2AOUA

Histamine methyltransferase complexed with the antimalarial drug amodiaquine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
288
structure length
286
Chain Sequence
b'MRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYEYDLLSTMDISDCFIDGNENGDLLWDFLTETNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histamine N-methyltransferase
publication title Structural basis for inhibition of histamine N-methyltransferase by diverse drugs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 286
sequence length 288
ec nomenclature ec 2.1.1.8: Histamine N-methyltransferase.
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13489 Methyltransf_23 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2aouA00
3FUWA 4QVKA 3LPMA 3MTEA 2ZWAA 4EMSA 1AF7A 3KKZA 1ZGAA 2QRVA 3BGVA 1N7JA 3R0QA 1Y8CA 1G55A 2PV0A 1SG9A 3HA3A 4X41A 4P58A 5E9QA 3THSA 4RVDA 5CCBA 1VBFA 2QYOA 4PYIA 3SM3A 5DRYA 7MHTA 3M6VA 5CCXA 1XDZA 5GP1A 3G8BA 3OPNA 3HCBA 3QV2A 4ATNA 1G8SA 3GRYA 4DKJA 4RTMA 1NKVA 4FR0A 1YFLA 2IP2A 4DCMA 2IBSA 4ER7A 1D2HA 2P41A 1T43A 4PYMA 4YUXA 1NBHA 5CVUA 10MHA 1B42A 3LECA 1O54A 3I64A 1UWVA 3KQOA 5DLYA 2AS0A 3SSMA 2ZWVA 3B7PA 3CKKA 3UZUA 1I9GA 3FUVA 2OBFA 1NW8A 5K0JA 1JG4A 1SUSA 1X1DA 3UJ7A 2IPXA 3UJCA 1AV6A 3ER8A 3ELYA 3KR2A 3Q7EA 4OX9Y 2IH2A 2OYRA 2Y1WA 5MHTA 5CVEA 4PWYA 5GWXA 3ELUA 3OCJA 4IV0A 1HMYA 1WXXA 2CL5A 2Y1XA 5BW4A 1M0EA 3EVCA 5F2NA 3H2BA 1P1CA 2JHAA 1SQFA 4RTRA 4E2WA 3TOSA 4GBED 3E7PA 3QOWA 3T7TA 4FZVA 1XCJA 2JH8A 2OY0A 3NWBA 1O9HA 2B25A 3AWIA 2ZVJA 3NVMB 3CCFA 3O4FA 3G5LA 4U7TB 1RI2A 2AOXA 2ZIEA 3FUXA 4R8SA 5DM0A 1JSZA 2ZTHA 3TFWA 4DQ0A 3TM5A 3JWIA 2AZTA 3C6KA 4PNEA 3EVBA 3LSTA 5T64A 5EKUA 4PINA 3CJTA 5LQNA 2JHPA 3A27A 4BY9E 1NT2A 3DUWA 1QANA 2YXEA 3BGDA 3CC8A 2PXAA 4F86A 1JQEA 4XUCA 2G1PA 3P2EA 4FS8A 2ZBRA 2R3SA 5K03A 1UIRA 2OPBA 3OU2A 3DOUA 4RTLA 5ICEA 3PLAE 1X1AA 4M36A 5ICCA 4FSDA 3MQ2A 5FCDA 5IH3A 4PGHA 4PIMA 2G8NA 2BZGA 4EVIA 1EG2A 2UYOA 2YR0A 5DX0A 4XCXA 2FPOA 5E1DA 1YF3A 1M6EX 5DXAA 2LD4A 1RI3A 3HA7A 3L8DA 3AJDA 2NP6A 4QDKA 4IKPA 2EJUA 3HEMA 3NW9A 3PS9A 5EEHA 1DUSA 1NV8A 1NW6A 2AOWA 4O29A 4P7JA 5HIMA 4M37A 3FPGA 1DL5A 5KQSA 3E23A 2PX8A 2O0LA 2XYQA 4GQBA 4PCAA 5KYGA 2AN3A 2HWKA 4CKBA 3M6UA 4AUKA 2ZW9A 3LDUA 5EIWA 5HIIA 4C04A 2E5WA 1D2CA 2OB1A 1BHJA 2G72A 4WVLA 5K0FA 3GJYA 2H00A 1EQAA 3KPJA 3LCUA 3P2IA 1R8XA 1ZHFA 4F84A 4CKEA 3G7UA 4QPPA 2ZIGA 5DM4A 1KHHA 2AN5A 1NBIA 1JTEA 3CBGA 5EG5A 2ZZNA 3A7DA 4MIKA 4DF3A 1EJ6A 1YZ3A 2HV9A 4GEKA 2BR5A 5DPMA 3EVZA 3BZBA 3JWHA 3A7EA 4LWOA 4R6XA 4AZSA 1VLMA 1SUIA 3KQVA 4V0RA 1XJ5A 3I5UA 5GINE 3VYWA 1VIDA 2OKCA 2PBFA 3P97A 4QQKA 4ZTBA 3CJQA 1PRYA 1WZNA 5C9ZA 3SSOA 4CKCA 3EGEA 3AY0A 3MCTA 3R3HA 1WY7A 4YV2A 2HTEA 3B3JA 3PX3A 3GRVA 4UOEA 2B78A 2O05A 2QY6A 4M38A 4LG1A 5CVDA 5G02A 1MHTA 2ZCJA 3K6RA 5H02A 1EAMA 2ERCA 2OZVA 1RJEA 2I62A 1P39A 3FRIA 3HP7A 2CMHA 3P71T 1ZKDA 4KWCA 4OBWA 1JG3A 2ZULA 4P7FA 4P7GA 4CXMA 3THRA 1YFJA 3UWPA 4HSGA 2ZFUA 5M5BA 4QDJA 4RTNA 2ONZA 3IEIA 4CTKA 3G8AA 3UJ8A 4RSRA 3LDGA 3HVKA 5FWAA 3GRZA 2ZZMA 2V7EA 3MGGA 4E31A 3JWGA 4M7RA 5E1OA 5HILA 1L1EA 2PX2A 1FPQA 2G70A 4PYQA 1ORIA 4GUAA 3FPHA 3M6XA 1JQ3A 4GC5A 3P8ZA 3TKYA 3AXSA 2PJDA 3KQQA 2IFTA 4PIPA 5U4XA 4YV0A 1XTPA 1N2XA 1P91A 5KVAA 1RI4A 2QRVB 5EKXA 3CGGA 5K0GA 4LECA 3G2QA 5E2BA 4R8RA 5IKMA 5CIYA 2CMGA 2YQZA 3T0IA 3LDFA 3B3FA 2PX4A 3DXXA 1YZHA 1SVUA 2FCAA 2YVLA 3GNLA 4AZVA 1U2ZA 3GWZA 1XDSA 3EMDA 3HCCA 3SGLA 2QM3A 3IV6A 4PCLA 3GRRA 2WA1A 3B89A 4PYOA 4QQNA 4RWZA 5T67A 3ER9A 4YUVA 2OB2A 2ZBPA 3C6MA 2O57A 3TR6A 4GOND 4OQEA 5B1SA 2PY6A 1Q0TA 3GO4A 4B17A 1JQDA 5ICGA 4OQDA 3P9NA 5DWQA 5JR3A 2WK1A 1OR8A 3FYDA 3KQWA 2XVMA 3KHKA 1L3BA 1KXZA 2GS9A 4MWZA 5HIJA 2GAFA 4R05A 3FUTA 1NE2A 4BLWA 5E1MA 1L9KA 1R18A 4X60A 1NW3A 1RJGA 5DM2A 2FK8A 3FUUA 2NXEA 1G6Q1 3HVHA 1G8AA 2EX4A 3FTCA 4Y30A 2C7PA 4KIGA 3EGIA 1R8YA 4RTQA 5LQJA 4MHTA 3ELDA 1KPHA 5GM2A 3BGIA 1UFKA 5EMJA 2ORED 1V39A 3NJRA 1RJDA 3ME5A 5LQKA 2IH4A 4L7VA 4DM3A 1QYRA 5E8RA 5BP7A 5E9WA 5FA8A 1NW5A 4MTLA 1RJFA 2G71A 3JWJA 1N7IA 5CUQA 5FHRA 4GOOD 5DTMA 3C0KA 3KR1A 4GOMD 4BLUA 2Z6QA 4Y2HA 5EZQA 3KPUA 5FULA 4YMHA 4GOLD 3PT9A 3HA5A 3UJ9A 3MB5A 1EJ0A 1RI5A 2GPYA 3HM2A 3C3YA 3R6TA 2BR3A 5CVVA 2NXJA 3HCDA 3PFGA 5FQOA 1AQIA 1XVAA 3BXOA 3Q87B 5EPEA 1PJZA 1KPIA 3EVFA 3HCFA 3ERCA 4HH4A 4ISCA 4GF5A 4RTJA 4G56A 2VDVE 2UYHA 1BC5A 1I1NA 2ZBQA 3DTNA 1EIZA 4YUWA 3D2LA 4FT2A 4PYKA 3A25A 2ADMA 3KQPA 4NECA 2WA2A 2FHPA 4QPNA 3KQSA 3SSNA 1H1DA 2JG3A 4OA8A 3B3GA 3DMFA 1WXWA 3I9FA 1I4WA 3PX2A 4KIFA 3TPZA 5BW5A 5EEGA 3NDJA 3O31A 1F38A 4E30A 1KYWA 3NTVA 3UA3A 4LWPA 5K8VA 3KQYA 4YUYA 2O06A 4XUEA 3EVAA 2AN4A 2NNWB 2PX5A 5DRTA 5GIOE 1NV9A 4AX8A 2FK7A 2PWYA 1X1BA 1O9GA 1YB2A 5GM1A 5EMKA 3CVOA 4PONA 3FPEA 2UYCA 1XCLA 4C05A 4KRGA 3KR0A 1KPGA 3SX0A 2ZSUA 4KW7A 3DLCA 4BP3A 2I7CA 1JG2A 5GOZA 3LBYA 2NYUA 4PYLA 1VQ1A 2YTZA 2BM9A 5EHIA 3TLJA 3UFBA 5HIKA 1X1CA 4RTPA 5LSAA 1YUBA 2YXDA 4H0NA 3EEOA 2UYQA 3ID6C 3IYLW 2AOTB 5EC8A 5K0NA 3SR4A 1KIAA 5DX8A 3HCAA 3KPWA 1XXLA 3P2KA 5FWDA 3BUSA 4V0QA 3G2MA 4YMGA 3MERA 2GB4A 3FTEA 3M4XA 3BWCA 2VZ9A 4EK9A 3K0BA 2AOUB 4U7PB 5FQNA 1IXKA 3FPJA 1VL5A 3EVGA 5K0BA 3ANXA 3TMAA 2Z6AA 3UJAA 1FJXA 5E2AA 4HTFB 3X0DA 3OZRA 4WXHA 5FADA 1G38A 2IBTA 3F4KA 1ZGJA 1DCTA 4Z2YA 3TKAA 2P3QA 2DPMA 2VDWA 3NWEA 3EVDA 4C06A 2EJTA 2IH5A 3GRUA 5P8WA 1L3CA 4ER3A 3DR5A 4FT4A 1ORHA 3HCEA 2I9KA 4C03A 3NDIA 3A26A 4EQZA 3CJRA 3I53A 2BM8A 4PYNA 3HNRA 4E32A 3LKZA 3P9IA 2C7RA 3DULA 5FTWA 2GLUA 3A4TA 4HG2A 4E70A 1TW3A 4BP1A 3GDHA 2H1RA 1VP9A 4X1OA 5DTQA 5FA5A 2NP7A 1VPTA 3REOA 5LQRA 3UA4A 3MTIA 2P8JA 5HEKA 2VDUE 5ICFA 4HC4A 4R6WA 3BKXA 5K01A 2P1DA 2R6ZA 2P7HA 5DX1A 3HTXA 1NW7A 2IIPA 3EMBA 5K0EA 4GC9A 2B2CA 2CKDA 5EIFA 2JH9A 3RODA 3GU3A 5EGSA 1RI1A 1TW2A 3WSTA 3GGDA 5DM1A 2PT9A 3C3PA 3DMGA 4PYJA 5K05A 2F8LA 3BWBA 2PGXA 3VC1A 5BXYA 2UZ4A 2QE6A 3SVZA 5JUWA 4EKGA 3BWYA 3E8SA 3UBTA 2PXCA 3EGVA 1QAOA 2PLWA 3OE4A 4YV1A 2V74B 3GIWA 4RX1A 3FPFA 3T7RA 4E2XA 2Q41A 3HVJA 2JHCA 5D1HA 2VS1A 3RIEA 3TM4A 1QZZA 2I6GA 3ORHA 3OU6A 5F2KA 2JJQA 5C1IA 1G60A 2AOVA 3SMQA 1FBNA 4HRAA 2BR4A 1WS6A 2P35A 3VSEA 5LR6A 2PT6A 1ZQ9A 3MCZA 4X63A 2C7OA 1KR5A 1QAMA 3IHTA 2C7QA 4POOA 3E05A 1XDUA 4K6MA 2K4MA 3FYCA 1JSXA 2DULA 2XYRA 3G88A 3OFKA 1KYZA 4X61A 5DTRA 3NVKI 2NXCA 4F85A 2OO3A 5EMLA 5LQAA 4QVGA 5E9JA 1QAQA 3FRHA 2P3OA 1VE3A 2PVCA 3HVIA 4FGZA 2XVAA 5CM2Z 1IM8A 5FUBA 2XYVA 4C4AA 4CWAA 2ONYA 4DCGA 3FZGA 2HR1A 3LL7A 2XBMA 4ER6A 1VP3A 2AR0A 4KDRA 4OA5A 5T6BA 3SXJA 3OFJA 4FSXA 4ER0A 4A6DA 4E2YA 4DA4A 3U81A 5GIPE 5CVJA 5EQJB 1SKMA 3EPPA 1Z3CA 4AZWA 3UJBA 1SQGA 3B5IA 2EG5A 2PKWA 3PVCA 3UJ6A 4XUDA 3QOXA 2ZIFA 3LCCA 3M6WA 4ER5A 3LHDA 4HGZA 3AXTA 2YUIA 4IV8A 5EOVA 3P9KA 4QTTB 3RW9A 5HZMA 3I58A 3G2OA 4E33A 3R24A 2KW5A 3S68A 5DXJA 3PTAA 3FTDA 1ZG3A 3OZSA 5DT2A 2A14A 3DH0A 4DZRA 3BKWA 1JR4A 5K0CA 5CD1A 1BOOA 3PFHA 1KP9A 5LQCA 2IGTA 3G89A 3OZTA 5EZSA 3G5TA 2HNKA 2B9EA 1F3LA 2B3TA 3V8VA 5FHQA 3KPYA 1AQJA 1FP2A 5EHGA 5ERGB 4CTJA 2ZLBA 1INLA 3TRKA 4QTUB 2VP3A 4RVFA 3GCZA 1R6AA 1TPYA 5HFJA 1D2GA 1FP1D 2HMYB 3MAGA 3TQSA 5LQUA 4YUZA 4RVGA 4JXJA 2CWWA 1P1BA 2PXXA 4RTOA 2BH2A 3FTFA 5EMMA 4C08A 3KQTA 2OXTA 2YX1A 5E8JA 2O07A 2P3LA 3DXYA 3EEYA 3G2PA 3OU7A 5EVJA 3M70A 5KQRA 4EKIA 5KS2A 2FYTA 3KPVA 5D1NA 1R74A 4KDCA 3LKDA 3P9CA 5F2OA 5E1BA 1HNNA 1Q0SA 2ESRA 3MHTA 2ZZKA 4RYLA 3DMHA 3EVEA 3T7SA 1IY9A 3O7WA 3OE5A 3KR9A 4RV9A 9MHTA 4FP9A 3DLIA 2PWPA 2AOTA 2P7IA 5K0LA 4OBXA 1R00A 3PB3A 2FRXA 3DP7A 1JTFA 8MHTA 1WG8A 3BT7A 3VC2A 4RTSA 5DSXA 1MJFA 2IDKA 3LCVB 4P7KA 2AOUA 3LBFA 3R9XB 3BWMA 4HGYA 4C07A 2GA9A 3LGAA 4RVHA 2AVNA 5C0OE 4RTKA 1BKYA 1JG1A 3KQMA 4MQ4A 4E2ZA 2NXNA 5HOQA 1X19A 3M33A 3GXOA 4HTFA 4A6EA 2H11A 2IDJA 3UJDA 2AVDA 2YXLA 4PGGA 3DXZA 2GH1A 2N47A 3KU1A 4KVZA 3V97A 2Z6UA 3ELWA 4IWNA 4AZTA 5K09A 2P40A 4DMGA 5DSTA 3NMUF 2PSSA 1L3IA 2EFJA 1M6YA 3LX6A 4BLVA
chains in the Genus database with same CATH superfamily
4O2AA 1N5DA 1R3DA 2RI0A 4OSEA 3UYLA 6YASA 4IO1A 4LQDA 2BFEB 2FN7A 3QPBA 1ZGAA 1VHTA 3VNQA 1T1RA 3UMVA 1K3UB 3GLSA 4QPCA 1P3DA 1KMHB 1UMDB 2ZPTX 2HUNA 3VU8A 4GE3A 5GMOA 3SM3A 3AF1A 1M1NB 4LWZA 1WUYA 4DQDA 4ZVPA 4ATNA 1R6BX 5EUQB 4F6LA 1NJ5A 3Q3EA 4I5IA 2B4QA 2PRZA 2YDXA 3B9QA 3O0TA 3EZYA 3CVYA 1BWPA 3NHMA 1EK6A 4IH1A 2FE1A 3SD7A 3ETDA 4CCYB 1CUWA 5EJFA 3R0IA 4EI2A 3N0XA 1Q7RA 3QBDA 1YKSA 5LQDA 2JGRA 1EUZA 2I7VA 1NKSA 3I64A 1DMSA 3I2FA 3QA3E 2PTGA 4I55F 2C95A 4ZU1X 2CNLA 1N3BA 2G07A 3CKKA 3IPLA 2Z08A 4EJFA 4K9KA 5E6UB 3AEYA 2QTNA 4N5HX 4F8EA 3YASA 2MDTA 2F8MA 1KSJA 1NRIA 2R8PA 2Z2KA 3LX8A 3NTUA 5HE8A 4FMDF 5T3UA 2J3JA 3ZHXA 2FRDA 4MYSA 2OYRA 4DT1B 4ZQBA 1LS1A 3UFXA 4AO6A 3OI7A 1X8XA 1M1YA 1KSGA 4OGFA 3U7JA 1AK2A 1FNSA 1BMFA 3NHJA 4INZA 3OZFA 3AF6A 4N18A 1SB9A 2EFHB 2JA1A 1I3NA 1P1CA 1F8XA 4W1RA 3E7WA 3T7TA 3QNMA 3KCQA 4F3RA 3FFTA 4LJYA 4UBIA 4EG6A 1DB3A 1M7GA 2ZIVB 1JXOA 1OXBB 5KNBA 2X1VA 1V96A 1V3TA 1RMTA 4X84A 4XGQA 1V9SA 1Z73A 3PYLA 4YRRA 3ZQUA 3U6BA 3IX7A 1K4YA 1QYVA 3PUYA 4ONEA 1CR0A 1EDOA 2O4UX 4R9UC 4DJTA 5FTLA 3CH4B 3C6KA 1KI3A 4J0QA 3Q6IA 3WS7A 1QNLA 4UCFA 5LQNA 4FYPA 3GFOA 1GFSA 2I33A 3M4NA 4YJDA 3NIWA 2EATA 2WILA 4M83A 1EFLA 2YXEA 4MH0R 4S1WA 1NIJA 4M9XA 4HI0E 1ADBA 1CZUA 3KUXA 2DE0X 3W8EA 3KP1A 1PKXA 1YOVA 5FDFA 4RTLA 4O25A 1BMQA 3IUPA 1VXRA 1N5RA 4M36A 3GFTA 3EF1A 3H6KA 3Q9UA 4MI3A 4R1QA 3MJHA 4LXXA 1LTKA 2Q3EA 3QFTA 2BGKA 4DDKA 3IEUA 5E1DA 1JXMA 4TM7A 3DMTC 4TT3A 3U49A 3ZR4B 4RY9A 5JANA 2D3WA 4W9RA 1E7MA 1GFWA 1T5SA 1TJ3A 3HEMA 4F1JA 1W36D 3TAHA 2WBLC 1OXMA 3LLMA 4DMLA 3T95A 2ORWA 4B0PA 3RS5A 3FPGA 3OEHA 4NICA 4P4SA 1D2MA 1JA9A 2BRUA 1V9LA 1QDUA 2XYQA 2H3EA 4IIDA 5G0UA 3CRNA 3RUFA 3CW8X 1O6FA 4RVUA 2XRYA 1NTRA 4ZJPA 3B2QA 1EX7A 3C6BA 3GUZA 5HUJA 2BCGY 1SUFA 3IT1A 4D3FA 3RC9A 3M3DA 2BP7A 5JH7F 3EG9B 4IH4A 4OQLA 3DT8A 1NYQA 1T8SA 1W94A 4HP8A 4TQGA 3ZY4A 2IOFA 1X7XA 4RLSA 1UKCA 2BGRA 1PT8A 1P0PA 3ZE2B 1WMFA 1Y8AA 2UZIR 3NZEA 3LJKA 4XASA 3TF5A 1J49A 3SZLA 1Y1QA 2VJKA 3MWDB 5JAOA 2DOKA 1K4KA 2FPMA 5IC6A 4XSVA 1DV2A 1WVGA 1K9SA 3ZCRA 3HI6A 4UTVA 4QHSA 5LA6F 4KSBA 2BEWA 1VIDA 3LP5A 2GYYA 3L92A 2A9VA 4QQKA 1BX1A 1S3GA 2HGZA 2Q1WA 1PJCA 3B36A 3MT0A 4XD7A 5EIHA 2X9NA 3JQAD 2PYZA 4JUFA 4YJ3A 2C9OA 4U2FA 3SXPA 4JXZA 3RRZA 4HRVA 2ES4A 3MTGA 3CUVA 1K06A 2OCGA 2PU7A 3G9UA 1QONA 2HDHA 3QXSA 4R1PA 1VG8A 5BSMA 3VHRA 1MG5A 4Q01A 3Q9NA 4BDSA 1P4GA 3W5JA 3HP7A 2IYPA 1V7CA 3NT4A 4L28A 3ZXXA 4FFSA 4L4ZA 3LWBA 3LHIA 4KPUA 4HSGA 4E13A 1CZHA 2DUMA 3LT1A 2VPWA 4LZWA 4O4LA 4YQEA 1N8SA 1BQ4A 1U8ZA 3LK7A 3WYEA 3VUFA 5EJ8A 1GYRA 2FZEA 3QHQA 1B0UA 4Z9AA 3T7IA 3W6NA 4C87A 1BRMA 2VAXA 1NKTA 1L1EA 4ZZ2A 4WNYA 1KK3A 1XNJA 2FPPB 2QN1A 1R88A 3E0XA 1OFUX 5TVKA 1J2EA 1W4LA 2XRMA 5BSFA 5AW2A 1J1IA 1WY5A 4PIPA 4BX8A 1PE0A 1SC1A 1O58A 2AWNA 2GBIA 2O8DB 1FA9A 3CZ4A 1T9ZA 4GAEA 1XTPA 2I80A 4MW6A 2YHUA 1AUQA 5A2GA 5KREA 2J3DA 2OV1A 3CGGA 3O9MA 4YK7A 4X20B 2DECA 5EXEA 3ZE1B 2OVFA 1E3WA 4RJJA 1L7RA 4NESA 2JIZA 4JH0A 1J24A 3KBOA 1TJ5A 4HYYA 3USCS 3ZGNA 1ONBA 1YZHA 3CW9A 4ZRMA 2QQEA 3RVKA 1CY2A 4ARSA 4AW9A 1C14A 4H7IA 4HDCA 2J9GA 4O4JF 3QX8A 5DU2A 1L8XA 3L0YA 4YUVA 1ZSYA 1P0QA 3DBLA 2REQB 1JPNA 4QOGA 4R2JA 4UTXA 5FL7A 1SXJD 4H7FA 4KPGA 1YR7A 1Z75A 3U0VA 4X7PA 2JLAA 1UPUA 1VLQA 4DSTA 5TNXA 4EI9A 1OAAA 3H04A 3KQWA 3SDZA 5JJKA 1JAZA 3FX2A 4BWFB 3ICPA 4F5EA 1AKRA 1ULSA 4R05A 1M2NA 1WIWA 1VA4A 2NZVG 1ODJA 1RJGA 1G98A 2AV6A 1Z2OX 1XI2A 2VYQA 3EGXB 2GBPA 2A9KA 2QG4A 5CURA 2Q5LA 2ZYTX 2HFKA 2XE7A 2LGJA 4IKOA 4Q48A 1PUIA 5T3YA 4LWQA 1SUPA 3UF0A 3BFKA 1GGFA 3NJRA 2XCSB 1VDZA 4AROA 1WMSA 3ME5A 4P92A 3WLIA 1QYRA 4OKIA 2FMXA 5DGTA 2ZTLA 4D9CA 5CUQA 1N7IA 1L5MA 1JQBA 3G85A 1Z28A 3OKAA 4NR0A 5F64A 3WRYC 3EUEA 4XX0B 2P68A 2PKQP 2CZGA 1MENA 4AJHA 5JIBA 3QLJA 2PA0A 1R6VA 2P2GA 1VGQA 4FHFA 4GOLD 4M8KA 1M2OA 3QNWA 3D0RA 4A26A 2ZU6A 4WK4B 4QHYA 2QN3A 3W04A 1LX7A 1H0RA 3LP8A 5ITWA 5LMZA 1BW9B 2XX3A 2QN7A 3CPJB 3U9TA 5HUHA 1WETA 2AT1A 2F3TA 1PJTA 1VPDA 2FUKA 3DKVA 2P9TA 4RF5A 1CUYA 3A1NA 4U7HA 2IPNA 1PWXA 3IUJA 4HLUA 2DFTA 3ESDA 3OIVA 1Z18A 3A58B 4AJEA 1XCGB 4P4NA 2BE9A 2VEOA 5CEJA 5KOIA 3EZ6A 4NECA 3LQRA 4H16A 5JWOA 3T9BA 1Z62A 2VP0A 3RQIA 2R4TA 4BL5A 4OIMA 6REQB 3L8YA 2ZETA 1N1EA 3EZXA 3QPDA 4G41A 4IG9A 4UD6A 1JG6A 2VDMB 1P7PA 4D45A 2M9MA 3DEYX 3DO5A 3UK0A 3NDJA 5JNSA 1Z22A 3D1LA 1FMFA 1AC5A 3A2KA 3AIOA 1KYWA 1UODA 1BXRB 1GNSA 3SF8A 3X2FA 3GRPA 2HEGA 3IEXA 4E1AA 3IO5A 3M4ZA 3VHXB 1S0UA 1VE7A 2ZUSA 3BD6A 3GXBA 3K6KA 1ANKA 3P7MA 3PPVA 5LZ2A 3HXQA 4WKCA 2HK6A 3T9DA 3W3ZB 3G49A 3G59A 3JQFA 5JJBA 5CB8A 2YWEA 5DLDA 3PXGA 2PT5A 3CVJA 2NU8A 4M22A 2XZPA 1V25A 3L04A 4H1HA 4C05A 1J90A 1YKGA 2VYNA 2WWXA 2OK8A 4F6CA 4J3NA 1XQ9A 4KAFA 5DO9A 4TLCA 5HKLA 1I36A 4KE8A 5GOZA 3RSGA 2WMYA 1RXUA 5KKAA 1ZS9A 1PI3A 2PGOA 3TD2A 1RLMA 3WBJA 1YUBA 2BGNA 5AO9A 4A2QA 2P65A 4RY0A 1J0DA 4LJAA 4FX2A 4ZDIA 4XE5A 3F6BX 3CRZA 1F4PA 1FDWA 5LMUB 3A9WA 4RMIA 2VQDA 1LWOA 3GH3A 3NG1A 2YMPA 1KL7A 1EDDA 3HKBB 3T4PA 4GH5A 1N6RA 2QZ4A 2YIJA 3LUJA 1SCUB 3JRXA 4NENA 3BERA 4UAVA 1M73E 1ZVJA 3GFRA 2VDWA 2RAVA 2I1VB 1RE1A 4MS4B 2EJTA 1AG9A 5AI6A 5ALOA 3KJQA 4QLOA 3ROQA 4I2VA 3WFJA 4FT4A 3RO7A 2AEFA 4TGLA 3AOEA 2GCIA 3CJRA 5HX7A 3AL3A 3ZV5A 1SXJE 3B9BA 1VZ3A 1U8UA 2BM8A 2FPIB 2FWIA 1T2UA 3A31A 1N2CA 5FBQB 4QM6A 2GPJA 4TLLB 1SZDA 2Z30A 1OJ7A 3TLGA 1H4SA 1NVEA 5BWMA 4HEJA 1OHHA 3SX4A 2WF9A 4ARIA 3VISA 4GLOA 5IAOA 3E9ZA 4HC4A 2H2WA 4B4VA 1IVNA 1PDVA 4NMMA 1FUYB 4BVGA 4OJTA 3TX2A 3W5UA 3U40A 3DVLA 3H5NA 4ZOLB 4MW7A 3FA2A 1RQPA 3VO2A 1UPBA 3MW8A 3GYBA 1NU6A 1IM2A 4RZIA 5IBCA 4M76B 3GJZA 1DUVG 1Y6RA 1JDVA 3KJZA 3VR6D 5BXYA 5LBTA 1ZN7A 5JUWA 3QI7A 4EG4A 1M6HA 3U3XA 1C8KA 3CO5A 4TYPA 2GXAA 3BWDD 3BF7A 4CIDA 2XXAA 1PJBA 2ZSAA 4K1LA 3TD9A 2TSYB 3WIDA 4BUCA 2YFQA 1GAJA 1GTVA 1W4BA 3AEQB 4KXQA 2GBLA 2VDNB 4TKZA 4UBNA 1GRQA 3UG6A 4YLYA 6CHYA 3MELA 4I9UA 2VUSA 2Z3WA 5AHWA 1ZRHA 3LH5A 1ECBA 4C4SA 1RKQA 3FF1A 1N5MA 1T5DX 2Q99A 1YS9A 3JAMA 3H9CA 1M8PA 4ND4A 4WLFA 1MR3F 2D2FA 5TMEA 1IN1A 3RWMB 1H3NA 3INNA 2ZAGA 3SHFA 2VP9A 2WG2A 4F3NA 1TZKA 3II6X 1C30A 4QU0A 1M1YE 4CM8B 2ONJA 3L06A 4B8YA 1GZSA 5LIPA 1XTSA 3SC2B 2X0NA 2ZB7A 2JCVA 5KVSA 3L8EA 2OO3A 3BWVA 1EVJA 1Z4JA 1WO8A 2J09A 2JK1A 3MRTA 2QV0A 4DPLA 4EELA 5I7RA 3O3CA 3W7BA 3WIUA 3GDWA 5JADA 4LYYA 1BA2A 5D5HA 3IPAA 4G5HA 4XR4A 2I78A 2R6CA 2AR0A 5UKDA 3HS3A 3OFJA 3OX2A 4E2YA 2HLDA 1IWBB 2O1XA 1K5HA 1NQWA 3ZUPA 3FSJX 1Z3CA 5AJVB 5I7FA 1UINA 2IU4A 2X8LA 3ES9A 4CKWB 2D0OB 4DUGD 3STXA 2H65A 3FNGA 3CWQA 3I01A 4O5OA 3W1VA 1SN7A 1U8XX 3KFXA 5AW3A 1YZLA 4FW8A 2VF2A 1MJGM 3ACDA 2W0SA 2BHNA 5DE3A 4UZEA 4OGGA 1XAHA 1FYXA 3U3KA 2A14A 3FYUC 1FFEA 2VJMA 2XQJA 3GHHA 5KJEA 2R1TB 4Q3NA 2ACVA 4DZRA 1ZGZA 1HEIA 5L3QA 4OI0A 1KP9A 5KINB 5KYUB 4RMNA 2E1PA 1UP4A 1G7CA 1M67A 2B9EA 3COJA 2ZXEA 3AUAA 4GNRA 1XR3A 3CRRA 4IL5A 4WXPA 2JBWA 4YCNA 1Z47A 1KQFA 1VSQA 3L0ZA 3R3SA 5CDYA 4QBIA 3EY9A 5CLFA 1YJXA 3KK0A 3OMXA 1MB3A 4I55A 3NRCA 1GGEA 1IXYA 4RJTA 4E08A 2HO4A 4GT1A 4YS6A 4XEUA 1LBHA 5B6JA 2Z9CA 4XLLA 5EMMA 5H4HA 4M1MA 1N78A 1FZTA 5E8JA 1L5FA 2G04A 2CD9A 2WJ6A 1BMDA 2ZTVA 4IIYA 2C98A 3LLVA 3LUPA 4MA4A 3LFHA 3M70A 4MSUA 2JPDA 5FI5A 5K5EA 4ZODA 4P3KA 1KE1A 1UMCA 1IZ9A 1HNNA 1OC4A 2WKPA 3KKNA 4KQHA 4NS1A 1ZW6A 4RYLA 3NBYC 4WZBA 3WB2A 3TBFA 4ILEA 4AB1A 1ITZA 1YNOA 4B9EA 4KG7A 4HAVA 1Z68A 4YIKA 4C0HA 5CPBA 1JECA 2K87A 2I3ZA 2IT1A 3NUGA 4EF6A 4QO8A 1IHPA 2IDKA 2FXVA 3A37A 1JJIA 3LBFA 2J5XA 3Q5DA 4MWGA 3UUGA 2AMVA 2GA9A 3D2BA 2GO1A 1EXNA 1FX0A 2RGGA 3PHCA 5HXAA 1XWWA 2R48A 2H11A 1F4LA 3I12A 1HI9A 2Z58A 3TMKA 3W1WA 3EB9A 2I76A 3IT2A 4PGGA 2N47A 4JQZA 4RZ3A 5F76A 3S2ZA 2VYND 1NTOA 1T25A 2WJ3A 3PNBA 2NVUA 4BO9A 3NMUF 1L3IA 3G0HA 2R8RA 1NWCA 3VO8A 1MRZA 2QUIA 4KUEA 1NVFA 1XP8A 1MEOA 1E66A 1AIPA 3D0KA 5ALSA 5JTTA 1LZLA 1U2TA 5K2MA 3NNDA 4DS3A 2PGAA 1HE8B 2WHRA 3SN6A 4RTMA 1Y98A 1ZCFA 1GCUA 2QY9A 4MHOA 4TMVA 4GZ6A 4RE5A 3TS1A 3ZI4A 4DCMA 4EO7A 2IBSA 3TLXA 1JDJA 3P2YA 4DA0A 4A8JB 4R2KA 1R16A 2R11A 1P2DA 3LECA 5K0TA 4RQBA 5JH7A 1OFGA 5LLTA 4IIHA 3N6RA 3SKVA 4BWGA 5L7TA 2BYTA 1N0WA 1NW8A 4MIEA 2K5UA 1XVUA 4PS1A 4RY8A 1PX2A 4Z0NA 3M4YA 2NUAB 4D9FA 3RS9A 4HYTA 3OFND 2VK2A 4G0OA 2ANBA 1BE1A 1KQ3A 2FRVA 3ELYA 4Z1OA 2OG1A 1JHAA 3PQCA 4B35A 5A3SA 1U5BB 3W5CA 1EFAA 3CLSC 5M34A 1I2DA 2FSUA 1U0HC 2AFHA 3CR3C 3HRKA 5LA6A 2Q7OE 4ZC8A 2YV3A 3DBOB 4MPRA 4NTZA 2NYRA 2FPWA 3ZWPA 1T1IA 1E3JA 4FN5A 4LCJA 4U39A 3E9CA 5JS2A 4KK3A 4E1VA 1J09A 3D7MA 5HDBB 3R7BA 4EGJA 2Q9UA 2EF1A 3I4LA 3CFYA 2QYHA 3PI6A 3RVDA 2ZVJA 4FZRA 3CCFA 4W5QA 3OJ0A 2FG5A 5FOVA 3WLSA 4D02A 5HF6A 4NYMQ 4A91A 2HD4A 4C89A 5JYDA 2XRZA 3ESYA 4HEQA 4KFCA 2ZB8A 3VOBA 3AILA 3CNEA 1MOQA 3GBPA 3M5CA 3ORRA 3QWHA 4TRJA 1MO4A 2OQ2A 3RSZA 5EHNA 3COSA 3TUJC 1UH5A 3CJTA 3D3QA 4JBXA 3D6UA 1IU9A 5DBEX 3ZD9A 4JYZA 3L4JA 3DUWA 2QL9A 2VNKA 2IXAA 3RFUA 3P96A 4X24A 5J4YA 1AKNA 1FDUA 5EJ5A 3IELA 4ERXA 4EFLA 3H9JA 4J75A 4YREA 4EF5A 3KUCA 2RGUA 3SBOA 5A4IS 1IMOA 2JFUA 2IW3A 3K92A 2CSXA 1J99A 1G17A 3RRJA 1UMBB 1R5OA 2V7QA 1PJ2A 4V3CA 3RIMA 3SLRA 1YF3A 5GZ6A 4RJKA 1YMUA 2I6UA 1FTQA 2P9QA 1I14A 2DT5A 1EP2B 3HBJA 4AI6A 3QFFA 4P7JA 1WVIA 4IDNA 3GLFA 1TVKB 3WLKX 3EG5A 1T2AA 1EE9A 2OGSA 1TX4B 1ND5A 4NG4A 2AN3A 4CFZA 3G1TA 4I3HA 2AH5A 5B6PA 5JFOA 4DNQA 4ZOLF 5JO0A 4FR2A 5G2OA 2GFQA 2I99A 1PZNA 3UB4A 1LC3A 4OKSA 4O4JA 2XKJE 3AFIA 3QUAA 4BNWA 4MMXB 4QJ5A 4F3YA 3V4VB 2OKGA 1DC4A 3DAHA 4KL8S 1CHNA 4G5GA 3TXYA 4AJLA 2PYDA 4KTVE 4AVYA 4TXHA 1UM9B 3NS7A 3LY8A 4HEA1 5DPMA 3GPLA 4F60A 5BV1A 4CQMD 1MXFA 4LWOA 2V59A 2HJHA 3F78A 2HHLA 3PPXA 4D9IA 1QTRA 5EGNA 3UIEA 2ZBDA 3Q0IA 5FX2A 2YN0A 1N3LA 2QMQA 2FQXA 3CLHA 4IDQA 4YRTA 2P9YA 4CKCA 2Z8YM 2D7DA 1J8MF 3IULA 2JJYA 5A04A 4TXJA 2WJAA 1QX3A 4JZYA 1XQVA 5A2QA 4OJYA 3HB9A 2RAPA 4LN1A 4DVGA 4EJ2A 5CYPA 4WCFB 2QJOA 4MUEA 2PFSA 1Z07A 1DARA 2LKCA 4OM8A 4AYTA 1E5QA 4C7XA 5L53A 3QE3A 2I62A 4XI9A 5DBGA 4OK3A 3ZVKA 2GSWA 4R5HA 4TV8A 3W5VA 1ETHA 4IZIA 4CXMA 5L4SA 3FOBA 5HKKD 1UPTA 2YXNA 1OTXA 1JXAA 1JR3A 1PZXA 2QUAA 3DA8A 3C14C 2PWAA 3G8AA 4Q16A 4R2IA 4YRSA 3VPFA 3I9LA 5JDIA 4RSRA 1G5PA 5J4LA 3WFZA 1IBRA 3PXAA 3JQ8B 1V9CA 2ZUTA 3B8EA 5E1OA 3AETA 3EDMA 4MOWA 4NJMA 3K0EA 2PSJA 1JHQA 1PWYE 5JFTA 5KMGB 3D6MA 4EB8A 4Q02A 2QLTA 3ZW7A 3WYAA 4KMSA 1UKVY 1C0IA 1G1MA 4JUBA 4NMLA 1S2GA 4RDXA 1UPAA 4B3DA 2OK7A 1Y9AA 2A9QA 2GK7A 2X14A 3FW1A 1AS0A 1UMDA 1RW4A 5FPQA 4WKPA 3MUFA 4HDRA 3C48A 2FSVA 1M1NA 4HDMB 2CMGA 3EWSA 5BMOA 3T0IA 3ZXSA 4PFKA 1RM5A 3QVSA 2YYYA 5G0SA 4XLZA 1N2CE 3KAJA 3E9DA 4CM7A 4J90A 2JZCA 4X71A 3UO8B 1I2MA 2NT3A 5SYNA 3TR5A 5FNVF 1XTBA 1KI6A 4MWDA 3KLOA 4YJHB 3W4KA 3QXJA 4CCYA 4REQB 3GVHA 2D2XA 3PEFA 3K4PA 4OQEA 5B1SA 2NQ2C 4FNMA 4MPDA 2QOEA 2BN4A 2O3TA 4B17A 1F8FA 1JQDA 4BRWA 2JD1A 4ML3A 1YRLA 3BXGA 2ZRGA 2FOXA 4P31A 4UKDA 4G07A 5P21A 3UWSA 1JFFA 3FYDA 1I2CA 4M99A 4LJLA 3MNFA 3OBIA 4G4SP 2GCGA 2RB5A 4LE1A 5AJZA 4J0HA 2XKAA 2RHGB 1UJ2A 4HGRA 4DT1A 4LNHA 3X1XA 1MOZA 1PSWA 5KTKA 3FUUA 2R96A 2WT8A 3A9TA 3JALA 4CMGA 3ZW9A 3O8DA 1VCMA 1PK9A 2CXOA 3DC2A 4MV9A 4KWHA 5F2EA 3EZ2A 1PT7A 2ZJ8A 3WLMA 5JAUA 2XQIA 1KPHA 1LDYA 2LWIA 1K92A 2B36A 5ALNA 1V39A 1AUPA 1IIBA 2D1TA 1A76A 2ODNA 1E9CA 3PFIA 4Q9LA 4XDHA 4Z4HA 5JZSA 1QKIA 2IDMA 3KJNA 5BP7A 1JKJB 2IXTA 2XJ9A 4N48A 2FZWA 4GOOD 4E3WA 1FTYA 2A0XA 4KN5A 4ARCA 1Q16A 4NCBA 3GPBA 2FZGA 1HFWA 1UZLA 1V71A 3RRXA 3ZHYA 2DHQA 3RK0A 1U2DA 5LM3A 1UAGA 1WW3A 3HLYA 4ZJUA 2C54A 2VDQB 3T54A 4EW2A 3D31A 2PUFA 2ZJAA 1QHNA 1KPIA 2EX1A 2QN6A 2R7AA 1D0IA 1E1QD 3DOIA 3ILXA 3QKTA 4OBBA 4WT7A 4UQLA 1BTOA 1GGKA 3MOGA 3Q0TA 3W2HA 2P0AA 2RBGA 4R8MA 4UNRA 1IL0A 1NX6A 1Q74A 1EIZA 4OREX 5A05A 4FEGA 1P33A 1XT6A 3A25A 4I1YA 4WNIA 5DYNA 1N0VC 4PAMA 2GRJA 3VGJA 3CF2A 4M9ZA 3AH8A 1KMNA 1A82A 3BXPA 3SSNA 1ISPA 2QGFA 3C3JA 3LRXA 4DDUA 1BHSA 2JFZA 1OWLA 3ADKA 3GEHA 4PCUA 1DMRA 1GY8A 1I4WA 3GP5A 1IN8A 4QEZA 1PLKA 4LFCB 4H3HB 1O5OA 5HCUA 2QTLA 1YGPA 4C7KA 9ABPA 1HLFA 1W5SA 2PX6A 4JODA 2F4VB 1V11B 5DGIA 1X77A 3ITNA 2G9RA 3A4VA 3T52A 3T99A 2H2AA 3VSBA 1P4RA 1W0CA 2Y4NA 3KC2A 3ZV7A 4ITRC 3EG9A 3HE3A 1DWQA 5ED0A 1SHLA 2HDNB 4K28A 3RYCB 4EY6A 1WLSA 2ZSIA 4AMGA 4L08A 1GNLA 2NVWA 4L5AA 2CE2X 1JI0A 4MEAA 4S04A 2VTBB 1XBTA 1XPOA 3HDVA 4F8YA 3MRXA 5KX5B 3B9RA 4ENPA 4R01A 1G4HA 2QS9A 5EHIA 2WSIA 2YTZA 4RTPA 1JAXA 2LV8A 3ONNA 4HBZA 3UM9A 3WLAA 3CNBA 3C8UA 5I7UA 2OILA 4KN8A 4P2BA 3I30X 1G0NA 3QVLA 1JDUA 1X3SA 1LRLA 2UYGA 4G1VA 5I9BA 2H2DA 3KPWA 3NV9A 3ZIAA 3EWIA 1QE3A 3FTEA 2FPGB 2DR0A 3JQPA 3NDBB 3ONEA 4WZBE 5TVGA 4AG5A 1PSZA 3CUSA 4GSYA 4I1VA 1JDSA 4YAFA 5LWHA 4L7QA 4JFAA 1W1UA 1YZNA 2YUTA 1TYZA 3TIGA 3ZHCA 2V5AA 4C14A 2CVHA 2OCBA 1GA6A 2QJWA 2ZRFA 3ONWA 1NF9A 5CJJA 1A27A 4HB3A 2EF0A 3V7FA 4ZYWA 2BEJA 1SZPA 1VECA 4LDRA 4EYQA 4BZQA 4RPHA 3UMGA 1NUUA 2RONA 1T3LA 4XYBA 5K8TA 2YJNA 4FXOA 4A03A 1TM3E 3HCEA 2X5OA 2QPAA 4KXUA 1GLNA 2GTIA 2Q3MA 2FPPA 1E0AA 1P1KA 4ZV9A 4DXAA 2I6TA 1FPMA 3ASZA 3GG2A 4RSGA 3H4VA 4RZUA 4GHWA 5CNIA 3A4TA 5ALWA 5FTWA 3PPWA 3CVWA 3HDJA 3FWZA 4RLFA 5DDIP 2Y1OA 1IN5A 1DEKA 1P0CA 3JQEA 4QGGA 4UM8B 4ZDJA 1CCWA 3DPSA 3T94A 4BNIA 2EP5A 1OW3B 2VHZA 4M87A 3VHQA 4DR1B 1CQWA 5KQGA 3HNPA 3LLUA 1DFIA 3LYAA 4FFVA 5KNCD 3TOXA 1IJKA 4O3MA 5I3CA 3PRKE 3RS2A 3HADA 3JV7A 5IJZA 1A7KA 3A1DA 4EA8A 5HNKA 4JJAA 4D3XA 1V48A 4CBVA 4DCVA 3ITKA 4BX9A 3W2EA 5FJIA 3SMVA 4UHBA 3BWBA 2TS1A 4W9MC 2UZ4A 4DC0A 4EQ6B 2REQA 1ZC3A 3FZNA 1C5KA 5M3BA 5CCEA 1VSVA 2W6QA 5K3EA 4WA8A 3RGWS 2YIMA 4B74A 2XE6A 3NRBA 4B3FX 3M9WA 1XELA 4G2NA 4RQAA 3W5SA 3KDSE 3PJDA 2FG7C 1VLHA 5TSDA 4LHXA 5JDCC 2QR5A 3OU6A 3SMQA 1BHQ1 5L6MB 3GCWA 3ZEIA 1IHDA 2O52A 1JQAA 3EGXA 4ENTA 5DASA 1LBIA 1ZQ9A 4FNGA 1WKCA 2EFEB 3KWLA 4G0UA 2B82A 5REQA 3RRMA 4BMSA 1W0JD 1GL6A 3I2IA 1JSXA 2XYRA 1ZHHA 3F46A 1GQQA 1KZ1A 3H1AA 3E3MA 4DWJA 4DNOA 1AUOA 3PEVA 1Z5NA 1M8FA 1ZJYA 3ZH2A 3TINA 1E1DA 3MC1A 3U13A 4CLRA 3H17A 3NLLA 2L0XA 1OBOA 1T0PA 1Y7IA 3JPWA 3QFRA 4XX0A 4XR9A 3S1LA 1WV0A 4O4HB 1IOWA 1JSCA 2YBDA 3HO6A 4LQLA 5I9TA 4D25A 2H2GA 4FSXA 2VCEA 3M5DA 4H7JA 3W7AA 3NWPA 2IYVA 1JEYB 4MUHA 4PZUA 3ZBTA 4AURA 1R4AA 4GFDA 4OAOA 3UQYS 2OMEA 3L8FA 5MFPA 3CEMA 1YL6A 2A9OA 5B7QA 4QELA 1BW9A 3M6WA 4EJSC 4LUCA 1UR5A 3ROPA 1FW6A 5A3QA 3IBCA 2AIRA 3DE3X 4MV0A 1JJVA 4Q39A 3HWWA 4UM9D 2P9GA 5AJTA 4XOUA 3R24A 1CRLA 1T4CB 2A0YA 3TQRA 1QFJA 2A35A 1XX6A 5AM2A 1WSDA 4ZQFA 5TQJA 3PGKA 3TE6A 6REQA 5ALUA 2HF7A 5EZSA 5FI1B 2JW5A 4D0SA 5A7HA 4IGIA 3WV4A 2B0CA 3W05A 3S5JA 2C84A 1FP2A 3BB1A 3V9PA 4RHCA 4BJHB 3LC0A 4MVJM 1IOZA 4JK3A 3IDQA 3A1WA 5B37A 5CXSA 3VHXA 4LFAB 1B74A 3MT8A 2N75A 3R76A 1FP1D 4P38A 1U0TA 4N7BA 2KPOA 4RWEA 1OWMA 1OASA 1XZNA 3TQSA 1SBTA 1N9ZA 2CF6A 3OIUA 4U00A 4WBNB 4BMOB 4R9VA 1D7OA 3KQTA 3L01A 4P5PA 5FLEX 4ZRNA 3AIMA 5FV7A 1OH6A 1ZUHA 1DSSG 3G2PA 3JASB 3ADOA 3OLZA 3OU7A 2XLCA 2F6RA 3WWZA 5IFLA 4NL4H 3KNZA 4G36A 2IYWA 2FW1A 2NU7B 5FTMA 4EZBA 3MHTA 3OIWA 1AF4A 3IVXA 5BVHA 4E5DA 2FWNA 4FJ1A 3DMNA 1SG6A 3OE5A 1ULUA 3M49A 4G8DA 2R44A 1PDWA 4MB2A 3ZZNA 1GPMA 3PPIA 5CFMA 1M75A 1RQGA 1T3ZA 1TEVA 4DMCA 1U94A 3A36A 1R00A 2BMDA 2RAFA 1V5EA 3PNSA 4CIWA 1JTFA 2PZKA 3MLEA 3BT7A 1R4MB 2C3YA 1ESCA 2C97A 2Y0BA 3R23A 1Q7GA 3A4MA 3ZD6A 3HKBA 4IDGA 1WCWA 5IZ4A 2PMFA 3AKYA 3GXOA 1SCUA 3TTTA 2OHJA 4UXJA 5TGDA 4HT3B 1H2AS 2LE0A 3VAZA 1FCJA 1I3LA 1LNSA 4B5LA 3H0CA 2I8AA 2W2PA 4MS4A 4DDVA 1WMBA 4Z9BA 1JLLB 3K53A 4UUPA 4L8GA 5KTPA 3RT7A 4PHTA 3ZEAA 2A3RA 5EXTA 1Q84A 1U1EA 1TJ4A 2BFOA 3LOUA 5K8UA 1XRLA 3AL2A 5SZIA 1NVVQ 3QVOA 4XTCS 1MQAA 3BGVA 3HWSA 2FPIA 1G2OA 3JQDA 3GLKA 3PHHA 3S0JA 2GM9A 3I9OA 3OZUA 5CFRA 2CT8A 1NNEA 2EEZA 2AK3A 3TOCA 3OM0A 3SFTA 4FGSA 3G8BA 4MRNA 3WLHA 2FW9A 4C30A 2Q46A 2DQYA 3MLBA 3CH5A 4UUMA 4L0QA 2IP2A 1XZIA 3A9VA 4KMRA 3FB1A 3SR0A 1T6YA 1ZD3A 2Y92A 4FWBA 4ZOLA 2B1RA 2NNLD 4JB3A 1CW2B 5DLYA 3FLMA 4FUQA 3IPXA 4Q9HA 1AKWA 5AVZA 3RHTA 4UVDA 1DXQA 3FUVA 4MCJA 2JC3A 4KFSA 5F7ZA 1P4JA 1ZPDA 1Q2UA 1SR8A 3W6OA 1X1QA 4H6XA 5I9LA 1DLJA 4AO8A 3KR2A 1GTMA 2P79A 4P5DA 1ZK3A 3AEQA 4FOOA 1JFSA 2PEZA 1WXXA 5FNZA 1W4ZA 1TVCA 3OEEA 2OXRA 4UNSA 1E58A 3DLTA 4WXRA 4E70A 3M7IA 3LVBA 1ZESA 4LSGA 3JXEA 1AGXA 2RAUA 3GY0A 4RO0A 3RYTC 1DX6A 1O9HA 4B4OA 4Z7OB 3AERA 2FUCA 1L1RA 4CM8A 1L5SA 5GJVC 2HF2A 4ECEA 4BPBA 2X4LA 4RETA 4IMRA 4G01B 1R8JA 1H2EA 3C24A 4DSZA 5HPYB 2B6HA 2DFKB 3DJFA 5EIXA 1JEQA 1V47A 1ZDMA 2QTGA 3CM0A 3MMPA 4NIMA 3X44A 2RMKA 3QLUC 4AS2A 5J2TB 2JDID 3H2SA 3RSOA 2IS1A 3IAS6 2IF2A 3IMGA 3UOAB 5H9VA 4B2YA 4QO7A 4R1UA 1FYWA 3K8ZA 4PC3A 1RZUA 1FS5A 4YI5A 1YIOA 4IDFA 5K03A 2JB9A 3K2IA 1XRJA 4HFRA 1X1AA 1CU1A 4YP0A 5DWDA 4CKWA 2QVGA 2NGRA 2QVLA 3CNLA 3I52A 4R3WA 1NM5A 1K7SN 2V65A 5B36A 4DRXB 2Z43A 2A0WA 1CVRA 5L3ZA 4BGDA 1FNMA 3TSYA 5AKHA 4E5VA 1KJ8A 3D1JA 4K6OA 4LHYA 4R84A 1OFVA 3MMNA 2PZJA 3IQEA 3RQSA 5HM6A 1OLUA 5JQWA 5A1JA 4TSKA 1DUSA 1HEUA 1O95D 1MN6A 5GPBA 4IDEA 621PA 3QV1A 2HWXA 3HDTA 4JKYA 2PGLA 5HVNA 4X1KA 4RIIA 2R1TA 1H8HA 1ZD5A 2VHUA 3PUXA 5ERYA 3U1TA 4TTQA 5KYUA 1YMVA 5EERA 2R6DA 5HIIA 4JU9A 3V4ZA 5CDGA 2ID7A 1V8PA 2CJYA 3TYXA 4BBJA 3OZAA 3FHCB 4JEHA 3O93A 5FNVA 2CNBA 2R87A 4Q3KA 4ZVOA 1YBFA 3D6AA 1KY2A 3PD7A 5EMNA 1YZGA 4OYLA 1J97A 1WA5A 4IGEA 5BSKA 1CJBA 1CE8B 1E63A 1JTEA 2C5EA 1PSDA 4UDNA 2WSYB 1TLLA 3FROA 1EJ6A 1OPXA 4UU1A 1HNZB 2H1FA 4B87A 5BSEA 1GDDA 3BZBA 3NOXA 4RA6B 3U6KA 3Q8LA 3F1LA 1GPNA 1UKEA 4AYWA 3KQVA 1BHO1 5MDHA 5JT1A 1QMPA 1RBYA 3P97A 3AQ4A 4Y2QA 4LBWA 3SSOA 4WJLA 3D02A 3I9MA 3EGEA 1JWAB 3LA8A 5BSRA 5DP2A 3WMFA 3TAUA 3PNQA 3URMA 4ESHA 1VLVA 3I2JA 3R20A 5J23A 4IGAA 1I1QB 3ZDRA 2FZVA 5G02A 2JJ2A 3AF4A 3I1JA 4KQ6A 3KYBA 3OTWA 4RV5A 4RLQA 4UU0A 3WLEA 1B00A 1K7YA 3Q8WA 2ZFUA 1UFQA 2EJWA 4O4HF 2XCTB 1ACLA 1EXVA 1SK9A 1GZDA 3OOJA 1ZCZA 3QNUA 4MVYA 5HM8A 3ZLTA 3RVPA 3U61B 4EGSA 3LCRA 1J21A 2CV1A 1GVHA 3EWAA 5TGTA 1YASA 3FWPA 4X8OA 2HIAA 1U2GC 3UN1A 3VPAA 3FPHA 3M6XA 3HU5A 3KQQA 4L9WA 3RS7A 3CG4A 2X8AA 2QW1A 3EZ7A 4O2BB 4IJQA 2E0IA 4D79A 1N2XA 3C6QA 3M34A 2QRVB 4KITB 1E9BA 2QF7A 4MS3B 1RPTA 4NP6A 1NLZA 2ZWPA 3RFFA 1IM5A 3TVDA 3HDHA 3FLAA 1DKOA 2Q1UA 2IHUA 4BU0A 1R6DA 5LPNA 3GNLA 4HPWA 1K6EA 1Y7PA 3T6KA 1XDSA 2AR9A 1L8QA 2Q3DA 3BCUA 3LUKA 4RWZA 4XGKA 3B3AA 1DXOA 1MJGA 3MN1A 5EZ6B 4G86A 3V6LA 2O57A 4N8SA 4B71A 2FEMA 2PY6A 1LF0A 2ZJ7A 3GROA 3ZOZA 3OJXA 1DQRA 1QJCA 5BO5A 2VQ6A 3V3KA 3P9NA 3ORQA 3GP8A 4WBNF 5AOCA 4JI8B 2E1RA 4D5GA 3GRFA 4ZAGA 4H77A 2NUAA 3FCOA 1L3BA 4MWZA 2VTVA 5HIJA 5SICE 3RU2A 3GJTA 4KYVA 4G1MB 2VO1A 4PTZA 5FAKA 1Q22A 1U5BA 4HDAA 2REOA 2Q6OA 3EX7C 2AA3A 1K2WA 2XZTA 4Y30A 3CNNA 3F6SA 4WZAE 4JLJA 3MGBA 4LYJA 4QYTA 1XMSA 3TTWA 1YE8A 3HGTA 1JSLA 5FOQA 2PUCA 1JW9B 1PG5A 1UFKA 4DN6A 1GZHB 2J9RA 3QK7A 2PL1A 3F47A 1KI4A 3R5JA 1H1LA 1QUEA 2CXXA 3WZ2A 3BPSA 3ICOA 1I5OA 2H7VA 3JWJA 4UEQA 4C3OB 3FDZB 3VTAA 2EKPA 2EZUA 1FTWA 1OD6A 1QX4A 2WU1A 3GJ3A 3OPYI 4I6JA 3ZDAA 2JLSA 1F0PA 4KR2A 4HVAA 1D4FA 1L4UA 3KPUA 2MYUA 3AO0B 4JB0A 2WW8A 3ED5A 4YMHA 3KYCB 3RC2A 2VH2A 1GGJA 4A0QA 4URHA 2DKOA 3C3YA 1W75A 2G9UA 3FTQA 4D9EA 3RTCA 1U04A 3EIXA 2HA3A 3Q87B 1VFNA 1F12A 2DZDA 1CFZA 1A2OA 3R0XA 2IX3A 5HHTA 4R1OA 2F1OA 1X1RA 1QRTA 3D3NA 1SBIA 2XHEA 1BD3A 2WMOB 3EK2A 3DCIA 4NZMA 5EKSA 4GECA 2PS9A 4GRIA 3KQPA 1P60A 1POXA 2FHPA 3KQSA 3KQNA 5KTTA 4NPAA 2OEPA 1TVKA 3DOCA 2NIPA 1E5DA 2ZI9A 2H2IA 5EEGA 5AW9A 4WQMA 4F45A 4MKRA 5SZKB 4HAOA 3SIRA 5GVSA 3OQ1A 2VRBA 1U0FA 4IAOA 3SVLA 1ISJA 5AHKA 4B43A 5KC8A 4DFDA 3BS4A 3TDNA 4BAGA 1FS6A 2CZCA 2ZYAA 2V5VA 1C4OA 3TRHA 4BATA 2XD4A 3DTVB 1RQ2A 4D4MA 3RABA 3UAWA 3CRQA 4I4IA 1UM9A 4RKFA 4UHEA 5A0FA 2GK3A 1J9GA 3ZGXA 1QSGA 4OFZA 1EVIA 4MVJF 4O08A 4G23A 3ZWVA 4V0MA 1DBPA 1W4RA 1W0KD 2NYUA 3LBYA 5IVDA 1KFJB 5TT1A 3DUFB 3T35A 3TZCA 2YZNA 1X1CA 4DEXA 5FA6A 5ARCA 5L3RA 1C9MA 1XVTA 1Y4AE 2RHRA 2VL7A 3D0QA 1JHUA 5LCXA 3SX2A 4EA6A 3GLGB 3IYLW 1UJ5A 2ZSKA 4PNPA 5KYWA 1IULA 2KWIA 2ZS7A 4A16A 1YGYA 3VR3A 4EVSA 4PQYA 4V0QA 2FX5A 2NAFA 4LDNA 2ZYIA 2P9HA 3VVBA 3LDAA 2JD0A 1FQJA 1MO5A 1VL5A 3EEFA 2Y05A 4D74A 2J0VA 2MIIA 2W6CX 3Q9SA 4PN3A 5EQDA 1JHOA 5J2TF 4ND7A 5AKJA 1UBFA 5ETJA 3WICA 4MO9A 4KO2S 3B1FA 1ZD2P 4DA9A 4QXMA 5JHHB 2HB6A 4D4KA 5AK4A 1K8RA 4TMWA 5BOVA 2GZ1A 4DSNA 2FZKA 3EZLA 4DV2B 1ZA2A 1COZA 3HHEA 3KTOA 3VR2A 1VMAA 3V8BA 3ZUGA 1LEHA 4QRHA 4D3ZA 1JJFA 4EKEA 2EDAA 3V1TC 8LDHA 1TJYA 4EQZA 2IXBA 1EWRA 3SEZA 2B61A 2X40A 4QDUA 3ZPXA 4HDSB 1G5RA 2Z8XA 5KMGA 1A9PA 4Q1BA 1JWLA 3I0MA 1K5PA 5CYOA 4LBZA 4IINA 1OB5A 4K9NA 3IHLA 3FZQA 2WJZB 1WZ2A 3ZDEA 1UPFA 4AJNA 3AUFA 3JYLA 1NVBA 4A1FA 5CM9C 4BLOA 2IHVA 3T06B 1Y5MA 5FBRB 2R6ZA 5DNUA 3KSAC 5B2EA 2W2LA 3Q2KA 3GCDA 4DG5A 3RUPA 4ZHQB 2V6IA 3AB8A 3NIGB 3Q5GA 4IJUA 2BMJA 5EGSA 4YJHA 4TXLA 5DM1A 3ZGOA 3ZBUA 2BSQA 3EUWA 2BHLA 4REQA 4UBLA 1ZNYA 1JU3A 4ZQGA 4EKGA 2M6SA 5JRDS 1F4VA 1E92A 4QXPA 5JCXA 2HF9A 4PHGA 3E3OA 3PUVA 1SY7A 3MWEA 4TL8A 4QXQA 2JHCA 5D1HA 2YS6A 3QY0A 3TM4A 5GOTA 3PUZA 4TXMA 2V4ZA 5JNRA 3ZTYA 2AG6A 1OWPA 1VKOA 3OHPA 4JCOA 3WB1A 3ZX4A 3WIVA 1NONA 3DOJA 4YPFA 3I09A 3FKSD 1XPRA 3QEBZ 2O8EB 2OE2A 4ROSA 5AHRA 4X62B 3FVVA 1JHMA 2WQZA 1E6MA 4EHDA 3VPXA 2JLUA 3HU1A 1RQXA 3G88A 3WMXA 4FLFA 4Q7KA 5C1DA 1TM1E 1CY7A 3IPYA 1N9GA 1WDWB 4PG8A 4CFYA 1JKJA 2P3OA 1N6NA 2HJ9A 3LUBA 3NYQA 4J0EA 4LZPA 3WKAA 1HKHA 4CWAA 4C7JA 1JVNA 2QN8A 3TXXA 2QRLA 3O4JA 1T1JA 2G8LA 2WDZA 3E4DA 3UTDA 4B3BA 3KL2A 2XTAA 1Y1SA 2Z8YA 3WGIA 2I2AA 4DDHA 3LRPA 2R68A 3F4BA 3KB2A 4CN8A 5JAIA 5JS7A 5LLDA 3OP4A 4CMIB 1S02A 3GARA 5IF3A 1GUFA 2VJOA 4PO8A 5I5GA 2YVQA 4Y0VA 4EB6B 3A0UA 4YCSA 1XNQB 1KRWA 3C97A 5EIBC 5L8VA 2HU8A 4EVRA 4NF2A 4G5SA 4ESOA 4LSMA 3FIUA 4FK8A 4QTTB 1FQWA 3UWDA 5FBVB 2GARA 5JISA 2CHEA 2JFVA 4O2BF 4QUEA 4E33A 1KU6A 3IALA 3PTAA 3V2HA 3VDNB 3FFXA 3FI9A 3RSCA 4F92B 2CXNA 2PHZA 3MMSA 3LHFA 3DONA 1PN3A 3FWNA 4PQRA 4Q4HA 1H23A 5D01A 2VPXA 1OXSC 1L5KA 1LW7A 2B3TA 2QLBA 3VJKA 1OLOA 2EIHA 3N2EA 1T13A 5JQGB 3T15A 4LY3A 1EFUA 1N57A 4MP8A 2A1TS 4RVFA 4BP8A 2BI4A 1RXEA 1DQPA 1UDBA 2Q6VA 2VP6A 3DMTA 5HFJA 1JIIA 3AUJB 4TSRA 3Q0EA 5D84A 1PJLA 4TKMA 3FOWA 2GNAA 4AMYA 2IPOA 3RYCA 4Y6RA 2JEZA 4U4AA 3C7DB 4EHFA 1EHCA 1P1BA 1EHYA 1TQ6A 3X43A 2O7SA 5LLSA 2VTBA 4TSFA 2FFQA 4OMFG 2X7HA 3MPOA 2I1QA 4JUAA 3QSGA 3KRTA 2QXUA 1CY0A 3LKDA 1J7KA 3IBSA 1VJ0A 1N2SA 2NWQA 4JX9A 5AICA 3ZE9A 1T6NA 3N75A 4D9KA 3HR8A 1DDIA 4EP1A 1WD5A 1OA1A 2O5EA 3I9V6 1CDDA 5CTAA 3JQ7B 4G8CA 3DLIA 1Q92A 1CR2A 4OEHA 3D2AA 2GSDA 2BHTA 3DP7A 3L46A 1KK0A 2P9CA 3LY9A 2FPGA 3K20A 1XD9A 5EWMB 1RAFA 4RQUA 2UXBB 4ND8B 2QTTA 3BWMA 1SPBS 2AYXA 2FEPA 5JCJA 2D5LA 1H85A 1CUJA 3F8WA 3AY7A 3AZOA 1BVYF 1FNCA 1K98A 1MIHA 2J9YB 1FXWF 2MOKA 3LUHA 2VDOB 3OFVA 3ZU4A 4IOLA 2AVDA 5EIOA 1GN9A 4BVHA 2A9JA 2XHZA 3KU1A 4OP3A 2AFIB 2APJA 5K1ZA 1ODSA 4URUR 4FHDA 2HQBA 3QMMA 5TX7A 4GXNA 4K6CA 4ZZ3A 1WPXA 2PSSA 2VT3A 1N6LA 3IBFA 2M6RA 5MF6A 3D4OA 4M0UA 3MBIA 4C88A 4ARUA 4RIFA 3F73A 1WF3A 3GJQA 3HP1A 4YPVA 4DIMA 3JRNA 3H13A 1LFAA 3JSXA 4JASB 3V8PA 3WHKA 1E0KA 2JARA 2BY4A 2RIRA 5FEMA 3HJAA 2I2DA 5YASA 2O6HA 1QH1A 2OWDA 2WTMA 1TEZA 4UE2A 1ZAKA 4FW9A 4CFSA 5L7YA 1ZNQO 2BMWA 3OPNA 2N42A 3DMPA 4N3GA 4ZANA 1DBQA 1QPGA 1OBHA 4RH1A 5I47A 1U9IC 1C3XA 1FSZA 1DBSA 2E4AA 4CMJA 4B47A 3E3LA 4Y9DA 2AUTA 1R9NA 2X6QA 3DT6A 4J6EA 4ER7A 3X1DA 4EYKA 4GWGA 4PYMA 2QD4A 3K30A 1P17A 5JZVA 1LY1A 4H0FA 2EDCA 1QVRA 3CF6R 3OEYA 3QYAA 4XEHA 4OHXA 1GZUA 4WKOA 1Z6TA 1CZLA 1NLFA 3AHFA 4QLBA 1QVVA 4EJ0A 1QGZA 1HE1C 1V6CA 1II9A 2HZBA 2B4KA 4E46A 4EQ6A 4EZEA 3E53A 5A9SB 2TYSB 3HU2A 3G2NA 1L6RA 5A4DA 2X5NA 3BE8A 1RBMA 4P0QB 2N1BA 2WINI 3JTMA 1M1ZA 1G9SA 4OL0A 1W2GA 2VNJA 4V2IA 3GZJA 4MUFA 3EC1A 4RHUA 4JJIA 1Q0QA 3LVFO 1L7XA 4LXTA 3OOHA 4M7WA 4V02A 1G19A 1XQYA 2MT9A 1NT4A 2NV2B 3AKEA 4GMGA 2K2QB 2OAEA 1VI5A 4RTRA 4H3SA 1Z74A 3VR5H 3L1JA 5F77A 2HM7A 1XZQA 2FPXA 1ZW1A 4QIHA 4H6WA 1NHGA 3O4FA 1WSAA 1RRFA 5G0VA 2OMKA 3DBHB 2AMLA 3FFBA 4NH4A 4TTTS 5CLJA 1P8JA 1SHKA 2A5YB 3WJAA 1JSZA 2PIAA 3C3KA 4MDFA 4GGPA 5T64A 3L1VA 4Z3KA 4OB6A 4F38A 2B8WA 1OXKB 2QM8A 3X1YA 5TE9A 4D4HA 4O4HA 2WC1A 1JYFA 2ZAOA 2OZLB 4K9OA 4MUMA 4TTIA 5K8CA 3INRA 3PUHA 2QR2A 4FB4A 3HKCB 2IZ6A 3O74A 3PLAE 1H2XA 3NC0C 4RFVA 5EFZA 3RAJA 4G4IA 3VSAA 5H82A 1SKUA 5KOHB 1PGPA 5DX0A 3ZD8A 5AW4A 4KWIA 1HA3A 3WRYA 3PUIA 5BWCA 5C53B 1VE5A 4RVOA 5FWYB 1VL6A 3TK1A 3ND6A 1F17A 1ZWLA 1T4CA 4HB4A 4QQ8A 4HGNA 2JVJA 5IDYA 2Q8PA 1I6MA 1PR2A 1NG9A 4HD8A 4KUHA 1VJTA 1I32A 1YR8A 1DXHA 3CLVA 2EX0A 1PZHA 4MR8B 4PICA 4ZHQF 1OI3A 2PZAA 1TJNA 2C0PA 3EXIA 2P5TB 1XEWY 2WZDA 3UAYA 3I6QA 4CN9A 1D2CA 5LP6C 4QNRA 4WVLA 4HQNA 1ORWA 2J5BA 4BNXA 4RDCA 4CGYA 2X0JA 2FUG1 4YRKA 3FHLA 4F2GA 3G7UA 1CQPA 1IBCA 1GU7A 4LZOA 1H4VB 1COWD 1LPMA 4LHWA 3HXMA 2FZ4A 2W42A 1ID1A 2VWGA 1P6QA 2GR9A 2BR5A 5TRTA 4WBNA 5CG1A 1XVVA 5DCYA 3TR0A 2QE7D 3DPIA 4EI7A 3A1CA 2J3QA 2Y0CA 4LJ9A 3JASA 821PA 2OKCA 4K3VA 2PBFA 1FUIA 2XUDA 1FUKA 5CLQA 1FUEA 1PRYA 5DBIA 1V6AA 1ZD9A 5ER9A 2NU7A 5FXMA 1P9NA 2O50A 2XSZD 3GVCA 2DMRA 3NTOA 5FOSA 3MCTA 1DJOA 3EIUA 1JWBB 1V3UA 4Y2JA 1H2ZA 4I3FA 1SUCA 2QMOA 1P0IA 1V4VA 2XH8A 4Q3EA 1OFIA 1FP6A 4I66A 4IHAA 4LG1A 4NK5A 3OSUA 4H6PA 5AK0A 1TIBA 4HMPA 2AKYA 1TUEA 2ZCJA 2HWWA 2YJ3A 2WJPA 1R4MA 3PT5A 4RE6A 3OTIA 2V6BA 4P7GA 4L27A 1I7SB 5T4BA 3THRA 1GAQA 3UCFA 4PCVA 2P69A 3WAKA 1V1JA 3MEQA 5KEIA 4B7AA 1M83A 1ZN9A 3UJ8A 1U1FA 4XQGA 4AF6A 5HJ7A 1UBNA 3I3SR 1GAEO 4P5EA 2NZUG 4OKNA 4Y18A 4M0PA 4IILA 1Q1GA 1JAHA 5U1PA 4DYHA 2PS3A 2VHJA 5THXA 5C4MA 1BN6A 1SBHA 4PYQA 3RTEA 5B12A 2Q4BA 4DCCA 2ZRLA 1APBA 3CTPA 2E4WA 4PG6A 5JO9A 4NBTA 3AHIA 3TKYA 3U7FB 1AS3A 1OGJA 4HNHA 3EDCA 3KJFA 4I1SA 1HTBA 2QP4A 3DYVA 3WHLA 5H8WA 4KPFC 3C1TA 2XMGA 4YP1A 1S1CA 1VL1A 4AF7A 2E55A 2IEZA 2WUDA 2B5OA 3I1YA 5BYAA 4PGAA 4Z4IA 2Q9CA 4TQAA 2BFBA 2D4HA 3USZA 1H6BA 4JENA 3FVTA 3GYGA 3U26A 1CY8A 3WHPA 2B7BA 5LVAA 1ZOOA 1VE9A 3PNMA 5JQGF 3SYTA 5HFAA 3S70A 1PR4A 5HG0A 3I4FA 2OB2A 3C74A 5AKLA 3RROA 3K9CA 3LT0A 4E21A 1GDHA 1L4BA 3RAEC 2WTNA 3HXTA 1Z5PA 4JVLA 1SXHA 4DBLC 3NH9A 5LMCA 2DH5A 4ZVVA 4G5YA 4ZZ1A 4EPYA 3WMRA 4MI9A 4BIMA 4TYMA 4TN1A 3FGZA 4MTCA 4ID3A 5GVRA 2XCRB 3IUMA 1DRVA 1Q1QA 4Y7DA 4C0LA 1BXKA 3G9QA 3H1BA 1ISGA 2WUFA 4K46A 1II0A 1P7ZA 4FEAA 4MVJA 4RD3A 4X60A 3RJTA 3O9ZA 3SP1A 4ZCRA 1VYVA 1OFTA 2BC9A 3HUDA 4RPKA 4U6QA 2WTUA 5GM2A 1MEEA 1MNQA 3L79A 1QUFA 2R4QA 3BORA 2Z6VA 1AE1A 2GT1A 3LVQE 1BVHA 1AUXA 2PD4A 3FOEC 2BD0A 4OHKA 1OZAA 1JDTA 4GOMD 2V7TA 4MVCA 4HAZA 1JLSA 2H8KA 2W0MA 4RKYA 1JFRA 2QRQA 4TTPA 1NI4B 3L02A 2EKLA 2WYIA 4A23A 3PT9A 4DCUA 4N6NA 3RIGA 4LVUA 4Z5XA 5J2TA 1EJ0A 3FSGD 2UZAA 1W5EA 3VV2A 1N1GA 2XMDA 5KKNB 2E4XA 3H87A 4JI2B 1ABFA 1HV8A 2PM8A 2O3JA 4C7BA 2UUCB 2JGIA 5J3JA 4YRQA 2ONCA 4YWHA 1G3MA 4JXXA 2ATCA 5CX4A 2HSZA 1CF9A 3ITDA 3QOFA 4ZAFA 5FO1A 3OZIA 4L8YA 4YMWA 3W9UA 3CLUD 1ZYUA 2W6OA 2QTMA 2DLDA 2I22A 4GM0A 5DSZA 4BGVA 5BQ5A 4CL8A 1NWHA 3GJRA 5IXSA 3L7DA 2OGUA 5A02A 1T34A 3OIYA 3WWDA 4JKOA 1M2HA 4MGKR 4M6WB 4CDMA 1XAJA 3BN3A 4F4DA 1GL9B 1UXJA 2PH3A 3OOYA 2D74A 3KVYA 4GXTA 2JAQA 3TUZC 2VP4A 1DBWA 3ZIDA 1T8WA 3KB8A 2XB6A 4MHSA 4WGFA 1GQOA 1YE5A 3TPZA 2QN2A 4DJJA 1J25A 4CL3A 2QZPA 5C34B 2ODTX 1KS2A 3LX4A 4G4JA 1F06A 1Z5OA 4XM1A 4BU1A 2AXNA 1BVRA 3BREA 4ESEA 1LC0A 3QIVA 2QPLA 4TX1A 4DNFA 4G0QA 2PVPA 2EEPA 4QUIA 3EPKA 3IP7A 3GG9A 4J0CA 3ORYA 3MWKA 2FK7A 4W8HA 5KYVA 2QD1A 5ES4B 1T9CA 3HEAA 1E3MA 3BJIC 3LKBA 3ND8A 1H9BA 4WSOA 4F06A 1W35A 3FDXA 4PONA 3T61A 1NN1A 4Q9IA 1QIJA 4QPZA 4OB7A 3W8DA 5BSGA 5IMSA 1VI2A 3AR9A 1CE8A 1MAUA 3LQ2A 3OOEA 3SDSA 3UYKA 3E9RA 3EEIA 1V8ZA 1OYOA 4MKGA 2VF4X 2PRYA 4MKIA 2ZRPA 5DOVA 4BZZA 4YNBA 3KUUA 4RA6A 2Z8ZA 2WM3A 5KSPA 1Z2DA 1HE3A 1P4SA 4L72A 1Q0PA 4FGJA 4BFYA 1RWPA 2CMKA 1Z2AA 1AN9A 4LRUA 1GKUB 3EEOA 2QNIA 2FWBA 4TMXA 4EEZA 5HF8A 4ZCMA 2MTBA 4OPMA 1YFKA 1ZIDA 2NUPB 2QYTA 1TQ8A 4FI3C 4X1YB 3PHIA 5ALPA 3K9FC 3H1EA 2FEKA 3L1UA 5DHRA 2VYVA 3F6YA 4UAUA 1OKKD 1YE3A 3T5MA 4GUDA 4Y9UA 1S3FA 1D0VA 3SC3A 1W19A 4FZ5A 1R10A 2J6BA 3FVRA 2E18A 3PTZA 4D92A 2UXDB 1VSBA 4TYWA 3I5AA 2X7XA 1U7XA 1RWQA 2YC4C 4YYEA 4GD3Q 3VJLA 1MF7A 2WWIA 1DKQA 2HMAA 1U7OA 4KYTA 1TM7E 4MYCA 4M1OA 4YQFA 4KE7A 4XYLA 3I5XA 3S1AA 1PD1A 1ORHA 4IXWA 4PLHA 2I9KA 2ZR8A 1TMGE 2XA1A 3B82A 1QYXA 4BGIA 4DYDA 5CA1B 5JLJA 1RDFA 4LVNA 4H3KB 1STOA 3ANTA 3D54D 3PXUA 3F67A 3PQ8A 1ZRSA 4RFSA 1P5RA 1VCNA 1WNTA 1VJRA 1ESEA 2UUBB 5C7LO 3AF3A 4PPYA 5EE5B 1F1JA 1T8YA 2GHRA 3J7TA 1WSBA 2BCEA 4J76A 1ZICA 2CUZA 2H1RA 1KARA 1VP9A 1EFTA 4XFDA 5FA5A 4O2BA 4AMVA 3ZV6A 4Q12A 3WL3A 1Q5PA 4MS3A 5HEKA 3LLSA 4MR7B 4B1FA 1P9WA 1WHSB 2A92A 3OE7D 4IIVA 1DCFA 2XMCA 1TXGA 3B1YA 3H1PA 4N4AA 4TRMA 3ZXYA 4LBVA 2P7HA 5F1OA 5B1HA 4ZXFA 1UZAA 2WHXA 3KFVA 1NDUA 2JH9A 4YECA 4CU2A 3EISA 2FSSA 2PTHA 1UPCA 3R5FA 3W3AA 3C3PA 4ZMSA 3DMRA 3BIWA 4DTCA 3T5DA 3VC1A 1DPFA 3RVBA 2ZM6B 4LMRA 2BJHA 5JI2E 2GVDC 3E8SA 1J33A 2IJGX 4HZIA 4NJEB 4OXXA 5EL0A 3OT4A 4QUAA 2NPIA 1NW9B 3GIWA 4YRCA 4EL0A 2JIPA 4M89A 4MWEA 3JZMA 1ISIA 3HVJA 2W6JD 5KHLB 3WDMA 5CDFE 1QZZA 1WKBA 4KGVA 3ZNPA 3L8GA 4PC6A 1C1DB 4G4GA 5K4HA 2PRJA 4FN4A 2AOVA 2AMYA 3J7AC 3RV3A 4HWTA 4EHJA 1C3EA 5A4JA 2OC4A 1V5FA 3UT5B 1K7CA 1USKA 4MIOA 4AKEA 1FVXA 2K4MA 2R60A 2PMCA 4TVSA 2GN1A 3QLVC 1KYZA 1N2GA 2F1KA 2W2KB 4CUKA 2X5KO 1QAQA 2CVQA 1H0KA 4PX2A 2O2IA 5EJGA 3RTBA 1KWKA 3NGLA 4CZ2A 3FDZA 3GFSA 4OU5A 5AI8A 5KVCA 3O4GA 5JAQA 1QHGA 2KLHA 1NA5A 1RABA 4WFKA 3UHFA 1Q0LA 1AY0A 3KYCA 4UNIA 2NUTB 4Y1RB 5ALFA 4DMFA 1FXWA 1WDKA 2IXDA 5GIPE 3F8SA 3NBQA 3T4XA 1SKYB 2BKXA 5IN5A 3PVSA 2P6PA 3C43A 1SQGA 4N3CA 4P3NA 4CMHA 3BRCA 1E6CA 4OHOA 1XLVA 2ADFA 1U3CA 2HZ7A 3C3XA 3WJ7A 1O08A 1QIHA 2C3PA 5LUBA 1XZPA 4EG7A 2W43A 3ESQA 2YUIA 1NSYA 5H3CA 1SH7A 1K3TA 5ALDA 2DP4E 3KOOA 3WXMA 1K8ZB 3IOBA 1L5LA 5JS1A 2H5LA 3S68A 5DXJA 3IO3A 2WHQA 3A6GA 5ALTA 3AVPA 1ODIA 5B4UA 4IG4A 2O7NA 3MTJA 1J0XO 5JASA 2OXCA 1M76A 3OCWA 4HDQB 1T10A 3U44A 4LJ8A 2UDPA 4GPAA 3IA2A 1ZNWA 2XY4A 3KPYA 2EFGA 4LDJA 3I73A 1W2WB 2FWJA 4A5OA 4HXYA 1JIKA 3LFUA 3IC5A 2P6UA 2C59A 3CR7A 4HS9A 4TZTA 1KQPA 1Z88A 4FE7A 3GNTA 4C22A 1SOAA 1T8PA 4Q18A 4MRMB 4B82A 2BH2A 1HO3A 3DTVA 3GUCA 3A6ZA 2OXTA 3QPUA 3SJCA 3M1YA 4WCDA 3Q15C 3RJMA 5A9RA 2ONKA 3HDGA 4AXBA 1HG1A 1I0ZA 1WJGA 5KS2A 2C29D 1HQCA 3K8OE 1F2TB 1T3HA 1UAAA 3VH1A 1E6KA 3DUFA 1Z37A 3CZQA 1JU9A 3EVEA 4PX3A 2A8YA 2NO1A 4HAYA 1LSJA 2FR1A 5JEDA 4C0SA 3CZMA 1TZBA 3GLGA 5KJCA 1CQIB 1G8YA 3CX6A 1XWIA 4Y6QA 3SEFA 2VA9A 2DFNA 3WMGA 5EY5B 1XHEA 1V3QE 5CB0A 1WXGA 5KYKA 2PKXA 3V33A 4PU0A 4Q4AA 3S2FA 3S2EA 4RTSA 2WJJA 2M6LA 2NQTA 2G5PA 1FDTA 1UKYA 1JDBB 1KVUA 4FKMA 3P9PA 1CKEA 1G6HA 3VPSA 4AJPA 1JS1X 2EHJA 3WL5A 2QTAA 4NNOA 1NVMB 3A3OA 5GV7A 2R8EA 4DPMA 1FFSA 1I6LA 2YXLA 3AKDA 3MTQA 3C41J 3DW3X 2OV2A 4AZTA 4D8YA 5K09A 3AVUA 2P40A 2XF2A 1LFDB 2FDXA 3QYFA 3PIRA 3UMRA 1EUDA 3SIWA 5KQMA 3THOA 1OV4A 3LX6A 1XRQA 2J45A 2PAFA 2MR5A 4FQ7A 1L4EA 2C9CA 1ZGCA 2B3DA 1I7PA 2YOHA 1KO4A 5C4IA 2O14A 3MS2A 4ZYVA 3CH6A 2GZ2A 2OHIA 1LSUA 7MHTA 1LLCA 1E98A 1V3VA 2NO0A 2ZJ6A 1XDZA 5B30A 3S55A 3QITA 3HCBA 2ZS9A 1SU8A 4N0DA 3DMDA 1WUHS 1JEAA 2D7JA 2Q1YA 1PQYA 2VQ3A 1YZYA 3G0BA 4RAQA 4KXXA 5F23A 1XDGA 3U5ZB 1U1CA 2JLCA 2OD9A 3K70C 5HW0A 5CBKA 1IPEA 2DFLA 4LC9A 4BMYA 3SSMA 1PS0A 2Q7XA 3PE4A 5HRAA 1GPH1 1SO8A 2NTJA 3FSRA 1ORTA 3R7DA 4D9JA 5ECWA 1FRFS 1QO0A 2XMBA 3TZQA 2Q5IA 3BICA 3VR4A 4KLZA 1QP8A 2M1ZA 4XZ3A 5D3ZA 1PG0A 2REXB 4LHVA 4MRPA 5HQTA 3Q7EA 3UWMA 2WZQA 5TS2A 4QC2A 4KXNA 4OJMX 3C1UA 5GWXA 3RUCA 1T0UA 4AO7A 4D0RA 2Y1XA 3ABIA 3FYHA 4WN9B 3CISA 2LPMA 5ILGA 2YZKA 3ZJ5A 1M5UA 3OLYA 4EAAA 2OBBA 3PGA1 1CDZA 3OQBA 3K9NA 2MYPA 3I0ZA 4KTTE 2O8EA 2RKWA 3AIIA 3BDVA 1CS4C 3OQHA 4NE7A 1G7RA 5KU7A 2ARKA 4E11A 1EE2A 1DJQA 2PPLA 2YCBA 4R1LA 3ZVLA 2DY0A 3ML1A 4GLBA 2JAHA 4JLDA 4XDGA 1KYIA 2OOSA 2QZJA 2EL9A 2H57A 2O7VA 3HBAA 3JTEA 1RIIA 2SCUB 2VJNA 3H6HA 4GX5A 4KH0A 1F2VA 3KT6A 2JHPA 2IOHA 4PINA 3ZDFA 2BGWA 2PS1A 2TRSB 2CN1A 1GG2A 2G0NA 4RABA 4HJRA 4MDEA 1WP9A 2WLTA 1E9EA 4B80A 1Z6GA 1KAEA 5C7IO 1NU8A 3OU2A 3IQHX 1VKZA 1WPQA 3I72A 3EFBA 4YROA 4KV9A 4F9EA 5CA1F 1ZI6A 3VO1A 4UEKA 3TL2A 4EB6A 1ABBA 4UXHA 4BEVA 2G5TA 1CDEA 4L76A 1WW2A 4OJQA 3WWOA 4DUYB 2LD4A 3HA7A 4UMVA 1KY4A 4C21A 1CSEE 2VZEA 4KOEC 1G2PA 2EJUA 4BFXA 1NXQA 2A5GA 5ARBA 3AG5A 4O29A 4F04A 4JBIA 4ZQIA 4C4PA 4DY6A 1ES9A 2JGMA 1CG6A 3RSSA 2NM0A 3WJ1A 5ADHA 5KYGA 1QH9A 3QXCA 5JROA 1CT9A 5LOVB 4YONB 3ZTWA 4BLTA 5K0SA 4TTAA 3NEAA 2CHGA 2E5WA 2HQ1A 3LBAA 2YRXA 4CNBA 4W6QA 3WLOA 1EQAA 4L5YA 5JQGA 1HK7A 3TBHA 1GCOA 2H9AA 4FOLA 4K8RB 4E5SA 4F84A 1U7WA 3PFBA 1MJHA 2P6MA 1K63A 5KCMA 1VHWA 1GZ3A 1D3AA 1KEZA 3NIDB 4LYAA 4YB8A 1N8TA 3OX3A 3SQOA 2YRFA 3DEIA 3GC6A 3OZEA 3AGQA 1E32A 3HB5X 4YFVA 2ZEJA 4Z4GA 3VPHA 1ZOIA 2JBAB 4WBXC 2GCNA 5T4FA 3VYWA 3NFRA 2F4NA 3K2QA 3V1YA 5I51A 2AQ8A 1QHHB 1THMA 1B16A 1AKEA 4JQSA 2HX1A 1YBMA 1HWYA 2FSPA 4F93B 2OORC 5KSZA 4M9UA 4EARA 2HMVA 3BTOA 1BZYA 3GRVA 2YZGA 2B78A 4MV4A 4QUKA 4AJ4A 4JROA 2W6NA 4Z51A 2IGBA 5C1PA 5DZSA 3AHEA 3X1ZA 1YCGA 5EWMA 1W5AA 1P7VA 1PGOA 2RCNA 1ACMA 2FW6A 4P7FA 3BG5A 3VMFA 4BLQA 4EPWA 3LTEA 3V1LA 1G8JA 4EVQA 3IEIA 2UZ1B 4NARA 5ITSA 1MQ9A 2W8BA 3NFYA 3W6UA 5INTA 1JMKC 1KYTA 2ZDHA 5DIFA 5AHOA 5J5CA 5AIBA 1TJPB 2AFIA 2PO7A 1LDMA 4L9RA 3W0LB 3JWGA 2QV7A 4G9BA 5IUJC 1RWKA 4FCCA 4EUNA 5BYKA 3JVEA 2DJ5A 3LWZA 4QJ4A 1U6KA 1GLVA 3AUSA 4UHDA 1EFRD 2XOEA 1YQUA 4Z3OA 3BX1A 3F3MA 2PRIA 2CLDX 5LJIA 2JHFA 2XTJA 2H1IA 4NAVA 4L16A 2O7QA