2AOUA

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
288
structure length
286
Chain Sequence
MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouA00
3LCUA 1QYRA 2XYRA 3KPVA 1MHTA 3E05A 1R8XA 5DPMA 3KQPA 4DKJA 5EOVA 2IH4A 1X1DA 3GRVA 4O29A 5CVEA 2PX4A 1XJ5A 4PGGA 4PYNA 1KYWA 3FTCA 1XXLA 4FT2A 2VDWA 3L8DA 3BT7A 3HCAA 3NWEA 2OY0A 1QAOA 1IM8A 2YXEA 5FULA 3B3FA 1JTFA 4QQNA 5ICEA 2F8LA 5G02A 1M6EX 5C9ZA 3P2IA 5CVDA 2B2CA 1QZZA 3CJTA 3I64A 3JWJA 3OZTA 4PYQA 1ZKDA 3T7TA 4LWPA 4E30A 3A25A 3GRUA 5EC8A 3UJBA 2OYRA 3LBFA 2AOUA 3B5IA 5IH3A 2PV0A 5E9QA 5JR3A 3D2LA 4CKBA 4YMGA 3T7RA 3C0KA 2OBFA 3GRRA 1TW3A 2FHPA 3SGLA 4E2XA 2FCAA 2CWWA 1PRYA 3OFKA 3PT9A 1P91A 4C04A 2GPYA 2PY6A 3MCTA 2QRVA 3BWCA 4Y30A 4EKIA 4KWCA 3AXTA 3JWHA 2P41A 3MB5A 4EQZA 1X1CA 5FUBA 2E5WA 1D2GA 4PCLA 5DTQA 3SMQA 4PWYA 2Y1WA 3DOUA 5DSXA 5FQNA 5BW5A 3UA4A 4F85A 2PXAA 2IFTA 3P2EA 3PFGA 4U7TB 5CIYA 5KQSA 2ZCJA 4FT4A 4PYLA 4YMHA 1M0EA 4PYOA 1VBFA 2IH5A 4PGHA 4R6XA 1EIZA 2QE6A 5EMKA 3HCFA 4E70A 1Z3CA 2ZLBA 3LBYA 3K6RA 5C0OE 1G8SA 4MHTA 3R0QA 2IDKA 2AVNA 2V74B 4IV8A 4AX8A 5DRTA 5DX0A 3DLCA 1RI3A 3M6WA 4DM3A 1I4WA 4P7JA 4ZTBA 3G2QA 5EMJA 5K0GA 1DL5A 1Y8CA 4C05A 2WA2A 4RX1A 3FUXA 3IHTA 3S68A 3G8BA 4RTLA 5HOQA 4EK9A 2CMGA 3BWBA 4FP9A 5BP7A 2QYOA 3TR6A 5K0BA 1G60A 1R18A 3MTIA 2I6GA 2BM8A 3HVKA 3G2OA 2VS1A 4GEKA 4DCGA 4LECA 2ONYA 5EKUA 3SSMA 1JG4A 3EVEA 3IYLW 4C07A 4R6WA 1M6YA 1NBIA 3P8ZA 5EVJA 2O05A 4M7RA 1ZG3A 5EHGA 4WXHA 4ISCA 4AZSA 3PFHA 4RTJA 4BP3A 1Q0TA 5FHRA 3FTEA 4M37A 2UYOA 2A14A 3KQMA 3I53A 1I1NA 3VSEA 2G70A 4P58A 1BHJA 5DM1A 3GDHA 5EIFA 1L3IA 1AF7A 3F4KA 3FPJA 2PXCA 3KKZA 3PVCA 2JJQA 3V97A 2ZZKA 4PINA 3HNRA 1SG9A 4C03A 4CTJA 1TW2A 5LQUA 5DTMA 2FK8A 3DMFA 4C4AA 1AQIA 3R24A 1L3BA 3I58A 1KHHA 2G8NA 3B7PA 3AJDA 3ME5A 5T6BA 1RJDA 2IH2A 2ZWVA 3OPNA 3LDUA 4E2YA 3QOXA 5D1NA 3UJ9A 4R8SA 5LQCA 5K0NA 4CXMA 3MGGA 2I7CA 2B3TA 3HCDA 5DM0A 2UZ4A 2NP6A 3FYDA 5DM4A 1XDUA 5K09A 3CBGA 4DCMA 4OBXA 1P1BA 5K0FA 2BR3A 3DXYA 3P97A 1NW7A 2YXDA 2AVDA 3KR1A 5DRYA 5E9WA 3R6TA 5CCXA 2HV9A 4QTTB 1R00A 2JHCA 4M36A 3THSA 2EJTA 4L7VA 5U4XA 3NMUF 3ANXA 2ZBQA 1AV6A 3C6MA 5FADA 3UZUA 4FZVA 1WZNA 5M5BA 5K0EA 4B17A 5CVJA 2NXJA 2PVCA 3B3GA 3EMDA 5GWXA 4PNEA 3DR5A 1SQFA 4ER7A 2CMHA 5GM2A 2PX5A 5DT2A 4V0RA 3QOWA 1YFJA 2GAFA 3EVZA 3IV6A 2VZ9A 4KRGA 1EJ6A 2AN3A 5HILA 1RI4A 1N7IA 2Q41A 5EG5A 3KQYA 2UYHA 1EAMA 2YVLA 5HIJA 1KPHA 3FTDA 5EMLA 3FYCA 1SUIA 2G1PA 2GS9A 1KP9A 3I5UA 3Q7EA 4LG1A 3FZGA 3THRA 1Q0SA 1RI1A 2NNWB 2ZWAA 3ELUA 4PCAA 3BKWA 5CVVA 3DXZA 4GC9A 3SSOA 2AOUB 5ICFA 3DH0A 3UBTA 2FRXA 2I9KA 3M4XA 4GC5A 1QAQA 2O07A 3BGVA 4M38A 4A6DA 4YUYA 3K0BA 5EIWA 4CWAA 4PYKA 4FSXA 2JHAA 1HMYA 3CJRA 3FRIA 3RODA 4F84A 1YZ3A 3KQTA 1UWVA 4YUWA 2AOWA 2IP2A 1P39A 3O4FA 4XUDA 5CUQA 4YUVA 5LSAA 3LKDA 2HTEA 4ATNA 1SUSA 5HFJA 1P1CA 3KHKA 3P71T 5KQRA 2ZW9A 2OZVA 2PWYA 4AZWA 3EGEA 4RSRA 1JG3A 4GQBA 3EGVA 5ICGA 3M33A 3ELYA 2ZIEA 2OXTA 2OB1A 2YX1A 1KYZA 4HH4A 2NXNA 5EKXA 4FS8A 2AOTA 1WG8A 2P35A 2V7EA 2ZVJA 1N7JA 3CGGA 3FUTA 3OE5A 2UYQA 3CVOA 4GOND 3TM5A 5EHIA 2Z6QA 1N2XA 4JXJA 1YFLA 3HP7A 3KQQA 5D1HA 3EEOA 1YF3A 1INLA 2H1RA 3MCZA 3G7UA 5ERGB 4UOEA 1BC5A 1HNNA 4OBWA 1XVAA 1WXXA 4QTUB 1I9GA 1KR5A 5DTRA 4ER3A 3BWYA 3PB3A 5E8RA 3TPZA 1UIRA 2AR0A 3BXOA 3EPPA 3HA7A 5BW4A 2PKWA 2ZBPA 3MHTA 4ER6A 3KR2A 4MIKA 2ZBRA 5T64A 3KQWA 5E1BA 1U2ZA 3FPEA 3MAGA 4YUZA 2NP7A 4E2ZA 2LD4A 3REOA 2WA1A 3IEIA 3QV2A 2R3SA 5CM2Z 4DA4A 5GINE 5EQJB 1VQ1A 2ZIFA 1O9GA 2CL5A 3BGIA 3ER8A 3B89A 2OPBA 3TM4A 2JH9A 4HGZA 1DUSA 1EJ0A 1G38A 4DZRA 3DLIA 1TPYA 4E32A 4EMSA 1RJEA 2EJUA 3BGDA 1AQJA 5ICCA 2WK1A 3VC1A 1FP2A 2EX4A 4CTKA 2K4MA 5HEKA 1RJFA 3PS9A 4OQDA 3T0IA 3CCFA 4IKPA 1FP1D 3CC8A 3GGDA 5EEHA 3UJCA 5K05A 1F38A 2G72A 2ORED 3PX2A 1X1BA 4KIGA 1L9KA 3DMGA 4POOA 3SM3A 5FTWA 1PJZA 2H11A 5K03A 2HNKA 2JG3A 3PLAE 4OA8A 2YXLA 3A4TA 5FWAA 5HIIA 1NV8A 2PX8A 3MTEA 3BWMA 3ELWA 4QVKA 1RJGA 5EEGA 3TFWA 2FPOA 5MHTA 5K8VA 5LR6A 4YV2A 3AXSA 4HRAA 5F2KA 3GNLA 1O54A 3UJ8A 1MJFA 4QDKA 4GBED 4RWZA 3RIEA 3OFJA 2IIPA 3LPMA 1ZGJA 3FUWA 4PIMA 3E8SA 4ER5A 1NW3A 3KQSA 4HTFB 4YV0A 3A7EA 3EVDA 4GOMD 3LDFA 1JQ3A 2KW5A 3NVKI 2BR4A 2ZULA 5FHQA 2DPMA 4XUEA 5E8JA 2XVMA 3KR9A 3RW9A 3UJAA 4AZTA 3R9XB 2OO3A 4P7KA 3LHDA 2IGTA 3LKZA 3OZSA 2G71A 3KPYA 3UWPA 2Z6UA 3G5LA 5EZSA 1R74A 3ORHA 4E31A 2AOXA 4EKGA 4PYJA 1X1AA 3EMBA 2H00A 4RTNA 5FQOA 1VP9A 1JSZA 4X61A 1ORHA 2DULA 2NXEA 3KPJA 4DMGA 4K6MA 4GOOD 3LCCA 3LCVB 4RTPA 3DMHA 4RYLA 4WVLA 3TRKA 1FBNA 1YUBA 10MHA 1JSXA 3C3YA 5FA5A 1VLMA 4AZVA 1L1EA 3O7WA 2C7OA 2CKDA 4DF3A 2QY6A 1G8AA 5P8WA 4XCXA 5B1SA 2PLWA 1VP3A 2AN5A 3P9KA 4A6EA 4E2WA 3OU2A 4RTOA 1D2CA 3V8VA 1NW5A 3HM2A 1JG1A 3DP7A 3DXXA 3FPGA 5FCDA 2P8JA 4IWNA 4RTRA 1RI5A 2AS0A 2YUIA 1EG2A 4BY9E 1G55A 3C3PA 5DLYA 1G6Q1 3GCZA 3HVIA 3VC2A 3NTVA 4RV9A 3T7SA 3UJ6A 3WSTA 3ER9A 4HSGA 4PYMA 3ERCA 4Y2HA 2JH8A 2P3OA 3GIWA 3LL7A 5LQKA 2YR0A 4FR0A 2AOTB 4RTKA 2PSSA 1QANA 3R3HA 3H2BA 2QRVB 4BLUA 4RTSA 2PX2A 3SVZA 5IKMA 8MHTA 2O0LA 1WY7A 3HTXA 3E7PA 3LGAA 2ZFUA 3X0DA 3LECA 5EMMA 3GO4A 5FA8A 3NJRA 3HCBA 3AY0A 3EGIA 5EGSA 5GM1A 3FUUA 2JHPA 5DM2A 5C1IA 2XVAA 3BUSA 3P9NA 1JR4A 2ADMA 4X1OA 4Z2YA 1VE3A 2AN4A 4RTMA 1SQGA 1F3LA 2R6ZA 1NW8A 4C06A 4YV1A 5GIPE 2PT6A 1OR8A 2HWKA 5DWQA 2PBFA 3GJYA 1NT2A 2P1DA 3ELDA 3GWZA 3GXOA 1JG2A 4ER0A 2Y1XA 4HGYA 3SX0A 3UFBA 4E33A 5LQJA 4GOLD 1XCLA 3JWGA 4MQ4A 9MHTA 3NWBA 1FPQA 2PWPA 4PONA 2ESRA 2IPXA 1RI2A 3LX6A 2VDUE 3PX3A 4FSDA 5CVUA 5EPEA 3UJDA 3BZBA 3NDJA 5GIOE 2XYVA 3G88A 1NBHA 3SR4A 5EZQA 2XBMA 2BZGA 3B3JA 5E1OA 4X60A 2C7RA 3EVAA 5DX8A 3A27A 2GA9A 2GH1A 3DTNA 3NVMB 3G2MA 2YQZA 3MERA 3DULA 4HC4A 5KYGA 5GOZA 3GRZA 1R8YA 3EEYA 3O31A 4GF5A 5HZMA 3OE4A 4QPPA 4BLWA 2ERCA 4LWOA 1ORIA 1WXWA 2B25A 2PT9A 3P9CA 4U7PB 4CKCA 4KDRA 5HIMA 1FJXA 1JQDA 1ZGAA 3Q87B 5DSTA 3FTFA 3VYWA 1D2HA 3FRHA 4OA5A 3TKYA 1SVUA 3FPFA 3G89A 4RVHA 5F2OA 1KXZA 4QQKA 1XDSA 5DXAA 1SKMA 3CJQA 4HG2A 5K01A 4KVZA 3E23A 4OX9Y 4XUCA 3TOSA 2P40A 5LQAA 2AOVA 4F86A 4P7GA 2P7HA 3NDIA 3UJ7A 3P9IA 4G56A 4BP1A 4KW7A 4BLVA 5JUWA 2ZSUA 4YUXA 2P3LA 2HR1A 5E1DA 1R6AA 1QAMA 1L3CA 2PJDA 1DCTA 7MHTA 4AUKA 2P3QA 1X19A 2NYUA 2EFJA 3HCCA 1UFKA 3JWIA 1WS6A 2GB4A 4PIPA 5KS2A 2BR5A 3FUVA 4FGZA 2UYCA 4H0NA 2PXXA 3SSNA 3A7DA 3SXJA 3AWIA 2N47A 5F2NA 2ZTHA 5E2AA 3HVHA 3KR0A 2OB2A 1B42A 5LQRA 4R05A 3U81A 2I62A 1XDZA 2XYQA 1YB2A 3M70A 2IBTA 3GRYA 5K0JA 3FPHA 3TLJA 2PGXA 2O57A 1JQEA 4IV0A 4QPNA 5T67A 1V39A 3P2KA 5E1MA 1NV9A 4C08A 5K0LA 2VDVE 3DUWA 1KIAA 3HA3A 1VPTA 3M6XA 4GUAA 5K0CA 3OU7A 3EVGA 5LQNA 1ZHFA 3NW9A 2EG5A 4MWZA 2AZTA 1JTEA 4RTQA 1H1DA 4V0QA 3LSTA 1KPIA 1KPGA 3HA5A 4KIFA 3OCJA 3KU1A 1YZHA 2GLUA 5KVAA 3MQ2A 4OQEA 4QDJA 4X63A 2YTZA 2HMYB 2C7QA 1VIDA 2BH2A 4EVIA 2ONZA 4PYIA 3HCEA 2FYTA 2VP3A 3EVFA 2IDJA 4KDCA 3TMAA 5DXJA 1NW6A 1ZQ9A 3EVBA 2QM3A 5GP1A 3CKKA 3PTAA 3M6UA 3TQSA 3TKAA 2P7IA 3HVJA 3KQOA 5FWDA 3A26A 4MTLA 1NKVA 2IBSA 4X41A 3LDGA 5H02A 1NE2A 3EVCA 2B9EA 5BXYA 2C7PA 3OU6A 4CKEA 3G2PA 1BKYA 2OKCA 4QVGA 3KQVA 1O9HA 4RVGA 2ZIGA 2NXCA 2O06A 1VL5A 3OZRA 4DQ0A 3UA3A 5CD1A 3I9FA 4P7FA 2ZZNA 1BOOA 2BM9A 2FK7A 2ZZMA 1T43A 1XCJA 2Z6AA 3C6KA 3HEMA 4RVDA 4HTFA 2B78A 4R8RA 4RVFA 3ID6C 3KPWA 5CCBA 3KPUA 1IY9A 3BKXA 5HIKA 1EQAA 5DX1A 5E2BA 5E9JA 3G8AA 4NECA 1XTPA 3GU3A 3G5TA 1IXKA 3M6VA
chains in the Genus database with same CATH superfamily
1AS3A 1RQXA 3MA0A 4KO2S 1US8B 2R5NA 3F97A 3UOWA 1HURA 3D6UA 4DJTA 4D4GA 3I2FA 2NOAA 3MTJA 4QXOA 2PQ0A 5FTMA 1IY1A 3ETNA 5CVEA 4A2PA 2XRMA 4TQ9A 3VBEA 1G9TA 3E9NA 3F1KA 5CBPA 4K9LA 4MUMA 1T2NA 3OEHD 3HCAA 4PHHA 5D00A 4DMCA 4E22A 1TRHA 3UWKA 4HI0E 2EFEB 4FGSA 2AL7A 3WYFA 4WFQA 1UBRS 2F8LA 5KMGB 4BNLA 1DMSA 3DAHA 3L7NA 3CB4A 3P2IA 5AK4A 4GICA 1Q91A 4FJ2A 3MTQA 3I05A 3OZTA 1XRSB 3PWSA 1A9XB 3IDSA 3QIAA 1WSAA 4MB2A 4YP6A 1J39A 4GLFA 1JKMA 2C8KA 4OUKX 3R9KA 3GRKA 1OGJA 2V4UA 3CKMA 2XI4A 4XQEA 5EC8A 1EUZA 5A4MS 3D7MA 3HC7A 2SHKA 3LBFA 5B6IA 1HFJA 2DWQA 2DQ4A 5JR3A 1RZRA 3F9IA 5FOUA 5LA6F 1JRLA 4Y0AA 1DC6A 2YCLA 2Z1MA 2CWWA 1FU7A 1YUNA 3OFKA 3PT9A 4ARZA 1II8B 1MNAA 4ROTA 1BEUB 1ULSA 4TTRA 4AJ4A 4BCDA 1E5TA 3BWCA 5JCOA 4BV9A 1U3CA 2CVQA 1ZM3A 5CJ2A 1H2EA 3SZUA 3H5NA 4C0QC 1Z07A 4RY2A 2OBYA 4TV8A 3VSBA 1W5AA 3DE7X 3BHNA 3HY4A 4TUYA 5JQGF 3ZCXA 1SZJG 3DOUA 2AD5A 4U7HA 5D7NA 4OUDA 7REQB 3SZRA 2BBSA 3KTAB 1BU8A 1TM7E 4HHEA 1M5UA 4F9FA 4NMMA 2JJ1D 3J80A 2H9AA 5DLQC 4R3NA 2TS1A 3GDOA 4I3GA 5IK2A 3VI4B 1NBOA 3HL0A 4PC7A 4MR7B 2IDKA 3RK4A 3AG6A 4QXMA 1OV4A 4NESA 4HB2A 4QA9A 3FZNA 5DRTA 3R7BA 3WLEA 5J3JA 1GTJ1 2LCQA 1UP4A 2HIGA 1QIGA 5EMJA 2FR8C 3AT1A 2Z57A 1M1YA 2LIVA 2WA2A 3G85A 1S0UA 2EQBA 4OAQA 4RX1A 4WGGA 5FI5A 3VPBA 4CDNA 5C46F 4QUDA 3ZCRA 3GROA 3KJGA 4LPSA 5BMOA 1E9FA 3G2OA 3GUVA 4L3OA 4MV4A 3PLRA 2ONYA 3E2PA 2OFPA 2HNBA 4BFZA 1LSSA 1T3GA 3GFGA 1O95C 5AHWA 4ZOLB 4CVNA 2R6R1 1ZG3A 3KUXA 3VJRA 2O8EB 1VIYA 1ST3A 2WJPA 4OL9A 3W0LB 2CHFA 2NYAA 4ZCPA 4Y9UA 1NLFA 1RYHA 1W5BA 1AN9A 2VCYA 3DYBA 1CS0A 1FXWA 2E7ZA 2UZAA 3FD8A 4NYMR 2FP3A 1DC3A 3V4ZA 2ZTMA 3HNRA 1E96A 5HIAA 4N48A 5DM70 2GLTA 3SICE 4P4UA 4FHGA 4QGBA 4YMTA 5L53A 4ZJZA 1V95A 1CPYA 3GEMA 3O8DA 1W2WB 2CV0A 4M0FA 1RBZA 4DADA 1NURA 3DDUA 3LHIA 4A15A 1NBME 3DW1X 1EKXA 3EWNA 3FMIA 4M0MA 1BRTA 4CG1A 4ZQGA 2ZWVA 1BH6A 2BKLA 1GPAA 1JJBA 5LYJA 3SYMA 4UD6A 1UXHA 1H4VB 4XGQA 3X1MA 3IUEA 5DK4A 3AVYA 1XDUA 1Q0LA 3LXMA 3B6EA 1V8ZA 5DYIA 4N3NA 3QPBA 1SC3A 4TKVA 5I4BA 3H2YA 2GPTA 1HT0A 3OPYB 3ZDZB 4HEHA 4M60A 2Z6UA 1A8PA 1D8AA 1P2VA 4OHWA 4OQ4A 3ANXA 4MV8A 5C18A 5JNWA 1AV6A 1Z45A 4NQZA 2NTYC 2NMVA 4DCVA 5JNLA 1WZNA 5M5BA 3AFNA 5KTSA 5BWNA 3F3KA 2PH7A 5DISB 1S9DA 3B3GA 1HETA 1DKUA 4G8BA 5ALLA 4ER7A 2CMHA 4L0DA 3EXFB 3BJZA 1VMKA 2C7GA 2PPLA 3FFXA 3IQHX 3JD0A 4GSLA 3OVMA 4AULA 1EHYA 3GVIA 4OO3A 3IV6A 3DW3X 2REOA 2VZ9A 4KN6A 4MS4B 3IP3A 4OXYA 3W5BA 3LT1A 1ZD2P 2Q41A 3ZHXA 2UYHA 1A9SA 1PJRA 1XEFA 2DWPA 1QGUA 1O5OA 2QLJA 3F3YA 3L7IA 3VZBA 4KXFB 1K5PA 3VH3A 5EXXA 4FJ1A 3FBGA 2GWRA 2R87A 3V4RA 1KXJA 4JITA 3WL8A 1UBTS 3F96A 3OE7A 1DWUA 4AG5A 5I7SA 5KREA 2OCKA 4AG6A 1AKYA 5UKDA 6GPBA 3WHLA 4TYQA 4KXMA 5HWSA 5EWLA 3C8HA 2FRXA 4FXPA 3GMTA 1NQUA 2QSUA 5KWSA 5ECYA 3W5IA 1EP1B 1ZJJA 2PNJA 3VJMA 3K0BA 4E5DA 3PHIA 2YYZA 2IHKA 1TCVA 4MGYR 4LUCA 5D5PA 1TGVA 1WF6A 1HQDA 4EY6A 1VXRA 3GY0A 2QUHA 4UU8A 4A91A 2AOWA 1C7FA 1P39A 4JR0A 4XQCA 5FTNA 3ZBPA 3GA7A 5LSAA 4Y6PA 2WU8A 2EL7A 5BSMA 1U7UA 3GT3A 1I01A 3KHKA 3IA7A 4J94A 1QIHA 4MUIA 2GNPA 5J4HA 4UJ5A 3UMBA 1KH1A 3FWPA 1EX1A 1YI8A 2WUDA 4HS9A 4J1QA 1SULA 2VSXA 5AYVA 4IVNA 4B3HA 1RYZA 3MMPA 1SHZA 1L7DA 2R6AA 2XIQA 4EUSA 2V7EA 2E18A 1A7UA 2L18A 3HLYA 1AGRA 3WO1A 1VG0B 1Z39A 2XOXA 5CA0B 2IXEA 3OOEA 4QGHA 1JXMA 2B8JA 1W0JA 1XVAA 4HV4A 2OXIA 4HLUA 2H6EA 2OLEA 1CR6A 2ZWMA 2FEXA 1O9BA 2DLNA 1E0AA 1UM9A 3K1ZA 1VI6A 1YV9A 3IBSA 1Z2EA 4TVOA 4CR6A 5BN5A 5KHOC 4FWBA 3BXOA 5FYQA 1K97A 1GA4A 4B4UA 1CFZA 4MKRA 4CV3A 2BN4A 4UU0A 4X1IA 2ACEA 5D86A 1HXHA 4OHXA 2D7CA 4MVJG 1X15A 4W9NA 1KJ9A 5EIHA 3H9GA 1OV6A 3QKIA 4G5GA 4IDEA 2HTFA 3WK6A 3REOA 4G0QA 1HE2A 2WTUA 1XZEA 2A1TR 3NBMA 4ZYVA 2E9SA 3UJHA 2IEDA 1OCEA 2QIOA 3O4VA 3OF5A 1Y4SA 4KI0A 1XDBA 2BELA 2M9MA 3H2SA 4KMOA 4BQOA 1T4MA 2A5DA 1CUBA 1EJ0A 1G38A 1CULC 1GTVA 1HE8B 2I66A 3AHHA 3PYMA 1XEWY 4FC6A 4J4BA 1DXYA 3TZLA 3ZNOA 3GT0A 4EDHA 2CXHA 2SCUB 4QODA 1WW2A 4OD0A 1RS0A 3U0BA 2GPAA 4O2AA 3LFHA 2QNIA 3PA6A 4TQUS 1V26A 5KJ6A 1E1LA 3I8OA 3CW9A 3LW7A 5FUVA 5TPWB 1CQJA 5ENVA 4UNIA 5H4GA 4OJTA 5K03A 3DFMA 3E9CA 2H92A 3OURA 4D9CA 2PWBA 1NV8A 3JSXA 3NETA 1MGPA 2PNFA 4YASA 2B4AA 3A6DA 5JZBA 5K8VA 2ZUEA 1YMQA 5C1OA 2I4RA 3L9WA 1MJFA 1U02A 2EBFX 1N92A 4IIJB 5JAQA 5CFLA 5KX5F 1W4ZA 2GCIA 2B2XA 1DAHA 3EDRA 2XSZA 3JQ9A 3OFJA 1VZ2A 2Z5LA 1XX6A 4JOQA 5FA6A 1L8OA 4LOKA 4X92A 2DHEA 4J4HA 1EFAA 3AVVA 1GHTA 2GBLC 1QP7A 3TAUA 3THWB 2XDWA 1O8CA 5CLIA 5CNKA 1QSGA 5IUKC 2DPMA 5FBQB 2I80A 2DSNA 5HCUA 5BV7A 1CNMA 5JS8A 2QDXA 4K9RA 1BD4A 1NUPA 4EHHA 4C1BA 2G71A 2VTEA 4RFLA 4MW4A 4X24A 3GCWA 2CKMA 3PEUA 1JE1A 1MX5A 5FFFA 3EMBA 1P5ZB 3V8RA 4O2BF 1OZFA 3COSA 1G6OA 3V33A 3K2BA 2K7FA 2FZWA 3D8NA 4US0R 5JNVA 3W5CA 4DFDA 4CMIA 3PFKA 4JP5A 1B8UA 1WXEA 1JU3A 4DMGA 2BEJA 2WIGA 3QNUA 4U00A 3IEXA 2RB4A 3SQXA 4RTPA 4WCFA 2VPIA 1U98A 3OCXA 3SF8B 3FFTA 4C88A 1FRFS 1HSZA 2CKDA 4MICA 5EJEA 2ZRGA 4Z8YA 3CNBA 5LP6A 5TEVA 3K0FA 5T4HA 3QE0A 4LHEA 2P0AA 3UHOA 2QTWB 4XX1A 3RHZA 5DYWA 1G7TA 3FLBA 4FQ7A 3PSHA 5COBA 5ED4A 5PNTA 4MMXB 5B2ZA 4M9ZA 1CERA 1OF1A 3TZCA 2JGDB 3U2QA 4PRLA 1E92A 1NUSA 1SQ5A 1FFAA 1JHQA 1JW9B 1QUFA 1CR4A 1DTWA 1P2TA 2A33A 1H93A 1DT5A 2YJGA 3LYUA 4IJ6A 4WK0B 4DYHA 3J7TA 5H7XA 3P0EA 3M1LA 4BNUA 3U7QB 3NUGA 5LQKA 2GK7A 3U3ZA 4Q3BA 3ZVRA 4WUTA 5IT0A 1T4CB 1YZKA 2HA2A 5G3ZA 4B9EA 2FLWA 3OM0A 3HTXA 1RSZA 2O7NA 1T9ZA 2Q1YA 4JI6B 3HB0A 4JOSA 5AJVB 3EPJA 1G41A 1NJ1A 1NUAA 2XWPA 2QJOA 4UU1A 3T1OA 2ADMA 4EHLA 1NVUQ 1GLGA 1D4AA 1XCMA 2QGZA 4MRMB 4B6QA 5GJWC 3H6HA 2NSJA 3HJNA 3VH2A 3I5AA 1OREA 3MEQA 4R9VA 4OLHA 1R0YA 3L4BA 2P1DA 1UPBA 5TEWA 4A1OA 4EQ6A 4ER0A 1JHDA 1QU3A 1R1DA 3KEMA 3WP0A 3UT6A 2ESRA 4MCIA 3NZEA 1YZUA 1EZZA 4XD7A 2B61A 3HXTA 3W5HA 2BEUB 1WV1A 1MJGM 4IJMA 4R41A 2BLNA 1W47A 3PDIA 3S55A 2JAWA 4J7CA 2ZCVA 1Y1TA 3AL3A 5U9CA 1XNQB 2VEDA 1GYQA 3KLBA 3ZY6A 4BMZA 2F8SA 2P2YA 5BNFA 1PKEA 1Y37A 4S1OA 3O31A 4FK8A 4WH0A 4LKRA 4HWTA 1DQRA 2I9PA 2Q2OA 4KTVE 4AYTA 3PNOA 2X0DA 3P9CA 5CX4A 4YQYA 1G17A 1U0LA 1C50A 1RRMA 4P8RA 3LBAA 2XTMA 3P4YA 5DSTA 3VYWA 2XVXA 4JLDA 5BMVB 3RVBA 1M1ZA 3TKYA 1FQKA 2ACVA 4C5CA 1EXVA 1FSZA 4MIEA 5JAZA 2N9UA 2NO6A 2QD3A 1AVTA 2B4QA 2G9ZA 1LI5A 4LRWA 4F2DA 2YNMD 4RFSB 2IK8A 2FXVA 1GZDA 3HADA 1M7HA 3S2GA 2ODEA 1OTXA 4TYYA 1XTRA 1RT9A 2JZOA 3F5SA 3MK31 5E0KB 3MMSA 2R8ZA 3QEBZ 3ESZA 5AW9A 2EDAA 1D5CA 1EBUA 1Z2CA 1PW7A 2H7YA 4WV3A 2LTAA 1DCTA 3FGPA 2XQVA 4N5LA 1V6SA 3ICCA 5H9WA 2ZRFA 1MHPA 3X1YA 4BNWA 4K9NA 2R1UA 4KFUA 2Z9CA 1QRTA 3ZJTA 2OB2A 4O4IA 2GM4A 3DP9A 4Y9TA 5K3AA 4JI1B 5GPBA 2L42A 1R15A 2YBEA 4R0VA 1GM5A 1XLWA 2BHTA 3DEHA 2BFWA 1XPUA 2O57A 5KYKA 4P4SA 2E3JA 3KCQA 1Z8NA 2Z8YA 2LBPA 3C24A 4IHJB 4C7JA 2EGUA 1M67A 1ISPA 1OZGA 1VIAA 2EF0A 4FZ3A 2I55A 4G63A 4TSFD 4BLSA 4LZPA 4YQEA 3G2KA 2O8BB 3VV2A 4MWZA 4B45A 4P7BA 1H1DA 4PPNA 5BWLA 1U99A 1T5IA 4GMHA 1FFCA 4M8LA 5BY2A 1X92A 5KNBA 2FMIA 2XCOA 2DE0X 1U2EA 4FEEA 1IN1A 2HEIA 4KU4A 1N6HA 4EVIA 3GLHB 2A58A 4EARA 2OZLB 4QATA 4R1UA 1E60A 2VP3A 3ISJA 3OTHA 1CJMA 2MSWA 3OCYA 4O8CA 4RESA 4X95A 3ZU4A 1AMNA 2DQYA 5A4JA 3L0DA 4IWXA 4YDHB 4CMEC 2I2DA 5I9MA 5BQFA 2H17A 2P7IA 4NOJA 4Y7CA 5FWDA 4LZZA 3KDPA 3CKLA 3HBLA 1AHIA 2QTRA 4YRJA 2R00C 1IZ9A 5I45A 1NZFA 2I91A 5DCYA 1NE2A 1QTNA 1PJQA 1OWLA 3NEAA 4IICA 2ZIGA 3LQ2A 4DRXA 1J25A 2C96A 3RSHA 4ACBA 3H5TA 3I9FA 4OHOA 4P53A 5TE9A 2WFLA 4DILA 2ZZMA 2AJDA 3H9EO 4KODA 4G3XA 4D9NA 1C4WA 1A98A 2G7ZA 4AJJA 4IMPA 2HXGA 1TQ2A 1VOTA 3L5KA 5JD4A 1FSPA 4RMNA 2B78A 2OCIA 4ZICA 1P4GA 2JEYA 1G20B 1OLXA 3H9UA 3FIUA 2NVWA 1IY8A 3T1YB 1OASA 4LS3A 4O1HA 1Q0HA 1EQAA 5EXDA 1OWOA 2WJ3A 3WNBA 3U6KA 2VVTA 4GU5A 3GLFB 2B99A 4F6LA 2OCAA 1P73A 3G5TA 5DZSA 6REQB 3JQCA 1WULS 3UG7A 1N6OA 2AIRA 1RPTA 1MTOA 2FP4A 3KZ1E 4KQHA 4MQMA 5CFOA 1MHTA 4NV3A 4ENVA 4S1TA 4X20B 3HBAA 3NYRA 5CLGA 3GRVA 4DQKA 3WGMA 1I1QB 4PYNA 5LMZA 5BRAA 3WB9A 3HHPA 1KKLA 1HY3A 1PE0A 3SN6A 1DUVG 2BKUA 3L8DA 3RE1A 3H42B 5LOVF 3RAGA 1JQBA 5CH5A 3NHKA 2O3QA 5G02A 3S7TA 1A0OA 2XECA 1FJ2A 1KJQA 1RLUA 4BFVA 3EMVA 5G4KB 3O84A 4Q7JB 1HG1A 1JEAA 1EFVB 4CPDA 5TLSA 3TH5A 3WICA 1HUQA 3JALB 4MP8A 1N32B 5B30A 3N07A 2Z2KA 1ZVQA 2QR5A 1AUQA 3PFFA 5AD1A 4BV2A 4KO4S 3I76A 3ADDA 3EG9A 4ETMA 4F38A 4KO3S 1RXUA 3GRRA 4XFJA 2FHPA 4DA6A 2O3TA 1KZ1A 3BE6A 4MKFA 1MT0A 2FCAA 4QTZA 1D6NA 2GO7A 4PAMA 4BMOB 4C76A 2ZDHA 5C1BA 1JHYA 2D3TA 3WLRA 4LW8A 3GWGA 1KBZA 3DOFA 3OMXA 1V1MB 5GV8A 3BTOA 3FF1A 2D2EA 5FUBA 1DAIA 3JAWA 3O2NA 4PYRA 3HH8A 4QUHA 5DTQA 5CB4A 4FBGA 1PZMA 4WERA 2ADOA 1R10A 2A59A 2G82A 2VRCD 3CRVA 3ITKA 3QE4A 4ZXFA 1JAYA 1SVOA 1UKVY 4ARBA 1ZMTA 3T4EA 4UM9B 5B7GA 1JL3A 1Q7RA 4WXEA 4DQXA 4YMHA 2VHXA 2CCGA 1VE6A 3LXRA 3R3JA 3ASUA 3CRZA 1EQUA 1QDEA 2ODAA 2PAAA 4XI9A 5JCOC 1OH7A 4GE3A 1ODLA 3LPNA 2Q5CA 1UK8A 4WJLA 3QUTA 4N8EA 4NP6A 3TLCA 5C8VA 4YPFA 3N58A 3UXMA 3E5MA 2QDKA 1RVDA 1YK1A 4TV9F 5EINA 1V8PA 3IURA 1FVXA 1L5ZA 3WDMA 1OFUX 2EFYA 1J5XA 2QB5A 4KBYA 5K5EA 4U3JB 2JGFA 5LN1A 1QU2A 4DLSA 4ZIRA 1GAQA 4LECA 1GAWA 2Y77A 4G01B 1T5LA 1Y7PA 1JG4A 3ORFA 3PC8A 4REQA 2QP3A 1PBTA 4HXGA 4Q34A 4XM0A 4BO1A 4FILA 4EFDA 4OF4A 4QHTA 1QHFA 3CW8X 5TGTA 2YHIB 4YRNA 3TECE 4PS0A 2A9JA 4RPGA 1OE0A 1SC9A 4GR5A 4UCQA 4MA5A 4NRDA 5DM1A 3R4VA 4XCQA 1SCUA 1SBIA 2JGIA 3FPJA 4AJIA 3KKZA 4JJ7A 4IGKA 2JIRA 2ZSKA 2ZZKA 4QULA 3QFTA 4CTJA 5DCLA 2VHYA 3D4PA 4RHFA 4BDSA 3AHFA 2DUMA 2ZATA 4WGFA 1UJ2A 1R5NA 3OZUA 4CQJA 3OJLA 2A9FA 3HWRA 4YXFA 2XMBA 5JZSA 2QTVB 5D5HA 2D6FA 2B92A 2MINB 5J23A 2QQEA 2PZKA 1ZK2A 4OJNA 2JGKA 4LVNA 4B6SA 5B7QA 2QEQA 4ANFA 1XMOB 1XAIA 4JKOA 1KOGA 2NSYA 3HUUA 1NXTA 1ZOIA 3DTVD 3F1LA 1Q7CA 3L82B 3IR6A 3W6ZA 1CCWA 1HEUA 4QFDA 4QJ4A 3QJGA 1UFOA 2XT0A 4FMDB 3BGOS 5CCXA 1TT7A 5AVRA 2VPTA 4QECA 1RWOA 5B1YA 2BDTA 2KSQA 2XNSA 5J5VA 2R8EA 1TKBA 4ZGBA 2NSDA 2ANCA 5KYNA 3DDSA 3F6RA 2OHOA 3FYUC 3L7DA 4BFWA 1AV7A 1UBLS 4A5SA 2BDEA 1WKCA 1XDWA 3E2IA 2OESA 5G0UA 3KHUA 1HE1C 1JDSA 2YVUA 3HV0A 4LPKA 1E2IA 2YMMA 3RC8A 5KTTA 1HOTA 2OBXA 1C5KA 2I3BA 2RJOA 2V9CA 1AK1A 1YVPA 4BMNA 5JMTA 5ADVA 5LBUA 5L40A 4PR0A 1LS6A 1X80A 1ZBDA 3PXDA 3QLJA 3VVMA 1WU8A 4MLPA 4IOMA 5T8KA 3W9BA 1UC4B 2L0XA 2VHZA 3EPRA 3I1YA 3JS5A 3MSXA 1QWSA 4N8SA 5HIJA 1JE0A 1KY2A 3GMIA 3ZI0A 4EM6A 4LJ5A 4GI1A 4HATA 2K2QB 3RRJA 4O33A 2PIDA 2O2HA 4HLDA 1Q0SA 2WBLC 1ZS9A 1R8SA 2QT9A 4JSYA 5HE8A 1L7XA 3T9BA 5JJIA 4IDDA 2TSYB 3DJFA 4AKEA 1U8EA 4RK7A 3SSOA 3PL1A 4OFWA 5M34A 1BJRE 2QSJA 5AO9A 4D44A 1IHUA 4P33A 4M9QA 3KVOA 4ECEA 5FPQA 4QTYA 3OTQA 2YJNA 5IFKA 2ZPTX 4LSZA 3ZW7A 1UWVA 1UEJA 2VHJA 3I12A 3NOVA 1GPNA 1RIIA 1X1RA 4GWKA 4P54A 4XUDA 1ULAA 4JJ4A 1DP4A 4Z3KA 1H23A 1Y42X 2FKNA 3N2KA 4LV5B 2AFVA 2AXQA 4QZVA 3E6AA 5IYZA 5JXJA 2ZW9A 2PUGA 1EK5A 4CEJA 5IUJC 1KWKA 3OI7A 3S6JA 4EGJA 1IATA 4D0RA 5J4LA 1E3WA 2H2FA 1J1UA 1TEZA 4MRRA 5AI0A 1QP0A 1FMLA 1I0LA 2CSXA 3ED1A 2OB1A 2PSDA 2X13A 4HWRA 3EH1A 1JEYB 1NN5A 1DAOA 1Y33E 5EKXA 5TMBA 3GZJA 1TDJA 1GV1A 1ZSNA 1GUYA 2I33A 4M83A 3S1AB 2YOFA 4Z53A 2WVAA 1G8FA 4JC0A 4ARCA 5H3CA 5KYWB 1ZKMA 3HU1A 1DO8A 3E9DA 3RVMA 3OKCA 1SKAA 3FKJA 3KSRA 2ZSHA 3CUTA 1L7RA 3T7DA 1TVKA 4Q47A 1A8HA 5I3CA 2X4GA 2G9VA 4TLLB 3F3MA 2ZUCA 5LA6B 4ER3A 1IUPA 1JEQB 3WYDA 3KU4A 1NXWA 3GX1A 4KGDA 4W5RA 4JWKA 1I6KA 3ROQA 1NMSA 1RM4A 5E1BA 1XFDA 2OCGA 4PZEA 2GCGA 3ZIDA 5JQGB 4GW3A 1BTOA 4HLUC 4YAEA 4ALJA 2D1QA 1FB5A 3ZQKA 3ZH2A 4KCGA 3L0SA 1CNFA 1JLHA 4FW9A 3PXUA 5JSUA 4YJGB 2ZIFA 1Y8RB 5KSWB 3BSFA 4FGJA 4MW9A 5CDFA 4H6WA 1W96A 4I1IA 3L0YA 4HGZA 3ZV4A 1UEXC 5BNIA 1G5IA 1P4SA 1MBZA 4W9NC 5TQJA 3HG7A 5F1OA 1G19A 2F1RA 2TECE 1BDIA 3INNA 4HZGA 3MBOA 2VJOA 3CH7A 4AKHA 1TF5A 4V2UA 2Q3EA 4OQDA 1AHPA 2LZ0A 1FP1D 1T24A 4Q37A 4MHSA 4LSMA 4J76A 5F52A 2G08A 1UIMA 5AVTA 4RAQA 3CVUA 2H11A 1ZISA 2IUSA 3DDWA 3MLEA 4MKGA 4D0SA 3W2HA 2QVZX 2WJ4A 5A9TA 3W5VA 4Y2GA 4TROA 3L8CA 1ZOSA 3MSCA 4G8JA 4C0AC 5EEGA 1YS1X 2PRZA 4D0GA 1DC7A 3K5HA 4I9HA 4ALNA 5ADWA 3CNEA 1SXJD 2QI9F 3N5KA 4P3NA 3C7DB 4LQ4A 5AK5A 1C1DA 2IXTA 4KAFA 3D8TA 3ZXXA 4WVFA 5IJ0A 3FUWA 1AZLA 2IS4A 5DEOA 2YIMA 4DLPA 3IV7A 3S2FA 1B8OA 2B1JA 4KQMA 3GVCA 3FVVA 5CJJA 1JFRA 2H4ZA 5TQVA 2WZDA 1PV4A 1T0UA 1WUIS 4JEUA 3JD2A 3ANTA 1I7DA 2E4ZA 1PKXA 2SICE 3FDFA 1EE9A 2X1VA 4PYJA 5A4DA 3IS3A 1X1AA 2O7QA 5GONF 2Z58A 1MDBA 1WSWA 1JTVA 2DFDA 1P45A 2YJ3A 3MWFA 1Q92A 2CYBA 4KK3A 1J2UA 1GRCA 4KLCA 4KP7A 3WL4A 4BNJA 1M9NA 1P6UA 5BYAA 2JIQA 1B2LA 1QG4A 2A4KA 2GN6A 2BV3A 3D1JA 4K6MA 1OLUB 2O8DB 1QIEA 1TO2E 3T35A 3I0ZA 1Z4NA 1QOPB 1K0UA 2ONCA 3E1KA 4ZV7A 5B1IA 4MIYA 1FBNA 3NVKI 1CHNA 5EJFA 5FA5A 1L1EA 3WDSA 1QWOA 3LP6A 4GUDA 3IX7A 1JHMA 1MVLA 1BROA 3BQ9A 2VWPA 4EUNA 3OWHA 1MC5A 4MGHA 1I3KA 2GD1O 2VTVA 3W4KA 4YT2A 1E1RD 5E7QA 1H2HA 3CR8A 1P72A 4FWIB 5KYUA 4F71A 1A1SA 5NULA 3WGVA 1QZXA 2UVQA 1FNBA 3GPLA 2XNDD 5ALIA 4ESVA 1WCIB 3V1LA 3DZKA 3T7IA 1TUGA 2JJ2A 3FAZA 4LHXA 4OJQA 4EG5A 1WWKA 5ALWA 4JEIA 1RQPA 1OWPA 3IRVA 3TNFA 5LP6C 2ZWOA 5LPNA 3DWFA 4UVEA 4KNWA 4DLKA 1JLMA 1PWZA 3B9QA 3U13A 1D6MA 4QOEA 1QANA 4IDBA 4AJNA 5KHAA 4NV0A 4QX6A 4J90A 1UBEA 2VJAA 4JQZA 4DIUA 3EDMA 4AS3A 5FA8A 1OXKB 1UK7A 3G9QA 3G0HA 3FB1A 2GKSA 4IHQA 1WMEA 3TG2A 5TF4A 1NRJB 1OB2A 3SHOA 1QGYA 1TZMA 2DY1A 1GPJA 2VSFA 4M0CA 5HJEA 1XIVA 1E4OA 2HOQA 3OCZA 3KT0A 3IAAA 4G2TA 1OR8A 1NQXA 2HWKA 3OZXA 5CAEA 1NXPA 3RS0A 1X7WB 1H8HD 1K3TA 2CLHB 4MRAA 1E2GA 2WIKA 5FPTA 3T5MA 4E33A 2G9UA 1EUCB 3L7MA 5TT1A 5KDOA 13PKA 1FC0A 1Z0UA 3C4QA 1CDEA 4PONA 4ZYLA 3IDQA 4KH0A 3AWDA 5DI3B 4TGLA 2XWQA 3WMGA 1OI4A 1SK9A 3T61A 3AERA 2BGRA 3EY4A 1W0KA 5EAIA 2AXEA 3KJFA 1RCUA 5DHUA 5FYDA 3SIRA 5IVIA 5IT4A 1ZH4A 4BCCA 1RCFA 3TTXA 3L4BC 1AC5A 1I3CA 2VXCA 4RMHA 1H42A 1MEEA 3CSUA 4L27A 1QG0A 1PNTA 3EBLA 5TF0A 1EG7A 3BIFA 5EQTA 1KJNA 2IOFA 5JPIA 5FP0A 3WIVA 4BLWA 1LDGA 2ERCA 2OQIA 3LUHA 1XROA 2C2MA 4P1ZA 3VDMA 4DTIA 5CB8A 3K20A 1GL3A 3NONA 4IH4A 1GU7A 1ZM2A 2QGNA 3LP5A 4IZ6A 4KNVA 3RGWS 5IC4A 2UVDA 1EM8B 4GXTA 2QX9A 3QU2A 5ALSA 3O8QB 5DXAA 3HBMA 4KR2A 2J87A 2YVQA 2PANA 3AKEA 4HG2A 4YJ3A 4TL7A 4XUCA 3SZLA 1TUEA 1KA9H 3DCNA 4BQSA 2A6PA 3DBLB 3U7FB 2GNAA 1G98A 3USES 1RLOA 1G6HA 1OA0A 2VEOA 3JRXA 4IVQA 2VIIA 2D0OB 5G0WA 4RKEA 4DZZA 2NN3C 3G5MA 4ND8B 3LWBA 3SFZA 3UXYA 2H31A 3RASA 1H4TA 1U1CA 1TJNA 3CFYA 3JD4A 4IF6A 3ORRA 4HDSB 5AJTA 5JUWA 5J2UA 4CTNA 2DFKB 1SAYA 1U4NA 2VLIA 4X5OA 2GUGA 1X19A 3IELA 2ZRLA 3HJUA 3VKWA 1SVWA 3I3OA 4K9SA 3THYA 2XZDA 1U0HC 4UEOA 1GG2A 1HLFA 1MQAA 3R3UA 4JBIA 4W7HA 5CHEA 4ZT3A 1KK1A 3PT5A 4MI6A 4MKIA 1N1DA 2X3FA 5J63A 3FDZA 4ZYWA 4ZOAA 4PG7A 1IIBA 1O94A 3A14A 2BTOA 1TX4B 3GG9A 2A9PA 1V39A 4HQ0A 3UM9A 2EQ5A 3NTLA 3GA0A 5ALMA 1NQVA 2D1YA 5JY6A 4N5DA 3ZLTA 4CGZA 2GVDC 4MS3B 4XOUA 3CZPA 3UPDA 5A4AA 2HZBA 2ZSJA 5ESWA 3V55A 3RK0A 4CM9A 1RHKA 4DC9A 4ESHA 8LDHA 2G6TA 4BAZA 1KPGA 3HA5A 3A0RB 3GGOA 3OX3A 3GT7A 2ZYHA 4OK3A 4DS3A 1JWLA 4JS0A 5JVDA 5KX5B 3SYKA 4F06A 1J8DA 3AR4A 1RMYA 1WW3A 3VU8A 3KLNA 4PYIA 3NCHA 1P1IA 4B3DA 4GKJB 2QJWA 2P2CA 3CLKA 4H2DA 2NTEA 2DSTA 4JT4A 1J5PA 2F90A 4DR6B 1H3NA 3ZWDA 2R1VA 1MMFB 1SVIA 3K8ZA 4X1KA 1YR3A 4TSRA 5TB5A 3CRQA 3BXGA 4YXWA 3G0BA 4XTCS 1CQPA 1OBCA 3WJ1A 2FCRA 2Q6TA 3NWJA 1CZNA 3INYA 1ZPDA 3EJ6A 4MQUA 5I7VA 5KYYB 3AR7A 2W43A 3MBKA 4MI9A 3R8FA 2C7PA 2B2NA 1G5QA 1TJPB 3JVDA 3G9XA 3QVSA 4PE5B 4QM7A 3COJA 4B33A 1OI2A 2FPIB 3EQZA 3RQSA 1RXIA 1GDTA 4O2BB 5IWCA 4KQ6A 1SQ0A 1U80A 1V1RA 3TI9A 3B6MA 2I78A 1KI7A 3D1VA 2A9KA 4N9WA 1DX4A 1ZI9A 1IY0A 1E1CA 4FIDA 2FFJA 4LZNA 2PZEA 4RVDA 3S70A 3ZV7A 2GEDA 2AFIB 4JYAB 1RWWA 3OC0A 4MVJM 4RD4A 4QU0A 1HNWB 3ND8A 4GHWA 1L4UA 2XJ9A 5HK8A 5JH7F 3NTRA 4MJXA 2J3MA 3ZQ6A 3F9RA 1E1QA 1LTHR 3NGXA 5LIRA 1Q5PA 1EE1A 5AKLA 4NECA 2PV7A 2E4XA 2H3EA 4LWQA 5BSUA 3HCWA 3TYXA 2VRWA 4F4HA 1V3TA 2CXSA 2FEWB 2W2KB 3ROMA 4MH0R 1ZJYA 1QONA 5FWNA 5BORA 1E3SA 1LPPA 4J75A 1XMQB 4ZZ1A 3FSEA 4LYEA 3FOZA 4ZVVA 4JA2A 4RA9A 2JL1A 4YH1A 1RMQA 3FTCA 1XXLA 5CXUA 4OAOA 3AM1A 1TTPB 5AXBA 3RTGA 2V3CC 2X9GA 1XEWX 3KOMA 1F2UA 2YW2A 3AM4A 3PPIA 4ODIA 2M6LA 5A7FA 2RGXA 2P9QA 4G0NA 2Q3FA 4OL0A 4KOAA 4A0RA 5KNCH 1PR6A 3VU0A 4PYQA 4ZVKA 3NPAA 3DKIA 2C94A 1VSBA 3HUTA 5ALGA 2D5BA 4BLRA 4IYJA 2ZP1A 3A25A 4ZANA 4M46A 1KMHB 1IZZA 3W8RA 3UJBA 3M9WA 3NIBA 1SQSA 2QRJA 3FNGA 4DGQA 4XLZA 5CLHA 4D8YA 1NMYA 1VPWA 2NZYA 4ARVA 1T91A 1BGWA 4FONA 3ROXA 3AF3A 4OM7A 3AEUA 3E7WA 3PFCA 3WKAA 2L69A 4WDRA 3ZCQA 5FTJA 4Y2JA 4Z4CA 3IOCA 4DDTA 4HRXA 1FYVA 1BXZA 4R84A 1XXHB 1FP4A 2IRWA 3N76A 2Z4SA 2Q07A 3AR8A 4FFDA 4K9DA 4X3CA 3WHKA 1SH7A 4I6JA 3OM9A 3L18A 3PDCA 4JOCA 4IQ0A 2W2LA 1R9JA 1Y48E 3B52X 4C3UA 3M81A 4LYGA 3RT1A 2VDPB 3DEYX 1JFTA 4TZ0A 1TL7C 1YCHA 4MROA 1ZMXA 4KQFA 3CPSA 3HE3A 3JX9A 1Z4LA 3I9LA 3PGJA 1VCHA 3ZN2A 1YBHA 4E5YA 1ZR4A 1DE0A 2GZ3A 1GTRA 3N0VA 4HL6A 3E70C 4FGLA 5T5QA 3LM8A 1B7GO 3D43A 5EMKA 4Y3UA 4UE2A 3RUDA 5H70A 4G5QA 1Z4JA 4BNDB 4E51A 2OORC 3OG9A 3DLCA 3TOXA 2Q6KA 4OXNA 4TS3A 3ZK9A 5JCZA 4DM3A 4EO7A 2VCEA 2VPYA 1KI8A 4CIBA 3K7EA 1DL5A 1Y3FE 3PQEA 1WZIA 1NXOA 5F5XA 4Q48A 3TRFA 4F45A 5HOQA 1I4DD 4KMMA 3T3MB 2VXOA 3BWBA 1Y4UA 1BMFD 1KYQA 3TR6A 1R18A 2I2FA 4LDPA 4DPMA 1ZAYA 3VKGA 2NQ8A 5AHXA 2FG5A 2OQRA 1NQWA 1ZSYA 1VYVA 3TZBA 3E3MA 3ICOA 2ZREA 1KTVA 1MZPA 2A84A 3N05A 5JMPA 1HQYE 2RMKA 1HTWA 4NFLA 5EJ2A 3T1HB 1DMRA 1LI4A 1U7HA 2DAPA 1KMMA 2XB9A 1NF2A 1J0CA 2GJSA 2QU7A 2OG1A 2WTNA 1I9CA 3KQMA 3KWLA 3LQFA 5E6RB 1W7AA 1GAXA 3PE4A 3O73A 1O5TA 3U0VA 3U7EB 2NO4A 1KJIA 2JIMA 4E1AA 5K8UA 4LQLA 5ALFA 1ONBA 4FWTA 1PNVA 1RYNA 5LQUA 3MF4A 6ADHA 2EYQA 3K30A 3PC8C 2ZBGA 3WR5A 1Z6XA 2DH5A 4RKYA 5F76A 4UU7A 4AN0A 5L7YA 5DHSA 1TEXA 4J0GA 1Z5UA 4OHZA 3BVPA 4O1MA 3D6AA 4QPCA 5FB3A 1JKIA 3ET5A 3M6AA 3MOGA 4MQFB 5BSHA 2CLKB 4KXVA 3REQB 1GQRA 3C8UA 4QXQA 3RRZA 3QPAA 4XD2A 1P75A 3O8LA 1KJYA 2F3PA 5LUBA 3GNSA 4MS1B 3DLTA 4RXTA 1DAGA 3WB0A 5AW1A 1KQOA 5LJLA 2BZ0A 4NG4A 1WMSA 3K1TA 4CM8B 3TIIA 1ONSA 2RIPA 2QAGA 2HMUA 1MFPA 4DSNA 2FVYA 5T7BA 1ZW6A 3CSSA 1C7IA 1KP2A 4RD0A 4FZVA 4QXRA 4QUBA 5K0EA 1NI3A 3QI2A 4G65A 1CRQA 4XVHA 3DEAA 2QNRA 4M98A 4QU5A 5B1DA 2XQIA 3DTTA 4BLOA 2IZ6A 3FGZA 4FI3C 4C0JA 2GQ0A 1ZMRA 1ZCBA 1E1DA 5HOEA 2VATA 3OHPA 3Q72A 3DLHA 2FRVA 2C77A 2Z2JA 1RNLA 5FNVA 4TWBA 3W5JA 5KNDD 3OSUA 1OXSC 3OX2A 4QOJA 3TTVA 4UUBA 5EIXA 2DTDA 4HEQA 4PZAA 2O23A 4DWOA 3K72B 3TOZA 1K27A 3FY4A 3JZDA 1WXHA 1VLQA 4ZKEA 3THRA 3ZTTA 4YRLA 4UHEA 4UTRA 2CLFB 1CVLA 4GRIA 1Y0BA 2IPLA 2QR2A 4XIGS 4O3MA 1BW9A 1GZSA 5E0OA 3W5SA 4PSAA 2PTGA 1P1KA 4GXRA 4BO3A 4EFKA 5IARA 1AKUA 4MARA 4NEQA 5ECDA 5T8KC 4FCTA 4KN8A 5JG7A 4LFCB 221PA 1USGA 4EHIA 4TPKA 1RWVA 1JLLA 2MR5A 4R2LA 3NAMA 2X8JB 3OEWA 3QF4A 3AVWA 3RYIB 4YYZA 2BFNA 2ETXA 4HYEA 5HKKD 2AG0A 2XR1A 3OAAA 1KOLA 5C8XA 4GP7A 3K0CA 5DIFA 2OZVA 2Q0HA 1MB2A 2GZSA 2X9QA 3EGEA 4GFDA 4PFKA 4BTVA 5LOVB 1MW8X 4KNYA 1QM5A 3EGVA 3VR6A 3EQ6A 1DQZA 1W93A 5HJ7A 4UVGA 3EQ2A 4R2MA 5E4JA 4HQRA 2P5TB 4W5WA 3VR0A 1BE6A 1TFUA 4ASUD 1YFLA 1HE5A 4X1YA 2CFCA 4B7XA 1K6XA 1SHLA 4CCAA 2H1RA 1Y5LA 5EIBC 2EEPA 5EE3A 4EHNA 1ZNWA 1C8KA 1SVMA 4KACA 4UARA 4HFNA 2RE8A 4CKWA 3P0JA 4U63A 4KLAA 3RWMB 1AO0A 4EFNA 2XMCA 2AI1A 4JDUA 4OLJA 3T3HA 4TXNA 4D97A 1W88B 1NW9B 1EFLA 3U31A 4YCNA 1ZW1A 2XZTA 3R5SA 5DU2A 4B81A 2X0JA 2Q4EA 1LA2A 3EGDB 3FPEA 1TO1E 4BRZA 3G3EA 4YAIA 1XB2A 2WA1A 3BE8A 4QYTA 3ZD7A 2G6BA 3LG2A 4DA4A 2X0KA 2WMDA 4I9FA 4J6EA 4HQNA 4KRXA 4H4DA 4ND1A 1KSFX 2MT9A 2JGLA 2QUKA 4INOA 2HY7A 4WL0A 2MHCA 5A0FA 1E5VA 3NGLA 4HXFB 4NX2A 3KJIA 2Q5EA 3JQAA 5IC6A 5CBKA 5LKRA 1P19A 1JT9A 2ZCUA 1M74A 2N1MA 1XU9A 1DAFA 3WRXA 4PTYA 2HUPA 3CNLA 3TR5A 4F6CA 5IF9A 1DKOA 3OBIA 4IGAA 4IIUA 5HEKA 4WLUA 1XTVA 3A10A 3ZBQA 4XM2A 4KWEA 4TV9B 3NP9A 1FTQA 1AKTA 2ZPAA 3BA1A 1IJKA 4EO4A 3T3NA 4PX5A 3CG4A 1JA0A 1L5YA 4YHHB 4Q5IA 2Y27A 3EX7C 4CM7A 2PX8A 3ELWA 3TRJA 4OVKA 2XKKA 3W1VA 1PL7A 4AZ3A 1E58A 2PMBA 2XUZA 1YRYE 1U3UA 3JVEA 5HSGA 1O6FA 4F4FA 5F2EA 2C95A 1DJMA 1ADBA 1OVGA 3A4LA 3JAKA 3OZ7A 1XZHA 4RVNA 1IB6A 2XX3A 3IDZA 1F12A 2UZ1A 1HTBA 3JD1A 1U0NA 1CY7A 3KNZA 1UDCA 1R16A 1VG1A 3D31A 3KPYA 2H0AA 4GZLA 5EUBA 3EVTA 3G5LA 4UZEA 2XKBA 3JZFA 1EK0A 1GL9B 3BSSA 3BIXA 4UD2A 3ZQ4A 3BDIA 4NBSA 1EZ1A 2GGSA 4L4ZA 4DLVA 1EM6A 4X8LA 5EJ6A 2H4XA 3DAFA 4Q1FA 2H2HA 1VP9A 1G8GA 1XZNA 5HF8A 5I8ZA 3R7WB 2GARA 2HRQA 1N9GA 3NWPA 1YRBA 3PDUA 3T3OA 3N2ZB 2X58A 1NWCA 4ZJUA 3GVHA 2JJ8A 4C2AA 2XUGA 4HX5A 4RM3A 4JB2A 7YASA 2VK4A 1BGXT 1TCAA 3F7NA 3QMMA 1PWEA 4L0CA 1LC3A 3QQPA 4PLYA 5AOVA 4GO1A 1D7AA 5ESDA 4UZFA 5KAMA 2XTZA 4IHAA 3SX2A 4KLZA 4Q18A 4YWJA 1ARZA 2UZ3A 3LPDA 2P5UA 3FJYA 4RZXA 4FW8A 1JR3A 3GL9A 3U7HB 3WWCA 2HA6A 3UH0A 4RF2A 5BSGA 1V47A 3PR1A 3FH0A 1T1EA 3JCZA 3TLAA 2GCPA 4E5VA 1KMQA 3IKLA 4JJ6A 2ATXA 1S89A 3HGQA 4C7OB 2P4EA 1E1NA 2G5PA 2IKSA 3QXSA 4M22A 1T9CA 2E37A 3A9SA 5SY9A 2WTEA 2DPXA 5CEFA 2AOTB 1V2HE 1D2AA 1DARA 3PUZA 3TLZA 4GRAA 4MPRA 5FIUA 3TD9A 1MVNA 4WPGA 3RC9A 1NVFA 3MN1A 2XWJI 4FLEA 1KDYA 4I4LA 4D4IA 4CMBA 1T5HX 4ENWA 5CDTA 1YZYA 4YN3A 2AI3A 4LF5B 3D6JA 5EGSA 1W46A 2WWHA 3SQNA 2QX7A 3WC4A 4H7JA 2DX7A 4CKYA 2YY7A 4C1NA 4YV1A 4DMFA 4MKXA 4AP9A 3RYCB 5AW7A 3PJRA 3MCWA 3RUIA 2WM9B 3KDSE 4N3GA 4R1QA 1V5EA 1ZOOA 1FPQA 3AUAA 1M7GA 5GAJA 1U31A 2JDIA 1RI2A 3HCNA 3PX3A 4H6PA 4UOQA 4KO1S 2B3DA 4RL6A 1R4MB 3KHSA 5FJIA 1P0IA 3B8EA 3QELB 3B3JA 2IP1A 1Q1BA 3O8BA 2PG3A 3L4SO 4KQIA 3U48A 3W8NA 4DJDC 1E79D 4EECA 4TMWA 5AXAA 3G2MA 3RIMA 2JRLA 4HC4A 2F4VB 1NVVR 1I0ZA 1TK2A 3VR2D 1R4AA 4CFYA 3ZE2B 2QAIA 3MGCA 2Z08A 4G0WA 1PCXA 2CHUA 4O8ZA 3IAS1 3B60A 4B71A 1ND5A 2VA9A 3AL0C 3UGJA 1MQ9A 3S1LA 3UAGA 2B25A 4U7PB 4L0MA 3FRHA 3E15A 3UC5A 1YASA 2H3HA 1SVUA 4NULA 4R69A 4TM8A 5TY0A 1K8RA 4RVHA 4CDMA 5C1DA 1MJNA 1E7WA 1F48A 1HFKA 4FPXA 5K01A 4UE6A 5K2OA 1A2BA 1OI3A 2I4OA 1ZINA 4D74A 1LQ2A 2P40A 4PEVA 2O2GA 2BBTA 3D54D 4EUHA 2QD2A 2XOKA 4P7GA 3Q3IA 3GGPA 3DOHA 2RI0A 3EDYA 1BDMA 3HI6A 3MYYA 1A27A 3KHTA 2CCJA 2ZBUA 1SOVA 5E1DA 1BYIA 2PKQP 4V3BA 1N4AA 1I4EB 1XA3A 1XOIA 2PJDA 3O1LA 1OX4A 1WY5A 3MAJA 2PMKA 4UBKA 4BRUA 4EYKA 3TG8A 1BFKA 4QEKA 1G4UR 3VHLB 1Z7EA 4M6WB 1PG2A 2BF4A 3K1AB 1KEVA 2A94A 3KR0A 3P52A 2OSBA 4KKXB 4LAFA 5JWRA 5ALJA 1H2YA 2MSKA 4MPPA 1IRXA 4RA6B 5TS3A 3E1SA 4DLXA 1Z0IA 3HR7A 1X1SA 5K0JA 1RWQA 4FFRA 3QYJA 2QZSA 4WN9A 1OH5A 5K8TA 2JLXA 2CBZA 4V1CA 3ZE6A 3JASB 5AKKA 1ZIPA 3KZXA 4WWHA 1SUAA 1WCWA 2ORIA 2W2PA 5THKA 1VPTA 1IK6A 2YIDA 1ODTC 1O2DA 1FA9A 2Z8YM 2DXIA 1JXQA 3MJCA 4PQRA 1QRUA 3C7TA 3DV0A 1NTOA 2GJKA 3VNSA 1UP7A 1O94C 3O93A 5EPUA 2VK2A 3KG2A 1HFWA 2HDNB 1CRZA 16PKA 2ID7A 1UPFA 1UR5A 2PS1A 3GIDA 3NS7A 4NZMA 2XDQA 4GI3A 3AJEA 4IVPA 3I4FA 4RZ3A 3TMAA 2QZPA 5JNTA 2YXBA 2IHTA 1GUDA 3GFVA 2ZM6B 3QEMA 2VZ8A 2X8AA 1AZSC 5LZ2A 4WKNA 1UKBA 3UKDA 3OQHA 3A31A 2JLVA 2YN2A 1GFZA 1Y82A 2G7MC 2GZAA 1L8XA 1W4LA 2PGIA 1LBQA 3A26A 3GLHE 2PD4A 3EODA 4D96A 3CMMA 1GSAA 1AKEA 2H4WA 1TLFA 2P2LA 3ASVA 3PHCA 4REMA 5IFLA 5C52B 3SQWA 1XI2A 3QKRB 5IVPA 1FW6A 1NASA 2PBZA 5TPZD 5GONB 2MSLA 4KYUA 5CA1A 3RIXA 2C3MA 2UVPA 3PFIA 2V0NA 1NX6A 3AGPA 2P2SA 3JAMA 4E4YA 2J0UB 1OTHA 4WECA 2UKDA 2QM7A 4FNMA 1BMQA 3ZVNA 2JFXA 3GAZA 4NNJA 2WAAA 4KXWA 1OSNA 4MR8A 3DF7A 4YCBA 3GMSA 4IMJB 1QV9A 3KLMX 1VHQA 5EWJA 4B40A 3TBKA 4DKXA 5C7LO 1VLJA 4EG8A 5CFQA 1AJEA 1GCAA 1YZFA 3NDBB 3F6SA 5DWDA 3G8AA 4DXAA 3V8PA 4HKTA 3QVMA 3KDAA 1VJ0A 1UT5A 1G20E 3MINA 4W1PA 3EXAA 4D4KA 4ZRNA 3NHWA 4CI9A 4NZ9A 4XARA 4EJ6A 1F0NA 2JZCA 3GLFE 1O95D 3H2JA 1D6SA 3U16A 5AM5A 4CUKA 4PZZA 3IR7A 4NICA 2VPPA 1LWNA 5KUTA 3IERA 5LDHA 1JIQA 4L4RA 1S01A 3JRNA 4DT1A 5ELXA 4Z9AA 1FRVA 4BVGA 2X6TA 4JEHA 3CJTA 5AI4A 1U9IA 4WEOA 2UZ0A 4CKCB 1NA5A 3IIEA 1KL7A 5J4KA 2OC9A 2ZDQA 4ZQCB 1PNQA 3W5DA 1EMDA 2EFCB 3QVXA 3ZVLA 4LZJA 4JGGA 1OX5A 2BFMA 3DL4A 2C9OA 1M2KA 4IRXA 2CFSA 5EZYF 3D5TA 1W85B 3UK7A 1GXSB 3O8RA 1ZR2A 2MTBA 5TV2A 1IXYA 5I7EA 2A5GA 2QW1A 1J6UA 4ZVMA 2XA9A 5M04A 4OTZA 1RXVA 2BUBA 4QGAA 3KOUA 3AEXA 5CPBA 3U7RA 2H52A 3H7AA 3WJ2A 1F2DA 1FUEA 3V1MA 3QTLA 2IJGX 4I7EA 3CZRA 3PXBA 4AYXA 3AXTA 3O7MA 1JH8A 5DBHX 1GA1A 1A69A 3B6JA 3OJXA 4EG7A 1TNDA 3EZLA 1EUQA 1E5DA 5AKXA 2V3WA 2W6JD 3MOSA 3STVA 3G1WA 1LRKA 3MGAA 1B4DA 2PXAA 3EZ2A 1TAHA 4RGVA 2PRIA 2X86A 2KB0A 1ZN7A 3KJXA 4UJ3A 2CHQA 4OI1A 1GFSA 4FGUA 2IEBA 3HXPA 2GERA 5EA2A 1QGAA 1WTCA 2BFPA 2L17A 2RCYA 2WSBA 1Z3CA 3D9QX 2GBGA 2PVPA 1GU0A 1QH8A 5G1OA 4NCXA 2W00A 2B8NA 2N46A 3C14C 1M3SA 3OD1A 4M0LA 4TYPA 4BNGA 3HZRA 1U3FA 1ZXBA 2XUDA 4KJZA 2HSWA 1U3VA 2JGRA 1I1HA 3F6EX 1ZI8A 4XR4A 5C32A 3DHWC 5JALA 4LDNA 2ZUFA 1JIIA 1YZGA 3G8BA 4M21A 3CRRA 2W6IA 5F5LA 1UK6A 3QUQA 4MEBA 1X3LA 3HVKA 2VK1A 3OWXA 2XJ4A 3OLVA 4GVPA 5E38A 5AOBA 3UAZA 2VFAA 1ML4A 1MQSA 2EZTA 3STWA 3T4XA 1GQFA 4ID3A 2I34A 2HU8A 3LIIA 3IMEA 4WNCA 4M7RA 1ISJA 4PAWA 4CF5A 2YZGA 2X14A 3E4DA 4RIEA 3BE5A 1QFZA 4BEBA 3BDAA 3DO5A 1Q50A 1Z6AA 3K1JA 4J2TA 2FSIA 2Y3IA 4ZZ0A 4P34A 1BHJA 3BWEA 3MTBA 3UNXA 1VC2A 1YU9A 2P69A 1DKPA 3CX6A 1CQXA 1LDEA 3EUWA 5ESRA 3H04A 2XHZA 2QTFA 5DTMA 4CKEB 4LSWA 1HNXB 1DV1A 4C4AA 3DO6A 3LVFO 4B84A 5FUWA 4G9EA 4RK5A 2Q46A 3LV8A 1PZNA 3NORA 1AQLA 3BXZA 5DB4A 4BQPA 2G8NA 3B7PA 1E59A 3E8XA 1DFIA 4J2OA 2DT8A 2FE4A 5LQCA 4MRNA 4J0JA 2YWCA 1Z5WA 2I7CA 1L7QA 3HCDA 3L2OB 3PEVA 4YA6A 2W2TA 4HVLA 5IBCA 4ZVSA 2ODPA 2BGUA 3JQQA 1NMXA 1CUYA 2CHGA 2HC9A 5EKTA 4IYRA 4AL4A 4BC0A 2GJ8A 4BGEA 3DG9A 1C81A 3THSA 1R00A 1QH1B 5KDDA 3TQHA 3A1DA 5JJLA 1Z33A 2XNJA 4J9UE 3LX8A 1AXRA 3SC2A 1L5MA 4LXUA 4MWGA 4WBNF 2B20A 2J3QA 3JY6A 3DE5X 5CVJA 2IW1A 3ZGYA 3OZIA 1LBTA 4U7FA 4TS1A 5BWMA 5DBOA 3ZEAA 1F4VA 3K9BA 3IE1A 2PRKA 1SUEA 3LIPA 1G2QA 4KRGA 3R8XA 2QAGC 2C2OA 2XBUA 1J42A 2W37A 3I32A 4QBIA 5A3VA 5JYDA 3T95A 3R2JA 4KO8A 1B43A 2W8BB 1K6EA 1NU6A 5A4FS 2CF6A 5I48A 4TKMA 3V3TA 1IU9A 3MPOA 1XMXA 3UMMA 5H3LA 1MTZA 3KSBC 1OFGA 1YA4A 2DKOA 3N7TA 3HJFA 5JH7B 3LT0A 1QR2A 4FQ5A 3SYRA 5JSZB 4UMVA 4OYRA 3IEKA 3TTSA 4X6UA 5EJ5A 2I9KA 4ZHQA 2IITA 2GM9A 4F11A 1U2GA 3IJPA 4LJRA 2B8TA 1SJ9A 2O1WA 4RO0A 4CWAA 5KPDA 2Q21A 1EEXB 3PDWA 4F84A 4FR5A 3EBOA 2ZRQA 4QAQA 3R6LA 1X77A 1ZX1A 2D1TA 2IF0A 4Q3KA 2PLNA 5AI8A 1P7WA 3W05A 1E6EA 5FFNA 5IJ9A 9GPBA 2REQA 4QDTA 3RC3A 1YS6A 3PHHA 3V7FA 4AM8A 2WFAA 4EFLA 3PYLA 3FWNA 3NI2A 3LA6A 1P17A 2C9DA 2LKCA 4AZWA 5AVWA 1QK5A 3EZ6A 2ECFA 3N8HA 3K5IA 3P9RA 5SYNA 3SBEA 2WU3A 6YASA 4X00A 3MJ4A 1IOWA 2H54A 4NATA 1A4UA 3VTZA 2NXNA 1OFIA 4W82A 4ENRA 2Z6VA 1DEOA 1UPUA 2Z6QA 4PNZA 4QVIA 3H5WA 2PSEA 4AX4A 1CB0A 5FLYA 4CIWA 1XP5A 4LZOA 3K0CC 2YYSA 1QVZA 4DYDA 1QF7A 2C8JA 3VOAA 4O4HA 4XGNA 3UQZA 4JAVC 3RFUA 5FPKA 4DUGD 3Q8MA 1KRXA 5KPJA 2WNSA 3N2GB 1F2TB 1QV7A 2W6PA 2WD7A 3OD5A 4HYTA 2IEAA 4FZ5A 2G4CA 4OMFG 4U7GA 5FOSA 3AESA 5DNCA 4JQCA 3H2GA 4QUEA 5K45A 2LWIA 3WYGA 4ER6A 5A6SA 4MIKA 4WACA 2V7TA 4I99A 1GUZA 4MWOA 2V5VA 4RHEA 4PF1A 3MAGA 3VAYA 4YUZA 3D2CA 4FNGA 4JLNA 3VHXB 2VQEB 1KZYC 1XP8A 1VMDA 2BI4A 5CNIA 4D1YA 4LC0A 4EAAA 3PXEA 3WBJA 1X8JA 3MWGA 4JWTA 4HZUB 2R8BA 5IAAA 3WLKX 5D3KA 3B89A 1EGVB 4EY5A 4LY9A 1KJJA 5AKEA 4Q19A 4ZEXA 1A71A 3NASA 2B4TO 3U3OA 4TVBA 4WKOA 1RJEA 3TQTA 2W22A 5B3KA 2GSWA 3BD8A 3U40A 1JALA 2HYDA 4U6NA 4BXOB 2K4MA 2PQ6A 5K4AA 4ED9A 3CCFA 1W75A 2C03A 3GCGA 1XRRA 2YW9A 2OCBA 3MXTA 2ORED 4JHXA 1QFMA 1U6KA 3IIKA 3V6LA 2QRQA 3LXUX 5LYYA 1JBEA 1K2VN 2QLFA 3BHJA 2HI0A 2HNKA 3JARA 3QI7A 2VWQA 3LWZA 4FOSA 1J99A 5IS2A 1R0ZA 2ILTA 2O14A 1Z36A 4QVKA 1Z4IA 2F7SA 3ZY3A 1DCFA 4BO5A 3WRXC 1GTZA 4NY1A 5JPCA 4NAHA 1B41A 1J2EA 4XR9A 1U2DA 2IIPA 2HJGA 4DNFA 1U7OA 2GDZA 3K73O 3CZCA 1CUVA 4FOTA 4GX5A 4GKAA 3I6MA 4C7MA 3LQ4A 3A7EA 2PPVA 3PC7A 1PEAA 1R7RA 1S3FA 3W04A 4DA9A 3NAQA 5REQA 2QRPA 1F8YA 3KR9A 1PNRA 3L7LA 5DHRA 5H80A 3R6WA 1OILA 1F7VA 1TYZA 4UKDA 4FYVA 4JXZA 2YHSA 2M6RA 5EZSA 5LUAA 1UANA 3M6LA 3TSAA 4PSCA 2HQSA 4YRPA 1SD5A 2PGAA 2JLSA 4UBLA 4YTEA 2MMCA 2PYDA 3VPHA 1VE9A 1EWTA 1EFPA 3IGFA 2G5GX 4GOOD 3A6HA 1IZYA 2FQQA 4BKOA 3W8EA 4CQMA 1WETA 1LF5A 3TRKA 2VYQA 4IS2A 2TMDA 1O7JA 2Y2VA 3HGMA 1G8AA 2RGRA 4RTOA 2VXYA 4NOLA 4ZYTA 3D0KA 3NGMA 3WK8A 1UC9A 4OYHA 1VMIA 4JC8A 1P2UA 2YUIA 4EVRA 1KFJB 3PENA 4AJ2A 4YCCA 3BQMB 4MR9A 3BULA 1M72A 5TMDA 5B57C 2O59A 4UNSA 4ZC8A 4XQGA 1AXEA 3UB2A 3WL7A 3UVEA 1ZZEA 2JAPA 3O8OA 4YRRA 2CXNA 3ERCA 4QICA 4KR9A 2CDCA 2P3OA 1Y1KE 2JFFA 2ZJZA 4M1YA 2XRZA 1O3YA 1QYWA 1I8TA 3IQXA 2CE7A 2ZBFA 1QKJA 1BHO1 3AY3A 3IULA 1PR5A 4IOKA 6AT1A 1PW5A 2PX2A 2CLCX 1G7SA 1L6RA 3LK7A 3WBKA 1CUHA 1JHAA 1PX0A 3PF8A 1K8YB 4OXIA 1X7XA 2VH2A 4U1RA 3SIXA 4JQYA 3X0DA 1NYQA 4AICA 1L8QA 1JZQA 1WX1A 2RK6A 3E9YA 3IMCA 3QJYA 4ZAFA 4ZAZA 1A9OA 1XK7A 1RC1A 2V8OA 4J7AA 5AT1A 1ESEA 3SC3A 4RTMA 3K94A 5H16A 3HN7A 4C06A 4K9KA 4QDXA 4M76B 3BCRA 2JVJA 5CXQA 4CV1A 2X4DA 2DPLA 1M8FA 2JW5A 4LI3X 1US8A 1EVZA 3VX3A 2HFKA 4Q7QA 3WAJA 2CXRA 3LO8A 4BZPA 1Z22A 2WMNB 3BZBA 3RG8A 2ZRNA 3IP6A 3A1CA 1VFPA 4OB6A 3JQFA 3ZWWA 4PLWA 2R0QC 3P26A 4RE6A 3N7AA 4R68A 1FYDA 1O4VA 1R8JA 5ICMA 2QE7A 4A0QA 4BS9A 5L3ZA 2P2GA 4G5FA 5LKAA 1X13A 5KMGA 2Q6VA 1FTNA 4GF5A 2NTJA 3OOYA 4QTXA 1JJ7A 4AMUA 3FOFC 4PSUA 3QBJA 2HDOA 1EGQA 4LWOA 1ORIA 1A9XA 4F60A 2EW1A 4DGSA 5FI3A 1J0XO 1A7KA 2G5TA 2BGWA 1ZL2A 1D7OA 4FVTA 2FWJA 1XDSA 3DQZA 3FNBA 2HA5A 2QUZA 3SK0A 5B6JA 3TFOA 2ZM5A 1U8TA 1HYQA 3NOQA 2RHJA 2OUIA 4F86A 5IEJA 3N74A 3WNCA 3P9IA 3NYWA 2JCXA 2Y6UA 2QTNA 4U2EA 5F4ZA 2VBIA 2DR2A 2Z9BA 1PF7E 4YUXA 3IFSA 4IRMA 5A3RA 1B8VA 1GTMA 4UAGA 4N0EA 1CQWA 3WGLA 5C80A 3PI6A 3EJWA 4AUKA 2OO5C 3JWIA 3HCCA 4Z9YA 3AGQA 3FCEA 1WS6A 3TE7A 4MVJD 7REQA 5KS2A 5L6LB 4GPZA 2O2EA 3VQTA 3KTAA 2D2XA 1N2OA 3KWJA 4UHFA 4URUR 5GVSA 2WWYA 5SZIA 5ADHA 4NYMQ 2LE0A 1KBQA 3G8DA 3KYCB 5LQRA 3U81A 1P4JA 1WP4A 2KBFA 4Z8XA 1NXXA 2RB5A 2ZYTX 3PPYA 2DU8A 3AHJA 4MR7A 2HHAA 5HKBA 2XF2A 2CXTA 1K4MA 1SUDA 2WILA 3D7RA 4GVXA 2R4QA 2NUTB 1K89A 1MRSA 5H4HA 1ZYUA 3DLAA 3E35A 4DOMA 2WV9A 4TLDA 2EG5A 5LFAA 1ZJWA 5E6SB 4XCVA 4IUYA 3VTAA 1VHDA 1W36B 3OCJA 2PS3A 1USUA 3M82A 4RGBA 2B36A 3P5SA 2QYHA 5AK6A 3C85A 2BH2A 1GT91 4C4YA 1F9EA 3AF4A 4ZOLA 3GRPA 4DEXA 1PHPA 3U6BA 2O8EA 2PKCA 2IDJA 2OCDA 1OPXA 5DXJA 1N1EA 1P4AA 3O1JC 4WJKB 5DK6A 3F6YA 5BURA 4WK2B 3CKKA 1RRKA 2VRCA 1X7ZB 1L5QA 3M6UA 1LLQA 2XMQA 1TZCA 1VDZA 3ONDA 1CS4C 4IIEA 5JS2A 4ZMBA 5C8ZA 3DT8A 4YLYA 4KRYA 3WB1A 5ITWA 3DZGA 4OFXA 4TX1A 1IJFA 1RZRD 1N36B 4OFBA 2HPHA 1R4NA 3AHEA 3ISTA 1DBIA 5F21A 3IHWA 3A3NA 2NW6A 1MORA 2VDNB 2XRYA 4KYVA 1H05A 2XMDA 2WEKA 4RLHA 1NJ5A 4U2GA 4R01A 1SHJA 2PK3A 3UCFA 4YJ2F 1HA3A 1PJ4A 2CLOB 3B3AA 3ZDDA 1OBVA 3V8QA 3EGCA 1HC7A 3DMRA 4DRZA 3KQUA 4OQZA 1MO6A 4OQQA 3GVXA 4PFQA 1P2BA 2AFIE 2JJMA 3KPVA 1C3OA 4BE9A 4D41A 1TVEA 3IQIX 3ND5A 3PCTA 4O02B 5IK2D 1YBVA 2BTQB 3D6MA 4LJYA 4B79A 2VJYA 2X4IA 5DNYB 1SA0B 3EXFA 1X3SA 2Q8PA 4D43A 4BX3A 3CLSC 3DFKA 1X7YB 1RKUA 2GXUA 2WYWA 2GZDA 3JQ7B 2XKAA 4MS4A 3TLMA 521PA 3VYRB 1J07A 2VJNA 2WJAA 1WM1A 1RBQA 3DLPX 4JOBA 1M6EX 4L5BA 2OZKA 4OHCA 3ZE8A 2XE8A 1E5LA 4B4KA 2EU8A 1ACLA 2GETA 4GPEA 4B3JA 1XYGA 4M8SA 1UPTA 1WD5A 1JDBC 1V7QA 1XWWA 2W2VA 4Z0TA 2EL9A 3A3PA 4BN0A 4E5MA 2R6FA 2HM7A 2IYRA 4RVSA 2V9ZA 3O8CA 3DTVA 3NTXA 4PHFA 2OK8A 1AT1A 3GOHA 3KBOA 3ZV6A 4R5HA 2OYRA 1YCFA 5JCPA 3IUJA 3V1KA 3GLSA 3R0ZA 3L0CA 4DSAA 1FXSA 4YBZA 3DMDA 1T10A 3SHWA 2QKYA 1XELA 2QQ0A 3AO0B 3ETGA 1UUFA 3C5CA 1RKVA 3AUKA 3HCOA 1UZUA 1QMPA 2G1AA 1JQLB 1U9IC 3RG2A 2OEPA 5B5SA 4MYSA 5JD3A 3D3JA 3FNRA 3VUEA 1X9IA 3GH1A 5T57A 3KYBA 3MB5A 2WKQA 5CEEA 4MUEA 4GP6A 2A0WA 2HYIC 1GSOA 2E5WA 2PGNA 3F49S 2O8CB 3QLEA 1U9ZA 5FQNA 2VRBA 3DOEA 1BU5A 1E2BA 3PQCA 4KQXA 3VO2A 2H1VA 5AXCA 1XXHE 4F12A 1BRMA 2K6GA 4A8PA 1C3VA 1E6MA 2XQGA 2YWJA 3O92A 3VPXA 1SC1A 4FEYA 4P5PA 4UZSA 2G3YA 4B31A 2A7QA 4WESB 1V8OA 3LUFA 3QEOA 1GR0A 4ZVQA 2D59A 1SGWA 2QN1A 4ZTBA 3G2QA 4ZYXA 3WFIA 3W79A 3S68A 4Y9SA 1EDOA 3F2VA 3NYQA 4MJ3A 1DJNA 3FRJA 4ZODA 3IAHA 1AUXA 2JS7A 2VS1A 1JKJB 4V0LA 2TMYA 1F6DA 3W1EA 2Z5FA 3SSMA 1XZQA 3FZEA 1E6LA 1A4IA 2FI1A 3GQVA 1M6YA 1QF6A 1PS0A 3ZTWA 1FIUA 3CE9A 1KEWA 3OE1A 4X84A 1W581 1I6LA 3I53A 4KIWA 4U02A 5FI0B 2Z2YA 3KAKA 4BMCA 4UATA 2G70A 2WUVA 1G2IA 4WNIA 2PRYA 3OE7D 1YA6A 2JJQA 3MWYW 3U44A 1SG9A 4C03A 2NO5A 1ZVKA 1D1SA 1SUCA 5ITVA 4XWWA 2A7XA 4ME6A 4EELA 1A1VA 2Z3WA 4PX3A 2P4SA 2SCUA 1AM4D 5H1YA 2XZLA 3PC4A 4XJXA 3JQPA 4J1TC 4LYHA 1YZVA 1SCKA 3HU5A 1AKMA 4O4LF 4YIKA 1FDIA 4CMCA 2JLQA 5TPWA 1LJLA 5JI2E 2C5GA 1T6XA 3CX4A 3ORSA 4HPJB 4KQKA 5BQPA 3FYDA 1XN1A 2IVZA 3TVDA 2GK4A 4DCMA 1Z74A 5C35A 4WX2B 2P6UA 2E48A 3CWQA 3AFHA 5HRAA 3V2IA 4LDZA 3R6TA 3DKKA 1TAUA 3MJEA 4IIJA 4DJ5X 3SS9X 5CIQA 2HHLA 1YULA 1PS8A 4H0CA 2HSDA 1VE1A 2VUSA 4M53A 5IDXA 4PQFA 1KE2A 4LISA 3V5NA 4V0OA 3GPDG 5F33A 2B5WA 2O3JA 3NKFA 4EZEA 1BAPA 2WZQA 3NIFB 3TX6A 5BSEA 4BHTA 2OVFA 2YJ6A 4AG3A 5IC5A 3GH3A 3HLTA 4UAVA 3DEIA 2GK6A 3HDJA 4G37A 4N01A 4V0RA 3HDQA 4BJ5A 2B1QA 3DHVA 1W0JD 2VDWB 2GAFA 2WICA 1XTSA 2XGMA 2ZYWX 3EOAI 4WNYA 1TADA 1Y1RA 4JLBA 1EJ6A 4X9XA 3BTSA 4W5NA 3JU3A 2A35A 1MPXA 1M2EA 4L4YA 2CNWA 4QWWA 1KPHA 1TM4E 2QMQA 3RKRA 2GS9A 2PJUA 3I5MA 1BYUA 3AYXB 4IBOA 3ZYZA 4LG1A 3DNPA 4I66A 3RJTA 1E3DA 2ZDGA 3ELUA 3E4CA 1THGA 2KMLA 1MFZA 2OTCA 2WUEA 3OHMA 3OKPA 4X3PA 1G2PA 3KT8A 4JX8A 4R54A 4TUYF 4XQ9A 3WXMA 1F14A 1OC4A 3IQGX 5AJZA 5F51A 1E64A 5C5DA 5FTLA 3MQ4A 4BFCA 3M1AA 2A9OA 3M4XA 2O07A 3EZ9A 3SF8A 4YCLA 4C4TA 4Q00A 3NTOA 5CGQB 1W48A 3KKKA 1DVRA 1NR5A 3HJGA 3CUUA 3DC2A 4QARA 2GMWA 4EP1A 1E66A 2WF6A 4ND6A 4WBSA 4BKMA 3SYTA 2CBGA 3PP8A 5JNUA 2FMXA 2VQ6A 1N6PA 4FN4A 1RM3A 1D4ZA 3OP4A 4MKHA 3GOQA 5KZMB 2EKDA 1G9SA 2JGDA 4D56A 2JCVA 5M29A