4BV3A

Crystal structure of sirt3 in complex with the inhibitor ex-527 and nad
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 270
sequence length 270
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bv3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bv3A01
1YTLA 2C31A 2JI6A 5BWLA 5EJ9A 4FVTA 4HD8A 3ZG6A 5DEIA 2H2FA 1PVDA 2Q29A 2Q28A 3HWWA 4IF6A 1BFDA 3GLUA 2VK4A 1D4OA 2UZ1A 4TWJA 4BVHA 2Q5OA 2VBGA 2V3WA 1U28C 4UUAA 5EJ8A 4ZP1A 2H59A 4D5EA 3U31A 3PKJA 5K3SA 4MPJA 2EZ8A 3CLSD 1U31A 1S5PA 1UPBA 3ZGOA 2Q5LA 1ZPDA 2PGNA 4V1CA 5EJ6A 5MGNA 1M2NA 1M2GA 4RMGA 5FYQA 4L2IA 3EYAA 4BN4A 4RMIA 1JSCA 2OORC 5EJ7A 4KGDA 1POWA 3GLSA 4MQ5A 4GM4A 4GM1A 3PKIA 3PDHA 4F4UA 2OO5C 4COKA 2A1TR 2A1UA 5FEMA 2H2GA 4BUZA 4F56A 1YHYA 5BWNA 4X3PA 1MCZA 4JUCA 4Y6LA 4UTVA 1T9BA 3GLRA 1NM5C 4JUDX 5MF6A 1PT9A 1N0HA 1YI1A 2EZUA 5MFPA 1O96B 1J8FA 2VBIA 4JUBA 4BVFA 4Y6QA 2VJYA 4D5GA 2NXWA 5AHKA 3CLTD 1V5FA 4KXQA 4MPPA 5K6RA 1PNQA 5EJAA 3OE1A 4JT9A 4R8MA 4BV3A 2IHTA 4JD5A 1Y9DA 3LQ1A 2FSVC 2EZ9A 2Q5JA 4C78A 4UTZA 2WVGA 2FRDC 2JLAA 1Q6ZA 1UPAA 2WVHA 1QPBA 4UUBA 4G1CA 4RJIA 2VK8A 2WVAA 1M2JA 2DJIA 1PTJC 1OZGA 1M2HA 4TWIA 2H2DA 3EY9A 2EZ4A 1MA3A 4KPUA 4BVGA 1XLTC 2EZTA 1V5GA 2IHUA 4BV2A 4MZXA 4JT8A 5DGDA 1YC2A 4JUAA 4UU7A 1PO7A 5K6TA 2NYRA 1Z8NA 3F6BX 3K35A 4J16C 4JU9A 4QQ8A 1T9DA 2H2HA 2JI7A 2W93A 3CF4G 4UTXA 4K9QA 2QQGA 4O8ZA 4BN5A 2PANA 4UTRA 1PI3A 5EJ4A 1S7GA 4RMJA 4V1CB 3D7KA 1POXA 2HJHA 2Q27A 2AG1A 4JU8A 1M2KA 3HWX1 4FZ3A 3E9YA 4RMHA 2VBFA 2H4FA 4L3OA 1OVMA 1YI0A 4K9LA 1V5EA 4J1TC 1E3TA 1EFVA 1Q14A 4UTNA 2JI9A 4RJKA 3CLRD 3IAEA 2H2IA 2Q5QA 4X3OA 1ICIA 3GLTA 4FEGA 5EJ5A 4RJJA 4Q9DA 4C7BA 1T9AA 3FLMA 1YBHA 4BVBA 3D81A 4JUFA 3JR3A 1U2GC 2X7JA 2BRUC 3D4BA 3U3DA 2FWNA 4MPRA 1PYDA 2H4JA 1OZFA 2JI8A 4K9PA 1EFPA 2OD2A 1YNOA 1Q1AA 3RIGA 5D7NA 4IG9A 4K9OA 1T9CA 4GPEA 1Q17A 3F6EX 4BVEA 4K9NA 2UZ1B 2VK1A 1HZZC 3IAFA 4Y6OA 5DGTA 4K9KA 4QELA 2PGOA 4QPZA 5K2OA 2IHVA 3FSJX 2QQFA 4GM0A 3CLUD 5MFZA 4GP9A 3ZGVA 4FEEA 2FN3A 5IMSA 1DJLA 1PNOA 2OD9A 4K9MA 1OZHA 2FR8C 2JIBA 2JLCA 4I5IA 4HDAA 4V1CI 3FZNA 3EA4A 2AG0A 3RIYA 4GG1A 2H4HA 5EJMA 1YHZA 1O97D 3JWPA 2B4YA 4ZZIA 1UPCA 4UU8A 1YC5A 4IAOA 1SZCA 4JSRA 1SZDA 2OD7A 5BWOA 1U2DC
chains in the Genus database with same CATH superfamily
1QDEA 2VG8A 5I8PA 3GP3A 3QQPA 3UHJA 4CG3A 2UUCB 4JL5A 2I76A 4D0LB 3O74A 3IPRA 1E3IA 4LMPA 2IHJA 4YTEA 5A5EA 3RODA 2G4CA 1U0LA 4U9UA 3VPXA 1OIWA 3AHDA 1G64A 4NESA 5KNDA 5JEEA 5BVGB 1XLUA 2YV1A 3LF1A 3OTQA 3QWHA 2Y0CA 3BMNA 4WOCA 4Y2VA 3DXYA 5DP2A 1RLMA 1P6XA 1B93A 5LKRA 4O3FA 4RH0A 3HFGA 5AJYA 4FNGA 2HI0A 2O5CA 3S8YA 2CJWB 4FQ5A 4ND7A 4JA0A 3R4CA 2C9YA 4ZXFA 2HX1A 2RHRA 3LCJA 4YDHB 3NCTA 2PPLA 2TMKA 4BGIA 4HQ0A 4CIYA 4Q1FA 4CLHA 3ISVA 2VJKA 4P08A 2GBFA 2N47A 1A82A 4G5SA 5CCDA 3T9DA 2H54A 3BEDA 1NUAA 2DBYA 1A3CA 1T6YA 2AEJA 1D4OA 1FUIA 4PAOA 1YKFA 1I13A 3ORYA 2B8JA 1ISGA 1V16B 3FAKA 4XJTA 2J0SA 1GNSA 1VCIA 4LTMA 4XLLA 1G6HA 2XMSA 1PK9A 3OPXA 4RZ3A 1B0AA 3RLIA 2C9MA 1E3MA 4O63O 1XALA 4C0SA 1Z15A 4HQ6A 3JVVA 2H1SA 4GLBA 2E6UX 3V1KA 2YJ4A 5FI3A 2H8GA 3ZDYB 1B8OA 4FBGA 3WKBA 2BI8A 2H29A 4ZEMA 4UUAA 2CDCA 1YJQA 4N5MA 4WDRA 4EWLA 2ACWA 1IPEA 1RI2A 2C4TA 2QTNA 5AOCA 3NMUF 1H8ED 1CEXA 1IM8A 3SQWA 3MHPA 1UFQA 1HT1E 1SU6A 3EIWA 4FS3A 1A1VA 2IF0A 3ITNA 4LX0A 4ALNA 1NYTA 2GPNA 2F00A 4IHQA 4KLCA 3ROKA 4EI2A 3HVIA 1DBRA 1N6HA 3R3VA 1FTYA 5F2EA 3K9QO 4B8WA 3RAJA 5JU6A 3A26A 4G1VA 3EOAI 2ZR0A 3HYLA 2HO4A 2CFCA 1V47A 1MOQA 3ZX5A 2H06A 5L6LB 3O21A 4QUEA 2MSLA 1BN7A 3AY3A 4B4VA 4RABA 4HGPA 1ZX1A 1WB9A 4A8TA 1E2FA 1H93A 1XU9A 1T4MA 4G8JA 1SOVA 3GWGA 5EJ6A 3NWEA 1GZDA 3NG1A 2PD3A 1EK1A 2BGIA 3WOVA 2WWXA 2FMFA 3J80A 1KSHA 4DC9A 4IILA 4AIRA 2PS1A 4CIWA 3IEUA 4DSOA 2UVPB 1O0BA 1GYRA 4Y7DA 3B13B 4BO7A 1DAIA 3FWNA 1N8KA 3ES9A 3FIUA 2RC5A 4PF1A 4RE5A 3REGA 3KYBA 4AX8A 5KOJA 2II6A 2GF2A 5BYAA 1YR9A 4FWIB 2XLCA 3JZFA 1LC0A 3SQDA 1XYYA 5DI3B 4ZYYA 3TTXA 2WTAA 1TKRA 5EZYB 1UXOA 2IXAA 3B5JA 4MWSA 1A27A 4DXHA 3VR5A 3CUSA 4RMNA 1BO6A 1D6SA 2OYSA 3A8TA 4RD3A 1DBQA 5KMGA 1HRKA 2MINB 5FR1A 3CS3A 2PVPA 2WZDA 2QRNA 3A6GA 5FT9A 4E09A 1WEKA 3RU2A 4BMCA 5BSRA 4HAOA 2C1EA 1S3FA 3PTZA 1QHYA 2EGGA 1VB5A 2C3MA 2J7PA 2QS9A 2XXAB 1P4JA 1TIBA 4BJ5A 2HA0A 1J24A 1P9LA 4NNPA 4W8OA 4EQ6A 3HHPA 1W34A 2WUEA 1CS0A 4G2TA 4GC5A 1GDTA 1TB4A 5CXSA 2FSVA 1CRZA 3JAWB 3KUUA 4MQ5A 2OESA 2WJWA 2FKAA 4E2WA 4PG8A 2WF9A 4QYIA 4GXNA 5T41A 4WBNA 2AZDA 4RK1A 5TT0A 4F3NA 1VHTA 3SWWA 4DJFC 1ZH6A 4OQFA 3K6RA 2HF7A 4GM1A 4PY2A 4A9AA 4G0NA 3STWA 3K73O 3U7EB 5BV8A 3OJEA 4R51A 1YNSA 1IRIA 3V1YA 1RCUA 3N76A 3G68A 2IA5A 2AR0A 3S4YA 4D6YA 2VNKA 3ZXYA 1QS0B 4BUZA 2VDMB 4P4GA 2GK7A 1ESNA 1XCPA 2OHHA 1YUBA 2PUWA 1YZUA 1A77A 3VO8A 4EF4A 2CYAA 3IPAA 1LFDB 1EFLA 1C4WA 1O6ZA 4WN3A 4YMVA 2PAFA 5D84A 3K71B 6REQB 1RFGE 4X1KA 1L8QA 1RMTA 2YW9A 4MIEA 3GLGE 2F17A 2R60A 1JIUA 1VG9B 1EFCA 3BK1A 4X7PA 3Q8LA 1UBHS 2PEZA 2FK7A 3HVHA 3MQ4A 3ECAA 4FILA 5F5LA 1OOEA 3WGYA 5T3UA 4HUJA 1Z8DA 3DA8A 2IEAA 3PL1A 4NPCA 3WZLA 1WUYA 3I73A 3L7KA 4PG4A 5D3QA 3WDMA 4FFPA 3CVOA 3B60A 4BVFA 2WT9A 3V33A 4BMOB 4Y6QA 3H5TA 1VFNA 4BO2A 3GNTA 3QVKA 2F62A 2ZIXA 3L02A 1NKSA 1PWEA 3DUFB 2B5WA 2UYHA 4LCEA 3I9LA 3Q8KA 4MYDA 4F6RA 1QYXA 1GFWA 1TC2A 2BFDB 1KP2A 4RHUA 2X0RA 1CCWA 3REQA 1N5JA 3HDQA 2A9QA 3GZ4A 1TECE 4YPFA 2IV3A 1JXAA 1B7GO 3S2UA 5JXJA 1Q91A 4DLVA 1C0KA 4TM7A 5T6MA 3T1NA 2VHVA 4KH1A 1DC3A 1HTTA 3GA5A 4IJUA 1OWNA 4AL4A 1AQNA 4HRAA 1ZCBA 5CUQA 2BTEA 2NUTB 3UA4A 5JECA 4BNFA 3WKDA 3OE1A 4BV3A 4R8MA 2IHTA 3OPVA 1EJ0A 1QF7A 4IFBA 5HKBA 3KQQA 1Q77A 4MH0R 3N74A 4NCXA 4AUMA 4K6CA 5IKOA 1I7SB 1ZNWA 3HZZA 3UG7A 3UXYA 2B9VA 3WLFA 2K6GA 4V02A 4DR2B 1AS3A 1R4AA 4P80A 4PTYA 2Q8QA 3EDCA 5LN1A 4L9AA 3K1ZA 1NI4A 3QV2A 4G1EB 3A1FA 3FPJA 1VI6A 1YJ5A 3WSTA 5BPHA 1KQGA 3U4DA 5IU6A 3WHIA 3A14A 3D64A 3OX2A 1R64A 3T1YB 1EM6A 4RK0A 3EXG1 3LUGA 3FCXA 2O0JA 4OGGA 3GLKA 3ZY3A 1SXJD 5AVOA 3EJWA 1W2WB 3OQMA 3SOPA 2I03A 3QIAA 2DQSA 1ATZA 2CXXA 2KBFA 2Y68A 4WKGA 1GR0A 1TFUA 2QTMA 3ZU2A 2O2XA 5EFOA 1MGPA 1XDUA 1PL6A 2JLXA 1CE8B 1DJOA 3MJDA 3WL4A 2HMUA 1M1NB 2HRDA 3G2JA 1IOVA 1M8GA 3G1UA 2EW1A 2OCGA 3AEKB 3EN0A 3Q3IA 4NJEA 4D4KA 4BE4A 3NTXA 4CT0A 1BMFA 2X0EA 2WOOA 2QUIA 4Z4HA 3DWGA 3IVAA 1AHNA 1WSBA 2VRWA 2XAUA 4CCWA 2AUNA 5HSGA 2JEYA 3UMRA 4BVGA 2BFFB 2DJ5A 2WPDA 3RUHA 3R9XB 1XDWA 2GYUA 3QXGA 1R0BA 1RAFA 1X74A 3BD9A 3CH6A 3HNPA 4XDGA 4H7FA 4E5UA 1QAOA 1GO2A 3IPLA 2YQZA 3WLTA 2AJ8A 2VTBB 3FTFA 4EMTA 3GPCA 5FX2A 2OVFA 2IHUA 5I7EA 5I8WA 1UK6A 1XLVA 1T5BA 2HCBA 2JD2A 3MEQA 3ZLUA 1M0WA 1XZGA 2RHCA 3ZLJA 3OQIA 3QVJA 1JW9B 1PR2A 4DV2B 1JAYA 1QYCA 4MKGA 4K6FA 2HMYB 4OJKA 3VBEA 1KMHA 3P2OA 3GRCA 3K09A 5LMCA 3ADBA 1NLZA 2RAUA 2PUTA 3C3PA 3C45A 1OW3B 3CUUA 4BC0A 5I9IA 4ASUA 5ILOA 2C0PA 4TN5A 1B6SA 4GDFA 4QFCA 3WL8A 4KQFA 1NXVA 1UH5A 5IARA 4P83A 3V8BA 3TZCA 3FFXA 5A03A 1TLFA 4YUVA 2PDAA 3RADC 2H0QA 5FTNA 3OMWA 1VRVA 3CVWA 2DZDA 1QLJA 3OEWA 5E9JA 5TPZA 3V7NA 3PXBA 1OWOA 5T3YA 3TR5A 4WOJA 2P9YA 3X1XA 2QMHA 1Z0DA 3TXXA 1G2QA 1PSDA 4LHSA 3DULA 3CF4G 1PV2A 1GAQA 1XD2A 2VP6A 4Z8XA 3ICOA 2PSFA 2VJDA 1Q6YA 2W2OA 5I47A 1R0CA 1VG0B 4JYMA 4I0WB 1AKWA 1IK4A 1NURA 3AR7A 4WOPA 5EJ4A 4KZKA 1TKAA 1AGPA 1KRHA 5GJVC 1BNCA 4R9NA 1IUOA 1L8XA 3CY6A 4LJ6A 4PZYA 4RD6A 3RPEA 5EHNA 4C0BA 4MUXA 3VU0A 2JVKA 3A4MA 5G4KB 3E9YA 1EDOA 1C30B 4UVIA 4P7GA 5LBTA 2DY0A 1TUEA 1WPXA 4EHKA 2PIDA 1XCLA 4P35A 4TV8A 3JV7A 2QD3A 1QPZA 1JR3D 4FHEA 1PR1A 4XKJA 4CW7A 2NO1A 2C7QA 4ALMA 2BFEB 3IV7A 1IBLB 3QVGB 5AH0A 3VNUA 1CP3A 2AG5A 2EAUA 4IIEA 1EFRA 1RJEA 1ADCA 3BXFA 1PCXA 1REQA 3E6AA 4R1NA 5DNUA 4IDEA 1YFKA 2IUFA 3CLKA 1LBQA 3PQ5A 4OFWA 2NTNA 4R8VA 4UHCA 3SEZA 2XOEA 1ISHA 4RVDA 3GGOA 1M83A 5IWAB 4R8LA 1E1CA 5IULC 2X86A 4E33A 2N1BA 3LKDA 4YMWA 2CVOA 1EVYA 2FP4A 2VQDA 2Y1XA 1AS2A 2ZVDA 1J8MF 3KYCA 2VPWA 2C82A 5C8YA 1TGYA 1LX7A 3ESAA 3OEHA 4U9HS 2B4AA 1X92A 2NGRA 1M5TA 2NP7A 5LQNA 3M6UA 1QE3A 3PNLA 4A2WA 3DLAA 3TQQA 5CFNA 4NTZA 1RHQA 3JWIA 3CZAA 1IZ7A 1MOZA 3CRZA 1T2EA 4C1NA 5AFSA 2OUKA 1J5XA 3GFOA 2BMWA 3I9OA 2QI9F 2ZZKA 5FLKA 3WHLA 3OY2A 4F3RA 3BTVA 5JSHA 4RZHA 2Q4DA 2XA2A 3S40A 4EI7A 5L7WA 5F7OA 4UBOA 5MDHA 1YMVA 3GLIE 3AHJA 3PYLA 1W47A 3IKJA 1W87A 3W1EA 1NSYA 5DOVA 2E55A 2RC6A 3OT5A 2ZS8A 3B1ZA 3H7AA 4M2LA 3QPVA 3WV4A 1DDIA 2MDTA 1JP7A 2GYVA 2YZ7A 3Q41A 4BJ6A 4K9PA 2VWQA 4OHBA 5EJFA 2NZYA 2O2ZA 1X87A 3HKDB 4BZWA 1ND6A 4EJ6A 3ZDZB 4B33A 4UXHA 3L7AA 1NRIA 4KFUA 1SZJG 5JANA 3Q3VA 4RE6A 5IK2A 3FJ1A 1IBSA 3EIQA 2CNLA 3GLHE 1V8OA 4FFNA 4HH0A 1DXQA 2JLYA 3IUQA 2RGNC 3KV3O 2Q7XA 5L4LA 2HA5A 16PKA 1UKEA 1T2AA 5E4FA 4C1BA 4D46A 4Y0AA 1ZS9A 1A9XA 1FFEA 4ZQBA 2FWAA 2XY4A 4IKEA 3OP1A 2WHPA 3P4YA 2NU8B 3NCHA 5TNXA 4AUNA 3ZVKA 5BR4A 3DZIA 4HDNB 5COQA 3TB6A 3MUOA 1Z36A 4OY3A 1Q83A 3CX8A 3PV0A 4UTOA 3CH5A 4NZYA 3NVMB 4XYMA 4H60A 3PNBA 1E98A 2BFBA 2HIMA 2VK1A 1EG7A 2PL1A 3DNFA 4ODIA 3AI3A 3OLZA 4OUKX 3IAFA 4OAOA 2C2BA 1Q0SA 2I1LA 2F1HA 3FHLA 3OWXA 2GEVA 4L9SA 3A3KA 5HA5A 5KJEA 3ZUGA 2E21A 2AI2A 3EGCA 2RGGA 1WAMA 2HA6A 3IRUA 1VL8A 1RIIA 4XWKA 5EKSA 4DHWA 1H2YA 2Y66A 1UBLS 2G8LA 3B78A 3RR2A 1FU4A 1NZJA 4URVR 1D0VA 2CXTA 2HWWA 4HB4A 2R6CA 3X1ZA 5B3LA 5JFTA 1SH7A 5AKHA 2IY8A 1BJKA 1I51A 2OCBA 1FQJA 1HL3A 4IICA 4RF3A 1PNOA 3EC1A 5JVDB 2G88A 4EBBA 4F4FA 5HNKA 1R8JA 1JQ3A 1H0KA 4BWGA 3QG1A 3RB8A 3GX1A 3L7DA 4X20B 4HK4A 4G9EA 3EA4A 1PQPA 3IP1A 2CN1A 1KJ8A 2FOIA 3SSOA 4I2NA 4JXJA 4RD0A 3UT5A 5TB5A 3LI2A 4YXFA 3L0BA 2H4HA 1SKBA 2ECPA 3W3ZB 1C3LA 1FSFA 3CBGA 3GRKA 5FJJA 3WAKA 1LK7A 3A1NA 1XRSB 1BJTA 2D1FA 4D4LA 1NU8A 4XUCA 5CYFA 4U63A 2WWTA 2AW3A 1KBOA 1UDXA 2F3TA 3F1LA 3FTQA 2B4YA 3IKVA 3GQVA 3MLBA 3UT0A 1DKMA 2R0QC 1RQPA 2CK3D 2Q3BA 3EEBA 4TL7A 3Q6NA 1NUQA 3IBCA 5F12A 3WGOA 2HSDA 3OU7A 3HP1A 1JBEA 2V9ZA 4NULA 1AKVA 4WJZA 3Q12A 4EHFA 3KAJA 5DTJA 5HUQA 2QB5A 1Z68A 3RYCB 4ZO8A 1FQKA 1P1IA 4PPNA 4YAOA 4UNIA 1E63A 3ASYA 5FPPA 2FXVA 1NZDA 5LP6B 1QG0A 3U4QB 1XEXA 3FMPB 1FYEA 1OPRA 3FSGA 4BUJA 4MKXA 4YR9A 3QKIA 2O9JA 1VE1A 2GJAA 1GPUA 1YB4A 1ZN9A 4RKWA 2X4LA 3BQMB 1UR5A 3T15A 4ISBA 3IJPA 4TMZA 2C8LA 4LMRA 1W9HA 2HJGA 2Q9CA 1VLJA 2QAGC 2RGEA 4ND3A 1EUZA 1QHEA 2RH5A 2XSZA 3OT1B 4PRZA 3ZDEA 1SQGA 4H7HA 4V3CA 4BQPA 2EF0A 3IR5A 4HRXA 3TTWA 5JZBA 1SBZA 2QRHA 3E3OA 4TQAA 3ON5A 1RHMA 2I3ZA 3ZY2A 1J1UA 1D6MA 2VTEA 1UMCB 2W6QA 4IKOA 3ND9A 1HLFA 2ZI6A 3B89A 4FMPA 2XHEA 3HP7A 2A5DA 3GD5A 2GAIA 3MJCA 4ZQFA 2P3LA 2VJMA 3OOYA 5IT0A 2F8SA 4U8HA 5BSVA 5K0EA 3BRQA 2IYPA 4LNAA 1ODLA 3ZYZA 3LHIA 2QTRA 2QN2A 1QKJA 3CZQA 5AUPB 5LNK6 1OCEA 4YS6A 1FQWA 1YMUA 2G76A 2OFPA 2AXPA 1GZ3A 2QTZA 3BOSA 2BUCA 1G6KA 3HJBA 3I6ZA 4CV2A 3IC5A 1GVHA 4CQNA 3RRYA 2J07A 2VNIA 4MJ7A 5AQEA 3UCEA 1KDRA 2P11A 1CETA 2W6OA 3KTFA 4GUAA 3NAQA 4FI3F 5H59A 2H65A 1B73A 5HDBB 3RIHA 1E3SA 2JF0A 2QKYA 3QYFA 4QOHA 1F0KA 4GECA 5EMJA 3G7NA 4MLCA 2FDXA 4X8OA 2WD7B 3B6JA 3O9VA 4UUQA 3KT8A 3DCNA 2PRJA 4MYCA 1Y9AA 4DUPA 2O3SA 2ZSJA 5KQRA 2DSTA 5I7FA 3M89A 4HEQA 2QM8A 3L79A 4D8VA 1T6ZA 3LQFA 1ZMRA 1HWYA 1XMSA 3LYLA 4AWAA 3N3BC 4GBMA 2HPHA 1F2TB 2IXDA 2NSLA 4PZDA 3T5MA 1LBHA 1P1CA 2ISSD 3QUAA 4FE3A 3QPBA 3HL4A 4KMMA 4B2IA 1M3SA 2FQWA 2PH1A 1HFEL 5JHGB 1AS0A 3O73A 2V4ZA 3EYWA 1I3MA 3ZXIA 2QZZA 3JVUA 1HYBA 2IYAA 3EEYA 1XRPA 3AHGA 4L3VA 3OQVA 4F46A 1LV7A 2VYVA 3WA6A 2DBRA 2I2BA 3I53A 1QQBA 2B0CA 3L0YA 3KWJA 2F7SA 3GGGA 4OLFA 2PRYA 2ZJAA 7AT1A 2PMWB 3IKMB 4QOIA 4F2WA 1U8YA 2HHLA 4WFKA 4RZUA 4DJEC 1AQJA 2FV8A 2CEAA 2LIVA 3OURA 4KNYA 5ERGB 1ZXXA 2AOUB 1J07A 1E2NA 1RSZA 2R5NA 3QPDA 4PONA 1FVXA 4K40A 1MP0A 3E82A 4IWNA 3ZWQA 4RMIA 1R4MB 4DVGA 5I7VA 3OQOA 2P8SA 5BRNA 2HMVA 4HB0A 3FUUA 5FUVA 5AW2A 4A23A 3EVDA 3KBBA 1NRJB 2IEGA 4ZC1A 4DCUA 1M8PA 1F9AA 1U4NA 1GV1A 2PM8A 2VUUA 1F14A 5DYYA 1QIFA 2HRBA 3HU2A 3L7CA 1KDZA 5D3KA 4HTFA 1UJ4A 3PX7A 3ROPA 3IPYA 3W77A 4ZYZA 5ITSA 2GBLA 1TA0A 4FEAA 1G38A 3ZVRA 5DW3A 5F9HA 3BZWA 4Y2RA 1AZTA 5ESXA 4G0VA 3ABSB 1ZGGA 2H3EA 1T6XA 2HSJA 2YHBA 1GUBA 3IJRA 2GESA 3EXHA 5IBPA 3T4EA 2AYYA 3FYHA 4PZZA 1IUNA 3ISTA 1LDEA 3TRKA 2XDYA 3AWDA 2IYSA 1M2WA 5CEFA 3EA5A 3T0FA 3S7TA 1NJGA 1B3BA 5IDQA 3ZJUA 2W6JA 3GLVA 3LBAA 3H1BA 5TVKA 4HAYA 1LVUA 2B1IA 3D3JA 2B98A 3JVDA 1XZPA 2DFTA 4HN2A 5BR7A 3AIOA 1Q7RA 3PWTA 1F2VA 5GM2A 4WIAA 4J2OA 1TUIA 1MCZA 2H1IA 5EVJA 4GMGA 4MIKA 2B94A 4Z9BA 1G20E 1OKKA 3RSLA 5BQXA 2Z57A 3JSXA 1XL0A 3D0QA 3PIDA 2INGX 5B1HA 4DWOA 1O5OA 3DC7A 3A9RA 4U7FA 3NKLA 3DLIA 4Y9RA 3K7EA 1Z4JA 2ZP1A 4KR3A 1H85A 1K6JA 1VPVA 1K68A 1BVHA 3PC8A 2ESRA 4DAEA 3GBVA 1MRSA 2ODPA 3ZK7A 4G2NA 3V8RA 3PDJA 3MTGA 5DGHA 3USCS 4GQAA 3UPUA 1JEYA 2PKEA 4E5KA 2C2GA 1U5BA 1OJLA 1FX1A 3M6MD 4CKCA 4RENA 2R8XA 3TFOA 1PZHA 2QL9A 2I7VA 1TYAE 3ZD6A 1I1HA 4AQ7A 2YJ3A 5JATA 4QTZA 3M2PA 2VF4X 3ROMA 1L4LA 2ODWA 1XXHA 2WF6A 4KGZA 1FNBA 1V1JA 4G4IA 1FTGA 4U0JA 2WF8A 3RKRA 3KL2A 2IYFA 1EEHA 3G59A 4D9BA 1N1MA 4FPXA 4M9RA 1W29A 5LQKA 4Z7JA 4Q39A 4HEHA 2VCEA 1NC3A 2XAAA 5JS8A 4KXQA 2GNPA 3M4NA 1TU4A 5EJAA 1O08A 1KYQA 2CLSA 1HE5A 4HY3A 4B4OA 5JYEA 4BV9A 5CFPA 3FNQA 5LPNA 4XYGA 1EK0A 5TXGA 5THKA 4R5MA 2FZKA 4HB2A 3LQ1A 3R9WA 3TBHA 2HU2A 2ETXA 2J9XB 1O0CA 1FX0A 4JFRA 1SUWA 5K2MA 1GVNB 2M1ZA 4INOA 1DFGA 2PL3A 4WNYA 4X7BA 5BXYA 3CONA 4HH1A 5AK0A 1NVXQ 1V95A 1X9HA 1CIPA 3RBVA 3BFKA 1UM9B 2I67A 1YMQA 2X23A 4OH1A 4I9FA 3LW8A 4AQDA 4EGAA 4LE0A 5FXMA 3H6HA 2ZSAA 3L1KA 4NJMB 4PIVA 1N5OX 1V1MB 2FGKA 4QGSA 4A0HA 1KI7A 3RF6A 4EABA 2HGZA 2NZUG 2O2SA 4IVPA 5BYBA 4HWPA 1NI3A 2Z3VA 2FMIA 3WSWA 5K99A 3O83A 4QDTA 3U4CA 1T29A 4I1IA 4IDCA 2YUIA 4RFVA 4UASA 5CTJA 2OR3A 3EXFA 2D0DA 2WNSA 3EXIA 2P67A 4BMNA 3H1PA 3E58A 3PP8A 3ZHQA 4E11A 5I7RA 1L5LA 4U5XA 4Q3OA 2FSSA 621PA 4RIIA 2XTAA 5F4ZA 3RAEC 2YS6A 3UAGA 3GARA 3CTPA 5TGZA 1Q7EA 3GR6A 4O4JA 4Z99A 4FFBB 4KFCA 1OT5A 3AEXA 3FCCA 2AK3A 3VISA 3J81k 4BO8A 1AG9A 1F2UB 3G8AA 3EFBA 1YR2A 5AKEA 3VNSA 3ZCQA 5AOVA 3FTCA 4OGKA 4Q3DA 1KVQA 1BN6A 5DO9A 3SS8A 4BB6A 3EWAA 2QYOA 4HNAA 3VDRA 3VR1A 5HWSA 1J2EA 2G5CA 4E3WA 5KCZA 5KSWB 5A0VA 4WUTA 3FDIA 3PQFA 3ZV5A 4A8PA 4MA0A 1A7JA 2FPPB 4I3GA 4ZVKA 4B40A 4YRGA 3EEOA 2VRCD 4Q82A 3X1KA 2FU5C 3K5IA 1DO2A 3DR3A 4M3NA 3ZEAA 3UJ8A 1N2HA 4YRJA 2VN8A 3UJ9A 3W2EA 3GT0A 1OXTA 4EJSC 3F6YA 4MWTA 4PGHA 3HV2A 4ZZ3A 2VHJA 1H2RS 1U0OC 4IYRA 4BRWA 4LY6A 3TIVA 4F8JA 2JB9A 2GGSA 5ADVA 3QHPA 2EKDA 1KYIA 1ZUWA 4WK4B 4JU9A 2AE2A 3E7XA 2DH6A 3DEFA 1FDRA 5ISMA 4NBLA 2NXCA 2ZRLA 1E7RA 3MIZA 3VR0A 3GIWA 4QGHA 4YNBA 1JMVA 3QKWA 5TQ2A 3TSAA 3QTBA 3C4VA 1FLNA 5GONB 4IJKA 1TIKA 3VOBA 1Z8HA 2FWMX 1UQUA 5DDIP 1JXQA 4O8ZA 1XZIA 1ONNA 3U3RA 1WA5A 4HBGA 4UHBA 4JGGA 3VC3A 1R6VA 5K20A 2V7QA 2HIAA 5DEOA 4WOBA 1PDVA 2AMJA 1JYFA 4M6WB 5EIBC 1NV8A 2HQSA 1N32B 1POXA 1PUXA 3A25A 5IANA 2ZT8A 4V38A 4RSMA 5A05A 4BDSA 2OZKA 1YR7A 1Q7BA 3VV3A 1Y9ZA 2XZOA 2OC4A 4F9TA 5TQ0A 3RREA 5AVQA 4JI1B 1XCGB 1L5HA 1JWAB 4E5NA 1PL0A 2PMDA 3KVYA 4KQ2A 3WMGA 2IS4A 1U5AA 5ALMA 2CKMA 4AS2A 2XGMA 4DRZA 1FMLA 3LQ2A 4O02B 3RJZA 3P9NA 1G98A 1SC3A 3MGAA 5HCUA 5IT4A 1E3TA 3A11A 4NYJR 4XB1A 4WACA 3BT7A 4JLSA 2ZWMA 1F8FA 1P1HA 2JPDA 4LMAA 2Q0SA 1FF9A 1UFKA 5ALQA 4CE6A 3BJIC 1NVVQ 5EWLA 1W5AA 2JI4A 4QSHA 3ROQA 3KQHA 1PJRA 1D09A 4A26A 4G67A 3SC6A 1RZUA 3PEYA 5E1OA 2VP2A 4ARAA 2AK2A 1A71A 4KXUA 4DGQA 4QBHA 3ZDBA 3RGWS 3HU3A 4JVLA 1U3FA 1JFVA 4MJLA 3WIDA 3BZUA 3RIEA 2HBYA 3S3TA 5KS2A 4HDRA 4Q9DA 4N7MA 1VA5A 4J2HA 3ND7A 4AZ0B 4FMCB 4LXYA 1EBFA 2JGRA 2NW6A 3W2IA 1NJ5A 1NVTA 1Q1EA 2JATA 2BMFA 1A8PA 3OIUA 4IFIA 1ACLA 4EB6B 1A72A 1YBHA 4DMUB 1N34B 3T0IA 4X64B 1I5EA 5JY1A 1VLMA 2UAGA 3FDXA 3SDZA 2DPHA 1EGVB 2YJ5A 3MINB 3OUTA 4IIJF 2PJZA 4JUIA 4YJGB 5C3MA 4BN0A 1FLAA 2IKSA 1E1LA 1ZQ1A 3HEMA 3OJCA 2RMKA 3MXTA 3WWZA 1WXEA 5F2KA 3RQIA 2GCIA 1ATIA 5IJ9A 4LF7B 3W90A 4WW0A 4BFVA 1JG3A 1H0SA 1GPAA 4P4UA 3WYCA 1GOTA 3DO8A 4LYGA 3BPSA 4ARBA 4D99A 4J6FA 4C0LA 3WYNA 1DSSG 3SX0A 3CLTC 3LPDA 3M4XA 3TW6A 3WLEA 1U3CA 2G9ZA 3T7KA 3BREA 4BAGA 1M66A 3LCVB 2ZROA 3O5AA 4TMVA 3VR2D 1YVPA 1JYSA 4AKHA 5A4FS 1KZYC 5FWXB 4MARA 4BUCA 1XK7A 3W5VA 4US2R 3EXAA 2HK9A 4PWZA 1IWOA 4UTPA 1WQ1R 3PDIA 2M6LA 3GFRA 2X1MA 4BQNA 1YNOA 1D07A 5FH9A 1GU0A 1PR6A 1MABA 1Z29A 1EJ2A 1P7YA 4BQSA 1E96A 1S8OA 4NG4A 5DHPA 4HP8A 3MZ0A 1FP4B 1YK0A 3BKWA 4TT8A 2QXUA 1XQXA 1ORIA 5KTYA 2XB9A 3USZA 4LOHA 2CUNA 2GKOA 4K9OA 3TB4A 1ZUD1 1KNQA 4C76A 1ZHFA 3IEPA 3RS0A 3VC7A 2OGTA 1IFXA 3L9WA 2EKQA 3QTTA 1V8DA 2D0IA 5AIAA 1UWKA 5HX7A 5IUNC 2VLIA 5FUWA 4J9UE 4B3IA 1JHYA 4N7BA 5B1SA 2BHRA 4Q37A 4UBJA 2WSLA 3T9BA 2XUOA 4V0QA 1P1FA 1VSUA 2E82A 3OP4A 4ERNA 1N7GA 1ZRNA 2HDWA 1HKUA 1XA0A 2D3WA 4DLAA 4DV5B 1U3TA 4YCSA 4L9WA 4LK3A 1OLUA 1A0OA 1H66A 1HUQA 2XHZA 2GYYA 2ZRKA 3LSTA 4LYYA 4CYMA 4FDTA 4G65A 4CTKA 5KPJA 3IMEA 1GGHA 1DAMA 1DPGA 1DE0A 4ZK6A 5JZVA 1U1CA 2JFPA 1XPOA 4GP9A 2JFWA 1C0LA 5F76A 2N0SA 1NASA 5IH7A 2WM8A 2V8BA 3KDSE 1LLFA 1NF8A 3I1YA 3R5HA 2FN3A 3OFND 5DULA 4DUZB 4FMBB 3UAWA 3UHAA 4TTPA 3WYFA 4BS9A 3A9CA 1DRWA 4TWZA 2CDRA 2DSNA 4EG1A 1OZHA 2FR8C 5A4MS 1BX3A 2FPIB 3X1MA 3OD5A 4IINA 3DFFA 4ISCA 4XWAA 4J1SA 1ZBQA 5HJ5A 5KJ1A 1N0VC 4ER6A 1TO2E 4BZZA 5AW4A 1UFRA 1A4XA 3M49A 2Z9DA 4QJBA 1JLRA 4EQZA 1DUIA 1I4EB 2EG5A 4KYTA 4BP8A 2ENWA 4IIGA 4G1BA 2WC1A 3ZW7A 1I4OA 3DJYA 3EFOA 3QVUA 3GIDA 4KQEA 1CQIB 4Q7JB 2FPOA 4RFLA 1OFUX 4EEXA 2NV2B 1DC4A 2PSJA 3Q3GE 2FG7C 2MU1A 1W581 1EINA 1ZVVA 2IYQA 2JRCA 2WQ7A 5BV2P 4QLBA 4YUXA 1EWKA 5IWCA 1C2YA 4IJQA 4RIEA 3SE0A 3E2MA 1SZCA 1NATA 1UBCA 3NIGB 1CFJA 4Y3UA 1JIIA 1HNWB 1QMGA 2BE9A 1WKVA 3QVWA 4KX3A 3I76A 1XTIA 4FJ0A 1PG5A 5LR6A 1MD9A 4EHHA 3D54D 2Y2UA 1GPNA 2AEFA 3OLXA 1LTHR 3HBNA 4CMIB 1OLSA 2GZDA 3CRMA 2DVMA 3BWYA 2C94A 4BFLA 4A8JA 3DKVA 3HRIA 3ZHXA 2PSDA 1EUQA 3ZCTA 2B99A 2ZE7A 3F2VA 2A9PA 1IZYA 2O0MA 4IRXA 4JJZA 4AROA 1BOOA 1F60A 4ILEA 4WXYB 4DDWA 1K1EA 3N0RA 5MGBA 3NORA 3WIVA 3Q8XB 1W4AA 1XP8A 4WINA 1Y82A 2WV9A 5HF5A 1K4KA 1BGVA 4MGZR 5TEWA 3R6TA 2O2YA 4JBNA 2ZW9A 3BSFA 3EAQA 4W1RA 2FEXA 9GPBA 3CNEA 5E38A 2A8YA 2XNHA 1GDDA 2IXBA 3FWHA 1C3VA 3WNBA 3ERCA 3WRWA 2A1UB 2C8KA 4KXYA 5EZYF 3D2LA 4ESHA 1H05A 4H0NA 4EPXA 2MYTA 2WJPA 4NYMR 2W98A 5M7EA 3ZHSA 3LUFA 4XYEA 3AM4A 5CDFE 4YAKA 5J5CA 1OYOA 1ONPA 3VZRA 2PXHA 4LYHA 4A6EA 5K3OA 3KEQA 1IVNA 5JBNA 5D01A 3LHSA 3EODA 5LOVA 3GHHA 4DYHA 4GLFA 4LFAB 2XCIA 2PUDA 5KSOA 3I6IA 3KSRA 4RM2A 2O8EB 2R96A 3NOVA 4MRVA 3V1UA 1E89A 4LOLA 4BBPA 3E18A 4MEJA 5EIOA 3BIOA 3VTAA 1ADJA 2BFMA 1PWXA 1MH9A 1GQRA 1RP1A 3K0FA 3ZGYA 1GAEO 5A5DA 2IX3A 4LFBB 1HYQA 1ZP6A 1XMPA 121PA 1JDSA 1RKBA 2VJQA 3QFTA 1RE1A 1ECCA 4QJ4A 4ZC8A 4CF7A 4WK0B 3L43A 5L7YA 4FYMA 2VPXA 4U5QA 2JCVA 1T5LA 3UWMA 4A2CA 3QEBZ 2A1IA 3GJ6A 5F21A 5AXAA 2PV0A 3OZVA 4MUHA 1Y5RA 4PE5B 1S02A 3F3KA 2I6XA 2FZEA 2RG7A 1B2RA 2O2EA 3KQUA 1MQAA 1N5DA 3NBKA 4HDMA 1JG2A 3UVEA 5K8JB 3ADOA 2OBMA 2C3OA 5BNFA 4MS4B 4DEYA 4YJ3A 4CETA 4W5RA 5DVZA 3HV0A 2ZVJA 4UEQA 4ZI3A 1Q0HA 3AV3A 1UC9A 4LDAA 2YWJA 3E15A 4H08A 5FYQA 2K2WA 1ABEA 1WXDA 4WKNA 3ZV4A 1SBTA 3E5NA 3ZW9A 5KPDA 2Z6AA 2CJFA 2GASA 2ORWA 3D8UA 1B3RA 2YQ4A 5D85A 4C03A 2MOKA 4E2FA 3QWAA 1J23A 2LIPA 3TMKA 5AK3A 3ZEIA 1II9A 3UGJA 2HWUA 1SWWA 3FKSD 4JH0A 3ROXA 2FW6A 1CRWG 3SFZA 2FZ4A 3AVYA 2Y05A 1QNLA 2I80A 5AVJA 2WWIA 2W83A 4OPMA 3AB7A 5SYAA 4QGFA 4DMRA 2VPZA 4H4DA 4ZREA 3ROFA 4B3GA 5ED0A 1MQSA 2C4NA 5CR9A 2RCNA 1AUXA 2BJVA 1KU6A 4G3XA 5E2AA 1PDWA 2A9VA 2VK2A 4MUKA 4YEDA 1ZD1A 3BE8A 4RAOA 4YCJA 3UB2A 3SMVA 4G8DA 4UBIA 3VAZA 3I2IA 2XGGA 3OIDA 3EAGA 1F48A 4U2GA 4RTPA 4ZHSA 3PUIA 5LYJA 4TSFD 2Q3FA 4K9DA 3IT1A 3CUVA 4KDRA 1KDVA 1SIUA 4G63A 3SKXA 4LAFA 3JQPA 4BC1A 1DWPA 4HMPA 4D96A 1SMKA 1A9PA 2QJWA 1CR6A 4W5NA 3KFVA 4MMYB 1C4KA 2GAJA 3PT5A 2Q4TA 1T3LA 3MWJA 4KPUB 4D25A 4I1UA 4IDQA 1E9DA 4OGLA 3DF9A 4W9RA 4YP0A 2VTDA 4E4RA 1AGYA 5A5VA 1VPEA 4X3PA 1LJUA 4WECA 1SC1A 4UNQA 3LT0A 4K81B 3GRRA 5EKXA 1L5VA 1PTJA 1C1XA 1QVZA 3LY5A 3UIEA 5D7BA 3C5WP 2I4NA 3AIIA 3AHHA 4ZFNA 4EY7A 4EKDA 2R1VA 4QU0A 4CKXA 4M7OA 4WDQA 3C16C 3RSQA 3ZVMA 5U4XA 2W0MA 3NDIA 3OT4A 1OI7A 1NC1A 4D80A 3CR7A 2DF8A 1DKNA 2VT6A 2PCJA 5LXTB 3DMFA 3QKSA 2SCUB 3LZ6A 3MFYA 2VCHA 4IVNA 4O4LA 1S2GA 3PHBE 1RTTA 4OQLA 4DT1B 3EWSA 1OUMA 4RVSA 1W88B 3DZHA 5BQ5A 4CVNA 4TVKA 5A62A 4KX5A 4OA8A 3R0ZA 4R83A 3PRKE 4UBKA 3ETLA 5CA1A 1LXCA 3KUKA 4LCJA 3AKYA 3FROA 4LOIA 4U3JA 2LWIA 4ZOCA 5FA6A 3V6LA 4HDKA 5IXJA 2ZJZA 1C8KA 1E3DA 1JG7A 2P1RA 3L8EA 1X7GA 4ZAFA 3UMGA 3U3XA 2GERA 1WMBA 3NFRA 2PZJA 1JU9A 4UFNA 4QNNA 4DF3A 3QA9A 4X8HA 5NLLA 2VDLB 3UKJA 5K6RA 4IVQA 1R66A 2DQ4A 3DT6A 3LXRA 1ZK4A 3PCXA 4Z0HO 3VNQA 2PUFA 5GJBA 1IWPB 4QX6A 1B23P 1Z62A 5TQJA 2H00A 2FSVC 1EDBA 4B44A 4LJ5A 5KWVA 4WEQA 2G9UA 4M8LA 1VMKA 2R6GA 3I5UA 5G40A 4C7KA 2R62A 2ZVPX 3EGXA 3WLHA 4C88A 2MMCA 1ZIYA 2VKQA 1USUA 3AHCA 4EM6A 1K7CA 2XUIA 4TLCA 5AK5A 4WGGA 3IJEB 3SX2A 1SVLA 1AH2A 2JFNA 1AF7A 2YWXA 2PT5A 3RU9A 4CQMD 1DOAA 5B2EA 3LS2A 4NMMA 2OO3A 2YINC 3FUVA 3T1TA 1WKCA 2D13A 3O6VA 4ZAZA 5JCOA 3RYTC 1QUEA 4JENA 4QBIA 4AICA 4RTMA 2WU3A 4CM4B 4RGYA 2P2DA 1Q7TA 4RFSB 1EE2A 2A5JA 1N2JA 1L7EA 2IOYA 5JAOA 1MJNA 1XVIA 1ZR4A 3WGGA 3GOHA 4ZYXA 2YVKA 1ZG3A 3UNXA 4H18A 2FMTA 4W5OA 1ZOLA 5EVCA 3S29A 2EF1A 3RYIA 3FOEC 5EC8A 1RYNA 5EZQA 2BEWB 5CAEB 2FUCA 5FPQA 1AKUA 2J67A 4R1UA 2FCRA 4LZAA 3OVMA 1YQEA 3O4VA 2R8BA 1NUHA 2B35A 2ONKA 2AOXA 4F71A 4F60A 3OCUA 1XTVA 3H9UA 1P72A 4RA6B 3KSDO 2QLFA 4UUOA 5U4QA 1UADA 1I6LA 4CTJA 3DLHA 2MR5A 2OA0A 3RJMA 1FDSA 2IBMA 1Y1QA 1EGQA 2RGDA 4MLPA 4QJ5A 3VKVA 4CM9A 4DA6A 1NJ1A 3NANA 1UDWA 4KMOA 3WJAA 3PD0A 4DN6A 4S04A 2VCYA 1DHRA 2DWUA 3TZHA 1NW9B 1QGDA 3GUHA 1Z0FA 3K5WA 4OX9Y 1T5DX 2X2PA 4Y2TA 5AOAA 4ARUA 4Y2XA 5EEGA 5ENZA 3IP6A 3DMHA 2OHIA 4MW1A 1SC9A 1M6NA 3R23A 5DTIA 4M9ZA 4ZU1X 3S2EA 6NULA 3F8TA 1ICEA 4HC4A 4HDCA 4R2WA 1F38A 3NKFA 4RACA 3EOBI 1O96A 1QH8A 5BO5A 2PL9A 3OJFA 1M67A 4OAQA 3NS7A 2M9MA 1U2GA 2AF3C 2FPLA 1SRQA 2FZ5A 3PPIA 1C9EA 4TRRA 4AU1A 1MC8A 5DOZA 3UXMA 3DS8A 2BFPA 1BEZA 1OIVA 1NQWA 1KO5A 3CCFA 3FPHA 3JD0A 4LDRA 1R0SA 2REQB 2ZI4A 1VLVA 2NO7A 2JKYA 4UTXA 5CG2A 3QX9A 5SYNA 3HBMA 2I1VB 3PDCA 4U7JA 2VLBA 1FS4A 1Y6ZA 2YZKA 3ZY4A 5HQ3B 2Q46A 4LHZA 3T5PA 1R9NA 4LXIA 1NQTA 4L27A 2PQ6A 1IPFA 1TQ2A 4NMXB 3D7KA 3GJ4A 1QVWA 1IYZA 1KKUA 1IHDA 2X76A 3B7PA 5ALRA 2VZEA 1YOVB 3C39A 4A0RA 3BC1A 1CTQA 1DJPA 1HF3A 2C9BA 3SF0A 5CIYA 2O50A 2HEGA 5I7SA 2CCGA 3HSKA 3JQQA 1RYYA 1X1BA 3LGSA 4QYWA 4MV7A 2AOTA 1W48A 1N6PA 1DS6A 2K87A 3UHFA 4EB0A 3L7LA 4NOMA 4TMYA 3HNRA 5IYZA 4K9LA 1GA1A 5D6NA 1NMXA 5BW6B 1E3WB 3KVVA 2F8LA 3H9QA 4X7MA 3DOOA 3P26A 4MR9B 1Z6YA 1I14A 5F1KA 4QOFA 1CY8A 1RCTE 1GGKA 1JVNA 4RVUA 3UAOA 1E2GA 2OZPA 3B70A 2VJLA 5IAGA 5SZIA 4AFNA 1EWVA 3ABZA 3KQSA 3DTVD 1RHJA 1QHFA 2WMDA 4G26A 1KYYA 4G84A 4JGBA 1UWLA 1KEEB 3DTVB 4MYUA 3TSCA 5L9AA 2D3TA 2JHPA 1NBWB 2Q21A 2V7XA 3GPBA 2PEYA 4HAXA 4QARA 3UMSA 2E9SA 4B2PA 1JFSA 2WIFA 2JDIA 3ITEA 1ZU5A 5G0TA 4P0TA 3S1SA 3A1SA 1NLYA 1T3ZA 4RLHA 3A1VA 4YCBA 4KHZA 3HCNA 3OIFA 2C58A 4FEGA 4YQEA 1KO8A 3K09C 1E60A 4HBZA 3A1UA 1RCFA 4E21A 4PGMA 1LF0A 3IMGA 1A88A 1IZZA 5TMPA 1N75A 4X6XA 2Z56A 3HR8A 4DLZA 4ZEWA 2WTXA 1VG1A 2GZMA 5B3JA 2BI4A 4RTOA 3DPIA 1J33A 3BXXA 1YKGA 2QE7A 4BVBA 3OE7A 4Q1BA 4F04A 5JNUA 4WK2B 4TROA 2V97A 4JJ8A 5K0SA 4E2ZA 2J1LA 3HDGA 2X7JA 1V8PA 3UJNA 3D4BA 3NEJA 4ZKDA 3PX2A 1IN4A 1C7RA 2IPAB 3N7AA 3U3ZA 3X43A 1QOQB 3H5OA 5JVDF 3MF4A 2OSBA 4RJTA 4B9EA 3G2NA 2PNFA 1UXJA 2Z4SA 1HG1A 1RE0A 4PLVA 2NUBA 3PNSA 3RASA 5JUWA 1QX4A 3H9BA 3H1AA 4B2YA 3LH5A 1T4GA 3AXSA 4LRTB 5KB3A 1ZVJA 3P2KA 3PJRA 5FV7A 2IFTA 2JJQA 5A7HA 2XUPA 3DR5A 5HF6A 2IYYA 1HA3A 4KKVA 2QRQA 1N2CA 2XTJA 3NQ41 1Q57A 2Y0PA 4RTKA 4IPTA 2Q1UA 4QTTB 4L57A 1QE0A 4L5JA 4O2BA 4XSVA 3GGJA 3HY4A 1AUOA 1A8QA 2DHEA 2Y71A 1WMFA 3S2SA 3R76A 4DDKA 3O8CA 1SFRA 1ZSVA 4PZPA 4QZVA 1XD9A 1Y8AA 2GAFA 2DCUA 2V9CA 3MSCA 4XD7D 1FCJA 4F8EA 2XIQA 3PFHA 1MZPA 4WXHA 5B4TA 3SAJA 2YFYA 4RBNA 3VA7A 2GN2A 2CCJA 1KY5A 5BN5A 1S2MA 2CNWA 1D4FA 1MO5A 4B9AA 1Z56C 2ZR8A 4F4JA 4ZCLA 4BVEA 5LP6F 1KDOA 1GFIA 3O75A 4Q18A 5HEKA 3PNQA 1BSVA 1ZJ4A 2YVUA 3PXDA 3WXBA 4PYOA 4EJSB 4H31A 1ONSA 2FOXA 2NQ8A 3CT4A 4RANA 2Y1GA 4NFLA 4JR0A 2AIRA 3RWOA 1W30A 2YY5A 2QV0A 3W04A 1UZAA 3E1KA 2IYWA 4BZXA 1N2BA 3EVBA 2I2CA 4HGZA 1CFZA 4DWVA 4AKGA 1QIJA 4CKEB 1YQUA 1C9DB 3FTDA 3OJLA 4EKEA 3HHEA 3N2GA 4NBVA 1CEQA 1H94A 1EVZA 4JEIA 2H1OA 1XNQB 3WB9A 4HS4A 4CV3A 3H2JA 3QHAA 2JJ8A 2WZQA 2Z2XA 3MTDA 2DUUA 2PUVA 1G1MA 1O4VA 2FSPA 3KX2A 4FYWA 4MQEB 1WMSA 4TVOA 4ARVA 3CC8A 1DDOA 2GFIA 4CIVA 3EHDA 4X6LA 3T7JA 3AH8A 1BS9A 3N6VA 2QTGA 3H2ZA 1RYHA 1FB5A 2OHVA 3FOCA 3R20A 3MWKA 4MDEA 2B69A 3FZNA 4DLPA 3OFKA 4R7ZA 1GU1A 2L0XA 1QYVA 3O2JA 1C81A 1DC5A 4M0KA 4R69A 2WG2A 4TRNA 2IH2A 4HG2A 1H2WA 4U6QA 3IHKA 4OHUA 3RVKA 4X85A 5BVHA 1VZ2A 1X1DA 3TR6A 1KR5A 3TXYA 4PZEA 2FRVA 2Y6VA 3UAVA 4YROA 3OCCA 1CWUA 4Q7KA 4F93B 1QR2A 3GQBB 3V4OA 4C07A 2ERYA 1XN1A 2VJAA 3I1JA 3ROZA 5E0OA 1TCCA 3WGHA 5K0BA 3PJEA 4LYDA 1MHPA 3WMWA 1V25A 1E1DA 2PFSA 2Z08A 4QXMA 2YL2A 4D6PA 3HJTA 4JSTA 4AJHA 1HNNA 3ZCRA 1L7NA 3IAM1 3PEEA 4K7JA 3SSMA 4X66B 3ED1A 4L4SA 1KC1A 1KYXA 2XMGA 4PZAA 4XVQA 3BMOA 4DJDC 2EV9A 3FHJA 3WWYA 1TTHA 5AHWA 5GQSA 2O8CB 2AOWA 2C31A 2VP4A 5JNWA 4KPEC 1EFUA 1L5QA 2AX4A 4FDMA 5HW0A 4XVCA 1QCYA 4LF5B 4YI3A 4YT4A 1LPPA 1X94A 2PNJA 4FP9A 1XDSA 4O4IF 4Q6WA 4EUHA 1RPAA 2ZKIA 5ITVA 2HT1A 2NAFA 2AC7A 3IUSA 3JWHA 5JADA 4B2LA 2GHTA 3SIWA 4A36A 2FI1A 3I05A 2NTVA 3LFUA 2OV1A 2XQIA 3TNLA 5I7OA 4TXJA 3DBLA 3EUAA 4PG5A 2ID8A 4YAWA 1PS0A 2GETA 3DOFA 4TKUB 1T0JB 1KAQA 1AK1A 1XQWA 3AFGA 1I6MA 3GUZA 3KR9A 3R4VA 3JVEA 3ENKA 3GJXC 3NYRA 4I55A 1TUGA 4MVJE 2BZ1A 1C3OB 1AD2A 1N1DA 1ZM4A 2G9VA 2V7GA 2YH2A 3LYUA 1J42A 5J5VA 2DLNA 3ZVLA 1BFDA 4DLUA 3TK1A 2QAIA 4QHSA 3TPFA 3NXSA 2CZGA 4W7SA 3ZIDA 2K7ZA 4AP6A 1X7XB 4BMPB 3VR6A 4FWTA 1JPUA 1PX0A 4UARA 4ZHQA 3D2AA 4DPKA 1R4NB 3GFQA 1SHTX 1VL6A 1A8IA 1T0PA 4OIFA 3AVOA 2G04A 5I5GA 2V5UA 3DLTA 2O8DA 1WXHA 1USWA 2XUFA 3ZWXA 1ZUHA 5AKYA 2BHLA 3TX2A 5DWQA 1WDKA 1QZZA 3QWIA 2ZXFA 3L01A 3KZVA 4DRXA 2JS7A 2GZ2A 3B48A 3U31A 2GN1A 2YTZA 3LXMA 4M0PA 5INTA 4K87A 4P34A 4CM8B 1N5RA 4CKWA 2J5QA 1S1CA 1HX7A 2E5WA 4CTNA 1EX6A 2I3GA 4MV4A 3O95A 3TLJA 2ZJYA 2ABWA 3RUDA 5EXPA 2XRMA 2EZ8A 1II8A 2P8JA 3NGXA 3QVXA 5B57C 3O1HB 4JJ4A 4KXVA 3HUFA 4WKOA 3RVMA 4DLTA 3SXPA 4DLNA 1WMDA 2X8AA 3O4RA 3PK0A 4UOZA 4JI7B 1I3OA 2RAVA 3MK31 1MGOA 4LDZA 4Y2GA 4YJ2B 1UPBA 1CY6A 1IM5A 2FKNA 2D8AA 1CJBA 5TQVA 2WHEA 4Q1DA 3JR7A 4PFKA 3K53A 3RHZA 4PZUA 3KHUA 3QUCA 4P3NA 1SUCA 2AWNA 3MCTA 4V24A 1ZH4A 4BLSA 1BHQ1 5IG2A 4Z53A 1ZCFA 3M9XA 1PZMA 2GEFA 2FJ0A 5IBRA 1TVKA 1D6NA 1RZVA 5BUZA 2I6GA 4PLYA 5WRFA 5HOQA 4Z4IA 3L4SO 4IL5A 2I7CA 3EF3A 1ORHA 3MRSA 1R3DA 4K8OA 3THWA 3DG9A 4IXNA 4I3FA 5ERYA 4H3HB 2OHJA 2AN5A 1PGNA 1NKTA 4DCMA 3Q7IA 3BJEA 3S81A 2G6BA 2I65A 1FJGB 1N78A 1IHUA 2XE6A 3IBSA 1Y7HA 2FPGB 4KIGA 4L4UA 3WNZA 4UHJA 2P4QA 3AR8A 3HNOA 4FOTA 4LJ4A 2RG1A 4MVJP 4YCDA 3DLBA 4PR0A 5A6SA 1E2JA 2ADFA 3ZQ4A 1NL3A 1E5XA 4U8GA 4KE7A 2QRJA 4FC6A 1PWHA 5K4AA 3A9UA 4GOKA 4LJ8A 4GI3A 1JQKA 3WAJA 1YFJA 2NPOA 3VHXB 3RUPA 3UFBA 3H86A 3MTAA 3N5KA 4FYKA 4JXXA 1ESZA 3QENA 4JI8B 3TCKA 5CVCA 5L3SB 3IDOA 1JVBA 1K97A 2NU9B 4OLHA 4RL4A 4OHKA 3BE5A 2YWDA 1ZSYA 3BFPA 3M6IA 3OZTA 3SKYA 4BEBA 5AKZA 4IDFA 2X1LA 1C7IA 3HBAA 2QVGA 4I4NA 3ZE6A 3N3AC 2Y76A 3CG0A 3IQDB 4IXWA 4CLRB 4NE2A 1QGAA 1T4CA 1HFJA 1EFPB 3PR2B 4KP7A 1G8HA 4J0HA 4II2A 1QYIA 4GL4A 4XVHA 2Q6VA 4TTIA 2Q2OA 2BLNA 2YOFA 2HLDD 3AOEA 3RS7A 1I5RA 1D9ZA 5BN3A 2YWHA 2JAUA 3G0CA 3ONWA 3R1IA 3VH3A 2ZYIA 5BUSA 4WRRA 1CNFA 1Q16A 4CLXA 3CLUC 2HOQA 4ES6A 5F7JA 1OBCA 4PHFA 4TQ9A 5FEMA 5J9FA 1UCFA 2QTBA 3FCSB 2WJ4A 2C9ZA 1D8AA 2XCRB 4MCHA 1U2EA 5KX5A 5AJHA 1WVGA 5F1OA 4DXAA 3F9IA 2R4QA 3AF0A 4XWWA 2VHWA 1JPVA 1AN9A 2XCSB 4ERXA 3VR4H 2LCIA 3AR5A 3M1LA 3SVLA 2YXLA 1KDYA 3I8XA 3KOOA 1D2AA 1Z6TA 3CVYA 1I4DD 3RLFA 2RKOA 1L3CA 4TXLA 2QROA 4I8DA 1RAGA 1GQYA 2YMLA 4UW9A 2YMMA 3TTVA 1H8EA 3DZCA 3MMPA 5CXQA 3ZDAA 4FX2A 4OJMX 4REOA 5SV2A 4LZWA 2WM3A 1SNYA 3GOQA 1O97C 4OMCA 3TRHA 1A69A 4PWYA 5J3JA 3KZKA 2ZKLA 3DLPX 4RCZA 4B35A 2XA9A 5HBGA 3JCZA 5JFOA 3HYCA 2GARA 2GWHA 3R3ZA 1ESEA 4EFMA 3ZHYA 3F6PA 4XM1A 2O5EA 1XI2A 1CUXA 4GOOD 5PGMA 5TARA 3JX9A 4BFUA 3Q8MA 2G4VA 1DAHA 5JXHA 4DV6B 2RBKA 4F5DA 3WJ2A 1GHTA 4GZ5A 3KV1A 3TIFA 5AI9A 2X5OA 1ESMA 1XGKA 2ZJFA 2F43A 5DI9A 5IZ4A 3ADCA 2Z8YM 3CXRA 3F5FA 4BO4A 3C8MA 4CEHB 3I23A 1A96A 2VWGA 3OJXA 4P31A 1YIAA 3DZDA 3TI7A 4EUNA 3RSGA 4XTCS 1PNQA 4GPIB 2IJGX 2IW3A 1QC5B 3A4TA 3TDKA 3LP8A 3G5UA 1YACA 3WGJA 4Z3OA 2GBLC 2X7HA 1BDBA 3F5DA 3PC4A 4I4TB 2UVPA 1JJVA 1VJCA 3K0KA 2VDKB 1FUUA 1E1YA 1R8XA 3R9KA 1DLIA 1FRNA 1GLNA 1NZFA 5H16A 3WHKA 4EY3A 4PZCA 5JS2A 1WVIA 4YRQA 3EXHC 5K6AA 2PZEA 4TS9A 1G5RA 2IZ5A 5DI3A 1GXSA 1IUKA 3ZCPA 1KZGB 3FPEA 1K3FA 1ZD4A 3GFGA 3OCVA 3PBKA 5LB2A 3SNKA 4ARZB 1N0UA 5CNIA 1KDTA 3FWZA 4F5ZA 2I1WA 1CUFA 1KTIA 2I22A 2IOHA 1C9NA 3BJZA 2MINA 2WM2A 3CZ9A 4UFOA 1D8TA 3WZMA 2WU0A 2WVHA 3H42B 3LQKA 3NR2A 4D9IA 4UUBA 2P9TA 2WTEA 2XLBA 3M33A 1ZAYA 2QR3A 2XXAA 5K09A 2ROQA 2F1RA 5AKKA 4ZEXA 1RQXA 2V6GA 1YB2A 4M21A 1YZKA 5GONF 4E12A 4KUHA 2V3CC 4AECA 2FK8A 3JAWA 4QXAA 3G0BA 1ST3A 4NENB 2GZ1A 1J49A 3GGCA 4M1MA 5P8WA 2OYCA 4JY7A 1A5ZA 3BMNB 4A5SA 2J45A 3CPJB 3NV9A 3QE3A 1PUJA 2IF2A 5KYWB 3CWQA 3PC8C 3OFVA 1GSHA 2GVZC 5FHRA 5EMLA 4BEVA 1FRZA 1YB5A 3AGQA 2XUAA 4UAUA 2BGRA 4MW7A 4PICA 5EXXA 5IAEA 3GYBA 3QWBA 3JS5A 2RK6A 2XMZA 4NS1A 1J39A 1JA0A 1V5GA 1XRJA 3GJ0A 4MIOA 4MVYA 2C3PA 1DCTA 4K28A 1GIAA 4NFSA 1VIVA 1M0TA 4G56A 1HQYE 1GSIA 2BI7A 3PXAA 2PJRA 2AEEA 2R48A 1ZITA 3FCEA 6REQA 4JZYA 1MF7A 2GJSA 2R7MA 1ZOPA 3MIIA 1Z2DA 2V0NA 2VF7A 3A9TA 1ECLA 3O2QB 2PRKA 5LQCA 3LG2A 1JQAA 3DM9B 4IQGA 4OXXA 2VHTA 4AMZA 3ZE0B 2OAP1 1VKZA 2OV8A 4JJKA 4MMZB 4ZAXA 2ZSDA 5L8VA 5EIXA 2GTHA 5A2GA 1GQOA 3TR0A 3DH0A 3FBWA 4O33A 4TZ6A 2A7QA 2C92A 2Y1LA 3DOJA 1ZNYA 1E2QA 3D02A 2E6KA 5REQB 5DH9A 5CFZA 3HFJA 4A2PA 3BIWA 4AKTA 1BZYA 1H6CA 2CVPA 3K9FC 2QIPA 4IHJF 3UMFA 4BIMA 4U02A 4TWBA 3GROA 1H69A 2F3SA 4QPNA 5JDCA 4ZVOA 3DUFA 3STUA 2CXRA 1ZGBA 3DVLA 3TW0A 3HJFA 5JXWA 1VLLA 3MJTA 2BFDA 2F67A 2V6FA 1KFBB 1WUTA 4Q6BA 4JP8A 5EHXA 5JAQA 4HAWA 3LX8A 2HWYA 1VP3A 3E9EA 3ZDRA 1KHTA 2WDZA 5EWMB 1E7QA 3OU2A 1IOWA 3V3KA 1DXOA 1G19A 3EWIA 1L4GA 1QTRA 4UZEA 2GXUA 1EFKA 2HY7A 2XOXA 4QGGA 1SKAA 1Z5VA 3HXTA 1RNLA 3NAGA 3I04A 2HJHA 2ZIZA 1NG1A 3O84A 3C1UA 4GYKA 4YAIA 4ZQHA 1DJQA 3C6KA 4GFDA 3ZIUA 5THXA 3C7KA 4RTRA 2YHUA 3QLVA 2VBFA 4GNRA 3ZBQA 2QD5A 3CKYA 1OXBB 3V1LA 3WTBA 3STHA 3VYRB 1SVUA 3RVSA 5E3HA 4ANFA 4LXTA 4M4SA 4BLTA 2IEYA 2IRWA 1E5QA 3AF2A 1XE3A 5L45A 3BCUA 1EYZA 1ML3A 1GCIA 1M34E 1XF1A 1BVYF 1CF2O 1ZGCA 3P2IA 4YAEA 3WP1B 4EVSA 4ZYUA 4LA4A 3W7VA 2OWEA 1SXJA 5KMGB 2H52A 1Z2EA 3NTUA 2PGJA 1VPWA 2QW0X 1ZK1A 1TXGA 1YVUA 1CE8A 3VI4B 3FJOA 5CYPA 5J4KA 4WADA 4HJRA 2I4IA 4XR9A 4MUMA 4O3MA 4KR6A 1XZLA 3AEKA 2Q5IA 3IVGA 1ZUNB 2BTOA 3KQKA 1CS0B 1RJ9B 3DD5A 1QH1B 4LGVA 4O1MA 5KNLA 2FFRA 3RTBA 4QICA 4TTVA 2ZFUA 4QYIB 4RORA 5DFAA 2O57A 5ALDA 5A06A 5IAAA 4J07A 4PNHA 5HK8A 2BFFA 1FXUA 1P77A 2Q2VA 4OHMA 5FBLB 3R9XA 4C7BA 1LSJA 4GZ3A 4FDLA 2KQUA 2LW7A 5DN9A 4BFCA 4R9VA 3H3FA 1AF4A 1J7JA 1I7PA 1IEXA 2YN2A 1IZ8A 1GRRA 3TUIC 2YKGA 1CF4A 4JUFA 1L0BA 1TYEB 2ALJA 2VDOB 3U4AA 3YASA 4AJNA 4BO9A 2R85A 1R0ZA 2RJOA 1HDIA 2GQ0A 2V1XA 3C1TA 3EBPA 3IUMA 3NBUA 4JITA 4F6CA 4MW5A 1VHQA 1ZUIA 1DTSA 3U3DA 4JVNA 1P3JA 2P9ZA 1NJ8A 4E70A 4Z5XA 1N5LA 1G7TA 2HRRA 2RHHA 4JBLA 4EITA 1DQSA 1MORA 3F7TA 1TVMA 3ANSA 3F8WA 4JQSA 4KQ1A 4NSNA 3S5UA 1QP8A 5IS2A 3MGCA 4X1KB 5IMBA 3DV2A 2REOA 4R8RA 1E9BA 2Y0BA 3IAS6 5A4DA 3WK4A 4AG3A 3A6PC 1L3BA 3PNKA 3D4PA 4LVOA 4QO8A 1NYLA 2XYPA 3KHTA 4FHCA 1KZ4A 1L9KA 1LSUA 2Z5GA 4HGQA 4URHA 1M74A 4IS3A 3AJEA 3IL2A 5E0KB 4JELA 1BX0A 2PIAA 2VA9A 1XQ1A 1T8UA 3MJVA 4DNPA 4JBYA 3MUNA 1DBSA 1HDZA 3GZNB 4BQEA 1T2NA 4J0IA 4PHCA 2E89A 3IV9A 2I71A 2SBTA 1KOLA 2XUGA 2HF8A 3OCWA 4TZKA 4CI0B 4RNDB 5IVIA 1U1EA 1T9CA 3OMLA 3L4KA 3C48A 2BVNA 5ADWA 3NWJA 3O94A 4NATA 4EG6A 4F6RB 4TYQA 3REQB 2QZ4A 5AVSA 2E48A 4YVFA 4YN3A 2ATXA 2VAWA 1AMNA 3I5XA 4G4SO 4D42A 1DBWA 3Q2IA 4G4JA 5KAMA 1X1TA 4LZNA 3U0BA 3UGKA 1EGHA 1IVSA 4TUYB 3ESYA 4S2UA 1KP3A 1RT9A 4CFSA 4E51A 2NAPA 1C30A 3IELA 1QZXA 3LRPA 3MUEA 2M6KA 2IY9A 2QYHA 2ZI9A 1FUKA 3H18A 1KSFX 2IHVA 4Q4LA 1YJAA 3DJFA 3WL5A 1SUEA 4P86A 3G2OA 1X1RA 1KARA 5MFZA 1JR3A 2X8JB 1UAGA 3NHKA 4JC5A 5DMXA 4P4SA 2BFEA 4X63A 4O4HB 4BVAA 2FFBA 4ER0A 1WP9A 5ALFA 2AJCA 5IEBA 4URZR 4DLWA 5BN4A 3U26A 4KTTE 1KOGA 2OD9A 3TZ6A 4RVOA 4AX4A 1T8TA 1FYFA 2HA4A 3UJHA 2J9RA 3DNMA 4DQVA 5F78A 3DOUA 3OX4A 4MICA 2B83A 4D44A 1XTTA 1E79D 2ATIA 4MJXA 4D97A 4DCVA 1ZCAA 3C3CA 2X13A 1J0CA 4BWYA 4C05A 3JYOA 1NBME 1LK0A 1OR8A 3RWMB 3WIBA 1SVNA 2IYXA 2V4MA 3FYCA 3O1JC 1PQYA 3UAYA 2HCTA 4EOGA 4EY4A 4LC9A 5JMWA 4OREX 3C24A 7YASA 1SRRA 3ZE2B 1DWUA 4JJEA 1T35A 4AY4A 4O0MA 3GZTB 1DARA 2W11A 4AG6A 3F71A 4LXQA 1JR2A 3ST7A 3H4VA 1P29A 1BWRA 1GNTA 4CL3A 1Z9BA 4QT0A 1D03A 3A0UA 1RHRA 1JLLA 3A4IA 3W06A 4Z7NB 3AMVA 3L7MA 5AKXA 3TWOA 4X62B 4JBHA 3GCDA 4PEVA 2EFYA 4KJZA 4OLBA 2O4UX 4R2IA 2GO1A 4MB0A 1T2CA 2QP4A 3LDAA 3JZAA 1X77A 4KN8A 2DFPA 4N5DA 1A98A 3NNSA 2BCGY 2AGVA 3R6LA 4KDEA 5K3BA 4B87A 2GCEA 5FOWA 3HB7A 2P62A 1WPRA 1VE6A 3I0NA 3PFGA 3WOHA 4F12A 4Z2AA 1AC5A 3ORRA 4PNPA 2D2XA 3P7MA 3SZ3A 1Z6AA 4RPKA 1QG2A 3HI6A 1XL1A 3P4UA 4FYIA 3BE4A 3OQIB 1HQDA 3L5KA 1MEJA 3LXXA 3NBFA 1QF6A 3N2LA 1GTZA 2F3PA 2YV2A 4Q9KA 1LC3A 1KMHB 1SXQA 2BOVA 4B7UA 3WI7A 3G8CA 1ECJA 3BA6A 4JB8A 3WJ1A 4P33A 1N3BA 4ZALA 3SYMA 4YCCA 3HKDA 3OO1A 3MWDB 2CL5A 3IERA 3TZQA 3CNHA 4AF6A 4BEJA 1E8NA 4EZIA 2LKCA 1UJ6A 1B6TA 1XJCA 2QZJA 3FCYA 4LDQA 4MYSA 4P3KA 1G21A 4TQGA 2B7LA 2GF0A 3AP2A 5KJFA 3BMCB 1Y1LA 5CDUA 4WBXC 3FFBA 3VBCA 1P5JA 4J0QA 1AQ6A 2DUNA 1OILA 2D5BA 1KRWA 3V42A 1Y34E 1B0UA 1K4MA 2R25B 2FPUA 3EASA 3GLUA 3C87A 2LCFA 3U3KA 1A8UA 1ULSA 2R3SA 3TNFA 1P1BA 3OKPA 2C1XA 2HTEA 2PGAA 4HDNA 1TOAA 5CHYA 2WI8A 4YGXB 2OUIA 4R81A 1XD2B 4EI8A 1PZXA 5J4VA 1EIZA 1Y3HA 4NK4A 1UP6A 3RUAA 4YYEA 4RH1A 5CU7A 2EL9A 4JBXA 3UQZA 5DISB 1ABFA 2PZMA 2ZR7A 1ODSA 3RRXA 4DG9A 1M7HA 1QFMA 2V3WA 3TGWA 1WRBA 2B3DA 2I9PA 3I6MA 3N2KB 3GLIB 3CR8A 1OAOA 4PPYA 3O3OB 4UE3S 1FTNA 1WABA 3KEGA 4WA7A 2BFCB 2FXIA 2GDJA 1QHSA 3FUXA 4EA6A 2I9KA 4QUKA 2IV7A 2VDJA 3BXGA 1DKQA 3BH7A 3E27A 3F74A 2IUSA 3PGXA 3MGGA 4JJAA 1ES9A 4DA8A 1PS8A 1XDZA 3STXA 2IZ6A 3PFNA 1U6KA 1J20A 3O91A 4H4CA 5CMLA 3GPDG 1P2UA 3K9BA 5DWVA 4DCPA 5JVDA 3PRJA 2VAXA 5D87A 2GM3A 1R6DA 1VJTA 2L2QA 2P6UA 5DMHA 4RTSA 3PLAE 1TK3A 4V0KA 4X20A 4G89A 3K1YA 4YMSA 5FUXA 3GLHB 1CUSA 4MUYA 4P38A 2BGLA 1UFVA 3L7JA 4JBIA 1REQB 2XDQA 4MRNA 4R16A 1U98A 4V0ME 5DLQC 4YUYA 3ER9A 1IQPA 1UIMA 1ZR2A 1DCFA 4OU5A 2LCQA 1XHLA 2G5PA 3WJ7A 2C7OA 5AI6A 1E1CB 2QL5A 3GAZA 2R6FA 4S1TA 3U7GA 2GBIA 3KU1A 2JGMA 1XEWX 1ULHA 2B5OA 4A8JC 3RO7A 1J56A 2YY6A 2D4AA 3Q9UA 3R5KA 1M2NA 3MA0A 5KQLA 1CK4A 1VOTA 2CK3A 3KYCB 1OFVA 4KDCA 4N5IX 2RKBA 4YO8A 4HNTA 3EGDA 1IY2A 1P80A 1BA3A 2F1JA 3HCBA 4TLDA 1E4EB 5LXTF 3K5HA 5TRTA 4LY0A 4DMCA 3RYCA 4KI7A 4W1SA 3DLCA 2ZAMA 2WSBA 2WYVA 2PTGA 3CUEF 1AT1A 3DKKA 1YA4A 1AB5A 5E6SB 5TJ9A 1RWNA 3SGLA 2ZAIA 5J59A 3P5SA 4J03A 3RUIA 5LP6A 1ZI8A 3U4QA 3DMDA 4K9SA 2HK8A 5JO0A 5LZ4A 2GXSA 4D26A 1LCIA 3R3WA 1Z07A 1WDWB 2GSDA 5D51S 2Y0DA 3A4NA 4OBWA 4IHAA 4K2AA 3TLAA 4NCAA 5KTNA 1LPAB 1BOFA 3I8OA 1ZWKA 3QPCA 1YV9A 2FPKA 2KX7A 1YHNA 3IT0A 4B4WA 2CXOA 2WMYA 3MCAA 4RLQA 3L1VA 4RO0A 3CH7A 3I37X 1WHTB 3BGOS 3PD7A 5G0VA 1PQWA 2A0WA 3DGFC 3H1EA 2RONA 3F67A 4JGIA 4UC0A 3SIPA 4IUYA 3PIIA 1ST2A 2RD2A 1JEQB 5TEVA 1AKNA 2GRJA 2E2WA 2H9AA 1X2BA 3I8SA 3OEED 1OSNA 1N0IA 1XVVA 1KEVA 1NI5A 1VLHA 3BS4A 3HABA 4CDRA 4MRMA 4FNMA 3HKBA 721PA 5AW1A 2VVTA 3PGKA 3VOAA 1G5QA 3FDFA 3C74A 2ZWVA 3PNVA 1P0CA 2CFIA 1MJFA 2TRSB 4PNZA 3E22A 4AS3A 1FIUA 4OI0A 2R7AA 3A1CA 4B81A 821PA 1P0QA 2KHZA 5IX8A 3BRSA 4OGWA 4P53A 1P75A 2B7BA 1OY1A 2AN3A 3LHFA 1A9XB 3AVXA 3HCOA 4KXMA 1Z0ZA 2MR6A 1Y89A 4JB2A 4EPVA 4LF6B 3X1DA 5LQAA 3IJ5A 2UYOA 4Q4HA 4UTVA 4LV6A 3VNRA 5H8WA 2UUAB 3NHYA 3GLRA 3GCXA 5JRJA 5L40A 3P8ZA 5FBWB 3FBGA 4HNUA 2YZ2A 4YV7A 2FP3A 3EQ6A 3O93A 1R16A 2IZOA 4JDUA 4J7XA 4QLOA 4RV4A 1WL8A 3FLBA 3GCZA 3FGZA 4XM0A 1Q7CA 3L92A 2WD7A 4OHOA 4ZZ1A 2GVNA 4OL9A 4UM5A 1G2IA 3K92A 3HDYA 3P0JA 4JI6B 3H5IA 3PX3A 3ZWPA 2QPAA 1Z35A 5TC4A 1KY3A 4FR0A 4XQGA 4I1PA 1XQ6A 2KE5A 2VWPA 4JUBA 1F2TA 4HF7A 1SPBS 3QMMA 3D1JA 4MUGA 1QHIA 3OF2A 1Z0SA 3FM9A 1KS9A 3OOSA 4CQLB 4CKYA 4DEXA 4ZDJA 2OENG 3HO1A 5FNVB 1EP3B 4BNUA 2ECFA 1JA1A 1KAHA 4JJIA 4M76B 3WX0A 3ZWDA 2WNIA 4TZ0A 2WW8A 1U7HA 4A1FA 3VNAA 3ZNQA 3C6YA 3Q7TA 1S7CA 2Y1KA 4FIDA 1DINA 1OA1A 1GR1A 1RXIA 4KACA 5CT4A 4GI5A 4ZCMA 5JW6A 2NXNA 3IR7A 3EB9A 1NRWA 4BGVA 2Y1DA 3FMFA 3TIXB 4HXEB 5JQWA 4JD5A 3TLYA 2OTCA 4TTSA 3GPLA 3A37A 1NTOA 2PK3A 2AOUA 3QELB 3WMEA 3LIPA 4GICA 3UOAB 5J2TA 3V4LA 1TO1E 1EE1A 3OPMA 4DIFA 1R4MA 3QXXA 1QRTA 2RH8A 4QU8A 5T5QA 1JHVA 1V5IA 1KSGA 2WVGA 4B83A 1IDN1 1SG6A 1PGQA 2XXJA 4RESA 4ZPXA 5DHFA 1Q6ZA 1U80A 2Q9BA 2QW8A 4Q5IA 5BV7A 4KXFB 4QO7A 4PFSA 3GEEA 4AKSA 5ICCA 4UNSA 4DE5A 5E7JA 1DZIA 2F1IA 2IC5A 1TRHA 1QPBA 2CWWA 4QYXA 3T9AA 1ADGA 3DAGA 1SEVA 3PTLA 4Z9XA 4X1YB 1JIKA 1C9YA 4JX8A 4C08A 1BH6A 1D2EA 4KVFA 2WSMA 4EAQA 2ZITA 3T5TA 2HXSA 3PGLA 1PTJC 3FETA 4XGQA 4LXUA 3SZOA 3SZMA 1P73A 4YT5A 4OATA 2CEKA 1CUUA 4OXRA 1AQYA 1WUIS 4HH3C 4UVEA 4PV7A 4BXOA 5ALXA 4Q16A 1GT6A 3IRVA 2P0YA 3B6KA 3D8RA 3RVBA 4KFTA 1Y80A 2A9OA 2LPMA 4LECA 1XZ8A 3RSCA 3TFWA 2VUSA 4PYIA 4YP1A 4MGEA 2Q6LA 5KAPA 3DEKA 4IWYA 3VRHA 3IIMA 4FX5A 1HE1C 1LLQA 1L5GB 4MZXA 4PXYA 4QG7A 4OQYA 2AUMA 4KODA 5HG0A 1OBFO 3INYA 3LBHA 1B6RA 2CKDA 3BJRA 1XZDA 3UXEA 2PBRA 2NZVG 2XQJA 3B9PA 3IUNA 3IH5A 2H63A 4FKMA 4HFJA 1TEXA 3ENZA 3O9MA 3E9QA 1G59A 3W05A 4YR7A 1EVIA 8MHTA 3OCYA 3RRZA 3HUTA 3HJGA 2D0OB 2W6MA 3IBFA 3GRFA 1UXKA 1T3HA 2YCBA 5C46F 3PFKA 4RHEA 3TBFA 1FDOA 3T1OA 4LSMA 4BDTA 2C97A 4CHGA 2JVIA 2QT1A 2WUFA 1L4YA 1N8SA 3PRYA 2IUTA 3EH1A 4BAUA 4YT8A 4F5EA 4Y2PA 3FYSA 3ZNNA 1YWGO 2ZQ5A 4EJ2A 4BX8A 4QU9A 2FMXA 4EFLA 1TUBA 2C5SA 1M6WA 2KBEA 1WS6A 3KQPA 3RV3A 3IQZA 1FTSA 3AM3A 4MDYA 4J0CA 1E5VA 1F0NA 1FNSA 3OM0A 4KKXB 4JLNA 1JTVA 1M6EX 4O08A 5HF9A 2A35A 3K31A 4ZI7B 5AHXA 4MVXA 1V43A 1CUEA 2PANA 4NBWA 4IIYA 4Q93A 5JCOC 2IYVA 4LIPD 2HDOA 1PI3A 3H87A 1YIDA 3M70A 4CMAA 4EMSA 1G20B 3M3HA 4NL4H 1CYEA 2Y1CA 4FI3C 5MN4A 4Q9JA 5HKLA 1QDUA 2GMWA 3F98A 4L4ZA 1T2DA 2DHRA 3VO9A 4MVCA 4C3UA 5CVTA 4KNWA 2C5BA 3U48A 2VSXA 5K3EA 1Y8CA 4ZVNA 3HE3A 1AA9A 2ZTUA 1NDHA 3QFFA 4L5IA 3LPCA 3RS3A 3BHMA 1WSAA 4NDZA 3ET5A 3ONDA 2P3OA 1YZGA 3R0XA 4U7WA 4NJMA 1V1MA 3H2HA 1OBVA 2D5CA 1PJTA 3UJCA 2OBFA 3K2BA 1QNFA 2A57A 3K0AB 2DFKB 1JG6A 4J8PA 5J2TB 3GC6A 3LVRE 5FOSA 2ZUWA 2PKQO 4L8YA 1KI2A 3ZTWA 1QU3A 4LJAA 3D6NB 3RROA 3NTQA 5DNWA 4MUEA 3V4ZA 1W5FA 5H4HA 2ZB8A 1L5SA 1OYYA 2PLAA 3OLQA 4BJ1A 5E2BA 4CBVA 2ZE5A 3KB6A 1BG6A 1UEIA 2GJ9A 4FFMA 1NVKA 5CT9A 5AVKA 1KMIY 3TSWA 1TQ6A 3E8SA 3ESCA 4RLFA 4LXGA 1KI1A 1XEAA 4M0LA 2JJMA 4H7JA 3EXHB 1M76A 1YASA 5B58C 5CD9A 1SXIA 2DT8A 2Q4EA 3R3HA 3ZE1B 1MVOA 4COOA 4DWWA 2DUWA 5TS3A 5I9LA 4Q9AA 1Z34A 4QUAA 4TLMB 1W36C 1A8SA 2I3AA 3HFSA 3QVTA 3C4JA 4OLAA 2QRKA 3D81A 3KVRA 3BILA 1PJ4A 1U2GC 4LMBA 4OYRA 1Y5MA 4JVMA 3VUEA 1ZNQO 5BQ3A 2XWBF 2YV5A 1QQTA 1H4TA 2UUBB 1UT8A 4DLLA 3VYWA 2IT1A 5G0WA 4DLKA 3O3MB 4MPRA 2VRCA 3CEPB 3QMVA 2Z2IA 1FXWF 1N5MA 1RI3A 1SHUX 4BRZA 3VGPA 4M9QA 1E7SA 1U0BB 4OIMA 3WLPA 5IKEA 3C3AA 2QE6A 1BA2A 1M6HA 1VRCA 4K5QA 5ADUS 4GPZA 2JIZD 4BQFA 3BJMA 1OJ7A 2G17A 4CTOA 3WNQA 2R1TB 4RXUA 2BDEA 2ZJ1A 2H11A 5K3FB 2BSQA 4IFTA 1TD1A 5FPKA 1R5NA 1CY0A 3ZZUA 2X0DA 1JEYB 3QX3A 1U5BB 2IIPA 2NNLD 2ZI7A 2PSHA 4CKCB 5KTTA 3BD6A 2R8RA 5FPSA 4DCNA 4ZK2A 1G9SA 1NIJA 1NTRA 1RZRA 3EZLA 2VHZA 3RBXA 2IPXA 3A32A 1J9ZA 3L1HA 2UZ0A 1JWLA 1HT3A 3P9KA 2O3TA 2NUAB 2OYRA 1XXHB 1PG0A 1E0DA 2WKWA 4W8HA 3TQHA 4BU0A 2QTCA 5ALTA 3PA8A 4RPGA 3WWOA 1DXHA 2VPPA 3F6EX 3TQSA 5CVUA 4BLQA 2WBLC 3SHQA 1X1SA 1XNGA 2ECQA 1IBCA 1VI2A 2UUPA 4PRKA 2ZWOA 1YS4A 4XZ3A 5CJJA 2FE4A 4W9NC 5FO0A 3JQAD 5EIHA 5AWFC 3CLVA 3KB2A 3Q7EA 2VSYA 1RS0A 4R5HA 2Q5HA 3SBOA 3TTYA 5B55A 5HGXA 1OT3A 4JEUA 3N6RA 1PGJA 4L8VA 4P3YA 2IDZA 5K2OA 1XJWA 1FX0B 3ICVA 3PZBA 2WFZA 3D6JA 1RKXA 2G72A 1F0PA 2I6SA 2JH8A 3P9ZA 2NV0A 4MHTA 4Z9YA 2DFNA 4QDJA 2HD4A 3UW3A 4NH4A 4OMDA 2FDRA 2J32A 4ML3A 5B3JC 4XCVA 3BWDD 3EJ6A 5F98A 5ITWA 3Q3HA 1L8OA 3C3MA 5A3RA 4RWEA 3ZWNA 4DA7A 2FMKA 2OV3A 2YWBA 3RF7A 2RHMA 3VYTB 2V9PA 5JZSA 4LRQA 4TVSA 1B43A 4OQEA 2XNSA 1RRGA 2AFHE 4JQYA 2OY0A 4LK2A 3KHKA 4NQRA 4PSKA 2H08A 4ZOLF 2OV4A 3EXFB 4B3MB 3G82C 1U9CA 2I0FA 1PT7A 4FSXA 3RQSA 2C04A 4QD3A 3CEJA 4RHYA 4B3CA 3K9GA 4EB6A 2A9JA 4IFEA 5HMMA 3VPDA 1U4SA 3LZCA 2PX3A 3SIRA 2PWPA 1T1RA 1JE1A 3NDBB 1A9ZA 2PU5A 3H0EA 3SN6A 4A16A 3I61A 2DWCA 2NIPA 4YJGA 1CJTC 4H16A 4FMDB 4OXIA 3C3WA 3RVPA 4DMHA 4EGFA 1JVSA