3ZY2A

Crystal structure of pofut1 in complex with gdp (high resolution dataset)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
356
structure length
342
Chain Sequence
ATDPNGYIVFCPCMGRFGNQVDQFLGVLAFAKALDRTLVLPNFIEFKHPETKMIPFEFLFQVGTVAKYTRVVTMQEFTKKIMPTVWPPEKRKAFCWTPRQEPGCHSKEGNPFGPYWDQIDVSFVGDEYFGDIPGGFDLKWLEKFPSEEYPVLAFSSAPAPFPSKGKVWSIQKYLRWSSRITEQAKKFISANLAKPFVAVHLRNDADWVRVCEHIDTTTNRPLFASEQCLGEGHHLGTLTKEICSPSKQQILEQIVEKVGSIGAKSVFVASDKDHMIDEINEALKPYEIEAHRQEPDDMYTSLAIMGRADLFVGNCVSTFSHIVKRERDHAGQSPRPSAFFGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 1
publication title Structural Insights Into the Mechanism of Protein O-Fucosylation.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
total genus 114
structure length 342
sequence length 356
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zy2A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zy2A02
3ZY6A 3SIXA 4AP6A 3ZY3A 2DE0X 3ZY4A 3ZY2A 2HHCA 3ZY5A 3SIWA 4AP5A 2HLHA 2OCXA
chains in the Genus database with same CATH superfamily
2WWVD 1JNYA 1K7EB 1DDGA 1EK0A 4MV4A 5KCZA 4NXNB 5K01A 1YQTA 3TGPA 1SIWA 1TYBE 3ECSA 1RFGE 3FBGA 3IALA 3KOOA 1RWPA 2NV0A 4MEBA 4O59O 3ZLVA 3EA5A 2EX0A 1XZMA 2G5TA 3FZYA 4FI3C 2E2WA 1YR1A 1A9ZA 1KO8A 3WNQA 2YY6A 2NPOA 4EW3A 4HLUA 3AETA 4MVWA 3ZCVA 2BHTA 1GG8A 3NDBB 4EGQA 1WMFA 4MQEB 3FYTA 1L4GA 4TN1A 2ZZNA 3RIXA 3A06A 1M2OB 4LC9A 3UXMA 3UOGA 1E2EA 5CLFA 3NBXX 3D1LA 4PYMA 3C1AA 5AUQA 5EHXA 4C08A 1L5QA 3T5BA 3KVOA 1F3LA 4L8VA 1Y8RB 1FRVA 5KTPA 3NOVA 1EE2A 2ISQA 4JYBA 4DA9A 2B7BA 2DT5A 3GNQA 4YACA 2FPPA 2PRYA 3C48A 3E23A 4YIKA 3N2ZB 3DPIA 3AR8A 5CX4A 1SKBA 3M6UA 4E33A 2BBTA 1SBZA 4DA7A 3UGTA 4HGOA 4CV3A 4EX6A 4V0SA 3WHPA 4DA8A 4TLAA 2PQ2A 3D7LA 5EZ5A 3LH5A 4MQFA 1L7BA 4PSKA 3FJOA 4WKBA 1OLOA 5IBQA 3WYGA 3E7WA 3THWB 1V3QE 3FM9A 3KYJB 4HK4A 2UXBB 4JLNA 3IUJA 4C03A 5DVZA 3ZJ5A 3NHPA 4TWAA 3QMMA 3MGKA 1GQQA 1W96A 4PFSA 3TUIC 5BWOA 3VNVA 1NY5A 1ODLA 3EGEA 1EK2A 3HO8A 5DHTA 4IGEA 1I33A 1QYRA 1EVKA 2GD6A 2RBKA 3FNHA 4GM1A 2P27A 2XUIA 3N7TA 3SBDA 4KITB 5HX7A 5JAHA 3B3AA 1DRKA 2C7QA 3N2NA 1YS2X 2NV2B 2QUZA 3FNBA 3HZHA 3PVSA 4HH0A 3PRHA 4CMKA 3F1LA 2X58A 3O3CA 3VDQA 4S1WA 5JDCC 1QWOA 4WUVA 4CF3A 1Y3DE 5CT9A 5E4TA 4LPKA 3EDMA 1ENZA 1YL7A 3Q8KA 1QQ5A 1NBEA 3AVPA 2L17A 3RFCA 4A7PA 1P0CA 3DE0X 2NYRA 2Q3JA 4FFBA 5EIBC 3OKFA 3WYFA 3T4PA 4W5HA 4E5PA 3CUYA 2J6IA 1KO4A 2HLPA 4OJMX 2PMFA 4CLDA 4Q3AA 1UZMA 4J0DA 1O8BA 2PSSA 4RPCA 1R7RA 4ZEXA 3VU0A 3K1AA 3UAOA 2AN3A 3W0LB 3PNPA 4OAOA 3CF2A 1MF7A 2H1LA 5JHGB 2MT9A 2LCQA 5DKFA 2F3RA 4AN0A 1Z08A 3DEKA 2FX3A 4OIFA 1XQ6A 5TARA 3I37X 3DBOB 4MR7B 1QMPA 4D02A 3IQZA 3NHZA 2DECA 2B8EA 4DLUA 2ZUTA 4EKYA 3QPAA 1RVDA 4CQLB 1E18A 2NUAB 2C5FA 1TFRA 2DF8A 1XZHA 3GVHA 2OCDA 4IXMA 2JIRA 4Q37A 3KVYA 3W04A 4DLKA 1A9TA 3COVA 4IR7A 5J2UF 1SEVA 3GEHA 4HN2A 4OXQA 1R1DA 2F8LA 4JT9A 4BLQA 5C4MA 4KO8A 1PQPA 2VKQA 3P9IA 3RC8A 2WTXA 3OFSA 1K66A 1HG0A 1JVSA 3I0MA 3VR1A 4JJFA 4P0QB 2WSMA 4JDPA 4ZJYA 1ZMOA 2VSYA 1KQNA 2J09A 1ZBQA 621PA 1D3AA 1U9ZA 2FDRA 3IQHX 3SN6A 3EGDB 4QOIA 4AZ3B 3OT1A 4I4NA 1P1HA 2NAPA 3BQ9A 5GONF 1R6VA 5KAMA 5IJXA 3CUUA 1UBOS 3I04M 2NUTA 2JCSA 2IUUA 1CT9A 1SU7A 2AFHA 2DPYA 3ESXA 4PZPA 1P2GA 4PTLA 1M2VA 5GOZA 2C82A 3RUCA 1OZFA 4RIIA 4BLUA 4DUGD 3QVMA 1KH3A 4PIMA 1N57A 4GVXA 4DMRA 4QFBA 1DDIA 1WPXA 1Y5LA 4B7AA 4NYIR 4K6KA 2F67A 4KHZA 1TRHA 1J9ZA 2QTCA 2Y0DA 3WBFA 2LIVA 4E4TA 3CSSA 1ZC4A 3L1JA 4G24A 4EY6A 4F11A 3S8EA 4RTJA 1XWWA 1B0ZA 5DNYB 1B73A 2PKCA 4NYIQ 5IJ9B 1D2CA 5CDUA 3KPWA 3A26A 3MA0A 4MKHA 1SBTA 1WEKA 3CEPB 3NHMA 3KOUA 5FL7A 2YJNA 4Z4QA 4Q39A 3MGGA 3WISA 1TQ8A 3AG6A 3ELWA 1OYOA 1R4NA 5F7ZA 4CIYA 1L5HA 1U9YA 3UQZA 3NYIA 3B85A 2NVUB 3U81A 1FPQA 1R8JA 2EARA 4NPCA 5IUJC 4OGKA 3J7TA 3Q7QA 5ALMA 3QXSA 1AHHA 4JC8A 2UUAB 3DMGA 2YUTA 2OFXA 1E9AA 2DHEA 2PZGA 1Y1PA 6YASA 3LT4A 5JDCA 1WVIA 2DR0A 4GLFA 4M1ZA 4XFDA 3WDMA 4UFPA 3N28A 1KO1A 1RHMA 1XD9A 1ZPDA 2GPTA 3MOGA 1HORA 3S99A 2CB0A 3UMBA 1LXCA 4B7UA 2QW8A 1JKJA 3FSJX 2KPOA 3Q0EA 4WV3A 3IEKA 5H16A 2J1LA 1IQUA 1TAGA 2BFCB 1E79D 2CVPA 4K5QA 7YASA 3ZDDA 4ZI7F 3WSTA 3DEHA 4WADA 2F1RA 3I61A 2E1PA 3I64A 3FPHA 3O8OA 4K2AA 5EJGA 1UKYA 4NBNA 2B4KA 1D2MA 1UK6A 1V11A 4ZU3A 1J97A 1JR4A 1QIMA 3NNDA 3CYFA 3H19A 1RXYA 2XT0A 1SBCA 1A8SA 3LY5A 4MK4A 4P2GA 3RRXA 1O6GA 4E1VA 5B6IA 4JHLA 3U37A 4AM8A 4QDZA 4R7GA 4R71A 4JZKA 4G1CA 1UMCB 5DOVA 3GFBA 1HMYA 1LQUA 1U7TA 1E1RA 1GCUA 3MTDA 4HGRA 1LC3A 4FOPA 5ARBA 4HPXB 1EAYA 1JR3A 3LHKA 3LX4A 3R24A 2BEVA 1AQYA 1CQWA 2WNIA 4TQAA 3ANYB 3B12A 4WEOA 5GJVC 4C22A 4YRGA 4XFKA 1U2ZA 4KIGA 4TX1A 4ECAA 1OVMA 2WDZA 4TV8B 5LB2A 3WOHA 3PYXA 4X95A 4PX9A 5BV1A 1AZSC 4DB2A 4Q3LA 1A71A 4URYR 2D1QA 2PL5A 4QJ5A 3V8PA 3EQ6A 4HH1A 2RI1A 5F2OA 4TV9B 2A5FA 3E8XA 4DV4B 2I2BA 2PGNA 3E6AA 4OH1A 1R6AA 4NEQA 1Z4MA 3BWDD 3PE3A 5IXYA 1J5EB 3HB7A 2ZRQA 4XEUA 3AVYA 1N2CE 5D3ZA 2ZXFA 4DSTA 2NUPB 4OKIA 4FUQA 2DLCX 4IH9A 1M7HA 3UWKA 4Z8XA 4CG3A 1XVVA 2X4IA 2X5NA 4EQ6A 3VR4D 3ZEAA 1ZONA 3GZNB 5C2JB 5CLQA 4WK2B 4FUTA 3A9TA 3OTIA 4QU8A 1E5VA 3AINA 1NQWA 4F91B 4RD3A 4BVFA 4Z5XA 2O54A 4ZEWA 4UM7A 2C8JA 3EBOA 4PWZA 4IWYA 4B79A 4GPEA 4TSRA 3UXHA 3N59A 4JELA 4A8JC 2ARKA 4G4SP 3QIAA 4G56A 4XYMA 4X92A 2PAFA 2OAEA 5C32A 3KSBC 1F0YA 2VK1A 4M9SA 3RAJA 3NOXA 1DAKA 2GCGA 2C54A 1NVTA 2QN6A 3VJKA 2BOVA 1ST3A 1JV2B 1UM9A 1YA4A 2HO4A 4W63A 2PRIA 5KSYA 1IUOA 5DV9A 5NLLA 5AESA 2DB3A 3ESAA 4GXQA 2JD0A 3AX6A 3OFND 2R7AA 1MCZA 1RMQA 4D0SA 1RT9A 2VC2B 2V65A 2JVJA 1T0PA 3AUFA 3E70C 5HFNA 3R3SA 2F2TA 2CUZA 2ZRAA 4H7DA 1RYZA 2ZAOA 3D5EA 5AJHA 2IDZA 3OIWA 4CTOA 4W8HA 3LKDA 5FWXB 2HMYB 4RKEA 1JJFA 1QNLA 1SCQA 3V1UA 2D2XA 4I81A 4C1NA 3WL4A 1YB5A 3BAFA 2HMAA 3GJZA 4UTPA 1FDRA 4R1QA 1U65A 2HHJA 3AOEC 2E49A 4P08A 3T3PB 1G63A 1XEWY 4D98A 3RS7A 2O2JA 1EUYA 4P36A 4P3NA 4LJ5A 4REOA 3ND8A 2V58A 3OJXA 2PMEA 4GOLD 2C7RA 2HW8A 1N2HA 2BFFA 3OFKA 1BEZA 3AF0A 4TL9A 1ZO8A 2JW5A 4RNDB 5B3KA 3SQWA 2WU4A 1KBZA 1O2DA 1XD8A 5AVUA 1Q11A 1GSHA 1ACMA 6AT1A 4M7WA 3EEQA 3DVAA 3NRCA 4URVR 4WKOA 3ZX4A 1ZK1A 4OHPA 2QLFA 4P3PA 1CQZA 5J59A 5JS2A 2QAJA 5FT9A 3WMEA 3ZKAA 4WBNF 1T35A 2JBWA 3K53A 3OUZA 4KMMA 1N34B 3PR3A 2VDUE 2CXUA 2WAAA 3JVEA 5LU9A 1JEJA 2POCA 5HE8A 1QBGA 2QRNA 2HBQA 3AETB 1CUSA 4QDJA 4I9UA 4IDCA 3U6BA 4TLDA 1BEEA 4IIHA 4R4JA 3G0HA 1KEVA 1XE3A 2R11A 2FAXA 4IG9A 2JLXA 4DM4A 2KSQA 3JRXA 2YC2C 4U7WA 2AXEA 4LUCA 4O4IB 1KI2A 3KZKA 4C0KA 1PJ4A 2XOKD 4PZ0A 5EGNA 3ORQA 3T3MB 2W9XA 4OB8A 2OSBA 1I2AA 1P5HA 4LY0A 1ZD8A 4C6TA 3QV2A 1D04A 1YAHA 3MEQA 3RIMA 3FUCA 3KAJA 3LLUA 1NM5A 4RZXA 1VLVA 5JNWA 4BTLA 5K6RA 4R2KA 3IYLW 3PPVA 4R9VA 5JZMA 1RKXA 2FPPB 1V5EA 2WDPA 3CCFA 3QQ5A 1ESMA 3WHIA 2OHHA 4XM1A 4NCNA 3EPLA 3OJEA 4FKZA 2VBGA 4U5QA 3D6HA 4MZXA 4RHXA 4OBWA 4DEVA 3AH8A 4EYKA 2PJRA 2XQFA 1T8WA 4NIMA 4D3XA 4P32A 2G8LA 3P2YA 4EKGA 3H4VA 3WK6A 3IKMB 5F1PA 4A8JA 1ZAYA 4MQFB 4B71A 2XMGA 2JFQA 2FQXA 3MT9A 3RVNA 3K9NA 4YHBA 2X22A 1JH9A 2KW5A 5JVDF 1CE8A 1IG3A 5A4MS 3OM8A 3P0FA 3GP8A 5LZ9A 1T6ZA 2OBBA 2B8NA 2AK3A 1WXHA 2Z3ZA 4YRDA 5IKOA 1K7CA 5DGXA 4E1BA 1VL0A 4M22A 1R4MA 3T12A 1NJ6A 1GGVA 3WGTA 4JVSB 1A0OA 3DYBA 2ZJ6A 4Q05A 4QYMA 3L43A 3TLXA 5KOJA 1N75A 3BB4A 1PI3A 3EXG1 2HWYA 4KB5A 4ZCTA 5HTOA 1QS0A 3B2EA 4HDRA 5IWCA 2BR4A 2QVBA 1EYZA 3TEFA 3JQEA 1XKTA 1CY7A 1C3VA 3D5QA 3EGXA 4TXNA 1C2TA 4MVJF 3WLKX 5DX0A 3C0KA 4O5OA 2RHOA 3QPDA 1DT5A 3ZNPA 5F98A 3VJMA 4FFBB 1WUIS 4KAFA 2RK6A 4R2MA 2BF4A 3R5SA 1T5SA 1P45A 1AO3A 3KQMA 1DOAA 2J5QA 5JD6A 2O9JA 1AK2A 2NT3A 3TRJA 3QE0A 2DWQA 1FNNA 4EP1A 4AULA 4WCDA 4N39A 4QZVA 1WMBA 1V8PA 3IIKA 3K1AB 1P8AA 3DEFA 1AZWA 4UVIA 3R6LA 3ABZA 1G2QA 2FN8A 3TCXB 3U17A 3LT5A 4M1SA 1QANA 3KR9A 5IBPA 4KGVA 3UMFA 5K8JB 2GX6A 1FDUA 4IIUA 4RM3A 1EFPA 4Q47A 2XZDA 5EPOA 1J0CA 2NZ2A 3DM5A 5FHQA 1JTVA 5ICSA 1B8UA 2HK8A 5CPFA 4JNCA 1RZRD 2EZ8A 5AM5A 1G7TA 1X42A 4F12A 1DX4A 1I6LA 1LPAB 3STTA 4AUKA 2O8DA 4KQXA 1CZNA 4N8SA 3R4VA 1JDUA 3OUUA 1B43A 2ZUEA 3SVLA 3AW8A 1XJ5A 1A4IA 2Y1KA 3OIVA 2C2MA 4BVKA 5K0EA 4UE2A 5C35A 2OHVA 2IW3A 4OHXA 1K7XB 1TM2A 5CB0A 1NKVA 2QYHA 4IIJA 1F5SA 2C9MA 1AQIA 3IKVA 4NDNE 5K0LA 3LKVA 4NFLA 1OH7A 3VISA 1AH2A 4BOYA 3AUSA 2A84A 1QF9A 3IBSA 1WY7A 2VHEA 4NBSA 4E2FA 3WWZA 1BDHA 1WLYA 1DBSA 5ITZA 1TYAE 3Q9SA 5I5GA 3K0KA 2NUTB 4NOJA 1GZ4A 4TVKA 1VKJA 1L5VA 2AFHB 2IPMA 4MKXA 3VH4A 4UEKA 3HABA 1M2VB 3WGUA 3EF3A 3WSVA 1XYVA 1EDZA 3X1DA 1NMSA 3LUHA 4MGZR 2ZYSA 4II7A 3MMSA 1PZEA 3RODA 1WULS 3CN7A 2BGMA 2EZ9A 2VUIB 4N5DA 3U3KA 4B6JA 4ZREA 3V4ZA 1Z2CA 5G1OA 1BMQA 2XCTB 1C81A 4KI7A 4G37A 1G7CA 3NTLA 4LEIA 4AN1A 3DDNA 1YCFA 4LMAA 4WNCA 4ERXA 4W9RA 5B3AA 3H0CA 6REQA 1RHKA 1CIPA 3DW1X 3B9RA 2P9JA 2ZTHA 5BT9A 4C01A 2OY0A 4EVQA 2VVTA 5L53A 2DSTA 4BMVA 5GOTA 3HV2A 4O4LA 1NX9A 2RKBA 3RK1A 4NEGA 5KINB 1L5HB 5FX2A 5KNDA 3OU2A 3FHOA 3R75A 3JQAD 2LP4Y 3M5WA 5HCUA 3UFBA 1Z07A 1Z5VA 1T10A 3K15A 4CEJA 4MLCA 1VPDA 2VUTA 1G21B 5BORA 1Z63A 1E0JA 2NTVA 4ALKA 2RGRA 2A92A 2BKLA 2YX1A 5FTMA 1JWAB 1SCUB 3FTPA 1U5BA 3JYQA 1I24A 3AFGA 3NTOA 4D80A 4Q7QA 3EVTA 2A9VA 1GQYA 1QYXA 1TD9A 2GNAA 3AJ8A 3D0QA 1I13A 2P0AA 1RXWA 1VL2A 3JVVA 3OLQA 4L0DA 2ST1A 5ECGC 3O8OB 3DAOA 2OLKA 1V11B 1UOEA 3HXQA 5BQFA 2C7BA 1G8YA 3E27A 1Q0SA 3INNA 1Z62A 3ES9A 3HM2A 4Y2JA 5FFFA 5CA0A 1CYDA 1Y8QA 4LK3A 4XIFA 2D5CA 2SKDA 4P7JA 1M10A 3CRVA 3D6UA 4Y9SA 2CSUA 4JBGA 4U6SA 1JEAA 4OP2A 1T2NA 2Q4EA 4I6GA 5JJCA 4KX5A 1WF6A 1HYGA 3PUJA 2J87A 4JB2A 5TNXA 4HRXA 1U7OA 3I9FA 4GKKB 3C6YA 2BEVB 1JIXA 2BKXA 2E3JA 3PGKA 4C7BA 5KBYA 1QYDA 3W4JA 1QFZA 1GZ6A 1Q7EA 2GQ0A 2WYWA 3JWEA 5TX7A 1FNDA 4JFRA 2FGKA 2Q0SA 1KK2A 1XCMA 2E4AA 2IYEA 2YIMA 4PO9A 1KBOA 4S35A 3R9IA 5JY1A 5FOWA 3R23A 4Y6GB 1R8XA 1M83A 1QZUA 3DE2X 1YB2A 3TRKA 3RS4A 4RGQA 2OKCA 3KX2A 3TSZA 2I71A 3N5KA 4R0MA 3RIYA 5CFOA 2QRHA 3BJMA 5FEUA 1ZM7A 3BREA 1E2MA 2CXHA 2Q3LA 3OZGA 4O2BA 3CX6A 1YUMA 2BDUA 4HNQA 5IASA 4CHGA 4X9XA 2AWOA 3IBFA 3AERB 5AJTA 3DJYA 2PU7A 1QXSA 1VQ1A 4QTUB 1E96A 1Y9DA 2X4LA 2ZSFA 1Y81A 3GUHA 3L7MA 2X19A 3OZEA 1IMOA 3PNBA 4GBMA 5E9AA 5BW4A 1MOSA 3FHLA 1AUVA 2RBEA 4B4KA 4G1EB 3K2QA 4GX1A 3ZZ0A 1QCZA 4PN3A 4AKIA 1NI3A 5J1SB 1I01A 2Z4RA 2ZI9A 4KFUA 2IY8A 4HWTA 3FI0A 3I4CA 4MYRA 4KMOA 4ZQCB 1DV2A 3V1NA 2GRUA 1Z8NA 2N3ZA 1ATZA 3SMVA 5JWRA 1A9XB 4X8MA 4EYSA 4COKA 5DJ5A 3GT4A 3LBAA 3LQ1A 1UM9B 1S3SA 1DQYA 4N3GA 2BTQA 4EUEA 1P29A 4PW0A 2EXXA 3H1EA 1Q2UA 1NW9B 3KV3O 2DQZA 3ICCA 3O4JA 4ZQGA 1MVNA 2FR0A 1O95C 2PS0A 2VL7A 1F6BA 1DPFA 2RH4A 3OECA 4MQ6A 4BJ1A 1LV7A 2UVPA 3UK0A 3KFVA 2I7CA 2GTIA 5E8RA 2WE7A 2ZIZA 4F46A 4YAKA 2B4AA 1CDOA 3W2FA 5HMLA 2ZIXA 3GLIA 2QX4A 3PC8A 1MHTA 1OB5A 1GN9A 2VEDA 4JI5B 4EJFA 3ISVA 4N0PA 3M6FA 2GPAA 3HDTA 4XIJA 3NWPA 5JNLA 1QCCA 2RGYA 4IV0A 1E4YA 1Y4UA 3OBIA 1Y6RA 2VJCA 1GO2A 1X7ZA 1O0SA 4HV4A 3ICVA 4Y7CA 5A6SA 2HMVA 4C7OB 2IX9A 4WXHA 3IDOA 5T67A 2HGSA 2NG1A 3HRIA 4XIIA 2BFFB 1FUYB 4AROA 2W37A 5HQTA 4QBHA 1C0KA 2P5UA 4GI5A 5CP8A 4CDNA 1KY4A 1YR6A 1H93A 3FBTA 1ZXXA 2YJGA 4RPIA 4GSKA 1H8HA 3FMFA 1Z6AA 2X40A 1HDZA 3U9SA 3T9EA 2OP0A 3IAS1 5DZSA 3FR8A 3DVAB 4FYWA 4KN5A 4OQQA 1E2HA 5K9ZA 1EZ1A 3LP5A 1H6CA 1FBTA 4W5QA 1AS2A 3BHJA 1LX6A 5ALOA 2I3ZA 4TWIA 2IEIA 1FVHA 2D1RA 4Z7OB 2VCHA 5EJEA 4GG1A 4X5OA 3VZPA 4Q18A 4JUFA 1KJIA 2A0KA 3CRZA 4AF7A 1IZZA 5H81A 3NHKA 1PEDA 2VHVA 3EPJA 3RTAA 1T9KA 3T8YA 3VOTA 4B81A 2X41A 2ZBQA 4W8GA 4D99A 1H1DA 4V38A 5P21A 3H5WA 5C4IA 2P67A 4NE7A 1R0SA 1GGJA 1YKFA 3EVFA 4ZT7A 1XVIA 3JZMA 5T41A 4BB0A 1KQGA 4MVJE 3QHQA 2C07A 3C15C 2J0UA 1RBYA 4FCTA 3FE2A 1TJ5A 3D4IA 3NUZA 4JBYA 4C6TB 4FDLA 5JCZA 4DR1B 1IN4A 4AZVA 1ULSA 4KX3A 4Q4HA 5B3JA 2V4ZA 1VKRA 5DLEA 2FETA 3EGVA 1IAQA 2WUVA 2NVWA 3KJNA 5EIWA 1Z22A 4Y2VA 2VA8A 3SJUA 2H4HA 3IDZA 1M8JA 2Q3BA 2QNBA 4BQOA 1NSTA 4XDGA 5DLDA 3ZGOA 4R54A 2WFAA 4PNPA 3EVBA 1HT1E 2B2NA 2WM8A 2OHJA 2HQBA 2PLFA 3JQQA 4A8JB 2V3VA 3F7MA 4FK8A 4HD8A 3ENNA 3U48A 2Z04A 4M0PA 4KWTA 4EGFA 1FNCA 3EIOA 1W5AA 4LOAA 3VGPA 1OXTA 5KTTA 1I32A 4OHYA 1X7XA 1JLRA 2W2OA 3TTYA 1DNPA 1H5NA 2F9LA 4BRUA 3HCAA 2ZWPA 3E03A 5GGXA 3W6PA 1VMKA 1O9GA 5B55A 1JAXA 1NI4B 3UJHA 3GLGB 1XDSA 1JYEA 1R4MB 4NULA 2ZAIA 1QAOA 4TQGA 5JPCA 5HA5A 3D0OA 3A70A 1JEYA 3CIOA 3IS3A 2QXTA 3A1CA 4JT8A 1QS0B 4NBRA 4A2PA 3OCWA 3K7EA 1LDNA 1V1RA 3CZCA 1JE1A 2GXUA 5LP6F 4XRRA 2FK7A 3I2KA 3EGXB 1U7PA 3ZK8A 3SOZA 1R64A 5DK6A 3OJCA 5K0BA 3GMIA 1N77A 1P0IA 4HAYA 5DT2A 4M88A 4I5IA 1H23A 2GF9A 3X1YA 5EMNA 3I4FA 4MHTA 1E3SA 2YZKA 4ZYTA 2NQ2C 5EUMA 1UL1X 1YA8A 1K08A 2BT4A 5H1YA 5A0FA 1C50A 3NU1A 2OAGA 3DQPA 2PVPA 3OVMA 4HX2A 4LI0A 2V55B 3VPBA 4D9GA 4DL9A 2XCSB 3HVKA 2ZVQX 1VP9A 2PEYA 2QVXX 4JNKA 5ECYA 3UV3A 3W06A 2FEWB 1X2EA 2YJZA 2NXNA 4KQJA 2AT1A 5IEBA 3VZDA 3QK7A 4YMLA 4S05A 4HSGA 4QU5A 1ID8A 3D6AA 1EFPB 5AKHA 4AECA 2P78A 3S7ZA 4KQ6A 2QKYA 4N7JA 1D2NA 2ILVA 5HTKA 4EAQA 1US8A 1YJ5A 4Q1AA 3WGIA 3THYA 1NLFA 1CF2O 2RB5A 2H3HA 2ZSJA 4E13A 2O7RA 5A06A 1QVZA 3GEDA 3UK6A 3I6IA 4PHCA 2FRVA 3VDNB 1BMTA 1NLZA 2FCAA 3DZDA 4MO9A 2WIJA 3VZCA 5ISMA 1XPRA 4KVZA 2O6LA 1NLYA 2JGRA 4LRQA 3D64A 4D3DA 2JFOA 1U6JA 2GRAA 1OKKA 1LVUA 5FTKA 1KAMA 2A0WA 2AUTA 1SOUA 1FE8A 4C30A 1D6NA 2QZ9A 3U56A 3UXEA 1XAJA 2KBEA 1TTTA 3E3LA 2RGAA 1FSSA 2C7GA 1D4OA 2H2DA 2JIDA 3L8GA 4IIJB 5BQPA 1EK5A 4O0LA 3HA5A 3FB4A 2IXBA 1CK4A 1J0DA 3LBNA 4ARBA 5AJVB 2ZRBA 2IYOA 3AKCA 1RKVA 4JA2A 2JEOA 4ZT4A 1WA5A 4OXXA 1TJNA 5ITZB 1N0VC 2TMGA 2XEXA 3D8SA 4FX2A 4WLVA 3UY4A 1HFKA 4DV7B 4PYKA 3I76A 1KPHA 1H2YA 3A1FA 1VPLA 1B42A 3Q10A 1M1NA 1L7VC 3F5DA 1EFVB 1N1DA 2KI5A 2PH7A 3JRWA 1ZVKA 4NBVA 3ZGLA 4MICA 3ZCSA 5AW0A 2JH3A 3GDGA 2QTRA 3KVVA 4ZI3A 3KS9A 3RAEC 3B6IA 4EEZA 4TVBA 1Q6YA 2ATVA 4PS0A 2MR5A 1H5QA 1NQUA 4U9IS 4D5GA 1I4DD 3ZBTA 1E5DA 1S2NA 3ZTWA 4ZZ0A 5HNKA 1N5MA 5JMOA 3WAJA 4OYHA 3MQ4A 4IHKA 1JKXA 4Y1RA 4MVXA 1EX6A 2HRCA 3A2MA 5CB8A 1NDHA 3QU4A 4TYMA 1EI9A 4NYJQ 1QFYA 2BHSA 4FXOA 3MS2A 1G20A 3SEAA 1TJYA 4O4LB 5A6VA 2WTAA 4TS1A 1X7WB 5CCEA 1QUEA 2FLKA 4MKIA 1B15A 1A8IA 5IWAB 1RSZA 3C14C 3OFVA 1DE0A 3PWTA 3AV3A 1JHUA 3LDUA 4AAYA 2O2DA 4EY8A 5I9TA 2P6RA 1AKTA 3IEUA 4CEJB 4TXLA 2NQTA 2WAYA 3TSOA 2J85A 4L0QA 3WGVA 1SG9A 4L4YA 3DQQA 3Q7SA 4MV9A 5KJ1A 5K09A 1CS4C 2C3PA 2M6LA 4DWJA 1JSXA 2XVYA 2VH5R 3ZOKA 5A4JA 1MQAA 1ZLYA 3DBLA 3ORYA 3ICOA 4JC0A 2YY5A 4IS3A 1VYVA 2OGTA 3D6JA 3HK2A 2CK3D 2CDCA 2YVKA 2ID7A 2A4MA 3CNBA 3OCXA 3RYHA 5DHRA 4PLGA 3H4TA 3AJAA 3F7NA 3HZZA 5ALLA 1C1HA 4X6LA 2XX3A 4PLVA 4X97A 4A5SA 5L8VA 5CM9C 2A0UA 3CPJB 4MA5A 3TL6A 3EC1A 2PXXA 4R8SA 4B9EA 3IAXA 4PZDA 3OD5A 1RWKA 3A6ZA 4PQEA 2XWSA 1E6KA 2JASA 3KPUA 4KWHA 4K81B 3PFWO 3TTUA 3IURA 3LK6A 5CTJA 5IKEA 1PK8A 5IC5A 3TCNA 4IIGA 1JL3A 1N3IA 4W7HA 1IXSB 2KJQA 3AEQA 4OU4A 1P5RA 3R74A 4CM3A 1KORA 3VXKA 2C5EA 2OO7A 2X76A 4X1YA 3K70C 2HXYA 4JWKA 3CX8A 3QXJA 1UJ5A 4LCBA 1QH9A 4LRTB 1H3EA 1XP5A 2WJ6A 3I5UA 3W34A 4E15A 1WCXA 3AF2A 4E2ZA 4Y2SA 2LCFA 5JJLA 1SAYA 2CYBA 3G5MA 3IXMA 1YZGA 3DFUA 1Y98A 1FLDA 3QZUA 1YC5A 3KJQA 4B3GA 1TFUA 4F04A 1N4DA 4RZ2A 2GT1A 3BXOA 4DV0B 1M2EA 2CLEB 1WAMA 4CI0B 2J6CA 2JLCA 2JFNA 3IIIA 3H2JA 5P8WA 1YQUA 4OQZA 4ZHQF 5G1PA 1ZIXA 1F8FA 4ER3A 1UT6A 1R0XA 1RCFA 1E5TA 3C7KA 3H83A 4WOJA 4FMBB 5C0OE 2Z6AA 1BJKA 1QG2A 4O02B 3W6OA 3TVTA 3K6SB 2YJ6A 2IHUA 1RM5A 1T4DA 5IBRA 2O3UA 3OE5A 4KWCA 1J20A 3G2JA 3HXOA 4AQ7A 3KZ1E 5L4NA 2APJA 4V02A 2WTUA 1XA3A 4E6EA 4L02A 3ITNA 3RFTA 1QU2A 1E3LA 2FXIA 3QIVA 1R0RE 4PZEA 4ZQBA 5JWOA 1ZIOA 1Z6QA 4X7MA 3RBZA 2J67A 1SKMA 1U81A 2IZ0A 3HDGA 4RLSA 3O6VA 4HB4A 3E9DA 1TKRA 2R97A 4XTRA 2ZSDA 2OVBA 3EVAA 3KAKA 4AJ9A 1I4TD 4DMMA 5AK5A 3GJ7A 3M1IA 5E1BA 1A7UA 4LJLA 4CFSA 1S4QA 3U80A 2G0TA 5WRFA 5FUVA 3VYUB 2FJ0A 5LIPA 4BO7A 3GLFE 2ZKIA 3LNTA 1TA4A 4QL3A 3CT4A 3HWWA 1RM4A 3QFSA 4CR7A 1V41E 3EHEA 4I4TF 3UWDA 4EH1A 1JWBB 1UINA 5ALRA 4BFSA 2OD7A 2UVPB 2ALJA 4PC7A 1SQ0A 4E5VA 1CUJA 4K7JA 1FC0A 1XCJA 2ZIXB 1J2EA 2GB4A 3KUUA 1K7FB 3ODGA 3E35A 4IJQA 2ZB4A 3GLIB 5AUPB 3NIWA 2GF2A 5FXMA 3JVIA 4GOOD 2WYOA 3G5AA 2RGEA 3CUKA 3M2TA 4RJTA 1DV1A 1WS6A 2R79A 2G5PA 4O6VA 2I67A 4PYNA 1K9SA 4K9MA 3EXHA 3GG9A 4R8LA 4ZEMA 1S2MA 1X7ZB 4QO8A 3EAFA 1RABA 2E5WA 5A6SB 2CSXA 4DYVA 3FTCA 1A5AB 3PHGA 5IN5A 1IONA 2CKMA 2IITA 2VPWA 3KL2A 4KYIB 4RFVA 5A7HA 3SS8A 4INPA 4EEXA 3F6SA 5A9SA 1EU1A 3VTFA 4G2TA 2IH2A 1CUGA 2H9YA 4S04A 3WKBA 1Z28A 2M1ZA 5HK8A 3FSGD 3G2IA 4GNKA 3KKOA 5IULC 5JH7B 2IT1A 1CFZA 3SQDA 1AKEA 1EVEA 4JASB 4GLLA 5CD9A 2P6OA 3PKZA 3SQMA 2HUPA 1YVEI 4D4JA 3OSUA 3IP9A 1VPEA 5JC8A 2IY9A 3OOWA 4I5GA 1OYWA 4IUYA 2JHGA 2ZIVB 3EFHA 4B45A 4D4LA 3A05A 1FZTA 2YXBA 4ZCSA 1UR5A 2IIVA 4PG5A 5FNVB 4JI0B 1Q74A 4M0DA 4RY0A 1TD1A 5EKUA 3I6QA 5GP1A 3GCZA 1KI1A 2ZRCA 4AF6A 2PH5A 1QTQA 3PQ8A 3E9YA 5IS2A 3KQSA 1TGYA 3PBKA 4HGQA 2G7MC 5ER6A 1CTQA 1U1FA 4O2LA 1W94A 2HO5A 1VE6A 2IKQA 4ZYUA 2J9ZB 2LE0A 2SHKA 3GLKA 5EWLA 3HVJA 5MGNA 2NXJA 3DE7X 1I3LA 2J0UB 2DWUA 1UMKA 1T5IA 3WGLA 2DU8A 2J30A 3NCHA 4EWLA 5KYVA 5EJ7A 3AR2A 5KQPA 3MGBA 2ZE8A 1G38A 1L5WA 2GAIA 3Q3HA 3SDBA 3K16A 1H85A 1R2QA 2AFIA 3LG2A 3OO0A 4MVJG 3NPAA 2NO6A 2HF2A 1L7DA 3SHWA 4IQ4A 3DMTC 2IXFA 4TVOA 3VPXA 3U7EB 2L82A 1P2FA 1SUBA 4GM4A 1G7SA 4UM8B 3ZDCA 1J9EA 2YQ4A 4JU9A 4PNHA 5BR4A 3ESBA 4Y2RA 4CMEA 1YZVA 5EP4A 1VHTA 2XLCA 2D1YA 3QHPA 3U09A 1SC6A 3P4UA 1P0FA 2HB6A 3PB3A 3I2YX 1IBCA 1TYEB 2Z3WA 5AKIA 1IBSA 3TBHA 3I39X 5BSUA 1ND6A 1E0KA 1G16A 2Q41A 4FOOA 3W4KA 1EP3B 1RPNA 3SSNA 1JT2A 1N6PA 1B16A 1X7XB 4ZIRA 2QTHA 2Q07A 3F97A 4Z9BA 2HJ9A 5M29A 4Q7EA 2FLWA 4ZANA 2IEBA 3UXYA 4B73A 3F5QA 2X13A 4GZ3A 4F96A 5KPDA 4U7DA 1P31A 2ACEA 4DIMA 3QGMA 3AEKB 1E9CA 3WK9A 3BXGA 1Y6FA 2XXAA 1WPGA 1USUA 1ZH6A 4HBGA 4BCBA 2ZBFA 1Q44A 2JLWA 4LXQA 1V1RB 3E9EA 1J24A 2K4MA 3N8HA 5ALPA 3GY0A 4BNUA 5CCBA 2AB0A 5FQOA 4Z1OA 2XA2A 4FILA 3D3QA 5KX5F 4F4IA 1G8GA 4WY2A 4BJ6A 1K1EA 4OI2A 4JQZA 2AZMA 3KPJA 2G71A 2A30A 1J0EA 1V9LA 1SVOA 2BV3A 2KE5A 3MHTA 2FZWA 4Y0VA 1U1CA 1DP4A 2QVLA 3A9VA 2Q6IA 3EF1A 5EIHA 2EHDA 3FH0A 3NGMA 3G02A 4RYDA 1PUJA 3PHHA 1SCDA 2OK7A 4L9RA 2VTEA 4LZAA 4EG6A 2XNJA 2QZJA 3A6LA 2R7LA 3AESA 5AVYA 4LV6A 3KT6A 3ANSA 4C7KA 2PUGA 2WKRA 3I72A 4O4HA 4PLWA 1F1JA 1VIDA 2XI4A 2AMLA 1T1RA 1JHMA 4QGHA 3RBVA 4ZYVA 3DZHA 3V00A 1GZHB 4LBYA 4O3FA 1A7AA 2XA9A 3PGMA 4RWEA 4QOHA 1DQRA 2ORWA 2V4UA 4LK2A 4RCZA 5LFAA 5ARDA 2GZDA 2MSWA 2N46A 1QJ4A 1K7SN 4RIFA 1MFPA 4ZI7A 3ZHOA 2IYFA 3D5TA 3B1ZA 4ME6A 3THYB 5LBIA 1NN1A 2WM9B 3M7IA 2WYIA 3UMSA 1P0MA 3H5RA 3R7SA 1SB9A 2GXQA 5JR3A 3O93A 1LI4A 2GARA 4ARAA 2QUIA 1FDWA 1R0YA 1I9CA 1RJ9A 2WEKA 1A88A 2HAEA 4C43A 5LWQA 2BFDA 4FMDB 4AY2A 1ISFA 1PWZA 1XZEA 2H1WA 1O8CA 1BE0A 2HK7A 3BWXA 3DHEA 3MUOA 2PDAA 3X2SA 3WLFA 3UENA 2QEQA 4DIUA 3SX4A 3W6UA 1TVMA 4BNWA 3G3EA 2DJ5A 1NBIA 3K94A 4KPUA 3ROXA 4EHLA 2BEJA 3PC4A 4K8OA 3I05A 5H83A 4PFJA 4I2VA 1H2WA 1X15A 1G8MA 4B48A 1XMXA 3IMEA 4MWTA 3WO1A 4V0OA 3NYQA 4MDHA 4Q3KA 2QBYB 1UZLA 1GVNB 4YJKA 1HE1C 1J8FA 1J2UA 1G98A 2JLAA 5DM0A 1ZHFA 2PY6A 3SJZA 2XXAB 5A4IS 1XHLA 3P0JA 2FOLA 4W99A 4UOQA 4YQZA 3O8LA 4MI1A 1C9YA 1D2GA 2A5JA 1V1JA 3L02A 3ETEA 1H22A 1M1NB 1YD7A 2J9FB 1LBHA 3ZWDA 5K3CA 4AY3A 1IOLA 1MJHA 2WWRA 2ZR0A 2ZRDA 2B3TA 3QVGA 1LKZA 2ZYGA 2EFGA 4OK6A 2LPMA 1PV1A 4F6CA 4YRMA 4PQRA 4NK4A 1DG1G 5TLSA 3K0FA 3VR2D 1N5JA 2GD2A 2JARA 2Y2UA 3IA2A 1Z0JA 4C0XA 1WR8A 2ZWOA 1UH5A 3REFA 1AQUA 2D5LA 2IU6A 4Y1RB 1KMMA 4J0GA 2CMHA 3SS9X 3KZVA 3SHFA 3V3KA 5CEJA 4GBGA 4LZPA 1SGWA 2C4WA 4QUKA 5FJIA 1E98A 3AM4A 1YZHA 2IUTA 1C7RA 4NY1A 1G5PA 1Y3IA 1T3SA 3FFAA 1M34A 5FI5A 2FWMX 1D0IA 3NTXA 2ECQA 4HB0A 2BMJA 4HHEA 3ZWQA 1PHPA 2E55A 4X8LA 4CM4A 5IAAA 1C30A 1V25A 5T3UA 1K92A 1AB5A 3KEMA 3EVNA 4L57A 5IXSA 2ZE6A 4OHBA 3ZU2A 5JXIA 2JL1A 1BC5A 2XXJA 3MTJA 1ODTC 4IFIA 4FVTA 1ZIPA 3B5IA 3DBLB 4LJ9A 1IQRA 3R7LA 3WLAA 4BQQA 3FMVA 1P4RA 1ZOOA 3WHKA 3L1UA 4LXUA 4AJ4A 2ZGVA 2AZ4A 2PG3A 1EXNA 1TLTA 4H3HB 4QO7A 3TZLA 3HYNA 4INZA 1NUQA 3WI7A 1TMYA 1UQRA 5D7NA 3WLHA 5DI9A 4EUHA 2AKEA 1OXUA 2MSLA 3UVEA 4LX0A 1ZL0A 5JNVA 1GRNA 2BRUC 3EHDA 2FF7A 4MR8A 1FSFA 1Z7GA 3WWOA 5IUNC 2XQKA 1BMFD 3ZD9A 1NDQA 1N2CB 3DT9A 1KOLA 2XGMA 3OE7A 2DBVO 4WI1A 3ST7A 3WYAA 3HI6A 2FW7A 2JVKA 1KYWA 4DMCA 4QFMA 4F3RA 4EHJA 1V3UA 4BB9A 2DQSA 1SN7A 1BSVA 4BMNA 1EG7A 4H59A 3AEQB 2I8LA 1XLTC 4NS1A 4H1UA 1R00A 4RW0A 3WB0A 4C0AC 3CH6A 5JLJA 5I8PA 2WR8A 1FNSA 1MTZA 3CFYA 3EGOA 3H7AA 4PSCA 3JARA 2E87A 2Q45A 1H0HA 5EY5B 2IFTA 5H4GA 1ZQ1A 4GXRA 4K3UA 4FHEA 1LSUA 4D92A 3MT7A 3AHIA 1SHTX 2WPDA 3VSEA 1I7DA 1CUCA 2PZBA 1PNTA 3ONFA 1IK4A 1HRKA 2C9YA 1W75A 3H5OA 4LC0A 4W9NA 1NUSA 1A5SB 1U2RA 1VLJA 2R8RA 4BYGA 5JIBA 2QVYX 1B0UA 3RHFA 1B2RA 2QTTA 3DW3X 2H4WA 3RG8A 4KBFA 4QDUA 3TIIA 4F85A 3A31A 4HDQB 4RDCA 3MTGA 3CNNA 3NJRA 2PWBA 1YBVA 1DKUA 3Q7EA 1U3GA 2Q8NA 4XCXA 5M5BA 4FLFA 2BZ0A 4GOXA 2ZUVA 3G9UA 3UO8B 4M36A 4K9RA 1DKOA 1L5YA 1U0TA 3SM3A 4EABA 4YAUA 1F4LA 3HM9A 4JJ8A 2PXCA 3TKLA 1U7DA 3B82A 2IS2A 4MA0A 4FFRA 3KQHA 4NVRA 2FN7A 2P69A 3AEUA 1XR3A 3L7DA 1UP6A 4YRPA 3QA9A 4MRPA 2HRDA 5JPIA 5FO0A 5LDHA 4P84A 2IPNA 3OZBA 1H4VB 3WLOA 3SAJA 3U2QA 1V6AA 2EJUA 3IHTA 3SU8A 4CKXA 1X13A 2A14A 3I5XA 4M1WA 3FETA 3IAM1 1KA9H 2AS0A 3FDZA 2JK1A 2P4SA 4PFQA 2HN9A 4D9NA 1D4ZA 5HBRA 5KO2A 4AN4A 4JYPA 2B8WA 2WIGA 4ARSA 4EITA 2P2CA 5LB4A 1SNYA 1DOZA 3UTDA 2A8YA 3IQGX 2DY0A 3GJXC 1GZVA 3RRZA 2PKXA 4FZJA 1YQDA 4QT4A 2VRNA 2O8VA 1YDHA 3G8YA 4HPWA 3V7WA 1BE6A 1X14A 2ORYA 2IV7A 3AUXA 4E07A 5HMMA 1PSWA 1UM8A 4E70A 3DB1A 3O83A 2IIPA 3BK1A 1IM5A 1CDZA 1PQUA 3QH4A 2JFFA 3C5EA 3QF4A 1EA7A 1VLQA 4WXYB 5DRTA 3TGWA 2Y27A 1SO8A 4DDTA 4YPOA 3DOHA 3H3XA 1GUFA 1NTOA 1D4FA 2YWGA 5CFZA 1ESDA 3G6KA 3HUUA 2I3AA 1T5BA 1F3OA 3E22A 4J3JA 5BXYA 4JU8A 4KMSA 1GILA 5A9SB 5FWNA 4HRYA 5LXTA 4GVPA 2QYTA 3AM3A 3CCBA 4QDKA 5IUKC 2JJ1A 4K87A 4WK4B 3DKIA 2NZWA 4AJPA 2HWKA 2C31A 5JFTA 3ZV6A 4AJNA 5EKXA 2BZ1A 3FYUC 3GA5A 1Z0ZA 1YSCA 3JY6A 5CT4A 2GAJA 4B2YA 1IVSA 2DETA 1T2FA 3FB1A 3N2GA 4DRXA 5EFZA 4A1OA 3CNOA 3KSDO 4ZAFA 4B4WA 5K8UA 4NRDA 4H9GA 5KQLA 2J33A 1Y6JA 3UW1A 3KWLA 1DX6A 2QE7A 3I2FA 5JO0A 2IOHA 4EG0A 4OQYA 1QONA 3KWJA 4FBGA 3NBFA 2HCJB 4P1ZA 3RVMA 2Z5VA 5EJ6A 1NUPA 5L3RA 4LWZA 1GQFA 1MVLA 2PGLA 3N53A 3OZCA 2GI4A 3MTEA 4OA8A 4ZV9A 1TOAA 1UJNA 4QUDA 2B7LA 3DE6X 1MFZA 4E3ZA 2IYRA 3A27A 1TYCA 4PPYA 5J2UB 3N5CA 4G5YA 3LLVA 4F1WA 3A6JA 2O14A 2FE4A 3LRPA 2QA5A 2C8VA 2XTJA 5AMXA 2HTEA 3P9XA 4N3BA 2AFIB 1DC6A 2PMWB 1UXHA 2QP4A 4LYFA 4N03A 4NU8X 2EKQA 3ZKWB 4DBLC 4J6FA 5B53A 3W7AA 4F86A 5LU8A 2DXIA 1RPAA 2ZYRA 2BGKA 1JDBB 1GR1A 4XASA 5CR9A 1KOJA 1LGYA 2ZZKA 4ERNA 3AXSA 1P7WA 1X38A 3KYCB 2QIOA 2O3RA 4HEA6 4IJ6A 4KE8A 1DL5A 4K6HA 7REQA 1VLHA 2JB9A 1T3ZA 4X7PA 4AMYA 4YROA 3QKRA 2PT7A 1FW6A 1RLMA 2XRZA 3TB4A 2DOKA 4TKVA 2WMDA 4UARA 4XJTA 3VJLA 1QK3A 4B33A 3GVIA 3OX1A 3OEED 2FDCA 1P1FA 2A58A 3K2BA 4Q7KA 4ZIRB 3BSYA 2EP7A 2ZSHA 4OXYA 3INTA 5DISB 1BO6A 1VMEA 2QLBA 3ODPA 5EA2A 3CNLA 4JJKA 5KNCA 5DXFA 4PHGA 5EWJA 3RSZA 4MMXB 3CW2A 4LFCB 1T9AA 1WZUA 3T1YB 2C5SA 1L5NA 1IUKA 4MP8A 3HADA 1OLXB 4YLYA 4IRUB 2WT8A 4C89A 5KVAA 1DAGA 1HFWA 2YFQA 5AW5A 1RAFA 4MRAA 3NUQA 1Q16A 1VLZA 1PT9A 1U94A 2RHJA 4BVBA 4DNOA 3B53X 1ISGA 1HDXA 1X7HA 3MWDA 3NV9A 5A1TA 2HH9A 1USKA 1B6SA 1PX2A 2VTDA 2CL7X 3P94A 3ADCA 1E3WA 1L3IA 3M3DA 2RGUA 5KTNA 1J42A 1HNXB 1ACLA 3QJ5A 4OSOA 2XXBA 1COZA 2FU5C 4JLBA 3UGJA 3QOWA 4CFYA 3I23A 1IPEA 1XRSB 3AESB 3FA2A 3QTTA 1D2RA 1OAAA 3FWPA 4DQKA 5DTRA 4O4HB 3ZIUA 1WU7A 2FDXA 2R8XA 4FNMA 5HGXA 2RAPA 2QL9A 2H18A 3SKXA 1OT3A 1QKJA 5FYDA 3V8VA 4JV5B 3K9GA 1G3IA 4CETA 3RC1A 4N0QA 4U02A 1TZCA 3D2BA 3KXKA 1FPMA 2DE0X 4PO1A 3AVQA 5B37A 4ZI7B 4IUDS 4H35A 3MCVA 4GLOA 2JS7A 3K6JA 1P2VA 2AJBA 3NBAA 2BP7A 2Q9CA 3NHRA 2FN9A 1VLMA 2EX1A 1A4XA 1RBQA 1RJ9B 2NVOA 3E5HA 4R2XA 2BFDB 2Y76A 3ZHRA 1LBTA 1URPA 4G1MB 4LCJA 5JEEA 4PLCA 2EWMA 3OM0A 2QG9A 4E5YA 4FDTA 1DIAA 4Y6LA 1OUMA 5HIMA 4KPUB 1P17A 3N1UA 3BMOA 3V2IA 3UAXA 1P60A 1Y5RA 3O3OB 2ODBA 4KXMA 4U39A 1NC3A 2BGIA 1PVVA 2NSYA 4MV3A 4RANA 3RIEA 3RK4A 3RU7A 1VIMA 2Z2JA 3HCCA 2VYVA 1F51E 3ZCXA 2ZRIA 3P97A 3CURA 5A05A 1P39A 3A6PC 1NJGA 3ZWPA 2CUTA 4OQ4A 1KSGA 4PTYA 1PNVA 1QHXA 2RGNA 1FMLA 1DEOA 2BI8A 4IDNA 3UB4A 4D6YA 5AQEA 5JMTA 4B1FA 1DG9A 2O5EA 3GZTB 3QVGB 4LF5B 4KIJA 1FU4A 4DIKA 2JJYA 1OWPA 3ML1A 3ETJA 2ZFUA 4D0GA 5DLPA 2EQAA 1J09A 3AYZB 2H63A 4ZMBA 2AOUA 2W6IA 4OHUA 4KLZA 3SFTA 4RSRA 4ANFA 2X5JO 1OFIA 1X2BA 2JZOA 2ZJZA 5JI3E 2Z2XA 3UJ9A 1GN8A 3ITKA 5AQ1A 4FYVA 1LNSA 4Z9XA 3SYLA 3N74A 3IUPA 2R1UA 2NSLA 3IDAA 4W1SA 1FTGA 2XUDA 3O4IA 2VF8A 1ISRA 1ZIYA 3OO1A 1GPLA 3PE4A 4FGSA 3A2LA 3SZOA 4F2DA 1BCSA 1KXJA 1M34B 4EMTA 1SUCA 3LUCA 3LQQA 1Z7EA 4DGSA 3KE8A 4K0KB 3ER8A 3HH8A 5JS7A 5AW1A 4V39A 3U7JA 4BYMA 1G7RA 4CM4B 2C5BA 2FZLA 3IOMA 1QTNA 3OMWA 4RS3A 3IVAA 3E5NA 1DGQA 1VSQA 5HJ5A 2VPXA 2YWCA 3P20A 4IWXA 4ZDKA 2XQGA 2F1KA 3U4CA 1SU4A 3HLTA 2GTHA 3R1IA 2JCGA 1PR1A 5KSPA 4D0RA 3GQVA 3SE0A 4RUKA 3S2GA 4Q5IA 5EXTA 3PFBA 1YXMA 4H6XA 1FJHA 3EF0A 1W4RA 1DXOA 3SSAA 4UZFA 5LQKA 5DYIA 5FKJA 3TNYA 3SZ3A 4BMXA 4NJEA 1BWRA 1X1SA 1PL6A 2FGJA 5LP6C 5HPYB 1C4WA 3NAQA 1USGA 4O29A 2HK9A 2VHZA 2AIRA 2OGSA 4YP7A 2ZCJA 1FYXA 4ITRC 3T7AA 2GEBA 2CLMB 1NF8A 2WF5A 5A5DA 4XX1A 4BPBA 2XZTA 2R00A 1T2AA 2VDLB 2XE4A 5K0CA 4FEEA 2EEZA 1OXSC 4OK5A 5I7HA 3E7PA 1DELA 5HCIA 2QV7A 1EJ6A 3DBVO 2ZRJA 4MX8A 2JC3A 3HWSA 5CDTA 1R9GA 3JARB 2VDPB 1XB2A 3L9WA 2B9VA 3GRZA 4FJ2A 4RGVA 4CWAA 2BGNA 3FPGA 2OQIA 3OI7A 4Y2GA 3WIVA 2EF1A 1EAMA 1IXRC 3PDIA 5DYWA 1O97D 2HGZA 3RYIA 3UK1A 1NV9A 3X2FA 1DAHA 2C9ZA 5G2OA 3CR8A 5GWXA 1NBAA 3EXAA 4WBNB 5E1DA 1USWA 5DBEX 3B38A 1P1JA 5DNCA 4KZPA 1FMFA 3A3NA 2PBZA 3OLCX 4AG3A 5KAPA 5AVRA 3MJFA 1VJ0A 2QX6A 3LL4A 1TU3A 8MHTA 2QV0A 1BW9A 2VKTA 1Q1AA 2AZDA 4H4DA 1WO8A 1FFXA 4JKIA 1IM8A 5FL7D 2ZM5A 1YQGA 4GXTA 4YMVA 2WJZB 1ZITA 2FP4B 1GRQA 2Q0QA 2M98A 5EQFA 2PGJA 3FFXA 4EYOA 3HLKA 4RPHA 3Q15C 2IP1A 2NU7B 4US0R 4WJZA 2YN2A 5I9SA 1J5PA 3MZ0A 1TAHA 5FPTA 3AEUB 5FQNA 2NTYC 5CYPA 5B6JA 2PAAA 2VT7A 3I5YA 1GTVA 3Q85A 1YHZA 1DKNA 4LCEA 2AEMA 5E9JA 3AUUA 3GO4A 4Q03A 4UZSA 1FBNA 2HXGA 2OECA 4QE3A 4G0UA 5DGTA 3KOYA 4C2AA 3FZNA 2UXCB 1ARZA 4BMDA 1SHKA 2RBGA 2GEDA 2OLJA 4IL5A 2CN1A 1L8OA 5L6LB 4GL4A 3NIGB 4H31A 4KXYA 1ZICA 3SZMA 1LDYA 1WBJB 3HCBA 2ODEA 5J3JA 1TU0A 2R6JA 1J07A 4G0QA 4YP0A 5J1TB 2BGWA 2EYQA 4GMGA 4N0MA 2YFKA 5JVDB 2AG1A 5L51A 3W5UA 3SJAA 2ANBA 4LSZA 3WX0A 4ZAWA 1H5UA 2VR1A 1ECGA 3G1TA 2B4TO 3I58A 1PJRA 4LPSA 4BU1A 5A9RA 2UV8A 1D7OA 1DADA 1RZVA 3MYRA 2J9GA 1DDOA 2PLAA 2V6MA 4KUHA 4DQDA 2JNWA 1E1RD 2G0AA 4UUMA 4ZYZA 5HM8A 1JR3D 3L6RA 3SXJA 2GZSA 1J70A 3BKWA 4ZV7A 4PLFA 3SG0A 2NSHA 3AB7A 1A9QA 2OQ2A 4DIOA 1FLVA 3QU9A 2DFTA 2V74B 3O8QA 3KQUA 2H11A 2PLNA 3F8WA 3GHHA 4LNAA 2JH8A 4N01A 5DCUA 1U8TA 3NHYA 5CU7A 3RHZA 3R0IA 1CB0A 4E46A 2NT4A 3GW8A 4MPPA 3RYFA 1OC2A 3PFIA 2A9OA 2P5SA 4F2WA 1QLHA 2RJNA 3WYDA 4ACBA 3OZXA 3QUSA 4ZXFA 3ROGA 5IF9A 4N7RA 4ZYYA 3NWEA 2VJKA 1WW3A 2CY0A 3SBXA 3MWEA 5F3WB 5FAKA 5SZIA 1V2GA 4IQ0A 4NV3A 4PG6A 2CLOB 5BSWA 4R9UC 4A6EA 4KE9A 2EJCA 3NBZC 2W4IA 3GAAA 3GLHE 4RVDA 3VI3B 1MD9A 4LI3X 4LRXA 3WZLA 1SC1A 2NU6B 4DC1A 1FUEA 2JAUA 3S3TA 3REQA 1PYDA 3NTUA 3OZ7A 1TTPB 1D1QA 5GM2A 4UDXX 3NP7A 4S2EA 3P7MA 5KIAA 2O3TA 4NZMA 4KR9A 4KUEA 4B6PA 2XR1A 3AEZA 4HWKA 4JA0A 3SF0A 1EZZA 5B4TA 3M6XA 1X7DA 1QHYA 4XIGS 1JEOA 4BFCA 1H94A 2P7IA 1NAIA 3LHDA 2DZDA 3DL7A 3KQPA 1KC3A 2PK3A 4MMZB 3NATA 1KI6A 4FYYA 7REQB 1ADYA 3IERA 1AS0A 3EQ8A 4WH0A 1AKUA 4D8UA 3QKRB 5KOHA 2D2FA 2BIFA 2H17A 1DCKA 1RAHA 1U2DA 3H84A 3LQKA 3QLEA 4PGAA 1KSJA 1WMSA 4TKVB 5BMVF 2GXAA 4KNYA 3A04A 1DARA 3RS0A 4AX8A 4Y2UA 4AG6A 2ZAMA 4BMSA 1GKLA 1M5UA 1F48A 3BX1A 3M4JA 5LQRA 1LW7A 5D01A 2CFIA 4V3BA 4RTLA 3ZU6A 2DPXA 3KQOA 5EWJB 4AJJA 3M1YA 2OO5C 5THKA 1I4EB 2DUJA 5GY7A 1Y80A 3CKYA 4OHZA 3LU1A 2EZUA 4YRRA 5IDQA 1VOTA 1XTRA 3PX7A 3CSDA 1C3XA 2P9FA 4QQRA 1G2OA 1U3CA 2ADOA 4ISCA 4PC3A 2YMMA 5IZCC 1Z2NX 4PCLA 1TKAA 4G81A 4LHZA 3MWDB 3MM4A 4V0MA 1AKYA 2HFKA 2BGJA 4D8WA 4J2HA 2CLSA 1INLA 3UYKA 5A4DA 3EJ6A 3W2GA 3BMCA 3UJPA 3UYLA 4ZYLA 2JGAA 3DE5X 3K5WA 1DAFA 4S1TA 2DLNA 2B6NA 4HLQB 4K6FA 1F8UA 3CZAA 3KOMA 4B7CA 4ENRA 2QG6A 1VYUA 4YLGA 1KGSA 1HH4A 1U3WA 1PG2A 2B1JA 1ECJA 3WAGA 1N25A 3ENVA 5BSEA 1LEHA 2WVAA 4QPNA 5T6BA 3CXUA 3MS4A 4WOBA 1FSGA 4KN9S 1CUEA 1H0RA 3BGIA 3QU7A 2XYPA 5ALFA 4Z86A 2C4NA 3FYUB 2JJ8A 4W5NA 1FDSA 4EVRA 2ZIEA 2FPKA 2OL4A 3BFJA 1E9DA 3LCUA 1I7QB 1XA0A 5ECWA 5IBCA 16PKA 4CL8A 3LIIA 3UMGA 4AXBA 4MNTA 3D3JA 3V32A 2CLCX 1U0SY 3LK7A 5F5XA 3ZHUA 2X8LA 1XZFA 4Q4DA 2BP7B 3PEUA 4Z7QB 2X3YA 3VMMA 3OPYI 4WCVA 2WLSA 4CHTA 5K6TA 3VGJA 4HS9A 3JQFA 3I30X 5KS2A 2Y1DA 4FQ5A 3BFPA 4C9BA 2HU5A 2AA3A 1GRCA 2GN2A 4ZEOA 4FGJA 1F5NA 1U0OC 2AFRA 4YV1A 4N48A 2EX4A 5BSKA 3I28A 1FXWA 1G3RA 3BMOB 4F6RA 1AKRA 4ZCRA 1G5TA 3K3PA 3AWIA 1NKSA 3I09A 3AUJB 3T1NA 2YL2A 4L8YA 4ZKDA 2EL9A 2W2VA 2P2ZA 1OBCA 2PV0A 4YIHA 5JSZA 2X2EA 1GA1A 1C9JA 3L7JA 3PSHA 4J03A 5J4YA 4JI8B 3SOPA 2Y0CA 2ZVDA 3KKPA 5BP7A 2IHBA 5B1DA 1HL3A 1XZIA 3AKEA 4U2DA 1GLVA 1TPZA 3MMNA 1Z4JA 4J7CA 3RC7A 1ECFA 3B5JA 1M0SA 2C3YA 3JZFA 1I1OA 1TM5E 3KHUA 4L9WA 3URMA 3HDYA 4F4DA 2O06A 4XGKA 1LSJA 3KKKA 4ZHQA 2GN4A 3ZHYA 1ZOSA 2R8ZA 1M66A 5HQ3A 3RKRA 1F7VA 3IT1A 1KSFX 2XT6A 4OI1A 1OBFO 3H6KA 2X0NA 3JV7A 2AOUB 1NQOA 3FSRA 4ZZ2A 1C29B 1R6XA 2K6GA 2V98A 5C46F 4CIBA 1RXVA 3H1AA 3HA3A 3MINB 4A8HA 4BQFA 2P91A 5LQSA 4F45A 1N5OX 3TXYA 3UKDA 4HB2A 3EEBA 2COKA 2Z98A 2FUEA 1W5SA 3EWAA 4RK7A 3WYEA 1T6XA 4B3XA 4ND3A 1BCSB 2XEDA 2N9UA 1LPPA 3Q40A 5JV5A 4GGOA 1GPUA 5CT8A 1KAEA 3P32A 3BBLA 3MG9A 3KPVA 4KXLA 1LV8A 5IZCA 1XVLA 2HD4A 1KAOA 3DE3X 1LDGA 3VMFA 4C0WA 5EZYA 4CM8B 3HL4A 4R1OA 5ELMA 5FDFA 1Z82A 1IXYA 2YXDA 3HCFA 1K98A 4NV0A 4EHHA 3MAGA 4K2HA 3V1YA 4EBBA 5HCNA 4PZCA 4Q4AA 1XZBA 4ND6A 1VGVA 2FMKA 1T8UA 4OHRA 4WNYA 5EWMB 2ZUWA 4LQDA 1SIUA 1TLLA 2A78A 2PUWA 4NI5A 4AIIA 4BRZA 5ITWA 1DKQA 3KQLA 4JDUA 2O19A 1CJCA 5E4YA 2E4VA 1OSNA 1S3IA 1MOQA 2XZLA 1SZPA 3H5NA 1CRPA 4FTWA 1XMSA 1Y7TA 4KSBA 3HI4A 4MHSA 2XHEA 2HREA 2ORIA 1THMA 1GAEO 1Z47A 3LA6A 3M82A 3HWX1 5FUXA 4BECA 1DMSA 4DUYB 1SCJA 4KQ9A 4B74A 3F71A 1FJGB 1IK6A 2QD5A 4LZJA 5CT5A 4BKRA 4D0NA 4CEIA 2CNBA 3PVCA 3MWKA 2BFPA 1N2IA 5HWSA 2HZBA 2Z8XA 1DIOB 1W5BA 3C98A 1KAQA 1UDAA 1YZYA 1V7QA 5H68A 1KWGA 2W00A 3LQRA 1N8KA 1OZAA 1DZIA 2XQJA 1GDTA 3EIFA 1NVVR 3PDIB 2K7FA 2ZE5A 4X6YA 3RYIB 3X1XA 4ZJUA 1FMJA 5TGDA 1J22A 3QOXA 1YAJA 2C04A 3D2LA 4JODA 3R5HA 3AVTA 3F0TA 4FBMA 4R41A 2FW8A 3ZHCA 1NVVQ 2PWYA 9ABPA 3QUCA 3UHPA 2FY8A 1YA6A 4KBGA 1R12A 3NIFB 4LTNA 5JCXA 2NNLD 3EQ7A 1H6AA 3KDPA 4WL0A 3FPAA 4YV7A 5ENDA 3KKQA 2IZ5A 3TD6A 5K5EA 1L4NA 5KHAA 1L6IA 1E8MA 1HEYA 1MPTA 3M89A 3T94A 2JRCA 3RO7A 3H2YA 1C0EA 3ZE1B 4UHEA 4B76A 1UWLA 5JJKA 2GN1A 5HP4A 4Q1CA 4ZOCA 1YQEA 5DFAA 4MINA 3M5PA 4KVAA 3H16A 4DRZA 2GEFA 4D41A 2ACWA 1Z0SA 1V39A 2H29A 1PL0A 2V59A 2ZRHA 1RP7A 3BCSA 3COZA 3LLMA 3DTYA 4JVLA 4LMPA 3K2IA 1NRXA 4L7QA 2DBZA 3EFBA 4M0CA 2H65A 3TM5A 4DCUA 1OWMA 3BC1A 3KTDA 3LGAA 3AI3A 1BX1A 2QLNA 2HRZA 5FPYA 3PUIA 1KOFA 4NBWA 3OICA 3JQDA 4CKBB 1SKAA 2MHCA 1HLFA 2O2EA 4QAJA 4ARVA 4ND8A 1E9VA 3DWEX 4JCOA 4NYMQ 2DFNA 4I9NA 4BNTA 4MAMA 1Z2PX 5JISA 3OHPA 3K9QO 5LN1A 4GF5A 3TLYA 3VAYA 1UOOA 3PCXA 3CXRA 2Z56A 3DZ8A 3OZAA 4J0HA 2W7TA 4P80A 3KB1A 2XNCA 3ESQA 3KZCA 4WK6A 4L9AA 3RFXA 4CMHA 2QJRA 1WBDA 4PM4A 1C3LA 1M6YA 1S3GA 1GHTA 3P9SA 3D4PA 4L5BA 4UBNA 1JFRA 2BFAA 3CN9A 3I83A 2E21A 3L6OO 5D8DA 1X80A 4XM2A 4N3NA 1AK1A 4X94A 5FCDA 3RUHA 1CERA 1WV0A 4UVHA 5I3ZA 1PIWA 4MGKR 1FFCA 2FEOA 3V9PA 1SXJA 1IRXA 1W47A 4DMKA 2YHIA 5CVTA 2H00A 3CT6A 4IPTA 5KU1A 2TMKA 4Q7MB 4WK0B 1KEUA 5DI3A 2PUCA 4YGYA 3O8QB 2REBA 4P9NA 4DR7B 5LIRA 2FPSA 1Z06A 1KNXA 2V7VA 3OETA 3UCEA 4B47A 1FSPA 1YFJA 1IBRA 5AXCA 4MQMA 1QOPB 1JXOA 4M3NA 1HWYA 2Y1EA 1KY5A 4MVJH 3WTCA 4PGMA 1YR2A 2I99A 1TJPB 1IY1A 4G8CA 3CH7A 3R6GA 3GUYA 2YH2A 5K8TA 1PKEA 3NW9A 3PLNA 1SQFA 4UE6A 5AHRA 5REQA 4FXPA 2IVZA 4CR6A 2D4HA 2W6OA 1S3FA 2HL6A 1X70A 3K5PA 3BGOS 3MWEB 3NM6B 5IVHA 1XXHA 1VXRA 2VBIA 1BE1A 1WPRA 4K26A 4Y2PA 3V4SA 2EYUA 3FCEA 4M8NE 4G0NA 2DQ4A 1XELA 4TLCA 1QGAA 1GPDG 5B4UA 1ZUWA 4LN1A 4YYZA 1T9BA 4S1OA 2XCIA 3EC2A 1IN8A 3H2ZA 4C0QC 1WDTA 1ISMA 1L6RA 3LQFA 4NQRA 3O82A 4Q15A 4QBIA 4YH1A 2BHNA 4NDZA 5AKLA 1XQYA 3W1VA 1RHRA 2YTZA 4OCZA 1E7MA 3B7GA 5KI6A 1HTWA 3SVZA 1GY8A 1S7GA 5JXJA 3HBMA 1POWA 3FKQA 4RETA 4W7IA 3ZDAA 4KFCA 3OIUA 1CUIA 3WBKA 3WRXC 2FN4A 1FFGA 5KOHB 3COPA 1OFVA 1QRAA 2IYWA 3GMSA 2JGLA 3AMVA 3F2IA 1HSZA 3M83A 4MKGA 4B46A 2AW3A 1TVCA 1WCIB 4D4KA 3ZY4A 3IPXA 4KYUA 1QF6A 2C99A 2W8BA 3DL2A 5DN6A 2QTLA 1YMVA 3NUGA 4ZICA 3L0OA 2CLKB 2JAHA 3QBEA 4I1RA 2G17A 1FLNA 3JWJA 5IYZF 3VYVA 2M6KA 4F8JA 3W5IA 1CZLA 1CUHA 1ISIA 1L7MA 4OY3A 1JHQA 5HRCA 3Q12A 3NASA 4MB6A 1JNXX 4EELA 4CT5A 3CIFA 2XNSA 3QV1A 1YMQA 3STVA 4ZJZA 5BPHA 4FDAA 2VJDA 3Q9NA 4WBXC 4ZAVA 2JA2A 4URZR 5C8YA 1YDWA 1TECE 3VTAA 5GJBA 2OBNA 3I5MA 1MG0A 4EATA 4BNVA 3A8TA 1H8HD 1IZ9A 3URKA 4WVLA 5KYTA 1WTCA 1ZWKA 3TNDA 1PD1A 4OH7A 1YCHA 2YVLA 2FA9A 4ND5A 2ZETA 1E2FA 1W9MA 1TMOA 4BWYA 2B94A 2WUGA 4TRRA 4KV7A 2PCLA 1F60A 3FMGA 3QTLA 4ILEA 3TECE 2P62A 1IEWA 1XZJA 5LDGA 3DWIA 2QY9A 1BA3A 1EFHA 5TGTA 1JA1A 2O1SA 3VTZA 2ODWA 3A9UA 2JAPA 1DAOA 3P9RA 3VUEA 3A37A 4XLLA 1ZH2A 2HI0A 2JF0A 2PT9A 1GTMA 3GGPA 1I3OA 1UAGA 3I6YA 4HGZA 5DASA 1F4PA 3QVUA 4WLNA 5AIBA 3OP1A 1QHFA 4GPIB 4LA4A 3I3OA 1U9CA 3P8ZA 1K68A 3FPCA 4HFNA 4N3CA 5DYNA 3UICA 4JVNA 3EARA 3IJRA 2H92A 5DULA 3IEVA 1RQRA 1IXKA 4ZRDA 1RC0A 1VCNA 2A9JA 1AKWA 3HDJA 1HURA 1SUIA 2A6PA 2GCNA 3A6FA 4IHAA 4KRGA 4RKFA 4YVFA 4HWSA 3QG1A 5DTJA 2XCQA 2MIIA 4YBZA 1HE3A 1B6GA 1XZAA 4C87A 4ZV4A 1UBMS 2ZDQA 3MMXA 4X45A 1DHTA 1UANA 4OXIA 3M8KA 4J1SA 2A9KA 3NDPA 2G08A 4KPGA 3PGJA 5ESRA 2CMFA 3EDRA 2BM0A 5A7GA 4F6RB 1GR0A 1ISHA 2QU8A 1N1MA 1RJEA 1T5OA 3LO8A 4QYIA 4XFJA 1U80A 3AY3A 2H0QA 5SYAA 1MQSA 1P75A 1QLWA 4Z99A 1T0HB 4BP9A 5ALGA 2C2OA 5JSZB 3PF9A 4L73A 2CL0X 2O57A 5CH5A 3GMDA 3I45A 3QPBA 4ZT6A 1LNQA 5IJ0A 4LVCA 2PPLA 4X93A 4PNEA 4JOCA 3MWFA 1UJMA 2RG7A 2G1AA 4BO2A 2VNJA 2P4UA 3DUFA 1KEEA 4ZYWA 3PQ4A 4KK4A 2H16A 1KJQA 1L3CA 1OAOC 3TQQA 2VPPA 1GG9A 1PNQA 2QD3A 2FK8A 4ZHQB 3D6VA 3TR0A 3WRXA 2G5GX 1O94C 2F4NA 3HXPA 3RTCA 1BG6A 3UIEA 5HQ3B 2XMRA 4HNUA 3WV4A 2ZDGA 5EN4A 2QMHA 1T1IA 1UPUA 4MEAA 3H5IA 3IUBA 5C8VA 2VJMB 4RH3A 3F2VA 1FX1A 1COWA 1U90A 1QIGA 3D9QX 1QMGA 3JYNA 3QJGA 3GN2A 3PUXA 3GGDA 4LTMA 1NVUQ 1T9GS 4H6WA 3R76A 3LGSA 2A5GA 2DJIA 3ZY6A 1X1DA 3AI7A 4CMIB 2ASEA 3ESZA 4NOKA 3G13A 3LTEA 2Z6QA 1E6CA 4PLHA 1SRRA 2YN0A 1KEWA 4M60A 4DNFA 3A4MA 3REGA 1TQ6A 4PAGA 1Y7IA 3S0JA 5JAOA 3HP4A 5BV0A 5EZYB 3GF4A 1ZCJA 4TMWA 4CN8A 3JQ7A 2VHUA 1TMGE 5AUOB 3FJ1A 3KZNA 3C6XA 3QVTA 4ZCQA 4ID3A 3OLZA 2J31A 3ILHA 4I99A 4NE9A 4UAVA 3TXAA 2OHFA 1UBHS 3QVKA 1I2ZA 3UT6A 1CS0B 3WWYA 2J5KA 1WWKA 2HA0A 1DEKA 3I9JA 3AONB 2BFMA 1MN6A 4XQCA 2IOQA 2CYAA 1AOXA 2JGDA 4X20B 3UFXA 3VYSB 3IV6A 4CL0A 4YXWA 3MJ4A 3DDZX 2CVOA 1U3TA 3TLZA 4ARZA 3VTKA 1OKKD 4X00A 1S8OA 1JU3A 2D5AA 4I19A 5HQJA 2FMFA 1VGRA 2RKOA 3MJEA 2O2XA 4CCWA 4QKQA 2V5VA 1P5ZB 3PUZA 5BR1A 5IARA 1NNSA 2H2IA 3WLNA 4CEIB 2X9NA 3TLCA 1U3VA 4YJ3A 2AC7A 2E37A 2WMNB 1AE1A 4J90A 3DO5A 4P33A 3ZPXA 3ZDFA 5ALUA 4GI7A 2I2WA 4E32A 1RZRA 1N2BA 2B98A 2RHTA 3A2KA 1JI0A 1XLVA 1RJWA 1ZFNA 4R5MA 4RFLA 1GD1O 1U0NA 2A0XA 4DJDC 2CHEA 5EHZA 3GFOA 2G4LA 3MRTA 4LXYA 3PGA1 2JLUA 4AUNA 1FYEA 3QX9A 5AM0A 3LA8A 5IAKA 3DOCA 3QM1A 3IC5A 4ZRMA 4JLKA 4Y2QA 3C6MA 4GP9A 2FPLA 2XQVA 4KQEA 2XJ4A 3I9KA 3RM3A 1TEHA 1THGA 3G8BA 1S8FA 1FA9A 1PL8A 4J1TC 1BIFA 4MA4A 3FGZA 5DHSA 2WNHA 1YRHA 3GX1A 3QKUA 3I62A 1QV6A 2AXQA 4ZK6A 5BUQA 1PJSA 2ESRA 2C8KA 1ID1A 4HQ0A 4XSHA 3VC1A 2VIIA 4IKOA 1XVAA 4MKFA 3SYMA 5KYWA 1OBOA 3GELA 1W4AA 2H2WA 2HIAA 3KOXA 3THSA 2BY4A 1N2JA 5F9HA 3DM9B 1E1MA 1K5HA 1O94A 2G7ZA 2QLJA 3ADKA 3AM5A 4WJLA 3LCRA 4W5TA 5KYXA 3AHGA 3O4GA 2RARA 2BGUA 1U99A 3F6BX 3KXIA 4MVJM 2OD9A 3I2GA 1M9NA 1C7FA 2GA8A 3G59A 1QVRA 2HQSA 1W30A 2VRCA 5JPDA 3M4YA 1QQTA 4KQGA 5EG5A 3ZWBA 5A5EA 1XNQB 5BQ3A 2O0HA 4MJ3A 3F3KA 4MGEA 2ZS8A 1XQWA 1C80A 2AQKA 2WW8A 3X43A 4CG1A 5KYKA 4P53A 1G8PA 4I3HA 4G1VA 2H85A 1SD2A 3GJ6A 1NW3A 2WOOA 4RY2A 1JU4A 3KHKA 2Q1WA 3GD5A 2RAFA 1ZM9A 1JW9B 2C5HA 5LJLA 4R69A 1WUHS 1GNPA 3VU3A 2NZ8A 4BATA 1Y3BE 1PLKA 2D3WA 4K6GA 4LRUA 5HJ7A 5EYPB 2H5JA 3A0UA 4RLFA 5C8DA 1XJ0A 1S2OA 3TPFA 1LY1A 1T2UA 3CJQA 1N5IA 3LY8A 4M8IA 3LF2A 5IFLA 1UBJS 1ZKMA 1PYOA 1LD3A 3K92A 3R4CA 4INAA 5FL3A 3S44A 4P3YA 3H7IA 1X80B 3CLSD 2CFSA 3AI1A 1EJ0A 3BMNB 4JT4A 2JZNA 1BRTA 5K3FA 4DA6A 4HY3A 1OI2A 5IK2A 1J8DA 1NNLA 1KO7A 4HUJA 4KWIA 1SXJB 3NS7A 4TMFA 1ZEMA 4WAUA 2GEKA 1E7RA 2QL6A 1WXEA 1CB7A 2Y0BA 2Q5CA 4WCFA 1G17A 2FZ4A 5D1HA 3RAGA 3T95A 2NGRA 4JR0A 3JVDA 3CONA 5JAMA 2G83A 1I94B 1ZK3A 3BFXA 5HZKA 1HYBA 4LYYA 4I9HA 1OV6A 2B8JA 2Q28A 3ACDA 4EIWA 1JT9A 4KSYA 4MHOA 1A8HA 3BZUA 2LR0A 1GGKA 2PL1A 2ZTMA 3T9AA 3C39A 3GB9A 5BNIA 4P5DA 3I2JA 1Y6QA 2REQA 4Z9FA 3IUNA 3WLJA 2IS4A 4R1MA 4I4CA 2XBUA 2LDXA 5REQB 1XL1A 3DMDA 1E9FA 4HS4A 3IUYA 1Z6XA 1GTJ1 3UT0A 2NXEA 2HMSA 4AS2A 4MYHA 2FSVA 4IIXA 4DV5B 1C1XA 1GQ2A 4FLEA 1E1CA 1XXHB 4BKQA 3W7BA 1MJFA 3GBPA 3QLVA 1WW2A 4BQRA 4J3FA 3RRBA 1AUOA 4GBED 3WMWA 4WLUA 4CV0A 1ZNZA 2P90A 3SJCA 3VNRA 3DNPA 4RJLA 2XGJA 3F8SA 2QN9A 3EXFA 3RS2A 5JSQA 1MR3F 2I80A 2I6QA 3DO6A 4RVSA 1APBA 1KK3A 2OLEA 3A7EA 4N3AA 4IW3B 3TTWA 3LDFA 3J7AC 1UC4B 1L9KA 2A0FA 4R8MA 3KL4A 4UCWA 5CFMA 2ENUA 3EB9A 3H9EO 5F1OA 4JQSA 2XB6A 2AL7A 2YOGA 4RVUA 3DOEA 3CJRA 4M1YA 1UCFA 3PHJA 4KAXA 1DJOA 1X94A 2AG6A 2XGGA 3BE6A 2WUEA 4GNRA 5FADA 1JA9A 3N2YA 3A2NA 4HWPA 1J5XA 2XTNA 3HB1A 3DLBA 3DEJA 2I2FA 2HHCA 5E7JA 2FNAA 4BVEA 3NWJA 4UJ5A 3QENA 2XB9A 2CJFA 3VAZA 1U6IA 4CW7A 2W8BB 1KKLA 1LF0A 5JMWA 3CVVA 1JWLA 2GBCA 2HU2A 5BUSA 3U44A 4RVGA 2OV4A 4F4JA 4G63A 2NO5A 1A2BA 4KLAA 1Z75A 3TCKA 5HZHA 4AKTA 1SBIA 5AKYA 3FOWA 3CF6R 4KXUA 1RMYA 3A36A 3KT3A 2HMWA 3L07A 4U7PB 4W1PA 5H82A 4RTNA 1PNRA 1SOWA 4CL3A 2QHXA 3PP8A 1AZTA 4DJEC 2E0IA 3BIOA 3R77A 4GYKA 4TSKA 4GKJB 1NVXQ 2LGJA 4FINA 5I4IA 2Q2QA 3NHLA 5C8YB 3QG5A 4ZJPA 3DG9A 2W93A 3EISA 2HWUA 4KQFA 3DZGA 2I4OA 3GFFA 5AKEA 4TTAA 1JHDA 2DR3A 3JYLA 3GYBA 1ULZA 1VRWA 4HADA 1F17A 3HXKA 1J2YA 2V1XA 2WHQA 2FPWA 3HJTA 2P30A 3LLSA 1JDNA 4UNIA 1X1CA 3ZW9A 1BKYA 3I5AA 1HE8B 2UZAA 3KK0A 4TSFA 3OT4A 1Q12A 5CH3A 3Q7IA 3RUEA 1E8DA 4PVCA 3UJ8A 4BC1A 4A0FA 3QLUC 1OASA 1XZGA 3NT2A 1BCRB 4FIDA 3AF6A 3KCQA 1OE0A 2BDTA 2DC1A 5C8XA 1NOJA 1QH0A 5KQGA 4CF4A 4UTOA 2OCXA 1BX0A 4XIYA 2OBXA 3T4XA 5K0TA 1TT5A 4GMFA 4HXGA 5EXPA 1KETA 4RELA 4HAOA 2BSQA 1CQJA 1DMRA 3T3NA 2Y68A 5AOVA 3OHMA 3QEMA 4LSMA 3SSOA 2UDPA 1Z83A 4QVKA 1RTKA 1IDN1 1UDRA 1JR6A 2C4VA 2J7PA 2OO3A 3MCWA 4P38A 1Y5NA 1E2JA 3MT0A 4NAVA 1L8XA 3K1TA 4LGYA 4QYIB 2ZUFA 1L1RA 4R6XA 2ZJFA 4W82A 5CCXA 2XW6A 1AXEA 4RK6A 5A4KA 4BN0A 5GJWC 1NUAA 5L40A 3I4LA 1GARA 3AI2A 4ZVVA 1OJ7A 2W5UA 4OL0A 3ZHSA 2A9RA 3U0BA 3QSGA 2WYVA 3HZRA 3LC2O 3K0CC 2WJHA 1PX0A 2C59A 4LF9B 1HE5A 2HBZA 1OLUA 4B3FX 2G06A 1VMAA 1KEEB 3DUFB 5MDHA 2GESA 1U3DA 3O0DA 2V45A 1XZDA 2J9RA 3MLBA 2ZKLA 4OLFA 1P61B 5AHXA 4DCSA 1QG0A 4DQUA 1UEJA 4BFXA 2GHRA 1A69A 2ETVA 1W36C 4GEKA 5HFJA 4IVPA 3HHEA 4FT2A 4Q4LA 5CIQA 4FCVA 5DMXA 2ZRKA 4CMBA 1NPDA 2W90A 3BF7A 3QE4A 1T4MA 2GPWA 4OQEA 3IB6A 2AD5A 3I34X 2JATA 2F1OA 1Z2EA 4IZOA 4Y6PA 3SIWA 3VH3A 3CVUA 3ORSA 2HF8A 3NBKA 3NTVA 2R4QA 4X60A 2HJHA 4NFYA 4YAIA 4RTPA 3R41A 3T34A 4BXOA 3NIDB 3A6EA 5AK3A 2JPDA 2VBFA 3P2KA 1ZGBA 4X7RA 4Q02A 4L7VA 2OV6A 3LI2A 1QM5A 3KDSE 3OKCA 4M1MA 1U2GA 1XTTA 4F9EA 3OF2A 3FWNA 3MB8A 2HHLA 3BZWA 1FFSA 1CJBA 2XRFA 1L4MA 3JQ7B 1MP0A 4JBWA 1ICEA 2EEPA 4RXUA 2PUFA 3EC7A 3CVWA 3OCZA 4MWCA 3IMCA 4BLTA 3PJRA 4FYIA 3ZU5A 4DRYA 4HQRA 4WKNA 3FPSA 3H8JA 4H7PA 5EHQA 1YE5A 2PPVA 1W4BA 5C1IA 1IWOA 2VAXA 2DKOA 3E82A 3CLHA 3UFXB 3K9FC 2ID4A 2X2OA 1H2XA 5HYVA 2AMVA 1B8OA 2N42A 1EVQA 1T8TA 2WKQA 1VL6A 3BMQA 4ARZB 4D9HA 3VBCA 2NAFA 2QZ4A 4F21A 3U60B 4Q19A 5BN1A 4R8VA 1HFEL 5KPJA 4LDNA 3MJDA 3ZHZA 3WHLA 2FPMA 1IUPA 4OMCA 4UXHA 1L5OA 3S2YA 4DXDA 2NZXA 3HU5A 3AR6A 3W3AH 1YL6A 3N70A 4ZZ1A 2NU9A 4IHJA 4YJ3B 5I01A 2B9EA 2CMDA 4FWTA 1IJKA 3W5JA 1E58A 1JSRA 3PRJA 1XHFA 4QRIA 2NX2A 4QTZA 5CVCA 1RKUA 1O57A 1Q92A 1W6UA 3H4IA 4DXHA 4YRAA 3AZQA 4FHDA 3HL0A 3KB8A 3KXPA 1K4MA 3QWIA 3ZV5A 4WINA 2VNHA 1OX6A 4JKYA 1XZPA 2Q9AA 1ZRMA 1I3CA 1T3GA 1EWRA 1I0LA 4DLVA 5I51A 1DRJA 5K0ZA 1P72A 1UMDA 4AMUA 3V9AA 4TL7A 2P3LA 4DQLA 1PT7A 1W4CA 2H7CA 4RK4A 4JX8A 3QELA 3VR6A 3DAYA 2PKQP 3A1VA 3HFRA 3I04A 3PI7A 4Q93A 3RU3A 3WLEA 2EIHA 4BX3A 3K1ZA 3VPSA 5IVPA 1Z9BA 3ZJYA 1YQQA 4H7HA 3CMCO 3VDMA 2WU8A 3ETHA 3K0CA 4AX4A 3LNCA 5BSGA 5IHPA 3A9WA 3ZHVA 1VCOA 5KYWB 3MIIA 3NTQA 5AJYA 4L08A 4TMZA 3TZEA 2CEAA 5HG0A 3O74A 3WGHA 3F6CA 3BWMA 3VR5H 1WNTA 4U63A 3ND7A 5LLSA 1GZ7A 2Q3DA 3TIVA 2PMKA 5KYXB 4N7BA 2VYNA 3L82B 4XUGB 1NWCA 4OJNA 4TWRA 1QE5A 4XVQA 3U1VA 3LUFA 4DPKA 4F60A 5IC6A 3CEMA 4ITVA 3ZV3A 1L0BA 4XD7A 3BT7A 3EZ9A 1NATA 3GWGA 2AMJA 4OEHA 4ZO8A 3SD7A 1LPMA 3WNDA 4KN6A 1P77A 3ZS8A 4AF8A 1RADA 2YDYA 4TTJA 1MEEA 2O2YA 1MZPA 5D87A 1WP9A 3NBYC 5JAPA 4KXFB 1WXXA 2A86A 4ENWA 2X9GA 5DBIA 1W44A 1LK5A 5TT1A 4RY9A 4FNOA 3HMKA 3ONDA 3RE1A 4M38A 1NBMA 4FOTA 3OE7D 3L7NA 1DXYA 3SJBA 1IC6A 1KZ1A 2IIBA 4X0EA 4XVRA 4KQWA 1I4LD 1PNOA 4O4JF 1CZOA 1IMJA 1VRVA 1TZ2A 1Y3AA 3MYYA 5AO9A 5LDDC 3NAZA 4BNDA 1WZEA 4RJKA 1FFBA 2P0YA 3D43A 5KOIA 5K3FB 3V97A 4L5IA 4QUEA 2JIZA 1JS1X 4B85A 1QGOA 5EIFA 4EPTA 1PFVA 1L4HA 2CXRA 4RL6A 5JSFA 1VDZA 5CK4A 1GU1A 3I0ZA 5SY4A 3LZCA 1PWXA 1Z4IA 3EG9A 4WHMA 3VNQA 3DLTA 1GKUB 2ZR7A 3P27A 1S8AA 3RW9A 1PZMA 1WB9A