3BGSA

Structure of human purine nucleoside phosphorylase with l-dadme-immh and phosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
286
structure length
286
Chain Sequence
b'MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
molecule tags Transferase
source organism Homo sapiens
publication title L-Enantiomers of transition state analogue inhibitors bound to human purine nucleoside phosphorylase
pubmed doi rcsb
total genus 95
structure length 286
sequence length 286
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2007-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bgsA00
1OV6A 2QTGA 1RXUA 1RR6A 1N3IA 1Z37A 4NSNA 5IFKA 3OF3A 2QDKA 3FAZA 1QE5A 1JDUA 1PR0A 5F78A 3SCZA 3DJFA 1LVUA 4M3NA 5DK6A 4DA8A 1RFGE 1Z38A 1LX7A 3FUCA 3UAZA 2OC4A 3DP9A 2ISCA 4D9HA 4L5AA 4FFSA 1SD1A 3BSFA 1NW4A 1U1FA 1C3XA 4JWTA 2OXFA 4F3KA 1PR2A 4PNPA 3IEXA 4DABA 4QFBA 1JDVA 1JPVA 4M7WA 1Z35A 1JP7A 1A9SA 1SJ9A 4JOSA 1M73E 1PK9A 3UAXA 4TYMA 3FB1A 4NS1A 4R2XA 1A9RA 1WTAA 3NM4A 1OVGA 1ZOSA 1Q1GA 1Y1QA 4H1TA 1TGVA 2AI2A 4LNHA 5F7OA 4KN5A 3IOMA 3DDOA 3LA8A 4I2VA 3NBQA 3GGSA 1Y1TA 3O6VA 1LV8A 4R2WA 5ETJA 1I80A 1RXCA 3ODGA 1PR5A 2B94A 5B7QA 4L5YA 4G41A 1Z34A 1K3FA 1PBNA 3E9ZA 1T8RA 3EMVA 4OGKA 4NY1A 3KUKA 5CYGA 3INYA 1ULAA 4WKNA 4OEHA 1PWYE 1T8WA 4F3CA 4E1VA 3EUFA 3NM6B 4MCHA 5I3CA 4DA7A 3UT6A 3E0QA 5EPUA 4YJKA 1A9QA 1A9OA 4L6IA 1Z5NA 3P0FA 2H8GA 1OU4A 5B7PA 3ONVA 1V3QE 4MCIA 4R31A 1PR1A 4GMHA 5CCEA 2A0WA 1RT9A 5K1ZA 2HWUA 1Z33A 4MARA 4X24A 2AI1A 5F77A 4GLFA 4JP5A 4DA0A 4WKCA 1CG6A 4WKBA 1ULBA 1VMKA 1NC1A 4QATA 2HSWA 4TXNA 4D8XA 1A9PA 1VHWA 4QARA 1JYSA 1Y6QA 1CB0A 2I4TA 3OCCA 3LBAA 5KB3A 1V45E 5CXQA 3BGSA 1Z5PA 2RJ3A 1TCVA 1K9SA 4DARA 1A9TA 2IQ5A 5C80A 4F2WA 4LZWA 2AC7A 5FAKA 1YQQA 4YNBA 3PNPA 3BL6A 2Q7OE 3KU4A 1ODJA 3K8QA 5EFOA 4TS3A 2OC9A 5F7ZA 1G2OA 1ODIA 4TXHA 1ODLA 1T8SA 1Z5OA 3OOHA 4QEZA 1V4NA 2QPLA 1SQ6A 2A8YA 1V41E 3PHCA 4LKRA 3OZEA 1B8OA 3PHBE 5F76A 2HRDA 2P4SA 3OZBA 1K27A 5EUBA 1ECPA 4YO8A 1YBFA 2AI3A 4QAQA 4IP0A 1VFNA 4TTJA 1U1DA 3PNSA 1JDSA 1Y1SA 4OGLA 4BMXA 2QTTA 5IU6A 3DPSA 4OY3A 3TL6A 4DAOA 1U1EA 1PR6A 4F2PA 3KHSA 3KVYA 2PGAA 4YMLA 1NC3A 3FWPA 2XRFA 2ON6A 1RXYA 1YR3A 4L5CA 3OZCA 3MB8A 1JDTA 3BJEA 5F7XA 3EUEA 3NM5A 4GKAA 1JE1A 5CXSA 1PK7A 4TXJA 1PW7A 4DANA 5JPCA 1Y6RA 1SD2A 4QASA 2QSUA 4GLJA 4TS9A 4DAEA 1RSZA 3GB9A 4M1EA 4K6OA 1V48A 2BSXA 3ENZA 4G89A 3P0EA 3O4VA 4TXLA 4P54A 2A0YA 2I8AA 4L0MA 4BN0A 1PKEA 1ODKA 2OECA 4D8VA 4DA6A 1TD1A 5CYFA 3FOWA 1U1GA 3KVVA 1XE3A 3DF9A 4LDNA 2GUWA 3C74A 2HN9A 4WKOA 3UAYA 4TXMA 4F1WA 1RYZA 3OZDA 1Z36A 1T0UA 4PR3A 3F8WA 4OF4A 4TTAA 4EARA 3FNQA 4EB8A 3MMSA 1V2HE 4G8JA 3OOEA 4LNAA 1FXUA 1OTYA 4BMZA 5CCDA 3QPBA 5F7JA 4U2KA 1RCTE 1A69A 1T8YA 1TGYA 5F73A 1TCUA 4BMYA 1U1CA 4WKPA 4OJTA 3T94A 4UC0A 4D8YA 4D98A 1B8NA 3EEIA 3U40A 5B7GA 5B7NA 4RJ2A 3LGSA 1OUMA 3E9RA 3UAVA 1VHJA 1JDZA 1PR4A 1RXSA 3K8OE 3OPVA 1ZL2A 3KVRA 3UAWA 4ECEA 1Z39A 1Y1RA 1JE0A 2A0XA 4TTIA 1YRYE 1OTXA 1PF7E 1YQUA 3D1VA
chains in the Genus database with same CATH superfamily
3RD5A 2QM3A 3HVJA 4LGMA 4ZXPA 2Z58A 1SXJE 3OHPA 2C0CA 2MR5A 2COUA 1X1AA 1RLOA 3FLBA 4NSNA 1VJ0A 4PFJA 3R40A 5M2QA 3PLAE 2B4TO 4HX2A 3IJPA 1UT5A 1R5JA 2DP4E 2MTBA 4H60A 4BFUA 1CQZA 1JDUA 1GM5A 1PJ2A 1U0LA 2WKPA 2NPIA 1ZMOA 3MBOA 4PO3X 4MQFB 5DW3A 2O1EA 1I1NA 1ONNA 5FWYB 5KX5B 5LL6P 3R8FA 5AXCA 1DFIA 2XJ9A 3TXXA 2O5VA 2YNMD 4O4LB 4FCCA 3BG5A 1DO8A 1D7AA 2AF4C 2IHKA 2X0IA 4EBBA 4ZVUA 4MVJA 4A91A 4ND7A 1BMFA 1CJSA 3B6MA 3EBPA 4JGIA 1ZM4A 3D81A 4L95C 2VJMB 4ZICA 2QENA 3D8TA 3EQZA 5BRNA 4A0QA 3KQHA 2HIMA 1DPFA 2CVOA 1OH5A 1OI2A 4L8LA 5FFNA 2VHEA 3NBZC 2PPVA 5LOVF 2QVLA 3NG1A 3QEOA 2ORWA 1CUBA 4BQSA 2ZI4A 1W44A 1YL6A 3UWMA 1Z6QA 1QH0A 2L17A 1Z7EA 3IXLA 1XNQB 4OGGA 3ECAA 1XTZA 2J3EA 4C5CA 1J2YA 2C07A 2PQ6A 4LNUA 3EEQA 1T6BY 3SX0A 4U39A 1R4AA 2HK9A 5FJJA 2J1LA 5K8VA 3GUZA 4DLYA 1ND6A 3HXKA 3FGNA 1R0YA 3DKVA 3JQDA 4FCWA 1K5DA 1WULS 1Z47A 2IUTA 3HVIA 4E88A 2C04A 1N4AA 1I2ZA 1E7MA 1K5HA 1USKA 4G2NA 4C4OA 3KOZA 3QZUA 4CKBA 4LFAB 3TLJA 4FTWA 1UOQA 1YQTA 1HUQA 1AM4D 1KMQA 4EG1A 5GGYA 4MRNA 4ZI5A 1B76A 4WNYA 3P52A 3VJMA 1IMOA 2PH1A 2PYIA 1E1DA 2IEIA 3NEPX 1ODFA 2VXCA 2OHHA 3B2QA 5EUCA 3T7JA 1YQWA 5E9AA 4RM3A 3ZWXA 1ECBA 4A15A 5DM2A 1LBHA 2XTMA 1R6VA 2A7XA 3QE4A 2W42A 1Y80A 4ZKDA 4IGAA 3Q2OA 3KSRA 5CA0B 1HL3A 1W0KA 4L2IA 4NENB 4A0RA 2RHWA 4BB5A 4NXNB 2WYUA 2EX0A 4KSBA 4JXZA 5H02A 4KXVA 4N8EA 2IV7A 3ENVA 2O8EA 4ZALA 1SD5A 3NBQA 4R5MA 1PZGA 3EZ9A 4JYZA 3UMMA 2B2XA 1EM8B 5KWJA 2E4ZA 3G13A 3ADBA 3EMBA 4K26A 2GZ1A 3L0IB 4G1VA 4PLGA 5A5FA 1NVGA 2WVHA 2UYOA 1PSZA 3UTCA 1JHYA 3BBPA 2HJGA 4I9UA 1VECA 3KOOA 4LXTA 4X84A 5G1OA 1KVQA 1V47A 4YXWD 4B76A 1RXCA 5EVCA 5SY6A 3UMVA 5HJ7A 1RYBA 5AYVA 4WGGA 3OLVA 2E21A 2IEDA 3C3MA 2J3QA 1WUIS 1Z45A 2XUHA 3ET5A 4YAWA 4P6VF 4DCVA 2HQ1A 4EB3A 1CEEA 5BVHA 2VDRB 3V80A 1HPLA 1T5OA 1ABFA 4OO3A 3CNNA 4H9GA 3ZBUA 1B8PA 2A94A 4RTMA 4UU8A 1L1QA 2XCQA 5DV9A 4BVHA 2GK3A 4I1SA 4JLKA 3N0TA 1L5HA 1VLHA 3GJ5A 4FOLA 4ES6A 7ADHA 4Q9DA 3ZDRA 1CFZA 1HTWA 2AJTA 4ITRC 2A3NA 3EUFA 4D0SA 3CNOA 1Y3IA 2VNIA 2WU3A 3UK6A 4TV9A 1M76A 4G5XA 4IEIA 4NICA 1O2DA 5HFJA 1UZAA 1T36A 3DV2A 3S4YA 1WL8A 2BZ0A 4N18A 1FFBA 1WF6A 3JQ9A 3P0FA 4H0NA 4L6IA 3ZDDA 2JVKA 1U8UA 4PN3A 3SDBA 2ZIEA 2X2OA 1IQ0A 3NR2A 4PZYA 1NKVA 3B6JA 4YGXB 3BCSA 3CLUD 4A0GA 4RQTA 2J9YB 2J5KA 3EARA 3EVAA 1XRPA 3V7FA 3QY0A 5EQFA 3BCRA 3EVFA 3MWEA 5TQ2A 1H3NA 3VBCA 2P7IA 5LD2B 1GCAA 3C97A 2DETA 5KUTA 2R65A 2G8NA 3QX7A 4KOEC 3RAFC 4ABTA 1D0SA 3K30A 2X5OA 3OHSX 4PSVA 2WNIA 1C4OA 2ORVA 1NHGA 1E7YA 3WHLA 1CU1A 2X7JA 1A76A 1QPBA 4AJJA 1KJ8A 2WF7A 3ASYA 4U7JA 5JVDB 2YYYA 3G68A 2JKZA 3S40A 2WG1A 2G1PA 2XITA 4RVFA 3U0VA 4L5JA 2BMEA 3MT0A 4X61A 3UHFA 5AICA 5JSHA 3TIFA 1JKJA 3BB3A 4HB3A 4LZJA 2QM8A 4TWIA 5FYDA 1ECCA 1TQ2A 2C9YA 5B6PA 4HRVA 2WDZA 2TYSB 4JUFA 1N9GA 3LDAA 1I3OA 3ELYA 3G88A 4XR9A 5CPFA 1T4CB 1JYSA 4NCHA 3ZNOA 3HB5X 3TW8A 2GZSA 2ZATA 2G88A 4MYRA 3JQ8B 4FKZA 5TGZA 3RG2A 5KB3A 3QWAA 4NOLA 4ZU6X 3I76A 2QRGA 1Z8DA 4JQSA 2JAHA 5ER9A 4D9IA 5HYVA 4BGDA 1JDBB 4LF9B 1PX0A 1P4SA 3LMKA 4JP2A 2W2XA 1TZKA 4RL4A 5D3ZA 4LJ8A 3F7NA 5DASA 4BAGA 3I64A 3M6FA 4TV9B 3CG0A 2FPGA 3D7NA 3E4CA 3HG7A 4Z1OA 4R0VA 3X44A 1MT3A 3HJGA 1NJ6A 2HJHA 1TA0A 1V16B 4MV7A 2REOA 5E6UA 3SNKA 5EJ4A 1P1RA 1L4UA 2H4WA 3SHQA 1DBVO 1D2CA 2VRCA 4HDRA 2VNHA 3UOGA 1QDEA 1VHLA 4O3FA 1GGVA 1RJ9A 2JDID 3L6BA 2WE7A 3VDMA 4BWYA 1PVOA 1GRVA 3JAWA 5JUWA 2Q7OE 3F73A 2H85A 9ABPA 2E5WA 2R6ZA 3QLUC 4OX9B 2M1XA 3PGJA 4GQAA 3THRA 5IXJA 2CEKA 3A6KA 3DWGA 4LF6B 5EIBC 5AVZA 1YR8A 1QH8B 1I1OA 1MOZA 4DPMA 1TQ4A 2QW0X 5F23A 3HFRA 4JL8A 3G2JA 2AX4A 3GJ0A 3FOAA 1L5RA 1ZJYA 2G7MC 3GRFA 5AI9A 3DHVA 2WBLC 4G63A 3U1TA 1ULHA 1WD5A 3CB4A 1O3YA 3F9RA 3GLGA 3R6TA 1H4QA 1N5DA 1M2VA 3SYMA 2PXXA 1B93A 4F9EA 1GPAA 1UJCA 4FDTA 4TLDA 3A4TA 3IKJA 3EVGA 5JIBA 3TWOA 4PLZA 1E6CA 8GPBA 3U13A 2HWWA 3O7MA 3U44A 1RCUA 2O4UX 3UCFA 3ZU2A 1LX6A 2H11A 1OTHA 4ITVA 3SYNA 4BJHB 4PN7A 1ZH2A 1RJDA 3A6EA 1S3IA 3GYBA 4OJKA 2JGKA 4FFRA 3ZN2A 4C6TA 1RE1A 3VSDA 3HCOA 3EDMA 1XF1A 4J0HA 1V6SA 2REBA 1OHHA 5E7JA 1EUZA 3IPRA 4HJRA 4XGIA 5F5LA 3DJYA 1FXSA 1ZM7A 4G5RA 4M8SA 3UC9A 4IMPA 4BVEA 5DN6D 3K0KA 4JQZA 2IWHA 1K27A 1U2DA 2DPMA 3RIXA 1JQLB 2ZI9A 2GHTA 2WV9A 2FJ0A 2P6OA 2OZKA 3COSA 3I2FA 3L7LA 1ZBDA 3FVRA 4IJMA 3A3YA 4X1KB 4YQFA 4LDZA 3WB0A 2E18A 2FPGB 3AOEA 3BQ9A 3MJFA 3PZBA 3C6QA 4B6GA 2DVMA 4IP0A 3OE1A 4FGSA 3B53X 1LFAA 2XLCA 3ILXA 5AJTA 1E5DA 4PZUA 3CRW1 2VTEA 3HYLA 4EHJA 1EZZA 2JBHA 1R0WA 3HCPA 4N9WA 3W8DA 4B09A 3B82A 3K53A 5JC1A 4G8BA 3KE8A 4TZ0A 4ARZA 3GFGA 1LBIA 2CNWD 1ACJA 3ABQB 4QJ4A 5FA8A 2NZWA 3WWCA 3F47A 2YDYA 4J1NA 5EHGA 1X80A 3A6GA 3OQ1A 4CM3A 1GRRA 2ZJ4A 4WSOA 2CJXA 2ISSD 2ZCUA 3K32A 4KXYA 4P5DA 4R8KA 2AK2A 4DGQA 2P0EA 4EY3A 1N9GB 4KQJA 3UMRA 1KVTA 4P38A 1KDYA 4BVJA 2OTCA 4RHFA 2JLYA 3T5GA 2N46A 3OZCA 4ZT7A 1E9AA 4O4IF 1W5TA 2WKQA 2NT3A 3MB8A 1U9IA 1Z07A 2W2LD 3NTOA 4FGKA 4J2HA 4NYJQ 2ZR0A 3L01A 2Z6AA 3BA6A 1PWZA 2YV4A 4J1TA 4QDKA 2D1FA 4GNRA 4EKDA 1E9DA 1SU6A 4XVCA 4JU8A 1MGPA 3OZFA 3A4IA 4DG8A 5JSYA 2H57A 4GKAA 3PRYA 1P9NA 3MCTA 1U9JA 1XU7A 4XQ9A 5SY4A 2QX4A 3W3AH 5EYPA 1QHYA 5CFQA 4UBOA 4PO8A 4HYTA 3AEQA 2QIPA 1TJ4A 3HR8A 5K6TA 2QSUA 4E1AA 1PUIA 1RI5A 1CNEA 1O8CA 2H59A 1XK6A 2MMGA 4WZZA 3JWHA 2AE2A 3NKFA 5TMDA 4L3OA 4AM8A 5CG2A 4KW7A 3LI2A 3RSQA 5EJAA 1W1WA 4CFSA 3V33A 3DAGA 2OENG 1G41A 1N3LA 3BXGA 5C2JB 3ZXYA 1GILA 1KP9A 1OXKB 3MTGA 4NJEB 1WXHA 5BW6B 4CU5A 2JLWA 4P3PA 3VHXB 4UD2A 4XSHA 4HTFA 4OHRA 1Y0BA 1LK5A 1KZ4A 2IPAB 3WMWA 1I4EB 2VJKA 3M3HA 2HSGA 4MUAA 1Z0SA 2JL1A 2PZ8A 4B6OA 2QZ4A 2VK1A 1BH6A 2WU0A 5BSHA 4PFQA 1YS7A 2EZUA 4EQZA 1KI3A 1HYEA 4Q4JB 4LG1A 4AQDA 4R9RA 2VXBA 3A6FA 3KB1A 4MGKR 3THWA 5TS2A 3KVVA 1CJUC 3C98A 5LN1A 4KN9S 5DHPA 2NVOA 1CE8B 2OEPA 3HKBB 4O02B 4UEWA 3D31A 1LV7A 2GUWA 2PMCA 1OROA 4DBLE 1JFLA 5BSTA 3RGWS 1XCMA 4EPRA 4F04A 2NP7A 1I4TD 2OO5A 3UXHA 1R0XA 1TADA 3B12A 4ON9A 4FMDB 5DP1A 2WWWA 2IW3A 4WKOA 1Q44A 5KOHB 1F3LA 1ZD5A 2KX7A 3ONNA 1D4ZA 4JNCA 1N3BA 4XLTA 3RHTA 4F1WA 2J31A 3OHMA 1OZAA 4TWBA 5HUQA 3F8WA 1L5WA 1GQQA 4OF4A 4R71A 5FWAA 2PX4A 2J09A 4LF8B 2ZSJA 5AM5A 2EGUA 4CR7A 3NKLA 5AESA 1H1LA 2R79A 2R97A 1NJFA 5GMOA 4PXAA 2MSLA 3C6YA 3MUOA 5FNZA 1YS9A 4CRWB 5CPBA 1M0TA 5B36A 1JBQA 4G8JA 5EE0A 2BAGA 4D9FA 4ID3A 1I2MA 3SQNA 1E3WB 1RJWA 5JBNA 2OZEA 1KQNA 4ARBA 5ENDA 4W63A 3D4PA 2P3OA 2Q2VA 1DEOA 2RHJA 3D8NA 3WWZA 3QG5A 2ZI7A 3DMTC 1J0AA 2AMVA 2B36A 4GR9A 6NULA 2OCDA 1LPBB 2FKNA 5DFAA 1UWKA 3EC1A 5E7QA 4G56A 5IYZA 3JYQA 2BT4A 1GZ5A 1BWSA 5HBRA 4WCVA 5HMLA 1EX7A 2VDLB 1NASA 1TGYA 4J29A 2WKRA 4LJ5A 4M87A 4URFA 4QM7A 3RADC 2FPPA 1XCPA 1J70A 3TFOA 1FP6A 3HMQA 2V3CC 1TUEA 1GLVA 2GD0A 3AR9A 1R4MA 2BF4A 2EJTA 2QA5A 3OOSA 5FX2A 2Z4SA 1ZJ6A 1T2DA 4MLDA 5HZKA 1KYWA 3Q72A 4QBIA 2PVPA 3TUJC 3D4OA 1T3LA 3R0IA 1QGUA 4TSKA 1PNQA 2A9PA 4OL9A 5LB2A 4BB0A 4J94A 5JE8A 2XCSB 4GOOD 1XTPA 1UPBA 1UDWA 4MPRA 4IJ6A 3ZXSA 1DX4A 4Y0NA 2O8VA 1C3EA 1RVDA 3L04A 3T1VA 3U40A 1EE9A 2WYWA 3IIJA 2GBIA 1Z6XA 1HM5A 3WL6A 1KU6A 5I9TA 1TK3A 3F97A 2VYND 4QOHA 1V37A 2UZ3A 2ZJ1A 3LOPA 5HIMA 5K3SA 3ZZ0A 4RE6A 3X1JA 4K9LA 2OO7A 1G9SA 2D1YA 3B5JA 2WKSA 1XZKA 2D5IA 2XSZA 3NIWA 5JAPA 4HDCA 5INTA 3NX4A 3F3MA 2ZTVA 2WTAA 2N1BA 2YFHA 2EXXA 4HYEA 3W0LB 2C4VA 3K0BA 5AJWA 2J8ZA 1WIWA 3H6HA 4IIBA 1FP4B 1W9HA 1KI1A 1XMVA 1PFKA 1XPRA 1WCWA 2FWBA 2B8TA 1B42A 1I7PA 2PRIA 3UG7A 3ZGOA 2ZM6B 1PS9A 1SZJG 1PDOA 1UXHA 2YV3A 3CT6A 1IBCA 1PQ4A 4HNAB 1ZJ4A 4QU9A 3T0IA 4C0HA 1M34A 4DJDC 5HQTA 2BDUA 3WE7A 2CFRA 3K0CC 4DMMA 1YRWA 1U31A 3QEAZ 1A2KC 1WCIB 3RIHA 2P65A 1WMFA 3UIEA 1IIRA 1ZIDA 1EKXA 3OO1A 1H1DA 3AU9A 4LXXA 4JSTA 3P0RA 2UXBB 1PUXA 4LGVA 1U9IC 1M2OA 4LY0A 4M9RA 2EYQA 4X1OA 4F2GA 3ZZ1A 3GFVA 5DI3B 1MO5A 3O1HB 3EGDB 4BLWA 4HT3B 1ZIOA 3EDYA 1PKXA 4RD2A 3QVXA 2YHBA 1Z37A 1NOKA 3FNEA 3UJHA 2DB3A 4RK0A 4QU5A 3G1UA 3MJRA 4DA4A 3R5HA 4UHCA 2J08A 1VB3A 3R3JA 3KETA 3GFSA 3GGDA 4EABA 1E9EA 5IBCA 4RHEA 3EEFA 2QU7A 4G0MA 1KYZA 2DFKB 2QR3A 1S2NA 4CMJA 1QZXA 1T5IA 3X1MA 2CJPA 4EKEA 2FDCA 3BT7A 1ZKDA 2X1LA 1DMSA 3D6NB 3DMHA 1KI8A 4EUEA 1RMQA 5JYDA 1W34A 1FUKA 4BQQA 4LOIA 1S3GA 1XMJA 1ZCFA 3HQ4O 5BT9A 2PX0A 4BNMA 1UF9A 4BC1A 4NI5A 2O9JA 2ACVA 1VMIA 5AK5A 1Q77A 4PIVA 3ZBTA 2WM3A 2RI6A 5KOIA 1H2FA 2H31A 4XI9A 2A2ZA 2YN2A 1HRDA 4PAMA 1HE8B 1Y1LA 4BB9A 4G8DA 5BSGA 4DFDA 1SULA 3EVNA 2VAMA 3T9AA 4ZHQA 3MWLA 1H0HA 4Y2UA 2PZFA 2XCUA 3AQIA 3NYRA 3TRDA 1GGEA 2LNDA 4JWTA 4RVSA 4EP1A 4GVPA 1XTSA 2X3YA 1E99A 2IGBA 4DABA 4I99A 5HS4A 3P9RA 3TLZA 3NTRA 2C8JA 2QL6A 2VL7A 4QDTA 3HDJA 5CW1A 1XWWA 3VNSA 4OGWA 1I94B 4NAVA 1F4LA 2R85A 1EHCA 3TNYA 1HZJA 3FCAA 1JHRA 3O9VA 3BJRA 4PYQA 3ZTYA 1GZ7A 3FB1A 3GLRA 4MR8B 4WNIA 2VP5A 4FDUA 4MYDA 4UCQA 1YHYA 4GUDA 4TRJA 1C4KA 3LX5A 2Q4EA 5B12A 5KNLA 4KJZA 4GI7A 4XVQA 3JAWB 1M5RA 1CY6A 1VSBA 3L9WA 1JZTA 5F9FA 1OCEA 3OSZA 3NJ8A 4RMHA 2A78A 4UJ3A 2D5BA 1GR1A 3P9IA 4OLBA 1SU7A 5KS2A 2AJ8A 1SXIA 2EP7A 2JI6A 4WK6A 5DLEA 2HR1A 1V25A 3B1WA 2JLUA 4IUBS 4CMHA 4YMIA 3OLXA 1QRUA 1AKNA 3UWPA 2W6QA 4KE8A 4QFDA 2Q45A 3ITKA 3GJRA 2AD1A 1KY5A 1L8OA 3A4YA 5HRUA 4ARCA 5KTMA 3OM1A 1UPCA 3ZHXA 4P32A 1GZ4A 2YHAA 3CWCA 3BIFA 2WV7A 3FYUB 1DKQA 3QFHA 4CQMA 4K9KA 1G66A 4ND8B 4IF6A 1U5BB 2O0HA 4NARA 3ZU5A 1UBOS 2P6UA 3AM4A 3VR5D 3HXQA 4YROA 4ZAGA 4B6PA 1VKNA 1KIAA 5HF6A 2F59A 4WIAA 1UBSB 1VE5A 4G1MB 3KL2A 4KIFA 4M9XA 3ZDFA 2PJDA 2GNPA 1XZDA 1LSJA 4Q9IA 2UZ1A 2B5VA 5CB6A 5F1YA 4PHTA 1SVNA 2Q0SA 4BVKA 4P0QB 1CJTC 5TS3A 4I8IA 1T5DX 4D0LB 1HT3A 5LMNB 1HDXA 3KUKA 1BDBA 4O0LA 1EDEA 1C8BA 3IVMA 1QGOA 4LY6A 1PT6A 4WZBB 1ECJA 4QPJC 1F2DA 1YHZA 1L4EA 2H6EA 2X5NA 4Y0VA 1M8FA 5D51S 5BNFA 5CDUA 3CA8A 2ZBDA 2DPGA 5FUWA 1T8WA 2INGX 3DD1A 5KHAA 2WU4A 4MZDA 3LY9A 2GM4A 1TT5A 3R5SA 3GDOA 2V97A 3AI7A 4HZGA 1DBQA 4OH7A 5HA5A 4BVGA 3K73O 1UWCA 4FNOA 4HQFA 4N76A 3OWHA 1ESEA 1ZSYA 1ISJA 1POWA 2JI4A 2VP9A 3BIWA 3OH8A 3U4GA 5C4IA 1CF2O 4ENTA 4KXWA 1I6MA 1E2QA 1XA0A 5LZ2A 2JFNA 2RH4A 1PR1A 2VDUE 2G4LA 2ZW9A 3OIWA 2WMDA 3QPWA 1HLPA 1RAEA 4A1OA 1BH2A 3N07A 2R1VB 3SAJA 4G9GA 3TSYA 4AMBA 4D42A 2BELA 4Z0TA 4CLEA 1N6PA 5FNVF 2AEJA 1HLDA 1F4PA 3VQTA 1IBSA 2WF8A 3NEAA 4X24A 3TR0A 3O8RA 1BJKA 1JB1A 4H3SA 3V4RA 1ZUIA 1SQGA 2ZRAA 4FD3A 2COEA 4YPVA 4K0RA 3TTUA 2RE8A 3I0ZA 2SNIE 1L1EA 4QXRA 4UM9D 4QRIA 1YFKA 4HAXA 1IEVA 1RKXA 2D4HA 3ED5A 4EYSA 1WMAA 2VHVA 2JJQA 2IYTA 3ZGNA 4AYTA 1N1GA 2OOSA 3OPMA 4QTZA 1T24A 2HSWA 2FSHA 4MP6A 1D2RA 2IPXA 4Z7JA 3DFMA 3N3BC 3AFOA 5MGNA 1KEKA 3G8CA 4MINA 5JXIA 4Y6LA 5L3SA 5B3JC 1CB0A 4F6LA 3H9BA 1IXYA 2V58A 1JU3A 2CLIB 2HLDD 1H6BA 2QZ9A 3P4YA 1JALA 1JI0A 4JL6A 4E4TA 5AKEA 2C2MA 4MLCA 4D80A 3D6UA 2QNRA 2ZTSA 3ONFA 4LWZA 3TZBA 3PWSA 1Y8QB 3DHWC 3G2NA 4D4IA 3I8OA 7REQB 1FJXA 3NOXA 1IUPA 5JZBA 2ADMA 2G06A 1A9TA 2Y66A 1RPJA 2RHCA 3FGOA 4MAMA 2JI8A 3IQZA 3IMKA 4Y2GA 1ZD1A 3ECSA 2UVPB 1CLUA 3LZ6A 5CJPA 4TLLB 1JHMA 4V0OA 5HM6A 1F17A 1DRUA 1OX4B 2HXYA 2ZXEA 4G5YA 4XUEA 5EJ2A 3OIFA 4DXHA 5KWEA 4QVGA 5H16A 4OK6A 2WJAA 5KVSA 2NVBA 5CRIA 1LLFA 2I9PA 1XZHA 2PT5A 2FE1A 3ZDBA 1Z4OA 2VRNA 1U94A 1ZNQO 1EDOA 2ZUCA 3E3AA 3INGA 2I8CA 3H2IA 4AZTA 5F9MA 2RC5A 1NN0A 4RLFA 2FZ4A 5K6AA 2FN7A 2QRJA 3KU4A 2OYCA 5LP6A 2Q6VA 5EAIA 2RG1A 4MWCA 3SBDA 1RBQA 5ESWA 1ZCJA 4BLOA 4BU0A 3OCWA 1NIPA 1LDBA 1UANA 2AMFA 2X4DA 1NR5A 1R00A 2XMQA 4Y2TA 1Y8RA 2FEXA 4B3XA 3MZ0A 3E23A 4YDHB 5EP2A 1YRAA 3PP8A 2IDJA 2QL9A 3KIPA 1KRHA 1KC3A 4ZAZA 4NCJA 4JI8B 3D7LA 3H2SA 1JA1A 4JLAA 3V34A 3MMZA 5C5DA 1G4AE 1MPXA 4ACBA 1AGNA 2POCA 5TJ9A 5J4LA 1PNTA 1OGYA 1SC1A 3I9LA 1XAGA 4S12A 1T2UA 2G9NA 4PONA 2VTBA 1N1DA 5HIIA 4DCGA 4ZI3A 1W35A 4II2A 1TU4A 2J3KA 1B8VA 1VKOA 2QT1A 3WS7A 4KNVA 2QSYA 1HETA 1JVNA 1M2JA 2HFKA 3HV2A 4NPCA 1B8OA 3AM5A 3LCMA 4JGGA 5BQ3A 5B2EA 4MUBA 3VYRB 4ZCIA 5JNUA 1XQ1A 3BTSA 3O3OB 1R5BA 2FRDA 4G23A 4KXLA 3GG2A 4EHBA 2IA5A 2OA0A 3VR6H 1P73A 1M2WA 3N2GA 4N3CA 3G7UA 3I12A 4UPEA 1JXOA 1ZD4A 2W58A 3OP1A 2OZLB 4K86A 4EI8A 5LYJB 4EW2A 2HJWA 1SUCA 3K5IA 1JSZA 1WP4A 5TY0A 4QHYA 4A26A 1B43A 3UHPA 4JLMA 1Y9EA 3L7JA 1E3LA 3V1YA 4KI0A 2IOHA 3ICPA 3JY6A 4D02A 1DKPA 1R8YA 3EQ8A 1WX1A 1GTMA 1JHPA 2HKIA 3AJAA 3H42B 3HY4A 4N6OA 2G1JA 3S7ZA 1E1NA 1SRRA 5JLJA 2L18A 1NQUA 4Q16A 4ROSA 3RB8A 3ZCTA 1HMPA 3T5PA 5EIFA 2QAGB 4R41A 2O2YA 1GDDA 3OEHA 3T9CA 1H5QA 1RQNA 2WIBA 4CDMA 3EXEB 5DBOA 2QLNA 5J4KA 3WNBA 3DTVD 2VF7A 4YCJA 4DZRA 4JD5A 1MVNA 3AP1A 4D56A 3SVZA 2IYEA 4MPTA 3KLOA 2C5HA 3VXKA 4PLTA 5JISA 3EXHA 3VISA 3V1KA 3S1LA 4ZKEA 2NADA 4HFNA 4J49A 4B32A 1AQJA 2XNCA 1OY1A 2CJWB 3T1OA 3HJBA 1IZ9A 3ZI7A 4Z4GA 3KD3A 4G0XA 5AHOA 2YS7A 4TTVA 4HH3C 3OF5A 1XHLA 1L2TA 1T3SA 5K2OA 4P93A 1FCJA 3IEIA 5F33A 3A3KA 4W9RA 3NEYA 1BX1A 1PK7A 2VHQA 5CXSA 3ENWA 3EGXA 3L8MA 2G36A 4RETA 2MSWA 2XUPA 4HMPA 4YMSA 3OC0A 2FPIB 4MKIA 3PJGA 5KJFA 3E9DA 2CNLA 3AETB 3CKMA 4GE0A 1NXQA 5JEEA 3CVYA 5KO2A 4I50F 3RGGA 3K9CA 2WP0A 1JRLA 3HC7A 5JS7A 3NDBB 3R0QA 1KY3A 3ORFA 2FQ1A 2KE5A 1Z4PX 4C7MA 2C9CA 2NTVA 3NAQA 3NYQA 1TM7E 1Y4SA 3OPXA 4S1TA 4B40A 4F6RB 5GTDA 4L8FA 4XZ3A 5L7WA 1SWVA 3UM9A 2YOHA 4WFJA 2O2HA 1FS5A 4MKRA 3W6OA 1AF7A 5EZYB 4ESHA 7YASA 2V1UA 4DTCA 4ZCSA 1JMVA 4EG7A 3D8RA 1S6YA 1U7DA 3IB3A 1MUUA 3ND5A 4G01B 3JQ7B 4RKEA 3S2SA 1Z26A 1KAQA 2CD7A 1M0WA 2ZROA 4RPJA 3V42A 1HLGA 2YN4A 2GLTA 3UZUA 1S2GA 3VU3A 3WNCA 1TXGA 4HTAA 1BXZA 2HMYB 4URUR 3K70C 2Z2YA 4ENPA 2XZOA 1FS6A 1VG0B 2V7PA 3P45A 5B3AA 4CL3A 2OECA 1S1MA 2WTUA 3VI3B 3BMCA 1BXGA 2JS7A 4XEUA 2QN2A 1R9MA 1QH1A 2ASVA 1J42A 2W7TA 4D0RA 5TARA 4OHBA 3REGA 5IUJC 4H4CA 5EJGA 1QHIA 3GGJA 1KAOA 1TDJA 1U8EA 4G2TA 5AWFC 3HU3A 1AUPA 4OGFA 1ZOLA 1ZD9A 4FWIB 1J7KA 3AINA 3ZHBA 4HR7A 2J0QA 4YP7A 2WOOA 1XX6A 2VH2A 4B3DA 4CMAA 2ODWA 4XWWA 1K8QA 1RYMA 5IDVA 3OLCX 5CMLA 2WWYA 3IP3A 1N34B 5A6VA 1E2EA 2FU5C 5DMXA 3VV3A 1FLDA 2X9LA 1OGJA 2HY7A 2QMYA 1X14A 3VSAA 5HTOA 4TQAA 1NBME 5LDGA 3I34X 5IF3A 2CXUA 1D9ZA 4YXWA 3TIXB 3CXRA 1ZHHA 1UXJA 4LYDA 2YWEA 3ZVRA 4MGYR 5J2UF 1MHTA 4Q24A 1G19A 3CLTD 2KWIA 1RRPA 4XUDA 2WMNB 5E1MA 5ALIA 2XXAB 3KB8A 3UMJA 3H75A 2GO7A 2O7QA 5LA6A 1N7IA 3GPCA 4B85A 2IWRA 3HPQA 1S2LA 1C3LA 4IH9A 4GX2A 5ESDA 4AKEA 2CZQA 4EG5A 3GZ4A 3KG2A 1CEYA 1J39A 1FXUA 1OTYA 2ZYWX 3K0FA 5DTIA 1G8HA 3GF4A 1HV8A 5CVVA 3G9UA 2OESA 1EEHA 1S2OA 1XLUA 1N5RA 1QUFA 3MFQA 3HEAA 3F6BX 3GFQA 4GBGA 5FYQA 5JVDF 5J23A 1L7RA 2NV6A 1K3TA 4KIWA 4BJ6A 2WIGA 2NXJA 2O3JA 2RSLA 3SOZA 1UADA 3LX4A 4H16A 3PWTA 1FQKA 1J5PA 3PT9A 1T0PA 1N7HA 1QONA 2QQ0A 4UZSA 2XUDA 4E4YA 3O8OB 4FIZA 2E89A 2RKOA 5LIPA 4R1MA 1XNGA 1VKRA 1UKAA 4UULA 4HGQA 2X4LA 2YZMA 2V55B 4MKHA 4EY8A 5M34A 1GKIA 3AVXA 3KP1A 3KDSE 5HJ2A 2FHSA 4F93B 2DFLA 1X42A 2HUNA 4MJXA 4A8JA 4ZHQB 1DQYA 2IC5A 1MAAA 3GCWA 4KQKA 2GAIA 3EG9B 1KJNA 4RLHA 3T35A 4KC0A 1EFRA 5J5VA 1RWMA 1X8KA 5LQRA 3MOGA 4QJIA 4MW7A 4OMCA 5FQNA 2GAAA 2C0PA 3ESDA 2C00A 2VWHA 5AJXA 1L9XA 3QUSA 2R5WA 3BXPA 2ZB8A 3JAMA 3DBVO 2E0IA 4KO2S 3A25A 3HBNA 5GV7A 3ZE1B 2PYDA 4YCCA 2NO7A 1Y5MA 4IFIA 3G2PA 2CL0X 1CY7A 2ZJAA 4BZZA 2X0KA 4NZPA 3ZI0A 4GOND 2JCYA 1N2SA 2JK0A 2FMFA 4JLBA 2HLDA 3T06B 3P9CA 3BN3A 2AZXA 3STUA 5CHEA 1JS1X 4XB1A 3EZYA 4FZ3A 1RNLA 3WIDA 4DCOA 3AI1A 4M98A 5B1YA 3PEFA 4IQGA 4P4LA 3IYLW 1T2VA 3PE6A 3OM0A 3GCXA 3W2FA 2ZBEA 4OFXA 4A0SA 2XRZA 1J99A 3DL0A 4WZBE 4OUKX 3THSA 4RZXA 5EZ5A 4AICA 4NYMR 2PWZA 3GRAA 4AUKA 3D1VA 4NEQA 3KPUA 1HT0A 1GKKA 4DY6A 3QUQA 2VNSA 3KBOA 2UYYA 2KLHA 4X92A 2ZBGA 3U5ZB 5GIOE 1QIDA 4M0PA 4J3FA 1HNWB 5IX8A 4MWEA 1JLKA 1BRMA 2F4NA 2C92A 1NU8A 1T36B 4Z2YA 3V4SA 4EIWA 1J06A 4A8PA 2FX3A 4JP3A 2FEWB 3AOGA 4PYJA 4DIOA 5GPBA 1GNPA 1KXJA 1U65A 1DAIA 1W47A 3CTMA 3ORYA 4CDRA 4FFBB 1H8ED 2F3SA 1A04A 4MMXB 5E4TA 3FZYA 4XPZA 5T5QA 4ED9A 5JHGB 2CMFA 3AY0A 4I50A 1DJQA 3FUCA 2X3FA 2XMRA 3KEQA 5FBRB 2ISCA 4FFMA 4NYJR 3DMYA 1WA5A 3BQMB 1F5NA 5I01A 4O0MA 5TJHA 1SUDA 3O3MB 5AOCA 3PHJA 2KPOA 4CDGA 3DB2A 4CVNA 3IDOA 1NQVA 4RTNA 3T7IA 4WJZA 2XGGA 3QLTA 4EJ0A 2CFIA 3P9YA 4TV8F 4TRNA 1V3TA 1RM4A 3BIOA 4LF4B 1Z5ZA 1EJ2A 4MKGA 5JXGA 1FQOA 1CUVA 1PR2A 2EZ9A 2RK6A 2IW1A 4PNPA 4NFYA 1ADCA 3A7DA 4FYHA 4G8CA 2CLHB 3R76A 1AMUA 1ZNXA 3GT3A 1U80A 2J41A 3DBRB 2YJ4A 3L7KA 4YASA 5BR1A 2BFBA 4JLJA 8MHTA 3PQ8A 3R24A 4JOSA 1KMCA 1HLFA 1MMFB 2XXJA 5CGZA 1XD2A 4QKQA 1ORTA 1FFHA 1F2VA 2XKBA 2QRLA 3TW0A 4AIRA 2QD5A 1DKRA 4ZMBA 1NUQA 2VAWA 3JZFA 4NMHA 5IJ0A 1YR6A 3IO5A 5JTUA 2I3BA 1PGPA 3K0EA 4D9CA 1JJVA 2JGRA 1KOGA 3DC2A 3K72B 4B3FX 2OBMA 3TOCA 2R86A 3ESRA 3MS4A 3VMFA 4IHJF 2H4FA 5B4TA 3RPEA 4AY5A 1OKKD 1C14A 3JVVA 4UCWA 5ERYA 5FO0A 3D6FA 1G6OA 3L18A 1OC4A 5LU8A 4NZZA 1P1FA 4FPXA 4RXUA 2QRVA 2O8CA 2JFZA 3WJ7A 3ZWBA 5E9QA 1PQWA 3IR7A 4XA8A 4PVDA 4Q00A 1Z18A 3E18A 3AH8A 3R6WA 4RZHA 1SXQA 3JQGA 3NP7A 4V0KA 1GHTA 3C8HA 4N40A 2H8KA 2WYHA 4N5IX 4DQ0A 1X70A 2CDRA 2CHVA 2DFTA 3TI9A 5C8VA 1L5VA 2CDBA 2VF2A 3ADCA 5KNCD 4BNZA 1VRCA 4PBTA 1GZDA 1BE0A 1Y37A 1SXJC 2QLMA 1A2OA 3DAYA 1SKYB 4KO1S 4KV9A 5B7QA 1Z34A 2GARA 4AVYA 1ZNZA 4YXFA 3VZCA 2WJ4A 3RSLA 1GTRA 3K9WA 4HB2A 2AFIE 4Y6OA 2RHRA 3HKCB 4EMBA 5ADHA 3PG5A 1QVVA 3U3ZA 1QG4A 2Q07A 4DV3B 2VCHA 1FMTA 1W96A 2F48A 2JBAA 2R8EA 3ZBPA 1C4WA 5LBUA 3H2BA 2B4AA 1M2VB 1ZO8A 2UXDB 1Z63A 3PA8A 4UDNA 4F3CA 2HA3A 5LZ7A 3TE7A 3M83A 1V8BA 2FW9A 5D7BA 2GM5A 2VXYA 1V1MB 3EA0A 3SXUB 2Q8NA 2ZYIA 3IALA 3KXPA 3RT7A 4NXMB 3GVPA 4XLZA 1WSBA 3JARA 4ZJUA 4KLZA 2Z9DA 5FF9A 3S28A 3STVA 4M21A 1JSRA 3IPLA 2D8MA 2I54A 3PYXA 2IX3A 1UC4B 2GEKA 5F9HA 5EMNA 1R3UA 1LDMA 4C0JA 1A7JA 2D0PB 1KO7A 4Y1FA 3DBIA 1CRWG 1O57A 2FZKA 2DZDA 3E8XA 4IFTA 2YWFA 3WB2A 4AI6A 2P78A 3ZVLA 1P72A 4HLDA 4IR7A 1HTTA 4I50B 3Q12A 3GLFE 1ETUA 1R0KA 3D0OA 4D3XA 4DXDA 1KS2A 2NZXA 1PJ4A 1BHO1 1NUTA 3DONA 3SIWA 3UMSA 3T5BA 4HH1A 2XVMA 1M2EA 3EXG1 5BT8A 4OQXA 3GIWA 1NXOA 1E1MA 2HMAA 3QY9A 2J9ZB 4OMDA 5CA1F 3M5CA 1XLWA 5TR9A 3ECCA 4H7KA 4HNUA 1RQLA 4A6XA 2XX3A 2AYXA 4H7FA 5KTOA 3LKBA 4FEEA 4Q7JB 3CRNA 1II8A 5BNTA 2BFDA 2V65A 1G291 2OFOA 2YVAA 5K0SA 3DZDA 3WL7A 1X7YA 4ZQIA 5KYKA 2M6RA 3JVIA 1Y6QA 1Y3FE 2I4TA 2EC5A 1I0ZA 2I78A 2NVWA 2EATA 3EIHA 3IBFA 1TNDA 1VBFA 4LJ9A 3A1FA 3Q7SA 2H4JA 1R0BA 1S8FA 3RS4A 2C3OA 4I3GA 5CCXA 2ZSFA 4ER7A 4FNAA 2IDZA 3GLIB 1XTBA 2PS0A 5L6LB 4BJ3A 2EQBA 2VXOA 3B9BA 2FV8A 3N8NA 3LGAA 4J0DA 1E2HA 4M0FA 4ZZ1A 4YCLA 1O95A 3IOBA 1B1CA 2P9EA 3JQ7A 1JECA 2GTIA 4UHFA 4NONA 1RPZA 3M1AA 3O4RA 1T3HA 3AY3A 3S6JA 1PFWA 2JEYA 5EQTA 3ZX5A 3FLEA 5DGHA 2J3IA 4IVQA 1WDTA 3T8YA 3ZD8A 2IRWA 3NT5A 3Q9LA 4C20A 4BNYA 4E5PA 1KSFX 2F1IA 3BMOA 3K9QO 3LE8A 4ZQHA 2Q0HA 4HI0E 3UEOA 5BUSA 5ELXA 1AG9A 3LQ1A 1NE7A 2BR3A 2BKAA 1SVIA 1FFXB 2BFPA 2GI4A 2GK7A 3GAMA 2WP8J 4N41A 3A3OA 4KK4A 2RC6A 1ZOIA 3HRHA 4LV8B 4QPNA 3I8SA 1X1EA 4J6FA 1R12A 1ZOPA 3SHFA 4QVIA 4MTLA 5BSFA 4FM9A 3L8ZA 3HDQA 1E2UA 1VPVA 3OQIB 1G8FA 2NN3C 3RS2A 1NGSA 3I2KA 3UT5A 4YALA 4PG5A 3F71A 3OZXA 3S1SA 4G65A 5A9TA 3UUWA 4YLYA 1OXVA 1XT6A 1ZGJA 5DBEX 1GUAA 1MW8X 4FFDA 1MR3F 3A4LA 4NBRA 1VYVA 4JJ6A 2IZ1A 2AFIA 1THZA 2QL5A 4PLYA 3FPHA 1KI2A 3WIEA 1EFDN 4IEEA 1GPDG 3REFA 3PUIA 4UMDA 4GOMD 4EJSC 2IYOA 1VCMA 2B6HA 2NYVA 1TZJA 3EW9A 1W85A 4K3UA 2JAOA 1LBSA 4F45A 3LS2A 2WA1A 1KI6B 3WLQA 5B1EA 1JR6A 3W3ZB 1N2GA 3QXGA 3D4LA 1A7AA 2J3MA 2O57A 2P4UA 2IE0A 3EYWA 5DISB 3RSFA 3OT4A 3NPAA 4YQEA 2RFLA 1DBWA 5K0TA 5JC8A 1QO7A 3INTA 4R84A 4GVXA 1W29A 3JTEA 4G4SO 4DUYB 2Y67A 2QROA 3T7TA 2JARA 1FEZA 1GY8A 3RBXA 3TMAA 3V2HA 3AUKA 3QFRA 1YZGA 4GEKA 3WXMA 2GH1A 3WGHA 1TE2A 3W1VA 2C7VA 3CUKA 4R9NA 1VJRA 2QVCA 3EGVA 4CKEB 3O8OA 1YR2A 4YJDA 4GE3A 4JU9A 2FOIA 3CJTA 3H11A 3ZVKA 1BE8A 4LBYA 2WJ6A 1ZJWA 4CIAA 1EP2B 1YS1X 1DTWB 3Q3EA 3R4VA 4AG5A 3DS8A 1E2BA 3CW2A 2YWBA 1Z3CA 3PCRB 4IDPA 3RC9A 4Y2YA 3T54A 2B2NA 4PX5A 3RVLA 4OGLA 4G0VA 1QHGA 1XRMA 2QTTA 3DPSA 2HQBA 4HDMB 3JQ6A 5L7TA 6YASA 2G09A 3TSZA 2AV6A 3MAAC 1G5IA 3EBLA 2DQ4A 4JQYA 3TL6A 1GT6A 4OA5A 4Q9AA 4WBSA 3IMGA 4TOIA 3KHSA 3ETHA 4DMLA 2JLAA 2PGAA 1EFAA 9ATCA 4HEJA 2RGAA 4DMUB 2EOAA 4Q12A 1NV8A 1V1RA 1MT0A 4YJHA 5KVAA 5A4KA 1FW6A 2XNHA 4QG7A 4HGZA 1NRXA 1TQHA 3EA5A 3ETEA 3KXIA 1CQJB 4PRYA 5FWYA 4C43A 1FRNA 1JF8A 5HKKA 4E46A 4MAAA 5E6RB 3JX9A 1IFXA 1SCNE 4G25A 3NM5A 1BOOA 4B3SB 4GDFA 1YBMA 2FMKA 2EW2A 5EHIA 2V7BA 1KIFA 2NTNA 3L7DA 4KL8S 3WGLA 4BRWA 1RQRA 4CF5A 1L7QA 4XX0A 5KJEA 5L95A 4KPGA 3FMPB 1FUEA 2E82A 5LP1A 1XEXB 5EP4A 2WA2A 1X7GA 1L7MA 1YE5A 2PCLA 4JJEA 3A28A 4XD7D 2YXDA 3AL2A 3GHYA 2IYWA 2R2AA 2XOKA 3L7NA 3NORA 4UNRA 4HUQA 2L2QA 4X9XA 4BO1A 2AKYA 4Y2RA 4OI1A 3HDYA 4QSHA 3W2HA 4RD1A 3OJEA 4AYWA 3E2PA 4MIOA 4CM7A 3AWIA 3V4FA 4DNQA 4F2DA 3FDJA 3ZHYA 3BB4A 5F98A 1TM3E 3EAGA 3RJZA 4LJLA 1HQDA 1NTRA 3DQZA 4QSMA 4AMYA 1RWXA 2P40A 3RSCA 3L6UA 4OVKA 3WBBA 4QOIA 3QEMA 1AB6A 1H6DA 1OXXK 3LDHA 3OAAA 1R0RE 5ALGA 5ARCA 3URMA 4EH1A 4QQFA 1HFKA 1HFEL 5LMCA 2G28A 2LZ0A 1RTTA 2ZAYA 2ZS7A 2FQWA 4W9NC 4IV5A 2BBWA 2J0VA 1WHSB 2QG9A 4IIFA 1ZLYA 2CFOA 3VTKA 2PKRA 3I52A 3WX0A 1AB5A 3LHSA 4DXAA 2C96A 3S44A 2GPYA 1AKQA 3CUUA 3FKJA 4EA8A 2MYUA 6LDHA 1JIUA 1MLDA 4C5AA 1E7QA 3E8SA 2OHVA 3WWOA 4AG6A 3SEZA 4PZEA 4NK4A 3S2GA 2PL9A 4AWAA 2F3QA 1Y1PA 1YT5A 1WUJS 2FMIA 3BYZA 3PEEA 1MB0A 1U2GA 3B7GA 3CR8A 3E5RA 4GWGA 4PC3A 4YT4A 3ZJUA 1ZJ5A 5ALHA 1OFUA 3GL9A 4K8OA 4YRSA 1US8B 1FQWA 4RY9A 4DV2B 1T1JA 4EFNA 2QXUA 2Y27A 3KT0A 4PICA 5JATA 4LHXA 4TZTA 4BRUA 2P3QA 4IH4A 4BDSA 4TTAA 3KDAA 5H7XA 1L5MA 4X95A 1CS0B 2NAFA 3ZWKA 1NBAA 2OLJA 1BD3A 5DXJA 1Q1EA 1JIIA 1R6XA 2P3SA 3O84A 2J0SA 2NYRA 1Q1BA 2YIJA 3OUZA 3WAGA 4U00A 4AJIA 3QKTA 1AGXA 1V2HE 4EHIA 2CKDA 5AJVB 5EE1A 3VZQA 2R87A 3BMNA 3ZZUA 2ZYDA 3MS7A 2VYVD 5K3OA 3IEVA 3HFGA 721PA 2PUCA 2R1VA 1FVFA 2EARA 1U99A 3HLKA 5BP7A 5EUQB 4WY8A 2W6NA 2P62A 3W1EA 4TZ6A 4G36A 1J09A 4KKXB 1R2QA 4JASB 1Y98A 3T38A 4P81A 5AOVA 2BDTA 2H63A 1TAHA 4B9EA 5IVPA 4DB4A 3U7GA 2C7OA 5CDFE 1ZP6A 2PX2A 1A4UA 2Z6VA 3H2HA 3UKJA 1O58A 2H3EA 3IP1A 1CF9A 4PQRA 4GLOA 5F73A 2B83A 4KRXA 3AL0C 4JLUA 4X20A 5AUPB 4QBKA 1PV1A 2DFVA 4G85A 3JALB 2BLLA 1BVUA 3GFBA 1VI6A 4BMYA 1Y9JA 1XN1A 2IYPA 4FYMA 4J1QA 5AJUA 5JZVA 2WQ7A 3KT8A 3BHJA 1N2HA 1TUGA 2FDXA 4MRMB 4PBRA 4DLPA 4Y3UA 3ZY5A 1B2LA 4OJTA 2RHBA 4KO3S 3CNQS 3TSOA 3E53A 3TIVA 5KYWB 1B8NA 3L41A 5EOVA 3OD5A 2HO5A 1PK8A 3PDHA 5FL7A 1JWLA 2WTNA 4YY3B 4LJKA 3UFXB 1RQGA 1HDOA 3SEAA 5AM4A 1SXJD 5FBQB 2I7TA 4IJUA 4ERXA 3CSSA 3FZQA 3WMFA 4EHAA 3FVVA 3KLMX 4PIPA 4R1TA 5E0KB 2IS2A 3TMYA 4ESVA 5BOSA 2QP3A 4ZDKA 5KQSA 4XDGA 5G41A 1XXLA 4JY7A 4CEIA 4FS8A 1KFEB 2IYQA 4Y2PA 3FYUA 3HSSA 5HCUA 2DT8A 2HJVA 4Y6RA 2BZSA 1AS3A 2ZJFA 4RXMA 2DBVO 3LH5A 3L40A 1PYOA 1RC0A 4QOGA 4Q3CA 1GPJA 2Y6UA 3LCVB 3KYCB 2VQDA 1N1MA 1U9YA 1NYRA 3PC4A 1O97D 2C2XA 4I46A 2JFWA 3R7SA 4BFWA 1FSPA 2FW1A 1FMCA 3M6AA 4RELA 2O8CB 4URYR 4G0WA 1BX3A 1YIAA 4EITA 2H29A 1U7ZA 3DUFB 2UZ1B 1ML4A 3ILSA 3JQ8A 3H5OA 2WWFA 3ILHA 3SIXA 5DTQA 1Z7YA 3C3XA 1OF1A 1VLMA 1JLMA 2XRYA 3FYUC 3AEKA 1I10A 2ZUSA 4RKWA 1YKSA 2BHSA 4A82A 2C78A 2GD6A 4BASA 1RXUA 1HNXB 2A0UA 4LJ7A 1UH5A 5EJMA 1WY7A 2BEWB 5JJ5A 2WHPA 2V4ZA 3H0CA 4IJVA 4CN9A 5IFKA 3A6PC 3FGZA 3P19A 3KVNA 3SPXA 4FXPA 2VOEA 2FP3A 3HUFA 4U9UA 2QG4A 3AHEA 3G0BA 4MRAA 4RCYA 5I7UA 2O8BB 2GK4A 5IG2A 4WNCA 1GWNA 1SPBS 1SKBA 1YZFA 4TKVB 4W5OA 2XTNA 2ILTA 1YJCA 3U1BA 2ZAMA 5A04A 5FIUA 1UXOA 4B47A 2CNNA 4L51A 5IDWA 3RABA 2DY0A 3L7OA 1FJ2A 1NONA 1UDXA 2AW5A 1EA5A 3K92A 4YHBA 1FLVA 1NIJA 4LQCA 4V0QA 5IPFA 1AY0A 1CJVC 3AIMA 1J9GA 1F2TA 4D41A 5JQGF 1C1YA 1JA0A 4K7JA 4WX2B 5E6SA 1KYYA 4K6FA 3WYDA 5A6SB 1XYVA 1NJ2A 1JLLA 2J9FA 3HA3A 4A3SA 3BDIA 4B7ZA 2JKVA 1U1FA 3JARB 4L4UA 4R8LA 3WRXA 4C06A 3ES9A 2E4AA 3CZMA 2O7RA 2B5WA 4MR7A 4UU1A 3ZUPA 2ZSIA 4O4LA 3ZQ4A 3DEYX 5DLYA 2Q5IA 1Z2OX 3RRBA 4F3KA 3FDXA 4AQYB 1GO2A 5IVKA 1O6CA 3IEXA 521PA 2WIJA 2XWPA 4QFBA 1Q91A 4WJKB 2GWHA 2OCPA 2OHOA 3OQHA 4MS3A 4RESA 4PX3A 1IHUA 4NYIQ 3RVNA 4YUVA 2X86A 3DQPA 3UPUA 1IB0A 1K4KA 4JL5A 1D4AA 4R8RA 1D6JA 3MTBA 2MSDB 2ERCA 3I9MA 2AUNA 2YNMC 4HZUB 3UAGA 5BPHA 3M2PA 2X1HA 3MT7A 4UNSA 1Z2NX 1JIVA 2Z2ZA 4G97A 4RMNA 3V4PB 2GBLC 1V4BA 2BGTA 4FZ5A 4RK4A 1LRLA 2Y1WA 1K8RA 2CLOB 7ABPA 2O07A 5KEIA 2CV1A 4N8SA 2Q21A 3MJDA 2FPWA 2OKGA 1R64A 1IY1A 2Y1CA 3FFBA 3K09C 4P7GA 3NGXA 3P20A 5BW8A 3UW3A 5MFPA 4LYAA 1FYWA 1A27A 1P7PA 3MT9A 4BP8A 3RHSA 1Y8ZA 4JA2A 4H31A 1J2TA 1A8QA 1O94D 2J0EA 2VUUA 3D8HA 3H1TA 1Q0UA 4MEAA 2ZZKA 2B8WA 2ZVQX 4MDFA 5IAAA 3MJSA 2IZ0A 3RG8A 1KJQA 2WAAA 1P8JA 2PJRA 1XL1A 3DVAA 1E64A 4ZGGA 2CK3A 2R1ZA 4JGBA 1V11B 2YKGA 8ABPA 1GAEO 3EGDA 4YRPA 5A5GA 3DFZA 2WFAA 4C4SA 4QOEA 3BWBA 1TYZA 3IR6A 1VLVA 2C4TA 3MELA 1PUJA 4HX9A 1BGWA 5GOZA 1HYBA 3KJIA 4ZYWA 3WLTA 1MP0A 3TD2A 4UCXA 3O2SB 1OXUA 1T26A 3RS0A 4DLVA 5LXTA 2PT7A 4CLOB 4HWSA 2P9JA 3Q6IA 2KW5A 3HUEA 5FUQA 1POXA 2BTQA 2C7GA 2GAOA 4TMFA 1O95D 1WVMA 4BCDA 2BFNA 2VJPA 5JH7B 2PMFA 3OZIA 4NY1A 1R8XA 3C8DA 1E2DA 2IVZA 2R68A 1TVKA 4DC9A 1XKQA 2CVZA 4WKNA 4IYRA 4QT0A 3UYKA 2FZCA 4GMFA 1MOQA 4MS3B 4MQEB 5K45A 4B7AA 3DDHA 3I42A 4MCHA 5DTMA 3UMGA 1U0BB 3TOZA 1F5SA 1HEYA 3G2OA 2ZB4A 4HNRA 3NBUA 1A3CA 3LIPA 3RUPA 2GBLA 5C81A 3AUSA 4MVJD 1A97A 3OCVA 3TUZC 3GUYA 3DHEA 1FQJA 3Q7IA 3IRUA 2FA9A 2QTCA 3MTQA 4R2KA 4XM0A 3FUTA 4K87A 4ZQBA 2J5QA 1NT2A 4NU0A 5IC6A 4TL9A 5DXFA 2PH7A 1KKLA 3W05A 3WMXA 1ORWA 1JX6A 3N0RA 4RCZA 2BFCB 2X15A 3K2EA 4PYIA 2PT9A 4XQCA 1M2OB 3R2JA 1FS4A 3MPUA 1NF8A 4ARZB 2G4VA 5F51A 2JATA 3FCCA 2I6TA 1VZ3A 1EGMB 4PU0A 2PV0A 2XDAA 5TB5A 1T6NA 3U4DA 4CQLB 1H0RA 1HMYA 1L3IA 2H0AA 4U7FA 3TINA 4CTJA 2JLVA 4BNIA 4CG3A 1UBLS 3EQ6A 1TM2A 3KLBA 4QO7A 4DPKA 5C46F 3A1UA 1LJUA 4JP5A 4H6WA 1Q6ZA 2B1JA 2I4NA 3ESQA 1FNMA 1S3SA 2N1MA 4JJKA 2FPXA 4KQWA 4GSKA 2FW0A 3T1QA 4NU5A 5P21A 3SKXA 4EO7A 3U5TA 2ZCVA 2DR0A 4MWDA 3G0HA 2PRZA 2J0UA 5I9NA 5LDHA 1ID8A 1JHVA 4QATA 1NBMA 2COKA 5DYNA 3KWFA 5FUYA 1HYQA 2Y4NA 1K8XB 3FETA 4B2LA 4BMSA 4EO4A 4EUFA 3JWGA 1JXQA 3Q1LA 1NQTA 4MRSA 3TGWA 4GBED 1BU8A 3K0FB 2BTQB 2FOLA 3N0XA 4MVJH 5FD8A 3EFHA 3HJTA 3N76A 5AVYA 4C0WA 4OXXA 1UMDB 4G6ZA 1J2EA 1DCMA 1NP3A 4DT1B 1JDJA 1XPJA 2B9EA 2YYZA 4IDEA 4N7MA 1V5GA 1GPBA 3KT3A 4KIUA 4HRYA 1EFVB 4E12A 3ZLJA 2R25B 2D3WA 5EXTA 5J9FA 4BE9A 3BSYA 5KYXB 2JASA 1NUSA 2V5AA 4O4LF 3E3LA 1KFBB 1EA7A 4EK9A 5GJBA 4D3DA 2C2GA 1N0VC 2WJWA 3QEMB 5NLLA 1E3EA 3DLBA 3KKLA 3EIOA 1LI7A 3LTNC 4QTXA 3IDSA 2EFHB 5CA0F 3X2SA 2VYCA 1MAVA 4JBLA 4U2CA 1YQQA 2H4ZA 2SBTA 2GBCA 1SHKA 3DOUA 3FWYA 3O4JA 3STWA 1LY1A 5FNVB 5JQGA 4QT4A 1M2FA 2E49A 2X40A 3MHPA 3NTVA 5AK3A 5BN4A 1GQSA 2V96A 5AD1A 4GHWA 2J4FA 3ZGZA 5C1PA 4JJ7A 4DM4A 4NIMA 5EKSA 5BSVA 2BTEA 2QUHA 4S1VA 1ODJA 3SHOA 1X9GA 4YRMA 3M6XA 2V5UA 4K9RA 1RKQA 2ATIA 3IL2A 3MCAA 5LSAA 1L7BA 4PWYA 2H18A 1SUFA 1PX2A 2QMHA 4LI3X 4PAWA 4TXHA 1VL0A 5IT4A 3QOXA 3HP1A 4B2YA 3GZNA 1WQ3A 4ZI2A 3ASZA 5CITA 2G9ZA 1YDGA 1PS0A 4QYSA 5BN3A 4EHKA 1PJBA 1THGA 4F5ZA 1CEQA 1QS0B 2Q27A 1CS0A 4DLNA 4MW1A 4UD6A 1LPAB 1V4NA 1JR2A 1VSVA 4AURA 1DZ3A 4EA9A 1QCDA 2GPJA 2RONA 3QQ5A 4M8LA 4Q19A 4WPGA 4X7BA 1R15A 5JS6A 4JC0A 2QX6A 3AF3A 4QEKA 3TOSA 4HNQA 1Z08A 1FA9A 1MDFA 2BCEA 1BKDR 4IMJB 3H2ZA 3TLAA 5AFSA 1VB5A 2LCFA 2NVUB 3GLHA 1N92A 3FHCB 4LJRA 1JKIA 1D0VA 4ETMA 2ZU6A 1O95C 2NO1A 1BHQ1 5LPNA 3ZY4A 4J0QA 4EQ6B 3CZCA 1QFXA 4MUIA 3L1UA 4O5OA 3CZRA 1M1YE 1U9CA 2FZLA 3DMPA 4KPEC 4FGZA 4GG1A 3M4YA 3RVMA 2QUJA 1X0VA 5F4ZA 4GKKB 1A2QA 3E22B 4QJ5A 4RPLA 5YASA 4C2UA 3MIIA 1MAHA 4D9KA 3FOZA 1RRKA 2Z6QA 1QRAA 1YBFA 3JD1A 3VNVA 1JG4A 3BIXA 4QAQA 3KOWA 1CUGA 2AJBA 3EASA 3F5SA 3W3AD 3G0CA 1IBKB 3ZV6A 1F3OA 5ILGA 1V5EA 4KFSA 3UBMA 3WLPA 5BNWA 2D2XA 1MQ8B 1US8A 5ALEA 4JBIA 3EIEA 3QU9A 3TKAA 4DN6A 5A03A 1ZN2A 4OY3A 2GPSA 3AKEA 1IJBA 3GRPA 3NYIA 1MA0A 1PTJA 4ZGBA 1KKMA 1JEAA 4R5HA 3ISVA 5L4NA 1UPUA 4ZAVA 2FQQA 1AOXA 4YV7A 3A9UA 4WD3A 2C5SA 3R7NA 2GYWA 4KB5A 1GR0A 1H66A 1U8TA 3BZBA 3IOEA 4LCBA 1TZ2A 3LBNA 2B6NA 4FE4A 1T4CA 2EKZA 3DAPA 1IHDA 4IS3A 3TAXA 1KGSA 3R1IA 2V03A 3NO4A 5TQVA 1WDWB 3HXLA 1RXYA 4QODA 2BPOA 4L5CA 4DKXA 1RCFA 5K0NA 4U6NA 4YJ3A 5CD9A 3RRXA 3PNKA 2ZKIA 2EGGA 1I9GA 1DJLA 2C9OA 3HUUA 4ZAFA 5AW5A 1WU8A 2BRUA 3ZBQA 5LR6A 5HMMA 2O0LA 1NMEA 3KYIB 3SFZA 1QC5B 3RFUA 1NPYA 5GADl 4UTOA 4TXJA 3HXMA 1W4AA 4F4FA 1UZMA 3GRYA 4W9MC 2C8VA 5MHTA 4JFRA 4QXAA 4F38A 5A3RA 1IZYA 3ACBA 5JNWA 3O4IA 2I2XB 2P2NA 4KNWA 2PH5A 4E6PA 1GN9A 1MX1A 4G0OA 2CNBA 2N9UA 4FBMA 3UJPA 2P5SA 1Z5WA 2DHQA 3GB9A 1NAHA 2QR5A 4D4GA 4E21A 1N77A 1RZRD 2IQIA 3EW7A 2V7XA 2UZ0A 2ZWMA 1P7YA 3O4VA 1DFHA 2WHEA 5K3BA 1YK0A 4OJYA 4QRDA 1MG5A 3N70A 1IZ0A 1JPJA 2GEBA 3AVVA 4LYJA 1BIFA 1JV2B 2ID8A 4M8IA 4JT8A 3Q3GE 3RV4A 4DQXA 4BGIA 4ZYXA 1EFRD 2R6FA 1YDWA 1KAGA 1XZMA 3GZNB 3OMWA 3MINB 4NOMA 5EPOA 5FFFA 2GEJA 1XALA 1LTKA 1SVLA 2O3TA 1RPNA 1LC3A 1P3DA 2XGSA 1RC8A 3PI7A 3ROFA 3COZA 3CW8X 1FF9A 2H17A 1MC4A 2SKCA 5HM8A 1HL7A 3G2MA 3Q5GA 1KFKB 1JAYA 4TWRA 4PQYA 4UATA 3LP5A 2JHPA 2FSSA 4RVUA 2EWVA 4QYMA 1ZH0A 4QGBA 4UBLA 3OQOA 2QY6A 2PO7A 3AEUA 1L1RA 3W2IA 3GUVA 4HVTA 4WK4B 3ONDA 4AKSA 1M75A 1RYZA 3OZDA 1ID1A 1T6ZA 1XZPA 2HWKA 4PGFA 4D3YA 2QL7A 2ZRDA 4PR3A 4CQMB 4CV1A 5LQAA 2VPTA 3GEEA 2GN4A 2F8LA 2UKDA 4HAOA 4NMLA 1C7IA 2OWEA 2AZTA 3L7YA 2BKEA 1NR7A 2ZB7A 1EZ1A 1GSAA 1NJSA 4Z99A 3NWOA 4M53A 3W5IA 3ZEIA 2OGSA 2O5RA 3KPVA 2C99A 2OXCA 3M34A 2NO9A 1PJ8A 2ZI6A 3IHLA 3JQCA 4DLBA 2FQXA 1FDOA 4TT3A 1KK1A 1DEXA 1ZUHA 3L8CA 4LWQA 5KCZA 3K4PA 2QRVB 4WW0A 4ZANA 5LZ4A 4O2BF 5KOHA 3UBTA 1MB2A 2NLOA 3HUDA 3OMXA 4DJEC 1XHFA 3OM9A 3TPZA 2PJUA 3Q8KA 1A96A 4MUHA 5FWNA 1U2QA 2OXIA 1J07A 2ID4A 3H3FA 3M6UA 3RJ5A 2GCIA 5T8KC 3PGKA 4DIDA 3C7KA 1P5FA 1CZUA 5F3DA 5K0LA 2YFKA 4K0KB 4G81A 4PSCA 3ZK7A 3RIYA 2VNKA 3VR3D 5KVQA 3W2GA 4C2AA 3ADDA 2I65A 3BRWD 1Y81A 5DYIA 3A2NA 3O21A 3AHCA 3U4CA 1C7FA 1D2HA 2CL5A 2DQSA 3R5XA 5DIZA 1IYZA 1CTQA 3G7SA 3JATB 2VP6A 1EUDB 1KNXA 2WSMA 4L50A 3IIIA 1EXWA 3SJUA 3FMVA 3PKZA 1W4CA 2Q5HA 3THXA 3M9LA 4CI0B 4DLZA 4Q1EA 4UBMA 2P91A 3CKLA 5IMSA 2CLLB 3W77A 1DMRA 4BE4A 2B34A 4D8YA 4OCZA 2PK3A 4Q48A 4UBNA 4D98A 5JAIA 2O2ZA 4EZEA 1MPTA 5CIQA 1GA1A 1H93A 3EXEA 4MXDA 3VH1A 5LOVB 1CUHA 5THKA 4ZJZA 2ZTHA 1S2MA 1XXHA 4PPNA 3JQBC 3LGSA 1T9KA 2IU3A 3LUJA 1DBIA 3DCNA 4POAA 4YMGA 1U0NA 4PYLA 5KNDD 3QSYA 1XZCA 2VZ8A 1EGAA 1C0PA 1T9DA 5JJCA 1CFJA 1OAOC 2G80A 4UUQA 4RYLA 5G4LA 1ODTC 3VAYA 3TQTA 1JAZA 3NONA 1U0RA 1KDRA 1AS0A 5BNIA 1ZUWA 5LP6C 2A7QA 4F1KA 4QU0A 3OEED 4PFKA 3AR8A 4L8GA 2C97A 3I6BA 2C7PA 1CVIA 1AQNA 1XZJA 1GADO 2ZYUX 3VR4A 3DAHA 5AVRA 1GL3A 2ZTLA 3HWWA 5DU2A 5G0VA 1MOSA 3F5DA 3QXJA 5WRFA 3SKVA 4DMFA 4JI4B 2DKFA 1K06A 5AO9A 1JEJA 4YPOA 2W8ZA 2A92A 4JP8A 4YIKA 1NG1A 4ZTZB 2PA0A 3H2GA 1M6NA 3GWGA 3C7TA 3OX2A 1T3ZA 3C5HA 3DPIA 3KQMA 5TVGA 1XDDA 4LXYA 4OQLA 4DR3B 4BKOA 3PQDA 1H3FA 1V26A 1DAEA 1V6AA 4N9QA 4TUYF 5BSKA 1YJ5A 3I09A 4V24A 3EVZA 3UAOA 4EFLA 4EG6A 3F4LA 1L8QA 1J6UA 4G67A 3R3VA 4WOKA 5BWLA 5E38A 1KVUA 4KMRA 5DNVA 2LWIA 4G1UC 2Q3FA 5L53A 3OP4A 4D0NA 1L7OA 16PKA 3EA4A 2RH9B 1WW8A 4X63A 3GLIA 3ERCA 4NDZA 4RW0A 5DK6A 2CHGA 1OC2A 1ZUNA 2LIPA 3CINA 1GIAA 3GCDA 2P1DA 3LC2O 4RMIA 1RQPA 2FJPA 4Q3EA 3USCS 4AJ4A 3NVKI 5JWHA 3CS3A 1UPFA 4BO4A 1GUDA 4LTDA 2XKJE 5I8PA 1N0WA 1NW6A 1KWKA 2I3GA 1CQPA 2AWOA 2FFJA 1XXHB 4GWLA 4LDPA 4R2IA 1XG5A 5IDYA 1I4DD 2VAVA 1LA2A 5EJEA 3M6WA 3NNSA 3D3EA 2B37A 4KGXA 5SV2A 4A0HA 1F6DA 1BHJA 1Y4DE 2FWIA 2YOGA 3V32A 1LDYA 2DPYA 3BMQA 1P2GA 1GGKA 1ESMA 1QZTA 3BF8A 3KDPA 4YMWA 2ZBUA 2W8BB 4RJIA 1CP3A 3LAWA 4LEIA 3WAJA 2L69A 1AS2A 2PUVA 2HW8A 4D74A 2GS9A 2IEBA 4KE6A 4ZCRA 4O8ZA 2B25A 1NXTA 4ZDJA 4IW3B 3GG9A 4L7VA 4CKEA 4RCVA 3C5VA 2WSSA 4TMYA 1NNI1 2IPNA 1N36B 3PUYA 5CB8A 4W5NA 4FE7A 1KPHA 1RAGA 4DLAA 3B9PA 4J16A 4BQNA 4C3UA 1GFIA 3PFWO 1WBDA 4ZTBA 5LYYA 1CDZA 5I4CA 3U6BA 2GXQA 3PC3A 3V46A 1BZYA 1ULSA 2B69A 3MPOA 1EK5A 4QPCA 5FPPA 1A9RA 4M1QA 1C7QA 1ISRA 7MDHA 3SIPA 5IJXA 4ARIA 5JD4A 1J97A 4KVAA 4OXYA 1YR1A 2IJGX 4ZVMA 4JR1A 3L8DA 5FTJA 4DMCA 3UXMA 9LDBA 4F2HA 2BFEB 3H87A 1ZU4A 4FDLA 2VI5A 4EY5A 1JZSA 1M66A 1FPMA 3VVCA 3BZUA 2FEAA 4CG0A 4XIIA 2IYRA 1FJGB 2JIPA 1QP4A 5HZGA 2RGDA 1KJYA 4LDAA 3KQKA 3BL8A 4EVIA 4WA8A 4M46A 1NFFA 2JFQA 2OCIA 3Q0EA 4ZCQA 4C01A 5TMPA 1OZGA 4E3WA 2ES4A 4BNDA 1ADFA 1PGQA 2Z4RA 4K2AA 5EN4A 3U56A 4E13A 3MERA 4RJLA 4X85A 2G5PA 3UQYS 1GZ6A 2B4RO 2RBKA 5FUVA 1ILEA 4R1LA 5AUNB 2NSHA 4KR6A 1K3FA 4J03A 3QKSB 4P3NA 1T8PA 2ANBA 2IU6A 4QVKA 4TWJA 5IUNC 5C32A 3WGZA 5ADUS 4F6CA 4OKIA 4L02A 2II6A 4W1SA 3V8MA 2CHQA 5HZHA 4EMTA 5B1HA 1JTEA 3G5LA 3FWKA 2R1TA 4YGYA 5BV2P 1UQRA 2IZOA 4B44A 4AJ1A 4DIBA 1UBRS 4JR2A 4LVUA 4NECA 1JEOA 1R5NA 4E1VA 2NUPA 4EEKA 3E7WA 2NUAB 3SBXA 3TO5A 5DCWA 3WLAA 1JQJC 1P6QA 3N05A 2FZWA 2A1TR 4IFEA 4DA7A 4EX6A 2BBSA 4H08A 4O1MA 1JJAA 3O1JC 4D4LA 4IVRA 1L5FA 3GFOA 4GOKA 2KHZA 4O25A 1NFRA 1HXHA 2MYNA 2UYHA 4UDYX 4KXFB 1Z75A 4HNSA 2WTMA 4DYHA 3ZLVA 2VDWB 4E5MA 4HGPA 3KQOA 4UHKA 3IEKA 3PFGA 1T15A 4MULA 3BMXA 3EY4A 2JH3A 1V7ZA 1DKMA 3QP9A 1G8YA 2JANA 4GMHA 1T10A 2Y1KA 5BV0A 4N01A 4CW7A 1E32A 2E5LB 1CY4A 1UP7A 2XVZA 1CK4A 2HA4A 3OX1A 13PKA 2FEOA 1GNRA 2QJRA 2AN9A 1CR4A 2HCFA 3HFSA 5AK4A 2ZI5A 3DVQX 5EINA 3RQSA 1CUCA 5EXXA 2MDTA 1U0HC 4HEQA 1K7FB 5IW8A 1G17A 1HG1A 3RS3A 1REQA 5A7FA 3DOHA 2DPXA 3IUBA 2IHBA 3D4NA 3UG6A 4CL0A 1QG6A 3P0JA 2BGLA 4OB7A 1JHUA 2QUBA 4L0CA 421PA 3GAFA 5ICCA 1VMKA 4GM1A 5J1TB 4PZPA 5ALKA 5T4HA 4UHBA 4YRRA 3WL8A 2BEJA 3SGLA 4IICA 1PO7A 1P5JA 4AW9A 1Y5NA 2P2GA 4R9UC 4L28A 3LPCA 3DEIA 5L51A 2XNSA 1RAFA 2IYUA 4UEJA 1X3SA 4AZ0A 4TUYA 2K87A 4EFKA 3WSTA 5EA2A 5C7LO 1JYEA 1QCCA 4JODA 4P80A 4TL6A 2WPDA 5JFTA 1EDBA 1UXGA 4C4RA 5JAHA 4PQGA 1N5KA 3BORA 3URKA 4IV8A 4YFVA 4OX9Y 2ATEA 2B21A 5IH3A 4PPGA 4K6MA 2K6GA 3L92A 1AA6A 4R9SA 1V16A 3VU1A 2D6FA 3W5AA 4A2QA 3GMSA 2JFFA 3KZKA 3HWSA 3SP1A 1JQDA 1CD5A 2FUCA 3EJWA 4TV8B 4XM2A 3W34A 5EWMB 4DQDA 4F91B 4CIVA 2CXPA 1TM1E 2WFZA 5DIFA 4I2NA 3BREA 1ANKA 5BVHB 4IQ4A 3BL6A 4K9DA 2X23A 5AXDA 4CQMD 3OCUA 4BNLA 1IUKA 1CBUA 1E6MA 2RBEA 4TT8A 3AFGA 1GPWB 2O23A 1FNBA 2GN2A 3B85A 4JEUA 5LDDC 5DBIA 1TJ3A 3RRJA 1P7ZA 4NU6A 1RE0A 1E0JA 3CR7A 3RK4A 3E82A 3KOXA 2VSQA 3FPAA 5A1TA 3GYGA 3G5TA 3DYVA 1E98A 4FSXA 4YT5A 3RVRA 3UJDA 1CYEA 1E92A 1WV0A 3K6KA 5EL0A 4ESEA 1IXRC 2BFFA 1Y34E 1IBLB 3QJGA 1IJFA 4DV1B 1EQUA 3OOHA 2ROQA 3IAHA 3RWBA 3TDKA 1DJPA 2A8YA 1Z4IA 2DFPA 5BMVF 5FKJA 2GNAA 1BCRA 3Q7RA 4M1TA 4QUGA 2BR4A 2EHDA 2F8MA 4LKRA 4HYQA 4CIBA 5JXHA 4G1EB 2QZZA 4B3RB 3CUEF 2JFOA 2VBIA 2JVIA 1TLFA 2AFHB 2OGUA 1W93A 1BOFA 1SUEA 2HB6A 3EUWA 4U9HS 3R9IA 4A23A 1V43A 2X2FA 2EFEB 3KCNA 3W2TA 3JQAB 4KEAA 3SN6A 1EGQA 2ZT8A 1B74A 2QPTA 4RPKA 4MGHA 1KAEA 4P35A 5K3CA 1O08A 4FLEA 4OAQA 1ECPA 4OHWA 5JCPA 4U7DA 1CZNA 2O5EA 4FONA 3FWZA 2AHRA 3I9V6 4JEHA 4OM7A 1TU3A 3JD3A 1G5PA 1P17A 3WQHA 1KO4A 3JRXA 4EBFA 4ZZ0A 4OK3A 2AT1A 3O73A 5IJWA 2EKQA 2H5LA 5AHKA 2XT6A 3ACCA 3DOJA 3KKNA 4KVFA 5THXA 5JAMA 1KQOA 3B38A 4E4RA 3NIGB 1W49A 1TZMA 1EBFA 2P6MA 1YV9A 1EPUA 4RFSA 5G02A 1UL1X 2OV6A 1MJHA 5TQ0B 1D6MA 3DXYA 2QORA 4TLEA 1A5AB 3BGDA 3L06A 3AVPA 4YMLA 5AH0A 2OMKA 5FULA 2FSIA 1RXWA 2GHQA 5KSZA 5HUJA 3DCIA 2JD2A 3M6IA 5ICMA 4ESOA 3FVWA 4P4GA 4BV3A 2MU1A 2AIRA 2JHAA 2V6FA 4QJBA 3UATA 4V1CB 2ORYA 3CPJB 3I9OA 4GDMA 4DC0A 4YAGA 4MVJF 1FVHA 2P7HA 4B3GA 2P9TA 3EUEA 3EEYA 1KE2A 5FUMA 3RASA 1GG8A 3DLHA 2PBZA 2VWQA 4K9PA 2J67A 4KI7A 3WQSB 4JH0A 1ACLA 1G7SA 4DANA 1PZEA 2CXSA 2J85A 1GCIA 5JBQA 1FMJA 2NUTA 5AP9A 4NBSA 2PMKA 4RTOA 3STXA 3KPWA 2XCLA 1QLWA 3R9KA 3A3NA 1AV7A 1X9IA 4CM9D 2HMWA 3OSUA 1JILA 2J32A 4MW9A 5JG7A 1T8UA 3VNUA 3KAPA 1NVTA 3U7EB 4ANFA 2HF9A 2E4VA 1DRWA 1H65A 4O4JB 2QMUA 4FX5A 4YI5A 4YRBA 2OAP1 3S55A 1CDEA 4ABYA 1XMSA 1RW4A 2R4QA 1U0FA 2H3HA 4B17A 1JNXX 1RI2A 1BS2A 3HVUA 4XCXA 5E7IA 2H4YA 2EFYA 3PQCA 4NBKA 3UO8B 3W5JA 2X6RA 4ZODA 5BSMA 1E9VA 2X19A 5ITZB 3K0AA 4TXLA 4E2YA 1CXZA 2H4HA 4I1OA 4C0AC 2VYNA 1BFKA 2YW9A 5DHTA 4L4SA 1WZUA 1E59A 3ZOKA 4A7PA 1E96A 1P9RA 1X8JA 1Y42X 2ETVA 2GBPA 1XMQB 3WIVA 2Z9BA 3HP7A 1AGYA 3ZE2B 3GU3A 3PNVA 5DRYA 2ECOA 1IOLA 2N0SA 1QB8A 4LBWA 4XXHA 3WJAA 1MV5A 1VL8A 3QVWA 4M83A 2EW1A 2P9QA 1SIOA 3Q7EA 3VO1A 1PFGA 2D8AA 2XY4A 3B3FA 4KJXA 4EW6A 1K86A 4UAVA 1XE3A 4GH5A 1JHQA 4WADA 5DGDA 1S9HA 2AMJA 3M81A 4LC0A 3VH2A 5JARA 2B30A 1Y3DE 4P7FA 4RAOA 4FX2A 5AW1A 3HYRA 3C24A 4MWOA 4LQ4A 2VZ0A 2ZRIA 1C2TA 2C03A 2JFYA 2A9VA 2PIAA 4GZ3A 2PUBA 5CM9C 4LF7B 3GRUA 2IOYA 3GCZA 3E1GA 3ANXA 1JLSA 1Q0PA 4TXMA 3DMNA 1U4NA 2D2FA 2QLJA 3CURA 3V2UA 3NNNA 2ZSUA 2V59A 2VYFA 3NS7A 4TKVA 3MNFA 4PCVA 1E8NA 3IT0A 4HF7A 5GZ6A 5I47A 5KMGA 3OPYA 3ZZMA 3MTAA 4YIHA 1G20B 1RBYA 1UFQA 1UJ6A 2PUWA 1AKVA 3RRMA 4CJXA 2RGXA 2XNKA 4Z49A 2OLEA 2OZLA 3A1WA 3HVHA 5FRDA 3AL3A 2DRIA 3Q9UA 4PZLA 5LQMA 1ZN9A 2HGZA 3DAFA 4TZKA 4PBSA 2TMKA 1V1RB 3BJMA 2PNFA 2E4WA 1M1ZA 1E77A 2CUKA 5E6SB 3GRZA 1E2FA 2EIXA 1K08A 2XR1A 4HGYA 5H59A 1FTNA 1TI7A 2CGEA 1TO6A 3DEHA 4BX8A 2PCJA 2R5FA 3UMFA 4US1R 2PGNA 3PDIB 3R5KA 4ZZ2A 2RG7A 2I7CA 2PV7A 1MD9A 3COPA 2K4MA 3KLNA 4TV9F 2QVXX 3ZX4A 4JT4A 2Q49A 1DIOB 1T13A 4X1YB 1PT7A 4GBJA 1FYDA 3JAKA 3PSAA 3T7SA 5JYEA 3PB3A 2CVHA 3T5MA 4BUCA 5CXXA 3V48A 1DXOA 1G9XA 2B20A 3GVHA 3MUNA 4UJ5A 2GCOB 3H11B 2PIDA 3OJ0A 4IXTA 2GXSA 5HRCA 1D2AA 3TR5A 4CT0A 2JGMA 3PGMA 4PF1A 1H2EA 5C4GB 3SFVA 2ZSHA 3SHVA 3BMQB 4HAYA 1TVKB 4MHOA 4GZMA 2VC2B 4OHOA 1Z68A 5JPIA 4FOOA 1EFPA 4ER0A 1IXSB 1RDFA 1O6GA 5GV8A 1IOWA 3HCWA 2QXYA 1G60A 1ISMA 2DM6A 4AF7A 5EJ5A 4MDEA 3FFWA 2GZDA 3Q85A 4JT9A 4GRDA 4LRTB 3R9WA 4UHJA 5IKOA 1SQ5A 5LQSA 3SR0A 4YMVA 2FQYA 5DX1A 1EP9A 3K9LA 3PZRA 5EJ7A 3HYNA 3UV6A 3OQNA 3G8BA 1NVVQ 2HQRA 4B3IA 3O4HA 1HYGA 2RK3A 4JCOA 1QF7A 2I91A 1PZXA 1RXSA 4EGQA 4H1UA 1MFZA 4JNKA 1GA4A 1JAIA 3C1UA 4RSGA 1XLTA 4ZRNA 1A2BA 1G20A 1M1YA 1Z25A 2NUPB 3PU6A 2X9QA 2NUAA 3KVRA 4MITA 4QGAA 3SF0A 3GA5A 4JYBA 1RHUA 1V8OA 2PUTA 4NS4A 1ARZA 1F1BA 5KOYA 3G8AA 3AY6A 5EHNA 1TU0A 3NVMB 5TNXA 5IKMA 2HZBA 3LSYA 4OATA 3ZXIA 1UBHS 1Y48E 3VKVA 1IK4A 1VJGA 3A1TA 4E5VA 5ISMA 2HRQA 5H82A 1L6IA 4QXQA 1MG0A 4AT1A 1JT9A 5CT4A 5E4YA 4JJ4A 2Q4RA 1NKSA 1XVUA 3L3BA 3PENA 5DGIA 2ZUEA 2O2SA 5ARDA 4RFVA 2YMPA 1J9EA 1G2QA 5AQEA 5EQJB 1KZ1A 4C6RA 1KJJA 5J43A 3GPIA 4LDJA 5DULA 1ZI9A 2KQUA 5LWQA 3TXAA 3AR4A 5J2TB 3K1AA 4BX9A 2XRMA 1TYAE 2EFDB 3RYIB 5H9VA 5BN3B 5AW8A 3LCRA 1MC1A 1N57A 2PL5A 3LPNA 3QIVA 4MA5A 4UHDA 4AYXA 1J1UA 1P1CA 3TRIA