1JF8A

X-ray structure of reduced c10s, c15a arsenate reductase from pi258
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
130
structure length
130
Chain Sequence
DKKTIYFISTGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Arsenate reductase from S. aureus plasmid pI258 is a phosphatase drafted for redox duty.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords arsenate reductase
total genus 49
structure length 130
sequence length 130
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2001-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jf8A00
4MS3B 3H1EA 1PEYA 3BILA 2CD7A 2NZVG 5B3JC 5BRJA 2QR3A 1NATA 5TPWB 4RWEA 5KWSA 1VPWA 4MAAA 5JNWA 3OQMA 3B2NA 4H3KB 4PZ0A 1JYFA 5KQPA 2R48A 3SNKA 3A0UA 3O2QB 2GWRA 3Q15C 3NHZA 4FE7A 4IILA 4QYMA 4XAQA 2YHBA 3HXMA 2PUBA 3T95A 3N75A 1FQWA 1C4WA 3E3MA 4LE2A 4MQFB 5KQGA 2MYUA 4PE5B 3QLVC 3G1WA 3GYBA 1FFWA 3GV0A 1YS7A 3OLZA 4WZZA 4EUKA 3F6PA 5T3YA 3I45A 3I5AA 3SM9A 3Q7RA 2PUCA 2H3HA 1BDJA 2E4WA 2IKSA 3OLVA 1MB3A 4KMRA 3TB6A 1ZVVA 2MSWA 2QXYA 5CNKA 4PICA 3M6MD 4EVRA 1USGA 5EWJB 1MB0A 1GLGA 1RXIA 3GL9A 4NQRA 4YGXB 4L85A 2B4AA 3RVMA 1JF8A 4Z9AA 1AB5A 4MR9B 4YS6A 4DQDA 4RSMA 3OQNA 4G0ZA 5IC5A 4F11A 5FWXB 1D1PA 3OMXA 4ZYLA 3FFTA 1Z25A 3HDVA 5B3JA 1LJUA 1ZITA 1JDNA 3S99A 5BR1A 1NXTA 1Z18A 4EYQA 3JS5A 1PHRA 3CU5A 4MGEA 1ZHHA 2VUIB 3NBMA 4JP1A 3MMNA 1K68A 3MYYA 2PAFA 1JBEA 2FKAA 2BGGA 4ZMSA 4MRMB 4W5RA 3D02A 3H5LA 1MIHA 3QLUC 2FW0A 2GKGA 3F73A 1J56A 4H60A 2L19A 3CG0A 1Z16A 1PEAA 2HPHA 1JFSA 3QEMA 2F8TA 3H5VA 1SD5A 1Z13A 3C97A 3N6VA 2ID9A 4G86A 2B1JA 4MS1A 2O20A 3O1JC 5CNMA 3CZ5A 3JPWA 5EWLA 3HO1A 4RXTA 1NXSA 4MR9A 2A9PA 4MR8A 4ETNA 1EWKA 4FE4A 1SRRA 3T6KA 4RY0A 2R47A 3GWGA 3T38A 4XFKA 4LE0A 1M5TA 5IUKC 1DZ3A 2PUGA 3OQOA 5FBKA 1Y1LA 3DBIA 3EODA 3RVQA 4RXUA 9ABPA 3Q9SA 2JBAB 3N0XA 4E7PA 1USKA 2JRLA 4TMYA 3KJXA 1JDPA 2FN8A 3OO1A 3QX8A 3ROTA 2PLNA 2WRZA 3QLVA 4ETMA 3GT7A 3G85A 2NT3A 3IP6A 1Z2EA 2I6FA 1DCMA 1U2PA 1FSPA 2M98A 2QV0A 1ABFA 3HZHA 1YVUA 4Z9BA 3QEKA 4W5NA 3IP5A 2KYRA 1ZH4A 1ZGGA 1JFVA 4KQCA 4F3TA 4NICA 1YIOA 3M9XA 3SG0A 1PUXA 2FN9A 1CEYA 3KTOA 1FFGA 5DGCA 3HUTA 3EJWA 1ISRA 2FMKA 3FGZA 3O2JA 3QX9A 1VRVA 5F64A 5IULC 4YP9A 5TQ0B 3KYJB 3NNDA 5CNIA 1E6MA 3C3MA 3QLUA 3GBVA 1ZAYA 1YMVA 1JWLA 1BA2A 4N41A 1F51E 4EY3A 3CG4A 2LP4Y 3OLYA 4KK4A 4XLTA 4DN6A 3KLNA 5BRAA 2ZAYA 4IF4A 2AYXA 4N0PA 4QYWA 1JL3A 3CHYA 4HNRA 1DCFA 4RV5A 4RZSA 5CNJA 3LUCA 1Z26A 2F8SA 3KG2A 2FQYA 1OXKB 1L5ZA 2JVIA 3I09A 3O74A 1BDIA 1USIA 5D2CA 4RK1A 3VNAA 2PUFA 2E4VA 8ABPA 1D5WA 2RGYA 4MQEA 2IDMA 4JOQA 4O1HA 3QELA 3IDOA 1QP7A 2AYZA 4MR8B 3UKJA 2WB4A 2R4QA 2PJUA 4G0QA 1SXHA 1NXXA 1ABEA 5ED4A 4W5TA 1QP4A 1LBIA 1VKRA 1A2OA 1Z17A 1MVOA 2E4ZA 1DBQA 2FEWB 1ZY2A 3H6HA 1C0EA 1RNLA 2HQBA 3L6UA 4O1IA 4UHJA 5IEJA 3H1GA 3H5WA 1F4VA 5KI6A 4ZMRA 3RVRA 5IBQA 1DRJA 4WUTA 2MYTA 3K9CA 4F12A 2M1ZA 4MS1B 3OMWA 3Q7SA 1DJMA 4F06A 1W9HA 1H9CA 1Z2DA 1YMUA 1E2BA 3LUJA 3LUAA 2IPNA 3LUFA 2FXIA 4LE1A 4RK7A 3CZCA 1D4ZA 3DZDA 4YCSA 2Q5CA 4GPAA 4TLMB 3BBLA 1ZH2A 3JY6A 3EDCA 3QELB 3MIZA 5KQLA 3MF4A 1EWTA 1U8TA 5KC8A 1YK0A 1XHEA 4G0MA 3RVPA 3RQIA 4MQFA 2PUDA 4KPYA 2LIVA 1L5YA 4W5OA 3HM9A 4Z4CA 1W25A 3FDFA 4N76A 3I42A 2QU7A 4OG2A 2A9RA 2CHFA 4OATA 5KC9A 1LJLA 3HCWA 4YV7A 5IUJC 3LUGA 4H3HB 3LOPA 2QZJA 4D6YA 1SXGA 4HNQA 4CBVA 5IX8A 5TPZD 2QVCA 4LRQA 3URMA 4PYRA 4LX8A 4XASA 1KGSA 5JNRA 3C3WA 4S04A 5PNTA 1APBA 3O2SB 4Y9TA 2GI4A 1JLKA 3HVRA 4ZPJA 1P8AA 4RK5A 3CTPA 4Q6BA 2CHEA 5EWMA 4OLBA 4RDCA 3SAJA 3W9SA 3A3KA 3C6QA 2FTKE 4MLCA 2L17A 4JB0A 4LDAA 3TD9A 1GUDA 3CNBA 2PL9A 1LBHA 4IMIB 2LBPA 5JNTA 4PEVA 4QPJC 1LK0A 2VUHB 4NCBA 4KREA 1JH9A 3H5TA 4Z4HA 1SXIA 1DRKA 1URPA 4N0QA 3RVNA 1Z15A 3H5OA 1YS6A 5DTEA 2YHAA 1ZESA 3F6CA 1KRWA 3HDGA 3A0RB 4LDZA 3OO0A 4MR7A 2FVYA 5KQMA 3T8YA 4D6XA 3N0WA 5JS2A 3HSYA 3EULA 2P4UA 3QLTA 1QQBA 3EQZA 4RXMA 3H6GA 1I3CA 3OLXA 4NV3A 1M2EA 4KFCA 4EVQA 1MAVA 5JS1A 2FMHA 5EWMB 2MYNA 5HKOA 4WT7A 1CYEA 3N0RA 1B00A 3KKEA 1OXBB 2WY2D 1D1QA 1QKKA 2FQWA 3CS3A 1QP0A 4N03A 3BRSA 3O1HB 3MM4A 2MSKA 3H5IA 5HSGA 1DBPA 1AB6A 2WMYA 3KCNA 3HEBA 3GRCA 4G0XA 3UK0A 1GUBA 1TVMA 2ID7A 4YLEA 4Z4GA 3GBPA 2FQXA 5TPZA 4Z99A 2GBPA 1PNTA 2PMCA 3M9WA 4KVFA 3UUGA 4YRZA 4Z4EA 3LUKA 4P1ZA 4QICA 5JNUA 2ZWMA 3VNBA 5HM6A 5TE9A 2RJNA 3FFXA 3JVIA 1DG9A 1QMPA 1U04A 2XDYA 3NHMA 2IYNA 3SY8A 3RVSA 2OENG 4JAVC 4ML3A 1S8NA 3D8UA 4YO7A 4O5AA 2PL1A 2A9QA 3RVKA 2RDMA 4Z0NA 2JVJA 2FEPA 2TMYA 3JVDA 4IRXA 5CHYA 4KRFA 5ABPA 3LFTA 1FFSA 3DGEC 1QO0D 1BAPA 2IOYA 1E6KA 3JTEA 4MS3A 5T7BA 2VK2A 3HUUA 3DGFC 1VLZA 4RU1A 5TPWA 5GQSA 4LZLA 4B09A 4XXHA 1GCGA 3RVLA 4JB2A 4TLLB 5HQJA 4KQ9A 3RH0A 2PKXA 1NXWA 3BREA 4RY8A 5IEBA 1ZDMA 4Z4IA 2R25B 5C5CA 3F7NA 2JB9A 2FMIA 2HQOA 4WXMA 1RXEA 3OM0A 1WETA 4MYRA 5FBHA 4YWHA 2FMFA 5GOTA 3RVOA 3KHTA 3O1IC 2H0AA 3E61A 1QPZA 4F8JA 2JVKA 3O21A 2MSLA 3NNNA 1EFAA 3HV2A 1R8JA 1U0SY 3QK7A 1U2QA 4WXEA 4EGSA 2NT4A 2JCGA 3N8IA 3LKBA 4KK3A 3Q7TA 2RJOA 3N53A 4E7OA 5TQ2B 5FWYA 3KYIB 3FFWA 1DP4A 2FSPA 3ILYA 3K4HA 4KZKA 2WWVD 5BQ3A 2E4YA 4MRMA 4KNYA 5TQJA 2HJ9A 2NUBA 1YK1A 4L4UA 2QW1A 2P9HA 1NXVA 4EVSA 4G0PA 1CHNA 1GCAA 2L18A 4MR7B 4FB4A 1ISSA 2HQRA 5FWXA 1JFTA 4OLAA 3GA5A 2HSGA 5EWLB 4RS3A 4MS4A 4IGAA 1T34A 2X7XA 3BRQA 1JYEA 3P9YA 1M5UA 4YR7A 1P6QA 1TMYA 2FLWA 2V0NA 1ZN2A 1DCKA 1IIBA 3H1FA 5DCLA 4MQEB 5TQ0A 1RPJA 4P98A 1JX6A 1ZGZA 4EYKA 4MPTA 3A10A 2E4UA 4RK0A 3FMVA 1RZRA 6ABPA 3QEMB 1HEYA 1NXOA 1Z12A 4ZJPA 2LPMA 4XARA 3ILHA 2OQRA 5JNVA 1P2FA 3KSMA 4ETIA 2E4XA 2W42A 1E6LA 1UDRA 1NY5A 4Q7EA 1BDHA 3O75A 3OM1A 1NXPA 4UHKA 4RK6A 3LMKA 2FLKA 4W5QA 5C5EA 4EYGA 2QVGA 2FEKA 3CKMA 5JNSA 3C3KA 1JHZA 4RKQA 3IP7A 4DADA 3RVJA 4MS4B 4D74A 1PNRA 1QNLA 3JPYA 3CLKA 3EQ2A 3SQNA 3LTEA 2A9OA 3TO5A 4HNSA 1K66A 3L49A 2DRIA 3MA0A 1EAYA 4N47A 3NNSA 3HS3A 1YTUA 2CWDA 2L2QA 5I4CA 6CHYA 7ABPA 3KS9A 4TN5A 4S05A 1NTRA 3R0JA 4M88A 1KRXA 1P6UA 4WWHA 1QQAA 2GX6A 3TX6A 4RKRA 5FWYB 2WJWA 3KLOA 2WJAA 3CRNA 5EWJA 5TQ2A 3CFYA 4RY9A 2LUOA 1TLFA 4G0YA 1EHCA 4OTZA 3DLHA 4OBBA 1BVHA 1DBWA 2IPMA 2MYPA 2QSJA 1A0OA 2VYCA 3H75A 3LUDA 2IPLA 1DC8A 1A04A 1KMIY 4HYEA 1DC7A 3EAFA 3MQ4A 3IPCA 2PUAA 1M2FA 4JA2A 3DLBA 1XWWA 4NCAA 3IPAA 4EYOA 5IUNC 3TMYA 1RZRD 3ROFA 1QO0A 2IPAB 3LUHA 4IMJB 5DLEA 4RK4A 4JASB 4Q6WA 3HK2A 5E3JA 5DKFA 1TM2A 3IP9A 4MLDA 3OLWA 2JK1A 1D2AA 2PUEA 2JBAA 3LKVA 3EGCA 4GNRA 4KV7A 3Q41A 4G97A 4G0OA 1TJYA 1XHFA 3HJFA 2NZUG 2J48A 2PE5A 1EWVA 4Z4FA 2N9UA
chains in the Genus database with same CATH superfamily
2NGRA 1GDDA 1NE2A 3OJOA 2OBXA 2G80A 1W76A 1CBUA 5LJIA 1J1IA 2GKSA 5AVVA 4DLZA 3TL6A 3KLBA 2KS6A 3NVMB 4NEQA 1XAGA 4BC1A 2HCBA 4P4TA 2CJPA 1NR5A 2I66A 2IYOA 3IVXA 4FFSA 5EVCA 1ULZA 2DXIA 2FH5B 3FWYA 3BHJA 1DAIA 2IU6A 3ENZA 3MJRA 3ZW7A 4C4YA 1AQLA 1X7XA 4KQ1A 5K0ZA 2FDRA 2GWRA 3OZGA 4B3BA 3Q15C 2FEOA 3DMYA 3VYUB 3PNSA 5EZYA 3T95A 3N75A 3HXMA 4UHBA 1WPQA 1K5DA 3VPBA 4I1PA 2Z57A 2XRZA 1RCTE 4D9KA 3HCNA 1SG6A 2YL2A 5EE9A 3UG7A 2GEKA 1O4VA 1U8FO 4URUR 2PNFA 3G2JA 4UE3S 3EGWA 2O2HA 4A2WA 4WZZA 5BV2P 1L7EA 3E8SA 5IT9A 4CNQA 3IQWA 4F92B 3JQ9A 4WZBE 1N2CA 1COWD 4H1TA 3K6RA 1ORRA 1S4QA 2A3RA 4BZWA 4X6YA 2IY7A 5BN3B 1XAIA 2IP1A 4X62B 2PS3A 2RIPA 2XUIA 4L95C 2E48A 4YS6A 5BQOA 4B85A 5EXXA 3MT0A 3MJTA 3PC4A 1A8QA 4PPFA 4ZYLA 1POXA 1ZR2A 2CL6X 4M1SA 4F2HA 4MGEA 1IL0A 1ADYA 3OTWA 4INJA 5ICMA 2GM4A 4PVCA 3ME5A 4N18A 3GUZA 1MC8A 4NJMB 4HPXB 2IP4A 3NV7A 1Q14A 2O2EA 4DXAA 1O3YA 4NOLA 3ZJ5A 2LR0A 3AI1A 4NFLA 3DKPA 4ZVPA 1F7VA 2I91A 1NJSA 1EUDB 3D4PA 1OZGA 4P35A 3PNOA 1SCBA 1C81A 1JVSA 1MB9A 2A3NA 3ZHYA 3DL4A 1XMPA 3JPWA 3U0VA 4X3OA 3BXOA 1RC8A 2C9BA 2EJUA 2P2DA 4FE4A 2R8BA 1K6MA 2GPYA 3FWNA 3PR2B 1AMOA 1QWOA 3GWGA 3OWHA 4TVBA 4YREA 4AY4A 4ZI3A 4IIJA 5C80A 2AHOA 5E1DA 4JA0A 3GMDA 4WBNA 2G4VA 4Q02A 4JI3B 4AZ3B 2IX9A 4KMOA 3V8PA 3K8OE 2WM3A 3T5GA 2XKBA 1IYZA 4NQZA 5JISA 2WIJA 4UVGA 2C2BA 3LCMA 1ZVQA 1R4MB 1SCQA 2WWFA 3I4LA 1MRNA 1PNQA 1FMCA 4E5SA 1K7EB 2VTKA 4JN6B 4URVR 4LECA 1T29A 2B82A 4AZTA 4EYSA 5L7YA 1LCIA 4G36A 1J6UA 2EC5A 1E1QD 1J9GA 4RDIA 1VIVA 4AMUA 5GM2A 1I4DD 2PT9A 4HDNA 2IHVA 4M6WB 1A5AB 1TW3A 1W88A 2AUNA 3P9IA 3MOSA 1IOLA 1G20A 5B36A 3N8HA 4GX1A 5CW1A 5TT1A 4Q4HB 2NPOA 4ZHQF 4B3TB 3HB4X 3SZMA 4TTPA 5EL0A 2VDLB 2Q0SA 2V5AA 2A4KA 4BVFA 3R4CA 4DHWA 3G0DA 2VDKB 3MW8A 4UE6A 4CF4A 2ZIVB 4ZI7A 4N9QA 4WCFB 4XVRA 3WJ2A 3DOHA 1CX9B 5BYKA 1ZOLA 5DGHA 3HR7A 1YS2X 5IULC 1N34B 1Q0ZA 1C3LA 4GZLA 4NCNA 4MUJA 3WXMA 1BTOA 3BOSA 2NIPA 1ZVMA 2EFCB 1BCRB 2IE0A 1E1KA 4BRWA 2K7FA 1CPYA 3A1DA 2XNDD 3QSYA 2GZ1A 5EI5A 4MVJE 3WLMA 2XGSA 1JJBA 2AZTA 5CLGA 1Q6ZA 2C3PA 3W5SA 3BXZA 3JYPA 3MTJA 5DI3B 1X9GA 3OCVA 1JT2A 4H27A 3WK7A 2H5LA 3AC0A 3FPSA 1PDVA 2VLIA 1YB7A 2Q2OA 3IAS6 1Z26A 3LZ6A 3MB8A 3D7LA 4RLSA 4W5WA 4WINA 4DWJA 2Q3LA 3RT7A 4FCVA 4DBLE 1Z4PX 1JLHA 2HDOA 2ODPA 4IFEA 1XROA 4X24A 3JQBA 1D5WA 1N5RA 3F1KA 2IDZA 3LI2A 3I1JA 1EBBA 4JOQA 4EUHA 1NAHA 5DX8A 1KDVA 1NRIA 5AJTA 3UQZA 4MV1A 2WB4A 3S27A 4K05A 1AE1A 1FB5A 4LDPA 4UU7A 4YAGA 2HKIA 3P4XA 4V38A 4V0OA 1V3TA 3RYHB 1NGSA 4DYVA 5KSZA 3WGJA 4DJJA 1RM5A 5DWVA 2D7CA 3HCBA 3TCXB 1ARZA 3VU0A 2LTAA 3ZWNA 1KI6A 5H9VA 1GR0A 3SD7A 3EIWA 4F9EA 2YXBA 4ZMRA 1ST3A 4G5QA 4JI5B 1P81A 1F9EA 4NU8X 2ORWA 1OI4A 1SUEA 3KT0A 1H9BA 1E9RA 3OFSA 4GQAA 2B7BA 4XDHA 1QRSA 4DJFC 4YRFA 4LRWA 2G5GX 2F3QA 3OQPA 3FNQA 2BFDA 1CY1A 1DIRA 2J0VA 3WIBA 4GKBA 4ZYTA 3UWMA 4MYTA 1T8WA 2P77A 1ZGJA 4FZJA 1R88A 3O0TA 4DKJA 2IIPA 4DLBA 4MW7A 2GSDA 3LRPA 4BWGA 3A8TA 4CLRB 3EDCA 3KYCB 1JSLA 1ECPA 4RFLA 2BRUA 1EWTA 2DWPA 2QTNA 4J7CA 2QG4A 3HCEA 5K45A 3LCUA 5DYIA 3NP7A 1GQRA 1USWA 2G9RA 5KS2A 1HT2E 1RAEA 2KX7A 3WB0A 4E3ZA 1XD2B 3HM9A 4YMSA 3PDUA 3AFNA 1E9CA 1Z28A 4BFZA 3O9VA 3B6JA 2RKWA 1U7WA 3RPEA 3IAS1 4ZOLA 5DO9A 1TCUA 4F2WA 1EUCB 1VSBA 5E8JA 3LDGA 4W5HA 2PEZA 1KI8A 3HN7A 1AU9A 3CX7A 3JQ8B 4YMVA 4ZOLF 3HCWA 3K6SA 1E2QA 4QYTA 1K8ZB 1AXGA 1PIWA 2CNWA 2JS7A 1B14A 1TYZA 1WCIB 2AJBA 4X1IA 3LWNA 2QL9A 3O82A 2QNRA 3PPVA 1KEUA 2AI3A 1MCZA 2NAFA 2ASEA 2QVCA 4CEIA 4ZOCA 4YCLA 1N2ZA 3JRWA 5DSXA 3OECA 1XRQA 1MO3A 2FPOA 1K92A 4JBLA 2CKDA 2BGLA 5LZ7A 4HOYA 3P32A 2ZJAA 3THSA 1HUQA 2IH5A 3KPWA 2O1WA 5EWMA 3E8XA 1QGOA 4QOGA 1JLSA 2ZT7A 2XUJA 1G4UR 2ZDGA 5E7IA 3RRBA 3T9BA 1PZEA 1ZPDA 2NSDA 3CH7A 4WLOA 3ILVA 2GEFA 3GGCA 3ONWA 4NEGA 5CTJA 1P9WA 2WIAA 4Q4CA 3DA8A 1C7JA 1NN0A 1P73A 4AO8A 4MOWA 5ITZA 2B92A 1NVDA 2VUHB 4KTTE 3RRJA 3WWDA 4BTLA 4MI6A 1CZOA 4PLGA 1OH7A 5HDBB 1UMKA 3ZWKA 1WE2A 2QTBA 1RXUA 1YZKA 2FGJA 2I7XA 3TTUA 5GP1A 1LVGA 2VBGA 4ENVA 3EF0A 4W8OA 5BURA 1IEVA 1SXJA 1YACA 3LCRA 4OUDB 3WR5A 4X64B 1E1QA 3L6BA 5JCXA 3ZI7A 3D2LA 3S6JA 5KDOA 2IU4A 2WHYA 4MQ5A 2CWWA 1JZTA 2BM8A 2EAUA 3DNMA 4X7PA 1CT9A 1C1XB 4D8XA 3KWMA 3SHVA 4OMCA 1M72A 3VR5H 2E89A 3DYIA 1XMVA 1J2EA 1T5IA 3CKLA 2JD0A 3JD2A 4Q93A 1XTPA 2HDNB 2VKQA 1THGA 1ULSA 4M1QA 3LAWA 1IXRC 1SU6A 4PFSA 1VYHA 3NBQA 2GZHA 2OBLA 4NS4A 4OOFA 3S8MA 3INRA 4B43A 3RS2A 3VUFA 4WGGA 9ATCA 2OVBA 1FMFA 1B8UA 1XL1A 4V0NA 2GD0A 1P7WA 1IONA 5DHPA 3GJYA 4G07A 1PNTA 4QG7A 3FPAA 3B7GA 3E9DA 3KKOA 1DKQA 2ZYSA 3HCOA 1QHGA 3M9WA 2QP4A 5CH3A 3UUGA 3ZY3A 1UOPA 1G41A 1YS9A 2IUTA 4QGHA 5GVRA 5AM3A 3ADDA 1L4YA 1U7PA 2DTDA 1PWHA 2F3RA 3BF7A 3LT4A 5GOZA 1NQWA 4H7HA 1B73A 4I55B 4KLNA 3NCHA 3ZDFA 3ENNA 4MI3A 1W8IA 1NI3A 4XEHA 5IF3A 2IYNA 2YZMA 4JAVC 1YOBA 1YCGA 4EIWA 3I58A 1FF9A 3F67A 4ND7A 3B3QA 3RJTA 4ND6A 4K6KA 3ZU2A 5KOYA 2A5YB 3EUEA 2FMUA 4ICIA 5EP4A 2FEPA 4F7DA 1DJPA 2H7YA 4UHHA 4KRFA 2UUOA 1E7MA 5CP8A 1FFSA 2PK3A 1V3VA 1E2IA 5A7GA 4LZOA 4HQ0A 4EUNA 4JC0A 3OT1A 1DJLA 3EUWA 3ROKA 5H3CA 1A50B 1GCOA 1R6AA 2VK2A 1LPOA 1U5AA 3PVCA 2RGWA 2OFWA 3TLKA 1H5QA 3IUEA 1TPZA 2OB1A 4RU1A 1G5IA 2VPWA 2GLUA 5LYJA 4DXDA 5JH7A 5KPJA 3AVPA 2XUAA 3BWYA 2UYYA 3ZLJA 2ZYAA 4S1TA 4BV2A 2VNHA 4IGKA 4UMVA 1M6NA 1YZLA 1JKMA 1QS0A 4LGYA 4O2RA 4JJ8A 3DHWC 4POOA 4ZOQI 1JILA 1Z8DA 3EZ7A 3FNIA 4LY3A 5IJAA 4MUAA 4W63A 2DQKA 4YMTA 1SXJB 3WZLA 4JBNA 3ZZ1A 4REQB 2OCPA 3V80A 3GPCA 4XGIA 4MPJA 1E64A 2XZOA 1U0NA 5CT8A 1ZM3A 3EK2A 1PGQA 1NPDA 1X74A 3D81A 5I9BA 2RJOA 1OH8A 1EM8B 1Z6TA 2Q3JA 3IIKA 4CKCB 1NF9A 6REQB 1JG7A 1JU4A 1MOPA 3K4HA 2QJTA 3PCTA 2AEFA 3SYTA 2FMTA 4S3MA 2EJWA 3PL1A 2O2ZA 3GLSA 3DPUA 3D3QA 3WAKA 4GRAA 4A8HA 3LV8A 4CF6A 1KARA 1XXLA 2DBRA 3M5PA 2WUWE 1YDMA 2XQFA 3R0IA 3V8EA 4BFVA 4EMTA 4WNYA 4BU0A 1V41E 4CQJA 4E09A 1QTQA 2DJIA 1JG2A 1DUSA 2HQRA 3VNSA 3CZAA 3DXZA 4BUJA 2IHNA 3GG2A 4DCOA 5JDCC 3AR6A 5K4AA 2ATIA 4MUNA 1ZD2P 3ASYA 4KHZA 3IR6A 3ABQB 4LWPA 3IRVA 4C07A 4D8VA 3V2UA 3WGMA 4H35A 2Z8ZA 1H2FA 4EMSA 2BI7A 4L6CA 4DLKA 5LN1A 4W1SA 4Z0HO 2GETA 4CQMD 4XWKA 1HDZA 3LBAA 1DC6A 2XGOA 3BCHA 2YWRA 1JG4A 1NW5A 1EM8A 1JX6A 1ESZA 3CB4A 1MO5A 1KO4A 4LA4A 4X54A 3UMJA 2CNLA 3B52X 3LF1A 4RK0A 4X8OA 5KAMA 3WSVA 3NC0C 4DLRA 4DG8A 1UPCA 1HEYA 4BIMA 5AMXA 4WLEA 3FVRA 4UNPA 4PIVA 3RTAA 3GFGA 3MXOA 3WZMA 5A4DA 3ZV3A 1T8YA 2G36A 4JBWA 1RXCA 5ITVA 3L4KA 2ZYGA 4G5OA 3UG6A 2BTOA 4FQ8A 1F8UA 4FMDB 5HYVA 1DKNA 1N6HA 5L3VA 3JXEA 2XTJA 1E3JA 2WOJA 4QASA 4QOIA 5MFPA 1OKKA 4QWMA 3DEJA 1BU5A 3CONA 4NVRA 4KO2S 2G4CA 4Q15A 4B87A 1BWPA 4WLVA 4D9EA 4AJIA 4XR9A 1KU6A 5D6NA 1YZVA 4GIBA 4DPLA 1FP4A 2XCUA 2R6R1 1WO8A 1X6VA 2I3AA 3MERA 4M1TA 3X1KA 4UARA 4DLVA 2CC2A 2PKCA 3VU1A 4ATNA 5BN1A 4N3BA 3NJ8A 3PD7A 4D80A 4PBTA 1J7KA 4NULA 2XOKD 5LQRA 2BFPA 3H0KA 5KCMA 3U1BA 1M7GA 3GRVA 2VBIA 2AFVA 2DMRA 3O9ZA 4FFBB 4IICA 4TN5A 4UJ5A 1E7RA 5CCDA 4BX0A 2IBMA 5LMZA 4FI3C 4B3GA 4U7DA 2HU7A 4ZA2A 5FWYB 3UJPA 1LSOA 2VI5A 3KEOA 3RC9A 2C2HA 2ECQA 3IKMB 1DBWA 4HLCA 5GTDA 4HDRA 3LQRA 1KGDA 2MYPA 2NZJA 1HG0A 1BGWA 2WD7A 3H11B 5C9ZA 4LDQA 4LZNA 5DH9A 2G3YA 3AI3A 1XCMA 3QITA 3AUFA 1MJGM 1P4JA 3COWA 3F5DA 3BA1A 2OG2A 3R3HA 1LA2A 3PNMA 3QYPA 4JR0A 3TNFA 1K4MA 3U9TA 2B5WA 1THZA 3PF8A 5CA0A 4CHTA 4G8BA 3K70C 3TKYA 4Q1EA 3GLHB 1FTWA 2C4MA 4FIDA 4RK4A 4GPZA 5EIHA 5IMBA 3KJZA 4BB9A 5KNDA 3GLIB 5DKFA 1EG2A 4WN3A 4ITRC 3TE7A 5IF9A 2JK1A 2QVLA 4FW8A 1FLVA 2W37A 4FFBA 5HOQA 1E4VA 3W8FA 4REOA 1ZN7A 4ASUA 1IN7A 4JT4A 1JU9A 1QYIA 4IP0A 4MA4A 2QD1A 5FEMA 1X1EA 5JTUA 2N9UA 1J70A 2RK4A 1EVLA 2DB3A 4YJKA 4OMDA 5MHTA 1NRXA 1PTJA 1R5OA 2A35A 3ETEA 5AW8A 1QE3A 3M1IA 1VPWA 3F7OA 2DPHA 3UV3A 1WHTA 2YW9A 4IOLA 2ZJOA 3UMFA 1T91A 3AZQA 3V4RA 3LGAA 5BNZA 5BWNA 2WF7A 1XZIA 4YRIA 1PJZA 1ODKA 1M2OB 2DTEA 3CT4A 4HEHA 4PXYA 4U3JA 1A4UA 2MR5A 5FAXA 3RIHA 2XDQA 3PE4A 3IERA 3MPOA 4DWVA 3LY5A 4XAQA 4OXRA 2PUBA 1C80A 3PPXA 4Q4JA 4LV6A 1AO3A 2HSDA 3G8CA 3DWGA 2Z0MA 3AO0B 4QECA 1L4UA 4I1SA 3IB6A 3VA7A 1A7AA 3GYBA 3OX3A 4XVQA 2AMFA 3T9FA 3U5ZB 4AQ7A 4ESHA 3KQUA 4FCTA 1EHIA 4P33A 1X1BA 3SYNA 2ENWA 5SZHB 3M3PA 1JFLA 1P2TA 2BKAA 3C3EA 1OPRA 4BBAA 3PUYA 3ELYA 3OG9A 4DQLA 3TB6A 4QQ8A 1QFYA 3M6UA 3RBVA 3VNUA 4Y9SA 5IN5A 3M6MD 4UAUA 3ZH2A 3HYSA 1BYIA 2VP2A 1K6XA 4QJ5A 3UFXB 1HX7A 1ZRSA 3IMEA 1VLHA 3T5AA 1FZQA 1W581 4RSMA 3WMEA 3DJYA 1M2JA 4X20A 2Z98A 4KQKA 4TTIA 2V5VA 1XLTC 1Z25A 4UEWA 3K6JA 1ML4A 3Q2OA 2Y1CA 2VZ9A 4QGBA 2XYGA 3W5IA 2YJ5A 5JS8A 2PRSA 2V7VA 3U44A 1RE0A 4DEYA 1HXHA 2E1PA 1IRXA 3PE6A 4O4LA 1JBEA 2AW3A 2ECFA 2B3DA 2YBEA 3E9EA 1PR5A 5JG7A 2J3IA 3HVHA 2PUDA 2GKGA 4GOLD 3E3NA 4U7JA 3WGOA 2C29D 3IPLA 3D6UA 5EE5B 3MCTA 3RSQA 4LXTA 3RAPR 4R98A 2ZVQX 2DKFA 5JAMA 3BWXA 1O58A 4HGPA 3SXUA 3T3NA 4JDUA 3UWSA 4ILEA 3IXLA 1CF9A 1K0FA 3QYFA 3C6BA 4IHQA 3WIDA 5EHXA 3IH5A 6Q21A 4FFDA 1RADA 4PU0A 1F1BA 4R71A 3NTXA 4H7KA 3ZDQA 5BSWA 5H82A 1CIPA 3JAKB 1S2OA 3OPNA 3LDAA 4H4CA 2BLNA 1MB2A 3QKSA 3RNOA 3ZW8A 5EZYF 1ZK2A 2HBRA 3OEED 1QVVA 3QMWA 1DTWA 2A0KA 2JFVA 4MVJP 3SSMA 4D8YA 5GIOE 3WDMA 1EP9A 1WXIA 2FSFA 3HYNA 4IXMA 5JRDS 3MWYW 3U3XA 1E5DA 1PT9A 5I47A 1VDZA 1DO0A 1PR1A 3FAZA 4LRYA 1L3CA 2Y9PB 1M1YB 4ZAVA 4E70A 5JCJD 1B4DA 1Y4UA 1Q1ZA 1ZCZA 4DA6A 5I7VA 4GZ5A 1M33A 4ISBA 3WMGA 2AN9A 2ODAA 4QAJA 1A8IA 1L7BA 2O0JA 2Y0CA 3SBXA 3AUAA 2PLNA 4Q4LA 3DE4X 2J5BA 2EFGA 4E22A 3A9VA 4Q3NA 3QBDA 2JEOA 5EJEA 2V1UA 1V4VA 2C3MA 1NX6A 3HP1A 2HRDA 1OIXA 2JFQA 2C59A 5HS4A 3QTTA 3R7FA 1QO9A 1YZYA 4Z9BA 4D3FA 4LNUA 2P9GA 4EO7A 1PR9A 4R9NA 3CF2A 1BOFA 4KN9S 1LKZA 4RORA 5CEJA 3A3YA 4OK6A 1JR3A 3KSUA 3OJLA 1LI7A 4QYXA 1GT91 1JKJA 4IY1A 4X71A 2ZSJA 5HXAA 5ICCA 1CRQA 5FTJA 4DSOA 1K7YA 2DPXA 3TW4A 4ER0A 1WF3A 4UTNA 4WZ6A 2XODA 1Q95A 4LGCA 4PZLA 1N1MA 5E2BA 4B3SB 1BHSA 3B9BA 2OD2A 3N2GA 4YP9A 1U2ZA 2QTAA 1KZGB 2Y1XA 2OG1A 2YOFA 3D5TA 2ZJ8A 4M46A 4NR0A 4TN1A 1GTMA 3DVRX 4BNUA 4ZICA 2RHWA 2CUNA 4O3MA 1U0BB 4MYSA 1FIUA 4CM8B 4AP5A 1C1YA 821PA 3CEPB 4IH9A 4IJVA 1YBAA 3CHYA 2H4FA 1AZSC 3SKYA 4LWOA 1QLWA 1RI1A 4Y6GB 3KSRA 3VC2A 3BL6A 1U7DA 1MAHA 4IIUA 3P9CA 1XVAA 4G56A 4O33A 4LS3A 3TPFA 2C3YA 3UZUA 2J85A 2X2PA 3WYGA 1BRMA 5J4HA 1A9QA 2W2KB 5DNCA 1HH4A 3IXMA 4TXLA 2HLDD 3M1LA 1KEPA 4OAPA 4ZU6X 1EXMA 1K4KA 1GFWA 3CUKA 2X4IA 2G25A 4K9KA 2XT0A 3QV2A 4Y9DA 5HBGA 3K92A 2I9KA 4P2BA 1Q84A 1KVTA 3CZ4A 5J4KA 4NH0A 3W9BA 1Z5UA 2TSYB 1AM4D 3V9PA 1VKRA 1SUWA 4OPMA 1THTA 4KFRA 1UAGA 3CR3C 4GO1A 4YUVA 4AJNA 5JANA 2V4UA 1ZNYA 5KU1A 1IC6A 1DXQA 2HSZA 3Q3VA 4AZ3A 1LQUA 1VXRA 3L7LA 1QGYA 2XYRA 3GJ7A 3V8VA 4CM4A 1QONA 3OIFA 2VZLA 5GJWC 3AFMA 3C6ZA 5I7AA 3RRZA 4BUZA 4M9RA 4HTFA 2IV2X 1JA0A 4AJ9A 4D4JA 3FKSA 2HN9A 1C2TA 1VZ2A 2C0QA 3DEKA 3M4NA 4IDNA 5DYWA 1VBMA 1V11A 3D3KA 3HCFA 3LVBA 3S1AB 1I4WA 1DKMA 2X42A 3OZCA 2BMEA 2GVDC 4TYMA 2RH4A 3AUTA 4LE1A 4NESA 1JUDA 4CLEA 3VH1A 3IDAA 2K2QB 3B8EA 1EK5A 1OXMA 3DVLA 3JZFA 4BVHA 2EDAA 1FJ2A 1WJGA 3QELB 2C2MA 3MTIA 4I66A 1Q3HA 4DPKA 5BUCA 3IOCA 3R76A 5L9AA 3MF4A 7YASA 4GNKA 3RQIA 3RK1A 4J6FA 4HNGA 1Q0RA 3G17A 4WECA 1K1EA 4KEAA 4D41A 2I2BA 4MRSA 2XNJA 3TZKA 2HF7A 1FVOA 5ALNA 4M3NA 4ZYWA 1GPJA 5TDHA 2AOWA 3S2EA 3AMVA 1BC5A 5IUJC 3ANLA 4HADA 3LOPA 2BMFA 1NW6A 2IYSA 1QHNA 3UMCA 2OXEA 2VF5X 5BV0A 5EXDA 3PDIA 5CGQB 2YOHA 1R5JA 4RACA 5IX8A 3SMQA 3U9SA 3WIEA 2ATCA 1K5PA 3HPRA 2DC1A 2B78A 3T7KA 2JJ1A 4XSGA 4Z3OA 2VDQB 4GQIA 4D6PA 2X8WA 1LD3A 1TF7A 4BJ3A 3GJ4A 1OBOA 2JARA 3COYA 4YCBA 2IEZA 5K2OA 4GMFA 3W9SA 4AC9A 3PQ3A 1YCFA 1OE0A 5I5EA 1NW8A 3PEWA 1FSGA 2Q3DA 3ROPA 2E6UX 2P69A 3GR6A 2DFDA 2R6GA 4IDHA 1LBHA 4Y2RA 3JAWB 3KZCA 4NCKA 5EA2A 4BP8A 4TKZA 2Q1XA 4KO3S 4MI9A 4ANFA 1USUA 3TECE 4NOKA 1A4IA 5GGXA 2BMVA 1C0LA 5EMHA 4AY2A 3PJFA 3MXTA 4AZ0A 3AY6A 2UVPB 4IFIA 2FSVC 2IBSA 3DC7A 3SYKA 3MCWA 3QVKA 2Q62A 3FLBA 1XTTA 1X7DA 2ZCUA 3RSOA 4C4XA 3I9FA 4OKIA 4MDHA 3NVDA 4KI0A 4S0ZA 1XMQB 2QMQA 1E9SA 1OHHA 1RBZA 3GEIA 2OMEA 2SECE 3CRVA 4RPJA 3WIUA 5ELLA 4UOZA 1XJQA 3OD5A 4M55A 4KQJA 1TVEA 4G25A 1FVXA 2QRLA 4WXRA 3DDWA 1W0KD 2HO4A 3OLXA 4KACA 4Q21A 2IUSA 5DLDA 1NBEA 3A58B 1L1QA 1JSRA 3TCNA 5HKOA 3J80A 1OTYA 1A9XB 2XW6A 2NXEA 2BCGY 4TL9A 1NQ5A 2JC3A 3GFRA 3U4HA 4CM1A 4DS3A 4DVJA 3IHLA 4KVZA 4CF5A 3A2NA 2ZRHA 3H5IA 5DBOA 1R00A 1AB6A 1E18A 1IHDA 1N6LA 2LV8A 5TARA 3FPKA 5CDGA 1T1SA 2VRCD 2ZYWX 1Z5ZA 1LV8A 2GB4A 2Q07A 3D6FA 1WUTA 2LKDA 3SX4A 1GPLA 1LSUA 4C2BA 5JS7A 1M54A 2HBQA 3IEPA 1X0XA 3IVCA 2P30A 2HJHA 1V9LA 1FVHA 4Z86A 3P9ZA 3RG8A 3WL5A 2JI9A 4QICA 4KIGA 5JCPA 1BEZA 1J9EA 2FPGA 3A6JA 1PHPA 4JUBA 3HRIA 1FNSA 4MW2A 5F76A 1B1AA 5WRFA 3RUFA 3Q5EA 3S70A 4B75A 4L02A 1AJEA 4ETWA 1FNBA 2OB2A 1TYDE 4GEKA 4N5MA 4KITB 1S8NA 5IT4A 4AS2A 4KG7A 4RTKA 4DABA 2J3QA 3O03A 3GGPA 1DTWB 1U2RA 1J2RA 1ZICA 2I8AA 3HRKA 1VPTA 2CYBA 5CHYA 5DHAA 4A16A 5ABPA 5IK2D 1QYVA 5FHQA 3MGCA 1NNLA 5KYXB 1QO0D 1NNI1 4BB0A 3BTSA 2ZTSA 1BAPA 3PQEA 4H77A 3PJDA 3Q4GA 1N2SA 3FDZA 3TQHA 5EIEA 1XJ5A 2BFCA 3C6KA 2AC2A 2N42A 4PPYA 4Q5IA 4AO6A 4B6OA 1IEWA 2HSJA 5ADHA 5J5CA 3VH3A 2DQ4A 3QWFA 1SEPA 5JCZA 3JQDA 4K5QA 4JODA 4I9FA 4B7UA 1EUZA 4JB2A 3BD7A 2XAAA 3KWFA 4KIFA 4KYVA 3N8NA 4XUGB 1YC5A 4ZZ1A 2GSWA 2AC4A 4TT3D 5EQDA 4KR3A 1UADA 1N9GB 4YHHB 3OCUA 2E18A 3VR3A 3KE9A 4QYIA 2PH5A 1YDHA 1FNMA 4PZEA 1J99A 1YJCA 2FMFA 4Q7JB 2VSOA 4QYSA 1VG1A 4MTCA 4CLDA 3TS1A 1JLMA 2CVOA 3PUVA 1W5EA 3O21A 1XWIA 5BPHA 1VHTA 3GROA 1B42A 4LJLA 3ZOZA 4XYEA 4M1EA 2H5EA 4ZQCB 2RGAA 2UV8A 2Q1WA 3UUWA 1T4BA 4JLVA 2EWMA 4LY6A 3ZHBA 1G5TA 4O4IA 2L0XA 2HK8A 3FTCA 4EATA 5COBA 3TMAA 4XGQA 3FFWA 1ZOSA 2B34A 2FSPA 1G1MA 1I8TA 2I2WA 3GHYA 5ESDA 4XWOA 3FOEC 3ITKA 3E70C 5TQJA 2E9SA 1H2YA 2D1SA 2FPRA 3ZHUA 2G71A 1WXHA 1R0YA 2ZBQA 1OBVA 5KYWB 5EG5A 4G0PA 2ZUWA 5E2IA 3ZN2A 1P5JA 3DC2A 3C5WP 2EHJA 5IN4A 1HETA 1LPMA 2F3SA 3C3YA 4Z2YA 2YCLA 3GEGA 2I4LA 4HSGA 3JQAD 2P6UA 2JG3A 1UT6A 1AUQA 4IGAA 5LQNA 2X7HA 4PQEA 1YOVA 5DNUA 3IMGA 1HDIA 3S55A 4JBYA 1NOJA 3ANMA 5HJ2A 2OYRA 3Q8MA 2I2CA 5CXXA 4EJ0A 1BE6A 2PGOA 3F2IA 1VG0B 2CGEA 1GT6A 3VSEA 4HS9A 2IV3A 1OD6A 4YQZA 1ZCFA 2OZLB 3QOXA 2BFFB 4GUAA 1KI1A 1IJEA 2PWBA 1VPEA 5LSAA 2HA0A 4AN0A 3C5HA 2C58A 4YCJA 2G07A 4Q3CA 1RIIA 1ZVJA 3GH1A 4DUYB 4AF8A 1SBQA 2FFJA 1I80A 3OPYA 4I50F 1ZCJA 3KPYA 1RKBA 2HWWA 4MV0A 1YHNA 5E9JA 2OXIA 2HLHA 4LTMA 4F2PA 3AR2A 4CTJA 3H0EA 1QHSA 3GLIE 2GEVA 2YHUA 4B31A 3VU3A 4UHKA 1VQ1A 4YRDA 1Q0SA 2C97A 3KSDO 4X41A 3BZBA 3IIIA 1Q22A 5A1TA 2AE1A 1ZNXA 3KT8A 4A6XA 1YCDA 4B74A 4F6RA 3T7AA 5K0JA 2GJAA 5H3LA 3ONNA 1REQA 1M6VA 2JJ8A 3LX5A 1EXWA 3CW2A 1YZQA 3FSGA 3EMKA 1O97C 1NUAA 2GCGA 2GZRA 4YYZA 5BSHA 2VNJA 2QHXA 5JCJA 3U49A 2DUJA 2QA5A 4AMVA 2Z6VA 4J3JA 4C0QC 1E1LA 1PEKE 2P2LA 1JEYA 2VPTA 2IZ6A 2O8FA 3HL4A 2BF7A 3R0JA 4FYHA 4FVTA 1OFUX 2NV2B 3HJCA 3GGGA 2RBGA 2NU9B 2B8JA 5ADUS 3ZDBA 2Y05A 4XQGA 1VE5A 2AL7A 3H2YA 3LRTA 4YP7A 2PXCA 3WKCA 3JQ7A 2O0KA 4DCUA 1J0XO 5B1EA 4ITUA 4OQNA 3C5VA 2IPLA 4EJ6A 1CCWA 4HEQA 4MV7A 3LBIA 1GAWA 1HV8A 1Q21A 2MJLA 2BE7A 3EOAI 3GZJA 3HMKA 3II6X 3AOEA 3IPCA 4Y3UA 3TZEA 1E1CB 4PCAA 1A8UA 1WUJS 1IQRA 2J5KA 2P3SA 1YZ3A 2WJZB 4NV1A 4PIMA 4UASA 3S3TA 5LIPA 2O19A 2IXAA 4M37A 1I32A 4QDZA 5HEKA 4JASB 4ER3A 1UODA 2A5FA 3BMQA 3K9WA 3L40A 4IRUB 1QCZA 1Z8NA 2IHUA 3V1UA 2DE0X 1C30A 3OLWA 1VL1A 2OUIA 2RAUA 3VNRA 2PUEA 2A0XA 4K8OA 1UAAA 1R8SA 3PXGA 1ESMA 1ZKMA 4EHLA 1PJCA 2HGZA 2A33A 2BFEB 4M0FA 2GA9A 4MYCA 3P96A 2OHFA 1SBIA 3WGQA 4U9HS 3ZV7A 4LXHA 3RRXA 2GXQA 4K9SA 5DMXA 4HXFB 1JQEA 1Y1RA 3E9MA 2Y1FA 4M1WA 4YMGA 1W88B 3T35A 3W90A 1MLDA 3HWX1 3T15A 1AQUA 5E4YA 4QXMA 5I45A 2CF5A 1KORA 1ZK4A 3E22A 5BSUA 3VX4A 4IQFA 2RD2A 1MTZA 4LKOA 4RIFA 3TFQA 1N7JA 1TZJA 4Z0PA 4ZVSA 3JQBC 1SG0A 1DQYA 5JRZA 3IELA 1E94E 3REGA 2RSLA 4ZU3A 1ZRHA 1RI5A 3QA9A 1F5SA 2ZJ1A 1MX1A 1TKBA 2V58A 2X4DA 1XZBA 1EK2A 2ZRFA 3IPXA 3KD2A 3PKJA 5FD8A 5B58T 2XCOA 3VR6D 3DZFA 3JQFC 4JYAB 3OOJA 5A05A 3FLMA 4IIFA 2H51A 3UK6A 1PZXA 4M9CA 3AEUB 3OLVA 1MB3A 4TMFA 3KUKA 5LYJF 4OP3A 4Q1BA 4W6ZA 2BHRA 1EHYA 3W6UA 1X1QA 3WGLA 3GL9A 1UDBA 2MT9A 1W4AA 2CUTA 1DG1G 4OD0A 2F3PA 3COZA 4MR9B 3ZIAA 4US1R 3G5UA 5IC5A 2QTLA 3KQLA 1WX1A 1WU8A 2QE7D 2WJ3A 3NBZC 1Y1PA 2JCYA 4N5DA 4Z9YA 3WGYA 1LJUA 2EL9A 3Q7PA 3V7WA 4ED9A 1PHRA 3LXUX 4QWWA 3DDSA 3YASA 2GBLC 2NUAB 3MYYA 4LIPD 1MVNA 3LZDA 3R20A 2Z1NA 3RADC 1R6BX 5EP2A 4FYXA 1BS2A 4B7CA 5EKUA 1YXMA 1J56A 3B1ZA 1A7UA 1HO3A 3GZNA 2ZI3A 4P4NA 4UZEA 3UJNA 3NQ41 5K3FB 3V1MA 1X8KA 1QR6A 3GVIA 3T4UA 1SBCA 1V96A 4O29A 3MT9A 1E9VA 4Y2JA 1N0VC 1FS6A 2PLAA 1ODTC 3FM9A 1ZC4A 4HFMA 4B7XA 1XI2A 5A5VA 1G64A 5HWSA 2D54A 2BM1A 2YWFA 2RG7A 4TROA 1I7PA 1T1EA 2HNBA 5G3ZA 4QPZA 4EW6A 4ETNA 4O4HF 3P7MA 1RHKA 4NDAA 5JQWA 1FDTA 1WSWA 3K72B 2WWWA 4BFTA 1JG1A 2OTCA 4DNFA 2FZ5A 3OQOA 2D0PB 5FBKA 1JQLB 1N5JA 2QOEA 3AR4A 4ENRA 1HTTA 2XZLA 1L4HA 1L9XA 3KKKA 3V8RA 1Z4QA 3UFBA 3NUQA 5A0VA 2FSIA 1USKA 2JRLA 2BUBA 2JAQA 2FUEA 5KSYA 1H1LA 4OM8A 1GPWB 2UVPA 2D0DA 4D3YA 4FDAA 1JHQA 4PC7A 1JAYA 1B15A 1C1DB 4IJQA 3R3UA 2DHDA 4CM5A 5K3DA 1DV1A 4LSZA 2JF0A 3QBJA 3UA3A 4I4CA 1EUQA 2PX0A 4P83A 1O1YA 4RD2A 5GWXA 5B1SA 4DA8A 4LJRA 3U4MA 2NN3C 5F2NA 3PRYA 1V7CA 4I9HA 3S81A 3BN3A 3GCZA 4CV2A 2PUVA 1VMAA 4MH0R 3VO1A 3CNHA 1BHO1 4DBVO 4JVNA 5BYAA 1L5WA 2WR8A 3CJTA 1W4BA 3HA2A 3K4PA 5K8LA 4B6RA 2O2YA 3E82A 1Y63A 2DUNA 1AV6A 2JZOA 1RWVA 4WCVA 1E7YA 3UGQA 3UXMA 4GOJA 1FFGA 2IZOA 2BMJA 4HAVA 4YT8A 3KZXA 1IH8A 4XWTA 3ESZA 5EQTA 1NHWA 1SQ0A 3NEAA 1PT7A 4UTOA 5F64A 2I8LA 2ZT5A 1F17A 5AO9A 4LFAB 2AA3A 5HIAA 5C8VA 3WA7A 2SNIE 1K6IA 2I34A 1Z6ZA 1LQ2A 2WIGA 3GPDG 4N8EA 1GNRA 1CUHA 3RSHA 3U7RA 1VE6A 3IUYA 3KR9A 4IDOA 2W48A 4PO1A 2PMFA 1UJBA 3GLRA 4MJLA 1DJOA 3D9QX 4XM2A 4AWBA 3QVOA 1U4OA 3ZWOA 2QQFA 3BQNB 3THOA 2D00A 1E7QA 1H0HA 1KY4A 3HBNA 1L4EA 2VYFA 4M1MA 3KG2A 4WKGA 1C29B 3FYUB 3K0FB 4R1MA 4Z8XA 4WHMA 4AKGA 5ALMA 3KQMA 1SHLA 3TX2A 1USIA 2R65A 2AXQA 1YJQA 1A7KA 1OAOC 2O7SA 5HRUA 3HI6A 5GV7A 1DWPA 2ANCA 3QELA 2WMDA 2P41A 4HXGA 5FIUA 1O9GA 2Q28A 3U6KA 4OYLA 5SYMA 3AVUA 4KI7A 1R50A 1XZDA 4DY4A 4PAQA 3E4CA 4TZ0A 3E5MA 1CP3A 3DBRB 5FOVA 1FFXB 1QPGA 4ARVA 3K35A 1A2OA 1J2UA 4B4KA 1EE2A 4CCAA 1ISPA 1ZY2A 1GCIA 3H6HA 4FDVA 3CWCA 4L16A 2XSZD 3TYXA 2D3TA 4RJLA 1KK1A 3STYA 1E59A 3DLCA 3PC8C 3TAXA 5IBQA 1OYOA 5IRCD 3QUAA 3K9CA 4BQIA 4F4FA 2R79A 5AKHA 4NXNB 3EG9A 3BD8A 1NBHA 2D5AA 4S1VA 3SQOA 4C7OB 3H9UA 4GGPA 4BGUA 1IPEA 1N8SA 3LPDA 2YJ3A 4F06A 1YMUA 4G5HA 1XJ0A 2PN1A 3LUJA 3U9LA 1W93A 1RKQA 1TQ4A 1KOFA 1XZFA 3IAEA 3K3PA 1LF0A 3KJEA 4J6EA 1V1MB 1ONBA 2HTEA 2VFAA 1KEKA 1U2GA 1BXZA 1G21B 2WIKA 4M1ZA 4OQDA 1QOZA 3W8RA 5CLFA 5IG2A 3JY6A 4PZUA 2VA8A 4YJGB 1Y8CA 2NO4A 5E7QA 3NIFB 1T26A 1JTEA 4HGOA 1ZNWA 3NFRA 1U8TA 2IIQA 4DA9A 3RVPA 2JFHA 4HDKA 2EW2A 1E1CA 3MWGA 2ZWIA 1KWKA 1W5SA 3KV1A 2ZIWB 2R9VA 1K88A 1H6BA 1SC1A 1C7EA 1YRQA 2ZR9A 3GH3A 2I1WA 1ZH8A 3GZ4A 4ZO8A 4RJIA 5CW2A 3AEQB 4JU9A 4OLFA 1UH5A 2F1RA 2C8VA 1JDZA 2HO5A 5G4KA 2X0DA 2WVGA 1RI3A 1XU7A 5GZ6A 1N6IA 4EJSA 4AO7A 3HVKA 3SFVA 2VJMA 5KCZA 2PGNA 4B2YA 1P0FA 4JI0B 4A7PA 2ISCA 1OA1A 4DSNA 5JOQA 4GL2A 1SPBS 2HU5A 4M2LA 2P68A 2Z5LA 3WFIA 4HNQA 1KXZA 1XRRA 1Z38A 1K89A 4L4XA 3URMA 2I7DA 4EY4A 5DOVA 5F9MA 5PNTA 1N75A 1IPFA 1CV2A 2QI9F 4UPDA 1JJFA 4LMPA 4J0IA 4M0CA 2NXWA 2PYDA 3ZEIA 5BOSA 4OLBA 4YVFA 2NADA 3R2JA 4L15A 4QEZA 5ERXA 4L0QA 3ZZNA 5HP4A 4PX9A 1GNQA 4F45A 3FOCA 1QOPB 4FOOA 1Z5NA 2PSSA 3CUYA 2OCGA 4I99A 3LYUA 3CNBA 3L6OO 2PL9A 3PICA 3MGBA 2AOUA 3N2ZB 2KLBA 1F4LA 1Q1GA 3OX4A 4FZ5A 1NVVQ 5L4NA 1GDHA 4WESA 4Y2TA 3FWZA 1JE1A 1J5XA 2NVOA 1KEWA 4I4NA 2XE7A 2XE8A 4J1TA 1WBBA 1QF6A 1Q91A 1K8QA 3UT5B 3QJGA 5M34A 1C2YA 1GRNA 1OLXB 3CY6A 3SDZA 2G88A 3LVQE 2FPUA 4RVFA 2ZIFA 1WLYA 2FRXA 3Q6NA 4R7TA 3N8GA 1H8HD 1ZP6A 2JJ2A 4KH1A 4Q3EA 4QU5A 3C85A 4XW2A 4NAVA 2FCRA 5E1BA 1G59A 3QLTA 1QZXA 4HQNA 3R9XB 4WKPA 4ZU1X 2BSAA 1E8NA 5JSUA 2D7JA 2WOOA 4D7AA 3AB8A 2WKRA 3GCXA 3EGDA 3CXUA 4ID3A 4WCFA 2CFRA 1WZ2A 2X22A 4MVJI 2FQWA 1O0SA 1W85B 2AI2A 3AHDA 3UAZA 3FROA 4UAGA 1M2NA 1I7LA 1H2WA 1RHQA 2JFXA 3AI2A 3LHSA 2YWJA 2FX5A 1TA9A 2JAPA 3K1AA 1U8XX 3K0HA 3O1HB 4TT8A 2WMYA 3GMTA 2VXOA 3GRCA 2GHRA 3DD1A 3RS7A 2GWHA 3UGTA 1PWEA 3WYBA 4EKIA 3EZ9A 4YRAA 1GUBA 1SVSA 1TVMA 1V5IA 4LPSA 3SQXA 3C3DA 3JQFA 4CKBA 3QMPA 5I7RA 1W1UA 3C14C 2G77B 7AT1A 3FHLA 3TVYA 2FSSA 4F3KA 4Z4EA 2NYAA 3QMMA 2Z58A 3ENVA 4PTYA 3C3BA 2ID4A 1NN3A 3RABA 4DIKA 1GDTA 1FTGA 2FY8A 4UM9D 3REQB 1QXSA 2CB0A 3NBAA 4KIUA 1QMPA 3WKEA 2H52A 1H6AA 4CMHA 3ORRA 2AOTB 1G4AE 3G59A 1GL7A 2KQUA 4CCYA 4I9NA 4AQDA 4K86A 1P60A 4OQEA 2FWRA 2ZQ5A 3KPJA 5JI2E 1L5QA 1CVIA 2CXUA 4PLYA 4Q7KA 2W98A 2IS6A 4IIJB 1JBKA 1DIOB 4NBSA 5BSKA 2QNIA 2D1QA 3DGEC 3ITDA 1AHNA 3EH1A 3GNTA 1XLWA 3G1TA 2ORIA 3FRJA 1SKYE 3JVEA 3NONA 4H9GA 5FQNA 5BQFA 1NBWB 1OX6A 1GTRA 1STOA 2JFPA 4B0OA 4CTKA 1PJLA 1PSDA 4BBJA 2IF0A 3WHKA 4DQKA 5AVUA 3QX3A 4B09A 5H4HA 1JTVA 1QJCA 4S2EA 1KAHA 2DM6A 2CMKA 1OSNA 2QTCA 3EWIA 4KPUA 3B48A 3SIRA 2C8KA 5IEBA 3FUUA 2QTFA 2R25B 1O95C 3A2MA 2H7CA 2BV3A 4C1NA 1W36C 2FSHA 1HWYA 1ZUIA 1L1RA 3B70A 4DJ5X 1MO2A 1WETA 3M9LA 3O7WA 3RVOA 3AOEC 3D3WB 3DTNA 1NYTA 2XE6A 4Q9DA 4P08A 4ZVVA 5IVDA 1E2NA 3SC2B 3O8NA 1CS0B 5H9WA 2GK7A 2JVKA 1CR1A 4WOPA 3L1HA 3NWPA 5EIWA 3PVSA 2V03A 3PUIA 5B3AA 3GRPA 4W9NA 4PSAA 3JYOA 4S24A 1CUIA 3N53A 3AEZA 2P7HA 3O95A 5TMPA 2VHQA 3B1VA 2MCFA 5AW7A 4TTAA 5CITA 3LT1A 4CIWA 5KUTA 1E2LA 1BWSA 3HFJA 3BJRA 5C46F 3KQHA 1AZWA 1GGKA 1YFKA 1TTHA 2DLDA 3MAGA 4FNAA 4TYPA 1RYEA 4L5JA 1OI3A 1HDCA 4FB4A 4RFVA 3DOFA 2HU8A 2RMKA 4N82A 5LBUA 3WL7A 4K9PA 4TKLA 3T1YB 4D3XA 3WK6A 1T6XA 2HSGA 5C1PA 4YMLA 4RS3A 4OGLA 5CVTA 2EL7A 1O5TA 1B1CA 3PZRA 1N7HA 3WZ2A 1B3BA 1V9CA 2HIGA 2D8MA 2XNDA 3EXIB 4LOLA 4PANA 5DNVA 4NBTA 2QSYA 1LY1A 4I4TB 1A2QA 2WFLA 2X58A 4I5GA 3T94A 1TL7C 4YMHA 1X9HA 5BT8A 1QDLB 4WE3A 3ZCXA 2Z9DA 2UYCA 3AHJA 3CN9A 2YIDA 3UMGA 3DOCA 4KXXA 3Q72A 4RE5A 4EPRA 3NBFA 3ZTYA 4QBGB 4P7GA 3ICQB 4GBGA 1UXGA 4RMGA 3ANTA 3NUZA 5A3RA 2WYOA 2G8NA 1CU1A 2BELA 5JRJA 4CEJB 3GDFA 3GA7A 5G40A 2WP8J 1S9HA 1UDRA 1ZBQA 3ETCA 1NXPA 2JGLA 4BAUA 1UKAA 1YKFA 2PZ8A 3FNEA 4MICA 4ZEOA 3QXHA 1ZCBA 4PN3A 5HGXA 1UIMA 1T4DA 4NOMA 3PC2A 5CLQA 2K2WA 2PIAA 4N5IX 4BLOA 4UQLA 4BIIA 3TF5A 3SBDA 4MROA 1O8BA 2ONZA 3F71A 1YQGA 4MIYA 5DK6A 5THKA 3I9LA 1YDEA 1G8SA 1JVBA 1NP7A 3HS3A 4O02B 1C8KA 5IBCA 4R2KA 3JZAA 3DT9A 4DV6B 2H18A 1YWGO 3R77A 3SLRA 2YC2C 3ET5A 4ZEVA 4ZYUA 1HZZA 1P7CA 2LDBA 2RHLA 3LBNA 3C5CA 2HZBA 1MQ9A 2FPSA 5AKEA 3TLZA 3U3MA 4DMUB 2DG2A 4ZRNA 5I7FA 2GX6A 1P7ZA 4QHSA 2HPAA 2GCPA 1TM7E 1XZCA 4KQEA 1N4AA 3ZY2A 3KKQA 3L0ZA 2IJGX 2YJGA 4BBPA 1Q0UA 1I1QB 1UXJA 2IGTA 2UAGA 3DDUA 3DFFA 3FX2A 4OBBA 1JIXA 4YJ2F 5COQA 3VXKA 5HFJA 3OJFA 5FA6A 3CLSD 3HKEB 1A0OA 1QVRA 2VYCA 3GVXA 2CNBA 1YH3A 3LUDA 3N7UA 4KVAA 4OYRA 4XJVA 5BN4B 5L3RA 4BZZA 4G0WA 3KQWA 1KOJA 3BE8A 3ZTWA 4WY2A 4RETA 1OZAA 3R5JA 5G0UA 3SBEA 3TQCA 4UZFA 1SIWA 3WNCA 4UAJA 3OM9A 3QKIA 2V55B 1PJ2A 4EF6A 1LI5A 4Y2PA 1FUUA 2VH1A 3A4TA 2AEMA 3JQEA 6PFKA 3N3BC 1FYEA 2O2SA 5JSZB 2NU8A 3DAGA 1JZQA 3HADA 4JYCA 1D2AA 1DXOA 3EMVA 4M49A 4R1UA 1XK7A 3V9AA 4AJHA 1U9ZA 1KO7A 1QK4A 4GOXA 4E2XA 3NIDB 2WU1A 3NTUA 1MX5A 4IG4A 4WDRA 4E08A 1ZK0A 3VPCA 2VDOB 1XHFA 2AWNA 1WCIA 2AOUB 2NPFA 2ZVDA 5KNCH 1TZBA 3BAZA 5IAAA 3U4AA 1T5BA 2CUKA 5C4IA 3H1EA 1RJDA 3QPBA 3QU5A 3C8DA 3KU4A 4BEBA 1LDBA 4BMZA 1OPXA 1GZVA 1RBMA 4N3NA 3LQ1A 5EMKA 1W96A 2HDWA 4BCDA 5FXMA 1FTNA 1CD5A 1Z7EA 3FLEA 2Z1MA 1MJFA 2HJVA 2Y6VA 4F1WA 2PG3A 1NDQA 1ZNZA 3SFTA 1Z5OA 2WK1A 3DE5X 5JXJA 3LHKA 5EHNA 4H6PA 3CW8X 1V26A 3GRKA 1Z0AA 4KYUA 4OQLA 3WQQA 2VDRB 4FGSA 3KEGA 3EVNA 4BMCA 2QMEA 4GI5A 3TXXA 1HMYA 1JR2A 3QFRA 4FEGA 1XZLA 2A94A 2ZJ2A 4Z9FA 4DNOA 5KQGA 2VUSA 1M6WA 1Q83A 1OLOA 2X3FA 4TRMA 3OEEA 3UQYS 2IBTA 1XDZA 3BEDA 2VWGA 1AGYA 3NWOA 3TO5A 2B1RA 2C9DA 2G76A 4OA8A 2ORED 3Q7RA 1SUIA 4JUIA 1IY2A 3NMUF 1EE9A 3MGKA 3IJPA 1Y7HA 3NWBA 1NKTA 3PT5A 4YRSA 3GQBA 1Q7CA 4LBVA 2XVYA 3WO0A 4GP6A 2Y1LA 1A9RA 3L5KA 3LA6A 2FX2A 1KI3A 4KQMA 4QA9A 1CB7A 5AJWA 3JVUA 4IMPA 1P8JA 1QGAA 3TNJA 4A0RA 4J75A 1PBNA 3DB2A 1A8SA 1Q0LA 1S1MA 2PS1A 2WYIA 3BE6A 4IXWA 1RZ3A 1KYZA 3I12A 1XRNA 3PQ8A 4MWEA 4O08A 2XEXA 1KVSA 2WJVA 3OX1A 2NWQA 2J67A 5GONB 1FYDA 3MVEA 5AI5A 5EAIA 4BYGA 4RNCA 1CUWA 4W5RA 1KETA 1J49A 4O4IF 1HTBA 1VJTA 2I4MA 3H9GA 3JWPA 5DTQA 3FOWA 3PV0A 4I1RA 1TMKA 3M3DA 1Z16A 5LL6P 3A1WA 3UOAB 3ZR4B 2DGDA 4D5GA 4D9GA 4LQCA 2ZRGA 3EARA 1GPH1 3PKZA 2BR5A 3D6NB 3VSDA 3I1YA 2W2PA 1XXHE 2EBFX 3HLKA 3QZUA 4GS5A 2GZAA 1SUPA 1RYMA 2C88A 2JIOA 2Q4OA 5EWLA 1VGQA 1A9OA 5G2OA 2CMDA 3DF9A 1U4SA 4MR8A 4RVCA 1X1AA 2VJKA 1R0WA 2XUOA 4RF4A 2GR9A 4L9AA 1WUIS 4NE2A 3I8SA 3IB3A 5J2TB 4U8HA 1QHIA 5TEWA 1H3EA 1S7GA 4M54A 4L2IA 4PCVA 4LYGA 2TMGA 2PUGA 2VK4A 1YVEI 3WI7A 1T9ZA 1WDTA 1GAEO 4GAEA 2I3ZA 1GV1A 3K2IA 2WYHA 1K6EA 3L4JA 2HA2A 3FE2A 2CF6A 3NAMA 2BKXA 4JBIA 2QTGA 4LW8A 4E7PA 1PX2A 2O3RA 4M0EA 3D3EA 3I4FA 1JDPA 2FN8A 2DBQA 1I33A 3OO1A 4FR2A 2YZKA 5K3OA 1ZKDA 1H2RS 2EQBA 2ZR0A 4IDCA 4IIEA 1NDHA 4GDFA 3LCCA 1W48A 5AI0A 3V42A 4UTPA 1RRGA 3QY9A 3N0TA 4AYWA 1J90A 1D8TA 1U2PA 4IX1A 4A91A 4JHLA 5KTYA 1INLA 1VKJA 3B13B 1DO2A 2XMZA 2C07A 1D2GA 5K0NA 4EFKA 4CHGA 1QGUA 1Z3IX 2GN6A 3E7PA 4FEAA 3V1YA 1YBMA 4KQCA 1SUAA 1X19A 1SQGA 5AI9A 1RMTA 3IAHA 1YIOA 5DHRA 3SG0A 4XD7A 1QSGA 2XXAA 2FN9A 3H9CA 5EIXA 2NUPB 2BFNA 3A2KA 1CEYA 4S1PA 4XIGS 3GDWA 3BE5A 4IH1A 1I2AA 1U8CB 3TDKA 3FGZA 3UAVA 1GU0A 2BOVA 2HK7A 5K51A 3BZWA 3KYJB 3T9AA 3A11A 3DDNA 3FG9A 5H70A 4AIRA 1WU7A 1YJAA 1KKMA 1JDVA 5AI4A 4M8NE 2F7SA 4J0CA 2QE7A 2QUBA 2EARA 2G5CA 2ZI7A 2CFOA 4Z1OA 2WG0A 5L3SA 2ODWA 4YDRA 1ZIPA 2ZAYA 1LZLA 4N0PA 2FJUA 1YS4A 4DBZA 4HNRA 5A3SA 2VAMA 4DMFA 1DCFA 3UB2A 4PG5A 1ZA2A 2WWTA 4P7BA 3FPFA 1NR1A 2HF8A 3QVUA 4BLVA 4TRRA 4LOIA 4QQKA 4LEIA 5I4BA 3WLNA 1YNSA 1GA1A 2IDMA 3H5NA 2E3JA 4RF2A 4DSZA 3R8CA 4PGHA 4XCQA 4KTVE 1IIRA 1IM2A 1EDOA 2PJUA 1TO2E 1SXHA 3A6KA 4EL5A 1XQ1A 4NBRA 4M7OA 1MA0A 4NYMQ 3TUIC 1N78A 1GITA 1GGNA 1Z17A 2PVSA 5IFKA 2GCIA 4UHJA 1PR0A 2JLQA 5D3ZA 5DI9A 5EQJB 3ZEAA 3C8UA 3GZNB 3KEMA 4OIFA 3RANA 3T5BA 2IUYA 1DRJA 2B0CA 2W6JD 4UUNA 1AKYA 1ODSA 1VJ5A 2MYTA 2O8DA 4RHYA 3VJMA 2WF8A 2VKTA 4JJZA 4HB4A 2AK3A 2W2XA 4YRTA 1GAQA 5CB0A 4JVSB 3OU2A 1GWNA 1JJIA 3T34A 5G4LA 1G2QA 5F5NA 3PXBA 1UBKS 1F8YA 4DLUA 5T8KA 3RTGA 1H0KA 3NHPA 1QZUA 1P0PA 1E61A 3BWEA 2DFTA 4GM0A 1FY2A 3KRTA 1K5HA 4IUCS 4WVFA 1T3SA 1EZ1A 1PVVA 3D0RA 5T6BA 5IT0A 2FHSA 3BB3A 1FLNA 4F86A 3B53X 3QNMA 1V16A 3F5SA 2C2YA 1L5YA 3D1LA 4II2A 1F2VA 1UBMS 4UXJA 1GQ2A 2J9ZB 4CI9A 4D0RA 2DULA 2QRVB 3P9QA 4XUDA 4N76A 1LFAA 3VR4H 3WJ7A 5EHQA 3ZJUA 1FYFA 5ALSA 5CFRA 3ZLVA 4EL0A 5AI8A 5IDWA 3HVJA 1Y6RA 1YA8A 4F6CA 1LJLA 2WD8A 3CXRA 4MQBA 4YGYA 2JJYA 2PKQP 4L5AA 5L3SB 1ORDA 2VAVA 4B6EA 1RYNA 1MRSA 2OCAA 5FUWA 1SVWA 2Q27A 3AP1A 2Q4EA 3FIUA 3L77A 1W4ZA 2PRYA 1X3SA 2BKVA 5EE0A 3ESRA 5DEIA 2H65A 3T5MA 4K6FA 1WCXA 3SU8A 5CBPB 4HN2A 3LQKA 3SIPA 2O8BA 2M9MA 1APBA 1DMSA 3S5JA 4ZTUB 1U1DA 4MMXB 4F4JA 2OECA 1OX4B 2Q5OA 1LQTA 2HIMA 4E88A 1TZCA 2P9BA 3KTAA 2IW1A 3GEEA 4EJMA 1ULBA 3JD3A 1J8MF 4QTTB 3HH8A 3TOSA 3DYBA 4RPLA 2DBYA 2OLEA 5KWJA 1ZJ5A 2A59A 2X5NA 3DYVA 2WSYB 1SBNE 3NZEA 5K3FA 4KNWA 2JIDA 4CKWB 5FX2A 1JEQA 3L1JA 4MV6A 4XD7D 4AAYA 4JKIA 3A32A 2XNHA 4IQ0A 1IWBB 1GZ6A 3R0XA 3RVNA 1U2SA 3ZIAD 3PPYA 2NU6A 4PG6A 5ERYA 3UXEA 3P0HA 2OO7A 3HC7A 4LN1A 3ZZTA 2HBYA 2X0FA 5EPEA 2HH9A 5ETJA 5DULA 5EMNA 1A5TA 1P62B 1AQYA 1M73E 5L53A 2G72A 1KJZA 1EA5A 4N12A 5LZ2A 1NN5A 1Z39A 5HIKA 2ZYIA 2D5IA 2AC7A 2V9PA 1L5NA 5FI1B 4CIVA 5DM4A 1Y9ZA 1DRUA 1C0IA 1QYXA 3G68A 4U63A 4MMYB 2EGGA 4OHWA 3MG9A 4C20A 1E2HA 4UXIA 1QJ4A 4NV3A 2PMDA 3JV7A 4HZIA 1CR2A 5FBLB 5ERGB 2V4MA 4NJOA 5K20A 1SKBA 3KLPX 1IUOA 1Z5GA 1RCUA 2VTEA 2WG1A 2YQ5A 2YV4A 2SBTA 4D56A 1QP0A 2BI8A 2F8MA 2ZSIA 2NZYA 4WN9B 1FOEB 1KTVA 3KCNA 5LVAA 2VCEA 1JXOA 4CLOA 3KZVA 1VSUA 5AW5A 4JH0A 3UK0A 4A5OA 2QBYB 3H18A 2FR8A 1Q0PA 1PFYA 2XNCA 3DE7X 3RRYA 2UKDA 3OMLA 4A8JA 1PL0A 2N47A 3FBTA 3MSXA 3JVVA 4FKZA 4KVFA 4WNCA 5CT9A 5CVJA 3AY7A 3WNQA 2RCYA 5LA6B 4X3CA 5JASA 4HX5A 1FU8A 1GV0A 3DFKA 3VHQA 1RM3A 2GTHA 3E3LA 3MBOA 5I01A 4LJKA 4PYJA 2ZDHA 1TTQB 1QZZA 4X8LA 2EBHX 3AL3A 4LF9B 4J90A 1IZZA 1M2OA 1UJ5A 3I2GA 4OI2A 2DT8A 5EUMA 4EPTA 1IUNA 4WK0B 3HNPA 4RIGA 2B94A 4CODB 4F96A 3AETA 4ZK6A 3VJLA 4R0VA 4R51A 1CE8B 1LI4A 1PD0A 1V4BA 4CPDA 4TUYA 2IIVA 4DHEA 5C7OO 1FXSA 5CK5A 4BLTA 3T1TA 3LGSA 5DNYB 4W7IA 4E33A 1E63A 1GUAA 3I01A 3NDPA 4DWOA 1VLVA 1QMGA 3FYHA 2Z95A 4FHCA 4AXXA 4J43A 1KDRA 2CE7A 5HQJA 1Z74A 2FUNB 4L4YA 2I3DA 2VJNA 2ZUUA 3OLQA 2ZAOA 3V8QA 1BCSA 5AKXA 1BS9A 1L4BA 7MHTA 1CUZA 1CXZA 1KTIA 4KBGA 3W2TA 2P78A 1ZM4A 5JYCA 1XQXA 2WEKA 2FAXA 3F7MA 2HIHA 1KP9A 4D9NA 2XECA 3A1CA 4ZVTA 1T24A 2BJHA 4XOIA 1E3EA 3C3AA 3T7EA 4B46A 1NZJA 2DWCA 1UBUS 1IK4A 2W83A 3PNYA 1W2HA 5LDGA 3SS8A 3FCYA 5ADVA 4A6PA 3BMCA 3LQQA 3N8IA 2MWMA 2PV7A 1KQOA 3Q7TA 4JLKA 4CR7A 4RZQA 1C0PA 2IYQA 5IWCA 2EG5A 2REQB 4GM1A 3T4EA 3IQHX 2J6IA 3AIKA 4L6AA 4FHZA 3TI7A 1OB5A 4MRMA 2EATA 5T4FA 3O93A 3IOYA 4BV3A 2J41A 3FR8A 1QHHB 3N8DA 1DBIA 3EEFA 4IXNA 4NP6A 5FULA 3RSLA 3MJVA 3UT6A 5C7LO 2QBYA 5DM60 4D9JA 5LZ8A 4ZQEA 4FN4A 2H7VA 3M6XA 3EISA 4D26A 3DZKA 4MWBA 4QELA 3W2HA 4NX2A 1TMOA 2X7XA 3BRQA 4KZPA 4IHJB 3W2IA 1L6IA 2BMWA 3CE9A 4LK2A 3WLSA 3G8BA 3QXSA 3EHEA 4QXQA 3S28A 4ALNA 2WSIA 2V0NA 4RELA 4OCZA 5LOVA 2DLNA 5TVKA 3IQXA 3Q88A 5EJIA 4R1OA 5AICA 3URKA 2A1TS 2R1ZA 4YRJA 3KHKA 3KQTA 5U4QA 3UB4A 2BAGA 3KDAA 3GCWA 4E51A 1KK2A 2PUJA 3IP3A 3RJ5A 2ATXA 1VHDA 2D59A 2Z2ZA 2IKQA 3A10A 3L0CA 4X6LA 5TJHA 4OSEA 3DO6A 3LDUA 1JNYA 3A1UA 1XTRA 3LOUA 3B5IA 1AXEA 5BV7A 3B3JA 4HDSB 4XDYA 1TF2A 1N2XA 1NJ5A 1ES9A 4URWR 2ZYRA 1SB9A 1QVAA 2R6DA 4XIFA 2SCUB 4OFXA 5AW0A 1VP3A 4LGVA 3B6IA 1DRVA 3H2SA 4HLUA 4NAUA 2ZSFA 2EIHA 2IXDA 4K6GA 1BMQA 4JL5A 2C9YA 3LUBA 1M9NA 4CMEC 1JHAA 1Q6YA 1TADA 2OY0A 1JHZA 2AHRA 2C96A 3A1VA 3HDQA 3KXLA 1DCTA 1PNRA 4OJTA 2WJPA 4H6VA 2JCSA 3HBAA 4HBGA 1X80B 5CM8B 4UHCA 3UAWA 1I14A 4EHKA 5B1IA 2NACA 1VJCA 2PDAA 3C8MA 5BT9A 1K66A 1VDMA 2OKGA 2WVHA 3FZYA 1YUNA 1GPYA 2ZVJA 2GCEA 3L49A 1E8MA 3A1TA 1N9ZA 1J09A 2W11A 5G3YA 2Y77A 4L74A 4D42A 1BW9B 3UW1A 3OPXA 4TL8A 1VHLA 2PZMA 3BJMA 1NMYA 1O97D 4I5FA 1SCIA 3EEIA 1HYHA 1F2DA 5C4GB 2NOAA 4TXHA 4DARA 5A62A 1QQAA 2ZJ3A 3ZK7A 3W06A 3QPCA 3B5EA 3KLOA 5COAA 1G0NA 3IAM1 4BNVA 5D87A 4OTZA 3MJFA 1BVHA 1AGRA 4QTUB 1UWVA 1DIHA 1JMYA 5T3UA 3CLVA 4UJ3A 3QJYA 3BJEA 1M0TA 4K9OA 3FOAA 4EY5A 2J3KA 4RA9B 1PG0A 2MDTA 2AE2A 1G9TA 1UFVA 4REQA 5TC4A 5TSDA 4LHYA 2QX7A 1WB9A 1R6VA 1H05A 4EYOA 3OIGA 2EJVA 3W79A 1RZRD 1QO0A 4JI7B 4ZCQA 4XGRA 2ZLBA 1J1ZA 5B6JA 2QORA 3ONFA 3DTVA 1VE9A 2XUGA 3D7MA 3W3AH 1IRIA 4Q47A 4AUEA 1M6EX 3WYNA 4CLXA 4XRGA 3SYMA 2O8FB 5G0TA 1QFJA 2BT4A 2OQVA 4L0MA 4JVMA 1QGDA 3E1GA 4X1YB 3RKSA 3G3EA 3SPXA 1E66A 4CCSA 4DV5B 2NZUG 3JAWA 1MV8A 2YNMD 4GL4A 1P5RA 1E4YA 3LOQA 4L5BA 4MS3B 4PRYA 1EP2B 5F9FA 1PG2A 2HEGA 1JWBB 1DAOA 1JJVA 3EWSA 4G41A 5E6UA 3OQMA 4PHFA 1UKVY 3R5KA 2KM1A 1CY6A 3OPVA 5E7JA 1UDAA 3AY0A 1IZ9A 1V7PC 1MKYA 3I1IA 2O5RA 3JASB 4TM7A 4FI3F 2C4TA 3LNTA 1KOLA 5IBPA 4PQGA 2PQMA 2IT1A 4QM6A 1OX5A 2YJTD 2P91A 3G23A 4IILA 1YFJA 1IM5A 1U0TA 4FB5A 1L7QA 1Y1KE 3PGA1 3DOEA 4GYJA 1KA9H 4LJ4A 4LE2A 4AUMA 4C5CA 2C7RA 4R5MA 3D5QA 3AL2A 2RHOA 3ENQA 3EVAA 1E2UA 1BYUA 3PEEA 4NKRA 5JHHB 1H2HA 3AR5A 1VLMA 4Y9RA 2Q3CA 2XCLA 1E1RA 1SWWA 3I83A 3OURA 1UZMA 4J0EA 4JC5A 4Q3AA 4R2JA 1HZZC 4XZ3A 3T0FA 1IWOA 4YNBA 2E4WA 2VNSA 5DM2A 3G9TA 2WWXA 1IEQA 3K09A 3SXPA 3K9HA 3T5TA 3RV3A 2HZ7A 2V59A 3VBEA 3ZE6A 4CUZA 2QR5A 4BJ6A 1KC3A 2Y99A 3PK0A 3PRKE 5JAQA 1VM6A 1UDXA 3W7AA 2VJQA 5IXYA 3UB3A 3KKPA 4K1LA 3T4XA 1H42A 2VK1A 4XWWA 5EGNA 1UDWA 1Z2NX 3DT8A 4J16A 1I94B 5M5BA 1O89A 3FFTA 1BX0A 4QLAA 5HZKA 1KYVA 2IIBA 2O8VA 5REQB 5B7QA 2CV1A 3H9BA 421PA 5BR1A 4EYQA 1WRBA 4GF5A 4UHFA 1ILEA 1K8RA 1GGEA 3LWBA 5CIQA 4HN4B 1LC3A 2Y1DA 9GPBA 2XB6A 4KOAA 4CLHA 3MBIA 4LRXA 3WICA 1Z6GA 1AK1A 3B1XA 3HBJA 3IVRA 3PEFA 1OWOA 1MIHA 1WQ3A 2OCBA 2Q45A 5BYBA 2YY6A 4FOSA 2GRAA 1TPYA 3H1BA 4YP0A 1DXHA 4PY2A 1FS5A 5LYJB 1PEAA 3DAOA 2YKGA 1SD5A 1Q7BA 2QM8A 4ZD6A 2Z30A 1DSSG 2OYSA 3NVKI 4RTOA 2O1XA 3ZE9A 4MAFA 2BR4A 2H2WA 4LMBA 3TSOA 2Z6AA 5CNMA 3VU9B 1TYEB 4MUYA 4NAHA 3QU4A 1FCJA 4I2NA 4RXTA 1XIVA 5FCDA 2PQ0A 3LYAA 2GF2A 4WD3A 2GGSA 4NFSA 1OX4A 1RSZA 4P32A 1DWOA 5E1OA 2PCJA 3IODA 4D9MA 1U9JA 3L8EA 1FMJA 3D1JA 2NUPA 2Q2NA 4CF3A 5KJCA 3D6TB 3AB7A 3DBIA 4X97A 4LDNA 2W2QA 2AF4C 1R74A 1ZIDA 4GXRA 2BY4A 1C8LA 3G0IA 4R6WA 1WZCA 3V8NA 4D46A 1LTQA 1R0SA 5DDIP 2HV9A 1WSBA 1NMQA 3D7SA 3HWWA 4MI1A 3GT7A 4OJYA 4CLOB 2XZTA 2EZ8A 3OQHA 1OUMA 2Y0EA 1JRLA 3PQCA 4WAUA 1OWLA 2QN1A 5HBRA 4F9TA 1LRJA 2M1XA 2A7QA 4EX6A 1WP9A 2H5IA 2O7VA 3EUFA 4LKRA 3AFGA 2XXBA 4U2CA 2CMHA 3LXXA 4IFBA 1GRQA 2BRUC 1NIJA 2OC9A 2PVCA 3WGGA 5BP7A 1HI9A 3L6DA 1Z7WA 2ZBEA 4HTAA 4UCWA 4OGGA 3DEZA 1JMKC 2F90A 5DTMA 1CIJA 2OHVA 1R8QA 5TEVA 4MKFA 3K0AB 1GSHA 1K98A 1LLDA 3HXKA 4EZIA 5BOSB 1IY1A 1U28C 1I1OA 3C5EA 3M6LA 2O23A 3ADPA 1HURA 2HREA 3GT4A 1J20A 4JUFA 3A4VA 5CNIA 5JSFA 3GBVA 2C5HA 3QE9Y 3DS8A 5F3DA 5A9TA 1G8HA 1BA2A 2YVUA 3OCCA 3G0GA 5CHEA 4WJKB 3AF4A 1QH1B 5FLKA 2IEAA 4BYMA 3OLCX 1K08A 2BR3A 1JLLA 2VT7A 3BHMA 3ZS8A 3QG5A 1XQYA 1SKYB 4TYNA 3RRFA 3CLRD 3CJRA 3OBIA 1SWVA 1X39A 2XUDA 1OLXA 3PF9A 4CM6A 1ESNA 3UENA 2XMQA 1DEHA 1C7IA 1QO7A 3PIIA 3PTAA 3WK5A 2N46A 3MJDA 2W6JA 1PUIA 1ZFNA 3ZCUA 1J22A 3W5DA 4RSHA 3CF4A 2IYUA 2QPTA 5T4BA 4NZNA 3NEYA 3D6VA 1CR4A 3MUOA 4RQTA 4WY5A 2EGUA 4GECA 4ZI7B 5ED4A 2NTJA 5DV9A 1MQSA 1LBIA 4QJ3A 1Y5IA 2FE1A 3GD5A 5KOIA 1UEXC 3C3XA 4XCVA 4KPYA 4O1IA 3IPRA 1XTQA 2IRWA 2JJMA 2RBKA 4HZUA 3HSKA 1EE1A 2G1PA 4QEDA 1W7AA 4C89A 5ALEA 1J5EB 1A5ZA 4QO7A 3IURA 1U8AA 4Z49A 3VVBA 3C45A 1MG5A 3BK7A 4RE6A 1X7ZB 2ZPUA 3S2FA 1AF4A 1TYBE 4F21A 4NYMR 2REBA 3RAJA 2Q5CA 3TINA 4UTVA 2PXAA 3BBLA 3QBEA 4JLAA 5I7HA 4WVLA 2KBFA 4M8SA 2HHLA 3ODGA 1QGUB 2HBZA 3ANYB 4G67A 3O9MA 2O2DA 2CLEB 4RW0A 2AFIB 3SE7A 1M0WA 1PT8A 1JHDA 1X1CA 2FW8A 5E95A 3H99A 1P91A 1F2TA 1Y82A 1H1TA 5CDFA 3AVVA 5EMJA 2XCQA 1CP2A 2R7AA 1JHRA 5K0EA 1GU7A 1W5AA 2AT1A 2Y1WA 5F33A 1NW4A 5EIBD 1PLJA 1G8FA 2Y27A 3QV1A 4RPIA 4ALLA 5KYYA 4YV7A 3DE3X 1BN6A 1Y8AA 2A92A 4TV8F 5NLLA 2OCKA 2XMRA 5CJPA 2C5FA 3EZNA 1SUBA 3PHIA 8AT1A 1SXJE 3ENWA 4DCPA 1GG2A 2QMYA 4L73A 1QKIA 3IP8A 3C3WA 4BZQA 4R68A 2ID8A 2ISSD 3CSSA 2QRHA 3O2SB 4S1WA 1JLKA 2XXAB 3VX3A 1AD2A 2CHEA 2W6NA 5AUOB 1UK8A 2LDXA 3ICPA 2ASVA 3QPAA 3IHWA 3C0KA 1N2GA 2C4UA 4LZZA 4YBZA 1UUFA 3BHIA 2WYVA 5FOSA 4EG5A 1TUBB 1NWCA 4HV4A 2D5BA 2GBCA 4Y9UA 4R0MA 5C8DA 2HRRA 4CMIB 1F5NA 4QNNA 3E2MA 3HVIA 3H5TA 4I2VA 5LLSA 3HDTA 3FZGA 2XYQA 4X65B 5C7IO 5AVSA 3EMBA 1OKKD 1U2DA 3RFXA