4L9AA

Crystal structure of smu.1393c from cariogenic pathogen streptococcus mutans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
ALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLPDSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVHSIGGFAALQIMNQSSKACLGFIGLEPTTVMIYRAGFSSDLYPQLALRRQKLKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRQLNDVQSLPDFKIRLALGEEDFKTGISEKIPSIVFSESFREKEYLESEYLNKHTQTKLILCGQHHYLHWSETNSILEKVEQLLSNHEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Smu.1393c
publication title Structural and functional characterization of a novel alpha / beta hydrolase from cariogenic pathogen Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 98
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l9aA00
5AH0A 2PUJA 3GUUA 5EFZA 3N2ZB 4G8DA 1UKBA 3EQ9A 5FKJA 2EDCA 2GZRA 5IKXA 4EY4A 5HQ3A 3PF8A 1SOMA 4G8BA 1UK9A 1GGVA 3HSSA 3F96A 4Y2YA 3QMVA 2ZJ6A 4FBMA 3AIOA 3G9ZA 4IO0A 4PSDA 1XZBA 4X93A 4X94A 3IDAA 2PPLA 2QJWA 3STYA 1X70A 1EVEA 1HBJA 4U2DA 4CCWA 1DTEA 2GZSA 4CG3A 1AUOA 5ALZA 5AJHA 3W05A 4V2IA 2GYWA 2DCMA 4QLOA 1R50A 4FKBA 3BIXA 2VAVA 2B4KA 2VA9A 4U2GA 3GBSA 5AKYA 3PUIA 5JAOA 3WL8A 3IUNA 4Y2JA 3WJ1A 2E3JA 5HFAA 4KE6A 3DKKA 3BE8A 3BDVA 5ALGA 1H2YA 4H7KA 4O08A 2HDWA 1QIGA 2HRRA 5ALJA 2DHDA 1VOTA 2XUHA 4DMCA 3I2HA 2QRUA 1QIMA 4BC1A 4FFVA 3OC0A 3WKBA 1WB5A 4I4CA 2FX5A 2CMFA 3PICA 1AQLA 5ALWA 1A7UA 3QH4A 4OUKX 2H9YA 4I19A 2EEPA 2JGJA 5AI0A 2PVSA 1EVQA 4FFWA 3GROA 4DIUA 1JFRA 4UHDA 3ZI7A 1K63A 1QTRA 1QIFA 2WIDA 4OYLA 1SFRA 2VT6A 4A5SA 5CXXA 1HDEA 1OILA 4LXHA 3G02A 3QVMA 3ANTA 5T4EA 1CEXA 3O4JA 4UBOA 3ILSA 3PE6A 4U2FA 4C87A 3AINA 3A70A 5AK3A 3IVMA 1PJAA 4MWSA 3G0CA 4G9EA 4B81A 3DEAA 3M81A 4U2CA 4HXGA 5ALMA 2QMQA 4B80A 5D3ZA 1MJ5A 4FWBA 5CH3A 4N8SA 1Q0ZA 3IURA 1H2ZA 3O95A 4CIAA 2ZSIA 1IZ8A 5EGNA 1FSSA 1P0IA 1QIHA 5LKRA 3HZOA 4BC0A 4QWMA 2O7RA 3V1LA 3G0GA 5AI5A 5JD5A 3M83A 4RNCA 5CW2A 1CUVA 5EIHA 4AQDA 4OU5A 1QO9A 1EXWA 3FCXA 5LYYA 4X6XA 2ZYIA 4HRYA 1JJBA 3R3ZA 3FWHA 2H7XA 1BS9A 1CUUA 1VKHA 3G8YA 5HQ3B 5ALSA 4YPVA 1SCKA 4I3FA 5FLKA 5H3HA 5HK8A 2G4LA 4DMKA 2Y2UA 2HU5A 3RARA 4AB1A 3TGLA 4UHBA 3DOIA 4UUQA 2OPHA 3FNBA 2OG1A 3F97A 1LPNA 1EA5A 1JMYA 2WUGA 2ONCA 3C8HA 3DD5A 4X92A 3G9TA 1XRQA 5K3BA 1CR6A 3Q8WA 4ARAA 5DNUA 3V48A 3H2GA 1IMJA 2PL5A 2PSFA 2B9VA 3IB3A 5ALTA 1U4NA 4YK7A 4HTAA 3BWXA 3STTA 1ZGBA 5KREA 4YX9A 2OGZA 1LPAB 5LZ7A 5CT9A 4OYYA 2HA4A 1RYYA 4KAFA 1R4ZA 2X8BA 2V98A 5AI4A 2DFPA 3AUKA 5EHXA 4J0KA 2GBFA 4NVRA 1EINA 3ESAA 5SYMA 1PFQA 1UXOA 5AI6A 4PSCA 1CPYA 3FBWA 4H35A 3K2IA 2RHWA 3E0XA 1DWOA 2BFNA 4AZ0A 1CVLA 1ZD3A 3CN7A 4MQLA 4C89A 5JARA 3ESCA 2X76A 1CRLA 3O4IA 3FVTA 5K3AA 1MPXA 5HF8A 3SC2A 2BGRA 3EQ8A 1C7JA 3WL6A 4WY8A 2WUEA 4OSEA 3WWOA 1J1IA 1GQRA 3BJRA 1K6EA 1ZGCA 2UZ0A 1FFDA 2XDWA 3O9MA 5DNVA 3EBLA 3DQZA 5YASA 3IIIA 5C7YA 3DOHA 4C01A 4N5IX 2WIGA 5AM0A 1QZ3A 1XQVA 3JWEA 4EZIA 3HABA 2OAGA 3WZMA 1YA4A 1WM1A 3DNMA 1GZ7A 4HAIA 1E5TA 2VSQA 4DNFA 1GPLA 3HYSA 4J7AA 4CG1A 4EY6A 3AZQA 4Y2XA 3G0DA 4QE3A 1EB8A 3F67A 1A8SA 4E11A 4ZRDA 5T4FA 5JYCA 3H0CA 4KR0A 1CUSA 5J3JA 3AIKA 1LPBB 2O2GA 3DKRA 1UWCA 3AZPA 3WWDA 5HCUA 4W1PA 1N5MA 3STWA 2QZPA 3C8DA 5JALA 1XRMA 3FYTA 2JIDA 2C0QA 3RLIA 3DL7A 1LPPA 3R3XA 4CG2A 4IQ4A 1QIEA 3P2MA 3I28A 3IUMA 5AM3A 1T4MA 3R3VA 1XKTA 5CMLA 3I1YA 4H0CA 2WHQA 5FOQA 2G63A 3OOSA 3HC7A 3MUOA 5DTJA 5LZ9A 2PU7A 3QMMA 5ALRA 4H7FA 4Y2PA 2GYUA 2G5TA 4Q82A 1MX1A 2XUAA 1ZI8A 3SWWA 3DLTA 2Q0XA 2CBGA 5DYWA 5HF6A 1XRNA 3G9XA 4PV7A 5BWBA 3C6XA 4FMPA 3VJMA 2WIJA 5LZ5A 3G7NA 2RAUA 3D3NA 4ZXFA 2PKYX 1ORWA 2WFLA 1XZMA 2XUKA 1XRLA 2VJDA 4AN0A 3C5VA 5FRDA 3A6ZA 4ZWNA 1UZAA 3D2AA 4WFKA 1EDBA 3PI6A 3QMWA 1CV2A 1A8UA 1P0PA 4GBGA 4WDQA 4W1RA 3F8SA 4QDOA 4EUSA 3B3QA 4C6HA 1QOZA 4BCCA 1XQXA 5FP0A 3NOXA 3KWJA 1MX9A 5AKZA 4B0OA 1KEZA 4BZZA 4EY7A 4Y2SA 3I2GA 2JGFA 2XUDA 2XMSA 4BVJA 3D2BA 3GFFA 4UBJA 2K2QB 1Y37A 4LYEA 4J0CA 4FNGA 4B9EA 1Q83A 4NMWA 5HKBA 5EHNA 2W22A 2ZYRA 4F5ZA 1KU0A 5AIAA 1JU4A 3E3AA 4FOLA 3EIOA 4PW0A 3LLCA 1XZEA 2AJBA 1AGYA 4TVKA 1VE6A 2VATA 3C87A 1MAAA 3H2HA 2QUAA 1BEZA 1F0PA 3GZJA 2I03A 5A7HA 4CFSA 4B83A 2VEOA 3FCYA 2FJPA 4Z49A 4NS4A 3BDIA 1GQSA 2RI6A 2ES4A 2ECFA 1DX4A 2J3DA 3V9AA 5HKAA 5JATA 3R40A 5AOAA 5A2GA 3C45A 4RE5A 3BL8A 3WQHA 4TPKA 5HF9A 3IULA 1JU3A 2ACKA 2X5XA 4BRSA 4EBBA 2XMGA 3UUEA 2O2IA 3SK0A 1OCEA 3H1AA 4H7JA 2OAEA 2J3QA 2CEKA 2Y2VA 3WI7A 3ZLUA 1P0MA 2H7YA 4TGLA 1L7RA 3NUZA 2XMCA 1CUHA 2WILA 1JKMA 3B12A 3KD2A 4X6YA 1ZI6A 2XUIA 4AMZA 2WHPA 3ICWA 2HU8A 1CUYA 4XWGA 2W6CX 5EI5A 2XUFA 2WTNA 2H1IA 3MVEA 5C8XA 3I2FA 3H19A 5CBKA 4EB0A 1YSCA 1OXMA 4GWLA 3TRDA 1AX9A 3LS2A 2JGKA 1MNQA 2XMBA 4LXIA 4KAJA 1BN7A 1ZI9A 2XLBA 3WYDA 5EHQA 1NU8A 2PUHA 5AKLA 4FLMA 4RGYA 4LIPD 3FLBA 1THGA 4X7BA 1MU0A 4QDXA 4QDZA 4RPCA 5K3EA 1UK8A 4Q3KA 3PFBA 2PSJA 2CJPA 5AKHA 2WFZA 2BGNA 2WFLB 1XZIA 4S0XA 4BVKA 4G4IA 3BIWA 2HM7A 1U8EA 5AHXA 1GT6A 3H17A 4FLFA 4BATA 2JGEA 3W04A 1AC5A 1QE3A 4C4YA 4G9GA 2RGUA 4OB8A 3R3UA 1UK7A 2Z3WA 4EA6A 2XQJA 4WY5A 1YASA 3STVA 5I7UA 1UKCA 4AMYA 3D2CA 1AKNA 1CUEA 4H77A 1WHSA 1R9NA 3CN9A 1QIIA 5IVHA 1YS1X 1W4LA 2WG2A 1ZD5A 4AZ3A 2B20A 4BP9A 4PF1A 1LZLA 3WK9A 1VA4A 5A7GA 3BF7A 1L7QA 1H23A 1BRTA 1Z68A 1HL7A 4H7DA 5EHZA 3S2ZA 1YCDA 5ALEA 5AIBA 3I1IA 5A71A 1ORVA 4ZV9A 2BJHA 1LPMA 2V9ZA 4U2EA 5IVIA 3WKEA 2OQIA 3B5EA 5JAHA 2J4FA 2HFJA 1CIJA 4Y7DA 2Z8ZA 4H7EA 3SX4A 4LYDA 4FBLA 3I6YA 5LZ8A 4QNNA 1THTA 3CXUA 4MEAA 1DT5A 4LKOA 5CRIA 4UBLA 4HXFB 1CLEA 1RWQA 1MN6A 5IH7A 5LKAA 2XI4A 1TAHA 4K6GA 5T4BA 2C5FA 3WK8A 4X00A 3AIMA 5A7FA 3IBTA 5CT4A 1TRHA 1ACLA 2XMRA 1VZ2A 3UUFA 4BCDA 4A23A 2WUDA 2QS9A 1MTZA 2WHPB 2XE4A 3KDAA 1SCQA 3FYUC 1JMKC 1EI9A 3O4GA 1F0NA 1USWA 1ZICA 4B6GA 3QM1A 2XQIA 5FPQA 4QDUA 1YS2X 1LBTA 1ZIXA 3QITA 1H2XA 3PUHA 1IUPA 4XX1A 1Q0RA 4Y2VA 4Y2RA 1JJIA 3HACA 1LGYA 1GKKA 3NWOA 3WIOA 1A88A 4DMFA 3ICVA 1XQYA 3N0TA 4E14A 1BU8A 4IHAA 4KRYA 4OU4A 2H7CA 5IVDA 1RP1A 3C70A 5AM4A 1VXRA 3L1HA 1QLWA 1ODCA 2OCIA 2HL6A 4DSAA 3R3YA 2IITA 5JASA 2WG1A 2QT9A 4ZGBA 2WJ4A 2QUBA 4GW3A 3ESBA 1N5RA 2EDAA 1ZJ4A 1EDDA 1FFAA 2YYSA 4DNOA 2HA7A 1CUDA 1AURA 3OURA 5LIPA 4BP8A 1EB9A 1NX9A 1WOMA 1UT6A 5C8VA 3WA7A 3CCBA 2JBWA 5AM5A 1J06A 3WYNA 3WA6A 3LIIA 2CZQA 2XUPA 3D7RA 3EF3A 4UFOA 4X6UA 4GHWA 1XLWA 3DL4A 3WKCA 2QM0A 4QDTA 4EY8A 2D5LA 2HADA 4BCBA 3A2LA 4CIBA 3I6MA 4H7HA 4Q3LA 2WU4A 4XIIA 1HQDA 2I3ZA 5EIEA 4DNPA 5FDFA 3K6KA 1VA5A 1UK6A 1E66A 2JEZA 2JEYA 4KEAA 4K2AA 1GKLA 3H2JA 2AJCA 3QPCA 1HLGA 4BYMA 3VISA 1ODSA 5AKXA 5CXUA 4Q1VA 4EY5A 4KJXA 1G4HA 5JZSA 2OQVA 1DQYA 1C4XA 1DQZA 2J4CA 3DCNA 1F6WA 2WJ3A 1EK1A 5K5EA 1ZD4A 1QJ4A 2RHTA 4Y9SA 2PU5A 3WK5A 4DSZA 1WCYA 1FFBA 1XZKA 1CUFA 3ZLVA 4HZGA 5ALVA 4LHEA 5JD6A 5AKIA 4JYMA 1CFJA 2QTBA 4X3CA 4EHBA 4AN1A 3UMJA 4ETWA 4UPDA 4W63A 4E15A 2GYVA 2OGSA 3FSGD 3QBJA 3HRHA 4GXNA 1QO7A 1GPNA 4KACA 1CUWA 5ALKA 1LPSA 5ESRA 5CT6A 1BE0A 3VKFA 4ZI5A 2PM8A 5JADA 5A62A 2VT7A 4J03A 2Y6UA 2XQKA 2O2HA 5AKJA 5AM1A 3W9UA 1K5PA 2VJBA 1Q84A 5HF5A 1TIBA 2C0PA 5K3CA 3C43A 4OB7A 1B6GA 2NW6A 3DYIA 2QOEA 5DNWA 4B0PA 1XQWA 1JI3A 3OG9A 1DWQA 3W06A 1TQHA 3ZV7A 3O4HA 1ZJ5A 3R41A 1P0QA 1DU4A 2BAGA 2DQZA 2OCKA 5ALXA 1O6FA 3D0KA 1E8DA 4Q34A 1XZDA 2WUFA 4K6KA 2C58A 2OXEA 1R88A 1YB6A 3HLKA 4LXGA 5CT8A 1EHYA 4L9AA 1FFEA 4QLAA 4UBNA 1B41A 2WG0A 1R3DA 2HA6A 1J07A 1EX9A 4L72A 5ISMA 1VJ5A 4ROTA 1IUOA 3WJ2A 4M0FA 3MGAA 1O6GA 5AOCA 1CUIA 1S8OA 2ORYA 1QONA 4ZV7A 2WQZA 2ROQA 4AO8A 1XZHA 2OCLA 5F4ZA 2XMQA 1I6WA 3C6YA 5LZ2A 3FLAA 1X2BA 2DHEA 4QZVA 4L3WA 2ACEA 1CQWA 1K8QA 4MXDA 2R8BA 4UFNA 3FOBA 4UHCA 1XZJA 1XZGA 3ZPXA 5JZBA 3STUA 4U2BA 2B61A 2ZJFA 4W9RA 4MYDA 5FV4A 4P93A 3WZLA 2JF0A 5K3DA 4K6HA 1T2NA 5JANA 3D59A 3T4UA 2WIFA 4BDSA 1DINA 1VZ3A 1CUAA 2WJ6A 1XFDA 4YASA 2WSLA 4ITVA 3WMRA 4QEKA 3EQ7A 5DJ5A 4UHFA 2YASA 3WKAA 1ZD2P 1CUGA 2GBIA 5SYNA 1QIKA 1BN6A 1DX6A 2VJAA 4DM7A 2QXTA 4BDTA 5AI8A 4QWWA 4MQMA 5CURA 4P92A 4MWTA 3U0VA 4UBKA 3TEJA 2XUJA 3VJLA 4PQEA 1WB4A 2CB9A 2QR5A 5CT5A 4BBZA 3ANSA 4X85A 3STXA 3VDXA 5JD4A 4F21A 2C5GA 3E1GA 4JH0A 1LLFA 2I3DA 3DS8A 1DT3A 4N8DA 5LLSA 4UBIA 2JGLA 3GA7A 1AMNA 3YASA 1ODTC 1XLUA 2XUGA 4CCYA 4FNMA 2ZYSA 4DNQA 1BROA 4K5QA 5D6OA 5AICA 3H2IA 1JJFA 1Y7IA 3FLEA 3O9VA 3JYHA 1UKAA 4UHHA 3KWFA 2XB6A 3QZUA 3WK4A 2WIKA 4B84A 4J0DA 1UOPA 4M0EA 3VVMA 5LZ4A 1CUXA 4RE6A 3AJAA 4FDMA 3AZOA 1DWPA 3DJYA 3AILA 4X95A 3OPMA 1MT3A 2HRQA 1VE7A 4J0JA 3T52A 4JUIA 1TCCA 2QJRA 5AK6A 2PX6A 4Q3OA 1C7IA 4BTLA 5C81A 3W9BA 2D0DA 5E4YA 2ZSHA 1WPXA 5E4JA 5E2IA 3D5EA 5ALNA 1XZFA 3PDCA 4H7IA 3WLAA 5E4TA 3FSGA 1XROA 2VQ6A 4PNZA 1TCBA 4CI9A 4BE9A 2QKYA 1F8UA 3JW8A 2WLSA 2HU7A 3WK6A 5AK4A 3A2MA 1HPLA 4C4XA 4AO6A 1E8MA 2CUTA 4P9NA 2DSNA 4DGQA 2BUCA 5ALDA 1LBSA 5AM2A 2WFMA 3E4DA 1ETHA 2Z3ZA 1VLQA 4A16A 4OB6A 4HRXA 2V97A 5ALIA 3ED1A 2DQYA 4JNCA 4WDRA 1H2WA 1MNAA 4QA9A 5FXMA 3WKDA 1YAHA 2RIPA 2YXPX 2AXEA 4X91A 1W76A 1GXSA 4ZREA 4IH1A 4UBMA 5ALPA 4X97A 4GLBA 1YR2A 2G5PA 5AI9A 4B9AA 4GEGA 4MEBA 5ALHA 4X90A 1QGED 2O7VA 4IH9A 1E3QA 2JGIA 1W1IA 3G0BA 3WWPA 2HIHA 4MJ3A 4N8EA 1HKHA 4G1FA 4AX4A 5KBYA 4DMHA 1X2EA 5A6VA 1XKLA 1G42A 2C4HA 4GDMA 2OGTA 5AO9A 3G9UA 1YA8A 5BV7A 4W1QA 1U65A 1LPOA 3CCCA 3KOOA 3QPDA 3HJUA 2BUAA 4PSUA 4B82A 1NU6A 1M33A 4BZWA 2ZJ7A 2OLEA 6YASA 3WL5A 4CCYB 1UFOA 1SCIA 5AOBA 4FLEA 4JYPA 1EH5A 5AKKA 4Y2QA 1R9MA 2Y1KA 3U1TA 4Q05A 2XQFA 3OTQA 1FFCA 5KWJA 4DTCA 4H18A 3F9CA 2YH2A 2PSEA 3D4LA 5ALFA 4NZZA 5JAUA 5ALQA 3QYJA 2FJ0A 1MAHA 3RM3A 3BF8A 2HA2A 1A8QA 5ALUA 1YAJA 2WU3A 3RK4A 1ZIYA 5FPPA 1WPRA 5DLPA 4J0GA 3W2TA 4JEIA 1L7AA 3HXKA 4F0JA 5EIAA 3ZWQA 4M0MA 1QFSA 4Y2UA 1IZ7A 1KU6A 4G8CA 1ISPA 2Y6VA 1E89A 3WWCA 4WFIA 4BAGA 3S8YA 3BJMA 4HVTA 5BOVA 1EK2A 4W1SA 2IIVA 2P8SA 3Q0TA 1CUJA 4L0CA 1JT2A 5AKGA 5AK5A 2HA5A 1XRRA 5D7BA 4AO7A 4HXEB 4HS9A 1N1MA 1FJ2A 2AJ8A 2WKWA 5BWCA 3VJKA 5HK9A 1ZOIA 3LP5A 3VXKA 2WTMA 3V1NA 1LNSA 4J0IA 4KAAA 4XJVA 1MX5A 4BAZA 3IUJA 4BE4A 3H2KA 3PF9A 3M3DA 3M82A 2XUQA 1EDEA 5I8PA 1ACJA 1CUCA 2I78A 2XUOA 4F60A 5K3FA 4WFJA 2ZYHA 4BVLA 5IVKA 1QIDA 4BAUA 3K9BA 3R3WA 2JGMA 3FAKA 2AJLI 3FYUA 1SC9A 4WCVA 5HFNA 4OCZA 4XVCA 4KYVA 1Y7HA 1QFMA 3IUQA 5CTAA 2CKMA 3I2JA 3C6ZA 5DYTA 5AP9A 1N8SA 1XZAA 1H22A 2PSDA 5DWDA 5ALLA 1BCRA 1BCSA 4C88A 4J0HA 1TKRA 4G4JA 3H1BA 5CH8A 5D3KA 5ALYA 3VVLA 1GPKA 3AFIA 1MO2A 4B85A 1XRPA 4BRZA 2PBLA 4B7ZA 2Z5GA 2HFKA 3C6BA 4ARBA 4BB0A 1UOQA 2DR0A 4WJLA 3RKSA 4GECA 3ESDA 1G5FA 3LIPA 5HZGA 2HA0A 4G5XA 2XLCA 3H04A 3L1JA 1IVYA 1LZKA 4J3JA 3KSRA 3O0DA 1CUZA 2VF2A 2LIPA 1U2EA 3NGMA 2QVBA 4E46A 1XZLA 1XZCA 1QIJA 4MYSA 1WB6A 2OCGA 1R1DA 4N5HX 4C4ZA 2XMZA 5I9IA 3QPAA 4DYHA 2XQGA 4UFPA 1XLVA 4KE8A 3X3HA 1TK3A 4IH4A 4AXBA 3DDUA 3BXPA 2FUKA 2VJCA 5JIBA 2WM2A 5DTIA 2VAXA 4DLNA 3V1KA 3H18A 2Z8XA 3WK7A 1W52X 4P08A 2HHAA 2BKLA 5ALOA 2PSHA 4D9JA 3A2NA 3DYVA 4FTWA 4FHZA 4KE7A 2BCEA 5C8ZA 1UOOA 3I2KA 1YB7A 2GBGA 3L1IA 5LP1A 3GELA 5JZ9A 4X71A 2HA3A 5CH5A 4OD0A 3F98A 3I6ZA 3IA2A 3TJMA 2C7BA 5KWIA 3V1MA 1D07A 4Y2TA 1PV1A 5DYYA 2DHCA 4GI1A 3PFCA 3WWEA 4BTVA 2XT0A 5JAPA 7YASA 1WHTA 3HEAA 2VTVA 5T4HA 1CUBA 3C5WP 2XMDA 1W75A 2QXUA 3ZLTA 3LCRA 1TCAA 3HI4A 2BUBA 1BEEA 1CQZA 3MUNA 4INZA 1G66A 1J2EA 1E8NA 2WHRA 4G4GA 1QTIA 5FUMA 2R11A 3WIBA 1AZWA 3I2IA 3KXPA 1W6RA 5AKEA 2GBCA 2IX9A 1K4YA 2ZVDA 4KRXA 3WL7A 3OM8A 2RONA 2AJDA 4KE9A 4OPMA 5K3FB 3G0IA 4PO3X 1VXOA 4UHEA 2V96A 3FVRA 3FYUB 3R0VA 1IUNA
chains in the Genus database with same CATH superfamily
3E82A 3FNHA 5AH0A 5BUZA 2R00C 1PVDA 1NIJA 3NBKA 2QSJA 3L4KA 3KVYA 3EIXA 4BNLA 2I3GA 3ZDXB 3O2SB 2LUOA 1ZOOA 3PC2A 1OLUA 4DR4B 3QKIA 4RQAA 2ZREA 4WN9B 2NZVG 1GGJA 4XX0A 4AIRA 2GZRA 1W0JD 1PKXA 1QK5A 1J21A 4GGPA 5BVGB 1VHDA 3M2TA 3CFYA 4EKGA 3B1KA 1BCRB 1X7XB 5IANA 2L18A 2PMBA 1J70A 5EMKA 4QU5A 4M36A 4D0LB 3GRUA 3AUUA 3VNUA 2HAEA 1OTHA 1LF0A 4P4SA 2C9YA 4CMHA 3GU3A 3FWPA 1IHUA 3ENZA 3JWPA 5L3ZA 2EIXA 2X6QA 1RWKA 2QK4A 1WPQA 3ZLBA 1IBCA 1XZBA 2J8ZA 3PPWA 3EVDA 3IDAA 4X94A 1NOJA 5EIBC 2I7VA 5B6PA 3STYA 4MS4A 1C1YA 1K4MA 1RIFA 3IQIX 2A30A 2FK8A 3Q41A 4MUBA 1V7PC 4ANFA 5B36A 3A4LA 1PK8A 5EUMA 1R3UA 4ZYYA 1F1JA 2E9SA 1T5BA 1HBJA 2Q5EA 3H16A 5AT1A 3VNVA 4M8SA 1C1XB 4U2DA 4BNTA 3S27A 2WHEA 1MC1A 1KZYC 2D4AA 4D25A 4RHXA 1FUKA 4OG2A 1J1UA 2FZLA 2ZR0A 2W98A 1XWIA 3MJFA 3PNSA 3W05A 1Y1PA 3GA0A 3H13A 2GNOA 3KJXA 2D7CA 3E84A 3Q3HA 2VPWA 2DCMA 1JHAA 1JG6A 1U7HA 3IA7A 1SZJG 2PZAA 4OQPA 3ZWOA 1ZAKA 3ESXA 3NTVA 3K1YA 4RD3A 2RGNC 3FHOA 4WJKB 1T8UA 3AKEA 1NW8A 4X1YA 1JQDA 1NG9A 3VO1A 2B21A 2ZW9A 3WLRA 4CKBB 3LQKA 1V4NA 3ZOKA 4M9CA 1BWQA 3WL8A 5GP1A 3MT8A 2E3JA 2FPIA 1IEXA 1OT5A 5CM2Z 4MITA 1E5LA 2A1UB 3P9NA 3N87A 5TEVA 4AS1A 1DI0A 1VI2A 3LUBA 1ZS9A 1G6HA 4DQUA 3BDVA 5F1KA 4MHTA 2D5CA 5COQA 3K94A 1KDYA 5A6SB 1CDEA 2JAUA 1QIGA 3TZKA 3ZJYA 4NU5A 3Q3VA 4MLCA 1SCNE 1Q1QA 3NBYC 4TYNA 2HRRA 4Z54A 3TG8A 3F7NA 1P7PA 3AO0B 3BFKA 2GPBA 1HT1E 5JC1A 4RPIA 3FR8A 4LDPA 2D0PB 2JJQA 4ZAVA 4IDNA 1F20A 2APJA 4DSOA 2NUBA 4BC1A 5DBGA 3O4VA 1JVSA 3OC0A 3TUZC 1JKFA 1KAGA 1UJ6A 2AG8A 2ECQA 2OENG 4TMXA 5C1BA 3WKBA 4JDUA 1GLNA 1L6RA 1WB5A 1QQ6A 2J7PA 5D5QA 5EWMA 2FX5A 3HVRA 2CMFA 2EZ9A 3LI2A 3C98A 1VYVA 1CZLA 4F1JA 1L4UA 3QXGA 4EBBA 2FOIA 3G2KA 4I19A 2A9RA 5B12A 1XWWA 1FVXA 3GJXC 2HWKA 2EEPA 4OIMA 1QYWA 3JQFA 3CUUA 3PE4A 5AI0A 1GEGA 2I1QA 3DT9A 4MVXA 5EXTA 2A9JA 1YJXA 3MZ0A 5EIFA 2CHUA 2NU9B 2GI4A 3KX2A 1R6TA 1H66A 1SVOA 2CC2A 2ZULA 4JYBA 4K9SA 3ZUGA 5CDTA 1YRAA 3S4YA 1CQJA 1GT91 3UKJA 3ZGLA 4JP5A 4GKJB 2LV8A 4I50F 3MTEA 5CLJA 1ZN9A 3COSA 4ZIRB 5JFTA 5AW8A 2AWNA 3C3DA 3U61B 3OX3A 4MR7B 4YJGB 5DM60 4D4IA 1E92A 3TVYA 4O0MA 1L4NA 2JIOA 3IPXA 4JJFA 1VJDA 1KA9H 1M83A 1G59A 1B43A 4Q9AA 3RROA 2VQ3A 2V4ZA 4QBHA 1KMHA 3ZW9A 3QW4B 3X1XA 3SF0A 3HXPA 1OILA 3SX0A 5C7IO 2P4UA 3G02A 4IGEA 3WAKA 4ALMA 1OBHA 3GFVA 5FTNA 5FORA 3O4JA 4BUJA 4NAVA 2TYSB 3FYSA 3LA6A 2O6HA 4WZAA 1N2SA 2Y1OA 1C9KA 3KVVA 3D6TB 1TIKA 1TJ4A 2AOUA 3GWGA 3DV2A 4GKAA 4R1SA 3ZH9B 1N5IA 5BSFA 1GCAA 4KPYA 4KR3A 2GSWA 3IVMA 1P4HA 4MWSA 1ISJA 4JL5A 2Q3BA 3G0CA 3WJ7A 3NWPA 4P4NA 3S3TA 3FI0A 3QKSB 1Z07A 4LI0A 1TJNA 4BASA 5ALMA 5A1JA 3L1UA 1M2FA 4PCAA 4B80A 4DXHA 5BR8B 4G0NA 1FP6A 1MJ5A 4ID3A 3ZQ4A 3IJ5A 4NZYA 1CZOA 3BB3A 5CH3A 3H42B 1RQNA 5D00A 1H42A 4U6SA 3OTOB 1SIUA 2R8EA 4NLLA 3HGMA 2BF7A 3U49A 4CQMA 4JUCA 3DMGA 4AVYA 1WXEA 2QN8A 3K3PA 3AUYA 4XEUA 4C4RA 1NQXA 4MDFA 1UWLA 1UMKA 2YY7A 3O95A 2IYFA 2A3RA 1C7RA 1DG3A 2ZSIA 2PGAA 1N0HA 1K5DA 4I66A 4KQ6A 1QV7A 4QREA 5HUJA 5CA1B 4D56A 4D46A 3P5BA 3H84A 4JOCA 2EU8A 1NLZA 4EUFA 4TKVB 4E30A 2BLNA 4YO8A 4J8PA 4HH1A 2E37A 3S5JA 1Y6ZA 4TT3D 3RYFB 4BQPA 2VJQA 4A9AA 4KO8A 1IL0A 2DTEA 2QN1A 4LX8A 4F3CA 1FFHA 3E53A 3U31A 3JQAB 3M83A 5MGNA 1C8LA 3QUQA 3WDLA 4IMIB 4U0JA 1C0PA 4TTSA 1CUVA 5H1YA 5EIHA 5PGMA 3IUBA 3QF4B 2VRNA 1QQ7A 3BERA 3MWDB 4XSGA 1QO9A 1DAIA 1EXWA 5FTWA 3FCXA 3SFVA 4X6XA 8LDHA 1ZSYA 5A3VA 3EZFA 5KI6A 1RWVA 1OWPA 2YFQA 4LEIA 4Q12A 1M2OB 3OA0A 4HRYA 1JJBA 3AMVA 4P3PA 3QNMA 3FWHA 4LHZA 5KAMA 5HGXA 2BC9A 1BS9A 2N42A 1VKHA 3CEJA 1Z5GA 1FL9A 1QGAA 3OPXA 3KQTA 3ME5A 4LJSA 3TE7A 2O2CA 1IHPA 2WMYA 1OU0A 1DV1A 1RAIA 4FW8A 4PR3A 5B30A 5HKKA 1R8XA 2VI5A 1MVOA 2ZRFA 3G2LA 1QH8A 1XFAA 2GDZA 2VYFA 4IGIA 5M04A 3QU4A 5A9RA 5IM5A 4DMKA 3FAZA 2M1XA 2Y2UA 2QW0X 3COZA 4FPXA 2HCBA 5COBA 4AB1A 3OU2A 4BQOA 3AKCA 2IRWA 4UHBA 1I4TD 2WQ7A 2H8KA 3PGA1 2P9QA 1AV7A 1PEYA 2GGSA 3IQDB 4QTTB 1M34B 2A7XA 4HVLA 3FETA 1JMYA 5AJZA 4F1KA 3RYCB 3K0HA 4HWKA 1E4YA 1E6CA 1M2VA 4MVJH 3DD5A 5J2UF 2QIPA 2C42A 3M3PA 5I51A 3JAKA 4L8YA 3L7OA 3MMSA 1U98A 2PR2A 3PXUA 1NC3A 4TKUA 1O57A 1XRQA 1SRRA 4XGIA 3B48A 4W5JA 2Y76A 4MIOA 1CLUA 3IO5A 3Q8WA 4ARAA 1MFPA 3DFFA 3TFOA 2E18A 1DQPA 3FFAA 5JAIA 4ZQFA 2WB4A 5JI3E 4MAFA 2YZMA 4O4JB 1C1HA 1SUFA 2GD0A 2VNAA 2VPYA 4IHQA 5IDVA 3UC5A 3ZGNA 3DVSX 1JR2A 2D2VA 3IB3A 3NPAA 3A3KA 4Y3UA 2EFEB 3EZLA 4WZBB 2VSOA 5IZCA 1X7ZA 3O8DA 5K0JA 2IHVA 4YK7A 1EZZA 1TO6A 1FQKA 1WUYA 2FR8A 3BWXA 1ZGBA 2I7TA 3FX2A 4HTAA 2OGZA 4RK1A 4UTVA 3LUDA 2VYVD 5FJIA 4WASA 1JSLA 2IGBA 2NVUA 1RYYA 5FO1A 5J2TF 3ZV3A 4UMEA 4TM7A 2V98A 3B3FA 2DFPA 3K31A 1LJUA 3PNPA 4GXQA 4KP7A 4MPRA 1Q1ZA 4EKDA 4NVRA 4GPD1 5JZOA 5H82A 1EINA 2HLHA 3KPYA 1PFQA 3OFJA 4KU4A 4QATA 1U9YA 2SKCA 4WQMA 3CW8X 4BFWA 8ADHA 1T3GA 3NHUA 4PSCA 5TARA 1CPYA 2GRUA 3SNKA 4JC8A 3IAM1 1LI5A 3V4RA 1KPGA 1QVZA 5C80A 1WCWA 3BGWA 3LBYA 1VYUA 4EATA 5I3ZA 1JEAA 5IU6A 1V0JA 1NBOA 2Y27A 3BDAA 4UE3S 3TLEA 1TRKA 2I3AA 1DWOA 1XQ9A 1AKEA 4HFNA 5HRUA 4YONB 1CVLA 2Q5LA 1PSDA 2WT4A 1ZD3A 3GGOA 3LC1O 2X76A 1L5WA 4RACA 4BFLA 1Z5OA 1WCXA 4G1MB 1QAMA 2C83A 2MINB 1B2LA 4J7XA 4JIMA 1DEAA 4E1VA 3E7PA 3FVTA 5LSAA 1M67A 2IOHA 5AESA 1QVAA 4KW7A 1GU0A 1NSYA 2EIHA 3L40A 1JXOA 3VBCA 4TLDA 4A15A 2IX3A 3C48A 2QN9A 3EB9A 3LGAA 1QKIA 2C2BA 3UW1A 3JASB 1GTRA 1T4DA 2CFRA 1KZ7B 1YZUA 3EQ8A 4QXPA 4B79A 5EAIA 3ESYA 4WY8A 2PX3A 1KDVA 2AUNA 1ZXXA 2BP7B 2O23A 4I55B 1M1YB 4FYPA 2I2CA 2QLNA 3MMPA 3WLSA 1L5LA 3BJRA 2XH8A 1RVV1 1WXGA 2IPOA 1K6EA 1X0VA 5C8YF 3PX7A 4KXQA 5FL3A 1SU6A 1OZFA 4BNIA 1Y3BE 2NT4A 1A2QA 2O2DA 2CXQA 1DQRA 2VUUA 3H11B 4J16C 1B8PA 4U8GA 3RODA 1NURA 4B87A 1N32B 1GUAA 2A5YB 2QWXA 4MB0A 1UBNA 2VTEA 2BMWA 3DQZA 3IVXA 5G0WA 1O0BA 5YASA 5I7EA 1A96A 3IIIA 4D8XA 1KP3A 2QUHA 1FXSA 1EX6A 4Q3AA 2AQIA 4ZI3A 2QUKA 4ABYA 2VYCA 5DHSA 3HJBA 2G71A 2F3TA 1HK7A 2O3QA 3FPHA 5LP6A 5JCPA 2GHQA 1W6UA 2WWVD 4LDZA 3JWEA 5LB4A 2FN9A 1BD4A 3U81A 4LMAA 5IAGA 1GQQA 4GC9A 1P4AA 1JQEA 4P3XA 4EX6A 1CEQA 1IMOA 3R6TA 1U2GA 2RFLA 3B51X 1G41A 2ZS7A 2R4QA 1E5TA 4D3ZA 1GPLA 3W8NA 1AS0A 3ZBQA 3SC3A 2C5AA 2GD1O 3K0FB 4CFZA 3GGPA 3DAFA 2HSGA 2D1QA 1TM5E 3JQ8A 3RSCA 5EJ5A 1K7FB 3GFRA 1VCOA 1SBQA 2JJ8A 4RIHA 2CNWD 3K0AA 5BR7A 5HDBB 4QE3A 2PX8A 4UU8A 1BVUA 5B1SA 3DHNA 4FMCB 4UKDA 2JAWA 1EB8A 5FAXA 1JIJA 4E11A 3PD7A 1JYEA 3V4ZA 2UZ1A 5F2KA 1K2WA 1UC4B 5T4FA 3UOGA 2FZKA 3AVYA 1CBUA 1XUOA 1NVMB 1AXEA 2YJTD 2ZU6A 2W90A 2OFFA 4WKPA 3U39A 1U6KA 4UQOA 3ZI0A 1KAMA 2OBBA 4RQBA 5KKAA 1ZCJA 1QYVA 2V7VA 4X8MA 1LPBB 1FXWA 2O2GA 3EUEA 4IIJF 4ZI2A 1MORA 1GZ3A 2YN2A 4A8PA 3HBFA 4C4PA 1OAAA 4W1PA 5CNKA 4P36A 3HO1A 4DEYA 4US1R 4Z4FA 2GXQA 2H8GA 4UPEA 1XRMA 4OHPA 3DAOA 3G8AA 4MR9A 3WNQA 3NP7A 1VMEA 5HMLA 1O9GA 1DKMA 2RK3A 3IXMA 1Q3HA 4ZZIA 3CJQA 4O2AA 5JANA 1DKUA 3DUWA 4KQWA 5TPWB 3F9IA 1L4BA 3HKEB 4HR7A 4Y2HA 3RLIA 2FMKA 1IG0A 2PD3A 3TXYA 2XJ9A 3DL7A 3JQ9C 3A6DA 2IBSA 1QHHA 3HN2A 3QRWA 3O1LA 3GVXA 3E9MA 2PRKA 2B3DA 3GRFA 4E2XA 5JVDB 5JMOA 3NDIA 3V6LA 1PW7A 1QIEA 5EQJB 2CV1A 3QFHA 3T1VA 1W36B 1MAWA 5JECA 1X94A 4U7FA 1P29A 4F7WA 4FNOA 4G6ZA 4H16A 2NXJA 2XADA 3IEIA 2LZ0A 1JH9A 1W2WB 2F17A 4IEFB 1M1UA 1RCUA 1WCV1 3OOJA 3CF0A 4DA0A 1KQFA 4AIIA 1T4MA 2KB0A 4CMKA 5B3JC 1X1RA 1WBJB 2EC5A 2X0NA 2GYYA 3R3VA 1T26A 3E0QA 1HNXB 3LGSA 2ZJ5A 3FYCA 1WDMA 1EFTA 1UBFA 4H0CA 2WHQA 1T10A 4GDFA 1JR6A 3GJRA 2BTQB 1WTAA 2HSEA 3LY9A 1DNPA 1N2HA 4YNBA 3MUOA 2PD6A 1AKMA 2X5JO 4BO9A 1ILEA 1OSNA 1JWLA 2P2YA 4EB6B 2XXAB 4H7FA 4M1KA 3A04A 3CKKA 1PZNA 4FK8A 2OBNA 2V7PA 3H65A 4Y2PA 4FJ0A 1P2BA 1UAGA 3ONNA 4K6MA 4BNKA 3NAMA 4Q82A 2OO7A 1FUUA 4BNYA 1KDOA 2PWBA 3IEXA 4KGDA 3ND9A 4M98A 4Y6SA 4RK0A 4MW6A 1ZI8A 3GOQA 1Y89A 2QT1A 3SU8A 3V2GA 3R76A 1YK0A 4EMSA 4OLBA 1MG0A 1CRQA 5F9MA 5FPKA 4ENQA 3MBOA 4X1IA 3SEZA 2C3OA 1UEIA 2XWBF 1NVWQ 2FGJA 5FULA 1S2OA 3H83A 3TYXA 4BO8A 3GRAA 4NYJQ 5AVVA 1RLIA 4EMTA 5KNCH 1UUFA 3LKBA 1C0IA 4FE4A 5TR9A 1SG9A 5KVAA 2SBTA 1ZH2A 3EMKA 4IF4A 5EERA 2A57A 1N7GA 2WA1A 2C3MA 1M1YE 5EXEA 1UAYA 3QX3A 1NOIA 3SKXA 3OFSA 1U63A 3HDYA 5J9FA 4D44A 3A3OA 3HH8A 4JDPA 1IFXA 1V6CA 2REBA 4JJ8A 3UJCA 4IIUA 1S8NA 2F1KA 4KBFA 4Y18A 3S2EA 5EIBD 5BRNA 1SCJA 3QKRA 2CVOA 3ZE1B 4KZKA 3W2GA 5CBPA 1MJGA 1XIVA 2P90A 1P0FA 3HCWA 4G4SP 3DA8A 3FFXA 4G25A 4EHLA 4AN0A 1JFFA 1SBZA 1UODA 3RAPR 1JQ3A 1ZISA 2C4UA 3CNOA 1TEZA 3KQVA 4HH3C 4N3NA 2M9MA 5K8VA 4ZWNA 4J94A 2N1MA 1ZD8A 3MJTA 3WYAA 1DWUA 4WZZA 4BEVA 1PK9A 1EDBA 1Z8HA 3H2SA 4TT3A 4KXMA 3PBKA 3BH6A 3QMWA 1PG2A 1A8UA 2X8JA 3IAUA 1O95C 4K9LA 2PO5A 2EKQA 4GBGA 3F8SA 1I32A 1CK4A 4QDOA 1K88A 2P65A 4K0RA 2G7ZA 5EXSA 3TMYA 3TQCA 2VF4X 4DE5A 5JUWA 2R8RA 3A6JA 2IV3A 4B2PA 5ITZA 4RU1A 3DBRB 4QJIA 1G8HA 3DNFA 1XQXA 4AS3A 2DGDA 1KZHA 5AUNB 3A4MA 4JI8B 4C1NA 2IEYA 2P41A 1QANA 4G0OA 1MX9A 1ZGJA 3RAJA 5JQGB 5AKZA 4D9EA 1KEZA 2HTEA 3TRFA 1HDCA 1RKQA 1X9IA 1KJWA 4LISA 3KCNA 1FNCA 5ENVA 2RGEA 3SSMA 1BG6A 4AI6A 3EE6A 2BFWA 2B1QA 4PHTA 4BRWA 2P8JA 5K0GA 4IICA 3KUKA 3ADCA 1K8XB 3UAGA 3TBFA 4D79A 5IT5A 2QL7A 3D2BA 3FI9A 4TRNA 2BR4A 4TXJA 4ZOQI 1FOEB 1XCMA 1KETA 2V8BA 1Y37A 5JE8A 4YCBA 1CP2A 2ZOSA 1AKUA 4FNGA 1IDN1 4HN4B 4QBGB 3C24A 3P19A 4NESA 2LDXA 3O8LA 4K1LA 3X2FA 3TCNA 2NYUA 2FPOA 3RU2A 1O94D 2C03A 2DPMA 4NMWA 3IP3A 4MROA 4BHTA 3PWZA 3HKBB 1E94E 4Q4JB 3Q3GE 3AEQB 5HS6A 1EIWA 4EJ2A 4M6WB 1VMDA 4CKCB 3QU2A 2Z1MA 1JIVA 3B5IA 3PJRA 5GVRA 1G7TA 1V39A 1DB3A 5B64A 3BMOB 1MKYA 1KMCA 4WSOA 4S2EA 3LLCA 4PXSA 5LMUB 4HNQA 4PG7A 1APBA 1ODLA 3HVUA 3CX8A 3AG6A 1VE6A 2GCGA 3RASA 5F33A 5C0OE 3RRMA 4NJOA 4NQRA 3TZ6A 2PFKA 1L4KA 1YQUA 3DXXA 1ORIA 3C87A 3LECA 1G0OA 2JLQA 5G40A 3VJRA 1UJ2A 1U0LA 1TD1A 2FFAA 2QUAA 2UVPA 3F49S 3JALA 3SQLA 3E7WA 3TTWA 3GZJA 1RLOA 4BP1A 1M8PA 1RLUA 1FK8A 2BGKA 4GYJA 2FJPA 3KZOA 1HZZC 4EMBA 5JYBA 3BDIA 3V7NA 2IDMA 1KHTA 5BVHB 3TTSA 1YE5A 2ES4A 4OXXA 4L85A 3N8HA 2XYQA 1JLHA 1HG0A 2VYVA 3T9AA 4HBZA 3OIVA 5L6MB 4PX2A 9ATCA 3TSYA 1W4AA 2GPYA 2HCFA 5DP2A 1CB0A 5JATA 5KHLB 1FZTA 3R40A 5AOAA 3UWDA 2P91A 4AC9A 5C1OA 1M6VB 2NSLA 2WJHA 3GA5A 4KR6A 1ADGA 2FZVA 3TI7A 1IZ9A 5K0BA 4KR2A 1DPFA 2OTCA 3IULA 4AYXA 1JU3A 4Q1BA 4DJEC 4HQKA 2GARA 1FLAA 1U2PA 1TFUA 5AHKA 4B71A 5F98A 1T15A 4BRSA 2BJWA 2HQRA 1C80A 3IPLA 2BEVA 3IOYA 4LQLA 4LYAA 3SSNA 1NVVQ 4YCNA 3OZ7A 4YS6A 2O2IA 3B3GA 2C4VA 1IULA 2H4JA 2FRXA 2ZIAA 1SQ6A 3A1FA 3TOVA 1JFSA 5T8KC 1H1LB 4B6SA 3EVGA 1DOZA 2FMFA 3AQIA 1JKJB 2OAEA 3S2YA 1XT6A 3CIOA 4YTEA 1EX1A 3A1SA 4ZQCB 3WI7A 4YMTA 4OEHA 2JGRA 1OE0A 1P0MA 2PXAA 2BFMA 3QELA 2BR5A 1LTQA 4ED9A 3NVMB 3VPXA 2Q6VA 3ZKAA 3G49A 3KT0A 5AUOB 2XMCA 4RAQA 4RGQA 1P4GA 4U7PB 3EDMA 5NULA 4DCJA 4X66B 3EGOA 3IDOA 3P9KA 3IP1A 1NP3A 2Z4RA 1IY2A 5BQPA 4YRGA 2XV1A 3JTMA 1ZI6A 4TWZA 4XB2A 3U5TA 4TWAA 1NVUQ 3VM6A 4EABA 3HYTA 3HZHA 3JZIA 2PV0A 1JEYB 1OX4A 1A69A 1XA3A 2XT6A 3O3OB 4L27A 4HAUA 2QTAA 2W6CX 2I2DA 2WMDA 1T5SA 3ET4A 3IBSA 4F2WA 4BYGA 5EIXA 2IE8A 3ZH2A 4L8LA 1FP4A 1U3CA 3MVEA 5C8XA 5CX4A 2Z83A 1GILA 1GL9B 5C2JB 3DMDA 3V9PA 2NVOA 2GHRA 1VBMA 4RGBA 3NDRA 4IHJA 4MRMB 3SIXA 3PRKE 3WQQA 5B1IA 3S40A 1A4XA 2OO3A 3H3JA 1RRCA 5CLIA 3LS2A 4ZT7A 4XYLA 2JGKA 5FNVA 1Y9EA 1IQRA 2BSXA 2X9LA 4GM4A 1N4DA 2XMBA 3QA3E 2H5LA 4F9FA 3RYIB 3U3MA 4KAJA 1NP6A 3LZ6A 2WVJA 1BN7A 1ZI9A 4FQ7A 2ZTHA 4M1ZA 4WKOA 1QO0D 1VLLA 2XLBA 1RMYA 2EQBA 1Z4IA 1MQAA 2FUG6 3LF1A 5EHQA 3U26A 3A9RA 2ASVA 4TWJA 4YROA 2ZKLA 3HDJA 5IPFA 4NE7A 2CDRA 2JKYA 4LIPD 2P9FA 5BSUA 1TK9A 1CD5A 1WE2A 2EFCB 4FEGA 4E6PA 3AHHA 5KYWB 3AF2A 1L7BA 3DMNA 2P2ZA 3RVJA 2ZT6A 2H51A 3UGKA 1QYCA 8AT1A 1LX6A 1LBQA 4IFBA 2AKEA 3KB6A 3N76A 4W5HA 3AL3A 3KS9A 5IYZA 1J0XO 4DR1B 3TIVA 1R0SA 3RVOA 5K3EA 2CNWA 2PKCA 5GJVC 2WWGA 3L0YA 1A50B 3A7DA 3LW8A 2WD7A 1QYRA 3OF5A 2EFDB 4PC7A 3SMVA 1E1CB 5DHPA 1RXWA 4JUAA 1T4BA 2WFLB 5EIWA 4ZYVA 2IUUA 2GPSA 3FR7A 2Y8EA 2QGNA 3BE5A 3IHKA 3QV2A 1ECGA 5IF9A 2W2OA 4IGKA 2V59A 5MFPA 1R0WA 4QGHA 5AW5A 3BEOA 1J5PA 3FH0A 5B55A 3GLFA 1MW8X 4KXLA 3HUTA 3MTBA 3KJFA 5AHXA 3LCCA 3P20A 3HB4X 3IQEA 5AJWA 4FLFA 3NAGA 3VNSA 1IEWA 5CFLA 4O4LA 2PLAA 3D3WA 2PCJA 3P32A 1AC5A 2ZUUA 1E1QD 2GH1A 4C4YA 1MD9A 4HDKB 2IY8A 3BB1A 4H6WA 4ZOCA 1I6MA 1Z15A 2FW9A 1J0BA 2X5NA 1AG9A 3LC2O 1O96B 2P3LA 4U63A 4C3OB 3ZWNA 2N3ZA 2V65A 1S7CA 2AMFA 1F2UA 3ZE8A 1IVNA 5FL7A 3U3DA 1FXWF 4EA6A 2G8NA 1P7YA 2IHKA 1PJZA 2BE9A 4XTCS 3W79A 5EMHA 1WBDA 2I55A 4A6PA 1X1TA 3M6UA 5LB2A 2EKDA 3S29A 1DCFA 2HEGA 3HPQA 3C1OA 4QGSA 5IT4A 4UQPA 1C2TA 2XZTA 1Z47A 3R3SA 5AQEA 3B89A 1L5MA 3W5SA 2FA9A 2IOFA 3EFBA 1ZC4A 3K09A 4EEZA 5KVSA 1OVMA 1AKNA 4LCBA 1N2IA 3NC4A 4H77A 5CD9A 1T8PA 1V25A 3BAZA 1TM4E 4G4SO 3CN9A 1EFDN 3Q11A 5KCZA 4XGRA 3R20A 5DBFA 3K9NA 3AYZB 1ZD5A 1J5EB 1W29A 3QNWA 3DOCA 5L3RA 2IDZA 4HWRA 4O6VA 5K4HA 1MT0A 1T3TA 3Q2IA 3EZYA 4BP9A 1RQPA 3QFFA 2G9UA 4PF1A 3I53A 3RS3A 3KDSE 3UFBA 1EUDA 1VA4A 2RHGB 4QFBA 3F5QA 4POOA 1ABEA 4OA5A 4ZT5A 2A0KA 5IXYA 4AKHA 1NYQA 1RBMA 4BV9A 4YMWA 1LVGA 1K8RA 4BO7A 2P40A 5BSGA 3IXQA 4FFBA 3JVUA 1B76A 1TLLA 3LO5A 4UM9B 2PBRA 3K4HA 4JSTA 1Z68A 2CLOB 5LQAA 2DPHA 1R66A 2FY8A 3LVFO 2O59A 3FMIA 3PA8A 4D4GA 1EWRA 2H1FA 3USCS 3K0KA 1GD1O 2GLXA 2D8AA 3S2ZA 1YCDA 2FYTA 5AIBA 5I4CA 2X6TA 5JCXA 4RBNA 1NQWA 5EL0A 5FWYA 4JMLA 1YO6A 5A71A 2W0SA 1BA3A 5IKPA 1V1RA 4I5GA 2UYOA 1LPMA 1XL1A 2V9ZA 1AM4D 4U5QA 1WAMA 3WKEA 3CS3A 5JYEA 1ATZA 5GVSA 4RNDB 3RSOA 2OQIA 2KLHA 1TYCA 1U1GA 3UHPA 5FWXB 4JSYA 3RS2A 3EX7C 4Z4QA 2M2IA 5JNRA 4LHYA 2JARA 4A2CA 4ZCIA 1JNYA 1KI6B 4BXOA 3SX4A 4DDHA 4IXWA 2ILVA 1HDOA 4Z4EA 2ZJ2A 4M9XA 4QJ4A 1X7WA 1GN9A 1UJ4A 3BE6A 3C8MA 2XMPA 3PXXA 3EIUA 1ESZA 3QFRA 3GJ8A 2C1XA 3NWBA 3OIWA 4LZOA 4NU6A 4TQAA 1Z62A 3FGNA 5IUKC 3ZX5A 4L0DA 4XJSA 3UHJA 1XXHE 5CRIA 2OXRA 1BYUA 2ST1A 4LI3X 3PTZA 4ZPXA 5KYKA 4B3RB 2GBLA 3OI7A 1NDHA 1P8JA 3MCWA 2XPCA 2Q3LA 4JCCA 3IQZA 5DGXA 4NENA 4RA9A 4RM2A 4WD3A 1X80B 1NXPA 2X9VA 2XI4A 1CFZA 2QR2A 2XVYA 1QPBA 4FGWA 2D1FA 2ZK7A 3P4YA 4C0LA 4KTVE 2P9TA 2ORWA 5K1ZA 4LZPA 4ONEA 3SZMA 1I6LA 1DG9A 1Q77A 1I1OA 2ZJZA 4E33A 4IVPA 3RI3A 1LV8A 2NO7A 2R5FA 1TRHA 1SBIA 2ODTX 2XMRA 1XDDA 1X8LA 3UUFA 4OUDA 4BCDA 4QUJA 4YAIA 1FDRA 4IEIA 2JD1A 3UWMA 3QVXA 3PVCA 4DANA 4RTQA 1PR4A 1IN5A 3PEUA 1EE2A 2EP7A 4ZOAA 5K3OA 3CZMA 5U4QA 1GEEA 4CQLB 1GQ2A 1R5NA 3Q5DA 3SFTA 2JLYA 2QPAA 3KQLA 1II0A 1JMKC 2JC3A 1J8YF 3O4GA 1P6XA 5KU1A 4F2GA 1W7AA 3LSTA 3R7SA 1R18A 1SC6A 4Q9KA 1FFWA 2G40A 2VTDA 4BIMA 4YN3A 3ZCRA 1RJDA 1LBTA 1O94A 2WPDD 1J90A 4MYHA 3R7FA 4C4SA 4LBZA 1H93A 1ZIXA 1H2XA 3CX7A 2BVNA 4IMRA 4OFWA 2J31A 1H94A 1TVKB 4Q1CA 3IHWA 2A78A 4WMLA 4JKOA 1IQ0A 3HCDA 5IM4A 4UUMA 3NI2A 3UTDA 4JWTA 3RT7A 4RTSA 2ZUFA 1AZLA 1XU9A 3IV7A 4Y2VA 4Y2RA 2IBMA 4B76A 1BXGA 3HACA 1YQEA 4P2GA 4ZDIA 5U4XA 4DJTA 4MGHA 3ZYZA 1BW9A 4AKIA 1Q44A 4NABA 3AP1A 4PPGA 1FVFA 2Z95A 5CFZA 4YMHA 3CURA 3N8KA 4Y9RA 2AR9A 1P1FA 2AEMA 2PVCA 3AFGA 3PHBE 5I7HA 1PQYA 3NDJA 3QENA 3EF1A 5JNWA 2R751 4XZ3A 2R47A 3QVGA 3E15A 3E5NA 3JRXA 3P9RA 4AG5A 1VKOA 4DV3B 2O8CA 2QX6A 3UAZA 2OZVA 2PX0A 3UFXA 4ZI7B 4JJKA 2XX3A 1CU1A 3OU6A 3SJAA 1R6BX 3W3AD 1SK9A 3IBCA 2CNNA 3C70A 2VSFA 3PDWA 1CY0A 2YINC 1RJWA 2OCIA 3EGEA 1X13A 1KRWA 2AR0A 5JASA 1VG1A 4XM2A 2Q4OA 2PG3A 4ARIA 1IZ0A 4CNBA 1M6NA 1SBYA 1ID8A 5CB4B 1O0CA 1LD3A 1FFGA 2G4VA 1Z63A 2WJ4A 2EZUA 3BK7A 3KB2A 2CFIA 4N7JA 4MRSA 1CJCA 3JYNA 3T38A 2Q5IA 1TEVA 3LDGA 3U1BA 4L75A 1I80A 1RACA 2EDAA 1ZJ4A 4K3UA 4PHFA 2XECA 4G8JA 1MIHA 1PJCA 3OESA 2YYSA 5DFAA 4TLEA 3NHZA 4JASB 2FSGA 2RE8A 1FFXA 4PNEA 3OURA 1D0IA 2QI9C 5DHFA 2FSFA 3GEBA 3HQ4O 2DU8A 1ZZEA 4QFMA 2RJOA 4QQRA 5EMNA 3UA4A 5KWVA 5HIIA 5HOEA 1UQTA 3FJ1A 3OCVA 4X1KB 2EQAA 5SZKB 3RO7A 3MJHA 4N6NA 4NBKA 5K2MA 3WGOA 4EJSC 1I94B 2G25A 3BMXA 2JBWA 4QPPA 2UU9B 3T1OA 2ZE7A 3KU1A 4ZJZA 2Z2JA 1P31A 5DTQA 2EERA 2MSEB 3SE7A 1NLFA 5FLXA 4JLNA 3BGVA 1QP4A 1Y4AE 3B38A 4HDOB 4LK2A 5ENDA 3TRHA 4LGVA 5DNYB 1TMYA 5B3LA 2IYXA 3EC7A 2A8YA 3KWMA 1TVCA 1M2EA 4YV0A 3EF3A 4HDRA 4UFOA 2ANCA 3IJEB 2MYUA 3OAAA 5I7WA 1D6JA 1XTTA 1E9CA 3MRTA 1OYOA 4RPGA 5EJGA 4GZ3A 1PIWA 3MWJA 3ZDQA 4Q9DA 4KXNA 3WKCA 3GLVA 2QM0A 4HDQB 3FPJA 4H6VA 4FX2A 2WI8A 2DBYA 2WYHA 4TLBA 4WX2B 2B0CA 2HADA 2Y1XA 3MYYA 4RVOA 1XCLA 3UVEA 4D4HA 3ER9A 2AK2A 2JA1A 3CSDA 3KEOA 4E09A 3OX2A 5FA5A 1EXVA 1PT9A 1YRLA 4AJLA 1WHSB 1SEPA 1G8MA 3AU9A 4Q3LA 3PLNA 5K7SA 4HNVA 2I33A 5KNLA 2DERA 1S3IA 4JBHA 4X41A 3NXKA 2P79A 4R31A 1WVMA 1AGRA 4JFRA 3FUTA 1XMQB 1TE2A 4AZ3B 1OGIA 3JWHA 2ZG6A 4L5CA 5TQ0A 5HOQA 1C30B 1PKEA 1QWOA 3EEQA 3PFFA 3K9LA 3LKVA 1UK6A 2NG1A 4I4NA 1ZN2A 3I01M 3S81A 2AN5A 1JG1A 4KDRA 5TDHA 1Y1KE 1HQCA 5JR3A 3QSYA 2EQ5A 3COVA 1AHIA 2Q1TA 1GNVA 2JEZA 3BZUA 3NYRA 4FINA 4Z0TA 1FLVA 1XVTA 2FSPA 4UVDA 5F2EA 5A5DA 3ZEAA 4E0BA 4CM9D 1GKLA 2BEWB 1Y33E 2AJCA 3V7UA 3GVPA 3DM9B 3QPCA 1LCIA 1ZXLA 1L5NA 3TKYA 1GPDG 1HLGA 4PG6A 2H1LA 3FYDA 4IHJF 4EVSA 3ZHQA 2PUGA 3HFGA 1WLSA 1ODSA 1S4QA 4FFMA 3N70A 2PT9A 3FXAA 1CJKC 4Q1VA 5AKXA 5C5EA 1KYWA 2IDJA 8ABPA 4UDOA 1X86B 3GPIA 2OQVA 2IHTA 3HBMA 3I32A 4HNTA 2AEEA 1PYGA 1CDDA 1XF9A 1DQZA 3KKOA 4B7XA 4QKQA 3BORA 2J4CA 2XTJA 3HCAA 4BZXA 5BN4B 5LQKA 4PR0A 1OXTA 5KNBD 1ZD4A 5FQNA 4CEHA 5IJ0A 1IXRC 5KTSA 1DUIA 2IYUA 4CU2A 1NWHA 3FBTA 4J0FA 4K28A 4NIMA 3ZCXA 2D0OB 5BUCA 2PE5A 2CNOA 3TE6A 4DSZA 1OASA 1FQOA 4X0EA 4DA8A 3JQ7A 5DM4A 1D2AA 3KSUA 1UMDB 1UF9A 3K1JA 4XPIA 2WHYA 1VHWA 1IN8A 2FEPA 4HZGA 1RW4A 4J3FA 4LDJA 4RIFA 4CLRB 2FX3A 2WHXA 3A37A 4IJUA 4HWTA 4Q00A 2I6QA 1C5KA 4YAGA 1CFJA 4X3CA 4EHBA 1SELA 3DDCA 4XOUA 4Q93A 4AKTA 4AN1A 2C2WA 2VDQB 3KRTA 3UMJA 1UMCA 3OIFA 1QNFA 2GKGA 2K5UA 4ETWA 2KE5A 3BG5A 2CUNA 3U4IA 4W63A 3RH0A 2GCIA 1PHPA 3K5IA 4PO1A 2OGSA 2CL6X 3A3PA 4G89A 1PGQA 2ID9A 4I81A 4TUYF 4KFCA 1E1QA 3R5TA 5EVJA 4HNUA 5CJPA 4IIHA 3WYFA 4R51A 4DKXA 4DIKA 4LDAA 3AWDA 1NMSA 1V26A 1Y6RA 2NXEA 2VJLA 3EG9A 4KACA 4QODA 1KJJA 1IBRA 1LPSA 1QZUA 1SBCA 1U2SA 2JLXA 4QFCA 4B1FA 4UZSA 4DLPA 4EL5A 3CVWA 3EXFA 1IQPA 3EEBA 1BE0A 4JD5A 4LTNA 1I3OA 2O3TA 4ZI5A 1DADA 2ZETA 4L5IA 4GI3A 3VC2A 2IOYA 4A6EA 5JFOA 1T4GA 1Y5NA 4MPDA 1CRPA 1OI4A 2AXQA 1SKQA 1NNI1 2OQRA 4WIAA 5JADA 1JHPA 1R4MA 2HRZA 4E5DA 4XCXA 2Y6UA 2XWQA 5AKJA 3B1WA 1VSTA 4FHCA 4JI6B 2NXWA 3PRJA 3BREA 5HF5A 4A8JC 5ITWA 4R8RA 4AY6A 3C43A 1YB2A 5DHUA 4E5VA 4N41A 1GGNA 2NW6A 5DBOA 3ZHUA 3ZS8A 1CZNA 3KWLA 3QEMA 1X1QA 3TKAA 4QUEA 1TTPB 3FIJA 5DI9A 3KE8A 2Y9PB 4WBXC 3MT7A 1DWQA 2IYYA 4ZCSA 4DLKA 2J9FB 1TQHA 2ATCA 4NFYA 1Q0UA 2VRWA 1UP4A 2FE4A 2RKBA 3M5PA 2XTMA 1P18A 3P0EA 5HR5A 3FM9A 2YBEA 5CG2A 5ALXA 1NC1A 2GTHA 1GGMA 1VJGA 2JD0A 4GX2A 3RHFA 3G1TA 2OHOA 2JANA 3QXCA 3P9YA 5DGHA 2EJWA 1XTVA 3BMQA 1AB6A 1ZM2A 3FG9A 2Q3JA 2NP7A 1NTOA 4Y67A 4OHMA 2PLFA 4FWTA 4AS2A 1XN4A 4K6KA 1NW3A 4LVOA 3FSJX 2R6R1 2H3HA 3K8QA 4GRDA 1IB0A 2QLJA 1R88A 1W0KD 2YQZA 1ISMA 3K9GA 2SHKA 3GX1A 3UH0A 5I3CA 3HLKA 3UK2A 3PXCX 1ADJA 1EFRD 2HJRA 4MK4A 2FB9A 3M6FA 1EHYA 1EGAA 2GAJA 4L9AA 2IA5A 5DWVA 2ZYTX 2PH7A 2WJZB 1SY7A 2CXHA 5H16A 3AY0A 4QLAA 3A58B 1B41A 1F1BA 4KDFA 5H7XA 3SHVA 3ZLJA 1XBTA 3UK7A 2WG0A 4YRJA 5KQSA 2FFBA 2N9UA 2PGDA 2YV4A 1EX9A 2YHBA 4PC1A 3U4DA 4B4OA 2DE0X 4JOBA 3RJMA 4EG8A 1Y8ZA 1HC7A 4WLFA 1KI7A 2J5XA 5ELLA 1E3IA 4MAAA 1XPRA 1HT3A 1Z7BA 3GPBA 1W44A 2C5HA 3QYAA 4L72A 3A4VA 3U4MA 3K1ZA 2JCXA 2I62A 4YRDA 1IUOA 3U56A 4DUPA 1P8AA 2BE7A 1G1AA 1YRHA 1YI0A 4LE1A 2EBFX 3AFHA 2QLTA 4MINA 2FWNA 3MGAA 4OFXA 4U3JA 5E1BA 1VMKA 1Y80A 3MD0A 1GTG1 3O5AA 4LSGA 1CUIA 2O8EA 1KARA 4IJWA 4YCDA 1P7WA 5IULC 1N0UA 1K7SN 1OT3A 1YULA 4MPTA 2ROQA 1X8KA 4EARA 4TV9A 1EK6A 2YXBA 3ONEA 1MB0A 2B7LA 4QRIA 3S70A 2RHJA 1Y6GA 4JVSB 5CJJA 1P61B 3DFMA 3IAS6 4KVFA 5F4ZA 2JLWA 4KO4S 5KHOC 1YOBA 3RFVA 1QGDA 1QYIA 3AI2A 4TT8A 1MHTA 3GEIA 2XMQA 5B7NA 3KSBC 2J09A 2UUBB 2JLAA 1I6WA 1SD5A 2G77B 2QV7A 2PKQP 3IAAA 3B85A 4R6WA 2P1RA 3WLOA 4IWYA 3PXGA 4C5CA 2FAXA 4KQKA 1EWYA 2G7MC 3D8BA 4PLFA 4QZVA 4XR4A 1CQWA 1HF3A 1D6MA 3OEYA 3HM9A 1K8QA 3Q4GA 4MXDA 1C41A 2X4GA 3RYHB 1PEKE 3GJ5A 1NQOA 1VBNA 2BMVA 3ADKA 4H15A 3I0MA 4ZDKA 2D7JA 1FP1D 6CHYA 5SZHB 3SD7A 1LW7A 4ENUA 1J99A 1BC5A 2XCRB 1YFLA 1U0BB 1U9CA 3GQVA 1M72A 3LFUA 3OQIA 3FMOB 2QP9X 3N8DA 4PWYA 5F1OA 1C9JA 1Z0ZA 1LS1A 1D3AA 1XZJA 3EXHB 5T57A 2O8BA 4PPNA 2I6UA 2CL5A 5KDDA 4I4LA 1F3LA 4IQFA 4XQCA 3KQUA 4RC9A 5JZBA 3IKMB 4F1WA 3ZE7A 1Q22A 1EZ1A 2WWRA 3MLAA 4U2BA 1N4AA 1QWSA 3LX5A 4H4DA 2ZJFA 3DF9A 4I7EA 4DCVA 5EN4A 2IU0A 1GVHA 4KMRA 3FOFC 2DLCX 1DKOA 1Z4MA 4BKQA 4YRMA 3HKCB 4EFMA 5FV4A 1Q91A 1WR8A 3I9V6 1HX7A 3ZC3A 3LBNA 4A2WA 5M7EA 4P93A 1HDXA 1HE5A 1H1DA 1K3FA 3FVVA 4E5UA 2NZWA 4HDAA 4QTYA 3THYA 1USVA 2C9MA 3HFJA 5GV8A 1JSCA 1P7ZA 4EY3A 1ZMRA 3CRQA 3O2JA 5DKFA 5TE9A 5KTKA 3TX2A 4B4DA 1JB9A 3H3FA 2YJGA 4EB8A 2Y1DA 1S02A 3EAGA 3TQOA 1PZGA 3GJTA 3BICA 4L3OA 1TTTA 4TN5A 5LXTA 1V95A 2P9JA 1HXHA 1ND6A 2GXSA 4IR7A 5GM2A 1VHLA 4NMHA 4BBJA 4NAUA 3BCSA 1JJAA 4LXTA 4Y9UA 2VK4A 4HEJA 2HX1A 1G21A 3EWNA 3LL4A 4MIEA 4QEKA 4R0NA 5KYTA 2NN3C 4K0KB 1DAOA 1GUBA 4TSFD 3MOIA 3DV0B 3WKAA 2H07A 3M6IA 5A5GA 1YRBA 2AN4A 3UAYA 3NUGA 4N0MA 3NIWA 5BNFA 1BN6A 1DTWB 3U7FB 3I72A 3OETA 1FDUA 3KBBA 1YB5A 4ZODA 3C3KA 3L8MA 3KT6A 3KV1A 2JLUA 3HBLA 3DDZX 2XJ4A 5CURA 1D03A 1NW6A 5AVRA 3VU9A 1KKLA 2E21A 4MWTA 4F9GA 3ZD7A 5E7IA 2EOAA 3TUIC 4URHA 3TEJA 2XUJA 2AMJA 4WVLA 2Q3HA 2W2KA 3O94A 4MWZA 3VJLA 2ZRMA 3ZDRA 4RQUA 4P3NA 2LNDA 3Q1KA 5G0TA 2J5QA 2BEUB 5TY0A 3BVPA 3NHSA 4L0QA 1QE0A 4EK9A 3NLLA 1UBEA 2HZBA 4BBZA 4YV7A 4CIVA 3DE2X 3II6X 2QRKA 3R0JA 3PLAE 4P0QB 3DDWA 1D2GA 1GPBA 1CWUA 4K9NA 3S2FA 3NFRA 3EH2A 3T9BA 1QG2A 1TVMA 3BGIA 1ZJYA 4LHSA 3BKWA 4AMVA 4FMDB 2HHCA 4F21A 1BJTA 2J3LA 3ZGXA 4ECAA 4R2IA 2ILTA 4EUKA 4W5NA 1U7TA 4B8YA 1W8DA 4FBGA 3EXEB 3S7TA 1DT3A 2D74A 4YAJA 4J07A 2PWPA 3RC8A 2P69A 4ZHSA 3GA7A 4OQNA 2V7QD 2Y1WA 2Z5VA 3IERA 3YASA 4C20A 4KAXA 4XI9A 1AMNA 2VR1A 2XUGA 3OEHD 4UHKA 1VI5A 1Y9DA 3I5AA 1P74A 4NJEB 3FWZA 4CM4A 1E0DA 4R2LA 5G0VA 4AZTA 4PNHA 1BROA 4R05A 3DLAA 2ZAIA 4K05A 1RYFA 4XTRA 5HCNA 3C6MA 3E1KA 3I23A 3V97A 3ER8A 1JJFA 3TNDA 1KP9A 2BZSA 2IYNA 4HWSA 3FLEA 4PQYA 3IUSA 3RRXA 1GV0A 2WYWA 4NHOA 1BD3A 1SWVA 2JH8A 3UK1A 3GZNA 1B6SA 3AXSA 1PLLA 2HF9A 2XB6A 3QZUA 3WK4A 4NKRA 1KYTA 2QX8A 3EVBA 3IDQA 3D6VA 2IZOA 1FTGA 1KFCB 3EBOA 3IAEA 4Q6BA 4WKGA 5ADWA 5LZ4A 1J6UA 1P3Y1 2JVKA 2VBIA 5CVUA 3CNNA 1TU0A 5BWLA 3NCTA 4CJXA 5C34B 1K8YB 3AJAA 3HV0A 3U7QA 2LDBA 4H60A 4FKZA 3OZGA 4W7IA 4CM9A 4LZWA 5J59A 1HE4A 4O4IB 2OGUA 1E18A 4PYRA 3SHQA 3ZV5A 4X95A 1PJBA 1AUPA 3MWYW 1P1JA 2I3BA 2YVLA 1HA3A 5CVCA 2H2GA 3I6QA 2GUWA 4G36A 1KRXA 2QRZA 4PTYA 1WKVA 1VE7A 2C9CA 5F77A 1KO7A 1ZKDA 4HO1X 2VCYA 1Z3CA 3CISA 3SQDA 1U9ZA 2B6NA 1QHXA 4L08A 4XIJA 1P5HA 1XPJA 4MV7A 4RVGA 2R8PA 5KNBA 5CFPA 1X1CA 5T64A 1S7GA 4DLZA 3UJAA 1BX1A 2PX6A 5L3VA 1ZAYA 1VG0B 1PU2A 1OTXA 3ORYA 4HCJA 4FDAA 4R5MA 3W6OA 2DETA 1C7IA 4KFRA 3WP1B 4BTLA 3K72B 2FF7A 2FWBA 4QT4A 4FYYA 4P7GA 3RRYA 3W9BA 5KNDH 4M49A 2O8DA 2C9BA 2IEDA 2NO4A 2NU6B 1E5DA 1SPXA 4R71A 1L8LA 2O2JA 1I01A 4YUVA 2ZSHA 5DGIA 1XDGA 1Q1AA 1EFPB 4XGQA 3RRJA 4BJ6A 2PN1A 3R1IA 1XZFA 3VU1A 3ENQA 4TL9A 3E8XA 1ZRSA 1DKLA 5KKNB 4QUAA 2RHLA 2YVKA 5E4TA 5EKTA 1XROA 3FCAA 5FPSA 5HJ5A 2VCEA 1CF2O 3IO3A 3CE9A 5TGDA 4G1EB 4OMCA 5AHOA 5IAKA 3DZ8A 3ZDBA 1IN1A 2AOTA 1RLMA 1WTCA 1JDPA 2XD9A 4CI9A 3L7BA 2ZUVA 1HY3A 1X9HA 4II3A 1IPHA 1OPRA 3RS0A 4BE9A 1A4IA 4RK4A 4RJTA 5K2OA 5AVTA 1HZZA 1P4SA 3JW8A 5DISB 3SM9A 1TNDA 4M9ZA 3DE7X 3B70A 3RUHA 3WFZA 5LMCA 1JDUA 3T5MA 3HCFA 1BWPA 4KC0A 3EZ7A 4L02A 2BI8A 2L82A 1A77A 2X1MA 3NNSA 2F3RA 3A2MA 4GF5A 5AK4A 4C30A 4C4XA 4AO6A 2BISA 1DEKA 3ZD8A 5JSKA 1GRNA 2NM0A 3SYNA 3VNAA 4P9NA 4P4TA 3TLZA 2JFVA 1N33B 2W2LD 3C74A 4ND4A 5ES3A 2ECPA 4BNNA 1JAYA 3FHJA 2EXXA 3SN6A 3TW8B 4DC9A 3O74A 3D8HA 5F7OA 1R6VA 3NONA 4PPFA 4C5AA 1RPAA 2FVYA 4MWEA 4OK5A 4D9HA 1FYFA 2XF2A 4HQRA 3B1XA 3E58A 4ZCTA 2DUMA 1OWLA 3E4DA 1ETHA 3IXLA 1QAOA 4TZTA 2HSWA 5KSOA 3RSFA 3U3JA 3F4LA 3D43A 4HPWA 2ZRAA 2V97A 5ALIA 4YJ2F 2R1VB 4P81A 4EJ0A 1QF6A 1Z9BA 3AU8A 3QMPA 3LDHA 2O05A 4BQSA 2QUZA 1QM5A 3MSXA 1H2WA 4JNCA 2YS7A 1MF7A 2ZYWX 4MKRA 3VNQA 3PGLA 2QTVA 4GKVA 3DE6X 3ECAA 4K86A 5GZ1A 5GM1A 1WLYA 3HDQA 3H99A 1ZMXA 4MW2A 4V1CB 2PKQO 3HYLA 3KJZA 4OA8A 1W0KA 4C7JA 4E13A 2J7KA 2SKEA 2WMNB 1L5KA 3M4YA 2ZJ1A 3PJFA 4GP9A 4FYXA 1L5YA 3T4PA 5E8RA 4QTXA 1OBCA 1UC5B 1IHYA 4PYLA 1GZHB 2C7VA 3B9QA 4OOFA 2BKAA 2P9HA 2QVZX 5AI9A 4BGDA 1DTSA 3FKQA 1VKNA 4R2WA 3FHLA 4B9AA 1E6LA 5DCUA 1W4RA 5EJ7A 1HDGO 1OLSB 5HS4A 2C7PA 1FC0A 1B15A 1GNPA 4YP0A 1LX7A 2VHXA 4IH9A 1SD2A 1E2KA 3N58A 2JGIA 1VRWA 4GL4A 4V0LA 5JJLA 2JB9A 2COEA 2P0EA 3RWBA 1X7DA 4UNSA 2Q6TA 2ZJYA 4NYMR 5I8WA 4PLPA 4MJ3A 4DR7B 2YJZA 1YHYA 4YJ3B 4I5DA 3WNCA 5H8WA 4XPZA 3TBHA 1C4OA 2A84A 2I2AA 4AX4A 1YZVA 2I7DA 2IS2A 2EJBA 3I92A 1JX6A 2O5RA 1X2EA 2FLKA 2GJAA 3AR6A 1ORRA 2X5OA 2C4HA 5F7ZA 1U2ZA 4LN1A 4P0TA 3ZCSA 1BFUA 3EVTA 3SHWA 1JIQA 1P80A 2ATEA 4URXR 3N39C 4IFEA 4DSNA 1E2DA 1LSUA 4WVFA 5FADA 1C3OB 3FPSA 6REQB 2FMHA 1HDIA 3DEJA 1XMXA 3HJRA 3B1JA 3MW8A 2CLFB 3EMDA 2P6NA 3S2GA 3MGCA 4B82A 2OZPA 4I14A 4WT7A 3RC1A 5JAMA 2R4UA 4JROA 4V0QA 2C7RA 3DR5A 2CYCA 3TIIA 1YZTA 3GI1A 3E9NA 3N5CA 1AZTA 3H6GA 1SM4A 3R6DA 1SCIA 4RQTA 2F1OA 1FW8A 5AKKA 5E9AA 2H5JA 3K0CA 5F7XA 1RXVA 1OXBB 5BSVA 4G0WA 1W1WA 3LUKA 1YONA 4JB0A 3WIEA 4TV9F 2HPHA 1HMYA 1AGPA 1Z74A 1SUBA 3KSZO 2GKSA 4LRUA 3QWAA 4JQYA 3OTQA 1JZSA 3NM6B 4GOLD 5KWJA 1N25A 2O1SA 1P9LA 4LWQA 5EUBA 1MAVA 4B6PA 1HETA 2BMEA 2FFQA 4KK3A 1NUSA 1WEKA 4DTCA 1IEVA 3FPAA 4PANA 1F2TA 1TMKA 2NOAA 1YDEA 1W5FA 2AFHB 1CJSA 3CJRA 3C7DB 4NZZA 5ALFA 4NEHB 3S44A 3QYJA 1GRVA 5J5CA 3V7WA 4C0HA 5HYVA 3U4QA 3ZS9A 4KNYA 1PG0A 2ZRIA 1ECBA 1NIPA 4J6EA 4MWCA 3FZGA 4YAFA 3T7RA 4E5PA 3BF8A 3D9QX 3OD5A 3I52A 1N8NA 1F2VA 2HA2A 2XTNA 4AZWA 2BRUA 1PT5A 2EFGA 2HLDA 3N2GA 3NIFB 3VKVA 3TIGA 4DUGD 4YXWD 4ZYUA 4ASUD 1EUCB 2EP5A 2VJOA 3LQ1A 4CLDA 2IHUA 3N75A 2GOYA 3AKDA 1NN0A 1CR0A 2O3JA 2Z04A 1YUBA 2PS9A 4MQEA 5IP5A 5IKOA 3I9LA 2HHJA 2EZ4A 1WPRA 1UBGA 1TKCA 1TJ3A 4J0GA 2JFZA 1A71A 3JAWA 4TSFA 3KP1A 3LNTA 4B5KA 4DLYA 1O77A 5JEEA 3HDGA 5K20A 1L0BA 3OPYA 3KEFA 1U2QA 4C2AA 4QPDA 2IEAA 2E48A 3CLSD 4G1CA 4PFSA 1JL3A 3TAUA 1WDTA 4YRKA 4Y2UA 1IZ7A 5LXTF 1XALA 5DLDA 2G82A 4G8CA 1ZJJA 3V1TC 2Y6VA 1XEXA 4HLNA 3ESQA 4CE6A 3ZCQA 4Q19A 3I09A 1E89A 1A9SA 3PUXA 3ZDFA 1ZHHA 4OX9Y 4BAGA 1TF2A 2IY7A 3LC7O 2J3HA 3ZCPA 3S8YA 3I30X 4LF6B 4JVNA 2CFOA 3GDGA 4BV3A 4WKCA 1Q0TA 3ZK9A 2VNKA 5IJ9A 1JYSA 4NARA 2R8XA 1XLTA 3MTAA 5EIOA 4OP2A 1W8IA 2OHJA 1NBHA 2C95A 3VPFA 3CBGA 3RFXA 4W1SA 2IIVA 4NCIA 5JROA 1O03A 2ZBEA 3EZ6A 3ZKWA 4UJ3A 4F91B 1KZ6A 1VSBA 2IC5A 1PRYA 1NMYA 2WAMA 1JT2A 2GZHA 3DZIA 3G88A 4GLOA 4JR0A 3R75A 5AK5A 4C6TB 2HA5A 5JTUA 3CHYA 2V7QA 4LHVA 3TIFA 4MGIR 1A5ZA 5IZCC 5D7BA 2ZLBA 3P2KA 4AO7A 3DZCA 3VZBA 4HS9A 1IY0A 3OEHA 2CMDA 1XVAA 2J3MA 1X7YA 4F4FA 5KC8A 4BEBA 2A0WA 2JZOA 2CY0A 4W99A 3UJPA 5DHRA 5DN6A 3RTCA 3R5KA 1O6BA 1YJCA 2BDUA 1C3JA 5ICFA 3LP5A 1KO4A 3DQPA 4R1MA 1RLJA 1VI6A 4AZSA 4BP3A 1ECLA 2VJNA 4DV7B 5F5LA 5A4KA 4KAAA 1QGZA 4M1QA 4XJVA 1OZAA 1PS0A 1X7GA 2X23A 1OLOA 3A6EA 3K6JA 1R9JA 2IYLD 2XCQA 3KD3A 4G5SA 4MRRA 4ZVNA 4CM8B 2ZJBA 4G41A 4CKWB 5C3MA 2R9VA 4JYZA 3ZVRA 1F3OA 2G1PA 1AQYA 3K4QA 3H5NA 1E7YA 3FWNA 1QH9A 1R5BA 1W94A 2EZTA 1YU6A 1S96A 1ACJA 1JHDA 4A03A 1CUCA 4K9KA 3RC2A 3W3ZB 3DZJA 5ES4B 5K4GA 1A5TA 3AYXB 3OE5A 4S35A 4ZEOA 5HE8A 1IK4A 5C1DA 6GPBA 1H4SA 3SQXA 2J3JA 2DHRA 2JRCA 1KI2A 1CG6A 2DCUA 2XUOA 3AW8A 3A1VA 3AV0B 3GRRA 3ILYA 4J9UE 3KUXA 4IIFA 1G17A 4BVLA 1QIDA 3GHHA 1G3UA 2BOVA 3Q88A 4MPJA 1YZGA 4QYIB 4EF5A 1C1DA 3C8ZA 5G41A 1KEPA 4YQEA 2JGMA 4ND7A 4QPJC 1ISGA 1N9GB 1UPCA 3E9EA 5HBRA 3UN1A 2EGGA 2QUJA 4LV8B 4DB4A 2B69A 2VH1A 4OCZA 2PV7A 2XWJI 3OZBA 3TXXA 3EHEA 1I3CA 1QFMA 3IUQA 3LXMA 4BE7B 5EYPA 1KJIA 1YA6A 2CKMA 3K73O 1U28A 3HSKA 3SM3A 2R85A 4EHFA 3TNYA 2YWDA 3VKHA 5IARA 5AP9A 1H8HD 2R87A 2VK8A 4TV8B 4JBNA 3HCCA 1NY6A 1H22A 1N3BA 1E6WA 1OFTA 2ODAA 5EQTA 3VGPA 4C0XA 1P19A 4K8RB 4RXMA 5EXPA 4EF6A 3HB9A 1UT8A 2YICA 2VZ8A 1Y1SA 5JDCC 4X3OA 5J4HA 2OHXA 4B09A 2QRPA 5DWDA 4KLRA 2PLWA 1BCSA 3JWJA 1FLDA 1U2RA 2INGX 2O4CA 4J0HA 2CJYA 1S2NA 4JLOA 2AFHE 1VSUA 2YJ5A 4P31A 4E1BA 2RKOA 1M75A 1D2NA 1YFZA 2PMDA 3ETJA 4D3DA 1QCYA 6ADHA 4L2IA 1FS4A 2YWJA 3H1BA 2RHBA 4XWYA 1XAGA 2GZDA 2ZE8A 2ZWIA 5KYXB 3B53X 1LU9A 1XJQA 2YMQA 3VPSA 3X1KA 4FZRA 4JC0A 2EHDA 4FVTA 2YWFA 2ZTMA 1WKBA 3FOAA 4RO0A 3V8QA 4B85A 4CTMA 1NTRA 1P6QA 2RGYA 2H17A 1ABFA 1PZFA 2R6AA 2AN1A 4R5HA 2PZEA 2HFKA 3BH0A 1A82A 5TF4A 3VMMA 4AJIA 4PY2A 4NS1A 3ZXSA 4N49A 1QHNA 1BMQA 4QEZA 2DR0A 2V3VA 4TN1A 4EWLA 4WJLA 2VQDA 4AJNA 1IBKB 2GAOA 2E1RA 2GEKA 4URUR 5DRYA 3ESDA 1SUWA 2MHCA 3TNJA 3AFOA 1V41E 4R83A 5HZGA 3IVAA 1WZNA 4FS3A 3AJEA 3C16C 1Q7GA 4RKRA 3L1JA 1NJ5A 2YVAA 4ND6A 3NT4A 3U9TA 3H87A 1CUZA 3FB4A 2VF2A 1WUJS 2Q4EA 4LJLA 4Q1EA 3MCVA 2LIPA 4DWVA 3GV0A 4RYDA 1NA5A 4DB2A 3MPUA 3DE3X 3H8JA 3OCXA 1K0UA 3F9RA 4TXMA 1FX1A 2FXVA 1TUBA 1XZCA 2PNJA 2CF5A 3NM4A 4N9WA 1KK0A 5B37A 2OPBA 1W88B 3UHFA 3W1VA 1D1TA 3U9SA 3Q5EA 5ULLA 3RNLA 3W2IA 1Y3CE 4MYCA 4Q4AB 4EJSA 5DW3A 5FFFA 4XFJA 1USKA 5BN5B 3WBJA 5I9IA 2QRVA 1LH0A 3D1LA 2XQGA 2G1AA 4DSTA 3FPKA 1BNCA 1RZVA 3CZ4A 3FOWA 1MQ8B 4KE8A 4MVWA 3RVLA 1QRDA 3L4BC 2VK1A 4AXBA 3N3BC 4JI4B 1YDFA 3V46A 4ZEVA 5C53B 1YC5A 1R8SA 2X6RA 2EZ8A 1RM3A 3P2JA 3BXPA 3WDSA 2VJYA 3VYVA 4CDNA 5FOSA 4E51A 2VQSA 3THRA 1KQOA 2B1RA 4X20B 2GN4A 4GEKA 2D2FA 3T5CA 4V0KA 4CMIB 1T0BA 4QUHA 2FPKA 1EAYA 2WIAA 1F5NA 4I1YA 3EJWA 3DONA 3RE1A 2TMYA 1MEOA 2F3UA 2Q0SA 2Z8XA 2QTMA 3EOBI 4X6LA 2BKLA 3VR4D 2PSHA 2NO5A 3BD9A 4ALJA 3G2MA 1R0KA 2DC1A 3DYVA 5H80A 4FTWA 3R8FA 1EU1A 2OKGA 4FHZA 2B1IA 3BE4A 3U44B 3CKMA 1PUJA 1Z7WA 1YOVA 2H0RA 2KX7A 4LOHA 2NYAA 2SCUA 4DM3A 1KK2A 3L1IA 3B9RA 3UJ6A 1T1EA 2XQVA 4YDHB 5JZ9A 1NQAO 1BMDA 1L4EA 2GTPA 2Q5OA 1TXGA 4JGGA 5IJXA 4JI1B 4F56A 5CH5A 4RCZA 1NMEA 4QLBA 4XWWA 3KYJB 1E62A 4Z9XA 4EGSA 4OHXA 2GKOA 2K7ZA 4DRYA 4F85A 1T6NA 1U4SA 2AE2A 4KN5A 1W85A 3SY8A 1X1DA 2OM6A 2P78A 5FJJA 2HBZA