2AOUA

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
total genus 102
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouA00
3CJQA 4CWAA 4QDJA 4E33A 3HM2A 3UJCA 4GOMD 3MTEA 3KQMA 3A25A 3B3FA 3NMUF 2AS0A 4X61A 4GEKA 4GQBA 3EVDA 3OE4A 3DXXA 4QTTB 3A7EA 2P3QA 5EKXA 4PYJA 1F38A 3DXZA 3FYDA 1NBHA 4RTLA 5ICGA 2NXJA 3KR1A 1XJ5A 4V0RA 5B1SA 1P1BA 4BLUA 4FSDA 5HIJA 1YZHA 2PX2A 4ISCA 2IBTA 2JH8A 4DCGA 2I62A 4IWNA 4PYQA 1KXZA 4AZVA 4C08A 2HMYB 1HMYA 2AN3A 3BWYA 3HVJA 5EMLA 1VLMA 3FUWA 2DULA 1VP9A 2EX4A 2K4MA 1TW3A 1KPGA 1VQ1A 2P40A 3MQ2A 4PONA 3SMQA 3TPZA 2C7PA 1QAQA 4IKPA 5KS2A 4GUAA 5LQAA 4GC9A 2DPMA 2ZTHA 3TM5A 4QPNA 4RVGA 5E1BA 3ORHA 3NDJA 5C1IA 2GA9A 1NW7A 3A27A 1FP2A 2ZIFA 2ZIGA 2PT9A 3DLIA 5HIMA 3TM4A 3THSA 2ORED 2JH9A 3V8VA 5K0NA 4E2XA 2PLWA 3GRZA 5K0EA 3M4XA 1NV9A 2BR5A 5DSTA 3FTFA 4E30A 5K0BA 1P91A 3HA7A 5FA8A 5EEGA 4U7PB 3ANXA 1FBNA 2G70A 4PYIA 2CWWA 3JWGA 3REOA 4ATNA 3WSTA 4YV1A 3ELYA 1UIRA 2BM9A 3HCEA 5KYGA 5DM0A 5FQOA 4PGHA 3I5UA 3GRVA 5EPEA 3X0DA 1JQEA 1AQIA 1SUSA 2JHCA 3EVCA 1NT2A 3FPHA 5T6BA 1L3BA 2B2CA 2YXLA 3QOXA 4O29A 3P9CA 5GWXA 5LQNA 4DKJA 3B3GA 3C3PA 2IPXA 1ORHA 3KQPA 4BLVA 3AWIA 5DTQA 3G5LA 5K03A 1XDUA 4CTJA 3UFBA 4P7GA 3LL7A 5KQSA 2ZWAA 3C0KA 2CMHA 4RVHA 4PIMA 2GLUA 4CKBA 1NW5A 2JG3A 5DPMA 1KYWA 2ESRA 5EHIA 4BP3A 2FRXA 2ZZKA 5FHRA 3AY0A 4FS8A 4HRAA 4OA8A 1N7JA 2FK7A 1R00A 3R24A 2ZZMA 2QY6A 3C6KA 4ER0A 1MJFA 3FRHA 3KPUA 3TKAA 3G8AA 1XCJA 4PCLA 1L1EA 3KR9A 2YXEA 5E1OA 2O0LA 7MHTA 3RIEA 1KR5A 3UJ7A 1V39A 2ZIEA 1L9KA 1XTPA 3LPMA 3I58A 3LBFA 2PX4A 3TFWA 2P3OA 3CVOA 2NXNA 1RI3A 2YQZA 3EVGA 2CMGA 4R05A 4E2WA 1IM8A 3HEMA 3BGIA 4GOND 5DXAA 2QRVB 5GIPE 2IH2A 3ER8A 1RJDA 2G8NA 1G8AA 3UJ9A 2OPBA 4LECA 3ER9A 3BWMA 3Q7EA 4CKEA 2C7QA 1DCTA 2ONZA 3B5IA 4RWZA 3MGGA 1WXWA 5EQJB 4YMHA 3PLAE 5GP1A 1KP9A 1UWVA 5K01A 4BY9E 1DUSA 5LQRA 1KYZA 2VDUE 1YF3A 3FUTA 2FCAA 3LSTA 2I9KA 1IXKA 3K6RA 1TPYA 4BP1A 2ZBPA 1QAMA 2XVMA 5KQRA 1DL5A 4RTRA 5FHQA 3PX3A 3CKKA 3GJYA 3BZBA 4IV8A 1JG2A 1NKVA 1WXXA 4KDRA 1YZ3A 2P41A 3CJTA 5K0CA 4X1OA 4WVLA 3T7RA 5DWQA 4OQDA 4AZWA 5CVVA 1SQFA 2VZ9A 3EEOA 3ID6C 1G60A 2NNWB 5U4XA 4E2YA 1O9GA 3FUVA 3KR0A 3PS9A 1L3IA 2PVCA 2OXTA 4C07A 1JSXA 3G2MA 4U7TB 5BW4A 5K09A 3LX6A 4PCAA 1VIDA 1Z3CA 1XCLA 4C05A 3SSNA 5JUWA 3BWCA 2VP3A 2H1RA 2LD4A 3CCFA 3ME5A 1O54A 5BXYA 4DM3A 2AOXA 4Y2HA 5EEHA 5DX0A 1WY7A 4ER5A 4RTMA 3B3JA 2ZULA 3MB5A 2PV0A 1L3CA 3FUUA 2JJQA 3MCZA 1NV8A 3HCFA 5F2NA 3LECA 5HEKA 3DMFA 4GOOD 2P35A 4H0NA 1D2GA 2ZWVA 2V74B 5C9ZA 4M38A 2G71A 3OFJA 1ZQ9A 5BW5A 1OR8A 1ORIA 3L8DA 3GCZA 1NW8A 1EJ0A 1SVUA 5IH3A 2P3LA 4QDKA 5E2AA 3EVAA 2PY6A 4G56A 5CD1A 3K0BA 1BKYA 2WK1A 3DP7A 2YXDA 4XUDA 2JHAA 2OYRA 3HCCA 1YFJA 5DX8A 1QAOA 5EKUA 3GO4A 1U2ZA 3EGEA 3RODA 2JHPA 3GWZA 2ZBRA 3DR5A 3SM3A 3HVKA 5EZQA 4CXMA 5K05A 2Z6AA 2QRVA 2OKCA 2EJTA 3HCDA 2H11A 5BP7A 2NXCA 2VS1A 1X1AA 3JWIA 3SVZA 3IHTA 3M6VA 4RVFA 2BR3A 2EJUA 1X1BA 3KKZA 4X63A 1QYRA 3FTCA 4CKCA 1RI5A 2H00A 1M6YA 4KDCA 3NDIA 2Z6QA 2AVNA 4QQNA 4DQ0A 4A6DA 5E8JA 5F2OA 3E23A 3PB3A 4YUZA 4P58A 4HSGA 3KPVA 4QVGA 3BXOA 3G88A 3GIWA 5FTWA 1JSZA 3UJ6A 3MTIA 4RVDA 4FT4A 5C0OE 3JWHA 3D2LA 2FK8A 1X1DA 3OZSA 2IDKA 3HP7A 2AOVA 3LCVB 1VP3A 1QZZA 3R6TA 5CVJA 4ER7A 2ZCJA 2OO3A 3NW9A 4X60A 4A6EA 4BLWA 4NECA 5DX1A 4HG2A 5EMMA 1EAMA 3M33A 2CL5A 3I53A 5CCBA 5LQJA 2Q41A 4OBWA 2IBSA 3I9FA 3C3YA 8MHTA 1FPQA 3THRA 2F8LA 3IEIA 4P7FA 3G7UA 3O31A 5CVDA 2QE6A 2GAFA 4OQEA 2ZBQA 5D1HA 2YVLA 5EGSA 2I6GA 3TQSA 5HZMA 3FPFA 1PRYA 2HR1A 2VDWA 5CUQA 2B9EA 5EZSA 1SQGA 3LBYA 3M70A 5CVEA 2YX1A 3UA3A 5DM2A 2IH4A 3HA5A 2P1DA 4FT2A 3FPJA 2OB2A 3KQWA 4JXJA 2Z6UA 3EMDA 3LDFA 4Z2YA 2PWYA 3FZGA 5DSXA 4K6MA 5EVJA 3SR4A 2Y1XA 3CBGA 2OY0A 5K8VA 3DULA 3B89A 3TKYA 4KW7A 1P1CA 4QPPA 3UJDA 3NWEA 2O07A 3EVFA 5H02A 4PYKA 4DF3A 1I4WA 2B25A 3BGDA 2YR0A 3P2IA 2NP6A 4M36A 2EFJA 2PSSA 3E8SA 1YB2A 3FRIA 4PYNA 4EK9A 2B3TA 1XVAA 2NYUA 3O4FA 2A14A 3OU2A 4GF5A 1X19A 3DTNA 4EMSA 4RTOA 3ELWA 1EJ6A 2PKWA 2WA1A 3BUSA 1WS6A 4M37A 5E9JA 5P8WA 2C7OA 3NVKI 1D2HA 1ZHFA 4EQZA 1JTFA 3LDUA 5CVUA 4RYLA 1MHTA 1ZGJA 3HA3A 3U81A 1R74A 3GNLA 1G6Q1 3OCJA 1B42A 5E1DA 3EVBA 4OA5A 2ZSUA 3KQVA 5ICEA 5GIOE 3HCAA 1RI2A 4YMGA 3P97A 3V97A 1JR4A 2FPOA 2HWKA 2IH5A 4PWYA 3G2QA 2KW5A 4MHTA 1XXLA 4DMGA 3ERCA 2YTZA 4HGZA 4YV2A 5G02A 2AN5A 3JWJA 3P9IA 4PYOA 4C06A 3PVCA 2PX8A 3A4TA 4DCMA 2CKDA 2O05A 3LCUA 1D2CA 5EIWA 4FSXA 2XYVA 3TMAA 5IKMA 5DXJA 3KR2A 1JQ3A 5K0JA 1YFLA 1AQJA 5ERGB 5E9WA 2IGTA 2UZ4A 3TLJA 5HILA 1RI1A 1SUIA 4RTQA 5FWDA 2GS9A 2ZW9A 3LCCA 3R9XB 4MTLA 4HTFA 5LQKA 2PXCA 3C6MA 3E7PA 2XYRA 2HNKA 4MQ4A 4PINA 3DMGA 2FHPA 3DXYA 3MERA 3BWBA 3R0QA 3G8BA 5E2BA 3O7WA 5T67A 3UJBA 4GC5A 1Y8CA 3GU3A 4DA4A 5DT2A 5HIIA 3SXJA 3HVIA 3MAGA 4E70A 5FUBA 3FUXA 5F2KA 3KQYA 4OBXA 3DMHA 4GBED 2PBFA 3LKDA 4KWCA 2OBFA 3T7SA 2PXAA 3KPWA 3OZRA 3DOUA 2N47A 2AVDA 3ELDA 2UYQA 4C03A 5GINE 1JQDA 4M7RA 4R8SA 4XUEA 4IV0A 4B17A 5LQCA 3PFHA 3RW9A 2PXXA 3PX2A 2G1PA 2PJDA 2IP2A 4QVKA 1G8SA 4MIKA 5EG5A 5GM2A 1I1NA 3SSMA 3VC1A 3BT7A 1JG4A 3HNRA 3KU1A 5FA5A 2BH2A 4C04A 4YUXA 4F86A 1QANA 3VC2A 4KRGA 1N2XA 3UZUA 2BM8A 3NVMB 3P71T 3F4KA 1H1DA 1NE2A 3T0IA 4X41A 1SG9A 3PTAA 3TOSA 3GRYA 5DTMA 3VSEA 3BGVA 3FPGA 1Q0TA 3GGDA 4FZVA 4AUKA 4F84A 3HCBA 2ADMA 4QTUB 3NTVA 5DRYA 5GM1A 1R18A 1R8YA 1NBIA 2GH1A 5FWAA 5HOQA 2BZGA 1M6EX 2P7HA 5MHTA 2ZZNA 2IDJA 4E31A 2P8JA 1ZG3A 4HH4A 1EIZA 5FQNA 2V7EA 5CIYA 2YUIA 2GB4A 3OPNA 5D1NA 4RTNA 3KQTA 2ZLBA 4AX8A 3EGIA 4P7JA 3BKWA 1TW2A 1EG2A 1NW6A 3KPYA 1XDZA 3NJRA 5DTRA 2XVAA 3EMBA 5ICFA 3KPJA 1T43A 4PIPA 4E2ZA 2XBMA 3EGVA 1VE3A 3UWPA 5K0GA 3IV6A 4LWOA 3TRKA 2AOUA 3DUWA 4HC4A 5EIFA 5DM4A 3LGAA 5T64A 2HTEA 2PWPA 3P8ZA 1VL5A 3H2BA 3QOWA 3MHTA 3OFKA 4HTFB 4L7VA 3PFGA 2ERCA 3SX0A 2IIPA 1YUBA 3FTDA 5KVAA 4PYMA 2O06A 3LHDA 3SGLA 5FCDA 1ZGAA 5EMKA 3KQOA 4AZTA 1KHHA 3CC8A 4XUCA 1RI4A 1KPHA 2Y1WA 3KHKA 1AF7A 3PT9A 5EHGA 3OZTA 1VBFA 1JTEA 3EVEA 4KIGA 4KVZA 4ZTBA 1VPTA 5LSAA 3G5TA 4XCXA 1Q0SA 2R6ZA 3AXSA 4RV9A 4LG1A 1UFKA 2HV9A 3DLCA 2AOUB 3LDGA 2NXEA 2NP7A 1WZNA 1R6AA 4RSRA 1X1CA 3HVHA 2AZTA 2UYOA 4RTKA 2PGXA 3CGGA 1BOOA 2O57A 2ZFUA 3P2KA 4FGZA 5DM1A 4MWZA 3SSOA 1IY9A 2XYQA 3BKXA 4LWPA 4AZSA 1JG3A 2AN4A 2UYHA 3HTXA 3EEYA 3A7DA 3NWBA 2VDVE 3EVZA 3GXOA 5K0FA 1M0EA 1RJEA 3UJAA 4ER6A 4HGYA 3A26A 4RX1A 4OX9Y 2PX5A 3KQSA 3G2OA 1FJXA 1ZKDA 2QM3A 4YV0A 1RJFA 2C7RA 2FYTA 2BR4A 1HNNA 4FP9A 4FR0A 1EQAA 1G55A 5EC8A 2I7CA 3UA4A 4C4AA 2AOWA 2UYCA 4DZRA 3FYCA 1SKMA 10MHA 1I9GA 2AR0A 3OE5A 2EG5A 4QQKA 4Y30A 1N7IA 1INLA 2WA2A 4EKGA 4YUWA 3ELUA 5E8RA 3AJDA 1NW3A 3FPEA 5E1MA 2IFTA 1JG1A 4PYLA 4EKIA 3P9NA 1KPIA 4E32A 4POOA 4PGGA 5CCXA 3P9KA 3G89A 4F85A 2OB1A 5FADA 1R8XA 4PNEA 4ER3A 3I64A 9MHTA 4V0QA 4EVIA 3M6UA 3M6WA 1BHJA 1PJZA 3E05A 3OU6A 1KIAA 5HIKA 1O9HA 1G38A 3GRRA 3M6XA 2OZVA 3MCTA 3UBTA 2ONYA 4YUVA 4UOEA 4P7KA 3UJ8A 5EOVA 3DH0A 2ZVJA 3R3HA 3P2EA 2E5WA 4R6WA 3VYWA 4KIFA 5LR6A 1FP1D 3LKZA 5M5BA 5FULA 5DRTA 2P7IA 3CJRA 3OU7A 3IYLW 5E9QA 5ICCA 1WG8A 4R6XA 2AOTA 3TR6A 2PT6A 1AV6A 3Q87B 1RJGA 5HFJA 3B7PA 3QV2A 3G2PA 1F3LA 4WXHA 3AXTA 3S68A 4RTJA 4YUYA 2B78A 2R3SA 5CM2Z 5EMJA 4GOLD 5K0LA 5LQUA 5GOZA 5DLYA 1P39A 4R8RA 2GPYA 4RTPA 5JR3A 3T7TA 1BC5A 2QYOA 3GRUA 3KQQA 4CTKA 3EPPA 4RTSA 2G72A 1XDSA 3GDHA 3FTEA 2AOTB
chains in the Genus database with same CATH superfamily
3ZU6A 2PKRA 2JJ1D 4PTLA 3KQMA 4LFCB 2R1VA 2VHXA 4G86A 4X61A 3HUTA 2H8GA 2PN1A 4MGEA 1N6NA 1WXEA 1KEUA 5EVCA 1FQKA 3FYDA 5FIUA 4JLWA 4B6SA 1Z36A 5C34B 2WLTA 3C5HA 1E6MA 3SXPA 3ZY6A 4BMXA 4RELA 2BWJA 1XJ5A 3HEBA 4V0RA 1O8CA 1NWHA 1UBGA 3WP1B 1FDVA 4ZJZA 3P9XA 5KJ1A 4CV0A 1XZEA 5KYWA 1JW9B 1OGIA 3U60B 2R85A 3B7WA 2BEVB 2FGJA 4X8HA 3ZE0B 3TLGA 3K8ZA 1NP6A 3WLEA 4AZVA 2ZYWX 2OBLA 2ZRBA 2ZRNA 3ONDA 1H65A 3PI7A 4V38A 4XVRA 5B1HA 3Q3GE 3FPBA 4JQZA 1J5XA 2JIQA 4DDUA 3ESQA 3U1BA 3NRCA 2VRCA 2K4MA 1KQPA 5JIBA 3LXMA 4JNKA 4YQYA 3TPZA 1MENA 2CF5A 1U7UA 1ZGCA 1QAQA 2W2QA 1XUOA 3DL0A 3GJRA 1YRWA 4GT1A 4NAUA 4MWGA 4UUPA 3QXCA 3SHOA 1D1SA 4EA6A 3OLVA 1GR0A 4HB4A 5DE3A 3QYAA 2RHWA 1BVHA 1LPNA 1N1MA 3RU3A 1L4UA 4PHGA 3KK0A 5JG7A 4EFLA 1KDRA 3GP3A 3HGQA 2QTVB 4TS1A 4E2XA 5BN4A 4X65B 1DELA 2J6BA 1QS0B 3ZU4A 2WTMA 1NUSA 4HQRA 2PJZA 2QNRA 1TM7E 3B3AA 3OZIA 2E2WA 3RB8A 2BTEA 4WKNA 2B2NA 3O95A 2G70A 1M83A 1NUUA 2XUPA 4WEQA 3NS7A 3PPXA 4X1IA 3RK4A 3AUYA 3GW8A 3WJAA 3ELYA 2GEKA 3MZ0A 2BM9A 1BGWA 2GHIA 1R0WA 3OWOA 4TKUA 4JP3A 4G23A 2C04A 3PQ5A 1XYYA 2PZEA 3F5MA 1ENZA 4BFXA 3D3KA 4NDAA 3QOXA 4NLLA 1XPRA 3NP7A 5BPHA 2QV7A 4X3CA 5KTYA 3KQPA 5UKDA 1U9YA 1GGFA 1UZMA 3V8BA 3R6LA 1N78A 1O94C 4QYIB 4ENUA 5MFZA 1Z17A 1J0AA 4PIMA 3D3NA 4ZARA 2JG3A 2YCLA 2ECPA 2FKAA 4JUAA 1UP6A 3C3DA 1A8IA 1QRAA 4HRAA 5J63A 5JLAA 3EB9A 2AEJA 4OA8A 1QF9A 3S29A 4D45A 1VYHA 1Z6XA 5FNVA 2C2ZA 4XQ9A 1LJ8A 1POXA 3B1ZA 4CETA 4Z2AA 1I7PA 1NP7A 3GEDA 3AL2A 2CUNA 1IRIA 4IHJB 4IZOA 5I9TA 1XMPA 3MN1A 1JHVA 1V39A 1ST3A 4X66B 4R16A 2NVUB 4D25A 2H4FA 1W4ZA 4L02A 4CFSA 3QK7A 2WAYA 5D3MB 1X9HA 2E1PA 2V7GA 2CCKA 1R37A 1TAGA 1ANKA 2QRVB 3KZCA 4J94A 1ILWA 1RJDA 3F5FA 2H3HA 3PQEA 4TLDA 2D1SA 5TMBA 2O8FA 3SYRA 1E2UA 4NDNE 4KQKA 5JEDA 4COKA 3EPHA 4QPZA 1LX6A 4IUCS 2GPBA 1WCV1 3FVRA 4YDSA 3VISA 2C3UA 2OLEA 1MTOA 3D6NB 3HS3A 2DWQA 5FL7A 5GJCA 5GVSA 1CU1A 2ODAA 4O2BF 5D3QA 3VXKA 4IXWA 3WLRA 3X1KA 1M75A 1CEXA 3GLHE 2JHFA 3SNHA 2GHQA 2JJMA 3DHNA 4HLUA 4DG5A 4QRDA 3WC4A 2Q8PA 1JR2A 2J4DA 3FKQA 3KDPA 3R40A 4H2DA 4HVAA 4ZO8A 5B1IA 5L4LA 2YZ7A 2P41A 4HQOA 2VSFA 4Y6GB 4ZCSA 4YHHB 2ID8A 4EY4A 2DUMA 2QRHA 4E5UA 4E2YA 1X6VA 1PWXA 3AHHA 3PS9A 1V6SA 2C5EA 2CLIB 4B3MB 3JQ8B 5KUTA 1U3UA 1GYRA 4AUNA 6ABPA 3RAFC 3D0RA 2C03A 1E63A 2XD9A 4FGSA 5HE8A 1Y6JA 4BFYA 2FW9A 1IM2A 1PI3A 1UOPA 3CCFA 4Y9RA 1X7ZA 1MQ9A 4RUKA 3WYEA 3IAXA 1ZL2A 2GEVA 1DUIA 3EG9B 3RDPA 4DM3A 4R54A 4ER5A 6GPBA 1HLDA 2DG2A 3BL5A 3CEJA 3FUUA 3R7LA 4ARIA 1ECPA 3TRIA 1VCIA 4Z7NB 1GM5A 1OE0A 4RH1A 1LY1A 4EHAA 5KVSA 3ADKA 3CW8X 1SAYA 1UDRA 3C4JA 2EEZA 4MS4B 5I7AA 4MVJM 3BDIA 4EJFA 1XJQA 1BCRA 2P3LA 4IMPA 2R47A 3ENZA 1KI6A 4R31A 4KAJA 2OYRA 4US1R 2OC9A 1ZGZA 2R6GA 5EKUA 1HKUA 4R9RA 3BH7A 4MR8A 1X9GA 4Y9DA 1TK2A 4MPPA 1W48A 4JVSB 1OW3B 4ITRC 3NGMA 5F5XA 1XDBA 2PMBA 4CMBA 4EHFA 5CM9C 4FMCB 4F96A 3R0VA 4IFIA 4C1NA 1Y1SA 3HP1A 5EXPA 4ENSA 1NFFA 3UPUA 1H5QA 1LGYA 3L4JA 4IZ6A 5D7NA 3SVZA 2WABA 1U2SA 4BWFB 4P8RA 2BR3A 1VE1A 1EVIA 3EPRA 3NUGA 3QKTA 5AI0A 4PTZA 1E8NA 2JBHA 2Z6QA 4XIIA 3OCVA 5J5AA 2EFDB 3V6LA 4ENPA 4MUFA 1L5YA 1XNGA 3KEFA 2YN2A 1K08A 1N2ZA 1AK2A 1CT9A 1V1RB 1UH5A 1A5ZA 2Q0HA 3G88A 1C2YA 3A04A 3T35A 2P9QA 1XN1A 3E5HA 1CDEA 1ZN2A 3NIDB 2FK8A 3S81A 1TJPB 1N1DA 2YIDA 3NEYA 4FZRA 4FBMA 4Q6WA 2W6MA 2ZRQA 4TM7A 3NW9A 1OASA 2G7MC 4A26A 4G09A 2MOKA 4B85A 4CV2A 2OBXA 2PZ8A 3KB1A 1GTL1 4WLEA 1FTNA 1Q0LA 4DEXA 4Z7JA 3PE3A 4BMPB 1CBUA 4KE8A 5DFAA 1WUTA 3LZCA 3PFIA 2FPLA 2IEBA 2FWRA 3E3MA 1EVZA 2PM8A 2X7XA 4WLNA 3MMZA 4TKUB 3S99A 1KAMA 4HGOA 3M0EA 2YVLA 2VUSA 2NU6A 2B5WA 4FILA 5GJWC 4RCVA 4HEQA 1HYGA 3C6XA 1YOVB 3CWQA 4C9BA 3QFFA 2WSBA 3BXXA 4UBJA 3JAKA 4UU8A 3D8RA 4BUJA 1WCWA 3BJEA 3HN2A 3HK2A 2EGUA 2M6SA 1A4UA 4AG6A 4B82A 4BE4A 4BRZA 5DSXA 1C7RA 1SCJA 3EWIA 4NARA 1ZIOA 2O3SA 4FEGA 1LF0A 2O6HA 4PN7A 3QSYA 3JARA 1G7SA 3SD7A 3B89A 2JFWA 2WWWA 4OO3A 4H0CA 4LMPA 1S2GA 4IZHA 5ITZB 4LF6B 3IDOA 4RORA 5H02A 2DP4E 3A1EA 1J06A 4FYWA 4QQFA 4FDAA 2FMXA 2WUGA 3IAHA 2FR1A 3RUPA 4E5SA 4TMFA 1P80A 5LB4A 1PHRA 3FTPA 3WR5A 4TGLA 3W5DA 2B36A 4JR2A 1O4VA 5F52A 5EQDA 1YB2A 2ADOA 3WO1A 3OTQA 4G1EB 3A4MA 3DONA 2ACEA 3O91A 2RGEA 5KWEA 1KJ9A 3FMOB 3FB4A 4IIDA 2W6JA 3AEYA 3K09C 3PGKA 1VA4A 1S6YA 4IICA 1RLIA 1LD3A 1S96A 1NQAO 3I01A 3NVKI 2EKBA 1XE3A 4LY9A 3NHWA 4DLSA 3CSDA 2OPHA 1T4MA 3L0BA 3L0ZA 2QW8A 3GNLA 1K9VF 4YJ2F 1CQXA 4B8WA 2ZSUA 4MJ7A 4UTNA 1IEWA 3WBKA 2JAOA 4BKQA 1TZMA 4BX9A 3NPMA 1P2FA 2VNSA 4N9WA 4OH7A 4N5MA 3FFBA 3FDXA 1E2EA 5AVRA 2D8AA 1WLSA 5HQ3B 3DVSX 4XSHA 4PYOA 4L4XA 4CM8A 2CNBA 5JWRA 3LQYA 3KQHA 4IXDA 1P0PA 5IKXA 3A9SA 2CB9A 1AIPA 3G49A 3P27A 1IVSA 3VMMA 2JFXA 1JQ3A 1CIPA 2JCVA 1NZFA 2AFRA 2G80A 2JFNA 4K9RA 1A97A 3RVPA 4AF8A 3MMNA 3WQHA 1ISRA 3A28A 5FWDA 3LGSA 1SU8A 2J0VA 4YY3B 2CNLA 3GLGE 3E9QA 4HPWA 4IIJA 2BV3A 4OJKA 4R1MA 4P54A 4X71A 2R11A 3QOFA 2XQFA 4ID3A 3AR7A 3GHYA 1V47A 1ZN8A 1GA4A 3BC1A 3D6TB 4W5JA 3SZLA 3KZXA 1ABFA 5BV1A 2QX7A 3HACA 4M8IA 5COQA 1Y5RA 3C7TA 3FUXA 5FFFA 3B60A 3IXMA 3QUQA 3LKDA 4ZQGA 3U3KA 2C78A 3B13B 1T3HA 2FPKA 1I80A 3BDVA 1JPUA 1XFDA 3AHGA 3OIYA 4AL4A 4C03A 4CIYA 1E99A 1LW6E 2VH2A 2WM9B 3CBQA 4LJ8A 4OU5A 2VL7A 3AGQA 4CM6A 1E64A 2V6GA 3RF6A 5KI6A 3OQVA 4C0HA 3FFTA 1LXCA 2ZU6A 2WJ6A 4G2TA 3EMVA 2VKQA 3KU1A 4BJ3A 2OVFA 4KIWA 4WK4B 1NFRA 2AJ8A 3P0FA 1SC4A 1WTAA 2KE5A 3SBOA 5HDBB 4ZYLA 2JLZA 1H1DA 4G5XA 3CG0A 1GFSA 2GAOA 3JQCA 1U8YA 2HU5A 1SG9A 1XQ6A 2JLSA 5A7FA 1XZHA 4Z99A 3JQFC 4LZZA 5CW2A 4GH5A 2GDJA 4NS4A 1RHMA 2WU4A 1YT5A 4FKZA 4IDCA 4KI7A 4MTCA 3FPCA 4E2FA 3TI7A 3L1KA 1RQXA 1TLLA 2BZGA 1U7HA 3AGPA 4A8JA 2IDJA 3QUBA 5DNVA 2NUPB 2NYAA 3UAYA 1GPDG 1VL6A 1JZTA 2AG8A 3FH0A 3AF6A 2VXYA 2WEKA 3UK1A 1N3BA 1OVMA 1T4BA 1NXQA 2RB4A 3DKPA 3KQTA 3QFSA 4PSVA 4Q1DA 4ZIRA 4URYR 5IKOA 1AMOA 1NW6A 2KLHA 2WHPB 5HKOA 4L3WA 2O59A 4KN5A 3KEGA 3BQNB 4GM1A 5DCUA 3W90A 3EIQA 5AI4A 2JJ1A 4TOIA 1HTBA 1WMFA 1Y3FE 2A5FA 3EBLA 1MOQA 4XPZA 4Z86A 3T4EA 4E2ZA 3QY9A 1Q3KA 5E4YA 1R0KA 3EEQA 5ALWA 1QYXA 3WSWA 4F4CA 3CZMA 3GR6A 3DDUA 3GEPA 2FEPA 4XD2A 4WPGA 5EJ8A 2OILA 3H8SA 4K1LA 3M2PA 1Y89A 4WD3A 4PYMA 3LHDA 4BO5A 4YJ2A 1ZGAA 5T57A 3IQEA 4LOAA 1RI4A 2ZR8A 5BW8A 4ZO9A 4LDQA 1C3OA 1FU4A 4ZTBA 1W2WB 4NPAA 5JNWA 2HJRA 3UT5A 3F78A 2DVMA 1QNFA 2HEGA 3DLAA 4AQDA 4IRUB 1CUEA 1T4CA 1WZNA 3CV3A 4BMNA 4D82A 3NV9A 1YULA 5AJYA 1RIFA 3PHBE 4BUZA 3EQ7A 2RBKA 3KZVA 5HK8A 4O4IA 1QJ4A 3QMPA 3LJKA 2H4XA 4L75A 4PO9A 5FWXA 3UM9A 3HFSA 3ORRA 4MW1A 2C4MA 4X1YA 1N2CB 1KTVA 3HDHA 1DRKA 3O8OA 5ENVA 3UXHA 3ZN2A 3VSDA 3IEVA 3NWBA 2JIBA 3RBVA 5A4DA 3G0DA 3ETLA 1V6CA 1Q3HA 1MMFB 4MRMB 8LDHA 5K0FA 4ZZ1A 1RJEA 1M0EA 3A05A 3ENWA 1J90A 3FCCA 3BM5A 1ZJZA 3ENQA 4KBFA 4B4WA 5L51A 5FKJA 1YI0A 3E22B 3KOWA 3DBOB 2RSLA 3NBZC 2IZ5A 3K72B 2AOWA 5KJEA 2R8YA 4QU0A 3FNGA 5D85A 5MGNA 1GPNA 1C8KA 1N7IA 4M76B 4EZEA 3OE1A 3OX3A 5JDIA 4EKGA 3PLNA 2YFKA 3S55A 5I7UA 2ZYTX 1DDIA 4Z0TA 2NACA 4B3FX 1M2OA 3IEKA 1USGA 1HGXA 4CW7A 2QGZA 4XQCA 2NUTA 3WHPA 1DAOA 2QSYA 4PLTA 4POOA 4PGGA 5ENZA 2OV1A 3G89A 2UYCA 2HEIA 2OB1A 1NRJB 3TSCA 1X80B 4K88A 4PLHA 4PLYA 3CWZA 4W4TA 3ZHYA 3UG7A 5JC1A 1PWHA 2OWDA 4LYEA 1XJ0A 1T9GR 5A0TA 1HE2A 3WA6A 2HF8A 4FE3A 1RDFA 2OCIA 1HYQA 3BWEA 5ILQA 3UJ8A 4I0WB 3GARA 3OFNA 3ZVRA 4DLYA 2CEKA 4PC6A 3WMFA 5M5BA 1Y8QA 1V2HE 1DZ3A 4MWTA 3CJRA 3MXTA 4J16C 5IF9A 1QZUA 4R5HA 2PS1A 2QUAA 3AJ8A 1U8FO 1C3JA 3SJZA 1AV6A 3AJEA 1KFEB 3RIHA 4K3UA 4QDTA 1PEAA 4MZXA 3AXTA 4R1SA 1M54A 4IYJA 4KR2A 3RT1A 5ISMA 5EJ5A 2VPYA 4EB3A 1TM1E 3N2EA 2LRHA 2Z30A 5GOZA 5K0LA 4QOJA 3STWA 1ISPA 1JIKA 2X14A 2B8WA 4MCIA 2I34A 5EZ5A 4P3OA 2QYOA 1U81A 3IERA 4YK7A 1K63A 2FTKE 3PXBA 2FCRA 3RFUA 1CJSA 2AOTB 3BQ9A 1KI4A 4Q4CA 3D7RA 4QDJA 4IIYA 4GRAA 2PVSA 3K2IA 1I5OA 2V0GA 1RQ7A 2VA9A 5IAGA 1L7OA 2ZUBA 3N2ZB 3C97A 3QJ5A 4OQXA 2MU1A 4NIMA 4FLFA 4LBZA 5G4KB 1HG1A 5J3JA 3ZD6A 5G1NA 1E7YA 3PRHA 1O96B 4EG8A 2DMRA 2QRNA 3CH5A 1DC8A 1B0AA 1MHPA 3EE6A 3NJ8A 4RF3A 2PX2A 3RG8A 5C8YF 5KYXB 3PEEA 4H27A 5JWHA 4DDWA 4IWNA 5ELMA 3NM6B 4CKWB 5DM60 2VNHA 4BV2A 4BZQA 1AS0A 1QDUA 1UXIA 3S7ZA 1GGMA 5BQOA 2AN3A 3EW9A 2CFSA 3S2SA 5EMLA 3TLXA 1CUCA 1VE9A 4D1YA 1OROA 5AHXA 1AN9A 1DUVG 2W43A 1SR8A 5DHFA 3WIBA 3I2YX 4LZPA 1MB4A 1KI1A 1VJRA 1W76A 2IYTA 2JVJA 1H1LA 1QMGA 5I45A 3DCIA 1LLUA 1RRCA 4TLCA 2Q2OA 2CDRA 1QV6A 3H19A 2GA9A 3ZIDA 4OQNA 4O1MA 1C30B 4Y2YA 1PS0A 2XIJA 4TXLA 4F38A 1L4BA 1MGOA 1Z08A 1ZK4A 2L69A 2WNIA 2J9FA 4MUGA 2BONA 2IE0A 1PNQA 1RHUA 3KKQA 3O8QB 5F2EA 1BVYF 2XYHA 2G88A 4GNRA 5M7EA 1XZJA 2B94A 2V7TA 3H6HA 1F9AA 4LOJA 5LYJB 2EKLA 1J0XO 3CSSA 3H13A 4KPUB 4RQTA 4EJ0A 4RKWA 3PUVA 3RS3A 2WZQA 5LOVB 2ZCUA 4TLEA 2JKZA 4K9NA 3ZK9A 3ZHCA 3LSYA 1I3MA 2ZBGA 4QUJA 3RVSA 5EQTA 3ZQUA 2WV7A 2AJBA 1CWUA 4E5NA 1PV2A 1ZPDA 4QE3A 1DE0A 1E1QD 1G42A 3L3BA 3KAQA 1KDVA 3AWIA 3PRYA 3OCXA 2O3QA 4EFNA 1RBMA 5H3CA 3JZDA 3TK1A 5IN4A 4FB4A 3G1WA 5JALA 3DLBA 4WHMA 1VG0B 1ZN9A 3QEMA 1MT0A 4ZQHA 2CXRA 3LY5A 2IS2A 3C6QA 3ZDXB 1Z73A 2NPFA 1L5KA 1N34B 2RK4A 3HO8A 3WKCA 2VTBB 1I1QB 2FWMX 4F4UA 1NBWB 1QSGA 1LTKA 3QPCA 3RBXA 5DYYA 1X9IA 4J7UA 3RTEA 5KYWB 2ZZMA 2QTAA 4D92A 4REMA 1XCJA 3WIVA 4Z9XA 1QGZA 5ESDA 2GK4A 2PX3A 1DIBA 3ANLA 3O93A 3LL4A 5AOVA 1JDUA 5IP5A 3U6KA 1FNCA 1P77A 2R6HA 3NTQA 4X45A 4ZCQA 4CGYA 5JZ9A 4MA5A 1S7CA 1LA2A 4CG2A 5I7WA 4CFZA 3ZD7A 1I2MA 1UBRS 2CMGA 2RH9B 2YQ4A 3I6MA 4UJ5A 2HGSA 4W7HA 5DXAA 5FNVB 2OFXA 2PG3A 4ON9A 5GONF 3T15A 3U40A 5ARCA 1H42A 5A03A 1E6CA 2WHPA 4Q3BA 2RH8A 5F5LA 3UK2A 3KB8A 5EQJB 1JXOA 4IDAA 3I6BA 2ONJA 1AQNA 4JOQA 1FIUA 3G0CA 3BIXA 3IKVA 1X1QA 1XB2A 3L41A 3V3TA 1NXSA 2ZRJA 1VMEA 1SQ0A 2CHUA 4PPYA 3PDIB 5HKLA 1V71A 2FCAA 1VCOA 4BRSA 1ADYA 1JIVA 2HSJA 3T5PA 5BORA 1OH5A 1SMKA 3RS7A 1AB5A 1VCMA 3MTAA 4FS3A 1IDN1 2HF2A 4CM5A 1NKVA 5BUSA 1WXXA 5KNCA 3DAFA 1QP0A 2XUFA 5E38A 4WVLA 1SQFA 2CNKA 4GPAA 2GKGA 2GF2A 4ALJA 3R5HA 1OBFO 2IX3A 1M34E 2QX4A 3KE8A 4YRAA 1O9GA 1U2GC 2W4MA 3KR0A 1VE6A 1PX2A 4M9CA 4OJMX 4U5QA 4X0EA 4GPIB 1CUVA 1GG8A 2CVZA 2BGMA 2GPJA 4YTEA 2OXTA 4C05A 4OJQA 4QG3A 4TKVB 1SIWA 2W2VA 3BWCA 2KM1A 2A1IA 3VR2A 3QXJA 3QVXA 3ZI7A 4XD7A 1C14A 4PM4A 3TXYA 4Y2HA 3BH0A 4LE1A 1WY7A 3VR6H 3R75A 1X15A 1ZWKA 1M74A 1JEEA 5KDOA 3KUKA 2ODPA 3V2IA 3W3ZB 3WLTA 1OU0A 2QJFA 3LECA 4P5PA 3DFKA 4PFQA 2AFHA 1ZIYA 5B58C 5ELXA 2NZUG 1IXZA 2A7QA 2W2MA 3GQVA 1ORIA 2HBZA 1UINA 2G4LA 2I7XA 3I5AA 4G63A 1EQ2A 2B0CA 4IG4A 4Z8XA 5EIAA 5IH3A 4CHTA 4ESOA 5SYAA 4DYDA 3LH5A 5EP2A 5C1BA 1NN0A 4H3VA 2YJ6A 3IA7A 3NATA 4HYYA 3MJFA 4JLUA 1U2ZA 4JFRA 1VPLA 4QNMA 1YONA 1OI4A 2PFSA 3NOOA 2CJPA 4HI0E 3R5KA 3FKSA 4WT7A 2V7VA 2QRVA 3C15C 3HCDA 5F12A 4S1TA 1XXHB 3C6BA 1V11B 1TJNA 2ERXA 1XRQA 3A58B 2WJZB 3INYA 4KK3A 4RM2A 3IE2A 3KKZA 4DILA 1J8QA 2Q5JA 3TRFA 1RZ3A 1J7KA 3GYGA 3KSDO 3M4YA 1P62B 3RTAA 2VYVD 1IFXA 2NO6A 4GKBA 3TBFA 3UANA 4P34A 4OXQA 4WOBA 4DG9A 4EZIA 4F72A 1YZYA 4A36A 4PSDA 1Q12A 3PRJA 4HSGA 4Q47A 1UEXC 3U61B 4HMQA 2AC4A 1K6EA 5L45A 1E9SA 5CVCA 4FT4A 3USCS 3AP3A 4LVOA 1P4SA 3ND7A 4WBXC 5HVNA 2GI4A 3KV3O 1X1DA 4LYYA 1E0AA 1XP5A 1YGYA 3IAS1 3PC8A 3ZYZA 2WIDA 1Y9ZA 4EEKA 3BMOA 4UQPA 3EOBI 3KYBA 1ATIA 1S4MA 1J33A 5CCEA 1R6TA 3D6FA 3GI1A 3D5TA 2QR3A 3BPSA 3TIXB 1N2EA 2ID7A 2HDNB 4RQBA 1WKVA 1Z83A 4TTIA 3G59A 1H6AA 3JTEA 5D00A 3V4OA 3IKTA 3RNLA 5EIEA 1N0UA 3EBPA 2GAFA 5K3DA 3WYFA 4XWWA 3FDFA 2DLNA 2F1HA 4A2CA 3CEMA 5LC1A 5HZMA 2HR1A 2XUOA 1Q1EA 1K5PA 3LBYA 1CUGA 1Z0ZA 3WTCA 2A4MA 2E5LB 1WPGA 2UZ1A 3M81A 1UJNA 3K31A 3ZKWA 4KQIA 1IMJA 2QZZA 2Q6KA 2YVQA 2NU8A 5J1SB 4OLHA 3AK4A 1Q77A 2V4MA 1VMIA 1P1CA 4QPPA 2R5WA 2RKWA 3Q3CA 4INJA 3TS1A 4KZPA 4EI8A 4PYKA 3GAZA 2EHJA 2C4VA 1HDGO 1GZ4A 2IEIA 3SF0A 1HH4A 4P35A 1UQUA 2VRWA 3P2IA 4LWZA 4DAOA 3PD7A 3KTFA 4XA8A 4AJOA 1OFHA 4RLQA 2FSUA 4Y6SA 3RVLA 1VHTA 4GF5A 2NWQA 4W9NC 1VDMA 2WA1A 3TTVA 3HCOA 4Z0PA 5P8WA 1WCYA 2HB6A 2WOJA 4ZA2A 4ZV4A 3D43A 3N8IA 3ZCXA 2ZUCA 4R8KA 2ZWIA 2V5AA 4FJ0A 4I6JA 1LLDA 2XMBA 5BMVA 2VTVA 5JFGA 2EEPA 2WM2A 1XLTC 2HHJA 3K20A 1Y8RA 2BGGA 1JAYA 1CJCA 4OFXA 3TMKA 4GM0A 4M0LA 3RS9A 3ZLBA 2R1VB 4HN4B 1QHFA 5FUWA 2GCNA 1C0KA 1SZCA 2PO7A 4DMGA 1ICEA 3TRJA 3WNDA 3SZGA 2QKYA 1DFGA 1M2FA 1W0KD 1ZD2P 4MV9A 4U9IS 1RMQA 4D0NA 5GV8A 1F48A 4TUYB 3AEQA 1DWUA 4DCMA 4OUDB 1DKLA 1D1QA 4H15A 1JEJA 4FSXA 4GI3A 4XWYA 5DXJA 2VHQA 1RJ9A 3P0RA 1JMYA 1EFUA 2IK8A 4RHXA 2BBTA 4C87A 1HYBA 4CVNA 3LK7A 2BFEA 4P0PB 4LXXA 1SUIA 4BO4A 1K92A 2GS9A 4AJPA 2EERA 1RC8A 2CXTA 1E1LA 1O0BA 1WHSA 3C6MA 3STVA 3MILA 2COKA 1LNQA 4Q7EA 2BZSA 3NXSA 5E2BA 3U17A 3HDTA 5IM4A 3K8YA 3UCFA 2V45A 4HNVA 5JO0A 1Y8CA 3OIVA 1LV7A 2SBTA 3ZQ6A 4I1IA 1XZNA 3FI9A 1HE8B 1S8OA 1QOPB 1Z37A 2EWWA 3LWDA 4FHGA 4R40A 3IPYA 3HCWA 3IJPA 5NULA 3SHFA 2PBFA 3PD1A 3UOAB 1RZRA 1FZQA 2B1IA 2QTGA 2WPNA 1IH8A 1YZFA 3QH4A 3L8YA 1EFKA 2NQ8A 2YWXA 4HFNA 1COZA 1YDFA 1WSDA 3UUGA 3ZV7A 4DMMA 3MHPA 1B14A 3PUYA 4E1AA 4RY8A 5JROA 5B12A 4EELA 2DH5A 2OYSA 2P65A 1AKRA 2CY0A 2CFTA 2OCGA 3AONB 1L6IA 1ZOPA 2J3MA 5JNRA 2EYQA 3CO0S 1WV1A 4DB2A 1EA5A 2N75A 2YW2A 4PGFA 2GESA 5E6SB 4JXXA 2JLXA 1K8XB 1RAGA 4GPEA 1EFVB 2WKRA 5D7BA 2BM8A 1VYTA 1J8YF 1EKXA 1TMKA 2FSIA 3BGOS 3OJFA 3P71T 4J0IA 4QRIA 3GH1A 5L3SA 3PXGA 3I1FA 3OP4A 1W73A 2O8BA 3QPWA 4HUQB 1L5QA 1P1RA 1TC2A 1K4MA 1Z62A 4R1UA 5DBIA 1QFMA 3RRYA 2IYQA 4AJKA 2ZRGA 5JAHA 4HH1A 1IY8A 2ZYDA 1Y82A 3U3DA 3LVFO 1CRPA 1G6KA 4B2YA 2VSOA 3R4CA 4E31A 5K5EA 4NMXB 3HYSA 2XDQA 3GEGA 3SVTA 6REQA 1EIZA 1GNSA 1Y80A 2AX3A 2RC6A 2GB4A 2UZ0A 5AK5A 3HJUA 3DAPA 3QX7A 4U7HA 1ATZA 2VVTA 3HPRA 1G20E 2IYZA 3RS2A 3R0ZA 3ZDFA 4AZ3B 4L5BA 4F12A 2X0RA 4CL2A 4JOSA 4D98A 2HO4A 2WE8A 4FQ8A 5I9NA 4U9HS 2I4NA 3CX7A 1VE3A 3C6YA 4D9NA 3I6QA 3K1TA 4M8LA 4O4LA 3VDNB 4YJ3F 3LZ6A 3KZ1E 1SVNA 4C6HA 3TNFA 2GN6A 3TTYA 3QKUA 1Q91A 2HIGA 3UPTA 1GARA 3MWEB 1FU7A 2GF9A 3QHPA 4WY5A 3SHTA 4M6WA 4LE0A 5KJ6A 1HFKA 2YOFA 3GJQA 4R5MA 2W37A 3U56A 4AZTA 1BDHA 3BMQB 1LBSA 4YACA 1ID8A 4TM8A 2ZYRA 4G5OA 3EVEA 4RM3A 4WBNF 5CFOA 5FL7D 3IO5A 2Q4TA 4MR7A 5DYNA 1UPUA 1Z82A 5AW6A 3T1OA 1JT9A 3H86A 3U44B 5CDHA 3NTLA 2Y1DA 3H5TA 1UFKA 3ESCA 3BAFA 2QTBA 3E5RA 1DEOA 1YSCA 3KT8A 4O4LB 4RQUA 3LDAA 4K9QA 3PE6A 2ZTLA 2I22A 1KGSA 4M0UA 4RSRA 5K9ZA 1Q16A 1L5WA 4P80A 1JEYB 1OD6A 3H1AA 3FOBA 4LQCA 4O1HA 3ZWMA 2QRPA 4MWZA 4ZU6X 3MB8A 2ZJYA 3IAM6 2D0DA 1XFAA 1ZM3A 3A9VA 4G84A 5TJHA 2JIRA 3EVZA 2DQYA 1GTMA 1X7DA 1KQOA 3QVJA 3PNBA 1U3CA 3F7TA 3RHTA 1JYEA 1CRWG 2WHYA 2BH9A 2D2VA 1QKIA 3GX1A 1ZJ4A 1DX9A 3QNMA 1OLOA 4AJHA 4IJWA 1NYRA 1R4AA 3OTWA 2C7RA 5EJ6A 2ZRFA 1EQAA 3NKLA 3QEJA 1UXOA 4M0FA 2Q3HA 3JWPA 3ZKAA 1A9RA 1N8TA 1I9GA 4R84A 2FF5A 1CUDA 1GZ5A 4QQKA 1IJBA 5FUYA 1INLA 1RIIA 2QYHA 3L06A 4LRTB 1QLJA 3F71A 4COOA 2A9KA 3GFPA 3TZQA 4M46A 1V7CA 3UJHA 3DAYA 1XAGA 4JXKA 4HATA 4EKIA 2FPMA 3P9NA 3WYDA 2GJAA 4IRMA 2H57A 4WNAB 4BKOA 1WB9A 1JNXX 2OO5A 4HUJA 4J3JA 3WMGA 5FADA 5AQEA 2ZGVA 4LS3A 2PD4A 2M1ZA 3M6WA 3K1AB 3MUOA 1F1JA 1US8A 2F3RA 3EFOA 3I45A 4MRMA 1LS1A 3ONWA 2F17A 1UM8A 1N2CA 1MO6A 4DUGA 5JD4A 2PIDA 4URVR 4G9BA 2PZAA 1YRLA 4IJUA 5B3KA 5BN3B 1W7AA 2YUTA 4AVYA 1NX9A 4IHAA 1KARA 4RZQA 2PS9A 4KXNA 1W5BA 3EZ2A 3PKIA 2DFTA 1MO5A 5ICCA 3K73O 2GAAA 2FA9A 1QFJA 1C7EA 1HPLA 2ZSIA 3HUUA 3QYFA 3V5NA 4XWAA 3U19A 2JK0A 1N0HA 3MM4A 5E0OA 1VL1A 3F96A 1ACMA 3EA0A 3LVRE 3RC3A 1H6BA 4LZAA 3Q0EA 4BNXA 1DEHA 1NMXA 2C95A 1WP4A 3ZW8A 4YASA 4G5YA 4DV7B 4OUDA 2IYAA 3AUKA 2ZRKA 2FSPA 3NT2A 4AF7A 3R7WB 1WZUA 4GEGA 4HWSA 3KIPA 1BZYA 2O2GA 4Y6OA 4CWAA 1PYGA 1KY4A 5SZJA 3VAZA 3NMUF 4PRZA 2EJCA 3WMEA 2L82A 3NYWA 1IQRA 2A58A 3D5EA 4H6PA 4OY3A 1C9EA 5F4BA 1B93A 2C88A 3ABQB 4ZGBA 3QMVA 1BMQA 5J58A 2CEAA 5FBVB 4ZTZB 5F9HA 2DUWA 3QYPA 2F1JA 1C7ZA 3JPWA 4WLOA 1G16A 4EVQA 4J07A 4NYMQ 1GVHA 4UZFA 5LUAA 1EX7A 4NU5A 3M8KA 2R1TA 1M5TA 3HV0A 4PYQA 4R51A 5H59A 1XMQB 4B4DA 2J09A 2GMWA 2X9QA 1NI4B 3F90A 1EVEA 3CZ5A 1P75A 4BQRA 1ESCA 3I0MA 3KJEA 1H3NA 4Q01A 2DULA 2X7JA 3K5IA 4HAVA 4JGBA 1L4HA 1O97D 2HPVA 3I0NA 3SMQA 2JDIA 2Y6UA 1N5IA 3O9VA 3P32A 2ECQA 3ND6A 1NW7A 1HBJA 3CZAA 1GQOA 5CLQA 5LL6P 1ZNWA 3G2NA 3DWEX 5JQGF 1J5EB 3CU5A 5HP4A 1AV7A 1GLNA 2ZJ5A 4TVBA 1G5PA 1JDVA 1KBZA 3BRWA 4GGMX 3ZTWA 3RRXA 2FZLA 2PHZA 1JR3A 1Z6AA 2WAMA 5AJWA 3ZDAA 3RUEA 1MQAA 1VCNA 1WTCA 3DMTA 1PVOA 4MP8A 1ZOOA 1ZNZA 5E4TA 1U9IC 4IIBA 5F73A 1UIRA 3FFXA 3WVNA 2QXYA 3KSBC 4Z3OA 3WRXA 3T7JA 4PLFA 3I5UA 4CR7A 4I36A 3RC7A 4D8TA 1BEUB 1P5RA 3ZZ0A 1HNXB 5ALGA 3WLSA 2QROA 3RM3A 4CCYA 3PXAA 2DHQA 2W2NA 1WMAA 1CV2A 2AMLA 2B30A 4INPA 5DTQA 5EERA 5IK2D 4FFNA 5C35A 3UFBA 4QSMA 3GVIA 4AUEA 4K9LA 2JPDA 1FVFA 1SXHA 1BNCA 4TSFD 2GLUA 2RGYA 4OHPA 2M32A 1UM9A 5FTJA 1DG3A 4TSKA 3EBOA 2ESRA 3HGMA 5EHIA 1W5TA 3TRHA 1XRLA 1RHQA 1CUBA 4L1KA 5AMXA 1CPYA 3STTA 3QU7A 4NV3A 4X3OA 4YJ2B 4U8GA 3AIKA 4E5KA 2RHDA 3HDVA 1JVBA 4RGBA 2F4VB 3F4BA 4QYXA 3R7AA 3FRHA 3CIOA 1N2CE 3RUAA 3TSOA 4HNTA 1ZIPA 1DHRA 1WUYA 2C5BA 2ZIEA 1NJFA 3LBFA 1KO7A 1SUDA 2BFBB 2VHTA 3GOHA 3NDPA 1WDLA 4I99A 4GE0A 4BFVA 2IITA 4DDTA 5AVVA 2X19A 4R05A 4C4YA 1ODCA 1U65A 4XPIB 1LVUA 1RYZA 1T34A 4KNWA 3KJGA 4Y7DA 2F3TA 4AY6A 4WLFA 5ERYA 3I6ZA 2ET6A 2XVZA 5ER9A 2LE0A 2ONZA 3R4VA 1N7HA 2FUEA 3B5IA 3NWPA 1WXWA 5K3FB 3RQIA 3SQLA 4ZIRB 4BJ6A 2IXGA 4BKRA 4M88A 3QLTA 5ES3A 4ZAVA 3UWDA 1MOZA 1ZO8A 1DKMA 4IMIB 1Z0DA 5C7YA 1QQTA 2CN1A 3EODA 1ZK0A 2GUGA 1OTXA 1ZOSA 3UHAA 2ZBPA 2IU4A 1QAMA 4KITB 2MSWA 2X0FA 3O38A 1R0BA 4DDHA 2A8YA 3FOAA 2N1BA 3DO6A 2Z5GA 1CZRA 1L1QA 3HU1A 1T1EA 3NP9A 3PQCA 2Z3VA 4L3OA 4UEWA 2X0EA 5L4NA 3UW1A 3FHTA 1PFQA 3GT7A 2BW0A 1YGPA 2XCLA 4KREA 4F97A 2LKCA 4YI5A 2PZLA 2JAXA 1DO2A 1GLVA 2GFQA 2AWNA 4J03A 4QOEA 4DJDC 3OT1A 1BQEA 4YJHB 3LX6A 3I1JA 2XE6A 4YJHA 4D96A 2P75A 2RHCA 4HYQA 3GFFA 1NOIA 2B8EA 5B3JA 3TG8A 1O5IA 4CT5A 1G5QA 3K9WA 1DBSA 2QRMA 3G82C 2HJWA 2VATA 4OGLA 5T6MA 1DSSG 2OHJA 3B3JA 2R8ZA 3MB5A 4K6HA 3H8VA 4K5QA 2X8BA 1UMBA 1DWQA 2Y0BA 4TV8B 1WM1A 4YMLA 4PZYA 2JA2A 2JFVA 5HEKA 2FQQA 4K9KA 3RS0A 1U99A 3F98A 2BOVA 3NYQA 4BXOA 3QXHA 5DGDA 4TRMA 4NENB 2GT1A 4J7AA 3RUFA 2B4TO 1VKZA 2W2KA 1U9ZA 2Z9DA 4GGOA 5LBTA 2A88A 2FN3A 4ZRMA 4IJQA 4BO8A 1LWNA 3AY6A 3ECCA 5JASA 4WOJA 2IYOA 2YWEA 2ZRHA 1KDPA 3FJYA 3EGCA 3FPSA 3NCTA 4NBNA 2GO7A 3I9NA 3KB6A 5AP9A 3CUWA 2AR9A 3DR5A 4UM9D 1JHXA 4IEFB 4FMCF 3OQIB 3WGOA 3LFTA 1R0XA 4DN6A 4KFTA 1IBCA 2ECKA 2EJTA 4ALLA 1RBQA 2OZEA 4IXTA 4JIMA 2VS1A 2FSFA 3CRW1 4KAAA 3EGDB 3R1IA 4FCCA 2YJ4A 3S1AB 1LV8A 3HXKA 1PNVA 5B2ZA 5HF6A 2MR6A 1WUKS 1E3DA 4XTCS 2Q45A 4LIPD 1I5EA 2Y4NA 4QQNA 4V03A 3GPIA 4Z8YA 1GN8A 1U7OA 5JQGB 1NXWA 2EWMA 3LMKA 3P9RA 4C14A 3BXOA 4UBLA 2BFFA 4EARA 2B3DA 3E5MA 1NJ2A 5KSWB 5KTOA 2WU3A 3HO1A 2C0CA 2V7QD 3ADBA 3TPCA 1W25A 4YIKA 5DHUA 3RC2A 4RJ2A 1A9OA 1XEWY 3PD0A 3QKRA 5CVJA 3QM1A 1SXJC 1K2WA 1LVHA 5CYOA 3VR5H 3L93A 1MAWA 2LWIA 3C7KA 4S12A 4HPXB 1N2GA 1P3DA 3AFHA 4NFHA 4G0ZA 4PZAA 5LQJA 8MHTA 2R751 1XNJA 4ZXPA 3SC2A 3G7UA 4UUMA 7MDHA 3S2IA 2GZMA 3QVOA 2QMZA 2QE6A 4OQEA 1Z56C 1Z26A 2K2QB 3Q8WA 4PAWA 2PU5A 4XWGA 1A7AA 4M60A 1BS9A 3A10A 4NESA 2D1QA 2HJ9A 1PVVA 3IAUA 2XW6A 4L2IB 5AESA 5FPKA 4LJ6A 1H3FA 4IWYA 4LGCA 4R0VA 2YDYA 3PUJA 4DR7B 3F74A 2RGGA 4G4GA 4H1UA 1HYEA 1U2QA 1HTTA 1V16A 3DLTA 1OLSA 2OB2A 3GUYA 4FQ5A 3U62A 2GCIA 4C6TA 3QUSA 4RS3A 2O48X 3RTBA 2QLNA 1KK0A 1S3GA 1GUFA 1NXXA 3E03A 3TVYA 1YTUA 1NDQA 4ND8A 4ZGWA 3OFND 3QX9A 4W82A 3TNLA 1Z2DA 1K6XA 4I8XA 3TDMA 1CF4A 2IU3A 1FFXB 3U4GA 3ZYCA 3MWLA 4A8HA 1DMSA 4DLRA 3AR6A 2WB2A 2DLDA 2NTJA 1YZVA 2G9ZA 1FRVA 2OXFA 3CT4A 5IJXA 4JBHA 2GAIA 3SJAA 3MUFA 3H5OA 1MG0A 5JXGA 1Q11A 1EJ6A 3GT0A 3T5DA 1GGEA 1P8AA 5E9JA 5A3QA 5E2IA 3TEFA 5KWJA 2QXTA 4YT5A 2DHCA 2QT1A 5CVUA 1RXWA 2FP3A 4BCBA 1SOVA 3Q6NA 5CX1A 3VR5D 2WE7A 3IODA 4UHHA 3CKMA 1B8VA 5GZ1A 3EIUA 2XRYA 1K89A 2PSJA 5ICSA 1A95A 3LT5A 3FSRA 4F1KA 2ROQA 3DYVA 1D7OA 1UMDA 3KYIB 4A2PA 4S1PA 2IH5A 2Z6VA 2BZ0A 5CCDA 4AG3A 2ZT8A 4IHKA 2A3NA 4EB0A 1PJ4A 3R6GA 5HIAA 1BS2A 2XVYA 2BEKA 2FQWA 1XZMA 4XFJA 3PNMA 3AB7A 1EWRA 2PGIA 3TZCA 1L7PA 3PVCA 4M1ZA 2PX8A 4I1YA 4IHJA 1FZTA 1CB7A 1EGVB 1MABA 2CKDA 4OB6A 2FZVA 4MJXA 4OXYA 1ZONA 5DF1A 4GDMA 2Q2VA 5H68A 5AJHA 4MB2A 2IDMA 3BH6A 3OOYA 2PQ6A 3P0JA 3PHCA 1CDZA 3I76A 4INAA 1T15A 2MYNA 4B4OA 4AULA 5C4MA 2GEJA 1G7TA 3BWVA 1T9GS 3LCCA 1M6HA 1WF3A 2CL7X 5LJLA 3IIIA 5KPJA 3JW8A 1P0FA 2OGTA 2QQGA 1N7GA 1GEGA 3O4RA 2IIQA 3ICEA 5I9SA 1TUBB 3U0BA 4ZQCB 3RT9A 3DXYA 3W06A 4QUAA 1MH1A 1O95A 1FDWA 4Y2TA 4F3CA 4F6RA 1A5SB 3GJ4A 2FFAA 4JITA 1RHKA 5EP4A 2V96A 1OAOC 1XKXA 5BN4B 1OIVA 3W04A 3ZIAA 4C5BA 2QLJA 1QK4A 2RAUA 1T8SA 3CLSC 3RFCA 4FZJA 2VJQA 1X13A 3FWHA 2FXIA 4NZZA 3GZ4A 3ONVA 3QSGA 5KKCA 4I1PA 2M1XA 5JRZA 1E79A 2OORA 3F2IA 2EZUA 4IV0A 5CFLA 3AF3A 1G7CA 1OFTA 1JLKA 5F1YA 2ES4A 1KQGA 4V24A 1H2FA 2ZPUA 3BT7A 1V1MA 4KWIA 5KTSA 4HAYA 2Z98A 3VC1A 4HUQA 4GO1A 3QE9Y 3KQNA 3EAGA 5HM6A 1RADA 5HCUA 1U3DA 1I01A 3H9GA 2DY1A 1JWAB 3NYIA 1OFGA 3N6RA 3KKPA 3BGWA 3OICA 4JXZA 3DM5A 3QLUA 2I2XB 3PNVA 3ZS9A 1WSAA 5E6SA 5LA6F 3JV7A 4R1PA 1KZYC 1QYIA 2Z3WA 2F3UA 3N7UA 5AJXA 2MYTA 4A15A 4Y6LA 1T8YA 1TMYA 2VK1A 2XT6A 4LVCA 2HLHA 3OCYA 4QJBA 4QTUB 5ESWA 3FGOA 1CZUA 4OHXA 4C4OA 1NBIA 3IOMA 1LPOA 2QW1A 5FWAA 5A5GA 3ZLJA 2J7KA 1JHDA 5KVCA 5LNK1 1GCAA 1R0RE 2P1ZA 3F6PA 4YDHB 3WL5A 5BUCA 4P53A 2ZLBA 1YU9A 4LZNA 2HY7A 1DV2A 1TW2A 3DG9A 1W0JD 3B8HA 4B3CA 2Q21A 1NYTA 3NZEA 1QGAA 4I5GA 3EFHA 2C20A 2YHUA 4I2NA 4HNUA 1DKQA 5JS6A 4CEHA 1Q57A 4EP1A 4W99A 3U3JA 4MQ5A 2UUPA 3RCBA 3ZU5A 2O1EA 3MHTA 1CLEA 2QN6A 3QG5A 4MR7B 1BJTA 3MCVA 3TLMA 3K92A 4ZK6A 3SQWA 5IRCD 4MUIA 4TXMA 4XYBA 1GNRA 1LPMA 4HGQA 2DUJA 5DHPA 3OF3A 5HKKA 1QQ5A 3T3GA 4BDSA 5KYNA 4YR7A 1Q7BA 1TUIA 4M6WB 2O0HA 3A6ZA 3ZQKA 2DLCX 1M7BA 3UGKA 1RPNA 1QTIA 5JAIA 1U6JA 4GLJA 5HR5A 2ZVPX 3H1TA 3M4JA 3WWOA 3G5TA 2R6ZA 4M2LA 3HNOA 3IHLA 1BJKA 2VPQA 2J07A 3VOBA 5GADl 1TT5B 3UWKA 2PEYA 5I7FA 5CA1F 4JYPA 1MV8A 3IEPA 3V33A 1HETA 2PR7A 3IAEA 2WP0A 1H8HA 2GCPA 4KLAA 1I0LA 1ZUWA 1QH1B 2AZTA 1UF9A 2NO0A 4M89A 5ECGC 1GRVA 3HI6A 1PJTA 4I4TF 5G0UA 5REQB 4Q7JB 5J5CA 2BI4A 1UFVA 2OQ2A 3P2KA 4Y7CA 2GZ1A 2V9CA 2DBQA 4X8LA 4X93A 5DIFA 4JVMA 4I9HA 2H2GA 5FBHA 5THXA 3SZOA 3AB8A 2XDQB 1GZUA 4E7PA 3KM0A 1R3DA 4Q19A 3DFMA 1KL7A 3A0UA 3W78A 1PLJA 3G68A 1MH9A 4A8JB 4AS1A 2FMTA 2HMTA 1PUIA 1I51A 4HGYA 1PAUA 3WWZA 1YQXA 2IU0A 3L8HA 2RKBA 4OX9Y 5EUBA 1MUUA 5CEFA 5KQGA 4YV0A 1AF4A 4WKGA 4F2WA 4AG5A 1WKCA 4MAFA 1NSYA 2YN0A 1EX6A 1HNNA 3RC9A 3HXPA 1BA2A 1G55A 4XGNA 1DB3A 3UA4A 4IILA 4B34A 1SKUA 3AINA 4DTIA 1DTWB 3UUWA 1ZC3A 1E0DA 1PK8A 2BUAA 3R7BA 1XROA 4IW3B 4RMJA 4V39A 1UWKA 3ILVA 1SU6A 3DDZX 4DR1B 1CUFA 3AHEA 1U6KA 5AKGA 3VZPA 1KEEB 1EM8A 1TVEA 4UTVA 1BXRA 4NR0A 3MWYW 4YRJA 1JE0A 3LX5A 4O4JA 1PF7E 1NMSA 1CYDA 2VUHB 2RHMA 2DFDA 1EJBA 3F1LA 3G0BA 4EGQA 1ZEMA 4JX9A 5LQMA 1MJNA 3JSAA 5K2MA 1Q7RA 2J3QA 3IP6A 2WKWA 3COPA 4HQ0A 3K4PA 3D7SA 1XK7A 4TTRA 2M98A 3A9CA 1GPWB 3GRRA 1GU0A 4BBJA 4BBPA 4DM4A 2NNLD 4N0DA 1OX4A 4L85A 3TINA 3WA7A 5K8TA 5ALYA 2XDAA 1GZSA 4KIFA 2PLAA 1DT5A 1F6BA 3DDWA 1HT1E 5DH9A 1CUAA 3NLLA 5PGMA 2GEUA 1U04A 3G2HA 1W47A 4IDPA 5AKKA 3TVDA 2PT6A 1P1HA 2I7VA 5K51A 4NZ9A 3OQ1A 5BNIA 5TMDA 3I5YA 4KJZA 4RJJA 5TIIA 2WFZA 4Q4JA 4OXXA 1QBKC 3B3QA 3UT0A 5ADVA 2XUAA 3HBJA 3IMGA 2PCLA 3TO5A 1G291 3OCUA 4RD2A 4FUQA 1O6FA 3IULA 3PK0A 2WKPA 5U1PA 3RKUA 2GPYA 2IDZA 5ECDA 4AZ0A 3NRJA 3D81A 5KINB 1KTIA 2F59A 2IZ7A 4PU0A 5I6DA 2V5VA 1WZCA 1GNVA 4JZKA 3A25A 4M9XA 4O63O 3TQQA 4XKJA 4PYJA 4KV7A 2FPGB 1VLLA 2A5DA 3DMYA 3LUBA 4FVTA 3DXZA 3QFTA 3N2LA 3HWWA 4RS4A 3W6OA 3HDYA 1FJ2A 5CDTA 4WK6A 2C5AA 1IU9A 4XR4A 2Q9AA 4YREA 3SQNA 3Q0IA 4F92B 3N0TA 2R96A 4Y1RB 1VPWA 2ZTUA 3QEBZ 1EVKA 4FIDA 2ISSD 2VDLB 3RBAA 2GPSA 4LY3A 3CKLA 1C4WA 1ORTA 1U0HC 4G5GA 4IEEA 3I8SA 4YJFB 3G2JA 4DSAA 5B6JA 2JANA 3GBSA 4TKLA 2G77B 5EZYA 2GN9A 1YUNA 5C8XA 1SBZA 2E49A 4GIBA 4AK9A 2OQVA 2CLCX 1E4OA 4W5OA 4KRYA 4XQGA 3V46A 3NYRA 2WSLA 4BGIA 5AM3A 1APBA 1JBQA 2WDZA 4B0OA 3RASA 4WNCA 1ZUHA 1SXJB 4NWIA 3P19A 1JFFB 1VKNA 3T41A 2HPZA 2H2IA 5I7SA 2B2XA 2ZETA 3THSA 2ORED 4BC0A 3UEOA 4M87A 2R4TA 3RV3A 1DXYA 1Y5LA 1SVWA 2PLWA 2XWSA 5EWMB 4DMLA 3L92A 5HUHA 3SHVA 1T6YA 4K6GA 1PG5A 1S89A 2VFAA 2VT6A 4TKMA 5MF6A 1FBNA 1YL7A 621PA 1H4TA 4QT0A 2P5TB 4HDAA 1MOSA 2QGNA 5A6SB 5IUNC 2IX9A 5KYGA 5LVAA 3LCRA 3D6HA 5ALXA 3CE9A 4D3XA 4WJLA 1RZVA 2XDYA 3I28A 4I55A 2B2CA 2CVFA 3LHFA 4CMKA 1QP7A 2AT1A 3OHPA 4FNGA 4NRDA 2JRLA 1ESNA 1ENPA 3I62A 5K03A 2P30A 4MJ3A 2D7CA 2Q5HA 3DNMA 1A04A 3IRVA 4NCKA 4NHOA 4CM4B 4FGUA 1FFAA 3A3OA 5JSQA 1QBGA 1MO4A 4MWCA 3MJVA 1C8VB 4ZK2A 2FFQA 2OUKA 4AS3A 1PBTA 1TLFA 3KEMA 3EVNA 4FFBA 4MRSA 2ZI9A 5G40A 5KC9A 4QHSA 1EK5A 3R24A 4HQNA 3ABZA 3DYIA 1PSWA 3ACDA 4J8PA 4M4SA 4R69A 4JJFA 4HR7A 3VMFA 3WBFA 4HF7A 4W7IA 4LXGA 3PDJA 5HRUA 2QUZA 4N0EA 4PCLA 1L1EA 1Y81A 1TTQB 1ONOA 1WW2A 2VG8A 2JD1A 2VP2A 3FMVA 1UK9A 3N2YA 4E4YA 4BFLA 5A1TA 1SCUA 3I58A 3PBKA 4FOTA 3T61A 5IUKC 3VPCA 1X14A 2PSHA 2VDMB 1H2AS 1NU6A 2FMHA 1ODTC 2WTBA 2R6FA 3G0GA 3NHUA 1NMYA 1Y5MA 3KE9A 1OCEA 3DNPA 2VAMA 3BGIA 4RK1A 2ANBA 4WWHA 2IWHA 3WGLA 5BVHA 3VR6A 1YB5A 2JH3A 2MSNA 4LN1A 4YGXB 5DBHX 3ZGYA 3BWMA 4CKEA 2WYUA 3S1SA 3NX4A 4IINA 1A9YA 4JI0B 3KSRA 2DTXA 1D2EA 1X7YB 3GQBB 3L7KA 1D07A 1T1RA 5SZHB 3EEIA 3LHSA 1ECBA 1KYZA 1WZIA 1PJ8A 1GD1O 4RPLA 3SLKA 3PCXA 4QO8A 4KRFA 2QLFA 4U3JB 1IXKA 4C6SA 1U0LA 1UKAA 3HYNA 1TPYA 3LVQE 3UK7A 5KQRA 2XKBA 3BRCA 3V2UA 3DE2X 1L4LA 1I32A 1P9NA 3FMIA 3SPXA 4OLAA 1L5VA 4HXYA 2UVPB 3T7RA 3H84A 2VP4A 3TLAA 3OX2A 4KMOA 1AUXA 2DKFA 3KVVA 4QFBA 3VNRA 4AC9A 1KH3A 1IXYA 1E98A 2GSDA 4QUBA 4CLOB 2QRZA 3DOOA 2AHRA 2YVKA 1YJXA 4PPGA 4MH0R 5FPQA 2QTMA 3EDCA 3O8QA 3RJTA 2MYPA 2WWVD 2VP3A 1U0RA 1HX7A 3O9ZA 3H04A 3QPUA 2X15A 2R97A 5BXYA 5AVQA 3LKBA 3NM5A 3L79A 4N47A 5KREA 2V7QA 1FDRA 3RT7A 1VE7A 3QKWA 1Z6GA 2HNAA 3HE3A 4UEQA 3ZC3A 2CJWB 1KHTA 3HZZA 4G0PA 1UPFA 2AX4A 2Q2WA 1Z5NA 3DMFA 1ND5A 2C29D 2Q0SA 3BRSA 5LZ7A 1D2GA 3E35A 1QKKA 4TLLB 4IQ8A 5EESA 1WXGA 5I5EA 5GGXA 3HUEA 2SCUB 5FPYA 3DV0A 1NW8A 1PHPA 2GXQA 3AP2A 5EWJA 1M34A 3W2TA 4MNTA 2Q28A 2VCYA 4IV5A 5CLGA 4LVNA 1RPZA 3EEBA 4P98A 4XUDA 2I66A 1CJBA 1EWTA 3RRMA 4UHCA 4JUBA 5DX8A 1E2BA 2G0AA 3LQQA 2JD2A 4ROTA 1CX9B 4EPXA 4XGQA 5FA6A 1O96A 4TQAA 4PQFA 5IS2A 1SHUX 3HVKA 1GFZA 5TF0A 1KU0A 3PPVA 5CBPB 3V4RA 1ZD4A 1UC5B 4YRDA 1KMQA 2VAWA 3IJEB 3KHUA 5CNKA 5ALIA 3WTBA 2Q1XA 2NXCA 1Q20A 3O8BA 2OXEA 4IOJA 5BP7A 2NYVA 4YMUA 1I4DD 4RCYA 3ADOA 3MF4A 5AIAA 2FWBA 4WOCA 5H80A 5BSKA 3VR4D 1EFDN 3ANTA 2AFHE 5DBOA 1SOAA 2H00A 4WXPA 3JAWA 3STUA 4CMJA 4CQMD 1CIVA 2CVHA 1HDEA 3A3PA 3L8CA 1EX9A 1N2SA 2TECE 2UYGA 4BBZA 1WUHS 4FLEA 2XNJA 3DGEC 5LN1A 4XVQA 3DBLB 5IX8A 4DR4B 4BJ1A 1C0EA 1OYWA 2IEDA 2WW8A 5B30A 3DO8A 3QPBA 1G8MA 4KWHA 3DKIA 3VR3A 3QEMB 2PX0A 4J0DA 3RAEC 3LUJA 4P38A 4Y9UA 4KR9A 5KDDA 1AK9A 2IYEA 8AT1A 1V9LA 4HG2A 2G3YA 1SUFA 1ZNXA 5IF3A 1E2MA 3KHSA 4D99A 3C1AA 1EE1A 3D7KA 3TXXA 4ETMA 1TQHA 3NHRA 3W2FA 5AK4A 4ZT4A 3QKSB 2J0SA 4K2AA 3FETA 3K0CA 3PLRA 5FO0A 2BGNA 1EGMB 4N3GA 5IEJA 4XIJA 2NU9B 2ZBQA 1KY5A 2C97A 2OVBA 2ZJFA 5LOVA 4G1FA 4BNJA 3FYHA 1MF7A 2WUDA 3OPVA 4Q9NA 1QQAA 1SQGA 3GFOA 3RBZA 4LQLA 4WGFA 4CMIA 3BB4A 3FPJA 3TIGA 4XASA 2O6LA 1BEEA 1H0KA 3FI0A 4P4NA 2QXUA 2D59A 3Q0TA 1Z33A 1GZ3A 3KLMX 3R3SA 2HREA 2JJYA 2BKVA 1PYDA 4J0EA 4XX0B 3ZDYB 5IJWA 4FKMA 2UVDA 1NVWQ 3CNLA 4BU1A 2Y9PB 2PX6A 5GJVC 2HWXA 5CHEA 1I4WA 3OOEA 2DT8A 4FC7A 4AKEA 4MQEA 2ODTX 2X5XA 5A04A 3WSVA 3C14C 1Q1ZA 1V5EA 4QLOA 2GBIA 2PBZA 2ZP1A 8ADHA 4JL5A 3C39A 4KLNA 5G3YA 1IMOA 3A6PC 5HKKD 3HADA 1TT7A 3DQQA 5BQXA 4TYYA 4EQZA 1JTFA 3I4FA 1Q0ZA 2GVZC 2OZLB 5DCWA 5HW0A 3TBKA 4G67A 4UTPA 1YOBA 4H16A 2P1RA 3W7BA 4DNQA 5HPYB 5B7QA 1E7QA 1VJDA 3WJ1A 1R16A 5G4KA 4GM4A 2OK7A 2ZSDA 2HSWA 2I4TA 3ZK7A 1UDAA 4R68A 3B48A 3BD7A 5T4EA 2X86A 2XA2A 4UUBA 1M1NB 1UWCA 3CW2A 4MHTA 4MDYA 1LW7A 1NWCA 2JFYA 3ZWCA 1O5OA 1JJAA 4PHHA 5G02A 3T6KA 5PNTA 3R3JA 1CEYA 4PBSA 1MG5A 5B5SA 2ZB2A 1QRDA 3V00A 3IDAA 1DBWA 1QVRA 3OM9A 2D3TA 4LSZA 5CEJA 2JIPA 2YFHA 2QD2A 3FCYA 1EGHA 5HZHA 1C8BA 3M7IA 3WXMA 1LLFA 1DBQA 5J9FA 5K0JA 1K5HA 5CNMA 3CPSA 4S1WA 5K3OA 1DRWA 3TLJA 5SV2A 5HILA 5AVWA 4OMDA 3PFFA 2P9GA 13PKA 1TEVA 3ISVA 5GQSA 1ISMA 2CXXA 2LR0A 5SYMA 5LQKA 1W9HA 3V8MA 2PXCA 3SEFA 2J59A 3D2AA 1OXVA 1M8FA 4OQLA 5T8KC 3VYVA 5KCMA 5A4FS 1F2UA 3L7LA 3RK1A 2D1TA 1E62A 4RD1A 1KVTA 1Z6PA 4YCLA 1W2GA 5DBFA 4E70A 4ESVA 5F2KA 1LI7A 5JD3A 3MJ4A 1BFUA 4XH9B 1D5CA 1FLDA 4D5GA 5A6SA 1UBMS 2O54A 3MEQA 1I5RA 1O9BA 1NG9A 1J2RA 2B8NA 4IX1A 3USES 3D4NA 1VG9B 2EL7A 3QPVA 3KQLA 1P7ZA 4CF6A 1KMHA 2VSYA 2H4ZA 2GPWA 3AEUA 4UEKA 3WOHA 4AIRA 4ITVA 4MIKA 3I72A 3OT1B 1YAHA 4R2HA 3OSZA 1ZJWA 3HNRA 5HTKA 4HJXA 4DIFA 1SGWA 3CH7A 5B1DA 1PFUA 1PZEA 3RK0A 3CXUA 3PUHA 1D9XA 4KFUA 5AI8A 3UWMA 3EVTA 2RGAA 3U1TA 3CUSA 1AZTA 1ESEA 3E70C 4B80A 3G5AA 1T13A 3K0FA 4YEDA 1AKYA 3NGXA 1I9CA 4JB0A 3CLRC 1OB5A 5AYVA 4OLJA 1KEKA 4ENVA 3BK2A 4KFSA 1M1UA 3VJMA 3ADCA 4B8YA 3H1GA 5DRYA 2QQEA 3BJIC 1R8YA 3AZPA 1DO0A 1TXGA 1AJEA 2D62A 4B33A 1OV4A 1ZG3A 1CR4A 2A92A 1WW8A 2XMSA 2QL7A 2ZG6A 3LP8A 1KZGB 3K0AB 3ND5A 1J7JA 3OJWA 5D1NA 4DMKA 3EGIA 4KR6A 1ZI6A 1A9XB 2F62A 2KMLA 4JI7B 3EQZA 3LXUX 3TUZC 1N2JA 1OWPA 1EFRD 4GPZA 4KQGA 4QFCA 3DP9A 1SCNE 2XVAA 1FFYA 5K20A 3FCOA 1I7DA 3KPJA 4J6FA 2XBMA 3SU8A 4ZN6A 3QLUC 2I54A 3TAXA 5IJ0A 3NU1A 1EXVA 4LXTA 2BHNA 1SD2A 5K6AC 1B43A 5EMHA 4U5XA 1T2CA 1F6WA 4FBGA 4ZVKA 5G4LA 1WETA 2FW1A 2Z58A 5F5NA 3SX0A 1NG1A 4EHBA 1TAUA 2GTPA 4IDOA 4B6JA 4XWOA 1LNSA 1FRNA 2X0DA 2W2LD 4P0TA 3ZCQA 4Z7QB 2V3CC 4C1BA 4Z0NA 2PK3A 3KQOA 5JNTA 1ETUA 4AWXA 1AGXA 5AVXA 2X7HA 4P83A 4PO3X 1DAKA 3QUCA 2FSVC 1KJJA 5LIRA 1RAAA 4IQ4A 2R0QC 1NVFA 5FORA 1NAIA 2C98A 1ZS9A 4L0DA 5F51A 5KSYA 1Y6RA 5DDIP 2XB6A 2BHSA 3MJDA 4JLMA 4B79A 1Z0FA 3ROTA 1T5LA 4CDMA 2NP7A 3LOPA 3HVHA 4EFDA 3RHFA 2OFWA 3NDBB 3AI1A 1ZW1A 5CK4A 3SSOA 1BTOA 5DM1A 5T7BA 1S2DA 3HU3A 3AHFA 1I13A 3BL6A 3L6CA 4URUR 3T1TA 1SB9A 3T5CA 2K7FA 1A8UA 1AY0A 3GXOA 3L02A 1UBKS 1R64A 2ZAGA 1SA0B 3F3SA 5DLPA 4EVRA 1LRKA 5ILOA 4J1NA 5AM5A 5ETJA 1CJTC 4DV5B 1Z4PX 4WZ6A 1ZFNA 4X1KB 1CUWA 4XX1A 4BEJA 1AQYA 4GQIA 2BR4A 1DZIA 3H2GA 4O4JB 2OLKA 5B3LA 4KAXA 4WCFC 1R8JA 2VUTA 4EA9A 1SD1A 1E3WB 3FYCA 3BCRA 4MV7A 3OE5A 3ABIA 4WI1A 3TLKA 5KYTA 4IUBS 2C2WA 1W49A 1ZK1A 1LSSA 2OCPA 3U4AA 4G1CA 2EAUA 4TKZA 3BULA 3B36A 5FJIA 4RDXA 4MVJD 1HLPA 2PGAA 3FPEA 4LYJA 5CH8A 4YB8A 3HBMA 4DMCA 4DRXB 4IQ0A 1V1MB 4BLSA 3L2OB 5JADA 4RHCA 2YHBA 5CCXA 1RM3A 3CPEA 3KLOA 1IY1A 2JJ8A 4ZT5A 4N3BA 4PNEA 3RRFA 1KZ9A 1RLOA 3VRHA 1Y4SA 2VJMB 1MXHA 1TCCA 1W46A 4M1KA 5C8VA 1WCIA 2FQXA 5JTUA 1ENOA 2WWTA 1VBNA 3O26A 2RGBA 1C8LA 3H05A 2OZVA 3NM4A 1IHXA 3O3CA 4CTMA 4NE7A 5TRTA 4BAUA 1EEXB 3BHNA 3DFFA 3GP5A 3O0TA 3R3HA 4RE5A 1PEDA 2Q1SA 4I5IA 1MZPA 1KIFA 1PGQA 2EL9A 2FEWB 3AVXA 3TD6A 1NLYA 2XOKA 4HDQB 2ZBFA 4FDVA 4ETWA 5JDIC 2B69A 1VL2A 1N3LA 1H69A 4ZGGA 3DWIA 1TPZA 4QXQA 4OGKA 3E9NA 1N2IA 2P11A 4PPQA 2ZRPA 4LHEA 1KVUA 3M9XA 1DJMA 2ZQYA 4QGAA 1FMTA 4PO1A 5L8VA 5E4JA 1SBHA 1RZUA 5IJAA 4JI6B 1P29A 2XYGA 4PZCA 4R8RA 3GAAA 3H99A 2HLPA 1EP9A 3DGFC 4GBGA 4PFKA 4ZQEA 2XRFA 1GTZA 3GDHA 4IY1A 1HZZA 1YS7A 3AF5A 3W3AD 3HM2A 1J0EA 4KXFB 4WXRA 4GXRA 1JEQA 3B3FA 1FSPA 1NT4A 3W5CA 2WVHA 4WX2B 4TVOA 1RYYA 1FMFA 1EUYA 5ICGA 1AXGA 2YBEA 5DNCA 4AO7A 4HDNB 4OHFA 4JD5A 2JLWA 1MPXA 5JJKA 3VA7A 5CB4B 2H1CA 2UUOA 1GCIA 1UDBA 1W44A 4C3OB 3WX0A 1N4AA 2CSXA 5HMLA 1GL9B 3ESAA 5DGCA 2IYLD 2A9PA 3FGPA 3DT8A 4XE5A 3J81A 2CVQA 4IGKA 3H1FA 3RWMB 3OKAA 1HRDA 2Z9CA 4FMPA 4ZDJA 1Z35A 3ANNA 3IB6A 4G1MB 3LBAA 2QB5A 1Z0KA 1E1DA 1FFXA 1Z39A 3UQYS 3IBYA 5KS2A 2KI5A 1G2QA 3WMXA 1TYDE 2V6FA 3RH0A 5K3EA 3K5PA 2EIHA 4FR5A 1IQPA 3L7YA 3ZJ5A 3JVVA 3ZVMA 1TF7A 2ZDHA 1AS2A 4JLSA 4RMIA 3TM4A 5KKNB 2IZ1A 1R4MA 3D1LA 1H0SA 5IXSA 4PC3A 3AWDA 3H9EO 2A6PA 3M4XA 3IGFA 1NV9A 3HYCA 1IVNA 2QT9A 4PZPA 1NPDA 5FA8A 1WEKA 4KZKA 3LT2A 4N8EA 4G24A 2C99A 3R3XA 2HU8A 4ZCLA 1HRKA 4MUBA 4FFSA 5KOJB 1VSTA 2H07A 3OLZA 1SZJG 3E1SA 1RS0A 4PXSA 4EABA 3GRVA 3ZS8A 1EBUA 1AQIA 3G8DA 3L7MA 3PE4A 4B4KA 2ZUEA 1KOFA 3CX4A 2Y9MB 3T3HA 2OR3A 5AW9A 2IPXA 2ZT7A 4OKNA 1GRCA 2A78A 3I3SR 3PTZA 2Q3EA 4YUAA 4J90A 1XDUA 2C5GA 5DULA 3IV7A 4O25A 2H1FA 2W5UA 5HFAA 3LL7A 5I51A 5J2TA 4ZI7A 3DPSA 1MCZA 2XOEA 3WQRA 5E7QA 1KE2A 1PJ3A 1Q44A 5FBLB 5JSUA 4HLCA 1JVNA 2BHLA 2LVBA 4AMUA 5CXUA 1TE2A 3R20A 2XUKA 4I9FA 4JN6B 5I5GA 4BKMA 1TQDA 2IUEA 2QY6A 3C6KA 3KG2A 2JFFA 4YECA 4A0SA 2NYRA 2YJTD 2KX7A 1OBHA 3ZCPA 1OGJA 3BB3A 3VJKA 4AKIA 4HBGA 4L8WB 1YBAA 4M1YA 3WL7A 2HO5A 1P31A 2D0PB 1ITZA 2PX4A 3V4LA 2QG9A 4LHSA 1OU4A 2IOYA 2P3OA 3TFWA 4DA0A 1U28A 2GCOB 3KFXA 4DLXA 1TD9A 1Y48E 1K27A 5KOIA 4DUZB 3ER8A 2WM8A 1KVQA 4DRYA 1Z74A 3B9RA 3EDOA 4KO8A 3WL8A 3ER9A 4JKYA 1Z5WA 2BCJQ 3ABOB 2DQKA 4ENRA 4F5EA 3D3WA 2CYAA 2JIMA 4UBKA 1XZCA 3OQHA 3KYJB 4R1QA 4ZQBA 4YLYA 5A2GA 5IPFA 5JDCA 1LJUA 4YH1A 4ZVOA 4DR5B 1BCRB 4Q66C 3M1LA 1LEHA 3M6AA 5EXSA 1YE3A 5JCOA 5JE8A 5IXJA 4E0BA 4LDZA 2WZCA 3MWDA 3AR5A 3V2HA 3IH5A 4KE7A 3PUXA 1SBIA 4V3CA 2E4ZA 4RTRA 4G25A 5CA1A 3PX3A 1OFUX 1XP8A 2X1VA 2D8MA 4I5DA 3N8KA 4QYMA 3TAHA 3TW6A 4B81A 4D44A 1E77A 1YZ3A 1Q0HA 1ZCBA 2CHEA 4B3SB 3BTUA 1XZGA 2WD8A 3HZOA 1O6BA 3BMNB 1GU7A 1QWOA 2QS9A 4CLDA 2H0AA 3L46A 4MITA 5ALRA 4B71A 2BIFA 5GTDA 3PGVA 4BC1A 1IHUA 1G9TA 2HOQA 4ACBA 5L4SA 3MRSA 5FR1A 3RLIA 2X4GA 1GSHA 2X1MA 3SLRA 1FNMA 2O2EA 3QLEA 2ISQA 5C1DA 4L5IA 1J42A 1CEEA