2B69A

Crystal structure of human udp-glucoronic acid decarboxylase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
312
structure length
312
Chain Sequence
RKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords UDP-glucuronate decarboxylase 1
publication title Crystal Structure of Human UDP-glucoronic acid decarboxylase
rcsb
source organism Homo sapiens
total genus 101
structure length 312
sequence length 312
ec nomenclature ec 4.1.1.35: UDP-glucuronate decarboxylase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2b69A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 2b69A02
4WASA 4YQZA 2C54A 1PS9A 3WGHA 4YXFA 1KVSA 2VYVA 4FGSA 5EQFA 3ZWOA 1L1FA 1SCUA 3JYQA 4HFMA 4Q3AA 4CL3A 1GV0A 1UAGA 4S3MA 4CMGA 5GMOA 4DMMA 4GX5A 1Q2XA 4GSLA 4UULA 4OYRA 4DLBA 4NJOA 3I9KA 3K73O 2YQ5A 3AOGA 3DHYA 3VDQA 5C7LO 2HMWA 1EBFA 4IMRA 3TRIA 1FDTA 3LK7A 4JQCA 4S1VA 1XA0A 3RU7A 3HB5X 4R16A 1VL6A 3HFGA 3JQ7B 1ISGA 1PGQA 1Z74A 1YL7A 2FWMX 1N1GA 1A71A 3KRTA 4R9SA 1YONA 1IZ9A 3GAFA 4CM8B 4P4LA 3GHYA 4JXKA 3GC6A 4YRAA 4GVLA 4TRRA 3I6QA 3CEAA 3IDSA 3TJRA 2CD9A 3VPXA 3ZH2A 4GKBA 4PLPA 4FC7A 1X13A 1HDYA 1I01A 1K2WA 3MJCA 1H6BA 4KZPA 4W6ZA 5TQVA 1TT7A 4XJSA 2HK9A 1U8XX 5F1KA 1SOWA 3ZZNA 4E21A 3I9OA 5COBA 4IS3A 4CM4A 3DFZA 5CP8A 1QXSA 4HY3A 1SPXA 3G79A 4XEHA 4R1TA 1DJQA 3ZU2A 3EMKA 1M76A 3GF4A 4KUHA 1ZW1A 3QP9A 1LUAA 4PG4A 3QY9A 4I9UA 2RHCA 1J49A 1HEUA 2HMTA 2PZMA 3INRA 1KBZA 3H65A 5CPBA 1YBAA 4A26A 5GZ1A 2ZK7A 5F3RA 3FBTA 4XIJA 3GZNA 1WZEA 4HUJA 4PZCA 5KVCA 4J4TA 1TT5A 1NAHA 2PZLA 2ZCUA 1LSJA 2JHGA 3HZZA 2BLLA 4L73A 4NDNE 3KSDO 5FFFA 4Z0TA 4RPJA 3F3SA 4QQRA 5JMPA 2GASA 2P2SA 1CETA 4HP8A 2NVUB 1ZCJA 3NUGA 2JCXA 4AJNA 1UAYA 3B1KA 3GG2A 4EUFA 4Q9NA 4I5EA 1U7HA 3ZWCA 4BV9A 4DYVA 2FY8A 1ZK1A 3O38A 3QWAA 1MG0A 2DBVO 1GUFA 1ZZEA 4LISA 3PHLA 3F9IA 3Q0EA 2H6EA 2V6FA 3ETDA 4UAGA 4UUNA 4R1NA 2QQ5A 1A27A 5B37A 4DWVA 1JLLA 1P9LA 4P22A 3WDSA 1B0AA 2G5CA 4IUYA 3E9MA 5HS6A 3HWRA 3NJ8A 5TIIA 3GDOA 4FS3A 1PGPA 5K9ZA 4C7JA 4DC0A 3RBVA 5ILGA 1DC6A 3STHA 2JFGA 2XF8A 3S55A 2B83A 3FR7A 1I2BA 5BSEA 1T2AA 2VTDA 4AJPA 3Q2IA 1LDEA 3G1TA 4HNHA 3A28A 3FTNA 1UH5A 2R00A 4L9RA 3RC1A 3DWFA 1KEUA 4GAEA 1D4FA 4Y67A 3WYEA 3WQQA 2YJZA 2O3TA 1KYQA 1G0OA 4AJEA 3KYCA 3PIIA 4NU5A 4BS9A 3S8MA 4E2YA 3PQFA 3H4VA 1ONPA 1Z73A 1GDHA 4XKJA 2Y66A 4XYBA 5TGDA 1LI4A 1XYGA 4XQ9A 4BIIA 1DIAA 1VSVA 2FPPA 5G0SA 3H3JA 1B3BA 4CPDA 1IHXA 4CMBA 1AUPA 1B2LA 1ZNQO 1MGOA 1E3WA 2YDXA 4OSOA 1E6UA 4QT0A 2VHYA 3LC2O 2G76A 3FN4A 4R01A 4RLHA 1DO8A 1Y7TA 4D79A 1LSUA 2IODA 1NHWA 3TL2A 4WCDA 3ADPA 1E3JA 4M89A 3GRPA 1Q0HA 4IDEA 5C5IA 2D0IA 5CHEA 1HSZA 2Q1UA 3HDQA 2DBQA 4TWRA 3MWDB 5JC1A 1U9JA 3LT1A 1ISMA 5AYVA 4CM1A 1UDBA 3I1JA 1G6KA 1ONNA 1BDBA 4GH5A 5F1PA 1NASA 3OEWA 1X1EA 3H7AA 4FOOA 2O7SA 4U6QA 3FNHA 4KWIA 3G17A 3H5NA 3M2PA 3HDHA 1A72A 2O50A 4ALJA 4BO5A 2TMDA 1B14A 1E7MA 1HDGO 4U8GA 2FR1A 5EQDA 3G1UA 1IE3A 3LLSA 4ZGWA 3M2TA 4JGBA 4PLYA 1OC2A 5ILOA 5JE8A 3KEQA 2C59A 4UVDA 1XU9A 5C37A 1O8CA 3L4BA 1DSSG 5U9CA 5DBFA 3X2FA 1T2DA 3BHJA 2UV8A 2Q45A 1J5PA 3GVPA 3IKVA 1WMBA 1XU7A 1KY4A 3CSDA 4BO1A 1QSGA 4QO7A 1PJ2A 1E5LA 1L7EA 2C2YA 1JWBB 4N54A 5JDIC 3WYBA 3RSHA 1QMGA 2PD3A 1N1EA 2OMEA 4UVIA 4BB6A 5L95A 2B4RO 1N8KA 2HAEA 4I5FA 3NDIA 4RDIA 1E5QA 3RFVA 2I3AA 4R9RA 1EUCA 4OQYA 5FYDA 1YQDA 3ONEA 3DQPA 4R1UA 3UCXA 1R16A 4I5DA 4OAQA 1HXHA 5FF9A 1LTHR 1B16A 3AI1A 1V0JA 3JD4A 3G3EA 1NVGA 4PZDA 1ZK0A 4Q3BA 1PWXA 4MIEA 4N5LA 4OXYA 3JYPA 3WWZA 4DL9A 5TRTA 3W1VA 1C1XA 4L76A 1WMAA 4BGEA 3C7CB 4YTEA 3DZHA 4JK3A 4J43A 5CDYA 4BO2A 2ZQZA 2QRJA 1DC4A 3DHEA 5BQFA 3O03A 1TB4A 4NMHA 4OXKA 1GU7A 2PTGA 3D3EA 3DBRB 1CWUA 2ZTLA 1PEDA 3DOCA 4PLFA 2E82A 4GGOA 4M86A 2VRCA 4R1SA 3Q2KA 1CRWG 1KC3A 4ZN6A 4ROSA 4BL5A 1K3TA 3GN2A 1XQ6A 2F1KA 3ITDA 2P5UA 4QTZA 1IUKA 1YQGA 4Z3KA 1SEPA 2Q99A 2QX7A 3S2GA 4BNYA 1Z75A 5IAAA 4JBIA 4N18A 4WCFC 1ENZA 2QZZA 3DZGA 4WOKA 4J0EA 1MFPA 4KTTE 3UCEA 2GZ3A 5IXSA 3CUKA 1YBVA 5DBIA 3PFFA 4TZKA 4DPLA 1U3VA 4EUHA 1JAXA 2BRUA 2PKQP 4J3FA 3ANMA 4M54A 1YDEA 2PZKA 3ASVA 5CDTA 3C3XA 2VYND 3PDJA 4PLTA 3TNLA 1UXKA 1QYVA 2JCVA 3BMCB 5KIAA 2VWPA 2WD8A 3EK2A 3NEPX 1E7SA 3LZ6A 4PRKA 2C0CA 1K6IA 7ADHA 5HRUA 4WLNA 1DFGA 1ZVMA 4GX0A 1XGKA 3P5SA 5IFLA 1GCOA 3WJAA 3K30A 2X7HA 1BHSA 4WECA 1NQOA 4CQMD 5DP2A 5KKCA 2Y99A 4AG3A 2OFPA 1BXKA 1PR9A 1JN0A 4WLVA 5A02A 3AM5A 5CEFA 5GZ6A 4EJ0A 2W90A 2RCYA 1SZJG 5L7WA 3SEFA 4CMHA 2ZQYA 3B1JA 1M6WA 4MKRA 3GUYA 4OGWA 1B8UA 4K6CA 1GQYA 3ENKA 3EZYA 4U0JA 1N9GA 1SB8A 1NPYA 1NVTA 3HDYA 4FR5A 3WYCA 1J6UA 1GQ2A 2OBYA 3HDJA 1U3TA 1LSSA 5DOZA 5DCYA 2LDXA 1IULA 3D64A 4WNCA 1DIBA 2OP1A 3KTDA 2RAFA 3B6ZA 4NBUA 2V65A 1X0VA 1LDBA 3W4JA 4B3HA 3ULKA 5THQA 3L4SO 3JYNA 1KEPA 3UUWA 1T1RA 3AUTA 1WDMA 5U4QA 3QRWA 3H9EO 3Q3CA 2O3SA 4B4OA 1TXGA 2ZKLA 1FDVA 3G0OA 2EF1A 4QUKA 5ENVA 2B0JA 2CF5A 3MJEA 1H6CA 1YOVB 4NPCA 3SLGA 1H94A 4BNKA 1WDKA 2Q4BA 2X0RA 1QV7A 3QVSA 4XDZA 4CLOA 3RBZA 4Q3NA 1S7CA 2UUOA 4U5QA 1E3EA 1PJ3A 1KETA 4XR4A 3JQFA 3DBLB 5G0VA 5C7IO 4BO3A 1RPNA 1YL6A 1FDUA 3F4LA 3W8EA 3D7LA 5CEJA 2CY0A 5CFZA 1VKOA 2O4UX 4D43A 1OFGA 4A27A 1NWHA 3QJ5A 4FD3A 4TVOA 1GTMA 2WYWA 4OQZA 2PGJA 2V6BA 2VQ3A 1HDXA 1O95A 3O9ZA 3BIOA 3VVCA 2QRKA 3DL2A 2Q4EA 3BMQA 3AUAA 3QWBA 2PY6A 3EC7A 4ZHSA 1V3UA 4JIGA 4XR9A 4YJGB 4LRTB 1GZ6A 1H9BA 2IYOA 2FPIA 2BKAA 1P1RA 4Y98A 1A9ZA 2DTXA 3E18A 2VYVD 3QV1A 1M6HA 2A9FA 1UXHA 2HU2A 2W2KB 4Z0HO 2Z1MA 3JQ8A 3RKUA 1PJ4A 4PG8A 5L53A 4YR9A 3T4XA 3CTMA 4NQZA 1VSUA 3ZDFA 5JY1A 1R12A 3Q9NA 4MP3A 1MXHA 2X22A 4I8XA 3OQ1A 2ZB7A 3I6IA 3LT4A 4YB8A 1DLIA 5IDWA 3WB9A 1DHRA 4WLFA 2C7VA 3WX0A 4IJKA 1GYPA 1HLPA 3PWKA 4IIVA 7MDHA 4AJHA 2VCYA 1HETA 2DVMA 3WSWA 1H0KA 4PZEA 1DIRA 5A9TA 1O6ZA 4KDFA 4LSMA 2Y68A 3ZWVA 3FI9A 3SXPA 3HN2A 2D5AA 1E1NA 1Q7BA 1DRWA 1RJWA 2OL4A 3H9GA 3I9LA 4J4HA 1Y5MA 4LN1A 4BKRA 3NTQA 2E48A 1J0XO 1UR5A 3H3FA 3ANLA 2FMUA 3V1UA 4MP6A 1E7WA 1R15A 3DZBA 1UDAA 1DBVO 5A3VA 5IDYA 4JP2A 4EEZA 3KZVA 4YT4A 1EQ2A 3HE3A 2Q46A 3D0OA 3E8XA 4N5NA 4QO8A 5T5QA 2HRBA 3RU9A 3AM3A 4B4UA 1OOEA 1Z82A 3BMNB 4DBVO 1R4MA 4NR0A 2J3KA 3NGXA 4YAJA 1NR7A 2JAPA 4MVJI 1F17A 1NVMB 3NT5A 1Z7BA 3OA2A 3PQEA 3K9QO 4FFOA 2GD1O 1XEAA 2GPTA 4WGGA 1ZK4A 4Y8VA 3TL3A 4B79A 1IOLA 2AQIA 2FR0A 3BAZA 1GY8A 3PP8A 4ND4A 4NBWA 4R4JA 3ZNNA 3L77A 1PL7A 2O4CA 3RWBA 4QFDA 1GD1O 1ADFA 3AM4A 3NJ4A 4YAIA 1PGOA 3CH6A 3JTMA 4B4VA 5FWNA 4PVDA 2WTBA 4KDEA 4IZIA 3TOXA 4YJHB 3EZLA 3P19A 5CPFA 3WLEA 3R0IA 4M49A 1LNQA 3K5PA 1SOVA 2PH5A 2WMDA 5AOVA 2IZ0A 4BNZA 4J6FA 1L7DA 1FDSA 1TEHA 2B69A 3RC9A 4E0BA 4CLXA 1Y9AA 3EGOA 4GMGA 1R4NB 2HUNA 3ZV5A 1ENPA 5I9LA 2Q1WA 2A35A 3JQGA 3RKRA 3F1LA 3ORFA 4XGKA 5L3ZA 4DPMA 3JQBA 5HTOA 1DC3A 1P1KA 4NJMB 3NAQA 5I7SA 2FN7A 5B4VA 1RYEA 4WUVA 3JSAA 4J2OA 4YAEA 1Z6ZA 1JA9A 3H9JA 3I9MA 5L51A 3EDMA 1V9LA 4FIZA 5THKA 3OJOA 4HWKA 4GLOA 4D44A 4OH1A 5BSHA 4GBJA 2B36A 2UVDA 3PXXA 3ETEA 4CLHA 1WAMA 3U4IA 4CM6A 4FCCA 3GGOA 4J1NA 1HZJA 2CF6A 3V1YA 5TC4A 5KVQA 1ISJA 3WJ7A 3ZI0A 1BXZA 4ZICA 2P4HX 2J5QA 2OP0A 4N7RA 3NKLA 2IEDA 3ADOA 3ZCXA 3VDRA 4YRBA 4Y6PA 4IXTA 4YPOA 1OI7A 4PRLA 3V1TC 5JAZA 5KJ1A 3OSUA 2I9PA 3FRJA 5C7OO 3ZNOA 2YZ7A 2IZ1A 2HRZA 4YBZA 4H7PA 3SX2A 3ZV3A 5FEUA 2AXQA 1HWYA 3KSUA 4IM7A 4LW8A 3I4FA 4EJMA 5IZCC 1PJLA 2NLOA 3AFMA 4OSPA 4RF3A 1SNYA 1AHIA 1WZIA 1MV8A 4W7HA 1VC2A 4ZQEA 5A05A 3D1LA 4L4RA 2QYSA 2O2SA 4PFJA 4CQMB 3VH1A 3DTYA 1NQTA 5JO0A 3L6OO 3WMWA 2EWMA 1F0YA 1ZK2A 3MOGA 3OICA 5K6AC 1GYQA 1T4DA 2X9VA 4M55A 1GUYA 1ZO8A 1R6DA 3NTRA 4EUEA 4IIUA 4B4WA 1HTBA 3W6ZA 1EQUA 1VE9A 1NWCA 2GDZA 5G4KB 3QQPA 4IDCA 5KKAA 3ZHXA 1DAOA 4J7XA 3WGOA 1CDOA 2YYYA 5G0WA 1FXSA 1YBMA 2VRBA 2XXJA 5CDSA 1YVEI 4F3YA 3UH1A 5ADHA 4BVAA 1SBYA 3GNSA 3DZJA 1DEHA 5JYEA 3UVEA 2V6GA 1ZEMA 3N7UA 3GUCA 3VPHA 2W98A 1PZFA 2ZIZA 2RHRA 3IAHA 5COQA 2UDPA 1DLJA 2EIHA 2G1UA 1R0KA 3DMYA 4XB2A 1BG6A 4WPGA 1UP6A 2J8ZA 2JFFA 3VKUA 1E3SA 5MDHA 5IXYA 2P9GA 1OAAA 4BMVA 5TT1A 1N92A 3ZV6A 3ONFA 2O48X 3FF4A 4FFNA 1SC6A 4XQCA 3RFXA 1V35A 4YJFB 1U4OA 5ICSA 4W9NC 1W73A 3P7MA 5B4TA 4XQGA 3TZ6A 4Q39A 3WGGA 5AQ1A 3AUSA 3MTGA 2Q2VA 4LCJA 4ZA2A 1KVUA 2DFDA 2NU8A 3RD5A 5L4NA 3PTZA 5HA5A 3V2UA 4FSHA 2X5JO 2A92A 3LYLA 1EEHA 2WD7B 1Q7GA 1DJNA 4ALMA 4CR8A 4BGUA 1N7HA 2GCGA 4IBOA 3PEFA 4XGIA 3HB4X 2BF7A 4BKOA 5KCZA 1YQXA 2BGMA 2EXXA 3C8MA 4LMPA 3RUEA 3AW9A 3D4NA 3U3XA 3BTVA 3OM9A 4U7WA 1M75A 3GGPA 4BNXA 4I1IA 1N7GA 4I9HA 3CIFA 4XYMA 3AOEC 3IP3A 3DBHB 3PRJA 1C0LA 3QWHA 2CVOA 2Y0EA 4IQGA 3PZRA 4J16A 2IXAA 3LF2A 5IF3A 2Q3EA 1LXCA 1EK5A 3OMLA 3AJRA 3A06A 5ENDA 2PD4A 1LX6A 3CZMA 4UREA 3F5SA 3GPDG 1A4UA 1ZKMA 2P5YA 2G82A 5TNXA 2RBEA 1V3TA 4GWKA 4JJIA 3C24A 4MVJM 1XWFA 5DULA 1YRLA 3I9NA 2ZJ1A 2VRCD 4BMNA 5JY6A 1P31A 2Q1SA 3U4CA 5KNLA 5A5EA 4HNGA 2OZPA 4HFJA 4XRRA 2CZCA 1P74A 4IDBA 4BKPA 1G1AA 1YL5A 3F46A 1RM4A 5F1OA 4IJUA 1E7QA 3ABIA 1E0DA 5A04A 1PQWA 3DC2A 4RQUA 2H5LA 3UFXA 4XYEA 3VKVA 3WTCA 4L4XA 5AXAA 1E6WA 3VPGA 4FPXA 2R6JA 2ZTVA 4B3IA 4R3WA 1PJQA 1ZSVA 3JQAD 1PJCA 2JJYA 1I24A 4XCVA 3PLNA 4UVEA 4K9DA 3NDJA 3IP1A 4WNIA 4ALLA 4CM4B 2EJWA 2H63A 3OEYA 2GYYA 1LBEA 2ZJ0A 3DXFA 3EYWA 4FFRA 2DU8A 1ZIDA 2NUAA 1B3RA 1LLUA 3MOIA 4XZ3A 1NP3A 4TRMA 3VHRA 1EVZA 4A73A 3OIFA 3JYLA 3QWIA 3H2ZA 3OJEA 4FFMA 1WPQA 2G17A 3TOZA 4E5NA 2Q2QA 3PHIA 1OC4A 1I3NA 4FW8A 4CM7A 4RVDA 1OMOA 4EEXA 6ADHA 3A4VA 2DTDA 5G2OA 2GN4A 4BO4A 1DAPA 2EEZA 3UOGA 3WS7A 3C7DB 2ZTMA 4MOWA 3GOHA 4OOEA 3RQSA 4J90A 5LC1A 1HSOA 3VTFA 4DQUA 2EP7A 2YFQA 3A1NA 1J4AA 3CMMA 1I32A 4WLOA 2P68A 3JD2A 2JD2A 1DB3A 1S6YA 1VJ0A 2X86A 3JQ6A 4OIMA 4DGSA 1LLDA 5EESA 4RPHA 5IDXA 2BD0A 4II3A 3QLJA 2R00C 4KTVE 1VLLA 1XSEA 4IINA 2HQ1A 2Q2WA 4XJTA 3WQSB 4CLRA 1PIWA 3GMSA 1DHTA 1EUDA 5JDCC 3LT2A 3UW3A 3KO8A 2PWZA 1Y6JA 2O3RA 3VAZA 2BFMA 5ITVA 1H5QA 1Y8RB 3K6JA 5JXWA 1MLDA 3RFTA 5G0UA 2IE0A 1JVSA 2QZ9A 3L07A 4FJ2A 3ZU3A 1B7GO 1JW9B 1GEEA 4N5MA 1ZJZA 1MA0A 4UUPA 1I2CA 2PV7A 2CDBA 3SJ7A 2RIRA 2FSSA 2RH8A 4CM3A 2I3GA 1YB1A 3OF2A 3KV3O 4INAA 5KJEA 4NFYA 3DO5A 4CLDA 2GN9A 2DKNA 3KUXA 5DNAA 1I33A 4I08A 5JDIA 5L45A 3KYCB 2JKVA 2P9CA 2DC1A 2NTVA 2WDZA 5F5LA 3DBRA 1EUZA 3ZWNA 5HM8A 3JQCA 4CMKA 9LDTA 3C1OA 1IHYA 3COSA 3EHEA 3NDRA 4NU6A 1YJQA 1K0UA 1ZEJA 2UYYA 4BNVA 3VOSA 1XQ1A 4CM9A 4MPDA 1P33A 3RUIA 3ON5A 2GO1A 1QLHA 1SMKA 3NRCA 5HS4A 3H2SA 3TSCA 4E2ZA 1A9YA 3C1AA 1YDWA 3H8VA 2NWQA 3WGTA 3GGGA 4RLSA 2PA3A 4DIFA 4EITA 1V3VA 1ZMOA 1ENYA 3IJRA 1R66A 3L6DA 3QVTA 4J9UE 1B26A 2BFAA 3DB2A 1NYTA 5JCJA 1QR6A 3S2EA 2CVZA 4J91A 2IXBA 4QFCA 4IDFA 3WXBA 4CMCA 2AHRA 4D41A 4NBTA 3QIVA 3BMCA 3ZWAA 2OBNA 5L40A 5H82A 1IPFA 4CMJA 2GZ2A 5A1TA 3DMTA 1RYDA 2VT3A 3AU8A 1QV6A 2JAHA 5GY7A 4CJXA 4ALKA 2AE2A 1U7TA 2HMVA 4YQYA 1G0NA 3C7AA 3PVZA 2X8LA 3P2YA 1PWZA 5DCUA 1I8TA 5I7EA 4ITUA 5BNTA 1Z7EA 2EKPA 4MIOA 2GUGA 3GDGA 5L7YA 2OXIA 2VHWA 3UCFA 3PHHA 1IY8A 3I83A 3TQHA 1D7OA 3PDUA 2I5PO 4HV4A 4Q3CA 3GRKA 2PKQO 2C07A 1K5HA 1OZAA 3KEOA 2VZ8A 1UJMA 4DUPA 4Z9XA 3FBGA 3LC7O 3U9LA 1CQIA 2CNBA 2Y1FA 3AY7A 4JBGA 2DUUA 4O6VA 4DTIA 4OL9A 3ROPA 4L74A 4R3NA 3H9UA 3KB6A 4D0RA 4E5YA 1U5CA 2I99A 2X5KO 3G49A 3RCBA 4PN3A 1DFIA 4R51A 1D3AA 4R68A 4XD2A 2NQ8A 5EJ2A 4HBGA 2E6UX 3LDHA 2X0IA 2EW8A 4DMLA 4WCFB 2QG4A 4ILKA 2O3QA 1VPDA 2DPGA 2O2YA 4Q3EA 4Z9YA 4E5KA 9LDBA 3L6EA 1C1XB 4B8WA 4CMEC 4NZ9A 3MJVA 2Q49A 3L9WA 4DLAA 1B8VA 3DDNA 4TKLA 1BXGA 1XLTA 3TN7A 2CMDA 4KUEA 1I0ZA 4CMIB 5T8KC 1B8PA 4GWGA 4NH4A 3FPLA 4YACA 3IUPA 3ENNA 5EN4A 3DBLA 5IN4A 5JW6A 4DIOA 4XWYA 1JWAB 1HE5A 5CG1A 2X0NA 3GNTA 3EAGA 2IDZA 2GZ1A 1U28A 4IQ8A 3ETGA 4P4NA 1X15A 5DBGA 3PJEA 5DF1A 4NBRA 4Y6SA 2PR2A 1P1HA 1CIVA 4ZQHA 1PU2A 1U4SA 3KYDB 3IQDB 3AI2A 4ZQFA 1UZLA 4Y6RA 2QIOA 4MINA 2D3TA 3ANNA 4RVHA 4J1SA 2HMSA 3KBOA 5T64A 1O5IA 4E32A 1WVGA 4JP3A 1TLTA 1U3UA 4G2NA 2P4QA 1DXYA 4P4GA 1ARZA 3ITKA 4QXMA 3DONA 4UVHA 3RUHA 3JQAB 4NK4A 4CV2A 1JVBA 1H2HA 2JFHA 4JROA 1Y8QB 3CZRA 3UICA 1BTOA 1WP4A 2NU7A 3LT0A 3RUFA 1PZHA 3RI3A 1QYWA 2YY7A 4CM5A 3PHGA 1KVTA 1QYCA 1MC4A 1T4BA 3E48A 1E3IA 1PL8A 2GF2A 1CERA 1AE1A 4ND3A 3T4EA 3ZGYA 5B12A 1P1IA 1ZUD1 5TS3A 1HDCA 4H15A 3EUWA 4BNFA 3SLKA 5A9SA 3W4KA 1SAYA 3IL2A 1RWBA 2EJVA 4RVSA 4YA6A 1CEQA 1UUFA 4FFPA 3WGZA 5KJFA 4D7AA 5L4SA 3U09A 4OXNA 1ZSNA 4U6SA 1F8GA 4D3DA 2VT2A 3UAGA 2OO5A 5JS6A 3ZNPA 1EBUA 2HDHA 3U4HA 5JCXA 3R3JA 3I4CA 1PR3A 4K6FA 4UUMA 5JLAA 2FR8A 3VPFA 1PQUA 4R5HA 3GK3A 3MJ4A 4LK3A 3SVTA 1Y81A 3HJAA 3K31A 3D3WB 4MO2A 3SJUA 1N9GB 3DZIA 1NTOA 4EW6A 1ULSA 1U8FO 5ER9A 3GY0A 1I3KA 2J3HA 3OP4A 1CYDA 4ZRMA 4L8VA 1LEHA 4NIMA 2J6IA 1P77A 2O3JA 3BMNA 5BR7A 2B37A 3JQFC 4MVJH 5F5NA 4D3FA 4HX5A 3RUCA 3IIEA 4BQPA 4TROA 4F6LA 2BI8A 4E30A 3M1LA 4MVJF 5AVOA 4PG7A 1HYHA 2GN8A 1AXGA 5L9AA 3QW2A 2EHDA 3FNEA 3WLFA 5ER6A 2Y1EA 2IRWA 2YUTA 4YDRA 3H9QA 3UF0A 4EBFA 4CV3A 2W2LA 4DVJA 4CLOB 2YV2A 4BNHA 2NVWA 3DAPA 3GHHA 3X2EA 4AJ2A 1XCBA 3Q6IA 4II2A 1NPTO 5AXBA 2XXBA 4PLCA 1E3LA 1HDRA 2VUUA 4YAGA 3IC5A 3RBXA 3QE3A 2OUIA 1WW8A 4MVJA 3CE6A 3FNFA 4YEDA 1E7YA 1ZXLA 8LDHA 4XYGA 4UEJA 1C1DA 1KVRA 3ZWXA 1AN9A 2YDYA 5EIOA 3ICCA 3TDKA 1CQJA 2FP4A 3CPSA 4RVUA 2Y0CA 2JHFA 4CMAA 2E4AA 1U3WA 2D5CA 1UP4A 1YB4A 2EKLA 1JKIA 2GNAA 1O0SA 1ZJYA 2BFOA 2GERA 2VZ9A 1A7KA 4RQTA 4ZD6A 4YYZA 4Q3DA 3FSRA 2Q1TA 3KM0A 1U2GA 3O8QA 4R69A 3AFNA 4RF4A 5HBRA 3UXYA 2ZB8A 1BDMA 2GSDA 4CQLB 1UP7A 2FHSA 4RVGA 3VH2A 3UHAA 3QVWA 3DAGA 3OA0A 4MP8A 2DAPA 2NADA 1MFZA 3DR3A 4MVJG 3ZU4A 1KVQA 1ZH8A 1PZGA 2X5OA 4PLWA 4LSWA 1K89A 3WMXA 1DIHA 3BMOA 1LRJA 1HF3A 3GMDA 3RAJA 1YS4A 2WSBA 3D4PA 2VYNA 3K96A 1C0PA 1LRLA 2UUPA 4GMFA 1H9AA 1PGNA 5TSDA 4HFRA 3F5QA 2WYVA 2HSDA 5DN9A 2HO5A 5J23A 4YRDA 3WGQA 1VJTA 1W4ZA 4GVXA 4OKIA 1LQUA 1ISHA 4LVUA 3BYZA 3SC6A 3GAZA 3E82A 5AXDA 3ROMA 2C29D 2CDAA 5H83A 3WNVA 1W8DA 4CQMA 1T2EA 1NAIA 3WIDA 2R2GA 2OORA 2B5VA 2FOIA 1BW9A 4BGVA 2I66A 1R4MB 4J7UA 4QX6A 4GPD1 3JQ9A 3O26A 3QA9A 5BNFA 1MX3A 3JQDA 1A5ZA 1Q1NA 3BHIA 3GLQA 3BA1A 4JX8A 1LRKA 1E7RA 1NHGA 4MIYA 3I9JA 2OGUA 3PJFA 3WG9A 2DBZA 4DXHA 2Y0DA 3NV9A 2WE7A 1CF2O 1BVUA 2PKRA 3FNGA 4XRGA 2EW2A 1T26A 4GKVA 2ZYGA 1IZ0A 3ZHYA 3O4RA 3IOYA 2TMGA 4CUKA 1F06A 2FZWA 1NBOA 4TRNA 1GQQA 1NFFA 3RJ5A 5T67A 2VWHA 2YV3A 1EE9A 2HJSA 3U49A 3ZWBA 5IZ4A 2NTJA 4WKGA 3ICPA 4GSKA 3OIDA 4L0QA 3V2GA 3PGXA 1PJSA 3K2EA 5IN5A 3L9XA 2P9EA 3WWYA 5JSFA 4BO0A 2C2XA 2C82A 2GN6A 2QHXA 2BH9A 5DCWA 3JQGB 4YJFA 4E2WA 2YW9A 2AEJA 3QWFA 4NG5A 2AEMA 1PX0A 5HWSA 4O63O 3F47A 2I65A 1YJ8A 2Y67A 3JQ7A 3ZW9A 4KQWA 5TF4A 4ESOA 1NR1A 2YHIB 2ZYAA 4AJ1A 4CM8A 1E1MA 4E33A 1GL3A 3JD0A 1PS8A 1EDZA 2ET6A 2IEBA 2ZB4A 4JJGA 4A03A 3KHUA 4BNMA 1HYGA 4Z3DA 3I52A 5DZSA 3ROQA 1EFLA 3RROA 1YE3A 3FCOA 4NI5A 3U4DA 5CDGA 2VHVA 4W9NA 3TWOA 3DBHA 4OKNA 3RUAA 2B4QA 1NQAO 1PJTA 2PGDA 2YV1A 4TSKA 1EVYA 4IGFA 2HKIA 5JNLA 4BNTA 4MKZA 1GUZA 1GYRA 3DFUA 2AQ8A 5JC8A 2X58A 1NM5A 4WEQA 3TZCA 2Q50A 5LCXA 3R3SA 1F8FA 2NU6A 4NNJA 4WLEA 1EDOA 4XA8A 3RC7A 1OBFO 1O94A 4J1TA 4K1LA 3B20A 1I5RA 4PIVA 2PFGA 3T7CA 1M2WA 2AW5A 2VZ0A 4E31A 4DA9A 3LU1A 3F6YA 2X0JA 2E49A 2Y1DA 4CM9D 4WOJA 4PLZA 2NVUA 4W99A 3AOEA 4C7KA 5A3JA 2I76A 3D5TA 3GFGA 4FJ1A 4J4BA 1M66A 1GCUA 3GN1A 3FWNA 3KLPX 4DQVA 4F6CA 2V6MA 2YHUA 1ENOA 4CV0A 2PLAA 4DPKA 1KERA 5JCJD 4RF5A 5CDUA 3UGKA 3PI7A 3TZHA 1KEWA 3KOUA 2BFPA 3OETA 3PHJA 1W0CA 2JD0A 3C85A 3R1IA 4BB5A 3W8DA 1FF9A 5TJHA 1Q0QA 3WGYA 1TI7A 1I3LA 4MVJE 3WQRA 1BSVA 4B8ZA 4XYLA 4XX0A 1M67A 4MVJP 2HLPA 4PLGA 3WOHA 5F21A 1LJ8A 2DFVA 3JYOA 3PJDA 4J49A 4M87A 3ST7A 3U5TA 3OJ0A 4ZRNA 2J3IA 2LDBA 3DZKA 5T57A 3WFJA 4ID9A 1SO8A 5H81A 1C3VA 3F4BA 5DT9A 4CL8A 2C5EA 4PG5A 1ZFNA 3EVNA 2D4AA 1GR0A 4HADA 4WEOA 4BMSA 4LCEA 2NTNA 1O89A 3I5MA 2H9IA 4CLEA 3DBVO 4D0SA 1PL6A 3VH4A 4BQRA 4R5MA 5G0TA 3ASUA 3GVXA 1EVIA 5IG2A 1BWSA 3CXRA 1C14A 4GL4A 5COAA 4E5PA 5TJ9A 4EGFA 2A4KA 2EKQA 2WYUA 4E12A 1MG5A 5ITWA 1ZSYA 4RV9A 4E4YA 3GEGA 5BSFA 3PYXA 4OJNA 5EPOA 1WNTA 1C0KA 3PK0A 2DUWA 2NM0A 2WEKA 2CUKA 3TF5A 4RPKA 1GPDG 3BTSA 3GEDA 4ND5A 4P38A 3AUUA 3GEMA 4KWHA 3LVFO 4BOYA 4Y9DA 5I8WA 3PPIA 2PGLA 3PYMA 3RIHA 1JTVA 3KETA 3AU9A 4BUCA 3ZWYA 1HE4A 1HLDA 1LA2A 4DQXA 1F12A 4XIYA 1T2CA 1EZ4A 5CEEA 2PK3A 1QYXA 3HUDA 4KP7A 3H5AA 1LU9A 1E92A 3SBOA 5L4LA 1HKUA 2IYPA 4DBZA 1JAYA 1BMDA 1UZNA 1IL0A 1Y8RA 2ZTUA 1JQBA 2BMAA 3GZNB 4FB5A 3I3OA 4RDHA 3W8FA 2DBRA 4BO7A 3IJPA 3TFQA 1TT5B 2GGSA 3VH3A 5KWEA 4TRJA 2VHZA 5U1PA 4GX1A 2HK7A 3QVOA 2AG5A 4IPTA 4R54A 3TPCA 3GT0A 3I23A 3WIEA 4E13A 2UAGA 4A5OA 1NFRA 2HCTA 3B70A 1X7GA 3ZV4A 3U62A 1X14A 2X4GA 2V7PA 3CINA 2VUTA 3HADA 4I5GA 1AHHA 3MZ0A 3E9NA 4FOSA 5JDCA 1IB6A 1LLCA 4XGNA 1X1TA 3HFSA 1X7HA 2CFCA 2Z5LA 3R6DA 2FZEA 4IDGA 1DPGA 1VI2A 1U2DA 4E2XA 5KOIA 4WK6A 1IYZA 2EG9A 3LF1A 3PJGA 4DLLA 5I9MA 1P1JA 4JN6B 5DOVA 3B1FA 1CJCA 3ZWMA 2D1YA 3Q9UA 1YKFA 3ZNQA 3EVTA 2WM3A 1I36A 1PGJA 2E37A 2EGHA 4J1QA 4WE3A 1X0XA 5ES3A 4ND2A 4F46A 2YQ4A 1HDOA 1UXIA 1D1SA 5JAQA 2NV6A 5IDQA 1JU9A 2XAAA 1ZXBA 1XG5A 4EI2A 1XDWA 3BTOA 4PLHA 5BSGA 2NVBA 1WLYA 1N2SA 4FC6A 1RM5A 1ZK3A 3K8ZA 3A14A 4FQ8A 1LC0A 3Q1LA 2C5AA 3EW7A 1A7AA 1KOLA 3W6UA 4AICA 4IDAA 4QEDA 3U0BA 3RUDA 3WSVA 3CMCO 1LDYA 2AG8A 3GZ4A 2X9GA 3FTPA 3OJLA 1N5DA 5KJCA 5JO9A 1KC1A 3OQBA 4UVGA 1TA4A 4R41A 2WWRA 5TX7A 1R0LA 2B4TO 4JLWA 1E3WB 3DZFA 2HMUA 3H5RA 1V6AA 3VTZA 2X9NA 5C3MA 3OBBA 5JAIA 5K0ZA 4EDFA 1E6EA 5B1YA 4W82A 5FI5A 4A2CA 1GPJA 1PZEA 3N74A 2J5RA 4IS2A 1GZ3A 4BHTA 1P45A 1BRMA 4E6PA 1A4IA 4H3VA 4ALNA 1ONOA 4CLRB 1ISFA 4TMFA 4X54A 3VPSA 4B7UA 3L4BC 5JBIA 3WGIA 2ZYDA 4G5HA 3HHPA 1RM3A 4PG6A 4GX2A 3OQ6A 1Q0LA 4TQGA 2W2LD 5A06A 4B3JA 4ONEA 4YT8A 3DHNA 1I10A 1NX6A 4RF2A 5A5FA 3UKOA 2J3JA 3INTA 1XELA 1D8AA 4LGVA 1SEVA 3RJ9A 3H6KA 5A4DA 4H16A 5DDIP 4MVJD 1P44A 5I9NA 1DOHA 5BT9A 1LDMA 3NTOA 4G81A 4WCFA 4DIBA 4O0LA 4D42A 1Z45A 4PGFA 3VVBA 1QKIA 1ML3A 2GLXA 2FPGA 3E03A 4RCVA 3E5MA 4W7IA 4J7CA 1GEGA 1HT0A 2QYTA 4RORA 1WXDA 2PH3A 2B5WA 4TZTA 3VZPA 4RO0A 5JAMA 4BV8A 2PNFA 4D3SA 4CR7A 4CMIA 5G4LA 1P3DA 4TKMA 1E1KA 4HXYA 1HL3A 1H6DA 3WNQA 1KS9A 2C7GA 3GVCA 3V2HA 2Y05A 3PFWO 4AFNA 1DIGA 1FK8A 2POQX 4RPLA 3RASA 1WWKA 4B7XA 1YB5A 3DMTC 1UZMA 4JNKA 2OOSA 1X7DA 2CDCA 5A03A 1K6XA 5EMHA 1ADCA 4AJJA 4W4TA 3DOOA 3FWZA 4LVCA 1Q7CA 2DTEA 3KYDA 4Z0PA 1QP8A 4NHEA 2PZJA 4CMEA 2AMFA 5TT0A 1VRWA 5CAEA 5B4UA 4FDAA 2NQTA 4IMPA 1ID1A 1NQ5A 2WJPA 2D2IA 1R0SA 1P0FA 3OECA 1XIVA 4GI2A 4BNGA 1GZ4A 3LSYA 5JFOA 4ZQBA 5T8KA 2I6TA 2CSUA 3JQAA 5DP1A 3OH8A 1Y8QA 1HZZA 5ICMA 1YOVA 4CR6A 1LDGA 5JYDA 4GGPA 4CUJA 4MKXA 3L0DA 3ROKA 2X6TA 2QW8A 5I7VA 1KEVA 3ZHZA 4CUZA 1ZBQA 3HN7A 3ZN2A 3GDFA 4LRSB 4MJLA 1D1TA 1Y9EA 4LMRA 1O9BA 2JL1A 1H93A 3BZUA 1EE2A 1T24A 1T2FA 3KVOA 3RVDA 1NPDA 2XOXA 3VZQA 1GAEO 3TZKA 4AVYA 3AY3A 2NU9A 1UDCA 3IMFA 1PJBA 2RH4A 1UXJA 4AJIA 1NNUA 4EZBA 3AI3A 4RZHA 1RM0A 4YT2A 4FJ0A 2BGKA 2QRLA 5KVSA 3PLRA 1V8BA 2A94A 1K6JA 2Z1NA 3JV7A 1AXEA 2VNSA 1NXQA 3D3WA 2AA3A 4GQAA 3DTTA 1XR3A 4O1MA 4YJGA 2Y1CA 3JD1A 4TVBA 1I2ZA 2YFHA 3WFIA 3GG9A 4A10A 3GFBA 2W2KA 4J2HA 4MDHA 4QECA 3ONDA 2G0TA 4RJTA 5T6BA 1W6UA 1U1IA 1R37A 3GR6A 3WTBA 4IJWA 4RZIA 3WBBA 4UEKA 3HSKA 3QVXA 4FBGA 1QG6A 4L75A 1LLQA 2SCUA 3OHSX 4OO3A 4E3ZA 3HNPA 3DAFA 4NFHA 1YGYA 3V5NA 3KXDA 4L4SA 4IQ0A 3JQEA 4K28A 4F45A 3IKTA 1WDLA 1B15A 3ZWWA 4I9NA 5KVVA 4KQXA 3M1AA 4JBHA 4XDYA 3DOJA 3NT2A 3N58A 4RVFA 3AY6A 4A0SA 1QLJA 1MXFA 1VM6A 1BXGB 3PGJA 4YT5A 5EINA 4CV1A 1DRUA 4BNLA 1DDOA 1DC5A 2VOJA 1FDWA 5EERA 5JPIA 3PYLA 4C4OA 5BNIA 3NX4A 4ZU3A 4NK5A 4GLLA 3PZBA 3GNQA 2ZCVA 3QSGA 2XPCA 3BHMA 4OHUA 4U0KA 4D46A 4DYDA 2AEFA 3VZRA 3KYBA 2W4QA 3VC7A 3MJSA 3MTJA 1ULUA 3GVIA 1HRDA 1XKQA 3ZW8A 1LQTA 3PWZA 4DRYA 3SC4A 3A9WA 1PQPA 1HE3A 2GR9A 1ADGA 2Y1GA 1I3MA 4BGIA 8ADHA 1F14A 3V8BA 5EL0A 4AJKA 5JMWA 3K2BA 1PS0A 3S2FA 2DT5A 1JDJA 1T1SA 1Y5RA 1LSOA 2X1HA 3C1TA 4OOFA 4ALIA 3NT4A 2CVQA 2B35A 2Z95A 1ORRA 1TVEA 4YCAA 4NFSA 3DEYX 1U5AA 4Z9FA 5I7FA 1QRRA 3IS3A 4HFNA 5I8ZA 1Y1PA 3CKYA 3HG7A 4YJHA 4CQLA 3TFOA 1FMCA 3LLVA 2VN8A 4EJ6A 4YVFA 2FRDA 2X23A 2BI7A 3E1KA 1LC3A 3LQFA 3OIGA 1MC5A 1ISIA 3NGLA 4XB1A 1E77A 4G65A 3BTUA 4OMUA 3WICA 3VZSA 5A9SB 4RPGA 4FFLA 1RKXA 1IPEA 2BHLA 1MP0A 1KY5A 4D45A 4IJVA 4UUOA 4AL4A 1R4NA 4AJ4A 4E5MA 5GZ3A 3D4OA 3QHAA 2Y93A 2VNAA 2FSVA 2ILTA 4NJMA 2DLDA 1XHLA 1HDZA 1YXMA 1GV1A 3BXXA 3RC2A 4PCVA 1EMDA 1KIFA 3BMQB 1H2BA 3D5QA 4YWJA 2HK8A 1BVRA 4ZJUA 2HJRA 2W8ZA 4ZVVA 4BNUA 2O23A 1BGVA 2O3UA 4IGEA 2NSDA 1QORA 4J9VA 3GQVA 1ADBA 3JQ8B 1SB9A 1MB4A 4FN4A 3WBFA 2NNLD 3AK4A 1HYEA 4A7PA 4XQEA 1PSDA 2GRAA 4M8SA 4BNIA 4BO6A 1PTJA 4AJLA 3E6AA 4KUGA 4WLUA 4BKUA 1VL8A 3W4IA 6LDHA 2OHXA 2EGGA 4IXWA 3M6IA 2ZB3A 4BNJA 4M1QA 2WE8A 1QYDA 4HKTA 3MJTA 3GH3A 2DPHA 2Y1OA 2F00A 1VJ1A 4JCOA 2NACA 3TZQA 4ZQGA 3FHLA 2EV9A 1DRVA 2AQHA 4BKQA 4DREA 3KLMX 3MCVA 4JJFA 3T7EA 1UXGA 3Q11A 4IY1A 3P2OA 1EFKA 2EP5A 2P91A 2AE1A 5KJ6A 4P8RA 4RL6A 3JD3A 4BO8A 3HQ4O 1C1DB 5MGBA 2JCYA 4Z6KA 3GA0A 3F1KA 3PWSA 5L7TA 3OFSA 2D59A 2DM6A 5IJZA 1H6AA 2YHIA 3GVHA 1ZMTA 3S1LA 3PQDA 5G4KA 1DFHA 3NYWA 4PVCA 4OM8A 2J5KA 3JQBC 3E9QA 5IZCA 4IDDA 4NBVA 3ZU5A 4QSMA 3O8QB 5TLSA 3MEQA 1GADO 5KTKA 3EY4A 2ZATA 2D8AA 3MWEB 1MUUA 2C20A 4J0FA 3WR5A 1YO6A 1VL0A 1NFQA 5AXCA 4FGWA 3GPIA 5K6AA 1VKNA 1GFSA 4BNNA 4BNWA 4URFA 3JQ9C 2BGLA 2IZZA 2EERA 3JCZA 3UN1A 3BMOB 4YJDA 3ZWPA 4DC1A 3K92A 1JKFA 1C0IA 3E5RA 3AWDA 2VOEA 4PLVA 5CG2A 2VHXA 4RGBA 4B7CA 3OJFA 3FR8A 1I30A 2DQ4A 1P0CA 2I67A 1T25A 2BELA 3INGA 4BO9A 1YH3A 1JKJA 4AJOA 4UEOA 3IUSA 2WD7A 3PIDA 4O59O 2H1SA 5LDHA 2VTEA 4IZHA 1YWGO 2VWGA 5FI3A 1BW9B 1P1FA 1EK6A 2VUSA 2O7QA 2PD6A 4KOAA 4O5OA 2JD1A 3LC1O 4WJZA 1FJHA 4EYEA 4YAKA 2AQKA 4CODB 1E1LA 3ZHBA 4ND1A 4KMSA 4K26A 3S2IA 5LDGA 2VWQA 3KSZO 1AGNA 3FD8A 5A9RA 1EVJA 1HE2A 1LDNA 3FPCA
chains in the Genus database with same CATH superfamily
2CYCA 2WFLA 3L8FA 2EDAA 2FJ0A 4F4UA 2IUEA 2PS3A 4FFSA 1DUVG 4BZPA 4YXFA 3CZPA 1KVSA 3KUKA 4FGSA 5EQFA 2VJYA 5LBUA 4KAAA 4AZVA 4CL3A 1ZIOA 2Y6UA 4IILA 3B52X 3CWQA 5GMOA 1KI6B 2OBMA 4DMMA 3H11B 2FK8A 1D1PA 4GSLA 1NGSA 3PDWA 1V26A 2ZBFA 2V4UA 3M8KA 2XGOA 2ZRAA 8ATCA 3AOGA 2N46A 2BFCB 4PQEA 3ESYA 4IMRA 4WACA 3QNMA 1KZ1A 4I6EA 4LKRA 3RIEA 1ZOSA 2ST1A 1WBDA 1JHZA 2WM8A 3RU7A 5CFOA 1XI2A 3VOAA 3PXAA 1AN0A 2DRIA 1D2AA 4C7VA 2FWMX 1HGXA 3KRTA 3L18A 5SZHB 4ZO9A 4ZZ2A 4F9EA 4AN4A 4CEIB 4V1CA 5JG7A 4CM8B 4DXAA 2QMOA 4C6SA 3GHYA 3VC2A 4RY0A 2C2ZA 4KNVA 4YRAA 1IUOA 4G1BA 4M36A 2UZAA 3DDOA 3R3YA 3DVSX 2WUEA 3I6QA 1XEWY 1N25A 2CD9A 2PS0A 3C1UA 3VPXA 4GKBA 2Y92A 4H7JA 4OI4A 1HDYA 1K2WA 2Q0HA 4G2TA 5FBWB 3ELBA 4GBED 3R8CA 1DJLA 3DLBA 1UPXA 5TGZA 4XIIA 2YFYA 2RGEA 2CYAA 4MRAA 3ED5A 2QL5A 3IT0A 2W83A 4R8VA 2R6HA 4CXMA 3OOYA 3UUFA 4DA4A 4IS3A 4F85A 3DFZA 1E89A 2YXDA 4KK4A 2WJGA 3WKDA 1XNHA 1SPXA 4A8HA 3C14C 5BV2P 3L41A 2VDLB 1UT8A 3PFIA 2WJVA 1C3XA 3QLEA 1ICIA 2HA7A 5AUQA 1C1YA 2H1FA 4KUHA 1J06A 2AC7A 3DV9A 1LUAA 2PS1A 3QP9A 2RHCA 3VJMA 3TX6A 4DB4A 1RZRA 3FW1A 5KNCH 4RTSA 1KBZA 2QU7A 4B48A 2PMBA 4EF5A 2EATA 2B25A 3HKDA 5AKZA 2QY9A 4A26A 1NLFA 5F3RA 1DX6A 2QI9C 1GNQA 2WD9A 3F96A 3FBTA 4GPTA 1HFWA 4JOBA 1WZEA 4XUCA 4PZCA 3NS7A 1JG1A 3U39A 3CCCA 1TT5A 2PZLA 3NV7A 3OMXA 3AJAA 3GRVA 3OIUA 4Q9JA 5CB4B 3KSDO 3K0AB 4L51A 5HZMA 1YNSA 5IJWA 5L3SB 4QQRA 3EAQA 5JMPA 1TC1A 4MW7A 3VTKA 4YCSA 2GASA 1X42A 3D6FA 4DNQA 2AZ4A 4CU2A 3IT1A 3U9TA 3MT9A 5JBNA 4PX2A 4YP6A 1PT8A 2JCXA 5CVJA 3HL4A 2DWOA 4I5EA 5KSOA 1M8GA 4BV9A 3RVQA 2YC2C 4Q6WA 3CPJB 3FIJA 3FNRA 4NL4H 3LYUA 5F51A 3N8IA 3R9KA 3O38A 3V2IA 2PMCA 3QE9Y 4MS4B 1W9HA 5E4JA 4KRXA 1CB7A 3U13A 5JPDA 3QMPA 2IS4A 2A9KA 1YCGA 3MLEA 4QDOA 4PGHA 5KHOC 1G59A 3T0IA 1ECFA 2NXNA 3KUUA 1UC9A 4I7EA 1FP4B 2MDTA 1CEXA 1ZIPA 2ZJ3A 4R1NA 5EZQA 1BFKA 4Z8YA 1G5PA 6CHYA 4MCAA 1M6NA 1NRIA 3S2YA 4DWVA 1ESNA 4QGFA 3N1UA 1CDZA 3WDSA 2ZYRA 3JZFA 3TO5A 4D26A 4F4DA 4PRZA 3G2OA 1J90A 2J9XB 3PNOA 3DXXA 2Z98A 1PYOA 1Y9DA 4FS3A 2ZANA 4LK2A 1G19A 2I6XA 2AOWA 2QNIA 2BFBA 1BAPA 4A8JB 4BVJA 4DC0A 3RS7A 2YWRA 1E2DA 2XF8A 1CULC 5EFZA 1YJAA 5KAMA 2HN9A 3RYHA 3UMRA 1YDHA 2H1RA 3IUBA 3VPCA 3V8VA 4LDNA 5LQRA 1XNRB 3GDWA 1ZRSA 1A0OA 5LA6A 2QL9A 3C0KA 4RE5A 3LWDA 3VUFA 3KSBC 5JYCA 4GAEA 4JQSA 3R23A 1J1ZA 3WYEA 2QTCA 3BL6A 3G6KA 1RJDA 4E1VA 1WMEA 2XI4A 3K1TA 2C4NA 4PC3A 1RPTA 1NN3A 4BS9A 3OTOB 3PE6A 3W8NA 3WOVA 4E2YA 4EHAA 3GLKA 2FLVA 2SBTA 2W9XA 3E3AA 4KO1S 4XYBA 1GDHA 4WFIA 3GJYA 5D3KA 5CD9A 1XYGA 4XQ9A 4H60A 4PSDA 2C9ZA 2PRSA 4K86A 5ADWA 2SKDA 2APJA 4JR0A 3TYXA 1ZA1A 3WIOA 1M1ZA 2WNIA 3WZMA 5AM2A 4KITB 1K9SA 1LWOA 2X77A 1J0EA 4UD6A 5LYJF 4UBLA 3TRHA 1Z6QA 4OSOA 5AW2A 5BUCA 3C41J 2GLTA 2VHYA 2ZCJA 1VSTA 3FN4A 4P31A 3RLFA 3KEFA 3REGA 1E6CA 2HRDA 1J33A 3DB1A 3IEIA 4LE1A 4Q6BA 3VOTA 1XPJA 3WA6A 3RYCB 3FHJA 2JGIA 1P2SA 4M89A 1X8JA 1WDTA 3GRPA 4YRRA 1Y9ZA 1G2IA 2R62A 4ZKEA 3ZDQA 3EGDB 1KQGA 4IDEA 3P9RA 4J0GA 5CHEA 1HSZA 3HDQA 4TWRA 1A50B 1V8ZA 3C87A 4G0QA 5C46F 5AYVA 3ML1A 3I1JA 4OYLA 1G6KA 1Z2PX 1BDBA 4CM1A 1NASA 5G02A 3VZCA 4A92A 3NWPA 4FYJA 3FNHA 3H2YA 4KWIA 3VX4A 3KS9A 3G17A 3TAHA 3IR7A 3O92A 4WY8A 2O50A 3EXFA 4R1LA 5I9SA 3A3PA 4BO5A 4BWGA 5AVJA 3SR0A 3X1MA 2FE1A 4QUHA 1IZ7A 4IF4A 2BEJA 4U8GA 5EQDA 1N34B 3LQKA 5CH3A 3I04A 4ZGWA 3DKKA 4K6GA 5SYMA 3SYNA 1AK2A 1AF4A 1SVNA 3SR3A 4RKYA 1T8SA 2JIRA 1H4VB 1YZQA 2ONCA 1QIKA 4MI6A 1HI9A 5ILOA 4O4IF 2RGRA 5HIAA 2FPMA 1DL5A 1QANA 1ZINA 1GLVA 1O8CA 2PVPA 1HNZB 4JJ6A 2FW8A 3AGQA 1FOEB 2FMFA 3C98A 1T2DA 3BHJA 1F60A 3DGEC 2Q45A 1J5PA 3FPSA 4BO1A 1SBTA 1UKCA 1XU7A 1ZI9A 3CSDA 4KIJA 4L0DA 1RJFA 1GRRA 4MGYR 1TEVA 1PJ2A 1F9AA 2O9JA 3AV3A 1I1OA 1I94B 1E5LA 3WRXC 1U5BA 1QIHA 4KIUA 3SIRA 4RH1A 2QBYB 2JFPA 2TSYB 1KZHA 3RSHA 1CUHA 2ES4A 4UVIA 1T8WA 5EJMA 1I7QB 1LBSA 1U7UA 2B4RO 3KL2A 3TEFA 4I5FA 1EWTA 1PKEA 2HAEA 1EM8B 4RDIA 1N36B 3N8DA 4FFBB 1EUCA 1YNOA 4OQYA 2CNOA 5FYDA 2BEWA 1T15A 3LY9A 1HO3A 2P77A 3DQPA 3NH6A 3F49S 3OOSA 3UCXA 3NTUA 4TTRA 1DBQA 2XCTB 4D9GA 4DAOA 3NWEA 3AI1A 4L6CA 4B2YA 3G3EA 1NVGA 3PNLA 2FE4A 1C9DB 1P2GA 1YZUA 3ER8A 2PT7A 1TECE 3RS9A 1V1MA 3PUIA 3RS3A 3A8TA 1KR2A 1ECGA 2AN1A 2FPXA 2VR1A 4WRRA 5JWRA 1C1XA 1QO0A 1ZAKA 3LI2A 2ZRBA 4L76A 3KKEA 3OEED 5DBEX 2BTQB 2PFKA 2QSUA 2RJOA 4ZYYA 1AQJA 2FDRA 3R3ZA 3TVTA 4BO2A 1FLAA 4EWLA 2QRJA 1CFJA 4AWAA 3LTEA 1BN6A 2PPLA 4WZZA 5DTJA 3DBRB 2LBPA 2FU5C 1KYZA 1KZGB 3PQ4A 1IUPA 3PFKA 2O5VA 1P9WA 4GVPA 1Z8FA 4MKGA 4YP7A 1EFAA 1ZD1A 2DB3A 1Z37A 2QM8A 3DDUA 2Q6IA 2QGFA 3DOCA 3NBAA 4JA2A 4EW3A 2F90A 4EFDA 4GGOA 2VRCA 3RNLA 1M72A 5EFOA 4C03A 2OE2A 3HO6A 4MHTA 4FCWA 1U7XA 1XZHA 4R8KA 2QPAA 3RV4A 1K3TA 5HIIA 3L6RA 1Z4JA 2P9BA 1ZMRA 2GWHA 2IGTA 1IUKA 1RLUA 1SEPA 3S2GA 4ZEVA 1ZITA 2B7CA 3S6JA 1ZJ4A 3G2KA 1YB7A 1EXDA 2R4UA 3H18A 1ENZA 3DZGA 2G9RA 5DNEA 4BFYA 4J0EA 4MRMA 4DSTA 4D8VA 1KJWA 3HYTA 2CL6X 1OX4A 4POAA 5HG0A 4TZKA 2RC5A 4UDYX 1TQ2A 3WV5A 2E21A 1RBQA 4UW9A 2A5DA 2R48A 4J3FA 3NVDA 2VYND 3ZGZA 5H3HA 3TNLA 1UBSB 2ZIXA 1UXKA 4HMQA 3OQMA 1AKVA 2YJTD 4OMFG 2LIVA 2VTBA 4KREA 1U1EA 3STYA 1ZG3A 2NN3C 4HLDA 4B35A 3RREA 2IHTA 1OXTA 1CV2A 4MRNA 5B57C 3OLYA 1NX9A 1Q50A 1DFGA 1Z3CA 1L1EA 4BV2A 2J0UA 3ABSB 1D09A 2O2XA 3EOZA 3P20A 1GCOA 4W5NA 4WECA 3TSOA 5DP2A 2Y99A 2VP0A 1O54A 2OFPA 2FGKA 4LV5B 3VR6A 5E3HA 5A02A 1AD2A 4MUGA 1QJCA 1V41E 4KOEC 1KAHA 5DX1A 5GZ6A 1K5GA 2RCYA 4JU9A 3HGTA 1QYRA 1UQTA 2C8KA 2OV4A 4JI7B 2ZRQA 3EEFA 1BS9A 4E03A 5L7WA 1UMDA 2GZRA 5CXUA 2NXCA 4WN3A 4CMHA 2QRZA 1V5IA 2ZQYA 3B1JA 4MKRA 1RRGA 3GUYA 4RH0A 4OU4A 4K6CA 3TRKA 1JHVA 1GQYA 1PWEA 2RONA 1SB8A 3HDYA 3N87A 1NVTA 5IANA 4LJKA 2Q1XA 5TQ2B 3PHBE 1QTQA 1J6UA 1KXZA 1GQ2A 2JW5A 1Z0JA 2J45A 4GLBA 5HZHA 3OPXA 4H1TA 4JFAA 1ZI6A 3O90A 4K6OA 4QFMA 4CGYA 2OCBA 1O6CA 3U3ZA 1LSSA 1O57A 5F5XA 3O7MA 4DEXA 5IC4A 1IULA 4PNZA 4WNCA 3KTDA 4FHEA 1CUGA 4HQFA 2R6ZA 1V96A 4EQZA 5C81A 3QXHA 4DSOA 5E6RA 2HLHA 1ML4A 1U9IC 1LK7A 1NVFA 1RJ9A 1IRXA 1XZCA 2BF4A 2C03A 4HGQA 4ISBA 2D4HA 1GG2A 4ZIRA 3AR2A 5THQA 1WSDA 2I4IA 2N3ZA 3JYNA 3VGPA 2I2DA 3SHQA 3X1XA 3PUJA 4AUEA 3AUTA 1WDMA 5U4QA 3VFDA 2JJ1D 4WESB 2QUKA 4F21A 1TM1E 3OKAA 3ZY2A 4B4OA 1TXGA 1QM5A 3PDCA 1BOOA 1FDVA 2F9MA 2BEUB 1ES9A 3MD9A 3SLGA 3K8YA 3BMXA 2E4UA 2HU7A 2CLOB 3CW9A 2CUNA 2V8OA 4I66A 4CLOA 4XDZA 1OX5A 3SF8B 4OLJA 2Z4SA 2UUOA 3ZG6A 4CG1A 2H7CA 2VF2A 2D3WA 1PJ3A 5ALDA 1V7QA 2WJ6A 3JQFA 1BGXT 3DBLB 3PF9A 4PPGA 1UJ6A 5G0VA 4BO3A 5C1DA 3L4JA 1RPNA 1TIKA 2IBSA 5JZVA 4DY6A 4I2NA 1BJKA 2F3SA 2XT9A 2O8CA 1DP4A 4HX2A 3K15A 4PC2A 1QGOA 1B00A 3W8EA 2K5UA 4G4SP 3EGEA 5CFZA 4D43A 5AVRA 5GP1A 1NWHA 3SQMA 2X3FA 3IKLA 1GTMA 2GN1A 4RSHA 1K66A 2P3LA 2Q3FA 2V6BA 2WSSD 3WJ2A 1O95A 3L0YA 4C2TA 4LCBA 2QRKA 1SXJA 5T4BA 4AECA 3WWCA 5AFSA 2IFTA 1ISPA 4L5JA 1W5EA 4LBYA 2H07A 1DXHA 1NI4A 2A57A 4FI3C 2PE5A 2ZSDA 3QWBA 2PY6A 1V9CA 5FHRA 4CT5A 3AXSA 3GEPA 3OE4A 3QE2A 3TGPA 2ABWA 1RBMA 2EKBA 1GZ6A 3VHQA 2EZ8A 1A9ZA 2R8PA 4AMBA 2LR0A 3BRWA 1ATIA 3LX8A 5AI6A 1M6HA 1INLA 1TKAA 3X2SA 4TZ0A 3PS9A 1O94D 4Z0HO 2NU7B 1ZRMA 3SD7A 1S3IA 5L53A 3PPWA 2QTBA 3GLVA 3QF7A 1T8PA 3CTMA 3T4XA 1ETHA 1E2GA 2FUCA 3S1SA 5FEMA 4U7FA 1MOQA 1QIJA 3P5BA 3QELB 4LEIA 3CEJA 3E9DA 2R7KA 3Q9NA 3ROZA 4EUSA 5L3VA 5MF6A 1Q6ZA 5TMEA 3VSAA 2WTUA 1KQ3A 1PD1A 2HI0A 5JQGF 1JFFB 1O87A 3CS3A 4LOJA 2Q8QA 3IP5A 1U11A 2PSJA 4WLFA 2DLCX 4JLVA 3WX0A 4ASUD 2X42A 1AKNA 4O4JB 2DY0A 4QUEA 1HETA 3D8SA 4GR9A 3I73A 1H0KA 1QKJA 5DRYA 4PZEA 5EMKA 4B82A 5A9TA 3SU8A 1UFVA 3I9FA 3IV6A 4LSMA 5DM70 1EWKA 3FI9A 1Y3IA 4I4TF 4RXMA 3H9GA 3B2NA 5EKXA 3FVQA 2XQFA 1FBTA 1T36A 3Q9LA 2QAGC 1M7HA 4GFDA 3ZK8A 4CL2A 1PDOA 3DYBA 2ZBGA 2BFFA 3ANLA 3IIMA 5E0KB 3V1UA 1UBGA 4AQYB 2JCBA 5A0VA 1TD9A 3UT0A 3D6HA 1DBVO 5A3VA 2GZHA 2XB9A 2XT6A 4FB4A 2D5LA 3KZVA 1EQ2A 2Q46A 5JXGA 4IHJF 5BNZA 3LL4A 3AM3A 1L9XA 2Q5CA 3NJRA 3TCKA 1ZUIA 1P2DA 2GDJA 2QG9A 3W5HA 2W8BA 3NGXA 3DC7A 3R74A 4YAJA 1GXSB 1F17A 3CB4A 2OKGA 4XLLA 4EFLA 1Z7BA 3AUFA 2WWWA 3GEHA 3OA2A 3PQEA 4LVNA 1AIPA 4YRZA 1Z6XA 2OA0A 1MHTA 1LBTA 3G5UA 4WGGA 1TZMA 1N75A 4QARA 2FZLA 2JHCA 4U2BA 2BE9A 3FPBA 1Q5PA 4DZZA 1XLVA 1E1CB 5ALHA 1AUOA 3PP8A 1W9MA 5LP6C 3FDXA 1NF3A 2C2WA 4R4JA 1M6YA 1PL7A 2O4CA 4QFDA 4KAJA 2Y4OA 3RKSA 1ADFA 2IPXA 1PFWA 1ZOOA 2C04A 2P75A 3JTMA 4UEWA 1ZWLA 2B98A 4BMPB 2HBZA 4YJHB 3T5PA 3EZLA 2QJRA 4KFRA 4H6VA 3P19A 4Y7DA 1P1CA 5CMLA 1QGYA 4JWTA 3FVTA 1SOVA 3HYLA 3TZEA 5JXHA 1EFPB 5H80A 4DZRA 4J6FA 1L7DA 1TEHA 4TS3A 4D9NA 1Y89A 2NSHA 5E9JA 3RC9A 4E0BA 4ERXA 4MUJA 3QTTA 4XQ0A 3IXQA 5K8JB 2HUNA 3I4LA 1ENPA 5G3YA 2Q1WA 1R0ZA 2YL2A 5JVDB 4D56A 3I12A 3JQGA 3GJ7A 5ERXA 4XGKA 3OE7D 2JI4A 1P5FA 2X5NA 3QEJA 1A5SB 5ITSA 4OHXA 1M0TA 1P1KA 3VSCA 1WEHA 2ZSHA 2X76A 1XMPA 4PXSA 2FN7A 1V5EA 4DHEA 3GLIE 5JJCA 3KVRA 2HNBA 4YAEA 5KNCD 2YWBA 1I2DA 1FFBA 2QU8A 3I9MA 2VUHB 1JHDA 1QHHB 3SS8A 1VECA 4Q01A 4C7MA 5HUJA 1JZTA 1DKRA 3O5AA 1G6OA 2R1TB 2AR9A 3NBUA 4HEHA 4PPYA 4BZQA 1VG1A 5AH0A 4ZCIA 2B36A 1XF1A 1T9DA 2P4EA 3KP1A 1WF6A 3PXXA 3VV3A 4MHSA 3TM5A 3DE3X 5B7QA 5EKSA 1VMKA 4FCCA 1AKWA 3GGOA 4LDZA 3D2BA 2CF6A 2OXTA 4CCWA 4UUAA 1ISJA 4MV5A 3KYJB 3TTTA 3QEKA 1KDZA 3PE4A 3M3HA 4DLUA 1MCZA 4FR2A 4TSFA 3T7KA 2IEDA 3ADOA 2K2WA 4P4TA 1ESMA 1FXUA 4YPOA 3R6LA 3AHIA 3IIJA 2JAUA 3RC8A 3BXGA 4WXHA 1QONA 1RWXA 1M74A 1QK4A 3GT7A 3OSUA 3FRJA 3JWJA 4KQ1A 5CBPB 4F5DA 1PVVA 1JL3A 1Y3AA 4FGZA 5EWMA 5SZJA 2AJ8A 3U1BA 4EABA 4DCMA 2GS9A 4NFLA 3ZV3A 4C6TA 2AXQA 1WEKA 3GLHA 1JQEA 2WABA 4HAYA 4IM7A 2P62A 4TWBA 2N47A 1PJLA 2QUHA 3LCJA 2B1GA 4RF3A 2PVCA 1KI6A 3E81A 3H11A 1JTFA 2WJJA 5HZKA 1WZIA 2VBGA 5JSQA 1P8JA 2HL6A 1SUSA 3NWBA 2P6PA 3E2PA 2P27A 3CT4A 1UC4B 5A05A 2OCLA 4B0PA 3D1LA 3CNQS 4LNHA 3TVDA 3BA6A 4AY5A 2NXWA 1Q1ZA 1MEEA 3DTYA 3I92A 4J75A 3L6OO 4KE9A 3VH1A 5BWNA 1UODA 4UPVA 5DXJA 1F0YA 2F9FA 2O2JA 5K6AC 4EUEA 2IDKA 2P65A 3GARA 2A9VA 1RWQA 3NTRA 4CQJA 4DLWA 2QV7A 4CEIA 1TM3E 2CJYA 3PUYA 1MAUA 1VE9A 1NUAA 5MN5A 1BMTA 1T2UA 5G4KB 3QQPA 4BQSA 1GPLA 1TK9A 2AJTA 1PV4A 4J7XA 3KKNA 1U8CB 2HQRA 3U7JA 3RDPA 3DDZX 1O6FA 2VRWA 1OFIA 1XD2B 3ZPXA 1IVNA 2FQWA 3P9KA 1UBTS 2YYYA 4HTAA 5G0WA 1NBME 3HBFA 2XXJA 3BUSA 3V4PB 1YQUA 2AI1A 4KU4A 3ZLVA 4WL0A 3GRZA 3GNSA 2VDJA 2KLHA 1TA9A 2QL6A 3JWIA 5D5HA 4DWJA 3N2EA 2ZG6A 1ZEMA 3N7UA 5LKRA 3PEUA 4LHVA 5D2CA 1P2VA 3K0CA 4KPYA 1SFRA 4X7RA 4DA7A 5COQA 4XB2A 3M9LA 4IWNA 3QPAA 1BG6A 1XKXA 3C8UA 3IAS6 5FR2A 4H6PA 2FN3A 2KQUA 1PV1A 1V16B 4A1OA 4B0OA 5IXYA 2RI1A 5JJ5A 3CF4A 3ONFA 1X19A 1T0IA 2ACEA 2OTCA 4KZKA 4JC4A 2BE7A 5I45A 5ICSA 4P7FA 2QW0X 5C7LO 3R76A 1I1HA 3QLTA 3THYB 3KXIA 3ABOB 3FTQA 3TZ6A 3WGGA 4YIKA 5IARA 2R68A 1VHTA 2HF9A 4DRZA 3TW8B 1RWNA 3PT5A 2NU8A 2DFDA 3NAGA 3T3EA 2UXCB 4IW3B 5CB4A 3K0AA 4H2DA 1FEZA 1KAOA 2O2EA 4U02A 1JKJB 3NRBA 4D9FA 2PO7A 1NW5A 3A05A 3EMBA 4B8YA 4ENPA 1EEHA 5ABPA 3HJBA 1CS0B 3RG2A 4DLTA 1N7HA 1NJFA 2E3JA 5HJ5A 2JLBA 4BKOA 1MGPA 3DPIA 2BFEB 1YQXA 1EFRD 1UK7A 2EXXA 2QM7A 3MWYW 1SZCA 3R3HA 4B85A 3K1JA 3D4NA 1W2GA 2HQSA 3KOOA 1VHQA 4RY9A 2Z6AA 4I1IA 2ZZNA 3R5XA 4BMYA 2QR2A 3CKMA 1Y82A 4XYMA 3AOEC 3IP3A 4UEQA 1ABEA 2DF8A 3EW9A 1C0LA 1Z6YA 3R7NA 4IQGA 1TCUA 1O3YA 4N12A 4J16A 1CVLA 1FP4A 2IXAA 1VJGA 3LF2A 3RWMB 2ATCA 2CXSA 2YYZA 2Q3EA 3B1ZA 5EOVA 3SAJA 1J24A 2H4YA 1NC3A 3H2IA 3C3JA 4G84A 5ENDA 1LX6A 2F1IA 2NU6B 4GI7A 5FPYA 1Q44A 3BFXA 4IRMA 2FEMA 1FXWF 4PGMA 5AM0A 5KEIA 2A78A 4BFTA 5KYWB 2XCRB 4JJIA 3CT6A 1XWFA 5DULA 2ZE7A 3T8YA 1YFKA 1J2YA 2I1WA 5DSTA 3VTAA 1EJ0A 3D8HA 3I64A 9ABPA 3E3NA 3I9NA 1WSBA 2DJ5A 3L7OA 1QNFA 5FKJA 4DT1B 1QQTA 4YS6A 4Y9TA 1XVTA 3QOXA 5KNLA 2OZPA 4HFJA 1J9ZA 1EJ6A 3OEHA 3K5IA 2CW5A 4BKPA 4Z99A 3M6AA 1S1CA 1DTWB 1ZN2A 4KJXA 1N2XA 4IJUA 1E7QA 4TV8B 2FZVA 4KLNA 2DCUA 2PQMA 4GYKA 1N6RA 4P5EA 2G1AA 3RIGA 1L3BA 1V4BA 4NKRA 4CTJA 2QX8A 5BVHB 3W9BA 1Z4LA 2CBGA 4ETIA 1NONA 4GHWA 4KODA 3OVMA 4YJ3F 4R1MA 4FPXA 5AESA 4AI6A 3WK8A 1Y3BE 1KEZA 1H0RA 2CXQA 4FQ5A 4XUEA 2ZTVA 3DHVA 1CRPA 4R3WA 5FBRB 5C8XA 3JQAD 1I24A 2GVDC 2O2CA 3GCZA 3SEQA 5HK8A 4XCVA 2AOTB 1D0VA 2EKZA 4ACBA 2ZIVB 3ILSA 2V3WA 3LW8A 2FN8A 3ZE9A 2VBFA 5J58A 2C7RA 1RCTE 4MV8A 1MQAA 4ALLA 2H1VA 1FFYA 2EJWA 2H63A 2ODEA 2QUIA 3DXFA 3FOWA 4FFRA 3RIXA 5HR5A 3RYCA 4DJFC 3Q98A 1DWOA 3FSJX 2R8ZA 2CKMA 4NVRA 3FFXA 1X80B 2ZUTA 3WLPA 4HS9A 1CUJA 1LLUA 4KMOA 2WTMA 1XJ5A 1QHYA 3G8AA 4EQ6B 1MQ9A 4JD5A 4C1NA 2O1WA 4XZ3A 1NP3A 4P6VF 4TRMA 5B7NA 2QRVB 5I3ZA 1E6LA 3GLFE 2C4KA 4A2QA 1M33A 1XEXB 1JLRA 2FH5B 4FFMA 4A82A 2BJHA 4FGKA 2NZWA 3AX6A 3PGMA 3OG9A 1GRNA 5FWYA 3CUEF 1CXZA 4Q05A 2LPMA 2QD5A 4IKEA 6ADHA 4MWDA 3A4VA 2JCGA 4JX9A 2EZUA 3R2JA 2DTDA 2RGUA 4RDCA 1A96A 4ZVNA 5G2OA 1L4UA 3NFRA 4PC7A 2P9YA 2IEZA 4GEKA 5ICFA 1HC7A 4BO4A 1BU8A 3FCCA 3C7DB 4FKZA 2H08A 4MOWA 1PRYA 4MRVA 3PD1A 2FMXA 4OVKA 3L49A 4CIXA 1A2BA 1GWNA 3HVKA 3KIPA 4UMFA 5LC1A 4DQUA 5IUJC 1PQ4A 1IN4A 1O1YA 3H1PA 2YYSA 1J4AA 3PSAA 1I32A 1KJZA 1MBZA 4TTQA 4WLOA 1DB3A 2AUNA 5FOVA 3T9BA 1OZGA 1S6YA 3NEJA 3JQ6A 3R9WA 4DGSA 1CYEA 1DRJA 4A15A 1A1SA 1QQ5A 3KPWA 4II3A 3QLJA 4LWOA 4M83A 1JLHA 5JZOA 4TWZA 5LZ2A 4DNXA 5CCBA 2VPQA 2WR8A 4PZ0A 4HN9A 2Q2WA 1B1AA 2AZTA 2ID4A 3W9SA 3P0EA 4E5VA 1DHTA 2QBYA 1ZGGA 4F38A 1KK0A 2ZTHA 3LT2A 4IHAA 3KD3A 4ARZB 3E3LA 3K2QA 4CW7A 1TJYA 4GUDA 1AH2A 5EVJA 3OSZA 4JB3A 5JXWA 3FNQA 4A5SA 4ZTZB 3RFTA 3TINA 4JIMA 4JMLA 4M0PA 3A3NA 1OX6A 2WM9B 4C0QC 4EPWA 4BLTA 1NBMD 1UIRA 2DPYA 4HB4A 2ETVA 1WJGA 2OCIA 3GD5A 1B7GO 3L07A 4N5MA 3ZU3A 1WETA 2ONKA 2XNDA 2LKDA 5JNWA 1O7JA 4OLFA 4QWMA 2CDBA 2CKDA 2NO9A 1S2IA 1M1XB 2QG6A 1MAWA 4GO1A 4G1VA 5EIFA 2OCDA 3LG2A 1GCAA 1CY1A 4KH1A 3ZKAA 2I1QA 4N0EA 2OMKA 4RJKA 3COYA 2E89A 2G7ZA 3RADC 4NBKA 4RH3A 4EATA 2BTQA 4RA6B 4BFXA 3FVRA 4DE5A 2DUJA 4NPHA 3T1TA 3TOSA 3WYDA 5JDIA 1RAFA 4P35A 1U0RA 1TK3A 2QZ4A 3DZDA 2JKVA 1Q1BA 2BJVA 2MCFA 3W5UA 1AX9A 3WL3A 2DC1A 2BBWA 1UKYA 2WDZA 5HRAA 2I6SA 2QZSA 3DBRA 3A7DA 5JS8A 1Z8NA 3H87A 3JQCA 3N6VA 5KQGA 2FN4A 4TM7A 3HVHA 3I9V1 4CMKA 9LDTA 1L4HA 3EHEA 3O2NA 2C42A 5KMGA 1YJQA 1K0UA 2CXOA 4H7DA 3MMPA 2E5WA 4BNVA 1WL8A 2AUMA 3PTAA 2QF7A 1XQ1A 1HQDA 3I1YA 4CM9A 1P33A 1ZOLA 5EUMA 4D74A 1SCQA 3E58A 5HS4A 2NAFA 3U60B 2IC5A 2CHQA 2NWQA 3GGGA 3HBLA 4RLSA 4Z4HA 2HO4A 1UBCA 1ACJA 3P94A 1NIPA 2JRLA 1F8YA 1B26A 2BFAA 3JR3A 4I9FA 2VHUA 3TD2A 3ER9A 5JCJA 1MAAA 1XZMA 2JGEA 3H8WA 2QJOA 2YN4A 1GPNA 3IH5A 3L3BA 1LB1B 3AO0B 1SKYE 3OF5A 4LQCA 1M2NA 3Q15C 2XYQA 2WF7A 1JIXA 4GM4A 4F1WA 3NONA 1GPAA 3FRHA 3TOVA 3M9WA 1S8NA 1A9PA 1U6KA 2VYFA 5K0EA 3IIIA 5EQTA 1NJ6A 1K92A 1OPXA 3HEBA 3JZDA 1XL0A 1XXHA 1KDOA 4MQEA 2A9RA 3V3TA 3AU8A 1PJRA 2JAHA 2WSLA 4OAPA 4WFQA 2XUGA 1XMQB 2AE2A 4AX8A 3ZIAA 4G0UA 5C0OE 3UY4A 3K9BA 5FTLA 3C7AA 4GL2A 2WU3A 1R0BA 1M2GA 3OESA 3P2YA 4MKFA 1JGTA 5GTDA 2IP1A 4ITUA 1OFUA 5HMMA 5BNTA 1C7QA 3AM1A 1QIMA 1Q57A 5ANRB 5M5BA 3VOBA 5F9HA 2PFSA 4Q9DA 1KK1A 4TSRA 1KP9A 1M8KA 1NBEA 2UXDB 1FPMA 4EJSC 2PM8A 5K3EA 3PHHA 1IY8A 3TQHA 1D7OA 3PDUA 4BJ1A 2ZM6B 2DPXA 4Y2UA 3EEYA 1VJCA 3H84A 2GAIA 3ZTWA 1CY2A 1RQNA 3H42B 1VKJA 5IULC 4GMXA 4DUPA 5IAGA 2VP3A 2HUPA 4O4LF 4RZ2A 3C16C 3U9LA 3VMMA 2Y1FA 3BICA 1W0KA 2DUUA 3M6VA 4UATA 5AOAA 2GM3A 4OL9A 3IFSA 4IOMA 3EPJA 2FX2A 4CKWB 3DEAA 3LUCA 4DTCA 1OWOA 2Q2OA 1IM8A 1Y8CA 3LBFA 4PEVA 4R40A 1LTQA 4Q1BA 5A4JA 2VP4A 3LXUX 1WHTA 2X5KO 2ZJYA 1V2GA 3CLRC 4EHNA 3KU4A 1LK0A 1G7TA 2EZTA 1MA3A 4R68A 2NQ8A 4QYWA 1VLVA 2VATA 4AAYA 4X85A 2QG4A 3D7NA 2O3QA 2YQZA 4E5KA 3AKCA 2X19A 1SCIA 4KVGA 1UJ5A 2CLLB 1X94A 4EFMA 5A7FA 2I2WA 5JH7B 2ZXUA 2ZUFA 4C05A 2ATEA 3AFGA 2BEUA 3E8MA 1UBNA 3AKYA 4H17A 5KU7A 3KWLA 1FU4A 4E94A 3L1VA 1XLTA 4HK4A 3WMFA 4X6XA 1L8LA 3K9FC 2AFVA 2CMDA 4KFTA 4KUEA 4EI8A 1E2PA 2HSEA 3INNA 4GWGA 4NH4A 3SQNA 2XUIA 3QU7A 3Q7QA 1D6MA 1NE7A 4V0QA 3ENNA 5EN4A 3DBLA 3NBQA 1EGMB 5JW6A 5CG1A 3PL1A 5E95A 1RKVA 2HCRA 2VZLA 4ENUA 4IQ8A 2DEUA 5DBGA 3IP9A 5DF1A 1ZVVA 2F7SA 3ORSA 3SWWA 1RRCA 1EFVB 2DXIA 4AF8A 2R6AA 4Y6SA 2PLRA 4ZQHA 1L6IA 1R8XA 3KYDB 3UAYA 4E1AA 4ZXPA 2COEA 3NBMA 1U3FA 1AO0A 5FFNA 2IHKA 3CURA 4I55F 4IUBS 4Y6RA 1P4SA 4LECA 1TJ5A 2D3TA 4MINA 3AH8A 4J1SA 4QATA 4YH1A 3DA8A 2GTPA 1CDDA 1BGWA 1PDVA 3C3PA 3HABA 4FE4A 4HAXA 4OI1A 3KPUA 1CJBA 1WVGA 5KYGA 1L8AA 1E1DA 1U3UA 1N8SA 2P4QA 4G2NA 3WHKA 1WF3A 3B6IA 3VUEA 4EPYA 4QXMA 3DONA 1N5LA 4UVHA 4NK4A 2GCEA 2YTZA 5IASA 3I8OA 1GTRA 4L72A 5JARA 3FJOA 3WKEA 1WP4A 2NU7A 3OTIA 4DA8A 3IUYA 1PZHA 3OCXA 3O83A 3QJYA 2YY7A 4FEAA 2CNWD 2R65A 4OK3A 3PHGA 4OUDA 1QYCA 4XWTA 1K6MA 2FF7A 3QELA 4E2FA 1OILA 4G5XA 3TPFA 1N2CE 5TS3A 4BP1A 4MRRA 3EUWA 4BNFA 3KJEA 5A9SA 3W4KA 1SAYA 2ODQA 3WGZA 4W5HA 2VRNA 1GVNB 4YA6A 5F7ZA 3TVYA 4GE3A 1NN1A 3QUTA 1US8B 2PUVA 1ZSNA 2XE8A 4HVAA 3T1OA 3U6KA 1AOXA 1QP4A 4O4JA 5DLQC 3ZS8A 2OO5A 5JS6A 4HAWA 4M1EA 1EBUA 3ZNPA 3DTNA 4Z4QA 1X74A 4DC9A 2WKQA 3K6RA 3HU1A 1BKYA 3LPCA 2NUTB 4JUFA 5SY6A 4NTZA 1BCSB 3KKZA 1QHSA 3HA5A 4R5HA 3HWSA 4IAOA 5BYAA 4LK3A 4Q4AA 1Y81A 3FGZA 3K31A 4JLNA 4LPSA 2FQ1A 2WP8J 1N9GB 5E0OA 3SJUA 1NTOA 4Y18A 3EPLA 2IPNA 5HFJA 4EW6A 2XQKA 1M8PA 1U8FO 4NCAA 2ZIUB 5FUMA 1I3KA 2J3HA 5KB3A 4FDMA 1CR6A 5CDYA 3W7AA 3KZCA 4OHBA 4L8VA 1SQSA 1LEHA 3K71B 2HK6A 3H1GA 3ED1A 2J6IA 1CP3A 4Z5XA 4TTIA 2BOVA 4XWWA 2A1UB 1I1QB 2MMGA 1GXSA 3I2KA 3NCHA 4HX5A 5FPHA 2V7QA 4L3VA 3KVVA 4EJ2A 5HKKA 5EMJA 2JJ2D 2P6MA 4EHIA 4PSCA 3MRTA 3SEAA 3WAGA 1JMVA 4J1GA 2CEAA 1SUFA 4PHCA 2GN8A 1AXGA 2WPDA 1E1CA 2PX2A 4GKKB 2EHDA 3T7AA 4G5OA 4KPGA 5CLIA 2OV2A 5KPDA 1DQZA 1N2IA 2CHGA 1SBHA 5ER6A 1CZNA 1Z36A 3D8NA 4GBMA 4O8CA 4YDRA 3U0VA 1N5MA 1N6PA 5E6SB 5I7RA 3O8CA 3GP3A 1SBNE 4PM4A 4AB1A 2QM0A 4MTCA 1BEUB 2MYTA 2W71A 4C04A 4YJGB 2IDJA 4US0R 4BNHA 2NVWA 3GHHA 1JR3A 3RFCA 1YQTA 1EFPA 1NPTO 5AXBA 1NYLA 4PX3A 3CUUA 2O0JA 3QE3A 2OUIA 5K3AA 4MVJA 4CQNA 3CE6A 3FNFA 1P9OA 5J43A 1ESEA 1OCEA 5JVDA 1RACA 2PDAA 2OVFA 1C1DA 3ZWXA 2R1VB 2ZI3A 4P4SB 3TDKA 5JZSA 1JQLB 4YRKA 4K9KA 2AC4A 4WXPA 4EG8A 1U31A 2YWEA 2HSWA 5AW8A 4ENQA 1S5PA 3AXTA 1G16A 1FFEA 5CYGA 5LU9A 3UTDA 1V4VA 1V2HE 2Y0CA 2YY5A 3GJ6A 4M9XA 4BXOA 3HJFA 1ACLA 1VZ2A 4FWIB 2HT6A 2AI2A 2QSYA 4ISCA 5DHRA 2D5CA 2L18A 1XEFA 2FUKA 1JKIA 3JVUA 1AK9A 1ZJYA 2WHEA 3L05A 4V0RA 5DMHA 2PUDA 1FMFA 2ZJ6A 5BV0A 1HNWB 2XT0A 1OASA 2MTBA 2NT4A 1IWPB 1J07A 3FSRA 3KM0A 1U2GA 3FCUB 3N0TA 2B1IA 3AFNA 3FMVA 3KKKA 3NB0A 4BRZA 4OI0A 2QPOA 5D3QA 2ZB8A 3VNAA 4OLHA 4L8WB 1XPUA 1VXOA 3FETA 3KKOA 2AYYA 4JU8A 2PT9A 5KTYA 1YUNA 3LHSA 3DAGA 3AFHA 3G5TA 4QUAA 5EWLB 1DEAA 4GRIA 2OHOA 2Q8NA 4UMEA 1KS2A 4UBKA 4HRVA 2X5OA 4L8LA 4LSWA 2XB4A 3L1IA 1DIHA 2PIAA 2QVLA 2HRQA 1D6NA 1LRJA 3BMOA 4RNDB 1HF3A 2AOXA 1C81A 2AXNA 2WSBA 4MCJA 4X5OA 2FUEA 1ZH4A 1YUMA 1YMVA 4EYOA 5BWMA 1PGNA 4BV3A 5IHPA 4EJFA 4QREA 2HSDA 3KT6A 4WADA 1KSFX 3NVMB 3ZCVA 1W4ZA 1YUBA 3IKMB 4GVXA 3U17A 1H2FA 1BHJA 1IY0A 2P41A 3BYZA 4IRUB 3TQRA 2WZCA 4OXQA 1F4LA 3U2QA 3E82A 2F64A 4NYJQ 1U98A 2C29D 3ROMA 2AKEA 4BBZA 3ZBUA 3OMWA 3TQCA 4MS1B 2CDAA 4GR5A 3OAAA 3URMA 4EEKA 3GROA 1BD4A 1AB5A 1W8DA 2CNKA 3P9CA 4C3VA 4B73A 4HYYA 2REBA 1PFUA 3WIDA 1BD3A 1P60A 1BW9A 2WKRA 3WNZA 4J7UA 5DYYA 4FM9A 5BNFA 2GD2A 3I5AA 1T5OA 5JCOA 1CUWA 2EJCA 2O05A 3DP9A 1A5ZA 2WU0A 2YICA 2X14A 3JQDA 4OHYA 2QT1A 3NR2A 4JX8A 4MIKA 4WH0A 3ZNOA 1J56A 3G9XA 3E4DA 3RRYA 1IN6A 3A1UA 2JIZD 3EXEA 3I9JA 1PEYA 2AG0A 1DMRA 2BSAA 2DBZA 3PJFA 4DXHA 1FW6A 2QW1A 2FWNA 3PU6A 5TEWA 3DF7A 3IILA 2ZUEA 3FNGA 1RYYA 1E9DA 5AVSA 3M33A 4QVKA 3EUAA 5LOVB 4V0OA 3ZHYA 2J6BA 4YECA 5AKHA 3E7DA 5DH9A 2TMGA 2J9GA 2ZRJA 3NHBA <