1JF8A

X-ray structure of reduced c10s, c15a arsenate reductase from pi258
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
130
structure length
130
Chain Sequence
b'DKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
molecule tags Oxidoreductase
source organism Staphylococcus aureus
publication title Arsenate reductase from S. aureus plasmid pI258 is a phosphatase drafted for redox duty.
pubmed doi rcsb
total genus 49
structure length 130
sequence length 130
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jf8A00
2JRLA 1W9HA 4WZZA 4MQFA 3RVLA 1KRWA 4EGSA 1DC7A 4W5RA 6ABPA 3A10A 3SY8A 1DBQA 4MS4B 3KS9A 4M88A 3T8YA 1OXBB 3JTEA 2IOYA 2XDYA 3H1FA 2QVCA 1M2FA 2A9OA 1BVHA 2FVYA 1YIOA 3TX6A 1GCAA 4L85A 3QLUC 2PUBA 3CNBA 4LZLA 2AYZA 2JBAB 2PJUA 2QR3A 3QLTA 4TMYA 4ZMRA 3P9YA 1GUBA 3NNDA 4YRZA 2IPAB 5F64A 3DGFC 5HKOA 2HSGA 3O2JA 3LTEA 1QO0D 2FLWA 2HQBA 3OMXA 4RSMA 4IRXA 1EHCA 1I3CA 2GKGA 2JBAA 2IKSA 1ZESA 4G86A 5IULC 5IC5A 8ABPA 5JNRA 4YO7A 5JNSA 3T95A 2I6FA 3KCNA 3M6MD 3LUKA 2QXYA 4G0QA 4ETNA 4EYQA 1JYFA 4NCAA 4GPAA 5GOTA 3UK0A 5EWMB 1DBWA 7ABPA 1SXGA 5KQGA 2PUGA 2VUIB 2ID7A 3HVRA 3RQIA 3OLYA 4LX8A 3LKVA 4MS3B 4S04A 1WETA 3OLZA 3LUGA 5JNTA 3I09A 2MYTA 1KRXA 2MSKA 3KLNA 4PICA 2LUOA 1EWVA 3L49A 3RVQA 1Z18A 3DLBA 2L17A 2MYNA 4OLAA 1L5ZA 1E6MA 1YMUA 3N53A 3QELB 3HJFA 2NZVG 1MIHA 1LK0A 1TJYA 1A04A 2P4UA 3CZ5A 3LUDA 3HUTA 2FQXA 1NY5A 1JDNA 2WJAA 1D1PA 2FN8A 5CNJA 4XARA 3QX9A 1YMVA 5C5CA 3N6VA 2IDMA 1DZ3A 3JVDA 3ROTA 2JVKA 1CYEA 2WRZA 3IPCA 5IBQA 2LBPA 2F8TA 3KLOA 2FXIA 5IUKC 1T34A 2LP4Y 1Z15A 3BREA 4EVRA 1JH9A 4RY8A 4KREA 3JS5A 5EWLA 3VNBA 1NXVA 1HEYA 1TMYA 1QPZA 1MVOA 4EYGA 3KHTA 2VYCA 4GNRA 3TB6A 4KPYA 1URPA 5T7BA 4NICA 3GBVA 1B00A 2YHBA 1UDRA 1JFSA 4D6YA 1LJLA 4RWEA 4NV3A 1ZGGA 3O2QB 3Q7SA 3NNSA 4YR7A 4IMIB 4MR8B 2FMFA 3UKJA 1NXSA 2ID9A 1J56A 1QKKA 1GUDA 5JNVA 4FB4A 1P2FA 1F4VA 3RH0A 1FFSA 1EAYA 2WJWA 4Y9TA 4MS1A 3O74A 3Q7RA 5TQ2B 4F11A 4O1HA 4Z9BA 1QP7A 4ZMSA 5KQPA 5KWSA 3CG0A 1NXOA 3GA5A 1Z26A 1ZVVA 2PLNA 3F6PA 4P98A 5EWMA 4KFCA 4LRQA 1AB6A 1XHEA 1PEYA 3EQ2A 5C5EA 2P9HA 3F6CA 3SM9A 2PL1A 2RJNA 3RVNA 4F12A 2RJOA 1Y1LA 2H0AA 3QEKA 4D74A 4G0YA 5TPWB 3RVOA 5BR1A 1RZRD 3KYIB 5IEJA 4OLBA 2R4QA 5EWJA 4E7PA 3N8IA 1RZRA 2RDMA 3H6GA 3KSMA 4W5QA 1Z13A 2IPNA 4PE5B 2R47A 2HJ9A 3QEMB 5IUJC 2PUAA 2GBPA 4Z99A 3MM4A 4D6XA 1GLGA 2GI4A 4H60A 3O1IC 1JBEA 3GL9A 4L4UA 5JS1A 1Z2DA 1D4ZA 2PL9A 4JB0A 4YLEA 4KNYA 3H5TA 3CS3A 4HNSA 3KTOA 1ISSA 2PMCA 5FWXA 3HXMA 4H3KB 2E4UA 3OQNA 5JNWA 1BDIA 1RNLA 3N0WA 4P1ZA 3E61A 1IIBA 3HEBA 4RXTA 3KKEA 4IGAA 5TPWA 1GCGA 1W25A 4ZJPA 4S05A 1Z17A 4N76A 3TMYA 4MAAA 3HSYA 1ISRA 3SAJA 1AB5A 2JVJA 3CKMA 4W5NA 5DGCA 1P6QA 4ZPJA 4DADA 2PUCA 1TLFA 3H1EA 5KQLA 2QSJA 3R0JA 4QPJC 3L6UA 2L19A 4XAQA 1M5UA 4YP9A 4WUTA 1LBHA 4UHKA 3ILHA 2PUFA 2PUEA 2FKAA 5TQ2A 6CHYA 3UUGA 1RPJA 1JFTA 1A0OA 1JLKA 2TMYA 4MR8A 3RVJA 4EYOA 3GRCA 3SNKA 3QLVC 1FFWA 4MYRA 3S99A 1ZN2A 4QYMA 5BRAA 1F51E 3GV0A 3LUCA 5FWXB 3H5IA 5TPZD 1YK1A 3HZHA 2FN9A 3O75A 2L18A 5KQMA 4N41A 3MMNA 3M9XA 2JB9A 4Z4IA 4G97A 3ILYA 3LUJA 4RV5A 4KZKA 4XXHA 5ABPA 2H3HA 5CHYA 3ROFA 2NT3A 4MRMB 4N03A 5JNUA 5EWLB 1RXIA 2V0NA 3DGEC 4RZSA 3MYYA 3D02A 3TO5A 4RK0A 3RVKA 3OQOA 1QQAA 1VLZA 3N75A 4QICA 3C3WA 2O20A 1MAVA 2QZJA 4CBVA 1DP4A 1EWTA 4EVQA 3G85A 2FW0A 1ABEA 3EGCA 3KJXA 3TD9A 3H6HA 3IP9A 3T6KA 2IPLA 4PZ0A 1JYEA 3I45A 4KVFA 4F3TA 4B09A 3RVMA 5IEBA 2MSWA 4Z4FA 1BA2A 3A3KA 3CZCA 3T38A 2FQWA 4F06A 2NT4A 1BDJA 2YHAA 3RVSA 5HSGA 1YS6A 2CWDA 2R25B 3Q41A 5FWYA 5B3JA 1PNTA 5FBHA 1CHNA 1M2EA 3LMKA 5DCLA 4RU1A 3H1GA 4TN5A 1PUXA 3HUUA 1PEAA 3OO0A 3IPAA 1R8JA 3HK2A 2B1JA 4JB2A 1RXEA 1ZH2A 2AYXA 2ZAYA 3CG4A 2RGYA 5CNKA 3K9CA 4O1IA 5TQ0A 1TM2A 2VK2A 3EDCA 5BRJA 1YVUA 2E4VA 2MYUA 3MA0A 4JAVC 3RVPA 3IP7A 3OLXA 3CU5A 4G0XA 3KYJB 1K68A 2WY2D 3NHMA 4Z0NA 1S8NA 3HS3A 1M5TA 3H5OA 4WWHA 4JP1A 5DTEA 4OATA 4WXEA 1USKA 3QELA 4OTZA 3H5VA 5DKFA 2VUHB 1NXWA 4W5OA 1QP4A 1ZH4A 3BBLA 1QNLA 3OM0A 2DRIA 3FGZA 4LDZA 4MGEA 5TPZA 2FMIA 3EAFA 2FEWB 3LUHA 1NTRA 1ZHHA 3H5WA 4Z9AA 4Q7EA 3HV2A 1U04A 4EVSA 2ZWMA 4WT7A 2KYRA 4DQDA 1DCKA 1SD5A 3NNNA 1LJUA 1BAPA 4NQRA 5PNTA 3HM9A 2JVIA 3CFYA 1JHZA 3H5LA 3EULA 3MQ4A 1TVMA 2M98A 3A0UA 4MLCA 4UHJA 1APBA 2GWRA 4HNRA 4YWHA 2FLKA 3QEMA 1DRJA 3OM1A 5B3JC 3IP5A 4YGXB 2WWVD 5HM6A 2E4WA 5I4CA 3N0XA 3JY6A 4FE4A 3M9WA 2E4XA 3F7NA 3Q15C 9ABPA 1ZY2A 1ABFA 1NXXA 1ZGZA 1ZITA 5CNIA 3F73A 1Z25A 2N9UA 2JK1A 4RKRA 1USGA 1D2AA 2HQOA 4MS4A 3GT7A 5FWYB 4IILA 1DBPA 5EWJB 5KC8A 3B2NA 3QLUA 1YTUA 3BRSA 3HDGA 3O21A 3VNAA 5IUNC 2PE5A 4N0QA 2F8SA 2QU7A 2IYNA 3C6QA 4N47A 5JS2A 2J48A 4RXUA 3FFTA 2PAFA 4EUKA 2MYPA 4ML3A 2QW1A 4HNQA 4ETMA 3IDOA 2PUDA 1NXPA 1U2PA 4MQEA 1DC8A 1DG9A 2OENG 1MB0A 4RDCA 3EJWA 4OBBA 2CD7A 2Q5CA 2FEPA 3C3KA 1C0EA 1NATA 4Z4EA 1SXHA 2CHFA 1JF8A 1KGSA 1DJMA 1H9CA 2HPHA 2A9PA 2W42A 4MLDA 4Z4GA 1U2QA 2CHEA 2FQYA 4OG2A 1YS7A 4MR7A 1E6KA 1USIA 2HQRA 5E3JA 4Z4HA 1C4WA 3C97A 3LUFA 3O1HB 4RS3A 2B4AA 4N0PA 4YV7A 4RK1A 3EQZA 3JPYA 1CEYA 1Z16A 2FMKA 3OLWA 1Z12A 5TQJA 3URMA 1SRRA 4G0OA 1PNRA 5D2CA 3SG0A 2E4YA 4QYWA 3CLKA 4LE1A 3GBPA 2FEKA 3W9SA 3IP6A 3MIZA 3RVRA 2OQRA 3KG2A 3CTPA 2A9RA 1D1QA 1K66A 4KMRA 4LE2A 3LUAA 4Q6BA 4MR9B 3CHYA 3FDFA 4IMJB 2BGGA 1QP0A 4Q6WA 1JDPA 3O1JC 4O5AA 1E6LA 2QVGA 3GWGA 3C3MA 1JFVA 4PEVA 4EY3A 2FMHA 3HDVA 3D8UA 3DLHA 2FTKE 3JVIA 4TLMB 1Z2EA 3E3MA 5TE9A 3FFWA 4LE0A 3O2SB 2LIVA 3CRNA 3NHZA 3I42A 2E4ZA 3LOPA 2NUBA 5GQSA 3HCWA 1ZAYA 1EFAA 1YK0A 4XLTA 4H3HB 3QX8A 3FMVA 4G0MA 3N0RA 2LPMA 4KK3A 4YCSA 1A2OA 2FSPA 2WMYA 1NXTA 1OXKB 1XHFA 2IPMA 3OMWA 4XFKA 4YS6A 3Q7TA 4JOQA 4MS3A 4RK5A 5BQ3A 3QK7A 1JWLA 1DCMA 1P6UA 4MS1B 4JA2A 4JASB 4KQ9A 1DRKA 4LDAA 5DLEA 4RK4A 4MR9A 3H75A 2PKXA 4Z4CA 4MQEB 4RK7A 4RY0A 1JL3A 4TLLB 5HQJA 5T3YA 3LKBA 5IX8A 1QQBA 4DN6A 2QV0A 1ZDMA 1MB3A 5TQ0B 1VKRA 4RXMA 4ZYLA 3K4HA 3HO1A 1FFGA 1VPWA 4KV7A 5CNMA 3LFTA 3Q9SA 1LBIA 4F8JA 3BRQA 2X7XA 2A9QA 1JX6A 3EODA 1U0SY 4G0ZA 4IF4A 1VRVA 3MF4A 4PYRA 4KRFA 1PHRA 3NBMA 4KQCA 4MRMA 3QLVA 4RKQA 1XWWA 1U8TA 2NZUG 3FFXA 2JCGA 4MPTA 3I5AA 3DBIA 5KC9A 1L5YA 4HYEA 2MSLA 1QO0A 3OLVA 3JPWA 1BDHA 4MQFB 2M1ZA 5KI6A 4ETIA 3OQMA 5ED4A 1KMIY 1QMPA 4KK4A 5FBKA 3BILA 4RK6A 1SXIA 1E2BA 1EWKA 4MR7B 1P8AA 1DCFA 4FE7A 1FSPA 3DZDA 3G1WA 2WB4A 3GYBA 4XASA 4EYKA 3A0RB 4NCBA 1FQWA 1D5WA 2L2QA 4G0PA 4RY9A 4E7OA 4WXMA 4W5TA 3SQNA 2GX6A 2R48A 3OO1A
chains in the Genus database with same CATH superfamily
2WUFA 3PXGA 1XAJA 5IKPA 4OH7A 1SOWA 3GCZA 1NMYA 4EJMA 3A10A 4FR0A 1ES9A 4IQ8A 5AHOA 2FFJA 3RUHA 3T8YA 5CVVA 2BMVA 3TQFA 2Y05A 3A1CA 1SJ9A 3BCUA 1BKSB 2XDYA 3VO1A 1XMOB 4Y2UA 4F93B 2A9OA 3IB6A 4MCHA 5CITA 1Q1AA 3NEYA 1BVHA 2GAFA 2XB9A 3SDZA 3ZHOA 4EHLA 1J07A 2V74B 3CH4B 4H15A 3JALA 1KDYA 1QYRA 5DWDA 2QD4A 2R7MA 2PMWB 2G09A 3T54A 2CUZA 2C4MA 4OLFA 2ZDGA 3TZHA 5C7YA 1EQ2A 1PR2A 2HQBA 1RWMA 2GPJA 2PWYA 4TS3A 2BFEB 2W22A 3B8HA 2E1RA 2Z56A 3OEEA 2XT0A 2ECQA 3D0OA 3MJCA 2V7WA 3V6MA 1NBEA 4KJZA 1KZGB 1ADYA 2WK1A 4MUXA 4DJTA 3KCNA 4X95A 4ETNA 1AS2A 2X23A 2G83A 3DWEX 3ZCTA 2CDRA 5KB3A 2HJRA 2W2KB 5ENZA 3NIWA 4L5JA 3RUIA 3IAS1 4K88A 3UB2A 2J6CA 2XDWA 1MXHA 4PPNA 4B7CA 4DLKA 2CXTA 3WLNA 2WIAA 1SU7A 2MSKA 2PCJA 4ZQBA 4IJMA 4HRYA 1DO0A 1D2MA 4HV4A 1Z4QA 1MORA 1MHPA 2A57A 3M4YA 2QLLA 2WSMA 5EIOA 4E07A 2XY4A 1P60A 2CCJA 3BD8A 4N0EA 1TZJA 1A04A 4P7GA 3R3VA 1WD5A 4DNQA 3F5DA 4LRYA 5DYTA 4EJSB 4BAUA 5DRTA 5JOQA 2J8ZA 1ZD3A 2IF0A 3P52A 3ESZA 3CNNA 3A31A 1Y3DE 3KVNA 3M4JA 1K8QA 3OZRA 4PNHA 4I50A 2B83A 4P4SA 3EXG2 1FS4A 1NNEA 2FVXA 3NWPA 1II8B 1YVDA 1VJDA 1CQJB 2EXXA 3E9RA 4KU4A 1MENA 5G0UA 2QTVA 3OQJA 1IBKB 1N2EA 3MJVA 1W9MA 3L8HA 3BCRA 2R6AA 1UQRA 3CPEA 3CVJA 4I1YA 3F5SA 3LFHA 4WXPA 1JJFA 1JFLA 2R62A 1QK4A 3BF7A 4F4CA 3DV9A 4ALNA 2B2XA 1V37A 3DMHA 2G88A 3W6PA 4LEIA 1M33A 5HOEA 5A3JA 4RETA 1K4KA 3NWJA 4R8RA 5E2BA 3URKA 5JCJA 1XAHA 4OY3A 4MX8A 3UMSA 4D9GA 4DLZA 1UPUA 1E1CA 3HYTA 2JCBA 4I9NA 3BJZA 1AX9A 3H05A 1AZLA 2I34A 2P0EA 3FKSA 1CETA 2YHIA 3IO5A 3PF8A 4ZANA 2XF2A 4X1IB 4XWYA 2ZXEA 2VZLA 4QKQA 5KKAA 5IAJA 1RLMA 5FTKA 2VJLA 3SHOA 3PTZA 2NVOA 4R54A 3PDWA 3TSOA 1BN7A 4HNAA 2PEYA 1G5IA 1E1DA 2JIBA 2X5JO 2AKAB 3KLMX 4M0MA 1XUOA 4UMDA 1SKMA 2ZIGA 4FUTA 1Z26A 1S89A 4BV8A 3CGWA 2VHXA 4HZIA 2ZRQA 1RMTA 2AE2A 4LRQA 3D6JA 4IUDS 2POCA 2QTWB 4HO1X 1Z6TA 1PW7A 1T13A 3PICA 1S4QA 4RPIA 1Q57A 2WPDD 4G0YA 3PFNA 4HZGA 1CQIA 3PHIA 4ARVA 3T9DA 2FG5A 3ANYB 3E3OA 1FPQA 3OH8A 4IIBA 5EKUA 4F5DA 2ZS9A 4BV3A 4WA8A 1YRAA 2BRUC 1IUNA 2VK8A 5GINE 2VP2A 4EUSA 3DTNA 1JVNA 3K3PA 4PXSA 3WOHA 4DL9A 1UMCA 1ZXXA 2C9ZA 1RJDA 1TYZA 2NZYA 3GD7A 2HYDA 2MDTA 3K92A 3TRHA 3O7MA 5HGJA 3RREA 3WK8A 3A14A 4BO9A 2P9FA 1XNQB 1NBIA 1SQ0A 2GHRA 3UV7A 2UZIR 3L8YA 1JIQA 1NX9A 1MMFB 3B9BA 3IVMA 3KZCA 5GV8A 5G1PA 4HX2A 4QL3A 3T5DA 4OMFG 1W36D 2QAIA 2GB4A 4Z8XA 4UE2A 5JNWA 3TB4A 4EVIA 4GEKA 5FUXA 2O2GA 3E61A 1L8XA 3VAZA 1DWUA 1GCGA 3AEQA 3QX3A 3WO1A 1Z17A 5J4HA 4HUQB 1Z37A 1SIOA 2ZTVA 5D84A 4B44A 1PZHA 3ZVRA 4C9BA 1X38A 5HOQA 1G8FA 2JVJA 3AXSA 1VDMA 3KUDA 3PUVA 4XJSA 1DAKA 5DBIA 5DGCA 5EOVA 1P9NA 2WINI 4BB9A 1A9ZA 1Z9BA 2CVPA 5KDDA 4ZI7F 5KNCH 3FTFA 4WLUA 4JNKA 3O3MB 4TT3A 1FQKA 2GYYA 1KVTA 1VLJA 2BWJA 3Q0IA 3GDOA 2RHHA 2CXQA 4N7BA 3VISA 3K4PA 3RJ9A 3V4RA 1G8PA 1L4HA 1U99A 2GFIA 3OZCA 4EPVA 1VE9A 3MG9A 4IUBS 3WJ7A 2BI4A 2ZDQA 3B51X 2GYUA 1OW3B 2WNIA 4PZZA 4BASA 1J90A 1OHHA 2VTKA 3LQ4A 3T9CA 3DNPA 3WLQA 1F17A 3KDAA 3WGTA 2IPXA 2HHHB 1IBCA 2BLNA 3LUBA 1AJEA 5FWXB 5TPZD 1T5BA 3NFYA 2GCPA 1UJ6A 2VEOA 4BKRA 1QYWA 3M0EA 3RWBA 1FIUA 4E22A 2MHCA 4ILEA 3MMNA 4B6GA 1ZVQA 1ZNXA 4CKXA 1OV4A 3WDKA 1NW3A 1VPLA 4KZKA 5D00A 1SCUB 1TZ2A 3C4VA 1PKXA 1KMQA 5JZVA 3O8CA 5COQA 1KAOA 3O4HA 2DHQA 4Q34A 3S7TA 3CNEA 3TOXA 1TA9A 2YWJA 4B9EA 1RHJA 3MGBA 2VBGA 1OBVA 1O95D 5J2TB 4LMPA 4BKQA 3N75A 1SXJB 3Q5DA 3QBTA 4JHXA 1MAVA 5FR1A 4PG8A 4FU0A 3IKMB 4AS1A 5K4GA 4A15A 4POAA 1DP4A 2H5JA 1M2HA 3G85A 1HFWA 2R6HA 4WLFA 1BMQA 3D1VA 1Y6GA 4EJFA 3LZCA 4Y2XA 1CLEA 1N2JA 2PWPA 1AQUA 1I13A 1XBTA 3JRWA 1P2VA 1FTYA 4KXUA 4J0KA 2R96A 4F8YA 1FFXB 4BFTA 1XHLA 3IMCA 4DIDA 2P9QA 3OQBA 1JHAA 3FNHA 1X7XA 5B2FA 2Q3BA 3WYGA 3HJTA 1Q84A 3HCDA 3AVPA 4QYIB 2WU3A 2K2QB 3SHQA 3HTXA 4DKJA 4YC7A 2RG1A 2C03A 2HWUA 3PCTA 5CDUA 1LDEA 4KSBA 4K6HA 1SQ6A 1CHNA 5A5GA 1AK2A 5IANA 1H2XA 4M54A 3WGOA 4BKPA 3ZJUA 2Q5FA 5ALDA 4L75A 4BVGA 1TCCA 3MTJA 4ALMA 1AHIA 4I5GA 1YBFA 3OF2A 4RHXA 1N2CE 1JHRA 1ZEMA 2XTAA 4QRDA 1DZIA 3LBYA 1NJFA 1Q3TA 5FRDA 3WKDA 5HZGA 2ZJ5A 3DXXA 5I45A 3WP0A 1E9SA 5FI5A 3GLIA 1DDGA 5E4JA 4M8IA 4C3OB 2IH5A 1UZNA 1ENZA 3FW1A 1I9GA 4FT4A 2C97A 3W77A 2RHRA 2H17A 5EXDA 2OQVA 4ESEA 5AO9A 5B1DA 5AW2A 3ZLJA 1DKUA 1QVZA 1VIYA 4WA7A 2XF8A 2PNFA 2AK2A 4LYFA 3DUFB 1JS1X 3NZEA 1LC0A 3SJCA 4V03A 1NJ1A 4FTWA 4X20B 2FZEA 4M1SA 1V8ZA 2WKWA 1XE3A 1YB6A 3UAXA 3WA6A 4TZ0A 3IODA 3T3GA 2OBNA 1O87A 3HBFA 5TEWA 2DRIA 4AMUA 5FOUA 2EJCA 2X5NA 4MGEA 4XRRA 3KKMA 1ISMA 1T25A 3B7PA 4IJ5A 1THMA 5K0EA 3SF0A 5JVDA 2NAPA 1B0UA 2FRDC 1RC1A 3NJ8A 1W59A 4NNPA 2GF0A 2H29A 4TSKA 1CF2O 3LDHA 1N7HA 4MJXA 4HWKA 4Q4DA 5EINA 5TT1A 3T4EA 2CVQA 4EB6A 2P3OA 4E5DA 1E2EA 2F3PA 4CL3A 1ZVMA 4TYWA 4QGBA 4URZR 4RZ2A 3UFBA 4NEQA 3BTSA 1AZTA 1RAGA 3CWCA 3TQIA 3HHEA 3BH7A 3V48A 3CFYA 1G2IA 2ZYAA 3MQ4A 4NMHA 1D2HA 3EX7C 3OQ1A 3GO4A 4MWSA 3PX7A 2WT4A 3GJ5A 4HNRA 2UUCB 1IHUA 1L8QA 2FPWA 1YR8A 2FLKA 3OM1A 3UFXA 4BDTA 1N2CB 3FCYA 4DUPA 2E4WA 2AZDA 4I4TA 4ZRNA 4FWIB 5IJAA 3JY6A 1J9EA 4DIFA 1P3DA 2Q7OE 3Q15C 3DF7A 1EVKA 2RCYA 1NXXA 4CGZA 5BUCA 1ZISA 1I1NA 1ZITA 4MIOA 1Z25A 5AJVB 1YA4A 3ZCQA 3UWOA 4YMVA 3DKVA 2HT1A 3NBAA 4FGSA 3VR4H 5HIAA 4CKWA 5KC8A 3KEQA 2G5CA 4IV8A 1A9XA 1NF8A 4KQXA 1H23A 1MZVA 3HUEA 3LDFA 1YC2A 5IXYA 4RA6B 5JSZB 2UKDA 3CF4A 5JS6A 4AULA 2CHGA 4RPJA 5JS2A 2WHEA 1UT6A 1XZDA 1H8HA 2QSZA 3D7MA 3Q10A 1MJ5A 4N18A 4QVGA 4RWZA 3S1LA 5TV2A 4L8YA 1DG9A 3LPAA 5GY7A 4Q4CA 2W2VA 5J4VA 3SQWA 3MC1A 2VTDA 2GVDC 3NI2A 3SKVA 3D2CA 1E3EA 2PWZA 3V3KA 2NYRA 5T64A 4D0LB 1TL7C 1PS8A 2D5AA 3ZIAA 3LHDA 2KI5A 5A62A 1MEEA 2XRFA 3I4LA 1KMCA 4ZT6A 3VO8A 1DB3A 1GPBA 3KDPA 4ZI3A 1ACMA 2W42A 3NM6B 3RRXA 3TIIA 4F6RA 3GMTA 2IBMA 1Q14A 3NDJA 1WDLA 4ZT2A 4G5XA 2IIQA 2GNPA 3W78A 1NXQA 4Y1FA 4JLMA 5K6AA 4RS3A 4B4KA 4D43A 4OSEA 1T1EA 4F9GA 1Y8RB 2DFPA 3WLTA 3JPYA 6Q21A 3A6FA 3ETLA 4B4VA 1G7SA 3KKOA 3PUIA 4XLLA 2FPKA 1C3EA 3IAM6 4HGYA 3FPKA 2CYAA 4L6AA 5F9MA 4KQKA 3ROXA 1MRNA 3C4QA 3ZV4A 1A2QA 4KQ2A 2TECE 3BSSA 2OCIA 1DXOA 2I5PO 4DDVA 3A2NA 1JEEA 2XB8A 3ECSA 1V11A 1G5FA 4D9IA 5MF6A 3D3QA 3SZUA 5KU1A 1LDMA 1JDSA 1Y1SA 4JX9A 2GUGA 1XNJA 3QJYA 2WW8A 4P2GA 1MO5A 2I7CA 1A5SB 3WBFA 3IJ5A 3I8OA 3MTEA 2ZWAA 4ZOCA 1M83A 1JR3A 1U4NA 2QVGA 4HPJB 3SIWA 3RABA 4K9OA 2GUWA 1SCJA 1QIIA 3I5UA 1CUVA 2YV2A 2KB0A 5K3BA 2AFHB 3CRNA 4P9NA 3KYCA 3ZWCA 3I2HA 4FFSA 1WXEA 1IPFA 4HQ0A 1QIKA 4IUYA 3SDSA 4YIHA 2ZBUA 1N6IA 5L3SB 3FMVA 1XZFA 4LHVA 4BZXA 4GYWA 3PWKA 3CIFA 2BHNA 2WMYA 4HQFA 2CLIB 1ZIPA 2ODBA 2XWJI 1C7ZA 1ZUWA 4E14A 4BCCA 1PGNA 1F9AA 1QH1A 4MUBA 4NBLA 5FULA 2AZTA 5AICA 1Z68A 2D5BA 1TDJA 3K0EA 2BMEA 3S8MA 2D5IA 4MR9A 4Z4CA 1VCOA 5G3ZA 3PP8A 1PGQA 1I3MA 4Z7JA 1L1QA 2VJOA 4NF2A 2IUSA 4P53A 4UD2A 5B6JA 2HSZA 5BPHA 1DEAA 3MWEB 3T94A 2ZANA 5KNBD 4NQZA 4QYSA 1I3LA 2FF7A 4I6GA 4PC2A 1Y4DE 2YS6A 3S2IA 1M7GA 3TBHA 5JYCA 2H52A 3T9EA 4Q9NA 4YAWA 1L4MA 5A9SA 3LX6A 2FK8A 1EBBA 1NJ8A 5ALKA 2BZGA 4JUIA 4DSZA 4KRFA 4BE4A 4PYRA 3CVVA 3LBFA 2FHPA 2VDRB 3GLIB 5BW5A 3H7AA 4H1HA 4ZOLB 2ZRHA 3I58A 4WPGA 2NP6A 1WLSA 2XCTB 3B82A 2RC5A 5IJXA 2WQ7A 1YOVB 2JFFA 1BQ4A 1WUTA 2GK6A 4MI3A 1RWKA 1J8FA 4GX2A 3SQXA 1NV8A 1U0EA 1V5WA 4IOMA 3AUSA 3GFBA 2ES4A 3SE7A 2YICA 3B52X 5I48A 2G9NA 1CR1A 4LW8A 4RD0A 1U90A 2F55A 1WP4A 3L46A 1DQSA 1KMIY 3LDAA 4G26A 1FOEB 3GGSA 4TWBA 4P54A 2JGIA 3OWXA 3RIMA 3DZDA 3NHSA 4NHOA 4MZDA 2ZU6A 2X0FA 4KOAA 3QPDA 1K5PA 2L2QA 2AB0A 3AFOA 4MB0A 3GA0A 1G4HA 4RM3A 3UPDA 2FXVA 4NCKA 1T1IA 5JBNA 4OL9A 5KYTA 1LSOA 4AWAA 2C5BA 1QHNA 1BXKA 4BQSA 4GXTA 2CNNA 3LWZA 2OWDA 2VT3A 2RARA 1B43A 1YJCA 4GI7A 3C3CA 2ZR7A 3D6UA 3NTLA 4MQFA 3SXUB 5IZCA 1WM1A 3CEMA 2JAPA 3QF4A 1DC7A 5IM4A 4LXTA 1UT8A 4YPVA 1CS0A 1XZPA 1FDVA 1GPH1 2WTAA 3R7BA 4XX0A 5B4VA 1R16A 2PANA 3A7EA 2X5XA 3VDNB 1E2LA 2JEOA 2EV9A 1TAQA 3TE6A 4DV0B 4U9HS 3PC2A 4BFVA 4NE9A 1NQXA 2CCKA 3CJTA 3TX6A 2P2YA 2I71A 3RS7A 5KDOA 3HN2A 3L2OB 3LCCA 2D2VA 1XTBA 1ECJA 4S2EA 2AGVA 2YINC 3ZWXA 1Q19A 3BDVA 4BO2A 4HQKA 1YZ3A 3UJ9A 3H4VA 2QNIA 3CLTC 1IEWA 1VC2A 2XQJA 1LDYA 1K1EA 1I14A 1X70A 1CY7A 2P1RA 3K7EA 4X8OA 5DGIA 3X1JA 3RF6A 4C05A 5GTDA 1ZK0A 1X0XA 1I3CA 1IMJA 3LT5A 3GGJA 1T35A 5J2UB 1P0FA 1W34A 1U2ZA 2YWBA 5HTKA 1XMSA 2HPVA 2O52A 4INOA 4GL2A 3DOFA 5AXBA 1T2EA 3V1YA 3LCRA 1T8PA 3QWAA 1XDZA 4LV8B 7ABPA 1M6VB 2MOKA 4FNGA 4GBED 3HCEA 4IR7A 1CDEA 1YFKA 2YNMA 4URWR 4MYSA 4BVBA 5BW8A 4MV1A 3KQTA 3GA7A 4CW7A 2G0NA 3QU2A 3OLZA 2QTZA 4LAFA 2IYTA 2OGWA 3I09A 1QGUA 1N2IA 4LECA 4UFOA 4HDSB 3ZD6A 3ZJVA 4PICA 3B20A 4DLYA 4KO1S 5HF5A 1WCIB 2UZAA 5EXEA 4ASUD 4INJA 4FQ5A 2PRKA 7REQA 3E4CA 2AT1A 5DM70 5LA6B 2HLNA 5H0IA 3IT0A 2Q27A 4XI9A 2VTVA 5IZCC 3D31A 1R3UA 4HKTA 3ZXXA 2IF2A 3WWCA 2WMDA 3ZVLA 4BUZA 1SG0A 1XCGB 2J4CA 2Q28A 4EDHA 2CW5A 1CR4A 5I5GA 5HIJA 4B76A 4ZO7A 3KV3O 2YFKA 3M3HA 5B1EA 4MV9A 4XB2A 3GYGA 5CNJA 1DC3A 2EW2A 3IUMA 3Q5EA 2BGMA 2CHUA 3KJQA 4XARA 5EKSA 3ZI0A 1U5BB 5HYVA 4K9KA 2GLXA 1EFCA 2XSZA 1IULA 3BT7A 2XOEA 1K97A 3IPCA 2KPOA 3L8FA 2QI9C 1OH7A 1IZ8A 1LH0A 2GSDA 3WKEA 3BREA 3DVAB 4U9IS 4DLAA 2NV0A 3F7MA 5H3LA 3AF0A 2X2OA 2ZRMA 5CTAA 3GEDA 5ICCA 1NPYA 2GILA 2H7XA 2BZ1A 1RM4A 1QE3A 3PXUA 4CKZA 3IURA 1JFSA 2BDUA 5JT1A 1KOFA 1WSDA 2G17A 3AUYA 2XCOA 4IINA 4TTPA 5J63A 3DOEA 4NV3A 4NOMA 1EDOA 3VNRA 3NAMA 4REQB 5EZ5A 5MFZA 4P0QB 3EZ9A 1DFGA 3KRTA 3D8NA 1KBOA 2QB5A 3NATA 4WBXC 4IIXA 2XUZA 4IZOA 1MV5A 1T2UA 2G6BA 1QONA 3CJRA 3SJZA 3ZBUA 2PKCA 3K31A 1PL6A 1P31A 2AR7A 1G1MA 2DU8A 3B6ZA 1OTHA 4JC0A 5AXCA 1E8DA 4K7JA 4QXRA 3QPAA 3UENA 4WK6A 3IUEA 1UEXC 3RNOA 4MUGA 5C7OO 3WAJA 3FVQA 1Z7BA 4K5QA 2P3LA 1SPBS 1T15A 2LV8A 2C2XA 2P8SA 3AUUA 3RT7A 4CXMA 5KYVA 3NT5A 4H3VA 2UZ4A 3HYLA 1FZTA 1E3WA 3EWIA 4AT1A 4BNYA 1TYAE 4IM7A 3KQKA 2DX7A 1JR3D 4NMXB 4D74A 1QV7A 1E3DA 1FNMA 3VVBA 4YR9A 5TPWB 1ZK1A 2EFYA 3KYIB 1BOFA 1R9MA 4WLEA 5JDIA 3C4JA 3SGLA 4Y0VA 2R86A 3KQOA 3N8IA 5IKXA 3H6GA 4KMSA 2C78A 1HT1E 4TL8A 4XZ3A 2RBKA 2XZTA 3D6HA 4NJEA 4YDQA 4B4WA 3Q0EA 4CLHA 3X44A 2ZYGA 4A36A 3RAFC 1TO2E 2BVNA 5EJ7A 4NYIR 1KK3A 3D5EA 1IVNA 3HVJA 3ND9A 2P90A 4AO7A 5T6MA 4N5NA 2AXPA 4YMHA 3PGKA 2PM8A 2ZZKA 3RV4A 4ZTZB 4JLPA 2FPSA 3WL7A 1GZ6A 4HNSA 4MV4A 5FWXA 4FSDA 2VJKA 4XIJA 3PPIA 4JI3B 3AT1A 2OO3A 3EDQA 3IRVA 2GEBA 1WDKA 2GS9A 2YV5A 1AS3A 1CIVA 1UEIA 2QPLA 2KLHA 2ZB3A 3AUAA 3CLRC 3CCBA 1SKAA 3OY7A 4LKRA 2WAAA 4GS5A 4RXTA 4Z7OB 1BHSA 3W5IA 3B7GA 3I76A 1SU4A 4UU7A 5LDHA 2O8FA 2FOLA 2GO7A 3G5MA 4FIZA 1CUBA 2O19A 1AB5A 1BH6A 2PKEA 4LXYA 4V2IA 1UPAA 1OU4A 1NYLA 4S12A 2HUNA 3TM5A 3J7AC 1XL1A 3LHFA 5FTJA 1R4NA 2IW3A 1W4LA 3KQQA 1XNRB 4S35A 2R2GA 1VKZA 4HSEA 1WU7A 1VRCA 3K0HA 4QQRA 3MOIA 1RWVA 4WUTA 4B6QA 1V2HE 3SC4A 3GLHA 2W70A 1AOXA 1Y5RA 4M0KA 4IKEA 1ZXBA 2TMYA 3AEQB 3KJEA 3RVJA 3J7TA 1Y80A 3LVBA 3T99A 1EP3B 4NH0A 2AMFA 4E08A 2AWOA 3FI0A 3IE1A 5E8JA 4ZTUB 1Y4AE 3HDYA 4MYRA 3HFGA 4QPNA 1QOQB 3QFTA 3P97A 1PO7A 4B3BA 1DJPA 1RYDA 3SBOA 4B3HA 3C8UA 4N9WA 4P3XA 3I2YX 1YBVA 4BFSA 2JB9A 3OIFA 1KR2A 4RL6A 4WK4B 1DTSA 2FA9A 2O48X 4ZEWA 2VNJA 5L7WA 2H3HA 2WJZB 3DOCA 2GEFA 2PL3A 2IXGA 4IJKA 4KWIA 4W5JA 4Y7CA 3UHAA 5JNUA 5J58A 2EVWX 3EVCA 1Z0UA 3MCWA 4HAUA 3IH5A 1Q92A 4IIJA 5L3QB 1JA0A 4D9MA 1NJSA 1KI4A 3C14C 3C98A 3Q7EA 3QVUA 3H8JA 3I61A 4OJYA 2IIVA 4IIEA 2VWPA 3ZK7A 4WBSA 3ZS9A 5LP6B 1YAHA 3E9CA 2EKDA 1T0PA 2YJ6A 2PMEA 4DV4B 1FXSA 1WF6A 5JC1A 2PZKA 3OWOA 4GPIB 3FOZA 2YWDA 2GZMA 2I22A 1H6BA 1MQ8B 1Q7BA 3VH3A 4BMOB 1BJTA 3MS7A 4QGFA 2QD1A 3IP9A 1GZ7A 3BWCA 3QV2A 3T6KA 1XRJA 1NE2A 4RMHA 2ZIXA 4DCVA 3AY0A 1UAAA 1Z5UA 4O02B 3RYFB 5FNVF 3AGPA 3CSUA 4A6PA 1EA7A 1NC3A 1VCMA 2IP1A 2FB9A 3JQAD 4FMBB 3ADCA 3ZWPA 3WWZA 3BC1A 4C4SA 3T7CA 2ACEA 3VBEA 2R9VA 2B99A 3MFYA 3BMQA 4EAAA 5HSGA 1KWKA 1BEZA 3M7IA 3Q41A 4QU8A 1JAHA 2IUYA 3LY9A 5DHQA 3U4AA 4AJ1A 3CWZA 1G6OA 3N8KA 3PKZA 3WGJA 4CM1A 3KT6A 5BSVA 1TJ5A 4RKYA 3TZ6A 4KIWA 1EIWA 1YD7A 1E2IA 3IEUA 1KL7A 3GCWA 3T9FA 3AM3A 5IWCA 1R8JA 1IVYA 1FLAA 2JFWA 1KU0A 1XDWA 2FWBA 3W8FA 5KEIA 1L9KA 2JL1A 4UASA 5HKKD 1X14A 4Q3DA 4G0UA 1TVEA 1BXGA 2RIRA 1DVRA 3NIDB 4P4LA 4QU9A 3KVVA 1GSOA 2JJ1A 4AY3A 3WMXA 5K01A 1UXOA 4YJFA 3Q3GE 4QXPA 3OCYA 1U8XX 3THRA 1YZVA 1W4AA 1RRCA 1H6DA 4CI0B 1R8YA 4AJIA 1BVYF 1OJ7A 3AETB 3HS3A 5AM2A 3D8HA 1EDEA 4BLRA 1Y9JA 4E6EA 4R2HA 3VPSA 3COPA 4PNEA 1WPGA 2NUPA 4YIKA 5AUQA 3FGZA 1B73A 1WWKA 3EAFA 4ZCMA 1T91A 4P5EA 1TK3A 5GZ6A 3ZGOA 2JIMA 2GYWA 2ZBVA 1AQLA 2ZSJA 3JRNA 2NU8A 4BMZA 3TL3A 4BWVA 2EFEB 4AQ7A 5IN5A 3RTAA 3TIXB 4ONEA 3W8EA 1CQPA 2JFGA 4EHIA 3NCHA 3P32A 5JCOA 2WSBA 3L79A 1R4AA 2FZ4A 2I2DA 2Y2UA 2B25A 2BH9A 2Z2IA 5LP1A 2C0CA 1F8FA 1R88A 4ENWA 4NQRA 4YASA 2H57A 3E5HA 5EXXA 4YJ3B 1V1MA 2FR8A 1W5AA 3LPLA 5CCDA 1RTKA 4UEOA 4BU0A 1L5SA 2FPIB 2YY7A 3UT5A 4BQOA 3RLFA 2CL7X 5AR1A 4LYJA 2AC4A 4WSOA 4E5UA 1FFEA 2Z2XA 5FIUA 4ER0A 3EZLA 3NDBB 3L6CA 4CQMB 1A50B 5K8VA 2OQIA 4FZVA 2R751 3UXEA 4DB4A 3PFBA 1U1CA 5T41A 3ONVA 5JJKA 2WR8A 3EGIA 1CQIB 1IM8A 3HU5A 3M82A 4NH4A 4W8GA 2YMPA 4Q1BA 2OR3A 4P4SB 1Y1RA 2VP0A 3GI1A 2W2NA 1BCRB 4W1RA 1QQ6A 1ZN8A 2I54A 2F9FA 1VTKA 2NACA 3FHLA 3KJNA 3VJKA 4AJ4A 4F2WA 3BRSA 1SKBA 3AL2A 5K0JA 1Z73A 3ML1A 2IUFA 4BAZA 1PNOA 4JLSA 3W0LB 2QLFA 5IZ4A 4WN9A 2X15A 1KI7A 1OLXA 4RZUA 4QARA 5WRFA 3UMVA 4I55F 1USWA 2ADMA 2VP3A 3HU2A 5IP5A 1HNWB 3PQFA 1WEKA 3RIXA 3BCHA 5BY2A 2Q3JA 3ZGNA 4HMQA 1MB0A 3U61B 1RC0A 1VB3A 3NIFB 4NU8X 3FI9A 3JQQA 1HYBA 5D7BA 2WIFA 4E46A 1TXGA 1IXKA 3PGJA 5U4QA 1RFGE 1VA5A 1R0ZA 1XVAA 3A9UA 4TKUA 2R87A 5HKLA 2BAGA 4HHEA 4E31A 1SFRA 5LQDA 1JB1A 2AJDA 2G28A 2Q5QA 1VBMA 2XQKA 4I1VA 4IRUB 3TLEA 1SBNE 1P81A 3RKUA 3WKBA 4UDXX 4DDUA 4H31A 1Z75A 4N0PA 3RROA 2A9KA 1ZQ9A 2Z58A 4XM0A 3BMOB 3MCUA 4IJWA 1CEYA 1KDRA 2FMKA 3PFKA 4U0JA 5K3FA 2X0DA 5IARA 1G1AA 1KZ4A 3OM9A 4EG6A 1BQEA 1TJPB 1KBZA 1DKMA 3G88A 3SK0A 1C7QA 3DBOB 4GMGA 3GJRA 3R44A 5AP9A 1D1SA 1GTZA 1HNXB 2YRWA 2W6IA 2XQIA 5H70A 4P34A 5U1PA 2Q2QA 1T2FA 1XNHA 3ZY5A 1P0QA 4R5HA 3RNLA 3WZLA 1C0LA 1I4DD 1X8LA 4PAMA 1DKPA 2QM3A 2X0JA 4ISBA 2C7RA 1SRQA 1LU9A 4FJ0A 4UU8A 1ZIOA 1CUHA 2J9FB 2Z9BA 2AMLA 2PUWA 3Q7QA 4PRYA 1YCFA 2VN8A 2H1FA 3REQA 3ZCRA 4EGAA 1OFGA 1GD1O 2LRHA 3OIVA 4ZZ1A 3GNLA 4W63A 1YR9A 2JKVA 2AI2A 3UJ7A 2VXCA 2D2FA 4L4YA 1K7YA 3DLHA 4DMFA 2FTKE 2XYGA 2YXEA 2DSTA 5FL3A 1D6NA 2HA7A 4S3MA 2QE7D 4LE0A 1U8CB 3AR6A 1PK8A 4TMZA 4CMHA 3H04A 3CW9A 3GJ6A 4CJXA 4J1TA 4H3HB 3RVSA 2WIJA 5IJ0B 4JH0A 3UN1A 4A6XA 1AD2A 3I1YA 3KAQA 5FHRA 2P5YA 2PJRA 2XNJA 1XLTC 2CGEA 3EC1A 4PPYA 1POXA 4WKNA 1SBHA 1EUCB 1OD6A 1P7VA 4X3PA 3FPAA 3QFFA 1AKYA 3JQ8B 4ZO6A 3VPFA 5BQ3A 1UP7A 1WKVA 1ZI8A 2BL4A 1REQB 1EWRA 2H4JA 5TARA 2ERXA 1DRKA 2W2LA 3CUVA 4FFNA 5ANRB 4UQLA 3L8ZA 4OYLA 1JL3A 4KNVA 4YV1A 1QQBA 5IX8A 1GQFA 1JP7A 5FWAA 3WMWA 4B3XA 2COEA 4PHTA 1B8UA 5CDHA 1DG3A 2Q41A 1DI0A 4X54A 5GJBA 5CU7A 4FDUA 4NPCA 1SXQA 3ABRB 3KXIA 5LQAA 3ITDA 4L4ZA 3GFOA 1KQGA 4YRDA 1SC9A 4JKIA 2AWNA 1U0OC 1VKRA 4YJ2B 1AIPA 4BX2A 4IQGA 3DE6X 5FT9A 3Q9SA 2C4TA 4F8JA 4JR0A 4G0ZA 2DKOA 5DW0A 4F4IA 1GNQA 3MJHA 1VRVA 2A0KA 3KUCA 2IU0A 1Y0BA 2FZWA 3NBMA 1ETHA 2ZZMA 3ZZ0A 3MRTA 3PV0A 1UWKA 3WIEA 4OA8A 3GJ0A 1L5QA 1N5RA 2BGKA 3PXXA 4G4SO 1N2SA 3GUYA 2YJGA 1QF6A 2V6FA 4O25A 3MILA 2H8GA 4EKNB 2B4TO 1OX4A 4EIWA 1ZBDA 3L02A 5H7XA 1FP1D 5DTIA 8OHMA 2BI7A 3K9LA 5ALXA 3L5KA 5A03A 2QZ4A 4BMXA 2QTCA 5ICEA 4RK6A 5BVHB 1U1DA 3T61A 1I2MA 1H6AA 2JJQA 4MEAA 1EWKA 1P8AA 2QV7A 5DO9A 2GVNA 5CB4F 3BXZA 4J3JA 3ND7A 3M2TA 2ENWA 4QSHA 1AHPA 1U5AA 1XP5A 2F17A 1S8AA 5IKOA 4A0GA 2EZ8A 1YQTA 4I81A 2Y4NA 3KQVA 4MW7A 5EJAA 3S1AA 3ND8A 3VR6D 4GBMA 4C2AA 2DB3A 3NOVA 1W9HA 5J1TB 1XZNA 1P72A 3S8YA 1TKAA 4FNAA 4EHDA 1NPDA 4BFYA 2Q1XA 1R0XA 5FTWA 5FBVB 2J5QA 4JI8B 1DARA 5IKEA 3H83A 3V4SA 3ZE9A 2H06A 1BSVA 1VLQA 1SC1A 2CDBA 2OUIA 3KS9A 2FZLA 1N5IA 2VA8A 3IEPA 3PQ5A 4WLVA 1E5QA 4BVFA 3AKZA 3NAGA 1XPRA 3F9IA 5K2OA 5CBPB 3HKEB 2Z09A 2J45A 1W87A 1U81A 2AZMA 4LF5B 3SIPA 4A2QA 5K51A 4AMZA 3TLMA 3L4JA 4MV7A 2YR0A 3U17A 1T6XA 3AW9A 4LOIA 2PXAA 2IUTA 2EKQA 2ZE6A 2FLWA 3C6XA 3JV7A 5LBUA 2RGCA 2X8AA 1EHCA 4C7VA 3O4VA 4UMVA 2FQQA 1XTRA 3S0JA 1PZFA 4MVJM 5IC5A 3V4PB 3ZUPA 1UF9A 4FYWA 5DN6D 5JNRA 4CKEB 2YH2A 2DR0A 2RONA 3EEFA 4E21A 3BIXA 4LKOA 2C1ZA 3ZE0B 3GGCA 2D1QA 3IT1A 1RM0A 3L8CA 3WRYA 3ZCXA 4BNMA 3D4LA 2ZRCA 1QCZA 3G9ZA 4KQ1A 4M7OA 4IUCS 4Q48A 4YEDA 3FHJA 4ZALA 3C41J 2I4MA 3IV7A 5DHAA 3JWGA 1QHSA 4O2AA 1T4DA 3AK4A 4D82A 6ADHA 2JI4A 1G0OA 3FIUA 5F1OA 5E3IA 2VF8A 2ZYSA 1GUAA 1OGJA 1EXWA 2R8OA 3M4NA 1T9DA 1NR5A 1EX6A 4PM4A 1DIHA 3HLKA 2Y1WA 3ID6C 1JBQA 1LF5A 3IEXA 1ULBA 1VYVA 4IZIA 4K40A 3JU3A 2FE4A 4PFJA 4PGHA 4BO0A 1XO1A 1NY5A 3FTEA 3BMCA 2B2CA 1B1AA 4IQ4A 1KDOA 2FN8A 1VI5A 1EPUA 3QX9A 1AC5A 5LBTA 1HO3A 4OB6A 2ZSAA 3KR9A 4IICA 2QA5A 3HRHA 4WY8A 1L4NA 5F73A 5FTNA 2I4TA 3VO9A 3U0BA 3AJ8A 3NGLA 4AZSA 4KR3A 5KVCA 3GPLA 1VSTA 1XMPA 1UFRA 4AKEA 5EIEA 4AKHA 5LD2B 1KSJA 1DKRA 1BWSA 2XMBA 5H81A 4UPEA 4J7AA 4IPTA 5HBGA 3JXEA 1TMGE 2BBTA 1JXMA 3MBIA 2HTFA 4R6XA 5ER9A 3EXEA 5BOVA 3AVTA 3HDJA 1UDRA 3ZDCA 2RB5A 2RGUA 1HDGO 5IMBA 1QB8A 1LJLA 1MKYA 4JVSB 1GUZA 1GLVA 1ZGGA 3E6AA 5KYYA 3L4BC 5E1MA 4X92A 3SDBA 1C4KA 3DM5A 4JIMA 2CKDA 2W37A 4XTRA 1HURA 1FJHA 1ZL2A 2X0KA 3BE4A 1FQOA 3D6VA 4R1UA 4HAWA 4D4JA 1GKKA 3FYCA 3OPYB 4Y9TA 2IYLD 4TV8A 4ARCA 3MAJA 5BYBA 1LZLA 1VECA 4C2BA 4I99A 4YXWD 2VZ8A 3BRCA 2ZAIA 4DT1A 3HNOA 2LDBA 4LDPA 4F11A 2A9FA 3GRYA 4UUNA 3EIQA 3RD5A 1KDPA 2A86A 5KWSA 3M1LA 4LWQA 4MVWA 1JH8A 2C59A 2PFSA 5EZYF 2E2WA 1KJWA 3V2UA 1FTGA 5DEIA 3F67A 1FVHA 5AKIA 2D0OB 5EIWA 5AUOB 5BOSB 5KVSA 2BFWA 2VH5R 5B3KA 4PANA 1GAEO 1KJ9A 2H0AA 4PONA 2BFDA 4WJLA 2RCNA 1Z4LA 4YN3A 3EQ6A 4E0BA 1NASA 2DPGA 4Z7NB 1CHDA 2E82A 4GZLA 3UBMA 5LYJF 4OLBA 2QMHA 5AVUA 1O0BA 5EWJA 3GLHE 4NAVA 3FH0A 4P35A 3MQFA 1J6UA 2PWAA 3W4KA 1KE1A 1XL0A 2VL7A 3MD9A 3E82A 3NG1A 4G2TA 2GBPA 3PLRA 4EGJA 1RJFA 2VS1A 4IKPA 3CX7A 4QECA 3AV3A 3GL9A 3B85A 1PK7A 3EF0A 3ZG6A 3ED1A 1KJYA 1XEWX 1QVWA 4U3JA 3V1KA 4YJ2A 2F1RA 4II2A 1WUYA 1HDZA 4Y2SA 3UQYS 1XTIA 2A7QA 2JCSA 3MWDB 3UK2A 5E7JA 3ZH9B 1YL7A 4EHBA 2P5TB 3W7BA 1YJXA 4HVAA 4IWYA 4KTTE 1WZNA 3OUZA 5BNWA 2XCQA 1MV8A 4NY1A 4PCAA 2HBQA 2VPWA 1U1IA 4P1ZA 3TAUA 4B43A 5BMVA 2WSSA 3D43A 4KL8S 2P65A 3K16A 2ZJOA 4GWLA 3TL6A 4BNJA 5D3ZA 1CY1A 4QXQA 4QOGA 4W5NA 1GTVA 3OE7A 3TUJC 2BHSA 3DMTA 3U1BA 1QS0A 4J90A 2RBGA 3UC9A 1HX7A 3PDIA 3KU1A 1N7JA 2NUAA 1LX7A 3C7AA 3K2QA 3L6UA 3KO8A 2L19A 4DBVO 3HH8A 4AG6A 1HDYA 1UODA 2WWWA 4ND4A 4UMEA 3VVLA 1QRUA 4IZHA 3GRRA 4WFJA 2FKAA 1YZUA 1QWOA 2PGAA 3D2LA 2PSSA 3UUGA 1ZW6A 4NNOA 3QTBA 1Q50A 1V4BA 4Q9LA 3PQ7A 5I9NA 4EYOA 3ENKA 1TVKA 3P7MA 4HDKA 2GM4A 1BD3A 2BFBB 4NBSA 1SNYA 4JI4B 1VXOA 2D06A 4H0FA 2ERYA 1IAQA 2JI6A 2WWIA 3MS2A 4V0NA 4XD2A 2PZFA 5EQJB 4A8PA 1N36B 4RF3A 3K0AA 4BFCA 4HWSA 1JEYB 3RHTA 5B57C 3R7SA 5KSYA 2PGDA 1FFHA 1WDTA 4LFAB 4DWJA 4RV5A 4LJLA 2ZI7A 4UVIA 4AXXA 5EKDA 3WB0A 1RQRA 3AZQA 4MRMB 3CZPA 3VUEA 3NBXX 4AECA 2GPWA 4GSKA 2OBFA 3GWZA 3UA4A 4M1EA 3JQ6A 4GC5A 1NVTA 1CWUA 5K6TA 1EJBA 1Z74A 2I2FA 4INZA 4DR1B 1P2UA 3JQRA 3H9CA 2N42A 5AHXA 2J1LA 2Q8QA 2HRQA 2WABA 4A8TA 4ZYZA 2Q4TA 4C3ZA 4EF6A 1IVSA 4UM8B 1CQWA 4O63O 1E4EB 1MJFA 5JCXA 1Y82A 2FW0A 4QG7A 1LV7A 3HBJA 4B82A 2B61A 2OKCA 5KJFA 1BW9A 2A2ZA 3C2QA 5FQOA 3I2FA 3NTVA 3OPYA 3ANNA 2PD3A 4ES6A 1ZICA 3KX2A 4H7EA 2IZ1A 4YQZA 1C9JA 2Z5LA 4TYNA 1I5RA 4DCCA 4N5MA 4S1PA 1BG6A 3N76A 3N8DA 4WOJA 4S2UA 2Q9UA 3RSZA 5D6NA 4EATA 2OHGA 4IVRA 1CUGA 1R12A 1UC4B 3GAFA 3OX4A 4GDMA 2HDNB 4O4JB 2YWEA 2QZSA 4EG1A 1KSHA 3SVTA 4BFLA 2CMGA 3N8HA 3WBBA 4UTNA 5C9ZA 4AKGA 1CDDA 5GZ3A 5HP4A 1U0GA 5SYAA 3W2FA 1XZIA 3MN1A 5D1HA 4B85A 3ILSA 4ZCTA 5IK2D 2HW8A 1QR2A 1YJBA 4BJHB 4LX0A 3S81A 1XF1A 3TIFA 4BMYA 3AEYA 3OOYA 2ATXA 3NP9A 1ZNZA 4RDHA 3ZY4A 3Q11A 1R6BX 4C88A 4DBLC 1PZNA 2PTHA 3K1YA 4D97A 1RI4A 3TRKA 3EXFB 4ZOBA 1N77A 4DPMA 4BTVA 1DWPA 1M2VB 3R5HA 3QFCA 3SHTA 4XM2A 4G2NA 3RHFA 4PLTA 1QHGA 3STYA 3A6PC 5AVZA 1Y4UA 1BA3A 2Q6IA 3U3MA 4M53A 4ND7A 1Y1PA 1JPNA 2WY2D 1Z2AA 2FPIA 3BFPA 4B87A 4OPMA 5IABA 4N5IX 1VPDA 4JBXA 4IZ6A 6AT1A 2MSNA 3VTFA 1BRMA 5C7LO 1USKA 2QVBA 4QUDA 1BHO1 2BN4A 3SS7X 5DWQA 2VF2A 5EMMA 2E9SA 3OLQA 2ZIZA 1QNLA 3OM0A 1ODJA 4GX1A 1FLVA 3UAOA 1E9RA 1TU4A 2V7TA 2PLAA 4FK8A 1Z6AA 3TSAA 1IMOA 4PYJA 3A1WA 4CCAA 1FYXA 4J49A 3SYKA 4DBLE 3HZOA 1YI0A 2ZWIA 3MXTA 2I7VA 3I05A 2BGLA 2MR6A 1JTVA 1Z8DA 2M1XA 1F8GA 5DX1A 2G0AA 2DTEA 1Z34A 4Z3OA 3BE5A 3R5TA 3C15C 3UJPA 2IHYA 1LFAA 4BLVA 4MYHA 1F8XA 1U8YA 3G2OA 4TM7A 3V8NA 5J2TA 1C1HA 1DCKA 4PTYA 2IYOA 3NNNA 1C7IA 1SCAA 5CEFA 3ZDEA 1GQQA 3OCUA 4U7TB 1FXUA 2VYFA 3E4DA 1KVRA 5CDSA 2RI1A 3K70B 3A6DA 4E33A 4HQ6A 1TNDA 3C70A 3ITKA 2CJWA 3HDHA 4G5GA 4PIPA 1U7HA 2X0NA 1H22A 4MKHA 4REMA 1I3NA 2PV0A 3HCAA 1FP4A 3STTA 4TLDA 5BR7A 5I4CA 4NS4A 2TMKA 1ZUNA 2E4XA 3F7NA 1NL3A 3O26A 1TYCA 4UFNA 4OMUA 3V4VB 3GN1A 2ZRPA 4NJOA 3VHRA 3EHDA 2O54A 1GHTA 3MT7A 2IS2A 2Q2VA 1MOQA 3TEFA 1V1MB 3O4JA 4FNMA 4IILA 4OXQA 4GM4A 4EGQA 3RIHA 5CD1A 2ZYUX 1US8A 4EQ6B 3GUZA 3QVKA 4MVJP 1THGA 5KWEA 2XITA 4GPBA 1GCIA 3F2VA 3PDUA 5J9FA 4GOXA 3QBDA 3VXKA 5AD1A 3OCJA 1DAIA 4L7QA 4IDHA 2Z95A 2DFLA 2P2LA 4AY2A 1Z8FA 2GDZA 1Z63A 5JYDA 3HABA 3NVMB 4L57A 2I6XA 3EJWA 1G3MA 3MK31 5EE3A 4L9SA 1WCXA 1O6CA 1IM5A 1JA9A 1X1EA 1Z4PX 2ZRBA 4ITRC 4Q7LA 2G25A 1TZBA 1RYMA 3KB1A 3E9YA 4O2AF 1DJMA 3P0RA 1F0YA 2AN1A 4Z4GA 2XX3A 2A4MA 2JHAA 1CUFA 1T6BY 1IY2A 2W58A 2WJ3A 4LWOA 2I4OA 1IN5A 3U9TA 4TWZA 4BP3A 3VZRA 4UM9B 4KAAA 3GAZA 3IUPA 3ZWVA 1O95A 3FMPB 4ZVNA 3OZIA 4KQHA 1M6VA 2QF7A 1UJCA 3OLWA 1Z12A 4Q82A 5DCYA 1J23A 4G0OA 5JFTA 1ZKMA 2H5EA 121PA 3DV2A 5E2IA 1VXRA 2AYYA 1GYRA 1W85B 4ZDIA 1NQ5A 4GOMD 2ZYVX 3TEMA 1Q0UA 4ZI7A 4KI0A 4E15A 4CFYA 3DZIA 3DBRA 2FEKA 1DFIA 2ECKA 1ICIA 2XGSA 3PGVA 3Q3IA 4BCBA 2C2ZA 4K2HA 4A6DA 3SU8A 2A9RA 3T1OA 4F2PA 1VE7A 3KL2A 3LP6A 3PA8A 3K0CA 1UBJS 2HAEA 2R00C 3EEBA 1OGYA 5HKBA 1L8OA 2R7LA 1BHJA 2BOVA 5IF9A 1VPVA 3UJCA 4G24A 1G8SA 2H2WA 1OKKA 4FCCA 4IHJA 1O7JA 3IDAA 1O6FA 4M8SA 4IH1A 2VHUA 3IVCA 3UCEA 1DBIA 4A6EA 5I7UA 3U39A 1J21A 2F48A 5C8DA 2HXGA 2DUWA 2YHSA 5KHAA 4RTOA 4XDGA 4RPHA 1T9ZA 1ZM7A 3GRAA 2YC4C 3R3WA 4L4SA 3ZX5A 2WG1A 2E6KA 4KXVA 4PSDA 4EHHA 2V1UA 2Y1CA 3TFWA 3FRJA 1DV1A 3RTEA 2INGX 2LPMA 2QZZA 3CUKA 3DXFA 5CX1B 3H18A 4MHTA 3CSDA 1HC7A 1RE1A 4Y2JA 1U2EA 5CDGA 5IN4A 3PTAA 4GUAA 1LLFA 5JH7B 5J43A 1ZOSA 3JR3A 1IXZA 3H75A 3U62A 1WSAA 3KQUA 2AI3A 2AIRA 1VGQA 2I03A 3VSDA 1WW3A 3UICA 4CR8A 4IEFB 1UBKS 2GZ1A 1ZM3A 2JGFA 3LVQE 4MJ7A 4Q00A 3SLRA 1CSEE 2PO7A 3ZWMA 1TJ3A 2OZVA 5K8TA 3OTOB 2CEAA 1KXJA 1Y9EA 4CMEA 2PS3A 5KOYA 4JR1A 5FLEX 1J5PA 2AG6A 2PVSA 5CHEA 2YIDA 1PJAA 1Z5NA 3MAGA 5J5AA 2HIGA 1LBIA 2O9JA 5EC8A 3NPMA 3SIXA 3EXHA 1ULUA 3CEAA 3T3HA 4IXWA 5IRCD 1NY6A 1Z06A 2IIBA 4XCVA 1G64A 2QQFA 1OI3A 4GYJA 3PZRA 1ECGA 4CNBA 2G40A 4KDCA 1LBTA 5B1SA 1NP3A 2ZIEA 4O59O 4TTSA 5CT5A 1LLQA 3N70A 5ESWA 3VHQA 2CHVA 5B37A 3DNFA 4G8CA 2Z4TA 2GBLC 2B4KA 1ODCA 3M6IA 1ZOPA 5EHIA 2QRVA 1A97A 4EJSA 1J0AA 3TR5A 1YU9A 4C07A 5AVXA 3P5BA 4S1NA 2DH6A 5DGHA 4KO3S 3ZDYB 4BNNA 5JCOC 3QNWA 2BUAA 4BB5A 3A0RB 1QTRA 4BVLA 4F4DA 3N87A 3C6YA 1KVSA 1M0TA 4FINA 3CZQA 3BJIC 4OQYA 4UNIA 2Q4RA 4ADSG 4FOSA 3RYHB 3DJFA 1KJ8A 4CV1A 1ORTA 1KFJB 1THTA 5EI5A 3WWOA 1FMCA 1MX3A 4PWZA 4Z2AA 1UDXA 3VO2A 5HUJA 4TV9A 4IGEA 3TSYA 1GNRA 4R83A 3MLBA 1JHYA 3RSQA 4GM0A 1PFWA 2VNSA 2Z6UA 1VE6A 3DKRA 5LP6A 2R7KA 2I80A 2X3FA 1XF9A 3LDGA 3WS7A 2A9VA 4XIYA 4ZT5A 4DUYB 4ZQEA 521PA 2XUJA 3F6SA 5TC4A 2EGHA 2PDAA 4QQNA 1CG6A 4P93A 3DCIA 3LKDA 3PWSA 3GZ4A 2OYRA 1SB9A 2RAFA 4HDCA 4KMOA 4RVOA 5CLIA 2JBAB 2RGGA 4X1YA 1F4LA 3M34A 2JEYA 3U7HB 1P5RA 4DG5A 3QXSA 1SHJA 4PYMA 1N8KA 3GLKA 1EFUA 4YJ3A 5F64A 1MRZA 4XD7A 4A2CA 3UY4A 3O8RA 1DTWB 3VC3A 1TCAA 1M2GA 3DDWA 4RV9A 3EEYA 4GPD1 2Y1EA 3IHWA 1S4MA 2PA0A 2O2ZA 2YVAA 1UDCA 1JQKA 4NCAA 1BNCA 1NE7A 1CXZA 3FMIA 2AG0A 2Q2WA 4EH1A 5K0ZA 4WI1A 2DFTA 2VUIB 3EZXA 2ADOA 4WK0B 5DH9A 3RJ5A 2CB0A 1BH2A 3VZBA 3R6TA 4AYWA 1Q3KA 3WIVA 1SO8A 2V7BA 3EUFA 3UZUA 4J94A 3UTCA 1K7SN 3L9XA 3IKLA 1LSJA 1L7OA 1Q5PA 1MQAA 1XFDA 2GFHA 3DCYA 4MYDA 5JPDA 5LVAA 1TECE 4GSYA 1EI9A 3OZSA 1SURA 4TMWA 1OZGA 3WAKA 3RS4A 2X2FA 3OEWA 1RWBA 3PRJA 3CRMA 3AUTA 4FMCF 1I7LA 2EQAA 3BHMA 3MQ2A 4YWJA 1X15A 3GFQA 3OZVA 4HD8A 4UAJA 2OOKA 3JAWB 1HDRA 3A9VA 3EIEA 1G19A 4S1VA 3R7LA 3WI7A 4GOJA 4C14A 4ILKA 7ADHA 2FE1A 1FX0A 4XCXA 4CZ2A 4I19A 3IR5A 3BGVA 4RQTA 4XYBA 2I8CA 2RI0A 1EESA 4G37A 5LP6F 2VDWA 3FB4A 2ROQA 2P4HX 2WF7A 3KTDA 4WL0A 5LKAA 1NN3A 4MWDA 5D7NA 4JI7B 3HRIA 1T2DA 1Z3IX 3KLOA 4V3BA 4CQLB 5COAA 1SZJG 1Z15A 3G0DA 4U0KA 3VKWA 4KREA 4FYJA 3ILXA 3OEED 4GNRA 3B9RA 1J25A 1YKFA 4HG2A 1XKLA 4KAJA 4DHWA 5JRJA 1URPA 3OBIA 4K8RB 5IM5A 5IXJA 1G5QA 3BMQB 1COZA 2GN9A 2G71A 2OFXA 4KQIA 5DNWA 4BO7A 4DR4B 1CB7A 1C41A 3Q7SA 1S8OA 1N8NA 1GR1A 2CFRA 1Y8AA 1U5BA 3DAHA 3ETCA 4NE7A 1QKKA 3QM1A 5HE9A 3WGYA 3ZDDA 4E5SA 1Z0DA 3GT3A 5EJGA 2YY5A 2I62A 4YRBA 1EU1A 4AG5A 3UMFA 2YYZA 1VLHA 5FF9A 4L1KA 4ARBA 1YRWA 1ORDA 1UKCA 3SZGA 4PVDA 4WH0A 2BFFB 2V3WA 3IC5A 4LA4A 5CAEB 3RVDA 4DJAA 3H2GA 2QVLA 3K6SA 2GM5A 1Z8HA 1ZGAA 3HA5A 1WW2A 3UH1A 2PLNA 5CVDA 4AY5A 1O6BA 4KCGA 3FPJA 3TZLA 2H54A 5GVRA 1WHSB 2EL7A 4YUXA 4ZGGA 2XGGA 2HLDD 3ZJ5A 4UTVA 3SM9A 2RJNA 2VDKB 3FPFA 3J81A 4NS1A 3TTUA 4H1TA 1U2GA 5LBIA 4U7WA 2MTBA 1OIXA 4MJ3A 2SKDA 4HB2A 1GPDG 4UMFA 2VJCA 3U60B 3C3PA 3IEIA 4PYLA 2V58A 4OQ4A 1H8HD 1SCBA 1NIJA 2ONCA 1YVRA 1Z13A 5AK5A 4PE5B 4EYSA 2HJ9A 2BKVA 3IBFA 3PE4A 4M76B 1BQ3A 3GJTA 4R2KA 1UC9A 4UDOA 4B9AA 5KTOA 1MNQA 2EWVA 1NRXA 2ZS7A 3KFXA 4M3NA 4TWRA 1IB6A 1K8YB 1HE8B 3AFGA 4H60A 4EJSC 5BPFA 3SVZA 4D8UA 5HJ5A 5JS1A 1G63A 1RQPA 2CXUA 2GBLA 3MERA 4BO4A 4M6WB 1NW5A 1PL7A 1D09A 1WUHS 2YZKA 2MINA 1QK5A 1X13A 2WDPA 3L0OA 3NYIA 3KELA 1UOEA 4GLBA 3RSLA 1M54A 4AROA 3THWA 1X42A 3Q2OA 5FI0B 3CKYA 1Z3CA 2DXIA 3RYIA 1XCPA 3BJEA 4H3KB 4QVKA 4O2LA 3N0WA 1Y3BE 1JQLB 3D8TA 1S9DA 3QA9A 3QPCA 4MAMA 5DYGA 4KNYA 1HYGA 2WAYA 1HA3A 1YRBA 2FFAA 4OHZA 2XWPA 3SEQA 3ZHQA 4J4HA 4WUVA 3SKXA 4EX6A 3RRFA 5BV7A 1H2EA 1LSSA 4AMVA 4MGZR 3CKMA 5THQA 4LYAA 3REGA 3T1NA 3NBYC 4ZPJA 4D57A 4GGPA 1SWVA 5HJ2A 3H1EA 3ENNA 3FSGA 4ABTA 4ACAA 4DDMA 1GITA 1X7YA 4UVHA 1IG3A 1JU3A 5BN4B 3O0DA 3A6JA 3KZMA 4RJ2A 4DDWA 3M2PA 1OAAA 4P0PB 2JLWA 1NBMD 2YDXA 1E20A 1KZ1A 2IZ0A 2GZ3A 2JF0A 2Y66A 4C04A 2DHEA 2UXCB 2FF5A 4DCPA 4PYKA 2IEAA 2VHWA 1Z5GA 1PR9A 3SI7A 1QUFA 2VHQA 5IVHA 2PSDA 4RY0A 1KO5A 4IXMA 4X94A 4OOEA 3L93A 3WQRA 5BRAA 1GZSA 4FEYA 3AHCA 4I5DA 3CVWA 3WMGA 1ADGA 4XYMA 3TW6A 1N6NA 2SHKA 4UJ3A 4N41A 4PCLA 3P9KA 1RD4A 4CTNA 1OLSB 4ESVA 1PIWA 3WGQA 1RXWA 2PMFA 3ILYA 4HYQA 3OM8A 5L3RA 4R0MA 4INPA 1H4VB 1YULA 4N5HX 4QREA 1GL6A 3T3IA 1TM4E 4W7HA 1E1KA 1CBUA 4LSMA 3TZCA 4ZAYA 2A7XA 1K2VN 5JAOA 4RIFA 1OROA 1KEPA 5D51S 3U44A 3HKEA 2LR0A 4JITA 4X84A 2EF0A 3AJEA 3D02A 4ZYTA 2OHFA 1G2QA 2AX4A 4MHOA 3HMKA 3NC0C 3IBSA 4EGFA 3DFIA 4D4MA 2NVUB 1XZJA 4GP9A 2Q49A 4JT9A 2YXDA 3A37A 1HTBA 1Q21A 3NW9A 4IIHA 2PQ6A 4MP6A 4V0QA 3EGCA 3N2LA 4MB2A 1Z35A 3ZU5A 3E05A 3OPNA 2VDPB 4XGKA 2I78A 2BCGY 3QVWA 5B1IA 1BFUA 5BNTA 2BHLA 3KV1A 3KYDB 1G8HA 1PLKA 4N4AA 2DETA 1WXGA 5CYPA 1ZNWA 1DUIA 4XWGA 1KETA 1NNSA 1AE1A 2AQ8A 1ZO8A 3JAKB 5DYIA 5DXAA 5LXTF 3B8EA 1J20A 3T3MB 1L1FA 2Z1DA 1NDUA 3DD1A 2PUHA 4EDFA 1E7RA 5DLPA 4YT4A 2D13A 4NAHA 3VNQA 4RHFA 1K4MA 3FSEA 4P84A 1WV1A 3ND5A 4XIFA 3H5RA 1WXDA 2ALJA 1L4BA 1TE2A 4RMGA 4KOEC 4PO9A 4CKWB 5DTMA 5LPNA 4X6YA 4D02A 4HXFB 3R41A 2DZDA 3TJMA 3QBVA 5EIAA 1RCFA 3HVUA 3L8DA 4L8WB 2VCYA 3I53A 2BFCA 2H9AA 1V1JA 2VA9A 2IEDA 5BXYA 1Y42X 1X1QA 2V5UA 3BRWA 1ESCA 3TZEA 1NA5A 1IOZA 3ANSA 1Z2OX 3X1WA 3R3ZA 1LBEA 3BXFA 5LOVB 3O8NA 3W5CA 2EX4A 3OU2A 4Z0NA 1XQ6A 2FEOA 4K28A 3WRXC 3GOQA 4BO1A 1LLCA 3HYCA 2BGWA 3PK0A 4YP7A 4O4IB 1NXWA 3TOZA 2QRPA 4F6RB 2CF6A 2BEVA 1W4CA 2JGAA 1AKTA 2ETVA 2ZUUA 3CF4G 3HLTA 3TRJA 1GJRA 1O96A 3L06A 5TPZA 3IILA 6LDHA 3H4TA 2PS0A 2FJPA 5GGXA 2WAMA 5AMXA 3BKWA 2QT0A 1QG0A 1E5TA 3KBOA 1J33A 4TTQA 1C5KA 2QG9A 1FBNA 1N9GA 3FHCB 4YONB 5I8PA 4WGGA 2YFQA 1OHHD 1E99A 1K6EA 2JH8A 2Z5FA 4XQGA 4CCYB 1YA8A 3KLBA 5HCNA 2PSEA 5HMLA 1D0IA 3FTPA 2VJMB 4UM7A 4BRSA 1UKZA 1CZUA 3AETA 3BDIA 3CF2A 2RHJA 1DQZA 1TZKA 3LOUA 3OJCA 1Y1QA 4P8RA 1J8MF 3ZGXA 3UWPA 2ZETA 3AQ4A 1V6CA 3GQVA 4LGYA 4B40A 4BIIA 3HM9A 3OCWA 1A4RA 2PD4A 1ZN7A 1GPWB 1NGSA 1VA4A 1SQ5A 2C3YA 2OYCA 2C29D 2C9CA 3K35A 5TMEA 1IWPB 2VQ3A 2LCIA 1EM8A 5KOJB 3HWSA 2PX3A 3N8GA 4HL6A 2QYSA 4FFVA 4E2XA 5AJHA 4D41A 1ZY2A 1J22A 3EPPA 5CX4A 2Z8YA 3V8RA 5LQKA 2IU3A 3CMCO 4J2TA 1QIFA 3ETJA 1USGA 2J4DA 1Z2NX 4FR5A 4BQFA 1T9HA 1KJIA 4HT3B 1CJTC 3LECA 1DBPA 3I9FA 4LJAA 4P83A 5DNAA 3B2NA 1O94D 5EWJB 3STUA 4JFRA 2B30A 1AGRA 1AO0A 4YJ2F 1DSSG 3KB8A 2YJ4A 3VNAA 2NXEA 2W83A 5FPPA 4YAEA 3KWLA 4ZVQA 1VL1A 4FHFA 1H2WA 2WTUA 1XXHA 3DBHB 2MYPA 3D1JA 3KWMA 1XMQB 4JLBA 5EY5B 3UXYA 1FDRA 2BEJA 4PPGA 2YYAA 3INNA 3E03A 3EA5A 4MVJA 4UNRA 5ADUS 2Y3IA 2CNWD 5EYPA 4H6WA 4BQIA 5I8WA 5CT4A 721PA 2J3JA 1C1DB 4EG5A 2EDCA 3NDIA 3Q88A 3R8FA 2GD1O 2EW1A 1JIIA 2Z5GA 4JXXA 4RABA 3FPSA 1TIKA 5FPTA 2NP7A 3OA2A 4CDMA 5DNDA 3ZHTA 4DLWA 3RIGA 5GONA 3GXOA 1MB4A 2IGTA 1N2BA 1U7OA 4IIJB 3EGOA 1T5DX 4TS1A 1UOOA 4KIJA 1THZA 4V0LA 5D3MA 1YQGA 3GVCA 4LXQA 5TQJA 4NFLA 4DWOA 1PLJA 2UXDB 4N3GA 3NHRA 5LUAA 2YQ4A 1OWOA 2NU9B 4EFKA 1B93A 3B48A 4NWIA 5A9RA 1UINA 5T4EA 1IIRA 3DO8A 3MBKA 4OP3A 3FDIA 1ZMBA 3GBPA 4KQ6A 4C30A 1ECFA 4QWMA 1CE8B 2GAOA 4XPIB 4WW0A 3V33A 1XJ5A 3RO7A 3WYNA 3CTPA 1NVDA 1UBEA 3OX2A 4I8IA 4LRXA 2WYVA 3LUAA 4OM8A 5E9JA 3IXQA 4UZSA 3MCTA 4Q6BA 1PT6A 3DXZA 3FDFA 2OHOA 3K30A 4DM7A 2V7QA 1O9BA 2H00A 9LDBA 1RXYA 3Q0TA 2GJSA 4D5EA 3OD5A 5DISB 4CDGA 3BCSA 1SVKA 4TWAA 3D8UA 3EJ6A 3BMOA 3I34X 2Q4DA 1C9NA 1GQRA 1DJNA 1GPMA 3TGPA 4Q3AA 3H9GA 3LC0A 1PDWA 4RADA 4WXYB 3IALA 4KJXA 1M6WA 3HFSA 1QP0A 3SEAA 2WBLC 5G1NA 3T5MA 1X7XB 1VRWA 1EZ1A 2KE5A 4HN2A 1LWNA 1CUYA 4OI0A 1DPGA 2DPXA 3JRXA 3W3AH 3PB3A 3H1BA 4TTAA 2P9BA 4DNFA 4MUKA 5ITSA 3LT2A 1N2ZA 1OYVA 3WLHA 1T9AA 4IXNA 3EG5A 3MTIA 1A9YA 2PKXA 4RK4A 3UJ3X 1CD5A 1V8PA 4G5FA 1C3VA 2OV6A 1XQWA 3RAEC 4R81A 5EMNA 3SQOA 1TM7E 4Q1VA 4R2LA 3DUWA 3M9LA 1R15A 2Y67A 5CA0B 1JR6A 5G0WA 4YVFA 1MZPA 5GPBA 4GL4A 1KYTA 2E3JA 2J32A 2UYHA 3E9MA 2NPOA 2J6IA 1QRSA 1I2AA 4OHPA 3VRHA 1QRRA 2VK1A 2P41A 4Q4JB 4R9SA 1NOIA 4KRXA 1JWBB 5AM4A 1IY0A 2G8NA 1MOZA 3PUHA 3R0ZA 4N6GA 3WHPA 5DP2A 4JOCA 1QE5A 4FFOA 3F5FA 4MPTA 1CRPA 3A11A 2PGNA 1HRDA 4CKBB 1WXWA 1RAAA 3I9NA 2F3QA 3QA3E 2R1TA 1IHXA 3B1ZA 4JGGA 4F3NA 3OQ6A 4OSPA 1GNPA 1AGPA 2WHPA 3H0CA 3Q98A 2PY6A 3OI7A 4QOEA 1SCNE 4PCVA 3KE9A 3C3XA 4FDLA 1GAQA 3O4IA 3R0QA 4NCIA 1QX3A 2IYVA 2YWRA 2BGIA 5AOBA 3OAAD 3B1FA 5HG0A 5DM60 3QG1A 3X2SA 4GMKA 2Q0HA 4JYPA 4KX3A 4XVHA 2HMTA 4RY9A 5JMPA 3IKTA 3CPSA 4RZQA 1KERA 2OK8A 3L6RA 3EASA 3WKAA 4RDIA 2W9XA 1MAUA 2XTJA 1RI2A 3BZWA 3OSUA 4BEWA 3VNUA 1U7PA 1YDGA 1PDOA 3QQ5A 1IOWA 4QHTA 1F9EA 3ELBA 1PX0A 2G77B 2R7AA 2NSJA 3IQEA 4Q4AB 1AH2A 3LGXA 3P4XA 1NUTA 1DQNA 1KP3A 2HKIA 2WM2A 4ZQCB 1YRHA 3CRW1 3C8ZA 3HVHA 3QMVA 4GR5A 3L7IA 4AB1A 2CK3A 1A9QA 3KFLA 3VR5H 4OJQA 1TM5E 3IO3A 4BOYA 4EEKA 1CE8A 1OWMA 4PFQA 4JB3A 3BD6A 4Y1RA 2QY6A 3N3BC 1I4WA 4OFXA 3KD2A 4BTEA 2IPAB 2H2IA 3K6RA 4KWTA 2W6OA 2KJQA 3BL5A 3IDZA 4KO8A 2NZ2A 5HKOA 2CMKA 3VJRA 1QQ7A 3PCXA 1SVLA 4D4HA 4IRXA 3RSHA 4EX7A 3UPTA 4RHYA 3P4UA 4G1FA 2JBAA 4JBGA 5KQGA 1A77A 4FPXA 4A0RA 3CO0S 4GVXA 1X1AA 5E1DA 2IV2X 4BMCA 1OYWA 1QHEA 3CEJA 2JIDA 4OYRA 4CTMA 5ITWA 3GUCA 2MMCA 3C1OA 3EF1A 1OR8A 4HTAA 2BC9A 1DBWA 1BROA 4Y6QA 3TLJA 4IY1A 2SNIE 3MWFA 3UK0A 1F0KA 4PINA 3UOGA 2G9RA 3WLPA 2JFUA 4WBNF 4PC1A 1ZIYA 1RDFA 3OIGA 1WETA 3JSAA 1E3WB 1FTQA 2CVHA 3DULA 3LUGA 4R05A 2GK3A 4LQLA 4LDQA 1KE2A 2AG8A 4RC9A 4MEJA 5U4XA 2AQHA 4JQYA 4OIMA 1B2RA 3IAEA 2P9TA 1G16A 3H65A 4GU5A 1I5OA 2UUOA 3A3NA 1PN3A 2HO4A 3FLBA 2IQIA 4XM1A 2P4UA 3AR8A 3CBQA 3JQGA 1EGVB 2HA2A 2RHWA 4PPFA 2C2HA 3T3DA 4M8NE 1RVDA 1X1TA 2WJAA 3NDPA 3PDJA 3E48A 4WZAA 2DBZA 4A8JA 4C06A 3JYHA 1CEXA 2OC9A 3RKRA 1IRIA 4FFDA 3JYPA 3MGGA 4G5RA 3BB4A 4RIHA 2HSWA 1IEQA 1R0WA 2EAUA 1Q1BA 3NM4A 1HE1C 1RWPA 3BGOS 1GL9B 4QFCA 4TQUS 5G0VA 4AYTA 4F9TA 3DE5X 1M2WA 2JAOA 3N6RA 3GP3A 1DEKA 2XNKA 3EGWA 4YRJA 4FW8A 4RFLA 2P9JA 3FDZA 2QTVB 1MEOA 2HGZA 3JATA 4P82A 4EJ2A 1PV1A 4H35A 5EWLA 2HZ7A 4DS3A 4HYTA 3QUQA 3KHTA 4IVPA 5CFQA 1KO1A 1YS1X 2QEQA 3TLYA 2OAP1 3VGJA 3OP4A 5JFGA 4MICA 5A7FA 1SQSA 3CA8A 3L6BA 1JLSA 5KJCA 4NPHA 3HCNA 4XQ9A 3LG2A 1T3HA 2QZ9A 3QV1A 3LLVA 1GG2A 4PX3A 1S2DA 5ALMA 2D74A 5C4MA 1JI0A 1XRMA 1SBTA 1Z36A 4JHLA 1PBNA 3SP1A 1GFSA 4QNNA 4L08A 2H9IA 1ZZEA 2GCOA 4K6CA 4WBNA 4MS1A 1OB5A 1DJLA 5KYUA 3SMVA 2PPLA 2Q6VA 3INYA 2QT9A 1UPFA 4B4UA 1UC8A 1P1HA 2CE7A 3QVMA 4HVTA 3EMBA 1JGTA 2ZPUA 3ICWA 4KN6A 7YASA 5FI3A 1SQGA 1A88A 2WLSA 5C0OE 3RUEA 4KFCA 2ZSIA 2Q6KA 2E4AA 1XHEA 3RRZA 3WICA 2NZXA 2P9HA 3EXEB 1QAOA 1JB9A 3RVNA 1ZIDA 1JQ3A 3NOOA 1A4IA 3ED5A 3RSFA 1TX4B 1XTUA 1M34A 3ONNA 2HEIA 1P0CA 1MU0A 2CT8A 1C7FA 4NC9A 1NMEA 1N75A 3HSSA 1AU9A 2OT3B 4RLQA 4E7PA 4NR0A 3K8OE 4CF5A 2ZB2A 2R47A 5L9AA 1QO9A 3WRVA 2O2YA 3N3AC 4JT2A 3L0ZA 4BLSA 1PZEA 2OXTA 1JSXA 3CXUA 3ZNPA 4D6XA 5IDWA 3VAAA 2QN6A 5ELXA 3KVRA 4QLAA 1USVA 3GGOA 1W88A 1YJ5A 3DQPA 2H59A 3NGXA 2ZB8A 4PAGA 4Z0TA 1JSZA 1D8AA 2VRCA 3H5TA 4EPRA 3E2PA 4MA4A 3EVZA 1KOGA 3NIGB 3TNYA 1ISSA 1V41E 2WIBA 4EG4A 4LYHA 1COWD 3IR7A 1A5TA 4B84A 1R6UA 1HLPA 1D2EA 1SXJE 1V45E 1ZL0A 2MR5A 2ORED 3EF3A 3O91A 4J0GA 4Q47A 4CG0A 3ROGA 2QL6A 4GGOA 4Q01A 5FBZA 3U19A 2BH2A 1H66A 1Z7GA 4F2GA 3L40A 4UXJA 1P7PA 1AQNA 2OVFA 1VL6A 2WZCA 3O83A 3MPUA 1ADJA 1F3OA 2JLRA 1HK7A 2AE1A 4I6JA 4K6KA 4CN8A 4EUFA 2VBFA 1H1DA 3U09A 2QSJA 1GFWA 5IFKA 5F1KA 3NHKA 1SBQA 1A5AB 3U13A 1F38A 4LHXA 3OZ7A 3Q6IA 3WYCA 6CHYA 3BA1A 1VG8A 3TLGA 4JODA 1NQTA 2VYNA 1P1FA 2E5WA 2Q6TA 4DG8A 2P7IA 4XQEA 4IHJB 1P2GA 1K63A 1YZYA 4A26A 4RVHA 4IDPA 1QGYA 1FFWA 4ZQFA 5UKDA 1ZN2A 1WP9A 1UMKA 3G2QA 1F51E 5CYOA 2ZRKA 5HBRA 3QU4A 4UC0A 1D04A 1AQYA 1YK1A 5A06A 1DELA 4OB7A 3NJRA 1W6RA 2XUPA 5F12A 4PN7A 4RH1A 1WW8A 1DINA 3FNRA 3NBZC 3NPAA 4KUGA 1P1JA 5LQMA 1P7CA 4XXHA 3EFEA 1TT7A 2XMSA 1DKNA 3AU9A 3MMPA 2NT3A 2NMVA 5EWLB 4V0RA 1QIDA 2J07A 2PFGA 1DQRA 5TVGA 3NASA 1XAGA 2QJOA 4QZVA 5F52A 1UBFA 3KK0A 5ALVA 1GARA 1V9SA 4JQSA 1EEHA 1E7WA 1L5FA 4MUAA 4KXQA 5HW0A 3OQOA 4EMUA 4NCXA 1NPTO 3QE2A 1H3NA 1V0JA 1VYTA 3A25A 3G2IA 5LNK1 1X3LA 4IIFA 2QZJA 3HY3A 5KCMA 4R2MA 3HXPA 2CLLB 2I6UA 3AVUA 2ZI6A 4BO6A 2ATEA 4OQFA 3NH9A 3NXKA 1R10A 4AMGA 1RLIA 3C1UA 1SXJC 2QM8A 3P9SA 1ZJJA 4Z2YA 3E3AA 1OI7A 2VHYA 3FWPA 3PS9A 4DJFC 1SVOA 1VHTA 4OFZA 1FS6A 4Z4FA 1BKYA 2XUDA 4P36A 2I76A 3T38A 2FQWA 1N9GB 1JIKA 2WP8J 1S5PA 2JLBA 2WMOB 2NW6A 3BYZA 1XEXB 4GLJA 5E38A 4ZEXA 2WM8A