3BGSA

Structure of human purine nucleoside phosphorylase with l-dadme-immh and phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
publication title L-Enantiomers of transition state analogue inhibitors bound to human purine nucleoside phosphorylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 286
sequence length 286
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bgsA00
3DDOA 5CXSA 3FAZA 3DPSA 1TCUA 2I4TA 1PR5A 2QPLA 3IEXA 3FB1A 5B7PA 4PR3A 2B94A 2ISCA 4D98A 1I80A 2QTTA 3UAXA 5CXQA 3NM5A 3FUCA 3P0FA 3KHSA 4OJTA 1RXSA 4H1TA 3KVYA 2QTGA 4P54A 4L5YA 1Z35A 4YMLA 4BN0A 4TTIA 1A9SA 3FWPA 1VFNA 1U1EA 3FNQA 4DABA 1VMKA 1TGVA 1SQ6A 3UAZA 5B7QA 3NBQA 1JDSA 1RT9A 4QFBA 5B7NA 3O4VA 5EPUA 1RXUA 5IFKA 4JOSA 3OZEA 3OOEA 4M7WA 1RFGE 2AI3A 4BMXA 4QAQA 4EARA 1Z33A 4M3NA 1JPVA 1QE5A 1PR2A 3PHCA 3UT6A 1Z37A 2HRDA 1OTXA 2ON6A 4TXNA 2QSUA 1OU4A 4TS9A 3DJFA 1VHWA 4QASA 5CCDA 4DA8A 2A8YA 3LBAA 3SCZA 1Z39A 4TXHA 1T0UA 1JE1A 1M73E 1V45E 3BJEA 1Y1SA 2OXFA 2H8GA 5CCEA 3OOHA 3NM4A 5ETJA 4TTJA 1YR3A 1A69A 1V4NA 4OEHA 1SD2A 4YO8A 3PHBE 5KB3A 1K9SA 1OUMA 4D8VA 2AI2A 5CYFA 2GUWA 4D8XA 3OZDA 1C3XA 2AC7A 5EFOA 5F78A 2HN9A 1PKEA 3PNPA 4WKNA 3OZBA 4WKPA 1ODKA 1ECPA 5F77A 4DAEA 4JP5A 5F7OA 1PF7E 4L5CA 3KVVA 3MMSA 1YQUA 3PNSA 4FFSA 1OV6A 1G2OA 4D8YA 3ENZA 1PR1A 1T8RA 4GLFA 4MCIA 3OF3A 1JDVA 1A9OA 3ONVA 2QDKA 4F3KA 4M1EA 4TXMA 4TXJA 4NSNA 1TCVA 1XE3A 4R2XA 1YRYE 1A9TA 1TD1A 4L6IA 2HWUA 4G8JA 4WKOA 1RSZA 1V41E 4TXLA 4LDNA 4TTAA 4F1WA 3ODGA 3D1VA 1YBFA 3KUKA 1PK9A 5FAKA 4WKBA 3U40A 3E9ZA 1A9QA 4G89A 1T8SA 3EMVA 2OC4A 1PK7A 4E1VA 3FOWA 1JDZA 4L0MA 1Z34A 3EEIA 4LKRA 4TYMA 4RJ2A 1Y6RA 5I3CA 3K8QA 2HSWA 3OCCA 1LV8A 4ECEA 5F7XA 1ULBA 3IOMA 2Q7OE 3EUEA 4OF4A 3OZCA 1SD1A 3NM6B 4DA0A 1A9PA 1Z5PA 1Y1QA 4TS3A 3UAWA 1ZOSA 4PNPA 4LNHA 4F3CA 4DAOA 5EUBA 4DARA 3KU4A 1PBNA 1PR4A 4GLJA 4OGLA 4R31A 3QPBA 1Y1RA 3KVRA 1RYZA 4JWTA 1CG6A 1V2HE 1B8OA 2A0WA 1U1DA 5F76A 1NW4A 4YNBA 1U1GA 2I8AA 3UAVA 4D9HA 4GMHA 1Z5NA 4GKAA 1PR6A 1TGYA 1Z5OA 3O6VA 5B7GA 2IQ5A 5CYGA 2P4SA 5IU6A 2A0XA 1U1CA 4MCHA 1K27A 3E9RA 1NC3A 1LX7A 1Y6QA 4QEZA 1YQQA 4I2VA 3E0QA 2A0YA 1JP7A 1PWYE 5JPCA 1LVUA 1RXYA 1ODIA 4G41A 2RJ3A 5DK6A 3BL6A 1T8WA 2XRFA 3TL6A 1ODLA 1RXCA 3C74A 4OY3A 1WTAA 4U2KA 1NC1A 4BMZA 3EUFA 1JE0A 4F2WA 5F7ZA 1Q1GA 1U1FA 3T94A 3GB9A 3UAYA 4DA7A 4LZWA 1ULAA 2OC9A 1Z38A 4WKCA 2BSXA 1JDUA 5C80A 4NS1A 1K3FA 1OTYA 3K8OE 1FXUA 1V3QE 1PR0A 4BMYA 4OGKA 4X24A 4EB8A 2PGAA 3BGSA 4L5AA 3GGSA 3P0EA 1CB0A 1VHJA 1Z36A 4LNAA 4QATA 1OVGA 1B8NA 1RCTE 1ZL2A 1N3IA 3LA8A 1T8YA 1ODJA 4UC0A 3DP9A 3F8WA 4NY1A 5K1ZA 3MB8A 3LGSA 1A9RA 3BSFA 1PW7A 1JDTA 4R2WA 4DANA 2OECA 2AI1A 4F2PA 4YJKA 4KN5A 4K6OA 1SJ9A 4IP0A 1RR6A 5F7JA 1Y1TA 1JYSA 1V48A 4MARA 3INYA 4QARA 4DA6A 3DF9A 5F73A 3OPVA
chains in the Genus database with same CATH superfamily
1R16A 1WNTA 1YS4A 2I6SA 3X44A 4C0SA 4ZYTA 4Q3CA 4BASA 5LVAA 2HCBA 5CURA 4EHHA 4UM8B 5LNK1 2W5UA 2Q1TA 2FX2A 1TCUA 2BEWA 1WD5A 3K9NA 5HQ3A 4CLDA 4NIMA 4QOIA 5BXQC 1N78A 3AP2A 4HZUA 3FOFC 4RK7A 4ZZ1A 4AJHA 3QSYA 3RK0A 3GLFA 2WF7A 3EDYA 3OIFA 1J07A 5IUKC 3U48A 1OH7A 2LRHA 2IDMA 3EH2A 3U3JA 1HE1C 4MDEA 2CNLA 1G1MA 1Q92A 1XEXA 3I01A 3MF4A 5G1PA 5HILA 4Q39A 4UAJA 4JP8A 3OTOB 2BHLA 3WV5A 1OU0A 5DV9A 1ZEJA 3AETA 2E4AA 3EZYA 1BMTA 3AG6A 3DTTA 4G1FA 4U00A 3SZRA 4D5EA 2WSMA 4PTZA 4H7IA 2Y1CA 2KPOA 1SIOA 3EDMA 4AX8A 1YVEI 2ZWPA 3K5PA 4MPTA 1TF2A 3GUYA 4DJTA 3CSDA 2O57A 1BFDA 1GKYA 3QOFA 4MQ6A 1WVIA 3RF6A 3TFWA 3W2GA 1W87A 4ZKEA 3A6EA 3A4IA 4FGLA 5FD8A 1DAMA 4PZPA 2O8BB 1P91A 1XRSB 1WM1A 3A04A 3LCCA 1EDZA 5P8WA 2P0AA 2PV7A 3TCKA 1Z4PX 4MB0A 2G71A 4EB3A 2DFTA 4HBZA 1G9XA 4RACA 3PD0A 1DEHA 4G9GA 3CA8A 1IAQA 2Y71A 1SCQA 3K9LA 5E7QA 2J5XA 1X39A 4CCYB 2RG1A 1U2DC 3NHWA 5D5PA 3BJMA 3F4KA 2GCNA 4M1KA 4TKUB 4D44A 5LMZA 3AU8A 3IGFA 4HWOA 5IFKA 2G40A 3LF2A 4DR3B 1JH8A 2GN1A 3AHIA 2M6RA 3H1EA 1PX2A 4RSMA 5A1JA 4DV4B 3DWEX 3GJ7A 3O4GA 5ADHA 1DE0A 4ZYVA 1AZSC 1DJMA 3DE7X 3LHFA 4BAUA 3ABOB 3S68A 1NQOA 3PXBA 4BMXA 3M6WA 2ZZMA 1SXJC 3LE8A 3PWKA 3QLEA 4KQXA 1ZGZA 3I62A 3H9BA 1VGQA 3PUYA 4OYHA 3AJEA 4ID3A 1DLJA 2ZIXB 2ZQZA 3BWYA 5EP1A 5I4CA 2D2EA 2ZS8A 1E7RA 4IIJF 3D4NA 4ZV7A 1IJKA 1WLSA 1PQYA 4B3HA 2C5BA 5E1DA 2FPOA 3WGGA 3RC3A 2QSUA 8AT1A 1G41A 1FEZA 3EDQA 1YRAA 2XXJA 1SUAA 1SXHA 3UC5A 1KJNA 2V7PA 4G3XA 2ZJ7A 3K53A 4FP9A 4H2DA 2DR0A 2UVDA 4PYQA 4X8MA 5GV7A 2JGNA 2FPXA 3DQZA 2G5GX 2ZJYA 4RVNA 1GNTA 5TARA 3S70A 1ZS9A 2NUAB 3ODPA 2X86A 3PF9A 3Q0TA 3BCSA 1XPRA 1XTJA 3T9AA 1NJGA 1SUCA 4DA9A 1JE1A 2QW0X 2NM0A 1UJNA 2IPXA 4INOA 2ZSKA 4HO1X 3Q3IA 3M83A 4ZWNA 4DCUA 2QYHA 2W6JA 1RZRA 1HTWA 1OGIA 1P7VA 1M2KA 4RM2A 3OP1A 3WLOA 1XTSA 2QRVA 1H2EA 1V2GA 1YK1A 3HXMA 3N9IA 3DGEC 3S55A 4BVAA 4RTQA 4WZZA 2WIDA 5F9FA 2J0QA 1JECA 1W4LA 2F8LA 4AVYA 5M34A 1ZUD1 2Q3BA 2X9GA 1VLLA 1Z56C 1U0JA 3OX4A 4Y9DA 4D9BA 2D1YA 4IF4A 3TINA 1N36B 3GXBA 4QTXA 2RHHA 3ADBA 2H4JA 3ESRA 1J42A 4UPDA 1KVUA 2HU7A 4UBOA 1K9SA 1Z26A 1HKUA 2G88A 3TZ6A 3H97A 3QU7A 2WHXA 5G0WA 5EVJA 1XZHA 2JA1A 2KJQA 3EA5A 4OCZA 2UYCA 1E2JA 3KT8A 4H7KA 4AZ3A 2Q41A 2XQKA 3MAAC 4LC0A 2K6GA 4MW7A 4NU0A 4TLEA 3LL4A 4JU9A 3RVJA 5AD1A 4MWCA 4UEJA 2PD4A 3QVLA 3A1TA 3FRJA 2X2EA 2A57A 1JFTA 2RARA 4PY2A 5EFOA 5F78A 3D3JA 3KSUA 4KGZA 4P35A 4RJJA 1WJGA 4BX0A 2XNKA 5LKAA 1PZGA 3EY4A 5DIZA 2IGBA 4AL4A 3WL7A 4X63A 5ED0A 1B15A 4XVCA 2A92A 2CWWA 3L7DA 4G0NA 1M6VB 3IQDB 4QFCA 4OGFA 4RVCA 5JJIA 4ALIA 1E5QA 4LDAA 4O0MA 2DWPA 1JJ7A 2EWMA 2XQVA 1JEYA 2QTFA 3PDUA 4OI1A 2ZUFA 4V3BA 1XHFA 3GZNB 2F9MA 2XBLA 2CNBA 2ORWA 4K6CA 2FF5A 3IP7A 3WK6A 1ETHA 2SCUA 3G79A 4N65A 1Z13A 3E2MA 4MVYA 5CLQA 3SLGA 4YRCA 1P18A 4E32A 1VPEA 4P7FA 2UZIR 3ZQKA 2AFIB 3NHRA 4GBGA 2HXGA 1G4UR 1YL7A 2HCRA 4OHUA 4Q3AA 2VAVA 4MGYR 5DK4A 5C8XA 4MCIA 2L69A 4IVQA 4DWWA 4E88A 1M2JA 2ZWVA 5LN1A 1CPYA 1Z2CA 2R6ZA 1D0VA 2J6CA 2UKDA 3BMQB 3GGOA 3L06A 3PUHA 1QYVA 2O1SA 4FR0A 4RPIA 4RNDB 5AHWA 3IHWA 1E1MA 1ZCFA 4O2BB 2PPLA 1EVIA 1L1RA 2G28A 3INNA 4WLUA 5KHLB 1TCVA 3SX2A 1TTHA 4KR7A 4P82A 5KYUA 4C0QC 2PU5A 5AYVA 2FZGA 2PJUA 3N2EA 1KZ1A 2GTHA 1RRMA 1SUWA 1QGDA 2QROA 1GD1O 3AQIA 4AJJA 1T0BA 1GLGA 3OUZA 2NUBA 2QMEA 4G5GA 4M8LA 2PWPA 4F4UA 1KAGA 2ZJAA 1N33B 1E3LA 2H7YA 1SEPA 3DUFA 4O4HF 1ZAKA 1QHFA 1U7UA 2EFJA 4J3JA 4DLWA 1DC8A 1ZHHA 4UBLA 4F1WA 1RXWA 4Z7OB 2ONZA 1NM5C 2JGIA 1IHXA 5E3JA 5J4VA 1QP8A 1IWOA 1IHYA 2DPMA 4V03A 4G0WA 3WLTA 1WVGA 1E79A 3K0FB 3OPYA 3U0VA 3IALA 1U8YA 2Z56A 2AZTA 1NP3A 1DEAA 4RMIA 5HCNA 3V48A 3WFJA 2P9CA 5DNAA 2EJBA 2QAGB 3DF7A 3UYLA 1L1QA 5HF8A 2F48A 3TR0A 5EQTA 1B6RA 1DG3A 5ALIA 4M8KA 4WASA 1KI2A 2HMYB 1E2PA 2QRGA 4UCQA 3CRRA 3MS4A 4ICIA 1IHUA 1MO4A 1WUIS 4HAOA 3UQYS 2WVAA 1POWA 2X5KO 3ZCSA 4PYJA 3I9KA 2L19A 1QP4A 4BFZA 3N7UA 1HE3A 2Q2VA 4R6XA 1Y6RA 1Z2OX 5MFPA 1KTIA 1OH8A 1MEEA 2REOA 4LYAA 5AI4A 3KYIB 2F8TA 3AJAA 1KDZA 1ENZA 3UK6A 2H29A 1DCKA 2J08A 2AB0A 3LCVB 4U5QA 1FMCA 1HFEL 1OLUB 1NJ6A 1KMHB 3PVZA 1C7FA 3QVOA 3SOPA 1PUJA 1Z88A 3IOMA 4NYIR 3VYUB 1WKVA 1VG8A 2BI7A 3EUEA 1A2OA 1F60A 3LK7A 3OHPA 4K9PA 1XT6A 2EXXA 3TZEA 3CUVA 2PSJA 1GAWA 4GOKA 3VR5D 4BXOA 1Q6YA 5G53C 4R1MA 1KZ4A 4MUNA 3FYSA 3ZWYA 3DTNA 3O2QB 3U7GA 3INRA 1L5OA 2EGHA 2Q3JA 3H99A 3IPYA 4M86A 4C0HA 1DLIA 2BZGA 4KTTE 1UKBA 2ZYVX 2HRCA 1IWPB 4ER7A 2ZUTA 2X4LA 1MB2A 4O08A 2YMQA 4C5BA 1O4VA 2Y0DA 3WTCA 2JI8A 3DAFA 4GI1A 4I1SA 4KXWA 4LMPA 3GAFA 4N47A 1GGMA 4HQ0A 4NESA 2C5LA 1PDOA 2I87A 2PXAA 3B8EA 2GETA 4CDNA 4RTKA 4X97A 4YAEA 2G5PA 1FFXB 4MW4A 1I2CA 3DZCA 4KFSA 4Y9SA 1VMAA 1C7EA 2P3LA 1G0NA 4GZMA 5BURA 5K05A 2IS1A 3AU9A 3KU4A 4Z4IA 1VBFA 1W5BA 2P75A 2CHGA 4G86A 3SR4A 4R31A 5LZ4A 4PZLA 3TK1A 1QP7A 2IY9A 4H3SA 2DAPA 4IFEA 4D6XA 2CY0A 1NG1A 2P62A 4JD5A 1DRJA 1CNEA 4RENA 1U2DA 3KQSA 4O8ZA 2Z2ZA 3MCVA 5JXWA 2WUDA 3V2HA 3FR7A 1IDOA 2IXTA 4H6XA 1CDDA 2XVYA 2XKJE 3JYQA 3WBKA 3CH6A 1GKIA 4CT0A 2I5PO 5E38A 5FLEX 3R5JA 4QOFA 2I8LA 1SG6A 1WW3A 4JEUA 1XVLA 1U04A 3GZJA 4KXMA 4BAGA 1Z0SA 5EIFA 5JWRA 1VKOA 1SXJA 5CA1F 1OWNA 3NV7A 3ENQA 2HCJB 5AVWA 4ZAWA 1XD9A 3G0BA 1Y3BE 1Z5NA 4GNKA 2P8JA 1YZQA 2PS1A 2R6CA 1MVLA 3AY6A 3GT3A 1CYDA 2J3IA 1SZDA 4ALMA 1MJFA 4PSAA 1N1EA 2X76A 4R3WA 5IAEA 3Q7RA 5I7RA 3IE1A 2FN7A 1TEZA 1CXZA 2FMIA 1E2UA 3CNOA 5CM2Z 3R7BA 4BC0A 1YZTA 4BNZA 3E9NA 4ZAGA 4PSDA 4XFKA 1Z3IX 2OP0A 5ALGA 1Z82A 3NHPA 3RKRA 3MTDA 5DXAA 3T9DA 1OFIA 1C8BA 4ZVSA 2PSEA 3DMTC 4EFMA 1G5RA 3AUKA 4KWIA 1IUKA 1K4MA 1MAVA 5HIJA 2CLOB 2GI4A 2XF8A 1NMZA 1SOAA 1TPZA 3UV6A 1S3IA 2Z2YA 2IX3A 1XPJA 4O4IB 4QICA 1WEHA 1KKMA 2VTDA 4X41A 1H2ZA 4KLZA 3E0QA 3ZDRA 2F3PA 4TLAA 4F3TA 4E1AA 3G2OA 4BO5A 3QVGA 2FAXA 3C3DA 3B7PA 4MVJE 5D5QA 4QPPA 4A10A 4AKGA 4QNMA 3IA2A 5BUQA 3HM2A 1D4AA 4WTOA 2XRFA 2I91A 5C5DA 2OFOA 5KUTA 1RXCA 5L3QB 3UQZA 2O2YA 4MV3A 3T5CA 3QVMA 3HP7A 1ZXXA 3C3XA 2Q4DA 2WG0A 2YWXA 3ZI4A 4U2KA 1NUTA 1RM5A 4ZYLA 4W1RA 1EWKA 3ZD6A 1GQYA 1A1SA 2C4NA 5FNVA 3GEHA 1G16A 1R2QA 1X1DA 2TMDA 3DOJA 2FR8C 3NHBA 2FWRA 3TGLA 1G66A 1J8YF 2IXEA 3W3AA 4LVCA 4HSGA 4DA7A 2PH1A 1YMVA 1XP8A 1YHYA 3O8DA 4XIJA 4NC9A 4XTCS 4DCJA 1G64A 4CLXA 4DCTA 1KSHA 1P7YA 3Q5DA 1ID1A 4H27A 4NHEA 4BMNA 1H9CA 1OYOA 1BKYA 5JCJA 3DVAB 1H9AA 1DO8A 2HHAA 3M33A 1JDUA 2R4QA 2W2OA 5GVRA 5CXXA 4ZU1X 1T0HB 4E46A 3LZ6A 4Q1BA 1EP1B 5IP5A 4CMBA 1ZOLA 1LVGA 4GM4A 3KKPA 5ESXA 3PHGA 3GLGA 5LC1A 1L7PA 2C3OA 3I6QA 3QKIA 4H15A 2NUTA 1W75A 4PRLA 2VO1A 3KZNA 2VDMB 1R9GA 1RQNA 3K09C 2F7SA 3C6XA 3QMPA 2LCFA 1W0JD 4IGAA 5EN4A 5CDTA 4QDUA 3C70A 4GG1A 5CJPA 3L1HA 4LBWA 5IHXA 1CJMA 1YAJA 2VZLA 3N2KA 4S1VA 2G09A 5KTMA 4TVBA 5EA2A 3KK0A 1TDJA 4J1QA 1QVVA 3ZVRA 2JZNA 3MK31 2AJLI 1O97C 4PQEA 3IBFA 2LP4Y 4WAUA 5EJ2A 2C83A 3GGSA 4Z0PA 3M3PA 4BGUA 1Y8RA 3EE6A 4H16A 3LVFO 2OBBA 2W2NA 2MU1A 1PWZA 3QOWA 4WZAB 3LA8A 1P3JA 2O5VA 5FWDA 4RADA 5FLXA 2C84A 2O23A 1D2RA 2P9HA 4GM0A 2YQZA 1K75A 4JKIA 5HJ5A 5FI3A 2EKLA 1FFHA 4GM1A 4A6EA 4LI3X 1W4AA 1E69A 3ILVA 4PHFA 1IE3A 1KI9A 3SF8A 3BZBA 2BVNA 3LECA 4MTLA 2RGEA 4MI6A 4QYWA 1NOIA 2NO9A 4R7ZA 2WNHA 1KO7A 4LZLA 1YFLA 1AKTA 1IONA 2UZ1A 1IEXA 1O3YA 4EA6A 3KLPX 4NBSA 4RD4A 1JG1A 2FMFA 1C2YA 1TEXA 4KN5A 4DLVA 3PFNA 1JS1X 2ZBFA 3O4HA 3ZEAA 1FRQA 1TQ6A 1V4VA 4XJVA 3CTPA 3EHEA 4FILA 4WESB 5ICGA 3ZHRA 2ZYTX 1C1XB 1O58A 2CNWA 1EVJA 1V48A 2WMNB 3BE4A 3GGJA 2GCOB 1S02A 2H59A 1YWGO 2B36A 2CD9A 5I6DA 5IWAB 3IURA 2CE2X 5H7XA 5EHXA 3BRSA 5TT1A 4MHTA 2GCPA 1IN5A 1L5MA 1BOFA 5PGMA 3JATB 4M9ZA 1NM5A 3RE1A 2MSKA 4MWDA 1P2GA 4BO8A 1XMPA 1M6WA 1JEAA 5DHPA 1WU7A 621PA 1ZVJA 2CLIB 4G1CA 5IRCD 1W93A 3TW6A 4BFLA 1AHIA 1N7GA 3I2JA 4RD0A 4NCAA 2Q1UA 3H2JA 1LPAB 3HSYA 3PUZA 4YJFA 2I4TA 1WMEA 1XVUA 2R1TB 2Q8NA 2VXYA 2QPLA 3F6PA 4YAFA 5C8YB 5ULLA 2UYQA 1GITA 1OXBB 3ZWCA 1ZICA 1G20B 2IYAA 1RQXA 1XL1A 4BO4A 1I80A 1ZJ4A 1CNFA 2J32A 2KB0A 2PGDA 3QUCA 1USIA 2OMKA 3NM5A 4XLTA 3UAXA 3JVVA 2OO3A 3QU5A 3VOBA 1XEAA 3ZWMA 2SKCA 5FO1A 4GQIA 4YROA 5HOEA 2JAWA 2XWSA 3M3DA 1P2BA 2JL1A 4A92A 1OILA 1GPMA 3WWYA 1GJRA 1EDOA 2PUJA 3HJGA 4TL8A 3WKBA 4M76B 3I5YA 4CXMA 2EP8A 2GJSA 2F3UA 4YONB 2NT4A 4CKBB 2EATA 1NQXA 4UXHA 1P2UA 4RTSA 3FUTA 3FWPA 4F60A 3GOHA 1O9HA 3B12A 4HEA6 2LPMA 4UZEA 3FHTA 1WP4A 1UJ5A 2XQFA 2HQBA 2VH1A 1CQPA 4EHLA 3K71B 5JJLA 2IYFA 2QTRA 1UBFA 1RP7A 1T36A 1RDFA 1FYXA 4ZI3A 1SXPA 2C0CA 1RT9A 4BX9A 5LA6A 3UMCA 1NMYA 2P9ZA 1DRVA 5LZ2A 3FVWA 1YVUA 3S27A 4G01B 5MFZA 2V6IA 4A91A 2JKYA 2YV3A 2JLCA 3PGMA 4JLSA 4KE8A 5TQ2A 1S4MA 2PH5A 3R5TA 3A3NA 4XD7A 3TVTA 1F0PA 1NBWB 1II8B 1CYEA 2DB3A 2XE8A 1VYVA 3DBOB 3U1VA 1N1DA 3TBKA 1FJHA 2B6HA 2JLBA 2FZEA 4XWGA 1BW9B 3IUYA 3JX9A 4NYJQ 2YOHA 1MO6A 1WB9A 4YALA 1QGUB 1QFJA 4PHHA 1NYLA 3GAZA 4E5UA 3M4NA 4KG7A 4RY8A 5ALUA 4MWSA 4ECAA 4YCSA 2QG4A 1Z37A 2QT1A 3FCUB 3WE7A 4GUDA 4JBGA 1E6UA 4R2MA 4HS4A 2P9EA 3VU9A 4K26A 1YULA 2VPZA 2ZB8A 3DV0B 5C4IA 1B76A 4V38A 3P9RA 4H3HB 1T9AA 2WHYA 4MW6A 3QBTA 4KOAA 3CCCA 3JQ7A 1OAOC 4HYQA 5BVGB 1F9EA 1VDZA 3DJFA 4W5NA 1VL0A 4BVEA 3OVMA 5CCDA 3OFNA 2ZE5A 3V33A 1H1DA 2I4LA 2J6IA 3AIMA 2P9FA 3K35A 3ZS9A 4BZPA 2UUBB 1Z5UA 2OCDA 3AUAA 1T6ZA 3FPCA 4JITA 2GBLC 5CEEA 2D7JA 2AF4C 1T0UA 2JBAA 1X70A 3HNRA 3KLNA 4CQNA 1Q7GA 3VPGA 3K5WA 1EG2A 5BQXA 3PE4A 4OBXA 3AF4A 2IOQA 4NJEB 3R7WB 1AKUA 3UMBA 4BO3A 1IPHA 5BT9A 3BWMA 4MAAA 1DINA 4TX1A 4XM1A 1U2GC 1ESNA 5AI9A 5ECDA 1FNNA 5JYCA 3NHLA 4O63O 1R6BX 3OE5A 3MHTA 2YN0A 4BHTA 4Z1OA 5EJ5A 1UKAA 5CYPA 3BCRA 4Y6OA 4YMWA 3V42A 2TMGA 3AF3A 4ZDJA 4KEAA 1MO2A 3CLHA 3PD7A 3I39X 3DMTA 4IQGA 2WAAA 4IS3A 1EUQA 2GM3A 1I14A 1YQ9A 2W2KB 3JARA 1ZW6A 2QLLA 5JRZA 3PC4A 1H0SA 3D7LA 3D2AA 1TM7E 4BKUA 3T7KA 3IE0A 2N0SA 4FB4A 4J1NA 1U3DA 1GZDA 2J5RA 2YXBA 4KGVA 4B3TB 1PTKA 5KB3A 3ZDBA 2MOKA 3Q8KA 1PD1A 2WV9A 4CIXA 4FDVA 4G4JA 4RA9A 5T64A 3P5BA 2QYSA 1BXZA 3NT5A 1BG6A 1GPUA 1NVGA 2QR3A 3EXHC 1GP2A 4DS3A 3G2KA 3RS3A 1P4HA 3DMFA 1YJXA 2AC7A 1P62B 2FQYA 1VBKA 2OVFA 1KIFA 3P2JA 1PKEA 4LZNA 5EEHA 1WCYA 5LBUA 3WGNA 3F8SA 1NJFA 3H42B 2QUHA 1G6HA 2C1ZA 1DMRA 3KUUA 4JASB 3RIEA 3GRFA 5L6LB 2VBCA 2CL0X 3LVQE 2E4YA 4DWJA 4LDRA 3UWPA 4CUZA 3PC2A 2IZ5A 5AUPB 1UOQA 3L7IA 1ZD4A 2FMXA 2FR8A 2W6JD 2WNIA 1RPAA 5LQKA 2G80A 3IQEA 3SEFA 1RZRD 1B8VA 2HMUA 4FDUA 4R05A 1H3FA 3RNOA 4ZQCB 1G60A 4YRKA 3E9CA 3FOAA 4HNQA 4IX1A 1FXWA 2WIJA 1W85A 4E12A 1M6HA 3PXAA 4D9CA 3KVVA 1DQNA 3MBKA 3MMSA 1UMKA 3F4LA 4IXMA 3NUGA 3UJ3X 1EJBA 1EB8A 1Y7LA 4FFSA 4S1TA 1Q5PA 4AZTA 4BFSA 2Q6LA 2R3SA 1PJ8A 5C35A 3KSMA 2V58A 2V1UA 1NRXA 5DHFA 1GGJA 1HE5A 2EVWX 3CBQA 1HR0B 4RCVA 1DJLA 1JWLA 1KJ9A 3NWOA 3OCJA 4EJMA 1TVMA 1CRWG 3CSUA 3ELBA 4X93A 1PNQA 3EMBA 1YZNA 4ZALA 4ZV9A 2C4MA 3QKSB 3K09A 2CB9A 1UOPA 2G7MC 1P1CA 4G65A 4AIIA 1AM4D 1P39A 2C5GA 2VK4A 2ZJOA 3NI2A 4XIYA 3WP0A 3WSVA 4DNFA 1RQLA 2EWVA 1KYIA 1X3LA 2P9YA 3DT9A 1YC2A 2NPOA 3WDMA 2D7CA 2QRHA 3UN1A 1YRYE 1N3BA 4KO1S 5EPOA 2JGDB 2HJVA 4PYOA 4P34A 3V5NA 4ZVNA 1ZVQA 2B8JA 4Y2XA 4RJLA 5E8RA 2DUNA 2FPRA 3CIOA 4H77A 1FP6A 3S40A 3TIVA 1XTKA 5F1YA 4DSOA 5HEKA 2D6FA 1GWNA 1IPEA 2O3RA 2Q5CA 4KPGA 1RLUA 3EJ6A 4LECA 4DG8A 1KETA 1UC5B 2XDQB 4MA0A 3FROA 4NH0A 4KIWA 4B8ZA 4Z4QA 2PYDA 2IEIA 3AP1A 4M46A 4RLQA 3H6HA 4TTAA 5KZMB 4GS5A 4FM9A 1QDLB 1NMSA 4R01A 3VJKA 5BMVB 1QRTA 1T5IA 3SSOA 5L51A 1P3Y1 3DFUA 2HQRA 1JMKC 1NU6A 1YU6A 1N8TA 2FRVA 3GFTA 3L0BA 4CR6A 4DLTA 1PK9A 1Z4IA 2ZRJA 4G0MA 4DMLA 4BP9A 5SY4A 2YWFA 2PGOA 4YJ2F 4B32A 2YXNA 4ZA2A 1VBNA 2FSGA 1DHTA 1JALA 5MN5A 4M9RA 2AOXA 1MJNA 5KYXB 4MRAA 3SKXA 3SYKA 4QYIB 3X2EA 5C3MA 4UOQA 5KWIA 3VRHA 3K70B 2HAEA 2YFKA 3H4IA 4UDNA 1WWKA 2D5BA 2WF6A 2F64A 1OLSB 4MPJA 4KTVE 3WJ7A 5JAMA 2CMDA 2PT6A 4H1VA 2JAQA 2JFGA 1QGAA 5IKMA 3KTOA 3ZW8A 5PNTA 3GNSA 1ONOA 5KWSA 1NVBA 5G1NA 3P4XA 4D9JA 4BX2A 2PUDA 1D2CA 3EZGA 4C3OB 3FB4A 4KAJA 2O5CA 1JEEA 1VJRA 2VVTA 1BZYA 1AGPA 1RXVA 3MOIA 4MR9B 5H3CA 2JCYA 2XODA 1QIDA 3MJVA 1I51A 3R5KA 4TWZA 4DBVO 4U3JA 3MGGA 4PYRA 3LX5A 3VKHA 2AVNA 2IDZA 2H7VA 2J09A 3DLAA 4P7BA 5DSXA 4Z0HO 3RK4A 3VH3A 1EP9A 4NNOA 5IN5A 3SHQA 1NBHA 4CN8A 2PUVA 1FFEA 1D03A 2JIZA 1RZVA 1USGA 2VP3A 2X8JB 3MJRA 4YCBA 4BVBA 1LVHA 2EFHB 2PUHA 4QXAA 1E79D 3E9DA 3PJFA 5J2UF 2F1KA 5I9BA 5J1TB 1ADYA 4XUEA 3VPFA 1LQUA 4UXIA 2IZZA 5AW6A 2X19A 4NENB 1SHTX 3JQGA 1WPXA 4R1PA 1T2VA 1YDMA 4JYPA 4A2WA 1P5JA 1Y4UA 3C6ZA 2PH7A 1QC5B 2N1BA 4JCCA 5DP1A 1ZH4A 3PC3A 3GLHE 4PAGA 1B00A 1PT9A 1YCHA 4OKIA 4TT8A 4EAQA 1QHIA 4L51A 1FX0B 1A7UA 3ZHYA 4KQFA 1VCMA 1MTOA 2XKBA 4C7XA 2BHTA 4JJKA 3HJAA 5EJMA 3RVPA 3HYCA 2PGLA 1M1XB 2D5AA 3L02A 3MGCA 3GWZA 5KVSA 3B3QA 4IJVA 3ZJYA 4EL5A 2QQ5A 4LJSA 3Q7SA 3WLEA 2YYSA 3KFVA 4GNRA 5IDYA 4PFKA 2VQFB 3IUPA 5KDDA 4RLSA 2ZVPX 3QYPA 2WT8A 1IM2A 2YBEA 4U4AA 4KFUA 5CD1A 1O57A 2EX1A 4WK6A 1RS0A 3DW1X 2CNDA 4RE6A 3CB2A 3T9CA 4D1YA 3CKYA 2NXWA 1E2GA 2PZBA 1JA1A 2VHTA 3BK7A 3S1LA 2Y67A 5M04A 4BNFA 1L4BA 4QLOA 2GPYA 1P6UA 1UWCA 4O1IA 1JEQB 3QWAA 1YE8A 3ZBQA 4RUKA 4ZCQA 2WJZB 2CN1A 1PJQA 2P1DA 3CF4A 4D9HA 1GFWA 2XEXA 4I99A 4P98A 1JAYA 4KE7A 3GA5A 4NI5A 1GKLA 4NPAA 4X0EA 5CEJA 3O6VA 3LSYA 1TAQA 3ZKWB 4EKIA 5B7GA 1SULA 4HAWA 3B1YA 1SBYA 3CEAA 3PNMA 4HF7A 4EELA 3NG1A 5D00A 1GTZA 2ZRFA 2D2XA 3TKLA 4BMCA 4BWVA 4D5GA 2UXBB 4JI1B 3RF7A 1GN8A 2WPDA 1OAOA 2G0TA 3F4BA 3LOUA 1S2OA 2RGRA 1MRSA 4U7DA 4NCBA 3O8OA 5DLYA 4TQ9A 5DLPA 5TC4A 4DV3B 1C7IA 2XTZA 3G1WA 3VZPA 1PJ2A 3IXQA 2P91A 1L7BA 2YFQA 1Q22A 5AIBA 5JSUA 3CR8A 2C9DA 4IDAA 1K27A 4U2CA 1S3SA 2AD1A 2GBLA 1P7PA 1Y6QA 2R66A 3VC1A 3DZIA 2C9OA 3SFZA 4B9AA 5JUWA 4DT1B 2XMCA 3A9VA 1N2CA 5I8PA 3H7IA 3H2KA 1NNLA 4L4XA 4C0AC 4JGGA 4FI3C 2EYQA 3DLIA 4FMDB 1U2GA 1O03A 3L7JA 4OXQA 2F8MA 2OLEA 3E05A 4MGIR 3RI3A 3S2IA 5JYEA 1SCBA 2B8WA 1E1YA 3PKJA 2CBZA 4J7CA 2ZRKA 1ZIDA 4WZBE 2R68A 3AERB 5DM0A 1ZVVA 4CG2A 2EJVA 1RYHA 2JCGA 3PTZA 5DYTA 2PO5A 2PL5A 2VDWB 5KS2A 5MGBA 4W7IA 3EIXA 1SXJD 1ECCA 1Y7HA 3T3HA 1EUYA 1TCBA 3KZVA 1DIAA 4LZPA 4UJ3A 5A5VA 1BJKA 1N7IA 4EY4A 2AG5A 3EUFA 1D6MA 2GBCA 1CRQA 1XD2A 2VDJA 2Z57A 1V6SA 2XCOA 1QQ6A 4AKEA 1BGWA 1VA5A 2DZDA 3M5PA 4LCBA 4FJ0A 3CR3C 2H1OA 2VT7A 3VU3A 2ANBA 1C7QA 1IY1A 2OZKA 1KNXA 3GHHA 1EDBA 3LNCA 2D00A 4EI9A 3ADKA 1S9DA 1H2HA 4DV6B 2C0PA 1VYHA 3K96A 3IXLA 3RIYA 4JBWA 1V25A 1QZXA 4KNVA 1XZMA 2C61A 2G5TA 2KI5A 2O8FB 3EB9A 1I33A 3KT3A 1L5LA 4NS1A 2IDKA 4EY8A 5AMXA 3NT2A 4MDFA 2YMPA 2LKCA 1T4CB 3KJFA 2Z2XA 4G36A 3ZUPA 3LUAA 5THQA 5FNZA 2O8DA 1XFAA 4EO7A 1RCFA 1KP2A 2HREA 4RJIA 4L2IB 1TMGE 3ROZA 2R1ZA 1XK7A 5C37A 5B3AA 1FDRA 2P9GA 1I9CA 4HWRA 2R6DA 3HUFA 3Q1KA 4REQB 4CGYA 5K45A 1OAKA 4TV8F 4OHZA 1J06A 5D8DA 1ML4A 5BUZA 2NTYC 1QS0B 2DULA 3PSAA 1D1SA 4L0QA 2APJA 2PRYA 4PS1A 4CMIB 4CF7A 4NAHA 3UK7A 2QUAA 3SC2B 3WWOA 1WSAA 1CY6A 1H85A 3TW0A 3DMNA 4XWOA 1ZL2A 3RYHB 4RTMA 1N3IA 5H80A 1UC9A 1VJTA 4DDUA 3W3AD 3JR7A 3L43A 5BW4A 3IV7A 1TB4A 3MB8A 1E9DA 3ZXUB 4EYEA 5JQGF 4N6OA 1XKXA 4B5LA 2EQBA 1F0NA 4LRYA 1GY8A 2W2LA 4R5HA 2IXFA 1RTTA 2C00A 2MMCA 2Q07A 2VNAA 3PP8A 3GMIA 3Q0EA 1G6KA 3NH9A 1C3JA 3IEIA 3SEAA 4DANA 2Y1WA 3UPUA 4NPCA 4KH0A 4IMPA 3DOFA 3ETNA 3LT4A 4BZQA 6PFKA 3AOGA 3PJRA 3N2ZB 1JMVA 4QRHA 1SA0B 2XT6A 2VCYA 3JSXA 4MVJM 4O4LA 4XCXA 4HLCA 4DXAA 1CUJA 4ZDKA 5CB8A 3E7FA 1J8VA 3C8UA 3QHAA 5L45A 4IDHA 5AIAA 4FYPA 1AX9A 1JYSA 3B7GA 1NJSA 2J0SA 4NBKA 4GPAA 3PA6A 3ZE2B 2PLRA 4KLCA 3W2HA 2FW1A 4L8YA 4DMHA 2IYOA 5BWLA 1UK9A 3I9V6 4W9NC 3EWIA 4HI0E 1M6EX 1WDMA 1EUCA 2DYKA 4S1PA 5ALHA 4D3FA 2QL6A 3BFJA 4DQDA 3THXA 3J7TA 3O1HB 3L7OA 1VKRA 3OPVA 2X0JA 2FGJA 4IOLA 5IVHA 3K9CA 4HH4A 1C3OB 3OZFA 3M6VA 1Z3CA 4HWGA 4ZHQF 2GT1A 2KQUA 1L5RA 3DV9A 2UYHA 2B7CA 3DWIA 4UD6A 3ZNQA 2QGNA 1NXOA 3AHFA 3BE8A 5CDHA 5HZMA 1YH3A 3FB1A 2Y1LA 1XZPA 5LJLA 1ZW1A 4FYWA 4EFLA 1JG2A 5AW5A 1PJCA 1R15A 1Y4AE 3SPXA 4LUCA 4L3VA 1G6Q1 4XR4A 4F12A 1GT91 2JGJA 2REQA 4UKDA 4TRJA 1Y7IA 3VKFA 3I73A 2QYOA 2ZJ6A 3KVYA 4TMKA 2QTGA 3S5JA 3M5DA 1KEUA 4GI5A 1GZSA 3HSSA 2XLCA 2Y6VA 2JCSA 1OROA 1M74A 4P6VF 3ASYA 3EFHA 4HFRA 4D97A 5E4TA 5L53A 1UXGA 5MDHA 1KIMA 4Y98A 4E21A 4Q9KA 1TM2A 2UUPA 1PW5A 3DE5X 4TWAA 2J67A 4ZDIA 5I7VA 4Q1EA 2HHCA 2KX7A 2LR0A 4TQGA 3ZE9A 1GPBA 3K2QA 4MMYB 4JL8A 3PDIA 3H5LA 4RIHA 1AD2A 2CNWD 3IVMA 3OX3A 4J1TC 5EJ9A 1PO7A 2JLAA 2JGMA 4FDAA 4ZOBA 4XYLA 1LWNA 5JD4A 2OXCA 1GLVA 1N6KA 2WZQA 3WSWA 5JVDA 1B23P 5JCXA 1X38A 1FFSA 1GGVA 4ZAFA 1DQZA 4CW7A 4JEMA 3HWX1 2OLJA 2V6GA 2H7CA 3F6YA 3VKUA 4KUGA 1TRKA 3ZWVA 1EQUA 4N4AA 4XQ9A 2LD4A 4HYTA 4OJKA 3AZQA 2B78A 1RRPA 2MR5A 4N5IX 5C7YA 4EF6A 1PUXA 2A33A 3PXDA 3MWDB 1HNZB 1CQIA 5CG2A 1N6IA 3U4CA 1LLDA 1TF5A 3PXGA 1U9IC 1Z33A 2GSDA 2VBGA 2ZUUA 3D2BA 3TAXA 4AROA 4BNHA 2MYUA 4O4HB 4OSOA 4RK1A 2PUEA 3FPKA 3ZWQA 3PQ8A 5IHPA 5FORA 1B0PA 2XR1A 1G21A 3F9IA 3BXHA 3OFJA 4TVKA 4X1IA 5IC5A 2V8OA 4HAXA 5DI3A 5GVSA 4HDNB 3SZGA 3PFFA 2AXPA 1C9YA 1JDNA 3P27A 4B35A 4MYRA 4HDRB 3SHFA 1TM5E 2GJ9A 5HWSA 1NA5A 4L72A 3R5HA 4UOZA 4HRAA 4PG8A 2V7VA 3ZI0A 2BTQB 1HYEA 2XXAB 2WILA 3GLQA 3IR7A 1NAHA 2ZSEA 5E4YA 1T3HA 3BH0A 4KFTA 3PWZA 4RGBA 5IEJA 4LF8B 1ZLYA 1MDBA 3USCS 4MITA 3EWSA 3T1TA 2H1VA 2ODAA 5ALJA 3FBWA 2Z3WA 4NFLA 5E6SA 3M82A 3LFHA 1HX7A 2E6UX 4UEOA 3R8FA 3AT1A 1KFCB 2H1HA 3W9SA 1PHPA 4Z4GA 3W78A 2DBRA 1YFJA 4B9EA 3C7CB 2ID8A 3CGGA 1ZISA 2OSBA 4KU4A 4NABA 4PHGA 4ATNA 1ZIOA 4J9VA 4RW0A 2I2CA 3TM4A 2XZOA 4R81A 3U4QA 2IHVA 1KVQA 2QU7A 4OOEA 2H2IA 2WKQA 5EQDA 3NO4A 1UBNA 2ZJBA 1FYVA 1JSZA 2AG1A 4W1PA 4C7OA 2ZS9A 3DZ8A 1WW2A 3WRYC 3RFFA 2DBQA 2ZXEA 4RGQA 3ZWAA 4F45A 4LF7B 1K8ZB 3OJXA 4TTSA 4ZODA 4JI6B 3VZQA 2GJKA 4YRLA 4WJKB 4TLBA 4D0SA 3HXLA 3T5AA 1W9MA 3EEFA 5T3YA 2GWHA 3TEFA 1O95C 5C31A 4DM3A 3FFAA 5A3JA 3EDRA 4JELA 3TRFA 5D86A 2GF0A 3WYAA 2FSHA 1QHEA 3H2SA 3OFND 1TZMA 2XWPA 4KXQA 3DONA 1RPNA 5IARA 3HR7A 1KEKA 1K66A 4ZO9A 2J33A 3DW3X 3EXEB 5DX8A 1VRWA 2R5FA 4FYHA 3WMRA 3F5QA 4NF2A 4BO7A 1HEUA 5AVZA 1E96A 3OZBA 2Y2UA 4AT1A 4QUJA 3QXGA 4BUJA 4KV7A 2HWKA 4AUEA 3C5EA 4OSPA 1CR4A 1JIIA 3AEXA 1IJEA 1PEYA 2WYOA 2B61A 4OTZA 3JD0A 1CUGA 3B2EA 4JUFA 4PFJA 3UFXA 4X64B 3U3RA 2Q6OA 2VTVA 2E9SA 1G8SA 1HWYA 3P20A 4QVKA 3QVTA 4L5CA 2WAXA 4BATA 4V0ME 4GECA 4U6SA 2YICA 3T7CA 4F86A 4ZIRA 3EVFA 3Q98A 2Z04A 2G82A 3OQNA 1NIJA 4FEYA 4NZZA 3UOGA 3PC6A 3OLZA 3WKEA 4F3NA 4I4NA 1J25A 4M0PA 1BQ4A 5BWOA 3NWJA 1BKDR 3AR7A 3K9GA 4YGXB 1MGOA 1WB5A 1RHQA 3CWZA 4HBGA 1FNCA 3EVNA 3ZCTA 4JR0A 2CV2A 4PLYA 1OW3B 3HU3A 4UM9D 4W5OA 3ESDA 3AKZA 2GTPA 3FI9A 2O8BA 2E5FA 1JPJA 1LPOA 1XKTA 5B1SA 4F3KA 5MHTA 1QV6A 1YKSA 3I9MA 5HMMA 4DB2A 4TXMA 1XRPA 1C81A 4C7VA 5JH7B 2YFHA 3I6BA 4NSNA 2WIFA 2HQ1A 2WJHA 5AKKA 4CCYA 3WK9A 1JVSA 3KT0A 1PAUA 5B6JA 3AF6A 1LXCA 1MO3A 1N1GA 2QT0A 3CB4A 5AICA 3HA3A 4YI5A 1OV4A 5KAMA 1KKUA 2D1SA 1FQOA 2BMVA 2QVBA 3EG5A 3PLAE 2HTFA 3D2LA 1AS2A 4R9NA 4UCFA 1QG6A 5AKEA 3WNBA 4AWAA 5JQWA 3MTEA 1XIVA 5HQJA 3TRHA 5AW2A 3N58A 1NBME 3Q10A 4WBSA 3RUEA 5E0OA 3G82C 3DL7A 5CFPA 1NXTA 4HNVA 1IM8A 5LP1A 1CUZA 1X1SA 1G7TA 4AS3A 2EZUA 1KJJA 1EKXA 1A4XA 3D1VA 3R20A 1UH5A 3ZE1B 5IKPA 5E3IA 1DKPA 3THRA 2REXB 4GZ3A 1KO8A 3T7JA 2DQZA 1HOXA 2EIHA 4F3RA 2ZIZA 2XA9A 3UWOA 2WAOA 5BV7A 1I3MA 1MFZA 1T8SA 4LOKA 4FKZA 4KDEA 4R1SA 2RG7A 3FWKA 4PC2A 5IMSA 1DJOA 3KELA 3OFKA 4KDFA 1X13A 4RBNA 1K8QA 1VRVA 2GX6A 2G1PA 4YCNA 1AHNA 1JDZA 3IT0A 2Y1EA 2ONCA 5FPKA 2AOTB 3DE4X 3I3SR 1Z34A 4OAQA 3ZBPA 3K0HA 3UW3A 4LKRA 2AJDA 2QRUA 4KLRA 3HPRA 4W9NA 2ACEA 2HMVA 3QKRB 1DNPA 4ID9A 4UUMA 3W8DA 2GKGA 1WLYA 3H9UA 2E55A 3D9QX 3I42A 4LVOA 3AJDA 2ZTHA 5K8IA 1NJ8A 2YZKA 4O59O 1R6UA 1OJ7A 4JNKA 3T1OA 2B8EA 2OR3A 1QYCA 1O97D 4FFNA 2I4MA 2QB5A 2Z6UA 1VG0B 4E2XA 5F7XA 1P1BA 4WK4B 5K0EA 3FWNA 4GC9A 2Q7OE 1HDCA 1QO7A 1WZUA 1OBVA 4PRKA 5FR2A 1GTJ1 2QLBA 4EA7A 4KR9A 1YHNA 4J6EA 5F2OA 4POOA 2IXDA 3F97A 4RTLA 4LS3A 4ABTA 2D54A 5ALYA 4A0RA 1L5WA 4DIMA 1FZTA 3CNLA 4I6EA 3STHA 4A0FA 1I6KA 1YCGA 2ET6A 2I6UA 1GXSB 2ZI7A 1Z5PA 2CKDA 1U11A 1I3KA 3ADOA 5BT8A 3U16A 5J2TA 4FOPA 1P1RA 5HGXA 1Y5LA 2XJ9A 2HUNA 2ZRMA 2W8BB 4E5MA 3AVOA 2FFAA 2GPTA 2PSHA 4MUYA 1JSLA 1CJTC 1SCUA 3L0DA 3NVKI 3BSYA 5EZ5A 2V54A 5HE8A 1N2CE 1U7HA 1N0VC 2GN0A 1FY2A 2CUKA 3A9CA 4LNHA 4M0EA 4DWOA 3W9UA 1PJLA 3ZJ4A 3A3KA 1QH1A 1OX4B 2GYUA 3PNVA 3NNNA 4J1TA 4XQ0A 3QV2A 1ZRMA 1PBNA 3DEHA 4OGLA 1UBCA 3O83A 2RHOA 3RC2A 4KMRA 2J3LA 5JNLA 2IEGA 2Q3DA 4HQKA 5EMNA 4L8LA 3GT0A 1EZ4A 3CX6A 5GADl 1XTVA 5L4NA 4ZO6A 3B48A 2C2KA 4FFVA 3HGTA 1O87A 3PU6A 5FWYB 3TLMA 4LGMA 3V1LA 4GOMD 4BVHA 1COWA 5KX5A 4A6DA 1EXVA 3E61A 1A97A 1YMQA 2ECQA 1SXGA 2HHHB 2O4CA 4HG2A 2XECA 4WFJA 5IAOA 5C7OO 5ABPA 1HDRA 3QUAA 3U80A 1O2DA 1P0MA 1Y1PA 2TSYB 1U9IA 4X00A 4LRXA 5CEFA 4QGHA 1Q44A 1KZYC 2JGLA 3G9TA 3IR6A 4UUQA 3X43A 3H2BA 2OBFA 2AFIA 3SC3A 1JHDA 2PZJA 1TGYA 3BFKA 2JIZD 4RH3A 2Q0QA 4O25A 4F1KA 4DMRA 2OGTA 2ORVA 5IU6A 4DNQA 3GC6A 3GFVA 3PVCA 1W94A 4L95C 5CFQA 1YGYA 3KWFA 3EGEA 4KAAA 2XVZA 4EX7A 4ZAVA 3NVDA 1P5RA 4G4IA 3FPAA 2D4HA 3GAAA 4MWOA 4RJTA 3KPWA 5BN4B 3QVSA 2H2WA 1Q0RA 1R5JA 2WD7A 3BIXA 3OWHA 3W06A 5AT1A 4P3XA 4PIMA 4AS2A 1HFWA 1ZX1A 1W36B 4KXLA 2CEAA 2L17A 2Q5OA 2QPAA 2P9BA 1R66A 2J9RA 3ICEA 2JD1A 2XITA 3KJXA 3BAFA 4WGGA 1ZMTA 1JX6A 2CFRA 2IIQA 2JRLA 4G5FA 5CX1B 2MSLA 1BNCA 2EQAA 5ER9A 1SY7A 4J94A 3ZPXA 2R7LA 2PKEA 3HCAA 3PWSA 2OV6A 3R76A 3VVCA 5ALDA 4DYDA 2EJUA 1U0RA 1G8GA 2BCEA 2OXEA 2GLTA 4WKGA 1T5LA 3RS0A 4AU1A 1GSHA 2FPKA 3C0KA 4WIAA 1VCHA 3KHKA 4LXTA 1WW8A 1OX6A 3GLIE 4KMMA 2FRXA 1Y5NA 3K0FA 2JLUA 2MINA 2H57A 2P6NA 3RGGA 8GPBA 3KXIA 3A27A 4QBHA 4ZO8A 3KD3A 4P33A 3HA2A 3WRYA 1FP1D 1R3UA 4URWR 4MK4A 3UATA 1NG9A 3TOZA 3IIMA 2M6SA 5JS7A 4GQAA 4UDYX 3WWDA 4PVDA 3RSQA 5KU7A 2A14A 1X1AA 2CXUA 4J16C 2WPDD 3FMVA 3QBDA 5HKOA 1THGA 1Z38A 4WKCA 4YDSA 5FUBA 5A04A 3R9XB 4ALJA 2N46A 1Y3FE 5AKGA 1J5EB 3KJIA 1IMOA 4DTIA 1LGYA 1EK6A 5DW0A 1LQ2A 4BZWA 4MR7B 4MVJG 4JU8A 4Q6BA 3AB7A 2ZYDA 3MHPA 2QL9A 3AM4A 1W44A 4DMKA 5MGNA 1C0EA 3RTDA 4BTVA 3SYNA 4REOA 2Z2KA 3NGLA 3OM9A 4QOJA 2X0KA 4FNAA 4R7TA 4RXTA 4JL6A 4OL9A 5T67A 1TA4A 1ZP6A 4UMDA 1YNSA 4NCKA 4XR9A 1NNUA 4X24A 4RE5A 1KK0A 2GRJA 3PFWO 1PVOA 4BC1A 3DULA 1JF8A 2V9ZA 3KQWA 5F2EA 3L92A 5L7YA 3PF8A 5JIBA 3QKTA 3UJNA 1IZ8A 2WJJA 4Q1CA 1O96B 3H2HA 4YECA 5EE1A 4LNAA 1A71A 1UEIA 4QRDA 5EZYA 2GAAA 5DT2A 1ZUNB 1I4OA 3L41A 4KOEC 1E1KA 4ZOAA 3SN6A 4PANA 2H08A 5F9HA 2N9UA 1KQFA 4PZYA 1Z5ZA 2XSZA 1LF5A 4I4IA 2VF2A 2WYUA 2GXQA 1NUUA 2WV7A 3U9LA 4A2QA 3BWDD 1RLJA 3R0VA 4WH0A 3ACDA 1A9RA 2I7VA 2J9ZB 3I2FA 4B3JA 3EPJA 1YRHA 2XX3A 3SJCA 1MX1A 3DMYA 1UQUA 2XD4A 5FOQA 3CXUA 3EWAA 1R50A 1EX7A 4EYGA 4WY2A 4DLRA 1G8HA 5ANRB 5KYNA 1AHPA 4DLZA 4M7OA 2ISQA 3DOIA 3LH5A 4OLHA 4RVDA 1IN7A 4WN9A 3SJZA 3VTAA 4Q3DA 1H6BA 2CHVA 4BWGA 1KQGA 2OFWA 5L3ZA 2CXTA 3EAFA 4EYOA 1SJ9A 4NV0A 1WOMA 2Z9BA 4FOTA 4UNNA 3E7PA 1MKYA 1ZIXA 2ZB2A 1Y1TA 3VSDA 1XZKA 3TPZA 2XBUA 4MARA 2QV7A 1PS8A 3SG0A 3V7UA 2OILA 4D8TA 4Z9YA 2ONJA 2I1WA 2BKVA 4RORA 2JLWA 1DJNA 1XRQA 3CF2A 2I2AA 1SGWA 4YRPA 4TWRA 3MTAA 4YRRA 5DKFA 5BYAA 3FZNA 2QLTA 4YP0A 4F0JA 4P4SA 3L4JA 2O7QA 2AEEA 2W2MA 4EMTA 1W47A 4RFLA 3CNBA 3A2MA 4Q4LA 1B1AA 3K4PA 1EXDA 1NVDA 1R88A 1Y3AA 2JIOA 1OBOA 3MA0A 3OJCA 4WXHA 3H83A 1GPDG 1KR5A 3GGGA 4E22A 4R2JA 5BWNA 1Y98A 5GOZA 1SVSA 1A95A 5CH8A 1A50B 3ZHZA 2FX3A 3P0FA 2IIPA 1EAMA 4KE6A 4OQLA 2HPHA 3LKZA 1GHTA 2W2LD 4QL3A 4H1TA 1BCSB 2V0GA 3O91A 1N8KA 3LCUA 4KRYA 3T3EA 1UT8A 4O4IA 2G3YA 5DM1A 3JZIA 1A2QA 1J8QA 1U2EA 2V6JA 4AJ1A 4QGSA 4IW3B 3HLKA 1JU4A 3AV0B 3TSOA 3GLSA 2VNSA 3BD6A 3N8IA 4DMUB 4FS3A 4NULA 5JZBA 4W5JA 3SXPA 4JIMA 5LDHA 4BV3A 4UBJA 4P32A 1Z74A 3NBQA 1RRKA 2PZ8A 4MI1A 4H60A 4DQ0A 1MEJA 3B9PA 3QRWA 2PH3A 4GE3A 4OREX 5F23A 3B52X 1ZH8A 3FNBA 1FU7A 5DBEX 3O4VA 4ZT2A 1D4OA 1AURA 5IJXA 3R24A 4I5FA 1A8QA 2FXIA 4CDRA 3OURA 1X9HA 1NXVA 3PNLA 3NS7A 3UKOA 2PT7A 1RKQA 1DT5A 1RZ3A 1T35A 4QPJC 3ZDEA 2G25A 3PI7A 2NWQA 2VPPA 5LQSA 1P2DA 4RMNA 4JI0B 1CIVA 1R6AA 1A98A 2ZUBA 4EP1A 3G2HA 5CMLA 4EY5A 1N4DA 4B44A 1A96A 3HLYA 3IPCA 5CFZA 1KY4A 1S2NA 1D2NA 3L7LA 4PZUA 2FMKA 3N8GA 3LTEA 3T5MA 1HT3A 1RJEA 5CRIA 2BBOA 1NN0A 1OH6A 3IP6A 4O4JB 3U6BA 3OC0A 4JEIA 4KZKA 5K0JA 3P9SA 1E0DA 4CLOB 5KSOA 1ANKA 5AKHA 3H17A 1M3SA 1SBIA 1GYPA 1OU4A 1M2WA 4YJ2B 1Y9AA 3OI7A 4Y2UA 3K9HA 4UE2A 4DQXA 3SGLA 3V1KA 1C80A 1WUYA 1A82A 2ZJFA 3V4LA 2ZW9A 1ODCA 4EEKA 1Z7EA 2ZWIA 5I5GA 1UBHS 5HDQA 3UWMA 3OLVA 5FL7A 3V97A 3E70C 3JQ9C 2YIJA 1DDGA 4QT4A 1EVZA 3V1TC 5C32A 3X1YA 5IULC 4IIXA 1AQYA 4UNSA 3TGWA 1VSTA 3U1TA 3OEHA 4A8PA 4E5KA 1Y1SA 1I32A 1L5ZA 1YT5A 2RB4A 3TLGB 1UZAA 2H3HA 2ZVQX 4FUTA 1TM1E 5GONA 3VYSB 2O14A 1Z6PA 3DWGA 3E7XA 5F2NA 5AVOA 1G3RA 3GLKA 3GUUA 4ARAA 2PM8A 1JFRA 3FOZA 3CXRA 1MJGM 1O77A 1QBGA 2FDXA 2GNPA 2W2QA 1A9XA 4JVSB 2X14A 3CE6A 3D3QA 1ULTA 2W6CX 1HDZA 3O82A 2QX9A 2GA9A 1BROA 3SKVA 10MHA 1DWQA 3V4RA 4ZZIA 1DBQA 3ZU5A 1TUIA 1HXHA 1PGOA 1UIRA 1GLNA 3MAJA 3ZXYA 1MOZA 2G4CA 1PJAA 4TYQA 3R8XA 3UNXA 4MUJA 4U2DA 3K70C 5GAJA 5EYPB 2AI2A 1OVMA 5BOSB 2AX3A 3LQ2A 4LHYA 1GV1A 3ABRB 1NI3A 5JOQA 2GCOA 3D5QA 2FQWA 3LGXA 3C24A 3ZE7A 4LXHA 2IXBA 1QAOA 4EJ2A 2A9VA 2H31A 4COOA 2GSWA 4M9SA 4MV6A 3JATA 5U4XA 1SQSA 2G0NA 4TKVA 3ZS8A 3D8SA 2O19A 4GBJA 3LUHA 1KYVA 4NLLA 1SKAA 2OBXA 4OMDA 3JPYA 3NBZC 4WN3A 4CIAA 1CR0A 1RWBA 3VUEA 3OLYA 3WIBA 5IG2A 3DKPA 2IEZA 3RUDA 3BQ9A 5E1OA 4QXQA 4NBTA 3MCAA 1GARA 1XZEA 1T9KA 2GYWA 3CEJA 3VPDA 1UDXA 4B2YA 4KAFA 3EXAA 3OJWA 4J16A 3FIUA 1CP3A 3LUCA 1F3LA 16PKA 2I0FA 3PNSA 4E1BA 3OO0A 3U7IA 1MT3A 1OV6A 2ZR7A 4RCYA 4XYBA 4FCVA 2YWEA 3LLCA 3QQ5A 4TQAA 5CM9C 4Q1VA 5HCIA 4CFSA 4HJXA 1QP0A 3N75A 1R6DA 4UHKA 2R8ZA 4UUNA 4CKBA 1OZAA 1MZPA 1TA0A 1NL3A 2IJGX 2OZPA 5CK4A 1I4WA 4GRIA 1FRZA 1SPXA 2OYSA 4EG4A 3GRVA 1HDEA 3P7MA 3U0BA 3A3OA 2ZCUA 4A15A 3REOA 4GSYA 4CTKA 5FEUA 4XWWA 4OXNA 1HLDA 5K2MA 3PYMA 2IXAA 2W98A 3AIIA 4XM0A 3Q2OA 4PG4A 3C7TA 2XUPA 2JBHA 2YHBA 1ORHA 3STVA 1Z68A 3KAQA 5EOVA 4B3FX 1P7ZA 2IKSA 3CVVA 4BCBA 5ISMA 1JVNA 4E7PA 4DY6A 1Y9ZA 1WB4A 3G5TA 1N2ZA 1II8A 1QKJA 4Z2AA 2FZ4A 5BQOA 2UDPA 2MWMA 4DSUA 2A88A 4PLHA 1VGVA 4UHDA 2OPHA 4ZPXA 3OX2A 1I2BA 1KEEB 2RFLA 3FW1A 4Q66C 3A6FA 2C77A 3DXXA 3SFVA 4F38A 4G0VA 3VHRA 1GT6A 1URPA 2AJTA 3RUAA 1T6YA 2XCIA 2AFHA 4KNWA 1B7GO 4X20A 1IUNA 2FW0A 4R51A 4PSCA 5FNVF 1F17A 2V3VA 4H6PA 1D6JA 2XGJA 3NKVA 4MJXA 3D1LA 3H5VA 1L5HB 2OGUA 3W7BA 1HQYE 4BX3A 3DV0A 1DSSG 2NYAA 1MORA 4UU1A 4N0MA 1PL6A 2AG8A 3KQMA 5DT9A 3SLKA 5I4IA 3K9FC 4K9KA 3L7CA 1NQ5A 4LJ6A 4MYHA 4YJHA 3WB1A 1Y3DE 4F4FA 1CDZA 1I0ZA 2ZU6A 1T2CA 1BVUA 4OL0A 4MRMA 3EVAA 1JDJA 3OO1A 1RM3A 4IJUA 2QX8A 4HDAA 1SKYB 2QNRA 3A4YA 3FFXA 1FQKA 3FETA 4GSLA 1GPH1 4EJ0A 2HFKA 3KL4A 1WXQA 3MJFA 1BVHA 3JQQA 4QBGB 4COKA 4D26A 3MBIA 3BTVA 3G88A 4K9QA 4X7MA 3BCHA 1ISJA 1YQEA 3LYUA 1GTG1 3G0OA 4M6WA 2WKPA 3M8KA 2HKIA 1Z18A 4OKNA 1VXOA 4UAUA 4UNQA 2GJ8A 1T1SA 2FEWB 4HEQA 3JD4A 4XA8A 2IA5A 3L8FA 3HC7A 2IPAB 1Y8AA 2WD9A 1DBPA 3CRNA 5EC8A 4OIFA 5EAIA 4I3HA 2HWWA 3U9SA 3OKAA 1P5HA 1GSIA 2VYFA 3DE0X 1Q0QA 1VB5A 1E2EA 3OHMA 5EP3A 3TDMA 1AO3A 1USKA 1C4XA 3MUFA 3DYIA 1GL3A 3G0GA 3VOSA 4U6QA 1PUIA 3BAZA 3JAWA 4WBNB 3TIGA 4ZEVA 1NXXA 1H05A 3HJTA 4JVOA 3TRJA 4IJ5A 4TV8B 6CHYA 1ZOSA 1KOFA 1Y34E 1ZI8A 2EX0A 1TYAE 4LDZA 1YZKA 2PT9A 4FC7A 4WOKA 1PZHA 1VSQA 3IP5A 1E60A 4LBZA 4BCCA 5ELLA 2P27A 3PKIA 2Q4TA 4F3CA 1AZTA 4BNKA 3Q6MA 4ETNA 1GCUA 4BMOB 2UZ0A 5EUBA 4DARA 1CZKA 3NNSA 4ZT7A 1NVEA 1DAKA 3TOVA 4Y2GA 1FCJA 2CLKB 1G17A 3GARA 1SQFA 3GFSA 5DVZA 3UHFA 3SM9A 2ZIFA 3KVRA 4B85A 4M1TA 2PMCA 4NOLA 3V2IA 1UUFA 1ZU4A 2A78A 2X77A 3GFRA 3PXXA 1R9NA 2B21A 1M34E 4F3YA 4HGNA 4C6TA 3W5BA 4B09A 5CAEB 1BDIA 4A2PA 2IHBA 3KU1A 2YYZA 4FN5A 1RRFA 5BNWA 1D4ZA 1JU3A 3BMCB 3FYUB 4X3PA 3MQ4A 4K46A 5I7AA 4JT2A 3RS2A 3DZHA 1IC6A 1Z45A 2YWRA 5LUAA 3UG6A 4ZJYA 5DHUA 2PNJA 4A6PA 2ZSAA 1K89A 1D6NA 1LEHA 3PQCA 2VA9A 2WWFA 1PWXA 3OIGA 2DKFA 4GMHA 4IIDA 5TT0A 4DPLA 4BRUA 3KV3O 1EWVA 3IUQA 1TZKA 2WI8A 4LSZA 3RTGA 3T7TA 2VZ0A 1AF7A 1LPBB 4P3OA 3GWGA 3DA8A 2NZJA 4AN1A 4B76A 3ZI7A 3KSAC 1XCMA 2J45A 3TIIA 2HFJA 5EZQA 1O6ZA 1NYRA 3PV0A 1OLXA 1NKTA 3QKSA 1YIOA 3K73O 4ZVVA 4QJ4A 3R3XA 3WAGA 1FA9A 3JQCA 2A0XA 4LE0A 1E1CB 2PXCA 2WIKA 3OP4A 5LQNA 4UE3S 5LQUA 1EIWA 1G5QA 5CDSA 3IULA 1TAUA 2V8BA 2OK7A 5CK5A 1GPKA 2JAXA 4N5MA 4RHTA 4JBXA 1TZBA 1H0RA 1JPNA 1DX6A 4XCVA 2VJMA 2Q1XA 4E30A 1XDZA 2QL5A 2HHLA 1KDYA 2JGDA 3A1UA 2GZ3A 3JQ9A 3JWGA 3MWEA 4QEZA 4UHEA 1ZQ1A 4ZQEA 4II2A 2M6LA 3FOCA 3WNQA 1IQ0A 2FZVA 3IVGA 4IIUA 4AN4A 3UMYA 5AVVA 1VSVA 4BNWA 1NNEA 1DAOA 3HBLA 3QTTA 3HJBA 5JPCA 4NCJA 4I8IA 4JI2B 5BSEA 2A0UA 2UV8A 2P9TA 3N39C 2E18A 5LA6F 2RJ3A 5DK6A 2ZUSA 1DC3A 5A6SB 3IP1A 2X0NA 3WK4A 1Y89A 3C3PA 1KMCA 3PUVA 1ODLA 2HBRA 4IFIA 4MEJA 5E1MA 5EIXA 2GLXA 1CJVC 2GZAA 3D7MA 1WMFA 3PQ5A 4DXHA 2YHAA 4OYLA 3CT4A 1GGHA 4K0KB 4MP6A 2XMQA 4NNJA 1DI0A 2GEDA 4WNAA 5D3MB 5J5AA 3WG9A 1K86A 1HC7A 4I9NA 5HE9A 2NQ2C 5A7FA 3GEGA 1Q74A 4N0PA 3MCWA 1KFKB 1Z7YA 2X1MA 1W4ZA 4QPCA 4LG1A 2ILTA 1EVLA 4IIVA 5FWAA 3STWA 2RBGA 3VU0A 4J4BA 2QJFA 3TSAA 2JGRA 1OLSA 5KTTA 3U61B 3FDZB 1WXDA 3CEHA 3EIOA 1VJ1A 4RPLA 5JYBA 3BFPA 3OKPA 2NT3A 2WE8A 1KRXA 1DV1A 3EDCA 4CI9A 2BW0A 2Q0HA 1ISMA 4IUCS 4CLRB 2YRXA 5IEBA 3RYIB 1IULA 3RRJA 2EL9A 3NFYA 3PFIA 4H3KB 3RJMA 4EA9A 2JH8A 3QUSA 1CLUA 3H9EO 3ON5A 5I9SA 2CLMB 4TWBA 3KSZO 4EKDA 1NN3A 1R37A 2IYRA 2DBVO 4NZPA 1ZVKA 1DQYA 1NAIA 3KZXA 3NALA 4G85A 4P5EA 4RHFA 4MR9A 3L8HA 2EWWA 4B45A 5AVRA 5HZGA 4R8MA 3C6QA 4DDHA 1JBQA 2JVKA 1TTTA 3R23A 4AD8A 5H5JA 4RHCA 1SU8A 4YP7A 2JAOA 3Q8WA 4IR7A 5DPMA 4HFNA 4LQLA 5HTKA 1JQAA 1NBIA 2O0LA 1OTHA 2IL1A 2JFNA 2J0UA 4Z4CA 3QE2A 3VISA 3W77A 1VMEA 4B33A 1R4AA 3KUCA 1Z8DA 5B58C 4IMRA 4YN3A 1VHJA 3Q15C 4MICA 3TX2A 1Q1QA 1L7OA 4FNGA 4NQRA 2NPIA 1EEHA 1L0BA 3PEEA 3RR2A 2CJWB 4NENA 5IT0A 5TPZA 2JAPA 4S0ZA 3QFSA 2DHEA 1CCWA 2JHAA 2MSNA 1TO1E 3IEUA 3AYZB 3NIFB 1JWAB 5BYJA 4FFMA 5HK9A 1OB2A 1BWRA 5BW6B 1F06A 2W6NA 4DV1B 3SX0A 1RE0A 1KDVA 4AMGA 1CE8A 1P4SA 4JJEA 5HZHA 3OCUA 1O95D 1WSWA 3QJGA 4O2AA 2QX4A 1UBKS 4Y1GA 5AW9A 3EXG1 3LUDA 4CLHA 4KIJA 1L4MA 1MG5A 3H4TA 1SKUA 1HDIA 4FEAA 4GU5A 1K5HA 4OQPA 4PG5A 2Z4RA 3FTNA 1YD7A 4CFYA 3NHAA 5L3SB 3ZW9A 2IXGA 4Z1MA 3D0QA 4M0LA 2BGGA 5IUJC 4Y18A 1TMKA 2Z8ZA 3FKQA 1KVSA 3LA6A 1NSTA 3VAZA 1KH2A 3LY7A 4AMZA 1HETA 3TJZA 4WE3A 1XCBA 2OUKA 3IBGA 1TAGA 3EPPA 3NRJA 4I5GA 4B73A 1KVTA 3MBOA 4MQUA 4DY4A 2XYQA 3EZ2A 1AZWA 1MQ8B 4K03A 1AK1A 1NW3A 1JIKA 3LC7O 1E94E 3HZHA 4FZVA 5EXTA 2F3QA 3ZKWA 1N2SA 3EOAI 4RZHA 1XNHA 4HAUA 1SBQA 4X62B 3HZRA 2E85A 1NVWQ 1JGTA 1YDEA 2QN8A 1ZK3A 4C04A 2YHUA 1EE2A 3LC2O 1ITZA 3IQGX 1FXWF 4JLKA 1FFBA 4RWZA 1EHCA 4ZVUA 2JCBA 2X4IA 3IEXA 3WZLA 3PA8A 4HNSA 1X1QA 1Q16A 4OUKX 1U28C 4F2HA 2AOVA 1DB3A 2B94A 2HNAA 2XSZD 2Y1GA 3AFOA 1JEDA 3I30X 4HDSA 4YUVA 1N4AA 3TR6A 1U4SA 1UQTA 1ZOPA 3NUQA 3U39A 1QCYA 5LR6A 5A71A 3KYCA 2AR7A 4L4RA 2H16A 5YASA 1ZG3A 3TW4A 3ZY6A 1SOVA 4HQNA 2DHQA 3HKBA 2A0FA 1CY4A 3OC6A 1GYQA 4QWMA 1V7QA 4X90A 1GUYA 2G6BA 4XWTA 2PG3A 1J1ZA 1WXIA 3CRZA 1R12A 2ZAMA 4P54A 5GY7A 3UUGA 1ND5A 4LPKA 1JTVA 2HTEA 1NHWA 1Z35A 4JJIA 5HBGA 1T9BA 2ZSJA 5SY6A 1S2MA 7REQA 3L4EA 2NSYA 1DARA 3HKDA 3AM1A 3BMOB 1HSZA 2HJSA 2PEYA 1QUFA 4EW6A 2BEUB 2NVWA 1ZC4A 3CW8X 3QVJA 3AILA 2R4TA 1P72A 2FFQA 5AKJA 1WEKA 3MYRA 2I71A 5GQSA 3UAZA 4YUXA 3VHXB 1DXOA 1W46A 1GPJA 3ZHVA 3ESXA 4QM6A 2G9UA 2AN4A 3NAQA 1NR7A 1Y1LA 3KJQA 1FS5A 4RZQA 4ZJUA 3DMGA 1UWVA 3GJRA 2GZSA 4M1ZA 2BLLA 2KYRA 4X84A 5EPUA 2IYWA 5IZCC 3C5VA 9LDBA 3CZMA 3KQYA 2K5UA 2KLBA 2J59A 4FJ2A 2X5NA 1IJFA 2AGVA 5E9QA 2DUWA 5CFMA 1N77A 2JJ1A 5TF0A 1A0OA 4UOEA 1QX4A 3WGOA 1HMPA 3LXUX 1M10A 2VHCA 3MN1A 5K6AC 2ZG6A 5K8UA 1KS9A 3ROQA 2PMBA 4HL6A 1QV7A 4EY3A 5IDWA 5HM6A 5JXIA 1N25A 5LQCA 4KSCA 1X2EA 3GF4A 1NN1A 2F3TA 2KW5A 3T3IA 2C7PA 3PNYA 2O8FA 3IVRA 3M9WA 4BGIA 4RLFA 3FUWA 3VTFA 2QD4A 5LL6P 3G9XA 4DCMA 4B2LA 2IBMA 2XYRA 2Q3FA 2RHWA 2X9LA 3AEUB 5KHAA 2QN7A 4ML3A 2HJ9A 4CF4A 5A4FS 2XA1A 3CLSC 5TEVA 1T1RA 5ALLA 3DYVA 3H0CA 1IIRA 5HKAA 4A7PA 5JT1A 2B4KA 2V7QA 2VH5R 3M34A 4J0JA 4YO7A 5DEIA 1FBNA 2V7UA 3FBTA 4B4KA 1MB0A 3JPWA 3A9WA 3MFQA 5EPEA 2J4FA 1TTPB 4I9UA 4REQA 5IBQA 1NMQA 3I2KA 3KHUA 1D2AA 3FCAA 4M55A 3Q3HA 3OTHA 1J39A 4OMCA 4B48A 3V32A 2Q6TA 4R6WA 1EBBA 1KAMA 1QS0A 2ORYA 3Q88A 3B1ZA 1QWOA 2BUCA 2ODNA 3H7AA 3ROMA 3NEPX 2RSLA 3SHTA 5BQ3A 1OKKA 1W5SA 4S1NA 4HMQA 1EH5A 1PYGA 3QITA 4FEGA 2XRMA 4U39A 5FCDA 1RWNA 4L57A 2H8GA 2E37A 4L76A 4GMXA 4GIBA 5COAA 4D9NA 2NO0A 1J0XO 3A8TA 4L9WA 1HT0A 3T9BA 3DXYA 8ATCA 4M0DA 2NU7B 4MPRA 1ZUIA 1Q0LA 1T8PA 3WMWA 3BWBA 3P9YA 1TLFA 2GYYA 4OO3A 3GEPA 3V7FA 2R48A 2C57A 4F6RA 3IT1A 1ISPA 1L3BA 2BLNA 1V16B 3IB6A 4NOMA 1KA9H 5EMMA 1OH5A 1U8FO 3VX4A 4UNIA 2WSSA 4FKMA 1PRYA 3BGVA 4CIDA 3DT8A 4FUQA 4IGIA 1E3IA 1Q7RA 3ZJUA 5GJCA 1E63A 4FYIA 4YPFA 2OE2A 4JHLA 4HDKA 5EKTA 5FEMA 4JOBA 1LTKA 1C9EA 1P75A 4K05A 1SEVA 1T8UA 4G4GA 2UUOA 4MHSA 5EXDA 4D8XA 3L8CA 2GCEA 2ZGVA 1ACLA 2RK4A 1AKQA 4FNMA 3GCXA 2RHTA 2FLKA 3AVXA 4LJYA 3M70A 4F4JA 2EKBA 1G3UA 5JBNA 1DRWA 5EIWA 5FUVA 2OQVA 3W9YA 5LCXA 2ZVDA 5FL7D 2GK4A 1O5TA 1GKKA 4PLVA 1U0BB 5IKXA 3B2QA 3TLXA 3FTEA 2VWQA 3BZUA 3OEHD 1W96A 2PRZA 4KQMA 2BEVA 2V7BA 3D31A 5CTAA 5GM1A 1E2LA 2JF0A 2OV2A 3CPHA 4I81A 1OPXA 5K8TA 1H4VB 5TRTA 3PEYA 4EEXA 2RDMA 2VCHA 3U60B 4AY3A 1JEJA 1DAHA 4FE7A 4L27A 5EWJA 4WEOA 3WLFA 4BIIA 1G2OA 4LGCA 5KQLA 3EOZA 2XDYA 3HJHA 2EW1A 4R3NA 1T3TA 1S1CA 1GKUB 3AB3A 3CONA 1X80A 2Q9AA 3GUHA 4IQFA 4UTXA 2XT9A 4G25A 1MQAA 1PR1A 4QQNA 3MLEA 2XJ4A 3N3AC 4X95A 5HF5A 3KKKA 3OF3A 1EINA 3TD6A 1WCXA 2GB4A 4U8GA 4W7SA 1CKEA 2V7GA 4CL0A 5HQ3B 5CFLA 4KRXA 4JKOA 1UDCA 5EGSA 3ZDZB 1W8DA 4HZUB 1PGJA 3D1JA 1ONNA 4K6KA 1M83A 1NUSA 2A5LA 3LQRA 4Q24A 4V0OA 2H5EA 1VIAA 3HADA 4D43A 2BZSA 3UHJA 3A2NA 1U8UA 1XEXB 2I99A 1M72A 5CT9A 5JDCC 3MJTA 4C08A 5KQMA 1ARZA 1DC6A 1IPFA 5SZKB 3PL1A 3WDLA 3IRUA 5FL3A 5JHGB 3JQFC 5TQJA 3AETB 4ZVKA 3TBHA 2FHPA 2NYUA 2Z6AA 3M5CA 5TE9A 2FV8A 2PMKA 1UJ2A 4N0DA 1D5CA 4XYGA 4EFKA 4HNTA 3NDBB 3OZVA 3RBVA 3MWDA 3OX1A 3T6KA 1YRLA 2PJZA 3HP1A 2QM3A 3SR0A 1NI5A 2QJOA 4CHTA 4K8RB 3O1JC 1XQYA 1N34B 2Q0SA 3UKJA 2XTMA 5EEGA 4DM4A 5FA5A 2ECOA 2OGSA 3GDGA 1R0RE 4E94A 1YA6A 1QH0A 1RAIA 1VP9A 2CJYA 5DHRA 4QUAA 2F3RA 1KK1A 3OT5A 1OE0A 2XGMA 3JD3A 3BQNB 3CZ5A 3GQVA 2M32A 3MS2A 1LLFA 4N40A 1IZ7A 5TMDA 4GT1A 2HMWA 3GBSA 3I0ZA 3MWKA 3VOAA 1K0UA 4N0EA 5DLEA 4EY7A 5C4MA 2C4VA 5K0SA 1LDMA 4HDRA 1JHZA 5TVKA 2LNDA 3R41A 2QX6A 4XWYA 1QMGA 3GA0A 1HV8A 3LQYA 3ED1A 3X2SA 2DKOA 1VKHA 3X1KA 4AJEA 1XTIA 3MGKA 4BO0A 1W36C 2XNJA 4E7OA 1XWWA 1KBOA 1KKLA 1XAHA 3LOPA 2PO7A 1L1EA 4LVNA 1R10A 1U2SA 5AHXA 3TSWA 3ZV7A 4E13A 4F4CA 1FJGB 1QLHA 4NG5A 1U2ZA 4ZZ0A 3HVRA 3CHYA 2UAGA 4DMCA 5ICEA 5ITWA 3KQKA 1ORVA 3C1TA 1NBEA 3EUAA 2FUNB 3FLAA 1GUFA 4UBIA 2C2BA 1ULBA 2YWHA 3CZRA 3LS2A 5DYGA 3RVRA 4YRFA 3ZHUA 4E11A 4C6SA 2JZCA 1ATZA 2QZSA 1Y3HA 3IBCA 1U28A 1DOHA 1KYYA 2R47A 3N53A 4LYGA 5CB4A 4MVJP 5EIOA 4CV3A 3MLAA 1E1QA 2I78A 4NV1A 3VU1A 5T41A 1QVRA 3HB7A 5FI5A 3RIGA 5CLIA 1U63A 2UYYA 2NVBA 5ECYA 3I8SA 3KQNA 3T4UA 1NLZA 3LHIA 1G9SA 5AM0A 4DA0A 1E3MA 5KYKA 5BR4A 2WYIA 3EGXA 4JSTA 3OUUA 1CVLA 4TS3A 4MWTA 1OIWA 3OT1A 3LWDA 2WUEA 5EMKA 2PY6A 3ADDA 2Q3HA 1C0IA 3STYA 2XV1A 2QRVB 4TZKA 5CT5A 2PWBA 3EWNA 4GPD1 4MA4A 5SICE 3UA3A 2C94A 3OD1A 3RC9A 2C98A 1MHPA 1JXMA 3WL3A 2WJWA 3H2IA 3QFFA 1J2TA 2K87A 1L7EA 3EXEA 3W7VA 1E3SA 3JTEA 1U0OC 4FB5A 4XB1A 2VPIA 4O4LF 3KTAA 2F1OA 3KZCA 3Q5GA 4RY0A 5K3FA 8ABPA 2YV4A 5IZCA 4DV2B 1W0KA 2AMFA 3LCMA 3O9ZA 5IJ0A 3ML1A 4JJAA 2ZIVB 3V4SA 3M9LA 4B3IA 1IAVA 3DB1A 4IIGA 2PR2A 4EKGA 4YRBA 2Q49A 1IBLB 3OOJA 1P7CA 3O8RA 1PYDA 5K6AA 5ALKA 3THWA 3TLCA 5IT5A 3TMAA 1WZ2A 3JVIA 3L93A 1UKYA 2B4TO 1XLWA 2G8NA 3M3HA 5IDVA 1NIPA 4A8HA 1X1TA 3OPYI 4ME6A 4MKZA 4PPYA 4ALKA 5ER6A 4DOMA 3D0KA 4JODA 4D56A 3QVUA 1WHSB 1PR6A 2OCBA 2WY2D 2CJFA 1UL1X 3ITEA 3N0TA 4OGWA 2PS0A 2GZDA 4NYMQ 4WERA 3PUKA 5CNMA 1Y5MA 3MMXA 2O54A 4OP1A 1EE9A 4GL4A 1CT9A 1E1NA 1M1YE 2PLAA 1L7MA 1FF9A 2V03A 1FVOA 1RAHA 4Y2QA 5BMOA 2H8KA 2PWZA 5THXA 1CR2A 3V2GA 1JEYB 3OQOA 1DX4A 5AHOA 2OBYA 5JH7A 5JMTA 3HJFA 3UY4A 5JPDA 2RK3A 1WZIA 1FUIA 1T3ZA 2F43A 2H4ZA 2ZBGA 2YZGA 3LLSA 4GZ6A 4P38A 5LLDA 4GOND 4ZVQA 2VT6A 4NS4A 5EI5A 1V26A 1EGHA 1I7NA 4LRUA 4Q4DA 2CEKA 4RIGA 3JVEA 1ILEA 1FJ2A 2G07A 3JCZA 3TZCA 3ZYCA 2OG1A 4V0QA 1BN7A 3OF5A 2O2SA 4BX8A 1PG0A 3AUXA 3NORA 5TF4A 1L4YA 5JNRA 3GN1A 1DTWA 1X19A 5F21A 2HM7A 3CR7A 4XVUA 2HGSA 3UK2A 1DQPA 2D1RA 2JIPA 5HS6A 2PUCA 4JDPA 2A30A 1WXXA 1RQ2A 5FPHA 4BFTA 2D7DA 1CUUA 1U6JA 2QOEA 3CINA 5H83A 1QIJA 2HRZA 1JA0A 2HU5A 2CVOA 1C0LA 3COPA 5JVDF 1SUFA 2C5HA 5BP7A 4CU2A 4URYR 3ZDQA 1I0LA 2G1KA 2HL6A 1F7UA 3CNNA 4M87A 5D84A 1TLLA 1DFGA 2CXXA 3R3SA 5HM8A 1WB6A 4N6NA 5TXGA 1D04A 1JE0A 1AUPA 2PRSA 3PQ2A 1ZJYA 4F2WA 2ZK7A 5FPQA 3LUKA 2HMSA 3RBAA 1ZSVA 2EP5A 1E7YA 3KPUA 1Q1GA 4M1YA 2X9NA 5JV5A 1HPLA 1U4NA 1VQ1A 3T1VA 1RXEA 1J99A 3DUFB 5AW8A 2V55B 2AOTA 4KYTA 1J9ZA 1GNQA 5HRAA 3RSGA 3C8HA 4JSYA 1OFUA 5AK0A 1BE1A 1EK1A 1FRVA 4X61A 5AKIA 4DIEA 3MG9A 4X85A 5AI5A 3K8YA 4LYHA 1T1GA 1EHYA 3L0PA 2SKDA 1HRDA 1USVA 1OY1A 3OY2A 2CLLB 3O4FA 3NTRA 4EJ6A 3K8OE 2EW8A 3RDPA 4C2AA 5JNWA 1CY1A 1GUBA 3CJTA 3AFMA 4MQBA 2MYTA 1BDJA 3OPYB 4N3AA 4OFWA 1E6LA 4X8LA 2D62A 3O2JA 4YBZA 4YT5A 4C6HA 4EMUA 1KEPA 1ZN8A 5EXXA 1N7JA 5B55A 1HORA 1O8CA 3OIUA 5D1NA 3ZV5A 1Z2AA 4E2WA 1E61A 4HVTA 4YREA 3CN7A 2PFSA 2ZFUA 1XZCA 5EJIA 3U81A 5FOVA 1XPOA 1O1YA 4IJ6A 4I3FA 2O7RA 2VJYA 4FHFA 1J2EA 4G5SA 2A84A 5FYDA 1JRLA 4C7JA 1C3LA 1GG9A 3C1AA 3ROXA 1X42A 4MGKR 1RAFA 4RF3A 4BQEA 4G1UC 1QK4A 2HD4A 4FXOA 1NLFA 3ZCVA 1PLKA 1GXSA 1UOOA 3P9KA 4V24A 2YCLA 2O7NA 3A1SA 4BNXA 4YAWA 3P2MA 3QM1A 4QQFA 4UVDA 2AA3A 2W8BA 1Y7TA 2J3EA 4DIOA 1AF4A 2G4LA 2HLPA 2BMJA 4M9UA 4OUDA 5ILQA 3B51X 3VC2A 1UAAA 2ZSIA 3DP9A 2P6UA 2UZ3A 4ZAXA 3ZWDA 3HCWA 2Q1YA 3K70D 2GN4A 2VHYA 4KODA 3AI2A 2VYCA 3AEQA 4Y6LA 1RI2A 4PICA 4Y8VA 4UULA 4YLYA 5A05A 2AX4A 2XBMA 1SURA 3KDPA 1IWBB 2E87A 3LDAA 3I8OA 2FG5A 5JALA 5JDCA 4HADA 3C14C 1M7HA 3IQXA 4UU7A 3J81k 2OTCA 3JQFA 4FI3F 4P36A 4CTJA 1J8MF 1LBQA 1XB2A 2E6KA 4QJIA 5EIBC 1F2UA 3DS8A 2PA3A 3GHYA 4E5VA 2O59A 5T57A 1QRDA 5BSFA 2YRFA 4OQXA 4CR7A 3P0IA 4J2HA 3MINA 4MW0A 2OV3A 1XG5A 3MMPA 3VZDA 4YUWA </