2AOUA

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
total genus 102
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouA00
3U81A 3SVZA 3FUTA 3RODA 3KQVA 5KS2A 3O31A 2JH8A 1HNNA 2P7IA 3LCVB 4OA5A 1AQJA 1ZGAA 3FRIA 1KIAA 1JG3A 3EEOA 4YMHA 3TM5A 3KQYA 3FYDA 3M6VA 2A14A 1F3LA 2UYHA 5MHTA 3ELDA 2R6ZA 2XVMA 1UFKA 3B5IA 3P9NA 4PONA 2ZIEA 3F4KA 2B2CA 3FUWA 3EPPA 3UA3A 5HZMA 4Z2YA 4EMSA 5FWAA 2Z6UA 4MQ4A 5C1IA 3ELYA 1P39A 2K4MA 4RTKA 3HCFA 5T67A 2ZIGA 4WXHA 1NT2A 1XVAA 1DCTA 3HVKA 3NMUF 2HMYB 1JTFA 3DTNA 4HH4A 3O7WA 5CVVA 3LDGA 3KPVA 5ICGA 5HOQA 4G56A 2YXDA 1BKYA 1N2XA 3GCZA 1NE2A 2ZW9A 4PWYA 5DM2A 3LL7A 4QQNA 2PY6A 5EEGA 5EHGA 1JSXA 2O06A 2Z6QA 2Z6AA 4OBXA 2N47A 2UYQA 3G5TA 5EZSA 3JWJA 5EKUA 1H1DA 1FP2A 5KYGA 1ZG3A 1ZQ9A 2NYUA 4RVHA 3HEMA 3LKZA 5E2AA 2JHCA 1XJ5A 2F8LA 4C4AA 3E23A 4ER6A 3B89A 4IV8A 5ICEA 3G7UA 4FSXA 1IY9A 5E8JA 3G2MA 5FQOA 2G70A 3FPFA 3DLCA 3ER9A 1O9HA 2O0LA 4BLVA 4E31A 5BW4A 5K05A 1KYWA 3OE4A 2Y1XA 1BC5A 3PFGA 3I53A 4HSGA 5K0EA 1QAOA 2AOUA 1EQAA 3HA7A 2XBMA 3HVJA 2ZZNA 2OPBA 3FTEA 4OQEA 4PIPA 2WA2A 2PVCA 3EGIA 3R0QA 3NDJA 2V7EA 3MB5A 1DUSA 5DX1A 5DPMA 3A7EA 5EGSA 3CJTA 5H02A 5HFJA 1B42A 1T43A 1XXLA 2YXLA 1FP1D 3EVAA 3VC1A 4C07A 4GOMD 5FUBA 5M5BA 1SQFA 1D2CA 3KPJA 3HCBA 3LKDA 3THRA 4C04A 3AJDA 2IIPA 2C7OA 3LBFA 3EVFA 5JR3A 1V39A 3FUUA 2NXJA 5GIPE 4QQKA 5K0FA 2ZFUA 1FPQA 1OR8A 1QANA 3SMQA 1DL5A 2E5WA 3PVCA 3PT9A 3P9KA 4UOEA 5DTQA 4RTNA 4E30A 2ERCA 2DPMA 4RV9A 3VSEA 4BLUA 3GRYA 4CXMA 5F2NA 4H0NA 1BHJA 2QE6A 3DMFA 4EVIA 1BOOA 3LDUA 3EVEA 2AZTA 2BZGA 3JWHA 1NBHA 2YUIA 2ZIFA 3C6MA 3FTCA 3FZGA 3GIWA 4GOND 4O29A 5CVEA 5T64A 4PNEA 1NBIA 4YUXA 5DXJA 3G89A 1D2HA 5F2KA 1D2GA 3HNRA 3REOA 4GF5A 1YFJA 1RJDA 3HCCA 5CCXA 1JR4A 2CKDA 4RSRA 1UIRA 3UJ8A 5FULA 4C05A 1TW2A 4KW7A 4CKBA 2ADMA 2NXNA 2ONYA 2JG3A 5DM4A 4AUKA 2AOTB 3UJCA 5DLYA 3SSNA 3DXXA 4WVLA 1XDSA 2EJTA 1M6EX 2AVNA 2PGXA 3NTVA 3OZSA 5GWXA 3PTAA 3P8ZA 3PX2A 3G2QA 5HIJA 1SQGA 3IHTA 3LX6A 2I9KA 2HWKA 1N7IA 2ZULA 3GNLA 4GOOD 5DX8A 4YV0A 3TMAA 1RJEA 3BWYA 4PYKA 2B3TA 1G8SA 3EEYA 4BLWA 4ZTBA 5E1MA 1TW3A 2PXCA 1ZKDA 5DRYA 2ZTHA 3KPUA 2DULA 4GC9A 5CVDA 4C06A 4ISCA 2G71A 5BXYA 5K0NA 5EEHA 4CWAA 4HGZA 2UYCA 1NV8A 2PV0A 1R8XA 4GUAA 5EC8A 1XTPA 2AOUB 3HA5A 4GOLD 3T7TA 3LCCA 2ZSUA 5DTMA 1JG2A 3I5UA 3SXJA 3NWEA 2VP3A 1JTEA 5U4XA 3GDHA 5EMMA 2G72A 1L3IA 2P41A 3LHDA 2YR0A 2XYQA 3CVOA 4YV1A 2NP6A 1MJFA 2BR3A 3ANXA 4PGGA 5EG5A 5E9QA 1JQ3A 5FQNA 3MHTA 2XYRA 4RTPA 2PBFA 3A26A 3ELUA 1R00A 4XCXA 2BR5A 1NW3A 3E7PA 4EKGA 3KQPA 3BT7A 4RTJA 1G60A 3OU2A 4YUWA 1ZGJA 2VS1A 4YUZA 3I64A 5K0BA 2FK7A 2FCAA 2IBSA 3DXZA 4PYOA 1X1DA 1XCJA 5GM2A 5GM1A 3TKAA 4F84A 4A6EA 3HCDA 3KR2A 4CTKA 4PGHA 5EVJA 4RX1A 5HILA 3HA3A 3CGGA 1FBNA 3D2LA 4M7RA 2AN4A 3KPWA 4PCLA 1X1BA 3AXSA 5GIOE 3PLAE 3A27A 2ZBRA 3EVBA 3OZTA 4RTOA 3KR1A 1JQEA 4F86A 3OU6A 2AOTA 3NDIA 1F38A 5C0OE 3WSTA 5EKXA 2V74B 5E9WA 5KVAA 4KIGA 3CCFA 3HVHA 4QPNA 5KQSA 2ZCJA 4C08A 1P91A 3A7DA 3NWBA 4HTFB 3UJAA 2O57A 4BP3A 3RW9A 3EGEA 1JG4A 3ELWA 4X61A 4E33A 4AZWA 4YUYA 3A4TA 4IWNA 3UJBA 7MHTA 3ID6C 2ESRA 2IP2A 1SG9A 1VE3A 3EMDA 2H11A 2HNKA 4CTJA 2IDKA 1RJGA 1U2ZA 2ZVJA 5CUQA 3FRHA 5E2BA 2ZZMA 4GBED 3BKWA 3OZRA 3DOUA 4K6MA 5HIMA 2NNWB 4KVZA 3E05A 3PB3A 3UWPA 4ER5A 3A25A 5DM0A 3DR5A 3KR0A 5FHRA 4PIMA 1QYRA 4AZSA 4E2XA 2O05A 2KW5A 3GRVA 4AX8A 5LR6A 2GPYA 3R9XB 4BP1A 1SVUA 2IDJA 3CJRA 2PKWA 3I9FA 3PS9A 5FADA 4RTLA 2CWWA 2EJUA 1Z3CA 3V97A 2OKCA 2P3LA 4QPPA 2PX4A 3Q7EA 2XVAA 1ORIA 1R18A 3CKKA 4U7TB 3P2IA 4IKPA 5F2OA 4RTMA 2OBFA 3Q87B 2FHPA 2ZWAA 1I4WA 5D1NA 3DULA 1X1AA 1G8AA 2FK8A 4ER0A 2JHAA 3FPJA 4V0RA 5GINE 3K6RA 1QAQA 3C3PA 1VP3A 3M6UA 1KPHA 1L1EA 4R8RA 1EJ6A 4HGYA 3TOSA 3BXOA 3AXTA 2BM8A 5E1OA 3R6TA 1IXKA 1NW6A 2NXEA 3KPYA 5FTWA 3M6WA 3UA4A 3FPEA 2XYVA 5HIKA 2PXAA 4A6DA 2EFJA 2HTEA 3SX0A 4PYJA 1QAMA 1O54A 1SUIA 5FCDA 1ZHFA 2P7HA 3MCZA 5HEKA 3MGGA 4FP9A 5FA5A 4ATNA 2AN5A 2IGTA 4DCMA 2OB2A 4EQZA 2JJQA 1YZHA 3TQSA 3GU3A 3TRKA 10MHA 3T0IA 5EHIA 3KR9A 3FPHA 2FRXA 1NW7A 4Y30A 5FHQA 2IH5A 4PYMA 3E8SA 3IYLW 4Y2HA 1Y8CA 1MHTA 2LD4A 1PJZA 4LWOA 5DSXA 4X41A 1G6Q1 3B3GA 3B7PA 5LQUA 1YFLA 3PFHA 4DQ0A 3KQSA 4EK9A 4QDJA 3DLIA 1VQ1A 4NECA 4CKCA 1WZNA 1I9GA 5P8WA 5LQKA 2QRVB 4RTSA 3FUXA 5BW5A 1EJ0A 3G2PA 3P9IA 3DH0A 3P71T 2EG5A 3SSMA 5DX0A 1KPGA 2P35A 3ER8A 2AVDA 2GS9A 2CMHA 4KDRA 2VDUE 3HVIA 1X1CA 5IKMA 1FJXA 1VBFA 3KQTA 3SGLA 1P1BA 3SM3A 1NV9A 5K0LA 2IH2A 2G8NA 4E32A 5CCBA 3EVCA 2UZ4A 3C6KA 1I1NA 4P7GA 5K01A 1L3CA 3LCUA 4F85A 2O07A 2BH2A 1WXWA 4ER7A 4P58A 5GP1A 2NXCA 1KXZA 2AS0A 3UBTA 3T7RA 5ICFA 3G8AA 5GOZA 2OXTA 3UJ9A 4YV2A 3HTXA 3VYWA 2PT6A 3BGDA 3TM4A 1R6AA 2PX2A 1WY7A 1WXXA 2H1RA 2QY6A 4HTFA 3KHKA 1WG8A 2GLUA 3GRRA 5ERGB 5K8VA 4U7PB 1NW5A 3JWGA 3LDFA 5CVJA 3TPZA 2AOWA 4PYLA 3FTDA 1M0EA 3P97A 5LQAA 5CIYA 2CMGA 4PYQA 3P2KA 3GRZA 5JUWA 4V0QA 2QYOA 2AN3A 2C7RA 5HIIA 1KHHA 3K0BA 2VZ9A 3KQQA 4FZVA 1L3BA 3OE5A 5G02A 3ME5A 1O9GA 5LQRA 3OCJA 1RI3A 2PLWA 3OPNA 3GGDA 5E8RA 2P1DA 4OA8A 1Q0SA 2HV9A 3FPGA 5DXAA 4RVGA 4E2YA 3G88A 4B17A 2AOVA 1RI5A 2AR0A 2UYOA 4PINA 2PWPA 4ER3A 4HG2A 4XUCA 2HR1A 4DM3A 3EGVA 5DTRA 5ICCA 3GJYA 4M38A 3NVMB 1YUBA 3GO4A 3S68A 5KQRA 2IPXA 4FS8A 3IV6A 3B3JA 3DUWA 4KWCA 4RVDA 5LQCA 1Q0TA 2JHPA 2C7PA 1VIDA 5FWDA 5K0CA 2PJDA 5DM1A 2PX5A 2JH9A 3KKZA 4P7JA 1R8YA 5FA8A 3C0KA 1EAMA 3LSTA 5DRTA 3THSA 4RTQA 3VC2A 4RWZA 5DWQA 3ORHA 3QOXA 2ZZKA 4FR0A 2ZLBA 4R05A 4AZVA 3FTFA 3O4FA 4DZRA 4EKIA 2B78A 3V8VA 5EIFA 2ZBQA 2I6GA 1HMYA 1KYZA 3OU7A 3MTIA 5EIWA 4X1OA 5CD1A 1AV6A 5DT2A 3LGAA 3HM2A 4E2ZA 3M4XA 1VPTA 3G8BA 2YXEA 4LG1A 2OY0A 1RJFA 4QVGA 2PX8A 1PRYA 1ORHA 2PWYA 2I7CA 3MQ2A 3FUVA 3P9CA 3DMHA 4FT2A 4XUDA 3UFBA 3DP7A 4DCGA 3L8DA 3HP7A 4YUVA 4RYLA 4FSDA 2GA9A 4YMGA 2VDWA 3DMGA 3EVDA 5K09A 3KQOA 3TR6A 3FYCA 3LBYA 2P40A 2ORED 3KU1A 4RVFA 4QTUB 5K03A 4DKJA 1SUSA 2I62A 2VDVE 5C9ZA 1RI1A 2WK1A 1R74A 4AZTA 3GRUA 3MTEA 4IV0A 3AWIA 4QTTB 4HC4A 1KP9A 4DA4A 2QRVA 1UWVA 4PYNA 3X0DA 4E70A 2FYTA 2PT9A 2WA1A 3IEIA 4GQBA 2YTZA 5IH3A 1X19A 4M36A 3BKXA 4OBWA 3UJ7A 3B3FA 4DMGA 3HCEA 5EQJB 1JSZA 3BGVA 3NVKI 2B9EA 3NW9A 5CM2Z 2Y1WA 1JQDA 3H2BA 3SR4A 3T7SA 4C03A 5E1BA 1N7JA 2YQZA 1TPYA 2IBTA 3BGIA 2P8JA 2CL5A 1G38A 4MWZA 3UJDA 3BWMA 1XCLA 1VL5A 2FPOA 1G55A 2BR4A 3PX3A 3RIEA 2ONZA 3AY0A 4X60A 2GH1A 3GWZA 3QV2A 3CC8A 2B25A 4P7FA 2PXXA 3BWCA 3ERCA 5K0GA 3TFWA 4RTRA 1P1CA 3QOWA 5T6BA 2C7QA 2P3OA 5LQNA 3UJ6A 3NJRA 1INLA 1QZZA 1EIZA 4GC5A 4MIKA 1NKVA 2OZVA 3LPMA 3MERA 3MAGA 3R3HA 4R6XA 2BM9A 3I58A 1YF3A 1L9KA 5BP7A 1AF7A 4LECA 1YB2A 2QM3A 1AQIA 9MHTA 4R8SA 4MHTA 1EG2A 4FGZA 4FT4A 3M6XA 1RI4A 4GEKA 4XUEA 5E1DA 2ZBPA 5LSAA 1IM8A 4OQDA 2IH4A 4X63A 5D1HA 3SSOA 3CJQA 1RI2A 1M6YA 3DXYA 3MCTA 4HRAA 5EPEA 3EVGA 4R6WA 3LECA 4DF3A 3TLJA 4PCAA 4CKEA 5B1SA 4OX9Y 2H00A 5EMLA 2ZWVA 3BUSA 3TKYA 3KQMA 4M37A 2NP7A 2OYRA 5LQJA 2P3QA 2R3SA 1KPIA 2OB1A 1VLMA 2YVLA 1XDUA 3HCAA 2IFTA 3M33A 3R24A 4LWPA 5CVUA 3EMBA 1VP9A 4BY9E 2YX1A 3KQWA 3BWBA 3JWIA 2GB4A 1WS6A 1YZ3A 3OFJA 4L7VA 3G2OA 5EZQA 1NW8A 1XDZA 3BZBA 3M70A 3G5LA 4JXJA 4PYIA 2PSSA 5K0JA 4KDCA 2Q41A 4P7KA 5EMJA 8MHTA 1SKMA 3P2EA 5E9JA 4KIFA 3CBGA 4POOA 2G1PA 1KR5A 2AOXA 4KRGA 4QDKA 5EMKA 3UZUA 2OO3A 3OFKA 1JG1A 3GXOA 4E2WA 4QVKA 3C3YA 2GAFA 5EOVA 3EVZA 4MTLA 5DSTA 2EX4A
chains in the Genus database with same CATH superfamily
2PUDA 3KC2A 5AJYA 2G17A 3ZGLA 3C24A 5KS2A 3V33A 2WHQA 4HNTA 2MYUA 2NUTB 2Y6VA 4WOKA 1GFWA 3QIAA 1AQJA 5DM60 5JPCA 4B5KA 3L4EA 2O7SA 3OIYA 2ZE8A 3VHLB 1O6FA 1JI3A 3HNPA 1P45A 2YHBA 4DZTA 4AWBA 1I0ZA 2GAJA 2OFXA 2TMGA 4N5IX 1GCGA 1VE7A 3I4LA 2RGWA 1SPXA 1UFKA 4WFQA 3TUIC 3G0IA 3H6HA 4MW9A 3ZIUA 3D4NA 4BDSA 1GPKA 4BB9A 2XITA 4CR6A 3OY7A 4NZ9A 1D0IA 1SK9A 1G20E 3QI2A 4Z2YA 1ZZEA 3HI6A 1GRCA 4JT9A 2DT8A 1KI4A 1V7CA 4QD3A 3UW1A 1AUOA 3B5EA 1R5JA 2PZFA 2RGCA 3H75A 1C0PA 2ZIGA 3NDPA 4IIJA 4MI1A 4UC0A 5K1ZA 1D03A 1YS1X 3D6NB 3SJCA 4ITUA 5KYXA 1TB4A 3HN6A 4HXYA 4PGFA 3MWEA 3LDGA 3JCZA 1SY7A 4GZ6A 1CETA 1N0IA 3FHOA 3D4PA 3QUTA 2QM8A 2K87A 1N2XA 2Q5IA 2ATEA 5FL3A 3TQIA 5CVTA 3MTBA 4OEHA 3NHRA 3UGQA 3NDBB 1I7SB 2HHHB 1VHTA 1JQKA 2DLDA 3UHPA 3IIJA 4AN1A 2Z6QA 1NVUQ 1OBFO 1WULS 6NULA 2C9CA 5DGHA 5A0VA 2O6HA 3LBHA 5GVRA 3BTUA 4L0QA 3L92A 2C57A 4OQZA 4Q24A 1ZICA 1ZQ9A 3IP5A 1AS2A 5H1YA 2DKFA 4G4SP 1NJFA 1ZCBA 3MG9A 3PP8A 4PNPA 1SVMA 2CFOA 3AP3A 4DJDC 1SBCA 4G81A 4MUKA 1E98A 1NMZA 4C4AA 5JQWA 4ZRMA 3PXUA 4YP1A 1W52X 2WD8A 1S3FA 5ALEA 1DAMA 1JQBA 4FSXA 5JYBA 1EFTA 1K3UB 4LDQA 4JC5A 3N8IA 3OE4A 1GGNA 2A1TS 2OZLB 3A2KA 2EL7A 2AOUA 3HVJA 4R81A 5HF6A 3G79A 3L0YA 3A6DA 2V7TA 3HSYA 1Y9AA 2J3IA 5AJZA 2XI4A 2YV4A 4FXOA 1DDOA 3GARA 3ILYA 3WFIA 4JNCA 2WFZA 2ADOA 5ABPA 5L6MB 2R86A 3THXB 2PYDA 5FNVA 1U9YA 3BH6A 2ZSBA 1AZTA 4F8JA 1PV4A 3LYAA 3QSGA 3A1DA 1SULA 2WF9A 4NU8X 4W63A 4D79A 5IRCD 3RSHA 4IF6A 4NG5A 1M6VA 3FYHA 4BUCA 2CNOA 4K9LA 3HY3A 2GD2A 3FSRA 1Z4QA 4LVNA 3T9AA 2JFOA 4RD1A 3VR4H 1M75A 3ZWBA 2QMUA 5EWJB 2XHZA 3A9CA 1JIUA 3RSFA 3OUZA 4AO7A 5JWOA 1O5TA 2POQX 2YBEA 4ZO7A 4UTPA 1JQJC 1WB4A 3DMFA 4RSGA 4XEUA 3TGPA 4BVKA 2ZIFA 1TOAA 2GJ9A 3D6VA 2Q9AA 1PEKE 1VRVA 4P82A 3K71B 4JI4B 5A71A 2C2GA 5C7IO 3HNRA 5BUZA 4NPAA 4Q93A 2GM4A 3WQBA 1B1CA 4NV0A 1XAHA 1JR4A 1Z2CA 2C88A 2A6PA 4REOA 3UJ8A 4C05A 4CKBA 4JS0A 5LVAA 1UAAA 4X6LA 4RQAA 3HVRA 3O82A 1TKAA 3UMRA 1LPAB 1URPA 2FPUA 3CZ5A 4M1YA 3OQJA 5BPHA 1GPWB 1MENA 1JDBB 1QCYA 1K68A 5CB4B 4PZZA 1U6IA 1QIHA 3FGNA 1RS0A 2WT8A 4A8JC 1T4GA 3H8JA 3NNSA 2ISQA 3D3QA 4I2NA 5ENDA 4AKGA 1SC9A 1JHRA 4CFYA 4ALIA 3U2QA 1NRIA 1UPBA 2D2EA 1ZNXA 2O2XA 3K73O 3TTTA 1ZKDA 3OF2A 4BGEA 1Q1NA 2HBYA 2I8LA 3U09A 1C8BA 4HNVA 4PM4A 1CUUA 4TUYA 2FOIA 4E14A 2VDLB 4MP8A 5GZ1A 3CEJA 4F72A 4BFTA 3OJOA 5A06A 4BVJA 4TV9F 4DJ5X 3GFTA 5EXPA 4DT1A 3T7TA 1CK4A 1U5BB 1S2NA 3JYLA 5DTMA 3I42A 3I5UA 4FGSA 4BNZA 1WV1A 4ZT7A 3VPAA 4A9AA 3IPAA 1GFSA 4XPIA 2ZVQX 2VPZA 2GT1A 5H16A 4DA9A 5BMVF 2G72A 4IJQA 5L51A 3J81k 1Y4ZA 3LHDA 3L8FA 5FBWB 3B2NA 5LOVF 1GGHA 1V4BA 4FFBB 1C2TA 2QV0A 1GYRA 3QK7A 5E9QA 5FQNA 4OYYA 5LZ5A 4PYRA 3WWYA 4KB5A 3F90A 5HGJA 5KWEA 3RT9A 3DLHA 4J0QA 2HADA 1KSJA 2OV2A 4H6VA 3OJWA 1U7WA 5D2CA 4F7WA 2C83A 3BWEA 3D2BA 1D6SA 3HYTA 4GXNA 4Q5IA 3T41A 5EIOA 3T7DA 4HN9A 1PZGA 1AXGA 4LBZA 1SIUA 1IC6A 1UOPA 2GZRA 3C1OA 5JARA 4MB2A 2GYUA 3FFWA 4CHTA 3ZHTA 4G1BA 1NVMB 4BU1A 1T9HA 2G7MC 4R9SA 2ONJA 3K1YA 4PCLA 1G21B 3AXSA 1I30A 1RJ9B 4TPKA 1KK2A 1KZYC 1OXTA 3A27A 5ER9A 4ACBA 3PLAE 2L82A 4M7WA 1PIWA 1A0OA 4B46A 3CXRA 2RIRA 4NNJA 4HAOA 4DGSA 5DCWA 1Z2DA 1QH1A 4PRKA 3SQDA 2FR8A 2FE4A 3PZBA 4RPLA 4UMEA 5U4QA 5I4BA 4Q4HA 3VHXA 3K5HA 3MSCA 4EGQA 3BBPA 1Z2OX 4E33A 3JZAA 3T5DA 7MHTA 4IMJB 3JPWA 3JD3A 1P2DA 4CTJA 4S24A 3D7SA 3OTGA 3ZWPA 2NVWA 4I1RA 3HKCA 4LJ5A 1BDHA 3HFJA 3AFGA 4D5EA 3QJYA 4GUDA 4YAJA 1WM1A 3C98A 3OZRA 5CH3A 4HWTA 4RVNA 3FVQA 3STWA 4K7JA 3UYLA 3NBFA 4UXIA 2WNIA 3O1IC 4Z8XA 1PWEA 3GRVA 4W6QA 1GZ7A 4B31A 4ZGBA 2AKYA 5HE8A 4Q21A 1UBTS 4QWMA 3R9XB 5C8VA 4M83A 1C7ZA 3VR2D 2C8LA 5A4KA 2CWWA 4FZ3A 2CNBA 2J4FA 1J2UA 4HDSB 4ZO9A 3GN1A 1GD1O 3KYCA 4P4SA 4Q7MB 2JLXA 3ZU2A 1T91A 3VU1A 1WDLA 3Q3JB 3HLYA 4EUNA 3HV2A 1LI7A 1J0XO 2AFHB 5D1NA 1F7UA 1X1AA 3IEKA 3U13A 4C88A 4L73A 3SZLA 3JQGB 1FQJA 1BXZA 2CD9A 2WMYA 5E7IA 5GINE 2ZJ3A 3LBNA 1ECFA 2X9GA 2BE9A 4X95A 1ICEA 3BM5A 3REQB 5ITSA 1J39A 3NAGA 1L5NA 1JGTA 3ZNPA 3EXHC 3WGNA 5H9WA 1E9RA 2B21A 2BKUA 3H3XA 4G67A 4L51A 5CA0A 3H2SA 1QBGA 5EUMA 4RD2A 3BK1A 4IMPA 1LPPA 4JP1A 3ILSA 4JX8A 1UADA 3CR7A 2ZS8A 3ZU4A 3PQ8A 4LKOA 3VXKA 5AJXA 1H9AA 4ASUA 5JBNA 1P4JA 2AUMA 3VKVA 4ND8A 2FHSA 2OLEA 3P0FA 1PGNA 2WWYA 3IV9A 3VPCA 3KQNA 4OXQA 1KNXA 3GZNB 3QVUA 3EGXB 2X5OA 1QFYA 4I50F 2KQUA 1DQRA 3OMLA 3DE1X 1TO1E 2AEJA 1NM5C 2H17A 1PJZA 1DBVO 3PX7A 4B33A 5CLHA 5JD5A 4O59O 4OB6A 4AMVA 2BE7A 2F9MA 3B7PA 4WK6A 2XMQA 1CHDA 2C5FA 2BTQA 1L5LA 3V2HA 4FC6A 1WCV1 1LLUA 2R4QA 4Q37A 1GR0A 2HU5A 2VZLA 3RFCA 4YCBA 3Q9LA 3K72B 1I9GA 2H1FA 4YRBA 5LQKA 5DO9A 3SYKA 3WIOA 2OCPA 3G2PA 5BW5A 1QVZA 3B5JA 1DMRA 4BRSA 5KTYA 4D8TA 2EG5A 1E2HA 1F17A 1USKA 4GL2A 1O4WA 1PJTA 1QG6A 5CT5A 4AG5A 5D3ZA 5HIAA 3LYLA 1L4KA 1RKUA 2LCIA 1R0KA 1SXJE 2O0KA 4FYIA 721PA 2XQGA 3GGCA 3AW9A 3ND8A 4IIEA 2FN9A 1IPFA 1B6SA 2PKRA 3ESBA 3ODPA 5EIBD 4G8CA 1I1NA 1FRFS 1R6XA 1SHTX 4ZVKA 2V58A 4UCWA 1YA4A 4O4HA 2R7AA 4RMIA 2EX1A 2IWRA 3PJFA 4KXNA 5FPKA 2FPPB 1RXUA 2OXTA 1QNLA 1A04A 3KJNA 3LNTA 4OLFA 4NPCA 3OSZA 2GVNA 1IBMB 4HWSA 3FMVA 1VMAA 2G4CA 2WZDA 3ESQA 5F7OA 1AS3A 3IQZA 1D6NA 4U7PB 2HO5A 2AOWA 4PFKA 1AM4D 3BRWD 3FTDA 4DRYA 2OR3A 3D4BA 2BMFA 3KIPA 4C4TA 1FDVA 5I01A 5EP2A 1KHHA 1MVLA 1RXCA 1O2DA 4ABTA 2EFHB 3GR6A 4Q05A 4UUBA 4AP6A 1RI3A 3KQHA 2FZGA 1W5AA 1ILEA 4DA0A 3RLFA 1YQDA 5FFMA 1J9ZA 2HV9A 4BQOA 3TGLA 2I65A 2R79A 4EGSA 3G88A 1CJSA 3NIFB 4OJYA 4RS3A 2OEPA 2UYOA 3AEUA 3INYA 4KIJA 4U5QA 5ALYA 4ZCQA 1ODLA 4BCCA 1CUWA 2X58A 4G5XA 3D1LA 2WM8A 2ZIWB 2NOAA 2FPGB 5EWMB 2Q1YA 3A0RB 3CEHA 2AGVA 3SYMA 2O0MA 3CF4G 4M38A 4R8VA 4UVGA 5CFLA 3NX4A 3FKJA 3L6CA 4B4WA 4CCAA 3N8GA 4E3ZA 3G0OA 4BAUA 3CURA 3VJRA 2HJGA 1IDN1 1JR3E 3KKZA 3NTLA 1LVUA 3C0KA 4JI8B 2OWDA 3H1BA 3OQMA 1YBFA 5DRTA 3V1YA 4BO4A 2R8ZA 1R4AA 5BNWA 3CX4A 3BK7A 4URVR 1U2SA 3AP2A 4U2KA 4V39A 1F8FA 1G6HA 4MS3A 1G6KA 1RHJA 1CULC 3V8VA 2DFLA 5CA0B 2CZGA 3JVEA 1J99A 4QDXA 5G3YA 1EUYA 1J8FA 4Q3NA 3T7CA 3CWZA 1SNYA 2NZVG 2XLBA 1U7PA 2FZKA 1H42A 3HM2A 2VF5X 3NDRA 3G8BA 3RWBA 1DADA 1BNCA 3I6MA 3DM5A 1CY4A 2PWYA 3BXEA 4FT2A 3FUVA 3WSWA 2CXHA 3EGXA 3HB1A 3HR8A 3MJHA 2JGDA 4DWOA 1E1CA 2K2QB 5H7XA 2IHZA 2OAP1 4FSDA 2OD9A 3BA6A 3RIMA 2G82A 1GZVA 1UWLA 3A1CA 2QVLA 1VJCA 2O2SA 2I5PO 3BIWA 3TPCA 2XB8A 3RVSA 1Z2EA 3OT1B 4FPXA 3L9XA 3BD9A 1YCDA 5BSVA 3CM0A 5IPFA 3LZ6A 2M98A 4AS3A 5HJ5A 4IXMA 1JYEA 2WJ4A 3R40A 4CMAA 1CQIA 1SBIA 4IV0A 2HXGA 4NAVA 2OZPA 4ZZIA 3C3BA 4JB3A 4DA4A 4EUSA 3A1UA 1WX1A 4HQFA 4PQRA 5CW2A 3X0DA 4EPYA 2WA1A 1MA3A 4MW4A 4WVFA 1Y7IA 5FUVA 1Y9EA 1XXHB 3M5CA 2EP8A 5ARCA 5IFLA 1WEHA 1YVEI 4LYHA 4XJVA 1AGPA 2YJ6A 3VDXA 4DG9A 1KJ9A 2O50A 1PZFA 2GARA 2RH4A 4CF7A 3GXBA 4KITB 2WHRA 2NW6A 2QL9A 3D7LA 1KH2A 1ZN7A 2HDWA 2Q0QA 2B4YA 3GY0A 4Q9NA 4C5BA 3BWMA 1G55A 2GZ1A 2VC2B 2YMQA 1KSGA 2JGJA 5AWFC 5PGMA 1LS1A 2GN4A 1U99A 1YWGO 4ZEWA 4JL5A 1T26A 3CSDA 2E7ZA 3KK0A 4G63A 2NIPA 3ZKAA 1TM5E 2IYEA 5T6BA 1X14A 2YFHA 4M0FA 3S1AB 3LAWA 1T5TA 3SM9A 5IJ9A 2OHGA 2FFJA 1JQAA 3MERA 1VJ0A 2GRUA 4Z54A 4DLAA 2V9PA 1PS9A 1U0SY 1JR3A 2IU6A 1YB2A 2PL1A 2Q9UA 3WKAA 3H87A 3FSGD 3DEJA 5BW6B 4DNXA 5CFMA 2DQZA 1CPYA 3DGEC 1KGSA 2IYSA 3EZLA 1WCWA 1PBNA 1HE3A 1QC5A 1A9PA 1XX6A 2VA9A 3CZRA 3HE3A 4HN4B 3CZMA 4K8OA 5D1HA 3ROPA 4HRXA 3W04A 3JRXA 1WUJS 1CYEA 1O94A 1X1EA 5HCNA 3AO0B 4C14A 1Y4UA 1EEHA 1ZP6A 1YKFA 1KSHA 5EWMA 4PCAA 4HCJA 5B1SA 2I22A 1GUFA 3VR4D 4BMCA 5JAOA 3T1TA 3BUSA 4UNIA 1HYQA 5IK2A 1WTCA 2VYND 3PQ2A 4IHAA 5C46F 4BFXA 3NPAA 4HWRA 4CF3A 1CY8A 2YCLA 1GNPA 3ROGA 1EVQA 4GWGA 1UPFA 1YR1A 2BH9A 1E0DA 2H2AA 4P32A 2QIPA 2HJRA 3TDKA 3M70A 5CDGA 1V3TA 3GLSA 5KNCD 2RI0A 3AVVA 2IHBA 1ETUA 5EMJA 3INRA 4KBYA 3LK7A 4GI1A 4HZIA 2X2PA 1PR9A 3RRBA 1SXIA 3F6PA 3C74A 3MF4A 4QLOA 4P83A 3SC6A 1QONA 3KQKA 4YMSA 4GX5A 5TT0A 3C97A 3TAUA 1UK9A 3VDQA 2DVMA 3O31A 1Y8RA 2FVYA 3ORRA 1PG0A 2IQ5A 3FCEA 3FRIA 3KELA 3MT0A 1SU6A 4G1UC 4REQA 3V4RA 3N2ZB 1L7PA 2ZJ8A 3MT9A 1U2DA 1V43A 2XE6A 3F7MA 1UQUA 2ZYSA 4AMZA 1XMVA 3HADA 1KJ8A 2YNMD 4IZ6A 1A97A 2VDWB 4XD7A 3B8HA 3SICE 1GQSA 1JKFA 3TRJA 3ZS9A 3ZXXA 1UKYA 1RQGA 5HZMA 2GEBA 2WG0A 5FWAA 1P7PA 4QUIA 5D00A 4ML3A 3PUYA 5G1OA 5G0WA 1TT7A 1ENOA 1QCZA 4WZAB 3DTNA 2NV6A 1EJ2A 2IZZA 2Q6OA 4TL9A 4ZVTA 4ZI7F 3DUFA 2HPZA 1V71A 3VNAA 2B2NA 4MX8A 5DULA 2AF3C 2IE0A 4E3WA 4Y9DA 4YWHA 1N5JA 3D2AA 3FLBA 5BOSA 2O06A 4BX0A 1BVYF 2DFPA 2HUNA 2JFWA 4JITA 3W4KA 2Z6AA 3FKSD 5AK6A 4X7RA 3ZD6A 4TN5A 4ZYLA 2MHCA 2VF8A 1PZEA 3COSA 4MIYA 5EI5A 2OORC 2GEJA 3N6RA 8LDHA 4XM1A 1NMEA 5A3VA 4DKXA 5LKRA 1M2NA 1DOZA 1HEUA 1C9NA 1ZC3A 3PIDA 3E23A 3VR2A 1TYEB 3FXAA 1H6BA 3GFSA 4Q3OA 4LYEA 5F7JA 4D6PA 4E5DA 4TUYB 2VNJA 3MQ4A 3KOYA 4RXMA 4KAXA 5IYZA 1JIXA 4E31A 4NI5A 3DBRA 1POWA 3EXFA 1TMGE 1W29A 4DPMA 2ZRIA 1CEXA 1GT6A 2TSYB 5AKYA 4PAGA 5KYVA 5GVSA 1CIPA 2OPBA 2BJVA 1U5BA 1J56A 4FLFA 3CONA 3N28A 3R0QA 3N6XA 3O75A 4Q4AB 5JYCA 5TJ9A 3GGOA 1Y5IA 1Q7CA 2PZMA 1W2WB 4BBZA 1ESEA 4FQ5A 5DYIA 2PD4A 4RH3A 2BCEA 4LF9B 5F1PA 2JIZA 1V6SA 1MHPA 2JLCA 3HYNA 1VE6A 3NHUA 4X94A 2FR8C 5DMXA 4YONB 4ARZA 5B1YA 3FUUA 5ALJA 2WMNB 2F1RA 2CDCA 4WK4B 2YNMA 1OR8A 2OQIA 3G0DA 5KSPA 1XLTA 2B2XA 3TSWA 3QVVA 4JQOA 4JLMA 4E30A 2VCYA 1I13A 1PDOA 2WC1A 4RESA 4XIGS 5I7RA 1P1JA 4YRQA 3JAWA 4KN9S 2IV7A 4A8PA 3ZCTA 4DCPA 5HWSA 1GFZA 1ZRMA 2P5TB 3K30A 1E3JA 3HU5A 4FFSA 2EQAA 3KXIA 5AXDA 3REOA 4WWHA 2JZNA 3G0GA 4Z99A 3V3KA 1T2FA 1VG8A 4ASUD 3WRYA 4DS3A 3RYIB 3B6ZA 4Q3DA 4CLRB 4F8YA 2AOTB 2BP7A 3RSOA 2EGHA 4I9GA 1ZOLA 4WVLA 5LWQA 1SVSA 2Y2UA 1XB2A 2PGXA 1QHHB 3AKEA 5JROA 4CE6A 2HA3A 3EXIA 5ALWA 3TLAA 5THKA 2E4XA 5DLQC 2FSVC 4F9GA 4DARA 3BWYA 1MJHA 3F73A 3GLGA 5E1MA 3TKLA 3U56A 1X94A 3WG9A 4Q9DA 1XNHA 1YZYA 1TUBA 2V0NA 2YV1A 3WX0A 1K2WA 2K7ZA 4I55F 3QELB 4QREA 1E2LA 1C7EA 5EIEA 4PAMA 2G9UA 2QRQA 3IR7A 4E03A 2H1OA 2R48A 3HA5A 3V4SA 3KXKA 3ESDA 4K1LA 3ZN2A 2DHCA 2H1SA 2JAUA 4WA8A 1ODTC 2R1ZA 2Y71A 1QZ3A 4BAGA 1W85A 1WMSA 2HWWA 5U1PA 3EF1A 3DE4X 3UMMA 3C5CA 4HQRA 4DR2B 1N6PA 1TRKA 3IP6A 1A1SA 1KYQA 2COUA 1NBOA 1YMVA 2C2OA 2H5JA 5FO1A 2PMEA 4OMUA 1XZIA 2VRWA 3LHIA 1E6KA 1VSBA 1Y82A 1Z7WA 3M6FA 1CY7A 3GFBA 4YT5A 1NW3A 4DM7A 3RYCA 2MSLA 1UBRS 4OQPA 2ZBFA 4TOIA 3RDPA 2GKOA 2PRZA 2C58A 1QRDA 3HU2A 4DSZA 1T24A 1P4HA 1X1DA 3KKQA 4R1NA 3U3KA 4ETIA 3KQLA 1KKUA 1WPRA 2WKQA 2XCUA 3X44A 2ZUVA 1O94C 1JWLA 5IH7A 3P0RA 5DOZA 4PZPA 3VFDA 3M4ZA 2J67A 4XX0A 5B7PA 3OOHA 4OFWA 1JKXA 3RH0A 2BCJQ 4IG9A 4ZDWA 2BISA 1P62B 3AR3A 4TMVA 2ZBRA 1PT6A 2Z1MA 1J5XA 2XR1A 4FTWA 1N6OA 2CY0A 4LY9A 2VUIB 2ZU0C 3R6WA 2DFTA 3S7ZA 1TM1E 3QENA 1YXMA 4IHKA 4F4HA 4MA0A 3PR2B 4C08A 1P91A 4YRRA 5TE9A 4A2PA 3S1SA 1GLVA 4NBUA 3HO1A 5L8VA 2BKLA 2GZHA 5K4HA 5T41A 1YR3A 4MUJA 2IUYA 2GBPA 4D56A 4KO8A 3HB0A 2GCOB 1SBZA 3OLQA 4P08A 5ALMA 1RXVA 2QPAA 5KJ6A 3V9PA 3BDIA 1FFYA 3BGSA 3CNNA 3DOUA 1M2GA 4C4OA 4QUKA 4ND3A 3NHZA 4IIBA 3GH3A 3GJ0A 2YUTA 3MCAA 4TTIA 4R9UC 1BFDA 5L40A 2ES4A 4EGAA 1R0SA 3U6BA 3LD9A 4BRZA 4QOEA 3MBIA 4AX8A 4OXKA 4CQLB 3A4MA 2JGAA 1OBOA 3O21A 2R7NA 1M34E 2PWZA 3NHYA 4PG4A 3D5QA 3AMVA 3B9QA 3RS5A 2FF5A 1PYDA 2YJ5A 4K05A 1AQUA 2P3LA 1LWOA 3N1UA 4M9QA 4KYTA 4F12A 5DOVA 2JAWA 4UE6A 3C3JA 5FPTA 4U7TB 4IKPA 4N49A 5ADHA 4CODB 3LHSA 1I4WA 1XD2B 1YV9A 2HQOA 2ZKLA 2ZRBA 4FYYA 4GMFA 4Q9LA 4DLKA 1KQFA 4C3OB 3WHIA 5CEFA 4K9MA 1T3TA 3WWPA 3C3PA 2GF2A 4LNAA 1HF3A 4UU0A 4XA8A 1DC3A 1R50A 1M6WA 1JJAA 2UZIR 5B53A 5BQXA 2BGTA 4IFTA 5FTWA 2RHJA 2VRBA 1MT0A 2AZ4A 4GQIA 4TMFA 3EQZA 3U9TA 3CTPA 5K4GA 3KZXA 3JXEA 2GDJA 4WBSA 2BFPA 1KF0A 1KZGB 1LSSA 3S4YA 1O6GA 3ICQB 2OD2A 1LEHA 2AN5A 5FA5A 1HA3A 2OSBA 3L7KA 5CB4F 4EJMA 5JH7F 5IS2A 5D86A 1Y7HA 1TQ6A 3TQSA 3QUBA 1AKUA 3LIPA 10MHA 5FPPA 4QJ3A 2C3YA 3KB8A 3STTA 1MDFA 1NLZA 2HAEA 4L4SA 3QPWA 4G1MB 4MROA 5AXAA 4DMHA 2JNWA 3ABOB 1T0JB 4L57A 5MGBA 1HYHA 5KTKA 3HKCB 1D2RA 1DRVA 4LZLA 1LQ2A 4CU2A 4DPKA 2XEDA 3FPCA 5IEJA 4LF6B 2FFBA 1OFUA 4B4UA 1JB1A 5AD1A 5B6JA 1Y4DE 5KKAA 4FFLA 1ODKA 5AVTA 1WZNA 1O77A 1N0HA 2XQIA 3MMPA 4JJEA 5IASA 1MC4A 5J43A 4R8MA 4A82A 2WJ3A 4N6NA 4ND2A 3VYVA 2WVJA 2P35A 4NCJA 5IJ0A 2FMFA 1NPDA 3CF6R 2QHXA 2ORWA 1VBFA 2X9LA 4QUHA 4Y3UA 1P1BA 3SGLA 5HVNA 1FJXA 3VV2A 3SYLA 3TXYA 1NF8A 3R5SA 3R8FA 4JNKA 3ZDFA 1JNXX 1CZOA 3DWGA 2QRKA 1FNBA 3M49A 3WB0A 4D0LB 1V95A 2QAGA 5IHXA 5JAIA 2A8YA 1RWWA 1ZO8A 2MIIA 3G8AA 2ONKA 3JQGA 4TSFA 4BVHA 1II8B 3VYWA 2QRHA 1E58A 3HCNA 5DYYA 3HSKA 4D4KA 3QE9Y 3DV2A 2YVQA 1WY7A 2RHWA 3I9JA 2X5KO 4MK4A 2HRDA 2NQ8A 1COWA 1TNDA 1ZVKA 4URYR 4LW8A 3HKDA 3VH3A 5JD4A 3TMYA 4BO2A 4Y7DA 1NQVA 4BWFB 1RRCA 2OCDA 4OMCA 2FY8A 1TMOA 5JUWA 4HQ6A 3UUGA 2NSLA 1UUFA 1P0IA 3KQQA 3K4HA 4JL8A 2RG7A 2HCTA 3H65A 2H5IA 3PNBA 2NMVA 2WEKA 3BERA 3JZDA 2PLWA 4A15A 4JK3A 3HWX1 3FPGA 4WSOA 2HSZA 2R00C 3AF0A 1LJUA 3NM5A 1MVOA 2AMLA 4ZODA 3QSYA 1AKEA 1ZFNA 3BL6A 4CKWA 2XCQA 4V1CB 3CUEF 4D0SA 1T2VA 2VQSA 3D2CA 4MR7B 4X8LA 5AKGA 4RHXA 4B7XA 4MDEA 2HKIA 1E3DA 4A16A 5IBCA 1NQXA 2DCUA 1CE8B 5IDYA 2YIJA 4XD2A 1SZPA 1V11A 5F3RA 3MT8A 2BMDA 1PR3A 1CJKC 4LNUB 4B74A 1CS0A 1WU8A 1GNVA 1D6MA 2A9VA 2NM0A 2O48X 2VK2A 4BE7B 2BI4A 1FFAA 2XVZA 4B85A 5KTMA 5LPNA 3H2ZA 3W5HA 1M72A 3S1AA 1QO7A 2VYNA 4UPDA 1NW4A 3V42A 1X7WA 4Z4HA 1Z9BA 5DISB 2R62A 3DEZA 1T5LA 2PS0A 3QEOA 2V7XA 5EIWA 3RYFB 5EN4A 4G2TA 4JQSA 4KZPA 3OQNA 1RZRA 2PA0A 3EDMA 2CJFA 4OKSA 3T5GA 2BHNA 5DT2A 3FDFA 5FBVB 4D1YA 4XGNA 1N8NA 1VPTA 4O4HB 1JAZA 4ITRC 2AXPA 1LPNA 2I2BA 1C3XA 4FMPA 4QVIA 2FPPA 5JNSA 1JPUA 3TEFA 4YRIA 3ITDA 1US8A 4ZRDA 1RWNA 2B4AA 3AH8A 4XUDA 4CM7A 4ESHA 4Z2AA 3W4JA 4IDQA 3TTUA 4R54A 3HP7A 3PQ7A 1Z4KA 1HK7A 4DCGA 2R1VB 1KIFA 3PRKE 5JT1A 3C3KA 3T1YB 2CHGA 2RKBA 2M6SA 3PDIA 3C2QA 3HZHA 1NMYA 3C7AA 4R3UC 2HHLA 1GAJA 4BYMA 3KXDA 3CGWA 4CG1A 1ZYUA 4QTUB 3COJA 2OHHA 3OPVA 3DMRA 3OFND 3A05A 4Q01A 4XTRA 4B6OA 2N1MA 4ZJYA 5B7GA 5E9AA 4PNZA 3WV4A 1KQOA 2CLMB 4RNCA 3LQQA 1ACLA 3HR4A 1I7DA 1EWKA 1C0IA 2O7RA 4C2AA 4PQFA 4BNHA 4DEVA 3PPXA 3PXBA 4LQCA 2XT0A 3F5FA 4UE2A 4Y1GA 3WZ2A 5MFZA 4U63A 2Y1WA 1A76A 4BNXA 4ESEA 2PSFA 3SR4A 1EM8B 2R84A 2HK9A 2PRYA 3QVTA 4P8RA 1VI6A 3A2MA 3LGXA 5DHUA 5EP1A 3UCXA 3WLSA 1BYUA 2CL5A 1QGYA 4CUZA 1XCLA 1MZVA 1W5BA 1J8YF 3OT4A 1GLGA 2CFCA 2PLFA 4DLPA 1W48A 1T0PA 2OCKA 4JR0A 4BBJA 4EW1A 5C5CA 4YJFA 5BO5A 4UAGA 1MFPA 1QYIA 2B25A 2IDMA 1A98A 4KOAA 3WZLA 1ZMBA 2EQ5A 2IU3A 3D7NA 3IXMA 2Y0PA 3RUIA 3ZTWA 4EEZA 1LLQA 1RPNA 4C3UA 1INLA 4L0CA 4V0OA 4KR9A 3VU9B 4F92B 3QFSA 4UZFA 3UWOA 1E3WB 3QEJA 4LECA 3KSBC 1PYGA 5J1TB 2QMQA 2Z1NA 2NT3A 3SBOA 2XVXA 2HDHA 4XUEA 1YSCA 4ZGGA 2EZTA 2VDOB 4FFNA 5B2FA 4OQDA 1OGJA 4CM6A 1E7WA 4HGNA 1ABEA 4F9EA 2WTNA 4LHXA 1M6YA 2JGDB 3VKFA 1E1CB 1B6GA 3EVGA 1I01A 3IKMB 5J4KA 1C3OA 2AEMA 2X13A 3JAKA 4HXFB 3HY4A 3FY4A 1RPJA 4M9UA 4RDIA 5E95A 1HQYE 4B3FX 2F64A 4C89A 4C76A 2RE8A 4HDAA 3U4DA 2NP7A 3NCHA 3R24A 1SKBA 5D7NA 3VR3A 1BS2A 3OM8A 4MIOA 1HNZB 1JYSA 1N6IA 1Y5NA 2BMVA 4OM7A 3LUFA 1CS0B 1N77A 2GB4A 1S96A 3E4DA 2J3MA 4RK4A 1G19A 4EPWA 4IHJB 3EZNA 2HPHA 2PSSA 4BMOB 5ERYA 1QX3A 4RV4A 4WLFA 4WV3A 1NVXQ 5LYJF 2G1PA 1OYOA 4WNAB 1KR5A 1SC3A 2HCJB 1EZZA 2QWXA 3K09A 3K4QA 1OXMA 3ANYB 1OPRA 1UDAA 4L75A 3I8SA 1PT8A 3W5VA 3W2IA 2WQZA 4M2LA 3B1JA 1GTL1 2G9NA 5J58A 3AFHA 1JZQA 3B3QA 4BQEA 521PA 2ZXUA 1O57A 2FWAA 1HNNA 2HCFA 3ONWA 3PNQA 1ETHA 3VPDA 4WNIA 2EBHX 4RKFA 4LOHA 2V3VA 5J2UA 4YEDA 1UK7A 2QUBA 2ZBDA 4UVHA 3W5BA 2YZNA 3EMKA 1F3LA 2UYHA 1YT5A 2IELA 2YZ2A 1I36A 1GTJ1 4LJ7A 2CHFA 1N2HA 4B75A 4QU8A 1R8QA 1NPYA 3R0JA 1UT6A 3DZCA 3UA3A 1EBUA 1ICIA 3R3JA 1FOEB 2V6MA 4H77A 1YDWA 2CMFA 2IODA 2Q4DA 4V0MA 1YONA 2K4MA 2GNPA 3N8HA 4PLYA 3KFVA 1O89A 1HQKA 1M8FA 5T3YA 3ZY6A 4F3YA 5HKBA 2CXNA 3QTTA 1BKYA 3WL5A 2OBBA 3TZQA 3DBHA 2J3HA 1E6LA 4ENVA 4MKIA 2PRSA 4RIEA 3LL7A 4TS4A 1VCIA 2QDXA 2PY6A 4RXTA 3W79A 2WQ7A 3AVTA 1TADA 1JSXA 1QYCA 4EGFA 1OLOA 3K9QO 3REFA 5CHEA 4U9HS 3SBXA 1AURA 1IH8A 3ZGVA 4BKRA 4K9NA 4XRGA 1IHOA 1RM5A 3I04M 1K8QA 5KYGA 2WD7A 2WZBA 2P2CA 4NCBA 3KJEA 1A9YA 3O03A 3WYFA 1ENZA 2BRUA 3IRUA 1K08A 2AWNA 3R3YA 5IUKC 5AK4A 821PA 2DBVO 5ICEA 4G0WA 1U7ZA 3G3EA 1FFXA 3G7UA 1JPNA 4ZI3A 4MVJE 3ON5A 2CWDA 2RONA 2DQSA 3A6LA 2DFKB 3GVHA 4GLJA 3L7OA 2IKQA 2PZAA 3LOUA 4KQKA 4MCHA 4MS1B 2V55B 3K9CA 4MOWA 1LBQA 1RXYA 1OWMA 3VV3A 1YTLA 3C85A 3A1WA 2EZ9A 1H9BA 1S8FA 2IXGA 4ZO8A 2Q1UA 4Q15A 3B2QA 4YQZA 1CQXA 4RTJA 4GKKB 1P4SA 3B52X 5H02A 3PFKA 4KQ6A 1XTRA 3GJTA 1XZ8A 2YXLA 4TTRA 4A4DA 4REQB 1S2OA 3ZCUA 4FE7A 4R51A 1PR5A 2Q2VA 1NLYA 2FLKA 4LRWA 3AVWA 5JISA 1B23P 2QR5A 4RZUA 2HCRA 1T5SA 3CNQS 2PE5A 1FS4A 4QQKA 5FTMA 5FI3A 4UQLA 2IYAA 3T9EA 4GNRA 2A0WA 1XLVA 1C0KA 1X74A 2ZWOA 4AY3A 2DPMA 1QFZA 4G9GA 4BLUA 1M33A 1RLOA 5C35A 4H0NA 5L3VA 1EA5A 2QE6A 1XTQA 1FNCA 2W6JD 3ONVA 2OGWA 2AZTA 3BAFA 1ULZA 3N70A 3QYPA 3IPRA 4YJHB 3WYDA 4ZJUA 3BOSA 1ADCA 3BIOA 4E5VA 4Y6SA 4ZREA 2C5GA 2WWVD 1PNTA 3M6LA 5FPYA 1FDRA 1Y37A 2DHQA 1D4OA 1P9NA 3N39C 4HWPA 1WPXA 4LYJA 1OIVA 4RC9A 2ONYA 1Y8QA 3ZHRA 5KX5A 3RTDA 2DG2A 5AM1A 3ED1A 3UC5A 1DWOA 1TLLA 4FHDA 4PLVA 1UZUA 3ZH9B 3ZXSA 4PLGA 2AVNA 3IOCA 4RSMA 3FLMA 2CNDA 3NBYC 4R1SA 1E5XA 1RVDA 4IZOA 4IOJA 3KCQA 3IHTA 1P7YA 1ZD5A 4G0UA 1RR6A 3PNMA 4IOMA 2ZJ1A 1E2PA 1GTG1 4K26A 4PYKA 3LRTA 2GHTA 4E11A 2PXCA 2WTXA 3LKBA 3A6ZA 2O8FA 1RCTE 4X71A 3DWEX 3PQ6A 1FEZA 1X1QA 3RREA 4G0VA 2GUWA 2VQ3A 6PFKA 4RPGA 3ZE8A 3TJRA 2V65A 3FE2A 4ZQIA 1SCJA 4KQ2A 2VDMB 3E22A 3OJ0A 4RHFA 2D3TA 4TM7A 2RHMA 4INOA 3VO1A 1GAEO 5DBIA 1Z5NA 3HHEA 1MEOA 1W5SA 2YR0A 3KLBA 4YV1A 3ECAA 4B3TB 1UK6A 4PGAA 3WL3A 2AC2A 3A1EA 2UVQA 1AK9A 3UCEA 3EFHA 2O3RA 4R3WA 3AIIA 4UEKA 4Y9SA 5LLSA 4JI3B 1L5FA 1CJBA 4FFWA 3E7PA 5AHOA 4XOUA 3T8YA 2WKWA 1F0KA 3ETLA 3I23A 5FL7D 2AIRA 1LX6A 2W5UA 1FP6A 3IJ5A 3S2ZA 3TGWA 1MC1A 3H5OA 2DERA 4OQYA 1QUFA 5LQSA 4JT8A 4A6EA 5L53A 1XQYA 4EJ6A 1WL8A 4NU6A 5EVJA 4ZAYA 3WFJA 5K3DA 4O02B 4BZQA 5BWNA 4H4EA 2CE7A 3KPWA 2VN8A 1VLLA 3ONEA 3TSCA 4HZGA 1OUMA 2NGRA 2X5XA 2ZR9A 3WP1B 2Y0DA 1HORA 4JFAA 1CT9A 4HATA 2ZRLA 1P60A 3R6LA 1T9GR 1QPGA 3QF4B 4L6CA 1HTBA 4UFNA 2Y1GA 1DKOA 1R8SA 3ZH2A 3MMNA 4EA8A 3EXIB 2DH5A 2VSFA 2WJGA 2G5PA 1Q6ZA 4WOPA 2A33A 2BONA 4DLRA 5CLJA 1T6XA 3HJBA 2D0DA 3NWBA 3MLBA 5JYDA 4ARCA 2WJ6A 3ELWA 1ZHHA 1T1IA 2YY6A 1JHQA 1SCUA 1Y1KE 1YI1A 4MIEA 4YUYA 2CBXA 4BNNA 3AR4A 2IXDA 1W2GA 1CUZA 4FI3F 5DP1A 5EZ6B 4DC0A 3EOAI 2R9VA 1FFWA 1S2DA 4GVXA 3ROFA 5JAUA 3CRQA 3ZGYA 1NVWQ 1YK1A 4QGFA 5G0VA 1KARA 2Q5FA 3OHPA 5BSRA 1KDZA 1W1WA 4BO8A 3ENNA 2F2TA 3KVYA 3LX5A 5IT5A 4HWOA 5MDHA 1TFRA 4K3UA 5HA5A 3K9NA 2JK1A 1CIVA 4NFSA 4N18A 1AVTA 3N0TA 4RK1A 4UTZA 3UJHA 3KEOA 1Y1RA 2V0CA 5DBGA 4Z0NA 2J1LA 4QUBA 4OHXA 3LLVA 2ZRMA 4X44A 1KE2A 2FEXA 3GDGA 3VR5A 1E2NA 2BF7A 4AK9A 3CKKA 1WETA 2DPHA 3SIWA 4FFDA 3ECCA 3F5MA 4F2DA 2FWPA 1QU2A 4YTEA 5K9ZA 2ZWAA 2YVKA 3H5VA 4GS5A 4N7BA 1Z12A 4OP3A 1NY5A 1UEIA 3VR6A 4NXMB 5JCXA 3EF3A 4GLLA 3JYQA 1D8TA 2BAGA 3IHLA 3LL4A 4LNHA 1LFAA 1RWVA 1VTKA 3OECA 5FR1A 2QI9F 1HUQA 3BXOA 3ZV6A 4GYJA 3I2YX 2P4EA 2GFIA 3IQDB 3QKRB 4GX0A 1ODFA 2NLOA 1FJ2A 1GITA 2D7JA 4FOTA 4F5YA 1ID8A 5DGCA 3F98A 1SD2A 3SF8B 1XQ9A 1QAMA 1SXQA 2BGJA 2GK7A 3N9IA 2BHRA 5FCDA 5TT1A 2J7PD 2GJKA 2GPSA 2EEZA 2E37A 3QMWA 1EFVB 1FRQA 4GE3A 4XJXA 3WLRA 3FVVA 5I8ZA 4X20B 3EOZA 1M9NA 4MPTA 3MOSA 5BSTA 2PNJA 1TVMA 3BHNA 1WPQA 3U4GA 3ZHQA 1XXHE 1XL1A 1FA9A 1KXJA 2FRXA 3EWNA 4WXYB 4ZOAA 4ZZ3A 4IF4A 4LF4B 1Y6QA 2GZMA 5SICE 4PZ9A 5KTSA 1VKZA 2FH5B 3P20A 4AS1A 2C5BA 1RADA 2A35A 3IJEB 1X38A 3VU3A 2VP0A 1HZJA 3B48A 2LVBA 2WIDA 4BNIA 1H0SA 1JL3A 2P91A 4EQ6A 1SQ5A 1MIOB 1IMOA 5A02A 1VQ1A 1G0NA 3OFSA 4MQLA 2X42A 1KOFA 3TCKA 4FX5A 3TZLA 4LZZA 2EL9A 2PWAA 4ZCPA 3IBSA 5KYUA 3AC0A 3P71T 5DH9A 1D8AA 3G2JA 1YE8A 1YDEA 3FD8A 2H6EA 4L9SA 4GPZA 3ZHZA 1C7JA 3NHBA 3ZWVA 4TLLB 3GLIB 1V35A 1A96A 5EZ5A 1P19A 4M9XA 2Y8EA 4C0QC 4Z4FA 2QNIA 2AG8A 4ENRA 1YVRA 2V98A 1NWHA 1YJXA 3H0EA 1BIFA 4I50A 5CCBA 3HDVA 1X80A 1RYFA 2XUOA 4ZOCA 3AF3A 1I2MA 3FOAA 5HUJA 3KZ1E 3T94A 5GP1A 1WKBA 4WUVA 1KXZA 1MX1A 1ISGA 4TV9B 1Z6ZA 2HOQA 2XODA 3OEWA 3HGMA 3AR2A 4WZ6A 2VLIA 3HMKA 1CJVC 1FNSA 4IIDA 1H2EA 1SU4A 1WDKA 4HTFA 4P2GA 4RZSA 4FYXA 4UUQA 4D4HA 2HHJA 1SHJA 1T8WA 1FF9A 1U0HC 1ZM4A 3C5EA 3H9EO 5ERGB 3UCFA 1U7UA 5LOVB 5CA0F 1KAHA 2CBZA 4LJLA 2I1LA 5CBPA 1U4OA 1PO7A 3HP1A 3UTDA 2AN3A 3C7TA 2Y2VA 1OGIA 4CDNA 3MS2A 4K9QA 3ME5A 3B2EA 4YRDA 3WAGA 2J6HA 4ZVRA 3AG6A 4WK2B 5KHOC 1YQUA 2GF9A 4DABA 3I12A 1Q0SA 4C7JA 3WVNA 3P2MA 4WN3A 3BHMA 5DGDA 4ID9A 4KLRA 4DFDA 5F1KA 1WE2A 5BRAA 4I14A 5A62A 1FVFA 3Q41A 1AQLA 2FGKA 3ZW7A 2XUJA 1XZMA 1K0UA 3EW9A 4BB0A 1CUDA 2GBGA 4JBXA 5EJ6A 1OLUA 4EAAA 3NVMB 1CY1A 3LY8A 2QN2A 3N6VA 4UM5A 2NO9A 4FS8A 3HDYA 2LE0A 4OO3A 5DSZA 3RF7A 2QV7A 3NP7A 4P4NA 4D96A 1R15A 1Q0TA 2BEUA 1ATIA 1VIDA 1DZIA 2D0PB 3A1VA 4J7AA 4JODA 2YHAA 5CXSA 2X77A 2I2WA 3ACCA 3OLWA 4YIKA 5BURA 4FFPA 5KWIA 4FC7A 3WMEA 3HRHA 1TAHA 2MYNA 5J5AA 4YC7A 5KCMA 3E8MA 4YRAA 2DR3A 2P5UA 4D0GA 2WAOA 4G0OA 4G0MA 5JALA 5IK2D 3BMNB 1Z0DA 3L1KA 2FU5C 4YCAA 3RRNA 4B9EA 5IJ0B 4RAOA 4EW6A 1AUPA 3DL0A 3SHQA 2JLWA 3QV1A 5HKLA 1X9HA 3QU9A 1QO9A 5LBIA 5TVGA 5E3HA 4QLBA 1GZDA 4YXWA 1EVZA 3VBEA 9GPBA 3ENVA 4HB0A 1UBOS 3B3AA 5EZYF 2QQFA 1ADGA 3DAHA 3RV3A 4RDCA 3WBBA 4DCVA 5L4NA 5F3WB 2DE0X 2YXEA 4TN1A 4X97A 4AYWA 4ZICA 2EDAA 4NWIA 4WLUA 3QU7A 4BKMA 1NBMA 3MTDA 5JNRA 3MQ2A 3C6QA 3C5HA 2C61A 4BLSA 3AEQA 3M8KA 4U3JB 2PUCA 2RJ3A 4O2BA 4Z3DA 4MQFB 2YWGA 1MEJA 2FEOA 4AL4A 1QE0A 4EJ2A 3R3ZA 1UODA 3RRJA 3IELA 3W34A 2FX5A 5LXTA 2H4WA 2WWIA 2R6HA 1SHUX 2XTZA 1ZVVA 5C2JB 1EDDA 5CT9A 4ZCLA 2FFHA 2FRVA 1K27A 2Q6TA 2WU3A 5B2ZA 5EE1A 1MVNA 1N75A 1QLHA 1VKHA 2NZJA 1NVVR 1YFZA 1ZGCA 2YQ5A 3MJ4A 4K87A 4X7MA 2QRVA 4NMWA 3WB2A 2JJ2D 4E70A 3FBTA 4ZOLF 4OHZA 1X19A 2FG6C 1W4ZA 3KDPA 3VM6A 2HF7A 4HV4A 3DPIA 4ZYVA 3Q7TA 4MR7A 5ARDA 1RIFA 2Y9PB 3L7AA 2V3CC 3K1ZA 1JQDA 1KP3A 1FSZA 1Q0UA 1R5BA 4P0TA 1ST2A 1SOUA 3C3AA 4LTDA 3H8WA 3PCRB 4BYGA 1KS9A 2PUGA 3HXPA 1XTUA 5C52B 1UEXC 2P2GA 4X84A 1YH3A 5FBRB 1PZMA 1MJ5A 1GZ4A 3IAM1 1C4WA 1P9RA 4X1IA 5A03A 2R97A 1VECA 4TXHA 2FEKA 4TV9A 2ABWA 3CWCA 3W8NA 4H7FA 3S29A 4Z0PA 1YRLA 1Y5MA 1ZK1A 2P68A 2HRBA 1LH0A 3ERCA 5KVQA 4F6RB 4JP3A 4WGFA 5A2GA 2QRMA 3JQ8B 4MWDA 2AA3A 3UJ6A 1SURA 1W19A 2BKAA 1OXXK 1VHJA 4HLNA 3TD2A 3DONA 1P3JA 2WQ6A 1WB5A 3MAGA 2GWRA 2QN1A 4H0CA 1EZ4A 5DVZA 4D97A 3NYRA 2WRZA 3K20A 4XR4A 1NQOA 1X6VA 4R8SA 5JXJA 1RI4A 5ICMA 1XJWA 2H08A 3NM4A 4ZAVA 3DV0B 4MAAA 5I48A 1CF9A 3PNLA 4OHWA 3PT5A 2OV4A 4KXMA 3WA6A 1VG1A 1YAJA 4LC0A 1JXQA 2Q9BA 3P27A 4FXPA 4NYMQ 3TQFA 5HKOA 4CIDA 4KC0A 3KKPA 3RVJA 4UTVA 1A8SA 3LCJA 4CN8A 2B7LA 1JFSA 1DDIA 1XI2A 1C8LA 4C4XA 2R5WA 1SVNA 5T5QA 3HBNA 2FZCA 2V7QD 3OWOA 1C7QA 4EG0A 1EJBA 3E4CA 1E32A 1G5RA 1AIPA 1XDUA 1R3DA 1T36A 4TXNA 2FV8A 1E8DA 4CF6A 1E5TA 5L3QB 3UK1A 3FYUA 1F7VA 1R0CA 3IR6A 3V46A 1JFFB 2YXNA 4BV3A 3R5JA 4DDTA 1VI5A 3BX1A 3SE7A 5F7XA 1U2QA 4HFNA 4PIVA 3CV3A 1CNMA 2QXTA 3LI2A 1Z39A 2PUFA 3DDWA 3EH2A 2E9SA 1NNI1 2OCBA 3B51X 5FI1B 1R12A 5CX1B 2MWMA 3DT8A 3SX2A 1NR1A 1OVGA 1GHTA 1K8RA 2RHHA 4E2WA 5EJFA 5I51A 1EGVB 1ZINA 3SQNA 2INGX 4BFZA 1FYEA 4BU0A 2ZB4A 1L7AA 1MLDA 2QIOA 3B6JA 3BBLA 3KQVA 4GMDA 4IZIA 3U3RA 3HCRA 5ALQA 4EFKA 4MI3A 1VBNA 2IJGX 3ZE7A 1PLJA 2OFWA 2AZMA 3LW8A 3F71A 4EF6A 1QXSA 4KO2S 2NTJA 2FPWA 5MHTA 5I9LA 3GBPA 4FQ7A 1DRWA 3DDHA 5IXJA 1NC3A 1UFVA 1AF4A 4E4YA 3HGQA 4G09A 2PH7A 5AW5A 1OZHA 5IBRA 1P2FA 3MINA 2XJ9A 4JP8A 5DGXA 3S99A 4DC1A 1N2ZA 2DHRA 3H42B 2WPDA 4KWHA 1F8XA 1NT2A 1XVAA 2GTPA 5IM5A 3UY4A 3GPIA 3KHSA 5IC5A 3ZJ4A 4FS3A 4UTRA 1N4AA 3MTJA 3X1XA 3OEED 4KPGA 3R7BA 2E87A 1G59A 4LRXA 1QDUA 5EQTA 3GJ6A 3OJLA 5JG7A 4TTAA 3AEKA 1XKQA 1GAWA 5KX5B 1AKTA 1A5SB 3JALB 4Y2TA 1NKTA 3CKMA 2Q9CA 3FDJA 3L8YA 3K53A 4RSHA 4TLDA 3N76A 1ZG3A 1ZXXA 3V4PB 9ABPA 5JZMA 2J0QA 3VKUA 3PR3A 3EEFA 5JNWA 1E9BA 5B4VA 4IIJF 5THXA 4KNYA 3B1FA 3II6X 1FXWA 4JBYA 3ZDRA 3HO8A 1Q0LA 3WK8A 4NBNA 4KE6A 5I7OA 1IBKB 2ZXFA 3Q5DA 4IV8A 4E4TA 3BL8A 1J90A 3MJRA 1V16A 3F4LA 2PS3A 4WOJA 5JD3A 3WK7A 4LQ4A 5SY4A 4HNQA 2NO0A 4B8ZA 5BW4A 3SQWA 1JWBB 1YCHA 2RI6A 2Z9CA 3GEMA 3PEFA 3ZJVA 1QAOA 5KQGA 3L43A 4DREA 3B6EA 3FPSA 3R41A 3VU8A 2I0FA 4QG7A 3ZK8A 5JXHA 3KHTA 1HBJA 5JVDB 4B80A 5JQGA 4UMDA 5GOTA 3CO5A 1RYDA 4BWVA 2MR5A 4ARVA 1SUCA 3WLAA 3LO5A 4BFYA 1QR2A 2GF0A 4GPTA 1ZRHA 4BV9A 1K06A 1ZI6A 3EE6A 1Z5OA 3F4BA 1JHYA 5BN3B 3GP8A 1VBMA 3LBFA 4HO1X 4UDNA 3CNLA 2QLBA 1UZMA 2AXNA 4U4AA 3I28A 1HNXB 3F7TA 2CLEB 2P6NA 4GWLA 4I4NA 5DTQA 1O4VA 3W8FA 1SH7A 1QPZA 3VSEA 2BEWA 4O5OA 3GRYA 1H0HA 3PD1A 1KH3A 1N2EA 1W6RA 2Y4NA 3LT0A 5DW3A 2OPHA 2QTVB 2BZGA 3L49A 3ICVA 1II0A 1OJ7A 1JHDA 4GOND 2NZ8A 3GIWA 2W6CX 1BRMA 2ZJ7A 3JVIA 4LWQA 4XFJA 2IV3A 1USWA 3A3YA 3USZA 4U7FA 1RXSA 3VNSA 3HKEB 2V54A 1X7YA 4MYRA 3O0TA 3EDOA 3GK3A 2XE4A 1ZM2A 2VF2A 3DD5A 5CB8A 4NFHA 1TCBA 1CJTC 4I5EA 5E3IA 4JR1A 2RMKA 3A3KA 1F2VA 1OC4A 3HBLA 3P5BA 4L27A 2JIQA 2I54A 3IO3A 3UHOA 7AT1A 2Z2XA 2GEKA 3MFQA 4G5QA 4BJ6A 4D4MA 2YHIB 4A6XA 3DHVA 3N7AA 3TCNA 3V7FA 1XAIA 1A71A 4ZTBA 4NVRA 4IMIB 4EPVA 4QGAA 3LOPA 4CUJA 1CSEE 4XIIA 2FDXA 1UDBA 2FOXA 2NAFA 1D3AA 1QQ6A 3FBGA 1WBJB 2P78A 4GX1A 5EJGA 1BTOA 3SXPA 3T1NA 4C6TA 5JEEA 4LZPA 4WH0A 3EA0A 3S8EA 3H04A 4YY3B 2Q5CA 4N01A 1A4XA 1XRJA 4OBEA 4J0EA 4GOLD 5JAMA 1E64A 2JHGA 3F7NA 4GDFA 1DIHA 2Z0MA 5AICA 1KFBB 3D3WA 3VRHA 1CUGA 3QYFA 4JBIA 1BWPA 3OZGA 4DOMA 5IABA 3DG9A 1JR3D 4QHYA 3DJFA 5KAMA 4GI5A 1VDZA 3LPCA 5SYAA 3LUHA 3CO0S 4FKMA 9LDTA 2FSUA 1I4DD 1CR0A 1E6CA 2BR3A 2C3PA 3R5TA 2XCTB 3G49A 4G5HA 5DP2A 4D9MA 3MUNA 4X92A 1ISMA 3OU2A 1XROA 3L8CA 2C5EA 3P0JA 3EB9A 3GF4A 4G8DA 5ITVA 4PYOA 4URFA 3RBAA 3E03A 4PRYA 1T25A 1ISJA 2BJWA 5GM1A 3B9RA 3E18A 1ZNYA 1IY1A 3TZCA 1BJKA 1J21A 3H3JA 3ZX5A 1P7CA 1DQNA 3VMMA 1J7JA 3EG9B 4UUMA 1X70A 2YJGA 2XAUA 3GLTA 4KE8A 4XLZA 1NSYA 1YOBA 3LOQA 1L7RA 4BXOB 5F9MA 2XF8A 3R09A 3EGOA 3CISA 3ETEA 2BI8A 1H9CA 1N2OA 3X1YA 1RWPA 4IDHA 3WSTA 4OJNA 4X90A 4QPNA 3VJMA 5J5CA 4WEOA 3TI9A 5JQGB 5JVDA 3TECE 1UK8A 4GPIB 3K31A 5EFZA 3ICPA 1BH6A 3C1AA 3D5EA 4PSVA 3IP8A 3NU1A 3EGEA 2Q5HA 3C43A 4IDNA 5ALNA 3T7JA 4EYEA 4HRVA 4X7BA 3E48A 5K51A 2V7VA 1QK4A 4LISA 2PU7A 5BNFA 1U8XX 3WGHA 5BN3A 2FPXA 1U2ZA 3D9QX 3DF9A 4NU5A 4B2YA 2QKYA 5CRIA 2Q3FA 5CDHA 5LQDA 4UM9D 3O8QB 3PA6A 3ND9A 4MS4A 3OICA 3N05A 1EUCB 3Q7RA 3I45A 4WLEA 3RLIA 2SCUB 5FHRA 3JQPA 4Z8YA 2CYCA 5IMBA 4WACA 5TB5A 3NORA 5E7QA 3Q0TA 4K46A 5JCJA 4EARA 1L5YA 5BPFA 3PNVA 3HPQA 5FADA 1JFLA 4JHLA 3Q0EA 2UZAA 2X8LA 3QI7A 3FFXA 4FYJA 4BVFA 3C6BA 4MGEA 5KU7A 5A7GA 5IFKA 3KS9A 5CXXA 1XD8A 4NJEA 4K6FA 3IDQA 3O4VA 1KJQA 3TTSA 1K9SA 2FHPA 2H29A 2IF0A 2JJ1D 4RH0A 3HABA 2BFEB 1FYDA 4JEIA 1MRNA 3CZ9A 4RY8A 2UKDA 1VP3A 2ZT5A 5GZ6A 1S8AA 2X2FA 2YJNA 2BN4A 1GUBA 1Z4JA 3IT3A 3MLAA 2Q2WA 4MKHA 4EKDA 4JD5A 1DSSG 4C29A 4KQXA 3FW1A 4CM8A 4YRMA 1DHTA 2XNCA 1CQJA 3CLTC 3NI2A 4P38A 5D5QA 3TZ6A 2W9XA 3K0SA 3L93A 3W5CA 1H23A 3NB0A 1P31A 4FR2A 4GSLA 3IVCA 5FR2A 2FMTA 3LHFA 1FNNA 1P29A 3LVQE 1P0MA 4FP9A 4YJ3F 5F12A 3FWKA 5F5XA 3GRAA 5JWHA 4H16A 4V0SA 4BEVA 4ZALA 5J4YA 4DMUB 1YZHA 5C8XA 1T6BY 1UM9B 2C3MA 2DEUA 4C2BA 4MJXA 4PLTA 4BZXA 2IX3A 4RJJA 1UZNA 4Y30A 4CEHB 3E8SA 3NC1C 4IY1A 3E1SA 2F62A 1ECJA 3N2GA 2FF7A 4RD3A 1N1EA 5MFPA 3RC7A 4REMA 4JP5A 3OO0A 4ZU6X 4A3SA 4BZPA 2P27A 3J7AC 4ANFA 5IJAA 2OBLA 2PGAA 1TTTA 4B6GA 4BKUA 3R74A 4F97A 4RFVA 2V6IA 2HU7A 3H18A 4P1ZA 1A2OA 3NANA 4XM2A 1VHLA 5AW2A 1VIAA 3AUXA 3PHLA 4M6WA 5JFGA 1T1EA 1AG9A 5FP0A 1RXWA 2OXCA 1GILA 1GLNA 4Q3BA 1Z6GA 2Z8ZA 4QUDA 3ZIAD 4PHGA 4IUCS 3CT4A 2PD3A 3ZW9A 3ZGZA 1FDUA 4GP7A 3U3MA 5TC4A 3LC0A 1TKRA 1I1HA 2HA0A 3A28A 1EGAA 4K6CA 3V8EA 3RADC 4O2AB 5ICFA 2Q4TA 1CVLA 1X87A 3K6SA 3HTXA 3CVUA 1BXRA 1W30A 2QM0A 4WT7A 4E5YA 1HDRA 3QBEA 2GFHA 3QLUC 2PX2A 2XE8A 2PKQP 2Y1EA 3CH6A 3LZCA 1Z88A 4HQNA 5DV9A 3WIBA 1WG8A 1XVTA 4GU5A 1EFPA 1KI8A 1P72A 2BFDA 1F2UB 4H7JA 4I9FA 1WF3A 4ES6A 1N1GA 2I1WA 3X1DA 2RHDA 3IGFA 5K0CA 1BDMA 5A3JA 3BDVA 5HIIA 3I09A 4FZJA 5IUNC 4E94A 1CUAA 2GASA 3OCJA 3U4IA 4KP7A 3TTYA 5HBGA 4L4RA 1BHSA 1Y3BE 4MHSA 2PBZA 3USCS 4EI7A 4HVTA 5TMDA 2P6OA 2XUHA 5EMHA 3N2KB 4B17A 2HEGA 1DIOB 2HQ1A 4OB7A 4KPEC 5AVOA 4QEZA 4D42A 4HLUA 2G83A 4E09A 2JBAB 3L0CA 1OH8A 3C8ZA 1NURA 4JGGA 3TJMA 4EITA 1Q2UA 2QEQA 4UHDA 4WN9A 5CT4A 4CPDA 1YVDA 4MDHA 3A6FA 4B6QA 3IBGA 4HPXB 2B37A 2X6TA 3NVAA 1I51A 3UV6A 3VR3D 4J3FA 1FYXA 3IHWA 2XCOA 4IIXA 4LPSA 2B7CA 4RNDB 4XIYA 4EB0A 1QRRA 2A5YB 5JASA 2AEFA 5FA8A 1NQUA 2ZSAA 4KUEA 3OQ6A 4RTQA 4C2UA 1E1RA 4RK7A 2LWIA 4JDUA 1QZUA 1H4TA 4FR0A 3IDZA 1E0AA 4FYMA 2C03A 3L8EA 4C4YA 4PZAA 1V2GA 2ZIUB 3PF8A 3C15C 1PZHA 2YIMA 4B09A 4C0AC 4YAKA 1MUUA 2PCJA 5EJ9A 1RLUA 1O6ZA 1PJ2A 3N5CA 1Z5PA 3HXMA 2W37A 1AGYA 4CT0A 3GEEA 2OBMA 1K7YA 3FZYA 1FTQA 3RC9A 4RMHA 1BKDR 1Z16A 3Q11A 4KEAA 2EP5A 4NOLA 2H4XA 1YQEA 3MGAA 3MMSA 2NUTA 2C2WA 3O8BA 1MX3A 2CJWA 3UKJA 3DF7A 4CQMA 3PVSA 4RF5A 1THMA 5FORA 4NYMR 2VNSA 5HMLA 1XYYA 5C7OO 3RKSA 3IBCA 4MHOA 4JJKA 1MX5A 1HNWB 1QP7A 5FPSA 3I2HA 2HJ9A 3JVVA 3KSRA 3RS4A 2BFCB 5HP4A 3ZIDA 3H11B 1TJ3A 1M66A 2X8JB 4UTOA 4FOSA 3PICA 4BB6A 4WOCA 1QTIA 4BN0A 1PSWA 2JAHA 3JR7A 4QA9A 4BNFA 3D7KA 4MULA 1Q1ZA 3LUGA 3PNOA 5IC6A 4DUYB 2W90A 1OLSB 2AWOA 2EFDB 3EZ7A 1OCEA 1S8OA 3PIIA 2JFUA 4IH1A 2G80A 1R6UA 3WGZA 3W77A 5EJ2A 4BIMA 3KUUA 1U3WA 1JSZA 3NW9A 1YU9A 2R6FA 3DLTA 2WIFA 4RPKA 1C1XA 1FFHA 3O9VA 4KAJA 2W6IA 1MRSA 3N87A 2HPVA 2C9OA 2XZDA 3DO8A 2QVGA 4ZVVA 3FFTA 5HF8A 1DBIA 4QARA 3K96A 2WZCA 4J07A 4Q34A 3VO8A 1JDNA 5A5VA 1U0EA 1I3MA 3I5AA 5TMEA 4BLRA 1CDZA 5IHPA 1U28A 4UEJA 4TS9A 5KINB 1VLJA 2QZJA 2KM1A 4N0QA 2P3OA 2IF2A 1CUEA 1WMFA 4IJWA 4ICIA 5FV7A 5BV2P 2V1UA 1ZUNA 1A9RA 2I3DA 3JD1A 1NKVA 1E0KA 1EE2A 2AW3A 1PGJA 2OZLA 2FN7A 4PZLA 4D8UA 2HLNA 4CETA 5I7FA 2ANCA 4NFLA 4B7ZA 1MO3A 1KE1A 1XU7A 3JYPA 2Q5OA 1WF6A 1CP2A 3VGPA 3T4PA 4E5NA 3HA2A 4EA9A 2P9HA 3OKCA 5FYDA 2BGLA 3CNOA 1H8ED 1NN3A 4UUNA 2WHPB 1SU7A 3PC8C 4X63A 5H3LA 3R7AA 3AF1A 4D41A 2A5LA 5DI3A 3GJ8A 4FKZA 4M98A 4YCJA 4J2OA 3L82B 1ACMA 2O8EA 5AVUA 1C3VA 1M6VB 1M1UA 2OK8A 3DDOA 3EDQA 5TEWA 2Q50A 4RKYA 1G7SA 5J4HA 1P9OA 1RWOA 2DWCA 3WYAA 1L7NA 3JALA 4MRPA 3DVAA 3DXFA 1NXXA 2ZJ6A 3PFBA 3TKYA 1IDOA 3TIGA 1J0BA 5EJ5A 3HXLA 1VLMA 3UAWA 2DXIA 2D3WA 4B3CA 2BBSA 5AR1A 2EJVA 3TTXA 2YX1A 4YRSA 2H4ZA 3Q7QA 2DBQA 5TVKA 4EPTA 1FFCA 4EAQA 3G2OA 2D13A 2WJVA 5IT0A 4BC0A 1RYHA 5IAAA 4XYLA 3SS9X 3LUKA 4M1QA 4UXHA 3WRXA 1ONSA 3PGA1 1M2VA 1PVOA 3QVLA 3CBGA 3G9QA 5B4TA 2AOXA 2O2JA 1CJMA 1NONA 4X3OA 4BJ1A 3PQEA 1LQUA 4RBNA 5H68A 2W6MA 3DCJA 4DC9A 3FNQA 5JXIA 3OUTA 4ZRNA 3X1MA 3M6AA 1ZMTA 3HVUA 3ZVKA 2L69A 4F60A 3LCVB 4HR7A 1RDFA 5KB3A 2PSJA 1K63A 4C6SA 3AJ9A 3O1LA 1W5TA 1SWWA 1W4RA 1MO6A 2JZCA 3O90A 2A14A 1TEZA 1YBAA 1FYFA 2Q28A 5LNK1 3L6OO 1QO0D 1T0UA 1R6DA 4F6RA 1VLQA 4ZMSA 3UC9A 2A5GA 5BR8B 4OX9B 4U0JA 1PL7A 2B9VA 5BSFA 1UBGA 1AC5A 2ZIEA 3C3CA 4BLQA 1H6DA 2P5SA 3FVTA 3KXPA 1QB8A 2Z83A 2R751 3DJYA 4HAUA 1UBCA 1XTBA 2G7ZA 4WXHA 4AJJA 3ZBUA 4N41A 1VKOA 2ZYWX 4M8IA 2HMYB 2IOQA 3L4JA 1HYGA 2AL7A 4X9XA 3OX2A 2IYFA 2C5SA 3UMJA 5FX2A 3BFKA 5KHLB 2BGGA 2ACWA 4QXMA 1MTZA 5BV1A 1PV2A 4DV7B 1E66A 2VP2A 2ZIZA 3HJCA 3R5HA 1IJKA 1G5PA 1FYVA 5EHGA 3WL8A 5KMGB 2DFVA 3JS5A 5JSKA 1ND5A 2XOKD 4E6EA 5JZ9A 1DV1A 3DCNA 1PSDA 4YMLA 2W2LD 4QU0A 3VZRA 3IX7A 2NYUA 4Z0TA 5TY0A 5CMLA 2F1OA 2ZROA 3V1TC 4JROA 3R7NA 1XJ5A 3B1YA 3W5AA 1M2KA 2X41A 3B89A 4LJ4A 4UU1A 5CFZA 1IYZA 3LMKA 5K4AA 3IIEA 2QPOA 5G2OA 4FIZA 4GECA 4F46A 3L6BA 5BN5B 5JYEA 1GNTA 1RJ9A 1XN1A 2I3BA 3NONA 1A50B 2AR7A 4II2A 5DF1A 4YQYA 1EVEA 1A82A 1H6CA 3TTVA 1TXGA 2YJ3A 4HSGA 2H2IA 3UM9A 3FTEA 1TZKA 5HCIA 4MQEA 4DIDA 1EK5A 3D3WB 4PSKA 1W88B 4FMCF 1ST3A 2R6AA 4EGCB 2EFCB 5EGNA 1Z0IA 3A7EA 2XF2A 3U7QA 5CEEA 3W1WA 1L8QA 3JQAD 3ZW8A 4CLEA 4X1YB 1O96A 4BMZA 1SQFA 3UMGA 4D9HA 1DGQA 4W5WA 1O97C 2B5VA 2XZPA 2F1JA 2OG1A 4O2AF 2WAYA 5E6SA 2NXJA 1CC1S 1M8PA 3UICA 2B4TO 3SMQA 1JDUA 2CXXA 2ZIXA 3S27A 2PUVA 5LC1A 4UOEA 1EFAA 4BVBA 5JSFA 4MWGA 3PJRA 2EATA 4KYVA 4XYMA 5CLQA 2CV1A 4KPUA 4RE6A 4TL7A 1G5QA 1VLHA 1U7XA 4OQQA 2AMVA 1S7CA 2CLFB 2XUZA 1DO0A 1XZLA 1E4EB 3OJXA 3IALA 1SCAA 5DNUA 2IXFA 2MSEB 1HDXA 1UIRA 5FULA 4QTXA 3ANTA 4L4ZA 4AUKA 2H59A 3SFZA 1OH5A 1YZQA 3PIRA 1QIGA 4XGKA 5T4HA 1M1YA 4V2UA 3AINA 4L8WB 3R7WA 3IAFA 5KBYA 4DBLE 4OL9A 2IS4A 4A2QA 3RO7A 3I9NA 2ZUSA 3LX6A 2W2LA 2VJLA 1DLJA 1N7IA 1FDIA 2XOEA 1HE8B 2WT4A 2XD9A 5CH5A 1L4BA 4RLHA 4FGWA 1X0VA 3FWPA 4NY1A 4LDNA 4TWBA 2LUOA 4O4IF 1JXAA 3NHSA 4R8LA 4LMAA 3H5NA 2CLIB 4B6EA 2H18A 2VJNA 3J7TA 5A3RA 4YIHA 1NMXA 1T35A 2QD2A 1EGHA 4YH1A 3CG4A 2M6LA 3WKEA 3PXXA 2FSPA 2ZUUA 3NBMA 2ZUTA 2FUNB 4IS3A 2C99A 4ND8B 4ZC8A 5K20A 2C84A 1VJDA 3FSJX 1RABA 4EHLA 3GZNA 2UU9B 1C7RA 3WLQA 3MJSA 3DE3X 4EO7A 2G67A 4XVUA 1CRPA 1W9MA 4RO0A 3A6EA 4EYQA 4X8OA 5KPDA 3QF7A 1N0UA 3A04A 2G9VA 4PHHA 3SC3A 3IUPA 3N2EA 1CUSA 2B36A 2VJOA 2ODBA 3WAJA 2YWXA 4KOEC 3EPRA 6ABPA 2BTQB 1OWNA 3EULA 3OCUA 4AKSA 2Q7XA 1X8KA 3ZWQA 2VAWA 3MZ0A 1LRKA 3K2BA 3FI0A 1M6NA 3GEIA 1HRDA 1N7HA 3BN3A 4Y2SA 5F33A 5AK5A 1JDPA 1NBME 2ZYRA 3RFTA 3HCDA 2FW9A 2G76A 3FJOA 3V6LA 2OBNA 3TZBA 1TFUA 1X7YB 3CGGA 3D6UA 4RGQA 3MWDB 5KJ1A 1LJ8A 1C14A 1PEYA 1P61B 1FDSA 1KEPA 4K03A 4Y0NA 2CC2A 5ESDA 2P6PA 2IRWA 2UUBB 2HZ7A 3PC4A 1E5DA 1D5WA 4GOJA 1Z6XA 2HC9A 4KNVA 2P75A 4FE3A 3WNQA 5JFOA 3G0BA 3G1WA 4NU0A 1ZD4A 2IXEA 2YHIA 2G0TA 2AI1A 3RI3A 2QSJA 3L02A 1EP3B 1O6CA 2AMYA 4GRAA 3DNMA