2AOUA

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouA00
4K6MA 3UJBA 2WA2A 2H11A 1B42A 3DUWA 2Z6QA 3FPGA 5HILA 5DPMA 4E33A 5ERGB 2QRVA 3B7PA 3SMQA 2PVCA 5C1IA 3HVKA 3C3PA 3DTNA 1JG4A 1EJ0A 1TW2A 2PX8A 2JJQA 2O06A 4YV1A 1YUBA 3LKDA 4PWYA 5LQAA 2UZ4A 2IDKA 2PXAA 3KQSA 1P91A 2NXEA 1KPIA 2GLUA 3DOUA 1JSXA 5HFJA 3U81A 3DP7A 3PFHA 4BLWA 2VDWA 3DXXA 3TRKA 2C7OA 2HTEA 1I9GA 3GIWA 5F2NA 2FK7A 1G55A 2I62A 4RTRA 1ORIA 1FBNA 1YFLA 2YXLA 3GWZA 2PWPA 4EVIA 2AOUA 2BH2A 3MTEA 3A7DA 3IYLW 3OE5A 4GBED 5FULA 5EEGA 1KIAA 3MAGA 5EIWA 3VYWA 5LQUA 3LCVB 2ZIEA 1FJXA 3D2LA 4QVKA 4E31A 2UYCA 1RI5A 3ME5A 3P9CA 3KQOA 4RV9A 2XVMA 5CVJA 2ZTHA 5E1BA 2C7PA 2LD4A 1O9GA 1WXXA 4R6WA 1BHJA 2I7CA 3HM2A 1EQAA 1P1BA 2FYTA 3KKZA 3TKYA 4AZWA 3GRYA 5DX0A 5BP7A 3O4FA 4U7PB 4V0QA 4QTUB 3C3YA 1XVAA 1R8YA 1R8XA 4FT2A 5DLYA 1G6Q1 5T6BA 3HVIA 4HH4A 3R3HA 5FTWA 4FGZA 4F86A 4E2ZA 4M38A 4FT4A 3FPEA 2HMYB 5B1SA 2CMGA 3QV2A 4C03A 3FYDA 1NW7A 1VL5A 3EVFA 5DXAA 4OX9Y 3A25A 5LSAA 3CBGA 3BGDA 1X1CA 1XXLA 3B3GA 3DH0A 1XCJA 2AR0A 2HNKA 2ZIGA 2ZULA 5T64A 1BC5A 3OU7A 3FUVA 2ZZKA 4ATNA 3FUTA 3MCZA 4QTTB 5K8VA 2P35A 4RX1A 1N7JA 5E1DA 5KS2A 1NV9A 3IHTA 4AX8A 1UFKA 2VP3A 2BM9A 1V39A 2YR0A 1AQJA 5E1MA 1L9KA 4E2YA 3BT7A 3FUXA 3KQMA 4C06A 1JQ3A 1R74A 3MTIA 2FPOA 3G88A 2CWWA 4BLUA 5GIOE 1RI4A 3SM3A 5EG5A 1YZHA 5BXYA 3MB5A 4PYIA 5P8WA 4RTMA 5EGSA 1I1NA 4KIFA 2EJUA 2QYOA 2FCAA 4LECA 2R6ZA 3AWIA 1D2HA 3M6WA 5GP1A 5T67A 2H1RA 2IH5A 1I4WA 2BR4A 2VDUE 3KPUA 3FTEA 3BWBA 3B3FA 5K01A 1YF3A 3NVKI 2IBSA 2B2CA 3G2OA 4MWZA 3NJRA 4RTJA 3MGGA 2H00A 4E70A 2ESRA 1JG3A 1M6YA 1SG9A 3ELWA 4M37A 5CM2Z 1JTFA 2OXTA 3E05A 3B5IA 4R8RA 2HWKA 4AZVA 1INLA 1X19A 3BWYA 5IH3A 5FA8A 3C6MA 4GC9A 4KDRA 1R18A 2DULA 5FQNA 5C9ZA 1L1EA 1WS6A 3JWJA 1MJFA 2NYUA 3CJRA 1SVUA 5IKMA 5FA5A 4GOMD 5HIMA 3PLAE 2PY6A 3TOSA 4OQDA 3G2MA 2PX5A 3LCCA 5FUBA 1XDUA 3DLCA 3DMHA 4IV0A 2O0LA 3FRHA 5K09A 3GCZA 5DT2A 1WG8A 1X1BA 3EVCA 2NNWB 4PNEA 4EK9A 2OPBA 3UWPA 4YMGA 5EKXA 3G5TA 1PJZA 1X1DA 1JSZA 1KPHA 5CD1A 4YUXA 3P9KA 5HIKA 4X41A 5EMLA 1VIDA 3ERCA 2CL5A 5MHTA 2WK1A 2UYOA 1P39A 3LCUA 2P3OA 1JG2A 3I9FA 4PCLA 4MHTA 3C6KA 1L3IA 1QAMA 5E9QA 2P40A 3LPMA 3OCJA 3OZSA 1TPYA 2YVLA 2OYRA 1XDSA 3EGIA 1VLMA 1PRYA 3DMFA 3BWCA 3LGAA 4NECA 1BOOA 2PBFA 2ZFUA 10MHA 5CCBA 3UFBA 4P7JA 4GOLD 2PT9A 2BR3A 5K0CA 4EKIA 2PX4A 3K6RA 3FUWA 5FWDA 4U7TB 3PB3A 3UBTA 2YXDA 4QQKA 4PGHA 3KR9A 4CKBA 1QZZA 3VSEA 3HP7A 2PJDA 1UIRA 5E9JA 5GINE 1YZ3A 3R6TA 5DSTA 2IH2A 4GC5A 1L3BA 1N2XA 2G70A 5JUWA 2P7HA 4PONA 2P7IA 2EFJA 3V97A 4A6DA 3KQVA 5EHIA 5EMMA 2OB2A 3A26A 4LG1A 1EG2A 2HR1A 2BR5A 3A4TA 3OU2A 2AN4A 4GEKA 4PINA 2EJTA 3UJ9A 8MHTA 2XYVA 3G7UA 3EVBA 1NW6A 3KQPA 5LQJA 3BKXA 4R8SA 5E8RA 3UJAA 3LECA 5EZSA 5LQRA 1YB2A 2ZW9A 4BP1A 1U2ZA 2ORED 4HSGA 4GOND 3RW9A 5CVEA 4HTFB 4OBWA 5DWQA 3TKAA 4BP3A 4ER0A 1H1DA 2QY6A 3CCFA 2AOVA 2OKCA 3TM5A 5CVUA 4E32A 4PYNA 2PGXA 2PT6A 3E23A 3EVAA 4WXHA 3FPJA 3SR4A 4O29A 2C7QA 4C05A 5CVDA 3PTAA 4KDCA 3ELYA 4DCMA 3OPNA 3JWGA 3DXZA 3UA4A 4FSDA 1Q0SA 3FZGA 2AN5A 2ZZMA 3QOXA 5FCDA 3NMUF 1FPQA 3CKKA 4KVZA 1MHTA 2ZZNA 3FTDA 4QVGA 2IGTA 3BKWA 3KPWA 4ER6A 5KQRA 2IBTA 1KYZA 1FP2A 4FS8A 4R05A 2YXEA 3M4XA 1D2CA 4HRAA 3VC1A 1KR5A 3GRUA 2ERCA 2OB1A 2NP6A 5DM2A 4G56A 3I58A 3KU1A 3UJ6A 2O05A 1JQEA 2ZBQA 2NXNA 4M7RA 5E1OA 4FR0A 2OZVA 1NKVA 3A7EA 2ADMA 3TR6A 1RJEA 1SUSA 1M6EX 2GH1A 2JHPA 2V74B 5CUQA 3E8SA 4RYLA 2QRVB 1ZHFA 2JHAA 2NXJA 3LBFA 2G72A 2XVAA 2AOTA 5G02A 4DZRA 5HIJA 2UYHA 3KQTA 2Y1XA 1KHHA 1WZNA 3F4KA 2ZWAA 4E30A 5DRYA 1JQDA 2P41A 4HC4A 4ISCA 3UA3A 4A6EA 1R00A 1ZGAA 4PYJA 3M70A 4QQNA 3KQWA 1F38A 3SSOA 3LX6A 1RJDA 3PS9A 2ZVJA 5E2BA 5GWXA 2B3TA 1UWVA 3AJDA 4XUCA 2G1PA 1XDZA 3T7RA 3UJ8A 2N47A 4DF3A 1VBFA 5FHQA 3V8VA 3KQYA 3GDHA 5K0NA 3P9NA 1T43A 2AOUB 3KR0A 3OU6A 1XCLA 2P3LA 3BXOA 1G8AA 1NE2A 4RSRA 3SX0A 3BUSA 4AZSA 2BM8A 4P7GA 3NWEA 1VQ1A 3B89A 4Y2HA 3GNLA 3LL7A 3BGVA 2WA1A 1O9HA 1FP1D 3SXJA 5K0EA 4CXMA 4PCAA 3P2EA 4R6XA 2IH4A 3SGLA 2PV0A 3ELDA 3FTCA 4P58A 4PYLA 1SKMA 1DCTA 2GA9A 9MHTA 2XYRA 5K0JA 4PIPA 3TM4A 1P1CA 4BLVA 4YMHA 3GU3A 4X60A 4CTJA 5DSXA 5GM2A 1EAMA 3I5UA 3LDFA 5K0FA 5K0LA 1YFJA 1RI2A 3CC8A 4M36A 3T7TA 4AZTA 2NXCA 1ZQ9A 2O07A 4RVDA 5DRTA 2P3QA 4FP9A 5HIIA 7MHTA 3BWMA 4UOEA 4HGZA 3KHKA 4Y30A 3LBYA 1R6AA 2JG3A 4C08A 3HCBA 1F3LA 2FK8A 3NDIA 1HMYA 3HCAA 5KYGA 1M0EA 2GS9A 4FSXA 3FPFA 4OQEA 3UZUA 1ZGJA 4RTPA 2PXXA 3BGIA 3LHDA 3AXSA 4IV8A 4KW7A 5EKUA 3M6UA 4PYMA 5EPEA 5EQJB 4CTKA 2QE6A 3OFJA 4CKEA 4YUYA 1IY9A 4X1OA 5GOZA 1IM8A 5CVVA 5K0BA 3HA3A 2I9KA 3EGVA 3G2QA 3K0BA 3C0KA 5FADA 4H0NA 4YV2A 2AOWA 4GQBA 3HCFA 2ZCJA 3Q87B 2DPMA 3IEIA 1KPGA 4RVGA 3EMDA 4MIKA 4Z2YA 2OBFA 3GJYA 1VE3A 4HG2A 1JTEA 3P71T 3AY0A 3HVHA 5EC8A 3T0IA 4YUZA 3HEMA 5M5BA 3B3JA 3DLIA 3EVGA 3GXOA 3REOA 5LQCA 1KYWA 2B9EA 4IKPA 3ELUA 2YTZA 2PSSA 1VPTA 1KXZA 2FHPA 3A27A 5ICEA 1XTPA 3EEYA 3NDJA 1SUIA 2IIPA 4QPPA 3OZRA 4C07A 3KQQA 3GGDA 1SQGA 5EZQA 1N7IA 1AQIA 3HNRA 1G8SA 3P97A 5EOVA 3HCDA 2ZLBA 5DM0A 2AS0A 5K0GA 2KW5A 5ICGA 4P7FA 2OO3A 5KVAA 3RIEA 2ZIFA 2XBMA 3LDGA 3NTVA 2V7EA 4DMGA 4YUWA 3ANXA 5ICCA 1DL5A 5EEHA 2PKWA 2UYQA 2VS1A 3O7WA 4DQ0A 3M6VA 1SQFA 4RTKA 3ORHA 1QAOA 4KWCA 3PX3A 5HZMA 4E2WA 3EVZA 3DR5A 1Z3CA 1NW3A 2QM3A 1NT2A 3NVMB 1RI3A 2AOXA 1RI1A 4MQ4A 3ER8A 5DTQA 2HV9A 3GRRA 5EMJA 4PIMA 1Q0TA 1NBIA 2ZBPA 5CIYA 3R24A 4F85A 3EEOA 3EVEA 3MERA 5FHRA 3FTFA 2O57A 3HTXA 3G8AA 3KPVA 3OZTA 2VDVE 1NW5A 1ORHA 2P8JA 2Q41A 3KR1A 5FQOA 3S68A 3UJCA 5F2KA 1BKYA 3ID6C 3JWHA 3MQ2A 2C7RA 4C04A 5BW4A 5E2AA 2AVDA 2YQZA 3VC2A 4RTLA 4QDJA 4IWNA 1WXWA 1ZKDA 4B17A 2PLWA 2JH8A 4PGGA 5DTRA 5GIPE 3BZBA 3O31A 4X61A 3EGEA 4DKJA 1RJFA 5C0OE 4JXJA 1D2GA 3LDUA 3TFWA 5DTMA 5EIFA 3THSA 3OE4A 3G2PA 4L7VA 2PWYA 4RVFA 2CKDA 2IP2A 4ZTBA 3QOWA 2I6GA 3I53A 3X0DA 3NW9A 1NV8A 3Q7EA 3G8BA 3ER9A 4DCGA 2F8LA 3IV6A 4PYOA 5DXJA 4CWAA 5D1HA 1OR8A 3HCEA 4EMSA 1HNNA 5HOQA 2A14A 1AF7A 1EJ6A 1TW3A 2R3SA 3FUUA 3UJDA 4GUAA 2YUIA 1G60A 2PXCA 5H02A 5U4XA 2PX2A 3P8ZA 3FPHA 1AV6A 2E5WA 2GB4A 5DX8A 3RODA 3FYCA 2IPXA 3HA7A 1O54A 4RWZA 4POOA 4X63A 5GM1A 3GRZA 3DXYA 3JWIA 2NP7A 2IFTA 3AXTA 3L8DA 2B78A 3DMGA 3EVDA 3WSTA 5HEKA 2Z6AA 3CGGA 4RTNA 4RTOA 3MCTA 2ONYA 2ZBRA 2ONZA 3HA5A 3LSTA 1L3CA 3HCCA 2B25A 3SSMA 4KRGA 3PX2A 3KR2A 3TQSA 2AZTA 1G38A 2P1DA 4YV0A 2OY0A 3KPYA 2G71A 3HVJA 1IXKA 1VP3A 4RVHA 5FWAA 3UJ7A 2AN3A 4ER7A 4PYKA 4WVLA 5EMKA 1QANA 3GO4A 4EQZA 2CMHA 3OFKA 5LR6A 3R9XB 4OA8A 2G8NA 3P9IA 4RTSA 5E8JA 3PVCA 1JR4A 3FRIA 3DULA 3SVZA 4GOOD 3TLJA 4GF5A 2IDJA 3R0QA 3LKZA 4QDKA 2JHCA 3SSNA 4XCXA 5E9WA 1EIZA 1Y8CA 3PT9A 5ICFA 4DM3A 4XUDA 4F84A 4RTQA 5LQKA 4HTFA 5CCXA 5K05A 1X1AA 1QYRA 2Z6UA 2EG5A 4ER5A 2YX1A 3KPJA 4KIGA 5JR3A 4ER3A 2AVNA 1NBHA 4OBXA 4YUVA 3CVOA 2ZWVA 3NWBA 3EMBA 3P2KA 4PYQA 1KP9A 3PFGA 5DX1A 3CJTA 4AUKA 3GRVA 4EKGA 5LQNA 1RJGA 3G89A 3M6XA 4FZVA 5EHGA 4XUEA 3H2BA 3P2IA 4LWPA 5K03A 2GPYA 2Y1WA 2ZSUA 1VP9A 1ZG3A 2VZ9A 3E7PA 2AOTB 2XYQA 3TPZA 1NW8A 5DM4A 2GAFA 4CKCA 5DM1A 5KQSA 3MHTA 5D1NA 4BY9E 4LWOA 4V0RA 4C4AA 4E2XA 2FRXA 2K4MA 3EPPA 2EX4A 1XJ5A 5EVJA 4DA4A 3TMAA 1WY7A 2BZGA 4OA5A 1QAQA 2JH9A 3G5LA 4MTLA 5F2OA 4QPNA 3T7SA 3THRA 5BW5A 3M33A 3CJQA 1DUSA 4P7KA 3I64A 1JG1A 4HGYA
chains in the Genus database with same CATH superfamily
3IPYA 2H11A 1YV9A 4G0QA 1YE5A 2VRWA 1UBKS 3ZS9A 5E3JA 3WIEA 1Z62A 2HA3A 4OXKA 2IKQA 3ZD9A 2KX7A 4KFRA 4EG0A 1IYZA 4C0LA 4H7IA 2BEVB 1DFIA 3RHTA 1UK7A 4RDXA 3CISA 4K9QA 2EATA 3LYUA 4WOPA 3SEQA 4U6NA 1JH9A 1JDSA 4I4TF 2OP0A 3A9RA 5B2FA 2ZT6A 4A1OA 2YFQA 3ED1A 1MFZA 3EQ9A 2FGKA 3FYSA 4BLWA 4QM7A 3A1WA 2HWYA 4RLHA 1O8BA 1LSSA 2OFWA 4S1WA 2OC9A 3VU8A 1XJWA 2PAFA 4JC5A 1H1LA 1KU0A 2HU7A 3NFYA 3FWHA 4BMPB 3BWDD 1VJ5A 3HVUA 2YS7A 1DOZA 4EYOA 3GJRA 5LQUA 2C4NA 2O48X 1MD9A 1EM8B 1R0BA 4E31A 4B85A 1P2BA 3RUHA 1PJQA 4A27A 4FVTA 1IQUA 4YRIA 2IEBA 1IK6A 3DYVA 4I08A 2PKQP 4QD3A 4RKFA 4C7BA 3QBEA 5IAAA 3NRBA 2G4VA 1XZBA 1QHGA 1B00A 3AJAA 3R4CA 5U4QA 1I2BA 1DUIA 2AYZA 4PQRA 4CF5A 1EVZA 5CLQA 4HAXA 4UVHA 2HA0A 3ZU4A 3DNFA 2FYTA 3EWNA 1DIRA 4V0QA 4LJRA 1C3VA 1YIDA 2IYZA 4JLUA 1R8YA 4XLZA 4FT2A 2OO5C 1UOOA 1VIYA 2C2HA 2R5FA 3QPDA 1OKKA 4G1UC 4GYKA 4XVRA 3HJFA 1JR3A 1WDKA 2H48A 1RC0A 4MXDA 5JS2A 1SVMA 3O8RA 5KX5B 5IJ0A 1NW7A 1V11B 1HTBA 1UBMS 2IQ5A 1ZSVA 2VXCA 3H5LA 2J0QA 2LE0A 2ZULA 1KAEA 1N6RA 2HO5A 3U19A 4GX0A 1UJ4A 6YASA 2XAUA 1DDOA 3FUVA 3E8XA 4KSCA 4C9BA 4UNRA 1P4RA 4Q66C 4YA6A 5CT5A 3JATA 4KFSA 3RYHB 3V00A 4Q1VA 5BV1A 3BT7A 4ZDKA 2G4LA 1RJWA 3NNNA 3B1YA 3CF4G 4J8PA 5T4HA 1IPFA 4TGLA 3U0VA 3FOBA 2QD3A 3KZXA 2NQ8A 1E9RA 5HBRA 5B12A 2QRKA 3SZOA 3EWIA 3IHKA 1J9GA 2JD1A 3CWZA 1U9ZA 3PLNA 2HWUA 2ZJ0A 3MINB 4URZR 2ZXFA 4ZT2A 5AKHA 3TZCA 2H1WA 1W6RA 1EHCA 1GZ7A 3KWMA 2AYYA 1G66A 1L8XA 2BEKA 4UM8B 1SHJA 4QIHA 1JT2A 1X19A 2JI6A 2XUQA 5LUBA 2Q5QA 1T3HA 1NOIA 1NF9A 3UAGA 4D26A 3JTEA 3RC8A 2VNIA 4MZXA 4YYEA 4JVLA 1K4KA 2A4MA 1U31A 2O3SA 2OGSA 4GBMA 4KUEA 3V4PB 3HY6A 4RE5A 2QVCA 3D6JA 4QL3A 3WLSA 1YJ5A 2ENUA 2XD9A 1T0BA 2OG2A 3OP4A 3R7WA 4YRSA 5LP1A 1QYXA 1ESMA 3MT7A 3OLXA 4JEMA 4NJEA 1Y3DE 1RQ2A 1A3CA 2B20A 3QFHA 4HN9A 1FCJA 1SVUA 3CLKA 3GVHA 2DVMA 3OWOA 2E0IA 3RSOA 3H19A 5A4JA 2ZB7A 4E6EA 3PLAE 1BWRA 3LZDA 3F46A 2WJ6A 3QJ5A 1ZMBA 3HJRA 4G5GA 2JZCA 4LJ6A 3AVOA 4NVRA 2D06A 4RIGA 1ATZA 4DBLC 4JT8A 2W8BA 2XGJA 1FK8A 3PDJA 2V5AA 2XLBA 2XZDA 3P9RA 3K0FA 4PFKA 1JQAA 4F3YA 3OPXA 1M0WA 2IYLD 1M2VB 4LZAA 3X2EA 1SXQA 1RTKA 2CL5A 4QUAA 2H17A 1I33A 1K68A 3UVEA 2GPNA 3MMZA 1OBVA 3I9FA 2IP4A 4JWTA 1Z2PX 2ZBGA 1NN5A 3C8HA 4E4YA 2B98A 2QORA 1XALA 1X92A 1HE8B 2EZTA 4CCYA 3WLAA 4I55A 5AJWA 2QX9A 1Z38A 3KBBA 1N34B 1MV8A 1NUHA 1PRYA 1NN1A 2X22A 3EPRA 3LLSA 3LGAA 3NI2A 3HDQA 2NZ8A 4NECA 2PBFA 3FW1A 3C8MA 1HC7A 4MH0R 2NUPA 2Z30A 2Q6LA 3IOCA 2VKTA 2OFPA 2FRDA 3BD7A 4XFKA 1XUOA 3DQQA 3E3NA 4GR4A 2QLBA 1RCUA 4N8DA 5DYTA 1KTIA 1RXVA 5I9BA 4HEHA 1F6BA 4CKBA 2R4TA 3U1VA 5B6JA 3FROA 5LLDA 1RZRD 3NIGB 1Z82A 1E1MA 3KEQA 5DN9A 1NC1A 3MBOA 1GZHB 3QF7A 1P1KA 1MRZA 1R6XA 3R6TA 4N39A 5A3SA 4BBAA 2HHHB 5CDYA 2MINA 4FFWA 3V8EA 2Y92A 1SA0A 1DO2A 1IH8A 4DSZA 4F9EA 2OB2A 4LG1A 1OI2A 4FYVA 1U2GC 2HYIC 3MM4A 8MHTA 1XP8A 1MJNA 3DDHA 3QIVA 5H3CA 1OH7A 2ANCA 1MG0A 2NIPA 4JP5A 1NW6A 5JCJD 2XHZA 4YRQA 4G23A 1OQAA 3OLYA 5EJMA 2Z57A 2AZDA 5DZSA 2QSUA 4IZ6A 3DW3X 1HZZC 1FTSA 2H29A 3QVXA 3MWEA 3HYSA 3URMA 1D0VA 5HPYB 4PICA 4WDQA 4Q7LA 1CSEE 3F7OA 2O6HA 2XTNA 3GFGA 1W25A 4NCXA 3J81k 4OQMA 3PZBA 4RM2A 3WRWA 3RWMB 3TCKA 4JHXA 3KSAC 1CF4A 2EGHA 3I04M 4PO1A 3ZDXB 4F1JA 2FXVA 1VI6A 2VUIB 3MQ4A 3OT4A 1Z18A 2CVZA 4MI6A 4X90A 1FJHA 5KYUA 3UAOA 2IS2A 3F71A 1GDTA 1BXGA 3NMUF 4PBRA 1MHTA 3NPAA 5C31A 3VNUA 3HJGA 1NLFA 4F38A 2VRCD 1G5FA 4NU0A 2VF7A 1KYZA 3ABIA 4WXMA 5AKKA 3SBDA 3THYA 5JVDB 2YXEA 3HBLA 1D2CA 4Q6WA 4BGVA 3AV0B 4Y6PA 3HHEA 5AM1A 2YKGA 5MN4A 4PLFA 2D1RA 5KJEA 1DXYA 2B7BA 3KVRA 4M7RA 1JQJC 1UJ5A 1GZ6A 3KVYA 3PHGA 1L5LA 2QOEA 1IDOA 2IGBA 3WNCA 2OZVA 4EUSA 2HREA 1KJWA 1A2BA 2V74B 3DEFA 3S1AB 4B3IA 2R1UA 1ENPA 5AWFC 5U1PA 4D8TA 4BOYA 2C2YA 1WMFA 3K5WA 4X20B 2GLTA 5FFNA 1AQYA 3L8EA 4N7BA 5B53A 5LKAA 1S2LA 3DO6A 3SLGA 2PV7A 1YZUA 4PYJA 3A0UA 3RKRA 3PPWA 1CP2A 2AEJA 5FBQB 3IDQA 3MWYW 3RHSA 4DA0A 3ILVA 1BIFA 1POWA 3DDWA 1E5LA 2AXQA 4J7XA 1UWVA 1V9LA 2D59A 3FYUB 1MO5A 3DOOA 4E3ZA 1DCKA 4Z4HA 5TGZA 1DPFA 2YJNA 1LJUA 4Q9JA 5FRDA 1M7HA 4IF6A 2H3EA 4JUCA 3GDHA 4AY5A 4D25A 3P9NA 2GVZC 1YVUA 1ZN7A 2F9MA 2ZUWA 3AT1A 3R7SA 1XCLA 5A4AA 3U4QA 2Y1OA 1P62B 4AZSA 4UTVA 4E6PA 2R8EA 2VDPB 2XXAB 4HLUC 4M1YA 2V7QD 2WA1A 1O9HA 2GBPA 4HQRA 4OJMX 4QNMA 4FYYA 1HOTA 3SXJA 2P8SA 3T0GA 3S1LA 5ULLA 3AUAA 2PV0A 2C1EA 3UYLA 1O0SA 3SXUB 1DVRA 3QQ5A 3DKRA 1A9ZA 3RSZA 4M6WB 3TM4A 4UOZA 1NYQA 2RHOA 1PFKA 4GE3A 1RBZA 3KNZA 3LVQE 3QUCA 2V7GA 2G0NA 4Y1FA 3PJGA 3P0FA 5ECWA 1IBCA 1JDPA 3H9QA 4RVDA 3M4NA 5K3DA 4UMEA 1PNVA 2GBCA 2TSYB 3D7SA 4KG7A 4HHEA 3TD9A 3TGWA 1V1RB 3LBYA 4U6QA 3WK4A 1HZJA 2FP3A 3ZY6A 5DIFA 3Q8LA 3HCBA 4AS1A 5BNTA 4I3FA 1M1ZA 2AZ4A 3G8CA 4R1NA 3RB8A 4O3FA 5JO9A 1L5KA 4XRGA 4MA0A 1X80B 2C0PA 1KBOA 1WMAA 1U7PA 2I67A 2WU0A 2XUFA 4IWYA 2JANA 5ALYA 1ANKA 1O96B 2J6IA 4LRSB 1IY2A 1PR0A 3ANYB 3G2QA 3O7MA 4BWFB 4CEHB 4KACA 2I4RA 3GCWA 4K7JA 4TUYB 1Q44A 1XJQA 4QFBA 4J7CA 2V58A 2ZJYA 3D4PA 2OZLA 3H7IA 3R3VA 3EMDA 5TPZA 3J7AC 1V96A 1RAAA 4YWJA 5C3MA 1Z4PX 1YMVA 1JRLA 2X8LA 1NXTA 3KWLA 3LH5A 4CLRA 2N75A 2NVWA 4MWEA 3EPLA 1ONNA 5FTLA 4IKPA 5DMXA 4HB2A 1EFVB 2E55A 3O4VA 4JJ4A 1TA9A 1TTQB 3I72A 3RARA 3RFCA 1AVTA 2JGLA 3ORRA 3GP8A 4Y1GA 1E94E 3TR0A 5DNAA 2HF7A 4I5EA 4O1IA 2FWNA 2AFIA 1A9XA 2FSVC 4JLAA 1R6UA 2CNWA 3AGPA 2O5CA 3ZZUA 3IOYA 4WRRA 4WVFA 5ICGA 3B2NA 3RSQA 1BRMA 3BEOA 1SMKA 4ZOLF 2XBMA 1NULA 4K6HA 1DL5A 1V7QA 2UZ1A 3B38A 3GXBA 3N0XA 5A3VA 2XKKA 4KQWA 3B53X 1P29A 3BIOA 5HZKA 1I7DA 1P2GA 3M5PA 5LC1A 5EJ7A 2IK8A 3GMTA 3AEZA 5IF9A 3F96A 3PXUA 1QAOA 4ZT3A 4NBVA 4E22A 4ECAA 5HRAA 1CFZA 2DP4E 3L46A 4RV4A 4E4RA 2RHBA 2AOXA 2A1UA 4MQ4A 5CK4A 1TI7A 4X1YA 5DTQA 3UAXA 4AF7A 4E09A 2NVOA 2W2LD 4EBBA 1UDAA 2Q7DA 3QVGA 1PJ8A 3PIIA 2HZBA 3OH8A 4BWVA 3MERA 5ALNA 4OHCA 4UFNA 2O14A 1SVLA 4FI3C 4JJ7A 4CF3A 1WU8A 2EBUA 2IHUA 1N2CB 1NNI1 3EW7A 4GPIB 1J21A 1V7PC 2X1MA 2C9ZA 3UMYA 4BKRA 3QKRB 4DQUA 2BV3A 5BOVA 3FFWA 4FR5A 4Q5IA 2JH8A 4V38A 5KAPA 5J4HA 1DC3A 2FOXA 1KJYA 1Z73A 4B4WA 1M1NA 3QELA 5CT9A 3MN1A 3ZGZA 3S5UA 2WVAA 3T7DA 1G4AE 3QSYA 1B6RA 2Q0QA 1T9GS 3JYOA 2CKDA 5MFZA 1R4NA 1ULSA 2ZT8A 4YFYA 5EJGA 1ISHA 1NX9A 4C4PA 3DCJA 4PFJA 4UATA 4EYEA 3O4GA 3O2NA 2VH2A 1MC4A 1FUIA 1MU0A 4KLNA 1YBAA 4JEIA 5E7IA 2YJTD 4DHWA 1YASA 2VFAA 2C3PA 2I34A 5H02A 2WJHA 3UK7A 1R15A 3GMSA 2AUTA 1V6SA 3GG2A 2BCJQ 4OIFA 1CNFA 3DF9A 4CG3A 3NYRA 4RD2A 3CS3A 3DOEA 4ZZIA 3CY6A 3WMXA 1NQ5A 3G0HA 1UKBA 1SU4A 3Q7QA 2HMSA 3DXYA 4FGSA 4R2KA 4XIJA 1RLUA 4E5VA 2DPYA 1G8PA 3G0GA 1Z35A 1G3UA 4MKHA 3TJRA 4L4UA 4RTNA 1G18A 3MCTA 2N46A 5KTRA 5FWYA 2ZRDA 4MO9A 3L79A 1ILWA 1ZH8A 2NAFA 3L6CA 3ZH2A 1MO2A 621PA 3KR2A 5JCPA 3PQ4A 2G06A 1IEQA 2ZI9A 1N5RA 3WRXA 1VP3A 5H81A 1HFJA 5A7HA 3QYPA 3PNLA 2QRMA 4M7PA 5A7GA 1ISJA 4EEXA 5LR6A 2C5LA 4ZYVA 3P5BA 3GPLA 1PT9A 3B8HA 3EJWA 5J5AA 5E8JA 1YBHA 3PVCA 2PYZA 1DFHA 3VH4A 1E60A 2R1TA 3ZWXA 3QNWA 4JQSA 5EA2A 3LGSA 3O8NA 4WKBA 4C4RA 1L5YA 4YT8A 4D3FA 5KCMA 1FP4A 1O5OA 5IJ9A 4RTQA 4YJGA 1D6MA 1E1QA 1FVXA 4IHJF 3JQGA 1V1MA 4H6VA 4MYDA 5AHRA 4C29A 1NP7A 5HM8A 3H9BA 5K8IA 3ZJVA 5JY6A 5DGHA 3CXRA 2XQGA 3BZWA 3LLUA 1C1DB 4MRSA 5BSVA 2I2BA 3P2KA 2OO5A 5FUYA 3CZRA 2I3BA 5ALWA 2OECA 2XWBF 4G4SP 4FZVA 4M53A 1P60A 4ZMSA 4BLRA 4OHOA 1KTVA 4MUJA 4PC2A 1C1XB 3IOMA 3DHNA 1HQKA 4FR2A 3IP5A 4MMZB 1MXHA 3ILHA 4PLVA 2H1FA 1TL7C 1JZQA 2NG1A 2OLJA 2A5GA 4S12A 4O3MA 5TMBA 1XF9A 3WQHA 4C4SA 5AI5A 4LX0A 1L9XA 3M49A 4YAUA 4TMKA 2HSDA 5J2TA 3RU7A 1MQ8B 5IYZB 1HDCA 5B37A 3A1CA 4OX9B 5L3VA 4I1OA 5REQA 4B82A 3UB3A 5K3BA 2FE1A 2FN7A 3TTWA 3UJ8A 3F4LA 3JYQA 3UJBA 5B4UA 2Q62A 2CZCA 1O57A 1BS9A 5G40A 4OJYA 5DASA 3AM3A 1TMKA 1Z2AA 3CUVA 3U4AA 3VYSB 4EPRA 4ID3A 4J1NA 1YOVA 4LV8B 3GELA 3X43A 3B2EA 2ID9A 2X7JA 3M0EA 3TVDA 1Z6QA 4D79A 5AVOA 3PEWA 1L4HA 5C1PA 3LKDA 3OPYI 4R98A 4HDMB 4AJJA 3ZBUA 2JIZA 1JLHA 4ZZ0A 1T4CB 4LYDA 5B1IA 5KTOA 4FD2A 1KKLA 2Y9MB 1W36D 5FI5A 2XDAA 1G55A 3HFGA 3MJDA 1O6BA 3I04A 3D1VA 5LA6A 2WWYA 1NVXQ 3NDPA 4MWOA 3R3SA 1F0KA 1I14A 1S9DA 2CK3D 2HC9A 1L5NA 5EIWA 3TE7A 5SY6A 3USCS 1MZPA 1D9ZA 3DAFA 1G3IA 4LWZA 4ZHSA 2H8GA 4JI7B 2CCKA 3VNRA 3LY5A 2Y6VA 4NMXB 1P4HA 2XVMA 3VR6D 2A84A 3WYFA 1GZDA 1ZJJA 5M3BA 4J1QA 3I5XA 3TSAA 5DVZA 3TRHA 3HDHA 2WHPB 3Q2OA 4UZEA 1JFTA 3HM2A 2GFQA 3L7OA 5TJ9A 4D82A 2F67A 2GSDA 1I5EA 4TXLA 4XAQA 2LKDA 3CVXA 1QF7A 4L78A 1FDIA 1I8TA 2ZDHA 3SICE 1C4OA 2EYQA 5JWHA 5BUZA 3ZNQA 1FZTA 2GF0A 3ITNA 3DC7A 3D4IA 5L6MB 4RFLA 1Y3IA 4WKGA 5E95A 2QY9A 1P2FA 4EATA 1E2KA 1PNRA 5FI0B 4WASA 3IMFA 3FVVA 1Z5WA 4XQGA 1H8HD 2A57A 2OXCA 2XTJA 3H16A 5AIAA 1HPLA 3B36A 4OAOA 1EFRA 1KFBB 4LOLA 2VXOA 1EM6A 2ZZKA 3ZE8A 1X8LA 5FORA 4WLUA 1P7CA 3QUAA 4KVFA 1N5IA 4ZYYA 3ACBA 2FA9A 3UCEA 2L69A 3GMIA 3V46A 4D3SA 1V39A 2DTDA 1Y98A 2VK8A 3KEMA 3EAFA 4B8WA 1ORRA 1E58A 2A86A 2J5QA 3KVVA 3PG5A 4AVYA 3QU7A 3VH3A 3BDAA 3L93A 3AL2A 4PQFA 1VLHA 3ZCPA 2KSQA 2OCDA 4N5MA 2VSYA 3D4BA 1ZU5A 5A6SB 1X7WA 3EZ6A 4W63A 2AX4A 5EJFA 5T67A 1V0JA 4MEBA 5CFZA 1E64A 1MP0A 2ZSIA 1QX4A 3QFRA 3FI9A 4ND7A 3FTEA 3NVKI 1UP6A 4BVBA 4K9KA 4EW6A 4DR4B 5DXFA 3QMMA 3ADBA 2FUG1 4DHEA 2JI8A 4J29A 3MBIA 4E70A 1SUPA 2HGSA 1DXQA 1JG3A 3A3PA 2IHVA 3AI7A 3NETA 1JUDA 2WSIA 4I6GA 4BXOA 1FFCA 3BM5A 3FPKA 1U2GA 3EVTA 1A88A 4AF8A 1IK4A 4OB6A 4M22A 2B92A 4RF3A 3DFMA 3QYAA 3RLIA 4XVQA 3SX4A 2JIBA 2RHRA 1HZZA 1UAGA 2OHGA 1IXRC 3PXXA 4PYRA 5D3KA 4E5NA 1SU7A 1MJFA 3LBHA 4O0LA 2RC6A 2V6GA 4UD6A 4QT4A 5JI2E 4PR0A 4W9NC 3AFGA 1U2QA 1X8KA 3PRHA 3H8JA 3S2UA 1JHUA 3A04A 4B6SA 3Q3HA 1U1GA 1IDN1 5D5QA 4BATA 2WYHA 1M2EA 4LJLA 6ABPA 3O8LA 2WWVD 3JR7A 1XDUA 2UU9B 3D64A 3W8DA 4ZJZA 2Z5LA 5A3RA 4JV5B 4JMLA 2I8LA 5BWBA 1UMBA 3IIKA 16PKA 3AF3A 2TECE 4BMXA 1J9EA 4WXPA 3GFTA 4YUXA 2F8TA 5FBKA 1RPAA 1Q16A 1Q1ZA 1D5CA 2DRIA 4P36A 4WCFB 4O0MA 1Y1SA 1JG2A 4MHTA 4BZQA 5LMNB 1ZGHA 1X86B 3C3CA 5E9QA 1QVZA 1OI3A 1DJPA 3LPMA 3OZSA 2YVLA 4IUDS 3KAQA 1NDQA 4QUEA 5KDDA 5EIEA 2JAWA 3AEQA 1HEYA 4N7JA 3N8DA 1JQ5A 4BEJA 1QPGA 1Q6ZA 2J3HA 3D7NA 1E9SA 2IC5A 4IIBA 4C2TA 2RHCA 3P0EA 4BNZA 2BR3A 5DNCA 3C3XA 3NPMA 3JZFA 5K0CA 3OKFA 5F5NA 5KNLA 1GA4A 2Z2YA 1XMQB 4ARZA 5F3DA 2IA5A 4MYSA 3SQOA 4QQKA 3VH2A 2ZDGA 3L3BA 1NNEA 2QGNA 1YOBA 1T4MA 4GAEA 5EXXA 2PX6A 2ILTA 1P3JA 3KKLA 1U1EA 1M34E 3NTUA 1QUEA 4CGYA 4F7DA 1AB5A 1IOVA 2XB9A 4G2NA 1M10A 1A0OA 4NY1A 4W7HA 4JEUA 3CE6A 4GRAA 4JS0A 3V97A 4MP8A 3WJ7A 5LU9A 4PSKA 1U0BB 4HD8A 2J0EA 1JR2A 1ZD3A 3ZUPA 4P93A 3ZGOA 1GL3A 3A4TA 3ZKWB 4EO4A 3AM1A 1H2EA 2XOKD 5KTSA 2IOHA 4O4HA 1UKAA 1V47A 3W9YA 3NOQA 4TTTS 2CCJA 3E82A 2OPHA 5B7QA 4IINA 1FNSA 1XQWA 2EVWX 3D2CA 3EHDA 4HLUA 1TNDA 2C5GA 1HETA 1L6IA 4KSYA 3IPCA 2V55B 3U2QA 4GPAA 4LGVA 1NUUA 1PFQA 2F1KA 2J5XA 3AR8A 4QGHA 9LDBA 2XOEA 1GHTA 3IDAA 3QLUC 3FFBA 3AI3A 5CBPB 5DWQA 5DV9A 4BP3A 1YZQA 3DHYA 1AX9A 1I3OA 3E3LA 3I6QA 4U9IS 4I8DA 1CP3A 4Q3DA 5D7BA 5DDIP 5FBRB 4NLLA 3NYQA 2EEPA 3ZS8A 4TYMA 1EEHA 1RWMA 3QU5A 2Q3FA 4H7DA 4YO7A 4CKEB 1BFDA 4C05A 2R6CA 3PTAA 3H4TA 4W5RA 3FCCA 2IOYA 2O52A 2WZCA 3L5OA 4LHEA 5BWOA 3DXZA 3K6SB 2DHCA 4AKTA 5EKSA 2DBRA 3V8RA 4D0RA 4D9BA 3UG7A 2ZZMA 1II9A 3H5TA 4MICA 1K8ZB 2RHDA 4JLDA 2YDYA 1TUIA 3OF2A 3BWXA 2BMDA 2JBWA 2PH7A 3A36A 4V3CA 3RYTC 3VTZA 2IBTA 2F8SA 1EVLA 4CKCB 1FFXA 3BA6A 4EHHA 2UVPB 1BQ4A 4JUFA 1D2MA 4MW4A 3GVPA 3R3UA 4UBIA 2CNOA 4NZNA 2QA5A 1DJMA 3CX4A 4YC7A 1ZVMA 2D4HA 3DAOA 4RPCA 1IUNA 2GH1A 1RBYA 2KWIA 1CUIA 3ECCA 4RAOA 4AZ3A 3O2JA 1ZS9A 2NXJA 3WGQA 1A9PA 4DARA 3DB2A 3ESBA 2B1RA 3Q6NA 2VQFB 1A69A 2UYHA 3AERA 3OZFA 4A92A 4HWGA 3JD3A 1LRLA 1PVDA 1FDTA 1RU3A 1U1FA 2P2DA 3E22A 1AU9A 4YP0A 5JFTA 4QQNA 3QXHA 3KQWA 2R86A 1VG1A 1DRWA 1JNXX 3SSOA 3OO1A 4TN5A 2ZVDA 1PK8A 5EUBA 3ITKA 3AJDA 2X4IA 4RA6A 2VZ0A 4MGKR 1V71A 2ZS7A 3LO5A 4TQ9A 3T15A 4CM1A 4DF3A 1NNLA 5FHQA 3SF8A 4N5DA 4RLSA 1SCJA 1JEEA 3PPIA 3SYRA 2BUAA 3LRXA 3OOYA 5AKLA 5JAQA 4EB6A 3W5BA 3RT9A 4ENTA 1Q0ZA 3KT6A 4P3YA 1IBKB 2Q1XA 4K6FA 3ENWA 2V5VA 1AUQA 4WZAE 4KIWA 1HE3A 1E6UA 2P9YA 3GI1A 3LIPA 3LL7A 2BMWA 1QP8A 4J7UA 4U2CA 2PPLA 4BNNA 5BN5A 1DRJA 2XUIA 1DBRA 2GAJA 3JYHA 4QXOA 4WADA 1V5EA 5JVDF 2GA9A 3NBKA 4WK2B 1DCTA 2DYKA 4K6GA 4M1EA 1P1CA 3C87A 4YPOA 4ENSA 2DLDA 4S1PA 4CQLB 3IALA 1JBQA 1FYVA 4YQYA 3T1NA 3IAM1 3V4VB 3L4BA 1NZFA 2F9LA 4J0IA 1ZM4A 4KWTA 5AW5A 1WOYA 1J0EA 1X8JA 2EAUA 3BXGA 3LQQA 4FP9A 3T1OA 4AN4A 3PCRB 4QBFA 4Y30A 5C46F 4UHJA 4WH0A 4JJAA 1UQRA 3PHBE 1R6AA 1SXJA 3IBGA 5L3QA 1G7RA 4QOHA 3JQAB 4IJWA 4PSVA 1GT91 1UBTS 4LYFA 2ZJ1A 3COPA 2RI0A 1DQNA 1U8UA 2RH5A 2AW5A 1E1RA 2IYRA 1QZUA 1RAIA 2JI9A 3NHUA 5IZ4A 1DI0A 1JP7A 3RF7A 2JDID 3O8OB 4TYWA 3IEMA 5F7XA 5HF5A 4C7OA 1P4JA 1GJRA 2O5EA 2WNHA 1EWVA 5FADA 2HDHA 1YA6A 3JAKA 3K9WA 4GT1A 4BYGA 3FNIA 1WPRA 2W2XA 5JSZB 4DLAA 3CZPA 2C92A 3L41A 1QOQB 4FHGA 4LN1A 1CZLA 3C5WP 2JIDA 1LS1A 1ADCA 3GJYA 1ENYA 1BW9A 4IDBA 4PX5A 4Z2YA 3Q8MA 1J0DA 3P71T 2QG9A 4X97A 2ACKA 4FWBA 5M5BA 4R16A 1HMPA 2XW6A 3OUTA 2Q5LA 4RANA 3REOA 5KJ1A 2TS1A 3LLCA 5DCWA 1QB8A 4M1ZA 2C7VA 2VPYA 3P0RA 1CDZA 1PQ4A 5CIWA 1U7WA 3A27A 3BIXA 3CEHA 4MJ3A 2I3ZA 3ND8A 1NMZA 1MTOA 1WA5A 3HWRA 4C07A 3PJFA 5EJ5A 4G65A 4LA4A 2XXJA 1XRRA 4AIRA 4Y2QA 3JV7A 3V33A 1T34A 1Y8QB 2EJCA 3OQ1A 1UC5B 5DM0A 5PGMA 3WGOA 3WA7A 2GZRA 2QENA 4P86A 5FUQA 3RHZA 4RSMA 3NTVA 4KLAA 2P0EA 3CG4A 1XCPA 1KMIY 3ZXIA 3RYCA 5FJIA 3H1TA 2FEMA 4Y6QA 1PR9A 2VLIA 5FAKA 4Z1MD 2I3AA 2VS1A 1XCMA 2YY7A 3I4FA 4J16C 4CZ2A 3WB1A 4BKMA 1U99A 3BAZA 5BSMA 3ORHA 4MINA 4N76A 3VKVA 1OE0A 1ZCFA 4CMEA 1XG5A 3KL4A 2EHDA 3NVMB 1K5HA 4ODIA 4DA9A 1EXVA 3CXUA 1RWKA 5AI0A 3HUEA 1DDGA 2CXTA 3NBXX 1F1JA 3SQXA 1HQDA 2COKA 2RJ3A 3ZEAA 4F85A 1JILA 3M2TA 3EEOA 4IW3B 1OAAA 1U0NA 3C16C 2NO1A 4CF6A 4HVLA 2WAOA 5JQGB 1XHFA 2WF6A 3TSWA 5C5DA 1V7ZA 3CG0A 2VKQA 5H9VA 4IIHA 4HX5A 5CNIA 1TIKA 1S8OA 4LBVA 3RE1A 2B8TA 2W6ID 4M98A 4RL6A 1Z28A 3S2EA 3BAFA 1C3XA 1E20A 4WPGA 1JPJA 4YRTA 3E8MA 3SHOA 1TEXA 2UXCB 4KQ6A 5CTJA 2BKVA 4OMDA 4TRNA 2R5WA 3MWDA 3H9CA 3LDUA 4QGFA 1DBIA 1E3WB 2H1IA 1QUFA 3G2PA 4IVPA 5C34B 1N6OA 2FNAA 1W46A 3HB9A 3QOWA 4ZTBA 1RLOA 2F1HA 4YQZA 3KTAB 1KJ9A 3MK31 1DDIA 5CLJA 1G5HA 3HPRA 3IJ5A 1JAZA 3KFVA 3SDZA 1NJ2A 2VL7A 1P81A 1JJBA 3LD9A 1BJRE 4Y2XA 3P9ZA 1RZVA 1JU3A 1NPYA 1T0JB 3CW2A 1AGPA 2E49A 2JLBA 4Z3KA 2XCIA 3R0IA 3RRNA 4ARIA 3QPBA 4G1BA 5EPOA 4Q9NA 3IUYA 4QTXA 1O54A 4POOA 2GN9A 1XROA 1Y5IA 3AGQA 1ULAA 3GRZA 1X1TA 3JVIA 3MCAA 3PEUA 1XMVA 1N2IA 4GLBA 3AI2A 1J8QA 4PY2A 1M8PA 1YS4A 4AMVA 2GLXA 1UPXA 2SCUA 4O2AB 4BNLA 3RIHA 3PRKE 2X19A 3I9JA 1WMDA 2P5SA 4MS1B 5JZVA 3GBSA 4IOLA 2W43A 1SBYA 1XQXA 1Y82A 3PX2A 4JCOA 2P9JA 3K0AA 3TQSA 3I73A 5FPQA 3LQ2A 1AD2A 2Z5VA 1PT8A 4D9NA 2UVDA 1UEXC 5IF3A 3LXXA 5IMSA 3EH1A 1AMOA 1G6OA 2GBIA 1O3YA 4XM2A 4DLLA 2DKFA 2QX7A 4JELA 4RH1A 3GEDA 4DCVA 2VNJA 1QMGA 2GD0A 3EQ7A 1IG3A 4Y8VA 4GZLA 3V1UA 5A6SA 1T13A 3KFLA 4ZD6A 1W29A 1PEKE 5FTJA 5I4CA 3AJ8A 2F3QA 3Q9NA 1EUCB 2ES4A 3EB9A 3ECAA 4AMBA 2SKEA 5CITA 2O5RA 4UW9A 4QJ5A 1HDXA 2EARA 2II6A 3OCUA 1BMDA 4BGEA 1PP4A 1DAGA 3VR6H 4UZFA 3IPLA 3ZWKA 1OFUX 1X1AA 2HMVA 3JASB 3JQ9C 3ZIUA 2RG1A 5DI9A 3T5CA 1RXWA 3G5MA 1XZPA 4M7WA 4R69A 2QUHA 5DK6A 3PA8A 1SQSA 2PRIA 3JALA 4ZQIA 2A78A 3T34A 1TCAA 4YRDA 4OBXA 3BFVA 2WMOB 4H1HA 4L15A 1P5HA 3OA2A 3ZHBA 4EKGA 1HNZB 4KHPB 2IF0A 4MYHA 3UH1A 5CB8A 1YTLA 3EBLA 4HNAA 2Q6VA 5DM60 1ITZA 3FDIA 3LT1A 1XFAA 2N3ZA 3A9VA 2Y1WA 4RQAA 2J4DA 1U4OA 3Q3GE 4FMDF 4E2FA 4MV9A 3GZTB 4YHHB 3P4XA 1YRAA 3WGYA 5KQSA 2AXEA 2TMKA 2PFKA 4RVOA 1T6BY 3DVAB 5EWLA 5TMEA 3S70A 4UDOA 1TXGA 1Z0FA 4ZQBA 4LSMA 2IW1A 3QJYA 1KI7A 1T8RA 3CJQA 5BO5A 1TB4A 7ABPA 1YVPA 3ORSA 1F8XA 1ZD2P 3K9BA 1QV6A 4TZKA 4F9TA 3RK0A 2QF7A 1GNSA 2EU8A 1EK6A 4UU8A 5LB2A 2HKIA 1I80A 1XQ9A 1J00A 3AY7A 2PBRA 4TMYA 4LGMA 2QRVA 2ID7A 1D1SA 1ZXLA 5LZ5A 4DIOA 1CK4A 3Q7TA 4S24A 4Q05A 1I2CA 4UE2A 3W6NA 3ZWCA 1EJ0A 3ESDA 2BDTA 2A0FA 2IEYA 2J32A 4XVCA 4TKZA 5WRFA 4X92A 3ZZ0A 5HGXA 3UV6A 5CFPA 4KPFC 1D8AA 1G59A 1TD1A 3A9SA 3I0NA 1JA1A 1EFPB 2ODWA 2YBEA 3HYNA 3OFND 4MLDA 2TMYA 5ALKA 4HWRA 4YCMA 2CEKA 4YIKA 1YQDA 2W93A 2AMFA 1U28A 3OPYB 5JJ5A 1HDRA 2Y0CA 1CHNA 3CZCA 3DDUA 3F8SA 3GEHA 4MKRA 2Q7OE 4RTRA 1BDBA 1Y9ZA 2QP3A 4OBEA 1LBIA 4Q7MB 3KWFA 2CLEB 2P11A 5FULA 1TGVA 2KBEA 4MKFA 4DV0B 4KR3A 1BHSA 4YJHB 4TSKA 1U0FA 1WOMA 5EUMA 3JAWA 4J6FA 2H5LA 1Q1GA 1YR9A 3MMNA 3PPYA 4XCQA 1QO7A 4Z9YA 3VR5A 4W4TA 2DT5A 4UPVA 3QPVA 2ZTHA 4KLCA 3OIFA 4KQEA 3W1WA 2MHCA 5CXUA 4KODA 4JYZA 2VRBA 1VLJA 3IB6A 3N76A 1A8IA 4Q4JA 2OFFA 1FYWA 4AZWA 1L7RA 2FW1A 5IYZF 5AK0A 3EXHC 1WCYA 1OPRA 3P32A 5GJBA 3DPIA 3VZDA 4Y98A 3N2GB 3LHFA 4MVJA 1CY4A 3RTAA 1WIWA 5HKKA 2I2DA 3B20A 2O3RA 4ZA2A 3SFVA 5K3FB 3SKXA 4V03A 5G0SA 1HYGA 2HMYB 3RWOA 4DUGD 1QR6A 3HG7A 5CA1A 4Q6BA 4UAUA 5DIZA 4D99A 1SQ6A 3FOCA 3P4UA 5MGNA 3PWZA 1HYBA 4IWXA 2WIBA 5EL0A 4WJLA 2HI0A 1XXHE 1LCIA 2C7GA 3M82A 1AK1A 2AMJA 2W4MA 3PNKA 4XGIA 5I45A 3GLIA 2IXAA 3N2IA 3NHFA 1AQJA 1E99A 1XFDA 5K3EA 4QBKA 5FEUA 2ZI6A 3WR5A 1NQWA 3FUXA 4DJDC 2QJFA 1R74A 2O8CB 1YU6A 3AUKA 3IXQA 1THZA 2FPOA 1EWYA 3SEAA 4C88A 2OESA 1RQNA 3BMQB 2KBFA 221PA 3GN2A 2IYFA 2O2DA 2OHJA 1LBHA 3GD5A 1LLDA 3KAJA 4LECA 1Q7CA 2VNKA 3CRVA 4P3PA 1YO6A 4N9QA 2C2ZA 2EQBA 2NV2B 3QVWA 1GADO 3IB3A 3D3QA 3SQMA 2VSOA 3OEWA 1E1CB 1G2IA 5FH9A 2W2PA 4XVUA 1AS2A 2A9OA 3R6DA 4MKZA 5I48A 5LZ2A 3ZDYB 2UZ0A 5DBHX 1SXPA 1Z0DA 1WO8A 1OXXK 1EK0A 1DHTA 3RFTA 4ROSA 5ALJA 4B80A 1ETUA 4OQYA 1SWWA 3K7EA 2XB2A 1VJ0A 5E6SB 2FWMX 5EJEA 2WJIA 1KFJB 3CZQA 1ZFNA 3F6EX 1KBZA 5CAEA 3DE6X 3F3SA 1E0KA 3BL5A 3B8EA 4IDOA 4JD5A 4RPIA 3IP1A 1C9YA 4DBLE 2WSYB 2JVIA 2YXNA 3LM8A 3PJEA 2RK6A 2ZIVB 2F55A 4U7HA 3COSA 5TGTA 2NYUA 1VIVA 3EC7A 2Y8EA 3QLUA 4WCDA 4QOJA 5HF9A 5FPTA 5SICE 4ABYA 1NM5A 1A5BB 1Q1AA 1ISMA 3BCHA 3HL0A 2CL6X 5TC4A 2FH5B 4H59A 1K89A 1NF2A 2ZE8A 4TKUA 2X0FA 3SOZA 4EL0A 2X8AA 2P9QA 3L02A 1DX6A 2W6QA 1BS1A 1POXA 4IEIA 3ZW7A 5CFLA 3DMPA 3G5TA 3BG5A 1A77A 4ZANA 2HMUA 3IV9A 4YIHA 5JALA 1YHZA 3BE4A 3CPEA 4JQYA 1CQXA 1ISIA 4H17A 4YREA 3RTBA 5HIKA 2PS3A 4NS1A 2FPGB 1OYWA 3TMYA 4ZO6A 4WCVA 4BJ5A 3DZJA 5KYYB 1SCAA 2X13A 2XDWA 2OORC 2WUFA 3P0IA 2C8KA 5JSHA 3H13A 3KJFA 1H2ZA 2QTAA 5FLKA 4HNQA 2YN2A 5ENZA 4BP9A 3D2BA 3KVNA 3O73A 3G0OA 4EY3A 2F3TA 2GCNA 1K6XA 3OUUA 4UPEA 5CCBA 4PG8A 3GJ4A 4EW2A 4Z0HO 5I8WA 4QUJA 5DCLA 2HA7A 4YR7A 2C82A 3DE4X 4PQYA 1T9CA 1MJGM 2PT5A 1CBUA 2IX3A 1P1HA 3BQMB 2RCNA 4L22A 2HUPA 1YT5A 5F9HA 3HP7A 1S2DA 3B5EA 4WKOA 3OM1A 4G0XA 4ARSA 4WA8A 1C3OA 2BOVA 3GJ8A 2IH2A 2B35A 4BUZA 3OX2A 1BQEA 3PYXA 2XQFA 3E7WA 4UASA 3U3XA 4AM8A 5FOQA 3D54D 3U4GA 3OTOB 4QQ8A 4IEFB 2UUBB 3CLUD 4GEKA 2AN4A 1ADGA 1R0YA 5DNEA 4ZQFA 3KQPA 1E96A 3ZK7A 1SELA 3X1ZA 4AURA 4EI7A 2Y71A 4C21A 3V3TA 1M34B 1UPBA 2BEUA 2SBTA 2ABWA 2R6JA 4OM7A 3WDSA 1HFKA 2JFNA 1Z56C 3KCQA 5EZSA 1X1EA 2PIDA 4Q1EA 4WZBE 5BUQA 1KI3A 1W44A 2FUNB 2YHIA 4D4LA 1L5SA 1YQUA 2P6MA 5D6OA 1LPPA 4BNHA 4HTFB 3W6ZA 4BEBA 4LZJA 2HEGA 3IVGA 3HXQA 4JLKA 1C7IA 2H7VA 2PD6A 2PZ8A 2Q3BA 2Z3ZA 3PUIA 3TM5A 2WD7B 4YGXB 1Y9EA 5LM3A 1ORDA 1E66A 1UXHA 2AK2A 4O29A 5HS4A 4X7PA 4PBSA 5KHOC 4KVAA 1G20A 5JS8A 3UHOA 3F5QA 1GPYA 3FZQA 5A9TA 1UADA 5JIBA 1TAGA 2GCEA 3AH8A 1TUEA 3QOXA 4C4YA 4EG1A 2O8BB 1NQTA 4FFMA 1P5FA 1XZLA 2DY1A 3EF3A 4LJ5A 1B2LA 3ZVLA 3B52X 4JKIA 4B48A 3OQJA 4ZDIA 5A5EA 1JFSA 2XECA 4FS8A 3BH0A 4ZVRA 1Y4AE 4YJDA 2C2KA 1VLQA 3T7AA 3OOSA 1H93A 3L7JA 1KR5A 3MWJA 5CFOA 3ES9A 1H2AS 2EX0A 3L77A 1Y80A 2JK0A 2XMCA 3UWOA 1ZOSA 1KK3A 2Q3LA 1KP2A 3B6MA 2Q3HA 3A32A 1KMHB 1F60A 4OYYA 5D84A 4F4IA 5I4IA 1WB9A 2ADMA 3RFVA 1FTNA 2HBYA 2NU9B 5TF0A 3ZHTA 3QMVA 1NDHA 1W0CA 3K2IA 4OATA 3ODPA 1C80A 1W9MA 3O83A 3RAPR 3AESB 1Z7BA 1R37A 1PGQA 2REQB 4EGJA 3KQTA 1F20A 1JEAA 1JXAA 2A5FA 5E4YA 3UAYA 4OFXA 1DRKA 3PR1A 3K09A 1ZIOA 2QM0A 2ZVJA 4POAA 4WN9A 2IEGA 2R48A 3Q9SA 3A11A 4ZAFA 5IKOA 5IUJC 3WYEA 2FF7A 5THXA 3UXEA 2RGWA 3ISJA 1VBFA 4CKWB 5BN4A 2NQ2C 2X6RA 4MQ5A 3UB2A 2PKYX 5J4VA 3GAFA 1YI1A 3B1VA 2QKYA 4IIJB 2VZEA 3BXOA 1OX6A 1W2GA 4ON9A 4DVJA 4I50A 4U2GA 5JNWA 2VZ8A 2IEAA 3PQ7A 2R9VA 4IDAA 1WPQA 2WTNA 2YN0A 1E9BA 3GGOA 2A0WA 1AKRA 1ODCA 2H4JA 3LDAA 4HPWA 4YPFA 3CIOA 5K8LA 2QD4A 5TQ2A 1CZKA 3AKEA 4PYLA 1KQGA 5DP1A 4YPVA 2NVUA 4BRSA 5K0JA 5K6AA 3OQNA 3FCXA 5LZ4A 1B8OA 1E18A 4ZI2A 3M5WA 3U4MA 2IBMA 1FW8A 1YHNA 1J1IA 2CNBA 4MJ7A 3OUZA 3G2KA 2OCBA 4KYUA 4WZAB 4EZBA 3ZE9A 4WESB 4PPNA 5LQDA 5IHXA 1ML4A 2WHYA 1U4NA 1AQ6A 2PRYA 3BWMA 1QF9A 3BWVA 3KHKA 4HGZA 2XUPA 4U9HS 4W1PA 1X7XA 3GAAA 6PFKA 3R3JA 3FG9A 4AUEA 3CO5A 1QONA 4IOMA 4L50A 3WOHA 1Z63A 3PNVA 4OQEA 4I4IA 5TT0A 1PV2A 1YULA 5LIRA 4PYMA 1EHYA 2C31A 1P18A 1Z6AA 3OFJA 3PHIA 4LVUA 1V9SA 1AKMA 3AUJB 4O8ZA 4CG1A 5GZ3A 3RADC 2I9KA 1JLSA 2I4IA 4BJHB 2G6BA 1OSNA 3OC0A 4BP8A 2EFGA 5AM5A 2WRZA 2NU7B 4L0DA 2A30A 5H16A 1TRHA 4ENQA 4QUIA 4A26A 1VE3A 2G0TA 1ZM3A 3WXBA 5C51B 2ARKA 3LQFA 5ED0A 2EZ9A 1C7FA 3RRXA 3NHSA 2VZLA 3HR8A 3AFIA 2ID8A 1MGPA 3CCBA 2O1XA 3ELUA 3PE6A 4IGFA 1ISGA 3WK8A 1C30B 1V43A 4YS6A 5DW0A 4RLFA 4EI8A 5BYKA 3ZDBA 3PGA1 3ZY3A 3TG2A 4YJ2B 4PGAA 3LFUA 1FXWF 5BVHB 3OZRA 2EERA 1A4RA 5EZQA 3RH0A 1N2JA 5A0VA 3IP3A 4FFBB 5IN5A 3L4SO 1NUTA 1FW6A 1XYYA 2O20A 2OQRA 3QSGA 2HU5A 2R6DA 4CLOB 5KVAA 1T6XA 2OAGA 1LFDB 1S3SA 2XJ9A 3IXLA 5KQPA 2HJVA 4P4GA 3FNRA 5ICCA 3QUTA 5TPWB 1JJIA 3SXPA 4L72A 2NWQA 2PKWA 1G42A 4YV7A 1F4LA 3FUCA 3I9MA 1DB3A 2YWDA 4MCIA 3HBMA 4FNMA 4FJ0A 3A6PC 2HSZA 5EN4A 4BL5A 2Q50A 1RPZA 3PX3A 2VPTA 3O5AA 5TDHA 4ARUA 1K63A 1DEXA 4V24A 1EVYA 2GNPA 5HCUA 1SC4A 2C4MA 2HV9A 2Y2VA 3DDZX 4YXWA 2FX2A 3W5CA 3VPHA 4XCVA 4L5CA 3LW7A 4CCSA 2QTCA 2C98A 4FZ3A 5CLHA 4OGWA 3JQ9A 1DGQA 2ZSJA 4HYTA 5FLYA 2VHVA 3MLAA 3KR1A 2VJDA 5JNSA 5DWVA 4DDHA 4C0WA 1V8FA 3JWHA 2DQZA 3KSZO 3BH6A 2BDUA 4EITA 1K98A 3O3MB 4DR3B 1LQ2A 3WGVA 2B4YA 4RTLA 4HO1X 1O94D 1FU8A 4OP1A 3AF4A 4U00A 2L42A 4YCAA 5COQA 3M5DA 1T5DX 2OSVA 4OVKA 1LTKA 3CEJA 1C1YA 4H6PA 5C4IA 5DGIA 2C9CA 4QAJA 3KLBA 3PXAA 2PSJA 3ANNA 1FBTA 5A4FS 1G9XA 1KI1A 3NHJA 3IV6A 4DCGA 5F78A 4WKCA 3Q4GA 3HCEA 5D1HA 4UFOA 5JD3A 1U94A 2FPUA 3QVUA 1UKEA 3W77A 1XD9A 4JB0A 4KYVA 4N40A 4LVCA 4BQIA 1NHGA 2IYXA 5I9TA 5U9CA 1GN8A 1JMKC 5F33A 1MO3A 5K99A 3NKVA 2Y05A 3HYLA 1RCTE 1T0PA 2B2NA 3VX3A 1ZM2A 3WZ2A 2G7MC 3VOAA 3HXPA 3QNMA 3IP9A 5JAMA 1SHTX 2B7CA 2MYPA 3VPSA 3ZD8A 4P5EA 4PAGA 2WDZA 4RZQA 4YXFA 4X63A 1V8DA 2RARA 2ZXUA 1GRQA 2QMEA 1WTCA 2EHJA 1KYIA 2PKRA 3CGGA 4MRVA 4EARA 2LW7A 3HA5A 3LSTA 1PZNA 4HKTA 4GI2A 1QCDA 1ZM7A 2Y9PB 3K4QA 4JJKA 4CIDA 1WDLA 5JQGF 3K9FC 2AZTA 1TJ3A 2P1DA 3GF4A 4KV9A 2VHZA 4HFJA 4UUPA 1KKUA 3LUPA 3KYBA 4Q3NA 4UCFA 2CLHB 4Y6SA 5B1DA 5L4SA 1QFJA 2WHRA 2WAYA 4FU0A 3UMRA 1Y33E 1W49A 4MW2A 2DPGA 5EXDA 5B4TA 1N32B 1QH1A 3ADOA 4B40A 3F9RA 3HJTA 3U7GA 2XF2A 3AHGA 3N0WA 1D0SA 3ED5A 5SY9A 1ZJWA 4RHFA 4K0RA 1E3TA 1Z29A 3FVRA 3R0QA 4F4CA 1JFFB 4V3BA 4I5IA 2HF9A 1GCGA 2ZRHA 3FIUA 3ZLJA 3HEBA 3AKDA 1E9AA 5GTDA 1X3LA 4LSZA 5A1JA 3VDMA 4IDGA 1LS6A 2ZATA 3KXIA 2J59A 3BSSA 5ITZB 3V1LA 3S55A 5JW6A 5J59A 2ATXA 3VXKA 3LPNA 1PZFA 4BVHA 3EMBA 1ADYA 4G25A 1KP9A 3EUFA 4Y1RA 2WT4A 1TO2E 3DMYA 4G5YA 3VZBA 4DDWA 3DLBA 1OWMA 1SNYA 2PUCA 2Q5CA 3M6XA 3MEQA 5JAHA 4FOSA 4NJMB 1WQ4A 2VDNB 5I9SA 2D2XA 2QRZA 3CB4A 1ZG3A 4QWWA 4ZVMA 5DBGA 4CUJA 1OZAA 3U0BA 4N4AA 4QQFA 3MHTA 4BN4A 4TKLA 1DTSA 4O2AF 3S4YA 5B30A 4YRLA 1QZ3A 3X2FA 4DA4A 4MQBA 5A1TA 3RIMA 4EFMA 2VXYA 1NATA 2IE0A 1D07A 2XSZD 3A6KA 1XVVA 3ENNA 3IPXA 4WMLA 2GWRA 4OU4A 1QQAA 2IDZA 3K1AB 1ODKA 1O95A 4FC6A 4E21A 5LD2C 3GLUA 3GNTA 1VPVA 1ZNQO 1LRJA 2OUIA 3NJ8A 4QX6A 3QA9A 3JS5A 1P77A 3DUWA 3L04A 1GPWB 3OD5A 5ALFA 3V55A 4Z2AA 4AY2A 2REBA 4BO5A 1VG9B 1VOTA 4JB2A 3SJAA 2C1XA 4YMIA 1AQLA 4MP6A 3AVUA 2ONCA 3P0HA 1UWLA 3JQ8B 2VF5X 1KO1A 4P3OA 3JRWA 4IOKA 1Q3TA 5INTA 1XMOB 1YUBA 1H4TA 3UHFA 1VLZA 4NCHA 1VMIA 4HB4A 3KQSA 1P91A 1DLIA 3IQZA 1E79A 2H7YA 4MDEA 1GTZA 1JSXA 4TS1A 1CHDA 4O02B 4ZREA 4RQUA 4UUMA 4Z0NA 2VK2A 4BTLA 2CFSA 3A6JA 3JQBA 3SQNA 1YQWA 3NTOA 4UVDA 3V1MA 5KOHB 1YFLA 1CJTC 4P92A 4TXHA 2ZB2A 3HB5X 5D8DA 1TCVA 2ZRIA 4HXGA 2ODPA 2RHHA 2JBHA 4LXGA 2IU6A 4LXYA 2ZAYA 2QPTA 3A1DA 2X2FA 4KP7A 5FXMA 3WHPA 1TT5B 1T9AA 2IYUA 3C5HA 2AQKA 3CH4B 3LW8A 3UNXA 2V54A 2FWPA 3SX2A 4AJLA 2NMVA 1W0JD 2QZJA 3VPDA 5EJ6A 3L6DA 2CNNA 3N6VA 1T1EA 2EZUA 5AK5A 1KI9A 3T6KA 2QTVA 4BQOA 2QUZA 3WQRA 3F90A 1V7CA 3SZ3A 4ERXA 4NBUA 4PG7A 2NV6A 5DBFA 2NSHA 2Q9BA 3O4FA 3FDFA 3X1YA 1PR6A 1XVAA 2HSJA 2NZWA 3FMIA 4KZPA 4PZEA 2FN9A 2B4QA 4E5SA 5EINA 1XCOA 3INTA 4ZXFA 3T9CA 3WP1B 5CGQB 1BWSA 5AP9A 2OGZA 2YJ6A 4C4TA 2WUVA 3AKCA 4FT4A 1Y1RA 4H7EA 4C03A 4OHBA 3FYDA 4C4XA 1VL5A 2VG8A 1O89A 1C8KA 3K3PA 4L08A 3H04A 4OB7A 2D0DA 4FIZA 4QLAA 4RJ2A 2BWJA 4HUJA 1GG2A 1XTZA 1J20A 1X1CA 3LRPA 3OJOA 4IXTA 1YUMA 4AJNA 3DTYA 2X77A 5EY5B 1AUXA 4IVNA 1FJGB 5BR1A 3EA4A 2C7BA 1IMOA 3LYAA 4QTTB 3EZ2A 3N5CA 4RZXA 5DLEA 5E1DA 2GRUA 1PU2A 1KRXA 3E6AA 3WLMA 1VL8A 1J8DA 4HYYA 1FSZA 1UFKA 4NENB 4AX8A 2YR0A 1M6VB 5FKJA 4CM5A 5IANA 4DV3B 1WW2A 1JQ3A 4G67A 4QYMA 2H2AA 4C06A 4BWGA 4GRDA 3UN1A 4TYYA 1B6SA 1WCXA 5KSPA 3OO0A 2EFYA 2AA3A 1JAHA 1LDNA 1Z5PA 1OV6A 2AUMA 4MA4A 2VDJA 2QVZX 2XJ4A 3VBEA 3SVTA 1R9NA 2W6MA 5C1OA 3C7DB 3FWZA 2NV0A 3IR7A 1Z0ZA 1J1UA 3GHHA 4CN9A 3CRZA 3BHMA 1OB5A 2PJRA 1UXJA 3BGSA 1JN0A 4JBYA 2Q4RA 4J03A 1SHLA 4E1BA 2O19A 2HSWA 2CYCA 1O7JA 3BTSA 1OXVA 1JIIA 2DHDA 1FX0B 3GFBA 3MAJA 4OYLA 1ZNYA 1QJ4A 5C8YA 4HB3A 3RO7A 1AMUA 1ZI6A 1Z4JA 1OKKD 1WMBA 3U09A 1T5LA 1JR3D 1YD7A 4EENA 2HNAA 1LF5A 3VPXA 4BNVA 4E5YA 5A5GA 4MRMA 2KI5A 4CCWA 1N57A 2X9NA 3JSAA 1WBDA 4B3CA 1UBFA 3JU3A 2Z98A 1MTZA 3D81A 1OROA 3FMOB 1K5GA 3G2MA 1E63A 1ZOLA 3FNBA 3GY0A 3GZNB 4LPSA 1GUFA 1IZZA 1OC2A 2JD2A 1ICEA 1BZYA 2XDYA 1C0EA 2BELA 3GCZA 4KXXA 2N1MA 1B73A 4C87A 4DVGA 2BCEA 4UHBA 1RAEA 3E0XA 4YROA 1R0KA 3A6ZA 4RGVA 4CFZA 4DLPA 5IS2A 1QRDA 3PV0A 1BCSB 1BG6A 1E6EA 3DT8A 2IXTA 4PNZA 3UFXA 3KZNA 3GLVA 5I9IA 2UYOA 1P74A 1XOIA 2C77A 1RPNA 1L4MA 3KV1A 3PQ8A 4QWMA 3V4RA 3OCJA 3PNQA 2OYRA 3MC1A 1QDEA 3EW9A 4KLZA 1AKEA 4A0QA 2XGOA 5IP5A 1DKLA 1IU9A 3BWCA 3GT7A 2ZAOA 2BMAA 2M6LA 3MXOA 3COVA 2CLDX 2JFFA 1IQRA 3AW9A 3IBTA 4QYWA 3TLAA 2JFBA 3GQBA 5J5CA 3FUWA 1WKVA 3W6OA 8LDHA 3V2HA 1VKZA 1CB7A 1IHPA 1RKBA 3AU9A 4CM9D 1SXIA 5KB3A 4D41A 1DJQA 3HJAA 4GICA 1EAYA 3EGDB 5E9JA 2VT3A 3AC0A 3JQEA 3H2YA 4D9MA 2B8WA 2VP5A 2CF5A 4NZZA 2VHTA 1XKTA 2YNMC 4F1KA 3U4DA 1TYDE 4AKGA 3QPWA 1T1IA 4U7JA 3LA6A 4J2TA 4ETNA 5E4FA 3PKIA 3CNQS 4L4XA 1GA6A 1Y89A 4AP9A 4L5IA 1VGRA 4YAOA 4CV0A 2WWWA 4KWEA 4LMBA 3L8YA 4UEKA 3BH7A 5FPYA 4DV1B 1F8GA 5KO2A 2Q6IA 3C7AA 5AJYA 5LQRA 2XADA 4Z9AA 3GEMA 3OTWA 1KH3A 2OCYC 3V4ZA 4RS4A 2V3CC 1TJPB 1RM5A 1VCMA 2OGTA 1FE8A 1RJ9B 2G67A 4DZTA 4RKYA 1SBHA 1XK7A 3QF4A 3DFUA 3LOQA 2FV8A 2GYWA 4AU1A 1QLWA 4RZ2A 4WZBB 3U39A 4ESVA 4DXHA 3KDSE 3A2LA 2E6KA 5C5EA 4E07A 3M9WA 2A58A 2O2ZA 1OT5A 3DOCA 2GO7A 2ZYRA 4I4TA 5FCDA 1TCCA 4YAGA 4URVR 1T5OA 4IGEA 4Y9DA 3WL7A 4CG0A 3TF5A 4P4NA 2BKEA 1L5HB 1T2DA 4FS3A 4GEGA 4KRYA 3O74A 1EVQA 3OOWA 4CR8A 4PHCA 3D3EA 1KZ7B 3GRUA 4LRQA 4ND5A 1RKQA 3C4JA 4JLWA 2QMYA 3KU1A 1RHMA 4IVRA 4M9XA 2RD2A 2J9ZB 3CGWA 3G2IA 4FDTA 3NOVA 2E82A 4ZEVA 1FSGA 3H65A 1RCFA 4ZVUA 3SWWA 5BWLA 2XXBA 1VMAA 1Q2UA 4TTPA 4YDHB 3IHLA 4PO8A 2J67A 4QHYA 3QY9A 4ZVSA 3LVRE 3MJRA 3IX7A 4KWHA 4DZRA 1RE0A 1B0UA 3AEKA 3L4JA 5B6PA 3EFEA 2O1WA 2BF4A 3IAXA 4N65A 4BGIA 2Q5IA 5LMUB 4TRMA 5EP2A 3L7CA 3EXIA 1A95A 1J24A 2FGJA 2OHOA 1JLLA 3GLTA 3CTPA 4PLWA 1YVRA 3ZIAA 5KQGA 5GWXA 2B3TA 2WJWA 2CDAA 3PTZA 2DC1A 1XVLA 3I9V1 3NCHA 2PGOA 4BO7A 1TKAA 3GPDG 4NMMA 1O5IA 1IULA 2I54A 3N07A 1L4GA 1ZR4A 1I3LA 2JHFA 1QKJA 3OU6A 4MA5A 4N6GA 3GEEA 1VCIA 2ZKLA 1QU3A 3IQIX 3K8YA 4ILEA 3WJ2A 4DIUA 3GVIA 3BUSA 1E2GA 4IJQA 1MX1A 1K8YB 3Q2KA 4AQ7A 1VQ1A 1J1ZA 3IAAA 3KRTA 1ZNXA 3W2GA 2FPPB 1FFSA 3I2KA 5K0EA 2EP5A 4BKOA 2P2YA 3WMEA 1X7ZB 5DLQC 5ADWA 1J7KA 3T1VA 5EP4A 1LV7A 4NJOA 4WBNB 2GZ3A 3QYFA 1XU7A 3LNCA 1MW9X 2E21A 4CTJA 1Z45A 2XNKA 2P2ZA 1ORVA 2HLPA 1OWPA 1RMTA 4Y9TA 1Z5VA 1TVCA 3GD7A 2CD9A 4WSOA 2DLCX 1W1UA 2AJDA 2BISA 3KSRA 4RA9B 2Z2JA 4X66B 5JCXA 2VYCA 4C08A 5HJ5A 1XV5A 2XWSA 1RDFA 5KYGA 5JNRA 2XA2A 1H2WA 4IGKA 1DV2A 2JK1A 2Z6VA 4KMRA 2DUWA 4RTPA 2FFAA 3HNPA 1XMPA 2PANA 4TSRA 3MTJA 1MABB 5EKUA 1F17A 3FCYA 3H0CA 1YC5A 4JK3A 2WJVA 4YUYA 1AY0A 1HE1C 1QTNA 4DUPA 1R5JA 4F6RB 4X7MA 1VL2A 1YJAA 3C0KA 3AHIA 4II3A 4CBVA 2AOWA 4AY4A 4DKXA 4NMLA 4P81A 3ZVKA 2GA8A 1HDGO 4IIJF 4Q9DA 3E5MA 1Z39A 4EYSA 4YAIA 1K9VF 4MLPA 2IPAB 4AP6A 3FHJA 1WTAA 1WR8A 3DYIA 2ROQA 4FPXA 2VVTA 2LDXA 1Q0PA 3B3JA 2R1VA 2B9EA 1QNFA 3KYCB 1E2BA 1FRVA 5FT9A 2ZUCA 4TTSA 2PH3A 1OLSA 1KO5A 2O2IA 4CL3A 1VPTA 1YR3A 3C3AA 2I87A 4XYGA 4LDZA 4DABA 3L0BA 3A3YA 1JEYA 1F6DA 4HOYA 3STUA 5DHFA 5TR9A 5A2GA 4A36A 3ROMA 1WZUA 2EFHB 1UINA 2GEUA 2CJWA 2M1ZA 1UFOA 2PKXA 1TECE 2QVYX 3DAPA 3O92A 1EGAA 1G0OA 4NP6A 3TLCA 2E7ZA 4D3DA 3K9QO 4F96A 3KYDB 4G0UA 1U0OC 1RHQA 2GNOA 4HZUB 4RK4A 4G0MA 3QU9A 3WO1A 1D6SA 1EG7A 5G1PA 2NOAA 3WE7A 2FMTA 3JQFA 3DBRA 1NHWA 3H84A 1BXRA 4RH3A 3HI4A 4TLAA 1KOLA 1IWPB 5K8JB 4N5NA 4F1WA 1ESZA 1DIGA 4G0OA 3AW8A 1ZMTA 1Z3CA 1IXZA 4ZJUA 4ETIA 5BORA 2PUHA 2X8JB 5EMNA 2X9GA 3WK9A 4RF4A 4UC0A 1U0EA 2H07A 1PJRA 2GO1A 4ESEA 2PQ0A 4RJIA 2QZ9A 5CPFA 5FHRA 3TEJA 4JIGA 5TPZD 5FYQA 1NW5A 2RAUA 1ORHA 3I6BA 3N7TA 4OMUA 3P1JA 3QXCA 4S1VA 2B94A 4MW0A 1BKYA 5FQOA 3UUGA 1I4DD 1PIWA 3DE0X 3USZA 3MTGA 4DCOA 2VJYA 4KPGA 4OFBA 4YJ2F 2L17A 1CUGA 4EJMA 4MEAA 4C43A 1RAHA 2F17A 3THSA 1JWLA 3TSCA 4U3JB 1OXKB 2OM6A 4P7BA 3TUZC 5FOVA 2ZT7A 4Q02A 2QJOA 1FC0A 4RJKA 1CTQA 2Y27A 5P21A 1NI4B 1Y8AA 2CNWD 3DD1A 4MRNA 3WIOA 4QDZA 3ZHSA 3RBAA 1QFMA 2ZJBA 4B79A 2A14A 2WMNB 3DVQX 1ST2A 2W48A 1HE4A 3FUUA 2XE6A 4IJMA 5CJJA 5DTIA 3VX4A 1UK9A 3N2YA 4LXHA 2JEYA 2XQIA 1SOAA 1XIVA 3LJKA 4OQZA 3CR3C 3CF4A 2HUNA 4RK7A 4FHZA 1G5QA 4M8NE 4QZVA 3GWGA 3I2YX 3JWIA 1Z74A 3IA2A 5HKOA 2GJSA 1PQUA 421PA 1UBRS 2V0GA 3ZK8A 1O97C 1CV2A 4CM8A 3WAJA 4DIEA 3T52A 3NHLA 3QG1A 4RC9A 4QTYA 4UULA 2PMCA 4KMOA 4Y9RA 1FYDA 5LP6C 3RIXA 2RIPA 1S0UA 1XZNA 2DOKA 4UHDA 4ND4A 3BFKA 4KJXA 1K06A 1VHWA 1MOPA 2VLBA 2RKOA 4ZOEA 2CC2A 3AR4A 3DZBA 2IYWA 4Z49A 4RTSA 1HI9A 4CVNA 3DKIA 5HRCA 3MF4A 2FDCA 2XWQA 3TEMA 1G3MA 2N42A 2P6RA 5CFRA 3CX7A 1PT7A 3FB1A 3LKZA 4J0EA 4OHVA 1Z8HA 4QDKA 4XQ0A 4DM3A 2UKDA 1OZ0A 3ZVRA 1J8YF 3DQPA 3L1IA 3OTGA 1KNQA 4L07A 2PGLA 4B2IA 4OLBA 2XNJA 4GNKA 3G8DA 4H1UA 2BE9A 1SD1A 3GUCA 2QT0A 3KPJA 4KYTA 3RSFA 5F7OA 4DMKA 2C04A 3MPOA 3NP7A 4KR6A 5HJ2A 1K88A 2ETVA 2I3GA 1MX3A 3LT0A 1CWUA 2HLNA 1R9GA 1ZZEA 1F4VA 1JJAA 1ESDA 2EOAA 2IYAA 2PWBA 3A3KA 3IE2A 3IMKA 3R7BA 2AC2A 2CNDA 5G3ZA 2AJBA 2NU8A 2H2DA 3FFAA 2GPYA 1E9DA 3GT4A 4Y9UA 4YWHA 3RV4A 5EJ9A 3FMVA 5DGDA 3ON5A 2UVQA 2BMFA 1G5RA 2C2XA 3B78A 2RGDA 1QGDA 4PC3A 5CW1A 1AKTA 2QN9A 2NADA 4HLDA 4IXMA 2KLBA 2R7NA 1EVKA 1NVBA 1XJ5A 3GROA 2P77A 1QJCA 2F4NA 2WVJA 3HXMA 1SCUB 1Y1TA 3MYRA 4QPNA 4TMWA 3ZWDA 3K2QA 1K7FB 3PQEA 3AIMA 2Y0PA 4PLCA 4XGKA 3L43A 3RU9A 1LDYA 3TLMA 4D5EA 2DHEA 3HMKA 5B5SA 1IBLB 1L5OA 4IKEA 3EQ8A 4BFSA 1LWNA 2HLHA 1X42A 2BKUA 2VJMA 1Z36A 2FFJA 2XTZA 4JBLA 5AOCA 8OHMA 5FBWB 1XRNA 3ZZNA 5LMCA 1W4LA 3BJEA 3MSCA 2VNSA 3CVJA 5DHAA 4L74A 2PO7A 3N6XA 2AHRA 3D6VA 1VE1A 4ZP1A 1L1RA 1FS6A 1KNXA 1K2WA 1LBSA 1BNCA 1E1QD 1R0SA 3CW9A 3DAHA 4TL6A 5F76A 3ZI4A 3ZE2B 4Q3AA 5JJBA 1CQZA 1WD7A 3KZCA 1C29B 2I62A 1FL9A 1HBJA 2BTQB 3SZUA 5CDGA 4BQNA 1U1IA 3FR7A 4G1CA 1I2AA 1TD9A 3QNUA 4MPRA 1U5BB 3L7BA 3KUDA 5D85A 2CMFA 3KSUA 4JEHA 3VYWA 8GPBA 2Z4TA 4TTVA 1CU1A 4EDFA 3C3DA 1GV0A 1SOMA 2IXGA 5DMHA 4YRKA 4IL5A 3R6LA 1OREA 4IOJA 2ZIXA 3I6ZA 3QEMB 1LPNA 2JJYA 4MQ6A 3T3IA 2O0HA 1WXXA 3I28A 4NABA 4LGYA 4YJFA 1OASA 3J7TA 1JDBB 2I4LA 2A9QA 3VDXA 2CUTA 2D3WA 2HU8A 2VK4A 3UHJA 1R1DA 5ALMA 4IS3A 5C52B 4HDCA 4EUEA 3ND5A 4EWLA 5D3QA 2BEWA 3R7LA 3GX1A 2I99A 3JQ6A 3G23A 4JITA 3E18A 4KGVA 2HJRA 4W6ZA 1OLUA 1W73A 4ZOLA 2OL4A 2WMDA 3MGCA 1M9NA 5K8TA 2DXIA 2KB0A 1CW2B 2R11A 2PGAA 3GK3A 4CF7A 3CBGA 3BGDA 1E1KA 4HQ0A 1DC8A 2X8WA 1XCJA 1ZUHA 1AM4D 1JNYA 1VE7A 1GYQA 1U7ZA 2OCGA 4G0ZA 1P31A 4MNTA 2PZLA 2JIZD 3HDVA 4N0DA 5IC4A 2OV2A 1XZJA 3K0EA 4X95A 2B6HA 1IJEA 2R8XA 2QN2A 2RONA 2X4GA 3ESYA 4HDOB 2G1AA 2NUTB 4S04A 1Y4UA 4MR9B 5BXQC 4U2FA 2WEKA 5ALZA 2B37A 4GBGA 2NU6A 3BYZA 2ZSEA 1HE2A 4L5AA 3A1NA 1QRAA 3ANSA 3CTMA 3L6BA 4PYIA 5EGSA 2XYHA 1QCCA 3C7TA 4A9AA 3F4BA 1ZD8A 1Q19A 4JYMA 2O8FB 4LDRA 1YF3A 5AK6A 4DCTA 5EFZA 4MR8A 1OTXA 1PI3A 2Z09A 1LUAA 5AXDA 3DZDA 1SKAA 4TTAA 1ID1A 4Z4FA 4XWGA 2OXTA 4E12A 2FG7C 3EZNA 4H18A 3FYUC 4AZVA 4WI1A 5ALQA 3TX6A 1JDTA 1Q84A 2BDEA 2I4TA 4RENA 3E5HA 4YR9A 4DBZA 1TZ2A 3I3OA 4UVEA 3TEFA 2W37A 3N28A 3NG1A 4O8CA 3U1TA 3WIUA 1E0AA 3LUKA 4PC1A 1JGTA 3OIGA 4O2LA 4MYTA 4R9NA 4DCJA 5FO1A 5A02A 1XRPA 4ZRDA 3PR2B 4TQUS 4JYBA 1DXHA 4L27A 1DZ3A 1N7GA 5CG2A 1W93A 3N3AC 1CF9A 3DFIA 1ZCJA 2FZ5A 4KEAA 4XB1A 1JYFA 3C48A 3MJTA 2FZVA 3LF1A 1EFRD 2ZRLA 3HJUA 3ESCA 3HS3A 4LRXA 3F6BX 2C78A 3BHIA 5DT2A 5FR1A 5J40A 5LBUA 4MUIA 4MUAA 3PDIA 3LRTA 1RKXA 2NNWB 3LP6A 3ZWVA 4DN6A 3OEEA 3FZNA 2BLLA 1Z6PA 1JVSA 3FD8A 5CD1A 5TXGA 2H16A 5EMLA 1PW5A 1JJFA 2W90A 1B8NA 1C7RA 1GNPA 2GVNA 2Q49A 3GRFA 4GU5A 4Q4CA 4LOIA 3THOA 5AXCA 4WXRA 2H1SA 3CE9A 2VSFA 4Q37A 3SZRA 4Z6KA 3OCYA 3CLSD 2O2JA 3EFOA 2YJZA 2FZWA 3WLTA 2XUZA 4HDSB 4B4OA 4AMUA 5BVGB 4G8CA 4O2BB 4A2CA 1BOOA 3CURA 4G8DA 2SKCA 4H3KB 4G41A 4OGFA 1ZM9A 3LVBA 4ZWNA 2BI4A 1EYZA 1G5IA