4L9AA

Crystal structure of smu.1393c from cariogenic pathogen streptococcus mutans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
ALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLPDSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVHSIGGFAALQIMNQSSKACLGFIGLEPTTVMIYRAGFSSDLYPQLALRRQKLKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRQLNDVQSLPDFKIRLALGEEDFKTGISEKIPSIVFSESFREKEYLESEYLNKHTQTKLILCGQHHYLHWSETNSILEKVEQLLSNHEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Smu.1393c
publication title Structural and functional characterization of a novel alpha / beta hydrolase from cariogenic pathogen Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 98
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l9aA00
3RK4A 1AKNA 2WILA 2OGTA 2HFKA 2XT0A 4AO7A 1GXSA 3IBTA 5AKLA 4DMCA 3FWHA 5FLKA 3FLEA 4PSCA 4DIUA 4MQLA 1FFDA 4DNFA 1QIFA 1Y7HA 2WG1A 2WFLA 3DL7A 5T4FA 3FSGA 4B0PA 4Y2UA 3QVMA 2VTVA 1LPAB 5ISMA 1YR2A 5LZ5A 1XFDA 2W6CX 4CCWA 4OYYA 2Y2VA 2HHAA 3R3WA 4F5ZA 4AB1A 4Q1VA 1YS2X 3G8YA 4X71A 4OB8A 1QJ4A 1CR6A 3BJMA 5CBKA 1T4MA 2IX9A 3H1AA 1DWOA 1XRNA 3AZQA 4Y2TA 4J0CA 2AJ8A 3T52A 2BUCA 4Y2VA 3P2MA 2WIJA 1XQYA 4W1RA 3DYIA 4OB6A 3ANTA 5HCUA 5DNUA 4X6XA 3TEJA 4X6YA 2VT6A 4FBLA 4HXEB 5AK3A 1ZICA 1GZ7A 1EK1A 3DKKA 4CCYA 2OCKA 3EBLA 5ALTA 1SCQA 1E8NA 5ALNA 3H2IA 2BFNA 3KD2A 3ZPXA 3W9UA 3C8DA 3VVLA 1A8SA 5A62A 4AZ0A 3AILA 2I3ZA 2FJPA 2I3DA 4Q3OA 5AM1A 4DGQA 2BAGA 3O4IA 5C7YA 1XZMA 1QZ3A 3D59A 1SFRA 3FLBA 3H18A 3IUQA 4DNQA 2JGMA 2AJLI 3IDAA 5AK6A 2OPHA 4WJLA 3AUKA 1VXRA 3DL4A 3RARA 4WFKA 5EFZA 3HRHA 3V1LA 3KOOA 4AO6A 1XQXA 5CH8A 1MNQA 3WWOA 5AKXA 1E8DA 2XUPA 3DOIA 4C87A 2AXEA 2WHPB 5EGNA 2HA0A 4DM7A 4M0MA 5ALQA 5AK5A 4LYEA 2BUAA 1WB5A 1VOTA 3LIIA 1UOQA 1YSCA 1UK6A 4HZGA 5AI0A 2PM8A 1TK3A 3AZOA 4X93A 2C5GA 1WCYA 1JKMA 4X7BA 3I1IA 2RHTA 1EINA 2XMZA 1K63A 1HLGA 4Q34A 3UUEA 3W9BA 1UFOA 1VJ5A 4C01A 3VKFA 5EHZA 3O9MA 4WFIA 3FYTA 3H2KA 1CLEA 1CUCA 3DYVA 3PFCA 2ACKA 1M33A 3F97A 1CUVA 3D5EA 3CXUA 5EIHA 1R3DA 1MX5A 3EF3A 2VAVA 4M0EA 2ZVDA 3A6ZA 3OTQA 5JZBA 2K2QB 1ODCA 5D7BA 1XZCA 5AM5A 4AXBA 1GKKA 1P0MA 3FVTA 2HDWA 1LGYA 1QIDA 3K2IA 3D2AA 4X90A 1YASA 4GHWA 3V48A 4BVJA 2Q0XA 1C7IA 4G4JA 5AICA 5AM3A 5JANA 5LZ4A 3FLAA 4UHFA 3D2CA 4H35A 1LZLA 1QIGA 5JAOA 5DYTA 5D3ZA 1XRMA 5AK4A 2XMBA 1TIBA 4IH9A 1AX9A 1JFRA 3C6YA 2GBCA 3OURA 1QFMA 3RKSA 1HPLA 2ECFA 4G9GA 3FAKA 1A88A 4PF1A 1L7RA 5A7FA 5JAPA 3V1KA 1KU0A 1CUZA 2HU5A 5DNVA 1PFQA 1XZIA 5CURA 4I19A 2XUOA 3PI6A 5ALGA 1XZBA 2H7YA 2WIGA 1ZD4A 4KE7A 4YASA 1CQWA 3WL8A 2HADA 5FXMA 5HF8A 4UBJA 2O2HA 4PW0A 2PBLA 4K6HA 5BWCA 4BCBA 3ANSA 1P0PA 3WLAA 5AP9A 1JI3A 4J03A 4K2AA 1CUGA 4MWTA 4QLAA 4QDOA 4DMHA 4AN1A 4PV7A 2OGSA 2WG2A 4W63A 4EY5A 4BAUA 1CUBA 4DYHA 2RGUA 5E4JA 5HF9A 4EZIA 1QIEA 1DWPA 3F8SA 5JADA 4IH1A 2CMFA 4Y9SA 1VKHA 2JGJA 4JYMA 5AM2A 2OXEA 4QE3A 4W9RA 1DQZA 4L3WA 3QM1A 4FNGA 5DTIA 3I2JA 5FOQA 3VXKA 3LS2A 5EIEA 1BN7A 2GZRA 3IURA 3EQ9A 3H2JA 4ZV9A 4ZGBA 4WDQA 1E66A 2VF2A 3BIXA 1FSSA 2WU4A 4UBLA 2HRQA 4UFNA 1CUHA 5CT6A 1DQYA 2PSEA 4BE9A 2XMGA 3OPMA 4E46A 4UUQA 2Z8ZA 4C6HA 1TCCA 1XZHA 3ESAA 5JAHA 3NUZA 1HKHA 1Q84A 1JMKC 1HBJA 2ZYHA 4QDUA 5ALDA 3I2KA 3WJ1A 5BV7A 2CUTA 1X70A 5LKAA 3EQ8A 4GWLA 4E15A 1EDDA 5ALZA 2RONA 3NOXA 4KEAA 3GROA 4QDXA 1QONA 5AKHA 4U2DA 5CT9A 2WIDA 4DTCA 3WYNA 3QMMA 1ODTC 4B80A 1AUOA 4N8DA 5FUMA 4BB0A 5IVHA 3ZI7A 4H7KA 5K3DA 4OD0A 4EY7A 3LP5A 1ETHA 2RAUA 2QR5A 3D7RA 1EHYA 2OQIA 2YXPX 4FMPA 2DHCA 2ZYSA 5ALEA 2WFMA 4NS4A 3SX4A 4G5XA 4OU5A 1LNSA 3W2TA 2WFLB 1L7AA 1MAAA 4KE8A 1F0NA 2QKYA 3BDIA 6YASA 3QITA 4ARAA 2DHDA 4B9AA 3GBSA 3I6MA 1MN6A 2AJBA 5AJHA 1N5MA 2V97A 2Z8XA 4OSEA 4DMFA 1K5PA 2C0QA 3FYUA 2JIDA 5HF6A 5I9IA 4BRZA 1BROA 5T4BA 1A8UA 1UT6A 1BEEA 2XLBA 1F8UA 2OLEA 3T4UA 1WB4A 2PL5A 2XMCA 4H18A 3BE8A 4LIPD 2H1IA 2YYSA 4HS9A 1QTRA 2WUDA 4CG2A 4Z49A 5AIBA 3W06A 4BP8A 4ETWA 1ORWA 1XKTA 2Y2UA 5LZ9A 4N5HX 2QUAA 3WZLA 4YK7A 4FKBA 5HK9A 3KXPA 4IQ4A 5CXUA 3QH4A 2C58A 5CH5A 5CT8A 3O95A 5EHQA 2HL6A 3ZV7A 4FWBA 5ALFA 3QPAA 5IVKA 1CUUA 1K6EA 1YS1X 2P8SA 4B7ZA 1QIHA 4K5QA 2LIPA 2IIVA 1F0PA 4B0OA 1THTA 5ALVA 3HYSA 4CI9A 2PKYX 2WIKA 1XRRA 3C8HA 1R1DA 2X76A 1ZOIA 1ACLA 1CUFA 4H7DA 2JGEA 4MEAA 3FSGD 3WKBA 3E1GA 4BATA 3QPCA 4JUIA 1L7QA 3C5WP 4QWWA 3L1JA 4IH4A 3DEAA 3O0DA 1G66A 4G4GA 5D6OA 3D0KA 4YX9A 4LXHA 4FLFA 5JD6A 3O4GA 3BJRA 3MGAA 1XLUA 2XB6A 5KWJA 5AI6A 3E3AA 2RIPA 5JYCA 5IH7A 2V98A 3WQHA 4CFSA 2OCLA 2ORYA 3WIBA 3FBWA 2GYWA 3AIKA 1JJIA 1BS9A 2WHQA 3WJ2A 1LPBB 4AMYA 1SCKA 3WK5A 2PX6A 2DSNA 3F98A 2EEPA 3I6ZA 4UBOA 4DSAA 1CVLA 3H04A 3VDXA 4QEKA 4UHBA 5LP1A 3DS8A 1AURA 4BTVA 1T2NA 3V1MA 3VJLA 1IUOA 3RLIA 3VJMA 4X97A 1YB6A 3B12A 5HQ3A 4DSZA 2PSHA 1FFEA 1THGA 3R41A 4PSUA 5JIBA 1AC5A 2AJCA 2JEZA 4ZV7A 1UK7A 2QT9A 4UHEA 1UOPA 2PPLA 5EI5A 4J0JA 5K3FA 5ALXA 5H3HA 5JZSA 4W1QA 4KAJA 5HFAA 4B83A 3PFBA 1ZI8A 3IVMA 5LLSA 2HA7A 3QPDA 4H7EA 3V9AA 3ICVA 1H2ZA 1RYYA 2J3DA 1WOMA 1GPNA 3AIOA 1USWA 3IULA 4XX1A 2DHEA 2C0PA 1BU8A 3W04A 2HA6A 3IA2A 1I6WA 1ZIYA 1XRQA 4Y2SA 3H19A 4X00A 3SC2A 3FVRA 1JU4A 5ALLA 1MJ5A 1XRPA 3WK4A 5CRIA 2BKLA 1QIMA 4RGYA 1VXOA 2PVSA 1MT3A 4CIBA 1IUNA 1YAJA 4JNCA 5HF5A 1MPXA 4G4IA 3WMRA 4GLBA 4KYVA 1U4NA 1D07A 1O6FA 4UFOA 4X85A 2O2GA 2HM7A 4X6UA 2ES4A 1JU3A 5ALIA 3WL6A 3AZPA 4BZZA 3PUHA 3LCRA 4FTWA 4V2IA 2QMQA 5ALRA 3WK6A 2CKMA 4FOLA 3HEAA 2G4LA 1X2EA 5EHNA 2QM0A 4BZWA 4H77A 5JASA 1EI9A 3HSSA 3L1IA 5ALJA 2VA9A 2O2IA 4EUSA 1XKLA 1YCDA 4H0CA 3D2BA 4FDMA 4BTLA 4H7FA 3OG9A 1MU0A 1QE3A 2V9ZA 3WYDA 4Y2YA 2DR0A 4Y2JA 1WHTA 1CUAA 1XZAA 5IVIA 1G5FA 1QIKA 2JGLA 2GYUA 4PO3X 3Q0TA 5AIAA 4DNOA 3I6YA 4XVCA 4XJVA 3AFIA 3EQ7A 3LLCA 1YA8A 4ROTA 5FP0A 1U2EA 1BEZA 4NMWA 2RHWA 3R0VA 4U2BA 5FKJA 4GECA 5AKJA 1AGYA 4I3FA 1W1IA 1WPRA 4P9NA 1JMYA 1XZGA 1MX1A 1IZ7A 4BDSA 4GXNA 1LPMA 4BAGA 1QOZA 5HKAA 1O6GA 2WJ3A 1MTZA 3H2HA 1Y37A 1ZJ4A 4J0KA 4ZI5A 3WKAA 1QLWA 2YH2A 2G5PA 2ZJFA 2VATA 2E3JA 5BOVA 2X5XA 5IVDA 4Q82A 2XQKA 4EB0A 4BDTA 1EXWA 4A5SA 3I2FA 5LYYA 5D3KA 3HABA 2FUKA 3STTA 1EDEA 4ARBA 2Z3ZA 5LIPA 1IZ8A 5CXXA 2PSDA 1R50A 4UHHA 5K3BA 5EHXA 2VJBA 5FPPA 4UHCA 1EVEA 3DDUA 3DOHA 2QZPA 2JGKA 1OILA 3ILSA 3WIOA 3BWXA 2C5FA 2EDCA 3FNBA 1Z68A 2QRUA 1S8OA 5ALHA 1CFJA 1EB9A 4Y7DA 4EA6A 1LLFA 3C70A 3G02A 1A7UA 1MAHA 2WUFA 3VJKA 1DWQA 4OPMA 3STXA 2XDWA 3DCNA 5ALPA 5AKEA 4AMZA 3TRDA 1W75A 4JEIA 3CN7A 5EIAA 4RNCA 3GFFA 4WY8A 1TQHA 2XLCA 1Y7IA 4KE6A 3M81A 5CW2A 3H1BA 2HA4A 1TKRA 3HI4A 3HXKA 5CMLA 4CG1A 3FCYA 4LKOA 1CUDA 5ALUA 3WI7A 2J4CA 3M3DA 2VT7A 3DD5A 2XUAA 4Y2PA 4Y2QA 2HRRA 3G9UA 4JH0A 1VZ2A 5I7UA 4HRXA 1OCEA 4Q3KA 2PUHA 4FHZA 3U0VA 1ZD5A 2NW6A 4AO8A 1XZEA 2BJHA 1CIJA 1J06A 5AO9A 4RE5A 5K3CA 4IO0A 2AJDA 3H17A 5ALOA 3G0GA 3OOSA 1E8MA 4ZREA 4KACA 3BF7A 1MX9A 1RWQA 4J7AA 4KAAA 3BF8A 4X94A 1ZD3A 1CV2A 4ITVA 1CUXA 4MEBA 3WZMA 7YASA 4MYDA 3PE6A 5ALYA 1WB6A 4A16A 3U1TA 5A7GA 4S0XA 1H2WA 3DQZA 1WHSA 3N0TA 1Q0ZA 2V96A 3STVA 2QXTA 3QZUA 5AI5A 5SYNA 2QOEA 4M0FA 5FDFA 1DT3A 1FFAA 4F0JA 1J07A 1FFCA 4J0IA 4JYPA 4KE9A 3NWOA 4C88A 3WWEA 5JAUA 4X3CA 2C4HA 1TCAA 2WTNA 5AH0A 3R3XA 4H7JA 3WKDA 1HQDA 2ZYIA 3JWEA 5FV4A 3BL8A 2XMDA 2EDAA 4EY8A 2XUDA 3I1YA 2QJRA 1AZWA 2DQZA 4X91A 2HA5A 5A71A 3PDCA 5DLPA 2XQGA 5KWIA 1EB8A 4FFWA 3WKEA 5IKXA 4AN0A 2RI6A 4L9AA 4ZXFA 4TVKA 2XUGA 4C4YA 2CBGA 5JATA 2HA3A 2BGNA 1C4XA 3CCCA 1B41A 2D5LA 1G4HA 2H7CA 2XUKA 2DCMA 3H2GA 5ALMA 4P08A 4QDZA 4BC0A 3K6KA 4UBMA 4UFPA 3WWCA 2WUEA 1H2XA 2QVBA 5AKZA 4ZRDA 2XUIA 5A6VA 5JALA 3HC7A 3GA7A 2WU3A 5C81A 2CJPA 1J1IA 5K5EA 2VJCA 5ALSA 5JZ9A 1Q0RA 5K3EA 1IVYA 1CUWA 5E4TA 1QO7A 3MUNA 4ZWNA 2ZSHA 4BE4A 3IIIA 4LXIA 4W1SA 1FJ2A 2ZSIA 1H22A 5ESRA 1N8SA 2ACEA 4CCYB 5AI4A 1CUJA 1VE6A 3ESCA 1CUYA 4GI1A 4E14A 1A8QA 2J3QA 3WK7A 2B4KA 3JYHA 4DNPA 3H0CA 3E4DA 1AMNA 1FFBA 1GT6A 3C6ZA 4TPKA 4NVRA 4OU4A 4WCVA 1RP1A 4QNNA 3DJYA 2ZYRA 4L0CA 1P0QA 2FJ0A 4KRYA 1ZGBA 2XQJA 4BVLA 5CT4A 3N2ZB 4RPCA 4UBNA 5F4ZA 4QDTA 2JEYA 2OQVA 5T4HA 4PQEA 4G8BA 3G0BA 2XMSA 1VE7A 4B81A 3ESBA 2QUBA 5AI9A 2XUQA 4Q3LA 4W1PA 1ODSA 1N1MA 2PSJA 3ZLUA 4FFVA 1CRLA 1BCSA 3GZJA 4GDMA 4HAIA 4KJXA 3FCXA 4QA9A 3STUA 3BIWA 1LBSA 1BE0A 1XRLA 4B85A 3R3UA 3R3YA 2GYVA 4WY5A 2ZJ6A 3VISA 1W52X 2HU7A 3G9ZA 1CUIA 3M83A 1QIIA 1WPXA 4XWGA 4B6GA 2Z5GA 3ESDA 1LPPA 1MNAA 1X2BA 1CEXA 1R4ZA 2XE4A 3DLTA 2WG0A 5AOAA 5LZ7A 1CUEA 1DINA 4FLEA 1H2YA 1DT5A 3C6BA 1UK8A 3F96A 4F60A 1UWCA 2CB9A 2HFJA 2Y1KA 3PF9A 2B9VA 4FLMA 4WFJA 4HXFB 2XUHA 5DWDA 5FRDA 3BXPA 3C6XA 3QMWA 5FPQA 3NGMA 2I03A 1QGED 4K6GA 1XZFA 1OXMA 1ZIXA 4GEGA 5AOCA 3HACA 3S2ZA 5BWBA 1KEZA 4OCZA 2QXUA 1VZ3A 3S8YA 1GKLA 4EHBA 2BCEA 3WA7A 2VQ6A 3FYUC 2XQIA 3QMVA 2JF0A 4LHEA 2H7XA 1GPLA 2XMRA 2PSFA 5HK8A 3F9CA 3ZLVA 4BCDA 1UKCA 4CIAA 4G1FA 3C87A 4GBGA 2DQYA 4HTAA 4N8EA 2GBFA 5DNWA 3RM3A 3STWA 5AKKA 5YASA 5A2GA 1XZKA 4KR0A 4N5IX 5HFNA 1K8QA 3YASA 2PUJA 4OUKX 5CH3A 4J0GA 2JBWA 2CZQA 3DNMA 2H9YA 1CUSA 4DLNA 3R3VA 1SOMA 3AIMA 3IUMA 3EIOA 2JGFA 3OM8A 4BBZA 1GQRA 2QS9A 5J3JA 4X95A 4P92A 4G9EA 1JJFA 4J0DA 4MWSA 5JD5A 4EBBA 2D0DA 1CQZA 3L1HA 1NU8A 4FBMA 1YA4A 1HDEA 5JARA 1BN6A 3C43A 4LXGA 4C89A 1QO9A 2G63A 5AM4A 1ZJ5A 4U2EA 2OAEA 3A2NA 4J0HA 2WLSA 1LPOA 3WWPA 1P0IA 1R88A 3KWFA 5LZ2A 3CN9A 1BRTA 1QIJA 2O7RA 2QJWA 3TJMA 3KSRA 5AKYA 5LKRA 1TCBA 4Y2XA 5T4EA 4BVKA 4NZZA 1UZAA 3B5EA 3HLKA 2GZSA 1QTIA 3G0IA 2WFZA 3E0XA 3HZOA 4L72A 4GW3A 4DMKA 5AKIA 2Y6VA 1LPSA 1GGVA 4PNZA 1TRHA 1XROA 3SK0A 2XMQA 1E89A 1N5RA 4AZ3A 1AQLA 5CT5A 1EDBA 3IB3A 1VA4A 2WSLA 2HU8A 3PF8A 4A23A 1R9MA 2WJ6A 5LZ8A 1W4LA 4UBKA 4HVTA 1IMJA 5ALWA 1PJAA 2VJDA 2XQFA 2WUGA 4WDRA 3C45A 4MJ3A 5ALKA 1SC9A 1XQVA 3X3HA 4AQDA 3WL5A 4MXDA 2Y6UA 4U2CA 2WHPA 5E4YA 1VA5A 4KAFA 3O4HA 1UK9A 3WA6A 3M82A 4OYLA 3DKRA 1E5TA 1UKAA 1EVQA 1GQSA 1E3QA 3WKCA 3ICWA 3UMJA 2PU5A 3A2LA 3PICA 1VLQA 1KU6A 1XZJA 4MQMA 1YAHA 5AHXA 5AOBA 2QTBA 3VVMA 2PU7A 5E2IA 1K4YA 3MUOA 4P93A 5DTJA 4F21A 3QBJA 1EA5A 1UOOA 4EY4A 3D4LA 2DFPA 4XIIA 2WM2A 4UPDA 4E11A 4U2GA 2R8BA 4O08A 1ZGCA 2B61A 1R9NA 4BP9A 4FNMA 4H7HA 3I2IA 4X92A 1LZKA 3FOBA 4I4CA 5DJ5A 3ED1A 3ZLTA 5DYWA 1NU6A 2OAGA 3JW8A 4Q05A 4QWMA 4B9EA 1ZI9A 2C7BA 3O9VA 2UZ0A 2BUBA 1LPNA 2G5TA 4K6KA 4BAZA 3A70A 2HIHA 1GPKA 2HA2A 1JT2A 2WIFA 5AKGA 3GUUA 3G9XA 3AINA 4U2FA 1IUPA 2WKWA 3BDVA 2FX5A 3G9TA 3WL7A 2XI4A 4BRSA 1DU4A 5A7HA 3UUFA 2VAXA 2WQZA 5JD4A 3MVEA 1B6GA 2WJ4A 1LBTA 4LYDA 1ORVA 4QLOA 4H7IA 4BC1A 2ZJ7A 3FYUB 4YPVA 4B82A 4C4ZA 5K3AA 4UBIA 1W76A 2XUJA 1MO2A 4G8DA 2CEKA 2X8BA 2B20A 3G0DA 3SWWA 1J2EA 2VJAA 3F67A 1G42A 1TAHA 2ROQA 3KWJA 1XQWA 3V1NA 1SCIA 1WM1A 2O7VA 3O4JA 2Z3WA 5CTAA 4D9JA 1H23A 1U65A 3CCBA 2J4FA 3I2HA 1QFSA 2VSQA 4AX4A 2WTMA 2I78A 4N8SA 3TGLA 1EX9A 1XZLA 2JGIA 1XZDA 3I2GA 5KREA 3K9BA 3PUIA 1ZD2P 1U8EA 2OCGA 2W22A 3WK8A 4KRXA 5SYMA 1UXOA 4RE6A 1XLVA 1XLWA 1ACJA 3G0CA 3IUNA 4OB7A 3D3NA 3G7NA 5DYYA 2ONCA 1UKBA 5HKBA 4INZA 3B3QA 5AI8A 1BCRA 1F6WA 4J3JA 4PSDA 3KDAA 3C5VA 3HJUA 4HRYA 3WWDA 3QYJA 4EY6A 3STYA 2WHRA 5HZGA 4IHAA 3W05A 5KBYA 2VEOA 2GBGA 1W6RA 1EH5A 1HL7A 2BGRA 4BYMA 4MYSA 4TGLA 2IITA 4Y2RA 5AM0A 2YASA 1NX9A 1YB7A 3R3ZA 1DTEA 1PV1A 4BCCA 1ISPA 4QZVA 4B84A 4CG3A 2OCIA 1DX4A 1DX6A 2OG1A 1ZI6A 3AJAA 1CPYA 3ZWQA 3IUJA 1JJBA 3A2MA 4HXGA 5HQ3B 3WK9A 2R11A 3OC0A 3LIPA 3GELA 4G8CA 2GBIA 3R40A 1Q83A 4C4XA 5C8ZA 4UHDA 5I8PA 2XUFA 5K3FB 2OGZA 3Q8WA 1EK2A 5C8VA 3I28A 5C8XA 1C7JA
chains in the Genus database with same CATH superfamily
1SHKA 4P8RA 2V6JA 4RKYA 1Q21A 4KO3S 4TLDA 3UTCA 2NVBA 1QR6A 2I8LA 1XQ1A 3ELUA 4IAOA 5DYIA 4HT3B 4N65A 4LYGA 3FUVA 3KJIA 3LUGA 3NWEA 4DCPA 3GCDA 4EO7A 2XT0A 1J20A 4DYVA 3IBTA 5TXGA 4EH1A 1SWWA 1NDHA 5A9TA 3F74A 2J9RA 2JHFA 3QHQA 3ZKAA 1ZU4A 4EATA 2MMCA 3PHLA 2MSNA 3DZFA 3LCUA 2O06A 3IC5A 1HFWA 4MUBA 4PSCA 1B0ZA 1E6MA 5AUOB 4DIUA 2PUFA 3ZJUA 1FFDA 5JT1A 1M34E 2O2YA 2YZKA 2O0KA 1QB7A 1T1IA 4JI7B 1JR3D 1N2GA 1RM0A 3PUXA 4M7OA 1GUAA 2PZ8A 5L3SA 1FLAA 3ENZA 3QJGA 4O1MA 3BFJA 4RSMA 3EPPA 3IV6A 1JEAA 5T4FA 2XNDA 4HYQA 1K06A 5AVSA 4RC9A 4NBSA 1N2SA 2F3SA 4UUBA 1C9YA 3KR0A 2ISSD 4MV3A 4HUTA 3ZKWB 4U3JA 5JVDB 4KNYA 4G65A 3RW9A 3I8XA 4JL5A 5FOVA 1JDPA 2HTEA 2XVYA 2CEAA 3RABA 4M0DA 1UH5A 2PSSA 2HGSA 4CLXA 4D6XA 2YBDA 3TCXB 4B8YA 1K8XB 4Q4CA 3ETNA 3F90A 1X3LA 1XFDA 2X4GA 2W6CX 4YO7A 4L9RA 2RAPA 2TRSB 5ADHA 1QZZA 2X4IA 4K46A 1C4OA 1JHPA 3QKSB 1XXHA 3UB2A 1VCHA 2X0RA 4XSVA 5CA0A 5FO0A 3T06B 1M8FA 3JZFA 2XNJA 3GMSA 1K8YB 1N2BA 2LE0A 4C29A 4Q1VA 4S1TA 4L0MA 4HGYA 2IT1A 3G8YA 4UU0A 4BP1A 1QQAA 1DC5A 2ZG6A 1CR6A 5JCOC 4I2NA 1VSBA 1T4MA 4KSBA 3E9NA 4DVGA 2DPLA 5CLLA 4REOA 4Z4CA 5IG2A 1D1QA 2H06A 3N6XA 5F64A 3UK6A 3JASB 4IZHA 4CGYA 1JDTA 2FXIA 1Y8ZA 3T52A 4PPYA 4BGIA 4I1PA 3GA5A 2C7GA 5C37A 1Z0UA 3L84A 2WIJA 1QVWA 1C0EA 3KOYA 3SLKA 3VO2A 1FY2A 2EQBA 5JQWA 1P1JA 3MRXA 2GD1O 2B0JA 3K05A 2MCFA 4JT2A 1XXLA 5DNUA 5LQCA 4P7FA 1GUYA 3HVHA 4YLYA 2W4QA 3AY6A 4CM9A 5KVSA 4YCMA 4MQ4A 3ROZA 2IH5A 4EW2A 4BO1A 4L8WB 2Q7DA 3G3EA 1L4FA 3ESYA 4E21A 4HP8A 3B7GA 1BO6A 2VT6A 4HXEB 1ECBA 1PQ4A 1TPYA 4Q1DA 1NPYA 3B53X 5DTQA 2RC5A 3MQ2A 3IP9A 4BX0A 4M8LA 2C98A 3ZE2B 4YMGA 2I9KA 1R4AA 2RGNA 3O1JC 4I46A 2G0AA 2O0LA 1SCQA 1TMYA 3PEVA 5JQGB 5ILQA 1Y9AA 2BDEA 4HWGA 5TARA 1FDTA 1LQ2A 5I7OA 1E8NA 1OIWA 3EGCA 5A4MS 4PZAA 2JH3A 2H08A 1DFHA 2VP6A 3H2IA 3MB5A 4MO9A 4RCYA 3ZPXA 1G38A 1UXHA 3UOWA 4L5JA 1ECGA 4YECA 4G85A 2C4WA 4UUNA 2BT4A 1SUAA 2J0VA 3EEYA 4BQEA 4MR8B 2XDQB 4DGQA 5AJTA 2AZMA 3RNOA 4C6TA 1GL3A 1XZMA 2JJ1D 4Z9FA 4DAOA 4M9QA 3OHSX 3CM0A 2WKSA 3Q6MA 1GDTA 3L0IB 2IYFA 3TO5A 1ADYA 1F8XA 3IH5A 3JR7A 2GHRA 5CLIA 1HUQA 3BCUA 4DKXA 2K6GA 3OFNA 3EPLA 2JGMA 1AQUA 2Z8YA 4NFHA 4R9UC 2MDTA 1LRLA 2XIQA 4KQ1A 3PEWA 2V8OA 3IDAA 1YD7A 3KB1A 4FFSA 4YJFA 5AK6A 1N4DA 4IO1A 3PLRA 2D59A 4QGGA 4XR9A 5ELLA 2UZIR 5HQJA 4LJ8A 3UK0A 2VJPA 5C2JB 5K0BA 5HMLA 2OV8A 2DWQA 2A2ZA 3R77A 4Q93A 3EVFA 3TPFA 1D03A 5KYTA 5K8VA 1HYGA 3L7LA 1NIJA 4UEKA 3DL4A 1IM2A 1P2BA 4EHDA 3GLIA 2Q9AA 2NO1A 3FSJX 1T4GA 2PIAA 1KK3A 3AR3A 3MYRA 1T0BA 1HQKA 3NHFA 3JWHA 3KOOA 4J1QA 2HKIA 2G5CA 4W6ZA 1XQXA 3V34A 4YQYA 3E84A 3H6KA 5BQ3A 3HXMA 3O1LA 1YI1A 3SC6A 3SQOA 3LHSA 3JVDA 3WGLA 3BD9A 1HDGO 3PDUA 3WWOA 1ZNWA 1TMKA 4E3WA 4GZ6A 5AKXA 2J5RA 5DW0A 3TSCA 1HL3A 1TI7A 2JFUA 3OZBA 1DQRA 5C0OE 4LI3X 2A59A 3SBOA 4HUJA 1F4VA 3IT1A 1AZLA 4H3VA 3VH4A 3WLEA 1KJ9A 2XUPA 4FCWA 3BGOS 4RL4A 4DT1B 3DOIA 3H65A 4C87A 1CRZA 3KSBC 2DTDA 3WX0A 1PQPA 3COWA 2YRWA 3CLTC 3HUDA 1ZDMA 1R0ZA 2H1WA 1J90A 3E7XA 4JZYA 5DNDA 2H0QA 5FTNA 4ALMA 4C4TA 1EUQA 1YMVA 1FW6A 2WHPB 2HSZA 2RGAA 4ARUA 3UWDA 2IDZA 3R0XA 1VE5A 2HA0A 1RAGA 2HNKA 3ZIAA 2XD4A 2FMIA 5ALQA 3UGTA 3ZUPA 3HEMA 1N8KA 2EKLA 3KL4A 2QBYA 1FRFS 1JAYA 4IHKA 4TKVB 2ZQZA 2BUAA 3DMGA 4JOQA 4RHEA 2BEVB 3LIIA 3F5SA 2GT1A 1EDZA 1F1BA 2F3TA 4OF4A 4LZJA 3OVMA 3V2IA 2I7CA 1JR3E 4L76A 1I7LA 1DBWA 2AG0A 4HZGA 4JT8A 2ZIAA 4CPDA 1ISHA 1VJRA 2ZTHA 4DY6A 1W6UA 2VHYA 1G5IA 4JJIA 5I45A 3OE7A 1Y6RA 2FSUA 3TVYA 2W2LA 4WXEA 3DC2A 5GJCA 1ZUD1 3DDWA 4RNDB 1CY1A 3EG9A 1RMYA 3DMRA 3V8PA 1P4RA 3OE4A 2EGHA 4EJSC 3O21A 4YYEA 4P83A 1JKMA 5LLTA 1OZGA 1TYBE 2IHZA 3SX2A 1KFKB 2QQ5A 3UMBA 2DP4E 4F9TA 3HTXA 2J9YB 4H0NA 1GZ6A 1E3LA 4E1AA 4XFKA 3HNOA 3SVTA 2F67A 4C30A 4E51A 3ND6A 1EINA 2H2GA 3OLWA 5DGHA 3M6LA 1H3FA 1OJLA 1K63A 1S6YA 3NJ4A 1C9DB 5DYNA 3AF1A 2IODA 1I7SB 2ZZMA 3N8NA 2P1RA 4FOSA 1BGWA 3OCXA 4FZVA 2F9LA 2G6BA 1ZVJA 221PA 4W8HA 1S01A 2R00A 3FZYA 5I9LA 3FYTA 2A35A 4Z99A 5IYZB 3QGMA 3MEQA 5JCXA 5JYBA 1CJSA 3WV4A 4ZI7F 5DEIA 4J7XA 3KKPA 1PL8A 3G9QA 4HX5A 5EKDA 3F97A 5I9NA 2OESA 3D6AA 4KLRA 4UZEA 1WMFA 3SE7A 3CXUA 1SUSA 3F8WA 4DADA 5AW7A 2X3YA 2R86A 2CB0A 2KX7A 4J4TA 1ORIA 1MX5A 4MVJG 1I33A 2P1DA 1E3WA 4WCFC 5CDTA 2GVDC 4DXHA 1HDRA 4CEHA 5HIJA 4R8SA 3UMRA 2I4NA 3LBAA 3QKWA 4KIUA 1MZVA 1N9GA 2W2KA 1HT2E 3UENA 3A6ZA 1GQ2A 2HRZA 1VLHA 4CKCA 3LWDA 4DV6B 4Z8XA 1ODCA 2J9GA 1VBNA 4BQIA 1OZHA 1WNFA 3UOGA 1ZIDA 3ZBPA 1I5RA 1RCTE 3ST7A 1TM3E 5CPFA 4W6QA 4ARSA 1YR3A 1HY3A 5CB4B 4MMYB 2K7FA 3MINB 1DNPA 3PGLA 4LZWA 2JLUA 4H3HB 1YJBA 3FCUB 1U94A 4RQTA 3FVTA 5E1BA 3KKLA 2I22A 2ZJOA 4OBEA 2IEBA 3KXIA 4ZTBA 2QU8A 1N9KA 1TAGA 2OBBA 1YASA 2IHVA 4QO7A 4GHWA 1Q3HA 1LLDA 2LP4Y 2FCAA 2XMPA 2QRPA 2GPAA 2QYOA 4ZAZA 3B7WA 2KWIA 5HFJA 3SDBA 2XCUA 1SBTA 4BFVA 4CCAA 5JDIC 5K0JA 5BSRA 3EWAA 3HJRA 5FI1B 1RFGE 5JANA 4LTDA 2FWIA 4DR4B 3D8UA 3VHXB 3OKAA 4RA9B 4IY1A 4R6WA 5FL7D 4DN6A 3G8BA 5EPUA 2NU8B 5FWDA 4RF3A 1GG2A 4OHPA 4X6LA 1XAGA 1ULSA 2FSSA 3FDJA 2GM4A 3PQ3A 4PYNA 2QV0A 2IPLA 5ITSA 4F2HA 4MJ7A 4OX9B 1ZVVA 1COWA 1ZONA 2Y92A 2ZREA 2IU4A 1R6UA 3JS5A 5F33A 1Z45A 2JBAA 5E0KB 1ZUNB 1GNSA 4ZIRA 4P7GA 2WM3A 3UJHA 3JAKB 1Q3KA 3GRPA 1Z35A 1SEPA 1SVMA 1YJXA 1G64A 3TJRA 1TCVA 4PYKA 2O6HA 1YKSA 5M34A 3SDSA 4M54A 4G97A 1ESMA 3WNDA 1A9OA 1FMFA 1KU0A 4HNGA 1YC5A 3RF6A 2QX7A 3PNMA 3HUEA 3D7LA 3KOXA 1CUZA 1T2FA 2HU5A 2O14A 3BCSA 3NPAA 1PFQA 1YRHA 3SSMA 4BRSA 1AY0A 3GMIA 4NE7A 5BSEA 4N7BA 1VQ1A 5DRTA 2AFIE 2XUOA 4WK6A 1RYEA 3GG9A 3RYIB 2JLRA 2ZUDA 4OQDA 1OSNA 2A9KA 2FZ5A 1CQIA 1MIOA 1ZK0A 5DCYA 5EEHA 2YHIA 1GCGA 2BV3A 3WBJA 1YCHA 1PUJA 2ZAMA 5LOVF 3SJUA 4YS6A 3WL8A 4WLVA 3NP7A 4ALJA 1ZSYA 5TY0A 2QTVB 3JSXA 4HNSA 3DOUA 4YRBA 1EDOA 5GV7A 2B99A 4EVQA 3SEAA 1IOWA 2Q4BA 1OYOA 3CEPB 4PW0A 2EATA 4J7UA 3TH5A 1IY0A 4K6HA 1UAYA 3PDIB 5C3UA 4EA8A 2XHEA 1TW3A 4PZDA 5EL0A 5BWCA 3D4PA 2YIDA 1QHHB 3FX2A 3FMGA 1R74A 1X1CA 2QSJA 2A57A 4UUOA 5CAEB 2WTUA 1INLA 3MWJA 4Z3OA 1S4QA 3DE1X 1W88A 1KOLA 3KFVA 1CW2B 3ANSA 4BCBA 1RKXA 5JS8A 4DOMA 2XTAA 3GGPA 4P5DA 5KMGA 2D00A 4BQFA 3A25A 3L46A 4Q0MA 3N58A 4K2AA 5J2TF 1F9AA 3PNPA 4L4ZA 3ZWAA 1QMGA 1QRDA 2XNKA 4E08A 1EA7A 4JJFA 1E2JA 2C7OA 4OIFA 4GBED 4TWIA 1ABEA 2JK1A 1SOVA 1HRDA 1E1CA 4GRDA 3S55A 4BEBA 2E0IA 3NHLA 4FFBB 3LPMA 3PDHA 4OKIA 5KYXB 1U3GA 1GCUA 1C9JA 4W63A 1TRKA 2JCBA 3LKDA 3MJSA 3HU5A 4J1SA 4J2TA 4PLFA 1TM4E 3HWX1 5EKXA 4DQKA 3CLSC 5BT8A 4DA6A 4PN7A 2VDVE 1BQ4A 1OE0A 5HF9A 3HBNA 4HNAB 1N32B 1QIEA 1DWPA 1NQOA 3LTEA 5EZ6B 4IH1A 4P4SB 2HMWA 1RE1A 5DNEA 3V00A 1VKHA 5KQPA 1P7PA 4JYMA 2OXEA 4P2GA 2E4XA 4QUDA 1LQUA 3GP8A 1IMOA 4W9RA 1DQZA 2J6BA 4RS4A 2YJ4A 4WA8A 1NAIA 1MH9A 3WLJA 2RGRA 4FR2A 1DRUA 4MR9A 1TOAA 3QM1A 4Y2GA 4ZQCB 4EHAA 5DTIA 4F5DA 2ADFA 4CL8A 2XDAA 4UTVA 3V2GA 3KZVA 1P74A 4GGMX 1QHXA 2BJWA 3ZE6A 3NEAA 1D6NA 4MPPA 3D8TA 2OK7A 4S24A 3T6KA 3WIVA 2ODTX 2ZI3A 2J9FA 3DOOA 2GSWA 1Z4KA 4PFKA 3OZCA 1NKTA 2RGEA 3BMNA 3D4IA 3G2OA 1I13A 2WJAA 3C1AA 2F1OA 3L07A 4PX9A 4Q9AA 3IBSA 3TSAA 1T9HA 2D0PB 1OFGA 1J0BA 1OGJA 4D79A 3UKJA 2YV2A 4Z7OB 1I4TD 3K4PA 1YKGA 4KXNA 3BIXA 5SZIA 2DH6A 3NFYA 2HRQA 2GZDA 3E35A 1A1VA 4RIFA 3EYWA 1K7CA 3RAFC 2XDYA 2HREA 2IIPA 4JEMA 4LSGA 1K89A 1H69A 4P3NA 2R8PA 1XDUA 2AG6A 2V7PA 3PYMA 3QYAA 5I4BA 1MHTA 3CWCA 4QQRA 1NVBA 4EQ6B 4X61A 1YU6A 5B2EA 4ZVQA 1W48A 3DZBA 1A50B 1UR5A 2ZR9A 3U3JA 4PICA 5DI3A 4DR7B 3Q3GE 1QTQA 3WJAA 2UU9B 3EBPA 1H5UA 2BMJA 3JWGA 3RVQA 1IXRC 4E46A 4HNRA 4PO9A 3C8ZA 1GRQA 1TCCA 1SQ6A 1XZHA 4CTJA 4FHCA 1W34A 5JAHA 3NUZA 4MQFA 3MB8A 4MVWA 4AWXA 1S96A 1JE0A 1GFIA 4C7KA 4RFVA 4YYZA 3Q1KA 4NTZA 1T5OA 3ZZ0A 2ZYHA 5CVUA 4ALNA 2J31A 2QVZX 1D1SA 4RHCA 5ALDA 1WTAA 3G1UA 3H8WA 1HTWA 2MHCA 4Y6OA 4YCCA 5BV7A 2CUTA 5SZJA 3X44A 3VNQA 2BMAA 2FX2A 3HGQA 2C7PA 4JIGA 4W8GA 1A77A 1BA2A 4IX1A 4LGMA 4D9KA 3U81A 4E15A 5KINB 5J58A 4WINA 5ALZA 1TZCA 3QNWA 2ZRMA 2RONA 4O4LF 4JC5A 3OECA 1KC1A 4KVZA 1TT5B 4QDXA 4QTYA 1KQPA 1R9JA 1NMZA 3TB6A 1ARZA 2VDMB 3QE0A 3SIWA 5DI9A 1EK6A 2PMKA 2H57A 1PJLA 4L8LA 4U2DA 3L1UA 1OIXA 1EFRA 2LCQA 1AJEA 3LWZA 4YN3A 3OUTA 4V39A 1YACA 5CLGA 5JUWA 1VC2A 1GLGA 4LVUA 4WZBE 1RJGA 3QMMA 1ODTC 1AB5A 1M34A 1ZH8A 3EGIA 1VGVA 3RC1A 4B80A 4N8DA 3O3CA 3GO4A 4OK6A 1GTG1 4CVNA 2ZIUB 4OGKA 4AICA 4V0ME 2YVLA 5KTOA 2KW5A 2WWTA 1J5EB 4OHRA 4BB0A 1WUKS 1Z37A 2H4FA 2CNNA 3C98A 3ENWA 4IQGA 3GGJA 4BMCA 5ESXA 3FMOB 1MABB 1DC3A 3ZZ1A 1KAMA 1DOZA 4L22A 3RVBA 4X1IA 3L8DA 1B7GO 4JBGA 3LP5A 3NHUA 2WYVA 1ETHA 1YBVA 1YJAA 2VTDA 2ZK7A 3ETDA 3ORQA 1YTUA 1EHYA 2W8BA 1I32A 2YXPX 1VI6A 5AJZA 2IQ5A 3IVGA 1T4CB 2VP2A 4U2KA 3W5DA 4NS4A 3SX4A 1NULA 4YAUA 5A4JA 3U3OA 3U56A 1HLDA 4AG3A 2NZYA 4KHPB 3GW8A 2W00A 5I7EA 3Q0EA 1JH9A 4GPAA 2EBWA 2R1ZA 5JAIA 4OFZA 1K5GA 1UPFA 2VYND 3W7BA 3PGXA 3LBHA 4O29A 3RRXA 1OKKD 4HQRA 1PJSA 2A3RA 1HSOA 3TIFA 1R6DA 4YRJA 1QWOA 4W82A 4O4IF 2PLRA 5TJ9A 3W2TA 5FBQB 4JLVA 1T8SA 5BRNA 1MAAA 2R9VA 2R2GA 2YNMD 4TWBA 4COKA 5THKA 4EFKA 2E5LB 1U1EA 1TZ2A 3G5MA 4IIFA 1KY2A 3BFPA 4ARAA 1YQQA 2DHDA 2OENG 3I6MA 5ICMA 3QX7A 3ER9A 4V0OA 1I8TA 5AVKA 3BSSA 1YE5A 4DMFA 2H1FA 3QKRA 3HBMA 4YLEA 4KR6A 2D5IA 3MOIA 3WYGA 2AMJA 1K5PA 2JASA 3L82B 3PRJA 4W5WA 4D9IA 1LSSA 3CPJB 1Z29A 3GEPA 3VO8A 4CMEA 4CM8B 4CKWA 1TADA 1VPWA 2IIBA 4KREA 5BSMA 3RO7A 4PWZA 1HWYA 3IVRA 1UT6A 2C8KA 1BEEA 5C34B 4F4HA 1PR3A 2WJGA 1F8UA 2HPAA 4LISA 4LOLA 1TW2A 4RYDA 2X22A 4Z53A 1M8JA 1UBFA 4Q24A 1I51A 2OBFA 3PQ5A 1KYWA 1NIPA 2PL5A 1V5EA 1YE8A 3IKVA 5LDDC 3BE8A 4G0XA 1Y1KE 1ISFA 2H1IA 2E6KA 2GARA 4BUJA 1XVAA 3CVXA 2YYSA 5A1TA 4IM7A 2CJFA 2GN6A 3HB9A 4U9UA 1S02A 1QTRA 4RZHA 2WP0A 4AIRA 1JWLA 4NYIR 1KF0A 2Y4OA 2ZB7A 2DERA 1WVGA 2ZJ5A 3TQQA 2V6BA 4EO9A 2Q4RA 4EG8A 2FLWA 3O4VA 4AJKA 5JNWA 1MOPA 4YJGA 3B51X 3OZTA 1N5DA 1R6VA 3ICQB 1SK9A 2EARA 3O84A 4FKBA 4FYWA 1B8UA 5HK9A 3U7FB 4ERXA 2RGCA 5C8YA 1NF3A 2OBNA 3AGQA 3BORA 1HI9A 2ZAOA 1N2IA 3A9RA 3IV9A 4GP7A 3ILYA 2I67A 2XWSA 2FZCA 1GTZA 1A0OA 4KV7A 3K15A 2Y0DA 3U4MA 3BVPA 4GP9A 1NMXA 1X7HA 1H05A 2D74A 4MP3A 5IVKA 2NVWA 1T29A 2P9GA 1G9SA 4KG7A 4XIYA 2JG3A 1XEWX 1YS1X 2P8SA 1KJWA 3OLXA 2PUDA 1E7RA 1E6CA 1MC4A 4K5QA 2OV6A 1AS3A 2QRNA 5DSTA 2AC7A 3U44B 1ZN7A 1IXSB 3H8SA 4RY9A 5DM1A 2HDNB 1K08A 3O2NA 3HYSA 1J97A 3GFRA 1XT6A 3OE1A 5F7XA 5JI2E 1ONBA 2OHGA 4G0QA 3S2YA 4CUKA 3LV8A 3GWGA 3HCNA 2H4XA 4TL8A 4GI7A 1P72A 2VYVA 4GYYA 1NVDA 3MLBA 4N7JA 1ZXBA 1EJBA 5CP8A 1RXEA 3AR4A 3T1HB 1QQ7A 4D43A 3GLFA 5TQ0A 3P0RA 3AT1A 4TV9A 2WNSA 2HBZA 2B25A 1KR5A 4HFJA 4R8VA 1OBOA 2VWPA 4I1RA 6GPBA 2HEIA 5K0CA 1SUWA 2CDNA 1HURA 2JHCA 2X3FA 3B89A 3FSGD 4J3FA 5IK2A 3WKBA 2P9BA 2J3HA 3ZVNA 4OGWA 4BATA 2YUIA 4LSZA 2AX3A 4INJA 3PGA1 2Q0HA 5LMUB 4NCKA 1M2OA 1BWSA 4QWWA 5SY9A 3WQRA 4L8FA 2XV1A 3FFBA 1RMQA 2DQSA 1G59A 3T1QA 5EIXA 5LXTF 4MP6A 1WEHA 1K68A 1QG2A 1W0KD 1ZM7A 2QNBA 1HDYA 3DF9A 3O0DA 4LXTA 2H2AA 4F11A 1I94B 2HBRA 5H5JA 2JCGA 5D6OA 3D6FA 3LBYA 1NJGA 2CE2X 2PH7A 3N70A 3D5QA 3PHIA 2X4LA 4FLFA 4FYMA 2PL3A 3BJRA 4I8IA 3GVCA 4RMJA 4N5NA 3WRYA 4ESOA 5JD6A 1NE2A 1UKEA 1XLUA 2I2DA 1U4OA 2TECE 4B46A 3TNDA 5KWJA 1TGYA 3LGXA 2NU9A 3HJAA 3KTAB 1MQSA 3E3AA 5IDYA 1OAKA 1E1RD 1SKBA 5JYCA 2C5HA 4BLQA 3BERA 3E1KA 3K0AB 3ND8A 1MUUA 2QMUA 4HEQA 4MGIR 4MIYA 4PS0A 5LA6F 3WQHA 4MA4A 4GPZA 1P4JA 2OCLA 3MIZA 1E2EA 4HDMB 1UEXC 1ZW1A 2Z1DA 5FO1A 1U5BB 4UULA 2V59A 2GYWA 2G36A 1OX6A 3C41J 1HV8A 2BKUA 2HH9A 5IYZF 1XU7A 1E1DA 1ANKA 2BCGY 4URVR 1QHSA 1PG5A 1RQPA 3EQ2A 3SZ3A 1A9ZA 2HSEA 3NV7A 3UAOA 3WK5A 3LTNC 2NZUG 3PXUA 4QOSA 3AKEA 4XASA 2PX6A 1Y63A 2PY6A 1E64A 2I8CA 4YV0A 3KHKA 1N6IA 2HO4A 1P7CA 1SHZA 3AERA 5B58T 3C7AA 4QUBA 5F2NA 2DFNA 1BA3A 5A2QA 3VR5D 2I2BA 2XCQA 2DLDA 3ANYB 3EVGA 3HHEA 2CFRA 4G89A 1TF7A 3E5NA 1JHDA 4OI2A 5SZKB 3VHQA 4BNTA 2F90A 3E53A 4E09A 3T5PA 1XTZA 3JD4A 5ES4B 3CFYA 3LQ4A 3RUFA 2M9MA 4QDKA 4ZZ2A 4BKPA 3NTVA 1UQRA 3OQJA 3D8BA 3OQHA 3UK1A 5CB4F 4QC2A 4IUYA 1T34A 4QUJA 4GC5A 1THGA 4PSUA 1DADA 3EAQA 4I55A 1AC5A 2AJCA 5BV2P 4QU5A 4EAAA 1KDVA 2OO5C 2NPIA 4RBNA 4WSOA 2GK7A 4CMBA 5G0VA 3W6OA 3KQUA 1U7DA 4IMIB 4C7JA 5C5EA 2G72A 3U39A 3QOXA 3O73A 1UOPA 3O9ZA 1T24A 4O2BF 1XNHA 2PPLA 3UAYA 5EI5A 2FR8A 4EW6A 4J0JA 5K3FA 2ZIXB 1THMA 2C3MA 1SKAA 1DXQA 3CNLA 5ALXA 4QXQA 3B70A 2CCJA 1JHOA 2WV9A 3CQ9A 3H5TA 5G0TA 4MKZA 1OPRA 1U2SA 2BGLA 2H5EA 5DSXA 2ATIA 4TS9A 2G8NA 1P3DA 2QY9A 4D0LB 1E9CA 4JI8B 3U3KA 5DX8A 4B83A 4TM7A 2PG3A 2F1KA 5HIMA 4HAOA 4L27A 1JSRA 3IVMA 4FHGA 3CPHA 3N76A 5EVJA 3NAMA 4NU8X 4B5KA 2I6GA 4PYOA 1E2IA 1KVTA 3V9AA 3VC1A 3TG2A 4G09A 1WG8A 3T5MA 4MS4A 4O0LA 5TX7A 3SAJA 4MX8A 3RF7A 3H7AA 3GUZA 1PKEA 5AQEA 1QXSA 1WAMA 1F2UB 3VSEA 1BVUA 1E58A 4HNVA 4M1SA 4RCZA 3W04A 3NKFA 2PRZA 1QDUA 3L7BA 1E79D 2O05A 1I6WA 1ZIYA 1XRQA 2FY8A 2OB2A 3MTGA 4GOJA 4Y2SA 4OMUA 3EGWA 4PIPA 4GPIB 2UYGA 3WB0A 3CUEF 1JU4A 1BGVA 1UBLS 4KDCA 1O6ZA 2I6UA 1MJ5A 1IEXA 2CV0A 3K9NA 2EL9A 3FW1A 4M2LA 1REQB 1DDOA 4F4IA 2DECA 2JJ1A 6ADHA 1T2EA 1G8AA 3R9XA 3LXMA 4RGYA 1QH1A 2VDOB 1V6CA 1Y6QA 3DDNA 1IUNA 3B1XA 4N3NA 3W8EA 4B3FX 4I50B 1FTYA 1JIUA 2ZYUX 4JNCA 5C1BA 5JC1A 1KO4A 3NC0C 3DH0A 3OD1A 4W5NA 3BMQA 4G4IA 2IV7A 4BX2A 3K35A 2EP7A 2JFGA 2VSNA 4KYVA 2HX1A 1ZW6A 3TG8A 1P6QA 1U99A 3IBGA 3MC1A 4TV8B 3SEFA 4ZHQB 1L5HA 1SJ9A 2NVUB 2VR1A 1D07A 2EWWA 1PNVA 4DQXA 3NBXX 1XNQB 4X6UA 2FN8A 4KN9S 1OY1A 1NVAA 2ES4A 1TQ6A 2ZVPX 1JU3A 1C4WA 3JATB 4TLLB 2O0JA 2R1VA 5LQRA 2ZB2A 4B4OA 3UUGA 1SKYB 1VE3A 3S4YA 3IOBA 5BR4A 3WK6A 3COZA 4FOLA 3HEAA 5BR7A 1WCIB 5BSTA 1KSFX 2AFIA 4LJ7A 1SBQA 4KZKA 1X2EA 2JFPA 1XF9A 3QI7A 5EHNA 3VV2A 1BDHA 3RV3A 4TTTS 1AOXA 2QYTA 3ML1A 4B35A 3AHGA 2JLXA 4POOA 3TM5A 3S81A 3ET5A 4IIEA 1WJGA 2AI1A 2AXNA 1PWZA 3BGWA 4BZWA 1BVRA 2BBWA 2HDOA 1EI9A 2YJ5A 2NQ2C 3I9JA 3PUWA 3PV0A 5ALJA 4YP7A 1C9MA 3BMCB 3EZ7A 3MLEA 2EX4A 4FQ5A 2IZ1A 2O2IA 3OLZA 4ENUA 4ZJPA 4JV5B 5HCNA 3M5PA 3D2BA 5AXAA 5JXGA 1K88A 2OFPA 2W11A 2ZE6A 1RHQA 2JLCA 3FTNA 5INTA 3EZGA 1C3EA 1W36B 3JZIA 3TZLA 1U0OC 1N0WA 2V9ZA 4NCHA 3DV0A 4L02A 4NJMB 2VPWA 1WS6A 4YDQA 4HBZA 4KXFB 5GADl 4D1YA 2B5WA 4AC9A 1WHTA 3R09A 3FUXA 1BXRA 1LK5A 2RGGA 2J9ZB 4Q1AA 3IJRA 1NNLA 1XJCA 1KYXA 2V0NA 4TMFA 1EX7A 4Z51A 1AGNA 4QU0A 4D46A 1XNGA 3A1UA 4F06A 2ASVA 4E5UA 2GYUA 1YDGA 2PUGA 2WDPA 1JN0A 2H4ZA 4BVEA 2D1SA 3MPUA 4UAUA 1C1DA 1HT3A 3CISA 4MROA 1BQEA 1YA8A 1ND6A 2Q99A 1FC0A 3AKCA 5CCEA 3NHYA 2VTKA 2CJXA 3LY9A 3RFFA 4FKZA 1EG7A 4TS3A 5TT0A 5I9TA 1T91A 4RESA 4HAYA 2NWQA 4TM8A 1UT5A 2GLUA 4YH1A 4JLMA 1JUDA 1DO8A 5FKJA 5B30A 3MGKA 4R69A 4B8WA 1YWGO 2EW2A 5AKJA 1EGMB 4D42A 4YCNA 2ZSBA 3SKYA 1E61A 1AGYA 1XAJA 4I3FA 1AKWA 3GC6A 1W1IA 3V33A 4YAFA 2E89A 2OORA 3T1VA 4WKBA 1L4UA 1QQ6A 3H9JA 1MX1A 1IZ7A 2PYDA 3VM6A 1E7SA 1SG6A 2QJTA 4K6OA 4I3GA 1QOZA 2HCRA 2HPVA 1WP4A 2O8DB 4REMA 4JLSA 4EGCB 1VSTA 4LKRA 4H6XA 2EV9A 1J4AA 2ZBFA 3K9WA 3LD9A 4KO1S 1DUVG 2WVJA 3Q72A 4FYPA 4RGQA 5T67A 3EZLA 3TQSA 4EMBA 3NANA 1E1QA 4RTNA 4EEKA 3PNVA 3ZDFA 4WJZA 2AC2A 3J80A 4L4RA 2IXFA 3L9XA 3KB6A 3T7EA 2R65A 2G7MC 1X7ZA 1QYCA 2D54A 3I42A 4Q82A 3BFVA 3GFGA 4IKOA 5EJMA 3WGYA 5BP7A 3W0LB 2YWDA 1KMHB 1J33A 5DHPA 1Y1SA 1EXWA 1RAHA 1ST2A 3HCCA 3ZBUA 4BDTA 2C5SA 3EFBA 3AMVA 3VRHA 3DZHA 2OVBA 4LOJA 4ZHSA 5LYYA 4RTRA 3OQPA 1Q91A 1VHQA 2GVZC 3LCJA 1VPEA 3CNNA 3P2KA 2B8WA 2FUKA 4RTQA 3NS7A 3AESA 2OHJA 2BMEA 1BH2A 3KXLA 4XGNA 3ZE1B 4PLPA 4YRDA 4O2AB 5LIPA 4ACAA 3L7YA 5B3AA 4BECA 3D02A 2RI1A 3IE2A 1ENPA 7REQB 1GJRA 1KEVA 1TM2A 3DULA 1U8CB 5CXSA 3I5AA 4GVLA 4M8IA 4HVLA 1KYQA 1ONSA 3EZFA 4LFBB 1U9IC 3MW8A 1KARA 1HSZA 3QEJA 3T9FA 3KQQA 5KVQA 2FPPB 4KTVE 1NRJB 4ETIA 2YMMA 2ZB8A 2V6FA 1JILA 5FPPA 4M1KA 3H1FA 6NULA 2BL4A 5I7RA 4K81B 4MV6A 2A9JA 2XXJA 5K8TA 3OM1A 3PNSA 3DTTA 3STHA 5FL7A 5TB5A 1CT9A 1ZMOA 1Z4NA 2RC6A 3DAFA 2JGKA 5U1PA 2GO7A 2IXAA 1OI7A 1PLKA 1ZEJA 2JCVA 3W3AH 5K45A 1G2PA 2QUIA 5DLDA 1QCYA 1RQNA 3ILSA 2CK3A 1N6LA 3Q8XB 2JNWA 5CYFA 3WIOA 5BYAA 4TYNA 3MRSA 3ZU3A 1CJTC 2OLJA 3HBFA 4FC6A 3F6YA 4L15A 3COPA 4XDGA 3GB9A 1B6RA 4H4EA 4BXOB 2P6PA 5CVVA 1A2QA 3ZD8A 1EB9A 3QHAA 4Y7DA 5IKEA 3M70A 4WZBA 4W9MC 1GA1A 2QLJA 3C70A 4GG1A 4KFSA 4XWOA 1YF3A 3W79A 3GBPA 3AC0A 3TE6A 2B83A 3C3EA 3KCQA 1M6NA 3P20A 4MGYR 3WRVA 3K20A 3VSBA 1R66A 4LF4B 3FBTA 2EBHX 1AS0A 2C92A 3STXA 2HWKA 3A31A 3U48A 4ZEVA 2PVPA 3GPLA 2PRJA 4DQ0A 3DGFC 4UJ5A 5D1HA 3SG0A 5AKEA 4C0XA 3R74A 3AP1A 1ICIA 4GR5A 3UWKA 2BHNA 3BB4A 2YWRA 4MITA 4A03A 1R8JA 2V5AA 4GOMD 3W34A 4WI1A 1RYMA 2R44A 3WY9A 2A6PA 1JAXA 1XR3A 4NZYA 1WY7A 2BGWA 2EU8A 3WYAA 3GFFA 3FSEA 5E7IA 4HB2A 2PLNA 2I87A 3HNRA 3QBVA 4MW4A 1Y7IA 4KE6A 3KAKA 2P9EA 1C1YA 1AM4D 5IFLA 1LA2A 1ZHHA 4XAQA 3DVSX 1JE1A 5F7OA 1T10A 3JQPA 1IULA 1YZQA 3MWFA 2AMYA 5CMLA 3HI4A 3HXKA 4CG1A 3DV2A 4LE0A 2QY6A 3N7TA 2I33A 5HA5A 3QEMB 1SZPA 3TDMA 5GGXA 1TK9A 3GG2A 2KB0A 2NV6A 4P80A 3PVZA 4Q4HB 5AR1A 3LPNA 4FFLA 2CLSA 5A3JA 4IJ5A 1L6RA 3CB4A 3F47A 3E9EA 4H6VA 3T3MB 1H5QA 1KEEB 2QAJA 1KY5A 4YHHB 3DD5A 2G9QA 2VQEB 3H97A 4DMMA 4S1WA 5HKLA 5HKKD 2VHTA 2V6IA 1A4RA 4A0SA 2WWHA 2Y0BA 3GJ6A 3OZEA 4MLDA 4TSFA 5FCDA 2BRUC 2O8BB 2FAXA 2ZIVB 4JH0A 4PO8A 4E4RA 3FIJA 1VZ2A 1K7XB 1ND5A 2XXBA 2AR9A 1LH0A 2CL6X 3KAQA 1OLOA 4HRXA 4N01A 3EC1A 4PIVA 1FL9A 4R16A 1XJ5A 3P45A 3E0QA 3MILA 4OGLA 3SIRA 1O9HA 4KQCA 5P8WA 4YXFA 2ZUVA 5CFQA 5DLEA 5CFNA 1ML3A 3LVBA 4FHZA 2IX3A 2FGKA 3LBNA 4NBRA 3OJXA 3IIKA 2ZE5A 4Q48A 4L57A 2JD0A 2DFLA 4RK1A 1KK0A 2ZKIA 4Q4JA 1J06A 2ZWVA 6PFKA 4P81A 4RXMA 1M7BA 1E9BA 4GT1A 3KHTA 3KRTA 4B7XA 3EGDA 4IXWA 4OMCA 3FWPA 3ISJA 4FC7A 1B8PA 1ADBA 2Y9MB 4XJTA 2PX4A 3VR6D 1QX3A 4I6EA 4PRZA 3S6JA 3SR3A 1LVHA 3DTYA 2H2IA 2QYHA 3HZHA 3D5TA 5TGZA 3SCZA 1KKUA 1ISRA 1GKIA 3DHWC 1MX9A 4CKEB 4LJRA 1XHLA 3CMMA 3LFUA 3L3BA 3LM8A 4KAAA 2F4NA 4X94A 3WLLA 4DAEA 2ZI6A 4B47A 3HJGA 2QTGA 2X2OA 4QM7A 2VWQA 4HDQB 4RV9A 1FB5A 4C1BA 5CFPA 1CBUA 1YZUA 4JITA 2LCFA 3KZXA 1ULBA 1U2DA 3QBEA 4PZEA 7YASA 1CU1A 3G2JA 1FPMA 2FQWA 3U9TA 2PUAA 2W6JD 1Z33A 3NQ41 1T25A 1TXGA 3R24A 1V3TA 3QY0A 3QLJA 2ZWMA 1L0BA 4RABA 2AW5A 1OGIA 1WB6A 4JMPA 2AXPA 2DGDA 1EFVB 2RGDA 5A7GA 3R44A 4BO7A 1RZRA 2DUMA 3U61B 3ZHCA 5DIFA 2B8NA 3AQ4A 1WHSA 2HHCA 3N0TA 3QOFA 3TLGA 4JASB 1SUBA 2DB3A 3PEUA 3LPLA 3RIGA 3QZUA 4WAUA 1J8YF 2Z4TA 4EO4A 2QI9F 1E5VA 3H4MA 3GAFA 4WZAB 3A36A 5SYNA 1WETA 4MQUA 2CFCA 1DT3A 2AZXA 4MWOA 2H92A 1IJKA 1PYDA 1NP3A 4JYPA 2RG7A 2ZYWX 4LJ5A 2FMHA 3PT5A 3V9PA 3VMFA 1M3SA 5JPIA 1RRFA 1G1MA 4ALLA 4C88A 2C4KA 2C4HA 1MQ8B 1TCAA 3ADPA 3DEKA 2JGDB 3AY7A 2EKPA 3IQWA 3RS7A 2OUIA 4A0RA 4JOCA 4FZ3A 3LP6A 3R3XA 1N3BA 3IAM6 4HAZA 1Y80A 4BNXA 4H7JA 1ZM2A 2QT1A 4WN3A 4ARZA 3WKDA 4ICIA 2ASEA 2VUUA 3QFTA 2XWQA 2YXLA 2P9YA 2VJMB 3TBKA 2I1QA 3GH1A 3IT2A 2D2EA 5F3WB 2KHZA 4DW8A 4HZUA 3WV5A 2Y67A 3ACCA 3BL8A 4PZCA 1KDRA 4RIIA 1Z4MA 3EAGA 4JYBA 1SKUA 4U7WA 4EHLA 5C4MA 2AEMA 3HL0A 5AHOA 1JYFA 3IESA 4NNOA 4EKNB 5MN6A 4B3MB 1IK4A 2FWPA 5GJBA 4KQMA 2PX0A 5H70A 4NL4H 2F7SA 1TKAA 2H5IA 2YY5A 2CBZA 1U28A 1SC6A 3V4LA 3S7TA 4YT5A 2H3EA 2X40A 5AUNB 4BNZA 3MCAA 3T9EA 2O59A 4IDGA 3WDMA 4ZI7A 3QK7A 2PN1A 2PKQO 5KYYB 4AQ7A 5FFFA 1U8YA 2IDKA 3PDCA 5DX1A 3GLHA 5NULA 1U1FA 5KWIA 1WDMA 2QN8A 4JP1A 1U9YA 3JWJA 3L7JA 4FFWA 1GNRA 5IKPA 3ESZA 5AW2A 4AN0A 2WF5A 3DMPA 4L9AA 4G0VA 5JJ5A 4DG5A 1VG1A 3TCKA 4DIEA 2QUZA 5JO0A 3FCSB 4KIFA 3RKUA 5JATA 2LZ0A 1G9XA 4QRHA 2H4YA 2UXDB 2QD2A 1C4XA 5DXJA 1BWQA 1E9DA 1WLSA 2P68A 1P2SA 2VYNA 3CCCA 4I9FA 4JSYA 4R54A 5CVTA 5K8IA 5FPTA 5HZKA 5T3YA 2VCYA 3B1FA 4BBPA 2H7CA 3EDQA 1G3RA 3DMNA 4A8JB 4DBLE 2VTBA 4RXTA 1R5BA 3PLNA 4XQCA 2ZI9A 1FBNA 2C83A 4WNCA 3GAMA 2KSQA 3P9ZA 3F4BA 5A3SA 3ZCUA 4GWGA 2RHCA 4TLBA 5EE0A 2GEDA 1H2XA 1MEJA 1QU2A 4M9RA 2AMVA 2IWRA 5FOSA 2XH8A 4N3GA 1OH6A 1IG3A 3WIEA 1A8PA 2R85A 1YOVA 2VRCD 3HC7A 1PUXA 5PNTA 3GA7A 3SR0A 2AN9A 5F3RA 2ATVA 3EFOB 3EY9A 3NAGA 4ZEMA 5C81A 1Z28A 2CGEA 5KTSA 3C7CB 3TW0A 3UZUA 2B4YA 1JG7A 1X7XB 1ZN9A 2I2XB 1KERA 2NUBA 3N0RA 4I4TA 4ZK6A 4RDXA 1Q19A 4RVSA 2F8TA 5A05A 3NTXA 3F3YA 5TF0A 3RSFA 3G59A 1IVYA 1RQLA 2E18A 4UVEA 5COQA 3RPEA 1QO7A 3MUNA 5B57C 2V3VA 4MPDA 2YZNA 3CJQA 3DM9B 4ZEOA 5DYGA 1VP9A 4B6EA 2JKZA 3VOSA 1X9HA 3C5HA 3I0MA 1YZNA 3IIIA 4RK7A 3NYWA 3VH3A 1LS6A 1M6HA 1TX4B 1WZ2A 4F71A 2VDWA 5F1KA 1H22A 2WWVD 4EW1A 3LUFA 4IIDA 4M0UA 1LDBA 1E7MA 4XWWA 4EJ6A 1GUDA 3KEGA 4BV9A 3QX3A 4KITB 3FMPB 4CCYB 5AI4A 4I50F 4JUBA 5IVPA 4BJ6A 3Q6IA 3ESCA 3L7IA 1CUYA 4UVHA 1O2DA 5AVJA 2GXQA 4BTEA 3KDPA 1CDEA 4D9EA 5A4IS 4GI1A 1DLIA 1KAHA 1VKOA 4EX7A 1HFEL 3KPYA 5MGNA 4HBGA 2CHEA 2J3QA 3WK7A 1P6UA 4R31A 4TV8F 4ZHQF 3JYHA 5CVCA 1Z7YA 4TUYF 1PEKE 3RADC 3AVPA 2XSZD 4WQMA 5DCUA 3Q4GA 1GT6A 4TPKA 3UA4A 3SX0A 4OU4A 4BU0A 2QIPA 4WCVA 4MRRA 4BWGA 2FXVA 4R8KA 2VF4X 5LOVA 1P39A 1VKNA 5CDGA 5CNIA 6REQA 2JIMA 4DUGA 4ZAXA 1P0QA 2PUTA 3T5BA 2A7QA 3JWPA 2XQJA 3WYEA 1M7HA 3Q3EA 1NW8A 4FMCB 1DFGA 1JDSA 4RHFA 5CT4A 2ALJA 5MF6A 1NW4A 1BVHA 3QLUA 4UOQA 1O94D 1VCIA 4Q00A 1OXTA 1NQUA 4QDTA 4D4KA 4YJ3B 5LD2B 3QXHA 1PSWA 3JQ7B 1KZ1A 2L82A 4KX5A 2BLNA 2ECKA 3GR6A 1FRVA 4PQEA 1KZ9A 5BNWA 2HI0A 3A2KA 1U7HA 3G0BA 4JKOA 2B7LA 5A6SA 1RCUA 4C21A 1I0ZA 3AUYA 2XMSA 4ZYYA 5CG1A 1VE7A 1C8LA 3SM9A 1TQ8A 2H11A 1NDQA 3OWOA 1GG9A 3OMXA 3EUWA 4RSGA 1URPA 2GJ8A 2YHAA 3ESBA 2QUBA 1UBJS 1R12A 3SQMA 1U6JA 1BKYA 3PJGA 4PSAA 1CNMA 2WAMA 1E4YA 2QAGC 3IT3A 2QW8A 3DOCA 3DUWA 4YAJA 1UPAA 4GX5A 2BHRA 2JPDA 1ODSA 1SK8A 1KBOA 4MW0A 2J41A 2TMYA 3G8AA 4HOYA 5FLYA 5BN4B 2IEIA 2CD9A 1CRLA 5GIOE 3DHEA 2YV1A 3VHRA 1XQ6A 2R5WA 5JSZB 4YDHB 1UPUA 2VS1A 1NLUA 4GRAA 4JLUA 5KCZA 5KUTA 3STUA 2QJFA 1W0KA 1Z3IX 2XJ9A 5GQSA 3BIWA 1NATA 3VUEA 3BMOA 4DV3B 2I4OA 1BKDR 5BXYA 1L5YA 2J5BA 1LBSA 1C3OA 4YFYA 1TEZA 2XEDA 2H52A 4IINA 1BE0A 2BM1A 2H07A 4D2IA 4YAEA 5BMOA 4B85A 1P2FA 3WHKA 4C4RA 5AVYA 1ODIA 1VHLA 4B7AA 1U7WA 4HDRB 5DN9A 3ZXUB 1KJZA 3H2SA 4WY5A 5HRCA 2R87A 3IRVA 3VISA 1M6VB 1NSYA 2EZ8A 2HU7A 3P5BA 1E1RA 1EPUA 4MW5A 5EIWA 5TEWA 1MOZA 1WPXA 1TK2A 1ZNYA 4FSDA 4GPTA 1YMQA 1ZMRA 3X1DA 1DPGA 1MORA 1X15A 1HO3A 2R6HA 3T5GA 4OXIA 3R3HA 5B12A 1NZJA 4I1UA 3KL2A 2ZJ1A 1UP7A 2OCYC 5IMBA 1LPPA 3A6LA 1MNAA 1OI2A 3OQ1A 5CCXA 3URMA 3CLUD 4WN9B 5GJWC 3DLTA 4F7WA 5C5CA 2WG0A 5D5PA 3ZWYA 4LOIA 1SD1A 3F6CA 4RKWA 5G0SA 1FUYB 2YFHA 4CM3A 4EY3A 1SCUB 1W1WA 2H54A 5CFZA 4TZ6A 2R48A 1DT5A 2QNIA 4DCNA 3IOMA 3BQNB 1UWCA 2G83A 1K1EA 3NHAA 1T3LA 3OFKA 5F78A 3RAJA 4KWCA 3QJ5A 3W5HA 3CVVA 5H9WA 1IPHA 2EX1A 2P9QA 4FOPA 4IDFA 5FRDA 1SUEA 3LUBA 4IRMA 4LBVA 2OAP1 3I0ZA 3QMWA 1LJ8A 3TRKA 1CP3A 3VR5A 4L8GA 2PJUA 1XMVA 1D2MA 4RM3A 5FPQA 3RUEA 2I03A 2DR3A 4OJKA 5IW8A 1XJWA 5FHQA 1ZNXA 5AXDA 1KJQA 5CDHA 3VSDA 2YJGA 2WSMA 2EOAA 2WSSD 3H05A 4O2AF 4QJBA 3JYPA 4WNIA 4F97A 1I2BA 3BYZA 3EN0A 3NM5A 4QHTA 4CLRA 3D0OA 3G89A 5J40A 3I72A 3UV6A 4D8TA 5JXJA 4A6EA 4K9QA 2QG4A 4E6EA 4J8PA 4N54A 2PYIA 4WNYA 4NXNB 2AB0A 2PTGA 3AR7A 1SCBA 2DUJA 3DGEC 2C2WA 1OROA 3FN4A 4K6CA 5FX2A 3E5HA 1JPJA 4TYMA 5L3ZA 1JDBB 2WAYA 2I8AA 3NH6A 3QNMA 4LBYA 2HT1A 3ZCVA 4ES6A 4GL2A 3ZNPA 4MUIA 3I5MA 4RMHA 3GT3A 2BCEA 1DIGA 1ESEA 1T36B 2R84A 3CW9A 3NW9A 3FYUC 1D2RA 2RH5A 3QMVA 4NYMR 4O4LA 1NQVA 1WQ3A 3TLEA 1TLLA 3TOCA 5JZOA 2PSFA 3P9IA 4QOHA 3T94A 4DPKA 1JECA 5HK8A 3F9CA 1B23P 1EYZA 2GTIA 2XBLA 1UKCA 5CXQA 1CZNA 3ROGA 4URXR 5EJIA 4B34A 1RXVA 2QRGA 5CNKA 3C87A 3KU1A 1C80A 3R9WA 1Z6PA 4N8EA 3TAUA 2GBFA 4HDSB 4KHZA 1V16A 1W8IA 2I54A 3BA6A 1CP2A 2IE8A 4U7JA 1E79A 1RLMA 2DBRA 4RJKA 2ZS8A 3S1AB 3EUFA 3QKSA 4WCDA 4A15A 1CNFA 4HXYA 3TOVA 3LI2A 3A3NA 3PI7A 3CH6A 4TKLA 2IYUA 1PZNA 4OUKX 5EG5A 1T0PA 3AYXB 4OHUA 2FQ1A 4I9HA 3I6QA 5D5QA 3UBMA 3AEKA 4BASA 4C06A 4ZYWA 3GOHA 4FKMA 4IZOA 2Z0MA 4P58A 4ZYXA 2FQYA 2IUEA 3W90A 2B1QA 4JOSA 1Q74A 3OM8A 1T4DA 4QO8A 1VBMA 3JASA 2GZ1A 3VPHA 1KR2A 2QS9A 5J3JA 2IXEA 3D81A 3L43A 4NDZA 5IJ0B 4MV8A 3BH6A 4OQZA 4MW9A 4OA8A 5DT9A 3WDSA 4IFIA 2X9LA 3KOWA 4WK4B 1H4VB 4UPVA 2IYXA 3NCTA 2R62A 1A27A 3I5YA 1VPLA 3KVOA 2B4TO 2EP5A 4BQSA 4CFZA 4CQJA 3IPYA 4O4IA 1IBSA 1GGHA 1NI4A 2IY9A 1SD5A 3OBBA 3DKPA 3KT8A 1NU8A 3GUCA 2ZUTA 3H7IA 3HYCA 1E6EA 1MB2A 1NHGA 1PK7A 2IOQA 1YL7A 1U04A 2QVYX 2XRMA 3IP3A 4PRKA 3RB8A 1YA4A 2I2AA 1CSEE 2VF7A 3ZDBA 4U7DA 4GOOD 1P6XA 1EWVA 1SCDA 5GGYA 3INRA 1N6NA 4C89A 2X9NA 3MA0A 1DBIA 4KVGA 4W7IA 4Q9HA 5E1OA 2QRKA 4YB8A 2AZDA 1T5IA 2Q28A 5E3IA 4Q18A 1VECA 4QPJC 5JSHA 3PUVA 3H9GA 3FAZA 3NEJA 4P34A 4PAMA 2NO7A 3WLSA 5I48A 2FDCA 4XGRA 1RVV1 1J2TA 1GZSA 3AHFA 3GMDA 4W9NC 1QLHA 2Z4SA 3ZS9A 1ADGA 5CB6A 3H4IA 3G23A 1M2GA 4M9ZA 3WOHA 3NEYA 4ZYUA 5CEFA 1HEYA 1P0IA 4KX3A 3R0JA 2BGUA 3RT9A 1F8FA 1NZDA 5BSHA 4UASA 3FKQA 4DUPA 1PTJC 4H1WA 1NJ1A 2QJWA 5EA2A 5AKYA 4YRPA 1KZGB 2NTNA 1TM1E 1GRRA 1QHYA 3LKZA 4GI5A 1GAEO 1N2ZA 4HLUA 2VK4A 3F6RA 4R3UC 3MPOA 4Y2XA 4DNXA 4EBFA 1NYTA 4MYUA 2F4VB 2ZI7A 1UQUA 3C7DB 3WP1B 5LQKA 4NZZA 1FNCA 1K66A 2F1IA 4QT4A 1I2AA 2CL5A 2BTQB 1O77A 1ZGJA 3HLKA 4MGHA 1SBNE 2D5CA 2EJUA 2IUYA 3RK0A 1NXOA 1V9SA 2PH5A 3DXYA 5K4AA 3E0XA 1NR7A 1QPZA 4FX5A 2ZVJA 4JSTA 4DTIA 2DUNA 1KH2A 2O0HA 4YNBA 4DMKA 1NVWQ 1GTL1 3P9NA 2Y6VA 1LPSA 3OZ7A 1Z88A 4QHYA 5MGBA 1WV1A 1GGVA 4PNZA 4YFVA 3JQAB 2FZWA 2JFYA 2Y1XA 2P6MA 3EVTA 4JVOA 5FI3A 4DLTA 3AF0A 3D1VA 2XMQA 3ONFA 3RBAA 4M89A 3SK0A 3VFDA 1E89A 4IF6A 4UE2A 1N5RA 2VP3A 2VIIA 1AQLA 4NG4A 4AZ3A 2R6ZA 3C0KA 3AXSA 4WLUA 4BLPA 4YRSA 4H9GA 4X45A 2D3WA 3UYLA 1XMQB 1IHOA 2P6OA 4JB2A 3KM0A 3SLRA 3KJGA 2WSLA 2QR2A 4JBXA 4UDYX 1P3JA 1PGPA 1QGOA 3JQ8B 4EYQA 4CMHA 4A23A 4TYQA 1MAWA 1RKQA 4GYWA 3FHLA 2WJ6A 2ZIGA 2O2EA 3NIWA 1V41E 1IQRA 4QU9A 4HMQA 4Y30A 4A0HA 4EYKA 3RJ9A 1P0FA 5L40A 3BSYA 3O26A 5M3BA 4UBKA 1E5DA 4XB2A 4QOJA 2COKA 4ZCLA 3QW4B 1H2AS 2HQBA 2NSHA 2XQFA 5E3JA 4A3SA 4B3IA 4BU1A 3G5AA 4F9EA 1WUHS 4EG3A 5K8JB 1BHSA 3X3HA 1VMKA 1UBEA 1NE7A 1N2XA 1O97D 1FUUA 1NONA 2WHPA 2AD5A 1YK1A 1ZCZA 2JFVA 2A1UB 3BK1A 3PNLA 4IP0A 1I3KA 4PC7A 1VA5A 3WS7A 3ZU2A 4BMVA 2VHJA 3BZWA 1UK9A 1B6TA 1T8RA 1TYZA 3S2UA 3U1BA 3ZD7A 1DKNA 2X15A 2IW3A 4OYLA 2YL2A 3TFQA 5DSZA 3L6DA 2W2QA 2C9OA 4A26A 5HUJA 1Z47A 1C9KA 2GRJA 3BHIA 4S0ZA 2OK8A 1EVQA 2Z9BA 1EX1A 3NIFB 4L5AA 5A04A 1E3QA 3K0CA 5ILOA 1B74A 1CK4A 2ADMA 3B36A 2B1JA 1XZJA 1U9CA 2JGNA 2DFVA 3WVNA 5AUPB 5AOBA 1PR0A 1W2HA 4L6CA 5GIPE 1ZOSA 5TMDA 1QE0A 3LAWA 3DZCA 5LXTA 2CHUA 2MMGA 4NICA 4OK3A 2PU7A 4C76A 1L8LA 5EUBA 5FORA 1G17A 4KXUA 1WW3A 3E48A 4F4JA 3IDQA 1K4YA 1T9AA 2PZLA 2XQVA 1L3IA 4R71A 4QBGB 3O94A 5DTJA 1I3LA 4JI0B 2HT6A 5LWQA 1L1EA 3N8IA 1CE8B 1FDSA 1CETA 3KQNA 3WBBA 2N3ZA 3VVCA 4HNTA 2A58A 3I04M 4A36A 4KN8A 4C0SA 4EY4A 4R2JA 3A9CA 4URZR 4P53A 2JFFA 5LA6A 2DFPA 5C7OO 4ETNA 1M2NA 3EW7A 2GKOA 4JLBA 4AP6A 5IYZA 4Q1CA 3ZDXB 4HQNA 2EJCA 1EUZA 3D6UA 1Z6ZA 3D6TB 1F4PA 4TZKA 2LUOA 2W71A 2ZJ2A 4II2A 1Z6QA 1YIOA 1ZGCA 4UCFA 3KTFA 2XXAA 3WDLA 4A6XA 521PA 3D8SA 2B61A 2AG8A 3CCFA 3FI9A 3FPAA 4O0MA 3VPSA 2VT2A 2WOOA 3GFQA 3GNQA 2JHPA 1Y8RA 3P7MA 5K0NA 2JIPA 2XRYA 3DBLA 3DQPA 3EXFA 3K4QA 4BP9A 3FGNA 4B6OA 5KNBD 4U5XA 1TE2A 2WLTA 3D43A 3F4KA 2VPYA 4L1KA 4X92A 5E38A 3FOBA 1AHPA 1KOGA 1ECLA 1E1NA 1D8TA 1UEJA 3EOZA 3ZLTA 1VGRA 3GJ0A 5DIZA 4D3DA 1Z4OA 2BDTA 1JZSA 1RWPA 1D2GA 2E1RA 1TTQB 3GHHA 4PCLA 5IBRA 2HUPA 1S3FA 4EWLA 3WTCA 5KJ6A 3TLAA 5EQFA 5CB4A 1YFZA 3S2GA 2LVBA 1CY0A 2WT9A 1JZQA 5HE8A 4KNVA 2NUPB 3E2IA 1SVNA 3A1EA 1B8NA 2IU0A 3U9LA 1LKZA 1HLFA 1T0IA 2BUBA 3L8EA 2HTFA 3MUEA 2G5TA 4D56A 4EGAA 2KMLA 1RRVA 1F60A 1L1RA 4M6WB 1OV6A 4O2BA 1OTXA 5DISB 4C7BA 4C5CA 2PX8A 2X1HA 4KZPA 1EQAA 1IAVA 1AZTA 1OU0A 1QHGA 2ISCA 4KGXA 4MSUA 5J5VA 4BQOA 2GOYA 5C7IO 3OEWA 2FWRA 4X63A 4R2HA 1NNI1 3VHXA 5LM3A 3QUQA 1FTNA 3OFJA 1SHUX 2NU8A 2WKWA 2QVLA 1YU9A 3VR3D 3G9TA 5JAQA 4R1TA 2XI4A 1NLFA 5K8LA 1MDBA 5DM0A 1AD2A 4R5MA 2FZEA 1DU4A 3MTEA 4CRWB 3HRKA 1MTOA 2YHUA 4JBHA 3ROQA 3R7WB 3MCUA 1V7QA 4F92B 2WQZA 2MSKA 2QG9A 3B52X 2W5UA 3A04A 4KP7A 5JBQA 3EDYA 1DC4A 1JHXA 2E49A 4PXSA 5TPWB 1QCCA 2EFCB 5DK6A 4GUAA 1B6GA 1QAQA 4WOKA 5HKKA 3K2QA 3WLNA 1KRHA 4IS3A 4M7WA 4FOOA 3S1LA 4KO8A 1BU5A 1U2ZA 1TF5A 4HYYA 3EGVA 3FTCA 4OXRA 4IOLA 3PRYA 2H2DA 1VMAA 3C4JA 1ORVA 1QPBA 3JD1A 4FWIB 1M9NA 4TMTA 1O4WA 2G9VA 1J6UA 3H1PA 2XE6A 3I4LA 4QLOA 4H7IA 3AR2A 1ZQ9A 4UM7A 2JIQA 2VF5X 4BFUA 3ILVA 4ENQA 5B36A 1YB4A 3SSNA 1EM8B 3I6IA 3A6FA 4YRKA 2FW0A 2FPXA 3ACDA 4UBIA 4MV4A 2O52A 4NZNA 5DHFA 4TXJA 2AT1A 1JFLA 1FA9A 5C35A 2YIMA 1KJJA 1WY5A 3FOAA 2RKOA 4G67A 3VDQA 2A0KA 3A7DA 3JVUA 4DCVA 2FSGA 3O8OB 3GT0A 4ECAA 2PQ6A 1KVQA 1T5TA 3IXLA 3TR5A 2B20A 3FHTA 1L5LA 1P4AA 1XAIA 2XHZA 2P77A 1VG8A 1QE5A 4L7QA 5AK0A 2CWWA 2VHUA 3EMBA 3WGUA 4G0PA 1O4VA 1GZDA 4UMDA 5TGTA 2B5OA 5G4KB 5J4VA 3SWWA 4YUAA 2NO0A 1IN7A 3B60A 5E0OA 1QMPA 1YDMA 2PJRA 3UTDA 3OY7A 2PKEA 2R7MA 3TZCA 4ZKDA 3WMGA 5FPKA 3GJ8A 4Q3AA 3KQPA 3PDIA 1DEOA 3UH0A 5BY2A 2FGJA 5JSYA 3EDRA 3EIFA 5HTKA 4FM9A 4BN4A 4JXZA 2NXJA 1HQYE 3OKCA 1VHJA 4INOA 2BN4A 3V1NA 4XQ9A 2QEQA 2WTXA 1SCIA 2C20A 4KWHA 1MO3A 4OHVA 2NO5A 3ZV4A 2W6JA 2X77A 2F1RA 2HWXA 4GS5A 2OYCA 1Z0AA 1Q0UA 2NUAA 2R6DA 4KQJA 5MFPA 1TTTA 1N1GA 2OFXA 1JQLB 1XX6A 2YYAA 4TLMB 3I2HA 1L2TA 3KHSA 3V2HA 3HA5A 2W83A 4RHXA 3ERCA 3PBKA 1BMFD 3WSWA 3O2QB 3UKDA 4NDNE 4MWBA 3MJHA 2WABA 4R3NA 1XZDA 3L6OO 2NQTA 3OZVA 5EWLB 5KYXA 4MRAA 4GOXA 2HQ1A 3V4VB 2IOFK 2GPNA 1C7QA 3A9SA 5HILA 3H4VA 3E1SA 3SF8A 3V8MA 1ZD2P 1R64A 1VLMA 1VLLA 2K7ZA 1V8ZA 5A06A 1F51E 3KG2A 1BDMA 3ND9A 3B6MA 3FXAA 5SYMA 5CD1A 1TM7E 5CM9C 3CLRD 2BFOA 3FVQA 2FOXA 4RE6A 9ATCA 1WXIA 1DC8A 5I4KA 1XLVA 3BWBA 1QFXA 1Y3HA 2RHHA 3L7MA 4GAEA 4NAUA 4Q6BA 4GMDA 4UVDA 1W73A 1O87A 4N82A 2AYYA 3G0CA 3IUNA 4X3PA 4CYMA 4E88A 3CH5A 4QX6A 3A06A 3W9SA 1GKYA 4E1VA 3KR1A 1VLZA 1UKBA 5ESWA 1GDHA 2GK4A 5I8ZA 3H16A 2E2WA 1TA0A 2ORWA 5HKBA 1WDTA 1E2LA 3I9V1 3ASUA 4YBZA 1BCRA 1F6WA 1Y4DE 4GLOA 5JE8A 2R8RA 2CT8A 3D6JA 2O3JA 1VJTA 3ZBTA 2J8ZA 5EZYA 5CGQB 1W5EA 2JARA 5KSPA 3VDNB 1M2EA 3E8XA 3HMQA 3C5VA 1Y8CA 2CZGA 4MWEA 4EHFA 1ZH2A 3WWDA 1O6CA 3WYFA 3ZW8A 1RJ9A 3MTAA 4E5KA 2WU1A 3QYJA 3RUDA 4GU5A 1VIYA 3NYIA 3FPEA 3JQ9A 4YMTA 1E2UA 3O5AA 1M10A 4EJFA 2GA8A 1QHNA