4L9AA

Crystal structure of smu.1393c from cariogenic pathogen streptococcus mutans
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
273
structure length
273
Chain Sequence
ALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLPDSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVHSIGGFAALQIMNQSSKACLGFIGLEPTTVMIYRAGFSSDLYPQLALRRQKLKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRQLNDVQSLPDFKIRLALGEEDFKTGISEKIPSIVFSESFREKEYLESEYLNKHTQTKLILCGQHHYLHWSETNSILEKVEQLLSNHEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of a novel alpha / beta hydrolase from cariogenic pathogen Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein Smu.1393c
total genus 98
structure length 273
sequence length 273
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4l9aA00
1E8MA 3Q8WA 1CUYA 4JYPA 2JBWA 5EIEA 4LYEA 3BE8A 2C5GA 2J3DA 4Q3LA 2WUEA 4Y2SA 3WLAA 4IQ4A 3W9BA 4UUQA 1R3DA 5AM4A 2XMGA 1AGYA 5K3FA 4C4YA 4I4CA 1EB9A 4LYDA 3R41A 1YCDA 3SK0A 1QIMA 1JMYA 4KYVA 2JGKA 2DFPA 2JF0A 4H7KA 3KDAA 3D2AA 1FSSA 1UXOA 1ZD4A 2HU8A 1MTZA 2DHCA 4ZXFA 4BCCA 2Y6UA 2OGZA 2O2IA 2XUPA 4OB6A 1XRMA 3GZJA 4DMFA 2BUBA 3ANTA 3OC0A 5A62A 3G0CA 1QFSA 1N1MA 1XRNA 4QNNA 2FJPA 3EQ7A 3LP5A 1Q83A 3LCRA 3AZPA 2ORYA 1U4NA 4H7DA 5HKBA 5JIBA 3QMVA 3AZQA 1XZMA 2XUQA 4FBMA 2WU4A 3M82A 4H7IA 5LZ4A 4AN1A 4Y2TA 4EZIA 5I9IA 1UKCA 5ESRA 1THGA 5HF5A 2IX9A 3DL4A 4KEAA 3V1LA 1YASA 4H35A 4AO6A 1MX1A 3STWA 2HL6A 5AM1A 2DQYA 5KWIA 3Q0TA 1JU4A 1MPXA 2V9ZA 2VA9A 3QZUA 2CEKA 3C45A 2J4FA 3GFFA 1CUWA 5HCUA 4O08A 3PDCA 1VA4A 1ZOIA 4DMKA 5AKYA 3WKEA 3DS8A 4U2DA 3OM8A 1VOTA 3H04A 4UBJA 1TK3A 4EUSA 1DQYA 2HA0A 3UMJA 2WG2A 1QOZA 1E8NA 1JT2A 1EVQA 2WSLA 5BV7A 5ALJA 4DMCA 5FKJA 4KE9A 3VJKA 2WJ3A 2XUGA 2Q0XA 1O6FA 5DJ5A 4RPCA 4F5ZA 2O7RA 1QTIA 3ICVA 1XFDA 1BEEA 3WA6A 2PUJA 1MNAA 1N8SA 3O9VA 1WPXA 2W22A 5CT8A 2PKYX 1QLWA 4KACA 4X3CA 3V1MA 4H7HA 4BVLA 4Y2RA 1DTEA 3C6YA 2VT6A 3MUNA 4CFSA 1LPMA 4Q82A 3ESAA 4IH4A 4NZZA 5AP9A 2CJPA 5CT6A 2XMDA 1ODTC 3C70A 1CFJA 4U2BA 1XZIA 3N2ZB 3I6MA 2YYSA 5A7FA 5IVIA 3D2CA 2IIVA 2OLEA 3FCYA 4YK7A 1GT6A 1QIJA 4M0EA 2JGMA 5J3JA 2RHTA 1O6GA 4ETWA 1AQLA 1XZBA 1CEXA 4QWWA 2OCIA 3I6ZA 4RE6A 1XRLA 2XQKA 4PNZA 1XZAA 5ALYA 2XLCA 2XQGA 3ESDA 1KU6A 2JGEA 1MAAA 4HXGA 3ILSA 1BN6A 4CIAA 2BAGA 4B80A 1ETHA 2GZSA 3BWXA 1F8UA 4J0KA 2G5PA 1A8UA 3BF8A 1QONA 5ALWA 4BBZA 3HI4A 4PV7A 3D59A 5CW2A 3WIBA 4J0JA 2XUDA 4HXEB 4QE3A 4LXHA 4LHEA 3H18A 5AM2A 4G9GA 4EHBA 4U2EA 1HQDA 3T4UA 2RONA 1FFCA 3VVLA 1CVLA 4KRXA 3QITA 3TRDA 1XQWA 4ZV9A 2WFZA 2QR5A 3GELA 3PF9A 3QPDA 4QWMA 5DYTA 1J2EA 1KU0A 4AX4A 1UK6A 4BP9A 1R1DA 2HHAA 2C58A 3FSGA 5I8PA 4UBIA 4AMYA 3HJUA 1Q84A 5IVKA 3DYIA 3V9AA 5EHQA 1VE6A 1XLVA 3GROA 4B83A 5BWCA 3G9UA 1C7JA 1QIEA 2I03A 3HYSA 2HU5A 1WPRA 4M0MA 4X6XA 1Q0ZA 1JKMA 5CH3A 2AJCA 2QT9A 4CCYA 4RNCA 3I6YA 3IUMA 2HRQA 3V1KA 3DKRA 5AI6A 4FOLA 5ALOA 3STUA 3I2KA 3B3QA 5LLSA 2QUBA 4K6HA 3KOOA 1QIKA 3C6ZA 5EHXA 3RLIA 4MEAA 4X93A 1JFRA 1QO9A 4EY4A 4MQMA 3EIOA 5AKZA 1LPAB 4D9JA 3HRHA 4X92A 4M0FA 4OB7A 1JJFA 3F9CA 2W6CX 4K2AA 5K3EA 1XZFA 1CUGA 5BWBA 4DNPA 4AMZA 4ZREA 1MNQA 5ALPA 4EY8A 3ED1A 2V97A 4MXDA 4A23A 3E1GA 1IUPA 4MEBA 3O0DA 4L0CA 1F0NA 2XUKA 3VJMA 2GBCA 2WHRA 2Z5GA 5ALTA 5ALEA 1GXSA 5HK8A 4G4GA 4XVCA 3ZV7A 3NOXA 1R9MA 1SOMA 5HKAA 3I28A 4BC0A 1GKLA 3X3HA 3IULA 1U65A 4Q3OA 5DLPA 1YB6A 3O4JA 2H7CA 2GZRA 3SC2A 2C0QA 1BRTA 1SCKA 5EIAA 4J3JA 4G4IA 2VQ6A 1G5FA 1W1IA 3DYVA 2H9YA 1AUOA 3G0GA 1CUEA 4H7JA 3VISA 4GXNA 1DINA 2PX6A 4BAUA 5HK9A 1LPOA 3WYNA 2BCEA 5FLKA 4AZ0A 1LPPA 3FCXA 3PFCA 2XUIA 2H7YA 5FV4A 4DGQA 3DKKA 4AQDA 4J03A 5DTIA 5AIAA 1WCYA 5K3FB 2QMQA 5CTAA 1LBTA 4LIPD 1JJIA 1VE7A 4AZ3A 3DCNA 3FBWA 3WWPA 4K6GA 4X90A 5AM0A 4QZVA 3HABA 1CUCA 5ALVA 2JGJA 4HS9A 1RP1A 1U2EA 3FSGD 3I2GA 2VAVA 2DHEA 5AK6A 1XZGA 5JAPA 1L7AA 4V2IA 3H0CA 3HACA 5ALFA 1EA5A 2WTMA 4TPKA 3CXUA 3O95A 2OGSA 3DOHA 4MYSA 1TKRA 1XZCA 3V1NA 4FDMA 5AKLA 1XRQA 4OSEA 4B9AA 4QLOA 5CH8A 2OAEA 3NUZA 2XQIA 2PBLA 3DOIA 1IZ8A 3A2LA 1CIJA 1JMKC 5I7UA 3O9MA 2ZJ6A 3RKSA 2OQIA 3QPCA 3ZI7A 3R3UA 4BAZA 3I1IA 4CCYB 3DLTA 4E14A 2ZSIA 3DJYA 1CR6A 1CQWA 5H3HA 2AJBA 5JARA 1QIGA 1NU6A 2BFNA 4Y2PA 3PE6A 2WU3A 2J4CA 2B9VA 3DNMA 3F67A 4U2FA 1S8OA 2X8BA 5JALA 1ZIXA 1UK8A 5AH0A 2JGFA 1EDEA 1IZ7A 1QIFA 2ZYSA 1JU3A 4E11A 4G4JA 3M3DA 1GPLA 3JW8A 4PO3X 2QXUA 1LZLA 4B81A 5CT9A 2QJRA 5AK5A 2HRRA 3W04A 5AK4A 1BEZA 3I2HA 3IVMA 3WJ2A 4UBMA 3WWCA 4G5XA 5CT5A 3WL8A 3R3YA 3OOSA 5ALLA 2WIJA 6YASA 1CPYA 4C4ZA 2ACEA 2BGNA 4Y2YA 2OCLA 3M83A 1A8SA 1LBSA 1EXWA 1K4YA 2WG1A 1TAHA 3E0XA 5SYNA 4CG2A 4WDQA 4FBLA 4W1PA 2XE4A 1R50A 2J3QA 5CT4A 3SWWA 3AIKA 3R3ZA 5EI5A 1MX9A 5AKHA 5AI0A 1VZ2A 4Q1VA 4Y2UA 2XMSA 5FP0A 3OTQA 1R9NA 2WIDA 2WKWA 2K2QB 3E3AA 2WIFA 4ZWNA 1HDEA 1BCSA 4Z49A 2YXPX 4MQLA 2EDAA 2VTVA 1FFAA 3VDXA 2I3DA 2XUAA 3G0BA 2OQVA 2C5FA 1ZI8A 3FYUB 2VJBA 1H22A 2WILA 4LKOA 3EBLA 3QH4A 4UFPA 3I2FA 2VT7A 1LPBB 2WFLB 1MJ5A 3H17A 2AJDA 3O4IA 1J07A 3QMWA 4BZZA 4I3FA 4YPVA 1CUIA 4PSCA 4UHEA 2BKLA 1ZD3A 1VLQA 3STXA 4HZGA 2Z3WA 3KWJA 5C8XA 2PUHA 2EEPA 1YS2X 3TJMA 1ODSA 3H1BA 3DL7A 2I78A 5C8ZA 1YAJA 3EQ9A 1MX5A 3C8HA 3BJMA 4UBOA 3MVEA 4ZV7A 5E4TA 4BC1A 5IVDA 2B4KA 2CZQA 2WIGA 4J0GA 1W4LA 3WWEA 3B12A 5JATA 5DWDA 4G9EA 3IIIA 4HRXA 1CUAA 4G8DA 3C87A 3ESCA 2AJLI 4X6UA 2XB6A 4KAFA 4XIIA 4FFWA 1PJAA 1EINA 2D0DA 1LPSA 1X70A 2VJCA 3WZMA 1J06A 2PSHA 2ECFA 4UFOA 3G8YA 1GKKA 2O7VA 2XMCA 1ZD5A 1XKLA 3S8YA 3C43A 4FNMA 1L7QA 3DQZA 3DEAA 4BATA 1XQVA 3WA7A 5K3DA 2PSJA 3BDIA 4NMWA 3C8DA 4KAJA 3PICA 1QO7A 1K6EA 4WFJA 1H2WA 1WHSA 1H23A 5JZBA 3IURA 4LXIA 3WKBA 5AKIA 1PV1A 1WB6A 1GQSA 3SX4A 5ALDA 3WK6A 5AI5A 1CUXA 3PUIA 2HU7A 3ICWA 3STYA 5HZGA 5JZ9A 2OGTA 5JASA 4BRSA 2AJ8A 3H2HA 2Z3ZA 5JANA 5LIPA 2XUFA 2WJ4A 2WUDA 2G4LA 2V98A 3GBSA 3FVTA 4MYDA 5C81A 3UUFA 4B7ZA 4MWSA 1YS1X 3GA7A 2DHDA 2VJAA 4EA6A 1UZAA 4QDUA 4A5SA 5AKEA 4BTVA 4GECA 2HFKA 3I2JA 3WKDA 2WJ6A 2XQJA 2ZJFA 1ZJ4A 4L3WA 4B6GA 2RIPA 5ALNA 4F0JA 2Y1KA 3TGLA 4HVTA 3GUUA 2V96A 2X76A 3HXKA 4OU5A 5AI8A 2WG0A 1QZ3A 3FOBA 4FWBA 2LIPA 4MJ3A 3W2TA 4PSUA 3A6ZA 4U2CA 4B0PA 1GZ7A 1HBJA 1EH5A 2WIKA 1CUJA 3AFIA 5LZ9A 4X95A 4XX1A 5JD4A 2RGUA 3A2NA 1KEZA 3BDVA 4QEKA 2FJ0A 4AXBA 1UKBA 1E8DA 3BXPA 3FYUC 4CIBA 1ODCA 3FNBA 1LZKA 4FFVA 5AICA 3LS2A 4H77A 5KBYA 5EHNA 4C6HA 2C0PA 1EVEA 2DSNA 1C4XA 4OYLA 1UK9A 2ACKA 4GBGA 4WY5A 4C01A 5D3ZA 2I3ZA 1Z68A 3F8SA 3AJAA 1VXRA 4L72A 1XKTA 3F98A 4BYMA 3OG9A 1K8QA 1YA4A 5IVHA 3G0IA 3EQ8A 3WWOA 2GBFA 3HC7A 1NU8A 2H1IA 4JUIA 2Y2UA 2JGIA 5CH5A 4CG3A 3DD5A 4N8DA 1FJ2A 1BROA 4MWTA 3NWOA 4JEIA 1USWA 4QDOA 5JD6A 4OCZA 1Y7HA 1LLFA 5JADA 5E2IA 2G5TA 2DCMA 4BZWA 4PW0A 2E3JA 5LZ2A 3G9TA 4NS4A 4W1QA 4BCDA 4KE8A 3IUQA 5AOBA 3FAKA 3ZLTA 5JD5A 2RAUA 3I1YA 1GPNA 2HA6A 4GI1A 2OAGA 4DTCA 5K3BA 3R3XA 4QLAA 1XQXA 5JYCA 3WJ1A 1H2XA 4OUKX 4I19A 4OPMA 3AUKA 3VVMA 1TQHA 1XLWA 2ZSHA 2BUCA 2QOEA 5CMLA 1MAHA 2QTBA 5ALSA 2FX5A 4J0DA 3WKAA 1T2NA 4BP8A 4CG1A 2JEZA 1W6RA 2CB9A 5AI9A 4DMHA 4K5QA 3WK5A 4WJLA 1CQZA 4J0IA 3IDAA 1DWQA 3QYJA 3G02A 3VJLA 1EK1A 2HA3A 4BE9A 3JYHA 1VZ3A 1BS9A 3WWDA 4Y2XA 3WK9A 1H2ZA 5LZ5A 4UHFA 2UZ0A 4QDXA 2HA2A 4OD0A 4PQEA 5DNVA 5FXMA 2PSEA 1TCAA 5A7HA 5D3KA 1UT6A 2NW6A 3JWEA 2OCKA 1T4MA 3ANSA 2VAXA 3BJRA 2HADA 3HSSA 2ES4A 4OYYA 2XUHA 2JIDA 1UFOA 4GEGA 5ALMA 4N5HX 5T4BA 1WM1A 4J0CA 1LNSA 2WFMA 1VA5A 3A2MA 1TIBA 3IBTA 3FYUA 5ALHA 2QXTA 3H2JA 1DX4A 4Y9SA 1QFMA 1K63A 4WFIA 3AIOA 3T52A 1TCCA 4AO7A 2XLBA 5CXXA 4EY6A 3W9UA 1MN6A 3R3WA 2Z8XA 1VKHA 5AM3A 5AJHA 5JAHA 3TEJA 2JGLA 5EHZA 3VXKA 1UOQA 2QKYA 3HEAA 5FUMA 3IB3A 1AC5A 2HDWA 3FLBA 1E66A 1D07A 2XMBA 4IHAA 5AKXA 2QVBA 4N8EA 1CRLA 1LPNA 5IH7A 1Q0RA 2GBGA 2Y6VA 2AXEA 1THTA 1P0IA 1ZJ5A 1ZGBA 1HKHA 5ALXA 5EGNA 1YSCA 4ARBA 2XT0A 3K2IA 5JZSA 4AO8A 3U1TA 1GGVA 1MT3A 4FLEA 1R4ZA 4J7AA 2CMFA 3ESBA 4UHDA 1AKNA 3G9ZA 5LYYA 2IITA 4KR0A 4B84A 4DNFA 4X7BA 2OCGA 3QMMA 4G8CA 4B82A 4DLNA 2EDCA 5DYWA 1EB8A 2QUAA 1A7UA 1QGED 4LXGA 4RE5A 2CKMA 2YASA 2VSQA 3MUOA 1W75A 4FMPA 2HA4A 2PM8A 2VATA 3QPAA 4B85A 4FHZA 4CCWA 1XQYA 2Y2VA 3CN7A 4C87A 4E15A 1OILA 3IUJA 1ISPA 2G63A 3M81A 4Q3KA 4AN0A 3WMRA 5ALGA 3PI6A 4K6KA 1EX9A 3AILA 3R40A 2O2GA 2QRUA 5KREA 5T4HA 3OURA 1DQZA 3AINA 4BAGA 4Q05A 4IO0A 5DYYA 4JNCA 1YR2A 3WL5A 4ZRDA 5LKAA 1P0QA 2HM7A 3STTA 3BL8A 2H7XA 4W9RA 3O4HA 2HFJA 2D5LA 3FLEA 1EDBA 1CUZA 3MGAA 5HF8A 1XZHA 1H2YA 1CUVA 3FVRA 2ZYRA 5LKRA 2PSFA 1NX9A 1A8QA 3QBJA 5LP1A 4Y2JA 2WTNA 5AM5A 4GDMA 3KD2A 3EF3A 2QM0A 1SCQA 3R0VA 4HRYA 2VJDA 2DR0A 2CBGA 1CUDA 3P2MA 4FNGA 4H7FA 4B0OA 4H18A 1EI9A 3FYTA 4BDSA 3E4DA 1XLUA 1J1IA 1UOOA 1ZGCA 1XZKA 3WL6A 4JYMA 5BOVA 1RYYA 2ZJ7A 2QS9A 1G4HA 4HAIA 4F21A 1ACLA 5FPPA 1XZDA 2DQZA 4BE4A 5DNUA 4W1SA 2QZPA 3K9BA 1X2EA 3WK4A 4DIUA 1QIHA 1XZEA 4WDRA 1WHTA 4X85A 1IUOA 1CUSA 2WHPA 1ORWA 3CCCA 4DNOA 5A71A 3RK4A 4P93A 2PSDA 4BTLA 3W06A 3D7RA 1BU8A 2X5XA 5D7BA 5A2GA 1ORVA 2JEYA 1E5TA 3PUHA 2C4HA 1R88A 4CI9A 2QJWA 3S2ZA 1WB4A 1FFEA 3F97A 2O2HA 3LIIA 3IA2A 5C8VA 1CV2A 1QTRA 1K5PA 1BCRA 3H2IA 2BUAA 2XUJA 4XWGA 4Q34A 4FLFA 3U0VA 4OB8A 5HF9A 1TRHA 2PU5A 3WQHA 1JJBA 5AI4A 1YB7A 1SFRA 4JH0A 1UK7A 5AHXA 4WFKA 3VKFA 3D5EA 1DT5A 3HLKA 1I6WA 4GLBA 3H1AA 2HIHA 3K6KA 4PF1A 1OCEA 3CN9A 4UBKA 4QDTA 1XZJA 4WY8A 3AZOA 3IUNA 1IUNA 5D6OA 3STVA 3ZLUA 2WFLA 4BDTA 4X71A 4G1FA 4KE6A 7YASA 1B41A 4EBBA 3I2IA 3WIOA 3RARA 1P0PA 1IMJA 2PPLA 3C6BA 1N5MA 5ALIA 3R3VA 1IVYA 3KWFA 4UHBA 3KSRA 3WK7A 4BB0A 5K5EA 4XJVA 5FRDA 4FTWA 5AKGA 4GHWA 1A88A 3FLAA 5KWJA 1F6WA 5DTJA 2XMQA 4KE7A 3F96A 1AX9A 2OXEA 1G42A 3C5WP 4KJXA 3H2KA 4NVRA 4DYHA 1GPKA 5LZ7A 2WUFA 4UPDA 1BE0A 2XUOA 1E89A 3KXPA 2WHPB 3PFBA 3W05A 1WB5A 4C4XA 1EDDA 1ZIYA 3LLCA 4AB1A 2XMZA 1XRPA 1CUBA 4P08A 4J0HA 1WOMA 4F60A 4BVJA 4DNQA 2GYUA 4HTAA 4X6YA 5HFNA 4S0XA 1ZICA 2XMRA 4FKBA 1VXOA 4B9EA 3PF8A 2XI4A 3CCBA 2WUGA 1DX6A 3D0KA 5HF6A 4UBLA 1HPLA 5JAUA 2OPHA 3BIXA 1M33A 2R11A 1E3QA 4PSDA 4ZI5A 2GYVA 4KRYA 3BF7A 2B20A 4ZGBA 5AO9A 2R8BA 5AKKA 3C6XA 1PFQA 5A7GA 1VJ5A 4QA9A 1MU0A 3BIWA 1FFBA 4UFNA 1CLEA 1QJ4A 3WL7A 4DSZA 4IH1A 1EHYA 1SC9A 4Y2QA 3WI7A 1G66A 4OU4A 1AZWA 5K3CA 2RI6A 2WM2A 3YASA 2B61A 1B6GA 3H19A 2PL5A 4W63A 4EY5A 4L9AA 2XDWA 2YH2A 2GYWA 4W1RA 3D2BA 5HQ3B 3LIPA 4RGYA 4C88A 5IKXA 1AURA 3G9XA 3A70A 4H0CA 1CUHA 4N8SA 2VF2A 5JAOA 5F4ZA 2GBIA 3G0DA 3QM1A 5EIHA 5E4JA 3H2GA 2P8SA 3FWHA 3OPMA 4FLMA 4ITVA 4BRZA 4E46A 4UHCA 3B5EA 3WYDA 4TVKA 5ALKA 4U2GA 5C7YA 4UBNA 3AIMA 5EFZA 1HLGA 5T4FA 5ISMA 3D3NA 3ZLVA 4EY7A 5ALUA 1UWCA 1X2BA 4P9NA 1DWPA 1HL7A 1LGYA 2HA5A 1DU4A 3RM3A 2XQFA 4A16A 1ZI6A 3N0TA 3D4LA 4EB0A 2CUTA 1CUFA 5AOCA 2PVSA 5AOAA 4Y7DA 4TGLA 2WLSA 1RWQA 4X97A 4HXFB 5E4YA 3L1IA 3C5VA 1QIIA 3O4GA 5CBKA 1F0PA 1OXMA 1XZLA 1P0MA 2ZYIA 4ROTA 3L1JA 1YAHA 5HQ3A 1GQRA 5DNWA 3DDUA 4BVKA 1SCIA 2ZVDA 2VEOA 3WK8A 4QDZA 5LZ8A 4INZA 1QE3A 4P92A 5CRIA 3V48A 1YA8A 5HFAA 4G8BA 1Y37A 1L7RA 4UHHA 4WCVA 4X94A 4ARAA 3WZLA 1TCBA 4Y2VA 4BCBA 3HZOA 3NGMA 5AK3A 5ALQA 4DSAA 2FUKA 1ZI9A 3UUEA 5CURA 1CUUA 5SYMA 1AMNA 4KAAA 3ZWQA 5ALZA 1C7IA 3WKCA 5T4EA 3QVMA 5FOQA 1DWOA 4X91A 2Z8ZA 4GWLA 2ONCA 1UKAA 4YASA 1XRRA 1UOPA 1W52X 5CXUA 5K3AA 2C7BA 1QIDA 1W76A 1XROA 2WQZA 1BN7A 5AIBA 1ACJA 2HA7A 1DT3A 5FPQA 5FDFA 2WHQA 4DM7A 2BGRA 5A6VA 2BJHA 1N5RA 3G7NA 1FFDA 5ALRA 1MO2A 4X00A 2OG1A 4N5IX 4H7EA 3ZPXA 4IH9A 2ZYHA 2RHWA 4C89A 1JI3A 4GW3A 4YX9A 1EK2A 2PU7A 2ROQA 1ZD2P 3L1HA 5AKJA 5YASA 1U8EA 1Y7IA
chains in the Genus database with same CATH superfamily
1E8MA 1XX6A 4I81A 3G1UA 3ZQKA 2YJZA 2NACA 3X1DA 1CUYA 3DV0A 3ZV4A 3WJAA 2FLVA 3DHVA 5EIEA 1QF9A 4YCLA 2G5GX 4ND7A 2JCXA 3TKAA 3FTEA 1P45A 3OEYA 221PA 1JHVA 2C5GA 2W2KA 3OEEA 1XCGB 4IWXA 4DLXA 3ZVNA 3UXYA 3ZDDA 1QQ5A 3FG9A 5K3SA 4BFZA 4KQHA 3FIUA 1LRJA 4IG9A 3O5AA 1I13A 1M2GA 1P77A 1S9HA 2Q9AA 3GGDA 1Z7GA 5LYJA 3W7VA 4P3YA 2VA8A 3FJOA 5AM4A 2A57A 2H06A 2HF9A 2XMGA 1YB1A 1Z7WA 1RACA 2DBVO 3BA1A 4PRYA 5K3FA 3SHWA 1Y3AA 2APJA 1KEUA 1U02A 4N4AA 2GEKA 1PTJA 3G2QA 3WAKA 3OY7A 1IEWA 3SK0A 2ZXUA 3A36A 3O8LA 3SICE 5INTA 1JP7A 5B6PA 1CZOA 4ND5A 1RBYA 3TG8A 2GF0A 1FC0A 3KSDO 4YT8A 2UUOA 4G36A 4YAWA 2IBTA 2FETA 2ZBGA 4C29A 1UBJS 1EFPB 3QOFA 2G7MC 4ES6A 4D9GA 3S5UA 2WQ7A 3ORRA 3ZWDA 1LX6A 3EOBI 1H2BA 2QTHA 1I7DA 4E07A 1MV8A 1NT4A 4R7GA 2HY7A 3BE5A 5AW4A 4PBSA 3F6BX 3N8GA 4CF5A 2OGZA 1SD5A 1EFUA 1PSWA 5B30A 3K0CC 3SKXA 2R8PA 2XUPA 1PUJA 1P9OA 5K0ZA 3GZJA 5JNUA 1TQ2A 4K9OA 2QAGA 3WYFA 5LL6P 2UXDB 2HQ1A 3ANTA 1QE0A 2CT8A 5A62A 2EW8A 2XV1A 1U7PA 2QE7D 3CF6R 4NFSA 1E3LA 1OFTA 2H1CA 3O2SB 3JAWB 4WEOA 2JLBA 3JY6A 3I3SR 3MWYW 521PA 2M6KA 4DQXA 4XPIA 3DQPA 4NYJQ 5L4NA 2A9JA 3JRNA 1BWPA 2PZKA 4MUFA 3QBTA 1N1MA 1XRNA 2C4WA 3N0RA 4ABTA 3EQ7A 1EFVA 1I36A 3FGZA 3M6XA 3ASUA 5LQJA 3PPXA 4JB8A 3LZCA 1KO5A 2G1AA 3F0TA 3IP7A 4NONA 4XJTA 1XQ9A 4B6SA 2XF2A 1U4NA 1R37A 5BN5A 3ZDRA 2H3HA 4KUHA 4J76A 5IJ9A 4QXQA 2AQKA 1QG0A 1OXXK 3QMVA 3CTPA 1OVMA 2ZIFA 4YVFA 4DF3A 1W36C 3MCTA 5KYYB 4H6WA 3JYQA 1KYWA 1VLJA 3GZNB 1L4GA 3OSUA 4K03A 3RV3A 2AXNA 1JR6A 2GA9A 4L02A 1QRRA 3NYRA 4EPWA 2WU4A 1Z8HA 1N3IA 3H3XA 4II3A 4AZ3B 2GD2A 2PJZA 3RYHA 4WKPA 4KNYA 3D6TB 1I2BA 4TWZA 5BSHA 1IK6A 2DPLA 3G5MA 3PX7A 2OBFA 1TZCA 1WTCA 4TV9F 5ESRA 5HF5A 3ZW7A 3EH2A 2OV4A 3V1LA 4ENTA 4WD3A 2R8EA 4H35A 3TR0A 1FRFS 1M34E 4PQRA 4JQCA 4Q47A 1J5XA 1KEPA 3GARA 3NBAA 4Q9LA 2I2DA 2PZGA 1D09A 2WJAA 3DEFA 5KWIA 3O0TA 3Q0TA 1JU4A 2EF0A 2FK7A 1IM5A 2Q8NA 1A5BB 1EWTA 3WIUA 4CUKA 1R4MB 3SYTA 3UJ9A 2OD9A 2YWFA 5CVEA 3C45A 3H8WA 2EYQA 4TWRA 1ONBA 4Q7KA 4ZQGA 4YMGA 1JECA 5CVCA 3ZUGA 3WDLA 1KFJB 5HTOA 3QWHA 4MICA 4D80A 1ONSA 3ZWOA 2VK2A 3NKLA 4KXQA 1ZKMA 3FYSA 4CIYA 4DMRA 1XLTC 1ZOIA 4KZKA 4DMKA 4AZTA 1EFDN 1OU4A 5K8LA 2AFRA 2JGAA 1KO4A 4OQPA 2QX6A 3SBXA 3U62A 4P7FA 3FAZA 2FWPA 4B45A 4EUFA 4Z7QB 4TMKA 4TLAA 2Q4DA 4AJ2A 4CYMA 3CVYA 2CHUA 2WF5A 1DQYA 2Q21A 1RWXA 1ULUA 3ZY2A 2C1XA 3MCAA 3ME5A 3M9LA 3R6GA 4G1UC 2JFYA 2WSSA 3P0IA 1UZUA 4G0QA 2H4JA 1E8NA 4O02B 1JT2A 2CNWD 2Q4RA 5I9NA 5JDIC 2FUEA 5DBEX 1GAEO 1LS1A 3N8KA 4XARA 1JDBB 3CRNA 4ZCRA 1JJ7A 1Z9BA 1ND5A 3IVAA 5ALJA 1CT9A 4IVQA 4DMCA 1WUIS 1CB7A 4RV9A 3WP0A 2QTVA 4DFDA 1UDXA 1QQ7A 1RWOA 5DBHX 2FRXA 5FOUA 3LX8A 2IH2A 3VJKA 1M34A 1KOLA 2DH6A 2EFJA 2X9QA 5LDGA 5FQNA 3ZNQA 5I01A 3KT0A 1PDWA 1NBMD 3FKSA 2IHTA 3E3MA 4FUTA 1PEKE 2TSYB 4Z7JA 2PGAA 5IK2D 2YMQA 3JTEA 3OOEA 1IY0A 5CBPA 3ZJVA 3PZRA 3GVIA 3QGMA 4NQRA 4OXKA 3OPQA 3C3KA 1WZIA 1MNAA 5EXTA 4Q1CA 1FUYB 3O1HB 1F5NA 4C2BA 4YCNA 1JNXX 3ZZNA 2IFTA 4MMXB 5AW8A 3Q7PA 4ZQHA 2BGMA 3HCNA 2BFOA 1AY0A 4HLUC 2FEXA 3KVRA 4UEKA 1YOVA 4WNAA 1YB5A 2G88A 3A0UA 2QDXA 4QASA 1TC2A 4WZBE 4C7OB 2W6ZA 1OX4B 4KR6A 5DVZA 4QT0A 3E5MA 2G9QA 4IQ0A 4P8RA 5HZKA 1VB5A 1Q14A 1LI5A 4Q82A 4KQ6A 4N7BA 2EKQA 2ZU6A 2VJLA 3OCJA 2O1WA 4IYJA 4N18A 5IMBA 4HV4A 5ITVA 4NCXA 3ETLA 4J1TC 5TVGA 3U0BA 3CB4A 1HT0A 1ODTC 4KQKA 1DFHA 5CIWA 2YIJA 4D4LA 1Z17A 1G291 3GIWA 4N3BA 4FGSA 2Y9MB 1XZIA 2NZ2A 1PW5A 3AHFA 3LO5A 4GGMX 1Z5PA 4WN9A 2GZHA 3D2CA 4ZCLA 4ZAVA 2IIVA 3USCS 3GFPA 3DEJA 2I34A 1C1XB 4KLRA 4AY6A 1GT6A 1OHHA 4L0QA 4X60A 3VYRB 4WSOA 2FFQA 3CKMA 3S2EA 3I9KA 4CN8A 1PLJA 5KIAA 4D5EA 5KO2A 1BA3A 1XZPA 3M9WA 2Z0MA 4PSKA 4X7RA 3ZV6A 3ZWYA 5J3JA 4FMDF 1T0UA 1O6GA 1I2DA 3E6AA 2MU1A 4P86A 3ZBUA 3PFKA 3TB6A 2BFFB 5TLSA 4M76B 2HLDD 3QW4B 2J9FA 3WBFA 5KX5A 1KQ3A 2O2SA 3B8HA 3UFXB 1XZAA 3GB9A 4GYWA 2XQGA 3U3RA 2P6MA 3D8TA 4BO7A 3D8SA 3T3IA 3ESDA 4LV5B 4DN6A 1WPQA 3KBBA 1BE6A 3LUCA 4F4JA 4ZDIA 2IGBA 2D1SA 4MVJE 4MO2A 1NJ1A 3AW8A 4J75A 4WY2A 3TQQA 3N8IA 4HXGA 1EXDA 4OF4A 2RGDA 4TX1A 2D1TA 1BN6A 4POAA 5FL7A 4NBRA 2ZJ8A 1NF8A 1IC6A 3GA5A 4B80A 1IJFA 3ANYB 3CNNA 1XSEA 3FUVA 2ZUVA 3HCRA 3MUFA 3O90A 3EIEA 4G1VA 4LHZA 3AVVA 3OY2A 1H0KA 3DV2A 1UR5A 5AVSA 2BL4A 3SF8B 2ZSFA 2C1EA 2JD0A 1A8UA 5SY9A 3C3WA 3KZ1E 4R5HA 3BF8A 4NARA 2JG3A 5I7OA 1REQA 1HI9A 3VC7A 1V41E 1Q0LA 3IAEA 4ZO7A 4E6EA 1CCWA 2PYIA 2OAP1 1NF3A 2E5FA 2RCNA 5A3VA 2AFHE 3IUBA 1WKVA 3B2EA 1HZZA 3DLIA 4JYBA 2XGJA 4WOBA 1ABFA 3RTEA 1J0DA 3UPDA 5K8VA 2XCOA 1UDWA 1YQ9A 1GQYA 4F4CA 4HXEB 5EE0A 5IDYA 3C6KA 3UQYS 3MS4A 5DLEA 2F1JA 3OE7A 1G9XA 2ZE7A 4B47A 4LXHA 1W36D 3ELWA 4GG1A 1GEEA 2QZ9A 5ED0A 1Q22A 4HGZA 3FDZA 3JZAA 4LYFA 1J0XO 1XELA 3LUFA 3F4BA 4G9GA 4CMGA 4YCJA 1ZA2A 3HP1A 1RAAA 4J90A 4L08A 3H9UA 2P68A 4MYRA 4U2EA 1SXHA 3GMIA 3ZGVA 5HOEA 1S4QA 2C2ZA 4PAOA 5JVDF 1QM5A 1OY1A 3UTCA 3KZMA 3M3PA 3VVLA 5TY0A 2ZUEA 1CVLA 4ZDKA 3OA2A 1XQWA 2VNSA 2WFZA 3VU0A 2QR5A 4XB6B 5C52B 4XDHA 3NHJA 3GELA 3QPDA 4O2AF 3T1TA 2EOAA 4PPGA 1UBLS 1NDQA 1QTNA 1LSJA 4OI0A 4TYMA 3DW1X 2FMIA 1YKSA 5AW0A 4XX0B 4RM3A 2Q1SA 2XNKA 2DR3A 1F4PA 2ZE6A 5M29A 8MHTA 4NZYA 4UBIA 1HTBA 3IOEA 3W6OA 2PUWA 3M1AA 4ZZ2A 3PVZA 1JEJA 3A3YA 1RXIA 1I3MA 2I6XA 2P4HX 3T95A 3T3NA 4ZFNA 4E08A 4OHRA 5EHQA 3DTVA 4B6PA 4O2BA 5IXYA 1CYDA 4LJ6A 3TDNA 3KAJA 5BUCA 5JYEA 3GROA 4P38A 4B83A 1P7CA 3GJ4A 1QFZA 4JGIA 2CDAA 3THOA 2AEFA 2LE0A 2PWBA 5C51B 2RHHA 2W6MA 1C7JA 4OK3A 1JG7A 1ZG3A 4HQNA 1QGZA 1VI2A 2L19A 4Z8YA 3TIIA 2PEZA 4RKFA 3OMLA 3H11A 2I54A 3G8BA 5HJ5A 1JJVA 1EZ1A 4Y0VA 1Q0ZA 1NP6A 4QBKA 4AKHA 2UUBB 2JCSA 4JJ4A 1MXHA 1JE0A 1B8VA 2B1QA 3LO8A 3ZY3A 3FR8A 4E03A 4CCYA 5C46F 5CITA 3DM9B 2NPIA 3PJRA 1NM5A 4LV8B 4Q5IA 4QEZA 5BYJA 2C00A 3OC6A 1EUZA 2IZZA 3SJAA 4GOOD 5EAIA 5I7WA 4TKLA 3V1KA 4Z4CA 2GN9A 1ECPA 2O14A 2ZI5A 5AI6A 1YL5A 2E4WA 3I0ZA 4FOLA 2GSDA 4CQMA 1U98A 1ZXXA 2FZKA 2QW0X 4URYR 3H86A 3I2KA 1V7PC 5U1PA 5LLSA 2QUBA 4DB4A 3DAGA 4AN4A 1G3IA 1GYQA 2FFJA 1LVUA 2Q1UA 3RLIA 3CH4B 4MEAA 4MUGA 2GVZC 2YHIA 5L6MB 2CMHA 3V8EA 3ZIAA 4BN0A 1V37A 3MJRA 4HDMB 3OKPA 5EWMA 5B4VA 4MQMA 1N9ZA 4MHOA 1EJ6A 2HSZA 3R3JA 3HVUA 3OESA 4IOLA 1OFUA 2EAUA 4LHSA 1ZXLA 3BPSA 2IELA 3PIDA 4RV4A 4ZAWA 1P73A 3PWTA 2VLBA 4O2AB 2BFDB 2OFXA 2GF2A 2VDLB 1HEUA 1QAOA 1JKFA 1VG9B 4KG7A 1G20E 4S35A 4M0FA 1S2MA 3IXMA 4X92A 3W3AD 4EGQA 1PV4A 4HPXB 2VK4A 4M49A 3TTYA 3L7CA 4MROA 1CUGA 1GO2A 4ZREA 4YN3A 4G2TA 4NCIA 3OU2A 2QTMA 1G20A 2VJPA 2P40A 4MXDA 3ZHVA 3KWMA 1JLLA 1XJQA 4Y1RB 2HGZA 1ZS9A 3VKGA 5CFOA 3E1GA 3D9QX 4DY6A 1JDVA 1N6OA 3L8DA 4MEBA 4M1QA 1SWWA 3A11A 3GF4A 4CT5A 2EARA 2JARA 2GBCA 3IHKA 4N1AA 2WHRA 4O5OA 1HDGO 4QPNA 1QU3A 4UULA 1XTKA 3DCYA 2O48X 3JQBC 4K9MA 2XF8A 5ALTA 3UAWA 4DIFA 2C7OA 4O3MA 5D3QA 5DFAA 3IEVA 1SC4A 3Q0EA 5FFNA 5HK8A 1FLAA 3GEMA 5TS2A 2KJQA 1PL0A 1V1MA 1UH5A 1YVRA 4L9SA 1KHHA 3ONEA 2BKXA 3DYBA 1TRKA 5I51A 3RVBA 3S81A 4AX8A 3JR3A 1BA2A 5CAEB 2IPXA 3EZFA 4ZKEA 1L4BA 1UBHS 2Q2NA 3PITA 2B25A 1LF0A 2BTOA 1ZRHA 1GVNB 4HAOA 4MGYR 4N3CA 3TAXA 2XXAA 2WKSA 1N8KA 1U65A 3LT1A 2LZ0A 3PC2A 3O4JA 1EWVA 3PFIA 4ESEA 1G3RA 2H7CA 3U9LA 2GZRA 1L7EA 3FOEC 2KM1A 3CONA 5AXBA 3OFKA 4RXMA 1WXEA 1SUIA 3SC2A 3GFVA 3L82B 2O8VA 1PQWA 4PC2A 4GX5A 4J3JA 5EIAA 4B4WA 1PJQA 3VSAA 4EG4A 3A1CA 1E7RA 3DMYA 3N86A 1B6RA 1Y8RB 3DYVA 5B2ZA 3AHDA 1IK4A 2VQEB 3SP1A 1EX6A 5IAJA 2ZWAA 1CUEA 2R8ZA 3K53A 2EFCB 2YMMA 4LX8A 3KPVA 2GAFA 2J33A 4JY7A 3D6UA 1M1UA 4GXNA 1VECA 1DINA 2I1WA 3GJZA 1MX3A 3JZMA 4IMIB 2PX3A 4PM4A 1G5QA 5B1DA 1PNTA 4LJAA 5BSMA 2OO3A 1TU3A 5F4BA 2QRQA 2GFIA 3PZBA 2JB9A 2W6JA 5AXCA 2ZDGA 1W96A 4WAUA 4QUGA 4MVWA 4R1LA 3K35A 1PDVA 3RQSA 5FLKA 4AZ0A 4BLVA 4MI9A 1EDZA 4O25A 1LPPA 5J40A 2H59A 2IEAA 5LNK6 2ZBDA 1VM6A 4AFNA 1Y89A 1MAWA 3D8BA 3C85A 1BVHA 1BMFD 1P1CA 4QULA 2A7QA 3KTAA 2ZYGA 1WCYA 2VPYA 2Z6AA 2JBAB 4L8VA 2RAFA 4BN5A 2BHSA 5CTAA 2BTEA 4FCVA 2DECA 3I73A 1EUQA 4TV9A 1JJIA 4R71A 4ZDJA 3PEYA 1A1SA 2O0LA 4P80A 1PZGA 4K6CA 3FDIA 4DCMA 3FBWA 1JRLA 1XCPA 2D0OB 4I0WB 4JA0A 3WWPA 3V32A 5LMCA 4X90A 3HH8A 1SULA 3FROA 4M36A 3MILA 4EG6A 4OQQA 4JI3B 2HOQA 2JGJA 4HZUA 3U7RA 1BX3A 1U3UA 1O0CA 4GE0A 1C7ZA 4BNKA 2GM3A 6REQA 1I32A 1VJTA 1HE2A 1AZTA 3FSGD 5KJ1A 3KOMA 4FOTA 4AY2A 4RTRA 2FVXA 2RBEA 3GEHA 2I6SA 5EUQB 1WX1A 3ZKWB 3ZVLA 1X9HA 1TZBA 2DHEA 4GE3A 3WGVA 3JRWA 5DGCA 3DDOA 2DR2A 4IM7A 3JQAA 1MIOB 2N46A 2QJTA 3EVGA 3N2KB 1MC8A 3TOXA 3QLJA 3DAYA 2I2CA 5FWYB 4DKXA 1E59A 2MSKA 1KWKA 4BQOA 2OT3B 2Q9BA 5FWNA 1IB6A 2FEWB 3FZEA 3OP1A 2FFRA 5FA6A 2PUEA 4GPEA 3GVHA 2E87A 1V9SA 4ZK2A 1D5WA 3AF0A 1DG1G 3KZCA 2YRWA 4I1SA 4DKJA 3BMOB 3B2QA 1M7GA 1FBTA 1YVDA 4DV5B 2RGNC 4EJSC 2NXNA 3F8TA 2ZB3A 5AKLA 1XRQA 2W11A 4OSEA 1F12A 4UTZA 4B9AA 5FQOA 1WZUA 1ZN2A 1N8NA 1RI2A 5BNIA 3AESA 3MUEA 3L02A 4RHCA 3G23A 2OAEA 2WRZA 4QREA 2Y27A 3SVZA 5FOSA 3OIWA 1FDWA 2BFWA 4L9RA 4CDGA 1BX1A 2YUTA 3G8DA 4FOSA 3AHEA 4MUJA 1IZ8A 1FU8A 3BFJA 4MPDA 3RLFA 3S6JA 5JUWA 4HNAA 3A2LA 3EXEB 5FFMA 3A28A 4I4TB 2NLOA 4B2IA 1DC5A 1N1EA 1GTMA 1QHXA 1UEJA 4QQRA 5A9SB 5B7QA 5LN1A 3OZRA 2ZJ6A 4IIJA 3A3KA 1EE9A 2D1RA 1Q11A 3BILA 3RKSA 1AQUA 2GZMA 4D25A 3WLIA 4KQCA 3QE0A 5A03A 4KSCA 1RXVA 4NNPA 4IJUA 2FPSA 5ES4B 3U4QA 1GQQA 1H4SA 5A05A 1P4JA 5DHQA 3DPSA 3QLEA 4R2LA 4DARA 1G38A 4B6RA 3RF7A 2AI3A 2O2EA 3HJCA 4Y6SA 1W5EA 1TEZA 4B3FX 1MH1A 1CR6A 1UJMA 1XHLA 4J2HA 3ACBA 1KDPA 1PVDA 3OI7A 4ZODA 2B37A 4DUGD 4E88A 2ODTX 3JSAA 3SNKA 5JARA 2V8BA 1HYGA 5FOWA 1W19A 2YVQA 3R0XA 4P31A 1IOWA 5FTNA 2F1RA 2BFNA 4HEHA 4JJAA 4R1PA 1FNDA 2PMKA 2WU3A 4RBNA 2ATXA 2AX3A 1UFQA 1BHO1 2IDKA 2E82A 4ZCMA 3A31A 2NO5A 4DEVA 3PPIA 3N76A 5CYGA 5CB6A 2V9PA 3BB3A 1OW3B 2P75A 3ECAA 1UK8A 5AH0A 2QRPA 5EWJB 1G5RA 2JGFA 1F51E 3G68A 5EJAA 3PDIB 3ZWCA 5B1EA 4LZZA 4ZK6A 1QIFA 1B42A 2ZYSA 1J20A 1GDHA 1YDFA 4QNRA 1P2GA 1DADA 4GI3A 4DANA 2XA2A 1X7YB 4G4JA 1WEKA 3R44A 2CE7A 1X0XA 2O3QA 5FLEX 4Z3DA 3RIXA 4G26A 4MQ5A 1TJNA 1P9RA 2W4MA 4GO1A 2G1KA 2QQFA 4X20A 5CVDA 1Y9EA 1PR4A 2ZWOA 2QJRA 5CT9A 1KZHA 5A1TA 5ER6A 4S1PA 1H4QA 4PIVA 3RFCA 1E3WA 2HRRA 1N7JA 2QRHA 2O5CA 1E9AA 2RDMA 1SD2A 1FTNA 2I2AA 1BEZA 1CY7A 3IVMA 5TQ2A 2QD5A 2MSDB 3WJ2A 1ZK3A 2W0SA 3DBIA 4ENUA 2UUAB 1W2GA 1EFHA 3L7NA 3MJSA 4C43A 1XL0A 4CMBA 1ODFA 3L9WA 4RJLA 4K1XA 4LY6A 1J24A 4E7PA 1WBJB 3JASA 3K5PA 5LVAA 1A5SB 1JIXA 4M1YA 3ESZA 4WN3A 3LVBA 5TMPA 2CJWA 2BZGA 2NUPB 1EP2B 2XYRA 4RW0A 3CW2A 4C4SA 3BKXA 1M2VA 4C4ZA 2WMYA 4K7JA 1LB1B 3SY8A 3A58B 2E4ZA 2GHIA 5FIUA 4BKPA 3IMCA 2Y1FA 1VL1A 3HTXA 1R66A 2PV7A 2JI8A 3AEYA 4RHFA 3DB2A 3A1EA 1LBSA 1HKUA 1JLHA 1Z4IA 4RGVA 1H66A 1K4YA 3MW8A 3PLRA 4NP6A 2J6CA 4RLQA 3KOYA 4NESA 3NOVA 4HEA6 3AQIA 3R76A 1O5TA 1LF5A 2YJTD 1Z18A 4FDAA 5G1NA 3DKPA 5THXA 5SYNA 3A4IA 1DAHA 3X1ZA 1AA9A 1JEAA 2NUBA 2GKSA 4QO8A 1L5SA 3UAVA 4CG2A 4DS3A 3I8XA 4JS0A 1NBAA 3PVSA 2E0IA 2TMDA 4JLDA 1X3SA 2WV7A 2XE4A 4R2JA 1U1EA 4W1PA 5A1JA 4UEOA 4KIFA 1R50A 2ATEA 4Z7OB 1VE1A 1FZQA 2A9KA 2BR5A 1AD2A 3SWWA 4MVCA 5IHXA 5CLGA 3TM4A 1I4EB 1W85A 3RADC 3QVOA 5FEMA 1G0OA 2C2WA 2MJLA 1Q0SA 2VBGA 3BXZA 4K6MA 4D8UA 2TRSB 4BQFA 2RKWA 3QBVA 1R6XA 3RK1A 4NOLA 4JVOA 3LY5A 1JTFA 2ZRNA 4XGNA 1Z5ZA 2D62A 3M6MD 2PE5A 4K9NA 4E70A 4CM6A 4R1OA 3GLHB 1NXTA 4DIKA 1AO0A 4R8SA 1U2QA 3OKCA 1IM2A 2XMSA 3SE7A 3KDSE 5HVNA 4NNJA 4RFLA 5FP0A 4UJ3A 4WZBA 3T0IA 2VNHA 4RY9A 2VUUA 1FNMA 1Y34E 2CVFA 4GX2A 2JIZD 4C7KA 1RAFA 3QVSA 4M0KA 2K2QB 2CB0A 2QD2A 3RSOA 3WZLA 3QIVA 4XGRA 3ODGA 3UGJA 1JXOA 4E5UA 2DT5A 1RW4A 1WU7A 2WIFA 1XJWA 2LDBA 3BG5A 3OF3A 4GVLA 3WHPA 4UMDA 1RMTA 1SHJA 3ZXUB 4Z49A 3EXEA 1YZKA 4ME6A 1EQUA 4NATA 2PUDA 1EKXA 1G98A 3G0BA 4WT7A 1NBIA 5LR6A 2GCNA 2PN1A 3H9CA 1MB9A 2GJ4A 3EVCA 1DKOA 3NEYA 3F6YA 4Q19A 3HWX1 4YRFA 3FYUB 3SJCA 2VJBA 2WILA 1ZAYA 2FX3A 1L1EA 2G25A 3EBLA 4XLZA 2ENUA 4LZJA 4ZGGA 2OHXA 2VR1A 4TLDA 2CYBA 3H17A 1RM5A 4DV3B 1J07A 1OVGA 2RGCA 2VDKB 1E5XA 2CXTA 3B1VA 3QMWA 4NNOA 4PSCA 5AVTA 3NLLA 3R09A 1OXSC 4PLTA 3P0RA 3OLQA 3STXA 2VO1A 3NJ4A 3K09A 4Y9RA 3L4KA 2G77B 4CGZA 1DOHA 1Z4OA 2COUA 3R5KA 5D00A 1I7LA 1YS2X 3TCXB 4OVKA 1RT9A 2Q4TA 5BYBA 1IPEA 1NBOA 5IJZA 5E6SA 3ABIA 1CQPA 5E1BA 4ILKA 4PIMA 4FDVA 1YQXA 1KQFA 2QAJA 2FF7A 3OPXA 5D3MA 2EX1A 2HQBA 3RVMA 4JYAB 4C6RA 1R9JA 4QDJA 2QTAA 2IXEA 3BJMA 1VJDA 3LOPA 4UBOA 3MVEA 3FPFA 3EZLA 2GPBA 2F7SA 3T6KA 5F2KA 1EFKA 3LF2A 1UC8A 5IVDA 3GZTB 2ZPAA 4JUBA 3QBEA 1SXJE 3KL4A 2CCKA 1W4LA 3EVBA 1IHPA 2JJ8A 2N9UA 1XTUA 1JHDA 2ZULA 3U09A 1OBCA 3QFHA 3AY7A 1NSYA 5C4IA 1BDHA 5DWDA 4D43A 2WV9A 1ULHA 2VBCA 3IIIA 4R6XA 2NIPA 4ZYWA 5B58C 4BJHB 1M74A 3EIXA 3GRPA 4GZLA 4FCWA 4OA8A 4QX6A 3V4ZA 2NVUB 5EJEA 1ISSA 4RPJA 1JXMA 4KAFA 2QVCA 3ABRB 3TLXA 4DL9A 5ELXA 4HX5A 1TADA 1I9GA 2X0IA 4FFWA 3ZDXB 2WICA 1FZTA 4WLFA 1VJGA 2IYUA 4P2BA 2IYXA 3WLKX 4DCSA 4X8HA 1QVWA 3T8YA 4L22A 3NHSA 2CXNA 1W0KA 4DMMA 4F1KA 2D0DA 3AP1A 1LLUA 3HCPA 2VJCA 4RKQA 1NYRA 4CKCB 5DM60 2XWBF 4CJXA 2IT1A 3DO8A 1L5WA 2W5UA 4FK8A 4TS4A 1RM3A 2Q2QA 4DUGA 4UHJA 1NVWQ 2VP6A 2R6HA 3KHSA 3LSTA 5JAZA 1ECCA 1W4BA 3U4GA 3L4SO 3W5VA 1J0AA 4UFOA 3RIEA 1PBTA 1P4AA 3G8YA 3NHRA 2P90A 5G0TA 2ZVJA 4W5RA 2OD2A 3LW7A 2O7VA 4LQLA 3TB4A 2FUNB 4RVSA 2XUZA 1DB3A 5TXGA 2HIMA 5KEIA 4Q6BA 1EJ0A 3DEAA 1GZVA 1HE3A 2ZUWA 5BN1A 2DUMA 2QJFA 3WA7A 1I1OA 1XALA 1DCMA 2GXSA 2YRXA 4QPDA 4DDUA 4OHKA 3W77A 4YMTA 4NMWA 5CLFA 1EGVB 2H7VA 2J3KA 4H0NA 4KAJA 1QO7A 1YZGA 3OJ0A 2HBYA 3DMFA 1M2KA 4HI0E 4M8LA 1U8XX 4NCHA 1H2WA 4MP3A 4ZCPA 1H23A 2CEAA 2MTBA 4YRDA 2ODPA 1YDHA 1CR4A 2R68A 2NN3C 2PO5A 3DEKA 5ER9A 1MJFA 2B94A 1N5IA 1FRVA 4IEFB 4MYHA 3AMVA 4HD8A 1E2QA 1WB6A 2AVDA 4HDMA 3KE9A 2IIBA 3S7TA 4DA8A 1JYSA 1R2QA 3HBFA 4GYJA 2A33A 3ASZA 1UCFA 2A35A 4WBSA 5SYAA 3TVTA 4B76A 4MV7A 4ZCIA 3UW1A 3PEWA 2WHEA 1GZUA 5ALDA 3PE3A 3SX4A 1FMFA 4RAQA 4EW3A 1HY3A 1Z83A 2YBEA 3C5CA 3D6VA 4TKUB 3FNGA 3CW9A 3NRBA 5AI5A 1CUXA 2X8JB 3KX2A 3ICWA 4BJ3A 5JZ9A 3KKEA 2OGTA 4FFBA 5JASA 2ASEA 1IJEA 1OA1A 3UJ6A 1XV5A 3EDYA 4H6VA 1WSAA 1VRVA 4MWCA 4N6NA 3H2HA 3QU7A 4RIGA 2Q5IA 1P72A 2FQWA 4KLAA 3VO9A 4TSKA 2ID8A 2WJ4A 3IMGA 2W6PA 3T1OA 5A5EA 1P2DA 5LXTA 3QBDA 1KYQA 4G0NA 1A9ZA 3JWGA 5CPFA 3T7DA 2C9OA 2YC2C 3TMAA 3KOWA 2FSGA 1I6KA 3C6QA 1QNFA 1VI6A 4U6SA 1UBEA 2BEUA 3M2PA 1SQ0A 4MKHA 2ZRGA 1Z6AA 2J5BA 4PQYA 2EP5A 1JQEA 2VJAA 3KAPA 4BO5A 3U56A 4D8WA 4J0FA 5KDOA 1R4AA 4JYCA 3BEOA 3B6KA 5FWDA 5A3JA 1Y3DE 2O2CA 2WYWA 5EE5B 3WNQA 1AUQA 4QUDA 2ZQZA 4A1FA 4L2IB 4UAUA 1NQXA 2I0FA 3QNWA 1G41A 1KDOA 4ZU6X 2PT6A 4L3WA 1WU8A 2B2XA 4BNMA 1UMBA 3SKVA 2DF8A 4O2BB 5I7RA 2N0SA 2OB2A 3UJ8A 2CXRA 4B5LA 3QVGB 5REQA 4BMVA 5DHAA 4RJ2A 2R86A 2FSVC 3FBTA 4C4OA 4F7DA 3SVLA 1T8UA 4AY5A 2E89A 4CUJA 5FBVB 2D2XA 5JYDA 4G24A 1K7CA 5B6IA 2GDZA 1I4DD 1KKUA 3H65A 2BDTA 2GAAA 4D9EA 2LIPA 1F0YA 1RYHA 2VPQA 1L4UA 4MJ3A 3HYNA 2GPAA 3FI0A 4PSUA 5HFJA 4XQEA 4LRXA 1Z7EA 3A6ZA 3A04A 3OJLA 4M38A 3ZVRA 4FD3A 4K8RB 3DTNA 4NCJA 2G9UA 3V00A 4ER3A 5DTQA 3O21A 3Q2OA 4BFWA 5CU7A 2AMVA 2UYOA 2G06A 4DLRA 4X95A 3UKDA 1RWNA 3L0IB 4PGHA 4NSNA 5JNVA 1NNI1 3EWIA 4U3JA 1NXPA 1U2DC 2HWUA 3PHCA 3NT2A 4PHTA 3ZE7A 1Q7EA 4EVQA 4JLBA 1P9WA 2AL7A 3AI2A 3GPCA 1QORA 1DC7A 5BV1A 4EJSB 1RXUA 3FDFA 4IIDA 4MMYB 5T8KC 3OZ7A 2ET6A 4L50A 1WD7A 4QEKA 2FJ0A 4LYYA 1ID1A 1E8DA 3FYUC 4H59A 3ETGA 1MB0A 2ODBA 1I4OA 4XWOA 4NBLA 2Q3DA 4F45A 3MGGA 2OGWA 1JEDA 4ZXPA 1NN1A 3LUAA 2H16A 3RVOA 3TQFA 1WB9A 1FDVA 5G41A 1NHGA 3NXKA 1O6ZA 1T2FA 3ELYA 4OYLA 4GBGA 3UGQA 3JAMA 1UFRA 5K2OA 4RVOA 2HQRA 3AEKA 2A58A 5D5HA 3SJUA 1P74A 1QVAA 3CRRA 5A0FA 1QFJA 1UEIA 1KORA 2PQ2A 3ND9A 3T41A 1NVBA 4ND4A 1XKTA 1N0UA 2PNFA 3OG9A 4KO2S 4LE2A 2NAPA 3KQPA 4NENA 1XXHB 3SZ3A 2XCRB 2OCAA 2PLNA 2GBFA 3BWYA 3RG8A 5JNWA 4N0MA 1B16A 3L7MA 2PQ6A 1U0GA 1QC5A 1QJCA 1F2TB 1X7WB 2DTDA 1UM9A 4QRHA 2NUTA 3M49A 2XVAA 4JUIA 4YBZA 4QL3A 3GPLA 3AHGA 3FPHA 1PJLA 3FTNA 2JGIA 1IXRC 4RWEA 3DD5A 4E94A 3LWDA 2F3TA 1IFXA 1OXVA 2PPVA 5A4FS 1T8PA 2ZI3A 1D2CA 2QM7A 2WB4A 2I4IA 3MWDB 4JEIA 3W1EA 3EXHA 4LSMA 4GC5A 1C50A 1Y7HA 5DNCA 3I30X 4KREA 3JQFA 2COEA 4DQVA 5LPNA 5HIJA 5E2IA 4OP2A 3ZI0A 2G5TA 1A4XA 1KFBB 2H3EA 3FTCA 2HI0A 4NYIQ 2FEMA 4ZU1X 2DCMA 3VDNB 3ZR4B 5HM6A 4BZWA 1OSNA 1KMCA 2P0YA 4I4TA 3FZNA 3U26A 2BBWA 2ZJYA 1TA0A 2QGZA 1D8TA 4INAA 4DVJA 4JV5B 1Q44A 1Y3HA 1BRMA 4RA9A 5KQLA 4PX2A 1DIGA 3P32A 4RSHA 2YC4C 1E6WA 1IY9A 1NW9B 2Q5HA 3THRA 1RBQA 2R8OA 1JUDA 5E7IA 1N2CB 2MSNA 1J0BA 2HCTA 2CD9A 2QQGA 5FX2A 4JLNA 2DQSA 3ER9A 2ERCA 4UJ5A 2XVMA 5JS6A 1RWKA 1IWOA 1GXSB 4IIBA 3B52X 4L4SA 3ZLTA 1KR2A 2RAUA 3WV5A 4FQ5A 4CMEA 2QP3A 1GPNA 2XB9A 3UAOA 1VIYA 4GI1A 2Z9CA 2ZSAA 3GH1A 4BECA 1V3TA 3HZRA 4PRKA 3UKJA 3IAM6 3COYA 1VPEA 4S2EA 1X7HA 4DB2A 3MT0A 4HWKA 5D3MB 1T5OA 2UV8A 1H2XA 2NP6A 3A6DA 2HXSA 4G65A 2FWJA 3R77A 1PK7A 7REQB 1JT9A 2IODA 2Q3MA 1UPBA 3AUKA 3GG2A 3MLEA 1NVVQ 3K16A 4N54A 4F72A 6Q21A 1XU9A 2DRIA 3FUWA 4JOSA 3B3GA 3ANLA 3CWQA 3GGJA 1DKQA 1MAHA 1QFXA 3OU6A 3FTDA 4R1UA 2JFGA 2RK3A 3EG9B 4OHMA 5DEOA 1V47A 2F2TA 5ALSA 2P4QA 3DZ8A 2AI1A 3T5MA 1NY6A 1H3FA 1XRJA 1RQGA 1NW4A 4OIFA 1AKQA 1JHPA 4S3MA 4BLPA 3LFUA 4BP8A 1XCMA 3UPUA 3ES9A 1AH2A 4CG1A 1Y1LA 3SF0A 2CB9A 4MVJF 2NX2A 1QOQB 4E4TA 5CCDA 1B23P 4K5QA 3O73A 1E5DA 4WJLA 3MJTA 1P4SA 4MA4A 3LX4A 2QQ0A 4TRRA 3QYJA 1GD1O 1YQWA 3G02A 3RD5A 3J81k 4TN1A 3HV2A 3QTTA 4GXRA 4HLCA 4EHHA 4ZIRB 1PZXA 2CC2A 3ZLBA 4IMPA 3QENA 1EK1A 4QYSA 1HZJA 4KDEA 3MRTA 4FE4A 2QBYB 1TO2E 1MKYA 1O7JA 2NV6A 3G8CA 1BNCA 4QTZA 1C8BA 1WKBA 3L05A 4QJBA 1QOPB 3AVOA 4IVNA 3K9FC 3E35A 3D7NA 5FBZA 1GGEA 3GPBA 4KBFA 1K0FA 4KI7A 4ZARA 4RXTA 3QSYA 5EJ9A 1Y1SA 3VHLB 1ECGA 2GFQA 1QNLA 5EPOA 5IYZB 1VPWA 1SIBE 2VK8A 3CX4A 3EXHB 3IDSA 3KJZA 4BMZA 1CNFA 4C4RA 3ON5A 1RP7A 2EBFX 3MWGA 3PHJA 1LDEA 1SXJB 4JP2A 4D2IA 5F52A 2PSEA 4KX5A 5K0NA 1PJ8A 4IDHA 5D3KA 4EFDA 1UT6A 2RE8A 2NW6A 5IK2A 3SF8A 3L8EA 3WYCA 3RAGA 2LKDA 2OCKA 4FKMA 3UOWA 1P7VA 3IQDB 4GZ6A 4JD5A 5BWMA 4NL4H 4INOA 3BJRA 3QI2A 4GXQA 3T12A 4J9UE 2NQ2C 2GD6A 1KNQA 1BHQ1 3DAOA 3NHKA 3HSSA 2ES4A 4DHEA 4YO8A 1I7NA 1GNLA 2A92A 3HWRA 5JXJA 3WNBA 2UUPA 2GM5A 3IH5A 3ZCRA 4PYRA 2FFAA 4K3UA 4TXHA 3K70B 1N6RA 3KFXA 1Y9DA 2P3SA 5ALMA 3N3AC 3BJIC 1LEHA 4JLWA 4GT1A 4COOA 4ZYZA 5JH7F 2Y67A 4DYDA 4YJFA 2QTNA 1VA5A 2TYSB 2WFMA 1X39A 4BNTA 4JZKA 5M2QA 1HNZB 3W4IA 1CB0A 5T7BA 1XEXA 5EIOA 3SZRA 5KNBH 3ROFA 3UWMA 4DAOA 4QM7A 2WQ6A 4QM6A 2Z1NA 2RGYA 4GU5A 3GP8A 1G8PA 5K4GA 1JX6A 2X13A 5ALHA 5G0WA 5BOSA 2QXTA 1QBGA 2AG6A 3GRFA 4PIPA 4M9QA 1ZNZA 3H2JA 5DHTA 2NU8A 2XIJA 1PNVA 1W73A 2ZIWB 3AR7A 4L0DA 4B32A 1UJNA 2UZ4A 1N34B 2CDRA 3I64A 1K63A 2QTVB 1ZVVA 1JXAA 3W5CA 2FQXA 2Q49A 2X0JA 5IAEA 1FSGA 4YJ2A 3R2JA 1HG0A 1OROA 3COWA 2XLBA 3AHHA 3L6EA 4ZJPA 3HCFA 4NDAA 1L5NA 3FM9A 3L1KA 2O06A 4H1HA 4QTTB 3T7CA 4IVPA 4EY6A 4YC7A 3TIFA 1XCLA 2J32A 1KJYA 2B30A 8GPBA 4LF9B 5D2CA 3ZHTA 1SKMA 2Z8XA 1VKHA 2IF0A 3W3AA 1CHDA 1T5LA 3QWFA 2OBMA 4M7OA 1G2IA 1DIOB 1TJPB 3LF1A 2CXOA 1O9GA 2QKYA 3T9AA 2KS6A 4LF8B 1P1KA 1JSCA 3LP8A 3OZXA 1YOVB 3FLBA 5CLLA 4US0R 4LF5B 1QG2A 1YIOA 1E66A 5IDVA 4COKA 2DEUA 3WGJA 1OF1A 4ZVTA 4QVIA 3U44B 2R3SA 3E8SA 3HEMA 2X4DA 4GRAA 5J59A 2ZETA 4IX9A 5BYKA 3RHSA 2DXIA 2UVDA 4DABA 3HY6A 2BFDA 1CRLA 2ZS9A 3NAGA 1LPNA 1ORDA 1JDNA 3W4KA 1PFVA 1XO1A 4UM8B 4MOWA 4A8PA 5BNFA 4ZI7A 1Q0RA 5BSWA 4G1CA 2P65A 2WNHA 4CLOA 1THTA 4Q1EA 2CFCA 1Z25A 4QBGB 1USVA 5JZMA 3G2LA 1VYVA 1ZGBA 3R5SA 3S2GA 2Q28A 2QI9C 4C0JA 3HP7A 2NV0A 2G9NA 4X66B 4P35A 4MPJA 3WLNA 2CV1A 3E9MA 2R1ZA 4B17A 4EFMA 1M2JA 1U0EA 3UG7A 5BPFA 1ANKA 1M7BA 2ZIXB 2PS9A 3A37A 1GADO 3IQIX 4GYKA 4CPDA 3VR2D 5K0EA 5KTTA 1JSLA 4N7MA 1SVKA 4GSKA 1ZA1A 1V11B 2DPXA 4INJA 1SUBA 3DLHA 1Y4AE 1JVNA 2Q0HA 3C74A 2YWHA 4PG7A 1GSIA 1U0JA 2CMFA 2VDOB 2OBBA 3KCNA 3ZHUA 5M3BA 1TQDA 4ZMRA 3U4QB 1U63A 1QRUA 1QPGA 1Q21A 1DELA 2IITA 1L4LA 4L51A 4KR0A 4WKBA 1WY5A 4WZAA 4E2WA 4IIEA 3Q5GA 3EA4A 2EGHA 4X7BA 3UK1A 4KPGA 2WY2D 5KDDA 3NPMA 2RG1A 1W88A 3E15A 2ZIZA 3HDYA 5IZ4A 4ZAFA 4WBNB 5EESA 4OFXA 2WAAA 3GU3A 3DHNA 2QLFA 1S2LA 3ZWWA 1IHDA 4I46A 2WSYB 4MV5A 3DBHB 5H9VA 3R7FA 3E7WA 1JA0A 3ZI4A 4AKSA 1KK0A 4ZPJA 2EDCA 5CJ2A 4MW6A 4BWGA 4NICA 1EB8A 4KMOA 5ESXA 3QIAA 4DSNA 2UZ1B 4UVHA 4EABA 1VLMA 5AUOB 3ZD8A 3FUCA 4FS3A 1WZNA 4L6CA 5K6TA 1I1NA 5CA1F 2BEJA 1RLMA 2HSEA 1JFVA 2YHSA 3IVXA 5TMBA 2OM6A 3N6RA 3BMNB 2IW3A 1L5VA 1P5HA 1W94A 1E7SA 2VSQA 4OYRA 1ZM4A 3AW9A 3TOVA 3UH1A 1W75A 3E8XA 2FSHA 1JZQA 2P8JA 4RZIA 2HA4A 1KFKB 2D54A 2PM8A 3B89A 4OGKA 3HPQA 4LSGA 3UJNA 3UK7A 1D7OA 1W29A 5B3JA 3UK0A 3IKTA 1XQYA 4C87A 4GNKA 5AHOA 4E15A 3O3CA 3EG5A 3O83A 5FTWA 2AEEA 3HYRA 1DG9A 2QY6A 3WLEA 3SU8A 4AN0A 3DC2A 3W0LB 1Z88A 1YT5A 1RVV1 1TKBA 4QO7A 1O03A 3K8QA 1TA9A 3NRJA 5JBNA 2QK4A 3PQ6A 3IQEA 1G9SA 1FS4A 2WHXA 3QVTA 5LQCA 4XIJA 1Y6QA 4PC6A 2VPWA 4FYYA 4CR7A 5KREA 2VTBA 4Y67A 3VMMA 5T4HA 1HK7A 1ZO8A 1RMYA 1XXHE 2DY0A 3OURA 4IXDA 5CJPA 3NV9A 4JI4B 1YZNA 2IS1A 2O3JA 5GINE 3R4CA 4Q05A 4UVIA 1DO0A 2BZ1A 1XNRB 1YJ5A 1KFEB 2B3TA 3UMFA 2VPXA 2ID7A 2WD9A 3TRFA 2NU8B 5LKAA 3RW9A 1P0QA 421PA 5F2NA 1EVLA 4Z7NB 2OBXA 2Z56A 4DPLA 3E9YA 4OHUA 3DUFA 5KI6A 4QBIA 1TTTA 3WL4A 1HH4A 3KKKA 4C0SA 2R6JA 3OIDA 4YT5A 2AN4A 1ZQ9A 3ZGOA 4N48A 2D5LA 2ATIA 4EMSA 5JRZA 2IS2A 5EVCA 4WBNF 5TPWB 5T64A 1Y82A 3IALA 1JHAA 5DYNA 5H81A 1ZR2A 3LBNA 5ERGB 4XCXA 1NVFA 3K4PA 1JLSA 1T3LA 1PNQA 1H2YA 3DOJA 4QUHA 4LC1A 1RBZA 1XPJA 2BBTA 3HDHA 2ZSUA 1KS9A 1ST3A 4UOEA 1GSOA 3CW8X 4Q3DA 1TQ6A 3L92A 3SBEA 1QDLB 2ECKA 4QT4A 1O95A 4B34A 1DEAA 2VDRB 1A7JA 2P4SA 1E3SA 4Y2JA 5KJ6A 4TWAA 2YXBA 4Q0MA 1C7RA 4HYQA 3JWPA 3KS9A 4IXTA 3PCXA 4FZ3A 3FOZA 4KH1A 3V4PB 2P0AA 2HRCA 3R0VA 4F92B 5JVDA 1X9GA 4UM5A 1B14A 2VDPB 4V3CA 5BUSA 1YRAA 2FW7A 3BMQB 3NTQA 4TROA 4EO4A 5HUJA 4DR7B 4WCFA 4DCPA 2CBGA 3KYJB 3P2MA 1NQAO 2CHFA 2WJHA 1ISJA 2YWGA 3IX7A 3K9WA 4TMXA 3W5SA 1C3OB 3WGLA 4UTVA 3IUEA 4B0OA 3QWBA 1L5HA 1ULZA 1M54A 2IOFA 3FTQA 4X8MA 1A98A 1F9EA 4RELA 1GPWB 3FCUB 4YQYA 3RJTA 1X1AA 2WU1A 2E6KA 1UOOA 3L43A 3VV2A 1GTRA 4KMRA 4D42A 2CLHB 1ZGCA 3RUCA 1XZKA 2HJSA 3CYFA 2V5VA 2VL7A 2ZT7A 3GL9A 2D2EA 3OFSA 4ZO9A 3U3OA 4DG8A 1HLFA 1V8FA 5IKMA 3SC2B 1UWVA 3EVDA 1RYYA 4U7GA 2DKFA 3B20A 1T1EA 3JQ8A 5DNYB 1L9KA 4K9SA 4P4SA 1W0CA 2HIGA 2QS9A 2Q5FA 3PL1A 2ZWVA 1AV6A 5E1DA 1TW3A 4E5NA 1L8LA 2H8GA 3B6ZA 4Q7JB 5FPPA 4L27A 3RE1A 1F1JA 2CUZA 1GUZA 4BPRA 4BUZA 5ULLA 4MS3B 1X1SA 3P1JA 5H83A 1E1MA 4HLNA 4II7A 5DNUA 3GJRA 4BGIA 2AN9A 2I6QA 4WZZA 3QXCA 2IOHA 4EECA 1WXHA 5LLTA 2I87A 1KY5A 3I53A 1VSUA 1O8BA 4F4DA 5DMXA 3C4VA 5JJBA 3K9BA 1XWIA 2O0HA 2Q6LA 3AGPA 3W5IA 3WK4A 5KHLB 4DIUA 3WADA 3CQ9A 3LRTA 1T5IA 2OYCA 2ZBEA 4WDRA 5EMJA 1E2LA 4EG5A 3EASA 1CS4C 2NOAA 4JZYA 3U39A 1ORWA 2A0WA 3NALA 3THYA 2BMAA 3CUYA 5B1YA 1P3JA 1GN9A 2RGGA 4P93A 3KEFA 3JRXA 1C41A 2X3FA 1EFTA 4MVJH 3W06A 1BU8A 1DJLA 1SCAA 3B51X 3I01M 1JAHA 4M8IA 3W8NA 3NHWA 1XHFA 3PC4A 4RABA 1M1NB 2EU8A 2MOKA 5D7BA 2FN8A 3TSZA 3WGMA 1HTWA 2PRSA 4AP9A 2VQFB 3RAFC 4PLPA 5DLYA 1EHCA 1L5OA 4HWGA 1K6JA 4E5KA 4PHHA 3OZWA 4WHMA 3U4IA 3D1VA 1UT8A 4M60A 4UVEA 3H4TA 1NJ5A 2GQ0A 3PUHA 2C4HA 3Q3EA 3RVDA 1PUXA 1MD9A 2GKGA 4M99A 4CI9A 1BCSB 4PGMA 4BFUA 3U7FB 2J41A 3LBHA 1WF6A 4MB0A 1FFEA 4XGIA 2JLWA 4Z1MD 1ZMXA 4XH9B 3I9JA 5ELMA 2VH1A 4LX0A 4O4IF 3U3KA 4G89A 3KXKA 5C80A 2YS7A 4NFYA 4EZBA 5D1NA 5C8VA 1TDJA 4YJHA 5EOVA 5KINB 1BCRA 1E3WB 2DH5A 2O2XA 3H2IA 3IAS1 3PQ7A 4ZMSA 3E2MA 4MUXA 3N07A 3PYXA 3GLIB 3QHAA 1PGJA 1S1MA 2JH9A 3B53X 4DCOA 1E7YA 3D02A 2PCJA 4Q34A 3SXUA 5KYXA 3U0VA 4GZ5A 2Z3VA 3FB4A 5HF9A 3ZWKA 3WB0A 3OQOA 2PU5A 1D2GA 3UMRA 1ZP6A 2QB5A 1YCHA 3ETCA 2I7CA 4UXHA 1CERA 1G8AA 1UK7A 2DKOA 2FSFA 3QRWA 4MW0A 4Q3AA 5ITZB 3PB3A 4EGSA 3VKFA 2Z8YA 1AS0A 2YHAA 3DE5X 4JBIA 1I3CA 3VVCA 2W71A 4B71A 1Q20A 3OD5A 4ND3A 2V6FA 4DG9A 1U3DA 2YUIA 3NTLA 2VDMB 3H1AA 2BWJA 2V4UA 1OCEA 3NDJA 1ZCBA 3UZUA 3TNJA 1D2AA 1D7AA 2BKEA 1K3TA 1JHMA 2FE4A 1PAUA 5JS8A 2P2SA 3ZU3A 1YZ3A 4F3KA 1A7AA 3C5EA 4HUQB 2JJ2A 3IUNA 2HLPA 3JVDA 1INLA 3KUCA 2WFLA 4JSYA 4NV1A 5F23A 2QG9A 3U44A 3HM2A 3R6WA 5CVVA 3LLUA 3ZJUA 4KW7A 3HCCA 3RYTC 4EBBA 1DAKA 1OLOA 1ZK1A 3U7IA 3HVRA 2OCBA 1KI3A 1EM6A 1H1TA 1UEXC 1HDXA 4WLUA 1JWBB 3T5DA 4AG5A 1BXZA 2NZWA 1U8TA 2OHJA 3PIIA 3E3NA 3Q7QA 3COVA 1YACA 5DN9A 4KQ1A 4MV9A 3U49A 2O19A 3GT0A 3R3VA 4LE1A 2X4LA 1KDYA 2Q8QA 1HE1C 1N92A 1IWBB 1PT9A 4ONEA 4UHBA 4B6QA 1FNBA 1N1DA 2M6SA 4ZYYA 2VDJA 3DFFA 3QJ5A 3P7MA 4YJHB 2BGGA 2PWYA 2FN4A 3C3CA 5KYVA 3FZQA 1MENA 2Y1CA 4FTWA 3LCMA 4EFNA 2C78A 1RYDA 2YW2A 4HMOA 1YZFA 3UANA 3T3MB 3WICA 1HORA 2WT8A 3LECA 1UAYA 4LA4A 5FNZA 3IR5A 1GA4A 1U8YA 2R96A 2M6LA 4NAVA 4UCXA 1CQJB 3BE6A 1Y8QB 1CULC 3FFBA 1N6PA 2KI5A 4CM9A 2DMRA 2W2KB 2ZOSA 3MJFA 1GHTA 2EQAA 3RAJA 3SMQA 1AB6A 1P18A 2Z2XA 2RK6A 2IOFK 3P27A 1BJKA 2HNAA 3BHMA 2ODNA 1NN0A 1E2FA 2QLJA 2JJ1D 2P5TB 3G3EA 4Q00A 3AY6A 3JYOA 3BMOA 1ICEA 4ZTUB 5LBUA 2YRFA 5K20A 3NORA 3V3KA 4YRKA 3QJYA 1E92A 1Y6JA 1DKPA 2F1OA 1U2RA 4LY9A 1FSZA 1U7TA 1E89A 1W4RA 2C84A 3IIEA 3KXPA 4PZYA 4LQCA 3AKEA 2ZSBA 2LCQA 4H31A 3THYB 1BHSA 4DLSA 1O95C 2C8LA 4XGKA 4YUYA 4EL5A 5JS1A 2WD8A 3IESA 1KI2A 2XOXA 3IKJA 1EDDA 4F6LA 3I09A 1VRCA 1R0WA 3DULA 5IH3A 1FSPA 1R6DA 4HTFA 5EJ6A 1FUKA 2H48A 1XRPA 1K7SN 1WW3A 1T2DA 3IFSA 4I1VA 3TBFA 4OX9B 1UZLA 5D5QA 2YJ5A 4NYIR 1A2OA 1AXRA 1P29A 3SIWA 5LA6B 5BSUA 4BQQA 4DREA 3CMMA 4IWYA 1T5BA 2EP7A 2CKDA 4M2LA 2ZUUA 1E96A 4J0HA 5LYJB 4M87A 4CTKA 2PFKA 1KYVA 4JVMA 4X9XA 4K0KB 2Z2YA 3E9RA 2GYUA 3QXJA 1X92A 3EAFA 3GFSA 4E5PA 4HTAA 4X6YA 5AJWA 3W5AA 1KAOA 3BB4A 4E3ZA 1ZICA 2XZDA 1DPGA 4OHPA 3DONA 4P22A 1SCNE 3CFYA 1AKUA 5F3DA 4LNUB 1AQ6A 1I33A 2GEUA 3QVXA 4NJOA 4ZT2A 1MCZA 3PF8A 4Q4HB 4IRUB 1X42A 1A9OA 2X23A 3DDHA 1DDGA 3D0KA 4H1UA 1FE8A 4KVGA 4HAVA 4UBLA 5JV5A 1SKYE 3FFXA 1HPLA 3VAZA 2LRHA 1TMYA 2Q4EA 3KB8A 4KV9A 2LXNA 3OKAA 3WIVA 3FKSD 2MYNA 3ZCTA 1M3SA 1Q0PA 1YU9A 3A4YA 2IYPA 3IEUA 3BIXA 1PKEA 1YRHA 4KN6A 4MW1A 4OMDA 1YKGA 3D5QA 1U9JA 2KWIA 1D1TA 3LYLA 1I9CA 2GYVA 4KRYA 4DC9A 3AVUA 1PJCA 1WCXA 4P53A 2VN8A 4PC7A 3ZHQA 1VHQA 2JHCA 5GM2A 3MELA 2YV3A 4RPIA 1KF0A 2QM8A 4D3FA 4KGZA 1AJEA 3QF4B 1PTKA 1PFQA 3HKDB 4A91A 4YXFA 1QGOA 1IQ0A 4J1QA 2A67A 4NFLA 5T41A 3UAZA 2J3MA 3OMWA 1W36B 2B4YA 1PJBA 4NENB 1A1VA 1VJ5A 2QRLA 4QA9A 4RVUA 4Q01A 4UASA 4LJ5A 3BBPA 1MU0A 2CXQA 1A8PA 3B82A 1FFBA 1Y7LA 3RU9A 1SBCA 3T4EA 1RLJA 1LKZA 1MOPA 2CNWA 3NFYA 3RS3A 5EJ8A 4J7CA 4RIIA 1HNNA 2QTLA 3DE0X 4IF6A 3NDBB 2F3PA 4TSFD 3WYBA 5FUBA 3BXFA 4DLWA 1PFUA 1WABA 2YBDA 3Q9UA 4JX9A 2FN7A 3UCXA 1GNSA 3I6QA 1FU4A 1SC9A 4IIXA 4IJWA 5ITZA 3TX6A 4LZOA 5E9WA 3GDFA 1VG0B 3WI7A 1CY6A 1TU4A 4KFTA 4CXMA 4BUJA 4MDEA 5K3CA 2QRKA 1MOZA 2NT3A 3T7SA 3YASA 2YOHA 1RRMA 1Q1BA 2I7DA 3KV1A 1MC1A 2N3ZA 2VP3A 2PL5A 1JYEA 2XB4A 4TYPA 2N47A 4L9AA 1ZIDA 3ZS9A 2G36A 2PUBA 3OFNA 2H4XA 1Z73A 4GGOA 3DWFA 4Y1GA 1AMOA 1FUEA 1PFKA 1MB4A 5BRNA 1WXGA 1H3EA 4P54A 4I1PA 2YVAA 4LDRA 4XWAA 1T5TA 3D2BA 5D8DA 3V42A 4U3JB 2X8LA 3LIPA 3PPVA 4ZD6A 2J7PA 4AJ9A 4KDFA 3EMVA 3A70A 4N8SA 1KTIA 5GZ6A 2VF2A 3IV9A 4IKPA 1J7KA 1A5ZA 1DNPA 1M1YB 2V55B 2PMBA 5F4ZA 5CEJA 5L4LA 1EBBA 4IGFA 5JPCA 1MB3A 2G71A 1FEZA 1R0BA 1A9QA 2V0CA 3AL2A 3HG7A 3QM1A 5DZSA 4F2PA 4QXRA 3UA3A 2VEDA 4HBZA 4ARIA 5H82A 4GLLA 3WHIA 4B3XA 2RAPA 4BLOA 3DZHA 4OXYA 5TE9A 3H1GA 1B1AA 1ZUD1 1PNRA 2CJFA 3TJRA 2ZTVA 1UPTA 4BVGA 4ZVQA 4UHCA 2ZS8A 2ID4A 1H6DA 4MUEA 1U7DA 3GFBA 3AIMA 2ZI6A 2A2ZA 1PFYA 3EE6A 3IQHX 1CF4A 7MHTA 1YS9A 3AUYA 1SCDA 1SURA 2JHAA 1Z0ZA 2E1RA 1L7OA 3JQ9A 1SGWA 3A6FA 3LRPA 3QTBA 3DPIA 3FGOA 4HK4A 5AK0A 4DMGA 1EM8A 5ALUA 5SZHB 1V95A 2IKQA 4P9NA 1SXGA 2YKGA 1DWPA 4YR7A 3ORQA 2QLBA 5E6SB 2JGDB 4Z86A 2NO1A 1LGYA 1TM4E 1E32A 3PQDA 1Q2XA 4Q9IA 4FFPA 3O91A 1KAEA 3U4AA 2AFIB 2W2MA 4WIAA 2ZJ5A 4V39A 3V80A 1RZRD 2GO1A 3EPPA 4X8LA 5UKDA 4LTMA 3WFJA 4OUDB 5I4CA 4US2R 4P4TA 2FSSA 1F4LA 1LBIA 1GA1A 2QENA 3VKVA 5JLJA 1IQUA 3V7WA 1SUPA 4CT4B 3BWDD 5JAPA 1OV6A 1U2GC 4RLSA 1RAHA 3MOSA 1DRKA 4C6TA 1MXFA 1RADA 2DUWA 2X5OA 3RFXA 3U6KA 1UPXA 1C3LA 4ZTBA 3QU9A 1PR0A 5HKOA 2J48A 5LCXA 3RV4A 1XTZA 1VCNA 4JB3A 3L1IA 3KTFA 1M5UA 3X1XA 3TBKA 4NDZA 1DBIA 2JAHA 4Q9JA 1C3JA 2CVOA 1MEOA 1QIIA 2YIMA 4PBRA 4OIMA 4XFDA 3ZBTA 3C3PA 5TJ9A 3X43A 3ZH9B 5IKOA 1F0PA 2BM0A 1IH8A 2GFHA 3GJXC 3H6HA 3A0RB 3V3TA 3L1JA 4MA0A 2XODA 4LYGA 3LKVA 1DC3A 1PUIA 1GQRA 1CZRA 2K4MA 3PNMA 4LTNA 5D5PA 2K7FA 4EW1A 4R2XA 5I7HA 1M2HA 2ID9A 3L49A 3GJSA 1X3LA 4NZNA 1YXMA 3D8HA 4HH3C 4M89A 4RSGA 4UAJA 2DFVA 3GGGA 5J2UA 3M6FA 3L7YA 3H05A 4KDCA 1R6BX 2RGNA 2A5YB 2J0VA 4QQKA 3H5WA 1D1SA 3MTJA 1NQ5A 2AWOA 2P9JA 2FAXA 3CY6A 1QV6A 3DMTA 4TL6A 1MO3A 4TQUS 3RRJA 4A2WA 1M10A 4FFDA 2MINB 4MR7B 3PRJA 4L5BA 3ZCPA 2R2GA 4ACBA 3KQTA 4A0RA 1E2GA 4EELA 2EVWX 5DISB 1SKBA 1D6SA 3CUWA 1Y5NA 5HFAA 1NVDA 1Y37A 1L7RA 1UAGA 2XVZA 4UHHA 2VDNB 4WNCA 2AOUB 4S1NA 1QGAA 2IWHA 5A02A 1FW8A 4LZNA 4R7TA 2D5BA 2PIDA 4E12A 1OB2A 3N39C 5DF1A 1P81A 3GLUA 1Z5OA 1F6DA 3NT5A 4CODB 1E9RA 3NNNA 4ENRA 3QOWA 4RZ3A 4FGZA 3NGMA 4WKCA 5AK3A 4D1YA 1K66A 1L9XA 4PSAA 3ZEIA 2FFBA 3A1SA 3VSCA 2FUKA 3FF4A 2PBFA 4CKYA 1AG9A 3WDMA 5LOVA 3UUEA 2CL0X 3SYRA 4LRYA 2AKAB 2REOA 3CR3C 2WKPA 2RHOA 4GP6A 4KQJA 4A0HA 4BO0A 2O7SA 4KAAA 4CI0B 3Q6IA 4LBVA 4YCSA 2Y77A 3ZWQA 5K8TA 3IHWA 3QEJA 2QQEA 4BMSA 5GJBA 1MJHA 2UVPA 4Y30A 3ETEA 3TVDA 3VYSB 3KT3A 3QYPA 4OBWA 1T3ZA 4R68A 621PA 1DWOA 2VQSA 2ZREA 4IHJA 3WLTA 2FZVA 2C9CA 4GWLA 4N3GA 4W6ZA 5AD1A 5CDFE 1Q3HA 1NJ6A 2ZR9A 1HYEA 3AXTA 2P9HA 2VF5X 4YASA 4D3SA 5KTRA 1YBFA 5A5FA 3K8OE 4M0DA 1D2NA 3A9CA 2Q7DA 3G6KA 3COPA 3L0DA 5IANA 2QROA 3WB2A 4FYKA 3I5YA 3SZUA 5K8UA 3A32A 2JGDA 4CQJA 4ZYVA 3A10A 5DK6A 3WMXA 1CYEA 5IT4A 1DT3A 2B4QA 5CGQB 2IE0A 5SV2A 5FDFA 2WHQA 5E2BA 3GH3A 2J5RA 4PYQA 1QAQA 3F78A 3AV0B 4HR7A 4ZALA 4DM7A 4BEWA 2CCGA 4HEJA 5JWRA 2GN4A 2P1DA 2OWEA 3R4VA 4PZ0A 4YP1A 5E1OA 2VSXA 3KKMA 4DRYA 5L4SA 1N5RA 4X45A 1MEEA 4TVSA 1E1KA 3RR2A 2QPAA 5GZ3A 4RVDA 3CVXA 4JI2B 2C7QA 1DMSA 1EBFA 5DIFA 1M6EX 5EHZA 4ZAZA 2A1TS 3OTIA 5A0VA 1R8JA 1W2WB 4CM8A 1MO2A 1XEWY 4X00A 5DHSA 2OG1A 2FKNA