1JF8A

X-ray structure of reduced c10s, c15a arsenate reductase from pi258
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
130
structure length
130
Chain Sequence
DKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Arsenate reductase from S. aureus plasmid pI258 is a phosphatase drafted for redox duty.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords arsenate reductase
total genus 49
structure length 130
sequence length 130
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jf8A00
1EAYA 3FFTA 3I42A 2LPMA 4HYEA 3MYYA 1DJMA 2HSGA 1USIA 1ZY2A 4G97A 2IKSA 3I09A 3QLTA 4LZLA 4MR7B 3HXMA 3K4HA 2FEKA 4M88A 1YVUA 5F64A 5TQ0A 4RKRA 1Z18A 1M2EA 3MQ4A 5TQ0B 3S99A 4DQDA 5B3JC 4IRXA 3O2JA 4D74A 5HM6A 2FEPA 3H5OA 3HV2A 4Z9AA 6CHYA 4LDAA 2FQYA 3DGFC 3M6MD 3QELA 2FW0A 4YP9A 3CG0A 4EUKA 4IMIB 4WT7A 1JBEA 1YTUA 3GV0A 3T95A 1E6KA 1P2FA 3O1IC 3KYJB 2VYCA 4NQRA 4W5TA 4IGAA 2WWVD 4FB4A 4Q6BA 3BRSA 5DLEA 2CHEA 3N0WA 3OLVA 3SQNA 1QP4A 2FXIA 3SAJA 3QLVC 2P9HA 3RVNA 1W25A 9ABPA 3G85A 2F8TA 2ZWMA 5C5CA 4ETNA 2PL9A 4YWHA 5T7BA 4FE7A 2LIVA 1NXOA 2H3HA 2FQWA 3JVIA 1R8JA 1U8TA 2PLNA 4JB2A 4PEVA 5DCLA 5JS2A 2NZVG 3CLKA 3T8YA 3KLOA 1YMVA 4LE2A 2RGYA 4MQEA 4RXUA 3N8IA 4RKQA 3C3WA 4EVQA 4O1IA 4Z9BA 1EWVA 1U2PA 2GWRA 2ZAYA 3M9WA 3RH0A 1PNTA 3KYIB 3G1WA 1GUBA 4KV7A 3HZHA 3H75A 3OLZA 3H1EA 1TMYA 3TMYA 1DZ3A 1EWKA 4RK7A 3VNAA 3H5VA 1PEYA 2QVCA 3H1FA 4F06A 4MS4A 1KMIY 2ID7A 3QK7A 5E3JA 5ED4A 4RY9A 2FMKA 3CRNA 3GT7A 1PEAA 2IOYA 2FVYA 2P4UA 5HKOA 3KHTA 1ZN2A 1KGSA 3LUHA 2NUBA 1I3CA 7ABPA 1DP4A 2DRIA 2PMCA 4XARA 1DCFA 1QP7A 4TN5A 2FN9A 3KCNA 5JNWA 3GRCA 1ZDMA 1DC8A 1Z26A 3QEMA 4PZ0A 5GOTA 4E7PA 4IF4A 2GX6A 3LUCA 5IUKC 6ABPA 1A0OA 3A10A 3TD9A 4H60A 4NCBA 5C5EA 4S05A 4MQEB 4EYKA 4DN6A 1Y1LA 5HSGA 1SD5A 1ISSA 1JFSA 4ZYLA 1SXHA 1VLZA 3CS3A 1LBHA 2TMYA 3H5IA 3HDVA 4YR7A 2O20A 4WZZA 3OM0A 2MSLA 3E61A 2QR3A 2HQOA 3A3KA 3CU5A 3W9SA 1H9CA 2LUOA 3EODA 2LP4Y 3JPYA 3JVDA 5DKFA 4GNRA 3RVLA 1LK0A 1XHFA 2E4ZA 3EDCA 5BRJA 3SM9A 3RVMA 4G0ZA 4LRQA 4EY3A 4NCAA 3Q9SA 4MLDA 8ABPA 1RZRA 1QO0D 4RK0A 4MYRA 2NT4A 1EWTA 1DCKA 1U04A 5IEBA 5CHYA 4MLCA 4ML3A 4FE4A 4QYMA 2FTKE 2JRLA 4RK1A 1JFTA 1USGA 3Q7RA 2PJUA 3T6KA 5KQLA 4ETIA 1NTRA 3FFXA 1CHNA 5IUJC 4OG2A 1SRRA 2NT3A 4N0QA 1RNLA 5BR1A 2QSJA 1GUDA 4OTZA 3R0JA 3EJWA 4Z0NA 2J48A 2GI4A 3IDOA 5D2CA 1Z15A 4LE0A 1APBA 1YMUA 1M5TA 4MS3B 3JPWA 3F6CA 5FWYB 3GL9A 1USKA 2M98A 2AYZA 2X7XA 1RXEA 1SXGA 3KTOA 2OENG 3C3KA 3DZDA 3MF4A 2FEWB 2MSKA 2VUIB 1D1QA 2QVGA 3QLUC 4N47A 4G0MA 3LUDA 1D2AA 3T38A 3I45A 3IPCA 2WJWA 5KC8A 1Z16A 3LKBA 3KLNA 3NNDA 1JLKA 1U0SY 4G0OA 2PUAA 4RY0A 3F73A 1PNRA 1T34A 4TLLB 4XXHA 1OXBB 4KREA 4RZSA 4ZPJA 4KPYA 3IP6A 1WETA 1RXIA 5KQMA 4DADA 1NXXA 2E4XA 1YK0A 4Q7EA 4YO7A 4KRFA 2PUEA 1BA2A 4RWEA 4EVSA 1ZVVA 1B00A 3RVOA 1FQWA 3RVPA 2PKXA 3MIZA 3Q41A 1BDHA 1DRKA 3ROFA 5KWSA 1HEYA 3QX8A 4IILA 4EYOA 3NNNA 3CZCA 5I4CA 4KQ9A 3CFYA 3OQMA 4LX8A 3C97A 4Z4EA 1JWLA 3DLBA 2PL1A 3LKVA 4LE1A 3SG0A 2QXYA 4JB0A 4W5RA 1MIHA 4G86A 5KI6A 4YRZA 3LUGA 4RV5A 3ROTA 1E6MA 5EWLB 5TQJA 3LUKA 3NBMA 3SY8A 3CHYA 3EQZA 4MS4B 1Z25A 3RVJA 3L49A 3RVKA 4ETMA 5B3JA 4MR9A 1YS7A 5EWJA 2HQBA 2YHBA 1QP0A 5EWJB 5IEJA 3DBIA 4HNQA 4YV7A 1S8NA 1EFAA 1URPA 1PUXA 1ZGGA 1C4WA 4E7OA 3KSMA 2QU7A 3FMVA 2MYNA 3HSYA 4RSMA 2MYPA 2IPLA 5JNRA 1LJLA 3L6UA 2RJNA 4MGEA 4ZMRA 1JYFA 3RVSA 4IMJB 1AB5A 1LBIA 2WMYA 3NNSA 2B1JA 5TPZA 4H3KB 1QO0A 3OLXA 4L85A 3DLHA 3D02A 4RK5A 1ZHHA 4UHJA 4XASA 1JX6A 1E2BA 1CYEA 4UHKA 1DG9A 3O2QB 1QMPA 3K9CA 5CNJA 4F12A 3OQOA 1TVMA 3UKJA 4G0PA 1KRWA 1JYEA 1QNLA 3JY6A 4HNSA 4MR8B 1ZAYA 2FLKA 1DBWA 4MR8A 3O75A 1RZRD 4G0XA 5BRAA 5JNUA 3EAFA 1A04A 5TPWA 5TPWB 4OLAA 3GWGA 1NXPA 3GA5A 2M1ZA 5PNTA 3SNKA 3URMA 3BRQA 4JP1A 1QPZA 2L18A 4KK3A 2FMIA 3CTPA 3E3MA 4MAAA 1FFGA 5IULC 2JVJA 3TB6A 1XWWA 2R4QA 4S04A 2FMHA 2V0NA 4EYQA 1UDRA 2YHAA 2IPNA 4Z4FA 1JF8A 5T3YA 1K68A 1L5ZA 4D6XA 5CNKA 3LMKA 1LJUA 4G0YA 1YIOA 4N0PA 1M5UA 4F11A 4OLBA 5TE9A 3KS9A 1GCAA 1ABFA 4MS1A 4Q6WA 3I5AA 4H3HB 4YLEA 1W9HA 2WB4A 1E6LA 3F6PA 1CEYA 3O2SB 3ILYA 3ILHA 4RK6A 3HDGA 1MAVA 3EQ2A 3KG2A 1MB3A 3M9XA 4QPJC 1TLFA 4YS6A 5TQ2A 4Z4HA 2GBPA 2JVIA 1FFSA 3C6QA 3FFWA 5GQSA 3MM4A 4XFKA 5DGCA 2R48A 1P6QA 4MQFB 3Q7TA 4RY8A 2E4YA 2FMFA 1JDNA 4N03A 5KQGA 2ID9A 1JL3A 2FQXA 3QEMB 3H6HA 1D4ZA 4KVFA 4O1HA 4PICA 3C3MA 1U2QA 5ABPA 3FGZA 2B4AA 2PE5A 5JNVA 3H5LA 4NICA 2FLWA 5BQ3A 1GLGA 2RJOA 5KC9A 2MSWA 3H5WA 3DGEC 4PE5B 5CNMA 4Z4CA 2PUCA 2WRZA 4RK4A 1J56A 2N9UA 3OLWA 1GCGA 3F7NA 4KZKA 2MYTA 4OBBA 4MS1B 4QICA 2JCGA 4XAQA 5IX8A 1KRXA 2A9OA 5DTEA 4KMRA 2XDYA 3A0RB 1Z2EA 4P1ZA 5FBHA 3OO1A 2KYRA 1RPJA 2BGGA 4EGSA 2WJAA 2F8SA 1NY5A 2WY2D 3P9YA 2IPAB 3RVRA 3O1JC 3CZ5A 4L4UA 2CHFA 3GBVA 1F51E 3KKEA 1YK1A 4EYGA 5FBKA 3RVQA 3BILA 3OO0A 3OM1A 4LDZA 5IC5A 4KNYA 2Q5CA 1ABEA 3FDFA 3TO5A 3IP7A 1QQAA 3O74A 2HJ9A 5JNSA 2W42A 3OLYA 2RDMA 3QLUA 4MR9B 1QKKA 1DBQA 4RXMA 4B09A 3BREA 4W5OA 2QZJA 3UK0A 2LBPA 4JA2A 3H5TA 4TLMB 3N0XA 1SXIA 1NXVA 5TQ2B 3IP5A 1ZESA 4WXMA 2A9RA 3CKMA 4Z4GA 3OMWA 3LUFA 2GKGA 3GYBA 2AYXA 2R47A 3LOPA 4F8JA 4NV3A 3N0RA 4MPTA 2E4WA 5KQPA 3D8UA 1Z13A 1D5WA 4JOQA 2PUGA 5FWXA 1BVHA 1DBPA 1AB6A 4JAVC 3HUTA 4YGXB 1D1PA 1ISRA 3TX6A 2VK2A 3CNBA 1Z12A 4G0QA 1NXWA 2JB9A 3LUJA 4HNRA 3H1GA 2E4UA 4Z99A 4GPAA 3A0UA 1VKRA 1DRJA 5IUNC 2L2QA 1K66A 2IDMA 3QEKA 3B2NA 1FSPA 1ZH2A 3MA0A 3HK2A 2PUDA 1NATA 3HS3A 3LUAA 1JDPA 3HVRA 4TMYA 2PAFA 2NZUG 1NXSA 1JHZA 5JNTA 4W5QA 5FWYA 3Q7SA 1EHCA 1ZGZA 3QLVA 3IP9A 3HM9A 1YS6A 3CG4A 3O21A 3QX9A 1P6UA 4D6YA 1A2OA 3IPAA 3HO1A 1F4VA 3LTEA 5EWLA 2JK1A 2H0AA 2L19A 1BDJA 4Z4IA 1VRVA 1IIBA 2R25B 5FWXB 3O1HB 1ZITA 1L5YA 1DCMA 2HPHA 3NHZA 3N75A 1C0EA 1BDIA 2CD7A 4KFCA 1Z2DA 5EWMA 2A9PA 3HJFA 4WXEA 5EWMB 1VPWA 2A9QA 2I6FA 3HUUA 4WUTA 3VNBA 2PUBA 1M2FA 1MVOA 2L17A 4RU1A 1QQBA 4MS3A 3N53A 1XHEA 1OXKB 5CNIA 4EVRA 4N41A 2QV0A 4MRMA 2VUHB 3HEBA 4W5NA 2FN8A 4WWHA 4ZMSA 1PHRA 2QW1A 2PUFA 2JVKA 3EGCA 3LFTA 3JS5A 5JS1A 2IYNA 3JTEA 5IBQA 5TPZD 1BAPA 4P98A 2JBAA 1P8AA 3QELB 1MB0A 2JBAB 4JASB 4MR7A 2MYUA 4PYRA 4RS3A 1ZH4A 3MMNA 3OQNA 1JH9A 4Y9TA 3GBPA 4QYWA 2E4VA 1FFWA 3KJXA 4ZJPA 4OATA 2IPMA 4KK4A 3HCWA 4XLTA 1JFVA 3RQIA 4N76A 3Q15C 1Z17A 3BBLA 3OMXA 3H6GA 2OQRA 1DC7A 1NXTA 4KQCA 3UUGA 4YCSA 4F3TA 3EULA 4MRMB 2FSPA 3N6VA 1TM2A 2HQRA 2CWDA 4CBVA 5HQJA 4RDCA 4MQFA 2FKAA 4RXTA 1TJYA 3NHMA 4O5AA
chains in the Genus database with same CATH superfamily
1HRDA 1QH1B 3DWGA 3AEUA 4O4HF 5IVDA 4YRTA 4Q7MB 4DLKA 3FYTA 4TVBA 3B1YA 5E38A 4RTPA 2NYRA 4CMBA 1GQYA 2BSXA 3SZOA 3II6X 1CR1A 1KZ4A 4RVHA 3OECA 2D6FA 4LXHA 2OSVA 4L95C 4AKSA 2PNFA 3F4LA 5FBZA 1LPBB 3V4OA 4BO0A 4XEHA 1JG4A 1I2BA 5KKAA 3UJHA 2ZI9A 6CHYA 5A6VA 4NMWA 4DJ5X 4WKGA 4BLPA 1XKXA 2CVPA 2WZCA 3BCRA 1ZK4A 1JBEA 4HQRA 5JWHA 1E0SA 1ZHOA 2BHSA 2REBA 4AS1A 4GI5A 2E5LB 1MW9X 1A8HA 3LGXA 3WQHA 1YJAA 2RGNC 1EQAA 3GEPA 1R8XA 2YXPX 1K7CA 1JR4A 3H1AA 1Z06A 1UC5B 2B99A 4HN2A 2FPXA 1NN5A 1GAQA 4MUFA 2QUHA 3VRHA 9ABPA 3KJEA 2I1QA 1H8EA 3EA5A 4ATNA 3ZTYA 4F9EA 1ACMA 2FZCA 2IS2A 1NXOA 4ZVPA 4CM1A 3N87A 2HU2A 4JB2A 4EI7A 3I9V1 2QP9X 1P7ZA 3W90A 1WTCA 3V8NA 3BSWA 4OFZA 5CAEA 2Z2IA 4KMMA 4FWBA 4LHSA 5LP1A 4L8LA 4ARCA 3GJRA 3TTVA 3NAZA 1CF2O 2H2FA 2YRFA 3RH0A 2O1WA 5B6PA 2D7JA 1KJNA 3V1KA 4YV0A 4HNTA 1H94A 2VDWB 3Q7QA 1G1AA 4WZ6A 5HE8A 2ZJ5A 3PI6A 3T99A 1C3VA 3WFIA 3OFVA 2QRUA 2WLTA 3FVRA 2ZRBA 2OMEA 1USWA 4OLJA 3F0TA 2P4UA 2ONJA 4O02B 3KJQA 1MB2A 2QX4A 2VEOA 4C2TA 2NU8A 1LI7A 2XUZA 3DBVO 3OIYA 3OUZA 2X14A 4B43A 3L7JA 3O91A 3EG9B 3MWKA 3QXCA 1L7QA 2FW9A 3KUUA 3RLIA 4NEHB 4U7TB 1S3IA 5CPBA 3RRBA 3EPJA 1WVMA 2FSUA 2A6PA 2II6A 1OD6A 3DZHA 2GX6A 3FH0A 2ZRPA 4IJQA 1O5TA 3WRWA 5DTMA 2E49A 4CM8A 4D97A 4XSHA 4H60A 2C0QA 3JQGA 4Y3UA 2WNIA 3VJMA 3CURA 3DFIA 3JV7A 1ORRA 1RI4A 2P2YA 4E5YA 1Q21A 5D3MB 3MAJA 4RTRA 3P52A 1K2VN 1ISSA 2XBMA 4NMXB 1M2VA 3WHPA 1VLZA 5LR6A 3OJCA 2OD9A 3OESA 3PRYA 3MNFA 4YR7A 2DFVA 3U09A 4WZZA 1CY1A 1W88A 4RESA 1HTBA 3E61A 3OLQA 4YAIA 2EP5A 2H1CA 4CQMB 1J5EB 1WY7A 1YRLA 1OJ7A 4RH1A 1TT5B 1GFSA 3B52X 2Z2XA 4I19A 1BGXT 3OJFA 2RCYA 1K97A 1JPJA 4G09A 2CK3A 2WSYB 2AN9A 5EJIA 3RVMA 1XQ9A 5C34B 1YZ3A 2HMWA 1OXTA 2W37A 3FTNA 4RVCA 1DXYA 1Z6AA 4PVCA 5DIFA 3T54A 5LMZA 2ORED 4BFTA 3WYFA 2EGUA 2AMVA 3CPEA 4LQLA 3WNDA 4DCGA 3DW3X 3BFJA 1FL9A 3UK6A 4KVZA 5F9HA 3TZKA 2ZBUA 3KSBC 1CDDA 2ZSEA 1WM1A 4HJRA 1IXYA 4FE4A 5BPHA 2MU1A 2FF7A 2OCLA 3C6XA 5CH8A 3SQOA 2AHOA 3ADOA 4DLTA 2VQSA 5IH7A 1JFTA 4R5HA 3V32A 3VZBA 4HGNA 1OF1A 4D1YA 2ZIEA 2JKZA 4KRGA 1NQVA 1JE0A 4LHEA 4GR9A 3KCQA 4EKNB 1TRKA 2NPIA 4LGYA 2GEFA 2H2GA 5D2CA 3D4PA 3G79A 1AY0A 4FS8A 1Z15A 5IKOA 3KUXA 5JUWA 2J3IA 4MO9A 5EIOA 1APBA 5CHEA 1NRWA 5AT1A 3QVWA 4K87A 3W8DA 2CFRA 2JANA 1USKA 1HG0A 1SCQA 1VIAA 5HFAA 4KACA 2OQVA 4IDFA 5BYBA 5CDFA 4CM9A 3D4OA 1Z6YA 2MSKA 2VYND 4XYLA 3OC6A 2AMJA 4H1WA 2JLXA 2XVAA 1CIJA 1QYDA 1GPH1 2BHNA 2IITA 3R3VA 3X1JA 2C2OA 3K2EA 5A4IS 4UAGA 3GZNB 1E20A 5DOVA 1C9YA 1Z16A 1GIAA 2WUGA 1Q0QA 4NDAA 4JLUA 3G0CA 2EATA 3D6FA 4CMCA 1L1FA 5JHHB 2HOQA 3C6MA 3LSTA 4AK9A 1Z3IX 1NHGA 2VSXA 2C5LA 2JRCA 3CC8A 1HKHA 2R96A 3U3OA 2QPAA 4GOKA 2H06A 4EVIA 1OILA 4I81A 4P82A 2CDAA 2Z3WA 3MJFA 3FA2A 3TNDA 3FUTA 2PRYA 3BK2A 1KP9A 3Q41A 3VZRA 4WBNF 2OLJA 4HGQA 4LGMA 2DKFA 2IDKA 3ZE8A 4KHPB 4X63A 3TW8B 3QV2A 1Y1QA 4BO3A 3GP3A 3IBGA 5JYCA 4LBYA 5EZYA 2XMPA 4PFSA 4JLBA 3EX7C 4EQ6A 2YBEA 1C4XA 2PL1A 4YCDA 1XA0A 4EGJA 1U6JA 2ZWVA 3LM8A 1V95A 4YB8A 5AOCA 4RIIA 3AI1A 4MV7A 1G7CA 3FLAA 4M1WA 2XOKD 4CKWB 3SY8A 1H6DA 5FBRB 1O95C 1R0KA 2M2IA 3BHJA 4MS4B 5BURA 1MPXA 1ND6A 4D3FA 4N5LA 1W1IA 3BL6A 3EISA 4DNQA 4GPBA 4MWDA 3DBIA 3IV7A 1N5LA 4UE2A 2IOHA 5KINB 3PIIA 3PFCA 1T4DA 4JWKA 4O5OA 3T4UA 2ZKLA 4EW1A 4A15A 3FNFA 3GG9A 2UV8A 5CA0B 3UMMA 1QRAA 3P9QA 3K1AA 2BUAA 3N28A 2QN2A 5T6MA 3H3FA 3TE7A 1JJVA 1G6Q1 1HFJA 1VJDA 2X40A 1KHHA 1X80A 4MLPA 3AOGA 3RVSA 2BHLA 3OT5A 4U2DA 2FUNB 3IEPA 5GONA 4CCYB 3AI3A 4DIBA 1DWOA 4A0HA 4H3KB 3HR7A 1KYQA 3H42B 1WZCA 5I9MA 1NV8A 3VSAA 2Q7XA 2F17A 2JH9A 1R4AA 3WWOA 4BU1A 4KXQA 1CUSA 3DM5A 4EG7A 4MRPA 2PZ8A 2XNCA 4X60A 1QKJA 4NS4A 2C5EA 1X42A 3PGXA 4NENA 5LBUA 2Z5LA 4YT4A 5EJFA 1B8OA 2AJDA 5JOQA 4O4IA 3Q8LA 3K9CA 3SS9X 4ETWA 5KTNA 4MVJP 1YMQA 2G28A 2H1RA 3TAHA 4UXIA 1JJFA 2HJRA 4YRBA 3Q5EA 4G3XA 4AY2A 4XR9A 3TLBA 3PHCA 2E55A 4OLAA 4LOKA 1HOTA 4YJ3A 3R75A 1J2EA 4IX1A 3X44A 3BXHA 3ZG6A 4FYPA 1JA9A 4K1XA 1H5UA 4EHHA 5TGTA 3UV3A 1XZEA 5I3ZA 5AHRA 1KZ1A 1VGQA 2P1DA 2R4QA 1B0UA 4Q39A 3BYZA 1ES9A 1B2LA 2V0NA 4HQOA 1T91A 1W6RA 2IEZA 1NW4A 3JYHA 3ZU3A 4XIJA 1XRLA 3LMKA 2DBYA 3VO8A 4LRYA 6PFKA 1C7IA 1SA0B 2PK3A 4GP7A 3E27A 1U2GA 3CR8A 2H9YA 1U8FO 2QAGB 2WVAA 3QFCA 4FIDA 3UPTA 5KQGA 2DMRA 3HV0A 2XITA 4BNTA 1WY5A 4WDQA 4HVCA 1MJGA 2PLRA 2JD2A 2TMKA 3KOXA 1GKYA 1CEYA 3IT3A 3N3AC 2BFAA 3LZCA 2J09A 1P9WA 3EOZA 4C03A 1JVBA 1FMJA 1RQ7A 2E5FA 1IN5A 2WV7A 2ZPAA 4IEEA 1FFSA 2FFAA 3A32A 2BPOA 4NK5A 4B71A 4ZAVA 3V1MA 4Y6PA 2CW5A 3GEEA 3CH5A 2QE6A 4B3JA 4DLNA 1JL3A 4NZOA 3NP9A 2OGUA 3WMRA 2VP5A 1D4ZA 3L8YA 4LCEA 4A1OA 3C5CA 2BFPA 4RY2A 1QIIA 2B92A 2BR4A 4N7MA 4QDKA 1KFJB 1KO1A 2H5JA 2VF4X 3M6AA 3OIDA 4MGKR 4NCJA 3DZBA 4BLRA 2B37A 2VAPA 2CNWD 5AVSA 1CF4A 1QX4A 1EK1A 1V37A 2DR3A 2X0KA 4FCWA 4MCAA 3SEQA 4F1KA 2JASA 2G5PA 1XP5A 4OQYA 1MGOA 4WKBA 1SA0A 3F8TA 5AKEA 5E7QA 5BNIA 4BB5A 3DFZA 5HNKA 3AJDA 3TBFA 1CUFA 3A1NA 4TXJA 4B2IA 3GROA 3JATA 1BJRE 4N3BA 1N57A 4JJKA 1OQAA 2RJ3A 4LW8A 4PFQA 4PPYA 4NAVA 2BBWA 5CLHA 5I9NA 3CTMA 2E48A 3JZMA 3A1TA 4LRWA 4ZXPA 3LNCA 2FZKA 3BULA 2V1XA 3OJEA 1KYZA 2WY2D 5C32A 1T9ZA 3CZMA 1LA2A 2J3JA 2ODBA 3MB5A 2WWRA 4AURA 4UMVA 3MGAA 3C70A 3E5NA 3KKEA 2VL7A 4B9AA 3AUSA 3FGOA 1T36B 4AJIA 1Y33E 3HZRA 4LVNA 1HMYA 4B3HA 4QFCA 2PX0A 4G56A 2W6JD 1ABEA 4XZ3A 2HRZA 4FSHA 1NR1A 1QS0B 3EMVA 2D2EA 1NUPA 1FY2A 3RF6A 5I5EA 1QX3A 4MAMA 3ENZA 2LBPA 4FEYA 5C5IA 1TJ4A 4IG4A 3P96A 2YVUA 4KEAA 1XEWY 1E3JA 1AKNA 2MHCA 3HVIA 4N48A 1W5FA 2GM3A 3M49A 4U02A 2GN9A 3ODGA 5AKYA 1O58A 1ZESA 2JFNA 3LP5A 1I3OA 4RYLA 1IMOA 5JZOA 4RE5A 3U4QB 3GT0A 2YWFA 3DOIA 4P3YA 4XVQA 1POWA 1FSZA 1UQRA 2C31A 2AV6A 2QORA 5CJ2A 5ENVA 5J9FA 3SZUA 4XM0A 3DYVA 4XCVA 2WQ7A 1FUKA 1PR9A 2EQBA 1JE1A 4HQ6A 4HQLA 3ZLVA 4I50B 3KKPA 1L5HA 3MRSA 1QYXA 2WP8J 1DJNA 5ALXA 4TT8A 1THTA 2Q45A 3F5QA 3HGTA 3H17A 3OCXA 3OD1A 3TOSA 1KOFA 4H59A 4U39A 2DEUA 1RHRA 1T1JA 1NJ1A 1SBCA 4K6HA 1E3TA 4JUDX 4RHYA 5LDGA 1FLVA 4DMFA 3KDAA 4QUKA 4DQLA 2ZCUA 1P61B 4QU5A 1ZCJA 4HPWA 1CJVC 2WUVA 4QTXA 4XM2A 4DFDA 3SF8B 3ZDXB 5DTJA 1Q1NA 5CFZA 1XQXA 4GRDA 4Z2YA 1CQIB 4I50F 3TQOA 4Q00A 5CXSA 4IOKA 4AY6A 4GPZA 3OCYA 4ER3A 2EDAA 1TGVA 1PFWA 1UPUA 3H9BA 3JD4A 3LVFO 1JA0A 1E1LA 4HMPA 4JX9A 1DADA 4KU4A 3NPMA 4UQOA 5LQRA 3T7EA 3G23A 3HS3A 4MDEA 1PVDA 2OAEA 5CLJA 1QF9A 3GLHE 3A6ZA 4CI0B 2I54A 4YUXA 4HAUA 3VVBA 1NBEA 4HC4A 5K4AA 2L69A 3UEOA 1EFRA 3ZI0A 4R83A 5JAMA 3IBSA 4BNXA 1N2BA 3D3WA 1GCIA 3OA0A 3ZDAA 1ECLA 4RNCA 1VYUA 2PKEA 3LAWA 4JT4A 4YLGA 1DXQA 3TDNA 4D6YA 2XT9A 1MXHA 1GY8A 4JN6B 5A7GA 2D0DA 4CM7A 3THYB 4R98A 1L5HB 4I50A 4ZAFA 2PWZA 1ZITA 5FUWA 4DUYB 1V3QE 3ZYZA 4ER6A 1MG5A 3LRTA 4GMGA 1KGDA 2EL9A 4RO0A 1RKVA 4X6UA 2DBVO 4BNFA 2ZYTX 5BVGB 1P60A 4CRWB 2Q7DA 1IY9A 3UMVA 2HA0A 1G66A 2ZB3A 4C0AC 2Y1FA 3INYA 1YIAA 1K4MA 4X71A 3USES 1TTPB 5DM60 4BKQA 2GAIA 1B0PA 1R9GA 5IXJA 3EGIA 2FUCA 2O4CA 3S2FA 2Y99A 3RDPA 3HU5A 4EBBA 2FE1A 1TK2A 1KAHA 2RHBA 3GB9A 2QUBA 1XE3A 2UYYA 3AEQB 4UVIA 1J9GA 4B0PA 2P4QA 3R0QA 1YF3A 2HK7A 3V4VB 4GLFA 2HM7A 4FFPA 1X0VA 2FN8A 3PHGA 1SVOA 1A71A 4WWHA 4L9WA 5KYYA 1WAMA 4TKLA 3PTLA 3UCXA 2C5AA 1BA3A 2D1SA 4UVDA 3UM9A 4QJ4A 4WGGA 4DPLA 4Q01A 4EX7A 2HWUA 2OECA 2PU7A 1J0CA 5INTA 4AIRA 4EI9A 1HQCA 3BXOA 3N5KA 1M7HA 4PG8A 1NQUA 3KOZA 3RC9A 1P6XA 2F3TA 2VSOA 4U6QA 4F3RA 1QIFA 3B9QA 2OE2A 5A1TA 5AI0A 2P2ZA 2J6BA 3LKDA 5LC1A 1MN6A 3CVUA 1KY2A 3FNRA 4CFZA 3AXSA 1R00A 5BWOA 1JGTA 1QRRA 4MVJF 3HACA 4O63O 1W87A 4BFVA 3IAAA 1L1RA 2ZUSA 2P6UA 3NRJA 1KBZA 2GT1A 4NG4A 2DAPA 2FPWA 1D5CA 1S02A 2AKYA 2B94A 3BD9A 3CW9A 2XRZA 1N7IA 3UWMA 5IYZB 3EHDA 3GEHA 3VR2A 1MO4A 1BMFA 2RHJA 4RQBA 4CI9A 2C4HA 4E4TA 4E5PA 2I62A 4ZRDA 3ZC3A 1Z2AA 3EW9A 2ZR7A 4L9SA 3R7NA 3FTQA 2HMYB 3TPFA 5IN4A 1EXWA 1YVUA 3IMEA 6LDHA 2P6OA 3ZX4A 5B3JC 1J09A 1E2EA 3C3BA 3RTAA 1IHXA 2AFVA 1ACJA 3I23A 4R1OA 2HA5A 4AZTA 1JKJA 1RJ9A 2RGCA 4ND3A 2CN1A 2WYWA 4I1RA 2RI6A 1WXEA 4NENB 1EGHA 1PJRA 3AIIA 4NPCA 5CB4A 1J0EA 3WR5A 1IWBB 5HRCA 3E2PA 3R5JA 1K7EB 5HS6A 1P72A 4ZJYA 1ZCBA 2SKEA 1KI9A 1RWQA 1E0DA 3KBBA 4ZCRA 3EBPA 4KX3A 4MGHA 5DLEA 3AETB 1HDCA 4AJOA 1G8AA 2VDOB 3U4MA 4L4XA 4YP7A 3IXQA 5M3BA 1RKXA 5EMKA 2P9HA 2ZTMA 2JFGA 1U9IC 4RGYA 3RIMA 1V5IA 5T7BA 3PC4A 3GCWA 3K5PA 3UUWA 2R00C 2HR1A 5JS2A 3MMXA 4ZFNA 2WPDA 5B4UA 3TG2A 2B6HA 3ICEA 4AY5A 4PCUA 4K9LA 1KOLA 3Q6NA 2FOLA 1B8VA 1TUBA 2QQ5A 4IVQA 1IXSB 3WIVA 3G0BA 3TQTA 4E03A 1SY7A 3G6WA 2WUDA 3C3AA 4MTCA 4CLOA 1I7SB 3I9FA 4NJEA 2VKTA 1CR2A 2W83A 1GQSA 3H1EA 1PCXA 3R5TA 1RRMA 4ES6A 3NGMA 1ISHA 2A1UA 1XN4A 2NO0A 1E9BA 1A2BA 2P1ZA 1GWNA 1JA1A 2X6RA 5LUBA 5HIMA 4GL2A 3O92A 4M8IA 1XA3A 3WLLA 2UUAB 3L8HA 3PV0A 5DEIA 1W94A 3REQB 1I6MA 4WI1A 1FDIA 3O8OA 1ZUWA 4IWNA 3FLBA 1CY7A 3EBLA 4IDGA 4Z2AA 1DP4A 2R66A 4S0XA 1QQ7A 1KJIA 2Y4NA 3DPSA 3EIUA 2WR8A 3GRCA 4PNEA 1U63A 2BEUA 1NL3A 4HH1A 2ZOSA 2AWOA 3WLNA 5CXUA 3TOZA 4BNMA 3K9QO 4TYMA 1BKYA 2OAQ1 2GCGA 5JAHA 4PX3A 3CT6A 4L02A 3HKDB 4BIMA 1R15A 2ODEA 1RYYA 4R54A 3RODA 4PZYA 2LCQA 1JSXA 1SELA 1Q2UA 3NHJA 1Y1LA 3TRFA 1IJKA 5JCJA 2ZDQA 5ALKA 2WKPA 5DI3A 2F6RA 5DCWA 4OP3A 4D5EA 4EF6A 4UBJA 1UZUA 5T4FA 2ORYA 4RFSB 1WQ4A 2AJLI 1C3LA 3W9SA 1FRFS 1XLVA 4DJDC 1JR2A 3BIOA 3GGCA 2ZJ4A 4POAA 1RM0A 1THZA 4QWMA 4C5BA 4YCCA 4HKTA 1LK0A 4HGRA 4UD2A 5E1OA 2MIIA 4PO8A 1WS6A 4HATA 4RKEA 4N9WA 2G9VA 4W1PA 5K8TA 3N2EA 1L5GB 4J0KA 1PDVA 2QJWA 5BOSB 1UMKA 1QQ6A 4IHJA 3UPUA 3D1JA 3F5DA 4CFYA 1M2HA 2F3UA 4XUGB 1JU9A 3B6KA 4JROA 1Y9AA 3R5KA 3T1NA 1ZM3A 2OL4A 4ARVA 5JJIA 3U3DA 1LH0A 3KLPX 1KTIA 4EW6A 1ENPA 4UEOA 3DTNA 2GRAA 2ZIAA 5ENDA 4HSEA 4DQVA 5ADUS 3W6PA 3QGMA 1C9DB 2GS9A 5H02A 3WGLA 4TSKA 4DGSA 2QN9A 4BMZA 5BMOA 1SXJD 4Q93A 5DTIA 2H5EA 5FOUA 1EVLA 3PFNA 2B0JA 1R0YA 1E1NA 1DU4A 1WKVA 4HL6A 2A2ZA 3R0JA 5BWNA 2V03A 2G4LA 2HCFA 4HRAA 3VR6A 4XFJA 4RJTA 1EFCA 1ENOA 1XTRA 4H0NA 1NAIA 5AHOA 4L07A 1RS0A 3RD5A 5G41A 3SWWA 1I1HA 4XUDA 5HTOA 4GYKA 3IEUA 2JI4A 4WCFA 4QWWA 1WEKA 1RYHA 3F7OA 3FSGA 2GLUA 2Y71A 1NTOA 5G2OA 2Y9MB 2ODNA 1ML4A 1ZD3A 2D3WA 3FGNA 1NRIA 2FEWB 3IQZA 4S1WA 5HEKA 1TEXA 1K9VF 4G2TA 3ZX5A 5KB3A 1ZJZA 2QEQA 3PQDA 3NTLA 3KR2A 4LC1A 1IN4A 121PA 1YAHA 3I2YX 5DASA 1CC1S 1Z8HA 3LKBA 1PLKA 3PP8A 4BKRA 4TV9B 3SM3A 4D57A 4US1R 3RS5A 1ZJJA 2WINI 5K1ZA 2CMDA 1SOUA 3HKEA 4XD7A 4E2ZA 3ZDCA 3IUPA 2HF7A 5HBGA 3V34A 2AK2A 2UVQA 2PMEA 4GOJA 1Y8CA 1P2DA 3L5OA 2CLKB 1OHHD 4MW1A 2C3OA 4H6WA 3AINA 5HKAA 5CT6A 5T5QA 4RD3A 2JFPA 1FCJA 3RVOA 2ADFA 3ZWAA 3B1XA 5CCEA 3SZ3A 2J9XB 3QE3A 3BIXA 4ZXFA 3LQKA 4J0QA 4IIGA 1ODTC 3OSUA 3OQMA 5B1SA 3I8SA 3QKRA 2XMBA 1AVTA 1PFGA 4CEJA 3W2FA 4J3FA 3JD3A 3L01A 4NPHA 1TMGE 3H0EA 3JQPA 3VYTB 5CFNA 2BGIA 2I67A 1GPUA 1XTJA 2UKDA 4M9SA 4OQFA 5DLDA 2OORC 4Q7JB 5F76A 4EJ0A 5KHOC 3VNUA 3BWVA 1EE9A 3C3CA 5AM4A 4C30A 1A98A 3CJTA 2Z57A 3E58A 2RARA 3P20A 5AUPB 5BSRA 3VDQA 1B0AA 1Z83A 1ST3A 4AO7A 4MR9A 5EWJB 1L7MA 2CNOA 1V47A 1S8NA 2JLQA 1URPA 4RORA 2UDPA 1Y3AA 3C4JA 4P93A 1NBHA 5EMJA 3PHHA 3N7AA 3P9SA 2FVXA 2DUMA 1W46A 3EGOA 3RYCA 2IH4A 4I5DA 1G8KA 5TJ9A 3VA7A 1ULTA 3IQWA 1TAQA 1P0CA 2R6AA 2VF5X 4IZIA 2VQEB 4B3BA 2V9ZA 3PDUA 1GGVA 3WLRA 4F7DA 1ZHFA 3D02A 3W78A 5BN3B 4X64B 2ZVJA 5COBA 2PVCA 4E31A 4AJLA 1NSFA 2CXSA 2IBTA 3I3SR 3DPIA 4FFBB 4HWOA 3ROEA 1CYEA 1QG4A 4ZQEA 1B6SA 1TM1E 3L4BC 5I4BA 5LYJF 1NBWB 3VTKA 2VHXA 3IS3A 4QBKA 4A2PA 3UT6A 2GXQA 3PL5A 4HN4B 3X1ZA 5KYNA 4RSHA 5H68A 2OFFA 3BWEA 4E2XA 5E7MA 1PYDA 1XTKA 3RUPA 5TPWB 2BFWA 2QMOA 4ILEA 2FG6C 1J25A 2ZJ2A 3FDZA 3I92A 3HJHA 4PHTA 4BMVA 1XMOB 3LYUA 5DCUA 1CY0A 4GUAA 2FMIA 4WTOA 1XEFA 1U99A 3HGQA 3CTPA 3FF4A 3NORA 4OI2A 3IT1A 4ZOAA 4MOWA 4IUDS 1Y7IA 4ER0A 1GQOA 1UDRA 3D6TB 2YHAA 3MGBA 2QT0A 3TJZA 3ZXUB 2QL6A 4EG5A 3LHFA 3RSOA 5J2TB 3IALA 2GSDA 1RYFA 4A0QA 4RTMA 3JQBC 4LA4A 3AF5A 1PL6A 3BB3A 5I3CA 2IEIA 3KKKA 2P78A 4MCJA 1I6KA 1I3MA 1QV7A 3GCGA 3RS8A 3ZHRA 5C1BA 5K7SA 3WLKX 4AS3A 3I5AA 4P6VF 1GUYA 3L8MA 2I7VA 3ZU5A 3NZEA 5HF5A 4UHDA 4N5HX 1FFAA 1J1IA 2DPXA 6GPBA 5LOVF 4LY6A 2HC9A 1P62B 1I94B 1XDZA 3F2IA 1J9ZA 4FGJA 2GAAA 4A0SA 2ASEA 2BH9A 3NTQA 1BXRA 4XWOA 3GJ7A 4WXPA 2IZZA 3QKTA 3DQPA 5A06A 2CNNA 3LWDA 1MX1A 3VI3B 1XU4A 2NYVA 4ZU6X 1QVWA 2FQXA 4BMCA 4BQIA 2X9LA 4AB1A 1UBMS 2XJ4A 1DBSA 1S2LA 2NIPA 4FGWA 1G3RA 2F2TA 2FRVA 2YDYA 4UZSA 3W6UA 5HOQA 4ID9A 3AILA 1Q1ZA 2WHPB 3M5PA 4M8KA 2A8YA 3JAMA 5KTMA 4HVAA 3GLVA 1CY2A 2GPTA 5KVSA 3X1DA 3W5IA 1QANA 4KW7A 4RADA 3L4KA 1F1JA 2HB6A 2PLWA 3KXKA 3K0CC 5ALOA 3VH3A 1CUCA 5EJ9A 5ELXA 4CL2A 4ZI7F 1OWLA 3WLHA 1Z5OA 5DNDA 3QTTA 2B2XA 5GJWC 2A35A 1E3IA 4KMRA 3PQ8A 4CEHA 1AS3A 1AZWA 3KHUA 1G19A 1VZ3A 1ZISA 4KQMA 4AMVA 4EWLA 2CDBA 2OC4A 2IS6A 3HYLA 1SOWA 1L4EA 3ED1A 3HA7A 1GXSB 2AYYA 1MMFB 3LFHA 3NP7A 5ILOA 1F51E 4EJ6A 3A27A 3AUAA 2C3YA 2DCUA 1L7AA 1Y1TA 2OWDA 4X95A 4AJHA 4O0MA 3H13A 3OM1A 1G21A 2RAUA 4DRZA 1IXZA 2VPYA 4QTYA 3H86A 3RJMA 1VL2A 4MI9A 3AR8A 4D9BA 3IAEA 3PJFA 5ECGC 2OV4A 3OPYA 3RT7A 4BEWA 3SVLA 1GILA 4JJIA 2O1SA 4JHXA 2QN1A 2RDMA 2TMDA 4NZPA 1DFIA 1CUEA 4UXJA 4JC0A 5ALFA 1FU8A 4QTUB 4DCUA 2HH9A 2Z9BA 4MW4A 2QF7A 4DMRA 2P75A 3O73A 4H31A 5GY7A 3BC1A 4F04A 2HYDA 1EE1A 2JGMA 3PCXA 2R1VA 3L04A 3SEZA 1SIWA 5K8VA 1WMFA 4YP0A 5TQ2B 5BW5A 2GHIA 1HTWA 3RG2A 1A1VA 3A9UA 4NZNA 1JXAA 3RC1A 4RTKA 2JLSA 3HPRA 5FEMA 3ZCVA 1UOPA 5KDDA 2ZSHA 3BWXA 1KQOA 1EX6A 5JPIA 2VR1A 3PGKA 2GJAA 3EIWA 1YDHA 2YMPA 2OGWA 3H5RA 4MUMA 2EZ8A 2WIAA 3WFZA 4CMIB 1DQPA 4X94A 3FZNA 4HYYA 1O6ZA 3BEDA 1MHPA 3DKIA 3KFVA 3PGJA 4NBVA 5DHPA 4BDSA 3IPLA 1Z4IA 4CV3A 521PA 2IA5A 3T7SA 2VHEA 1NI4B 1CY4A 1ZIXA 4RGBA 4BLWA 2H4JA 3EY4A 3WLFA 2JJ1D 4AXXA 2AK3A 3CRW1 1VMEA 3N05A 2BFCA 5HUQA 3IIMA 4IFIA 1UAYA 5HBRA 1RC8A 1M8PA 1MCZA 4Z99A 3CKKA 4ZTBA 3W77A 3W5SA 2F43A 1V7CA 4BZWA 3WBJA 2BKAA 4ALLA 2Y0EA 4PZEA 4MHTA 4Y2YA 2VTBA 2AG5A 1IUNA 2D1YA 4XQ9A 5CK4A 3WSTA 1SU8A 2ZXFA 3LL7A 2INGX 4HJXA 5JATA 3QEJA 1TL7C 4EARA 1XLTA 5KWJA 4MEAA 2EW8A 2PQ2A 1YQDA 2KE5A 2BFOA 3DQQA 1CETA 4OYYA 1CS0B 4J7CA 3FYHA 3P4XA 3K5WA 3DDOA 1ZJWA 4JC5A 2WOJA 4UFNA 3K92A 2E87A 3D5TA 4FWIB 4PVDA 4B4VA 5K4HA 5KTSA 2JK1A 5LDHA 1M2NA 2FRDA 2IKQA 3C8HA 3CRVA 4WINA 4R01A 3KT0A 5LD2C 1SD1A 4WLUA 2ZT7A 2GD1O 3DVSX 3MJSA 2E5WA 4HMOA 3ICVA 1T29A 1XB2A 3RC3A 5ADHA 2CFOA 1HDGO 2G9NA 4KCGA 3A1CA 1VMDA 4RZQA 4YCJA 3AYZB 2PXAA 3NVDA 4ZN6A 4C6TA 1D2HA 2C4KA 4GGPA 3NXKA 1REQA 4MXDA 4IR7A 4N9QA 3WL7A 4BJ3A 1FLDA 4N4AA 4DUGD 4G4SP 4ZYUA 4ABTA 2J07A 1OAAA 1PWXA 5FR2A 1EIWA 3N53A 4LN1A 1WKCA 3ELBA 1T2VA 4CIDA 1JJBA 1BRTA 2ECOA 3MLEA 2O7RA 1VL0A 4RD2A 2IZ1A 1YI8A 1ZEJA 3H2ZA 4GLBA 4N12A 5FLEX 3U7JA 2UU9B 3LGSA 3ND9A 4B76A 1WB9A 1NMEA 3M6WA 3NC1C 2JI7A 2WA2A 1FBNA 4Q3LA 4RBNA 2QLJA 3KZMA 4XTCS 4NSNA 1L4GA 5F77A 5KCMA 3ETCA 4P7KA 3UA4A 1GGNA 3A1UA 5ECWA 5EERA 4NATA 3HHPA 3ZNPA 4QKQA 5L4SA 3LF2A 2JBAB 1Q91A 1SKAA 3MT8A 4KI7A 5AW3A 4ADSG 1BFKA 2ZAOA 3D8BA 3JWEA 3KJXA 4O4LA 2UAGA 5KKNB 2HFKA 1OPXA 1GA4A 1BFUA 3AJ9A 1IN1A 4GPIB 3WZLA 1R50A 4YCLA 4MRVA 1DIOB 5E1MA 3FUWA 3AF3A 4DNFA 1W7AA 2FXVA 4N76A 4W5WA 2J5BA 4MQLA 3CUKA 4MV3A 1LZKA 4O8CA 3UJNA 2UUBB 4ZHSA 5K05A 5EE1A 2CXQA 1GRVA 3Q9UA 1O94A 1S9DA 1M3SA 1V0JA 1VJTA 4R1NA 4X91A 1RMYA 3RT1A 4EYQA 4JQZA 2Q2NA 3DZJA 3G7UA 3EA0A 3WL3A 3GLGA 3RHTA 4QLAA 5DHAA 1PKXA 3IOEA 1G59A 4CTMA 2WHXA 4Y1GA 3S0JA 2HSGA 3OX4A 4GBGA 5AIAA 4E6EA 1USIA 4L5IA 1I2MA 1QIEA 4G97A 1UODA 4M7RA 3A9RA 4P38A 3I09A 1XMIA 2G3YA 3MRXA 3TXAA 5H9WA 2BHRA 5DGHA 4CUZA 2JJYA 1V7QA 1XLUA 3PQ2A 4GAEA 3TLJA 2WG2A 4D8XA 5E6UB 1ZA1A 1E4EA 1Q11A 1SZDA 3GGGA 2FEPA 5HILA 1WSAA 2NACA 3AVPA 4YP9A 2C2WA 3FBWA 2FYTA 2GN8A 1YTUA 1V1RA 3T95A 3W9YA 1IMJA 1ZAKA 3FPBA 4NQRA 4P81A 4UE3S 4YMUA 2ZJFA 3UMGA 4QGAA 4JJ7A 4BEBA 3BRSA 1B6GA 3LF1A 4MW9A 2A84A 4QASA 3G0DA 4IICA 2J9GA 2DHCA 2ZTSA 4FGSA 3NHKA 1VG1A 1LGYA 1V96A 1P2BA 2F8TA 5CT5A 3LT0A 3E22A 1YRQA 3KKZA 2R1TA 5FOVA 3RF7A 3RFUA 1NYTA 2C54A 3SBXA 3I5XA 4YBZA 5DCLA 4DQUA 1R8JA 1QU2A 1OYVA 1P2TA 4F6CA 3T8YA 4X1IB 5GINE 5F51A 3OU6A 3WV4A 1L3CA 3LE8A 4FYWA 5L95A 5J2TA 3U7IA 2D8MA 3B8HA 1OIVA 4ZCQA 1CV2A 3QKUA 1ULUA 2AZDA 4BVBA 3UJ3X 3H75A 4YRCA 5I01A 5JNLA 3TMYA 3NVKI 2H7CA 1BOFA 3VR3D 2XLCA 4LDPA 3U80A 3GJ5A 4OLHA 1RC1A 2G72A 2GILA 4V0LA 1KMIY 2ID7A 3I2FA 1DC6A 2JEYA 2B21A 3ZXYA 3DH0A 4ZGWA 4EPWA 2C7OA 1YB5A 5EMHA 1P1JA 5H59A 2D0IA 1HUQA 1HH4A 2FVYA 3K1JA 2ZR9A 4HRVA 3T3HA 4WJLA 2K2QB 3WQSB 3WSVA 1ML3A 3EPPA 2ZJ1A 1G9SA 3OOSA 3U4QA 1GXSA 2XYGA 3AI7A 2WM8A 1CFJA 2DPMA 5LZ9A 2VT2A 4C22A 3KD3A 5F7XA 5LPNA 4TN5A 2Y4OA 4ZO7A 4B6RA 1NJ8A 3C15C 2CUZA 3D5EA 1U2GC 2NNLD 2R1TB 1H4VB 4K46A 1C9JA 4R8LA 5B5SA 4EHJA 5AM5A 4E7PA 5AKIA 1DG3A 1R18A 1A0OA 2VLIA 3SYMA 3VZQA 3QUAA 1J49A 3ABSB 1NE7A 5LA6A 1RHKA 1WSWA 1ZWKA 2FPSA 1MABA 3BH7A 1QK3A 1S7GA 2HU5A 2ADMA 2ZRLA 2QHXA 1II8A 1LU9A 1NVGA 1YRHA 3HYRA 3O2NA 3PNYA 5BWBA 3HKEB 4IQFA 2PKWA 2TMYA 3KZNA 2OVBA 4DDMA 1IQRA 3ZBUA 2PRKA 3GDOA 4H4EA 4KODA 4MUYA 3JRWA 4E5DA 4KR7A 2JLWA 2GM5A 3G7SA 4N7JA 4QGSA 4P5EA 2IDJA 4E5SA 5KOHA 5DKFA 3S8EA 1DTEA 1R9JA 2ZYWX 4B7UA 2V7BA 1XAGA 2QP3A 4F5EA 1H69A 2W2KB 2PQ6A 3ZYCA 1RMQA 4TLEA 1XR3A 2VUSA 3Q9SA 5ALYA 4AU1A 1FTQA 3PX2A 1RZRA 3UNXA 2V3CC 2NUTB 4DRXA 5KTPA 2WM9B 1EU1A 2Y1CA 3OOJA 4DMMA 3NC4A 4ZC8A 1UDXA 1PGPA 2X3YA 3UF0A 4D8WA 4F4DA 3OG9A 4DTCA 2NV0A 4QNNA 4RK1A 3HUDA 4JEIA 4IBOA 4MDYA 3GFOA 1BX1A 3FFXA 1WKBA 2CYAA 4V03A 4DA6A 4URHA 3FNHA 4EW2A 3L92A 1YOVB 4M9RA 3FOEC 3FUVA 2LD4A 2P35A 3A4IA 3T9BA 2HWYA 3ZJ5A 4E14A 3JQ8A 4B8WA 4YRFA 3G9XA 3C5WP 5GIPE 5B2EA 5LIPA 2QRHA 3R77A 3EZ9A 4MRNA 2C59A 5EUMA 3PEVA 2C29D 3ADDA 3AHHA 2VK4A 5AQ1A 4OP2A 3O31A 3A1DA 2BSAA 3DDWA 2Y1OA 3B2EA 1XMVA 5CYPA 3F2VA 1SVIA 1DRUA 5H3LA 5K3CA 1M54A 4FYJA 4XVUA 4ENSA 1W5EA 3EK2A 4IIJB 1AQJA 4RLQA 3RRNA 4LRUA 4KE6A 2C9CA 1VP3A 1ARZA 1VPVA 1E1CA 1JEQB 1R0WA 1U2ZA 1AUPA 1NC1A 4S1NA 5KMGB 2PUAA 2IUTA 3AP2A 5HFJA 2GARA 4CV1A 5LQUA 1VPEA 4DA9A 2I2XB 5K20A 3AKCA 1WETA 4DADA 1CUHA 1NXXA 1DELA 1NZFA 3IQXA 3OKFA 1F9AA 1EK2A 3Q3CA 4G8JA 5E9JA 4I5EA 3CVVA 1CULC 1S3GA 1O6BA 1SUSA 4M83A 4OOFA 4WE3A 1TM5E 4M9QA 3GRAA 4XB2A 3W3AD 1U8EA 2QVYX 1F2VA 4DDVA 3T12A 4RV9A 1EUCB 1SM4A 4MMYB 1PJZA 2HF9A 5FPTA 1QOQB 4XQGA 5I4CA 1ZIYA 2LXNA 4QPCA 1F2DA 2ZM5A 3SIXA 4UUMA 5AESA 4Z4EA 3KKNA 4CMGA 1VIMA 2R2AA 4A4DA 2N47A 3T0FA 1XELA 4W5RA 2W58A 3EIQA 4KXLA 2CL5A 4LCJA 1F6DA 1G3MA 1LUAA 1ZXLA 2GPAA 3KEMA 5CTJA 5H3CA 5CD1A 1I5RA 5AJYA 3ZKWA 1VP9A 3C39A 2BMJA 2FK7A 1P9RA 2AR9A 2EOAA 1P0IA 3AWDA 3OF3A 3W9BA 1IVYA 1J2RA 3VX3A 1XRMA 3OZRA 2YHIB 1I36A 1SG6A 3SOPA 2QROA 4IX9A 2ZI3A 5HWSA 2Z04A 2Z4TA 5D3KA 3B13B 3AVUA 3EQ9A 1UOOA 3E2IA 5G3YA 5A4DA 1O0SA 1E3DA 1RAIA 2H8KA 1ILEA 2VP3A 3ANYB 4RSMA 4J1TC 4YVFA 1SEPA 2QTGA 1X80B 3N6RA 4TN1A 2X86A 1R9MA 4BX3A 1DDIA 1EK0A 1JYFA 2QL5A 3R5SA 2RCNA 1RJEA 5ITVA 4GX5A 4QPNA 1IEWA 1Z73A 1DEKA 4QUJA 1TW3A 4FYMA 4D41A 3VAZA 1OBCA 2V7XA 3VDRA 2FPGA 3ILVA 4MYTA 1I80A 5HW0A 1EEXB 4C7JA 1NW6A 3IMGA 3SBEA 2WYVA 4UPVA 2AZMA 4MWGA 5KWIA 1RBMA 4BAZA 5KYKA 3O2QB 1JYSA 5K3BA 3U40A 3Q12A 2GPYA 2W90A 1O77A 3G5TA 3ETGA 1XAJA 1N5MA 4HADA 2XTJA 1OB2A 1E5VA 3CO5A 4QOGA 1A04A 1ESMA 1M1ZA 2CHVA 2G40A 3MWLA 5F21A 4ZYXA 5EE3A 2JKVA 2P7IA 4TYWA 4F96A 4JI5B 3FB1A 3AUTA 4JQOA 1XJCA 1OTXA 4LBVA 2P3SA 3GFTA 2L18A 4UU1A 1TO6A 1ZK3A 3GN1A 3PVCA 5ULLA 2HRBA 4IXNA 4MAAA 4WESA 2GEDA 2QJFA 1CUYA 2QTCA 1X9GA 4Y2VA 3H83A 5TGZA 3WB1A 4A10A 1GNTA 3RSGA 2NV2B 3MWFA 2CFCA 4DMGA 2H1FA 4DCMA 4P0QB 2GO1A 4TKZA 1CQWA 1CUZA 1S7CA 5KDLA 3GAAA 5DN6A 3AV3A 1I51A 5ESRA 3DHNA 3LV8A 3FOBA 4KX5A 3ZE2B 2WEKA 3AF1A 4FDVA 1X39A 4BO7A 5JLJA 1ILWA 4YROA 5CT8A 3LO5A 1Z22A 3FPKA 3NWOA 4B3SB 3B1JA 4N0DA 4U63A 4BNGA 4N5MA 1RJFA 5LB4A 1TLFA 3CUEF 1OXSC 3ZS9A 1W52X 4PYLA 1I8TA 1DAMA 4MIOA 1DKQA 3N39C 2O07A 3RRJA 4C05A 5GZ3A 1FW6A 4FLEA 4P4NA 1P6QA 2C94A 2A4KA 2PVPA 1TPYA 3C5VA 5E95A 2GJKA 4Z86A 5E3IA 5EHQA 5HS4A 2VEDA 4PC2A 4O29A 2FOXA 4YCMA 3ZVMA 3PGMA 3RANA 1SC3A 4J0IA 4MIEA 2VJMB 3EUWA 2Z2JA 3PUIA 2B35A 2QRJA 4PICA 3WP0A 1SCUB 3MGCA 1X77A 2IZOA 3MJVA 2B4AA 3QSGA 3V2IA 1RLJA 1GGFA 3B60A 2O19A 2PGDA 4N40A 5ESDA 1Z38A 5L3ZA 2FLWA 3WB2A 2DTXA 4DIEA 4AKIA 2R65A 1PNQA 5JR3A 2MSWA 3UJDA 3MPOA 5ALHA 2QRZA 4L28A 5LSAA 1JJ7A 4Z4CA 2HXYA 2VP6A 4NMHA 5MHTA 3UC5A 2FW1A 1WW3A 2FR8C 3NT2A 1HORA 4JU9A 4HZUA 1J5PA 4RK4A 3E4CA 3SFZA 4MWBA 2N9UA 1R6UA 3K0CA 2J7PA 4J1SA 1OWNA 4DY6A 4KZKA 4BP9A 3N59A 1MP0A 3GMDA 3TEFA 3CJRA 3B5IA 3HWX1 3WSWA 1XLTC 5E4FA 5AJTA 3A0RB 5HF9A 5PGMA 3WK8A 4A2QA 1GA1A 3B5JA 4UBLA 4WV3A 1KETA 4AT1A 1WOYA 2QRLA 4ND8B 4X8HA 5HHTA 4LF8B 2ISQA 2HCRA 3SR0A 3NJRA 3WO1A 1GTMA 3P9YA 2ATVA 4K7JA 1T4BA 3DMFA 2CHFA 4L74A 2A88A 2QR5A 1XJWA 2ZREA 3RVQA 4ZI2A 4MW7A 5IC5A 4DLBA 2PH7A 1PFVA 2QGNA 3T4EA 1XQYA 2HWXA 1UBJS 4BC0A 5IAAA 1JTEA 2R8BA 1V39A 3AP1A 2HO4A 1U5AA 3IL2A 2Q5HA 5JNSA 4GPEA 2QRMA 3OP1A 1OI7A 1EHIA 3PF8A 3HNRA 4C08A 3KAJA 2QZJA 4FFMA 4QJBA 1OFVA 5DBFA 1NF9A 2OUKA 2DQSA 5EHIA 2AEEA 4KIFA 1JKJB 4OH1A 5B37A 3UMJA 4TLMB 2I6UA 4PHCA 2GD6A 1NXVA 2QU8A 3GCZA 2IP4A 4PC7A 4TTTS 1C1DB 2VDKB 1Z37A 2VN8A 3KQVA 4JLDA 3R8CA 2IIPA 2QD1A 2CJWB 2AJCA 2GKGA 5FBLB 3I61A 2Y6VA 5J5VA 4UDOA 1KIAA 3AY0A 4NIMA 3ROGA 3GZ4A 3HL4A 2AJ8A 4JGBA 4RABA 2E4WA 2GF2A 1JIXA 3LI2A 4O25A 1XCLA 5D01A 5KQPA 4H3VA 3ZWYA 1SUFA 1Z0ZA 2HSEA 1I7QB 1VB5A 3CWZA 3Q2OA 4UQPA 1P5RA 2PZFA 4LSGA 1JHRA 3TX6A 2E7ZA 1HYGA 1NP7A 1K6XA 1Q83A 1U4OA 1MH9A 2VJKA 5ADWA 3NM4A 4WBXC 1KE1A 3E0XA 1Z07A 4I3GA 5FHRA 3SJ7A 3SX4A 4G9GA 5EKSA 5C7LO 1EM8A 1VSBA 2QTNA 1YQTA 3FHCB 1K3UB 4YMVA 1ZVQA 1Z29A 4DG8A 1NULA 3OQPA 3X3HA 1DRJA 2C83A 2OCIA 3IRUA 1VA5A 1LV7A 4PLPA 2UXBB 3S4YA 4D02A 1CUIA 1NW8A 1J39A 4AECA 2X3FA 3TVTA 4WFKA 2ZW9A 3WY9A 4IV5A 3TTYA 1U0RA 4BMPB 3GRUA 2VBGA 1AKTA 3BE4A 3PT9A 2DR2A 5LA6F 1BKSB 4OVKA 1KDVA 4Y6OA 2C42A 4Q0MA 1E66A 1LZLA 2A9VA 3WRYA 2A4MA 1TZMA 4GHWA 1OZ0A 3HEMA 2DT8A 3NUZA 4I1UA 3IFSA 4RNDB 5KOIA 5FWXB 5KNCH 4HZIA 1E4EB 2NTEA 3AR6A 2AQKA 3IPRA 1Q17A 4DA0A 5AW9A 3G88A 3LBIA 4I5IA 4TV9F 1Y9DA 4AXBA 4S1TA 1X7WB 2NP6A 1JIUA 3HCAA 2VZLA 2P9YA 3PEFA 2XZDA 1QYCA 2OK7A 1JLRA 3QPBA 3TDMA 3QWFA 3HJRA 5DNEA 4I2NA 3D4NA 1CZUA 2LDXA 3FNGA 3M2TA 4JLJA 4LXYA 4M3NA 1MEOA 5DYYA 5EPOA 5F7ZA 3T3EA 3WLMA 1X7XB 5I7FA 1NG9A 3AUJB 2GMWA 4XH9B 1L7EA 2HRRA 3HB0A 5AM0A 2GEVA 4TMXA 5B1EA 2O2XA 4HVTA 4RCZA 3L8CA 2BUBA 3RBAA 3RAGA 1X1DA 4MVYA 5ALMA 4YRMA 1OLSA 1YE3A 1XDSA 1P1HA 3JS5A 3PGVA 2NO9A 5J2TF 3WLEA 1PNVA 4EECA 4X61A 1SVMA 2GN2A 5IBQA 3RIHA 4CLRB 2H0QA 4FT4A 3PXUA 1J5XA 1ZRSA 3LBFA 4G67A 2Q29A 2D1TA 3IB3A 4MPPA 4WZBB 5A3JA 3P5BA 3GFGA 1V8BA 3OQNA 4EKYA 3KX2A 3GBPA 4TRJA 1Z08A 3C3XA 4Y9UA 3NWBA 5IXSA 1PGOA 2PG3A 2XWJI 5ENZA 3RU2A 5TC4A 3KWMA 1AGXA 3IIJA 2IYRA 3K73O 4FONA 1E8MA 4D3SA 4XLTA 2ZVPX 2ZTVA 5LYJB 2PT9A 3TRDA 5D8DA 5F23A 1E1QD 2HIHA 4DJTA 5HJ2A 3UBTA 3EOAI 1JXOA 1TM2A 3ZBQA 1R6VA 2JJMA 1VHDA 3PNSA 2WJ3A 3PNVA 2PT7A 4IZOA 1KSGA 4I8DA 1Q22A 1NBMA 2RKWA 5LMCA 2F1JA 2OAGA 2VHUA 2EFDB 2GZ3A 2M6LA 1JDZA 4I2VA 4YRGA 1VJRA 5L3RA 2D4HA 1O54A 1JDUA 2I76A 2H2DA 2WTMA 3E9ZA 3GQBB 4LNHA 2IKSA 2C5FA 4TUYB 3WGTA 2OD7A 3OEHD 1W0JA 3P2IA 3K0FA 3MQ4A 4MYCA 1MKYA 1YVEI 5JY6A 4IRUB 4E2YA 3VU3A 4YXWA 4GOOD 3W1WA 4CWAA 1UT6A 1FPMA 3JXEA 4EMBA 1C1XB 4DV3B 3AU9A 2HMUA 2VUUA 2W2NA 3NV7A 1PU2A 3CG0A 5K3FA 4BNHA 1NG1A 4WT7A 4TTVA 3NBKA 2FQQA 3SX2A 4B4UA 1IHOA 3DOJA 4TKVA 1NUAA 4B33A 1V8DA 3B3GA 5K0GA 2GVNA 4IUBS 1KNXA 2MJLA 3NG1A 1EGAA 4PLGA 3ZN2A 1MX5A 2IY9A 4DJJA 3SAJA 3M4XA 3FYUB 3QLVC 2R5WA 5H4GA 4WSOA 4HDNA 3PUJA 2X1HA 3EWNA 4M1QA 1QHIA 5BUZA 3PX7A 1Z8NA 4OHPA 4XUEA 3FTFA 4UHEA 5BMVA 1YZNA 4YAKA 3PC8A 4HFRA 1TNDA 5TLSA 2PLNA 2VYFA 3N76A 4FP9A 5C5CA 1YMVA 3CLTD 4FFLA 5TGDA 3UMYA 2B4RO 3C3WA 3K16A 1R10A 3K35A 3OKCA 4QDXA 1GTG1 1U2PA 2QMUA 2PUJA 4DL9A 4F2GA 1MQSA 4R71A 3Q0EA 2FW7A 2PJRA 3WKAA 4JXZA 4IF6A 1E1DA 4AJJA 3RFVA 2X2OA 4OB8A 2FPIA 3UHFA 1I32A 1ODCA 1Y6RA 3ZLBA 5ICCA 1KH2A 3QJGA 1CZHA 2VT6A 3NHUA 2QBYA 1AGPA 2CXOA 3PDWA 1IBLB 4EELA 4B3RB 4F06A 5MFZA 1LDNA 4PXYA 1Y3FE 2QMHA 1KI2A 5IU6A 2FMKA 1UCFA 2WW8A 3KUCA 3LRPA 4Q7LA 3EN0A 5GGYA 2HREA 1A1SA 1DS6A 2ZUCA 4YTEA 3DYIA 2CHGA 2VZEA 2CYCA 1KGSA 2PM8A 4KL8S 4CPDA 2NUBA 4M9CA 4IV8A 4CF7A 4NOMA 5KYWA 2NU8B 1MTZA 4LZJA 3NXSA 5TIIA 3ZCXA 5CW1A 2K5UA 3JQBA 4E70A 2NSDA 5J4VA 5FPSA 2IJGX 3W6ZA 4UCFA 4E5UA 4MGZR 3FJ1A 5FUBA 5KJCA 2AHRA 4B34A 3TD9A 3ZCQA 1HA3A 1S9HA 3MLAA 1JAZA 1YDWA 4GC5A 1QZZA 1W59A 3VPBA 4BTEA 3H6KA 4RENA 1NIJA 3L6OO 5KMGA 5CCXA 2JFXA 4U2BA 5CLLA 2HA7A 2OO7A 4FJ2A 4HGOA 2DYKA 3KOWA 5CH3A 2FPMA 1LBHA 3H5IA 1P4RA 3GUYA 3H7IA 2Z8XA 1TOAA 2IZ6A 3A3KA 1I9CA 1U8XX 1DB3A 4OMFG 4BNDA 4MW6A 4PAOA 1XTQA 1PT6A 3DFUA 2HYIC 1AT1A 4MB2A 1LDYA 1X1CA 4I0WB 2AD1A 2ZYHA 1YFKA 3M9LA 4N1AA 1U2DA 1B4DA 5UKDA 1IZZA 2XTNA 4EY3A 5J23A 1KZ7B 3DB2A 5GM2A 4ZT2A 4DIMA 3U48A 3WYEA 1HNXB 2ZJ6A 3DC7A 1C0KA 1EWTA 4LTDA 1U94A 3HNPA 1DCKA 4GVPA 3R0ZA 2YMQA 1H4SA 2WD8A 2G9RA 2ZYIA 3WAJA 4UUOA 4O08A 3WIUA 2CLDX 3PVZA 3CLSD 1V11A 2ANCA 2PMDA 3EGDA 1I3NA 3DMPA 3PLNA 5ALWA 1S8OA 2P40A 4BCBA 4JFRA 1A69A 5TNXA 5LYYA 3VMFA 5DM4A 2NZ2A 5TMEA 4QC2A 2JZCA 3LZ6A 1OUMA 2P62A 3W8FA 1YA4A 4IGFA 5DW3A 3N8NA 2PA0A 5I9LA 3SIPA 4UW9A 1U0TA 4W7IA 5GONF 1T4CB 4WADA 3H19A 3F9CA 5I9SA 2C07A 4OMCA 1F0PA 4BNDB 4TLCA 3L7AA 1YE8A 2ZUTA 1OROA 2OENG 2JD0A 5C8VA 2R85A 4KG7A 5ELLA 3SQXA 1UBRS 5HF8A 3TLGA 5LU8A 4CVNA 1OZHA 1SCBA 3F5SA 2RHCA 4ME6A 4DR4B 2GPBA 1PGNA 2NSYA 1JWBB 3O38A 5G1OA 4ENPA 2B2CA 3LUDA 1D2AA 4TMKA 2D59A 1ZH0A 4ZCSA 3VVMA 5KNDH 3CLUD 3K30A 3OURA 4JP8A 3EVBA 4IH4A 5A0FA 3TZ6A 3CNEA 3MSXA 1FFBA 4Z4QA 4DCOA 1PBTA 5D87A 1YFZA 4E1VA 4X62B 2XW6A 2X9GA 4KYVA 2BEWA 2VP2A 3IP6A 3D2BA 1O6CA 2XQFA 4UXHA 1J90A 1TM7E 4FZVA 4Q7EA 2XGMA 4CM4B 1I4OA 4EYSA 3G1UA 4DIUA 1YR6A 2A57A 4OUDB 2BKXA 3NWEA 2VJQA 2VJLA 2ZULA 3SKYA 3WLJA 3ZIAD 3RVPA 3VYUB 1EXVA 3ZIAA 4B8ZA 3U60B 2O8EB 1X14A 4HXEB 4E5MA 2EC5A 4FNOA 2ZYVX 2HNBA 4L5YA 2C57A 4O2AF 4DB4A 3TKLA 1O9BA 2IOFA 1X7YA 1ZOOA 5FWAA 2VRNA 1YU6A 2WFLA 1QRSA 1XKTA 3UMCA 5DX8A 3JAKB 1KRHA 4YRZA 5A1JA 3HLKA 3WNCA 3GEDA 4PC6A 1ZI9A 1DC4A 1PJ8A 3H2KA 2WYIA 1A9YA 3OZUA 3ICOA 4CQJA 3UENA 5E3HA 3DP7A 3EVTA 4MUNA 1ADCA 4URFA 3WGQA 3IEMA 5LVAA 2GLXA 1EB8A 1FVXA 2FZLA 3NATA 4BGVA 4XQCA 2ILTA 1WPRA 4A8HA 4FD2A 1JFLA 3UV6A 3N7TA 4ZVVA 3EH1A 3FKSA 2BEWB 3PD1A 4NU6A 3V9AA 4ENVA 4V0MA 1NNLA 4QOFA 2PO7A 5IWCA 5JNRA 4IS3A 3LT2A 2RJNA 4MGEA 3V2HA 3ACCA 5EJMA 1Y8QB 2A5GA 5BYAA 1LBIA 1MJNA 1YS1X 2V8OA 2WMYA 1M0SA 3NNSA 3OCJA 2V7QA 1T10A 5FDFA 4R2IA 2FWAA 3QOFA 1Z9BA 3OIVA 1IHYA 1XLWA 2JAOA 1GFIA 4EB6A 3AMVA 4HXGA 4DC0A 1G5TA 3AY7A 3H1TA 3E7WA 4IIDA 2OYRA 1E2BA 1O9HA 3BMCA 4BQEA 4TL8A 2XEDA 2JFWA 4JLVA 1TJPB 4HY3A 1TVMA 2AEMA 1PHPA 1L8AA 4D46A 4KAAA 2G1PA 1KRWA 2M9MA 1EJ0A 1EUDA 1FVHA 3PE6A 4PNHA 3UJ8A 3EAFA 5AKJA 2F43B 5T4HA 3FD8A 5CFLA 1TCUA 3IELA 2BY4A 3LLMA 4XGIA 1JHOA 3KDPA 2EW1A 4Y2TA 1WNTA 4A36A 1KC3A 2YV3A 4LZAA 1I5EA 5IK2A 4MMXB 3J7TA 3DC2A 3TB6A 3ITNA 3T1YB 2Q9BA 4ESOA 4NBWA 4OHMA 2I7CA 3AVYA 3CUSA 4YO8A 3OCWA 2F3QA 2VHTA 1K7FB 3BL8A 4J0DA 4CGZA 1XRPA 5IJWA 3F3YA 5E8JA 3A31A 4GOND 3EC1A 3G59A 3SIRA 3O1LA 4GXNA 3TMAA 3UJBA 1QYVA 4S1OA 1I10A 3S1AB 1I9GA 2WKRA 4I1SA 3B3AA 4QRHA 5CEEA 4D56A 1W2GA 4PLHA 2VJNA 2JG3A 2XZLA 5F9FA 3BFVA 3T61A 3CN7A 4M0MA 2GETA 1QE0A 4ROTA 3SXJA 5J40A 2E4AA 2FB9A 2ZZKA 3BRWA 4B4WA 1Y9EA 3AM5A 1QQTA 2GUWA 5CCBA 2ZZNA 3N2ZB 1V45E 4M87A 1CQJA 3EVNA 1XF1A 5JAPA 1QAQA 7MHTA 1WHSB 1OVMA 5DVZA 2OCAA 2WVGA 1KYIA 3H8VA 2ETVA 2PGXA 3EXAA 3FUXA 3WMGA 1FNDA 1A7KA 3RYIA 4D9IA 4OV6B 1X8XA 3HUFA 1U2QA 4FI3C 2PE5A 1A50B 1JSLA 2WFZA 1PG2A 1ACLA 3HVKA 4RVGA 4JJGA 3D2LA 3HP4A 4BZQA 4MVJG 2H1WA 1T1RA 4P31A 4C4PA 2BUCA 3MTAA 5DM0A 2YN4A 4JLSA 4F93B 5CNMA 2RB5A 1RVDA 1T5DX 4X8MA 4KWHA 4FYIA 5DP2A 4F5DA 1J56A 3L46A 4CLHA 3HBLA 1NBAA 4LBZA 4DNPA 5J4LA 5HIAA 1NKSA 4WK4B 3D5QA 4MS1B 2FR8A 2XV1A 5ALGA 3QPUA 2XWSA 2XYPA 3EFOB 3FBTA 3OOWA 3FRIA 1KPHA 5JMWA 3U3RA 2Y2UA 2HJGA 4JEMA 3UGJA 1THGA 3E9RA 2HU8A 1EJ2A 3DW1X 1BQ3A 5LL6P 2OUIA 1UPTA 4C0LA 1KI3A 1U0NA 4N8DA 4W8GA 1GPLA 4YXWD 1RLMA 1N4AA 5CFQA 4FW9A 2BAGA 5CBPB 3EPHA 5IMSA 1ZJ6A 2IQIA 4MEJA 4J9UE 4R3NA 2KLBA 4YP5A 3IEXA 4EOGA 2WMDA 5H0IA 3FB4A 4H7PA 4HUQA 3RS2A 4KDRA 2ZI4A 4XE5A 1WQ1R 5EGNA 1AGRA 4EY5A 2C5HA 4I5FA 5C81A 1B76A 1I4DD 3L8EA 3SEAA 1GQRA 1QKKA 1DBQA 3TR0A 1VG8A 4JVMA 2WWTA 4J1QA 1EQUA 3NHAA 3JYQA 3GCXA 4TXHA 2CFIA 1D9XA 1ITZA 1L7RA 1Y89A 2I2CA 1KJYA 3PICA 4RF5A 5JJCA 2WSSA 3IP5A 3KPWA 1J06A 1UBUS 1FYWA 1COWD 4GDMA 5BSUA 4GZ5A 4Z4GA 3L1VA 3OJ0A 1OLXB 4UUQA 3RC2A 3GYBA 4B3IA 4UNPA 2R7NA 1PL7A 1SH7A 1D6NA 1LWOA 3I34X 4DDWA 2QD2A 2VJCA 1KWKA 3DVQX 4JIGA 4RS4A 2FWPA 4W9MC 1G6OA 2H6EA 3ZTWA 2HUNA 4DWWA 4G37A 1N2JA 2LR0A 4UM7A 5ICFA 4DILA 3ESAA 3ZWOA 1RWOA 3IUEA 3TCNA 4F3CA 2AXPA 4N0MA 2HF2A 1N9ZA 4W9NC 1T0PA 1Y1RA 2JB9A 5B1DA 2CSXA 4BU0A 4WLEA 4B85A 1MGPA 4EABA 5HJ7A 3K70D 3RM3A 4Z49A 3U61B 5JSZA 1BD4A 1H8HD 3VZDA 2L2QA 1BIFA 4TVSA 4JI2B 4IW3B 2JJ2A 2PYIA 2ZIXB 4KV9A 4TT3A 1V3VA 1E7YA 1PW7A 3TM4A 1DT3A 2BFDA 1HK7A 4UZEA 2CV1A 2PGIA 3AEUB 2ABWA 1R4NA 2DHQA 3GUCA 4Q9KA 4OAOA 2VNAA 3M3DA 4C01A 4WBNB 3HCRA 5F12A 2J7KA 2A3NA 4HAIA 2I7DA 2O59A 4TTPA 2EBFX 3CCFA 3GJXC 2O9JA 5IMBA 1Z5UA 3D3WB 1E2PA 3NEPX 1YQEA 3NHRA 4X8OA 3TLZA 1IM8A 3LTEA 5HZMA 2TECE 3EDMA 1T0JB 3G2PA 1A76A 2E21A 1KEUA 2OZPA 2PV7A 3AVWA 3ZV4A 4ALMA 4AZSA 4QOJA 2Y0CA 4EHFA 3CGWA 3SOZA 4F2PA 5HQ3A 4J29A 2UUPA 3WKEA 4BQOA 3DKKA 3ROXA 4TKUB 1UJ4A 4D98A 2JCVA 2WG1A 2ODWA 1G20E 4Q1VA 3AKZA 3HM2A 3AEKA 1UK6A 4LK3A 5I7AA 3DDZX 5B36A 5JW6A 3L4BA 3DV0B 2N46A 2ODAA 3QVVA 5A2GA 5MN4A 4DDTA 1S6YA 4MLZA 3VR3A 4FEGA 1N0UA 4L4YA 4N41A 3QMPA 3ESBA 4QUDA 3A2KA 2IYTA 2O2IA 4WNAA 4MV4A 5EL0A 3IEKA 4PX5A 3WGJA 3RFXA 5KZMB 2I3GA 1I2DA 2Y0BA 2XMDA 3ASZA 3M5DA 4FMBB 1TKBA 4OA5A 1R0ZA 1JHVA 1O89A 4MUJA 4YRJA 4CM9D 3DAOA 3ZUGA 2DJ5A 2OBFA 1MORA 4WK0B 1L7PA 2AR7A 3RU9A 2HDHA 4J0FA 2C2MA 1T1IA 4JASB 4PYRA 2CLIB 4B87A 1N7JA 1XK7A 1R66A 2Y1DA 1VL6A 2BWJA 5EINA 2XRFA 3HKBB 3O4GA 1QR6A 2BEVB 3UXHA 1L8XA 3IH5A 4BVLA 2Q3MA 2HHJA 1AGNA 5DSXA 2QWXA 3T5TA 3VPCA 3BMOA 3BBLA 5ES3A 2WP0A 4MQUA 3DAPA 4A8JB 4HGYA 1Z0DA 3C7AA 2PGNA 4Y1RB 3MWGA 2G9UA 3EULA 4DHWA 1PTJA 2FSPA 2YBDA 4Z7NB 2CUNA 5JZ9A 2NSHA 1JLLA 5HFNA 2XKBA 4FYYA 2JIMA 3DVAB 2XCUA 4B74A 4I1YA 1H6CA 4ZQCB 3A2MA 4H08A 1F06A 1SN7A 2F3PA 4KXUA 4LISA 2XE8A 3VTAA 4ZIRA 3MYYA 2G5GX 1PZEA 4KFTA 2YS6A 4TTJA 2O8BA 4YRQA 4AWAA 2DSTA 1JT2A 1D8TA 3K4HA 2OLKA 1R2QA 4KDFA 4RFVA 3BERA 1XVAA 3LDHA 1Z18A 2BIFA 1SBNE 4MQ6A 5HXAA 4RFLA 4V38A 3L7LA 4Z9AA 5NULA 3CV3A 1KPIA 4LDAA 3SXUA 4D4KA 5DB4A 4JY7A 5JBNA 3R7WB 1W6UA 2VYCA 4QDUA 3GLIE 1N1MA 3RU7A 1F7VA 3SQNA 1EGMB 4JLAA 4R8RA 1DJQA 3NVAA 4C7VA 4NV1A 1VBNA 3W2HA 4JYMA 3VSBA 1SCNE 1JI0A 1E6CA 1L4NA 4FUQA 1U0BB 1D9ZA 4TRMA 4OUKX 1QHFA 1E4YA 2JCBA 1ZGHA 4DM3A 3SJZA 3L41A 4QJ3A 1VSTA 1L0BA 2QDXA 3S40A 2GZMA 1LB1B 3OT4A 5JNUA 4FFRA 5FULA 1Z4MA 7GPBA 3DE5X 1BROA 2VRCA 3K8ZA 1ZKMA 3JWPA 3IE2A 4J3NA 4JVOA 1Z6GA 5JASA 2WJGA 3IT0A 1MF7A 1PZNA 3NDPA 4LXQA 1FUYB 4D9KA 1Y7PA 3AX6A 3I05A 5BWLA 1M6NA 1VFPA 3CX6A 4EO7A 2BZSA 5AD1A 4HUJA 3MCTA 3SSNA 1VBFA 1YGPA 3MTDA 2QQEA 1F6BA 1BMQA 3CRNA 1Z63A 4JBIA 2IOYA 1EX1A 4LBWA 1G3QA 4F2HA 2HQSA 3ASVA 3LXRA 3EGWA 3LUBA 5IN5A 3R20A 1DAEA 3SMVA 1KI1A 4BASA 4B47A 3KD2A 5EXXA 1XPOA 1RJDA 3GR6A 4Q3KA 3R74A 1PR5A 3A4YA 3ZE1B 4XIYA 1DG1G 1RI3A 2IYLD 1SQGA 3DKPA 1PZMA 2TS1A 2QG9A 4IF4A 3R7FA 1VDZA 3FROA 4I6EA 3OJLA 3JVUA 4DCSA 5ICEA 5FWDA 2O8CB 1JG7A 3AHJA 3FCAA 4Q1FA 1RW4A 1FYXA 5D86A 1A96A 2RHWA 3PYLA 3B7GA 4N6OA 1VG9B 2GAOA 1SIOA 4DN6A 1KVUA 3SZMA 4KTVE 1X9HA 4C0SA 4LS3A 1OX6A 3GMIA 4NJMB 2F3SA 3LY8A 3OUTA 1P9OA 2HAEA 4YEDA 1YXMA 2LNDA 2PUHA 4B48A 5HM8A 3PCRB 1A9ZA 2IUEA 1KI6A 4BYGA 4YIHA 4WDRA 1JQKA 5HIJA 2YWCA 5CCDA 3V7NA 3HXOA 4AJ2A 3OU2A 4LYAA 3SBOA 4B31A 4LAFA 5ESWA 2HK6A 3MTIA 3H9JA 1VE5A 4UM9D 5ECDA 3H16A 3NHWA 1CUXA 4LRQA 4E51A 3UHPA 3FJYA 4QM6A 4ZVUA 5JCOA 5CXQA 1ESCA 3HVJA 1VJGA 1U8UA 2I4OA 3JQGB 1SQSA 5BWCA 4UOZA 2JJQA 1S2IA 2JCXA 1BE0A 2EJVA 5F4ZA 1HNZB 1SBQA 3PNPA 4KFRA 4MNTA 5CIWA 5A05A 4I46A 3SYTA 4AUEA 4CIBA 5LXTB 1NJ2A 3P9CA 4U2KA 3PWTA 3H8SA 1GAWA 1QLHA 2DJIA 3CM0A 1KO8A 1SKUA 4OGKA 2CHQA 1EZ4A 4X84A 1G5PA 3PFBA 1OU4A 5D7BA 3GZNA 5EA2A 5A3QA 4WKOA 4U9IS 4EA7A 2Z6QA 1IATA 2XB9A 2KSQA 1BE1A 1MEJA 5IHPA 2IX9A 1P4HA 1EQ2A 3L6DA 3H11A 1BH2A 1H3EA 2JHAA 4GMFA 2Y92A 4B81A 1D6MA 5TS2A 2WJJA 3G8CA 3ABZA 1YMUA 2BDUA 2GTIA 2XGSA 2WU1A 3JPWA 3JX9A 4IG9A 1CSEE 2BJWA 4HAWA 1WUHS 1GL9B 5A0TA 3B9PA 4RLSA 4HNAA 3ZUPA 5TVKA 1P1BA 1NOJA 4Z1OA 2OD2A 2OC9A 2R3SA 4NAUA 4NE2A 3WGUA 4GMKA 4EJSC 4IH9A 1SKMA 4IDDA 1H0KA 2BEJA 1QG2A 2CZGA 4CMEC 5AVVA 4K3VA 5M7EA 4YUAA 4Z53A 1ESDA 3LPCA 1ONNA 1LTHR 1X19A 3IA7A 3A1SA 3KKMA 1GT91 4GMHA 3JWJA 4GT1A 2NVOA 4G0OA 5DT9A 2H65A 3GD5A 2F00A 4G5OA 4BMYA 3TVYA 1EUDB 4FR2A 2DXIA 3S7TA 2NZYA 1EWYA 3TR5A 1LRLA 4CG2A 4CTKA 4QUIA 3FAZA 5C8XA 2ODPA 3U7EB 1OGJA 5KPDA 1GKKA 2QUIA 3MQ2A 3QHPA 5DOZA 5TRTA 4P4GA 3BE8A 3P5SA 3U6KA 2ZQYA 4DUZB 3GVIA 4EVSA 1CQPA 2DHEA 3F8SA 3MILA 1NAHA 4P84A 4RVUA 3RTEA 1Z88A 2AG0A 2YQZA 4QQ8A 1X86B 1UPFA 4NE7A 2IELA 1VCIA 1X1EA 4JQCA 3ZWQA 4P5DA 2Y27A 1DIAA 1NA5A 1XRQA 3I9NA 4K40A 4L72A 2BD0A 4FQ7A 4LX8A 1YL7A 4LEIA 1XT6A 3ELWA 3M81A 2GERA 1PSWA 3WMWA 1DMSA 5K3EA 1DEXA 1OLOA 1ZK0A 3L1KA 1E6UA 4ZREA 3TSZA 3ENKA 3WB9A 1XTUA 4P4LA 2F67A 5JRZA 1Q1AA 4E3ZA 5LOVA 3EXHB 1VG0B 5TDHA 3RVJA 1ZU4A 1KFEB 5DV9A 1AO3A 1QK5A 1UP4A 2Q8QA 3ANNA 3BE5A 3DL4A 3KZCA 4QYXA 5AQEA 2VI5A 4DARA 2PD3A 3LY5A 3TDKA 1FVOA 2RGRA 4G0NA 1MTOA 2WIDA 4D9CA 4FOTA 3FZGA 3DZFA 3AW8A 4XB1A 2P7HA 1YT5A 1UEXC 3QW2A 1A2QA 4ZV9A 1T1SA 1MIOB 4BEVA 1JDBC 1IZ8A 1R3DA 1A9PA 1NLUA 1RD4A 2MYNA 2JGDA 2O23A 2UZIR 3H2HA 3OFSA 3TLCA 3UFXB 5BV0A 4H35A 4F21A 4DIFA 4ZVSA 2Q3FA 3D7LA 1Y3BE 4OO3A 4XB6B 2QTVB 3F8WA 3W5AA 3KL4A 4ZQHA 3PR2B 4O4JA 3ADCA 3KELA 3P0HA 2E9SA 2RG7A 1YS9A 1FSSA 3NJ8A 3DLHA 4Q21A 3QKSA 1YQXA 5J4YA 1GL7A 2F1KA 1ZC4A 2HBQA 3FNEA 4O4HB 3RRZA 3GLQA 1FNMA 1JPUA 5BWMA 3CPHA 3S7ZA 2ZI6A 3IUNA 1HLDA 2H1LA 4QXRA 4AZ3B 3JQFC 5CNJA 1E6EA 3K15A 3U0BA 3D2CA 1SVWA 4TLAA 4C1BA 1U02A 1HR0B 5DBEX 1FRQA 2A0WA 2IXFA 3NIDB 4LVUA 3FLMA 4XJVA 1DAKA 2XCLA 1U6IA 1KYVA 3VU8A 1NLMA 3SNKA 1W34A 4P3PA 4U2CA 5DXJA 3U4HA 2B8NA 2GCOA 3BRQA 2VT3A 4R68A 4TSFA 3U1TA 3OCUA 1DINA 1NDQA 3CX4A 3STXA 5EJ7A 5I7HA 3FUUA 1R4MA 2DPHA 4ON9A 1OCEA 1ETHA 4WNIA 3WQBA 4CKXA 5HZHA 5JIBA 3COPA 2VNJA 4OMDA 3VC1A 2A5DA 5FNVA 1WU7A 3AR9A 2ACKA 5CVUA 4ABYA 2HSDA 5IJ9A 1LJUA 1K5HA 1CR6A 2WE7A 4JL5A 3EZFA 2C3UA 3RAPR 3LD9A 2Z58A 3TCKA 3WTCA 4EFKA 3CB2A 5K03A 1LC3A 5JD6A 4HDOB 1WUIS 1JNXX 1ABFA 2G1KA 2F9FA 4QT4A