2B69A

Crystal structure of human udp-glucoronic acid decarboxylase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
312
Chain Sequence
RKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucuronate decarboxylase 1
publication title Crystal Structure of Human UDP-glucoronic acid decarboxylase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 101
structure length 312
sequence length 312
ec nomenclature ec 4.1.1.35: UDP-glucuronate decarboxylase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2b69A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2b69A02
1B3RA 4CMEA 4IIVA 1MXHA 1H6BA 2DPGA 4RZIA 4YDRA 4CMAA 1OC2A 5DF1A 3MOGA 4KTTE 4OO3A 1GPJA 1SEVA 1FDVA 3KV3O 4JBGA 3OQ1A 4YAKA 5ER9A 3VVBA 2YDYA 2D0IA 1RM0A 1H9AA 2O7QA 4JJGA 4XGIA 4NIMA 2A9FA 2JCXA 1UXHA 4ALIA 2EERA 1EVYA 1Q7BA 1BW9B 1NBOA 1V3UA 2QYTA 2HQ1A 1NX6A 2JCVA 2EWMA 2HKIA 3KLMX 3BTVA 1HDXA 2G82A 3WB9A 2NU9A 4M1QA 1ENZA 4FJ1A 2B0JA 4NJMA 2FN7A 4FQ8A 2Y99A 5AXBA 3OIGA 5BNFA 1DFIA 3EZLA 5AXCA 4MP3A 3TZ6A 3L9XA 1OAAA 3GQVA 3QLJA 2J5QA 3OQBA 2D5CA 1K6XA 3WMWA 1C0PA 3A14A 4J7XA 5DBGA 4HV4A 2XOXA 3WLFA 2CFCA 5CP8A 4DUPA 1RM4A 4E4YA 3PDJA 3SLKA 2YFQA 4BOYA 2CY0A 1JKIA 4FN4A 1N2SA 1XA0A 5G0VA 4Q39A 1E6UA 4ZQEA 4IY1A 2VOJA 1DXYA 3KVOA 5G0SA 4Q9NA 3VC7A 4I9NA 2Y1DA 4BGIA 2VWHA 3PHJA 1UUFA 2DM6A 2YHIA 3RKUA 1MG0A 1OFGA 3DBVO 3WGGA 3GHHA 1JWAB 1LDEA 3E9QA 2GRAA 3PI7A 4WLVA 4DLAA 7MDHA 3KB6A 4S3MA 3L0DA 3AI3A 3UVEA 5K6AC 4XQEA 2RH8A 4R69A 2VYNA 2GZ2A 2C2XA 1KEWA 3TPCA 4MVJD 1E7YA 3KLPX 1EFKA 1YRLA 1LRKA 3TJRA 1FDTA 1GU7A 4TSKA 4FSHA 2OUIA 2O7SA 4OKIA 5HRUA 3WIEA 1CWUA 3QSGA 3VKUA 4D7AA 3K92A 3VHRA 2CF6A 3CIFA 5I9NA 1ZZEA 2D59A 1LA2A 4WLNA 4RF3A 4MOWA 4KQWA 3HE3A 4RF2A 4CM9D 3B70A 3K31A 2CDBA 3TFOA 3EYWA 3IOYA 4GH5A 3ROKA 3DZGA 1KVRA 4YBZA 5JW6A 3C8MA 1UZNA 1MGOA 1HE4A 5KVQA 2DTDA 1QYXA 4BQPA 1I30A 3D3WB 3VH4A 1EVJA 2EG9A 3WGQA 3GF4A 3PGJA 1YH3A 1Z6ZA 2JD0A 1G6KA 4XYLA 5A05A 3O9ZA 2P9EA 3E82A 2Q4BA 1P9LA 1B15A 4OSPA 5FFFA 1QLJA 4PG7A 4BO5A 5K9ZA 3R3JA 3JQ7A 4BKRA 1T2FA 1HRDA 1M66A 4N5LA 3WGYA 3A28A 2AXQA 3JCZA 4B8WA 1NFRA 4PRKA 1YBVA 2GO1A 4RL6A 4M87A 3BYZA 3WICA 3ZW9A 4EEZA 4DMMA 3WX0A 3M6IA 1E1LA 2NTNA 2AE2A 1PGJA 5GMOA 1PZGA 1EQ2A 1Y1PA 4FOSA 3EZYA 4F6CA 2SCUA 1LRLA 1U2GA 5IF3A 1E7WA 1PGQA 5JBIA 1W4ZA 2GPTA 4Y6RA 5JY1A 1EK6A 1HE2A 4BNGA 4LVUA 1ZXBA 4J2HA 1A4UA 4UVHA 3V2UA 1DHTA 4OIMA 3TFQA 2FHSA 1BDMA 4BB5A 2VHWA 3A06A 5AOVA 3PHIA 4K26A 5DBIA 3OH8A 4E21A 5G0UA 1DFHA 3VAZA 4NDNE 4TWRA 4RV9A 4WEQA 3FRJA 4M55A 5JCJA 4JK3A 4DRYA 4WECA 1MV8A 3QHAA 1JDJA 5B4VA 3W4KA 3QIVA 4CM1A 4MDHA 2GR9A 5THQA 4Z6KA 2IYPA 3KUXA 4GI2A 3LLSA 3WYCA 3VDRA 4BNNA 2DFVA 4E33A 1GR0A 4KOAA 4D44A 4R9SA 3S2FA 1DJQA 4IS3A 3PPIA 3X2EA 3PJDA 1ONOA 4W9NA 4CMJA 3B1KA 1E7QA 2JHGA 4N7RA 1XSEA 3MEQA 4L4SA 3WJ7A 4AJIA 1I0ZA 4WGGA 5IXYA 1JVSA 4NBRA 4BQRA 2ZJ1A 4J1QA 1ZK3A 4QFDA 2EXXA 2H63A 3O03A 1B8VA 4YJGA 1LDBA 3X2FA 1O9BA 2PWZA 3F5SA 3WQQA 1HE3A 1N1EA 1NVMB 3RQSA 5ICSA 1DC5A 2XF8A 3DR3A 4WLOA 2ZQYA 4R1NA 3KZVA 2OP1A 3U0BA 4P4NA 5KVVA 3QY9A 3FR8A 1A7AA 3KSZO 1CETA 4FC6A 3OQ6A 1KOLA 2X7HA 1YDEA 3AU8A 1H6DA 1T24A 3I9LA 3INGA 5BSHA 2ZCUA 3OIFA 2EHDA 2W98A 4J4TA 3EY4A 3ENNA 1H6CA 2J3HA 4BGEA 2HLPA 4NJMB 3I3OA 4TKLA 2BELA 3NT4A 1JKFA 1EVIA 3QWBA 2O50A 3NTOA 3G49A 3RBVA 3QW2A 3TSCA 4D45A 3W4IA 2GUGA 1QXSA 4OXYA 3NGLA 1FMCA 4LCJA 3U4HA 2O2SA 4B3HA 2RH4A 3BAZA 2UAGA 3E18A 5L3ZA 3HQ4O 4ZD6A 1IUKA 3FTNA 1VKOA 2Q2QA 3ZWWA 4RGBA 5CPFA 2FP4A 8LDHA 2X9NA 1HDCA 1PU2A 4DWVA 2IYOA 3GRKA 1S7CA 3OJ0A 4KTVE 3VZQA 1T4DA 1QP8A 1P1RA 4H16A 4R1TA 3I5MA 3LF2A 4MINA 1GUZA 1F12A 4Q3BA 3RBXA 1PL6A 3PHHA 3ZWOA 5JC8A 1Z73A 4CQMA 1TT5A 1Y5RA 3M2TA 2A94A 1T1SA 3DBLB 4Z0PA 3RUHA 3JQ9C 1N7HA 3IP1A 3GH3A 2IZZA 3QV1A 1YQGA 4PG8A 5KJ1A 1NXQA 1D1SA 1NP3A 2HCTA 3HG7A 5DOVA 2Q99A 3WNVA 4Q3CA 1WPQA 2J3JA 1GL3A 3DAGA 3U5TA 3U09A 5A9SB 4CMBA 1LEHA 2NVUB 1LTHR 1ZO8A 4KQXA 4M49A 4W7IA 4Z0TA 3VDQA 3LT2A 4YXFA 5IZCC 4UEJA 4D43A 2VOEA 1X0XA 4ALKA 1BRMA 2GD1O 3FNGA 3SEFA 3BXXA 1L1FA 1H0KA 2CD9A 2VTEA 2YY7A 4YR9A 2P5YA 3CEAA 2EV9A 5TLSA 2GN4A 1KVQA 4BVAA 1ZEJA 3OSUA 1FJHA 1BXKA 1U2DA 3EAGA 4LCEA 2HRZA 3PJGA 3V2GA 3TF5A 3TRIA 3DHYA 4J0EA 3NYWA 1U7HA 3DZHA 1LBEA 2V65A 4QT0A 3PEFA 1ADFA 4Z3DA 2X9VA 2W8ZA 3RVDA 3PWKA 3JQBA 1RPNA 1JN0A 2E6UX 1PS9A 5L7YA 1ENPA 4ROSA 4RVDA 5TF4A 5TX7A 2ZK7A 3U9LA 3KSUA 1ZH8A 2VNAA 3EVNA 3OJEA 3K5PA 1LQUA 2GGSA 3G1TA 5COAA 3UH1A 2X0RA 1WXDA 2EF1A 2VRCA 3L4BA 4TVBA 4WLEA 5JMPA 4MKRA 2EW2A 2X5OA 3AM5A 4PGFA 3U49A 1ORRA 3CUKA 3H8VA 3OJFA 5JAMA 4MKXA 1ZW1A 1B3BA 1J49A 4IDBA 5EPOA 5H81A 3FTPA 1DEHA 2JFHA 3GRPA 1ENYA 1U3WA 2DBZA 2FWMX 3DEYX 3GUYA 3ZNNA 3E6AA 4WK6A 5C7LO 1KS9A 2R6JA 3OHSX 1ULSA 3ZHXA 2NQTA 4LMRA 1WLYA 1NTOA 4XB1A 4FD3A 4UVDA 1CEQA 4OJNA 5EERA 2P2SA 2O3RA 3GN1A 5BT9A 2BFOA 3WGTA 1LQTA 2Y05A 4TQGA 4XJTA 1M75A 3OEWA 2POQX 4PG4A 1DFGA 1GYRA 4U0JA 5A5EA 3PXXA 3GUCA 3JYNA 3HDQA 1PR3A 1SZJG 4WNIA 2Z1NA 3QRWA 3UGKA 4F46A 4OAQA 4OYRA 5H83A 4MVJI 1GQQA 2J5RA 5JE8A 2ZB4A 2ILTA 3UICA 3DZJA 4RPHA 3DO5A 5A06A 3FBGA 1JVBA 3GPDG 4PG6A 3WTCA 3WYEA 4YT4A 4QUKA 4R3NA 3TWOA 5JDCA 4RDHA 1X7GA 2AG5A 4FFOA 2X23A 1UDAA 1P0CA 2FR8A 3H9QA 5DCWA 3KTDA 1PZFA 2HK8A 2XXJA 2Y67A 1E3EA 2E4AA 1AXGA 1UXJA 4GX2A 4H15A 2WWRA 1ISGA 2EP5A 3I83A 5T5QA 4FOOA 4XD2A 4RF4A 2XXBA 1GYPA 1CERA 4WCFC 1TB4A 5IN5A 3B1FA 3S55A 1ZIDA 3PIIA 1WMBA 3ULKA 3ZHYA 3G1UA 4A7PA 5LDHA 1C1DA 3Q6IA 1J0XO 1MB4A 3W8DA 4GMFA 2EKQA 3FCOA 3DZKA 1LSSA 3R0IA 4XKJA 3WYBA 1SOWA 5JS6A 4E2YA 5A02A 1GY8A 5BNIA 1VJTA 4TZTA 5EQDA 2B37A 4J4HA 3E9MA 3UCFA 2D5AA 3OECA 1Y8QB 1IZ9A 1ZK4A 3FNHA 1Z82A 1DJNA 4MPDA 2OFPA 1B0AA 5F1OA 2A35A 5HWSA 3D4NA 5AXDA 4YRAA 1HDZA 1ZSVA 2AQ8A 3MTJA 4IDAA 4GGOA 4NBVA 1QYWA 4BV9A 5L7WA 3KEQA 2ZYDA 3EC7A 4CMIB 2CVZA 1OZAA 4FFPA 1Q0LA 2IXBA 1ISFA 1WZIA 3GEDA 2NQ8A 3RU9A 4J9VA 5JAIA 4Y8VA 4GMGA 1YONA 1IY8A 5JO0A 2VYVA 2GN9A 5A1TA 3BTUA 3WBBA 3WXBA 4E2WA 3RAJA 1RJWA 1UAYA 3ZHBA 1ZSNA 2DC1A 1TT5B 2IDZA 4Z9YA 1DIBA 1KYQA 1PJ2A 3C3XA 1I5RA 4GSKA 4WJZA 4LVCA 5AVOA 1BTOA 3NV9A 3O38A 3D64A 3UAGA 4KZPA 4BMVA 1RM3A 5TNXA 1UDCA 3PFFA 3TZQA 3WGZA 5COBA 5DBFA 3GK3A 2H1SA 1H2HA 2BH9A 2PH5A 4B4UA 2I3GA 4P4LA 1CQIA 1MG5A 4DIOA 1YKFA 4OXNA 1X1TA 1NFQA 2AEFA 3OEYA 3DXFA 1P44A 3PJFA 4JROA 4HUJA 3ZI0A 3I4FA 5LDGA 4BNLA 3DOCA 2F00A 4PLCA 1PSDA 1T2DA 4RQTA 1Z75A 3CE6A 3TOZA 3JQAB 1JU9A 1NAIA 3S1LA 1Q2XA 3ADOA 1KVUA 4Y9DA 4DPMA 2IXAA 4L4RA 1K0UA 4JBIA 5JDCC 1U1IA 3V1TC 4XGNA 3ASVA 4W7HA 2YYYA 3UW3A 5DN9A 2DUWA 1NQ5A 2X8LA 4FGWA 1EE9A 2YV2A 4NFYA 2PGDA 2OO5A 4IDGA 3PLNA 2WSBA 2VHXA 4XJSA 1VRWA 3ZZNA 1DLJA 5KIAA 4Z9XA 3ZU2A 1ISHA 3B1JA 4Y67A 1MA0A 4YJFA 2Y1EA 4ND5A 2YW9A 4MIOA 4L73A 3N74A 4J16A 1Q7CA 1VL6A 4TZKA 2RBEA 3TNLA 2OZPA 4TRNA 4OOFA 5JXWA 1R4MA 1YB4A 4ZRNA 2YZ7A 2X0NA 1V6AA 3JQFC 2QIOA 4UEOA 2HK9A 3D7LA 3MJCA 3ONFA 4RQUA 1UJMA 1HDRA 5DP2A 1BVRA 4A73A 3LC7O 4N5MA 5A5FA 4MO2A 4Y6SA 4JXKA 2BI7A 1I3MA 3NGXA 2X5JO 6LDHA 1HDGO 3QVSA 1B26A 5KWEA 4LRSB 1N8KA 2QQ5A 3LC1O 1HE5A 1WDMA 5CPBA 2NADA 1SMKA 3AFNA 2I99A 4W99A 2WE8A 1NWHA 3GZNB 3ZH2A 1R16A 1U9JA 2AA3A 2YV1A 1DIHA 3H65A 4ND2A 3BMOA 4XB2A 3ZW8A 2AW5A 1W6UA 4D42A 2OHXA 4AJPA 4BNHA 5TS3A 3CINA 5TT0A 1A5ZA 4E5YA 3AK4A 4NJOA 5L7TA 1HL3A 3GFGA 3Q9UA 3W6ZA 1QKIA 4B4VA 5ER6A 3D0OA 4BKOA 4CLXA 3ANLA 4DBZA 3JQ8A 2PGJA 4EITA 2DAPA 3IMFA 3O8QA 1PJ4A 3JQAD 4NU6A 2C5AA 1R4NB 2BHLA 3IP3A 2VHYA 4ZA2A 1YWGO 3SLGA 1NPYA 2GDZA 2Q50A 3AUTA 4MVJG 3WJAA 3AY3A 3RKRA 4ITUA 4WLUA 4KDEA 4CR8A 4NFSA 1QYDA 2Y1GA 1GV0A 4A10A 4ND4A 5T64A 4GVXA 3JQGA 3FHLA 3OFSA 2X58A 5ENVA 3KYBA 4AJHA 1LLQA 2YUTA 1Y7TA 3G79A 5DT9A 3GT0A 1EEHA 3MOIA 5I8ZA 5LC1A 4E2ZA 1LJ8A 4DA9A 4CR6A 1T2EA 4TVOA 5FYDA 3BMQA 4R54A 4F6LA 1O95A 1A4IA 1HDOA 2HMUA 3DONA 3IJRA 1VM6A 2AHRA 1ZEMA 1C1DB 4AJ4A 4CM4A 2JCYA 4Y98A 2FPPA 4X54A 5C37A 4B3JA 3QVWA 2BF7A 3JQ6A 5TJHA 4J3FA 1IYZA 3RROA 3TOXA 3CPSA 2GLXA 2VZ0A 2G1UA 2HMVA 1XGKA 4AG3A 1ULUA 3W1VA 4EI2A 2C7VA 4D3SA 2QW8A 4YJDA 1CDOA 1MUUA 2LDXA 1KC3A 2BKAA 3F1KA 3BA1A 5CEFA 1LSUA 2D3TA 4UVEA 1L7EA 2HJRA 3HFSA 5A9TA 3T4EA 3OMLA 4PLVA 1XQ6A 3ZV6A 3D3EA 2UVDA 1ISIA 2O4CA 3D1LA 3CMMA 3JTMA 4I9UA 4PLTA 2X0IA 1QV6A 2AQHA 1DLIA 1I32A 1I33A 5BQFA 1NNUA 3UXYA 5THKA 1EDOA 4I5EA 5C7OO 3NT2A 2BGLA 3MJEA 4HY3A 2RAFA 4DLLA 2JD2A 4HWKA 4BHTA 1MLDA 2EGGA 2X5KO 4EUFA 3QWFA 1E3JA 5IXSA 2P68A 1E3WA 5KNLA 1X1EA 2QRKA 1KEVA 2WD7B 3NTQA 3IKVA 5DULA 4HADA 4E2XA 4S1VA 3C1AA 2ZTUA 3SC6A 1LSOA 3GAFA 3GVHA 5KKCA 5L45A 1XELA 4FFNA 5HTOA 4LW8A 1VJ1A 4DQVA 2ZKLA 2HJSA 3VTFA 1MP0A 1OBFO 4E6PA 4G81A 4DYVA 1V3TA 1I2BA 1I3NA 3WFIA 4BO6A 5ITWA 3ZHZA 4F3YA 2HUNA 3CXRA 4NBWA 1PJTA 3MJSA 4IQ8A 5U4QA 4RCVA 2O3UA 4R5MA 2C82A 1DOHA 1LNQA 3M2PA 1GQ2A 1U5AA 1Z45A 2Y0CA 3AUAA 4ILKA 4EUEA 5C7IO 4RVSA 1LRJA 2FY8A 4E12A 5IFLA 2CDCA 1AE1A 3DZFA 4NBUA 4BNKA 1YGYA 2DTXA 2FPGA 2DBVO 2E48A 1JQBA 2RHRA 1HEUA 5ICMA 1O94A 4YQYA 1JA9A 1GEEA 3UKOA 4B4OA 4D0SA 1E1MA 4YJFB 1LUAA 2Y93A 4UUPA 3N7UA 3VZRA 1EUZA 1D3AA 1N92A 4QO8A 4OHUA 5T67A 4AJNA 2C54A 4PLGA 2UYYA 4CLOA 1R4MB 4J90A 1ZJZA 3I9JA 3B20A 4AJEA 4HFRA 2YQ4A 4NI5A 1PZEA 4CLEA 1DC4A 1YQXA 4FC7A 1TT7A 4PZCA 4EZBA 2AQKA 3WFJA 1MC5A 3JD2A 1BWSA 3FNEA 1ZK2A 3EK2A 1VL0A 4AL4A 2JJYA 3ETDA 3IC5A 4B3IA 4NK5A 1AXEA 1UP4A 2NSDA 3LF1A 1P1KA 1VLLA 1LLUA 4IIUA 4MIEA 4IZIA 5TJ9A 2GNAA 1ZKMA 2ET6A 4DYDA 1HYGA 2DKNA 5KCZA 1G0NA 1U8XX 3FI9A 4CL3A 3FWNA 4FCCA 1E92A 2VHVA 1K2WA 2EW8A 1YL6A 4D0RA 4U8GA 4PLPA 4D41A 1Y6JA 3VPHA 1PJQA 1YL5A 4I1IA 3O8QB 3TDKA 5JO9A 2JD1A 4OL9A 4OH1A 1YE3A 3QVTA 4W6ZA 2VWQA 5BSGA 4CR7A 4DREA 4IZHA 2NVWA 1C14A 4CL8A 3AOGA 3JQ9A 1PGNA 4NMHA 1LC3A 4XGKA 4P38A 1AUPA 4QEDA 1YVEI 4NH4A 4AICA 5AXAA 4MVJF 3HUDA 1CRWG 2FSSA 3IKTA 1Y5MA 3D5QA 5GZ1A 1HSOA 1MFPA 2D8AA 4MKZA 1MC4A 1P1HA 1R15A 3JQEA 2NVBA 5IZCA 4CM4B 4C4OA 1GCUA 1V35A 4GAEA 4PVDA 2PKRA 4ZVVA 1EBUA 1BXGB 3ROPA 3VH2A 4HFJA 5ITVA 3H9JA 1NPDA 3JQCA 2EKPA 4BNJA 3C7DB 3PRJA 4XX0A 1R12A 4XQCA 4AJLA 3WSVA 4OQZA 4CM7A 4KP7A 3MJTA 1V0JA 3DL2A 3PQEA 3RCBA 3ZN2A 4RO0A 4E13A 3WQSB 3KM0A 4IDEA 3E03A 3TZHA 5AYVA 4ZQHA 3KYCA 3PZRA 3ZCXA 1HKUA 4QO7A 5G4KA 2PZKA 2W2LD 3M1AA 1QLHA 3QQPA 1OC4A 5L4LA 2PZLA 4CMHA 2PNFA 5GY7A 1DPGA 4LK3A 4C7JA 1TXGA 5ES3A 4BNFA 3NDIA 3RFXA 3WGHA 5KKAA 1NYTA 4BKUA 5F5LA 4XEHA 4OXKA 4CPDA 1SEPA 2YHUA 5G0TA 1H93A 2CMDA 4IINA 3U62A 4CQLA 4BKPA 2WM3A 2FZEA 2E82A 1V3VA 1YBAA 4II3A 4IDCA 4NHEA 3I1JA 4TMFA 5JCXA 4NNJA 3MJ4A 1XEAA 1E3WB 2Q1UA 2QZZA 3GG2A 2C7GA 1LI4A 3NTRA 4PLHA 1VC2A 4GGPA 1YOVA 2B83A 1EE2A 3FR7A 3GFBA 1IZ0A 4O63O 4OMUA 1M2WA 4GBJA 5COQA 4CMGA 1I3LA 3EVTA 1M67A 1ZXLA 1FXSA 2R2GA 1SO8A 3NEPX 3ZWYA 3DB2A 1JLLA 3ZU3A 4FFLA 1WVGA 2QG4A 4DQXA 3A1NA 4IXWA 3JSAA 5T57A 1J4AA 2YHIB 4R51A 1A27A 1EZ4A 1ENOA 2P91A 4LSMA 4YB8A 3AOEC 3RUAA 4WASA 4E32A 4M8SA 1QR6A 2NACA 1B16A 1VSUA 2NTVA 4IMRA 4JCOA 5EN4A 3FD8A 1EFLA 4TRRA 3GA0A 5IAAA 4A26A 1P0FA 1U3VA 3LYLA 3W8FA 2C0CA 4UVGA 3I9NA 4J1TA 1UZLA 3JD3A 4PLZA 2VTDA 5EJ2A 4A2CA 1KVTA 2Q2WA 2WYWA 1P1IA 4I9HA 1B2LA 1RM5A 2PZMA 2I9PA 3DDNA 3FN4A 4G2NA 4BNZA 4B7UA 5L51A 3GGPA 3HB5X 3ITKA 4WCFA 2VUUA 3GNQA 2X86A 3QVXA 2FPIA 2OGUA 2OOSA 1LC0A 2UV8A 3DBHA 3JYQA 3H5RA 4R1UA 2WYVA 3PIDA 3QWHA 3ADPA 4ALLA 4DLBA 3W8EA 3QVOA 3L77A 1AHIA 3ABIA 1CYDA 3ICCA 5KOIA 1EMDA 2TMGA 2OMEA 4L74A 5CEJA 5G2OA 5L95A 3AI2A 4J43A 3K73O 3R6DA 4E0BA 3ANMA 3BMNA 2PD3A 1L7DA 3JQ7B 1RWBA 5KJFA 5KJ6A 2I5PO 1UXIA 5F21A 2HU2A 4J49A 3RUDA 1NQAO 2ZJ0A 1TLTA 4E5PA 2LDBA 2NV6A 1K3TA 2ZB3A 1I10A 1Y8RA 2P9GA 3SVTA 1A72A 3SXPA 3AW9A 4BO8A 1YJQA 1BVUA 2D4AA 1A7KA 3UCEA 1ZK0A 3NX4A 3VZPA 4BGUA 2CDAA 1SNYA 1C3VA 4CMKA 4RLSA 2DQ4A 4JX8A 5GZ6A 4WEOA 4CM8A 4TRJA 3PYXA 5A04A 1FDUA 3U4CA 5A4DA 1OI7A 4B7XA 4B79A 1Y9EA 3WOHA 2HMWA 1UH5A 2VYND 5HM8A 4YAGA 1DBVO 3U3XA 3NJ4A 4ONEA 1T2AA 4F45A 4N18A 4IMPA 2GZ3A 4II2A 1IULA 4MVJM 4E5KA 3ZNQA 4UULA 2A92A 5TT1A 3OA2A 4DTIA 5L4NA 5CG2A 3GVPA 2O2YA 3NDRA 4LRTB 4U6QA 1N5DA 1UP6A 3S2IA 1YQDA 2D1YA 5BSFA 3I9KA 1SPXA 1PEDA 5F1KA 1Z7EA 2WMDA 4BO2A 5FEUA 4JP3A 2GYYA 3JD1A 3ZNPA 4CUJA 3IDSA 1DIGA 5CAEA 1DHRA 1Q7GA 2WYUA 5CDGA 3VVCA 4FJ2A 4QFCA 4J2OA 4YJGB 3M1LA 2EEZA 3GVCA 4BNMA 2BFMA 2Y1CA 3PZBA 5EL0A 4PLYA 4RJTA 1U3TA 5JY6A 1PQPA 3JD0A 4GKVA 5G0WA 1PGPA 4M86A 4XRGA 1ZJYA 2NU7A 5ADHA 4PRLA 4BO9A 4B7CA 3AJRA 4K6CA 5L9AA 5KVCA 2OORA 2FZWA 2ZTLA 2DLDA 3GVIA 3H2ZA 2VZ8A 3EMKA 2CZCA 4URFA 3T7EA 1P74A 4WCDA 3K6JA 4CQLB 1R37A 3WGOA 1NVGA 1Y81A 2RIRA 4HXYA 3ZWXA 3C1TA 4ND1A 3JQFA 2EJWA 4DPLA 3C7AA 1C1XA 1F17A 1LSJA 1HDYA 4GLLA 1NM5A 1GAEO 2Y1OA 5I7FA 4GX0A 2QYSA 4XDZA 2O3JA 2UDPA 1IB6A 3QWIA 1VJ0A 2OL4A 4IBOA 4R9RA 3BTSA 4LGVA 4PLFA 2FOIA 5TIIA 3HHPA 4INAA 4YAJA 5BSEA 2QZ9A 3GGOA 2PV7A 5T6BA 3N58A 5C3MA 5JCJD 4QX6A 2Z95A 3V5NA 4DVJA 2YDXA 5EINA 3F5QA 5J23A 4NG5A 3L4SO 1NHGA 2Q1TA 2D2IA 3RIHA 1M6WA 3KXDA 2EJVA 4CQMB 3H5AA 1LXCA 3VPGA 4BO7A 1E5LA 1NQTA 1B8PA 3H3FA 4R3WA 4CM9A 1H6AA 1ZNQO 3DAFA 4O59O 2CNBA 2DUUA 3I9MA 3T4XA 5DNAA 3V8BA 1KY4A 4WNCA 4D79A 1ONNA 3SJ7A 1LU9A 1BW9A 1P45A 2QHXA 1ISMA 1SOVA 3F4LA 4WOJA 4CV0A 2PGLA 4MJLA 2FR0A 3ENKA 3LU1A 1UXGA 5MGBA 3F9IA 1GEGA 1HYEA 3G17A 2P5UA 3VKVA 2J5KA 1M6HA 4WCFB 2PFGA 4R01A 1D7OA 1MXFA 5I8WA 4I5FA 1ZUD1 2DU8A 1LDMA 2BRUA 4A03A 3DBHB 4RPKA 4CM3A 2R00A 3K2BA 3KYDA 2NWQA 3DOJA 1M76A 4PVCA 4K9DA 1E1NA 1VPDA 1HZZA 4ID9A 1V8BA 4RVHA 5JLAA 4BB6A 1F8FA 1SBYA 4H3VA 3LT1A 4RZHA 3CH6A 4TRMA 1F0YA 1X0VA 4IM7A 4MVJE 4BNIA 3GZ4A 1GCOA 3LLVA 1BHSA 2GERA 1DRWA 4IQ0A 4NBTA 4XYEA 1I2CA 1Q0QA 2AMFA 3WMXA 1EVZA 2C29D 2VT2A 2HMTA 4O5OA 1LDNA 3UCXA 4K1LA 3C1OA 4P4GA 1BDBA 5T8KA 3I52A 3DAPA 3KSDO 4IGEA 1IHXA 3DMTC 2V6FA 1PIWA 4NPCA 3L6DA 4PIVA 4FS3A 2I76A 2V6BA 2EKLA 3UUWA 3PFWO 1WW8A 4H7PA 2BFAA 3MJVA 3ICPA 1IHYA 1KERA 1XLTA 4IDFA 2ZQZA 3DTYA 3Q11A 1RYEA 3WQRA 2I66A 1AN9A 3PHLA 3ST7A 4DL9A 3DBRA 3ITDA 2HRBA 1ADGA 5A03A 4CQMD 3ZWMA 3RC9A 2FMUA 2Z1MA 3U4DA 4BV8A 2J6IA 4IJUA 4OOEA 3R1IA 1E3SA 4J4BA 4QQRA 1EK5A 2YQ5A 3E5RA 4MVJP 4CV2A 1EUDA 4XIJA 3K30A 4XYBA 5B1YA 2Y1FA 1YDWA 4AJ2A 5EMHA 1D8AA 4ZRMA 2EIHA 3FSRA 4RF5A 3WDSA 1Q0HA 1PWXA 1QG6A 2VUSA 1MX3A 2PKQO 3ZWNA 3D3WA 3K2EA 3PJEA 4U5QA 2W2KA 3B6ZA 2PZJA 1Y9AA 3GC6A 4IUYA 1N1GA 1NWCA 2IEDA 4DPKA 1K6JA 1ZVMA 3KRTA 4CM5A 3SBOA 4LISA 1B7GO 3ZV3A 2B5VA 1T25A 4OQYA 1XDWA 2E37A 2I67A 2W90A 5FI3A 1RKXA 3LDHA 2NU6A 1BGVA 1PS0A 2B5WA 5JNLA 4JGBA 5HS4A 3GEGA 5IZ4A 3QP9A 1E77A 5LCXA 3HN2A 2H9IA 2Q45A 3VPSA 3CZMA 2DBQA 5EIOA 4I5DA 3DZIA 5FF9A 3ROMA 2J3KA 2JHFA 5JDIC 1PS8A 5L53A 3RC2A 3LK7A 4YCAA 2R00C 4QSMA 4Z3KA 5IDWA 2VRCD 4GKBA 3WBFA 2DBRA 1HSZA 5A3JA 4Q3EA 1ID1A 1T1RA 3UOGA 3PWSA 3Q3CA 5JSFA 4J6FA 2P4QA 4ZQBA 2GCGA 3GN2A 1O5IA 1PJLA 2WE7A 2ZCVA 1P3DA 4UAGA 4ZQFA 2O3QA 4UUNA 5B37A 4GSLA 3LZ6A 3CZRA 5EQFA 4YRDA 1XG5A 1PTJA 3WNQA 3H9GA 4BNVA 5T8KC 2BLLA 5IN4A 4EDFA 3TQHA 2EP7A 2JKVA 1S6YA 5IDQA 2NM0A 4G5HA 2BFPA 4PN3A 1DB3A 2X6TA 4IDDA 3NRCA 3FPLA 5CEEA 4ZU3A 3L6EA 1E1KA 1ONPA 4MIYA 4KMSA 3ZV4A 3AM4A 3L9WA 5JAQA 3ON5A 2NTJA 3LT0A 4XR4A 4RVFA 4G65A 3F3SA 2PA3A 3IUSA 4D3FA 3UHAA 2PH3A 3NT5A 1KEUA 4LSWA 1U3UA 3H3JA 1R0SA 5I7VA 4AJOA 1GZ6A 5IJZA 2YJZA 3SC4A 4BL5A 4O1MA 3GEMA 5DP1A 3NDJA 2VRBA 5G4LA 4YJHA 3QWAA 4BO0A 1TEHA 2Q4EA 3UF0A 2P9CA 4J9UE 3K8ZA 5AQ1A 1T26A 1ARZA 1BXZA 2GASA 1DAOA 2J8ZA 1YL7A 2VQ3A 2HDHA 2Y0EA 4A0SA 1NPTO 4BO4A 1C0LA 3GDGA 3WIDA 1LDYA 4FBGA 3AUSA 4DC0A 1CF2O 3BHJA 4DGSA 2IZ1A 1UR5A 4UUOA 1N7GA 3KYDB 4EJ0A 1ADCA 3LVFO 9LDTA 4OGWA 2V6MA 1AHHA 2BMAA 4CV1A 3W6UA 1B8UA 4J1NA 2NU8A 3GDOA 5I9LA 1W8DA 3H6KA 4R1SA 1LLCA 1JW9B 1OOEA 3RU7A 2WD8A 4KWHA 3O4RA 1OMOA 2PTGA 1DSSG 1FF9A 3BZUA 2I65A 4OSOA 1I2ZA 4JN6B 4B8ZA 4W4TA 4MP6A 2VNSA 2IODA 3JD4A 3OIDA 4IGFA 5TRTA 3RUCA 2VT3A 4BNUA 1DDOA 1DRVA 3ZWPA 4IJWA 4XR9A 3WGIA 3R3SA 3DBLA 3OBBA 1V9LA 3BIOA 2UUPA 1E3IA 3ROQA 1H9BA 5B4TA 4RVUA 2VYVD 4BUCA 2E49A 4AFNA 2H5LA 2V6GA 3DBRB 4KWIA 4XCVA 1DC6A 3OICA 1VSVA 3OETA 2DVMA 2Z5LA 5A9SA 5TSDA 2NVUA 1ZSYA 5DDIP 4XA8A 2QRLA 4FGSA 3VPFA 4EGFA 4RLHA 4ALMA 2CVOA 1JAXA 2GF2A 2WTBA 3CSDA 3EHEA 5HS6A 4RPLA 1XU9A 3IIEA 4NZ9A 3RUEA 1P77A 1K5HA 1JKJA 2ZIZA 3UFXA 2O3SA 3BMOB 4J7UA 1DRUA 4JNKA 1PR9A 4CMEC 3Q2KA 5IDXA 4L9RA 1LX6A 2PK3A 3AFMA 2W2KB 3E48A 2YV3A 3GDFA 3PVZA 2QRJA 3L07A 4HFNA 4YWJA 2AEJA 2ZTVA 2B4RO 1X15A 1XCBA 5F1PA 3E8XA 2DFDA 3JQ8B 4CUKA 1PWZA 2HSDA 4IJVA 1KBZA 1HXHA 2O48X 3H5NA 2IZ0A 3VTZA 4EJ6A 2C07A 3AOEA 4UUMA 1EDZA 4CODB 3GMSA 1UAGA 3PTZA 2X22A 3ZWBA 3GLQA 4E5NA 4FFRA 3Q0EA 4R4JA 1XIVA 4CMCA 3AY6A 4ALNA 4LN1A 5I9MA 1E6EA 1D4FA 4YVFA 2PKQP 4Y6PA 1PZHA 3DQPA 1WZEA 3JQGB 1EBFA 2WEKA 3VOSA 5ENDA 3HNPA 3DC2A 4BO3A 2VCYA 5DZSA 3DOOA 3D4PA 4JIGA 1GADO 3OJOA 4CUZA 3BMQB 3JYPA 3OA0A 1QMGA 4U0KA 1R0LA 4UEKA 2AE1A 4QTZA 2G17A 5U9CA 4YT5A 3PGXA 3CKYA 7ADHA 3PQFA 2AG8A 2WJPA 5BNTA 2F1KA 3TZCA 2EGHA 3ASUA 2PY6A 4CV3A 5DCUA 4U6SA 3NAQA 4YA6A 5I7SA 2CF5A 3OM9A 3Q1LA 3CMCO 4EUHA 5KTKA 3GR6A 2W4QA 3GNSA 4PZDA 1HTBA 3COSA 1I01A 4ZGWA 5ILGA 3P5SA 4A5OA 4QECA 4GQAA 4WPGA 4NK4A 1YO6A 4FFMA 2DT5A 3ZDFA 1VE9A 4MVJH 1T2CA 1X13A 3BTOA 1GZ4A 1H94A 1NAHA 5EESA 1O0SA 1I8TA 1QORA 3BMCA 4GPD1 1XR3A 2FRDA 2JAHA 1ZMTA 3QE3A 4HKTA 3S2EA 5CHEA 3VH3A 3JQDA 4CLRA 4DBVO 4L76A 4WLFA 3OP4A 1GV1A 2V7PA 1UDBA 2Q1WA 3INTA 4AJ1A 1KIFA 2BI8A 3KO8A 1GZ3A 3RD5A 5FI5A 1WDLA 4YJHB 1QSGA 3K96A 3HSKA 2P4HX 4K6FA 3TN7A 3QA9A 1IL0A 3P2YA 4WOKA 3WR5A 2ZB7A 1E7SA 4GLOA 4CLDA 1HWYA 5DOZA 2CSUA 4JP2A 3IS3A 4KUEA 1YB1A 4I8XA 1PJCA 1PJ3A 3HDYA 3FWZA 3BHMA 1P1FA 2CUKA 2OBYA 3H2SA 3BHIA 4DXHA 3JYLA 1Y8QA 3FPCA 3PYMA 2OBNA 4YACA 4AJJA 1E7MA 5CDTA 1CJCA 4N5NA 3MWDB 4M89A 1H5QA 1XWFA 4YEDA 1QYCA 1HETA 1E5QA 5GZ3A 1W73A 4CMIA 1ZBQA 3I23A 4Q3AA 3DMYA 2PR2A 3KOUA 2NNLD 1I3KA 3GVXA 4HP8A 4Z0HO 3WLEA 2QX7A 2BGKA 2VWPA 4IQGA 3LC2O 3AUUA 4WKGA 3GAZA 2JFGA 3H9UA 1JAYA 4DIBA 3VH1A 3AI1A 4BNXA 4YAEA 3PP8A 4CLHA 5A9RA 1K89A 4JJFA 4CLOB 1U4OA 2J3IA 3PLRA 4FR5A 2OXIA 3ONEA 4YAIA 2Q2VA 3Q2IA 4XQ9A 4ZJUA 3HN7A 2ZB8A 1Z74A 4L4XA 2IRWA 3V1UA 3KHUA 2OP0A 3A9WA 1U4SA 1GDHA 3SX2A 4GWKA 1QRRA 5KJCA 4R5HA 1X7HA 3LSYA 1R0KA 3I6IA 3QJ5A 1UXKA 4CJXA 5U1PA 1U8FO 2JFFA 3ZWCA 2IE0A 2Y66A 4KUGA 2B4QA 4L0QA 3V1YA 3IL2A 1I36A 1NQOA 1C0KA 3TL2A 3JQAA 3OJLA 4W9NC 1HLDA 2H6EA 1E7RA 4GWGA 3RUIA 3ZV5A 1WMAA 3I6QA 2RHCA 1WWKA 1YJ8A 4I08A 2YFHA 2FR1A 3HZZA 1CQJA 1FK8A 4BGVA 3IQDB 1A9YA 1CIVA 1ML3A 3MZ0A 4PLWA 4RVGA 4A27A 5A3VA 1R66A 5JPIA 3TL3A 2G0TA 4J0FA 1HYHA 3JV7A 1PGOA 3FF4A 3H7AA 3MWEB 4UREA 2GN6A 4JLWA 1VI2A 2Q1SA 5TQVA 3WS7A 1ZFNA 4B4WA 3WSWA 3ZNOA 1NFFA 4ZQGA 3HDJA 1HT0A 2NLOA 1U5CA 4M54A 1TI7A 5HA5A 4XYMA 5JC1A 3IUPA 1SB9A 2DPHA 4FDAA 1XHLA 1NR7A 5ILOA 5IG2A 5CG1A 3MCVA 4I5GA 1Z7BA 1ZK1A 2ZTMA 3TZKA 5DCYA 3DWFA 2X4GA 1P33A 4P8RA 3S8MA 5I7EA 5TGDA 3ETGA 3L6OO 4NQZA 3EUWA 1IPEA 3GG9A 2PD4A 1DC3A 3WTBA 1O89A 1H2BA 3RUFA 1K6IA 1XU7A 2IEBA 2PD6A 3GZNA 5B4UA 2A4KA 2O23A 3WWZA 3H4VA 4XYGA 1DIRA 1C0IA 4XWYA 1MFZA 1NVTA 3DFUA 2XPCA 2BD0A 3GPIA 4P22A 3F4BA 1BMDA 3A4VA 1GPDG 3KYCB 1KY5A 5G4KB 3H9EO 4E31A 1LDGA 3RFVA 1J5PA 4PFJA 1U28A 1N9GA 4L8VA 4ND3A 1F14A 3GNTA 3KEOA 2VWGA 4NU5A 3GGGA 2HMSA 4GX1A 1SAYA 4OKNA 3HADA 3DMTA 1QV7A 3DHEA 1R4NA 1GYQA 2JL1A 1PQUA 2UUOA 3P2OA 4HBGA 4QXMA 3V2HA 3BMCB 5H82A 4ZICA 2G5CA 2GSDA 1R6DA 1SC6A 8ADHA 4YYZA 4CM6A 4GVLA 3FNFA 2CVQA 3PQDA 3E9NA 4XDYA 1PX0A 2X1HA 3INRA 1YB5A 4CLRB 3W4JA 3HDHA 4NR0A 4WE3A 3UN1A 1HF3A 4IS2A 1XQ1A 3AM3A 3RI3A 4BMNA 1VKNA 1YOVB 2VN8A 3ONDA 1EUCA 1AGNA 2VZ9A 4TROA 1W0CA 1E0DA 3KBOA 1ISJA 3FBTA 3LT4A 1BG6A 4UVIA 1GUFA 3DHNA 3P19A 3RBZA 1J6UA 3WG9A 2C20A 1F06A 2I3AA 2ZYAA 4YT8A 4MVJA 5KVSA 4HNGA 3HJAA 4XQGA 5L4SA 4Z9FA 3JQBC 3KETA 5JMWA 4RPJA 1G0OA 4TKMA 2B69A 4XRRA 3G0OA 4BO1A 4BIIA 2AQIA 1RYDA 1KETA 3L4BC 3ZGYA 1KEPA 3JYOA 3F46A 1ZCJA 3ORFA 1WAMA 1HLPA 2FSVA 3NKLA 4DQUA 4KUHA 4DIFA 4XZ3A 1YS4A 1E3LA 2PLAA 4O0LA 3HB4X 3GOHA 3RFTA 4RPGA 4BNWA 1SB8A 4OM8A 2AEMA 3RWBA 4J91A 3P7MA 5F5NA 5JDIA 4C7KA 2C59A 1O6ZA 5BR7A 2O3TA 4EBFA 1P1JA 2WD7A 1T4BA 4Q3DA 2VHZA 3GY0A 3IJPA 4EEXA 3AU9A 2X0JA 3E1KA 4PG5A 3AWDA 5JYEA 4GL4A 4AJKA 1PQWA 3IAHA 4IJKA 4IXTA 5TC4A 1B14A 1SCUA 1X7DA 3BMNB 1IE3A 4HX5A 4YTEA 1EQUA 3RC7A 4IPTA 3HFGA 1ZMOA 3RSHA 3T7CA 4JBHA 1JTVA 4ZN6A 3S2GA 1PJBA 4JJIA 1GFSA 3RC1A 1PL7A 3WWYA 4KDFA 1VL8A 1WDKA 3DTTA 4E5MA 4PCVA 1Y8RB 5CDSA 2DTEA 4FPXA 4EJMA 3LQFA 3D5TA 1WP4A 1FDSA 3C24A 2B35A 1UP7A 3RJ9A 3I9OA 4DC1A 2WDZA 5IDYA 4AVYA 1NASA 4DMLA 3ZU5A 2HK7A 1F8GA 4FIZA 5FWNA 3O26A 4EYEA 3U4IA 1DIAA 4PZEA 1BSVA 3EW7A 3ZWVA 1QYVA 4CM8B 3GHYA 3D4OA 3PWZA 2X9GA 4Q3NA 2G76A 3HWRA 4MP8A 1X14A 1XKQA 2B36A 4YQZA 4ESOA 5K0ZA 3RASA 4D46A 4YT2A 1A9ZA 3CTMA 1P31A 1GD1O 2ZATA 1PL8A 2O4UX 1XYGA 3MTGA 4R41A 4JQCA 3STHA 3EDMA 5JAZA 5B12A 4FW8A 1YXMA 1WNTA 4J7CA 4GX5A 1LLDA 1KVSA 1KC1A 4ALJA 2C5EA 1TA4A 4O6VA 6ADHA 1DO8A 2XAAA 2I6TA 3C7CB 4E3ZA 1GQYA 1GTMA 9LDBA 3I4CA 2W2LA 2HO5A 4RORA 4LMPA 4N54A 3PYLA 4BNTA 4W82A 3OF2A 2BGMA 4HNHA 4ZHSA 3G3EA 2Q3EA 4XIYA 4BS9A 1YBMA 3ZWAA 1D1TA 1TVEA 5F3RA 3ETEA 4YRBA 3DFZA 1PJSA 3GMDA 4FB5A 3VZSA 4WUVA 2Q46A 4BKQA 4YPOA 1ADBA 1IPFA 1O8CA 1I24A 2ZYGA 4EW6A 3RJ5A 3F47A 4NFHA 4U7WA 1N9GB 3NUGA 2C2YA 2GZ1A 4BMSA 2Y0DA 4RDIA 3AY7A 3F1LA 3NJ8A 3F6YA 3DZBA 3VPXA 1FDWA 1UZMA 2HAEA 2Y68A 3PDUA 5JYDA 5KJEA 5K6AA 5L40A 1Q1NA 4BNYA 5MDHA 3SJUA 2B4TO 4HFMA 1GUYA 3E5MA 3PHGA 4R16A 5JFOA 1IOLA 1G1AA 3C85A 1DAPA 1A71A 1JWBB 3K9QO 1NR1A 3ANNA 3EGOA 2Q49A 1NHWA 5CDUA 3ZU4A 1C1XB 2VUTA 3PK0A 3Q9NA 4R68A 4FJ0A 2TMDA 2GN8A 1U7TA 5HBRA 1E6WA 5CDYA 1HZJA 4K28A 2JAPA 5CFZA 4E30A 2RCYA 4L75A 4J1SA 4D3DA 5C5IA 2NUAA 1BXGA
chains in the Genus database with same CATH superfamily
1IUPA 2HC9A 4PX9A 1B3RA 3A37A 4TL9A 1MXHA 1H6BA 3EMVA 1M0WA 5IBPA 1R8QA 1T4MA 1RPAA 1N7IA 1QS0A 2YIDA 2JJ1D 5TEWA 4FWIB 1SEVA 4JVLA 1FFXB 4YUVA 1MAHA 2IYUA 3ER6A 1NUUA 3OQ1A 1XNHA 5DNDA 2X0DA 4YAKA 1SC4A 2BSQA 5JYBA 5HVNA 1KAEA 1Q16A 2ESRA 1D0SA 3BCSA 5G1NA 4EFKA 4J16C 3H2IA 1UXHA 2AOTB 4FVTA 2EERA 2ZIUB 3IV7A 4LOAA 5K8IA 2HJ9A 1EVYA 3HA3A 3OQIA 3TE7A 4M4SA 4ON9A 9MHTA 1UKAA 2QYTA 2X9LA 4EG7A 2OQIA 1TQDA 2ZR9A 2EWMA 3P2JA 1QPGA 3KLMX 2WUDA 3CEHA 4MWGA 1E3TA 2QMUA 4JJZA 3G8BA 1QRDA 1ENZA 4FJ1A 4YP6A 3W8NA 1QWSA 2W11A 3ELWA 5AXBA 4BX0A 4C04A 1DFIA 2IP4A 4IIDA 2ZM6B 1YJXA 4NE2A 4MP3A 5KC8A 3G7NA 3VU0A 3ANTA 5IMBA 3FJOA 4IHKA 3VRHA 1H8HD 1K6XA 4CL2A 4L8LA 2BDTA 3G2NA 3WMWA 2XOXA 4HPJB 2C2OA 3K2QA 4K3VA 4UPDA 4DUPA 1V95A 2EWVA 2NZYA 5IASA 3RSZA 1JHUA 3SLKA 2V5VA 5F2EA 3TTUA 2AYYA 4YRTA 1N2SA 2O6LA 2J1LA 3L02A 4MQEB 4ZU6X 3E3AA 4JB3A 3ZGVA 1RADA 4N40A 2Q6KA 3OM0A 5J4HA 3MTAA 5HCNA 5JI3E 3GJ4A 5KX5A 3KVOA 5LNK6 5SZHB 2OTCA 3F73A 2DM6A 1XWWA 1NYLA 2YHIA 1IOVA 3RKUA 3WGGA 2WWXA 3JYHA 4QHSA 3MC1A 1LDEA 4EO4A 2XWJI 4EHFA 2HK6A 2NX2A 3E9QA 4DLAA 1RWKA 4L07A 4M1OA 5GJWC 1KBOA 3D6AA 4L57A 4XQEA 4XUGB 1H8ED 5D85A 3UVEA 3FTQA 5JALA 2VYNA 2H2FA 2PVPA 2WKPA 4GMDA 4QU0A 4L3VA 2X5XA 1L5HB 2GJ4A 4UTNA 1GTL1 1Q7RA 1GPWB 2V74B 1TADA 4PE5B 4GKKB 1CS0B 3O73A 3TJRA 1SCIA 4B3XA 3UMFA 3RVOA 2XE6A 1M2JA 1R0RE 3HEAA 3AFGA 3ISJA 1D6SA 5E6RA 3VX3A 2JGIA 5EKXA 4FSHA 2YRWA 3PNKA 3HJFA 1XMSA 1B8NA 5EZQA 3DD1A 4DCMA 1KQPA 1I0LA 3VKUA 3H6HA 3RV4A 3VHRA 2CF6A 2Q29A 1ZZEA 4PAWA 4ZVQA 1CTQA 1TL7C 2W6IA 1T4CA 3B78A 4KDRA 4RF2A 3UK2A 4ENVA 3ZHSA 1EYZA 3A8TA 3N8IA 1EUDB 4GVPA 4UHHA 3ME5A 5DIZA 3IOYA 1C8LA 2QTFA 1R0ZA 2XTJA 4GH5A 2N3ZA 4RW0A 4XVHA 3ROKA 4BE9A 2Y76A 5F9HA 3L6RA 4KACA 5JECA 2QL6A 3TSYA 4QPZA 3U7QB 3TCXB 1O1YA 1ZQ9A 4BMXA 4EVRA 1YTUA 1NVXQ 2VDNB 4HDKA 4LJKA 5LP6B 4GMHA 1TAGA 4B6SA 5BOVA 3V8RA 1I30A 3EGXA 4BQPA 2QBYA 3VH4A 4EHAA 1TIBA 3KJEA 1EVJA 2EG9A 3H2JA 3GF4A 3UXMA 5AM3A 1YRHA 1QQ6A 1E6KA 1YH3A 2R48A 2JD0A 3EGIA 1G6KA 3IMCA 1GGHA 3O9ZA 2P9EA 2V9PA 3RSFA 5A4IS 1P9LA 1L4NA 3G2LA 4RH3A 3RYCB 4UJ3A 5EHQA 2XMCA 4BBPA 2OA0A 3JQ7A 1QAOA 13PKA 3FUTA 1FS6A 3M34A 3WGYA 4BKRA 8ABPA 4E7PA 5IYZA 3C5CA 2VTBA 5IKXA 2BY4A 1D2AA 1LFDB 2GDJA 1PVOA 4C88A 2J9FA 3JCZA 1RLJA 1GLVA 4B8WA 1YBVA 4TT3D 4GXTA 4RL6A 5J40A 3BYZA 2HV9A 3WICA 2ATEA 5ISMA 3FW1A 2FN4A 4ZYYA 1KWKA 1Z8FA 3OFNA 1X3SA 4ND8B 3WX0A 1RBQA 5K7SA 2PSSA 1MC8A 1W47A 3VC2A 3L1KA 1QC5B 4PZ0A 1EQ2A 1CEYA 3DT9A 4WZ6A 4FP9A 3RYTC 3L7AA 4F6CA 2ZBVA 1ICEA 3W2EA 1LRLA 5AT1A 1PGQA 3L7BA 4O5AA 3TECE 2Z2ZA 3L93A 1B41A 4LKRA 3CGWA 1XX6A 1TRKA 4RC9A 2AR9A 3T9FA 1CP3A 3BFKA 5EHNA 1DHTA 4M7RA 2J0QA 5F52A 1KQFA 3TTWA 5A7GA 2FHSA 3QBEA 3A06A 2IV3A 3TLEA 2N9UA 1SIOA 1WBJB 1JQAA 3I2HA 3H99A 4ZOAA 1A69A 1OGJA 1XVLA 2XODA 3V42A 4ZO8A 4BMPB 1CDDA 1XN4A 2WFAA 5JCJA 2ECOA 4WECA 4H1WA 4P3XA 3N76A 3RSGA 4CM1A 1VCOA 1XTKA 4TXJA 5D7NA 2YQZA 3QVGA 1R9JA 4V02A 3I92A 3JU3A 4Z6KA 1U65A 1Z56C 1MOZA 2YZKA 3IDOA 3KUXA 4NC9A 3HWWA 4QOIA 3UJCA 1S3FA 1I0IA 3VDRA 4EF5A 2DFVA 4E33A 4R3UC 1G8MA 1U0RA 2B9EA 3W3AH 2Q8PA 4J0HA 1CUDA 4WA7A 1J24A 1TU3A 3GT7A 1T5BA 2P9BA 1YI1A 5AW6A 2XGSA 3X2EA 5EIEA 2HGSA 2JHGA 2WTEA 4HAVA 3F6EX 5DM70 3WJ7A 3UMYA 4LKOA 3THYA 4WGGA 1ANKA 3R8CA 4PGHA 1JVSA 3WHKA 3NHUA 4BQRA 1ITZA 3COZA 5BUSA 5K03A 4JLAA 2EXXA 2YS6A 3O03A 4Q34A 3KXIA 1QYIA 1R5BA 4J29A 1CNMA 1L0BA 1HE3A 3UMGA 1P3Y1 4D8XA 1EX9A 2CBXA 3ITNA 4N3CA 5EJ5A 5BWCA 4WXEA 1ZD1A 5CTJA 4GGMX 1DC5A 1MKYA 2XF8A 5E6UA 2CNNA 1M6VB 5CA0F 4R1NA 4RV4A 2IBMA 2P30A 4NJEB 3JAWA 3U0BA 4EW2A 4QU9A 5HKKD 4IILA 4RK5A 2XNDD 3SSAA 2QTAA 3RRYA 1CETA 2H9YA 3OQ6A 3JVUA 1KOLA 2X7HA 3EZXA 3INGA 1T24A 4MX8A 2ZCUA 1X8XA 4OQNA 1JR6A 1VOTA 4BVBA 5JRZA 4ZTUB 1H6CA 4BGEA 2HLPA 4PXYA 4W5QA 1JKFA 1J0DA 4GRIA 3QWBA 2I6SA 1POXA 2O50A 3G49A 3I0MA 3NTOA 4RHFA 4RENA 4ZO4A 3W4IA 3X1DA 5BQXA 1QXSA 3TAUA 3NGLA 3HXOA 4X6XA 1MCZA 2O2SA 3BQMB 3EEQA 3BAZA 3RYHA 2UAGA 4LXYA 4NLLA 1NQWA 3L1HA 1IUKA 4MV8A 1UDWA 2Z09A 3MWKA 2FP4A 2RG7A 1BA2A 1JXAA 2V96A 1NF3A 1OX4A 1F1JA 3HACA 3QQ5A 1KOFA 2FWBA 1SCBA 2IYOA 2YVQA 4DWVA 3OJ0A 2XGJA 3UAYA 1E64A 2GEVA 2M6SA 5K0NA 1CY0A 2YOGA 4H16A 4BZWA 4L5YA 4PTLA 5ALPA 3I5MA 2V7EA 1ZJ6A 4MINA 1FTWA 4YFYA 1F12A 1RYHA 2CJXA 1RAHA 5FWAA 3RJZA 3UMSA 1M2NA 2F3RA 1PL6A 3PHHA 4IDHA 4UE2A 3T99A 2R1TA 5JC8A 4NBSA 1THGA 3LWNA 5HQTA 1S8OA 2R5NA 3LGXA 1YS2X 1OYYA 1FS5A 2A94A 3M2TA 5EJIA 4BKMA 2ANCA 3DOFA 1OI3A 3ZDDA 5FPKA 2CSXA 1F2TB 2XCUA 4Z0PA 1KAOA 4IYJA 3X1YA 3GH3A 2FUCA 5KJ1A 2P6OA 1D1SA 3NM5A 4KXVA 4UBOA 5TPWA 3RR2A 3BH0A 4EG1A 2RGGA 3R5TA 2YKGA 3WNVA 4Q3CA 1I7QB 4WN3A 1UBOS 2J3JA 1UPFA 2ID4A 3MLEA 3QYJA 4YHBA 2FSPA 3R75A 2J0EA 3HJRA 3G9XA 1IWPB 1ZO8A 3QY0A 4IIJB 1H5UA 4PO8A 5EC8A 1QH0A 2F7SA 3GDWA 4YXFA 3PR2B 1OXSC 4EA8A 4DMRA 1Z37A 3CW2A 4K1XA 4LSZA 5FV7A 4D43A 3ACBA 2GD1O 1MU0A 3SEFA 3BXXA 3U40A 5DM4A 3NOXA 1JKJB 1YQEA 4JUIA 3CEAA 1JQJC 2EV9A 3R74A 5TLSA 5BN1A 2GN4A 3PDWA 3E58A 1BXKA 2ZPUA 2C9ZA 4D2IA 1M1XB 5ALHA 3KSAC 3ANXA 2HRZA 3IUBA 5CYPA 3SSNA 1EA5A 2O20A 3KUKA 4ZVOA 5HXAA 2IGBA 3HRIA 4UDYX 3DZHA 1ESDA 4FQ5A 4N5DA 5LQUA 3N70A 1APBA 2C03A 5A71A 3JWIA 1WE2A 4QSHA 1FMLA 4PO1A 4AS3A 1OQAA 3IE1A 2GM3A 4UATA 3RVDA 1CUYA 1GPMA 4PQEA 1N5LA 4JQYA 2ZIEA 5KREA 4BPRA 2FUNB 1D6MA 1ZR2A 1VL1A 5C0OE 1IN6A 2XB2A 5BVHA 5COAA 1ZH8A 2HXSA 1VE3A 2H1OA 2G4VA 3L8ZA 2X0RA 2EF1A 3L4BA 4TVBA 2WD9A 3K5WA 1T1IA 5HRCA 1XZCA 3UHFA 2QUJA 3R8XA 1XHFA 4F5WA 4ZIRB 1ORRA 4Q3OA 3MWFA 1ZW1A 1B3BA 3UT5B 3WBKA 4IDBA 3LA8A 3KALA 1FXUA 4YS6A 5EPOA 4R0VA 1U3WA 4KVAA 5L6LB 5F76A 1WM1A 1SUDA 4WK6A 5AHKA 3UAXA 5ABPA 2AD5A 3WGJA 4M0PA 1IY1A 2C4HA 3TLYA 5IAKA 1NTOA 3A6LA 1PJ8A 2P77A 1DAKA 4EQ6B 1ZYUA 4QYMA 4OXIA 5H68A 4FD3A 3HLTA 4FYIA 1W34A 4H6VA 4OJNA 1JSXA 4U9IS 5EERA 1TO2E 2QAGB 3UAOA 4REMA 2O3RA 3DEIA 4B40A 4D25A 3NEYA 4I1PA 5E9JA 5AKXA 1PE0A 3AV0B 3A6ZA 4LE2A 2FUG1 2POQX 4PG4A 4EHHA 1DFGA 2O8CB 1K8RA 2P11A 4RVCA 5EIBD 3VMFA 3GUCA 5KAMA 4F46A 1PR3A 2R8XA 2Z1NA 4WNIA 1EGMB 5EKSA 4EQZA 2WF7A 1YRAA 5H83A 5J3JA 4AY5A 3PI6A 4HD8A 4MVJI 4UASA 5JE8A 2XD4A 1JEYA 2OGZA 4JEUA 2D7DA 1MRZA 4FDMA 5A06A 3MCAA 2DY1A 3ROXA 3NGMA 4KYVA 4PG6A 5BV7A 3W1WA 1ZM2A 1P9WA 2XMQA 1ETHA 2J9ZB 4KV7A 4PO3X 4QUKA 4KPEC 4J1TC 1FYEA 3ZCUA 2AG5A 2ZUDA 4FFOA 2X23A 4BN5A 3KJNA 3PDIB 1YRBA 2WJGA 1L8QA 2I29A 1PZFA 2HK8A 5ALOA 5HIKA 3EVFA 2Y67A 4I14A 1XMOB 2E4AA 2HTFA 4NYIQ 2XHEA 2PV0A 4H35A 4H15A 3N2LA 2BEWA 1ISGA 3I83A 2PNJA 1UOQA 4ZP1A 4YRLA 5BW5A 4QIHA 1CERA 4WCFC 3BK1A 2A57A 3L7NA 1R9MA 2CXRA 3DMFA 3FYUB 3B1FA 4DCSA 4LWOA 4ZODA 1UDXA 5CIYA 2W37A 2H31A 3C3JA 3ILVA 1XZ8A 2NP7A 2PE5A 4L5BA 1IBSA 1S96A 1XCLA 1G8GA 1YQ9A 4UHDA 3RS2A 2VDWA 5B36A 2ADFA 1RXUA 2OAGA 2QM0A 3W5CA 3KOXA 5J4VA 1QZUA 2R1UA 3TAHA 1GY8A 4E14A 5BNIA 4WK4B 1BU8A 1VJTA 4TZTA 5EQDA 1KZYC 3UCFA 3DE6X 4D3ZA 3OECA 1VGVA 2IYEA 3BFPA 1KY3A 1FTNA 1DJNA 4PNPA 4OP3A 3IIJA 2R65A 4LJSA 2A35A 4HQ6A 4X5OA 5J58A 4OHFA 2ZUVA 1RAIA 2ODTX 4I3GA 3D4NA 3RLIA 1TVKB 4BLVA 1HDZA 3ESCA 1ZSVA 4IDAA 4GGOA 1RHMA 4BV9A 3SC2A 1PT8A 1DT3A 4MQMA 3FCUB 1G8FA 1V5IA 1ZWKA 2IXBA 1ISFA 3IYLW 3GEDA 3UPDA 3O8RA 4LF8B 3ZZ0A 4CKWB 1OLXB 5JO0A 5A1TA 1HKHA 1WSDA 1Z7GA 1UM9A 3T5CA 3WXBA 4E2WA 3ZHBA 1A9TA 1EAYA 1UBKS 2DULA 4DA7A 4AKGA 3RK1A 4EH1A 2O1WA 1FUYB 2IIVA 4PSCA 2BSXA 1ATZA 1I5RA 1USVA 4F3RA 4PS0A 5LWQA 2OV6A 1A9PA 1MQ9A 3D64A 3HPRA 3MFYA 4Q9HA 3I5UA 2HRRA 5DI3B 3UJHA 2P6RA 4RULA 1QCZA 1XRJA 1F38A 2C9BA 4KE9A 3T1OA 3VTAA 2DHEA 3LCUA 1YZLA 2R25B 2PL1A 3KWLA 4FYWA 5DBFA 3GEHA 4DWWA 2YR0A 3EXIB 1JEYB 3JVIA 4MCAA 5CT9A 2PH5A 2Q4RA 3P9CA 2I3GA 3JWHA 1CQIA 3PE3A 4GPBA 4MLZA 1EIWA 1VRVA 5C3UA 4PZZA 1C3XA 4OXNA 4Q0MA 3RS4A 1SXPA 2K2QB 1W49A 3CPJB 1JGTA 3LPLA 2M9MA 5KNCD 1U2RA 3CF6R 3CF2A 3ZKWA 4GM0A 3MOSA 3JALA 4Y1EA 3DOCA 4QJ3A 4MDYA 3WDLA 4RQTA 5EJFA 3CE6A 2MTBA 4MS1B 1MF7A 4U3JB 4BEWA 4CG2A 4GKJB 2CMGA 1K0UA 1CZRA 5ULLA 4Z49A 1A1SA 1V16B 3V1TC 5TF0A 4H27A 1TEZA 1WMEA 1QUEA 1PBNA 3OKFA 5EMMA 4KKVA 3G59A 1XZIA 3BRWA 1EE9A 3UANA 1Y98A 3GPBA 2OO5A 1L5LA 3PLNA 3UQZA 2ZBGA 1LBQA 4P80A 1THMA 2GEKA 3HSSA 2BBOA 3CKKA 4JXJA 4TM7A 3LDUA 1U04A 3NONA 1DLJA 3A10A 3MBIA 4HQFA 4L8WB 5FFMA 5E2AA 4YJ3F 5G1PA 4EPWA 1LF0A 3DS8A 4MUFA 2WDPA 2J87A 3B1JA 2KS6A 4FEAA 4Y67A 3TOCA 3K6SB 1DTWB 1X42A 1LPNA 2R60A 1RZRD 2CW5A 2Q28A 4MQ5A 4B2PA 4TVSA 4N82A 3SFZA 1Q7CA 3V8PA 3G89A 3L6UA 5KHOC 4YFVA 3WBJA 1G20B 1C9DB 5DX0A 3RQIA 1Q1QA 4RD6A 1HBJA 1GDDA 3DGFC 5I9IA 5AICA 2VDUE 4CFZA 1PT7A 1YB4A 3EMDA 1HLFA 4O3FA 4ZRNA 2FI1A 2NXJA 3IQHX 4G67A 4KNWA 3VR4A 2QIOA 3WJ2A 1Y1RA 3ONFA 1UJMA 1HDRA 3KKKA 1N4DA 2WIJA 3FXAA 4N5MA 3WK7A 4Y6SA 2BI7A 1I3MA 2QV7A 2CV1A 4J0CA 2XSZA 1RLTA 1T9AA 3AYXB 4ARBA 1ZRNA 1HE5A 4G1UC 5CPBA 4QKQA 3AFNA 1RP1A 2EFHB 4W99A 4YCJA 5LDDC 2WE8A 2WTMA 1PJZA 5BVGA 4XWKA 1PRYA 2X5NA 2VJNA 3H4IA 4IKPA 3H65A 2RGCA 1GPH1 1BKYA 2AW5A 1RWXA 5ALKA 3SNHA 1R6UA 3LHSA 5TS3A 5KQMA 4A6EA 2BFCB 5IEBA 3UFBA 1LWOA 3P2EA 1MW9X 3W6ZA 1QKIA 2VJYA 2YH2A 5ER6A 3TQCA 3UHPA 3V8MA 4CLXA 3QTLA 4G9BA 3EZ2A 3MAGA 2XXAA 3QBJA 4KQ2A 2YHBA 1XTZA 5AK6A 1T0IA 1QQBA 3NO4A 3SZRA 5CDFA 2XKJE 3QUTA 1M8KA 4AMUA 1YASA 2FNAA 4MHOA 1R4NB 1PFKA 3SLGA 4EPTA 4WAUA 2GDZA 4QBTA 3FIJA 3FOFC 1S8AA 1WU8A 2PYDA 3PXAA 4TKUA 4HDRB 3SQXA 3U4QB 3AWIA 4DIDA 1HGXA 1PFGA 1PKXA 3CVUA 3HP1A 4MKFA 2O8BB 1H23A 1GQOA 5HX7A 2YUTA 1Y7TA 2N42A 1BWQA 2PU5A 3GT0A 4HB0A 4I19A 4FMBB 1V3QE 1ZGJA 2CMKA 3EWNA 5I8ZA 3RYIB 4CR6A 4DA9A 2UZIR 3DCIA 4R54A 1WO8A 2B9VA 1O95A 3MTBA 1U0TA 3IJRA 1EUCB 1VM6A 3C8HA 9GPBA 1SUBA 2AHRA 4CKCB 5IANA 4W5JA 3FOZA 3ESQA 4J6EA 1EEXB 2AMVA 3C6ZA 2Y77A 4B3JA 2P1RA 2IU4A 3QVLA 3SLRA 2BF7A 4GLBA 2QUZA 1NVUQ 2PUCA 2H0AA 1JE0A 4NZNA 3QPVA 1Q21A 1RKBA 1QVWA 1GNTA 2FEMA 1GLGA 4RA9B 3RU2A 4OI0A 2VS1A 4K6KA 4U2KA 3BD9A 4C01A 2C7VA 2OBLA 1FSSA 2X7XA 2QW8A 4RKYA 2VQ6A 1QKJA 2ZSAA 2GEJA 1YQQA 4FFBA 3OOSA 2NPOA 1SWVA 2ETVA 4CT0A 2LDXA 3CG0A 1FP4B 3MRTA 3TR5A 3F1KA 1D2RA 4FS8A 4GRDA 1Q83A 1E6LA 2KSQA 3UMJA 3VYVA 1CR1A 1JYEA 2QTTA 5GV8A 4UVEA 2BGNA 3HFSA 2HJRA 4QODA 3K0FA 3OMLA 1XQ6A 1ZOSA 4BUCA 1I51A 2UVDA 4I9UA 2PRIA 4K88A 3JTMA 4JHXA 4QLOA 1XLTC 1QV6A 4OFXA 1NXPA 1DKRA 1JFLA 4B80A 3I32A 5IVDA 1G8HA 4GC5A 5JSZB 1KFCB 4LG1A 2MSEB 3TE6A 3CWZA 3AFIA 1T8YA 1WA5A 3KQSA 4KKXB 5C7OO 3CB2A 3NT2A 3OURA 3EBLA 5K51A 1CXZA 1AMOA 2N75A 2C3YA 2RAFA 4B81A 2FK8A 2B34A 3CO5A 1AM4D 1MLDA 2EGGA 3NRBA 2HHLA 4CKXA 1GZ5A 1I1NA 5IJ0B 3SYKA 4URVR 4KW7A 3UY4A 2D3WA 2QRKA 1KEVA 2WD7B 3BDVA 1M10A 3VR5H 3IKVA 4FB4A 1TX4B 1ABBA 5K8TA 2VH2A 4S1VA 4XSHA 3VO9A 4RTMA 2FMIA 3E1SA 1XEXB 4JI6B 1YIAA 4IF4A 4AO7A 2JGAA 1ZGBA 2WB4A 1KMCA 3CF4A 4G85A 2NUTA 1MJFA 3L7DA 4FFNA 4LW8A 4DIUA 4URZR 3I28A 2B94A 1OBFO 2XZPA 4WZBB 5BXQC 1QZXA 2WF8A 3FM9A 4YASA 1E9EA 3KJZA 3ZHZA 2QMYA 3N8HA 1E8MA 3OLYA 4EG0A 5EP2A 4AXXA 2RE8A 3GUUA 4RCVA 4OBWA 4R5MA 4M83A 2QEQA 2EHJA 1J1UA 2A9QA 1DOHA 1KZGB 4YJKA 4D26A 1KK3A 3UJ6A 4LPKA 1LFAA 2FOLA 3C0KA 5LMZA 1D9ZA 2R86A 1O57A 3HBFA 4DNPA 5C7IO 2FWIA 3K71B 2WQZA 1QH8B 1JT9A 1RI4A 1UEIA 4X00A 3HO8A 3SZOA 4PY2A 1MH9A 3IQGX 5HJEA 2YXPX 3V4OA 3FE2A 3DZFA 3U81A 4MS4A 2XGGA 4BNKA 1C2TA 1YGYA 1FFSA 3TPFA 1XZPA 4MW1A 2X41A 4DLZA 1HOTA 2PMWB 2HB6A 2AC2A 4NBNA 2PX4A 2V6IA 5ICMA 1S4MA 4ZI7B 1O94A 3VU1A 1RJDA 2F8SA 2GM5A 3UKOA 5JATA 2H4HA 3H8WA 4G0XA 1XVAA 3D6TB 5E8RA 1ISPA 4LY9A 4QPJC 4O33A 1E8NA 3V1NA 2OO3A 3K9CA 3N7UA 4HDCA 4JBYA 1B74A 1HFWA 3DQZA 2J0VA 4QO8A 2WZQA 3TD6A 4PLGA 4LFAB 2G77B 4LYDA 1R4MB 1T35A 1QRTA 3TW0A 3HU3A 4K8OA 3K0KA 4ND7A 4PBSA 2OESA 4CIYA 2C9YA 2I4OA 1OA1A 1HQYE 1MNAA 1PZEA 1F60A 2W2MA 1FX0B 4N01A 4NI5A 3TD9A 2Q0XA 2PA0A 3QVJA 4FC7A 2DP4E 1RQNA 1TT7A 3PBKA 4FCWA 3EG9A 3R6LA 5FP0A 2CLLB 4S0ZA 4ZZ2A 4LF9B 4DM7A 1U31A 1MC5A 4IG9A 4G0VA 4JB8A 3M6LA 4ROTA 2C96A 2RB4A 1WF6A 3P26A 2DWCA 4MWDA 1HDIA 4CEIA 5REQA 3TI7A 3OE1A 5JWOA 1PR4A 1XFAA 2NSDA 1BVHA 1W9HA 4RD3A 1IN1A 2EJBA 1PV2A 1Z2NX 1IMOA 4WXRA 4WXHA 4N9WA 1Q2UA 2F43B 4MIEA 3VMMA 2NGRA 2PR7A 2ZJ5A 1ZKMA 2AVNA 2M2IA 3R5XA 3QTBA 3SBXA 2ET6A 1JDZA 2ZWPA 3BOSA 3ZHQA 4C14A 5AM2A 1G0NA 3A6GA 2RKOA 4KFTA 3REQA 4CL3A 3FWNA 3ER9A 4F11A 1D07A 4Q82A 5D84A 1K2WA 2COUA 2JCSA 4WKBA 3CISA 4N0DA 4RYDA 3IPCA 2PKEA 4HRYA 4S1TA 5C81A 1G41A 1UC8A 4J0IA 1WNFA 1NVFA 1M2VA 4IKOA 4X7BA 4YH1A 1EKXA 3H2GA 3DDUA 1YAHA 1YGPA 2NXNA 4PSDA 1GG5A 1L7AA 3NEAA 4ZVMA 5JO9A 4FXOA 4TGLA 3MD0A 4MYCA 4ARAA 2P35A 5JQGF 4BGPA 3X43A 1LJLA 1BS1A 2KBFA 5BSGA 1OCEA 1JMYA 3IBGA 1UT5A 3FPHA 4GNRA 5FB3A 3WYFA 1PGNA 1VKHA 2RGXA 5PNTA 5JVDF 1OI2A 1TMGE 1LC3A 3R5HA 3RVBA 4CE6A 2J9YB 2D62A 1Y9JA 3IQFA 1YVEI 2G80A 3GL9A 4NH4A 3GCGA 1VMAA 2CV2A 2ANBA 3UXEA 2H5IA 2N0SA 1T5LA 4MVJF 4ER7A 3JAMA 4JYCA 1HQDA 3IKTA 1XKLA 2W6ZA 1HSOA 2C7BA 3KLBA 2D8AA 1BH6A 3M6MD 4KLAA 4U7PB 3HCAA 1EA7A 4CM4B 1WV1A 5C80A 1SVMA 3I3SR 2IT1A 5HPYB 1GCUA 2VNJA 3PGVA 4PVDA 4TYYA 2PKRA 4LYYA 3WLPA 1EBUA 2HLDD 1BXGB 3RSQA 3VH2A 4HFJA 4X92A 1WHSA 3H83A 3MRXA 5EZYB 3PRJA 4MR8A 2MSCB 4AJLA 2P6PA 4OQZA 4ZFNA 3KOWA 4LXTA 4TXMA 3UM9A 4CM7A 3DYBA 2V7XA 1X1BA 2CLMB 1WD5A 3LE8A 5TQJA 2BMDA 3IOBA 3OT4A 5HQ3A 3T3OA 2XX3A 3E81A 1G5QA 2GK7A 4LDZA 2F4VB 2HHAA 4IZOA 1FU4A 3SICE 4RIFA 4B3MB 5G4KA 3PC4A 5DYIA 3I04M 3GUHA 3L8GA 4MJ7A 3RWMB 3M1AA 1KIMA 2H3EA 5L4LA 3WL6A 2PZLA 4CMHA 5I4BA 4N39A 1SXJA 4W5OA 1O2DA 2WLTA 3OIWA 2YFKA 1VE1A 1FVHA 1XTPA 3BIXA 5CJ2A 5EQTA 5ES3A 3SOPA 3VDMA 3EDQA 1U3GA 4Q1EA 5KKAA 3RFXA 5AIAA 3C15C 2AZXA 3HJUA 2LV8A 2YHUA 1H93A 2CMDA 2PUAA 2BKEA 4C03A 4BKPA 3JZIA 2WM3A 1XAJA 3HKDA 2NU9B 3LGAA 2FZEA 1SKQA 3H6GA 4H3KB 3O94A 1K2VN 1V1MA 1U8EA 4B6QA 4DJ5X 2Y92A 1V3VA 3CZAA 1Q6YA 3NHZA 3MJ4A 4FSDA 1Z3IX 4JOCA 3CFYA 4XCXA 1CEXA 3GG2A 1QO0D 2GK6A 1TCVA 3CV3A 3EVGA 4PLHA 2ATXA 5I7OA 5TQ2B 1FQJA 1UJNA 2OPBA 4O2BB 4WFJA 1QTNA 4OMUA 3NAMA 1M2WA 3AVQA 1I3LA 1KR5A 2RC6A 5MHTA 4A8JA 2Z2JA 1SO8A 1MO4A 3MS4A 3LIPA 4HN4B 2YWDA 1M6YA 1JEQB 4MR7A 1G9TA 2QG4A 3T9CA 3UIEA 3ZE8A 3C3AA 1C5KA 1CY1A 4X8LA 3A1NA 2ZYTX 2B6NA 3JSAA 5D6OA 4TQAA 3QPUA 1AHNA 1A27A 1E5VA 2UYQA 3N0XA 121PA 3RUAA 1SURA 4YB8A 3VKHA 4WASA 3C8ZA 2DR2A 1ZINA 1UWCA 2D1FA 3M4JA 2ZRMA 1TTPB 2Q7OE 3CCCA 1B16A 4Q4JB 1ZZGA 3KX2A 4IMRA 5L3SB 3KT3A 3EDOA 3I76A 4DCVA 2VHJA 3EA0A 1UBRS 1X38A 1SXJE 4LYEA 2EBUA 1O54A 3RT1A 4JU9A 3VPDA 2GBLA 5DNVA 3KQLA 3THWA 4Y18A 3R0JA 3HY6A 3KQOA 5CX4A 1L5RA 4WN9A 4LWQA 2GH1A 3KOOA 3CLUC 4M88A 1T3TA 2UKDA 1ZC3A 1P1IA 3CCFA 1UZAA 1LBHA 3EFHA 3FPGA 1P7PA 3MAAC 3OESA 4GM4A 5IARA 1Z5GA 1XPOA 3CRQA 2VF2A 3BFJA 4M21A 5L51A 3P9YA 4BNZA 4B7UA 3G2IA 2YY6A 4DQ0A 2IXDA 2PL5A 2DWQA 2VUUA 2X86A 3QVXA 3VR4H 2BGJA 1XMPA 2UV8A 3ML1A 1KJQA 2CCKA 2ZIFA 3NVDA 3QVMA 3KK0A 4LK2A 4ML3A 4TN1A 3V2GA 1COWA 1J1ZA 3EDCA 2WSYB 4LV5B 4PAQA 2AJLI 4B6EA 1K3FA 2J3MA 3KHKA 4C7VA 3DVRX 1ES9A 3A1FA 1AKEA 2XZOA 1X9IA 4W1RA 4F04A 1TJYA 1EJ2A 2HFKA 3X0DA 4CGYA 1E4EB 1FP7A 1XEFA 1XRNA 5FWXA 1XWIA 2L17A 1W5SA 5L95A 1SC1A 3K73O 3UV7A 2JNWA 3ANMA 5LA6F 5DBHX 1WEKA 4TXHA 3QGMA 3U6KA 1EGQA 1UXIA 3QYAA 5HF5A 5F21A 3NHYA 3EGDA 3MG9A 4KI0A 1KMHB 4X7MA 1QQ5A 2QTLA 1DX6A 2HU2A 2J67A 3A25A 4J49A 1JIQA 1UPTA 4HDSB 4BC1A 2ZUUA 5AOCA 5LZ9A 4PAOA 4H18A 2IZ7A 2LKCA 3QFFA 3R5SA 3C7TA 2X0EA 4GBGA 2ZB3A 4TSFD 1Y8RA 4EKNB 1V6CA 1CFZA 2P9GA 4CETA 1DI0A 2IW1A 3SXPA 3K09A 1RJFA 2D4AA 3BJEA 2VAVA 3UCEA 4EGAA 2SCUB 4BGUA 1DKPA 4CMKA 3NIWA 2OV8A 5C8ZA 1H4TA 1GCIA 1PHPA 2QX9A 3OQPA 5TE9A 3HCOA 3U4CA 4KBFA 3JRXA 3QU9A 4BP8A 3DLIA 5ARBA 1Q0ZA 4UTRA 4US2R 2BCEA 1USUA 2PLRA 3FY4A 5HM8A 1JIUA 1JRLA 2IYZA 5K0SA 1L7VC 1WX1A 3U3XA 1MAUA 2AVDA 3NJ4A 1J97A 1UT6A 1T2AA 5DSZA 4IMPA 4R8VA 4X6UA 4CNBA 3LW8A 1S2OA 4EVIA 4U2DA 2R0QC 4KQ1A 1UMCA 4UULA 2A1TR 3B9PA 3OA2A 5TT1A 2O59A 2MYTA 4JI7B 3NDRA 3EFOA 5FR1A 2A9RA 3DV9A 3AETA 4WZAA 1J8VA 4U6QA 1N5DA 1JXOA 3TNYA 2IYRA 3ESXA 5BSFA 4B5KA 3IPRA 3ZBUA 1K97A 3EXEB 5KYUA 3JATB 4E2FA 4AN4A 3T1YB 2VAMA 1PDOA 2QE6A 1RTTA 2PKWA 5SYNA 5C8XA 3OU2A 1GZUA 5FEUA 3WKDA 3LYHA 4CUJA 4XX0B 4QYIB 1JFSA 1NR5A 4DR4B 3OUUA 3ZD9A 4DZRA 1Q7GA 3D3KA 3OPQA 5LMCA 4I1YA 3FMFA 5HJ5A 4ZEMA 4YGXB 3IAFA 4ZHQF 4Z5XA 4IJSA 3CRVA 2FVXA 2ZAOA 4ED9A 2E4YA 2XMDA 3DV2A 1PQPA 5IPFA 1CNEA 2CFRA 4QRHA 4M86A 4UHCA 5CYFA 5AKLA 1ZJYA 4DILA 4A91A 1Y7PA 2EOAA 4WVLA 1VL5A 4H59A 1GRQA 2VQDA 4OATA 4AKTA 4B7CA 3OMWA 4BO9A 5M04A 1V11B 3AJRA 1K27A 4G63A 3O7MA 4ME6A 5TQ0A 4K0KB 1G7RA 1KS2A 1MJGM 3CC8A 5IWAB 2VZ8A 3ZY4A 4URFA 1V39A 2GVNA 2RGNC 2TRSB 1BX1A 1P74A 2DWUA 3E22A 4IOKA 1CF4A 4MUNA 1NVGA 1ISRA 1WL8A 2RFLA 4MMXB 3TUIC 4ENRA 3KQKA 2C83A 2CMHA 3TQFA 3TMYA 4JT2A 1K6MA 4PS1A 5G41A 1UFVA 1XCOA 5EWLB 4B46A 5ADWA 2GN2A 2HIMA 3T41A 1BN7A 5DTEA 4DBLE 3HCBA 5LOVA 1RABA 4GLLA 1HDYA 4OBEA 3P0HA 1NM5A 4R8SA 4YUAA 3M6XA 1IPHA 1D0VA 2OHFA 4PR0A 1P5JA 5CLQA 1JFRA 3CKMA 1NTRA 4L2IA 1CZLA 4H77A 4P7FA 3OWXA 4QATA 5CK5A 1WHTB 1XMVA 4UAJA 3UK1A 1X80A 4HXEB 4UEWA 3KNZA 4JKOA 3TIGA 1ZM4A 2QZ9A 2IHZA 2W2OA 3PCTA 4LOJA 1AF7A 2QE7A 1D4ZA 4KQ6A 3AR8A 1BDHA 4QG7A 1WP9A 2Z95A 1JEEA 2HA2A 2W5UA 5DGDA 2C04A 5F73A 1XOIA 4IFIA 4Y0AA 3T3HA 5T6MA 2OV3A 1JLKA 4Q47A 5LD2C 2NAFA 2DLCX 2WT9A 1Q15A 3VPGA 4BO7A 1TEXA 4ARZB 1LPBB 3H3FA 1H6AA 1ZNQO 4H0NA 2ODWA 3MN1A 5CMLA 4NENB 4ZT3A 2DUUA 2VSQA 1H1LB 3EIHA 3I6YA 1J7KA 4BV2A 3T4XA 3NWPA 2DE0X 4Z4QA 1QGUA 2D2EA 3KQNA 1QVAA 4WNCA 1XVIA 3BN3A 3ZE7A 3LXUX 1XTVA 1OASA 1BW9A 2G4LA 2QHXA 1ISMA 3LBHA 2Z1DA 3Q7TA 4YXWA 3RREA 2PGLA 4MJLA 2FR0A 1SWWA 2J7PA 1I2DA 1OA0A 3A6DA 4M22A 1BHO1 2QMOA 1HYEA 4XM1A 2P5UA 1GG2A 1KH3A 4RK1A 2PFGA 4R01A 2QJWA 3AR2A 3IP9A 4Q1CA 4F6RB 5HZMA 5A0TA 3FLEA 1WCIB 1LDMA 2ADOA 4AW9A 3N87A 4Y2JA 1P6QA 5JANA 1T9ZA 2GFQA 3BM5A 4QQ8A 5CHYA 4YAWA 2Z6QA 3GAMA 5IYZF 4X6YA 2RBGA 2NWQA 3CZ5A 1MJGA 3DOJA 1JR3D 4LHXA 4WD3A 4EO7A 4ZGWA 4K9DA 2G5PA 3OCJA 2QTVA 3ZW7A 1E1NA 1VPDA 1HZZA 3FPFA 3AF4A 3A58B 2ZP1A 4FIDA 1MJHA 1W2GA 3PUXA 1F0YA 4IM7A 4PPNA 2ORED 4BNIA 3GZ4A 1BKSB 3LLVA 4MQ4A 3G5UA 1UKEA 4KH0A 4UOEA 1DQSA 1U28C 3HMQA 1NKVA 2QTGA 2OYRA 3VYWA 2WJ6A 1E1QD 2HMTA 2NSLA 4TZ6A 2VJQA 4P4GA 1SC9A 1BDBA 1U81A 4HNTA 3I52A 4Q48A 5I6DA 2GPSA 4O4LA 3WGMA 2XTMA 3WRXC 4HAOA 4CI9A 4XIIA 4ZJYA 5L6MB 5LPNA 4W1PA 2QN9A 1PIWA 5C34B 2P3QA 2JIZD 1EUYA 2AZDA 3L5OA 2W70A 1VG0B 1XMJA 2I76A 3V7NA 2GRJA 1US8B 1WEHA 2WHPA 1KERA 4YRIA 2ZQZA 4K9SA 3KL2A 1XXHB 1Z2DA 3BSWA 3Q11A 3WQRA 3VNUA 1GZ7A 2JS7A 3MWGA 1AN9A 3FTDA 3U3ZA 2R2AA 3AL2A 2ZR8A 3PHLA 4RJKA 2PMKA 3ST7A 4RH1A 5JRJA 4M0MA 4WFKA 5BQPA 2CUNA 4RLQA 1ADGA 1NW9B 3RRBA 1VSTA 4Z9BA 1IUNA 3ZDCA 2J33A 3SX4A 1STOA 2PXAA 3UH0A 1MGPA 2V1XA 2ZJ3A 2BEVB 3QYPA 3X1XA 2KI5A 1E5TA 2IZ6A 2OC4A 3AX6A 2IOFA 3OP1A 1DEOA 3P96A 5DFAA 4CV2A 2ZJZA 1N5JA 3LBYA 4XYBA 3UWDA 5B1YA 1GKKA 4J7AA 5KWJA 1T9GS 2HF7A 3FZQA 4ZRMA 1VP3A 3T4PA 4Q9KA 1RP7A 1YUNA 3N2ZB 4CDNA 4DNOA 1GLNA 1PWXA 4YQFA 4AQYB 2VUSA 5GONB 1MX3A 1D4AA 4EX7A 4UTPA 1G59A 4NWIA 2B8TA 3Q9SA 2GN1A 3SXJA 2F3QA 5IJ9B 1PKEA 2W2KA 1Y1KE 3B6ZA 1N1MA 1Y4SA 3LPDA 1XCJA 2PGIA 1DAFA 1RDFA 1C8BA 1N1GA 1XL1A 1P75A 2P40A 3A04A 4DPKA 1OR8A 2V55B 3TGLA 1Q3KA 3VNAA 1XT6A 1X7XB 4CM5A 2ZB2A 4FEGA 3SBOA 1CY4A 2X15A 3MT0A 2Q3MA 4UBKA 3ROGA 1PNTA 4FZVA 1MC1A 1ZHFA 4E70A 4ZZIA 1E62A 1ST3A 2W90A 3GNLA 1JG2A 3MT9A 3LDHA 4NCIA 3HK2A 1XDZA 3N2KB 5H5JA 3H1AA 3KTAB 4JGBA 2FSVC 1E1RA 4OUDB 5DHRA 1KHTA 3ADKA 1JG7A 3QP9A 1E77A 3T3PB 3IMGA 1CE8A 1SUPA 1TKRA 1XE3A 2VSNA 3WK8A 1EK0A 4Q9JA 3HB1A 4DB4A 2PS0A 5DTJA 4RTNA 3CZMA 2DBQA 3I12A 5LBIA 2FE4A 3SZUA 2HO4A<