1JF8A

X-ray structure of reduced c10s, c15a arsenate reductase from pi258
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
130
structure length
130
Chain Sequence
DKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords arsenate reductase
publication title Arsenate reductase from S. aureus plasmid pI258 is a phosphatase drafted for redox duty.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 49
structure length 130
sequence length 130
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jf8A00
1BA2A 3DBIA 5KWSA 2LIVA 3HDVA 1C4WA 4Z9AA 2A9RA 4S04A 2TMYA 3QELB 2WJAA 1YIOA 3LKBA 4XARA 2R4QA 3KLNA 4PYRA 5IUKC 4O1IA 2H0AA 4OBBA 2KYRA 4RZSA 1GUDA 1JYFA 3QX8A 3BILA 2WY2D 3O75A 3JTEA 2QZJA 3N75A 3MA0A 4N47A 3DGEC 1M5TA 3DLHA 3IDOA 3HM9A 2VK2A 4IMIB 4ETMA 5CNKA 5EWMA 3T95A 4E7PA 2QSJA 3HZHA 2FN8A 3IPAA 3FFTA 3OLXA 5I4CA 5IEBA 2I6FA 2CHEA 4PE5B 1P6UA 2E4ZA 3Q41A 5IBQA 3I45A 3DLBA 3F6PA 3KKEA 3FDFA 2VUIB 2JVIA 4MR8A 1D5WA 5IEJA 1TMYA 3CZ5A 4HNRA 3OMXA 5C5EA 3JPWA 4EVSA 1JX6A 4G0XA 2FXIA 3HUTA 3HVRA 3NHZA 1TVMA 2ZAYA 3N6VA 4RV5A 4YCSA 2QVGA 3CZCA 1LJLA 1LK0A 1JWLA 1TM2A 2DRIA 1DBPA 3HUUA 3O2JA 4MGEA 4OLBA 1P2FA 1NATA 3OLZA 4YS6A 2Q5CA 2PAFA 5F64A 3ROFA 9ABPA 2XDYA 5FWXA 1JLKA 2NUBA 5DTEA 3HV2A 4XAQA 3E61A 1LBIA 4WUTA 4QYWA 1VLZA 3BREA 4M88A 4W5RA 2NZUG 3A3KA 1APBA 2BGGA 3A10A 2PUEA 4B09A 1M2FA 1USGA 1BAPA 3KYJB 4Z4GA 1Z16A 2B4AA 2YHBA 1ZVVA 2HPHA 3E3MA 5EWJA 4DQDA 1BDIA 4YWHA 3RQIA 4MQFA 5IUJC 1SXHA 4RKQA 5TPZA 5KC9A 3ROTA 2IPNA 4EVQA 4N41A 1K66A 4LE2A 5IULC 2CD7A 1U04A 5KQLA 3DGFC 2AYXA 3JVIA 3BBLA 3H5VA 4ETIA 2ZWMA 2P9HA 1QNLA 2FW0A 1QP7A 2PUCA 1U2QA 2ID9A 2FQYA 1Y1LA 3CHYA 3EDCA 2HQBA 4ETNA 4KREA 1JDNA 4F06A 3QX9A 1JDPA 2PUFA 2MYNA 3C3WA 1L5YA 5JNRA 3N0XA 1QO0A 1P8AA 1F4VA 3GBPA 4TLMB 2V0NA 3OO1A 5HSGA 1WETA 4IF4A 2NT4A 4FE4A 4FB4A 3FGZA 1KGSA 3ILHA 1JF8A 3LFTA 1U0SY 1ZITA 4NV3A 1NTRA 4L4UA 1NXVA 1MB0A 4RXMA 3T8YA 5KI6A 3GWGA 2ID7A 3GBVA 4IMJB 3HXMA 1SRRA 3M9XA 5ABPA 2GI4A 3ILYA 3KYIB 4Q6WA 5JS2A 3N53A 4MR9A 1Z18A 3HDGA 2VYCA 5B3JC 3CG0A 2QVCA 3GA5A 4JASB 3LOPA 1E2BA 3H1EA 3F6CA 2RGYA 1USKA 3Q9SA 4D74A 2OQRA 3LUDA 4ZJPA 4MS1A 1FFGA 4LE0A 1FFWA 2HSGA 3RVPA 3LUCA 4H60A 5BRJA 2HJ9A 2WB4A 3MYYA 3OM1A 4HYEA 4KFCA 3O2QB 4IRXA 3Q7RA 2AYZA 4DN6A 3KCNA 2WRZA 1DP4A 3MMNA 4MR7B 3SM9A 2RJNA 4N0QA 5DCLA 1XHEA 2HQRA 3IP7A 5BRAA 4RK0A 5CNIA 1PNRA 4Z4EA 3F7NA 1KRXA 5IUNC 4ZYLA 5E3JA 3JVDA 1W25A 5EWLB 4PEVA 3HCWA 3JPYA 1ZH4A 2PUDA 2LBPA 3TB6A 3NHMA 5BR1A 4OLAA 3NNSA 1ABEA 4Z4HA 1SXGA 5TPWA 4RK6A 2L2QA 4O1HA 3N0WA 4RDCA 4WXMA 1A0OA 2QR3A 4QPJC 2VUHB 4D6YA 1D4ZA 1EFAA 1E6KA 1VKRA 4NQRA 2FMHA 4KMRA 3K4HA 3QEMB 5TQJA 4LRQA 3RVOA 4D6XA 3RVSA 3KJXA 1YS6A 3MQ4A 1PNTA 1Z26A 1ABFA 3MM4A 3CTPA 1K68A 2PUGA 4DADA 1EHCA 3VNAA 1A2OA 3LUHA 1VRVA 2PL1A 3MIZA 5HM6A 4Q7EA 3M9WA 4G0OA 1DBWA 3GRCA 4YRZA 5JNUA 5CHYA 2MYPA 4MS3B 5FWYA 3O1HB 4KV7A 3H6HA 3H5WA 3UKJA 3R0JA 3URMA 5KQGA 4QYMA 4NCBA 3KG2A 4RK1A 1RXIA 1DCMA 3L6UA 4OATA 3JY6A 4EVRA 3EODA 4FE7A 2FSPA 3CLKA 3OLVA 5JS1A 3G85A 1YTUA 4TN5A 4KVFA 1ISRA 1E6LA 2PUBA 1Z2EA 4LX8A 2PMCA 3RH0A 5FBHA 3TD9A 2JK1A 4MQEA 4KRFA 1CYEA 2FN9A 1YK1A 4YR7A 1GCGA 1ZDMA 2A9OA 3MF4A 2JBAA 4RY9A 2FTKE 2L17A 3I5AA 1DRKA 4OG2A 3UUGA 2JVKA 2R25B 3T38A 3RVLA 3RVQA 3GYBA 3GV0A 3H5IA 4Y9TA 5GQSA 4WZZA 2F8SA 3C6QA 2H3HA 1ZY2A 1JL3A 1GUBA 1JYEA 4MRMA 3P9YA 2MSLA 2LUOA 5TQ0A 2IYNA 5IC5A 4ML3A 4G0MA 4RY8A 1RPJA 2NT3A 3HK2A 2R47A 1ZHHA 3LUAA 3HO1A 3RVNA 3BRSA 2R48A 3FMVA 1QKKA 5PNTA 1D1PA 2FKAA 5T7BA 2PLNA 3O21A 3QLUA 4ZMRA 4RU1A 4KQ9A 3TX6A 1JH9A 1XWWA 3N0RA 4YO7A 4WT7A 4Z4CA 2QV0A 2GX6A 3QELA 1USIA 2FMKA 1RXEA 2CHFA 3EULA 3H5LA 1EWKA 3QLVA 4W5NA 2FVYA 2PJUA 2O20A 1LBHA 4LE1A 4Z99A 3W9SA 1BDJA 1PHRA 2F8TA 3H5OA 2JVJA 3O1JC 5DGCA 3EGCA 2JRLA 4KK4A 3VNBA 2E4VA 4L85A 1DCFA 3LUFA 4MR8B 4TMYA 2PE5A 1ZGGA 2PKXA 3KTOA 1ZN2A 2E4UA 3LKVA 4N03A 3SY8A 4EY3A 5HKOA 5JNVA 2QW1A 3QEMA 2GWRA 1NXPA 5DKFA 2MSWA 3F73A 4Q6BA 2YHAA 5DLEA 3CU5A 4F12A 1Z15A 3A0RB 2FQWA 1BDHA 4GPAA 2PL9A 1VPWA 5C5CA 1DCKA 2FMIA 1L5ZA 2HQOA 3OLWA 1CEYA 4JB2A 2IKSA 1W9HA 4MS3A 1JFTA 3A0UA 1MB3A 5FWXB 1S8NA 5TQ2B 4MLCA 1NXWA 2WWVD 7ABPA 3HJFA 1NXTA 1CHNA 4JOQA 3SAJA 4RK5A 4TLLB 4YP9A 2FEPA 3Q7TA 2M1ZA 2NZVG 4MS4B 2MSKA 3OLYA 4G97A 3TO5A 1U2PA 3CS3A 4N0PA 2X7XA 5IX8A 4G0YA 4KPYA 4UHJA 1M5UA 1Z25A 1E6MA 3M6MD 5EWJB 1I3CA 3QLTA 1QP4A 1QQBA 4MQFB 1DC8A 4OTZA 1EWTA 4PICA 1U8TA 2LPMA 4KQCA 1J56A 4EYGA 4UHKA 5KQMA 4W5OA 1QPZA 4Z4FA 3HEBA 1H9CA 1R8JA 3KSMA 4JP1A 4ZMSA 3QLUC 2IPLA 3NNNA 1T34A 3Q7SA 1FSPA 4XXHA 2E4WA 2GKGA 1LJUA 4IGAA 2OENG 1MVOA 1KRWA 3CRNA 3QLVC 4HNSA 4IILA 2MYTA 1D1QA 3CG4A 2L19A 4RKRA 4YV7A 5BQ3A 2PUAA 1QQAA 1TLFA 3IP6A 4YLEA 1DC7A 4F8JA 3JS5A 4RK7A 3OMWA 3L49A 2WMYA 4EUKA 4N76A 1QP0A 3EJWA 2IPMA 4RXUA 4XLTA 5KQPA 5TPZD 3LUJA 4MYRA 1ISSA 4JAVC 3LUGA 3H5TA 4S05A 1NXOA 2LP4Y 3RVRA 2QU7A 3CKMA 5CNJA 5HQJA 4EYOA 3G1WA 1ZH2A 4EYQA 3IP5A 1EWVA 3H1GA 1DBQA 4H3KB 3Q15C 3RVMA 3C3MA 3RVJA 4MR9B 4XASA 4G0PA 1Z2DA 5FBKA 2IOYA 3GL9A 2JB9A 3K9CA 3HS3A 3NBMA 1QO0D 3NNDA 4ZPJA 1NY5A 1QMPA 2GBPA 4MS1B 4P98A 4W5TA 3O1IC 2FLWA 5KC8A 4RXTA 2FQXA 4W5QA 1FFSA 1HEYA 1SXIA 3FFWA 4RY0A 4RSMA 1DJMA 2E4YA 3D8UA 3O2SB 1B00A 5B3JA 3I42A 1M2EA 3KS9A 3IPCA 3SNKA 2IPAB 2M98A 3KLOA 2MYUA 3OQNA 4LZLA 4QICA 4RWEA 3EQ2A 4LDAA 1GCAA 2FEKA 5D2CA 5JNWA 1ZGZA 3GT7A 3I09A 3UK0A 4Z9BA 1BVHA 3SG0A 5TQ2A 3SQNA 4MR7A 3B2NA 5TPWB 2W42A 1PEYA 3C3KA 1TJYA 1UDRA 6ABPA 1RZRD 1DG9A 1D2AA 1JBEA 2FLKA 1JFSA 4RK4A 4MS4A 3N8IA 1YMVA 4HNQA 5EWMB 2QXYA 3QEKA 1DRJA 1IIBA 3H1FA 3S99A 3D02A 3LMKA 2JCGA 3OO0A 3IP9A 2FMFA 4G86A 4WWHA 5EWLA 8ABPA 5ED4A 1YMUA 4WXEA 3OM0A 1NXXA 1RNLA 4F3TA 2B1JA 2RJOA 2WJWA 4PZ0A 3O74A 4NICA 3CFYA 1A04A 4MLDA 1YVUA 1GLGA 4LDZA 1YS7A 1AB5A 4MPTA 1EAYA 5FWYB 3RVKA 4GNRA 4NCAA 2A9PA 4XFKA 3DZDA 5JNTA 3LUKA 2RDMA 4G0ZA 4KZKA 1ZESA 3OQMA 4F11A 4P1ZA 5TE9A 1OXKB 2CWDA 3H6GA 1SD5A 2P4UA 3C97A 4RS3A 4JA2A 2FEWB 4MQEB 1Z17A 1NXSA 3CNBA 3FFXA 3H75A 4O5AA 4EYKA 2L18A 2IDMA 1F51E 2JBAB 3KHTA 1XHFA 1URPA 1Z13A 5JNSA 1JHZA 3T6KA 1PUXA 4Z4IA 2J48A 4CBVA 1OXBB 1YK0A 1Z12A 5GOTA 3LTEA 2A9QA 1JFVA 1MIHA 1KMIY 1ZAYA 4YGXB 2N9UA 4MRMB 1P6QA 3OQOA 1C0EA 5TQ0B 4Z0NA 1MAVA 3HSYA 4JB0A 6CHYA 1RZRA 4KNYA 3BRQA 3EQZA 4G0QA 3QK7A 4H3HB 3EAFA 4E7OA 5CNMA 4KK3A 4EGSA 4MAAA 2E4XA 1FQWA 1DZ3A 1PEAA 3TMYA 5T3YA 1AB6A
chains in the Genus database with same CATH superfamily
4E46A 3N2IA 3O2NA 4G5QA 4OPMA 1Y5RA 4YT4A 3OLQA 4N54A 3LKBA 1TUIA 5IUKC 3W77A 1G8YA 1XL0A 2HDHA 2X9NA 3EEQA 3GNQA 3SJZA 3U81A 3N8NA 3TLYA 1TEXA 2PMWB 4ZTBA 4C07A 1X74A 3OZTA 3T06B 4B84A 1YRLA 4IGKA 1XTSA 2PO5A 3SLKA 4BB9A 3OURA 4DIMA 3HI6A 3CH5A 4DT1B 2VA8A 1IBRA 1TIBA 1V3UA 3J80A 1UZUA 5KWIA 2YTZA 2RFLA 3BGSA 4OA5A 4O2BF 5KIAA 1X1AA 4X3OA 4XOUA 5DM4A 2D1YA 4LNUA 1JUDA 1VZ2A 1ZUIA 4XX0A 4FILA 3UJDA 2I4OA 1YCFA 5KPDA 3NKFA 3V55A 1NUHA 5COAA 5D8DA 3CX7A 1QV6A 3U13A 4B3JA 4EI2A 1RVDA 4MRNA 3T1VA 3JASA 1IC6A 3UAGA 5H0IA 1SBYA 3IOCA 4NTZA 3Q41A 3Q3EA 5K8UA 3I45A 3IT0A 3KB1A 1N2HA 4GOKA 2QR2A 3FWKA 4GBGA 4LY0A 4RSMA 2II6A 5KX5A 1OXSC 3GDWA 4HRVA 1EWQA 5WRFA 1O9HA 5SY4A 3AF3A 4K6HA 2QN8A 3GRKA 2QNRA 2XMSA 2PNFA 3RJTA 4WDQA 1HYBA 3MFYA 5C0OE 2ZAYA 1ULUA 3QFRA 2Q2WA 2L0XA 3HNPA 3K1TA 3MFQA 4HZUB 4AIRA 1I4TD 2QU8A 4OHZA 1D6NA 5K2MA 3AB8A 2P41A 1S5PA 3FUCA 2BGNA 3K73O 3PCXA 5B4TA 4CKCB 4I2VA 3KEOA 5DOZA 2Y0PA 3VR6H 3O2JA 3FUUA 4G0NA 2NQTA 2OHIA 3BHMA 3BMOB 4OSEA 2XOEA 3GCXA 4YJFB 3EXG2 1Z7EA 4YPVA 2EX0A 1Z35A 4YROA 3L1IA 1DQYA 1H3NA 4C43A 1A8UA 1L8LA 4GWLA 4R83A 3UM9A 4QKQA 1ISPA 1Q16A 3OX1A 4BECA 3AUFA 3NH6A 1QMGA 4JBHA 3TECE 3LX8A 1XJQA 2X41A 5HCNA 4NCXA 5BNFA 4BJ5A 3THXA 1Y5MA 3IDQA 3VVCA 3VNUA 4LSZA 3TSWA 1A5BB 4Z4GA 3T3MB 2GNAA 1FFXB 2ZUDA 4CKWA 1EE2A 2PTHA 1FP4B 4UTXA 3E3MA 3QMMA 3OD1A 4DQDA 2AL7A 3OIYA 2JDIA 3PFIA 1TYZA 2I8CA 3LO8A 4NZNA 5CVDA 1EE9A 3E9MA 3QBTA 4JJEA 4XW2A 1R6XA 4CJXA 1I3NA 2VPPA 2VXBA 3UA3A 5LP6F 1LQUA 4ATNA 2DERA 2ZYWX 4FYIA 1V3TA 3ZC3A 1KTVA 2J6BA 3I9MA 1QFZA 3OA0A 2JFOA 1RW4A 3ZQUA 3KCQA 5E6RA 1DBVO 4JLBA 1PL0A 4ZGGA 1TVEA 2RI0A 1DG1G 1ODJA 2P7IA 1REQA 4H59A 1A82A 4IWNA 1L5YA 5FEMA 3E9DA 5KHAA 4RHEA 2XYRA 4D25A 2YWJA 2A9KA 3BGOS 1WETA 4P3NA 2AIRA 1RLMA 4NE7A 2AV6A 3EBLA 3O47A 1EQ2A 3RFFA 2O0HA 4KYUA 4D9BA 3UJHA 1JF8A 1KH3A 3LFTA 3C41J 3K2BA 3KOWA 1ETUA 3UAVA 1NTRA 3AWIA 2ILVA 3JQBC 4RCYA 2BTQB 3F96A 1RI4A 4FIDA 1WP4A 4LJKA 1U3UA 2BEUA 4ESEA 2A5YB 2J8ZA 3SHVA 2QSUA 3D2LA 4GC5A 4KMMA 1JILA 1G8MA 3G79A 3WGQA 3X43A 5ABPA 5AW8A 1CY1A 4U00A 3CUEF 1EXWA 1P1FA 3KYIB 1B8NA 5FA8A 4OQLA 5B3JC 3G8AA 3T3EA 3QBDA 4NAHA 2GRUA 2D5AA 3COYA 2BUBA 1LRJA 3GUZA 3B5JA 2W98A 3LM8A 3L6CA 2WUGA 4MJLA 3CZMA 4Z2YA 4Q4AB 4M49A 1T6NA 1ES9A 1WNFA 2ENWA 1KZ9A 3LX5A 1MORA 3DUWA 3TG2A 2GYVA 2REQB 4HWPA 3SF0A 4YECA 3W6PA 5LQRA 4KFCA 4LBWA 4WGGA 2GVNA 5K0SA 4I3HA 3MMNA 1GPH1 1Z4KA 4MXDA 4D97A 2RJNA 4G4SP 1BH2A 3I6MA 2XGSA 2XW6A 4OOFA 3EZ7A 3KYBA 4C88A 4RSGA 5COBA 3TLJA 1QGYA 2HPVA 5KVAA 2ZI9A 2R4TA 3GN1A 5BP7A 4JHXA 1ICIA 2ESRA 2IVZA 4U7WA 4XUEA 4YDRA 1AHNA 3ST7A 1FFAA 3DMDA 4BQSA 5CXUA 4DLSA 3W3AD 4LYAA 3ZGVA 4PEVA 5AVYA 3JPYA 2PUDA 1R00A 3MINA 2NO9A 3BQNB 1N2BA 1USWA 1XZGA 5I7AA 3OFKA 1A5TA 4TRMA 4YMVA 1LSSA 1B3RA 2W11A 2Y71A 5DGTA 5FOQA 2VNSA 5DNUA 2ZUEA 3AVOA 1GD1O 4UMVA 3KAJA 5FQOA 4GX2A 2C9DA 3OPXA 2ZIUB 4MVJM 4HLUA 2OCYC 2WYVA 3DVLA 2C5HA 3DYIA 2CBXA 4O2AA 4YRKA 3A1UA 3I4CA 4EGFA 1P0IA 3K4HA 5TQJA 4LRQA 4QZVA 5EEHA 3ZJ5A 4DV1B 1Y1KE 4MUEA 4R8MA 3SZMA 1HLGA 4IVRA 4BLQA 1R18A 5K0EA 5CITA 1PNTA 5E1DA 4UNSA 4EKNB 3RNOA 3VNAA 4HRYA 9LDTA 3FZEA 5TJ9A 1AG9A 1SWWA 3EGXB 2I9PA 5GWXA 2YYSA 5BYBA 1VE5A 1OH6A 4KKXB 1WB5A 1KOFA 4PR0A 1ONOA 4RFSB 5L6LB 1ZR2A 1QRDA 1ZVJA 3BC1A 1P7CA 2Q6VA 1CIJA 4FWIB 4E88A 3H84A 4JX9A 3P9RA 3KQYA 2W4MA 1G98A 3WB0A 3FUTA 1J99A 1LS1A 3BXGA 4OVKA 4D9KA 4J0EA 4F5YA 2PR7A 2VDOB 4HPXB 1MQ8B 5DYWA 1VCNA 1EM6A 3AL2A 5HUHA 3EODA 4TTJA 4N3BA 3BL6A 2AFHA 2XMBA 3UWPA 4HL6A 1AQJA 1YRAA 4G3XA 1B6TA 4DLLA 2RHRA 4HDCA 1YL7A 2ZS8A 4ZEXA 3IJPA 2ZIVB 3U7RA 2OHVA 4EO4A 5KINB 3R6GA 1IJFA 1KBZA 1THGA 2A9OA 2XB9A 1H5NA 2JIBA 4NCKA 2Y99A 3BBPA 3I5AA 4NBRA 3OESA 4JYBA 3TRKA 3IAM1 4H7HA 4QNMA 4EX7A 4N1AA 1K8RA 2JIZA 4XKJA 3KQOA 1WG8A 2FE1A 3TOSA 1KY5A 5GQSA 4DSOA 2H4HA 4G37A 2JGEA 2REBA 4HYQA 4RKYA 5G0VA 4BX2A 4NOJA 2B4TO 5FNVB 4B6JA 1EJ6A 1TQ8A 3L1KA 3P9YA 3GFRA 5AK0A 4DVJA 3RCBA 1H0KA 1UMDA 5TQ0A 3UJBA 1G16A 3ZJTA 3T3OA 2O50A 4E94A 1NLYA 1RPJA 3CUTA 5AVOA 4ZV7A 3LQ1A 4F71A 4AF8A 1DAHA 4Q9DA 2G0TA 1WABA 2IUEA 3WS7A 1JIUA 5C81A 3HO1A 1J5EB 2JFUA 4NU5A 1UPFA 3BGIA 4ZHQA 4Y6RA 2YWXA 1I6MA 4GZLA 1Y1RA 2NVUA 4KDRA 3DDWA 4Y2QA 3MJDA 5A4MS 2UZ0A 2AE1A 3TX6A 4LRSB 3N6XA 1J07A 1SZDA 1XWWA 4DBLE 3NORA 2BKVA 3C3XA 4EFLA 4MVWA 4X8MA 1NFRA 3RPEA 4TWJA 1LK7A 1JSCA 4NLLA 2H54A 1VLLA 2C2BA 1KC1A 4G8JA 3V1KA 5BW8A 1ZM9A 4AAYA 1BFDA 1LBHA 1R50A 1MR3F 3QU4A 3ZG6A 2TMKA 4AMVA 5BSKA 3QW4B 3C4QA 4BLPA 3L4KA 4G01B 2Y1WA 4B9AA 4LKRA 5KMGA 4O2BB 3ZCUA 4GWGA 4PO1A 2RB5A 2VKTA 2VQ3A 4Z0HO 3VR3D 4DCTA 3S8EA 3QJYA 4MR8B 3PNKA 1BTOA 5AOVA 5FF9A 1UFKA 5JFOA 4YMLA 4L16A 2Z8YM 3LC1O 1A77A 1O6CA 2P8JA 2QW1A 3IQGX 3TD2A 1O58A 1EDBA 2IPOA 3AFNA 4HATA 4GX0A 4E70A 2QLLA 4QBFA 1T1SA 5JMWA 3ZV5A 3SYTA 3VAZA 4IDEA 3NOOA 5C4MA 2XWSA 1R0SA 2OK8A 2PRJA 5CVJA 3AM5A 5K6TA 3L6DA 3KB6A 4ZO4A 5AW2A 1N34B 1KYYA 3RVDA 1ADFA 4TT3D 4KR2A 4UU7A 3ETJA 4ZKEA 3TSAA 1DQRA 2D2IA 3GT4A 3RVBA 7ABPA 4WKNA 3O95A 1H22A 2IXTA 4H15A 4A8JA 2AW5A 3BJRA 5B4VA 2I4LA 2ZTUA 3PA8A 4QU0A 1KPGA 1E8MA 1KVSA 4WFQA 2MINB 1Z39A 4O4JB 3K0AB 5ELLA 3P4XA 3H6KA 1FXUA 3G2HA 2BP7A 1CJUC 1FRNA 2AOVA 4WJLA 2H0QA 3IJEB 4C76A 2FX3A 3JYNA 3ZEIA 1EFPB 2EX1A 1E3QA 4B3FX 2ODPA 3M6MD 2IW1A 2ZJ0A 3QLTA 3ASYA 3QFHA 3RK0A 3THWA 4BJ6A 1MZVA 2BR4A 3M1AA 1VOTA 2Q27A 1J56A 3GNTA 2BE7A 2VPWA 4J07A 2V5VA 1YQ9A 3S5JA 4A0RA 3MCAA 3WC4A 4CN8A 2Z5LA 4E13A 1OZFA 4PXAA 2FP3A 3T5BA 1XK7A 5C46F 3ZNPA 5CYOA 4CG0A 3KX2A 4AK9A 3DG9A 2PLAA 4GVLA 1H85A 1Y1QA 2AXEA 2HCFA 2YHIB 3JRXA 3KNZA 1G3RA 3MK31 4K28A 4BRUA 1HT1E 3PF9A 4OKNA 5TR9A 1SUFA 1CY2A 4X20A 5CEFA 7REQA 1XQ6A 4ARZB 2ZZNA 2L19A 1ODCA 3NDIA 3FSJX 5AM2A 2ZQZA 4DDTA 3FTNA 4QEDA 8GPBA 4HAIA 3PQ4A 1Q12A 2HMWA 3ADKA 2J5BA 3KXDA 2GVDC 3QBVA 1VSUA 3OMWA 3EC1A 1SCKA 4RBNA 2CDBA 2HLNA 1UF9A 2FG6C 5KYYB 4WXYB 5TPZD 3T4XA 3JZMA 3AB3A 3QUQA 3N86A 1XCBA 2XCIA 2YV2A 3MTGA 1NXOA 3ZE8A 4BDSA 4CG1A 3V5NA 3ITEA 2REOA 2Y0EA 4ZO8A 1EK1A 4K86A 1YR9A 5CX1A 2CNKA 3GGCA 3TR0A 4DPMA 1DBQA 2J9XB 3VPBA 2RGNC 2DECA 1LPNA 4PAQA 4IL5A 4C06A 4R8LA 4R1UA 4WKGA 4J1NA 4M87A 5K3FB 3ZHQA 4S0ZA 4LF5B 5H83A 1RAAA 2GBPA 1GFWA 2R7NA 4YDHB 4P98A 5E0OA 3ZTWA 2PKCA 3WZMA 1C7QA 3ANTA 3N2ZB 1Z0JA 2ZYDA 3OH8A 4MTLA 5GV8A 4DLXA 2P3QA 1Q2UA 1HEYA 3PHIA 2AEJA 2DPHA 4G4GA 1OR8A 1VL6A 1YUNA 1A8PA 2VZ8A 5JADA 4HUQB 4JROA 4G09A 1YTLA 5B1HA 2H4JA 3NS7A 3IIJA 1VHLA 4E2YA 4NV1A 4ZAYA 2IEYA 2QPLA 1VCMA 3I01A 3VI4B 5EJ8A 2BFBB 3GELA 2UYYA 1JAYA 5TF4A 4K3UA 1THZA 2CNOA 1CRWG 3N59A 4OEHA 4PPGA 4X9XA 3RR2A 4C3ZA 4H1HA 1J25A 1E20A 2PMFA 2QOEA 4LOLA 4PLCA 2RHTA 4C5BA 4F1WA 4MR7A 4O8ZA 5EHXA 3KUCA 1OI4A 4K3VA 3TZKA 2DSTA 2YVKA 3L0IB 1FYWA 4B48A 2CJWB 4X71A 4TM8A 2YJGA 1CBUA 1T43A 1M8GA 3N8IA 4LOKA 2O8BB 5IJ0B 3GEIA 2B5WA 1I4LD 2GCPA 4NPHA 2H6EA 1E1KA 2ZDGA 4CW7A 2WV9A 1J33A 3S28A 2C8JA 3EGDB 3QM1A 1W0CA 4JVNA 4R8SA 4Y2XA 1J5XA 2CMHA 3VPCA 4D26A 1RLTA 1C3XA 4MRSA 1I2AA 2Q1XA 2VO1A 4PCVA 4F3TA 4KXQA 3TTYA 1GTVA 1CNFA 3LHKA 2V6GA 4F4HA 5IAAA 4W7HA 1NU6A 3RIGA 4Z54A 1NJ1A 3Q0TA 1A7AA 1CF9A 4XGIA 4YJ2B 5FWYB 1O7JA 3A9VA 3LPNA 4I7EA 3V8PA 1MMFB 3B9PA 1KZ6A 1VKHA 4F9TA 1C0KA 1C1YA 3WRYC 1T5TA 1XD9A 4G0ZA 4ZK6A 4ZYVA 3U39A 1Y48E 4M0KA 1W1IA 1LF5A 2IYUA 4LF4B 4M9ZA 3D0KA 3JQAD 3Q3GE 3QPVA 1NSFA 4LJ7A 1L8AA 3ZW7A 2J0UA 3DB2A 2JLAA 3GG2A 4FEAA 3C97A 2JHCA 2O5CA 1G6OA 1NXSA 1S4QA 1SHLA 3JCZA 1T2EA 1N2ZA 3U16A 2VJKA 3AZOA 2AFIA 4PY2A 4JQSA 3PT9A 2DOKA 1H8EA 1L5HB 3IA7A 4LQ4A 1OJLA 2FP4B 2J48A 1RYFA 2CXNA 2YMMA 1F2TA 3AOEA 2PJDA 3C4JA 3JZAA 4GKVA 1RFLA 3TTVA 4MRMB 3IVRA 4JR0A 1PLLA 1ICEA 1MAHA 3D7MA 4WERA 1RZRA 4PLYA 4R01A 1GLVA 5CFOA 3ZGZA 1N2OA 4EPVA 4FKBA 3NIWA 4S1NA 2DCUA 2WSLA 3KYDA 5AI0A 4KK3A 2HR1A 3EISA 1Y7TA 4K7JA 2AG8A 1H3FA 2E4XA 3UV7A 5E95A 4ENTA 4GOXA 2NXWA 2XEXA 1GCIA 1X80B 1CRLA 1RHQA 2Q0QA 3FTDA 4RZXA 1MQAA 1S7GA 5T3YA 1H2HA 4FCVA 3SBEA 1XMQB 3DBIA 3ZW9A 4XM2A 2IYTA 2RHGB 5I8ZA 2WJAA 4D0SA 4XIIA 1SG6A 1NPYA 2ZTSA 3MT7A 1KARA 2ODBA 2PZJA 3P94A 4K03A 3ZV3A 2FW6A 4M6WA 1E6WA 1XZQA 2OM6A 4UAVA 4AZ0B 1MRSA 3G9XA 4CTNA 2Q99A 5MF6A 3R9KA 3L4JA 4N47A 2PCLA 1FTWA 3OIGA 3EOAI 5LA6F 1CUZA 1RQGA 3WQQA 4I5EA 2YC4C 3Q8KA 2KQUA 2GFIA 4LSMA 1H8HD 1VRWA 2CV1A 1HDIA 1D07A 2OV8A 3BMQA 1RE1A 1H6BA 3VV2A 2RK3A 1U3TA 4TMXA 3ZU6A 1PW7A 2Y2UA 3NG1A 4WNAB 2DXIA 5CP8A 2A1UA 4LOJA 4QDZA 3S55A 5MGBA 2EBFX 4FJ0A 1IUNA 4ZANA 3VMMA 1OZ0A 3ETEA 4QUJA 3AGQA 3ONDA 2IYYA 1TMYA 1CY8A 4EG0A 4OX9Y 1M8KA 3K2IA 3MUNA 2QTLA 3WWZA 2GAJA 4MKRA 2XXAB 3AM4A 2APJA 4FFNA 5IJ9B 2WYHA 3EXAA 4Q16A 3B89A 1CDEA 4D9FA 4EGAA 2JGLA 1TVMA 2X9VA 2LDBA 1NUQA 4II7A 3OCWA 5HKKA 3QHPA 3UY4A 1M1UA 1I94B 1HYGA 5H3CA 1MQ9A 3OX4A 1MRZA 1NLFA 2ZBRA 2WG2A 3M33A 3OEWA 5CYFA 5AW6A 1NATA 2R8ZA 3HO8A 2XDYA 3NWJA 5FPYA 3B2QA 3GGSA 1WS6A 5C4IA 3IIMA 5J4KA 3HU5A 4EKDA 1T6YA 3I9V1 2LWIA 1A2BA 3KT0A 2DTDA 3JALB 3VI3B 1ULZA 1VLZA 4DCUA 2NZUG 2W2XA 3TVTA 1Q0SA 3U62A 1HBJA 4HEA6 3L3BA 4ZIRB 4PQGA 5JD6A 4J1TC 3LGAA 3PD0A 1CCWA 3AKDA 2R6HA 4ZGWA 2W37A 1HDRA 2HHLA 5F21A 1AQNA 4CIBA 3H5NA 2J67A 1MNAA 4RKQA 2J0VA 4OMFG 4QPCA 3F6BX 5A0VA 3LXUX 3WXMA 5IAEA 1AKUA 5BUCA 1GUZA 3CRVA 1KDYA 1BWRA 3H3JA 3GLGB 2IYEA 3ENKA 4KNWA 5F7ZA 5BWOA 3DDSA 4EFKA 3ZXSA 1QNLA 1E5DA 1V1RB 2ID9A 3GEHA 3PYXA 4GKBA 1KE1A 4Q15A 4X66B 2JGDA 3IP1A 1JAXA 3QX9A 2YH2A 5ICGA 4TTAA 3RASA 2ZAIA 2AWNA 5LZ9A 5DJ5A 5DHPA 2FR1A 5CT8A 3B6ZA 1X39A 2GK3A 2QN3A 4HXGA 3KJEA 4IZOA 4Z0TA 1WMBA 2NU8A 4L1KA 3ILHA 4Q39A 3BXZA 4QVGA 4XPZA 2E49A 3HI4A 3RAFC 4NV3A 2ZBPA 3IUPA 1SFRA 3AUUA 3UHFA 3IAS1 3HB1A 1KXJA 1SVWA 3FYUA 4MP8A 1IU9A 1C9MA 4YJGA 2WI8A 3T7AA 4EGJA 3GWGA 4X62B 1LX7A 5AH0A 4WZAE 1CP2A 2EL9A 3GI1A 2XVZA 4CDRA 4AWXA 1OC4A 5A03A 3QNWA 1WW3A 3EB9A 2HM7A 2J7KA 5IC6A 2Y9PB 4A10A 1ZR4A 1SIWA 3KJIA 3O3NB 3F6YA 3Q9SA 4RA9B 5FO1A 3E5HA 3VR4H 1F06A 2F17A 3GPLA 2YZNA 2MSCB 3CZPA 4WDRA 2FPIB 4Z8XA 4G5HA 1JQBA 4LGYA 1USUA 3R3ZA 3N0TA 2WB4A 2PLRA 4RPGA 3QVGB 3VM6A 4YT2A 3W5IA 4DZZA 3O7MA 3LBFA 5JISA 4MW4A 4FD2A 3KWLA 3TL2A 1DC6A 1LPPA 2JCVA 1LRKA 4Z1OA 1D09A 3BWEA 5EUBA 4R2WA 2X42A 2E55A 3MBIA 2ZSKA 3W2TA 5CB6A 6REQB 4CNBA 3ENNA 3PKIA 3D3EA 3GGJA 3HKEB 2GVZC 2ACKA 4NZMA 1BX1A 1W25A 3BD7A 3FW1A 5EWLB 3O4GA 3TOZA 1FTQA 3FKSD 2VDKB 3JYOA 4CKEA 1A7UA 3WFIA 3KWJA 1ABEA 1OC2A 1V2HE 1SXGA 4RK6A 1F8GA 4JBYA 2JCSA 1VLQA 2JATA 1ZM3A 2R5NA 4YQFA 1ESNA 3GLFE 3HU2A 4HDNA 1ZHOA 2G63A 2G67A 4GP6A 4HGNA 5I8PA 3ELWA 4GXNA 3OCCA 2PWYA 1PKEA 5J1TB 1Z8DA 3TKYA 3ZCXA 4DBZA 4UTRA 4HGZA 2ZE5A 1RBYA 1H4TA 1CRQA 1O5OA 2P27A 4HFNA 4W1PA 4X5OA 4ZT4A 1MOPA 5EQJB 2GO7A 3K05A 3HBMA 4LRWA 3U4MA 4LK2A 5IHPA 2JIRA 3VO1A 4MV6A 3UWOA 1Q7BA 3H3FA 5FI1B 3CVYA 1VE3A 4KXFB 2WF5A 3TGLA 1ZCJA 4RIGA 4EATA 3R0JA 5K8LA 3PXDA 4C4OA 2CLHB 3OFVA 1U0BB 5K3CA 3QNUA 1YZHA 4ANFA 1A9XA 4NCBA 4FVTA 3KBBA 2H65A 5F4BA 4DF3A 3V8RA 1U0TA 1LV8A 4TRJA 1EDDA 1P2TA 1GG8A 1PEDA 4FYJA 1NI3A 4IDPA 4L9AA 3UAOA 1JHYA 4HFRA 1KVTA 1ISRA 5AQ1A 1ZN9A 4EJSC 2R6DA 3MD0A 1UDCA 2C0QA 3R5JA 5JQGA 5ARBA 1A2KC 2I4TA 1TTQB 1ACLA 2OV2A 4D56A 1Q15A 2L17A 1OJ7A 2ZDHA 3H87A 3LYLA 4GYJA 5LXTA 3AEZA 1E5QA 2A30A 2PEYA 2VJCA 3ORHA 1GZ7A 2R25B 1KERA 3AEUB 3RD5A 3T38A 3K20A 4DNQA 3E8SA 2BAGA 2Y1OA 5CVVA 2FWRA 4OYHA 4CIAA 3L6OO 3C8ZA 1BXRA 2I34A 2QRVB 3A1FA 4NFLA 3CX4A 1R0LA 4AKIA 3F7MA 3PYLA 1TCBA 2IS6A 1ZSVA 4EHBA 4LJSA 5IC4A 1DBRA 1RTTA 4DCPA 1LBEA 3UMYA 3OA2A 2Y6UA 1O3YA 4RFLA 2EIXA 4GT1A 1BXGB 2EZUA 4G24A 1PFQA 3AV0B 3UJCA 4P3OA 5DISB 3NP9A 2P91A 3QF7A 2C4VA 1KKMA 5FOWA 4C2UA 1VE1A 2N46A 3D5QA 3F5MA 2PLNA 3I6YA 2FRXA 1KAQA 4G26A 4AFNA 5JU6A 5DH9A 3RUHA 3KFLA 4UNPA 3NDPA 4HLUC 3DT6A 2FMKA 2DU8A 1AA6A 1KNQA 3K6JA 4FDLA 2H7XA 3U60B 4DMCA 2V45A 2FF7A 4J03A 1TXGA 1X92A 4ALIA 3IIIA 3GAFA 3HCAA 4GQBA 1NMSA 5LA6B 3S7TA 1HDEA 1X7XA 2G06A 3IR6A 5HILA 5BR8B 3ICQB 4CQMA 4KLNA 4XVQA 3KTOA 4RM2A 3SBXA 3MRSA 4MIEA 3WYAA 4DLZA 3W5UA 2DR3A 4DCOA 4NP6A 4DABA 2Y4OA 1HE3A 2F3SA 1YUMA 2FSFA 2J30A 4ZVMA 3FD8A 3L6EA 1GZ6A 3KR2A 4KFUA 5EERA 5NLLA 1XU9A 1ZKMA 4R0VA 4PG7A 3UBTA 1FYEA 2C5AA 1WNTA 5B58C 1GR0A 1U7XA 2H5IA 3R5SA 1JKFA 4RD1A 4XGQA 4FM9A 1KMHB 1VPWA 4DLNA 3OLWA 1RADA 5AUPB 3H8SA 5HQ3A 4OIMA 1I36A 1S3GA 1Z0KA 3P20A 3ZKWA 3G1TA 2Y05A 2VZ9A 5T6MA 1EKXA 1TCCA 1EDOA 5FWXB 5TQ2B 3RYTC 4LWQA 3SF8B 2PT5A 4LXTA 1NYLA 4N4AA 3I4LA 1RIIA 5C51B 2Q6KA 2E5WA 3DDUA 3T4EA 1XQYA 4YP1A 4AMYA 1OLUB 1VMIA 1T10A 3L9XA 5DM60 1TC1A 2GPSA 2KMLA 3KPYA 4HLQB 5FX2A 1VGRA 2V65A 5AJHA 1EM8B 1SD2A 3CIOA 3VR0A 3K9QO 5CXSA 9LDBA 4WHMA 1J9GA 1YZTA 1NQVA 4U4AA 4DQKA 4GI3A 4XRGA 3JRNA 3NDBB 4I1IA 4NCNA 1Y5NA 2QK4A 1UBMS 1RXSA 1ZOIA 2NO6A 4Z4FA 2W2LD 3OD5A 4NOLA 2BE9A 1Z62A 3I6IA 3I2YX 4BDTA 3MJTA 3KK0A 3CURA 3UHOA 2OV6A 3KVOA 4ZAXA 2ZBDA 1KEKA 3B7WA 4XIFA 2ODAA 3SDBA 3F3SA 4YRPA 5E7IA 2Y1GA 2WP8J 3S3TA 3FCAA 1KFEB 4KAJA 1A9ZA 1LJUA 4WBSA 3P9CA 2CVPA 3CT6A 3CGWA 4LTMA 2VHCA 3SI7A 4C7XA 3MCUA 3ZWNA 1M6VB 1LXCA 1RI2A 5LJIA 2UYQA 4RNDB 2OXTA 2DR0A 4GE0A 4ND5A 4LVOA 4EF5A 1P8JA 4XLTA 4BVGA 3I4FA 2PKRA 3IDFA 2JHGA 3R74A 1M54A 3KR1A 3FYSA 5EJ2A 4IQ0A 4OA8A 1KFKB 2VP0A 1PIWA 2IUUA 3UJ8A 2WNHA 4UMEA 4ZV9A 3VYWA 5BN4A 2OMEA 5FH9A 4XEHA 3RYIA 1W88B 4H3KB 1HTWA 3ZLTA 2FDCA 5M2QA 3RVJA 3IOMA 5DYIA 3RB8A 3P2IA 2JKVA 4ASUD 2HN9A 3U40A 4TL8A 1Z6GA 2JFVA 2XUDA 3FB4A 4RF3A 3IMKA 1AZWA 4R5MA 2JI6A 3O1IC 4W5TA 2PNJA 2FQXA 3W06A 5HCIA 2JJQA 4KOAA 3WQRA 4N6NA 5AKLA 4LUCA 1QH1A 4G67A 1IWOA 2C03A 5KOYA 2K4MA 4OGKA 3LE8A 4KN6A 3O2SB 1HE2A 1FA9A 3F90A 3RWOA 4CM4B 4DV3B 4YBRA 1DKNA 3I9FA 4XOIA 2DBRA 1JB9A 2OLEA 3RYHB 1SOWA 1I7NA 1RZUA 1JDTA 1VB5A 1Y6ZA 3EDQA 5DXFA 2RB4A 5I9BA 4G0WA 1P0MA 3HBJA 4DWVA 3S2EA 3Q2KA 2OY0A 1W5TA 5AXAA 2OA0A 5DASA 3FKQA 5DYNA 5GTDA 2XPCA 4FMBB 3UYLA 1IXZA 4PM4A 1YWGO 5DXJA 1FW8A 3PENA 4DJFC 1WXFA 3G2LA 1FDUA 2GM3A 1X7ZA 1KQFA 1BSVA 4FQ7A 4EAAA 2J4FA 4R2LA 2YXPX 4NMLA 5FULA 1TK2A 4MMZB 4BLWA 1G6KA 1JBEA 1NR5A 3B85A 3V7NA 2M6KA 4EZBA 4F72A 4XDHA 4B45A 2O8NA 4W8GA 2SCUB 4JP8A 3U4HA 3P9QA 4L73A 3KJQA 1PW5A 3EXHA 5CA1A 2YS7A 5BURA 3QRWA 2QN1A 1JJAA 1NUSA 2XITA 3K0FA 1PQPA 2A86A 3W8DA 4R9UC 7GPBA 1KY2A 1NDHA 2ZRJA 3HYSA 4RGQA 3WAKA 5KOHB 2WJWA 3TYXA 5I3ZA 2IEDA 1GA6A 5F76A 1BE1A 1KDOA 4PFKA 4CTJA 3DP7A 4OYYA 3KUDA 1J00A 1P7YA 3D6AA 1UPTA 2WM2A 2OP1A 2VJBA 1NVAA 2YMLA 4GNRA 3B5EA 3SS7X 2VAXA 4CCYB 1OFUX 3W8FA 5FNZA 4DUGD 5E3IA 4XYMA 1XEXB 3QKIA 2AS0A 4H3VA 5J40A 5JY6A 1QVAA 2R84A 5DYYA 2RHLA 3K92A 4KYVA 4NSNA 4XCVA 1ST3A 2VJDA 4Q9NA 1EA5A 4JA2A 3TBHA 2IK8A 4MQEB 4ZAZA 1XZKA 5I9TA 3X3HA 4B3GA 1UFQA 4EYKA 1Q44A 1KVUA 4PCUA 4B6FA 5ADUS 2G9VA 4D0GA 1MBZA 1ODIA 1KO4A 1M2HA 3FWPA 4YUYA 5JNSA 3T3GA 3ZV6A 1X70A 3F7TA 5DBGA 3ZWYA 1UXKA 5FBZA 4EPXA 2ZIFA 3VC1A 1BYIA 5KU1A 4E0BA 3MXTA 4R51A 5IZ4A 1RBMA 2CCJA 1K06A 4EABA 1T15A 1LQTA 3BXXA 3N2KA 4JL8A 5FR1A 3TPFA 2A4MA 2AH5A 4NAVA 3OJEA 2V7EA 1SVNA 3LDHA 1UH5A 1TAQA 1C1DA 5C7IO 2ISCA 4HAWA 1UWLA 1Y8RB 2FSUA 2NZWA 4ZEWA 3D6NB 3NBFA 2ZSBA 3P2KA 2XNKA 2LCQA 3ZWDA 5T41A 3LNTA 1E59A 4E5KA 2G4CA 3DW3X 3H2SA 4AJ2A 1F60A 3MQ2A 4ZARA 3L8ZA 5B3LA 4OHMA 5FHQA 3HDVA 2JIQA 4OQQA 3WGKA 2K6GA 4PGAA 4BVHA 5M3BA 3JD0A 1R6VA 3GLIB 3PRYA 4X41A 1PAUA 5A02A 3L40A 1JW9B 2P9BA 2W6ID 4BATA 4NC9A 4IDAA 4KQIA 5AXDA 5FKJA 3U44B 1WV1A 2C20A 3E81A 2J45A 3DWFA 4UBMA 4YRTA 5C8ZA 2E18A 1X87A 1BEEA 1GGVA 2ZYIA 4IW3B 1V9CA 3HM9A 3QENA 3EC7A 1KBOA 5AIAA 5A0FA 1EFVA 3T95A 1NKSA 4EX6A 2QSJA 3LG2A 1FFEA 4M7PA 3ROZA 1RI5A 1E5TA 1Z5VA 4UULA 3JD2A 4QM7A 1UKCA 3K70C 2B7CA 5DM0A 5CB4F 4MQBA 2ZVQX 3QI7A 2ZZKA 1NYTA 5IYZF 3R3UA 3B8HA 2H7CA 3H17A 1Z9BA 1ZXLA 4LKOA 3RODA 4IUDS 3FR8A 5BNTA 1ST2A 1U3DA 2GBLA 1JEDA 4R7TA 5IEJA 4L6IA 5ICCA 3DMFA 4R41A 5FL7A 2P9JA 4BGVA 4ZCIA 3F1KA 1XKXA 3BIFA 3RRZA 4EA6A 1G41A 5LYJA 2Z30A 4ZQEA 2ZRLA 4H0FA 5CW2A 1IHYA 4JT4A 5FL3A 3N6VA 3P2YA 4JUBA 2C2YA 3U3MA 2QWXA 4NONA 3UIEA 4JLVA 1P6XA 4WECA 4PQRA 2CJPA 5EKUA 4G2TA 2RCNA 3AOEC 4EHFA 4TVKA 1P2FA 4K9SA 5F64A 1CSEE 2NXJA 3GJYA 5IWAB 2GJSA 4X93A 5EHNA 1E1YA 5HDBB 3VGJA 1C7RA 1JLKA 3VHLB 2O2DA 4EARA 2YIDA 4GLOA 1L2TA 1F3OA 3NJ8A 3SU8A 5HFAA 1ITZA 4AMGA 4JQCA 2XRFA 3WAGA 4M9XA 5D5PA 1USGA 1B2RA 3ZZMA 2QI9F 3D81A 4DNFA 2OXFA 2B4KA 4P3PA 2Y1DA 1U8FO 2YVUA 5EQDA 2G0AA 4MQFA 5KC9A 4WCFB 5TPZA 1IXSB 4RD3A 3IBTA 3T3HA 1Q83A 1U5BB 2I3AA 3QV2A 1JI3A 4WLNA 2ZCJA 1TW2A 1XU4A 2IW3A 2ORYA 3ZDEA 1DEHA 1P2VA 1XUOA 2HEIA 4IQ8A 1U2QA 3FNEA 3SZGA 1UJ2A 3BH7A 1Y63A 3COVA 2OHOA 3NHSA 4WLEA 4ZQHA 1YNSA 3SBDA 3KU4A 2Q1SA 4HRAA 1BROA 3BD6A 2X3UA 5A04A 3IHTA 5E1OA 4O4LA 2IY7A 4YRFA 2VPQA 2HQ1A 1EZ1A 4G4JA 5L3QA 1NIJA 3GDFA 1JFRA 2FSHA 5A5GA 1VHQA 3FN4A 1TIPA 4WKCA 4I4CA 4Y2HA 2PPLA 3Q0IA 1B0ZA 1QQ7A 3PLRA 4CLOA 1I3OA 1O6FA 2UYHA 1E0AA 3AZQA 2O3JA 3VTFA 1CZUA 4MI3A 4YC7A 2QN7A 1ZIPA 3PI7A 4CIXA 1ACMA 2C57A 1NJ2A 1EFDN 4WIAA 1DQNA 5A5DA 3ZUGA 3MMZA 4DSTA 3SN6A 1IK4A 4ZYUA 4HDRB 1Z18A 3HDGA 1HE1C 1P1KA 3TS1A 1E1CA 3M1LA 3VTZA 4BU0A 3GLUA 4RVNA 2JJ2D 1AKTA 2FZVA 5F73A 1T3SA 1PBNA 4AD8A 4IIEA 2OQRA 1P4JA 3DB1A 1FFGA 3DOEA 2AZXA 1FUUA 4NJMB 3PJDA 1EXVA 4HQ0A 3CLUC 1UK6A 5FOUA 4E5NA 2CLDX 4D9NA 4W8HA 1KU6A 5BRJA 2QL5A 5ALGA 2ORWA 1YKSA 3S81A 3U7HB 5CH8A 3GMDA 3QXSA 5AVKA 2O8FB 1CR2A 2GN8A 2ZJ6A 2WBLC 3QVLA 5C5IA 3O9VA 3T3DA 5EC8A 2M6SA 2QM3A 4N0QA 3AETB 1N6KA 4CKBA 3O8OA 1NC3A 1X8KA 2A6PA 4EPYA 3C5VA 4TKUA 4JGBA 4X1IB 5K99A 1U99A 4TLAA 4WY5A 1NDQA 1RPAA 2WWTA 4RADA 3I9V6 4GVPA 1U7OA 4K9OA 2JCBA 3STVA 2HADA 5BT9A 2VDJA 3SC2A 2X6TA 3F2VA 3HBFA 5B6IA 4OHOA 2LBPA 4NR0A 1HL3A 4BN4A 4KUHA 1AY0A 4R1OA 3NHAA 3NWPA 1L7NA 3E0QA 5SZKB 2G5CA 2P79A 1EK2A 1XQXA 4N3NA 3E2MA 4WXMA 3WK5A 4JYAB 2EG9A 3FF4A 5DEOA 1DKQA 2ECKA 2YBEA 1K86A 2Q5IA 4UHBA 5F35A 1W49A 1RI1A 1UK7A 4HEQA 3H1AA 1T9DA 3DZ8A 1N1MA 2Z4SA 4KQ6A 1Z8FA 2FPOA 4IO0A 3DQZA 3PDJA 3A3PA 4MUYA 1YS6A 3A3NA 2QENA 1NOJA 2GDZA 3ZIUA 1W5BA 4Q4JA 4PZDA 1J8YF 2VYVD 4OF4A 1O96A 2A78A 4RHUA 2RMKA 1E2PA 1NG1A 3LUHA 2ZJZA 4REQB 1X1BA 3OTHA 4GWKA 6NULA 5CAEA 4GR5A 2X4DA 1MQSA 2OOSA 1GJRA 2W6PA 3D6HA 1MXFA 3GRCA 3JQ9A 3KPVA 1T4CB 3FYUC 3V7WA 2Z4TA 4ZQCB 4WGFA 3K5WA 3WK6A 4U2CA 3U7FB 2OMKA 4CQNA 1RMTA 1T2CA 5HRUA 4UBNA 1NBHA 3AEXA 1VL8A 4FMDF 1D0SA 4G56A 1CUSA 4GICA 4S12A 4RY2A 2PD4A 2COEA 3LXRA 1FE8A 1SY7A 4EVRA 2UYOA 1L4LA 1M1YE 2G1PA 4G89A 2OHGA 3CLKA 3OLVA 5DRTA 1G20E 2DF8A 5JH7A 4HAUA 1VLMA 1YUBA 4NYIQ 5JVDA 3CLRC 4ZQGA 4O8CA 1EGVB 1E96A 1E4OA 1I4DD 2EZ8A 1KSHA 3K4PA 3MWDA 5FBHA 4EO7A 2Z1DA 3UGJA 2Q5OA 2Z5GA 3N3AC 4LBVA 3D43A 1Q1NA 3MF4A 2V7GA 2X40A 2UVPA 4BBJA 3EXIA 4LHEA 4MVJF 4CCSA 3ASVA 4UM9B 3GW8A 4ZAFA 4L0QA 1I30A 2IY8A 4MITA 1ZIYA 2ZI6A 2AQIA 3STWA 2P2GA 3WNZA 3CN7A 4RV4A 1NI4B 1FRVA 4PG5A 3WGOA 4A4DA 3VVMA 3VC2A 1RZVA 3G23A 2GJ8A 1EIZA 3D7KA 2IYNA 4PZUA 2FPXA 5IAJA 2Z1MA 1PS0A 2NT3A 3EQ8A 3OT1A 4OGFA 1UM9A 3GNLA 4QTXA 1H8HA 3G0GA 2OCIA 4NFSA 3PQ7A 1KAEA 2W6CX 1Y5IA 2XI4A 1C9NA 1QKKA 1TCVA 1D1PA 3P9KA 3SZOA 4PYQA 1VPVA 4BVLA 3DBLB 4BEVA 4MV5A 3CUSA 2A8YA 5L7WA 2VH2A 1AUOA 1JPUA 1KVRA 3QELA 1RXEA 3OPMA 4L0MA 4NYJQ 2ORVA 4E14A 4UCFA 1ZCAA 2JGNA 3NP7A 4H6VA 2Q8NA 3BD9A 4YP6A 1NBAA 1UBKS 3C6KA 5CG1A 5CFLA 4ZVLA 4BFUA 2Z56A 3F4LA 3PVSA 1QVVA 3IKMB 1N9GA 4OKIA 3OPVA 5IT0A 1H9BA 4FHEA 2R8YA 4L2IA 3SY8A 4IG4A 5AI4A 4P54A 3R5TA 2QEQA 3RIYA 3ROKA 3V8VA 3UMJA 3ZOZA 3TCKA 2OAEA 1DBIA 5A3QA 3SXUA 4AU1A 5CB4B 1HUQA 2EZTA 1M2VA 1BGVA 5KYVA 3TSZA 1I0LA 3GRYA 3ZCRA 4DCSA 5IYZB 4LZAA 1W30A 3ETCA 3BXEA 1PT7A 2C42A 2B8TA 4MJ3A 3K9GA 1LB1B 1IN4A 4CL8A 1BDHA 3NRJA 5LQCA 4CUZA 3IODA 2IEZA 1A5AB 1F2VA 4KR3A 4B6PA 3ZLBA 1C9DB 4X8HA 2V6BA 5BW4A 2JG3A 4MRPA 4PRLA 3AP2A 5IM5A 5E8JA 1M0WA 1PJTA 1SCJA 2G71A 3V4OA 5FLXA 3A0UA 2FY8A 3HDQA 5EKXA 1JFTA 3EIXA 1DKUA 4U39A 1N8NA 3V1LA 4RTLA 1CR1A 3E70C 2QB5A 2FPGA 2AZ4A 2CFTA 4B47A 2J5XA 1V16A 1VRCA 3A26A 5BUSA 3AV3A 1CJVC 1HL7A 2MSKA 3NC0C 1E5XA 1U1CA 4EY4A 3CS3A 1R8QA 3FPLA 2NO7A 2YYAA 3IPXA 1M0EA 4EY5A 3SS9X 4QL3A 3ER9A 1JBKA 4OTZA 1EWTA 3BKXA 4G85A 3MUEA 4EYGA 2V8BA 4IH1A 1WB4A 2VIIA 3TRDA 3GDHA 4F92B 3BCUA 3G9ZA 3LWDA 5DMXA 4D1YA 1GTZA 2Y92A 4ZEMA 5JJIA 1QHYA 4LC1A 3U4DA 4ETWA 4QT4A 1K4YA 1VC2A 5IHXA 3NFYA 3RAJA 4K05A 5MN5A 1TZMA 2W93A 1XTTA 3D8HA 3D64A 4W8OA 721PA 5AI8A 3IIKA 1U6KA 1ZWKA 4M1KA 4TTIA 1U7PA 2WKQA 1MIOB 3KB8A 2YINC 1WXWA 2VNKA 2NWQA 3VJRA 2FPPA 3H0EA 4TKVA 4H3SA 3TBFA 1QP0A 1K2VN 5KQPA 1SG0A 2FW1A 4YRAA 4B34A 5LWQA 3JYPA 1BEUB 1N7HA 3QSYA 2CZCA 3OCXA 3TLXA 3ND7A 3QOFA 2B2CA 1JSRA 2QMEA 4AUMA 3SC3A 3VH1A 3RVRA 1M7GA 3ZJYA 2ONYA 3DFIA 1R12A 2OK7A 3OICA 3PUVA 4GPD1 1IFXA 3SZRA 3MSCA 3OI7A 4G0PA 3NRCA 3LQRA 4UE2A 4WJZA 3CCCA 5FBKA 2IU6A 3V1MA 2FW8A 5E0KB 3RSZA 1QGED 4JUAA 1ODKA 3F8SA 5ILQA 4KWCA 4WZAA 5ECWA 4XDGA 3KAQA 1DTEA 3OQBA 4JNCA 3A4TA 3RBVA 1CF4A 1GZSA 2RAFA 3PXGA 1B0AA 5EIXA 4CEHA 1JHRA 4N7JA 4TOIA 4N82A 2P68A 2GN6A 2XKJE 1NFFA 2OD7A 4Y9DA 4ND8B 1P44A 1IUOA 2ZVPX 1E1QA 3DFMA 3Q8XB 1QHGA 3TOCA 3C24A 1ZAKA 3DHYA 4QICA 3ENZA 4LDAA 2WM8A 4I4TA 3WJAA 2XMPA 5AR1A 3AR4A 3GT7A 3O4JA 2UZIR 1WZ2A 4A26A 1ZK2A 3IESA 3UUWA 4JHLA 2ACWA 2R6AA 1CFJA 3JRWA 4U0KA 3LXXA 5F9MA 3T99A 4RF5A 3FBTA 1OF1A 3LVBA 1YQWA 2D5LA 3SZUA 4N8EA 2XOKA 5KOJA 2AQ8A 3CTMA 1JFSA 1YR6A 3NV9A 3QF4A 4WADA 1W75A 1O1YA 3MILA 3A6ZA 4S35A 3THYB 2Z2XA 3B82A 3QEKA 3BMCB 5MN4A 4PHCA 4S1OA 3TK1A 1DU4A 3BE4A 2ZIGA 3T4UA 3UEOA 3ZTYA 3DE2X 2VJOA 2GEVA 5JR3A 4KX5A 3RV3A 3NVKI 1GZDA 2XUJA 3MPOA 1OXXK 2JFQA 3PUWA 4R2KA 2ERCA 1V95A 2XB4A 1AKWA 3GLFA 5DGIA 4BFYA 3VR2D 3OM0A 3ZE2B 3IMEA 1N2XA 1SBIA 3IUBA 4QD3A 5D3MB 1L4GA 3FZNA 2GYUA 4L02A 1IJKA 1LTQA 1T2DA 4HB4A 5AW7A 1E7YA 1GLGA 1GTL1 2Y8EA 3D4LA 4YAFA 3UKDA 3GD5A 3UJ7A 2I3ZA 3QFTA 1ZXXA 3Q40A 1QG2A 1SR8A 1W46A 2NNWB 2X7HA 3IDZA 4PWZA 2WPDD 1Q3TA 5DGHA 3GZNB 4ZCMA 3FOEC 1RKXA 4PAOA 2C61A 3CEAA 1PYGA 2QX9A 2QVYX 3KFVA 3M2TA 3PVZA 4C22A 3T7RA 1J4AA 5KSWB 4W6QA 3F5FA 3OZVA 1QH0A 1EWYA 1OAKA 1ORWA 3A7DA 2VNIA 3X1XA 1HI9A 1HURA 5JSUA 1KFBB 4FE3A 4HN4B 4KTTE 3CUWA 3SMQA 4FW8A 3DBVO 4HI0E 3TJZA 3NWOA 3IELA 1ADCA 1C9JA 4RA6A 5C4GB 4NPCA 1BEZA 3OJLA 1FP7A 5TXGA 1A9OA 1O97D 2O6HA 4FMDB 2PUHA 1AV7A 1KO1A 2WE8A 5C35A 4GL2A 4KI0A 1T5IA 4TYPA 3F9CA 3D59A 1NVMB 3GHYA 4L76A 1CQPA 4YUWA 1GGJA 1RI3A 1B8OA 1X2EA 3JZDA 2QLFA 1DV2A 3M89A 3O38A 3WRVA 3CVXA 1DDOA 1YZQA 3A4NA 4ENQA 1KY3A 2A0WA 3LT1A 5BWCA 1SBTA 3WYBA 1Z37A 3NHPA 3ZK8A 1K7YA 1KJYA 4R1PA 2VQSA 5IF3A 3SZ3A 6CHYA 3BJZA 1FSSA 3CXRA 1NLZA 3DFUA 3A6HA 5JZSA 3EQZA 1H93A 4CM9A 5BMVA 3W5DA 3KFXA 1II9A 1MT3A 1KEUA 2MWMA 4PXSA 5EL0A 5BSRA 2G88A 3EJ6A 2NZJA 2C2WA 3E4DA 4URFA 4HWGA 3GFPA 4GXQA 2ZTMA 1DAPA 2ZIXB 5BN1A 1KQ3A 1NAIA 5EAIA 3RRXA 3DMGA 2P3LA 2DQYA 4V38A 5J63A 1AK2A 1GR1A 2HF8A 4AXBA 3JARB 4JS0A 4Z9AA 5ALKA 4JA0A 1Y80A 2DHEA 4NX2A 1LLFA 5KO2A 1W87A 1M0SA 2DUWA 3EXHC 1JZSA 2Q6LA 2CXSA 1L4HA 1KQOA 3O75A 4GC9A 3E5RA 1PHPA 3SIPA 2O7VA 1YRWA 2HWYA 2H18A 2R5WA 2DR2A 3D2AA 1QYWA 4IP0A 4PZ9A 1NVVQ 2W2TA 5EWMA 4QODA 4H6XA 3UMMA 1DDGA 1VHJA 3MGCA 3PR3A 1S0UA 1QQ6A 4DWJA 3IXLA 4EJSB 3KDPA 4BAUA 1BX0A 4RW0A 2X0JA 2I6FA 5SYAA 5K6RA 3D2BA 3PC7A 4B71A 1GHTA 2GZHA 1QFMA 1FLDA 5GJWC 4MV1A 1TCUA 5J2UA 1T9GR 5JAPA 1O4WA 3A58B 1Q0ZA 1XZBA 2B98A 3FDFA 4BC1A 4BB5A 4WXPA 3PP8A 5MGNA 4RO0A 2Y1LA 2FN7A 3HDJA 2FFAA 4WESA 1S8FA 4F2DA 2ZI4A 3BB1A 3UG6A 2BFCB 5AMXA 2YVQA 3PHJA 3NOXA 2X0NA 3AIOA 3EMKA 1NWCA 4XQEA 3UXEA 5LLTA 3HTXA 4BMZA 4LV8B 3HVRA 3IDAA 5EHQA 3HWWA 1R66A 4HQ6A 1RS0A 4GHWA 4GPTA 3ELYA 3AONB 1U0GA 1XPOA 2YWGA 3A2MA 1EFRA 1DO2A 1D7OA 2FPSA 2QVGA 4OHBA 5JI3E 2GM4A 1YR7A 4GW3A 3L1UA 5JS8A 1C9YA 2JARA 5EPUA 1CRPA 3QHAA 2W2LA 1JKJA 4RVSA 4YS6A 2PAFA 3EIHA 3OOYA 2CXOA 1YRYE 1PDVA 3IRVA 3O8QA 4B2PA 3GFBA 1OGYA 1SBNE 4FC6A 2V03A 4QQFA 2BFEA 4WXHA 4ZI7B 5I7HA 2OGWA 3UMFA 1LBQA 4KIJA 4TV8A 2HO4A 4PYIA 1JMKC 1IHUA 2QG4A 1CNMA 4J0DA 2QE6A 3BXFA 2D2XA 4MB2A 2HMVA 3GVIA 4BHTA 1RAFA 4EW1A 5KYWB 3QOXA 2CVHA 2GEUA 2P6NA 3NIBA 1HX7A 1S2MA 5BQOA 3BF7A 2C3OA 1B3BA 1JQDA 1V45E 1IYZA 2VQ6A 2IYWA 2Z08A 1SXHA 5CGQB 4JGIA 4AZ3B 4PU0A 5K8JB 3OQVA 2AWOA 3HCRA 5TT1A 4QX6A 4C4YA 4BYMA 3PS9A 1U0HC 2OV1A 3A1NA 4LMPA 1IHOA 3H5VA 1TF2A 2QD4A 4YALA 4G9GA 3RG2A 5FTLA 1YFLA 3UICA 4V0QA 5EPEA 4DBLC 4MH0R 2X23A 3REFA 1EBBA 3KKZA 3OZUA 2WABA 1EB9A 1PP4A 3LA6A 3MPUA 2CDCA 4I9UA 2HQBA 5EJ6A 5IASA 3CX8A 1WF3A 2C98A 3Q6MA 1WUYA 1GPNA 5AJVB 5REQB 2I2BA 4MI9A 3C3WA 3FAZA 2DUNA 4B2LA 5JJLA 3WSTA 1T8PA 5KVQA 5ELMA 1DJNA 3LQ2A 1CDDA 3R0QA 2OE2A 3M5CA 1HLFA 2GD1O 3I92A 5EUMA 3FUWA 3FCEA 3I0MA 1U1IA 1UT8A 3Q0EA 4MA5A 5JWHA 2I7CA 1BE0A 1UKEA 4D8YA 3I9JA 3LOQA 3EOZA 3E22A 5FTJA 3DTNA 2GBLC 5ER9A 3K35A 3OIUA 3WBJA 3HWX1 5BPFA 2CSXA 3CISA 3FMGA 1Q20A 3L9WA 4AQDA 4KCGA 3KHSA 2JEOA 4HQNA 2O7QA 2VAMA 2Y0CA 4L4SA 3LUBA 4GH5A 3E9ZA 3M8KA 4JLWA 4U3JB 3RC7A 3EIQA 4Z1MA 5JS2A 3V8NA 2A5JA 2IRWA 4ZCSA 4B4UA 1JU4A 3GRFA 3CH6A 3MJ4A 3V4PB 2BFWA 3LQYA 3G2NA 3H1TA 5LQDA 3A2KA 3DE0X 3F6CA 1QZ3A 5KTYA 1J2JA 3OJFA 1W5AA 1SUBA 1XTPA 3K1ZA 3SQLA 3WA7A 4ZJPA 1SEVA 5J43A 5CA0A 2EFJA 4IRMA 4RZUA 3DVAA 2UKDA 2XCRB 2MCFA 1OI3A 2X5JO 1B8PA 3WK4A 1PD0A 1OBOA 1OV4A 5LWHA 1DC5A 2O2EA 3B3GA 3ZI7A 4R8RA 4JKOA 5DYTA 4K6FA 5CLFA 4TQAA 1XO1A 1Y5LA 4YJ3A 4EFDA 1NA5A 3CW2A 1MO6A 4ITUA 3RYCB 2XWPA 1G6HA 5HZHA 3NATA 2B1QA 2ZBVA 4WA7A 1OHHA 3WXBA 3IEXA 4BVAA 3TIGA 1Z4QA 1OLXB 1N9ZA 1QBKC 2DX7A 4KXLA 1RKUA 4LS3A 1Q6ZA 4EL5A 2R65A 3JVDA 2WA2A 5K0JA 1BKDR 2HRBA 1GXSA 3K9BA 2Q9CA 4Q3EA 4BMPB 4RYDA 1C7EA 4M1ZA 4JLJA 5A4FS 3FCXA 1ZKDA 4MDEA 2C78A 1XOIA 1PG0A 2FPKA 2OYSA 4E07A 1HQDA 4WOPA 1AM4D 3GPCA 1K92A 1KSFX 2DFLA 2LZ0A 1SKUA 3AEQA 2VCYA 4FBGA 1QH8B 3WR5A 2VUHB 3ZGXA 4KBYA 2A0YA 3KLBA 2R11A 3N76A 4G81A 4LYJA 5GY7A 2P6UA 2BMFA 1XMSA 3PEFA 5IJWA 1BCRA 1MGOA 1W6UA 2EBHX 3A4MA 3DBOB 3F5DA 3MGBA 4TMZA 4UU0A 4B7XA 3ZY4A 4MUAA 3EUAA 4QLAA 4BO2A 1OX4B 1KK2A 2WSBA 3HWRA 1A2OA 2VTEA 3TDKA 2EEPA 5KQSA 4OGGA 4G5YA 1QDLB 2LRHA 4L27A 2XJ9A 3BCHA 3ZOKA 4HN9A 5F3DA 4LXGA 2CV2A 4ECAA 3RSFA 1ONBA 3JWGA 1FVFA 4OBWA 3SPXA 1G0NA 5G0TA 4QYMA 3KG2A 4N49A 4C2BA 5L3VA 4FKMA 3TL3A 2IHVA 2FOIA 1YKFA 4FE7A 4YAUA 2F67A 3O8DA 1S7CA 2JF0A 4W82A 3CW9A 1TO6A 2AEEA 2PX2A 3G85A 1H6DA 2ZRCA 4U6NA 4W5HA 5JPIA 3ZZUA 2VJPA 3V3TA 3WLHA 4A1OA 2FX5A 2CMDA 3BORA 1E3MA 2O8CA 4IF6A 3SMVA 3RYFB 3HKDB 1YK1A 3VOBA 1W36B 3SJUA 5AW0A 4Q7KA 2V7PA 3ET5A 3K9WA 4G65A 4GD3Q 4MUGA 5KNBA 3DEFA 2JIMA 1S9DA 1YJCA 5EZYF 1LEHA 3B3FA 3UANA 1NKTA 1QJ4A 2LVBA 5A2GA 1KAOA 3KL2A 1UDAA 2N75A 5DBFA 4TWZA 2J0EA 4UBIA 4ZREA 5GGYA 3RRJA 2H06A 3QVKA 2V0GA 2B4YA 2B61A 2W6IA 1LUAA 4FMPA 5AVSA 1ZOLA 4RZIA 2V74B 3ZWCA 1O2DA 4ZA2A 3K72B 1XFAA 3P9ZA 5AHKA 4NI5A 1J9EA 4RY8A 3JQDA 3WL6A 1PFVA 3UJ3X 3GP8A 3ZU3A 3NBYC 1AKNA 1N6IA 3LUAA 3TLMA 3EVCA 1ZL0A 2O0KA 2WSIA 3NPMA 4PO3X 4D42A 5DNAA 3KXKA 1NW9B 4OJKA 1UEJA 2AJBA 4L15A 3UAZA 2QTAA 1SUWA 2IIPA 4RU1A 3FOWA 1TUBB 3U4IA 4M60A 1VIMA 4V2IA 1IHPA 2PM8A 4FFDA 2A14A 5D3QA 2VUSA 3IP8A 3QGMA 1F5NA 1P5HA 2ERXA 3EPRA 4NZZA 3L7IA 1S4MA 5ED0A 1Q0PA 2VTVA 4ITVA 2F43B 4DUPA 4MWOA 3RIXA 3WQBA 2LW7A 3O3OB 2PWBA 3VUEA 1DUVG 1NUUA 2ZT5A 4KRYA 2ZRGA 2CUNA 1FXWF 3TFWA 2A1TS 3MRTA 1I4EB 2QYTA 1CK4A 3G68A 3I2GA 3JQ9C 3OPYB 3MCVA 1FP6A 1G4HA 2JJ8A 2OFXA 2QT1A 3CB4A 2QTRA 1WXQA 4RDIA 2EEZA 5F2EA 5I7FA 3U7QA 5JUWA 1FRZA 1NG9A 3I9NA 3WSWA 4LC9A 1QGDA 1SELA 1V5GA 5CBPA 4NY1A 4MV8A 1ZQ1A 1O03A 1NM5A 1JQ3A 3QE2A 1JG1A 3TEJA 3UYKA 4CLEA 2A58A 2J33A 4JJ4A 1L5ZA 4YA6A 4V0MA 1XVUA 1PE0A 4WV3A 4P2GA 3MJCA 1II8A 2G1UA 2VJAA 5EJ9A 4OO3A 1T9GS 3GIWA 4TKZA 2AC2A 3PWTA 4D3YA 5DNCA 4WY2A 2C07A 3QX7A 4EUHA 2KPOA 3DYVA 1SCNE 2DPXA 2YN4A 5DN6D 1XQ1A 3O9ZA 4N8DA 1R15A 1LZKA 1H9AA 2GESA 1XT6A 4M9QA 1ATZA 2VSXA 4PLHA 3R7WA 1U2PA 2QIOA 4N0PA 2QJTA 2WINI 4KPYA 2RH4A 3DPSA 1XLUA 4OL0A 1E6MA 2A1IA 2AJTA 1VPDA 3AJEA 3DEKA 1JKMA 1Y3DE 3MAGA 2AOUA 2XNDD 5JBNA 1G7RA 4GBJA 3K1AA 2O54A 2V1XA 4GGOA 4PSCA 1UBRS 5CPBA 5FXMA 1GZHB 3KDSE 5KWJA 1ECBA 1H9CA 1SBQA 2EJCA 2IHBA 1PLKA 1NF8A 2V7UA 5IDYA 1G4UR 2H4ZA 2O5VA 4KG7A 3VO8A 2F1HA 3A36A 1BKYA 1VL1A 2PXCA 3GCZA 3FPSA 2XCOA 1E3WA 4R81A 3RBZA 4LOIA 5AVQA 1JEOA 1GCUA 1YQUA 5DIFA 1Z6PA 4OY3A 1VL0A 1M3SA 4YLEA 2QL7A 2AX4A 1SIOA 2VJMA 1IOZA 4MPRA 4EUKA 3VO9A 1ZGCA 1NVFA 2CLKB 5K0GA 5FWAA 1A9SA 5JSZA 1DKRA 4MGYR 1SPXA 3BQMB 5F98A 2BGMA 1Z0DA 2FVXA 3I0ZA 4QEZA 4CUKA 3L0PA 5JALA 2JJ2A 3QZUA 1VG1A 2QU7A 4FMCF 2Q7XA 3H4VA 2QYSA 3JQGB 3EEBA 4QYTA 1K5HA 1RTKA 3M6IA 4ZCTA 2A35A 5I47A 5LZ4A 4XWGA 3PHLA 3UC5A 4AKGA 1W52X 1PG2A 2YWRA 3EFHA 5IARA 3NXSA 3QPBA 3PBKA 5CVTA 1ADGA 1GTRA 1FFBA 2HTEA 3Q11A 2JZOA 4EUSA 3L5KA 3C48A 4AWAA 1V9LA 3E27A 1JB1A 3N28A 2YOFA 1Q19A 5BN3B 3FMPB 1OILA 3ZU5A 3F0TA 4H9GA 3JQ8A 1M6WA 1MO5A 2B5VA 2WZQA 1U2TA 4O2RA 1KY4A 4ECEA 1XZNA 2I33A 1F17A 4RY0A 4HDAA 4A27A 3I8OA 1C4KA 3ZQKA 4AMBA 2YQ5A 2E4YA 2NX2A 1Y9JA 1J2EA 3AY7A 3TLZA 4CMIB 2IS2A 3AB7A 1BMDA 1YU6A 1B0PA 1CS0B 1SUPA 1E7RA 4XQCA 1ILWA 1EFCA 1XJ5A 2J09A 4N7RA 1ZGHA 4RWEA 5DHAA 3FGPA 1PV2A 1GCAA 2DZDA 2Y1FA 3GAZA 3K8OE 4HQRA 3SKVA 4ZU6X 5ADHA 4JNKA 3W2HA 1KQNA 3AY6A 2R8OA 2P9GA 4K87A 3RIMA 3BIXA 3ZJVA 2I6TA 4OHWA 3FA2A 2V7QD 4HF7A 2QHXA 1H2RS 2CFSA 1LC0A 2FZKA 2Q41A 5JNLA 1UDRA 2HYDA 1PZNA 2DGDA 1UJNA 2QTGA 3AF1A 3HWSA 5JCXA 1ETHA 1D2AA 5U4XA 2QTNA 4YRDA 3LDFA 4CCWA 1I4WA 4RESA 2VYVA 1SOMA 2QP4A 2QX4A 1CQZA 1XMJA 3KXPA 3K2EA 1NW3A 4J0JA 1O6BA 4RVHA 3LHFA 4JSRA 1KJNA 2R751 4PYOA 4XJXA 4K6CA 1XLTA 3B9QA 1MB9A 3EZNA 4N01A 1B4DA 2WWWA 1NY6A 3IT1A 2XUHA 3EZFA 5KEIA 3OU6A 4UHEA 2GQ0A 1GGNA 1VXOA 1O77A 3LQQA 3VPFA 4U63A 2RGRA 3CVOA 3IUJA 4KEAA 3QKRB 1S8AA 1ZIXA 4NICA 4N7MA 1EYZA 1T0PA 4LDZA 3IAXA 1F14A 1QE5A 1AB5A 3T7EA 1EAYA 2OWDA 4KL8S 2GPBA 3NUZA 4FCCA 5FOXA 4D3SA 3H9GA 2A9PA 4KQJA 2VEDA 4M1EA 1HR0B 2XNSA 1TQ6A 2W43A 3FVTA 1J0AA 4K2AA 1Q0RA 2I66A 4K9RA 4PINA 2O5EA 1XTBA 1PGNA 5L40A 3FSRA 1ZESA 4NJEB 4NE2A 2IH2A 5DHQA 2N0SA 2QZPA 3HP4A 1BN6A 1LV7A 4N5MA 3HACA 2IH5A 4RS3A 4GECA 4ZYWA 4ZQFA 1NW5A 3NBAA 1TVCA 3MB8A 4IDDA 4MYTA 4R8VA 1MW8X 3BZWA 4AJ4A 2H85A 1M1YA 2PS1A 2VKQA 1OPRA 2NP6A 1EVQA 2C1EA 2Q9AA 1YZUA 1G20A 2V7VA 3AR9A 3WNVA 1MOSA 3T5CA 4L50A 2GHIA 3EUEA 3IEKA 2H8GA 4GQAA 1C3OA 3S2UA 2B37A 4F60A 4P4SA 3ZHSA 1FZTA 4MMXB 3T4PA 2B36A 1QCZA 5GJCA 4RC9A 2I8AA 5FUQA 1MAVA 1MVNA 3FUVA 4DSUA 4BBZA 2ORED 3OECA 2QM7A 1H2FA 1FDVA 4REMA 5F12A 1GNSA 4BVBA 3JZIA 4WZBB 2CMKA 4YP5A 3ZHCA 1GNPA 4EHHA 1BHJA 4HC4A 3GPIA 1ZMTA 2GFQA 2I1LA 4FFMA 1JMYA 4OQDA 4BX0A 2C7RA 3LCCA 2EWMA 4FPXA 1E9CA 1EMDA 3ANYB 2C8LA 3GRZA 3JYLA 2A9RA 1W4AA 3C5CA 1KJ8A 1AUXA 4OOEA 2XYHA 4JFRA 4J76A 4C0QC 1XZHA 1E3LA 2WHYA 3H11B 4WL0A 4YEDA 4D8WA 1T9ZA 4R84A 1TM3E 4BFXA 5IH7A 3MA0A 1IY8A 1IG3A 3TINA 1BDBA 3I64A 1WD7A 2D1TA 3MB5A 5ALPA 5EFZA 4TLCA 3M4NA 2WWGA 5ADVA 4C4RA 3FLBA 1OA0A 4PX5A 1SKYB 2FFHA 4IMIB 3CBQA 4GMKA 4GOJA 4KE7A 4TYQA 3A6JA 4XWTA 3VR5D 3B38A 2CE2X 2NNLD 3FB1A 4X8OA 4ZZ3A 1P1HA 3UXYA 5A4IS 4CU2A 3A1DA 4WVLA 4O3FA 4NBWA 1D8AA 1NVUQ 2PGJA 1CUBA 4L4XA 4R5HA 1RU3A 4K5QA 4GG1A 1V37A 5L51A 1N6NA 4QGSA 1HETA 1G63A 3CB2A 3HR4A 1YI8A 4FOTA 2Q5HA 1EJBA 4HADA 5DW0A 3GJZA 3PC6A 3YASA 5A9RA 1FYDA 3UFXA 2IGBA 5C32A 1XMOB 1D2NA 4UU8A 5AESA 1ZVQA 3MXOA 4EJSA 3HVKA 4DJJA 4CI9A 2VF8A 2DSNA 4OKSA 3I32A 3K9FC 5JAUA 1A98A 2WHPA 2BD0A 2B1IA 5SV2A 3BGVA 2GARA 1PR2A 3PC8A 1A69A 4KXYA 3T7IA 4X6UA 1T0UA 1NVBA 1ZMBA 3SDSA 1GKLA 3QE0A 2CKMA 4JU8A 3VNRA 1I2MA 3EY9A 3Q10A 3UXMA 1XVLA 4GP9A 4D4HA 3ROFA 3W34A 1YVPA 5CTJA 3W0LB 4A0SA 3A9UA 3BGWA 3IEPA 1IZYA 1J09A 2FEMA 2XYQA 4TSFD 5ECDA 3IPLA 4CV1A 1IMOA 2DFKB 4O02B 2QYHA 2CMGA 1APBA 3O4VA 1EJ0A 1C80A 3OQIA 1MTZA 3ZK7A 1PZHA 2EW1A 1WUKS 1XVTA 5IXYA 3U5TA 3MT0A 2QTHA 2FA9A 2ECPA 1AT1A 5HIJA 4AKTA 1SC9A 4IOKA 2KW5A 4YWHA 4RLQA 1MH9A 4RETA 4EVQA 1BMFD 2CVOA 5JOQA 3UWKA 5IULC 4PC6A 2CD7A 2HH9A 5EZSA 5FTWA 5GVSA 4RTSA 4AG5A 1VJ5A 2QLNA 3C2QA 1Z82A 1OREA 3HPQA 3I83A 2E4AA 4O4IA 5CVEA 4DNOA 1OB5A 4GRDA 3GLGE 3UUFA 2F00A 2ZB2A 5IRCD 1K5DA 2BYTA 2YWDA 2H2FA 1FVHA 3R2JA 3O94A 4HDKA 4KVAA 4CG2A 2Z6UA 1WXDA 1Z6AA 2ZWAA 4QOJA 3WRXA 1SU4A 4INJA 1SHTX 3ZPXA 4D57A 2EQBA 4FZ3A 2QTBA 3LSTA 4IF4A 4BN0A 4E6EA 5EKTA 4HAXA 2BY4A 1CJSA 2PMBA 4IICA 4XH9B 3VU0A 2A5DA 1MB4A 4Y7CA 1JIIA 3VR6A 1P7WA 2ZRMA 3Q4GA 4E33A 1DV1A 1T2VA 4FMCB 4LAFA 4QO7A 3K6SB 4XSHA 4FI3C 5DN9A 3AILA 1P1IA 3GBVA 1W2WB 3AO0B 1Q2XA 1EHIA 5P21A 1WXEA 3HH8A 3IUYA 4WOKA 2GI4A 4EB0A 5F2KA 5COQA 3N53A 2PBLA 1U5AA 1UOEA 2B4QA 4MR9A 3DDCA 3TNJA 2FJUA 4HWOA 1SO8A 1G60A 2C58A 1PGOA 2NIPA 3DT9A 3GMSA 3QLEA 3AERB 3EK2A 4H4EA 4LFCB 3WDSA 3DAFA 3GLRA 4LGVA 1NWHA 3ZR4B 3ZCSA 3DP9A 2CJYA 2BGKA 4WA8A 3AUYA 1LPOA 3G6WA 2CL5A 4GLJA 3W8NA 2WKRA 3CZRA 3PQCA 5EJIA 3VNQA 2WLTA 3MMPA 2JGKA 4GXTA 2WUEA 4EPTA 4FBMA 4I9HA 5FFNA 3T1TA 3LS2A 3C3BA 4NK4A 4I50F 3LPLA 2B34A 3GT3A 2V0CA 3ML1A 3MQFA 5E2AA 4E6PA 3KSBC 3PWKA 1EEXB 4GLLA 2QLMA 3EXEA 3FTEA 2VPYA 1HSZA 2DH6A 5DNEA 5C3UA 1KI3A 4Z4EA 1BW9A 3VR2A 4Z6KA 4D5GA 3AHFA 2VYND 1JDVA 1WY7A 1U1EA 3WLRA 1T8RA 2AR7A 2C4NA 2VJLA 4PQYA 3WP1B 3QWIA 1POWA 1TGYA 2JS7A 4ZVQA 3TB6A 3IVGA 4J6EA 4Z4HA 1X3LA 1ZRMA 1MXHA 3LL7A 2X2FA 1IHDA 1Q3HA 1KL7A 4GQIA 4IMRA 5EGSA 5K3SA 3H97A 2OPHA 2DWPA 1N4DA 3W3AH 2JD1A 4LYGA 1WPXA 5E9JA 1IEQA 2PKQO 4QPJC 4BFCA 5JZOA 3ZLVA 1WCWA 2XIQA 3DV9A 1Z7YA 1M73E 4DIKA 3QPUA 3UQZA 2WR8A 5K09A 1QRAA 2C99A 4D6XA 4M54A 4ZD6A 3W7BA 3UMBA 1P1CA 2H1RA 5GONB 2J3QA 1HH4A 2YC2C 4WK6A 1WRBA 3TEMA 1K68A 2V59A 2WNIA 1ZJZA 3E03A 3UJAA 3X1MA 2CE7A 1OAOC 2Y0DA 3AUKA 4IRUB 1S1CA 4GOMD 4ENVA 1NFQA 2TRSB 4ZXPA 1OH5A 4FXOA 3EOBI 1CS4C 2QPAA 3DE5X 3HB9A 3LZDA 4QFMA 2XDAA 2ZCVA 3KHKA 2Q3DA 2C7OA 1WR8A 1XZAA 5KQGA 5J4VA 4BIMA 2NUPB 3L0DA 2NSHA 4PNEA 2AG5A 1OYYA 3ZY3A 4DA4A 1EUZA 5AICA 3RKRA 4KWTA 5ARCA 2A0XA 4FGKA 3EPPA 1EP2B 1ZJ6A 2R1VB 2NU9B 1VL5A 2G07A 2X9QA 3NTOA 4P5EA 4EEZA 1Y8CA 5A9TA 3WWYA 1PZEA 1G9XA 1CPYA 1OTXA 1NI5A 3ESRA 3VPHA 4A03A 1QDUA 2HWUA 3FYCA 2C4MA 3D1JA 2NU7A 1GCGA 2GBCA 1PWZA 1RZ3A 1VGQA 4YMGA 5JSQA 1N2GA 1NRIA 3G8DA 1Y0BA 2PKYX 5FCDA 5C53B 3LQ4A 4AX4A 5A6SB 5B1YA 2GRJA 1IZ0A 3RVLA 2C2ZA 3GV0A 5FOVA 2QVBA 1GT91 1W4BA 2ZYHA 1NJSA 2VHWA 1XMIA 2KI5A 1R6AA 1XKTA 1GYPA 2DC1A 4I6GA 4RENA 4Q4CA 1G1MA 2GCNA 2YWEA 1AF4A 1QVRA 2ZRKA 4J1QA 4RVFA 5LC1A 4MQ5A 3U0BA 2VQEB 3ABQB 1I6LA 1F9AA 1P2DA 5EP1A 2QTFA 3DBRB 2PIAA 1IOVA 1YASA 4D96A 3PUZA 4IFBA 5AOCA 4GZ5A 4Y6LA 4RGYA 5CDSA 3DD1A 4Q1AA 2ZQYA 1N7IA 4BJ3A 3LWNA 1Q7CA 1CJCA 2NU6A 2QW0X 3ED1A 3INYA 4MVCA 4WKPA 2XZOA 2IBSA 4ED9A 1CZNA 3E1GA 2AHRA 1NUPA 3CPEA 4HGPA 10MHA 3URKA 1EWKA 1RWMA 2PU5A 3ZI4A 2FVYA 3A1SA 1BQ3A 1S2OA 2O3SA 2QMQA 1T1JA 3JQAB 4LISA 3ZDZB 4QOFA 1RAGA 3W9SA 4OYLA 4CM7A 4YNBA 1J0CA 2VAPA 4KFSA 4A6XA 5LUAA 4UDNA 3EVDA 4DDKA