41A 4MV8A 2P9JA 4GMHA 2WYOA 4LBZA 4QPNA 4TTAA 3RSOA 1I6KA 2OBLA 1U8TA 1PZMA 5CIYA 2H48A 3ADBA 5J5CA 4M38A 1B6SA 1NNSA 4I3GA 4RPJA 4U5XA 2MYNA 4OXNA 3WLIA 1DWOA 1S4MA 2G1KA 4NYMR 2X7XA 3J7AC 2C4TA 1GYRA 1TZCA 5E2IA 2G9NA 3ISVA 2WNSA 3AP1A 1KMMA 4I50F 4OKNA 4LTMA 4H15A 5JAUA 2O07A 4NMXB 5IWAB 4R16A 1ORTA 3OQOA 1Z7EA 1YRYE 1YVUA 1P2UA 3DL4A 4EMSA 5D5PA 3E15A 4IXWA 4FFBA 4N1AA 3AEUA 5JDCA 5LFAA 2IUUA 5I9BA 1FJ2A 5B64A 4ASUD 5CR9A 1QKKA 1M2OB 2G1JA 4V0OA 1DFGA 3I8XA 1DPFA 1ZWKA 1QRAA 2UV8A 3HDQA 4U63A 2OA0A 4GXRA 4PLYA 1U7DA 2ZZNA 4C4SA 3GCWA 4MB6A 3QKSB 4I3HA 3TCKA 1U94A 1PD0A 2OV3A 2Q99A 2XIJA 3C1UA 1L7AA 3C43A 4X3PA 3T3HA 1T2EA 3OCVA 1F2UB 1BJKA 6REQA 3NCHA 2JD0A 1RBZA 1Z17A 4PBSA 1XMVA 5EG5A 3P8ZA 3IQDB 2IUYA 4PX5A 4IXDA 4EG7A 3RUPA 1PBNA 4Z4GA 4HAZA 4UTVA 1Q19A 5IKPA 5FR1A 2ECQA 2GCOB 2EKBA 1M8FA 4URZR 1B0PA 1U7TA 4KQ6A 1RBQA 3IPXA 1TKCA 2CMGA 1PR2A 4CIVA 2C4MA 1ZP6A 2EJUA 4DA9A 1T0UA 4R5MA 4TKUA 4EG6A 1G38A 1HMPA 3AFNA 4GM1A 4W7SA 3L18A 5DWDA 5AJTA 4YAFA 4ETMA 5AVYA 3TZQA 10MHA 5FR2A 4ZVRA 3Q8XB 1WV1A 3B5IA 5GAJA 4QDTA 4IFIA 4GDFA 1ZC4A 3KHSA 4D0NA 4FUTA 3QXCA 2DZDA 3JQCA 2FV8A 4E5UA 1SC3A 1I13A 2NSLA 1EJBA 5DHQA 5IUJC 1A72A 1DBVO 2HFKA 2X3FA 4FFRA 2BFNA 4IHJA 2PV7A 3DR5A 4CQNA 3D8TA 2Y27A 3KKLA 3HLTA 4B40A 1T0HB 3JVIA 4FGZA 3UA3A 721PA 5GVRA 5AI0A 3F67A 4Z2YA 3I3OA 2GN1A 3NHFA 4GYKA 3VPBA 4BQPA 1NF3A 2A0YA 2VPIA 4M1KA 3H11A 4LMAA 1LSOA 1XTBA 5BT9A 3IULA 5EMMA 1ZH2A 5MFPA 1TYEB 1FRVA 1XEXA 1R0CA 4ZQEA 4F72A 2FMIA 5B7QA 2G5GX 5DX8A 1U8EA 3FYUB 1RQNA 3M83A 1HX7A 4G0MA 1Y82A 2PJDA 1RJEA 2HF9A 4NYIQ 2YWCA 5A4FS 4JI8B 5DO9A 3DC7A 2A5JA 3AIMA 3GRFA 1Q44A 1Y7IA 1J06A 3IP5A 3N0VA 3NOQA 3P52A 5CP8A 2QJOA 1E9CA 2UUPA 4N5MA 4ICIA 4N3AA 5EYPA 1CUXA 1PKEA 1T5TA 2Q1UA 3R9IA 4BKRA 8ADHA 3DDCA 3TF5A 1UT5A 1S5PA 3H42B 2C5GA 1RXUA 3QFFA 5HQJA 2Z4RA 3GOHA 5ESXA 4TMXA 2HN9A 2J3QA 2OY0A 4PR3A 4DUGD 1HLFA 2XEXA 3RUFA 1QK4A 4ADSG 5LP6C 2PG3A 4M1OA 2I4TA 4WVLA 5BQ3A 1TEVA 4NV1A 3ZKWB 2DPGA 3KQNA 3KZOA 1XDDA 4GP9A 4M83A 4W7IA 2D2VA 5A3SA 5IZCC 2EKQA 3EDQA 5L7WA 3G2QA 4UAUA 2X5KO 1YIDA 1G5TA 1I2DA 2JFXA 4Q7KA 3SX4A 2TS1A 1H3EA 3L8FA 1V3VA 3DD1A 4LC9A 3WYAA 1JWLA 2JLBA 4H17A 4ER5A 3CMMA 1Q1ZA 4ZVKA 3S7TA 3NQ41 1I7LA 1YNSA 3FDJA 3E9NA 4AP6A 1V39A 5IG2A 3EC7A 2F3SA 5JE8A 1MRNA 1QOPB 2DQKA 5FADA 3Q2OA 4Q48A 5KTRA 2HCRA 1JA0A 3TOVA 4JXZA 3U16A 2BFOA 3EPHA 3H9QA 4HT3B 2UYQA 2X1HA 1VMAA 2ZZKA 3S2EA 3T7KA 1KTVA 3V1KA 3W3AH 1CR4A 4U2DA 4YONB 3V7YA 4RCZA 3T5MA 2VDWA 3NPAA 5M7EA 1IHXA 3OP1A 4V0SA 3V2GA 1OFGA 2QRUA 4BEBA 1E2UA 5AJVB 4L0MA 1ZGCA 1PS0A 4UUQA 3NRBA 2XQIA 3GH1A 3LYAA 2YHAA 4DDMA 5AKXA 2J5RA 3F98A 3IBYA 4MJLA 3TBHA 1LQ2A 4AY6A 4YT2A 1J99A 1EUDB 2R6ZA 5BPHA 1GEGA 3FGOA 1P39A 1RAFA 4IRUB 2ZM5A 1XZ8A 4PCVA 4PYLA 4QDUA 1V4VA 2PH7A 3FDXA 5HTOA 1CZHA 2VHZA 3D7MA 3I2GA 1L4MA 2H59A 3K6SA 1P80A 1RXSA 4C5CA 5HIAA 4K9NA 3GB9A 3K30A 4OYRA 2G9RA 1KMCA 4RPKA 3M34A 2AR9A 2BELA 3K0AB 4C22A 1EXVA 1KSFX 1TD1A 1QZZA 4MQFB 2HJWA 2P3OA 1GPLA 4KE6A 3IP1A 1ZONA 2IFTA 3I01M 2NACA 1MDBA 2GYWA 2CB9A 1UBHS 4HR7A 3PITA 4QKQA 3KDAA 3L02A 3WQQA 4EPWA 5LXTB 1GNTA 2AJ8A 2PZAA 3T3PB 1YRQA 4KQ9A 5FFNA 1XZEA 2M6SA 3M5DA 3ESCA 3KZMA 1YULA 3PGKA 1MQSA 2X0DA 1IPFA 3VNVA 4F38A 1OQAA 1W48A 2IP1A 3EBLA 3AV3A 4ZYTA 4PZ9A 1PR9A 2Q5LA 2RGYA 5FAKA 3QPWA 1TU0A 3PHJA 4D4MA 4C6TB 4XWAA 1JMYA 4EGSA 1BWPA 4RMNA 3IB3A 3KUKA 3PXUA 3BXHA 4RXUA 1I4TD 2G6BA 3WS7A 2EZ4A 3D81A 4FU0A 1TVKA 2F1KA 2SHKA 4UASA 2VQFB 5LLDA 1I94B 3PRKE 4KSCA 1H1DA 3V1LA 4UTRA 1R18A 1QWOA 3D8UA 4XB2A 3PC8A 5E6RA 5FIUA 3RC3A 3LUPA 3T4XA 2I0FA 3DR3A 3KKMA 2CJYA 4F4DA 2NMVA 4OQDA 2QMOA 4US2R 2HU2A 4PG7A 3JS5A 4URWR 4BC0A 2XZLA 4QEDA 4X7RA 4ZC1A 1X1EA 4F46A 3QM1A 5JO0A 1F1BA 1K86A 3PKJA 2GTIA 3NDPA 4HDOB 4M0FA 2ZPAA 2QL9A 4CQMB 2QTBA 4YCMA 3GOQA 1AB6A 4BE9A 4QG3A 4PS1A 4Q4HB 4RH1A 1VYUA 3QW2A 4JI1B 2VHWA 4RM3A 1G3RA 1PR0A 1QE5A 3BWMA 3LHKA 5A06A 1P75A 4GO1A 2HIGA 2J5QA 1UANA 1ZG3A 1O0SA 4KQEA 1T3GA 4RVFA 3TVYA 2AOUB 4N3NA 5LKRA 1U2TA 4MH0R 3MWKA 1QOZA 1QYRA 4BQIA 2ZTLA 4EY4A 5L3QB 1GSHA 2G17A 1IJKA 1TB4A 3H9GA 2PY6A 3OFND 3CX3A 1BROA 3Q5EA 4OLJA 1FP4A 2CXHA 2WUFA 3DLTA 1Z5PA 4BGVA 1TK3A 3V4OA 1MAVA 1I3KA 1L5SA 2EBHX 3DTVD 3FSGA 4DLXA 1SK9A 3DAGA 3A36A 3PVCA 1RE0A 3EDCA 1CQXA 1QP0A 3BF8A 1HKUA 3DC2A 4C21A 2OFXA 3IODA 3RS4A 1FEZA 3HVJA 3K1AB 3MZ0A 4NJOA 2VAMA 4K8OA 5LYJA 4HLNA 3VHLB 1T34A 3A2NA 3PQ6A 1U8UA 4QUBA 4ZIRA 5TIIA 4L5BA 1ST3A 4AROA 1A5AB 2V59A 4BKUA 1XJCA 2BZ0A 2GILA 4I5EA 2GNAA 3VBCA 4CKYA 2R62A 2NU8A 3NIWA 1RRGA 5C9ZA 3F78A 9LDBA 2XMGA 3EEQA 4XAQA 4FGKA 4ZHQB 4CF5A 4L8GA 5EJ7A 1FUEA 1SD2A 4L9WA 2FB9A 3UCFA 5HRCA 2HWXA 2FK8A 1ITZA 4QUDA 5FI0B 5H68A 1A7KA 3IXLA 4KYVA 1YCHA 3OKAA 4RTLA 2FSGA 2B6NA 4XWOA 3OOSA 3ZDDA 5HE9A 3UBMA 3PFKA 4YTEA 5ALTA 2W5UA 4A8JA 2ZCJA 4O59O 1SULA 2NZXA 3HR4A 4HVAA 2UUAB 1VRWA 4XARA 1UWCA 1GQ2A 4GGMX 1WZIA 3R0XA 1GZ5A 4UVEA 3NIFB 4QECA 4BC1A 4EY8A 2ISCA 2AC2A 2QYHA 1EK2A 3REFA 5AIAA 3NFRA 3GDFA 5EIEA 5KYNA 1L7XA 1J20A 1ZRMA 1X1TA 3GIWA 2G0NA 1GAEO 2J6BA 3NGXA 3W05A 4BKMA 2QX6A 1I14A 4NU5A 1NBME 1QLHA 1QWSA 4RV9A 5F3DA 5G40A 1QGYA 4GLBA 1E9RA 1YQUA 1C1YA 2VEOA 3BB1A 4HC4A 3TX2A 1FA9A 3ZK8A 1GG5A 1XRPA 1P4JA 4M0UA 1DMSA 4RU1A 3F8SA 5E95A 2BFEB 1C0EA 2QXTA 1Q0ZA 3QHQA 4K88A 4BNVA 2ZR7A 2XUAA 1IE3A 3QOYA 4MR8B 1X1SA 3V4SA 4CODB 1N2GA 4L72A 1ES9A 1G8KA 1YZHA 3RBXA 4E07A 3G2KA 4YAGA 5EZ5A 1ZZGA 4DA7A 4DADA 2IXEA 1II9A 4R1UA 3WLMA 3LIIA 4GI2A 3DFUA 4B17A 4XVQA 1DUSA 3C74A 3HCWA 1KC3A 2D5AA 3C5WP 2RI1A 4DM7A 4KPFC 4KFTA 4RIFA 3SOZA 1SXGA 1XGKA 4U0KA 2AHRA 4JI3B 1W52X 3NJ8A 3TGLA 3TUJC 16PKA 1ZLYA 1NV8A 3PYLA 5MN6A 1JMKC 4JU8A 3E9QA 2ZJ2A 2OHFA 2ROQA 2XYHA 4KMRA 2HJRA 4QWWA 2ZYVX 2WWXA 3S8EA 1ZU4A 3E8MA 3H9JA 4POOA 1TO6A 3LZDA 4AJEA 1QZUA 4M46A 4MS4A 2F8MA 4A0SA 3AF1A 1AKQA 4B6SA 1A96A 1XMXA 2HLPA 4J7UA 4E11A 3B1XA 3RE1A 3PX3A 1T2VA 1RVDA 1VJ1A 3WL5A 1SCDA 3RIMA 1KAQA 2PUTA 3GJ6A 3OE5A 1NFFA 2B7CA 4FJ0A 4FZRA 2HBYA 4H3SA 2DUNA 3K5PA 1REQA 2YXDA 4OQLA 3SLKA 2OM6A 3CG4A 5G1NA 4MP8A 4V3BA 2I7DA 4YASA 3NTRA 1BVYF 2OOSA 2DHDA 4R8VA 4JBNA 1U1IA 3DOUA 3ZWAA 3N74A 2GD0A 2ZTVA 3MTBA 3PIRA 2J0UB 5K0NA 3ABIA 3F5FA 1R0RE 5L3ZA 1Y6ZA 4YDHB 3IC5A 5LC1A 3VPAA 2HA3A 4Z51A 2Z3WA 2ZT7A 2BH9A 1JQ5A 1WCIB 3W8NA 3IJ5A 1KI3A 1X7WA 3EA5A 1N7HA 4UHDA 4JJ8A 3VDQA 4PZLA 4DIBA 2HBQA 1ZJWA 1W47A 2QLTA 2BJWA 1OKKA 1ACMA 1G20A 1HKHA 2C2MA 5AJZA 5L3RA 5B3KA 3P9SA 3UT5B 1MOQA 2K7ZA 2RJNA 4CDMA 1BEUB 4YYZA 2PAAA 4IJ5A 4YFYA 1DKLA 2BEKA 4A03A 4DQUA 1GKLA 1GSAA 3ESAA 1WV0A 5A4MS 4HB4A 5J3JA 4KNWA 3GLIA 1T0IA 3LW8A 3NORA 4W8HA 3IOEA 2ET6A 4A36A 3KOZA 3AX6A 3VR5H 4UNSA 3A04A 5JYDA 1H65A 1FDTA 3W6ZA 5EY5B 2X7JA 2X0IA 1L8LA 1WPRA 2EWMA 4YMVA 2FW9A 3FLMA 3OT1A 3JQRA 2R2GA 3EPLA 1IOVA 2OCKA 4GQBA 4LOKA 4DEVA 3D3WB 4Z8XA 4BWVA 5BSEA 4Y0AA 1YS6A 3DEJA 3CN9A 3SBXA 3WWDA 2CNWD 3UG7A 4V1CA 1DC5A 1VHQA 1YBFA 2EFGA 3GXBA 4OI0A 3CTPA 2GPJA 1R4NB 3VR2D 4A8PA 4E5MA 1ETHA 1HDRA 1E8DA 3FWKA 3K0HA 1SCKA 1FFDA 1JHQA 5ELMA 1WX1A 1XALA 3QVKA 2F48A 1FNCA 3JQAD 3N5CA 4AMZA 4F5YA 5LU8A 1U0HC 3SBOA 3RYTC 2XRYA 4HPXB 5IXSA 1EDBA 1SPXA 2ZU6A 1GNPA 4WLFA 2C4NA 3G8YA 5DI9A 1QTRA 4ZV9A 3AY7A 5K9ZA 1QANA 1UOOA 4B3CA 1CVRA 4W5WA 1G20E 4RPGA 1TFUA 1XXHA 3VGPA 3VOSA 2FPWA 4BEJA 1OT3A 1VI5A 1UODA 3PE3A 3SQXA 2HQ1A 1SOAA 3KQPA 2GNOA 4R8LA 3GLIE 5TGDA 4ABTA 2PUWA 3B7GA 2BI7A 3PHIA 4ZI2A 1J5EB 5AI9A 3NYIA 2I67A 1KR2A 4NPCA 4JZKA 1COZA 3NATA 3WLHA 1E99A 3P9IA 4K1XA 5HA5A 1DAPA 2FSUA 3DHVA 3RIYA 3FBTA 1LD3A 7REQB 6YASA 2ID7A 4EKNB 1M1YB 1YMUA 2E5FA 2HF7A 2P9QA 1LSUA 1MVLA 2XJ9A 1PYDA 4ZMBA 2GCEA 3EGXB 2VZ9A 1QHEA 1ZMRA 4UU0A 5CX4A 5C5IA 4N12A 5EWLB 1Q7CA 3PYXA 4HN4B 4I4CA 3HFRA 1MTOA 3ZWPA 3RARA 3C8HA 2IZOA 4V39A 3SNHA 3L8HA 1WB9A 4JJKA 4OJQA 4OBWA 1DDIA 1H05A 1KJ8A 2DQ4A 2YHSA 4TTVA 5HCIA 3MWFA 3UUWA 1YDHA 4YJ3A 4QOEA 3NHJA 1YZNA 1Z08A 1TJ5A 1Y1RA 1X8XA 4KK3A 2PLWA 1DNPA 2VNKA 4ND6A 4UBKA 2RONA 1DO0A 3ZHVA 3FGPA 1RE1A 5CD9A 5CLIA 4M0KA 1JJIA 1TIPA 5BSWA 4CKCB 1Q0QA 5CT9A 3ED5A 5KAPA 2C3YA 1C3OA 1MKYA 4LSWA 4BX9A 2VYFA 1FP6A 3C3EA 4JNCA 5EIBD 3QEOA 4DBZA 1XXHE 1DT5A 2A9VA 2PX5A 4GR4A 3OE4A 5HYVA 2BMEA 3H5IA 5JAIA 4YIKA 3X1KA 4CYMA 5JG7A 1E1LA 2QVYX 2NO0A 3CE6A 3E8SA 4UNRA 1SCNE 1PR6A 5B4TA 1PFVA 2AR7A 5BSHA 5CG1A 1E2GA 2QS9A 1QRDA 3NTLA 4TM7A 3DL2A 4LCJA 4HX2A 5I4BA 4MW1A 4UU1A 3OIWA 3WBFA 3EEOA 4F6RB 2Y1CA 4QARA 1C5KA 4HQ6A 4L51A 1BQ4A 1NYQA 5CVCA 4I1OA 4I14A 3H5AA 1RFLA 2P2YA 2HLDD 2W98A 4JLOA 4GKKB 5A9TA 3H04A 1RRMA 1E60A 3GLKA 3OI7A 1J23A 4KYIB 4PGFA 3T61A 3TTUA 3EN0A 3IBTA 4LFAB 5E3IA 5KVCA 4ENUA 3SP1A 4Y9RA 1Y1TA 4OXRA 2Y9PB 1GZ7A 4YLYA 4MA5A 1KEPA 2NVBA 4OHKA 5A1TA 4G8BA 3DONA 3MCUA 2QMHA 5E9QA 3RT9A 1WHSA 4G4GA 3P2JA 4GHWA 4G84A 3KYDA 4DAOA 2PLNA 1EFDN 5EPOA 3O6VA 2XD4A 5DBOA 4X7PA 1KH2A 4FCCA 1JUDA 2W6JD 3KSDO 2VRCD 4R9VA 4UZEA 2KX7A 5JCJA 2RAVA 2QD1A 3SYNA 5CK4A 1YZTA 3COVA 3CZ5A 5JO9A 3SKXA 2X8JA 2LGJA 4P3KA 1RWNA 4KQIA 3JQ6A 3P19A 2ECFA 3V97A 4QODA 3ZU2A 4L9SA 5IBQA 3PX2A 3M8KA 2HBRA 3WADA 1M2NA 4PX9A 4GGPA 3M2TA 4C3ZA 4D9BA 3DUWA 3Q40A 3V8VA 3KPYA 3O47A 5D6OA 1QB7A 2QQEA 3G1UA 2Q1SA 3G0DA 3S81A 1JKFA 3QKRB 5TPZA 4OU5A 4FHZA 1WSAA 3GC6A 5E4FA 3T4UA 5JS7A 2HWKA 3F6YA 4JX9A 3CUUA 2OLJA 3NKFA 3PUHA 4PLGA 3RSHA 2DKOA 4YRBA 4F0JA 2J0QA 4JEUA 1TO2E 4QPZA 3SDBA 4PNPA 3TAHA 3PR2B 1UKBA 5LM3A 3HUTA 4RZ2A 3Q0EA 4QRIA 4U02A 1GVHA 2YVKA 5CD1A 3ESRA 5ELLA 2XKJE 1U2RA 7YASA 5BN1A 3GCGA 4GRAA 4RADA 1J42A 5ICCA 4JNKA 4QO7A 3DEHA 3RC9A 4OBXA 3G13A 1M2KA 3LBFA 2AKAB 2JRLA 4NCXA 1WABA 1PWXA 2FW0A 4LY9A