4MJ3A

Haloalkane dehalogenase dmra from mycobacterium rhodesiae js60
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
302
structure length
302
Chain Sequence
MDVLRTPDERFTALPDFPFAPRYVEVDSGDGGTLRMHYLDEGRSDGEVVLLLHGEPSWSYLYRWMIPVLVEAGLRAVAIDLVGFGRSDKPTSRDDYTYQAHVDWMWAAIEEIGLADVTLVCQDWGGLIGLRLVGEHPDRFARVVAANTMLPTGDHHPGEAFLAWQKFSQEVPLFPAGQIVNGGSLSTLSAETIAAYDAPFPDASYQAGARQFPMLVPISPDDPATPANRKAWAALGRFEKPFLSAFSDSDPITGAAEPVLRGHVPGARGQSHVTIAGAGHFLQEDKGRELAEAVVTFVRANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and biophysical characterisation of haloalkane dehalogenases DmrA and DmrB in Mycobacterium strain JS60 and their role in growth on haloalkanes.
pubmed doi rcsb
source organism Mycobacterium rhodesiae
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 98
structure length 302
sequence length 302
chains with identical sequence B, C, D
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2013-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mj3A00
5ALMA 5AK6A 2XQGA 2Y2UA 2WJ6A 4BP8A 3QBJA 2Z3ZA 4H7HA 4PSCA 1SC9A 2XQIA 4K6KA 3H1BA 1QGED 1DU4A 1IUOA 2RHWA 4QLAA 2DCMA 1QTRA 2C5FA 5YASA 2WU3A 2H7YA 1ODTC 4L9AA 5KBYA 1AUOA 3QPDA 4WFKA 2BGRA 3G8YA 2BCEA 4MYSA 2WFMA 3QPAA 4XWGA 1AGYA 4PW0A 1Q84A 4LXHA 5ALHA 4E15A 2QKYA 4J0GA 2XLCA 1RYYA 1TQHA 4H7IA 2PL5A 2OXEA 2WHQA 2V98A 2OGTA 3I6YA 4MEBA 3K9BA 2CB9A 4NVRA 5AI5A 3STUA 4X6YA 5T4HA 4AX4A 3T4UA 2JEYA 3HSSA 4QDZA 3LP5A 3ZLUA 1ZI6A 4B7ZA 5DNVA 1VE6A 4L0CA 4RE5A 3EQ8A 1H22A 1G66A 4CCYA 3H17A 4X90A 4RPCA 3ZLTA 1X2EA 1BN7A 1PJAA 2XUPA 1JI3A 4WFIA 5FKJA 3OM8A 4H7JA 2EEPA 1IUNA 4DNFA 2B61A 3WIBA 1T2NA 1PV1A 4BTVA 1CUSA 1EX9A 3DQZA 5AH0A 1UK7A 1YS1X 4X92A 3RARA 1P0QA 3DEAA 1WCYA 4AN0A 5CH3A 3OPMA 2C4HA 5AM3A 1ZIYA 3BIXA 4K2AA 1YCDA 1ZD2P 3TRDA 2B9VA 2V9ZA 3S8YA 3IUMA 4KYVA 4YX9A 2HFKA 1MPXA 3G0CA 4MWSA 4DMFA 4X97A 2OAGA 1HBJA 3STXA 3FLBA 4EY4A 5BV7A 1UXOA 1MN6A 4FKBA 3C45A 5JAPA 3FBWA 4EY5A 1SFRA 1XRRA 3WMRA 4TGLA 3F67A 5JD5A 2PVSA 1QTIA 4M0MA 2OCGA 3EQ7A 1QO9A 1LNSA 2NW6A 4P93A 1EDBA 2HA5A 5DWDA 4M0FA 3OURA 1JFRA 4LXGA 1GPLA 3DL7A 1LPSA 5A71A 4F60A 2VAXA 3HLKA 4U2CA 1MTZA 5FRDA 1QOZA 3D0KA 4G4GA 1XKTA 2HL6A 4Q82A 4BZWA 3WZMA 5C8XA 1EDDA 1N8SA 2I3ZA 4WCVA 1K63A 4PV7A 2ZYSA 3NWOA 2O2HA 5HZGA 1I6WA 1HKHA 3AZQA 4JYMA 4OD0A 5AM0A 2ROQA 4KJXA 4MYDA 2JGMA 3WK8A 1JT2A 2HADA 1CUHA 5HF8A 4X00A 4XIIA 4EHBA 3WK6A 1XQVA 3V1MA 3R3VA 4LKOA 4QLOA 4KAAA 1M33A 5ALRA 1XRNA 5HKBA 3NUZA 1XZEA 4EA6A 4X91A 3PI6A 5ALLA 4E11A 2GYUA 1ORVA 5AKLA 1VKHA 5HK8A 3DOIA 4FFWA 1MJ5A 1XZBA 1JMYA 5A2GA 4ZWNA 4F0JA 4HAIA 3I1IA 3RLIA 4A16A 2FJPA 4UHDA 4B83A 1YASA 4IH1A 5LYYA 1CUEA 5ALUA 4KE6A 3BDIA 3MGAA 2WFLA 1JKMA 4YK7A 4UHBA 4QZVA 2C58A 3PFCA 4Z49A 1USWA 1DWOA 5FOQA 4CIBA 4X3CA 4K6GA 5AO9A 4KE8A 2DHDA 1SCKA 1BEZA 2Y2VA 1UOPA 4AZ0A 3WL5A 4LHEA 4X7BA 4OU4A 4J0JA 4PO3X 4X85A 1K6EA 3MUNA 1CLEA 3QM1A 1N1MA 3W04A 5LKAA 3VJLA 3LS2A 4BVLA 3W2TA 2O7RA 1HPLA 1MO2A 2XUAA 4AMZA 5ALTA 4Y2QA 1R1DA 5SYNA 4UFNA 4CFSA 2XMSA 3KWJA 4W1PA 5K3DA 3TEJA 3DYVA 1IUPA 4QDXA 4BAGA 4L72A 4C89A 4RGYA 5C81A 4RE6A 2GYWA 2VAVA 4BCCA 1K4YA 1T4MA 2V96A 3N2ZB 4BCDA 2PKYX 4N5IX 4K6HA 1DINA 2YH2A 5EGNA 4OSEA 5LKRA 3IULA 5JAHA 4EUSA 3DKRA 3GUUA 4YPVA 5CW2A 3A70A 1DQZA 4B82A 2ZJFA 5AKXA 4BDTA 3AIKA 4UHFA 2FJ0A 3WWDA 3V1KA 4UBOA 1HL7A 3LIPA 3A2NA 5IVDA 5ISMA 3AUKA 4QNNA 4FBLA 3HJUA 1AKNA 4FLMA 5AKYA 4CCWA 4GDMA 3QPCA 1W76A 2IITA 5ALYA 2QS9A 3ZWQA 5JAUA 1CUBA 4N8DA 2HRQA 1GQRA 2C0QA 2WUDA 2P8SA 1CUZA 4DMCA 2WIJA 1MAHA 1UKAA 3IDAA 2D5LA 2I03A 5FP0A 1TAHA 1NU6A 3BDVA 3BJRA 3A6ZA 4BB0A 1P0PA 5E4JA 3PF9A 3AJAA 3D7RA 3QZUA 5K3AA 4MJ3A 4Q3LA 5FXMA 3ED1A 2HA3A 4G8DA 2BUCA 5T4EA 4KR0A 5CURA 3CN7A 1XRQA 5C8VA 5LZ9A 2QJWA 1TIBA 4X6UA 4UBIA 1H2WA 4FOLA 2CKMA 1XQWA 1ZGBA 5ALXA 5EFZA 2FUKA 4HRYA 1F0NA 4AO6A 3RK4A 1EI9A 1FFAA 4B9EA 5HCUA 3DOHA 4ROTA 3H1AA 2XB6A 2XQFA 4G9EA 4OPMA 1QIJA 1W6RA 2DFPA 1EK2A 4BVJA 3PUIA 4ARBA 3IA2A 5I9IA 4UBJA 3WA6A 5F4ZA 3F98A 3IUNA 4FMPA 4B80A 1QE3A 5EHZA 3DJYA 1K5PA 1LPMA 2ZJ7A 2QTBA 2XUFA 3AIOA 4J0DA 3L1IA 3D2AA 5CTAA 4ARAA 1XRMA 5FDFA 4BDSA 5BWCA 4AO8A 4EY8A 1YAJA 3IVMA 4KRXA 1BCSA 2ZYIA 4BYMA 1J07A 3I2KA 2IX9A 1ACLA 1E5TA 4UBMA 4X95A 1L7QA 5CH8A 3KD2A 4Y2JA 1VXOA 1XRPA 4DSZA 4KAJA 5HQ3B 3B5EA 4Y2VA 2I78A 3S2ZA 4QDUA 2BGNA 4IO0A 4FTWA 5JZBA 2B4KA 3L1JA 4JUIA 2QUAA 3G0IA 1JJIA 3G9XA 2BUAA 2CUTA 4S0XA 1GKKA 1R3DA 1Q0ZA 5C8ZA 1WPRA 2WQZA 4W9RA 4BP9A 3FAKA 2XDWA 5DTIA 1U2EA 1EB9A 2YASA 3BJMA 1YS2X 3Q8WA 3PUHA 1OILA 5AIAA 1CQZA 1H2YA 4KAFA 4DTCA 5AIBA 1R50A 5ALPA 3F8SA 2CEKA 3H2IA 1FFCA 1R4ZA 4MWTA 3ZPXA 1CUXA 4QDOA 1W52X 4Y2XA 2HRRA 3I1YA 1THTA 5JZSA 3WK4A 5DNWA 3V1LA 5DJ5A 1QONA 1ZD3A 4QWWA 2OLEA 3UUFA 2PUJA 4GI1A 2ACKA 1QFMA 2GYVA 3FVTA 1EH5A 1UKCA 5EHQA 3PF8A 1SOMA 2J4FA 2VJBA 4QA9A 2Q0XA 3V1NA 5J3JA 2WIGA 1MX9A 2XQKA 1F6WA 2XLBA 1U4NA 4BBZA 6YASA 5BWBA 2GBCA 1BCRA 5D3KA 1BROA 4X94A 4TPKA 1N5RA 1GPNA 3FVRA 3F96A 2HHAA 4C6HA 5FUMA 1AURA 2CJPA 1KU6A 3VJKA 3DL4A 2XE4A 5JALA 2AJLI 4CCYB 1VA4A 2JF0A 2RHTA 2R8BA 4O08A 4F21A 1ZIXA 4J0CA 4U2EA 1CUDA 3MVEA 1IZ7A 4Y2YA 4XVCA 3H18A 1FFEA 2C0PA 2H1IA 1XZJA 1MU0A 4Y2PA 1EDEA 3AINA 3QH4A 1QO7A 4BC1A 3F9CA 1AMNA 4Q1VA 2XUIA 1QIMA 1X70A 5CT5A 4KE9A 4CIAA 2OCKA 2HA0A 4B9AA 3UUEA 1QIDA 2PUHA 1A8SA 3GBSA 1H23A 4KEAA 2VATA 1WB4A 3HZOA 5DYTA 5H3HA 1XZCA 1CVLA 3QMVA 4MEAA 3OTQA 1DT3A 3BXPA 5LIPA 5AI9A 4BZZA 5ALIA 4FNMA 2PX6A 1XZIA 3I6MA 4G9GA 4G1FA 4CG1A 5CXUA 3H0CA 5CMLA 5AK5A 1ODSA 4ZRDA 1SCIA 3DDUA 2J3QA 3LLCA 3D5EA 1ZJ5A 4DNQA 1C7IA 4ZV9A 4ZREA 4LYEA 2HU7A 2Y6UA 2ACEA 4G8BA 4J0HA 4J0IA 4B6GA 2EDAA 4BVKA 5ALEA 2OGZA 5HKAA 3GZJA 3WA7A 3G9ZA 2H9YA 2G5TA 2XUGA 3DLTA 4AQDA 3JW8A 2QJRA 4V2IA 3IIIA 3FLAA 4B0PA 1VE7A 2E3JA 5LZ2A 1TCAA 5ALZA 2VJCA 2HA6A 3SC2A 1G42A 4DMKA 5K3FA 1FFBA 3A2LA 2PSHA 2DQYA 3HI4A 4ITVA 4L3WA 4X71A 1AQLA 2QT9A 1CQWA 1CR6A 1WOMA 2XI4A 5E4YA 1QIEA 5AKKA 1ZOIA 5I7UA 4UBNA 2WHPA 4J03A 5HK9A 2WFZA 3ZLVA 2XQJA 2PSJA 7YASA 2XUKA 5T4FA 3STYA 5AOAA 1JU4A 4GBGA 2VA9A 3M83A 1ETHA 2VT7A 5ALJA 3O0DA 3WWCA 4JNCA 1BN6A 5CT8A 4FFVA 3N0TA 2HM7A 2AJDA 1CUGA 1QFSA 3DKKA 3QVMA 5JYCA 3AIMA 4Y2UA 2PBLA 3C5VA 4Y9SA 4GHWA 4LIPD 1VZ3A 3H2JA 1E3QA 1LPAB 3IBTA 5JATA 3O4JA 5KWJA 2CZQA 1QJ4A 1UK9A 4JH0A 5K3EA 4OCZA 3WKDA 5LP1A 2ZSIA 1WB5A 3H19A 3DYIA 3PDCA 5JARA 5CT9A 5ALVA 4H7FA 3R40A 2C7BA 1ACJA 1CUIA 4BAZA 3TGLA 1QLWA 1UFOA 1LZKA 5KWIA 2IIVA 2JEZA 4P92A 5AKGA 3WYNA 1U65A 3WK9A 1C7JA 4HVTA 3K6KA 4EB0A 3G9TA 5SYMA 1P0IA 5DYYA 2K2QB 1BE0A 1UK8A 3O4HA 4H7KA 4Y2SA 2HU5A 3HC7A 4UHEA 1ZICA 5AKEA 4C4YA 2Z8XA 3M3DA 2OPHA 5ALSA 3C6YA 3FCXA 2WG1A 4BAUA 2XUQA 1S8OA 2BKLA 1AZWA 2PU5A 5JIBA 1XZMA 4ZGBA 4DGQA 2ZYRA 1ORWA 3D59A 5AKIA 5A62A 2WTMA 3GELA 4KE7A 1CUYA 1J2EA 4A23A 5ALDA 1WHSA 4LYDA 1WB6A 1QZ3A 4WY5A 5K3BA 3EBLA 5E2IA 2ZSHA 5A7FA 4HXFB 3R3XA 4AN1A 1XKLA 2HDWA 3D2BA 1LPNA 4WDRA 3VDXA 5KREA 4IH9A 1UT6A 3W05A 3D4LA 3WWEA 2WUFA 4U2GA 3FYUB 2QRUA 4AB1A 4C4XA 1TRHA 5I8PA 2PPLA 2ZJ6A 2XT0A 2QXUA 1EXWA 2XMDA 4C88A 1W75A 1YB6A 5HF9A 3VJMA 1FJ2A 2WSLA 5IVIA 1A88A 2WU4A 1Y37A 1A7UA 2Z8ZA 3OC0A 2RI6A 5T4BA 1OXMA 4EBBA 2I3DA 2VQ6A 1U8EA 1TCCA 4C87A 4G8CA 5D3ZA 3V48A 3WKBA 2JGFA 1ODCA 4Y2RA 5AI0A 4FDMA 4AXBA 3R3ZA 4I3FA 4WDQA 3VVLA 1EK1A 2AJBA 3CCBA 3V9AA 5JD6A 4BE4A 4PSUA 1ZD4A 2XMZA 3JYHA 3H2KA 1HLGA 4A5SA 1B41A 2C5GA 5CXXA 3O9MA 4UFOA 5CRIA 3IURA 4FHZA 1E89A 1E8DA 4M0EA 1MNAA 2Z3WA 3X3HA 1OCEA 3D3NA 3YASA 2VJAA 3WJ1A 1GGVA 4NMWA 2BUBA 1VJ5A 3ANSA 4DM7A 4J7AA 4H18A 1LZLA 1J06A 3FYUC 3ILSA 3WL6A 4U2FA 3AZPA 3HEAA 3GFFA 3BWXA 2XUHA 2B20A 1XLVA 5LZ5A 5FPPA 5HQ3A 1VA5A 5AI4A 4H0CA 2CMFA 1CRLA 3NOXA 4UBLA 2HU8A 3WK5A 2G5PA 2J3DA 3G0BA 3W9UA 2WLSA 3A2MA 4UHCA 1KU0A 2XMRA 4WFJA 5ALKA 3G0DA 1YAHA 1ZI8A 5LZ7A 4ETWA 1L7RA 4HS9A 1BU8A 1E66A 4G4IA 3BF7A 3I2GA 3ESBA 3B3QA 3T52A 5DYWA 4UPDA 1LPPA 2GZSA 1IMJA 1J1IA 2GBIA 5FV4A 3KSRA 1LPBB 1KEZA 4W1QA 3H2HA 2GZRA 4U2DA 3U1TA 4J0KA 4HZGA 1UK6A 1CUVA 2X8BA 5C7YA 3EIOA 5AI6A 1C4XA 3ESAA 5HFNA 4NZZA 3C43A 4J3JA 2WG2A 5ALQA 2Z5GA 1UZAA 4QDTA 1NU8A 2J4CA 2X5XA 1Z68A 2BFNA 4PF1A 2WIFA 1TK3A 1YA4A 3M82A 4BE9A 1MX1A 1XZDA 4XJVA 3OG9A 4Q3OA 2JGIA 3O95A 5JADA 2CBGA 3C6ZA 1CV2A 5AOCA 4AMYA 1CFJA 5ALNA 4N8SA 4JYPA 1XZHA 1XZLA 1P0MA 1N5MA 4C01A 4WJLA 2OCIA 4I19A 1K8QA 1QIFA 3TJMA 1VOTA 3AFIA 3E0XA 1ZGCA 2YXPX 2AJCA 1UWCA 3LIIA 3QYJA 1YB7A 3GROA 1ZI9A 4W1SA 5CT4A 2OCLA 2HIHA 3KXPA 1RWQA 3C87A 1QIGA 4FLFA 5EI5A 5CH5A 5DTJA 4HXEB 3WJ2A 5IVHA 5JASA 3PE6A 4GWLA 2X76A 1ISPA 3O9VA 2OAEA 3BF8A 4UFPA 1CUCA 3STTA 2GBFA 2OG1A 5AK3A 1LGYA 3FCYA 5AOBA 1Q0RA 5FPQA 2WJ4A 5JD4A 2QR5A 3I2IA 2WG0A 4C4ZA 1UKBA 2ORYA 3PICA 4GECA 2WUEA 2QM0A 4DLNA 4EY6A 1A8QA 5K3CA 4AO7A 1BRTA 1GZ7A 2VT6A 4Q05A 2QMQA 1XZGA 4BC0A 1CUWA 2HA7A 3RKSA 1L7AA 2OGSA 4F5ZA 3SWWA 1EHYA 5D7BA 5A6VA 5D6OA 3R3UA 3JWEA 3FSGD 2PSDA 2DR0A 1IZ8A 5AP9A 2V97A 1Q83A 3I28A 1GXSA 3ESDA 5ALWA 1YSCA 3R0VA 4DSAA 2O7VA 1JMKC 3WWPA 1XLUA 1BEEA 3LCRA 3SX4A 1EINA 4OYYA 4YASA 2RONA 3STWA 2WUGA 3MUOA 3QMMA 2OQIA 5IVKA 3WIOA 4DNPA 4ZI5A 3FNBA 3C8DA 1THGA 1XLWA 2RGUA 3R3YA 1G4HA 5AKHA 1XROA 1QIKA 2JGLA 4BRZA 4E46A 1DX6A 1DWQA 5BOVA 3DD5A 4K5QA 3VISA 5K5EA 1XZKA 5AK4A 4KRYA 2XMCA 2XMBA 3E4DA 1PFQA 3WKAA 1HQDA 1SCQA 3C5WP 5ALFA 2VF2A 1F0PA 4LXIA 3WKCA 3WI7A 3KWFA 3VXKA 5EIHA 3SK0A 4OUKX 2YYSA 3CN9A 1CUJA 2WHPB 1CUUA 3DS8A 1FFDA 1VXRA 2VJDA 5FLKA 2PSEA 2QZPA 2WTNA 2ES4A 3DCNA 3O4GA 4BRSA 3IUQA 3WYDA 3G9UA 3QITA 2LIPA 3WL7A 4GW3A 4DYHA 2O2IA 3WK7A 5EIAA 3FYTA 2UZ0A 1XFDA 2WFLB 1XQYA 3ZI7A 2GBGA 4KACA 1H2XA 1EA5A 3GA7A 3EF3A 4PQEA 2W6CX 2WHRA 2HA2A 1X2BA 3KOOA 2WIDA 1XZAA 2QXTA 3O4IA 3G0GA 1D07A 3STVA 1R88A 1EVQA 2R11A 3CCCA 3PFBA 1GQSA 1JU3A 1VLQA 4FNGA 2AJ8A 4OB8A 2VTVA 3BE8A 2W22A 5HF5A 2RAUA 5CBKA 1LBSA 1VZ2A 4EY7A 2WKWA 2G63A 3FLEA 5CT6A 2BJHA 1GPKA 1DWPA 3C6XA 5E4TA 1UOOA 4FLEA 2EDCA 3FWHA 1MX5A 1E8NA 3ANTA 3I2FA 3I2HA 5AM2A 1W4LA 2WJ3A 5K3FB 5LLSA 1WM1A 2Y6VA 3FOBA 1MNQA 3WQHA 4MQLA 2FX5A 2QUBA 1NX9A 2JGEA 4B81A 4BCBA 1XRLA 2BAGA 3H2GA 3WWOA 2JGKA 4GXNA 1B6GA 4GEGA 3QMWA 4X93A 1H2ZA 4IHAA 5EIEA 2ZYHA 3K2IA 3RM3A 3Q0TA 2DHCA 3DNMA 4B85A 1GKLA 4PSDA 4X6XA 5LZ4A 4FBMA 2XMQA 4QWMA 5IH7A 2PU7A 4WY8A 4B0OA 3I2JA 2PM8A 3IB3A 4H35A 4DMHA 4RNCA 1Y7HA 1XZFA 3VKFA 4QEKA 2DQZA 3P2MA 1A8UA 2Y1KA 2G4LA 1E8MA 4HRXA 4UHHA 2OQVA 3WL8A 5ALOA 2DHEA 4CG2A 3C70A 4CI9A 3D2CA 2JIDA 4EZIA 1DTEA 4AZ3A 4CG3A 3E3AA 1BS9A 4N8EA 4JEIA 2JGJA 2PSFA 1EB8A 1QIIA 4Q3KA 3U0VA 2O2GA 5IKXA 1MAAA 3I6ZA 4E14A 1CIJA 3OOSA 4H77A 3WLAA 3W06A 2QOEA 2ZVDA 1O6GA 2ONCA 3C8HA 1W1IA 1EVEA 1JJBA 4OB7A 4ZV7A 2H7CA 1LLFA 4U2BA 5ESRA 4MXDA 3G7NA 3FSGA 1CEXA 2HA4A 3L1HA 3VVMA 2VEOA 5LZ8A 4HXGA 3HYSA 3ICVA 1GT6A 3B12A 3ZV7A 1CUFA 4TVKA 3BIWA 3WZLA 4I4CA 4UUQA 3WKEA 5AM4A 1O6FA 4HTAA 4B84A 2XMGA 3H04A 1QIHA 4QE3A 2VSQA 4FWBA 4IH4A 4BTLA 5AM5A 2QVBA 1FSSA 2ECFA 5AI8A 1WHTA 4ZXFA 3G02A 4N5HX 1ZD5A 3EQ9A 3R3WA 1HDEA 4W1RA 1R9NA 1IVYA 4PNZA 5EHXA 5HF6A 4OB6A 1DX4A 4D9JA 4OYLA 4BATA 3NGMA 4GLBA 4DIUA 2HFJA 1CPYA 4OU5A 3E1GA 4DNOA 3ICWA 4UBKA 3AILA 3AZOA 1R9MA 3HXKA 4NS4A 1G5FA 1DT5A 5ALGA 4P9NA 5DNUA 3UMJA 2RIPA 5AM1A 1AX9A 2JBWA 2WILA 1XQXA 1UOQA 5A7GA 2WM2A 1YA8A 1F8UA 2XUDA 3BL8A 3F97A 5DLPA 3W9BA 2D0DA 4G5XA 1TKRA 4H7EA 3HRHA 5AICA 1WPXA 4MQMA 2AXEA 4INZA 4W63A 2XUJA 3HACA 3C6BA 1TCBA 1MT3A 3ESCA 1DQYA 1LBTA 4Y2TA 5JANA 5JAOA 4XX1A 1YR2A 2WIKA 5EHNA 3KDAA 1RP1A 1ZJ4A 5A7HA 3R41A 2DSNA 3IUJA 4Y7DA 3CXUA 4Q34A 5AKJA 5JZ9A 4G4JA 3M81A 2XUOA 5AKZA 5HFAA 1Y7IA 5AHXA 2H7XA 3HABA 4H7DA 1JJFA 4IQ4A 1LPOA 1AC5A 1CUAA 3FYUA 4P08A 5AJHA
chains in the Genus database with same CATH superfamily
2H3EA 1Z6AA 2NGRA 3EH2A 1RVDA 3B6EA 4OO3A 4RESA 5AK6A 4BMCA 1RFLA 1FP2A 3EXG1 2XQGA 2JGRA 4S2EA 3I9LA 4TM8A 1S4MA 1YE8A 1FBTA 4W8GA 3CH6A 4NYMQ 4WZ6A 5HW0A 4OHOA 1GRVA 2IY9A 2WJ6A 3L7OA 3OEHD 3JR3A 3QBJA 2PGDA 1WU8A 2Z4TA 1PL8A 4H7HA 3SC3A 4BHTA 1PNVA 2XQIA 1OFIA 3ZD8A 1A04A 2W0MA 3H1BA 2YTZA 3BRQA 1RRPA 3HVIA 3ZHCA 4PX9A 2RHWA 3OT4A 4DIMA 4M3NA 3X1WA 1J1ZA 1GDDA 1P1RA 3DGEC 3CBGA 3FTNA 2WU3A 4KPUA 3WYBA 2R6ZA 4WZAA 4BLSA 2EP8A 1W73A 1F4VA 2ZSFA 1NW6A 2AN4A 3CVOA 2IEYA 1EWRA 4J1QA 1JGTA 3LQRA 3PQ6A 3BMXA 4JJAA 3A1NA 4EL0A 1FTWA 3CURA 3TW4A 1A4UA 1AUOA 1FDRA 2AR7A 4LWOA 4WFKA 5KBYA 1X7XB 2ZWIA 3N86A 3CE9A 4UATA 5HJ5A 1HDYA 4AECA 3U4AA 4Q1FA 3VR6A 2HF8A 1PR4A 3B3GA 4XWGA 1Q84A 2QTCA 3JYLA 2E89A 4FR0A 4DUGA 5F7JA 1FLVA 2DY1A 5U1PA 3RREA 4Z54A 1JEYA 4NS1A 2VUUA 3REGA 1G98A 3JTMA 3EYAA 3H1GA 2ZUWA 3L8MA 1CRZA 3RS0A 5B7GA 3GLGE 1GNVA 4KQFA 1JFSA 4G1MB 3CWCA 1NW8A 2B6NA 2CB9A 4FMDB 4PO8A 4XR9A 5AI5A 1H1DA 2PKQO 1AA9A 1OX4A 2C3OA 4IDFA 5T4HA 4M54A 1O94A 4RU1A 5IBCA 4X66B 3IV6A 4V0SA 4DBLC 3W3AH 3DR5A 4J7XA 1KK2A 4I6GA 4U3JB 1FUKA 3G8DA 1VCIA 5BSMA 4CF3A 1RJFA 3NT2A 4LX8A 4PYMA 3CLTD 3W9SA 3ZLUA 3THRA 4ZYYA 1W88A 2BTOA 4B7ZA 3DO6A 4YMTA 1EWTA 5L3QB 3IPRA 4OAPA 1WMEA 4JJEA 3N87A 4P58A 4RE5A 5BQFA 2FP4B 1P31A 4ZT6A 3EQ8A 2RK4A 2JFGA 5ED4A 1KI6A 3E9DA 4KREA 3LLMA 3TQRA 1NN1A 1QGYA 3KZNA 3OTHA 2ECKA 4CCYA 1SKYB 2ZIUB 2CV2A 1ZOPA 5I9TA 1QR6A 4FFBA 3WDLA 4DCJA 5AW2A 1GM5A 2YVQA 4D8XA 3CRZA 3ETEA 1N3LA 1M7BA 3ROEA 2QA5A 1D4AA 4EHJA 3EX7C 2VJNA 2Q7XA 2XTMA 2C0CA 9ABPA 1O3YA 4L8GA 3V7FA 2WABA 5C8YA 2VK1A 1UBSB 1U8ZA 3SE7A 4UULA 1VL2A 2FLKA 2EEPA 3NRBA 1NVVQ 1ZSNA 1IUNA 4Q3DA 4PNEA 3U44B 1TADA 2KBEA 2LRHA 2OCAA 1FUIA 3ZHOA 1VKOA 1JQ5A 4N1AA 1XYGA 4M86A 3S2SA 1RZRA 2NNLD 4I9GA 1T8UA 2A5DA 4RIFA 3USCS 2FH5B 3KKMA 4OLAA 4PG8A 4KIGA 2O57A 5JV5A 2BM9A 3MMXA 1P0QA 3DVLA 1ZG3A 2C2ZA 3A3YA 3C1UA 3ITEA 3ZV4A 1WCYA 5B1SA 3KT6A 1U7UA 3GFPA 4BO8A 2C4HA 1N7IA 2B5VA 2QL7A 3E2MA 1KRHA 4MX8A 4GT1A 5C52B 3HO6A 3DDCA 1IAVA 1V6SA 4O1MA 4ZXPA 4AG6A 2PV0A 2ZIXB 1PWXA 4J0QA 4B75A 3K1JA 1KO1A 4OIFA 3TFWA 2JI9A 4DR5B 1NYQA 1OTYA 1Z8HA 1ZD2P 2EFCB 4K2AA 4KO4S 4NZPA 4Q1CA 1KDVA 3TRDA 5KTYA 2CL5A 2CF5A 4JSRA 4NCJA 1U2PA 5BV8A 2O8BA 4FDTA 1CDDA 1PQUA 2V8OA 3LWDA 1DEAA 4F2PA 1KARA 3ACBA 4D92A 2AOTB 3S8YA 2QROA 3IUMA 4OQFA 4DOMA 5E95A 3FWYA 1SD5A 4CTKA 1MPXA 1N6HA 1XMPA 1APBA 2QTHA 2VL7A 3O2SB 1OXUA 3QVGA 3MJTA 3SJCA 2AOUA 4HY3A 2PMKA 1G6HA 4B35A 5BV7A 1WW2A 1XXHE 1EZ4A 1PK9A 2BLNA 4FKBA 4LJ7A 4Y6SA 1RWWA 1EAYA 4G0YA 3PLRA 2QQEA 1I1OA 2X4DA 3HP7A 4NCKA 4P33A 4UU8A 3RSCA 1JDSA 3FBWA 5BXQC 2A5JA 4YUZA 3EZYA 5JAPA 1K4MA 3AVUA 4GVLA 1TL7C 5KJ6A 2CLFB 2MSWA 1B74A 3ZW9A 3KSBC 4IHQA 1QH9A 2OCPA 2VPWA 4KI7A 2MINA 3WMRA 2PVSA 2VSXA 3QOXA 3M9XA 2TECE 2HDOA 1I3MA 3NO4A 1KSGA 3ZIAD 2OMEA 3PX3A 3ZN2A 5HIJA 1QO9A 1LNSA 3KC2A 3ZC3A 4RF3A 3KE9A 4D9EA 1QWSA 4P93A 4E5MA 1MB9A 2HA5A 2AH5A 4UU7A 3HDQA 3TIFA 2NQ2C 4XB1A 1QOZA 3IXLA 1X94A 3MK31 5T3UA 2YJ4A 2AFHB 3OIWA 4G4GA 4KLZA 1I3OA 1XKTA 1J5PA 1I32A 2CWDA 1DNPA 2H48A 3TZHA 2FHSA 3U26A 4KXVA 4ZQEA 4AJ4A 1XDUA 1E2FA 1ZLYA 4QDJA 1JA0A 4RANA 3WZMA 2X3UA 1G5TA 4L5CA 1TNDA 4XYGA 3UW3A 1G6Q1 4GZ5A 1JMVA 4O25A 1VTKA 1N8SA 2I3ZA 1KMCA 2Q3BA 4O2AB 3CX8A 1J09A 2OXIA 4AP6A 1ARZA 3CNLA 2GN0A 1PJSA 1GADO 2ZYSA 5AYVA 3FGNA 3I9NA 3L1VA 4LZZA 4MUAA 3T94A 5F9MA 3ZS9A 5KYNA 3AZQA 2D1SA 2VG8A 3ZCQA 4HQKA 4AICA 2QAGB 3GK3A 3K4QA 1W1UA 2ROQA 4ENRA 5DM4A 4RTMA 2IYSA 2R1TB 3RVBA 1JT2A 1QH8A 1D04A 4NFHA 2GLXA 4IIDA 4OHMA 4X00A 4DLSA 3O4RA 3R7AA 4OI2A 5J4YA 4M8KA 1J49A 4XFDA 4YUYA 4I8XA 2FPIB 1OHHA 1RZUA 1Z35A 3E03A 2QVYX 3DZCA 1BSVA 3QWAA 4IDNA 2HB6A 3TW8A 3V4FA 5A9SA 1YQEA 3ABZA 4YI5A 3R3VA 1NR1A 2P9BA 2DFLA 1E1CA 4L95C 3EIWA 4QLOA 2M2IA 4KAAA 2VLBA 2CMDA 2XTAA 4O2LA 3FG9A 4IDQA 2FQYA 3SBXA 1N9GB 3GGCA 4G36A 4ZU1X 4EDHA 4G0UA 2XT6A 4EBFA 2BZSA 4B76A 3DZKA 3T8YA 3KLNA 2TMDA 4OGGA 5FI0B 3WLRA 5IYZB 4P35A 3KYIB 1XRNA 1KVSA 4BVEA 1XZEA 2JI7A 3EXIA 3ZKWB 4Y0AA 1X1BA 4LJAA 4C0WA 3TRKA 1FOEB 4HYQA 1QFZA 3U1VA 1IIRA 2DX7A 2EVWX 1H0RA 2G07A 1P60A 2XR1A 4R0NA 5T67A 1ORVA 1T3TA 2AUTA 3K31A 5DOZA 5A0VA 1XP8A 5AKLA 3IEKA 1SOVA 4Q24A 4CTJA 1VKHA 2PG3A 4H1TA 5A5DA 5JFTA 3LK7A 3KLOA 1BMDA 4KOAA 4I50F 1PD0A 1YJAA 2D3WA 3B78A 4GRAA 4L8WB 4ZWNA 3BXXA 2WWIA 3SM9A 3UXYA 4EVSA 3AXTA 5REQA 5E6UB 3IMFA 1ONBA 3C3YA 2VYCA 3HYLA 2I1QA 4XPIB 3RLIA 3N2IA 4R8VA 2FJPA 1E6MA 2OSBA 1L8LA 3ZE9A 3ZWXA 3KZ1E 4O63O 5KVSA 4IRUB 1IG0A 2H4FA 3CSDA 2PQ0A 1C30B 1CUEA 2VRNA 4Y1RB 4PBSA 5EE1A 4E5SA 3DFMA 4KE6A 1RLJA 5JASA 4OX9Y 4F5WA 3V4VB 2KLHA 4CM8A 4IIJB 1TF5A 3DP9A 3NM5A 5K45A 3R4VA 4XB2A 4E2FA 1V4BA 3QLJA 3UT5A 1AKYA 3RSZA 5TMPA 3WDKA 2QXYA 2VTKA 1XCBA 4J0FA 2P62A 4FGSA 2VYVA 2J6HA 5TGTA 4GOJA 2H4YA 4R3UC 4UOEA 1PDWA 1MHPA 2QW1A 1NQVA 4P2GA 3UK1A 2PBRA 1QKIA 3BMNA 3D6NB 2JJ2A 5M29A 4K28A 5ULLA 5JTUA 3X1XA 3C5CA 4KE8A 2DHDA 4GR9A 4QEZA 4B3BA 1DI0A 1K5DA 1KVTA 1U7XA 1LY1A 3H2ZA 4FYVA 4RYDA 1P2SA 4UQPA 5EWMB 1MIOA 4POOA 5JBIA 2VNHA 3GPCA 2YV1A 5GWXA 1AMUA 1JLRA 3GJTA 3WL5A 1SIBE 2H65A 3EUWA 5DCYA 5BNWA 4DVGA 5IJ0B 5DHTA 4CF7A 6ABPA 5A6SB 1Z07A 2QE7A 3C3EA 4FJ0A 1GPBA 4BKPA 2FPGB 4XE5A 4CEJA 2X0JA 1K6EA 3QOYA 3R0IA 3DUFB 2ZFUA 3VPAA 1CLEA 3F5SA 3H5TA 4I6EA 1N1MA 1HFJA 3LXUX 2I4LA 2NMVA 2I6QA 4N7RA 2WZBA 1AQUA 1WCV1 3I92A 3VTFA 4QUKA 3ZR4B 5K4AA 5K09A 2DC1A 1WXXA 1ABBA 4UXJA 3PTZA 1J20A 5HG0A 4C0KA 4L5IA 4DIOA 3SYMA 4GO1A 1T6ZA 5I7HA 4QUHA 4UAJA 5A02A 4Q3NA 4DS3A 2ADMA 1HPLA 1IJBA 1QFYA 2VCHA 1AXGA 1BZYA 5HXAA 1Z26A 1BE6A 2H16A 1QK4A 1R1DA 4Y2QA 3Q0IA 5G0SA 4R1SA 1S3FA 4UEKA 1CKEA 3JWGA 2CE7A 4IO1A 2C7RA 5B4UA 5K0EA 3V4RA 1DO0A 2M32A 5HE9A 1FDWA 8GPBA 2VHXA 3KS9A 4W1PA 5CK4A 5GGYA 3K9LA 2JDIA 3TEJA 4RV9A 5CEFA 5GMOA 3R0ZA 4RCVA 3GA5A 4N0DA 3NORA 1OTXA 1YVUA 3PD0A 4L72A 3V34A 2D0OB 3BE5A 3ZWCA 3ZJ5A 4BLTA 4PU0A 1E2PA 4LNUB 5LP6B 5K4GA 4EYOA 2IJGX 3CX7A 3HR8A 1G20A 4R1OA 4U7PB 1T4MA 1GIAA 3E9NA 2VDWB 5LQSA 2WV9A 2A9FA 4II3A 1I4WA 1KEEB 3L49A 3O21A 4MK4A 3F2VA 2E4AA 2H1FA 4LI0A 4WVLA 3G9QA 4JKOA 3VR3D 2D59A 3L0CA 2HEGA 2SKCA 3TNLA 1DINA 3B3AA 5EAIA 1YV9A 4R1TA 4DR3B 4LQDA 4HQLA 4ESVA 5LKRA 2RGYA 1ZGJA 5DBGA 3RSGA 3G79A 4V3BA 3LKBA 3K8OE 1M73E 2IXFA 3WBFA 2QD1A 3CIFA 4XFKA 4YRAA 4PVDA 5CW2A 1WBDA 4BQIA 1DQZA 2ZJFA 4ZGGA 1SZJG 2RHMA 3AIKA 3EDCA 4V0KA 2RKOA 1KQPA 5CG2A 4NOJA 2JFWA 1YFZA 2EP5A 5T64A 5CCEA 3ZDAA 2AXQA 1TA4A 1UJ2A 5TQVA 2HNAA 1GNQA 3BK1A 5F3WB 1DIOB 1HL7A 1FSGA 1PW5A 1ZM7A 2GUGA 2P4EA 3CZ9A 3LIPA 4HDMB 5DN6A 4BL5A 5DT9A 1LF0A 1VL6A 2IWHA 2Q2QA 2UZ1B 1GNTA 5GP1A 4M55A 4RPJA 2PUFA 3E3NA 4NE9A 1SXQA 4AF6A 1AKNA 4P81A 4OKSA 2FLVA 4US1R 1ZCZA 1N1DA 2XEXA 4ML3A 5TX7A 3MB8A 4BNGA 3QHQA 1N2BA 1W76A 3CISA 3OJFA 3P2IA 4HWGA 3WTCA 2QS9A 1Z6ZA 2P91A 4TX1A 4XGRA 3GUHA 4PO9A 3RRXA 1CUBA 3P2EA 1P2TA 1RWXA 2P30A 3PHIA 4LY0A 5AHKA 3T15A 1H2RS 3G59A 4FHCA 3ZUGA 2CLHB 3PGA1 3MUEA 4RGVA 2J08A 3B85A 4OQQA 3CONA 2RGBA 3I9OA 2IIBA 3ZY2A 1Z4LA 3PRJA 4TMKA 5E9QA 2RC6A 1KO4A 2XNDD 3KVRA 4NK5A 2WIJA 1VKRA 3LI2A 2LXNA 2HK8A 2QM7A 2V54A 1MQSA 3NH9A 5FP0A 5FWAA 1EFPA 1TAHA 1Z2CA 1T2FA 4L7VA 4D1YA 3IHTA 4G1UC 4MGYR 4TSFD 1V6AA 5EKTA 1YRBA 2EX4A 3C3AA 5EJ6A 2J8ZA 4TQAA 4TTRA 1C7EA 3GN2A 1SKAA 3MJSA 1QHGA 1Z6TA 4RZIA 2F8SA 2F62A 2X4GA 2WWYA 3ENQA 1WVIA 1Z36A 3BD9A 5HGXA 3AX6A 4BV3A 4CNBA 1COWD 1CY4A 1O5TA 4EZBA 5EJ5A 4UARA 3HVRA 3ED1A 3VDNB 2BUCA 1Z88A 1E3SA 4EUKA 4CIYA 3QKSA 4N3NA 4OP3A 5CURA 3CN7A 3V2IA 5IZCA 3TOVA 4URUR 3SQOA 1XRQA 2CLEB 2V9PA 4AZVA 3PEYA 2VSFA 1TIBA 3K96A 1N2JA 4FXPA 1ZIDA 3C85A 4L9WA 3V4PB 2CV1A 1Q1BA 3SSAA 1S2IA 1USIA 2NZJA 3CZQA 1CJVC 5DLYA 3GPDG 4DL9A 4HVAA 4LEIA 4LE1A 3RS7A 1LA2A 5ALXA 5EWLB 1UPUA 2FUKA 3L0SA 3Q1KA 2COUA 5B1EA 1F0NA 3RBVA 4AO6A 1CRQA 1EI9A 3JQ6A 2WAAA 4G5SA 4HQFA 2ATEA 4MEJA 3RPEA 3WR5A 1ZZEA 2Y1FA 1NYLA 3SC6A 4F1WA 5AVRA 4L78A 5THKA 4F4DA 2C83A 4JXJA 4ROTA 2FSSA 5JYDA 3H1AA 4HFJA 4HX2A 3K1AA 4NLLA 4G9EA 4Y1FA 5I47A 3AF3A 1KOLA 5D51S 2CLCX 2AXNA 3PGJA 3IMKA 3DDHA 3QVGB 5JY1A 1CETA 1SXPA 1BWPA 1K8YB 1O57A 1PJ3A 3QUCA 2VDKB 2BCJQ 3RW9A 4ARBA 3IH5A 3AI3A 2FA9A 4L08A 5A0FA 1U0NA 1L7PA 4D99A 3K0CC 4D0GA 4G1VA 4MKXA 2GCIA 1EG7A 4QIHA 3EDMA 1IQ0A 2LCQA 4HV4A 4R1QA 4DQ0A 3QBDA 2PZ8A 3FF1A 4B8WA 2FPRA 4EKDA 2NTNA 3K20A 2VQSA 4OVKA 3RTCA 3VOSA 3IESA 4LSWA 2XNKA 3A05A 4B80A 1VSVA 4LVUA 1XCGB 3LGXA 1XJ0A 5F9FA 3DJYA 1F14A 1K5PA 3OQHA 1MFZA 2R4QA 4JLUA 3ZBTA 3FPGA 4YROA 3G2OA 1Y48E 3DCJA 2KMLA 3GFGA 3WRYC 3KHUA 3L1IA 3QE3A 3T3DA 1DKQA 3C0KA 5CTAA 4CDRA 2FRDC 4FBGA 4F5YA 1NIJA 5FDFA 5IT0A 3QUAA 4ARUA 3W5IA 5K3OA 1NVXQ 3ZHXA 4QGAA 1Z2EA 1ZH0A 4TV9B 5ECGC 5MHTA 4H4CA 3NHFA 1L3CA 2FK7A 1I7DA 4OJTA 2AZDA 4EY8A 3K30A 1JYFA 2E7ZA 2VTBA 2JRCA 3IE2A 4H0NA 4IDHA 4FMCF 3ZCUA 4Q4CA 3BOSA 3EVCA 3PFWO 3A58B 3Q3JB 3KUUA 3PZBA 1TMGE 4ND4A 4JBXA 1ZR2A 4GX5A 2PUTA 4OGWA 1ZD1A 4JLMA 1TQ8A 4Q0MA 4UDOA 4Z4HA 1Z18A 3TSAA 4BTEA 1CHDA 2IYUA 3B53X 3A26A 2PTHA 4R2LA 1NMYA 1UL1X 3DDSA 3GJ7A 4RY9A 4TKVB 3BT7A 1EESA 3KXIA 5I5EA 4WASA 5CH8A 2C7QA 3TOCA 3HJGA 3NJRA 4ZALA 2FKAA 1WXIA 4DSZA 3EC7A 4YRSA 4AJ9A 4PC2A 4GI3A 3VU1A 2Y27A 1E59A 1IEQA 1PZHA 3B60A 1WU7A 4YGXB 2DF8A 3B5EA 5A9SB 1N33B 4Y2VA 3I4FA 3KPYA 1V4NA 721PA 3HY6A 1M2OA 2J5QA 2W0SA 1V1JA 1JA9A 3LLVA 4K7JA 4QAQA 2Q4OA 4MTCA 3KZXA 3EOZA 1I2AA 4FI3F 4DUPA 3L1JA 6PFKA 3KQNA 5BUZA 2YY7A 2L19A 1UZNA 4BNIA 3G0IA 4LDRA 2C5LA 4YREA 3I45A 4Q9LA 4WK0B 2C9DA 4EFKA 2WV7A 1JJIA 3G9XA 4QBIA 4WW0A 5BW5A 3IV7A 5KX5F 4JL8A 3EEFA 4GXRA 1YI8A 3I73A 5FA8A 1NN0A 3PQEA 3N0XA 1OLUB 3IXQA 4RHXA 2XTZA 4U7TB 3TBFA 1LBIA 2N46A 1I7SB 4S0XA 3TAHA 2Z4SA 3RYFA 1INLA 3OJLA 2W2NA 1SXJC 1GAQA 3OPYI 4D8UA 1EM8A 5KNCH 4EI9A 5C4MA 1R3DA 4OSOA 4YS6A 1WPRA 2R4UA 4RD6A 5ICFA 4ZOLF 3DW3X 1LD3A 2YUTA 2GR9A 3UM9A 4BP9A 5G0UA 5D6NA 4CIDA 4JC5A 4L75A 2DPGA 3PUZA 1V8ZA 5BVGB 3U81A 1DRJA 1R5OA 3PSHA 1MW8X 4LCBA 2VPYA 2PVCA 4HLUA 4X8HA 4X54A 3HXTA 3AOEA 1QO0A 4R31A 2WT9A 4WOBA 3OESA 4KGVA 1HE5A 5HM6A 4Q3EA 1GLGA 1GGJA 3DNPA 3QU4A 1F2UB 1N2SA 5DW3A 3Q8WA 3WO1A 3N07A 4M7WA 4GPD1 3H86A 4X1IA 3W2HA 3NHYA 2JGDA 1OILA 2CSUA 4N01A 4QASA 1CQZA 3PJRA 1XTSA 3ORHA 3SU8A 4YR9A 2FN7A 1DE0A 5AIBA 5C1BA 4EJMA 1CIVA 2AFIB 1GPDG 4IYJA 1F12A 5ALPA 2I8CA 2DT5A 3IDZA 4F2HA 3LQFA 4ZARA 3H2IA 1Q16A 1QAOA 2C31A 2FZ4A 2DPMA 1SU6A 2QTLA 4PYIA 3VQTA 4YDSA 2I2BA 4UTXA 1HE1C 3PENA 3A7DA 3MT7A 3ZGVA 1JHZA 1G2OA 2R86A 3V2GA 1KTIA 3IT2A 1W52X 1Z83A 4UEWA 1JDVA 4XWOA 3GP8A 5FOXA 1NLZA 1JQLB 5EJGA 1X80B 2BBTA 3BWEA 3ZK7A 1X9GA 2C4NA 1C7QA 5JZSA 3HJTA 1DWUA 1JWBB 1SU8A 3V1LA 1RD4A 3JZDA 3ZZMA 5HFJA 4ER6A 4ZVNA 1LBHA 3L01A 4QWWA 1K3UB 4MITA 1BE1A 2HXGA 1KI9A 1UKYA 1M6HA 2FPGA 2W5UA 4HWKA 3GNQA 2F43A 1IXRC 1X80A 1XC7A 3FVTA 4EMSA 4AMBA 2HD4A 5DWQA 1FVOA 2IV2X 3L7KA 3TI7A 2CUNA 3UFBA 5EHQA 2F9MA 2KWIA 3PXEA 3D1VA 4O2RA 3C41J 2NO7A 1JPVA 3FPCA 3V1NA 1MO3A 2FZLA 3SYKA 1OGYA 4C0QC 2EF0A 2P1RA 2YOHA 2CDCA 3CLSD 4H4DA 4QULA 2Q5CA 3EDOA 2WMDA 4MZXA 4D3ZA 2XQKA 1U4OA 4OK5A 1F6WA 1Q57A 1Q2UA 2OORA 3CW2A 2GWHA 3HA2A 2PNFA 2B5OA 2FPPB 2Y0EA 1RT9A 2FRXA 5LU8A 4Q93A 4BBZA 2JIBA 2E21A 2OHXA 3PWSA 4MW0A 3EXHA 2DEUA 3OMWA 2WE7A 3OKFA 4YVFA 5D3KA 1RRGA 4FIDA 4O4LB 5AW5A 4DLBA 1BROA 2D1YA 2UUPA 4X94A 1WBBA 3LL7A 4R2IA 3ANMA 2BF4A 3LG2A 3FVRA 4K9OA 4TS4A 3JQ7A 4DCSA 3JARB 4F1KA 1FYXA 2HHAA 2P5TB 3GEGA 3QVSA 2GEFA 3ADBA 2O19A 1BVUA 3AJDA 1VQ1A 3GN1A 2CJPA 2ERCA 1YQTA 4JLPA 3TJZA 4JT8A 4O4LA 3DL4A 1UZMA 3SQWA 2BY4A 2XE4A 3ECCA 2GNPA 1KDTA 2MSLA 1KVQA 2VC2B 3F4LA 2AJLI 3GGSA 3GNLA 4FK8A 4IFBA 4POAA 2C7OA 4Z53A 4V0OA 2EU8A 4PTLA 4BFZA 4XVUA 3QE9Y 4PZPA 5EFOA 2JF0A 2SNIE 3FNHA 3LE8A 1SBCA 1WHSB 4RGBA 3KEQA 1E2JA 3EY4A 4TKLA 5JMPA 4CKYA 4G86A 4F3CA 2PANA 3N2GA 4L9SA 4GKAA 3AJ8A 1CDEA 3JWIA 3KLPX 4KO2S 3ZNNA 3PITA 4A0HA 3RQIA 4J29A 2QLNA 3GLFB 5ILGA 3GT3A 3ROFA 2P5UA 1XPJA 4KKXB 4J0CA 1ADCA 2I2CA 1MKYA 2XYPA 4WBSA 1YD7A 4PXYA 5C4GB 4PZEA 4E1VA 1IZ7A 4PN7A 4OX9B 4WWHA 1DXQA 1RMYA 3H18A 2C0PA 1FFEA 1ENOA 1EZZA 4AMGA 5JECA 3SS7X 2PUAA 3IUPA 1IN6A 1QGUB 3TTSA 3OLXA 1G20E 4E88A 1FS4A 1XDSA 2PD4A 3EAQA 3FNRA 4C21A 5MFPA 4JBLA 5EZ5A 1DO2A 2WA1A 4ZVRA 4B3JA 4MP6A 5JZMA 3QH4A 3MYRA 4JLSA 4S35A 3L06A 1QO7A 2YWJA 3CPSA 4P6VF 4CKXA 1T0IA 5GIOE 2IS4A 3C7TA 2JANA 1NLFA 3ZQUA 4C6SA 3W79A 2IPLA 4ZAFA 4O4HF 3AK4A 3QEMB 4C6TA 4DJEC 2VK4A 3PNOA 1QZXA 2XCLA 1T8WA 2P3QA 3C74A 1X70A 5TJ9A 1TUEA 4X84A 1K7CA 1MG5A 4DANA 1GU1A 3HSKA 1VECA 4QYSA 3UAOA 1SCUB 2IT1A 4BZXA 2WPDD 1Y1PA 2ZYUX 1ICEA 1I10A 3FCOA 5KVVA 2QY6A 1R0CA 1PV2A 4YA6A 5FL7A 2G77B 1G3QA 3CNNA 3GY0A 4IJ6A 4ZN6A 1OOEA 1FP4B 3PA6A 4GIBA 1JG3A 5KKCA 1QRRA 1B3BA 4UVHA 5K6AC 5H3HA 3QJGA 1T2AA 4HMQA 3S28A 4DV3B 4BVAA 1CVLA 1Q14A 3CG0A 4F4IA 3O8CA 2Q5LA 1ECBA 2O3RA 9LDBA 3UTCA 4J6FA 2WJIA 2F90A 3F90A 5EMJA 3GDWA 3OZFA 5LIPA 3ODGA 3OUTA 4YJDA 1GA6A 3ORQA 4BZZA 1IHOA 4KTVE 3KQYA 4QJ3A 3F7MA 3P2YA 4FNMA 6Q21A 5KHLB 1MD9A 4JLJA 4R1PA 1W0KD 2WJHA 3H0CA 2A78A 3O82A 3VU9B 1ODSA 2E2WA 2CYAA 2BGJA 4TWJA 4B4OA 2Y93A 1RYZA 1SCIA 4XSGA 4WLFA 3IAFA 2Y1XA 3RIGA 3SPXA 3WISA 4ZDJA 5DK6A 4DNQA 3OWOA 1C7IA 4U4AA 4UQLA 4HGYA 1NDHA 3NBYC 3WDSA 2Z83A 1KI4A 1G0OA 4DCVA 3EZGA 4ZGWA 2DP4E 3IAUA 4MS3A 5KNDH 3S1SA 4OGLA 4QBFA 2QVXX 1REQB 4NZOA 4ZV9A 3RUIA 2ODTX 3BAZA 3P26A 4ICIA 4E94A 3KQVA 2BCGY 4LYEA 1VCMA 4JP3A 4BBJA 2Y6UA 2OBXA 3KJQA 2ACEA 2VAPA 1Y1QA 3RVRA 1KZ7B 4ZV4A 4KYTA 1CS0B 1DAGA 4W4TA 1L7EA 3JYPA 4P8RA 3K94A 4BVKA 3SQMA 4EG4A 2OMKA 4TQUS 2P4UA 1T4CB 2MDTA 2P5YA 4BNNA 3G9ZA 3ETGA 2IBSA 4TMFA 3TR0A 1O96B 3MMPA 3ZCXA 4PZ9A 1WKVA 3A1UA 2W6ID 3I8SA 3OZRA 3WGKA 3DLTA 4QU9A 1D6SA 3I04M 4H0FA 4Q03A 1MB2A 1GARA 1Q1EA 3DTVA 3EEQA 3NWJA 3F73A 4QO8A 1S01A 1Z4KA 4M9ZA 3WICA 5JSFA 2HU2A 3PFKA 4FZVA 4NDAA 1U1CA 4M37A 1R9GA 2F4NA 5KTNA 3A1FA 4LWZA 4E21A 3FLAA 2ZB4A 3F5QA 3SE0A 4GSKA 2B6HA 2E3JA 1TCAA 3LM8A 4NBUA 3C1AA 2RK6A 1OU0A 2RI0A 4NATA 2HA6A 4LTDA 4DA6A 4FGLA 1GDTA 3QFHA 1AQNA 1HE8B 3SC2A 1EUQA 2VPXA 2H1HA 4DZTA 2ONZA 1JQKA 2OV2A 3KR1A 5GZ3A 1IN1A 5CK5A 3RAPR 2V59A 1UBRS 2VDNB 3A2LA 3OOEA 1OXSC 2NYUA 2IF2A 4OYHA 3FSJX 3GRZA 4UTRA 4TYYA 2RMKA 2JFBA 4YJKA 3HI4A 2YXBA 4ITVA 3C6QA 4Q7KA 5HCIA 2O8FA 2GLTA 1MQAA 1KJQA 1GCAA 3A11A 4JJ6A 4HNSA 3PHLA 4N82A 4Q9KA 4X71A 2IV3A 2X8WA 5G1OA 1Z0ZA 4YQYA 3UJ9A 4L27A 4DEYA 1Q2XA 2P67A 2QT9A 1CQWA 3AUYA 1VLZA 2XI4A 4PO1A 1DQNA 3DE1X 5EXSA 4B5KA 4C06A 5ADWA 5KYYB 3K70B 1IMOA 3HUEA 4G0NA 2PLNA 1JDJA 1CULC 1QIEA 2J9ZB 1N7GA 5AKKA 5I7UA 1NI4A 3FX2A 1U31A 1OROA 4LXUA 4MW4A 4B3GA 4X8LA 4P31A 1K6MA 2AOTA 5KEIA 2BFAA 4JEUA 1UMBB 4JSYA 4OOFA 1H69A 5KDDA 2X5NA 3HP4A 1YB1A 1TQ6A 3ZLVA 1TIPA 4H1VA 5L7TA 2WD7B 2BGIA 3O5AA 3UZUA 1K75A 1JU4A 1GEEA 3CR7A 5DOVA 5E1BA 5D1HA 1TJPB 2VA9A 5FO1A 5JVDF 1E2EA 1A5TA 4FB4A 5K0BA 3JAWA 3ZWNA 1YR9A 4J6EA 4AYWA 2GSDA 1E9VA 1NXWA 1YR8A 2GXUA 5EA2A 2ALJA 3WLQA 1T34A 3O0DA 2GK7A 5EP4A 1KGDA 1X0VA 1A50B 3PSAA 1RWBA 3D8UA 1JHRA 3OCWA 5C1IA 2HIAA 4YAUA 4EG5A 3Q6NA 3R5TA 1W0CA 5JXGA 5EJ9A 1EKXA 4P0QB 4KC0A 1Q50A 2NQ8A 3N8NA 2P2ZA 3UC9A 1HT1E 1WQ4A 3W6NA 1IBLB 4GPIB 1I6KA 1S2LA 3BH7A 2BE9A 3TLEA 1QFSA 3DKKA 2JLBA 1S0UA 3QG5A 1EYZA 2EBWA 4URWR 2ZRCA 4E6EA 4OXYA 5MGNA 1N6OA 4DR1B 4AUEA 4KMSA 4K9KA 1DPFA 1NF2A 5FO0A 2ZQZA 4HUTA 1IXZA 1EVJA 2OV8A 3O03A 1Q7RA 4GHWA 4C2BA 4EI7A 2A3RA 2XDAA 2VP4A 1ECFA 1EQ2A 3H2JA 1MCZA 5JTTA 2BGKA 3W1WA 4E3ZA 1FMCA 1JRLA 1GYRA 1X9IA 3NYIA 5IU6A 3AERB 5JATA 1PJ2A 4B1FA 4FQ8A 2NPFA 1CB0A 1W0KA 5AJYA 5KWJA 2KS6A 2LIVA 4TUYA 3SHQA 5FHQA 4BNJA 2GXQA 4RPKA 4D0NA 1S2DA 1XP5A 1GL6A 1OIXA 2PT7A 4I50B 3Q15C 1AKEA 5GINE 1UPTA 1RXVA 3SD7A 1HYEA 2JLAA 3RUDA 2WIBA 4U7JA 2JFXA 2VXYA 3VR1A 4BFXA 2EXXA 3UWKA 4DIFA 4H7FA 3EODA 3R40A 4X1IB 4XQGA 5KAMA 1ACJA 5L3ZA 4OH1A 5H82A 5J1TB 1X8JA 2V45A 3CT6A 2GM4A 2AKYA 2QBYB 1UFOA 3FGZA 1J0CA 4QEDA 3DHYA 3HXLA 1XD2A 3S7ZA 1IN8A 1E60A 2P65A 5IAOA 4JBNA 1XU9A 4JP1A 3N8GA 4I66A 4H60A 4AS2A 1Z0JA 1PR5A 5F5LA 1SAYA 2JLCA 5TPZA 2CNNA 3GT7A 4H16A 1V3VA 1U65A 4XA8A 3IUYA 3WK9A 3VHQA 5C32A 1C7JA 1Z7BA 3WADA 3AOGA 3K5PA 1X1SA 4RLSA 2Y77A 1W0JD 1JLSA 1ZWKA 2G9RA 3AP3A 1YF3A 4RIEA 2K2QB 4QOJA 1BE0A 2FTKE 3E9EA 1FVFA 1SU4A 2DKNA 3Q2OA 2NUBA 2VSYA 4Q15A 1MUUA 1LXCA 3FHLA 4Y2SA 3TRIA 4EJSB 3DLAA 1Y5NA 5LBIA 1TJNA 4V03A 4C04A 2XTJA 1XEWY 2GRAA 1UBLS 2ZE5A 1TXGA 2QEQA 3P9SA 4GKVA 4IQGA 4E7PA 1OZ0A 1ZICA 3G5TA 4ZYZA 3INYA 5DLEA 1CJKC 4RH1A 3G8BA 3DPIA 1R6XA 3MBIA 1FJHA 2YN0A 8MHTA 5CAEA 3KU4A 2BOVA 3SJUA 2OPHA 5ALSA 1Y82A 2IOFA 2OHHA 4N39A 3UJHA 2ZJYA 5LLTA 4DEXA 1WSDA 2QZJA 1XCOA 2TMKA 1D2MA 1SEPA 3FCXA 4C7KA 2PX5A 3D6MA 3QFRA 1G8JA 1J56A 2WG1A 2QD2A 3DMTA 1FCJA 1M75A 1XAIA 1CR1A 4QPJC 4IDDA 5CNJA 4XUEA 2G17A 1Z6QA 3FH0A 3PZRA 3A3PA 4C08A 2ZWAA 2R62A 2UYHA 4ABTA 3FNGA 2NP6A 2XUQA 3LQ1A 3OZCA 2UVQA 1A2QA 2BKLA 3KTFA 4TYQA 4CF4A 1A0OA 2O05A 3OOHA 2HMUA 2PU5A 5JIBA 4BBPA 3QWFA 4ECEA 3UT5B 1C0PA 4D44A 2A9JA 4OJQA 5KNLA 4RKRA 2AN5A 2JHFA 2DPXA 4PYLA 3JQ7B 4YJ2F 2AMYA 4K9LA 2FN8A 3OQOA 1D2CA 1ORWA 1EJ6A 3QX8A 3TOZA 4Z9YA 1K88A 1KDRA 2VRCD 1ONNA 5AKIA 4ZFNA 2R68A 4PYNA 3BC1A 1H4TA 3I3OA 4K81B 4WN3A 5DV9A 1DAIA 3GELA 1IH8A 3O38A 1CUYA 1O4VA 1TM5E 3O8QB 4KRFA 4R9SA 1J2EA 1Y8ZA 3FCSB 1U7HA 4NJMA 3MINB 5ALDA 3MFYA 4LYDA 2ZITA 2H11A 1WB6A 4I46A 1HNZB 1N6NA 4CM3A 1I2DA 4WY5A 1LWOA 5EE0A 2FW9A 5E2IA 4Q01A 4XH9B 3EWSA 3SEZA 1SVOA 4FOOA 4HXFB 5LB2A 1DAOA 3N2KB 3W3ZB 4LNAA 4U8HA 3R9KA 1C8LA 5LMNB 2Q1TA 4NFYA 4RSHA 2A1TR 1JG7A 3DVAA 3EAFA 1G3RA 3I8OA 3LUPA 1UODA 4GKBA 4RC9A 4RWZA 1J9ZA 4BPRA 3D2BA 1II9A 4C4SA 2D4AA 4NOMA 1YR1A 1P33A 1RMQA 3GGJA 4BN0A 3M33A 3UGKA 4BB5A 5KREA 2BBWA 3OLQA 4MW5A 4Q39A 3UWOA 4YWJA 3FBTA 5CDUA 1EP2B 1HWYA 3W05A 5LMUB 1N75A 1RQXA 1TPYA 1Y9JA 4OUDB 1ECCA 2WUFA 3FR8A 4I9FA 1C8VB 3M5PA 1DBVO 4ARZB 4C4XA 1AH2A 1U2DC 3ADDA 5JNRA 1A2BA 2PZBA 1QGOA 2XT0A 5ITVA 3L0PA 2QXUA 1FW6A 1NURA 2DTEA 2XMDA 4KR7A 1W49A 4JODA 3WRXA 3VJMA 1E6CA 1B6RA 1XTRA 4RA9A 2C96A 5IVIA 3HN6A 6REQB 3QA3E 1Y37A 4ARZA 4EHNA 1WDKA 3G2IA 1SCUA 1N0UA 3LBAA 3O94A 1M1YB 1ODJA 3SG0A 3F8WA 2RI6A 3PEVA 4NE7A 5CYPA 1GPAA 2QENA 1TO6A 3D54D 1OXMA 1Z2AA 1HDZA 5HMLA 1KP3A 3H6KA 3HEMA 3LGSA 3R5JA 3MSXA 2WD8A 5FR2A 3EPLA 1L1EA 1WABA 3LT5A 1CJCA 1E2LA 1S5PA 1F8FA 4BX2A 5TEWA 2C2XA 3TUZC 5CX1A 2C5SA 3SEFA 1P2DA 1KEWA 3H5OA 1TCCA 3QYPA 2R2AA 2CBXA 2Q3JA 4FDUA 5D3ZA 3VO1A 4MPRA 2XB4A 4CR7A 3LY8A 2EKBA 3L0IB 4A6PA 5HUHA 4RV5A 5F51A 2A57A 4RHUA 4UE6A 4LCEA 4AL4A 1SBYA 2BMFA 2R8OA 4Y2RA 1L5HB 1LW6E 2XAUA 3B5IA 2WDPA 3IAM1 3THOA 1B8OA 2GFIA 4WHMA 5DBOA 1LV7A 3OFND 1PYDA 2QMYA 4WDQA 3RU3A 4I5FA 3HMQA 4HG2A 2V7BA 3EG5A 3A6DA 4HCJA 5T41A 4A2WA 1VPWA 2IS2A 1BO6A 1N7HA 3FNEA 2ZRHA 4NCXA 3AP1A 4BE4A 4PSUA 3DT9A 4GI2A 1PZNA 2PA3A 2VWGA 3MT9A 4O0MA 2ZAMA 5C1PA 3ENZA 1YZKA 3B3FA 2UZ1A 3LXRA 1V9CA 3DMHA 3LQYA 4JLAA 4LV6A 3T1YB 3JYHA 3QFFA 3NHZA 3U60B 3QELA 4NKRA 1HLGA 3MRVA 2Q2NA 2PK3A 4BMDA 1ZYUA 4F91B 1VMIA 1L3IA 1SCBA 3GEEA 1Z9BA 5CRIA 3T1VA 3U4HA 3Q2IA 4M0EA 3QE0A 1JHDA 2AE2A 1SUAA 2VJAA 2NACA 2HUPA 4NMWA 1QMPA 1SKQA 5CDYA 1SURA 2Z5FA 3VX3A 2K87A 4C1BA 1W88B 3HKEA 3BXGA 1DV2A 1CT9A 4H18A 3D7LA 1PGJA 2LGJA 4FCWA 4Y9RA 3TR5A 1TT5A 1YO6A 3EOBI 1J06A 3WL6A 1JS1X 2BP7B 1BE8A 4U2FA 4B73A 1E58A 3DMNA 3NKLA 4I1OA 4KR3A 4EABA 2XH8A 3BWXA 3I4LA 1R5NA 3CV3A 3EWNA 2R60A 4NARA 4ZEVA 2HZBA 1M34B 5LZ5A 5FPPA 4QYWA 1JBEA 2BP7A 2B99A 2RARA 1F2DA 1UT5A 4PPYA 4YONB 5JQWA 1E5LA 3AFOA 1C1XB 2ZRNA 3PCTA 2B3DA 4EB6B 1QRUA 1CLUA 3Q3CA 2I91A 3OIFA 1US8B 3A14A 1Z8DA 3GLQA 1PR2A 5CFQA 4PFSA 1M34A 1H6DA 2JARA 4AVYA 2HU8A 4PAMA 1IHYA 1RPTA 3IR7A 2G5PA 1UM9A 2CJWB 2VP0A 5D84A 3W9UA 4LF7B 5LQAA 1R0YA 3I09A 3H9UA 2I6GA 1AV7A 3FRJA 4XLTA 4ARSA 1U3FA 2GD2A 3VR2A 2HK6A 1T26A 3SDBA 4PS1A 4FNOA 1HT0A 1G8KA 2J0EA 3N6XA 3G0DA 4P0TA 3L3BA 3UAYA 4CLRB 4XD7A 1ZNZA 3IKMB 1SIUA 1D7AA 1P29A 1Z4NA 4PM4A 5LZ7A 1ONSA 3ZK9A 1E66A 1V3UA 2FFHA 3B1YA 4N5DA 5DGHA 1ZUNB 4ZVUA 2CL7X 3BF7A 2FZEA 4YUVA 1AO3A 1XLTA 3OX4A 1M2HA 2NOAA 3LYUA 2J0QA 5AJUA 4I7EA 3H4TA 5DYWA 5HMMA 1XU7A 3T52A 2QUKA 4UPDA 1OH6A 5GV8A 2BEUA 3IQIX 1LPPA 2AOWA 2J07A 5JG7A 2R25B 3T1QA 2NU7B 3OQVA 3FTCA 2O5RA 4LQCA 1NBMD 5JLAA 2GBIA 4NU6A 2PZFA 3Q8MA 4JXZA 1TM4E 1QP4A 1RVV1 2W2LD 4ZICA 3L4BA 4W1QA 3H2HA 3BREA 4EMBA 3AUTA 2P41A 2ZYAA 4X44A 1ULSA 3LMKA 2NV6A 4S1PA 3F1LA 1SWVA 2JI6A 1LNQA 1LX7A 4PBTA 1B16A 4HZGA 2ZT5A 2FFAA 1IQPA 3K8QA 3KXKA 4O5OA 3NDIA 2YZ7A 1S2GA 5HIIA 4X64B 4ZYLA 5H68A 1G38A 1DCMA 1SVNA 3Q3GE 1CUVA 1A8PA 1KYQA 2EP7A 2X8BA 2XF8A 3FFWA 3N2NA 2MCFA 4JI5B 1DAPA 5C7YA 2YZGA 1C14A 3PYXA 3EIOA 3QLVC 1AZTA 1C4XA 3C48A 3ABSB 3A1EA 3Q7RA 5HFNA 4ZO9A 1M1NA 3H3XA 5BW8A 4FONA 4NXMB 2AI1A 4GPZA 2C7PA 4XWTA 2Z5GA 3TTTA 4HGPA 3O3CA 3QFSA 1U0OC 2OV1A 5DGCA 4MV0A 5IKEA 1VPEA 2AGVA 1VHWA 2J4CA 5LBUA 5KNDA 1NLMA 1Z68A 2WIFA 3OT1A 1TK3A 3OP1A 1PEYA 4FFOA 2IXBA 1NFRA 5JNVA 1EIWA 5JE8A 4R2HA 1U0GA 5I8ZA 4I1UA 4B6SA 4UCXA 1I5EA 4KQXA 2MT9A 3RRFA 4P2BA 4FZRA 3NHMA 5C5DA 4JYZA 3O95A 2PMCA 1GZ3A 3AVQA 3C6ZA 1CV2A 2VIIA 3LU1A 4H2DA 4LSZA 5KSPA 5AOCA 4U9IS 2JCXA 3PTAA 4AMYA 2GN8A 4C0BA 1CFJA 2V6JA 4OA5A 5LL6P 1GAEO 1GKUB 4N8SA 1XCJA 1EAMA 1XZLA 1LRLA 3UAGA 1P0MA 2P2GA 4PVCA 2D6FA 5DX8A 1ZMTA 2H0AA 2JFZA 4LJSA 4YCCA 3ECSA 4EVQA 4RDXA 2DPLA 4I19A 5CM8B 1NC1A 2V4ZA 2MSDB 3QIVA 3FZEA 1XMQB 3D3WA 2O8NA 3CZ4A 1KWGA 5DU2A 1YR6A 2CDBA 4RCYA 4XLLA 4GM1A 1OX4B 4EK9A 1K6XA 4EGQA 2WU1A 4TWZA 1VOTA 1DG9A 3ZXIA 3A2KA 2D1FA 3USZA 1Z75A 3GOHA 3W6UA 5JBNA 1UWCA 2QMOA 4KVAA 4BGVA 1M1YE 1Z8NA 8LDHA 3TFQA 2WF8A 2HMTA 4BNYA 4WKPA 5EUQB 4D9BA 1TJ5A 4RUKA 1F51E 1SC1A 4YAGA 4IV5A 4B2PA 3NHPA 5TLSA 3BAFA 4ZYTA 1ZRNA 3G5LA 3KVVA 4YXWD 5JS8A 1FU7A 1RYDA 3AUJB 2IS6A 1CNEA 1EWYA 1TUBB 2MR5A 5CH5A 3DVSX 4IQ0A 1VLHA 1Z7GA 1ZA2A 3F6SA 3I72A 4RJKA 5E4FA 3RC3A 3UJDA 2R84A 1V8DA 2I80A 5C1OA 3NHJA 4GWLA 1TA9A 1B6SA 3L7DA 1RRFA 3T3PB 1FX1A 1SD1A 4TM7A 4TKMA 4R5HA 2RG7A 4E13A 4EW1A 1AZLA 4ENTA 3BF8A 5LXTA 4UFPA 3PFNA 1R27A 3TPCA 2PS1A 1OH8A 2E5WA 1Z5ZA 2QV7A 3STTA 1GGHA 1RCTE 2H1VA 4AC9A 3TIGA 1TLFA 4BO7A 3GUYA 4RK1A 3AVXA 1KP2A 2ZPAA 3N39C 3SHFA 4NEHB 4NBSA 5E6UA 3SHTA 3ZVLA 1QV9A 2IIQA 3FCYA 5IYZF 4LF8B 2HC9A 2V65A 3Q9UA 3GBVA 4WNAA 1ZC4A 1BXZA 2GEKA 2QR5A 4MYRA 3G23A 1WZ2A 4M1KA 3UMVA 2X4LA 1PZEA 3TMYA 3UJBA 1U5CA 3NWBA 2D0PB 4GM4A 1YTLA 4EKNB 4JI0B 4JT2A 3NC1C 4B4KA 5K0GA 5ICSA 1HF3A 1RHUA 2A88A 4JOBA 1A8QA 4KQKA 1Y1KE 3F7NA 4AO7A 1IOLA 1ZK2A 4NU5A 1BRTA 1JR3D 3W1EA 1RWOA 3W5JA 1Z22A 1NSYA 3B8EA 4J9UE 3SKXA 1U2RA 3E82A 3HKCB 1ZVQA 3IHWA 4PQRA 3ROGA 2FUCA 3FPSA 7REQA 2NUAA 2VDMB 5K0CA 2YS7A 4B6OA 4HFRA 5C7IO 3FTFA 4YCJA 1DCTA 3HXMA 4EKYA 4GKKB 4M9SA 4HN9A 2ZS8A 2YYAA 2GO1A 4K6OA 2I2XB 1OLXB 2OGSA 3COWA 3MS4A 1EBBA 3RGGA 4EYEA 4B6PA 1NVVR 4PZ0A 3DBRA 1EHYA 3JQDA 4LYAA 5D7BA 5HA5A 3UN1A 5CVEA 5C8DA 5CDGA 3GQBA 4LOAA 3K4HA 1WMDA 4Z7OB 1MQ9A 1D0IA 1NJFA 3PVSA 1KETA 3IDSA 3MFQA 1OTHA 4TMZA 3IDQA 5H3LA 3JWEA 1XG5A 2C04A 2WHEA 3FSGD 4U2KA 2PSDA 2F1HA 3GDFA 1FTNA 3DZBA 3DULA 4WGGA 4M1ZA 4M53A 1KYIA 4FEYA 3NYRA 5FOVA 3IL2A 1GXSA 3T1HB 3F6PA 1HNXB 4MUIA 3IOCA 4UEOA 2BHTA 5HDQA 1R0ZA 1YSCA 1RW4A 2XXJA 1F5NA 4KDRA 3L7CA 4RLHA 5TF0A 5FYQA 2Y68A 3KOZA 1FSFA 1YZHA 3H65A 3L7BA 1C1DB 1DL5A 4CUKA 2VOJA 3CWQA 4NQZA 2JVJA 4I4LA 4PGAA 2NVUA 4BEWA 3OLWA 1NXVA 4O8CA 5LN1A 4G5OA 1O6BA 3E05A 5CA0F 2AJTA 3N2YA 1WBJB 3O3MB 4NBWA 3ZGXA 3GJQA 1G16A 1G5HA 4BIIA 1EBUA 2V7WA 4ZU6X 3UB2A 5K0ZA 3N8KA 5BO5A 3LCVB 3P8ZA 1KXJA 3DXZA 3MUOA 1E1DA 5IULC 2OUKA 5GADl 3JPYA 5INTA 3CXRA 1A4IA 2AKAB 2OQIA 4PLWA 3KKKA 4ZI5A 3CHYA 3OFJA 1B26A 2H2AA 4LY9A 3X1YA 3C3XA 3DD1A 3FM9A 3EN0A 1QUEA 1YBMA 1KSFX 2R5FA 1RAFA 3CEHA 4NU0A 1Z5UA 5B53A 4A2CA 4UMVA 5BWNA 3EXHC 1XLWA 2IDJA 4QFMA 1KF0A 2RGUA 3F9RA 1QYRA 4JASB 1IPHA 2BN4A 4ZT2A 3FFBA 1A2OA 4I55F 2G76A 4YI3A 5FI1B 1YRQA 2EKDA 3O26A 5FADA 3M6VA 5KNDD 1IBKB 1NUPA 3NNNA 3TSCA 1TZJA 1QIKA 3GL9A 2Q4EA 3EIEA 2PPVA 4GAEA 3JQFA 1DX6A 1U2ZA 2W6JD 1M0EA 1BX1A 1EFTA 1ZGHA 1AQIA 1E2KA 2C8JA 2CFTA 2Z5LA 3B1ZA 3DVQX 4FCTA 1UEJA 4KBYA 4R98A 2W2QA 3SR3A 3WX0A 4HH1A 3MTDA 4WPGA 2EW2A 5I9NA 1E3JA 3FHOA 1PJBA 4OHKA 2CXOA 3IEPA 3LDHA 2J67A 4BNXA 1NQXA 5JI3E 1Z12A 5J63A 3AM5A 2O6HA 1TJ4A 1RMTA 3C7CB 4MQ4A 3EGEA 2XMCA 1AGRA 3T9BA 1CR4A 4JBWA 4B46A 4JLNA 3K70C 1GPJA 1YZNA 1DQPA 2VHEA 2O20A 1CVRA 1PFQA 2XE7A 3V80A 1UWKA 3VYTB 5HR5A 4ZC1A 5ICGA 3WKAA 2XXAA 5CDFA 2FY8A 4BE7B 5L3QA 4YNBA 4LXIA 1V3TA 1BC5A 3SBDA 2JFYA 1Z63A 2FP4A 4F4FA 1KVUA 2VT2A 3LWNA 3M5DA 1BXKA 1KI6B 1XXLA 1XE3A 2OV6A 2DLNA 4MW1A 2V55B 3MYYA 1J97A 4G0XA 3WTBA 3MELA 1LK0A 2FPSA 3CN9A 2XZDA 2VKQA 2ZIZA 1DXHA 4ODIA 4YP1A 1QS0B 3G0HA 1FNNA 2AG1A 1N2CE 3HY4A 4FJ2A 5FBRB 3TLGA 4FWTA 2QZPA 1CJMA 1U7DA 2WTNA 1SA0A 4YH1A 3O4GA 3AEYA 3SFZA 2Y0PA 4QFBA 2C1ZA 1Z15A 3HM9A 3Q8LA 2XAAA 3J81A 1COZA 1ESMA 3EWAA 4A8HA 5LUAA 2JH3A 3IQXA 2ERXA 5HILA 3TW6A 2ZB8A 2WNSA 2O2IA 3ET4A 3QXCA 1NBMA 1U6JA 5EIAA 5G0TA 2ZAYA 3AJRA 3R7BA 3PXUA 3TPFA 4WSOA 2GDZA 3MTJA 4NE2A 1CS4C 5C51B 3LO5A 1I2MA 2UZ0A 4RTJA 4A36A 1O87A 3NATA 5K3SA 2WFLB 2O1SA 2Y1DA 5K2OA 2Q2VA 3VU9A 4H7PA 1W44A 4RIGA 3HE3A 4QQKA 4G37A 1GV1A 1PG2A 2PUWA 1ZJWA 1EA5A 1UF9A 1AB5A 4QPPA 2C8VA 3H5NA 1QM5A 3EF3A 2FMUA 2W6CX 3H9GA 5E9WA 1I4LD 1X2BA 2HQOA 3BZWA 3ETCA 3KOOA 1XEXB 3HU3A 3MSCA 4PGFA 3RG8A 2WIDA 2FFQA 1Y8QB 1XZAA 1YL5A 5TQJA 3T95A 4ND3A 1E9EA 2HSJA 4JJKA 3G0GA 4C7OA 1J00A 3VDQA 3WC4A 3RVOA 2P77A 2QZ4A 2R7MA 3LECA 2AZXA 5KJFA 2XCSB 5KPJA 2HI0A 3CCCA 1V95A 3ZYCA 1FJGB 4FFSA 5BSVA 2AJ8A 2VPPA 4O4IF 5FUQA 2OB1A 2VTVA 5CNKA 2ZK7A 3S2UA 5D3MA 3CO5A 4GD3Q 5J2TF 3UF0A 3ZNOA 3TGPA 1F8GA 3EMKA 3E53A 2O3TA 4ZT7A 1XMIA 5HF5A 3HMKA 3CZ5A 5BQOA 1B7GO 3BFJA 3VUEA 2RAUA 5F12A 5HIAA 2FAXA 2A5GA 4R8LA 4HUQA 4FSHA 1GQFA 1LBSA 4Z7NB 2R8ZA 3VSEA 1H1TA 2X0RA 3FY4A 4FKZA 1OIWA 3DEIA 5BP7A 5CB6A 2DGDA 3ONFA 2CW5A 4LJ8A 4BLRA 1LS1A 3LCUA 3NOVA 3SQNA 3FLEA 1ZNQO 3A3OA 4F04A 1VYUA 4GGPA 1HDGO 4C3UA 2BJHA 4HUQB 3AYZB 1UWVA 3FPKA 4RY2A 3D64A 3OQJA 5T5QA 4F2WA 5IXJA 3C6XA 3IT1A 2HJSA 4QGGA 5I9LA 3ELBA 4HZUA 2Q0SA 3BTSA 3I42A 1VBMA 3IUBA 3MJVA 4WXYB 1DFGA 3ANTA 4D6YA 3L43A 1NW9B 3QFCA 4ZMBA 2Q6KA 3V7WA 1QKKA 3I2HA 4PHHA 4NXNB 4QARA 3CZMA 3LX4A 5LLSA 4TZTA 3W5HA 4WY2A 5KNBD 1HSZA 3QRWA 1FTYA 4Z9BA 2CNWA 3ZNQA 2QM8A 3SZOA 1C80A 3KRTA 2IK8A 1KS2A 1CVIA 1YK1A 2FX5A 3OWHA 1TGVA 4MQLA 2UYOA 3WG9A 1ZNXA 4FHFA 4EAQA 2ETXA 2YMLA 2A5FA 1T9KA 1EFDN 3Q10A 4TT3A 1S3GA 1Y5LA 3R2JA 3KDPA 2XGMA 3C4QA 1HZJA 4BCBA 1CWUA 5AVUA 3RUEA 5TRTA 1YFLA 1VMAA 4JQZA 3EGVA 3BH6A 4TKVA 1L7DA 1LDNA 2ZCUA 1JIVA 4GEGA 2H3HA 1IK6A 4PYJA 2WQ6A 3PFGA 1OU4A 3PD1A 1Y7LA 4BJ3A 1W19A 2CEAA 1E2DA 1MV5A 3V32A 2PKRA 4OK3A 3I83A 4EUHA 5BN1A 3IGFA 2IOQA 4IHAA 1BH2A 2P9JA 3K0SA 4RVOA 4IRXA 3T5AA 2ZYHA 3DV0A 1RBYA 1JW9B 4PZDA 8ADHA 2DETA 1YNSA 3IO3A 3RM3A 1GNPA 1JDBB 3C97A 2NLOA 2QL5A 4CMIA 1IZZA 1X77A 1AN0A 1EHCA 4PSDA 3SX0A 1TPZA 3RTBA 1E6LA 5LZ4A 4FBMA 1DRUA 3U7IA 4URFA 2D74A 4G5YA 4MVYA 4UUBA 4WY8A 3RTAA 3FOWA 2CNLA 3U4IA 1VPLA 1KXZA 1H93A 1Q1NA 3GRAA 4C4RA 3NU1A 4R6WA 3CNBA 2PM8A 3IB3A 3MLBA 5CG1A 4DV7B 4UUNA 3PL1A 4RNCA 2ZBGA 1XIVA 1GLNA 3EGIA 1Y7HA 1GP2A 1YONA 4GU5A 4DDMA 1ZJYA 3M2TA 3NALA 1WXFA 3VKFA 1ZU5A 1XA4A 1LSSA 2YWFA 1JHYA 3V4ZA 1MO5A 1A8UA 1PWYE 4FT2A 2Y1KA 1ONPA 4B4UA 1E8MA 3OJWA 3F49S 2ZJ2A 2QUHA 4EI2A 4AURA 3LHFA 4MUGA 2CMKA 3RUCA 3C70A 1OWOA 1KKLA 3LCMA 3EPPA 4PR3A 4QGBA 4WNIA 3ST7A 5JWOA 4EZIA 2REXB 1GCOA 4QKQA 3MTAA 4WKCA 4LOLA 3UYKA 2C1XA 4PZCA 5FEMA 2JD0A 2PSFA 4IKOA 4EEXA 1EB8A 2PZKA 2GH1A 4LRTB 2CLLB 1ZKMA 4FT4A 4Q3KA 4PWZA 3U0VA 5CFNA 3QW4B 5C3MA 3FYDA 1ULHA 3ELDA 1OPRA 1U0TA 5AJZA 4NCNA 1EGVB 3W06A 2WYVA 5ECYA 2P0EA 1W1IA 1IDOA 3EXFA 4K9DA 4LOJA 4OB7A 3LXXA 4U2BA 3P0EA 4RXTA 1ZAKA 2QW0X 3OZUA 4RAQA 3KQSA 4B44A 5G0VA 2R48A 4BEJA 4FCVA 2EJBA 1O9HA 4YRNA 2D0IA 3HFRA 3QU2A 3ZU4A 4OXQA 4BKRA 3CKYA 1CY1A 1M8GA 1V8FA 5CDSA 1UM8A 2ADFA 3QNWA 3T7IA 4MYHA 2HTEA 4D82A 4G67A 2HA4A 4L15A 4IV0A 2WM9B 5AUNB 3DWGA 3EHEA 4LDQA 4REQB 3B3JA 4HXGA 2XIJA 2ATCA 3E7XA 4HNAB 1EJBA 3PEEA 1K5HA 2XOKD 4UM5A 4IJMA 2G7ZA 1PLJA 2NZWA 4Q4JB 4XCXA 5EMHA 4ALNA 4H4EA 3RVNA 2DUNA 1P74A 4D56A 4KUEA 4LC9A 4AY2A 2C9ZA 2C77A 1Q44A 3BIWA 2FSVC 3KOMA 3NPAA 4YT2A 4HGZA 1KBZA 2YW2A 3WKEA 5CCXA 3IKTA 2AG6A 2JHPA 1O6FA 3H9CA 1DKLA 2C2KA 2JAPA 3DLIA 4HYTA 4MIKA 3SJZA 1K0UA 3KJFA 4R40A 1M8KA 2IODA 4LGMA 4ZAXA 4BEBA 2DBYA 2EQBA 4CL8A 2Q28A 2IELA 2WT4A 3DBRB 2Q5EA 4NMLA 1PJ8A 4WLNA 3T7DA 3TLXA 5JJBA 1H6BA 1FTQA 2YDYA 1BNCA 2AEMA 3KD3A 5TT0A 3L7AA 1C7ZA 1MMFB 1U9IA 1N6LA 1ZWLA 4FWBA 4I1SA 4JP2A 2JLYA 1TC2A 1TZKA 2LPMA 3BK2A 3F6BX 4G1EB 3R24A 1WHTA 5I45A 1SELA 3CUEF 1ZW6A 4JJGA 2Y4OA 1KZ6A 5FORA 2JLSA 2FMTA 2WFAA 4J3NA 1SBNE 2NV0A 4OJMX 1Q22A 3U80A 2EQ5A 1GL7A 4GOND 4PIPA 2NZXA 3BRCA 2AEEA 1RJEA 2RJNA 3EQ9A 1UFKA 4FNAA 1HDEA 4MI9A 1X1CA 1IVYA 2YN4A 3B52X 3A6HA 3SXUA 1IWOA 5HF6A 2ZBEA 4OB6A 1KO7A 5KWVA 4TKUB 4DLKA 4ZI7F 1ZK1A 5TPZD 4D9JA 2QGFA 3DYBA 1AA6A 1VLMA 4OYLA 3HR4A 1R12A 5B64A 3PNPA 4C30A 4OAOA 3FDJA 1IEWA 1YQUA 2JZOA 4GLBA 2EKQA 4L1KA 4S1WA 1F9EA 2R2GA 2WF6A 3EFOA 3NI2A 4BO9A 1HEYA 3T3EA 3GCXA 3IVCA 2BDEA 1YA6A 2ZUTA 3U1TA 1KYZA 1NQWA 2B4TO 3E70C 5EKUA 3CX3A 2O8EA 1EJ2A 1R9MA 3ITNA 5LD2C 2WWHA 1L4KA 2CB0A 1EFVB 3C3PA 2ERYA 5DNUA 5EUMA 4BNFA 4DMLA 2RIPA 4IF6A 5AM1A 1U2SA 5EP2A 4OI0A 3L07A 5F5XA 4F93B 4LA4A 4JJFA 1E9BA 3IEUA 4YAJA 2ZUUA 4NCAA 1DFHA 1MORA 3WOVA 5A4MS 4QXAA 3MT0A 2AF4C 2WM2A 4FE7A 4YCAA 5L9AA 1F8UA 4X1OA 4AAYA 2WINI 2X5OA 1DC8A 2IYFA 3TZBA 3LC2O 3PD7A 3H1EA 1C9EA 2NUTB 5D85A 2W70A 1DC4A 2D0DA 2J7PA 3RU7A 1BRMA 3NRCA 4G5XA 2CSXA 3SF8B 2BM1A 3IPAA 3N0WA 3KEGA 4QBHA 3HRHA 1DG1G 2ZE6A 4XVRA 1WPXA 1CDZA 1IB6A 1P73A 4INZA 4BNVA 3H42B 3ZHSA 1B1AA 1O5OA 5HS4A 5JC8A 1JPJA 1IAQA 4EELA 4LXXA 1WSAA 2QAGA 4RL6A 2ZUEA 2NV2B 4NIMA 3NLLA 4MW6A 2O48X 3PL5A 1JN0A 2CVZA 2RGNC 4NHOA 3QKTA 4Y2TA 1G3UA