3ZY2A

Crystal structure of pofut1 in complex with gdp (high resolution dataset)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
356
structure length
342
Chain Sequence
ATDPNGYIVFCPCMGRFGNQVDQFLGVLAFAKALDRTLVLPNFIEFKHPETKMIPFEFLFQVGTVAKYTRVVTMQEFTKKIMPTVWPPEKRKAFCWTPRQEPGCHSKEGNPFGPYWDQIDVSFVGDEYFGDIPGGFDLKWLEKFPSEEYPVLAFSSAPAPFPSKGKVWSIQKYLRWSSRITEQAKKFISANLAKPFVAVHLRNDADWVRVCEHIDTTTNRPLFASEQCLGEGHHLGTLTKEICSPSKQQILEQIVEKVGSIGAKSVFVASDKDHMIDEINEALKPYEIEAHRQEPDDMYTSLAIMGRADLFVGNCVSTFSHIVKRERDHAGQSPRPSAFFGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Mechanism of Protein O-Fucosylation.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Transferase
molecule keywords PUTATIVE GDP-FUCOSE PROTEIN O-FUCOSYLTRANSFERASE 1
total genus 114
structure length 342
sequence length 356
ec nomenclature ec 2.4.1.221: Peptide-O-fucosyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11340 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zy2A01
3.40.50.11350 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3zy2A02
3SIXA 4AP6A 3SIWA 3ZY3A 2HHCA 4AP5A 3ZY6A 3ZY5A 2HLHA 2OCXA 3ZY4A 3ZY2A 2DE0X
chains in the Genus database with same CATH superfamily
3CN7A 2GPBA 4FR0A 4B31A 3RUIA 2VDKB 5KU1A 5TGDA 2CSXA 2K7ZA 4K9KA 2J9YB 3A1SA 3O3OB 1YK0A 5KQGA 2B37A 1XLTC 3GPDG 4KPGA 1CQWA 2WUFA 3EYWA 5CUQA 5EGSA 1MX1A 2FE4A 2HMVA 3P2JA 4P34A 5DULA 1PD0A 3CJRA 4AQDA 2ZWIA 2QMZA 4NU5A 3P4YA 4YLEA 3SP1A 5BP7A 3PQDA 4X7RA 4F56A 1YGPA 1NVKA 4ROTA 4LRYA 1HLGA 4V0LA 5LA6B 3W2IA 4DDWA 4F6RB 3KQWA 1IZYA 5IKOA 1U0FA 2ID8A 1ZH2A 1P5RA 1WSDA 3UOWA 4IIHA 5E4JA 1T2CA 1N5MA 3COWA 1PV1A 2UYGA 2W43A 4DR4B 2JLVA 2V5UA 3L1UA 3MLBA 2A67A 4J0QA 3ED5A 4JLBA 3L7MA 4M53A 2VLBA 2GESA 4JEIA 4TMWA 5K0GA 3TDMA 1BE1A 4QSMA 1PX0A 1BD4A 1E7YA 4RE6A 5LA6F 2PYZA 3VISA 3VKFA 1CQJA 4I3FA 2X8AA 2C5AA 2AI3A 2JFBA 1U31A 2W71A 4NCNA 3K70D 4EY7A 1MENA 3J7TA 1I3LA 1KSFX 1E1RD 1W85B 3THXB 1PHRA 5JISA 1N4DA 3I58A 2WKQA 4LNUA 3WZ2A 4JODA 2KX7A 5HF6A 1U81A 1Z0DA 4MS1A 4PX3A 4QT4A 5AKXA 3RFCA 3N8HA 1OTHA 1PLKA 2EW2A 1FDUA 3CRMA 3UWSA 3K70B 3FPCA 5T3UA 1FFXB 1TC1A 4MVJA 4X60A 5KSZA 4RHYA 4EFLA 1L7BA 2IEYA 2Y1EA 4KHPB 1YFZA 1R9MA 4R8SA 4BX0A 1HYGA 2NQ2C 4I9FA 1KP2A 1P3Y1 5EP2A 2X9NA 4MV5A 4Q4AA 1R0SA 3KKNA 3SG0A 2O06A 3UPUA 1UPFA 3B5JA 4IL5A 3WADA 2IOFK 3NHSA 3AW9A 4NXMB 2VATA 2I8LA 3B6IA 4Y1FA 1YDFA 3RYHA 1YWGO 2V6MA 2FR0A 3T7RA 1JHVA 3D1JA 1RXCA 2GN1A 2OO3A 2RG7A 4DUGD 4MDEA 4PLTA 5B58C 2V9CA 1DG1G 2OQIA 3ETJA 1NKVA 3CLHA 3GDOA 3VO1A 2DKFA 4F11A 2H5LA 3KOXA 2YJ3A 2VS1A 5CVDA 5EQFA 3R0XA 5BN4B 2VT7A 4KR2A 2CCKA 1UBEA 3FN4A 4RSGA 2GPWA 3A2LA 1THMA 1WHTB 2FP3A 3CT6A 4GX1A 4J0IA 1G8KA 1YZUA 3IX7A 2Q4EA 3L46A 3OICA 5EXEA 2ECPA 5JAZA 1D0VA 1O9BA 2M6SA 3NXSA 4KRYA 5D7BA 2NM0A 5I7VA 3KTAA 2HCFA 1OBFO 2OFOA 3AHFA 2GRAA 2I6SA 4G0ZA 5AM0A 1SZJG 1FW6A 3OOHA 1G19A 3CKLA 1II8B 4BYGA 1QZZA 1IJEA 2CNWD 3GEHA 3CA8A 3CRW1 2SCUA 3D7NA 3O9MA 4B74A 4BO1A 4D8WA 4PPNA 4ZGWA 4HMPA 4CG2A 1Z0ZA 1COWA 3K1AA 4AUNA 2X8LA 3CM0A 3S1AB 2E48A 2HGZA 4G2NA 2VDQB 4G0MA 2GM9A 4YALA 5AVKA 5CA1A 1PWHA 4KFTA 1P91A 1USUA 1EDEA 3DL0A 3TDKA 3QKRA 3SJUA 1B6SA 2PL9A 2BCJQ 1TUBB 2G9RA 1HDXA 2Q99A 3I45A 3LV8A 4HG2A 4C29A 5IAOA 4R1OA 2O2JA 1OAKA 2XITA 1B15A 1BO6A 3R5SA 2UZ1B 5AOBA 3SD7A 1S9HA 1PW7A 1AZTA 1H05A 2R79A 4YO8A 2VDPB 3OC6A 2B8JA 1NYQA 3DZHA 3D4NA 3GUVA 2FRVA 3LQQA 3COZA 5CT9A 1Z8HA 1GQ2A 1W4BA 4L5BA 4RJLA 2DU8A 1UANA 1I4EB 4TMKA 4YV0A 1RRMA 1ZITA 1EWRA 3OZIA 4Q9DA 4L0MA 4QEDA 1VXRA 4UVGA 3JQRA 2JPDA 3H75A 1W5TA 4WOKA 3C41J 4XTCS 1YSCA 2P5TB 3D5EA 3TOZA 1RWBA 4PCLA 5ALWA 4CVNA 1R12A 1R6VA 1TT5B 3O8NA 3OA2A 5CPBA 4AZWA 4HGPA 4XRGA 2FPGB 4WL0A 4W6QA 3KQYA 3QOYA 2Y1KA 5EOVA 1NNSA 3V8RA 3V6LA 1NG9A 4MV7A 4DQ0A 1X38A 2JANA 1XAGA 3A6EA 3AV0B 3L3BA 2EBWA 4UUQA 1MX9A 2ZBFA 1CRZA 1CZLA 3U3ZA 1V5IA 2ZSDA 4TOIA 1I0ZA 2QNBA 3H87A 4LE1A 3RPEA 3KT6A 3CKMA 2POCA 4EA6A 3F73A 5PNTA 4DR1B 1GPBA 5A9SA 3L0OA 1H0KA 1SU4A 3II6X 4Z0PA 4ZQCB 5JDCA 1ZCBA 1HEUA 2RHOA 2ZRIA 2VZ9A 5G0WA 1WBBA 4TT3A 2VRCD 4IZOA 2WJHA 3ZV4A 1V2GA 1SA0A 3K31A 4K9OA 5ESWA 3QUTA 3RYFB 2E87A 2V59A 2YY5A 3I34X 4KCGA 4UASA 2H11A 4AQ7A 2R68A 3LCMA 1M9NA 1M6VB 4HQOA 1VI6A 2YZKA 3UUWA 5IM5A 1DT3A 1SKQA 2XA2A 2QAGA 3C45A 3RREA 2I99A 2RE8A 2PUBA 1TW3A 3BHIA 4BMNA 1T5IA 2RHGB 1XJ0A 1SKUA 3C7DB 3I4FA 2V7QA 2XLBA 4B09A 4Z7NB 1H94A 1KI1A 1M1ZA 1GQRA 1MC1A 2BI4A 3JQBA 4I36A 2NO4A 2HNAA 4L4YA 2ECQA 1W94A 2YZMA 4MW1A 4H59A 3ZQUA 3CRNA 1U1GA 1XEFA 3GC6A 1FFCA 1QCZA 2GT1A 4R7TA 3Q41A 4OYRA 1R64A 1VRVA 4QOFA 4ER7A 2ZKLA 2X0KA 2H0AA 2GJ4A 1H4TA 1KBQA 2N1MA 3PQ2A 3W5IA 1ENPA 2QW0X 2QTGA 1Z56C 4HDNA 5EE9A 4O4JF 1OC2A 2BELA 3L7KA 4C08A 3FXAA 1TQDA 4F2HA 2JC3A 1E61A 5BORA 1U2DC 2A2ZA 4U8HA 5I9LA 1JI0A 2X40A 3IELA 5C31A 1IM8A 2F43A 3PC8C 3SQLA 1FX0A 3LTNC 3A4NA 2YHIA 3HNPA 5JH7B 2W42A 3IODA 1IN1A 3TOXA 3PRKE 2OKCA 3ACBA 1HQKA 2JD0A 2PX2A 1QRAA 4C4PA 1FRVA 2PSSA 5AK0A 3FCCA 1GPDG 1RLJA 3CC8A 3BD9A 1LDBA 1O0BA 1U3CA 4H4DA 3V2GA 5E6RA 3O0DA 4L4ZA 3QX9A 2XTAA 3NTRA 4HNRA 2I7CA 3NU1A 3CE9A 4DCNA 2W90A 3I9V6 2WYOA 2C8VA 4RABA 1T0JB 3IALA 3IMCA 4PNHA 3LPDA 3PE4A 4LHXA 1VTKA 1II8A 4IWYA 3ZE8A 4M22A 5K5EA 4LC0A 4DILA 1H8HD 1X13A 1NG1A 5K0ZA 4DE5A 2NTNA 4HEHA 2EX0A 1U9IC 5BVHB 2DJ5A 2VP0A 4MB0A 2XUIA 4MCHA 1J2RA 3NORA 3HM2A 2Y3IA 4FOPA 4DBZA 4FNOA 4GQBA 4JB0A 5CFOA 5CJ2A 1NNUA 2OG1A 4UDNA 4DRXB 3N59A 2BGUA 3FDIA 3VSDA 4HAUA 4GWKA 2ONKA 1V8OA 3NEJA 2DY0A 3EVGA 5H9VA 3I76A 1D2AA 2GXQA 2WAMA 1ZINA 1U04A 3ZQKA 5KHOC 4FM9A 4B6OA 2J8ZA 1D4ZA 4ZXFA 4N7MA 4PG6A 2JJ2D 5ANRB 2HA7A 5JS2A 2CYAA 3AR9A 2G88A 2NUTB 3IJEB 3WGTA 4EJMA 1U7HA 2QE7D 3ELWA 1SQFA 4ICIA 4MW7A 1MTZA 2OZKA 3UKOA 1U2EA 3LP5A 4RD4A 4D98A 1T9BA 1H4SA 2BR3A 2V03A 3H2IA 1L7MA 1UR5A 2MTBA 4GQIA 1P7WA 2GRUA 4ID9A 4PTLA 5JSHA 1VHDA 5TARA 4RTQA 1WULS 1HURA 5ALJA 1C8VB 3NO4A 1EVKA 4W1PA 3UPDA 2O3SA 4XWYA 1NLFA 1H66A 1IOWA 1SMKA 5AVUA 3IPRA 3O83A 4UD2A 1NUQA 3HI6A 4YAKA 4YMVA 4DCMA 1RCFA 4FFWA 2GN0A 2GWHA 3ZHBA 3GRPA 4PGFA 2PE5A 2BBTA 2EOAA 4D97A 4DY6A 4F85A 4WY5A 2C7QA 2ODQA 5LZ9A 4UUAA 2FG5A 1VJGA 1FJHA 3QVVA 4D56A 5JLJA 3R4VA 2OC9A 4Z99A 2J3QA 3H2SA 1U3GA 2QN3A 3FCUB 3LCUA 2OA0A 2R751 1ZGCA 3FSEA 3ILSA 3TQQA 4N3CA 5LSAA 4OKIA 3ISJA 3UOAB 3W2GA 4AI6A 2VBCA 4OQLA 3FTQA 3U3XA 3ZGZA 3F5FA 2J0QA 4MVJG 4TM7A 1KYQA 1PEDA 4C0JA 1F8GA 3IA7A 4S1VA 1BVYF 4DR2B 3ZDAA 5JBQA 3A9RA 5IJXA 3O3MB 3OCJA 1VPDA 4X7BA 1KO8A 5KAPA 1F60A 3KEQA 1YMQA 3INNA 4BNVA 2DGDA 3PFKA 4ND2A 4JZYA 1JKXA 4KR0A 1K7CA 2PZLA 3ILVA 4WW0A 2O20A 5K4HA 1JNYA 4YMUA 1NMXA 4BAUA 4L4SA 5C4MA 2COKA 1EQAA 3PX2A 2WWHA 5FBHA 2FSHA 1SUWA 1Y7PA 4B9EA 1Q0LA 1XZIA 5I7SA 3FROA 4N49A 1L7QA 1ZU4A 1JYEA 1RWXA 1ZCAA 3BIXA 3QVWA 4GHWA 4AF7A 4AMUA 5EPEA 1JG6A 2BHRA 4IXNA 3ZW8A 4COOA 5CFNA 5EZQA 1DEAA 3B60A 4RCVA 1U63A 4UZEA 1AN9A 3E9RA 4ITUA 3NBQA 3H1PA 1DFIA 4YR9A 3AUYA 2IWHA 4Q37A 3T8YA 5DHPA 2CL7X 1FRNA 2WFZA 4FFNA 1K4KA 3F74A 3GHYA 3LH5A 4YT4A 4HDRA 5FEUA 4LF4B 4EVQA 1RRFA 1ULTA 2NUAA 3ITKA 4XPIA 2GM4A 1C1HA 3HSYA 2P3LA 4JUCA 2RHCA 4YRMA 3KOUA 4DV5B 2WYVA 2X1HA 4ZT3A 3L1KA 3I2HA 3OTQA 3AR8A 1TC2A 1PNVA 2QL6A 1DG9A 4EO7A 3O8LA 2CVPA 5CYOA 1D9XA 3FKSD 1CR4A 2IE0A 2OXFA 5GV8A 1RXUA 2PGXA 4WXHA 4XX1A 5HP4A 4ROSA 3CN9A 3EGCA 4ZEWA 3NYWA 3QE0A 3QMVA 2WQ7A 4FGUA 1ORIA 5LQUA 1ECJA 2GD6A 5KYUA 2MT9A 4UMDA 3HCPA 1U2ZA 1RTTA 4JGIA 3V5NA 2C31A 4ZAZA 5JT1A 1FYEA 4KFRA 5D3ZA 1WUYA 3VYUB 2FWAA 3FYSA 2FWPA 3MD9A 5JHHB 2PKWA 3IPXA 4LJAA 4ARBA 2D5IA 1LI5A 2RC6A 5EKXA 3RSHA 4F3NA 4AN4A 1J99A 2VJKA 1SZCA 5KVSA 2GBFA 1X8LA 1V5GA 1DKOA 1CVRA 5D3QA 2RIRA 3ML1A 1JBEA 4E31A 4FB5A 5JY1A 1GG8A 1QLWA 1YL5A 2H3EA 4C76A 5EIHA 5CH8A 1GKIA 1NRXA 2J4CA 2H7CA 5ECYA 3VHXA 1T1EA 3HRKA 4J3FA 4MP8A 5CRIA 4U1RA 3SXPA 3V34A 1U2TA 3BL5A 2Y67A 2YHSA 1EGMB 1F9EA 2LV8A 3JQCA 1H2AS 5BSVA 5LQKA 4A6EA 3SR3A 4RMIA 4ZZIA 1I94B 2PM8A 3TECE 3AF6A 4CTNA 3GPLA 1JZSA 3GI1A 5KWIA 1R9GA 5KS2A 2P2GA 3DMTC 1VBNA 3PNQA 4Y6PA 1NGSA 3HN6A 5IAKA 3X0DA 4GBED 4Q3OA 1F8FA 1SC3A 2QVXX 3L0IB 4E7OA 2KSQA 3CO5A 4QYXA 2PX8A 4HS4A 5JPIA 1V37A 3DBHA 3KVYA 5E0OA 4ZJZA 4ZI7F 3ZTTA 4GBJA 4Z1MA 1V8DA 2VCHA 3OTHA 4LWOA 1Z45A 4ME6A 4U2BA 3RBAA 1EFPB 3BMNB 1OI2A 4JZKA 2A94A 3PIDA 4UD6A 2O7QA 2OHIA 1PJ4A 4OG2A 2FX3A 3L0YA 2IPOA 3P2IA 4Z86A 4BP1A 2XLCA 2C95A 2C7GA 3DOOA 4QLAA 3PRHA 1XPOA 1T9KA 2IHJA 1I1HA 1XVTA 4G41A 4QDOA 5FNZA 2FG6C 3ZJVA 3VM6A 1FFEA 4P93A 4XX0B 3B78A 2AFHB 4GP9A 1MQSA 4UARA 2H9IA 5F9FA 2I7TA 5GTDA 2NLOA 4NFHA 1D2NA 4C7MA 3SEAA 4X95A 1YU6A 2EARA 3N9IA 4CMKA 3JX9A 4OFZA 1X7GA 2PXCA 3IEUA 4N3AA 5HF8A 1DS6A 1XHFA 3UUGA 3KB1A 4D2IA 1W0JA 3O75A 2AFIB 1E0DA 2VQ3A 4ND8A 4TROA 3VVBA 1TI7A 1UBLS 4LGCA 1NN0A 3LCJA 4HLQB 4ABYA 1WOYA 1ZA2A 2F17A 2IP4A 3LX4A 3OQ6A 4PX2A 3LO8A 4R2MA 4WI1A 5K2MA 4M0EA 4HBGA 3UMYA 4MJXA 5CT4A 1BE6A 3X1WA 2O1WA 1AUVA 3LOPA 4LGMA 4A92A 1CKEA 1G8HA 1M67A 4MS4A 4PO9A 4PE5B 4R8VA 5J3JA 3FNBA 4QPJC 3F5DA 4Q6BA 3AM3A 1OB5A 5ES3A 4BQSA 4R9RA 1ZR2A 3K0AB 2VPXA 3WGNA 1OH6A 3QWHA 1A50B 3WGGA 221PA 3W5JA 1XBTA 4JX9A 3TLGA 2W4QA 1BHQ1 3O8OB 4XSVA 5DXJA 4Z4HA 1RQNA 1QANA 3S5UA 5IWAB 4MQ6A 4EDFA 3NWEA 4LC9A 1HPLA 2OPBA 4H60A 5DIFA 1YU9A 1NULA 2J9FB 3HUTA 2OENG 1ADBA 1KNXA 2FZLA 2QY6A 3LL7A 1NXXA 2Q3FA 3HWRA 3IKJA 4M89A 4O2BF 3DOFA 1BWSA 1E62A 5JWHA 4YJFB 2WT9A 3O26A 2DVMA 5HEKA 4OX9B 4JX8A 2C84A 3QI2A 4P0TA 1HFKA 3ZNNA 1XZNA 2GZHA 2GZRA 3A3OA 4JBIA 4LY3A 4FYVA 3UJCA 1PJ2A 2YRWA 3IDSA 3IPYA 1QQ5A 1Y3BE 4LV5B 4P7BA 5A5EA 3PYLA 1SK8A 5LWHA 1J07A 1YKFA 1D8TA 3PDIA 5HKLA 3G2HA 5B37A 3KLBA 2HLHA 4IOKA 3AUJB 1W5BA 5DBFA 2CMDA 3HFJA 1BRMA 3PKZA 2CL5A 1LPMA 3WLQA 4ASUD 2YJZA 2MR6A 2Y9PB 3L1VA 1T13A 4IJKA 3N5KA 4MIEA 1JDTA 1E3TA 1JB9A 1GD1O 1CUJA 2KM1A 4U0KA 2Y66A 3PG5A 2GJSA 2VDWA 4WN9B 3JZMA 3D8SA 4CYMA 4EW2A 3LPAA 1FS6A 3FYUC 5T4HA 2VOJA 1FC0A 5JMWA 5GIOE 3UANA 3OCXA 4OHPA 5J1SB 4IDAA 4R6XA 4P80A 1L7OA 4Z53A 3MNFA 3GRYA 1GPJA 2B8TA 3EIUA 4OATA 3B6JA 4UDOA 5I51A 4F4JA 1QTQA 1ULZA 5H4GA 3QVUA 1O0SA 3IVAA 5BYAA 4D82A 3C7CB 4U6SA 4G5RA 4XB1A 1JJAA 3AF2A 4IO1A 4LV6A 3LCRA 2ECOA 3LPLA 1USGA 2HMSA 3KKPA 3LLCA 5HK8A 3S1LA 2Q3MA 3PL5A 2NWQA 1SGWA 1RXYA 3HFGA 4HNHA 4L5YA 1LF5A 3BCRA 2O3RA 3VQTA 4WLUA 2XBUA 5AR1A 2Z6QA 3A6PC 1WHTA 4KRGA 3SCZA 3IEXA 2I3ZA 4TYQA 3GJZA 2JGMA 1ISIA 1ISSA 1M76A 1GFWA 1OX4A 3OBBA 1E5DA 4ZICA 3ID6C 2JA1A 1CYDA 2MYUA 2OVBA 3OZCA 3Q8WA 4PYLA 4W1RA 4JI4B 4IV8A 3N05A 2YC2C 2ORVA 3R1IA 4Y6RA 4QDXA 3G68A 1QG6A 4PZLA 1Z34A 4E09A 2X5KO 4P2BA 5J2TB 1LTHR 5JXGA 4RK7A 5T6BA 4DHEA 3QLJA 1KZHA 4MDHA 4AY4A 1QHIA 3N0WA 1CEYA 4UZFA 4NBLA 2CK3D 1QHNA 3SAJA 1NQVA 1LFAA 1MB4A 2IYTA 1GVNB 2WSSD 5JARA 1JYSA 3BFJA 3K16A 4OQQA 1KSGA 2CD9A 2I8AA 5J4HA 3NWBA 3I6MA 4L5IA 2W70A 3F1KA 4L4UA 3UWDA 2Q4TA 1HETA 1BCSA 3M8KA 2PLWA 3L1JA 5LKRA 4EMTA 3KVOA 3H5LA 4LWZA 1OAAA 1IHYA 3U13A 1L7PA 1WBDA 3I1IA 1E6LA 2NXCA 3Q8XB 4MQFB 2I78A 1XTSA 4BBJA 5FOUA 2IQIA 5EG5A 4HGNA 1UWVA 2YUTA 1OA0A 3ZW9A 1V1JA 3TRHA 1V11A 2Y92A 4ZZ1A 1TJPB 4UXJA 1IBCA 2H2WA 3AB7A 1RJ9A 4LV8B 4QNRA 3JQAB 1CUSA 4IXTA 4X6XA 3OEEA 4OHFA 4CLHA 3PV0A 2EIXA 4B7XA 4DWOA 3DE3X 1EK0A 4XYBA 9ATCA 4JC5A 4D42A 1SC9A 2XB4A 2Y8EA 2V7TA 4Q4HB 3MGGA 4JT9A 1I13A 4MHSA 4BWYA 2VAMA 1WPGA 1NT2A 2JFPA 1QPBA 5FADA 1TEVA 1MW8X 2AI1A 3ZZMA 1JFLA 4INAA 5FLEX 4EY3A 1SBCA 2BMAA 4NARA 1MQ9A 3FPHA 1OFVA 1HDEA 3R5KA 1EE1A 3RSFA 3EPRA 4K1LA 4MRVA 1QVVA 2EFCB 5DP2A 2V9PA 2FMTA 1DWQA 2IZOA 2WIAA 2YVUA 5KQSA 2C4UA 1HOTA 3BXOA 4QPCA 5FULA 1OCEA 4M21A 1IHOA 3W5BA 1GAEO 1KJ9A 4U6NA 1XD8A 5DSTA 1VDMA 2NYRA 5JCPA 1QGAA 1ZZGA 5K99A 1P9RA 1P19A 4AL4A 4GSYA 3DBRB 2ID9A 1RFLA 4L0CA 3UJ9A 1QE0A 4R05A 1TKAA 4Q19A 3U3DA 1D1SA 4B2PA 3F8SA 3VGJA 3U80A 1F6DA 4BVHA 5H81A 1UXOA 4HD8A 2AR9A 1KY4A 2F62A 3HXTA 3KT3A 3TNYA 3WK8A 1IXRC 2W2XA 4W5NA 1KAGA 3ST7A 3TMAA 4CCAA 3IXMA 3K0BA 3Q1LA 4HNGA 4J2HA 3JALB 3DYBA 4BKPA 2A0UA 4I14A 1PFYA 5EXXA 2G5PA 3T9DA 5B4UA 4PXAA 2JW5A 4RHFA 3WP1B 3VJRA 1VI2A 3VX3A 2SICE 1BX3A 2WF9A 3SLRA 1KJYA 4DDVA 2H52A 4DABA 3DNMA 2XVZA 2EVWX 2ZR0A 3TIGA 3DZ8A 1ESMA 2C3PA 2IHZA 2VH2A 1P7PA 2RHWA 2VP6A 3KAPA 3NT4A 2HCTA 4KYIB 5CW1A 2GVDC 5E7MA 4C07A 3NTVA 4NMHA 1A0OA 3WLHA 2B25A 3AEQA 1C7FA 1U7ZA 3B3QA 4XB2A 3ZHCA 4NCHA 3B1WA 4OBBA 3I9MA 4AULA 2W58A 5C8YF 1C4XA 4K3VA 2PU5A 2OV2A 4MR9A 1PFGA 2LVBA 2JFZA 3KM0A 3MN1A 4TVBA 2OPHA 4BFLA 4EHJA 1XU4A 2C00A 3D5TA 1Z2EA 3I73A 4DR5B 2CMFA 1ZQ9A 4P81A 3DLAA 5AKZA 1XIVA 2VEDA 1EB9A 2W7TA 4Q02A 1PFQA 4JUBA 4GZLA 4BZWA 2PFGA 3ZZ0A 5EJAA 1WV1A 1GLNA 5IBQA 4D57A 5AVTA 5AHKA 4PV7A 3L82B 4LS3A 4YPFA 1J22A 5A3VA 3L6BA 4WVLA 1LDGA 1XDSA 2Q9UA 5M5BA 1NZDA 3OPXA 3G8DA 4DCPA 5EIFA 1XQ9A 1ADJA 4CF3A 1BA2A 4G5OA 3QIVA 4E70A 3NNDA 4GGPA 1CJMA 1NVDA 1WXFA 4CIYA 1FTGA 4B35A 4PG5A 2ZAGA 2IPAB 1S3FA 2QN7A 4P92A 4MRRA 2H4YA 1MG5A 1UBOS 2R8XA 4K5QA 2Q07A 2ZRPA 5LN1A 4P3OA 4TL8A 4TLCA 1OWMA 1JG1A 4H0CA 4POAA 3SOPA 4CG0A 1XMOB 4N48A 4ACAA 5IJAA 3LF1A 4LDNA 1DKPA 5E6UB 4MPPA 2RBKA 5A5GA 3N3AC 3DKPA 4FW8A 1NE7A 2Y0BA 4QSHA 5JXWA 2C9YA 2YS7A 1SVWA 3CJTA 4FFBA 4I4TF 5LLTA 1XTIA 4QEZA 2AT1A 1SWWA 3NBZC 3TLEA 2ZRAA 4CEJA 2FPPB 2F67A 1MDFA 2BFCA 2JD2A 3I42A 3AYZB 1AE1A 1ADCA 4H7HA 1JL3A 2I91A 4PEVA 1WHSA 4UFPA 1Y7LA 1U4OA 2A5GA 3GROA 2VC2B 3QI7A 1ML4A 4IOMA 4O6VA 4MKIA 3KLMX 1XP8A 4P7KA 4UM7A 4HFJA 3WIEA 4F8YA 1W8DA 1JTFA 5H1YA 2XXAB 4GPAA 2H2IA 3AOEA 1EWTA 3HKBB 5LIRA 5C32A 1RJ9B 1XX6A 5C3UA 3BUSA 3W9YA 1T8YA 2Y0EA 3ENWA 4CLXA 3PFIA 2J6HA 4GSLA 4C30A 5BUCA 5L3ZA 4UOEA 4DSNA 4F9GA 3C24A 2LIPA 4UTZA 2HF9A 2FN7A 1Z74A 4C2TA 2PUJA 1JDZA 3E53A 1GYPA 2BGNA 3EARA 1BDJA 1OZ0A 4BNMA 4O4JB 1KFBB 3RIEA 1G64A 2L82A 3QUBA 1E79D 3QIAA 3AVXA 4WEQA 1EGVB 1HRKA 2Z09A 3W7VA 4KREA 2R7KA 3Q3JB 2WHPA 1CX9B 1UKYA 2R66A 4LOHA 3VV2A 4CQMA 1TRHA 3FI9A 1RYHA 4HSEA 6ABPA 2XWSA 4QGHA 3DO6A 3F2VA 4FU0A 4YRDA 4YUXA 2JBAA 2XGJA 3HLYA 2VDOB 5IDWA 5LJIA 4LRTB 2QR5A 1GVHA 3N2ZB 3VU0A 1NM5C 4A8JA 4WBNF 3HRHA 2ZWOA 5A05A 3FM9A 5IF9A 3S2FA 1C9MA 2V65A 3EY4A 1XMXA 2GJ9A 3DL2A 3F9RA 5JAQA 3TLGB 2C29D 2DUNA 3CYFA 4DOMA 4F06A 5IHXA 4JNCA 4R01A 3I5AA 1PDWA 5FF9A 1B23P 2WB2A 3HMKA 1JFFB 3W1VA 2QT9A 2RI1A 2NVOA 3EQZA 4ZHSA 4EY8A 4ZHQF 1Z38A 1M54A 2BP7A 2FA9A 2J9FA 4YV2A 5ISMA 4OI0A 5LP6C 2BVNA 3JQ9A 4OLBA 3OZUA 1PAUA 3S99A 2OD2A 4YFYA 4FUTA 3WAKA 1YD7A 1SULA 3CTPA 2DQYA 3L0ZA 4I6GA 3A31A 4JVSB 3AI7A 4D4JA 3E9DA 3GLSA 5TVKA 1NL3A 3JVDA 5AUOB 1CUAA 2DFDA 4QOJA 1N1DA 5IU6A 1UT5A 2HSJA 2QRVB 3SK0A 5B3JC 1TVCA 4KWCA 4N8DA 2FPIB 2HFJA 3QXJA 2UDPA 4HNAB 1RWWA 2F1KA 1A3CA 1JI3A 1H93A 2C2OA 4PWZA 4ENUA 4Y1RA 1ZWKA 1ZEMA 3NIGB 1XLWA 2FB9A 3ES9A 2J0UA 1WP4A 3HU1A 2HRCA 3FNIA 3M4JA 1E2MA 1EWKA 3QXXA 4GUAA 5JYEA 1UINA 5KYYA 3MINB 5CYFA 5BW6B 3AL3A 4B3FX 2XIJA 3TI7A 4ABTA 3A0UA 1G4AE 3TW8B 3ZDQA 1VFNA 1M5RA 1GCUA 3FTNA 3NVAA 3R7FA 4YAOA 4R69A 4V1CB 2ATEA 2Z04A 3ZWOA 1V26A 3V00A 4JLKA 3GLHB 1F6WA 4HX5A 3C3WA 2JZNA 4F96A 5J47A 1D7AA 4KOAA 4ZAXA 2Q1YA 4PXYA 2AWNA 3OD1A 2JGNA 4NPHA 4AY6A 1NXPA 2G71A 2CHVA 1Q7BA 4JGBA 2ZTUA 4HQNA 2E49A 5FTKA 1R0WA 2QV0A 1NVUQ 2XV1A 1A7JA 4G5XA 1FS4A 2KI5A 5AW8A 3S2EA 4IR7A 3T38A 4QQRA 3EXAA 3QELA 3V8BA 2RD2A 2ABWA 3FY4A 3VNBA 3DHEA 3SEQA 3W1WA 3VZQA 1HF3A 3I6YA 4A5SA 5I4BA 3FFTA 1GGEA 5JUWA 4IPTA 3N28A 3LC7O 1W88B 3AVYA 4M0DA 2XI4A 2IPMA 3CPJB 2B21A 2E4YA 2WF5A 5B7GA 3HB1A 2G4LA 3MT8A 2XSZD 1K4YA 2HREA 4KVFA 1UEIA 2XNSA 2XTNA 2CLHB 3GJ4A 4FHDA 4XDZA 1KDTA 2H16A 1KH3A 4DLUA 1EG7A 3AH8A 4PX5A 2DM6A 3MUFA 5JS7A 4TZKA 1W48A 4JC0A 1PT6A 1QH8A 4YMHA 1FQJA 1PR5A 4FXOA 3GRUA 3ROQA 1K2WA 1X94A 1Y0BA 2ZTVA 1A69A 3BQMB 1WMEA 1WUJS 3EC2A 1VL8A 4MQEA 4OXQA 1KMCA 1S7CA 3DHYA 1Y4DE 2QEQA 3HGMA 3KR0A 5FL3A 1IH8A 2I2CA 2JL1A 2WR8A 1E3JA 1GSIA 1LJLA 3SXUB 3UJDA 5JAMA 1SY7A 3NM4A 2R4TA 3MA0A 1WB9A 4CLDA 1TYZA 1MO4A 3BMOB 4XKJA 1P6UA 2I33A 2ODAA 2RHBA 1EP1B 1MW9X 2VF4X 1HFEL 3OEED 4UTPA 1FYDA 4C87A 3T0IA 3COVA 1HT3A 3BD7A 1T2EA 4J9UE 3FOFC 1XYVA 2ZYVX 1JLKA 4OMFG 5E1DA 3KVRA 4PO1A 3VDXA 4WDQA 4JLAA 1T9HA 3LFTA 2ZBGA 4B47A 5B1EA 1OFIA 1W1UA 4TWRA 2NADA 2OCBA 4TYWA 2XUFA 2NSJA 3HGQA 3OZDA 3WA7A 2X0FA 1JR6A 3TGWA 1OIWA 4TX1A 1C9KA 1N3IA 2MIIA 3B38A 4WT7A 2XOXA 1L5ZA 3MAGA 3PPXA 1UBSB 2KE5A 3GLFB 1YUMA 4YJ3A 2UZ3A 3JZIA 4X1KA 2UV8A 2P5YA 1L0BA 3ENZA 4R51A 3B8EA 3A05A 3VJLA 1FE8A 1QB8A 1A7AA 1FZQA 2W2LD 3H0CA 1WW8A 3MS7A 4ZRDA 1HT0A 1NJ6A 1E2UA 1CHDA 3HCNA 4PSKA 4U3JB 4LXIA 5DIZA 2EL9A 3PBKA 2ZS9A 2RKOA 3K96A 2P9ZA 3WOVA 4ZODA 3EEYA 3FMOB 3FVQA 5K3FB 3RV4A 5A3QA 3F2IA 2X5OA 1JEYA 2BIFA 3R8XA 1PNOA 2WEKA 2JEYA 1NPYA 2WFLA 1WDKA 4AD8A 3ER6A 3EF3A 4ETNA 3KZ1E 1V47A 4DLXA 4IDHA 1DAKA 1GR0A 2OCIA 5IG2A 2ZBPA 2J6CA 4F92B 3EAQA 1XN1A 4MIYA 4AP9A 4EUNA 4D9NA 3DFZA 4CLRA 4WKBA 3RJZA 3ZQ6A 1ZI6A 2ZIZA 4BKRA 3KCQA 2YHUA 3JD3A 4IVQA 5A5VA 1ODFA 5EMKA 3WYFA 5CHEA 4EG3A 1BDIA 2QJWA 1CULC 4UE2A 2C88A 4B17A 4KG7A 4URZR 4RDXA 4JOBA 2AWOA 5E6UA 4ZCMA 3WLPA 5JH7F 4UHCA 4G0WA 5FWNA 3Q3CA 4WCVA 1EK1A 3R77A 1GADO 4HC4A 5JJ5A 1NUTA 5FV4A 1NV9A 4J43A 1Z4MA 1JDNA 1ZGHA 3BB3A 3USZA 4X54A 2R6R1 1T29A 2AXQA 4HEQA 3GUCA 1N6LA 4OD0A 1RMQA 4IW3B 3I1FA 1KSJA 4M1TA 3WLIA 4C14A 5HWSA 2ODWA 4YN3A 2K7FA 1IBSA 1IEWA 1UXJA 3VR6H 4R0MA 5FPKA 3ZNQA 1TZKA 3N8DA 3PDUA 1F4VA 1XQ1A 4EPYA 3GJXC 1DHTA 3ZDFA 4JJ8A 3F4KA 5DHRA 3WS7A 3K73O 3NWJA 1PT9A 2F6RA 2QRPA 4CIVA 1NA5A 4KSYA 5TQ0A 4YX9A 1Y9ZA 3V7FA 4CCSA 1EUCA 3GG9A 2BI7A 2R3SA 1EEXB 3L01A 4B3MB 2H31A 4NTZA 4AP5A 4LXXA 4MRMA 2Q9CA 3MMZA 4FYXA 1B1AA 5CDFA 4I2NA 3K9LA 2W2KB 3O7WA 3MQ2A 2D1TA 1KP3A 2K4MA 3GBPA 4LN1A 1E3MA 1N9GA 5JZBA 2OL4A 5CLLA 1K7SN 5IM4F 1LV8A 1H9BA 3DTTA 3WRXA 4EKEA 2ODTX 3DZIA 5GIPE 3ZKAA 5ABPA 1WXEA 1Z6TA 2VBFA 3T7CA 6ADHA 3M9WA 1EJBA 3G0IA 4A10A 5EUBA 5E4YA 3UWOA 3HR4A 4PBTA 1OTXA 1UBGA 1UBRS 3GJ7A 2PA0A 1TNDA 4IJMA 2HC9A 2NZXA 4A8JB 1LRKA 3P9XA 2FUNB 3CR8A 3HKCA 3UENA 3BK1A 3T5AA 3PVCA 2GSDA 3OPYI 1QQAA 3OESA 2NTEA 5D6NA 4PQYA 2ERYA 4IWXA 1R0KA 3W9BA 5IDQA 1ISPA 2DE0X 4MWOA 1I7DA 1KKLA 1ESCA 2Z5LA 5JPCA 1BEUB 4G8JA 5KQMA 1NASA 4NQRA 3OE4A 4TT3D 1J23A 3INYA 4MICA 4LSMA 2WIFA 4BU1A 1ZOPA 1OXUA 4O0LA 2NUBA 5AH0A 3KJZA 1TF7A 4CLOB 4F9TA 3KCNA 3SGLA 1G20A 2RI0A 4L73A 1FTYA 3ZBPA 4D41A 3AG6A 4UEJA 2B0CA 1Q57A 2QTVA 3BN3A 1J25A 1BOOA 4JMLA 4MKXA 3UXHA 3OIGA 3I8SA 1ZWLA 1SUAA 2A5FA 5BN1A 5C8DA 4H7FA 5EJ4A 1WDWB 2EGHA 5BW4A 5BWNA 2X13A 2YFKA 3BH7A 1YBHA 1APBA 3KXIA 1CP3A 2G40A 4AICA 3U09A 2AOTA 1CIPA 4NE2A 4PG8A 3KWJA 4OHBA 4FFSA 2XTJA 3ETNA 4UHDA 5HOQA 5BNIA 2FOLA 4BVEA 2JFNA 4J4BA 1DO2A 1D2EA 1UDRA 1JQ3A 1GZ3A 4WNAB 1B6RA 4H3KB 4YJGB 5JEEA 3BXFA 4KQKA 5CNMA 4Q16A 4YMSA 3RK1A 1B1CA 1FS5A 3FUXA 1N2EA 1E1YA 3I30X 3O2NA 4TL9A 4YR7A 4LZNA 4YPVA 3PPVA 4W9MC 5C5CA 4Q4AB 1C0EA 5KSWB 1A9QA 1Z2DA 1GY8A 1X3SA 1G2OA 5K1ZA 4BNLA 3MUOA 1JN0A 1D0SA 2J3KA 2XBMA 4DLKA 4XH9B 2WM2A 5AJTA 1U2GA 4UU1A 1OI7A 4JIGA 3AXTA 4G8DA 4OLFA 4F2DA 3R0JA 1J21A 2Z9BA 1DBWA 1WMAA 1ZA1A 1QE3A 1NDQA 1R74A 4HYEA 1EP3B 4R98A 3MCVA 5BR1A 1D0IA 3W8EA 1J4AA 1F14A 3OZVA 2PUEA 4Z0HO 2WWWA 1QK4A 5CR9A 4OYLA 5JXHA 3UC5A 5B1DA 1ZVJA 1A4XA 3EIHA 4CHGA 5E2IA 4BO8A 5CEJA 1XALA 2RJ3A 2DCUA 3HJUA 5KEIA 1MT0A 1JKIA 2JFVA 2BP7B 2Z2XA 3I04M 4MWCA 3GF4A 3RO7A 4LSWA 1E1LA 1EJ2A 4NFSA 4QO7A 3G49A 2NZ8A 2NAFA 1J56A 3ZK7A 1HDZA 2WOJA 1JHXA 1UAGA 2J9ZB 2IP2A 1Z0IA 1HWYA 5LP6B 5KYTA 1H2ZA 2VK8A 2PYIA 2HU5A 4OHUA 5BV1A 13PKA 3PUYA 3FNEA 2FZCA 2WPDA 1ISFA 1QAQA 1VG0B 2CBZA 3MBIA 1M2NA 2J87A 4J7UA 1Z7YA 2ZBRA 4WX2B 1RP7A 2OAEA 3MC1A 3SE7A 4JT2A 3QX3A 1VA4A 2JGKA 2AFHA 3EMDA 4PTZA 3W4IA 3FAKA 3GFFA 1O08A 5LWQA 3VTFA 4EI7A 4EP1A 3TNDA 3UMVA 3H9QA 4R3WA 1QFYA 5C1BA 2Y0DA 5CVTA 3OO0A 3R44A 5KOHB 5T41A 4BVBA 5LM3A 2BGLA 2P35A 2Z57A 2IDKA 2GHRA 3FMIA 2ZG6A 1DAEA 1R6BX 3D59A 1E3EA 4AM8A 4X8MA 2QX8A 3DS8A 3ESRA 3LDGA 4A3SA 2XCSB 1REQB 2PL3A 2Q5HA 2BONA 4IUBS 2QS9A 4DZTA 3PLRA 2HMUA 4M6WA 1W46A 1I7QB 1KO7A 4J9VA 1PJAA 3EXEA 3TQTA 3LUAA 4CQLB 2PMEA 2QGZA 1XJ5A 1KAOA 3BFPA 2AEEA 3OCUA 5JRZA 1Q19A 2PQ6A 5E3JA 1ZI9A 1KSHA 2XTZA 1IY1A 1AURA 2HR1A 4GXRA 1DADA 1YQUA 2H5EA 4HO1X 4TQAA 1P4AA 3OTGA 4N3BA 5FHQA 2MSEB 3UK1A 2Y1FA 3BAZA 4Q12A 2I2WA 3G2LA 4RE5A 3D3WA 3K0FB 5FWYA 1V1MA 3SJZA 2NTVA 3W7AA 1ZU5A 3IEPA 2I4MA 1GPUA 1T36B 2P75A 2WFLB 4CFZA 2XE8A 3ENVA 1DBRA 3L9XA 2DPGA 5IHPA 1SRQA 3LNTA 1PN3A 2POQX 5C1DA 2Z98A 4CDMA 2EBUA 5IYZF 5EC8A 4INZA 3JTMA 1ORTA 3CRZA 4I5FA 5JSYA 3DMTA 2RGRA 4L5JA 3QFRA 5I45A 4ND5A 3C8UA 4H2DA 1II9A 2IXAA 1KK3A 1PJ3A 2WRZA 1TM2A 1QKKA 1ESEA 2O6HA 2YZGA 2GCOB 1IQUA 3I4CA 3M5WA 2GPSA 3DEYX 3IA2A 4K2AA 3WOHA 7REQB 4HAOA 2O2EA 4Q1AA 3X43A 1AS0A 1R7RA 1V4VA 3C5WP 3PNOA 4XLTA 1V3TA 3K1JA 1B00A 2A3NA 2JHPA 4IGFA 2FPUA 1T2NA 1CJVC 3CLKA 4QA9A 2IHBA 2OZEA 2PZJA 4WNAA 3WI7A 2IH5A 4M98A 2YWCA 2BRUC 1ANKA 5FBKA 1ZMTA 1JQEA 1J70A 2Q1WA 4QQFA 2YC4C 3O21A 5BMOA 3ZLJA 1GSAA 4Q18A 1EM6A 5TLSA 3BMCA 1E1QD 5EJ8A 2VQFB 4DB2A 2AQ8A 1QAOA 1C9NA 2QNRA 1QYWA 1SCKA 2H1RA 5GONB 3VPDA 4JQSA 3W5VA 2G1KA 2I6QA 4N7JA 4ESHA 3WIDA 1G55A 4ENPA 4KQ6A 4Z5XA 5B6IA 4DV3B 1PZFA 1MHTA 1Z8FA 3GH1A 3RK4A 5H8WA 3GP5A 4M86A 1IM2A 4B33A 3IP7A 4URHA 3GLFA 4E94A 3FYDA 4PQRA 4WZAE 1K6XA 2XCLA 1L6RA 4WQMA 1DKRA 3EMVA 2C4NA 2WHYA 4QM6A 2JVJA 2PMDA 1N9GB 3BDAA 2A9FA 4QWMA 4LGYA 1XXHA 5KTOA 1QM5A 4UVDA 4U2FA 4K9MA 3JWIA 3G17A 1ZJ6A 1Z5WA 2O7VA 4JYPA 5E4FA 3G2QA 1IY8A 3WZMA 4BGVA 4CQMB 4RIEA 2VA9A 3K0CC 3UBMA 4EA7A 1F9AA 4ZKDA 2RHLA 5EKSA 1TMKA 1YQTA 3IMGA 4FX5A 5L40A 3DW1X 2QMHA 2DTXA 3OQHA 4L3OA 1K06A 1OGJA 1USWA 3NTQA 3MRXA 4X6YA 3IQIX 5DGTA 5CLQA 1AA9A 5K01A 5DW0A 3IBFA 4MUEA 4CMIB 2O3JA 2NO9A 1ZN7A 4XQEA 3WQBA 2G25A 1DARA 3L8YA 1VJCA 1T2DA 5J1TB 4FEYA 3VFDA 4CNQA 5JS6A 4XWWA 4X65B 1U9JA 1QF9A 2GEVA 2XQKA 4RM2A 4AZSA 4CXMA 1LEHA 1I8TA 1NBMD 2ADOA 3FDJA 4MX8A 5B36A 4Y9UA 4MWDA 4Q1VA 1MO3A 3NH6A 3RIYA 4O1HA 3SR4A 2YW2A 4GC5A 3VI3B 3ZEIA 2HYIC 2EBFX 4L85A 1YF3A 4UTRA 4US0R 2EKPA 4OYYA 5MHTA 1JEQA 1OBOA 3ZQ4A 2IPNA 3W2TA 4BMZA 4CDRA 2Y1GA 1PR9A 1CVLA 3LPNA 1LS6A 3PPIA 4IIFA 1KZ1A 5FTJA 2VK4A 2ZSEA 4GKAA 2O5RA 3Q3HA 4PU0A 2WKWA 2ZCVA 1NMQA 5TGZA 4HB3A 4LYHA 1PJRA 1KVSA 3ZCXA 4NV3A 2ZDQA 3JATA 4Q6WA 5LCXA 3TD6A 1RE0A 3ANSA 4PQGA 1XB2A 3A6ZA 8LDHA 4BMOB 1Y5RA 1Y9EA 3OPVA 4EH1A 1JIQA 3QPCA 6GPBA 4P35A 4B6PA 5CA0F 1XK7A 2ZWAA 4LQLA 4E0BA 1C8LA 1TCBA 3D6UA 1JPUA 1KI3A 5LOVA 1K8YB 4BHTA 4ZMBA 4Z9BA 3R3WA 4TTQA 4PYJA 3E9ZA 4BQEA 1KS9A 2ZI6A 4N3NA 3PGMA 3IAEA 4CM9D 2ZWMA 1O97D 4QGGA 2J07A 5IT4A 1RWKA 1QRDA 2FFAA 2P9CA 2JIRA 3R20A 2AF4C 2Z8YA 2G5GX 2ZRGA 3GA5A 3VPHA 2AC7A 4WLVA 2OR3A 1OXSC 2PJUA 3RRFA 2OXCA 4DQVA 4OQEA 4K8OA 5KMGA 2WHXA 3AQIA 1OH7A 4CV3A 1DPFA 2C2BA 1YR7A 2GTIA 5C53B 4RTMA 3WHKA 3E9EA 1NN5A 1LNQA 5EWJB 2FSGA 3D4LA 1SXIA 5YASA 4EHFA 4F3CA 1M0SA 4F5WA 1V1RB 4ID3A 4IQ4A 2BSXA 5K0EA 1YHYA 1M2HA 3IDOA 3TCNA 2FX2A 3QHPA 1NBEA 1PZEA 1OX4B 3ORQA 1UJNA 2FUG6 4JOQA 3EFHA 1E7WA 2PIAA 2G9NA 3EWIA 2IEIA 4YPOA 1I3CA 5IBRA 4Y9SA 4ZTUB 3A27A 1UODA 5EKDA 2HA0A 3FPKA 5BNTA 1UFKA 1LVUA 2VT6A 3LHDA 2DTEA 5C46F 4ZDJA 3EVEA 1BMTA 2FJUA 2XODA 2CBXA 5AOCA 4AKSA 3WHLA 1Q1GA 5TQ2B 3BJZA 4IDGA 4UVEA 3WK4A 3W5DA 5K8LA 5K0JA 3EGXB 2O5EA 3AEUB 3PICA 4YRFA 3RF7A 5BSUA 2YY7A 3S7ZA 3BWMA 3Q3VA 4IDNA 3L1IA 5FOQA 4PR0A 3UMCA 4AS1A 1E8MA 2YASA 2WF6A 1B8PA 5DI9A 2BFBA 2AW3A 2JIDA 1R16A 1X1EA 3A4LA 3QMWA 1JKMA 4FNGA 4O2RA 3WDSA 5C8YB 1DTSA 2HEIA 1USKA 4JN6B 4AT1A 1UK7A 2PH3A 5IC6A 1ZCZA 2Q8NA 3AFOA 1MVNA 2JH3A 1P74A 2HM7A 2JVKA 3GQVA 2FR1A 4Y6LA 5F52A 3JPYA 1ZUNB 3NAMA 1TLTA 1M2OB 3FYUB 4QYIA 1QX4A 3LW7A 1RJGA 2FSPA 1QJ4A 2HJGA 4UNNA 1YNSA 3MS4A 5COBA 3E61A 5FT9A 2EJTA 3ESYA 3PC8A 4KFSA 1KI9A 4L0QA 2QTAA 2XYVA 5KNBD 2VJOA 2OGTA 4UHEA 1U99A 1CR0A 2PH5A 1YULA 3RADC 1JEDA 3PXAA 4IKPA 4FHZA 3DUFB 1E5VA 1UKZA 4P86A 1P1JA 2JLQA 2XVYA 4P4LA 4TXJA 1KQFA 3T15A 2PWZA 2OK8A 3I64A 3KUKA 3E0QA 4R0VA 4UAGA 5KTYA 4CGZA 5K3FA 3ZGLA 4C0XA 1P0PA 3EIOA 3LLVA 3AUUA 4IXWA 1FIUA 4DQLA 1BZYA 5FEMA 2ZYTX 1XVUA 3LGXA 3PTAA 1W29A 1T36A 2RJNA 4TRMA 3WK7A 2DPXA 5HJ7A 4DV1B 3ND8A 3K0HA 1PT8A 1YS2X 3M5CA 3REFA 8ADHA 3KQQA 2G0AA 4XEUA 4GM0A 4LHWA 4HWGA 2L17A 3TXYA 4A91A 2I6UA 1G6HA 2J6IA 2WJIA 3C4JA 4G0XA 3HRIA 4UTXA 3ZU6A 2BGRA 4CEIB 3RRBA 3G5MA 4TLDA 3AETA 2B7LA 3ZVLA 4I1VA 4XUCA 4CT0A 2X19A 7REQA 3FAZA 3P9PA 3RSLA 2CFIA 2GFIA 1OFUX 4G1UC 4Z1MD 1DJOA 2IKQA 2BHLA 1Z37A 4XJSA 4Y7DA 3ZWNA 4GO1A 2WUWE 1I3MA 4BLQA 2XBLA 1BVHA 1U0RA 2A33A 3GFPA 4Y30A 2X5NA 4CM8B 4CUZA 2IYYA 3QEAZ 3GYGA 4OXNA 2BEVA 2H7YA 2BH9A 1TIPA 4YJ2F 4L2IB 1OWPA 2XMZA 1JIJA 5IH7A 3G9QA 1BVUA 3OJEA 4EHKA 3LY8A 4F9FA 2ZRFA 3KT0A 1FDOA 1RRKA 5EIBC 4D9IA 3KHTA 4JJ4A 1SCUA 4Z4GA 3TSOA 1XRNA 1OH5A 4PYRA 4CLEA 1HMYA 3Q6MA 1GCIA 4JYBA 3Q0TA 1H3FA 4E1BA 4YJDA 3B6MA 2DKNA 5HX7A 1AZSC 2YWJA 3Q87B 5IZCC 2ZYAA 4ARCA 1XEWY 5HKKA 2I9KA 5GGYA 4GOND 2PHZA 1IIBA 1EJ6A 1KDOA 4H7IA 5D51S 3L79A 3GYBA 4B6EA 2CLDX 3B1YA 3EUWA 2CW5A 1QG0A 3QPUA 4B4UA 2PBRA 1PW5A 2ERCA 4B3DA 2OQVA 3ME5A 1NMSA 5JQWA 4INPA 2O2CA 3Q9SA 3OF2A 3ZTYA 4HDAA 1E64A 1PR6A 2Q4BA 3C3KA 1DDGA 2W6JA 1VE7A 2N42A 2QL7A 4PAWA 2X2FA 4KDFA 4WUTA 4Y2GA 4Y9TA 1QHEA 1K6MA 3S55A 3W6PA 2ZBEA 3SC2A 2YN2A 2VRCA 4YAGA 5C18A 4ZTBA 5JEDA 1FNSA 3EIEA 3K70C 2SKDA 1U7UA 1ZHHA 3R9IA 5T67A 1TUEA 2AEFA 3FR8A 2C59A 4QBHA 4MITA 4BUJA 1OT3A 1THTA 2F9LA 4Y18A 1G1AA 1HXHA 1JDBB 3C8DA 3ONWA 4Y0NA 4AJKA 3IAUA 5DYYA 3ZWMA 2A1TS 3PHIA 1G21B 4AX4A 2FYTA 4A2QA 3SR0A 4ER0A 5CTAA 3BF7A 2DC1A 5CIWA 1Z35A 2YHAA 3AUKA 3BXGA 2J3LA 1J42A 4Z7OB 5IVPA 1MA3A 1XNJA 1DC3A 3ZLVA 4KXVA 2PGLA 3NKVA 5ICSA 4ARIA 3U56A 1P77A 4AUKA 2BFDA 1E6UA 2Q2NA 2C04A 1WQ4A 3HP7A 3NDIA 3DQQA 3M2PA 3N70A 4DF3A 4F71A 1U7OA 5CCDA 3RS4A 1HG0A 4AG5A 2GYUA 3IKLA 3PD7A 1XXHE 3TE6A 4IV5A 2GZ1A 4YP9A 3RASA 1BHJA 1J1IA 4YT2A 4JASB 3CVXA 1T9CA 3K6JA 4JYZA 4BJ1A 3THYB 3ABIA 3VZDA 3MYYA 1VA5A 3W2FA 1D1TA 1UKBA 3FFXA 2VSYA 3CZRA 2BSAA 2X9GA 2LP4Y 1JVSA 5REQB 3SLGA 1E8DA 3QA9A 4GC9A 2JCXA 3HB4X 5I8ZA 4FWBA 3FNFA 3ETGA 5I5EA 5M34A 1PQYA 3C85A 3E9MA 3A9WA 1A5BB 3AX6A 1FUEA 4OHCA 4PHCA 4ZT7A 4QODA 4NECA 4EYOA 5B4VA 3FDFA 5JJBA 4G0UA 4WJKB 3MT7A 2JGAA 2Z2KA 1H2EA 3BWCA 2GMWA 2P5UA 3Q72A 5COAA 2Q7OE 3ZBTA 4YRAA 2VHWA 5TEVA 4YUVA 1HT2E 3OE7A 1JZQA 2SKCA 3QELB 2RH8A 3MTEA 5TDHA 5KTNA 2P69A 5HZKA 1KAMA 4JLOA 4QLBA 4EMBA 1QF6A 4NXNB 3QGMA 1KVQA 4BZQA 4HLCA 3NHPA 3JXEA 4UCXA 1GV0A 2XNDD 1XNRB 2W22A 5A3JA 3BXXA 1DJQA 1I2AA 2GNPA 3ZLTA 2FWIA 2FW7A 4FI3F 1QMPA 2A0FA 2IEGA 4IJ6A 4MVJI 4XVRA 3DAOA 3R0ZA 2EQAA 1M74A 5IC5A 4UBJA 5TC4A 2JIQA 3N5CA 2PRIA 1G7SA 1PR3A 2YYYA 4QC2A 2UXBB 4R7ZA 3IURA 3KEFA 2ZP1A 3PDHA 4Q05A 3PCTA 3GFOA 2FY8A 4UFOA 3AHGA 1KYVA 4AJOA 1TA4A 3JYHA 5K0TA 1O6FA 4CM8A 1JH9A 2HPVA 4RGQA 1E5LA 2WSSA 4A16A 2HYDA 3PR1A 3EVNA 1EFCA 1EFLA 4BRWA 1WSWA 1V5WA 3F3SA 3GT4A 3VNRA 2XYPA 3LX8A 1KEPA 1L3IA 1P1CA 3W2EA 4BNYA 5AVXA 4LYAA 4F4DA 3HL0A 2DUJA 5C52B 2DQSA 3GO4A 3HVIA 2BKVA 5U9CA 4BQNA 5HR5A 1M2EA 1EFKA 4P4NA 1T4CA 1G6OA 1MV5A 1Q77A 2V8BA 3RRXA 3N07A 1GPWB 2EDAA 2PD4A 1FPQA 2XWPA 1YQ9A 3MWKA 3OU7A 4LHZA 4DMFA 5HJ5A 1E7SA 1SCBA 3R5XA 5BV0A 3N0TA 3BE5A 2FCAA 4KLRA 4WV3A 4LBWA 4QUHA 4ZI2A 2HIMA 1H4QA 3MK31 3QVGA 1KQ3A 2V7XA 5TSDA 1MFPA 3SWWA 4N8SA 4MA0A 2REQA 3U26A 3LTEA 2GPYA 1RBYA 3ZR4B 3CPSA 5KWSA 4RQTA 2H1SA 2A57A 2CDNA 2R2GA 2AMLA 1UC8A 1UZMA 1J7KA 1NBAA 1YB7A 1JLLA 1UFOA 2XKAA 4D9EA 1UADA 4O2AA 3ZQJA 2J30A 4EDHA 4QXQA 1OKKA 3BZWA 2BMFA 4ZD6A 4B9AA 2I1VB 4CIBA 3CZ4A 3HYTA 2R87A 2P2YA 5DOZA 1N0UA 1VHQA 4ZKEA 3INRA 3OOEA 3HNOA 5BSGA 3HV0A 1NFQA 5IAGA 2DY1A 1E2NA 1DVRA 3K6RA 4L3WA 5BW8A 1XG5A 3B9RA 2I4RA 2NW6A 3AFGA 1CK4A 1LUAA 1W5SA 4CI0B 1IDN1 1R0ZA 1Y34E 4DCSA 1UC9A 1YTLA 3O8BA 1R8XA 2ZBQA 3HM9A 4A27A 1NAIA 4ANFA 2Y1OA 5A62A 1D04A 2H0RA 4UTOA 1X7XA 4GKKB 2GCIA 1S4QA 3V55A 5ALVA 1U0OC 2XGSA 1XC7A 3VSEA 3ETLA 4RMJA 2YHIB 3STXA 5IP5A 4G26A 4DYDA 5EINA 1VLQA 4A0FA 4B3CA 4G5FA 4WNCA 4AJLA 4RSRA 3WISA 1TAGA 1GA4A 2BKLA 3S7TA 3CUWA 3LZ6A 1KIFA 4NR0A 3IVMA 4QOHA 3IUJA 4WTOA 5HPYB 4AJNA 3AJRA 3NDBB 1WXHA 3RTEA 2EZ8A 3GG2A 4FTWA 1R5NA 521PA 4D45A 2PMBA 4W7HA 1ZD5A 5G4LA 3RB8A 1KEZA 4DYHA 4DPKA 3WGZA 4F4HA 1P5HA 3NNSA 4QJ3A 2BE9A 1P72A 5U4XA 2ZIAA 3KEMA 2LWIA 4GR5A 3HBNA 3HZZA 4LVNA 4HGOA 3NI2A 4YEDA 3EGIA 1T3TA 3ZWPA 2HDNB 3DJFA 4OHYA 3A9VA 1DIAA 3K05A 1GQOA 3VRHA 4W9NA 1Y3HA 2JZOA 4GZMA 2BMVA 1FQWA 3TW8A 3U5ZB 1OTYA 4TV8F 2DFPA 1Z4IA 3Q7IA 1KMIY 3F6BX 1LLCA 3BHMA 4G63A 1CNMA 5IZ4A 2ZI9A 3DD5A 3IQWA 4KV7A 4M1QA 4BB6A 4H3VA 1J7JA 5L3SA 2P79A 5K0BA 1F7VA 4OEHA 4BEBA 1VQ1A 1YAHA 4DJDC 1C7RA 1Z6AA 4D6XA 1JZTA 3MBOA 2HRRA 2DKOA 3LPMA 4Y98A 3VNAA 4IDOA 4C04A 1RQLA 4FONA 1AMUA 2IYFA 4FN5A 2C42A 2V6IA 2QWXA 2G76A 2NUTA 2XYGA 3K5PA 1ZK2A 4S0XA 4FMCB 3L06A 1OF1A 3TF5A 1NDUA 3R3YA 3DO5A 2I7VA 1VJ1A 1DAOA 4HDQB 5A02A 3OPYA 3ASVA 3UT5A 3IVGA 1P0FA 4PFSA 1L9KA 2ZYGA 2P90A 1TEXA 3QY9A 2UYQA 2XXBA 2A78A 2BFWA 4N4AA 5UKDA 4JB3A 1L4NA 5ITWA 1JHYA 1YRQA 1Z3IX 3A1CA 3AHDA 3ECAA 4IJWA 3SF0A 4QQKA 2XHZA 4B3GA 4WKGA 3CE6A 5EI5A 4GOMD 1HQCA 4JOSA 1SNYA 5FH9A 1WCXA 2AN1A 2WY2D 3PFCA 2JDIA 3OUTA 1SG6A 2ZLBA 2D1YA 3IAS1 4PS0A 5G3ZA 1RRGA 3X2EA 1C14A 3FLMA 5GJCA 1GUAA 3VU9A 1DCMA 4BE4A 1N7JA 3VAAA 3UJNA 1N2CA 4M1OA 3IPLA 4UXHA 3A6FA 4BIMA 1Y1PA 1M83A 2Y27A 4V0QA 7GPBA 1QGUA 1F2UB 1NI5A 1U6KA 2CNOA 2VHEA 3KQNA 2A0XA 2PWAA 4PCUA 1H6CA 2HY7A 3UAYA 1Q16A 2H00A 1PRYA 1ZKMA 3IHLA 4LYJA 4YRTA 1ZM7A 5D5QA 4B7UA 1XDGA 2IUYA 2C5EA 4FHCA 2IYOA 3IAM6 3U31A 3E9YA 3BZUA 3KPYA 3OIYA 4QFCA 4CV1A 1CDZA 4WESB 4J0HA 1ZGZA 4DQXA 5HQJA 3TNJA 4RELA 3SX4A 1SXPA 2WJJA 1Z2OX 2JIBA 4YAWA 4I1SA 2NYAA 3NEPX 2ZSJA 1L4KA 3NAZA 5EGNA 4DIFA 3L02A 3VTKA 3AB3A 4JLDA 3OQ1A 5JG7A 3H2GA 3HHEA 4HBZA 1U0HC 1SKMA 1ZH0A 5FDFA 3O9ZA 4OA8A 2D5BA 2IS4A 3SDZA 5C4IA 2CMHA 1XMSA 2J48A 4F97A 3EVZA 1H0HA 1M6NA 3X2SA 5HS4A 3ZV5A 1X1AA 4KQ2A 3VZRA 2WAXA 4J0CA 1C0LA 3OFND 1N0VC 1U3WA 5ALDA 1RSZA 2YVKA 4M9SA 4KDCA 3ZDEA 1GEGA 1ZDMA 1NF2A 1UFRA 4BBPA 3RYCA 3GEDA 1YJAA 3ILYA 4KPUA 5DO9A 3RK0A 2N3ZA 1DAIA 1A9YA 3TQCA 1JU9A 2IYRA 2ZRQA 1YDMA 3BSSA 5D00A 3QE2A 4EO9A 1L7XA 1ZNQO 2Z08A 1M2JA 1NVAA 3HDYA 3WGQA 2C2KA 2QSUA 3BCUA 5EXDA 3H11B 3MJEA 3UK6A 2WM9B 5I01A 1RBQA 4JUIA 4XVUA 2BFFA 4IGKA 1SVUA 3FYTA 3I2FA 3EA0A 2MYTA 3NW9A 3S3TA 1AXGA 4EL0A 3ABSB 4D8YA 1RPTA 3S2SA 4AYXA 4C4ZA 1I5OA 1KOFA 3H1BA 4RKFA 4PGAA 5J58A 1G8AA 2BFEB 3RSQA 4QOSA 1B74A 1UKAA 4RENA 4I1RA 1MO2A 2NVUB 3NUZA 4OI1A 2FSVC 2PWYA 2QMEA 2VBGA 1RAHA 4UUOA 4U7HA 4KWHA 3W77A 3HDVA 3DXFA 3HSSA 3K6KA 3IUSA 2WA2A 5AW0A 2Q62A 1YZVA 4Y1GA 4EEKA 3EY9A 1RU3A 2IVFA 4B3BA 1F17A 5EESA 1MIOA 4FCVA 3CGWA 2WJ4A 3SIXA 3LKZA 3FNHA 1Q44A 5G0UA 5KSYA 4J7XA 2ZUBA 3HB5X 2VYCA 3MJCA 4G1CA 4I5GA 5LZ5A 5EL0A 1YUNA 1DQYA 4LAFA 3F4BA 2GERA 4WKPA 1Y4AE 4DLSA 1MAVA 3FWHA 4C5AA 5KHLB 4JJIA 1MDBA 3WDLA 2X42A 3CLUD 1MABB 2J9XB 3E7PA 3K09C 2XCRB 4LQDA 1ZBDA 4RS4A 5CM2Z 1G63A 3IAXA 2AUMA 2NSDA 4N5NA 4RJIA 4E5PA 2GM3A 1YQEA 3PQ8A 4FLMA 4AU1A 3I9LA 3CWZA 4HDRB 2FW0A 4US1R 5KQPA 4QGFA 1XU9A 2QP9X 3AU8A 3DZBA 1P6QA 1VE9A 5HRCA 2FG7C 2FN9A 4WN9A 3O8QA 2B78A 4P3KA 1NPDA 1C7EA 1XAHA 1K68A 2XMSA 4WCDA 4XLZA 3S5JA 4B4VA 3AQ4A 3QQPA 4BEVA 1X87A 1K5PA 3E4CA 1YBMA 3NM6B 1YJXA 1VG8A 4IIJB 3EEFA 1KI6A 4PZAA 1CF2O 1B76A 1V1MB 1GT91 2D0OB 2FMXA 1ESDA 1UBUS 2PYDA 4V03A 3X1YA 2VHUA 1JEJA 2FF5A 3KDSE 2O2IA 3TTYA 2BEUA 4KIWA 4O3MA 4Y2VA 5CP8A 4TUYB 1L5QA 1CEEA 3BIWA 4C7KA 3A04A 4DCGA 4YMLA 3WIVA 2PSHA 4EZEA 4OXXA 4CTKA 4MH0R 4F8JA 4PVCA 3WMWA 1DX9A 3JASA 2BFNA 1JPVA 1I7NA 2XUGA 1I7PA 1HL3A 1SWVA 1XRJA 4CKBB 3FLBA 1LWOA 1R8SA 4CF7A 1E9VA 4NEHB 2HJ9A 2F1JA 1AHIA 1CUVA 3HH8A 2R4QA 1VSBA 1YIDA 2W8ZA 1RE1A 3K2QA 3WBKA 3CHYA 2F4VB 4A1FA 4CCYB 2ZAOA 3NHWA 4EGAA 4KITB 1IEVA 1UPCA 2TSYB 1VE3A 3A9CA 1NI4B 4C6RA 4ZOCA 3QYPA 4INOA 2FKNA 3OQIA 2UUBB 2FK7A 2WHQA 5IN5A 4B6QA 3Q9NA 4KX5A 2O3UA 4F72A 4HP8A 1N57A 2IW3A 2I3DA 4WAUA 2YWFA 1T6NA 4CIAA 1ENOA 4FT4A 2VKTA 4N1AA 3WC4A 3TOSA 2Q0QA 3IUPA 5FPSA 4ZEMA 5F2NA 5EMJA 5HYVA 3HZHA 3EZ2A 2ATIA 3ZUPA 1T3GA 2BMWA 1LPNA 3LZDA 1ZJZA 5A06A 2BBSA 1EXDA 4O4HA 3F8TA 5B2EA 1GTMA 5BWLA 2AJCA 1RQPA 4J91A 1EFRD 1OX6A 2UYOA 1JW9B 2VP4A 2Z1DA 4Y1EA 3C6MA 2WWVD 3WL6A 3BEDA 1YZYA 4ADSG 5DCUA 1M72A 5J2UA 4KUGA 4Q7JB 4RETA 3U19A 1CB7A 1IPHA 1I0IA 1Z22A 2MINA 3GGPA 2HDHA 2SNIE 3EIFA 3AYXB 3D6VA 4MOWA 4MXDA 3NB0A 2I6GA 4X84A 4LY0A 4YCCA 3CMCO 1GFIA 3B7PA 2XRMA 3R3XA 1YVRA 4O4IA 3CLVA 2GDZA 1P5FA 2H9AA 3CVJA 1I4DD 4R1MA 4U0JA 4JXZA 1TD9A 3G1WA 3JY6A 4BXOA 2BWJA 5E9AA 5BWMA 3PDIB 1T35A 2WWFA 3IR6A 1Q2UA 2XYRA 2JF0A 3KQPA 4B82A 3I2GA 2PA3A 4P2GA 2OV8A 1G66A 4DSAA 5GY7A 3RF6A 1P9WA 4PZ0A 3WLAA 4MGZR 1FRFS 4LBYA 5LVAA 1IK6A 3OWOA 2VYVA 3CTMA 2QN1A 3GMDA 4YGYA 2GKGA 2N9UA 5JECA 1IY0A 2JEOA 5FPYA 1XQXA 1ZGBA 4LCJA 2BJHA 1EVZA 1FNNA 2G9QA 1L5RA 3AV3A 3K9BA 1TD1A 2PZKA 3QXGA 4QXPA 4RJKA 2JA2A 3D7RA 4BMXA 3B3JA 1ULBA 3STWA 1AG9A 4TYYA 2RGNC 2Q3BA 1J0EA 1F0KA 2QI9C 2EF1A 2ZK7A 3L2OB 4HGZA 2ZAYA 2IITA 3P9QA 3HDJA 3V33A 4ZYWA 2ZYIA 3B48A 1M5UA 3LXXA 3OIDA 3KPJA 1PFWA 5JJCA 3INTA 2QRKA 4NZZA 4EL5A 2CNLA 2XA9A 2OORC 5JCZA 4LJRA 5LXTF 2DTDA 3FHLA 4LECA 5KDLA 5BNWA 4KGXA 4GECA 3K71B 2PGDA 4J1TC 1RC8A 3LT4A 4HUQA 2QOEA 4NONA 5JW6A 2I6XA 4JKIA 2IHKA 5EE5B 3HWWA 1UK9A 4DJJA 4DLAA 3HABA 2GM5A 3I5MA 2A9OA 3LUBA 1WR8A 3HEAA 2X4DA 5ENDA 2WPDD 4M8IA 3HUEA 1Q1ZA 2NV6A 1V8BA 1L7AA 4GAEA 3RIHA 1BW9B 1NQAO 1QC5B 1YOBA 3NETA 2EATA 3M3HA 2FPOA 2WJGA 3CX4A 4YDRA 3FUVA 1LK0A 3C6QA 3N8KA 2PAAA 1J00A 5H3LA 2V7GA 3DMGA 4MI9A 5EWMB 4L51A 1S3GA 1Q6ZA 3FMFA 5HQ3A 1G16A 3TZLA 1DLJA 4I4TA 3ISTA 1DBVO 2EL7A 1DQPA 2VDMB 3MEQA 4LDQA 5TR9A 3TUJC 1YK1A 1KIAA 3ESZA 4QIHA 1FX1A 1MNAA 2FPKA 5TQ0B 5C7IO 3RSZA 2JKYA 1ZN9A 1YE5A 3HKDA 4LFBB 2YRXA 1L4BA 3KJGA 4CTMA 1PIWA 2DFTA 1E2HA 2A7XA 1T4GA 1X14A 4JLVA 1JSZA 4AS2A 2I2AA 4U2KA 2BE7A 4XYGA 1A9XB 2X1MA 4L8FA 1J1UA 4ZQGA 3A4MA 1EM8B 2AC4A 2DBVO 3EEBA 4R9UC 3ZV6A 2H63A 5BWBA 5EJ5A 5EERA 4HYQA 2R9VA 5H02A 3OLXA 1XCPA 4C22A 2G72A 2H48A 5KVCA 1GTJ1 1RBZA 4MV1A 1NC1A 1CR1A 4C1BA 2PRKA 3L6UA 5ERXA 4L72A 4A2PA 1O6ZA 1RZVA 4DDKA 5FAXA 4MWZA 2CYBA 2XYQA 4D26A 3UY4A 1CJUC 1X2BA 2I6TA 2LKCA 4NICA 2IZ7A 2HXGA 2WJVA 2Y99A 5E4TA 4D44A 3DAHA 4OHVA 3TTTA 4G5YA 4MA4A 1JSCA 1P4SA 4X91A 3T1QA 5ARBA 1RLIA 4RHXA 3IKTA 3H7AA 5FUWA 1YS1X 4N5DA 1I7SB 2CUTA 4LMAA 1NW8A 1EE2A 4XPZA 4URXR 3T06B 2CZCA 1DQNA 4ALLA 5J4KA 3E1GA 2C4VA 4KO4S 1RM5A 3Q10A 4NZOA 4AZ3B 5B12A 5LQJA 2NU9A 3G89A 2XNCA 4E51A 2VA8A 3KQLA 2MOKA 4CKWA 2JVIA 4N0MA 2BFCB 1Y8RB 3NALA 2DB3A 1ENYA 3VSBA 2CMKA 5CITA 4RXMA 3RTGA 5CEFA 5C5EA 1FRQA 4K6GA 5BRAA 1WB6A 2O05A 3BRWA 4AC9A 1P7YA 5I7AA 1E3IA 1CP2A 4YCLA 1Y5LA 3QPAA 2W6QA 3QX7A 1D2RA 3JZDA 4AURA 2KPOA 1BWRA 2CNKA 2OKGA 3UHJA 2OMKA 1V6SA 1SCNE 4I66A 3T1NA 3V4SA 2XUPA 3TB4A 1B0PA 3HB7A 3N6VA 4HVAA 1TJ4A 2X7XA 3PXBA 4OXIA 3NASA 2Q2WA 2L2QA 1QDLB 2HV8A 2OORA 4ERNA 5HILA 1X1SA 4W5HA 5CA1B 2PKEA 3GNSA 1P0IA 5I3ZA 5KTMA 4J4HA 1Y5NA 4OM8A 1ZISA 3KLNA 2GLUA 5FUMA 1HE3A 1V11B 2OECA 3NTXA 4I6JA 5FA8A 3EC1A 3VOBA 5KKNB 1RAIA 3RSSA 1WW2A 3FGNA 1EBBA 2ARKA 3TE7A 3VR3D 3S29A 1NVVQ 4GKVA 3LAWA 1TM4E 1FP1D 4TYPA 1QIFA 3FOAA 1W75A 1IY2A 3AGPA 3BC1A 4EPTA 5LYJB 2FUCA 2GKSA 3PHHA 1A77A 2Q5CA 2X8JB 4XIYA 2VP2A 1P4HA 1C3LA 3H11A 1R5JA 3NT2A 2NUPB 1OAOC 2QB5A 4Q00A 4RV5A 4CMBA 3G5UA 3VUEA 4BO2A 5CXSA 4JCCA 1FJ2A 4YB8A 2X7HA 3EMKA 4Z3KA 3IAM1 4Q1FA 4CMCA 2H4FA 2YWHA 1CUYA 2WYUA 1YB4A 1ZN8A 2JKZA 3SZUA 2IXDA 1SB8A 4QXRA 2WM3A 3VPSA 3WE7A 5JRDS 3G9TA 2IU6A 1EUDA 2W6PA 1NURA 3GEGA 1RYEA 4FFBB 1G2QA 3LE8A 4W7IA 5JVDB 4RK0A 3VPCA 1QE5A 3VOTA 3RC9A 1XVIA 5I7OA 2YN0A 3JAMA 4OJMX 4YQZA 4UEWA 3PC7A 1Y4UA 3LRXA 1N5JA 4RTOA 3ELBA 1NBMA 1VJRA 3ESXA 4G09A 2DFVA 1PUXA 2V58A 4NE9A 1F0YA 2VSFA 3EF1A 3K8QA 1BX1A 1VLLA 2B1GA 3RC2A 2JK1A 4B32A 1OLSB 1WVMA 4NV1A 4C0HA 3PQEA 1EUZA 1K0FA 4OH1A 3VSCA 3AI1A 4HT3B 5HVNA 3IT3A 1NX9A 1CPYA 3QEOA 3HKDB 1U2SA 4O5OA 5TXGA 2AVNA 1R2QA 1VMKA 3U5TA 2IH2A 1HZJA 1XA0A 4QG7A 3ZCQA 2AYXA 2HHJA 5DX0A 1JT9A 3F7TA 4DRYA 4LPSA 3CGGA 4JR1A 3WYDA 1HSZA 2D1FA 2JHFA 4GYJA 4S1OA 2OHHA 3O8QB 4F86A 1FFSA 2X41A 1JDBC 3JD4A 4DLNA 1PNRA 5KYYB 5JAOA 1XR3A 1PK7A 4LISA 1PI3A 3LHFA 3L4KA 1S8OA 3R74A 3QLTA 5H9WA 1VXOA 4RF2A 2PX0A 3EQ9A 1RYMA 2B5WA 4DPLA 5A4JA 1TF2A 1GPLA 4UUPA 3QBVA 3WDKA 1QVAA 2O0MA 3EDOA 3SVZA 1ZY2A 1MU0A 3W6NA 4FBLA 5KJ6A 3UVEA 2QKYA 4M7OA 2D00A 3G7UA 3JQ7A 4ZN6A 1E9AA 1MJGA 2WOOA 3WWPA 4BP3A 2BDEA 4R1UA 1M7GA 1SU8A 1NZJA 1E7RA 4I8XA 2OESA 6REQB 3LWBA 3TD2A 3WK5A 5CK5A 3IOEA 3UT5B 4LF7B 1ZCJA 1LW6E 5DGHA 1SEVA 1BH2A 3DDSA 2FRDC 1X8KA 1BAPA 1MUUA 3ZHVA 1ZG3A 4LSZA 4WFKA 5WRFA 5M04A 1TQ4A 2NACA 3Q1KA 3ZWAA 4M37A 1DRKA 2PZAA 3IXLA 3KDPA 3OHSX 2YMLA 5HBRA 3VR4D 3BD8A 1PSWA 3ZXIA 2XMGA 3MWLA 5FBQB 5IMBA 1UOPA 3CLTC 3IE0A 1RZRA 4TS4A 3NMUF 1PU2A 2CJYA 1J90A 1E3WA 3QJYA 4KH1A 4NOMA 5DU2A 5TT1A 1NVGA 2HPHA 4FZ5A 1LQ2A 3QG5A 2QRQA 2QQ0A 2QA5A 3U60B 5F1PA 2R8ZA 4H1VA 1G8SA 2O19A 1TIBA 1U2RA 1VZ2A 1F0PA 3EEIA 4HKTA 3A9TA 2VTVA 1U8AA 3U4MA 1V9SA 1IJFA 4GMFA 4P4SA 5EHIA 4KUEA 1Q22A 1HQYE 2XTMA 3AF4A 3BJRA 3OG9A 1RADA 1T4MA 1HE1C 1GNLA 1BW9A 2C4KA 2HUNA 3KZOA 3TRIA 1VJ0A 3BMOA 5EJFA 1ILWA 5DV9A 4ZYTA 2Z6AA 3FGZA 3UHOA 5JSFA 3KLOA 1KFKB 5F3WB 3E03A 2FMKA 4XFKA 2OWDA 3OQPA 5J2UB 3PRYA 3QPDA 3OPMA 4K1XA 4KJXA 5JD3A 5TPZA 4E5MA 1FBTA 5HQ3B 4DL9A 5J59A 5CYGA 1FTWA 4FFPA 3M6IA 3ZN2A 4BV3A 4I08A 1GCOA 4TQ9A 3LUPA 5E3HA 1DC8A 2OMEA 1T9DA 3AIMA 1L4MA 1X7ZB 5EP4A 5G0SA 4HGYA 3VNUA 4HMOA 4JP3A 1V7CA 2LKDA 3D6JA 4XGNA 1SVIA 3BHJA 4QYMA 4RTSA 1U0BB 1K5DA 1EA7A 2ZXFA 3KSMA 5KPJA 3IEVA 1YVEI 5DI3B 1WPXA 1C8BA 1L7VC 3HU2A 1KZ9A 1RYFA 1LPSA 3ET5A 3QYAA 3OZXA 2C2YA 2ZT5A 1HNNA 1TUBA 4YP0A 3UJ7A 2BAGA 2AXEA 2DBYA 2G9UA 4IZ6A 3HR8A 5IK2A 1DIGA 2FHPA 1KJJA 5NULA 5GJBA 4D3XA 1Z62A 1ORRA 1VPWA 3PNMA 2QD3A 3WFIA 2AMJA 1X1CA 3ONEA 4RF4A 5IBCA 1KK2A 1R5BA 3UG6A 4MHOA 2KB0A 3FX2A 4PRKA 4EHNA 5EYPA 3ZX4A 2DERA 3SNKA 2HDWA 3AP1A 3R5TA 1BRTA 2D54A 1C50A 2YXEA 5CEEA 1TUIA 5M2QA 3I61A 1E99A 3A10A 4MVJP 4GOJA 4RESA 4GL2A 3L7CA 2CKDA 4LYEA 2BGJA 2R1TB 5FOWA 1UT6A 5I9BA 4HB0A 4DJTA 2X0RA 3BL6A 1XI2A 4A8PA 1KO5A 3DAPA 3LT2A 4NFLA 4CU2A 2EFJA 4PBSA 1Z08A 1N5LA 4MYSA 4I9UA 1AGYA 4Q9NA 2E7ZA 3UKJA 3EVBA 4EFDA 1YV9A 3EX7C 5HIKA 4V24A 2VK2A 3I09A 2ZT8A 1DCFA 3K09A 5D5PA 3W5AA 1R4AA 4OJQA 3IRVA 2EEZA 4HK4A 4PPQA 3CUKA 2GZAA 2RAVA 3ZNPA 3C5EA 1Y5IA 3IOCA 4KLAA 3R7WB 4BTLA 3N0VA 3BH0A 1MAUA 1EHIA 2QTBA 4V39A 5AVOA 5BT9A 5K8VA 1B42A 3DG9A 3HG7A 5LUBA 5FFNA 1ZVVA 1A4RA 3NOXA 5EWMA 1SVSA 2OV6A 3HXQA 1T8UA 3CX7A 4QPZA 1HSOA 2AK2A 2BM0A 2B2XA 1FJGB 1NI3A 1QRSA 4LNAA 1GZDA 4EFMA 2QUKA 3C6BA 3E23A 1ZONA 1WB5A 2A0KA 2CLEB 3BGOS 1ZXXA 1X1BA 2Q49A 5TE9A 3RVPA 3VKUA 4B7AA 1XMVA 1U8TA 1XEWX 5BYKA 4R4JA 1JA1A 2D2VA 4X8LA 5BUZA 1KMMA 1JEAA 5FOVA 2QSZA 1LV7A 4QUGA 3RVRA 5HKKD 3KJNA 2B4AA 3E5NA 1CETA 1UFQA 2VNSA 5JJIA 4UAJA 3LKVA 4IH1A 3TMYA 4LZWA 4DFDA 3DOEA 4Y6SA 4KRFA 1KF0A 3R0QA 4P7JA 2PT9A 3E1SA 3HPQA 1C1XB 1VPVA 3QTLA 4DJAA 1A2BA 2C4WA 3GU3A 1X7YA 4GP6A 4QRHA 4J3NA 4W5QA 1A9TA 4ZVPA 3PK0A 2EFGA 5LZ4A 2HPZA 1GLGA 2B9VA 3SBOA 3T99A 3NIWA 2ZJ5A 4P08A 2P4UA 2XMRA 3BD6A 3D6MA 5ULLA 4Y6OA 4MGEA 3TJRA 1U9CA 2Y93A 1SEPA 2BGTA 4KE7A 3H42B 3ZX5A 4DXAA 1DWPA 3GFVA 1NLMA 1VBKA 3MJTA 4PLHA 3LSYA 4ZPXA 3NCHA 1UBFA 3OC0A 3HVKA 4UDYX 5ALMA 3ND5A 3JRNA 2LPMA 3U44B 2Q5FA 2YQ5A 5KYGA 3U6BA 2VWGA 3DOJA 3AJ8A 3U9SA 2HWYA 2O2XA 2QVLA 3FJ1A 4OSPA 1P2GA 4C3OB 1UP6A 3G1UA 4NHOA 1Q1AA 4OU4A 1EBUA 1Q7GA 3BSFA 1JAXA 2WUGA 3DDOA 5LZ8A 3FMGA 1FFWA 1Y8RA 4X61A 1SIWA 5FKJA 1DJLA 1RRPA 4C6TB 1T2UA 1JR3D 2ZM5A 2IY8A 2BOVA 2Z9DA 3M49A 3PFBA 4JQZA 1N2CE 2NU8A 3M3DA 3CXRA 5AIAA 2ZETA 1XTRA 4UEOA 4R2KA 1SBZA 5BMVA 4PZEA 5HF5A 2C3MA 3M70A 1XP5A 2VT3A 1JJ7A 1ZPDA 3B70A 3AR7A 1FXWA 1MOSA 4QTTB 4PTYA 1TGVA 4BO5A 2WAYA 4KBYA 3V1LA 4B3RB 4KI7A 4XCQA 2QMOA 1EE9A 2Z6VA 4NLLA 2E55A 3KSZO 1YCGA 2CJWB 3B1KA 2Y2VA 4KIJA 1VHJA 3TR5A 3E8XA 2IYPA 3HE3A 4NJEB 1F8XA 1L5SA 1U7DA 4RY0A 3BZBA 1K6IA 4BNXA 2C8LA 1XZMA 1Y6ZA 5CVVA 4UJ3A 4WD3A 5CXXA 3L4BA 3OJXA 1IZ0A 2BZ0A 1JAIA 4W7SA 1H6AA 2GAAA 5FR1A 2AN5A 2LUOA 2HCBA 2Z4RA 3N2IA 1WM1A 2R25B 3G7NA 4V0ME 4W8GA 4WH0A 3SEFA 1QOPB 3PT9A 2GETA 2DSTA 1AB5A 1ZGGA 5KKAA 3EFBA 4A5OA 4MARA 3LIIA 4XVQA 3RG8A 3STVA 2XAAA 1BX0A 4ENVA 2GNOA 4RMGA 1F2TB 2B3TA 3I3OA 5HM6A 3B1JA 5IABA 3IPAA 3OJCA 4DXHA 4FB4A 1SG9A 3U7EB 1IK4A 2F64A 3OY2A 4JLSA 4BO3A 2C2GA 1XWIA 4JI3B 2QD2A 4ZCIA 1TZJA 2P5SA 2I2FA 3BB1A 2PDAA 3UMMA 1W36D 4DNOA 1T5BA 3AF5A 1VB5A 4YV1A 1XDZA 3A3PA 3AILA 5AJVB 3TZQA 2YXLA 2WZDA 1IC6A 4FYJA 1JALA 1LTQA 2VUSA 3PX3A 3RAEC 3M6AA 1QVRA 3GLQA 3G1TA 2PZ8A 5FTLA 5B1SA 3SJCA 1VGQA 4HAZA 4HRXA 1W5EA 3FBTA 4MEBA 2OBMA 3VHXB 4DAEA 4CEIA 4F3TA 3CWQA 2A1TR 5AM2A 5JSKA 2JFQA 3DNFA 1N6RA 2GA8A 4PLPA 4MK4A 3OFJA 1A2KC 1PZNA 4NYJQ 5DBGA 1KAEA 2OFPA 5G02A 4IIVA 1RWQA 1AZWA 3C8HA 1IM5A 1ZIPA 1G4UR 2CEKA 3EFOB 2Q1SA 2XWQA 4C0WA 4TLMB 4DLVA 5K20A 3KAQA 4LFAB 3VR5A 1P62B 2B4RO 3MXTA 2Q9AA 3ELUA 4DSZA 1TRKA 1GDDA 1N5KA 1U2QA 1XMIA 3D4PA 1YJCA 2D5LA 3OT5A 4UE3S 4Q9IA 4D5EA 1U3UA 3H8JA 2W4MA 1Y1SA 3LVQE 3PIIA 3WWZA 4EEZA 4EYEA 1T0HB 2QAJA 2TMKA 4ALIA 1TCAA 1D2MA 2C2HA 1AM4D 3ZE6A 4QLOA 4L0DA 4XR9A 3SYNA 3ZVMA 1JUDA 4BGUA 1VHLA 2VP3A 1JIVA 2C03A 3PHCA 3R8FA 3H86A 2IEBA 2OE2A 1R8JA 4DDHA 3RYCB 1Z68A 3DBVO 4NBVA 4XWGA 3MILA 4G86A 3WBJA 2GLXA 4KNWA 4OXKA 4JI6B 3Q7QA 4AYWA 3BG5A 4OYHA 2B2NA 2FRXA 5AW1A 2WG2A 3LD9A 4D0SA 1O5TA 5BVGA 2FQWA 3OP1A 3I9V1 4E4TA 4CMEA 4GM4A 3JQFC 2ODEA 1FDWA 1SBIA 2DLCX 4MJLA 1VIDA 4KOEC 1WTCA 1A8IA 1HQDA 4HXYA 1QP8A 1KOLA 1BDBA 3OZFA 3A0RB 4LJSA 5IMSA 2GNAA 1LRJA 2QU8A 2OG2A 3O90A 4MUKA 2OCXA 4QRIA 4UMEA 1C80A 1RI2A