1JF8A

X-ray structure of reduced c10s, c15a arsenate reductase from pi258
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
130
structure length
130
Chain Sequence
DKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
publication title Arsenate reductase from S. aureus plasmid pI258 is a phosphatase drafted for redox duty.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 49
structure length 130
sequence length 130
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jf8A00
3OQMA 5TPZA 3D8UA 2QXYA 4ZYLA 2MYNA 2HQRA 2M1ZA 3H5LA 5FBKA 3P9YA 3DLBA 1PNTA 1W9HA 3C6QA 4G0XA 4MQFA 1LBIA 3M6MD 3JS5A 5C5EA 3LUHA 2IOYA 3SM9A 3QEKA 1EWTA 5KWSA 4LE2A 3OLZA 3W9SA 4F11A 2L18A 1CYEA 3GBPA 4RK5A 3H5IA 8ABPA 1ABFA 2PUGA 2LUOA 3HVRA 2HSGA 4RK7A 3N53A 4H3HB 2M98A 2R48A 4M88A 3N0WA 3HCWA 1A0OA 4G0QA 5KQPA 2MSLA 1FFWA 1XWWA 3A0UA 3OMWA 1F4VA 4QYMA 4KQ9A 1OXBB 5F64A 3RVNA 1M5UA 4IILA 1TM2A 1M5TA 1AB6A 1GUBA 3CKMA 4MR7B 4LRQA 4IGAA 1ZESA 1HEYA 2P4UA 2FN8A 3LUJA 3QEMB 2PUCA 4FE7A 1T34A 3EAFA 4HNQA 4YRZA 4LDAA 3HUTA 4F06A 4Z4IA 2QVGA 4EYQA 4MYRA 4RV5A 6ABPA 3SG0A 3LUDA 4P98A 1QO0D 5GQSA 5PNTA 2PMCA 5FWYB 1JWLA 3GL9A 1C4WA 4NQRA 2L19A 2CHFA 2GX6A 3CRNA 5BRJA 3Q7SA 6CHYA 3QELA 5CNKA 2FVYA 4L4UA 2GKGA 1WETA 1TMYA 1FFSA 1JYFA 1U2PA 4G0YA 4WZZA 3HXMA 2WJAA 4WXMA 2MYPA 4YV7A 2A9PA 2JBAB 4MLDA 5CNIA 4XAQA 4OBBA 4MS1A 4UHJA 2JVKA 3B2NA 3H1EA 3LUCA 4RXMA 1JDNA 2FQYA 1Z16A 4ZMSA 2X7XA 3QLUC 4MLCA 4RK1A 1Z13A 4WT7A 1ZGZA 4YGXB 1JBEA 3URMA 5IUJC 1USKA 2F8TA 4QICA 4ZPJA 7ABPA 2IPNA 5TQ2B 2V0NA 3RVPA 3MMNA 3KHTA 2PKXA 3CFYA 1BAPA 3E61A 3O75A 1JLKA 2VYCA 4G97A 1DCKA 3QX9A 3G1WA 2FQXA 1JFVA 1ISSA 1GCAA 4Z4EA 3IPCA 4Y9TA 4PE5B 3EQZA 1NXWA 4Z0NA 1AB5A 2KYRA 1D1QA 2IPAB 4LE1A 3HDVA 3MA0A 1E2BA 1NXVA 1RXIA 1ZITA 3C3WA 4Z99A 4G0PA 1QQBA 1ZAYA 2LBPA 3I45A 3KS9A 2WMYA 1YK1A 3LUGA 1K68A 4JB2A 5HQJA 4EYOA 4RZSA 4RK4A 3O2JA 3L49A 4MS3B 5TPWA 3TB6A 1NY5A 3KLOA 4Z4FA 1A04A 3ILYA 3SNKA 2WB4A 4PEVA 5D2CA 1YK0A 1JYEA 5TQ0A 4XASA 1P8AA 1DZ3A 2ID9A 1RZRA 2YHAA 4RDCA 3BREA 3JVDA 3KYIB 4MPTA 1L5YA 2CWDA 2LIVA 3UK0A 3QLVC 2HQOA 4P1ZA 4OLAA 3VNBA 3T95A 4PYRA 5TQJA 5E3JA 1DBWA 3KTOA 3OM0A 5JNTA 1APBA 1C0EA 3JPWA 3T6KA 4EGSA 2QR3A 3RVSA 4DN6A 4KMRA 4F8JA 3HSYA 3N75A 5GOTA 1FFGA 4MRMB 5FBHA 1GCGA 5TPZD 1EWKA 3A3KA 3OLYA 3NNSA 4EYGA 3O2SB 4O5AA 1VRVA 4RS3A 1USGA 4MR8B 2GWRA 4EVRA 2DRIA 3H6HA 5TE9A 4S05A 4RY9A 1RNLA 4RSMA 2NT4A 4EUKA 3C3KA 3FFWA 3QELB 4ZJPA 4MR9A 1DRKA 4LE0A 1Z26A 1BDJA 2FKAA 3QLTA 2FSPA 3I42A 1ZN2A 3N6VA 1BDIA 1M2EA 3DZDA 1S8NA 4HYEA 5IUKC 4UHKA 1MVOA 3OQNA 1RXEA 2PUFA 1FSPA 4RK6A 3FGZA 1QNLA 5EWJB 4MS1B 1DC8A 3BILA 1P6UA 1RPJA 5T7BA 2QV0A 2E4ZA 4Z9BA 5FWXA 3F6PA 3MQ4A 3HDGA 2I6FA 2Q5CA 3IDOA 3RQIA 1YS7A 4TLMB 3TD9A 1M2FA 3L6UA 4NV3A 4N76A 2PJUA 3CU5A 1DC7A 4KQCA 4OATA 3EODA 5IC5A 4RU1A 1ZHHA 2JB9A 2WRZA 2E4WA 3Q41A 2QSJA 4OLBA 4EVSA 4WUTA 1I3CA 1QP7A 4N0PA 4KPYA 1J56A 4JP1A 2FMIA 3T8YA 5ABPA 4LDZA 2H0AA 2QU7A 4ML3A 3T38A 2W42A 3FFTA 5KI6A 5B3JA 5KQMA 1NXSA 3IP9A 3DGFC 5DKFA 4ETMA 4EYKA 3GYBA 5JNVA 3O1JC 2F8SA 4JOQA 4Z4GA 4E7PA 3KCNA 3QX8A 1LBHA 1CEYA 3I09A 3JPYA 3DGEC 4CBVA 3BRSA 1QO0A 3F6CA 3MF4A 4LZLA 2A9OA 1PEAA 3CZ5A 1JDPA 2B1JA 3SAJA 2A9QA 2NZUG 3ILHA 1DP4A 1NXPA 3NBMA 3KJXA 3NNNA 3O21A 4MAAA 1A2OA 3O74A 1IIBA 3S99A 2FXIA 3Q7RA 5IEBA 4MS4A 3F7NA 5DTEA 5IEJA 3IPAA 2OENG 1YMUA 1ZDMA 1SRRA 3LUKA 5IBQA 3TO5A 1QQAA 4F3TA 2PUAA 2H3HA 1DBPA 5C5CA 2XDYA 4XLTA 3EULA 1UDRA 4G0OA 5BQ3A 4GPAA 2R4QA 3N0RA 3BRQA 3K9CA 1EWVA 4IMJB 3LOPA 2PUBA 1JFSA 3HO1A 4XARA 3CS3A 1D4ZA 4Q6BA 3QK7A 3M9WA 2HPHA 3MYYA 2PUDA 4YR7A 1JX6A 4IMIB 1PNRA 4KZKA 3R0JA 1GUDA 1U2QA 4HNRA 1QP4A 1DRJA 3ROTA 2MYUA 3IP7A 4OG2A 4MQFB 5HM6A 1U04A 3GRCA 5IULC 5HKOA 4MGEA 5DCLA 4NCAA 1Z25A 3VNAA 1XHEA 4L85A 3OQOA 3EDCA 1Z12A 1NXXA 2LP4Y 2JRLA 2ZWMA 3OLXA 2JBAA 1RZRD 1ZH2A 4ETIA 2YHBA 5KC8A 4W5RA 4WXEA 1Z17A 5JNWA 4NICA 1D5WA 4DADA 2FEPA 4RXUA 3A10A 3Q9SA 1YTUA 2CHEA 2ZAYA 4O1HA 1E6KA 3CLKA 3CNBA 4ZMRA 1NXTA 3HEBA 2NUBA 1F51E 2VUHB 4RWEA 1ZVVA 3TX6A 5IX8A 3HJFA 3GA5A 4YS6A 5FWXB 3EJWA 3TMYA 2GI4A 2WJWA 2PAFA 4W5NA 1BVHA 1R8JA 5JS2A 4DQDA 4RY8A 2CD7A 1KGSA 1SXGA 2FMKA 1ISRA 3CZCA 2OQRA 2P9HA 1ZY2A 5BRAA 1YIOA 4PICA 2J48A 2NT3A 4Z4HA 1U8TA 2FQWA 4KFCA 4TLLB 4IRXA 2RGYA 3RVKA 1ABEA 5I4CA 1L5ZA 4MQEA 3HUUA 4LX8A 4Q6WA 5ED4A 4RK0A 4YCSA 3Q15C 1DG9A 5KQLA 4N41A 3OMXA 3H5TA 1DCMA 2RJOA 1TJYA 3JY6A 3OM1A 4YLEA 3UUGA 2HQBA 1NXOA 5T3YA 4G86A 5EWLA 4MS3A 3NNDA 3RVLA 1QMPA 3G85A 1W25A 3GBVA 3H5VA 3LKVA 4E7OA 1JF8A 4PZ0A 2RJNA 3DBIA 2IYNA 5EWMA 1TLFA 1PHRA 3HS3A 1JH9A 1XHFA 1PUXA 2PE5A 4KREA 3SQNA 1MAVA 1NTRA 3CG4A 1LJUA 4YWHA 1QP0A 4MS4B 4QPJC 2JK1A 3MM4A 4RY0A 4NCBA 2FMFA 1JL3A 3O1IC 3F73A 4W5QA 1FQWA 2E4XA 3K4HA 2L17A 2PLNA 3KSMA 3GWGA 5JS1A 3O1HB 1OXKB 4GNRA 1MB0A 2PL1A 4MRMA 5CNJA 2WY2D 3RVQA 1SXHA 4Z4CA 3DLHA 2FEKA 3BBLA 3QLUA 4KVFA 5DGCA 1DBQA 4FB4A 2JCGA 3H1FA 4MR8A 3H6GA 2AYZA 1Z18A 2PUEA 3N8IA 3N0XA 4D74A 3UKJA 3HM9A 3NHZA 1EHCA 1Z2EA 1K66A 2VUIB 4EVQA 2FLWA 4G0MA 3D02A 4O1IA 3A0RB 2MYTA 3RVOA 1USIA 3LUFA 4XFKA 1Z2DA 2WWVD 4Q7EA 5TPWB 2E4VA 1VLZA 2ID7A 4KRFA 1Y1LA 2AYXA 2R47A 1MIHA 3LKBA 2HJ9A 3JTEA 3HZHA 1SD5A 1YS6A 4Z9AA 1DJMA 3CHYA 3JVIA 1LJLA 1VKRA 2A9RA 5TQ0B 2MSKA 3OLWA 1BA2A 1BDHA 3O2QB 1LK0A 5EWJA 5HSGA 2FTKE 3IP6A 5B3JC 4JASB 4MR7A 3EGCA 1D2AA 3KKEA 3I5AA 4HNSA 5JNRA 2FEWB 2GBPA 1E6LA 2PL9A 3H1GA 3QEMA 2LPMA 3C3MA 1JFTA 4KK3A 3RVMA 1B00A 3Q7TA 5CNMA 4D6YA 3GT7A 4TMYA 3HK2A 4F12A 3KYJB 3M9XA 9ABPA 4G0ZA 4ETNA 1DCFA 4WWHA 4YP9A 3FMVA 4EY3A 1KMIY 5FWYA 2RDMA 3OO0A 4JAVC 1E6MA 3LTEA 2NZVG 3C97A 3H75A 1ZGGA 2QVCA 3OO1A 5JNUA 5JNSA 4S04A 3CG0A 1EAYA 2FLKA 3IP5A 4QYWA 3HV2A 2FMHA 2BGGA 3KG2A 2B4AA 3ROFA 2E4YA 5KQGA 1MB3A 4N0QA 3RVRA 5KC9A 1CHNA 3QLVA 3CTPA 4MQEB 1GLGA 4MR9B 4FE4A 4H60A 2JVJA 5BR1A 2IDMA 3RVJA 4B09A 3NHMA 3GV0A 1JHZA 2IPMA 3FFXA 3H5OA 3MIZA 4RKRA 3EQ2A 4N47A 4RXTA 1ZH4A 3KLNA 3LFTA 2MSWA 2R25B 4RKQA 2TMYA 2QW1A 3LMKA 2JVIA 5EWLB 1U0SY 1H9CA 1TVMA 4YO7A 3H5WA 4H3KB 2E4UA 4JB0A 1URPA 4KV7A 2N9UA 5IUNC 2L2QA 1D1PA 3OLVA 5EWMB 4KK4A 4XXHA 1EFAA 4KNYA 5TQ2A 1PEYA 1VPWA 2VK2A 1KRXA 1P6QA 1YVUA 4IF4A 2FW0A 1Z15A 3FDFA 2O20A 2IKSA 1YMVA 4N03A 1QPZA 1KRWA 4W5OA 2QZJA 2IPLA 5DLEA 1P2FA 1SXIA 3E3MA 3SY8A 4D6XA 4OTZA 2FN9A 5CHYA 4JA2A 1NATA 3LUAA 4TN5A 3RH0A 4W5TA 1QKKA
chains in the Genus database with same CATH superfamily
4RQUA 5FLEX 2M2IA 5JS7A 5HJ7A 3N74A 3PCXA 1V5FA 2PFKA 2QXYA 3HCCA 4Y2HA 4BNDA 4ZYLA 5K99A 3WICA 3P9YA 3CLTC 2B82A 3NGLA 1GKIA 2HA6A 4NP6A 4R0VA 1DV1A 1E1MA 4UD6A 3N2NA 4WADA 1P91A 4MQFA 2CXTA 4NLLA 5ECYA 2FZ5A 5M2QA 3AL2A 3OMLA 5G1NA 2VK4A 4MOWA 4N65A 1AA9A 3UHAA 5FUMA 1FLDA 1UJ5A 1ORVA 3K0BA 4IGFA 3ZXSA 1R66A 1NX6A 3PHJA 1FMTA 4P93A 1CERA 1YZYA 3UUEA 2IIVA 1XEFA 1L8XA 5KTYA 1MO6A 2HL6A 3L77A 4BQFA 2Q62A 2W8BA 3CF4A 3NHAA 4G0QA 1CS4C 4BGEA 3F5DA 3PC2A 3A0UA 3KJFA 4DVGA 4J0KA 1N6IA 1V3VA 1LI7A 1T2AA 4X1YB 3QLJA 3ZXIA 4G65A 1P4AA 2XGJA 3ZWCA 4MRSA 2W8ZA 1WMAA 3GH3A 3OIGA 4IDAA 4MW5A 4U8GA 5D85A 5JSZA 3CX6A 3D3KA 4Q9HA 1H0KA 1VHDA 2G9VA 2XBMA 1Q7TA 2Q0SA 1TA4A 1Y37A 1LLUA 3BL8A 2SNIE 3D7RA 4RIHA 5EQJB 3U2QA 4D56A 2PUCA 3OQIB 4FE7A 2YY5A 3GPIA 4Q48A 2FW6A 3JD3A 2W22A 4IIFA 3S68A 3HVUA 2G8LA 3L5OA 2GDZA 1WUIS 1Z75A 2HI0A 2J30A 3FPLA 1XQVA 4IXDA 1A9TA 1CUJA 5I7RA 1JA1A 4X54A 2CHFA 2FW1A 5JZVA 2VK8A 1T9ZA 1E9VA 2I4LA 1U99A 4EAQA 5L53A 2OY0A 2X1VA 1M2JA 3IGFA 3K1AB 4QLBA 2ZYHA 5AHKA 1F6BA 3MTBA 5E1BA 2O7VA 3SMQA 4D3XA 3CVYA 1T8YA 1B1CA 1I0LA 1PZFA 3FUWA 3L8MA 4JX8A 2CNLA 4C14A 5FPKA 4J16A 1ZJZA 3TQCA 1C7QA 3UAVA 1E9AA 3CZQA 4BU1A 5GZ1A 1W46A 2FMTA 4QPPA 2X7XA 5EXDA 1CUGA 1PZGA 2IEDA 1NUSA 3OLQA 2F1JA 2W9XA 4OB8A 4D4IA 4E4YA 3NH9A 1H4SA 2GYUA 3GZTB 3N39C 3EIWA 5B4VA 4O8ZA 3VC2A 1FJHA 1G8GA 1MLDA 2QTVA 1IAVA 2ZBRA 5A05A 4DDMA 3U80A 1QPBA 2PZMA 1NI4B 4ZOEA 2VWQA 3I4CA 4M4SA 5LMZA 1C4XA 4L51A 2DUUA 1TQ8A 2C97A 5DM4A 4UTRA 1AQNA 1XVVA 1M66A 2XZTA 3T1VA 4PVCA 4YBRA 2JI8A 2OCXA 2W2XA 3CFYA 1JLKA 3D9QX 3O75A 3UB3A 3TINA 3N05A 4TWIA 2IC5A 4YFYA 3Q3VA 1X1TA 1JR3E 1M1YB 1DAIA 1GCAA 1LUAA 3DMGA 3NHRA 3MYRA 4B3IA 1YZFA 2BI8A 3HMKA 3ASZA 1Y7IA 1KMNA 2KYRA 2SECE 1J7KA 4MKFA 3LUBA 3ZS9A 2FGKA 5CDYA 6YASA 2BR5A 2ZREA 4HEA1 4QDXA 2RHHA 1Q77A 4WK2B 3SGLA 4BNGA 3DP9A 1KORA 5DM2A 3EVEA 5HFNA 1I94B 2AFHB 2FPUA 4M0MA 3ZDAA 2FG7C 1VL0A 7YASA 3I9V6 1T91A 5HF8A 4YJFA 2F8MA 3DMFA 1ZM7A 5GVRA 2P6MA 4B5KA 1K8YB 3TPZA 3O9VA 3N2KB 5LJIA 3L1HA 2WTBA 1IWBB 1MTOA 4AMZA 5TGZA 4YLYA 3G8YA 4PHGA 3DWFA 4BV8A 4DLBA 1UMBA 4U00A 3AGPA 5SZJA 3K0CA 5HZKA 1NR1A 4ZVQA 4HWPA 3PNYA 1U1FA 2FPXA 4J3NA 5C7LO 7AT1A 2CVHA 3P9IA 3VYRB 5JSQA 2FPMA 4B8ZA 1SUBA 2HQOA 1U65A 4WDRA 3ZWDA 3N8GA 421PA 4MV6A 4GDFA 4PFSA 5TQJA 3KTOA 1O94A 2AEFA 1NTOA 3LHIA 3RVSA 1YB7A 5AH0A 1Z0DA 1Q1ZA 3OEHD 7MDHA 1J0EA 3K5WA 4MKXA 2QVYX 2RSLA 2QAGA 2CNKA 5F2KA 4F6RB 3UPDA 3NTQA 2EYQA 1YV9A 1POWA 1ZGAA 3DZJA 3O2SB 4Q05A 4Q3KA 2RBGA 4H4DA 1P44A 1K5PA 1QHNA 3FLEA 1UWLA 1W76A 1WKCA 2GCIA 1AGYA 2A0KA 1UL1X 2GZSA 3FZNA 4IV8A 4M8IA 4M0PA 3VR4H 1ZMRA 2XB4A 5K2OA 3PPXA 2GCNA 3AESB 2CGEA 3H2KA 3C3KA 1NPYA 2W6QA 3OOSA 4OL0A 4OIMA 5I7VA 2AN4A 5D1HA 3UG6A 2H8KA 2YASA 3FDIA 4IG9A 2HTFA 1YU9A 3MB5A 2DPHA 3VX3A 1U7DA 2HK8A 1YVDA 2OFWA 3W9BA 5IMSA 4BQPA 1P77A 2QAJA 3GGCA 3U0BA 4DNQA 5IF9A 5KYYA 4YPFA 2C2MA 2YHIB 4FS3A 3V00A 3ND9A 1AXRA 2ZI6A 4CU5A 2LIPA 1KAHA 4EDFA 1JIVA 4JYPA 3OOYA 2XNJA 2FR0A 3DD5A 2C5EA 1F2UB 3CH5A 2RGWA 2REOA 4GLBA 1YRQA 3WL5A 1D2CA 3P0IA 2FP4B 2E3JA 1O95A 3MT8A 3NHBA 2X1HA 4JI5B 3N70A 3EODA 5K7SA 1RSZA 1W85A 4FFOA 2GLXA 2JB9A 3UGJA 4IIJF 2OBNA 4JLDA 4BMNA 1PK7A 1C8KA 1PR6A 3E7FA 1DELA 4GF5A 4Q15A 4NULA 4BMCA 1LSSA 4JP1A 2FMIA 4Q93A 1Z88A 3GXOA 2ON6A 5SZKB 2WJ6A 1FSGA 1KK1A 1MXFA 4ZHQA 3IOEA 2ZROA 4WZBA 2BCJQ 3C87A 4CT4B 3ZH2A 4FFBB 5KOJA 1VZ2A 3R0IA 3LQ2A 3CXUA 2DWCA 3V4FA 3D0QA 3AB8A 4BB0A 2IF2A 2WWHA 1NKVA 3OTIA 5KYUA 3W78A 2G3YA 4LX0A 2JATA 3QX8A 5KSPA 4K87A 1FMJA 3MCZA 1SZCA 2VDPB 3R6DA 1FLNA 2P9JA 3CRZA 4FGUA 4NQZA 3ZWKA 4DDUA 2FDCA 1DJQA 3WNBA 1OLXB 4HN9A 1RJFA 1LVUA 4JJ4A 4BN4A 3BH0A 5CX4A 2QLBA 2HQSA 2EV9A 5LYYA 2J3MA 4OU5A 4WCFB 1NHGA 4YP7A 5L3SB 1LVGA 5FWNA 4AS2A 4MV9A 5CHEA 1WCV1 2H1WA 2ZT8A 4F9FA 4R4JA 5BSEA 3DR5A 1WMSA 1KO7A 2NXCA 3E1KA 2ZIAA 4JIMA 3TQFA 5KYTA 4JXXA 1ULZA 9GPBA 3RJ9A 4XCXA 1E5LA 4C4XA 5A6VA 1TIBA 5C5CA 2UYQA 3DEZA 1UDRA 1XRQA 1IOZA 4HFRA 4GPAA 1RJ9B 3JD0A 1P1KA 3E4CA 2GR9A 2BDUA 3HRKA 3I2HA 4S1TA 1MZPA 1QQTA 5BSHA 4M1YA 2PR7A 1JFSA 4CXMA 3E48A 4KGZA 3C85A 1N1DA 3AP2A 1XX6A 2FR1A 3FVVA 1XAIA 2YJ4A 4XGRA 2GO1A 3O4GA 2JI6A 3PNQA 3EASA 2NPOA 1GVNB 3MJ4A 3GEIA 1EU1A 4HLQB 4CLXA 4Z7JA 3DOJA 2P75A 3KAPA 1TCVA 1QP4A 1JXMA 3U7GA 1W88B 3AIKA 3INTA 2MYUA 3WGNA 3TKYA 1CUYA 4NH4A 2C1XA 3E7WA 1YR3A 2VT3A 5CYFA 4ZGBA 3DULA 5BN1A 3VNAA 3KDPA 4QBTA 4MW2A 1T3TA 3RRZA 5ELMA 1E92A 2CNWA 4QBIA 5LVAA 4MPPA 1HFJA 1T4MA 1K97A 3LVFO 3TTSA 3ET5A 3G0HA 4YDHB 4KFRA 1I2MA 5LBUA 4NICA 3B1KA 3H05A 4YCAA 1BOOA 2WSMA 3BX1A 1L1QA 5NLLA 1YVPA 2FEPA 2IS1A 1VE7A 3CV3A 1YQGA 1O94D 5KREA 2JD0A 2CHEA 2EX4A 2SICE 5CYOA 3RIHA 4X20B 4ZMRA 4ZZ1A 4YRLA 4EUHA 3JQFC 5AUOB 4YDQA 3E8XA 4CEHA 1OF1A 3BL6A 1FNDA 1HLDA 1U0TA 1E2HA 2FW8A 3PWZA 3VU1A 5D3ZA 2GI4A 4C29A 1BVHA 2J4FA 4QQKA 1SIUA 4GR4A 1VJCA 4UNIA 4R1LA 4B35A 1KO5A 2WVJA 4YNBA 3FB1A 3AUYA 1ZY2A 2PUHA 1CJVC 4FYYA 2NZ2A 4JK3A 4KDRA 2QDXA 4PX9A 4UFNA 5FTJA 2CXUA 1KYWA 4AP6A 2PZAA 4EH1A 1AKQA 4PNHA 2FQWA 1CRPA 1T4CA 1DJLA 5GTDA 4K3VA 5FLXA 1SZPA 4G8BA 1QG0A 2YMPA 3L1KA 2Q4OA 2ONJA 3ABZA 4TOIA 1KQNA 1HQYE 1U81A 1K4KA 3VOTA 3PQEA 1Z4JA 2VKTA 4L73A 2DHRA 2H1CA 1TC1A 2ZJFA 3NKFA 4HAXA 2PLAA 5AKGA 5CB4F 1WCIB 5B6IA 3QHAA 4K28A 3LBHA 3JQAA 3AZOA 4IGKA 4O33A 4FCWA 1U0EA 3MG9A 1GPDG 1DBSA 3B1FA 5E7MA 1TF5A 2PBFA 2WNHA 4FSDA 1GSIA 4LOLA 2DT5A 1E7YA 3V80A 3LKVA 4F4IA 5KJ1A 4LCJA 1UBUS 2YN0A 4EHJA 5JAHA 3QOYA 4IQFA 3D1VA 2DBZA 3ANXA 3IPXA 4RL6A 3FJOA 2CVPA 1JDVA 1VMKA 1O95D 4FOLA 1L1EA 1UPAA 3DZCA 2QS9A 4DDVA 3HY4A 3SNHA 3NUQA 1NTRA 1ACMA 1VBMA 1NMEA 3EXEA 3JYHA 4QTTB 4BJ6A 1MB4A 3DHWC 4D46A 4MNTA 3R2JA 4MRVA 5JYDA 4ZD6A 2Q4EA 2IXDA 1TQ4A 2XMCA 4MLPA 1NN3A 2G8NA 2AOXA 1J8YF 2AOTB 3D5EA 3GWGA 3OWOA 4JR1A 3U1TA 3R76A 3TW6A 3WJAA 2B69A 3PTLA 4ZC1A 5HZMA 2F17A 1NOIA 4KXWA 3ZY4A 1MC1A 4K9LA 1RCTE 4QXMA 1JSRA 4Y0NA 2EJBA 3ZY6A 3C1UA 3A32A 4HN2A 1R0LA 2J41A 1SK9A 4JUCA 2X8JA 4GBED 4BWYA 3NV9A 2XMZA 4WJLA 4ALMA 3GROA 4EVQA 5CLHA 5DYGA 1PCXA 3N0VA 5KTOA 5IWAB 2ZPAA 4D7AA 2P2SA 2HFJA 1D1TA 3FMGA 3WB0A 4AY4A 3I2IA 4MPRA 3G13A 1MIHA 2GMWA 2GSDA 1GRNA 3GQBA 2HGZA 5BVHA 3LBNA 2NX2A 4KIWA 4AZ0A 1DVRA 1DPFA 1GCUA 3IO3A 1ORDA 5JZ9A 2GESA 2L42A 5BN5B 2RHDA 3RS9A 3QE2A 4DYHA 3UB4A 1ZUNA 3V97A 2VDOB 1IZ8A 5BPHA 2B99A 4W7HA 3JAWB 4G1BA 4OJMX 2BFFB 5AHOA 3U40A 4YAKA 4HNSA 3SS9X 2UKDA 4G5GA 5F5LA 2ERXA 3QUQA 4KH0A 3SK0A 2O8VA 3C3MA 2B1RA 5DI3B 4DB2A 3HYNA 3VTKA 4F12A 3NBXX 4NHOA 5CM9C 1YZ3A 4X7RA 4LXTA 3SWWA 4TMTA 3TYXA 4J6FA 5JTTA 3LK6A 2RDMA 4IY1A 2VK1A 1RKQA 5JCOA 2IPOA 4UHFA 3U7HB 4U2EA 2AJTA 2WSIA 3K2QA 3NM4A 3OD5A 3ZDRA 4FMCF 4R7TA 1EAYA 1Y48E 1XHLA 2FLKA 1FX0B 1WXXA 2WKPA 3WNCA 1B73A 2EZ4A 2O14A 3I64A 2CNWD 2IOFA 1OOEA 3GLIE 4RHFA 5I4KA 5BR1A 3EGIA 4N8EA 2PUWA 3TNDA 2NV6A 2DFLA 2NZXA 3HSKA 4KFTA 4MA0A 5CTJA 1G6HA 1FXSA 1B6GA 1LS1A 1XKQA 1XL1A 3B6KA 1EGVB 3G7NA 3G82C 1NUPA 4P3XA 2X9QA 4MUBA 5AK6A 5K2MA 4AO8A 4ARIA 1JWBB 1E77A 2JVIA 1P81A 4HQOA 1LLFA 5E6UA 2KX7A 3UQYS 4XVCA 1GPYA 2C7BA 3QEOA 3WL8A 1E6UA 3QMMA 1R0SA 3VPDA 4YV2A 4M7RA 4U2BA 4CTMA 3QU2A 5IUNC 1RC0A 2QA5A 3WGJA 1T2FA 2ZJ8A 3GLQA 3WGZA 3IC5A 3ONVA 4HDOB 2WAMA 3D2CA 3M83A 1X92A 2PWAA 1YC5A 3TLXA 4TS9A 4UDYX 4XGNA 1OXTA 4DLYA 2A92A 1UODA 3LK7A 4FP9A 4P4UA 3GEDA 4LS3A 3E3MA 3Q87B 4GZ5A 1F8FA 5F7JA 3WWCA 4D6XA 1OFUA 2JLCA 2FWPA 1QE0A 4JA2A 4RA6A 4WXHA 1Z0UA 1K0UA 3L9XA 5ARBA 4AIRA 4BGDA 2OGSA 1KEPA 2RI0A 5CW2A 4FHCA 1CXZA 1PQUA 1V16B 3LC7O 5A04A 1GFIA 2IHJA 1LDNA 1LSJA 3CM0A 3JQAD 3PS9A 5IZCA 3PHLA 2FEOA 1VKOA 3HKBB 2RGNC 5E8RA 3UB2A 3A9VA 5FA5A 1OI4A 3IHWA 4XJSA 3Q8KA 1G3QA 1Q7RA 2P8JA 1EI9A 2WSSA 3X1MA 2XY4A 3SZOA 5F4BA 3JS5A 1JTEA 3FR8A 2W2NA 1BJTA 2ZXFA 5FYQA 1NJ1A 4IHJA 1F2VA 3DT8A 4GUDA 5FL3A 5D6NA 1HDRA 2O59A 1ABFA 2XRMA 2LUOA 2O2GA 2RG7A 4LN1A 4RK7A 4ITRC 2FMXA 2L69A 1T29A 2O2DA 1NKSA 2M98A 3GCXA 4H3HB 4J0QA 3T7SA 4AZ3B 5K0EA 3KWFA 4QUBA 3V8QA 4ZDIA 4UFOA 5THXA 2JLBA 1KMHB 1LV7A 1M7HA 1EB9A 5AM4A 3SIXA 4H6XA 3VDQA 4K9QA 4DAEA 4K6HA 2I2BA 2D5BA 1L7VC 4BBJA 2B2XA 4WXYB 4EDHA 1HETA 2FWRA 3FYSA 2OFPA 5CCBA 1PYDA 2AQIA 3O9ZA 2ATCA 3BXGA 4JQYA 3RARA 4KQIA 4ZEMA 1PWYE 4FMDF 3EEOA 2HWYA 1EESA 1MB9A 1ST2A 3PJDA 1ULTA 1YRWA 4TWRA 4N9QA 1TKRA 5CG2A 3UTCA 2INGX 4JLNA 4PZUA 2R7LA 4ALLA 2Q2QA 3N7TA 3Q3GE 3SHFA 4DEYA 4MMYB 2K7FA 3VH2A 2JAPA 5LA6F 3L4EA 2X8WA 2G6BA 2FOIA 4CM8B 4HH0A 4MV7A 1W5EA 2ZJAA 4YV7A 3PQDA 4HGNA 4P3NA 3QF4A 5AHRA 3VR6A 1Q0UA 5B7PA 2BEJA 2JZNA 3BXHA 3PR2B 2EZTA 2A57A 3F46A 4MS1A 3SC2B 1X1AA 3U7QB 4JI8B 4JFAA 1P9LA 1Q0PA 4B4KA 2ZCUA 4L8VA 1EFUA 2CXXA 2XT6A 3MAAC 4ZVPA 4TQAA 3VHQA 4PZCA 2B8EA 4FJ1A 3DTTA 3LF1A 3MWGA 4KLRA 4AKTA 2GEJA 5E38A 2PZEA 2ACWA 4UOQA 1HO3A 2G04A 1NJ8A 1OTHA 2JLZA 1HKUA 2GZMA 1XYGA 3WBKA 1C0KA 4R83A 3F4BA 4EGJA 1DGQA 2YWJA 4ZPJA 2IK8A 3PUHA 2F9FA 4JLJA 1BH2A 2ZTVA 4L5AA 3SLGA 1OVMA 4WY2A 3GJRA 1HM5A 3ZOKA 3NTRA 4QPZA 5DGXA 3U7RA 1RQ2A 2V7PA 1S8AA 4G0VA 1Y8RB 3OX3A 4HWGA 4LMBA 3I4FA 3JVEA 1KP3A 1FJGB 3O2NA 5J4YA 3CRQA 4KQKA 4MDYA 5JO9A 4UBKA 4EG8A 4IIHA 1N1MA 3WLNA 1XLUA 2AGVA 2DTXA 1QIGA 2XYRA 2YW9A 3C3WA 4IKEA 4RZUA 5ENDA 4BNUA 1WUKS 1PR9A 5BOSB 3SYMA 4OJTA 4QXAA 2FYTA 4R1MA 2AN9A 1U4OA 5DK4A 1VBKA 4DNXA 2VUUA 1ZIPA 3PFNA 1VPLA 4C06A 3AFNA 4NE9A 1XWFA 3BPSA 4G5HA 1EZ1A 4D8WA 2EHDA 4YK7A 1A04A 2XDQA 4FOSA 5DHAA 1VKJA 2POCA 1CY7A 3ZNNA 4IYRA 1HE4A 1QGZA 1H2HA 2O7NA 3ZE7A 4XASA 5K5EA 1II8B 2JA2A 2COEA 2FRXA 2Q5LA 3IMCA 3IUPA 3TAHA 4ZCTA 5ICCA 1BU8A 5BUZA 1GM5A 3FPEA 3QENA 1L5YA 2Z58A 1VIYA 4L6AA 3SPXA 1L4EA 3HP4A 3QXCA 1S7GA 1YCFA 2W8BB 2O3UA 3I5MA 3LOUA 4JUFA 3WLFA 3AJEA 2I6TA 4OLAA 5G0VA 1M34E 1T8TA 1TYCA 2ZVDA 4HB4A 4F2PA 2IU0A 2B30A 3JZIA 2O9JA 2ZBDA 3JPWA 1HT2E 3KVVA 3VH3A 4OHFA 3HABA 4PF1A 4Y6PA 5H7XA 3ZZ1A 4B17A 5B57C 1FMFA 5JSZB 1BNCA 1FBNA 1TW3A 1A2BA 3R5TA 4HLUC 5MDHA 3R0VA 4M0DA 1T2UA 5FXMA 3HUDA 1ECCA 1U8FO 3BXPA 1UIRA 5HMLA 1JA0A 4JL6A 3TLBA 4R51A 3WRXA 4EYGA 1H4VB 2PUVA 1EFPA 1N0WA 1NP6A 2OGZA 3KSUA 2VBCA 1JLMA 3GLGE 4I50F 2MSEB 2WSSD 3Q8WA 5HNKA 4BNFA 4Q7MB 1XRMA 5AVOA 4UNPA 4NC9A 2I4NA 1COZA 5I7WA 3ERCA 4Q3OA 4X91A 1RNLA 2R60A 3G5MA 4YO8A 1YZNA 4YJ2F 3WL6A 4B8YA 1PGJA 3PHCA 4WKBA 3X2EA 3PD0A 4DHWA 3T9AA 4B74A 3IBTA 4MEAA 4U4AA 1XZDA 4O4LA 1ZN2A 2I29A 3RWBA 4EWLA 1JILA 1XZKA 1HE1C 1LXCA 2X4DA 2ZJ4A 1P7ZA 4Z8XA 5FWAA 4EUFA 3MJRA 1S5PA 4BNNA 4EHKA 2ZAMA 5L4SA 2O52A 1UZAA 1DKLA 5FUYA 5DM60 3DAYA 1KAMA 2NTYC 4IDQA 4WA8A 1GT6A 1JHUA 4FS8A 3AHDA 4HYQA 3DB2A 4LQLA 4E5PA 3CF2A 1L2TA 1KDYA 1CKEA 1KVSA 5IJ0B 1WHSA 4RO0A 3KQWA 3QVOA 2X4LA 4LKRA 1KFJB 2CXRA 2QRUA 1YS7A 3TD9A 4HXFB 4KRXA 2XCIA 1G8YA 3KQOA 2IV2X 2DR0A 4EELA 5A1JA 3WTCA 3OJWA 1ZH8A 1OPXA 2C77A 3B5IA 4MSUA 4PLFA 5IC5A 4DJFC 1CLEA 4WKPA 3D4PA 2ZJOA 3CR7A 3SBDA 4E88A 1C3XA 1K6EA 2QZ9A 3LIPA 1J06A 1SCBA 3V32A 1HNXB 4ISBA 5E0KB 4ZDWA 3U1BA 5AVYA 4NFHA 1UR5A 1QC5A 2F43A 2UVQA 2WFLB 1VL5A 1ZJ6A 3IODA 3K0AB 5E6SA 4CM7A 2QU7A 3Q5EA 1O7JA 4OXIA 1YKGA 3ZJYA 5KI6A 3WK5A 3B6IA 2ADMA 4IZIA 2B1GA 4O02B 5DKFA 1N5RA 4ZYVA 4BX2A 1KZ9A 4OUDA 1XVAA 4OBXA 3GNSA 4D5GA 1EUYA 2NP7A 3EBPA 2RGBA 1E59A 4R41A 1YA8A 3RSFA 1KDZA 5JLAA 3DEFA 3JD4A 4PG5A 3T7JA 4UDXX 3K92A 5E9WA 3ZEAA 5A3VA 3ZZUA 3F6CA 4CQLB 1XMQB 2X4IA 1H2BA 3AOGA 4BIIA 1L9XA 1QK4A 3BSYA 4K26A 4OQMA 3RJTA 1E9FA 5KIAA 3M89A 1AA6A 3A11A 3IBFA 2O2YA 1WZCA 2A0FA 9MHTA 1OBHA 2CXPA 1JG4A 2IYEA 3O74A 1FF9A 2RHOA 1KYIA 2C2OA 3EIEA 4FEYA 3ITNA 4G8CA 5DVZA 1CLUA 1YQTA 5EZ6B 4I8IA 4LF7B 4BLQA 3NFRA 1AMNA 4LOHA 4PC2A 4ID9A 4PCLA 3LUKA 3ADKA 4I3HA 1BVUA 2VZ9A 1JHMA 3NX4A 2PRZA 5F51A 1CF9A 4D0LB 4LI0A 4CL3A 1KJNA 1C4OA 1C3JA 3RDPA 1TJ5A 4CIVA 1XJQA 2WU3A 1EUQA 4RL4A 2CLKB 5A62A 1X87A 2C2ZA 3AVVA 3EVTA 2C04A 2Z3WA 2ZJ7A 4UC0A 2WVAA 3K09A 3X44A 3ZWPA 2ESRA 5C8YF 1L3IA 4LHWA 1D4ZA 2WOJA 3G7UA 1RRKA 2DKOA 3P26A 3QK7A 1LI4A 2GM3A 3GWZA 4FT4A 4KUGA 5E2IA 4NKRA 3S2ZA 3ZCVA 1PNRA 4F5ZA 4WBNB 4BNYA 2UV8A 3C5WP 1RHKA 5JXGA 1CZRA 5DBFA 1A2QA 5KJ6A 2PX5A 3GRFA 3IP7A 5DM1A 2YFKA 5F78A 1N5LA 1FMLA 2DOKA 1Y82A 4BRUA 4XWWA 4MW9A 5LQSA 4TVKA 3W5UA 4AS3A 3E70C 3LNCA 4IZOA 4R8VA 3WWEA 1KO1A 5AKXA 3AUFA 1JG7A 1XJWA 4A2PA 1W1WA 4ETIA 4W5RA 1UBEA 3KQMA 3RAFC 2PWYA 1F3OA 2ZG6A 1WW2A 2JEYA 3NYIA 2IV7A 3PXEA 3U62A 5IANA 5CFRA 1Z37A 4BWGA 4IOMA 3VHRA 1XOIA 1L3CA 2WOOA 3KHKA 2VF7A 3OZBA 1NMSA 3RHSA 3WDLA 5HGXA 4HEA6 4O1HA 5KYYB 4P3KA 3V55A 1AT1A 3E1SA 4KE9A 5EQFA 1EVQA 3ANSA 4IDEA 3EEQA 1PEKE 4JP3A 2BLNA 1CC1S 3LVBA 3G1TA 3OT1A 3ZNPA 1WXWA 2P62A 1ENZA 4YP1A 2Q07A 3TTVA 5L40A 2ZDHA 1NN0A 2CNNA 4XGIA 2XPCA 1GAQA 5KSOA 4QU0A 5LP6A 4DV6B 2CVFA 2BHNA 2WHEA 4XDHA 1VXRA 1CDEA 1IC6A 3K6KA 4AKEA 4DMHA 1HZZA 2O48X 2J48A 3OU2A 4KFCA 4DXHA 3CSUA 3EWNA 3FOBA 3WLKX 1HT1E 1U1GA 1VCMA 2B25A 1PQ4A 2F1HA 1MTZA 2CXQA 1ZRHA 2Q49A 3F78A 3P9KA 4G07A 4XSVA 4XWGA 4N8DA 1B42A 5K0CA 3S40A 2YWRA 4YCSA 1L5FA 2VT7A 3G2QA 4R5HA 4ZHQB 2WU4A 2FUCA 3G3EA 1ADGA 2J7KA 3JY6A 3OM1A 2WWRA 4V0SA 5KOJB 2D5IA 3TSAA 3U9LA 5T3YA 3EY4A 4GI2A 1TE2A 1RJDA 3EXHA 3NT2A 3D6VA 5FPHA 5KYUB 5IVHA 3NT5A 3G85A 1AHHA 1BW9A 4BP8A 3PDWA 5ALKA 3SYTA 3JASA 3DJFA 3VAYA 1P2VA 1V25A 1JF8A 1P74A 2D8AA 5LXTB 3D8TA 2IYNA 4K1XA 2IEAA 1CETA 2GCGA 2C29D 5ECDA 4G3XA 2CBZA 3AR4A 5ICFA 1MGOA 5B2ZA 3VSDA 4J7XA 4JGIA 2RH9B 1XMPA 3UQZA 5L3QB 1I5EA 2IYRA 3B3AA 3KVNA 2IUYA 4IDHA 4PO8A 3WQHA 5C37A 2D1SA 4R16A 1Z2NX 3DHNA 4UU8A 5JFOA 1X8XA 4M7WA 4D3FA 2XUZA 2Z4TA 1MAWA 4FGLA 4OKNA 1OGYA 3RQSA 4ZGWA 1QYIA 1OHHD 4UUNA 2QY9A 1UBOS 1AUVA 2VJYA 4PS0A 3W3ZB 4E5UA 1RKVA 4FLEA 2VJPA 1JH8A 5AP9A 2HF2A 1A9OA 1QNFA 1Y9AA 4TRNA 2B36A 5H1YA 2ORIA 2YVLA 1LSOA 3EEIA 2A5YB 2FSIA 1WY5A 1RWPA 2HLNA 4EJFA 3KB8A 4K5QA 3R3HA 2ZBVA 4KXLA 4IVNA 5AUNB 4V02A 1NF2A 4LC0A 2Q0XA 3WRYA 3NHZA 2GYYA 4N5NA 1OBVA 1UK6A 2BI4A 1XP5A 2NSLA 3R3SA 4PTZA 4TLEA 5CM8B 4US0R 3BUSA 1MFPA 2C54A 4XFKA 1KH2A 1LBTA 1LSUA 1X19A 4Z51A 2YVQA 1NYTA 1U6IA 2NV0A 1YKFA 3CUEF 1ML3A 3EG5A 1B8NA 3GT3A 1SC3A 1V5WA 5F9HA 2A3NA 2YWBA 4KACA 2JIZA 2RHCA 1LA2A 1TVCA 1N7GA 1LFDB 3E82A 1UDBA 3RTGA 3PG5A 4EHBA 4Z9AA 1WDKA 3WGLA 3H9BA 3BWBA 2ZKIA 3EK2A 2A58A 4J7UA 1FE8A 2VH5R 4B3GA 1BA2A 3L7CA 3GFPA 1YRYE 3MRTA 2FTKE 1N5OX 5BV1A 5HSGA 1FW6A 3ESXA 2HJRA 4OHBA 3K2BA 2B2NA 2ZRLA 4PRKA 4YY3B 5IBRA 3SX0A 1N4AA 3PR3A 4HNAA 4RPCA 3A1TA 1GPBA 4RLSA 1KOFA 4E2FA 3KLBA 3QEMA 1TPYA 4ZDJA 1KWGA 3UPUA 3U3OA 1B00A 4HRVA 2WINI 3GT7A 4F3YA 4MARA 4HTAA 3SIPA 5HK9A 3GEGA 3HZZA 1FNNA 3O7MA 4C7XA 4DUPA 3GO4A 2A1IA 3UCXA 3TRIA 3ENVA 1B2LA 4N7RA 4TKZA 3R5FA 4QUGA 4CT0A 1BMDA 4M3NA 4WCVA 4Z0TA 4MIKA 2BKLA 3KJZA 4GO1A 2ILVA 2RHGB 1QVZA 4RHYA 3USZA 3KQKA 3MC1A 3MUNA 5LU9A 1QZXA 2ATVA 3HV2A 3ME5A 3PGVA 4RVFA 5DJ5A 3WSTA 2G72A 1T8PA 1YACA 5KC9A 2VYQA 5CR9A 3S70A 5LDHA 1IM8A 4I0WB 4UHDA 5FF9A 2BTQA 4ARBA 3ONEA 1KEWA 2IA5A 2OBBA 4JWKA 3Q9NA 1ICEA 2UZAA 1XTRA 3REGA 2CWWA 3T61A 3E9DA 2FZGA 3FFXA 3WLLA 3K71B 3ZV3A 4F4CA 1ZH0A 3FYUC 2HYDA 5IH3A 1WA5A 1SUEA 1Z82A 3NCTA 5AKZA 2A9VA 2JLRA 5LLSA 1PSDA 1H6DA 2X7JA 1PE0A 1E9BA 4WCDA 821PA 2P69A 1EHYA 3GARA 1N5IA 1SUPA 2IOHA 4M9CA 3RS0A 2HHAA 2XLCA 3WLPA 4LXIA 4LBZA 4ZCPA 4K6CA 5C8ZA 3D6MA 3F2IA 3H3XA 4LTMA 4Q9KA 4BKRA 1T8UA 2OHHA 4HAUA 4P5PA 4NDAA 4ASUA 1OIVA 1PBNA 1QKIA 1YVUA 2XCOA 1X7ZA 1QTRA 2OT3B 2OV2A 4IF4A 4NCXA 1AKYA 2BHRA 2IVZA 1S96A 1Q17A 4ZVTA 1N3LA 3EXEB 1H8ED 2QVLA 1T9BA 5AM1A 3V2UA 1ZD9A 3QH4A 3PNKA 3C7KA 5CLGA 1EQUA 2JFFA 5TJ9A 1NATA 2NUPA 2ZIXA 4OLFA 4IIUA 3DLTA 3CUWA 3CW9A 2GXQA 4OAQA 1IOLA 3H19A 2CHGA 4LHXA 3H5AA 4OA5A 1L7NA 2YS6A 1ND5A 3MJCA 2AG1A 4AICA 1XV5A 2IHBA 1PT6A 1O6GA 1UDAA 2B92A 1V5GA 3A9UA 3LF2A 3NVAA 1AD2A 1H9AA 1N9ZA 2J5QA 2P6UA 2XUAA 4FC7A 4IAOA 4DZZA 1FYEA 1N2CE 2X8JB 1RW4A 1GV0A 4GIBA 4LKOA 3V3KA 3V7UA 1A7JA 1G291 4NAHA 3I6BA 1V8DA 2I6UA 3L8YA 4JZKA 4EEKA 3AVUA 1KVTA 3HEAA 1DO8A 4HXGA 4WZ6A 5HDQA 3QVGA 4GEGA 3UCFA 1LZLA 1I4LD 1NBMA 3V7FA 3LPDA 3GBPA 4HN4B 1YAJA 2JGJA 4K6FA 4WK4B 4YAOA 3O92A 4HLNA 2P67A 3GQBB 3H0EA 1CY4A 2UYCA 2EYUA 3IDAA 1TT5B 2P30A 2R87A 3BB3A 5AXDA 4DJEC 1M2VB 4GQIA 4I4NA 4KR9A 1P1RA 2QNIA 3GUZA 5JXHA 1I9CA 5K8LA 4NCJA 1KC1A 1TW2A 2QX7A 5F64A 3TOVA 3CJRA 1CEXA 4O3FA 2HK7A 2Q3FA 1PYOA 1VC2A 2K5UA 3CKMA 5EIBC 3LYHA 1XLWA 3LPCA 3TKLA 5JBNA 3T3NA 3ZDDA 1F9EA 1PDVA 2LNDA 2P4UA 3BAZA 4A0QA 3IBSA 3LUJA 3ZZTA 2QRMA 3DKKA 2G7ZA 3R0ZA 4CM3A 3IUQA 4DMLA 1QRAA 1T1EA 2Z9BA 3MINA 4QJ5A 2BM9A 1CW2B 5JECA 1JQJC 3DV0B 1L7PA 4FSHA 3T7KA 3U16A 3CRW1 3DOUA 4GPZA 1UBSB 2GM9A 3T5AA 4FKBA 3DCYA 1C0IA 5AM3A 2EZUA 3BL5A 2PS0A 1UPFA 3FFAA 4UTOA 3UT5B 4KLNA 1NNUA 1E1LA 2PANA 3FCCA 2JIZD 1WETA 1N1GA 3OSUA 4N6NA 1JYFA 1ZJ4A 2RK4A 3MLBA 2AE2A 1LU9A 3HXMA 2G5PA 4PCUA 1T4GA 5AJWA 5FR1A 4TS3A 3F0TA 1U02A 4OHVA 3RUAA 1SG0A 1CX9B 3H4IA 1Y9ZA 3O3NB 1PO7A 4ARZB 1TRHA 3O4RA 3T34A 1S2DA 5K51A 1JDNA 1IK6A 5K3BA 1R8XA 4DA6A 4V24A 5FPSA 3DVSX 4MO2A 4F1WA 1M0EA 3O0DA 5DBIA 1NP7A 3WGIA 1UOOA 3HCEA 4MYCA 1YDGA 1D6NA 2FMUA 4U7PB 2Q4BA 3IE0A 2HCBA 5DIZA 5LUAA 4JJGA 1NVEA 3EGEA 4FXOA 5GAJA 2OFFA 3V5NA 4F93B 3ICQB 4TZ0A 4OCZA 2QYTA 1KNXA 2DECA 4FX5A 1GTSA 1TNDA 1Z5GA 1Z62A 4GOMD 4KQ6A 4UQPA 3FVRA 2X5OA 1X9GA 4C03A 5K4GA 4IPTA 1C1XB 4WVFA 4FD2A 3KHTA 3O91A 4MEJA 2JAWA 3EVCA 2NNLD 3OQ6A 2VAPA 2W2OA 5EQDA 5I9TA 1D6SA 5BR7A 1JFVA 1Y7TA 3NG1A 3PRKE 2HZBA 3QMWA 3EGOA 4TXJA 5EJAA 5HOQA 2CL0X 4PYJA 4EYSA 1XDDA 5JD5A 5DHRA 4GXTA 1D1QA 1OH5A 1QKJA 1USVA 4RA6B 1H2EA 1FDIA 1NXVA 1EEXB 1CUVA 1VJ0A 1WXEA 2C94A 1QQBA 1S8FA 2WWYA 2AX3A 1NJ5A 1Y4AE 1YWGO 2X86A 3GRRA 1T3ZA 2C4KA 2W71A 3D64A 4N7MA 1NVVR 1DT5A 4EYOA 2NUAA 2PS1A 3SQOA 4B4WA 2QLNA 4J49A 4Q7JB 3HWSA 5F77A 3TF5A 2HRRA 1EVKA 2XQGA 5AKLA 3UHPA 3GJ8A 2I6GA 4L6CA 1R4ZA 4G25A 3WKDA 1P5HA 3DL2A 3G2PA 1XC7A 3LO5A 3T9BA 1OZGA 2OV8A 4JLAA 4JLKA 4XWTA 1DC4A 4IHJB 3LBAA 3PQ3A 2W70A 4CIWA 4ASUD 4HZGA 2JFOA 1VIAA 4XB2A 3FYHA 2PV7A 1Q6YA 1Y89A 2F7SA 2QD4A 4GZMA 4J1QA 4TN1A 3RUDA 2WF8A 3F5FA 4TL9A 2O4UX 2DYKA 3P0RA 1ZVQA 1B26A 2HO4A 2ZSUA 1RIIA 2Z3VA 1MOPA 2QJWA 3KKMA 4HUQA 5A3QA 1SCJA 5ENVA 1XVUA 4JYMA 5LZ7A 4MVYA 2J3DA 5LKRA 3ZZ0A 4X0EA 3NFYA 4D5EA 2ADOA 4GZ3A 2EQ5A 4L50A 2P5YA 3E0QA 3H2ZA 1PGQA 1SO8A 5CVVA 4QOFA 5KYGA 2OV4A 3C7TA 2RI6A 3JRNA 5ALLA 4BEWA 4N3NA 2LTAA 1DQYA 2CVQA 1E6EA 5CT9A 5ESRA 1JHAA 4L02A 3GCGA 5TC4A 4F4JA 2Z0MA 3V8VA 2W2VA 3DMTA 4J1NA 4O5AA 2G83A 3IKLA 3ZJ4A 1EIZA 4HDMA 5EE0A 1DAHA 2CDBA 2GWRA 3PXGA 3UJHA 4DZTA 3ZQ6A 1E9CA 2WBLC 3NBQA 4PAWA 4WACA 3WDKA 4V1CA 1XKXA 3UY4A 2LCIA 1X0XA 1I7LA 1STOA 5FBWB 4IH4A 5BNZA 2ZYTX 1Y1TA 2EW2A 2B9VA 3LS2A 4RPLA 4WE3A 2DPMA 4GWLA 3VZDA 5I7HA 4YASA 3T3DA 3TLCA 1W5AA 2PBZA 2ZYDA 4Y2VA 5FUQA 4OHYA 2YCLA 3AYXB 3A2LA 3EIUA 5A4IS 2GM5A 3I04M 3SBOA 1J5EB 2ZT7A 3H8SA 3IOYA 4J76A 2VP9A 2NSJA 4MQ4A 5CCEA 1H6CA 4PNPA 4MS1B 4D8VA 4HDKA 3EUEA 5CDFE 3TLEA 1D3AA 1SXJA 3HVIA 3IPLA 5IARA 3RS2A 3MQ4A 1LDBA 4AJIA 1RFGE 1XZMA 4KI7A 4MRPA 4ESOA 5A1TA 5FLKA 4G0WA 3T5GA 4IJUA 4F86A 1QONA 1HEIA 1JS1X 2BKXA 2HDWA 3DMNA 3EBLA 3O83A 3F9CA 4HFJA 8AT1A 1P33A 3LJKA 2EATA 2JD1A 2AK3A 2HB6A 2G63A 3CNNA 4KQFA 4ZVKA 3WLOA 1YA4A 4LJAA 5DFAA 5DMHA 5LQUA 3C3YA 1MJHA 1B0AA 5KVAA 1LNZA 4HATA 4NCNA 4IIGA 4ZU1X 4DIOA 2BLLA 2TMKA 4G1CA 4EW3A 3I3SR 4HR7A 1QIIA 2ZS8A 1BN7A 1MA0A 2JCXA 3U48A 3BKWA 4YN3A 4CL0A 2EWVA 3N1UA 1JDJA 4OGKA 2A30A 4KR2A 2OZKA 4I36A 4N5LA 2ODQA 2JLSA 1EFRA 2PVPA 4YHBA 3ZWNA 2A5FA 2XA2A 3COJA 4GPBA 3K6JA 1ZC3A 3I92A 1EXDA 4FHZA 4C4TA 3KKLA 4HJXA 4ZI7F 1SULA 2ZSIA 4RMGA 4M98A 3I5UA 4ENUA 1EXNA 1CUUA 3NHUA 4FQ7A 4N5MA 4NBTA 4YMGA 2QHXA 4RGQA 1MNAA 4Y9RA 4YXWA 3ONNA 4B3RB 4RE6A 3IT1A 1YDMA 2FG6C 1OFUX 3II6X 4I1RA 4QXPA 4YRPA 4KI0A 3HSSA 4QNRA 1OFIA 1AMOA 5I6DA 2V54A 2RIPA 2FXIA 4KDFA 4NH0A 1C0PA 3F7NA 5ESDA 1SKMA 2XXAA 1Y8ZA 4O4IA 2OENG 4C3ZA 4DLAA 1LQTA 4Z3OA 1UWCA 3MD0A 5DW3A 4NI5A 2AWOA 1PQPA 4LBWA 2GN0A 1ESDA 2XDYA 4L7QA 1IN7A 1OB5A 4JGGA 3RVOA 5K6TA 2EC5A 5KVCA 3RTBA 3BRQA 4DEVA 5UKDA 1JXQA 1Q0ZA 1HTWA 2PD6A 1K92A 2VTDA 2OEPA 3KD2A 2QRKA 4ZAWA 1Z6PA 5IT4A 2PUBA 2BCGY 1KMQA 1E5TA 4YI3A 1IU9A 5K0LA 2D6FA 1U8YA 4UJ3A 4HEQA 1U5BA 4CFYA 4R1TA 3IA2A 5EMNA 5DSZA 5AI0A 2Q3JA 3IEXA 4LGVA 2J0EA 4X5OA 1VHTA 1EFPB 1ZO8A 2OORC 3ESAA 4B6RA 5JWOA 2O5EA 4M1OA 4EY8A 3DWEX 3VZBA 7ADHA 1U3VA 1M6WA 2J08A 4WNYA 5JATA 3QV1A 1G20A 3GMIA 1SIWA 1FXWF 1IPEA 4QGBA 1F2DA 4JBLA 4QU5A 1L8OA 4YCNA 3SC6A 3P2OA 1WG8A 3N59A 2WP8J 4ZT6A 5KOIA 1RQXA 3DZ8A 1Q50A 4TMZA 4LY3A 1T9AA 3HQ4O 5JJCA 2MSDB 3FWZA 3F3MA 3PWSA 2KW5A 2HA5A 1XYVA 3CNBA 3TLJA 3VM6A 2SBTA 2NUBA 1F51E 1G8PA 2EJCA 1M2OA 1J25A 1DJOA 1ZD1A 2G5TA 2VUHB 3DV2A 3I2GA 3OKPA 1FFBA 2GEBA 4MQBA 1NZJA 3TX6A 4EGAA 2X9LA 3TMYA 1PS8A 1GRCA 3U31A 2WD8A 1ETUA 1WHSB 3KL4A 4IOLA 4D3SA 4WEOA 3IRUA 3REQB 5JZBA 1JAIA 4X41A 5K05A 1F3LA 2G36A 4Q39A 5LNK6 3KTDA 1L4MA 2QRNA 2WT8A 4U3JA 3R9IA 1Z2AA 2QX6A 2Y1OA 2OGWA 2YNMA 3VGPA 2EWMA 2X58A 4Q9AA 1XRNA 2OO3A 4TZTA 1Q6ZA 4ZV7A 2GXSA 3K1TA 3PFKA 4IXMA 3F49S 4TLLB 1G8JA 5G53C 4PQEA 2R1VB 4EW1A 5HP4A 1ZFNA 3LY7A 3KD3A 5T3UA 1QC5B 1MBZA 3WWYA 2ZAOA 4XWOA 3X1KA 1K7SN 1US8A 3PF8A 4EBFA 5JWRA 3FTFA 3UOAB 4RMHA 1TJYA 1UEJA 4IEIA 1DMRA 1YT5A 3NMUF 2FEAA 4OUDB 2E87A 1FLVA 3D8HA 3JZAA 3LQFA 3OCJA 4BNMA 4X8MA 2SCUB 3K96A 5CYGA 4BMPB 5KAPA 3DNMA 1SXJD 2GO7A 2XUQA 4U2FA 3K7EA 1GU0A 3TAUA 4L28A 3TZEA 5DCYA 3JQDA 4MKHA 1JMKC 5AW6A 3QVSA 1DJPA 1W5TA 3NWOA 5LZ9A 3KJNA 1PNVA 1PUXA 3RO7A 2DVMA 2OKCA 1MCZA 1EUDB 4WLUA 5KVVA 1HORA 1ZK1A 1T3GA 4JP5A 3BZWA 2PYIA 5EERA 5AXAA 2R86A 2IXEA 4GOKA 3ZJUA 4PSDA 1FVXA 2VXYA 5CYPA 3MM4A 3ID6C 2YS7A 4C0LA 3HGMA 2UYGA 2YDYA 1AHIA 3PIIA 4L9AA 2Q7OE 4AC9A 4TX1A 1X1RA 2QX9A 3RBZA 3MCAA 3JYQA 3DYVA 5JADA 1X7HA 3ZHVA 1L8LA 3FSEA 4DSUA 5AHWA 3L06A 4N5DA 1FSZA 4R9NA 5GWXA 4FB4A 3IOCA 2QTFA 4ZT2A 5AVJA 2PSJA 2ZIFA 4D74A 5GM1A 1DC3A 3V2HA 1GHTA 1KYYA 5AK0A 1J9EA 1FDRA 4YXWD 2WIJA 3AU9A 4O63O 3I9FA 1RI5A 3F8WA 2WVGA 1IUOA 2ZW9A 2GETA 2XT0A 1H5UA 1ZIOA 1W4LA 3IAUA 3M6FA 5J40A 3BWCA 2J0SA 1B8OA 1G3MA 1CP3A 2R47A 1LD3A 2X5KO 2A88A 3LKBA 4F7DA 4M21A 1Z0AA 5ERYA 4RETA 1YS6A 3DSRA 4EF6A 1TPZA 4PWYA 4EFKA 2F9LA 3KSAC 1THMA 3D7KA 1YE5A 1ZWKA 4UBJA 5EKDA 2ZVPX 3DCJA 1I80A 4N12A 4DDTA 1LK0A 5A3JA 1O9BA 4JFRA 1C3LA 5B3JC 4JASB 3C16C 4MR7A 3AERA 4QULA 1NE2A 5U4QA 1GZ6A 3KOOA 4JBXA 1EX9A 1IIRA 1OI3A 2DJ5A 2FEWB 1F7VA 2DY1A 4M0KA 2P2DA 3WXBA 1SOWA 4JXZA 1H93A 2D4AA 1CUWA 4BCCA 5T8KA 1CZNA 1TEVA 2Y27A 2HIGA 3NIDB 3UT0A 5DNUA 1HMPA 4MVJH 5IN5A 4ETNA 5LP6B 1B6TA 3L79A 2H0QA 4A4DA 3VR5D 4UNRA 1MORA 1BROA 1G4AE 2P3QA 5EL0A 1QE3A 3TIIA 2ZJ6A 2BUCA 4IEEA 4OHWA 3TW8A 4C3OB 1IJKA 5JT1A 2QN8A 1DAKA 2IW3A 1W0JA 3D6FA 3AVQA 2BGGA 1VL6A 2Y0EA 5ILQA 2XA1A 1E1RA 2JAQA 3L05A 4RHCA 1A9RA 5THKA 4TKVA 5JJ5A 3WMFA 3LQRA 5KBYA 2A2ZA 4GI1A 4G5OA 1JQAA 3VKUA 3UYKA 2WTUA 3R7LA 3S7TA 2OFOA 1BWSA 3W2TA 1KTVA 3AHJA 4RKRA 2WIGA 3FB4A 1YRLA 1GDTA 2R2AA 3C5EA 4PR3A 4QJBA 3W2HA 1CZHA 2RHLA 4BLVA 3AF5A 1SA0A 1RE0A 1LW6E 5BVGA 2OVBA 2GBIA 2MSWA 1PJZA 1VL1A 4NCKA 4ZQEA 4GUAA 3CPEA 3AFMA 4RLFA 4YRGA 1H9CA 4LRYA 2WZCA 3EXHB 1OWPA 1JBKA 5SZIA 1TX4B 3JASB 5AKEA 1CUDA 2L2QA 4QX6A 1CTQA 3TB4A 3HO6A 3RRXA 2X2OA 4FEGA 1JIKA 2BSQA 1JI3A 2A0WA 1WZUA 4KNYA 1PEYA 3VUFA 3SLKA 3LSYA 1UAGA 2YNMD 4WGFA 5BYJA 3GZ4A 1R12A 1MOQA 1XZ8A 5E6RB 3TIXB 2ODPA 2FFAA 2YWEA 3A1UA 3OICA 3V4OA 4BVJA 3GHHA 2OAP1 4B3CA 2WKQA 1NC3A 2HRBA 4JJ8A 1OLOA 4BASA 4A92A 2O5VA 1LPBB 1NXQA 2QD1A 4O59O 1Z35A 3HN6A 5CHYA 3DDSA 4LNAA 2AQKA 4W5TA 1BX3A 3ZTTA 1CNMA 4C6HA 5F21A 3JQRA 4NOKA 3HXKA 3W77A 5CDHA 4I4IA 1E2PA 3BE4A 1YBMA 3TMAA 4DGSA 2CFSA 4Q1CA 1OXXK 3WIEA 4RVUA 2PBRA 3D3JA 3M6UA 5EZQA 3CEPB 4ZC8A 2GNOA 3TFWA 3IT0A 1SFRA 1ECPA 4ZQBA 1Q19A 1WM1A 2J3JA 2QTTA 6LDHA 4HS9A 3KSBC 3ZGXA 3HDJA 3RT1A 2QXUA 1ZCBA 3TSWA 5JBIA 3HP7A 2ACKA 3GG9A 4I66A 4FVTA 4RK5A 8ABPA 4ZQFA 2V7TA 2Z6QA 2WUDA 3CX7A 2EG9A 1MDBA 2OCIA 3SJAA 1Y9EA 2Q6IA 1M2KA 4PFJA 2CV0A 4RA9A 1RRFA 1YFZA 3ACBA 2PGXA 2L0XA 4ZCIA 1OXBB 4DUYB 4Q4AB 5K45A 4IILA 4F0JA 521PA 5B58C 4OSPA 3WLQA 1CZUA 1BHSA 1UXIA 3KAKA 2G06A 2V7WA 4DA9A 4HNAB 1JR3A 1DKOA 3V7YA 2HU7A 3AVYA 3QEMB 1GXSA 1JVSA 4D42A 1NQWA 1IHDA 3Q98A 1J1UA 1V9LA 3ENNA 4G2NA 1KI2A 2Y2UA 5DGTA 5IDYA 4Z4IA 3GDHA 2GCOB 1W75A 3TLGA 4RV5A 4ZTUB 3LUDA 4RORA 3INNA 2W2QA 3N07A 3OJCA 4K03A 2M6KA 4G1VA 2X7HA 2XKAA 3G1UA 4MI6A 1ORTA 3TD2A 3FLBA 3IIIA 2ACEA 4IIJA 3BSWA 4X92A 1Z7BA 4I4LA 3RK0A 1ZMOA 2JNWA 3F8TA 1JTFA 2CKMA 3SE7A 3TOXA 2CLSA 3OF5A 3DKRA 3VR6H 2ZUTA 2R1TB 4IG4A 1HR0B 3L40A 4QEDA 3W7VA 4AF6A 1F17A 3BCSA 2MYPA 2HU5A 2BTQB 1ZA2A 4RWZA 1AVTA 2JBAB 2CMFA 2Z04A 3OQ1A 4E1BA 4OYYA 1PW5A 4UHJA 2PSHA 1Y4ZA 4BBAA 1H05A 1GU7A 3C15C 2ANCA 1LPAB 3CIFA 1A77A 3EOAI 4Q37A 3DPSA 2UVDA 1QYDA 1ZK2A 2O2EA 2ET6A 3PFHA 4O4HF 1ESZA 4P4TA 4GGMX 3MTJA 3NYQA 4R68A 5IYZA 3MTIA 5F76A 4YGXB 1JB1A 1JJVA 2BEUA 2GRUA 2NSYA 1RI2A 5TSDA 4QJ3A 3COZA 5JVDF 1L4BA 1G7TA 2PZGA 4C4ZA 1SBCA 1U3WA 1E2JA 3C41J 3WI7A 1IY2A 1QH8A 1U7PA 7ABPA 1X15A 4D4GA 4Q0MA 3ADPA 2BR4A 4W8HA 4DYDA 2W11A 4LK2A 3PXCX 1W0JD 3DYBA 5I01A 3MWKA 5D01A 5C7IO 2Q0HA 3HU1A 3SXUB 1NLZA 4TPKA 3I37X 1E1RD 1E7RA 4YT8A 1IHPA 4KIFA 3SYNA 5TVGA 3ZDZB 3ZHCA 4YIHA 3LT0A 4PE5B 3PQ2A 1QU3A 4YT5A 3HH8A 2QNBA 4CIDA 3NAGA 4ZJYA 1ZAYA 3QPCA 3KS9A 1UPBA 2JI7A 4AWXA 4B0PA 3K30A 3N8HA 2IU3A 3FFBA 5JAUA 2ATEA 2DPYA 4FKZA 2CZQA 1BRTA 4DGQA 4MB0A 1CQIA 5JDCC 1SELA 2AC4A 1IVNA 4HX9A 4KQEA 1JNXX 1Y4UA 2V59A 1A8PA 1SCIA 3EVBA 2YXPX 3OU7A 4AJEA 4JV5B 3FVTA 1QRRA 5LUBA 3BULA 1YB1A 4LRWA 3LBIA 3R77A 1K89A 2DH5A 1TTTA 2J67A 1BQ3A 3GEBA 1M0WA 4QWMA 3QVGB 4KV9A 4KPFC 8LDHA 1RZRA 5HGJA 3QQ5A 2CBXA 4CV0A 4KAJA 4C20A 1Z73A 3JVDA 4I46A 2E7ZA 1IZ9A 4IM7A 2QL9A 2BONA 5F2EA 2WT9A 4RC9A 4W6ZA 3ONDA 4FXPA 3GRVA 4KN6A 3GNTA 4PYRA 3QJGA 1RWVA 1ZD2P 2QTHA 3SBEA 1WEHA 4ENVA 1CPYA 1RXCA 1CRWG 2O3TA 3HSYA 1Q1GA 3JCZA 1HV8A 1Q0LA 4MQLA 3AM5A 3O4VA 4DBZA 1A8IA 4IH9A 1KI8A 1GCGA 2IITA 4P81A 4EKNB 1IRIA 1OPRA 2ID8A 3GELA 3LPLA 4KXVA 4KE7A 2AG0A 1I1OA 4XKJA 1ADBA 1G9XA 1QZTA 2X6QA 2QJRA 1VYVA 4EVRA 2PE5A 1KPGA 4N1AA 1ZJWA 4ZTBA 3E9YA 4INZA 4EA9A 1V48A 5IVPA 4YMSA 2FF5A 2YWGA 4KHPB 1E6WA 4B34A 4Y2JA 3HR4A 2XCSB 2CB9A 3CVJA 3O8LA 1TO6A 4C0HA 1JALA 1OIWA 4WXRA 1QLWA 3S7ZA 2PJRA 1UJ6A 1MVOA 4F6LA 1AS2A 1NYRA 2BJHA 3GLSA 3WC4A 2C9DA 1UBLS 1UQUA 1C5KA 1JFRA 2NYVA 1QNLA 4NENA 5EWJB 2WWTA 2XJ9A 3RTEA 1J5PA 1P6UA 4Y2QA 3STVA 2EIHA 5ENZA 1MKYA 1WHTA 3GRAA 4O08A 3S2UA 1CT9A 1JR3D 4NS4A 1XRPA 4A10A 3HDGA 3O8OA 5AW0A 2H8GA 4QDUA 1EE9A 1RYMA 5CIWA 4LVOA 1HNNA 3NS7A 3PQ6A 3RS3A 3DAHA 3RRYA 4OQZA 4U9UA 1D4AA 4P0TA 3W5BA 1MJNA 5KSWB 3QXXA 4OJNA 4EJMA 1S2LA 2E4WA 3PVSA 3EW9A 3Q41A 4OM8A 1FS6A 2V98A 3ZE1B 2OV3A 4X6XA 1I3CA 1E8MA 4PQGA 4C43A 1PZMA 3F4KA 3TR0A 5EZYA 1WABA 4JYZA 2DQKA 4YJGB 3F8SA 1Y3IA 1SHTX 2P2ZA 3PWTA 3T7AA 4Q34A 1NAHA 3CKYA 3VJMA 4XVHA 5MFZA 5KTSA 1Y5MA 4HX5A 3TLAA 4FEEA 1TU0A 5FUVA 5ALRA 4H59A 4DFDA 3ZEIA 3KB6A 4F4HA 5BMVA 4L8LA 3G8BA 4KVGA 4E7PA 3WL7A 1TFUA 1DJNA 2J6CA 2AB0A 3KU1A 5FYDA 1RE1A 3K15A 4AL4A 1NFRA 1Y1RA 3FIJA 2XCTB 1RXVA 4OK5A 1S6YA 1AZTA 4C2BA 1TEZA 5C8DA 4IV0A 1Y8QA 4URZR 2ZSEA 4KTVE 1PJTA 1QQ7A 4UDNA 1KZ6A 3W4KA 3WGOA 3C3DA 3Q3JB 1OXUA 3U3JA 4EHAA 1R18A 4B31A 4U63A 3UPTA 4LVCA 1F06A 3TM4A 3BK7A 3FPKA 1K5HA 1F60A 2PH1A 1UEIA 3CE9A 3D1JA 3L4SO 3QUSA 4WESA 2X0FA 2X76A 5EYPA 4PCVA 4JROA 1EZZA 1Y3HA 1T1GA 4I4TF 1VSUA 4NFLA 3EULA 1GNTA 2E89A 2X2FA 3ADOA 3L82B 5FT9A 5KPDA 1WRBA 3KIPA 4KPUB 4HQRA 2WHRA 3QOWA 5KAMA 4A23A 4YFVA 4ZK6A 3LOPA 4JVLA 5ELLA 5CCDA 2Z3ZA 4PWZA 4EY6A 2J9RA 2HWXA 1DG1G 2ZE5A 3VR2A 3G49A 2NSDA 2BL4A 3TRHA 2WIKA 2CL6X 5A5GA 1LQUA 1DXQA 1G7RA 2IEYA 3QNUA 4H15A 4K9OA 1Z2OX 3WP1B 3GDWA 2GCPA 3SM3A 4JH0A 3IEUA 2IDJA 5BP7A 1AGRA 2W2MA 2X13A 1VJ1A 2ZXUA 2WTXA 1BYUA 1B8VA 4HDMB 4D0GA 3WVNA 4V1CB 4KYVA 1HNWB 3DDOA 5HKOA 1OAOA 1PD1A 1Z68A 1UXGA 1X7WB 1I4DD 2XUDA 4L85A 3K3PA 2VDKB 3PR1A 5B1DA 1RZRD 3HRHA 2YRWA 3NATA 1WQ4A 2WTEA 4WXEA 3RSLA 5BSTA 3RADC 1CG6A 5EGNA 3BMXA 1N75A 3KOWA 3C6YA 5CFPA 3QOFA 5JPCA 5AXCA 1D5WA 2Z30A 2GZRA 4DADA 1F8GA 3NUZA 2I87A 5DM70 1ONSA 2ZAYA 2J5RA 1UC9A 3IURA 3UV7A 2ZRDA 2GVDC 2PQ0A 2QUJA 4J4TA 4YDRA 3WOHA 2PD3A 4BUZA 4UEWA 2AXNA 1SXJB 4RFSB 2LV8A 5TDHA 3WLTA 4AVYA 3EXG1 4ER7A 5GMOA 4E2ZA 4R98A 3Q8MA 2AHRA 1NRXA 3QX3A 5DF1A 4UVHA 2FMKA 3MSXA 3QGMA 4PHFA 2IH5A 2WM8A 1MV5A 1UOPA 2OBXA 3AJ8A 5AFSA 3I62A 1VRWA 1N57A 1WIWA 2JASA 3R5SA 4PG6A 4YRKA 1IB6A 3OZEA 3ANLA 1V8ZA 1X77A 4RESA 4KFSA 4UM7A 2ZRJA 1RR6A 2YMLA 1L5LA 4ZKDA 4UVDA 1FFDA 4I9NA 1YO6A 4QBGB 4C5BA 3H87A 4Z3KA 3QFCA 4A8HA 1DX4A 1ADYA 2DE0X 3I1YA 4YRRA 5JG7A 1G2OA 2ZDGA 1FBTA 4UEJA 3GPBA 2BP7B 3HA3A 1FS4A 1E5DA 1JRLA 4E4TA 1O03A 4DJDC 1YFKA 2VI5A 2D00A 1QHFA 3AIMA 5A7HA 5TEWA 4Y1EA 3V1LA 1ETHA 1NVFA 4Y6OA 3LLUA 2N0SA 5T67A 5LSAA 1J8FA 5FOVA 4IJMA 4COOA 3PFBA 4GKAA 5EWMA 3TNLA 1AQIA 2WJHA 1K86A 3IIMA 4ZARA 2BSAA 2NU9A 1WBDA 3IEVA 3B51X 4GP7A 4WAUA 4QVIA 3QTTA 4QOIA 5K01A 4M8SA 2Q8PA 2MIIA 2I4OA 1M6VA 5K9ZA 1PZXA 1DKQA 4BP9A 3D81A 2JK1A 2XQVA 4O4IB 1NVVQ 5LB2A 1C81A 3UAWA 4M0UA 1DE0A 3DPUA 2PXAA 1E3QA 4MKRA 2OZVA 3WTBA 6ADHA 4MEBA 3EZGA 3EYWA 1D2EA 4J29A 3KQYA 3RRJA 3FGOA 4D9MA 1NBEA 2WY2D 1Z7YA 2EKDA 3AIIA 2R00C 1O5TA 4W9RA 2VRBA 4WEQA 1HYEA 1JW9B 3QLUA 1UUFA 2M9MA 2X0IA 4K9SA 4L5YA 5D3QA 3GLIA 4EMTA 1X6VA 2GTPA 3MGGA 5EI5A 1XDUA 1AUOA 1SCNE 1SN7A 1GPKA 2DJIA 2VP2A 2IYOA 1UBKS 2YZ7A 3U13A 2EKQA 4CZ2A 2FLWA 3S55A 3HJRA 3A0RB 3GLVA 4HQLA 3W9YA 2Y1DA 5L3VA 5TNXA 1NJGA 4R2JA 3Q9LA 4UREA 3P2MA 1Q95A 2JI9A 1JQEA 4EA8A 1VJTA 1WUYA 2XMSA 5HM8A 2F3PA 2NM0A 1ODKA 4RD3A 3P9QA 4NZOA 3WFJA 3U7FB 3PDIA 3PL5A 4RZHA 1LJLA 4RTLA 2XCQA 2IDZA 4LHVA 3H84A 2BH2A 3T52A 3JWHA 1IZYA 3EC2A 5KHAA 3KOMA 4ZRDA 2GZ2A 2VAMA 3PJRA 1Q44A 2HLHA 4PIPA 3TRKA 3IP6A 4BV9A 4QT4A 5AD1A 1A27A 3CF0A 4HL6A 5F33A 2Q0QA 4RZXA 3RVBA 3I9OA 2HJVA 1L7QA 4LOJA 3PC8C 3GPDG 4Z0HO 2A33A 3UFXA 1WXHA 2PUTA 4UASA 4YACA 5EMJA 4DM7A 2HAEA 1MQAA 4CKCA 4XYLA 4IUBS 1M2OB 3VR2D 2IYWA 1RWNA 4DUGD 3KYBA 4MV5A 1NDUA 1V2GA 2DUJA 2Z08A 1UKYA 2PAAA 2VL7A 4LFBB 5KX5F 1OH8A 3FOAA 4GW3A 3DDNA 1FIUA 4Q4JA 2FP3A 8OHMA 1CS0A 2BD0A 1T6XA 5EPUA 2QVCA 4X95A 5CA1F 1CB0A 4U3JB 2Y1FA 5GV7A 5CVUA 3B6MA 2QI9F 1WPQA 3BEOA 4ERNA 4N3BA 1AXEA 4JLBA 2E4YA 4RPHA 4H3SA 1SBYA 1BXRB 1U4SA 3QLVA 4D92A 4G4JA 2VVTA 4IR7A 4HGOA 1GLGA 3HCNA 4P82A 2JKYA 5FBRB 1N32B 5EHQA 1RWQA 3ZUGA 1N6NA 1US8B 1JU3A 3H5OA 4D3DA 3QY0A 5BWOA 2PR2A 1WD7A 5FA6A 3WY9A 3FYDA 3IVGA 4DR3B 3SZGA 1J0XO 3GW8A 2WFZA 1JEEA 2C07A 2PYZA 4RFLA 3NAMA 3ZQUA 2G1PA 4L22A 4E5VA 2FA9A 4JB0A 1UKBA 1Y4SA 2W4IA 1N6KA 4UU1A 2RGRA 4QOEA 4QGSA 3AJAA 1GZ7A 1SC4A 2AXPA 4GPEA 4E1AA 3UV6A 3FROA 2GEVA 5AKYA 3X1DA 4B45A 3RKRA 4OD0A 5JXWA 2CEKA 3D31A 3PQ7A 4ZCSA 4BCDA 4MGKR 2XMGA 2ZJ0A 3PZBA 4RTNA 4BVHA 4LPSA 1Y8CA 1J8QA 3VNUA 2O20A 4S1PA 4J03A 4E0BA 3OY2A 2Y4NA 1Z6TA 3CR3C 4RCVA 4Z1MD 1J99A 2ASEA 3RNLA 1GLNA 2Z2JA 4C2TA 3PPIA 3BQNB 4RFVA 1QHEA 3RH0A 4BNLA 4M2LA 1RHQA 1PTJC 1B4DA 5EP1A 1VLQA 3BDIA 4Q19A 2VNIA 4JVNA 4BVGA 1EJ0A 4GX1A 3WLSA 1M8FA 2MHCA 3BE8A 4EGFA 4EQ6A 1NQAO 2MYNA 1S3IA 3B6JA 3OLCX 4BEVA 4D9NA 4D4JA 4N82A 3RABA 4RH0A 1EP3B 3U4IA 4U7HA 4YMWA 4B2PA 1I32A 2FN4A 3INRA 4BVLA 2ONZA 2DTDA 2DX7A 2AVDA 3CEJA 4BNZA 2JF0A 3T41A 4M49A 2D7CA 3KZKA 4LE2A 1NOJA 1J24A 1U2GC 4FYHA 3K0SA 3KR1A 2YUIA 2DPXA 1Z9BA 2ZBQA 3V6MA 3W5VA 1D4OA 2Q5JA 3E23A 4DQKA 2O5RA 5JSUA 4A6EA 1DQNA 5AK3A 3AX6A 4PC7A 1N77A 3A1SA 1XTTA 1B74A 3CEHA 3KDSE 4WINA 2GYWA 3X43A 4JELA 1Q7GA 2JFUA 5D51S 4PSVA 3THWA 4YR9A 4O25A 3BMQB 3WHIA 4MR7B 1C2YA 2Z9DA 1H66A 2RIRA 2P4HX 2R79A 2H17A 3C6ZA 3M1LA 5CH3A 3OCZA 5L7TA 1W36C 5CT4A 2OCKA 4G1FA 1PWHA 3QFSA 8ATCA 2JH9A 1ID1A 3HUTA 3KR9A 5GP1A 3UK7A 4F06A 1F20A 4E5KA 2WD7A 3MWFA 4Y2RA 4I8XA 1QO0D 5IJXA 2PRSA 2Q5EA 2YBEA 3JQBA 4XA8A 3QTLA 1YL6A 4ZVMA 2EF1A 2N42A 3TW8B 2Q6VA 1E8DA 1Z7EA 2QN9A 2V9CA 4FNAA 2XE6A 3EWIA 4MHOA 4NABA 2XOKD 5FA8A 5B4UA 1UPTA 2G0AA 3N2LA 2WJAA 4OK3A 1MD9A 2HMYB 5KNCD 3MUOA 1NPDA 5IC6A 3FTPA 2DG2A 3KAQA 4Y3UA 4HDQB 1EXMA 4XAQA 5DE3A 1T4DA 3UWKA 3WIOA 4ACBA 5D1NA 1Y5RA 1ZRMA 5CT6A 2V9ZA 1GYRA 2RGEA 2R3SA 4HKTA 1SA0B 5CIQA 5G4KA 5BVGB 4BGUA 3SVLA 3MWJA 4PX3A 2FXVA 3DTYA 2R7MA 1JUDA 3PQCA 1OTYA 2H4YA 1LPPA 4OQEA 2ZATA 1M34A 5FRDA 1GG5A 3ND7A 4S35A 2WIAA 2P68A 3ENKA 2AOWA 1XCOA 3KFLA 4IJWA 4KR7A 1PDOA 1B2RA 2ZSBA 5BNFA 3L41A 4GX5A 5EINA 1YL7A 4X24A 2ZXEA 2XUFA 4Y1GA 4EF5A 2RONA 4X3CA 1IXRC 4GD3Q 1S0UA 6REQA 5HKAA 3R74A 2AJBA 4WECA 4ZXPA 3UXHA 5FR2A 2V9PA 3GLGA 1WU7A 1JDUA 4Q3LA 2CLFB 1OI7A 2ZBUA 1OD6A 5HZGA 3QX9A 2BEWB 4C2AA 4Z4EA 5ALDA 3SYRA 5DASA 2Q5QA 2LR0A 2W2KA 3AEUA 4ZV9A 3COVA 1PLJA 5TT0A 3NP9A 5ITZB 3DLHA 2J0UB 4Z99A 3B20A 2LBPA 2AZXA 1M2WA 4XOUA 1E7QA 5F7OA 1CIJA 1XA4A 1BIFA 2HHCA 3CPSA 4RK4A 2GCEA 4JOCA 2GF9A 2C82A 1C9EA 3KALA 4MXDA 3L49A 2X0NA 5ALIA 1NY6A 3KVRA 3GFQA 3R40A 4YP5A 5AWFC 4HV4A 5B6PA 3HB4X 3DM9B 4XQCA 1CK4A 1NG1A 1NY5A 2C2XA 1EFKA 1FNCA 2FY8A 1GR0A 1L5OA 2F00A 3KT8A 3QYFA 2YZGA 4OLHA 5IKMA 4MP8A 1CJUC 2ODTX 2XQJA 5LJLA 4BX0A 2ID9A 2UYOA 3Q5DA 2RGDA 2Y6VA 4BN0A 2WJGA 1OGJA 3CLUD 2GTIA 4CKEA 2F64A 1RLTA 3M5CA 3S5JA 4B6EA 3UK0A 1FTYA 3GUYA 4DC0A 3MJEA 5B6JA 1DIOB 3DJYA 4UVEA 1SCQA 1DV2A 1B43A 1II9A 1NGSA 5E8JA 1BG6A 2XUIA 4ES6A 4Z5XA 1XNRB 4NNOA 1R6BX 4F8JA 2NV2B 2X6TA 4JLUA 3MWLA 1VG8A 1PS0A 5EMKA 2UZ1A 3M70A 4YRFA 1UDCA 5FBHA 3TVYA 4YV1A 2O7QA 3DF9A 4MCAA 1YIDA 5HXAA 1GXSB 4JXJA 4GHWA 5HTKA 5CVDA 1VRVA 4AUMA 4RS3A 4DMFA 5H59A 5HTOA 2IPXA 4HF7A 2Q9AA 1ZS9A 3DNPA 3RYIB 4CKBB 3OFNA 2OXEA 3VPGA 2BFPA 5D86A 2QGFA 1GFSA 3B1WA 2OHFA 4IFTA 2I4MA 4OQLA 4YCMA 3Q0IA 4LBVA 1MVLA 2F1OA 3S2IA 4YUXA 1DTEA 4JT9A 5J58A 4IIJB 4ZJPA 3PXDA 5KWEA 5JFGA 1NQVA 1MX1A 4HQNA 3Q7PA 1FVHA 3IPRA 4W8GA 3ETDA 1JXOA 2RHJA 3EFOB 1HFKA 2CSXA 1SY7A 3DZDA 3JQ8B 3L0YA 2ZJ5A 2RH8A 3DEIA 3FJ1A 2ZUFA 3MB8A 2GERA 1TAGA 3DL0A 3E3LA 3OHSX 4XRRA 2NO4A 4W1PA 2AL7A 2OYRA 5EJIA 5H82A 5BR4A 3VDNB 1FUYB 4KKXB 5EXSA 5IM4F 1C8VB 1G21E 1P31A 2RHMA 5H81A 1QQ6A 3VSEA 4OFWA 2SKEA 2ECPA 5IYZB 2NP6A 3K05A 3FNRA 4GOJA 1E7WA 3BJEA 3IAS6 3GZJA 1Z4QA 4NV3A 5FOWA 4NBLA 1Z5VA 1VSBA 4M1KA 1J09A 3TR6A 4ZXFA 2JAHA 4MUAA 1DC5A 4RF4A 1L7MA 2CEAA 2QR2A 3DWGA 3LHKA 3RPEA 3RREA 3RC8A 4OLBA 3OZVA 1GDHA 3EDOA 3F3YA 2VQ6A 1K5GA 4NEQA 5ALNA 1QV9A 1DRUA 3FDJA 1W94A 1CYDA 3GA7A 3GB9A 3EGDA 2GRJA 1DIHA 4MVXA 3GBSA 3KSDO 5KQMA 5DTQA 3W6PA 1PF7E 1OC2A 4BZQA 5BNTA 4GR9A 4IIXA 4R40A 1EVZA 2QZZA 1U1EA 1P4HA 1SVKA 3B8EA 4LDNA 5K8UA 2OK8A 3DGEC 1QG2A 2I1LA 4FUTA 4AYTA 1WP9A 4LZLA 3LU1A 1NBHA 4DJTA 4YGYA 5FQNA 4G5RA 1CQIB 2AW5A 2PQ6A 3RK4A 2Q4RA 1LDGA 1LVHA 2LXNA 4GM4A 3A3YA 4GGOA 3T5DA 2FPWA 1E5XA 1A4UA 2D3TA 2FQQA