4BV3A

Crystal structure of sirt3 in complex with the inhibitor ex-527 and nad
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 91
structure length 270
sequence length 270
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bv3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bv3A01
5EJAA 1Q1AA 2C31A 1EFVA 2JI9A 2FWNA 4UTXA 4JSRA 2JLCA 4UU7A 1T9BA 2AG1A 2WVGA 4J16C 4MPPA 1YI1A 4UUBA 2Q5JA 4JT9A 3PDHA 4K9NA 4C7BA 4HDAA 4BV3A 2Q28A 2UZ1A 1Z8NA 4BN5A 2EZ8A 1Q6ZA 4GM4A 2VK4A 4RMJA 1PTJC 1QPBA 4BVHA 3CLTD 2UZ1B 3CLSD 1BFDA 4JT8A 3JR3A 1M2KA 2Q5LA 3F6EX 1M2JA 4X3OA 2NYRA 4JD5A 2H2FA 5MF6A 2H2IA 2JI7A 4IF6A 4JUFA 4UTNA 4D5EA 2HJHA 3U31A 4JUDX 4FZ3A 2IHVA 4BVGA 4BUZA 5MGNA 3D7KA 3GLUA 2DJIA 2A1TR 1OZGA 3GLSA 2PGOA 2EZUA 4QPZA 1M2GA 4G1CA 4BV2A 4KPUA 4L2IA 5MFZA 2OORC 5K6TA 5K3SA 4K9LA 1POWA 1PNQA 3U3DA 1PO7A 1J8FA 1T9CA 4X3PA 1YTLA 4K9QA 3IAEA 2H2GA 4FVTA 3D81A 3HWX1 1PYDA 4UUAA 5BWLA 4QQ8A 1YC5A 4JU9A 1N0HA 2IHTA 1XLTC 1U28C 3PKIA 2VBGA 5EJMA 5EJ7A 2PANA 3RIGA 5EJ4A 2OD7A 2QQGA 4UTZA 4JUCA 1YNOA 4FEGA 4V1CA 1UPBA 1V5EA 2A1UA 5EJ8A 3D4BA 1YC2A 1M2HA 4V1CB 1EFPA 1O96B 5DEIA 4IG9A 4D5GA 3CF4G 4RMGA 4Q9DA 2VBFA 2EZTA 2FRDC 1PVDA 1E3TA 1T9DA 1PT9A 4COKA 2FN3A 4GM1A 5AHKA 2PGNA 5EJ6A 3GLTA 1D4OA 1MCZA 4KXQA 1V5GA 4K9MA 1YI0A 3E9YA 1ICIA 2AG0A 2Q27A 4RMIA 4F4UA 3CLRD 3EYAA 3FZNA 1YHZA 2IHUA 2H4HA 3OE1A 4RJJA 5EJ9A 2JI6A 4JUBA 5D7NA 4GM0A 3RIYA 4Y6OA 4V1CI 2FSVC 4BVBA 3ZGOA 4IAOA 1JSCA 1T9AA 1SZDA 1NM5C 4JU8A 4UTRA 4RJKA 4QELA 3ZG6A 2H2DA 4K9PA 1O97D 1POXA 1UPAA 4BVFA 4GP9A 2EZ9A 1Q14A 1S5PA 4L3OA 2WVAA 4MPRA 3PKJA 4JUAA 2OD9A 4O8ZA 5K2OA 2OD2A 3IAFA 1OZFA 4GG1A 5MFPA 1S7GA 3ZGVA 1V5FA 4BVEA 2B4YA 4TWJA 1SZCA 1M2NA 1YHYA 4K9KA 4FEEA 2WVHA 1ZPDA 5FYQA 2W93A 1PNOA 4K9OA 4TWIA 3GLRA 4Y6QA 2H4JA 2VBIA 4UTVA 2Q5OA 4R8MA 5IMSA 1Q17A 3K35A 2V3WA 1YBHA 3EA4A 3LQ1A 1U2GC 1U31A 1HZZC 1U2DC 2VJYA 2VK8A 2EZ4A 2FR8C 1OVMA 4MPJA 4ZP1A 3EY9A 1PI3A 4GPEA 1Y9DA 2H4FA 4C78A 2Q5QA 5DGDA 4Y6LA 1DJLA 2H59A 4I5IA 4RMHA 1OZHA 2NXWA 4BN4A 1MA3A 2H2HA 4J1TC 4ZZIA 2VK1A 5BWNA 5FEMA 2BRUC 2JLAA 3JWPA 5DGTA 5K6RA 4KGDA 4UU8A 3FLMA 4MQ5A 4MZXA 4RJIA 2JI8A 2QQFA 3FSJX 2OO5C 2JIBA 2X7JA 3CLUD 4HD8A 4F56A 2Q29A 5EJ5A 3HWWA 1UPCA 5BWOA 3F6BX
chains in the Genus database with same CATH superfamily
1TYEB 2ZUSA 3OKAA 5HP4A 1ZMBA 4R7ZA 4LQCA 5EJAA 1RADA 5HWSA 2JLXA 4X0EA 3TF5A 4CTNA 1EVJA 1LBIA 1Q1AA 4KQ1A 4HNSA 5ER9A 2PX4A 4TQ9A 3W0LB 4BHTA 4C2AA 2W2OA 3RF7A 2HDNB 1ZXLA 1M34E 3A9SA 4CF5A 4I9HA 1JUDA 5AW1A 2MR5A 3F8SA 1O58A 1Z6XA 3CX7A 3H05A 4CMGA 4FHDA 5IMBA 2JLCA 3A6EA 1M5TA 3KE9A 2GHRA 3HCEA 2FUG1 4RHYA 1CCWA 2PL1A 1TVMA 5I7VA 1XALA 1U6JA 4I3GA 3BZUA 4LHVA 3CVYA 2QMHA 3SFTA 1Z4KA 5J58A 5LA6A 3KTDA 4WY8A 2J9ZB 1NRXA 5I7RA 2H54A 1JECA 3EVBA 3MD0A 4YACA 1CLUA 3LKVA 3R09A 1T9BA 3KEOA 2UV8A 4MS3B 1FTYA 4IDNA 1GYPA 4BOYA 1OXSC 4HH4A 3SHTA 2AG1A 2P9BA 3H11A 1EK5A 3NEAA 2X4DA 3EGXB 5ESRA 4PO3X 2L69A 3DBRA 4XXHA 2GZ2A 2DPGA 3DZGA 3KQMA 3U4QB 2YV4A 3ICPA 3B78A 3WKAA 1G8SA 4YP1A 2XXJA 2P3OA 2JGFA 2R6CA 4B7UA 2O05A 1DOAA 2RDMA 2LIVA 2QF7A 1HT0A 1N5RA 1R0WA 1TCUA 2FG7C 2HCTA 2GGSA 2IIBA 3BMNB 2JBHA 3T54A 3L43A 1VHWA 3W2FA 3EHEA 4IS2A 1V8BA 1IUOA 2YQ5A 3GFPA 3HU2A 2FSIA 1Z2CA 3LUHA 4KDCA 2E4AA 4LV6A 5LN1A 2BT4A 3ZZMA 4F72A 2HIAA 2XKBA 1O5TA 2DGDA 2ST1A 3QBVA 3HJCA 4ZOLB 4Z2YA 3M6LA 2QXUA 3BEOA 3VYUB 4DC9A 1EXMA 1P39A 2J3EA 4IRXA 4I50B 1GFWA 3IJEB 5C1DA 3I37X 2O50A 2FTKE 1Y6FA 4JR0A 2REQA 2P6UA 1HG0A 2VNIA 4MQLA 3UMBA 3L4SO 4GM4A 5KQMA 2YDXA 5CCBA 3GRCA 3WLTA 3GJRA 3FZEA 3MWDB 2W7TA 4BX2A 1RLUA 3QJYA 1JZSA 1DAIA 2GXQA 3OU6A 4FD3A 1SKUA 4R6WA 5SY9A 3N0XA 4OTZA 5DNUA 2C9OA 1SH7A 1NUSA 1CD5A 1SQ5A 2AJLI 4RY8A 4UXJA 4XOIA 3PFNA 4G3XA 5K0GA 2QE7A 5IN5A 1JHXA 1X7YB 2VBCA 3NBQA 2X8AA 3ZI7A 1A97A 2PLWA 1BCRB 2QAGB 1CR1A 4LYEA 3SBDA 2GZMA 4BO2A 1CY8A 1NLFA 1NX9A 4HRAA 3SJBA 4ATNA 4ZMRA 2XUZA 3H1AA 3DOUA 4HDMB 4FMCB 4BVGA 1JHYA 1N6KA 3BD8A 2YWRA 5A03A 2BGWA 3DMTC 3DV0B 1ADCA 5IC5A 1LX7A 3RSQA 3D7KA 1RXEA 2OL4A 3NHMA 4KQ2A 1ULZA 4DV0B 4Z3DA 4X8OA 3JY6A 2CDCA 3RTEA 4DVGA 5KZMB 3E9MA 3K32A 1DLJA 2PGAA 4M1KA 1CUYA 3K1YA 4O4JA 5KYXB 1E7QA 1LFAA 5GOZA 5C51B 2ZW9A 1G2QA 5LZ7A 1LZLA 2IU6A 3UEOA 2IPNA 5CDTA 3KSMA 1V8OA 3LW7A 4KPGA 3FRIA 2OLKA 4C4YA 4QPZA 5BT9A 4HBZA 4KLAA 1NI5A 4TTVA 2E1PA 1L7MA 1MDBA 4MWDA 1U9IC 4CTKA 1PGPA 1LWNA 3O1HB 4G1CA 1NXXA 1R6TA 3ZGXA 5AM0A 3ZY4A 3GPLA 3F7OA 1RMTA 1JFTA 1A7AA 3HXPA 5B6JA 4DA0A 1FXWF 4CHTA 1IEVA 2GFHA 3DDHA 3BMXA 1SXHA 3JVVA 2ID8A 1KO4A 5C5DA 2NUAA 1LQTA 4G2NA 4BMYA 4OQXA 1MW9X 1G1MA 3INTA 2G07A 3GH1A 5A3RA 2CV2A 3HR7A 3C85A 2AZDA 2D1FA 3GRFA 3STUA 1FNSA 3ZI0A 2ZUEA 5FUXA 1V9LA 3JQBC 4QUKA 3W3AA 4QFMA 1SN7A 3V34A 3GDGA 2VCHA 5FORA 1EWYA 3VV3A 1W85A 3CCCA 5IZ4A 3JVEA 4HYEA 1XHEA 2RK6A 2VJQA 4CCSA 4O2LA 1C9EA 3SXPA 1KRHA 4C3VA 1D09A 4R16A 3EIHA 1KBOA 1GN9A 2OXFA 1JMYA 4WD3A 4PPFA 4RZHA 4CT4B 1M1YB 4PZUA 1CUFA 2WJHA 1K86A 3K2IA 3NT4A 2E6KA 2V7VA 3H4IA 4RF2A 2QW0X 4WZBB 4N47A 4EUEA 1I7DA 1C3VA 1NURA 3D7NA 1RHJA 3N8DA 3CPJB 3CZCA 1NVVR 3KKOA 5H1YA 4CTOA 3U19A 4EVQA 4YHHB 5IVKA 2HYIC 3KB6A 5BQPA 5BYJA 2FPRA 1IZZA 2A5JA 3DCYA 1MB3A 2VHEA 2DCMA 2FOXA 4OLJA 1T1SA 5CVTA 3KPWA 4BQEA 4PNEA 1QQ7A 1EDOA 3HCDA 1CHNA 4C06A 4NZYA 3WS7A 3WADA 1V11B 1WULS 1YVDA 2XGOA 1G19A 2DP4E 4LXHA 3IIEA 5AHRA 2LVBA 3RV4A 2FI1A 2VJMB 2I65A 4PYOA 1N6LA 1PS9A 5CA0A 3PS9A 1TMOA 2AJCA 3E3OA 3OQIA 4YJFB 3VO9A 2RK3A 4KN8A 3D4BA 5LQAA 4UHKA 4AW9A 2F8LA 3CX8A 1CNFA 5KDDA 3L1UA 1TT5B 4NZNA 3VTFA 5A3JA 3I8XA 4U1RA 3TAXA 1WSDA 3AR4A 1B8NA 5FNVA 3IERA 4RNDB 2PT9A 1UC9A 1T2UA 1QVRA 4D5GA 2VEOA 4Q12A 1HT1E 1NN0A 3HRKA 1J9EA 1AKMA 3DQZA 1BDMA 3C6BA 1X3SA 2ZTHA 2XCUA 4H7DA 2JGJA 1LDBA 3ZXYA 1A8UA 4BFCA 1N7JA 4LJ4A 4LOHA 2NV6A 4EG5A 4KVZA 3IC5A 3I9MA 4F6RB 3RBXA 2FUEA 3ICQB 1G16A 2GI4A 3EZXA 1PHPA 3FCAA 5KYVA 3GIDA 4BKOA 4KP7A 4Q82A 1YVRA 1ZIYA 3L6BA 2JPDA 3MRXA 1XRMA 4E09A 1DAOA 5LLSA 1T3SA 4LE2A 3ESYA 3H2BA 3NASA 4EFKA 2HYDA 4QXQA 4NCBA 1X7DA 4OHUA 4JL6A 3R9XB 3NGXA 2CNWD 1S0UA 1MZPA 2QX6A 2NUPA 2VJPA 3B6IA 4Q3EA 2VK2A 3K71B 3BKXA 1M2FA 1V5GA 3GT4A 1WUKS 3NXKA 3KC2A 5TX7A 2ISSD 5MGNA 3D6MA 3VUEA 1CU1A 1RXSA 4OSPA 4HLDA 5K05A 3SGLA 1N0UA 3RTAA 4EGSA 3N8IA 3B53X 1M74A 2PK3A 2QW8A 2VAPA 3IPRA 3FBWA 4L5IA 3PL5A 3L7JA 1OGYA 4XYEA 3V4RA 1QLHA 3W1WA 4JI3B 2IW1A 3H5WA 3TO5A 2ZUFA 2AFHA 3B1ZA 1CEXA 4FR0A 2FYTA 2JEZA 1VL0A 2QRPA 4O2AA 4KHPB 4NBLA 2IYNA 1EGHA 2A9RA 4JMLA 4OREX 5BN4B 4MAAA 1EM8B 3BK7A 2Z5VA 1E2GA 1EXNA 2R2GA 4JC4A 4LOIA 3NP7A 2EHJA 4LIPD 2JI6A 4JUBA 3NHJA 1SQ6A 1S7CA 4GM0A 2RHHA 3JW8A 1FU4A 1EHYA 2ECKA 3WP1B 4RHFA 5TT0A 1CEYA 1MC1A 1EA5A 2QN9A 1CETA 4MW0A 3CONA 2R5FA 3L0BA 3RS9A 2R11A 3ND7A 2JGEA 2VYNA 2G1UA 1JT9A 4J7XA 4LVOA 4QG7A 4WGGA 4Y3UA 3LL4A 1T34A 5I9LA 2X77A 1I2MA 4H7HA 4K87A 5KWIA 5G4KB 1AGNA 1WF3A 4H6WA 3IX7A 2ZE6A 4OQEA 2WU8A 4PFKA 1JR3E 4ALIA 5J5CA 2PWAA 1C30B 1CY4A 2WJYA 3TK1A 2N3ZA 4LDJA 4NF2A 3A6KA 3M6XA 4M60A 4DDUA 1L4FA 2I2BA 3C4QA 3S5JA 4L02A 1GGKA 4LPSA 3PF8A 1CY0A 1G8KA 3EFEA 1KO7A 4HEJA 3WHLA 2NSYA 1SURA 3BN3A 4KN6A 1PS8A 3ZWAA 4D0NA 4HEA6 4ZI5A 3J80A 4F04A 3Q6MA 3V2HA 3SVZA 4F5ZA 1NQTA 3CLRC 2WMNB 4N7RA 4RGYA 2YXLA 1E6WA 5DI3B 5IP5A 2OD2A 3VPXA 1UFOA 2RE8A 1B14A 3AFIA 1L4KA 2NO4A 5IN4A 2FSUA 4WNIA 4EITA 2NVWA 2O59A 1ZR4A 4YREA 2O3TA 2QEQA 4CQLA 1P2DA 2YNMC 4EUFA 3ZGVA 2PWZA 2Q21A 4BVEA 1KSGA 1XZHA 3O4FA 2VDQB 2FVYA 1WUTA 1O5OA 2HB6A 2AX3A 1BE8A 1RRMA 3UCFA 2XEDA 4TQAA 3B52X 1X7XB 4BNIA 3E3AA 3MPUA 1JBKA 1ZNYA 1KFCB 1I4TD 4GOOD 1PJSA 1UXJA 3ZZUA 2YWHA 1YE5A 4LRTB 4EEKA 3HNRA 4M37A 3MQFA 2L2QA 1HM5A 2F1IA 2A3NA 4AQ7A 1Y3BE 2IU3A 1GPBA 1XFDA 1RHUA 2CJPA 4KGXA 2CXUA 1ZCZA 1PNOA 5GWXA 2GD2A 3DUWA 2Z6QA 3R6TA 2JFQA 2WQ6A 2PMKA 1WMAA 5EE1A 4BNTA 3AM1A 3DBVO 5EFOA 2H9AA 1WJGA 4TWIA 1A2KC 4H77A 1KAOA 2QL9A 3A1SA 4Q9KA 2CXOA 4MQEA 2PRJA 3HS3A 2BV3A 3TD2A 4R8MA 1NKTA 1PIWA 3F78A 4DV4B 4QM6A 3IJRA 5HILA 3T3PB 2GAFA 5L7TA 3S2FA 2WSYB 4NARA 2QXTA 3K0KA 3KBOA 4FDVA 5JNUA 1SULA 1ONSA 3TZQA 4C08A 1R9GA 4BRZA 3BZBA 1XP8A 3A4YA 5KYUA 1D1SA 4YASA 2AMFA 16PKA 1U31A 1P4JA 5LKAA 2HH9A 4FX2A 4N5IX 3I61A 4TZKA 1H5QA 2BM0A 2CWDA 3PJEA 4R8VA 4BEJA 2PA3A 5I7HA 1TM5E 2O2CA 3ESCA 3Q6IA 2B5WA 1XDBA 3U1TA 1GXSA 1DTSA 4MGYR 2XQIA 4EGCB 3AYZB 3BX1A 2QMZA 4H6XA 4PNHA 3VU9A 4CR8A 2QAGC 3RHTA 3HFRA 4MAMA 2G7ZA 2BFEB 3HN7A 3U3XA 3VH2A 2W42A 4Z4IA 2O8EB 4FCVA 3EARA 1H4VB 2AGVA 3RRFA 1DJMA 3CX4A 1PAUA 2AVNA 3KOXA 5F9MA 2HY7A 4IVQA 4KFRA 2PS1A 4U7FA 4EJMA 1Q0ZA 2D54A 4I99A 4XASA 1ABFA 4XUGB 3B3GA 1IN7A 3L5KA 3QFCA 1GU1A 1CUCA 2VRNA 4FGZA 3AESB 3V1KA 4C03A 5IYZA 1V0JA 4J0JA 3OPVA 3C7TA 5JPIA 2WWTA 1YKSA 1U3CA 2QN8A 1SCDA 2H0RA 3R7FA 4F96A 2Q45A 2QTZA 1H8HD 2A2ZA 3U81A 5EHZA 4MV3A 3VYTB 4MK4A 4IMRA 2OBLA 3I52A 2FPOA 2BF4A 4KO1S 2B4AA 1ORHA 4WEOA 2OV8A 5FPPA 1BFKA 1Y63A 4ZVNA 4ZEMA 1Y7HA 2KLHA 4PFQA 4TOIA 4D57A 5CVVA 3TNLA 3C74A 3PGA1 7MHTA 2KBFA 4YV1A 4CM7A 4FSDA 4B2YA 1EHIA 3QEOA 1G2OA 1HBJA 2J4CA 2IQIA 3AF1A 3L46A 3PQ6A 4MWGA 1S96A 4INPA 2VT3A 4MB2A 5B1SA 3CUUA 2IUUA 2I33A 1Z8FA 1AA6A 3TJRA 2CXXA 3NWJA 2J3QA 3IMGA 1KZGB 3D0KA 2ASVA 1IHDA 3TJMA 1FX0A 3LE8A 3MCWA 5CEEA 1L5ZA 3J81k 2IS2A 1NL3A 4BV9A 4NECA 2KPOA 3EEQA 4KJZA 2OKGA 2XNKA 4FJ2A 3H83A 3GRYA 5DMHA 2OHVA 4Q4HB 5ALKA 2NU7B 4KUGA 4GMHA 4CLRA 1KOJA 1RM4A 2FP3A 4XE5A 1OTYA 5KOYA 2GX6A 3ADOA 1M6VB 1BAPA 1JDTA 3DB2A 4C7VA 2WUFA 3S1AA 1DS6A 1RP1A 3TNDA 5ENVA 3UJCA 2BFPA 4H59A 4EENA 4KSCA 5YASA 3PNQA 4K5QA 4HLCA 4AIIA 4BP3A 4A7PA 1UZMA 4WBNF 3QFHA 4X91A 1BA3A 3HUUA 3DYIA 4HMQA 5EPEA 1NBMD 4BTEA 2DRIA 4P7FA 4ZZ1A 3QX9A 3STYA 4PC1A 2QUHA 1PR0A 1LB1B 2FKNA 2IHYA 4XJTA 1ZOSA 2B92A 1T5IA 1U98A 1H1LA 3KWJA 1N6HA 4HMPA 1EFTA 3MB8A 4TVKA 2HI0A 3F7NA 1G63A 1QTNA 3LIIA 3RUDA 2LW7A 4IIFA 3GCWA 4Z49A 2OO5A 3UJDA 4LZZA 4NQRA 1IWBB 2PQ2A 1J49A 1ESMA 3O94A 1IEXA 2ZQ5A 3QX7A 4D42A 4I4LA 5DB4A 3KELA 4FFDA 4II2A 4MI1A 3M6IA 3BBPA 3EDCA 4ES6A 3F0TA 1Z8HA 2NN3C 5A62A 1N2JA 1WUIS 3N3BC 1Y98A 3OX1A 2P2LA 4NU0A 1W5TA 3B1YA 3THXA 1UXGA 2O52A 2GEKA 4H3HB 4AB1A 3LFUA 1PQPA 5BYKA 2PMDA 3X1JA 4UEJA 4LPKA 3M6FA 2ZUBA 2PVPA 4B79A 3EPPA 5JXGA 3I83A 1I6KA 5FYDA 3GFRA 5JR3A 3GX1A 1RYYA 1RC8A 1MIOB 2WP8J 1NW9B 3QQPA 4EA8A 1KAQA 1NQVA 4NPAA 4J0CA 5K6AC 4LF5B 4ADSG 2BN4A 1ZIOA 4K9SA 3I2YX 3K05A 4OUDA 3KQKA 4B6QA 3U1VA 2ZSFA 4UUBA 5CFMA 1VXOA 1Z16A 2Z98A 4LJ9A 5TEVA 1WA5A 3PC6A 4EHNA 4CI9A 1FFXB 2R751 2HU7A 5AOCA 3CGWA 4KCGA 3COPA 3B5JA 3KUCA 2C7VA 1OI7A 2P4UA 4I3HA 4BJHB 5EN4A 5DI9A 2F3RA 4LRXA 3QG5A 3RANA 5H4GA 6ADHA 2EF0A 1CQPA 3DMRA 3ONVA 5JU6A 4RQBA 4EF5A 4REMA 1GAWA 3A6JA 3UQYS 4DLAA 4ZQIA 3K9LA 1CF2O 5KSYA 1YBFA 3AK4A 4FEYA 1Y0BA 2K4MA 4BFVA 1BJRE 5GTDA 1YR6A 5KWEA 4M88A 3UUWA 4KBGA 1AGYA 2OILA 4MYDA 4BQSA 3PXCX 3ZHYA 1N0VC 1QPBA 1B0AA 3A32A 4MTCA 2IVFA 4GVLA 3TXAA 1VDMA 5T67A 3CLSD 1J0DA 4NFLA 3WHIA 2V1XA 4OPMA 1FFYA 2EBFX 4A5OA 3K1AA 5I5EA 1L4NA 1UMBB 4RD6A 2BGRA 1V37A 1ZWKA 2Q3LA 2FQXA 4HSGA 4AIRA 1QORA 3FTEA 4MVJM 1DJNA 2WD9A 2V9CA 2R66A 2A8YA 2EOAA 2WTBA 4EQZA 5IKMA 1CZKA 3ERCA 4Y98A 2VH2A 3D2BA 2UVDA 4M9QA 4UTNA 4L51A 4R1SA 4GYWA 5ER6A 1TRKA 4NMHA 5FBLB 1KY4A 1XTUA 3U31A 1IY2A 1V3VA 1YCFA 1I5RA 2IHVA 3GNTA 2QTHA 4K6GA 1G8AA 1QHNA 1WD5A 3OLYA 4JITA 3LBIA 3G02A 5H9VA 1Z18A 1JDJA 1ZGHA 3QWBA 3WKDA 3RRZA 3FI9A 1PT8A 3MAGA 5TGZA 3QOWA 3C6MA 4KIFA 1FFWA 1R8XA 3MS2A 3W8NA 1YH3A 3PEVA 4KWTA 4ND2A 3DVRX 4LC1A 4YQYA 3WKEA 4I5FA 3CB2A 2PKCA 3DMTA 3CO0S 1HQDA 4K6HA 2WZQA 4J1QA 4FB4A 1X14A 2HA6A 5SY6A 3G2PA 4AZ0B 1TMYA 3HJHA 4C5BA 2NZ2A 2NAPA 2FN7A 3F71A 3MC1A 3FB4A 2J6CA 1OPXA 3OZCA 1GUZA 1X1SA 1J20A 1JTVA 4RJLA 1QUFA 3R0ZA 2OXEA 5CLQA 3VTAA 2Q1TA 1ZXBA 3ZJTA 2BSXA 2B21A 3JYPA 3GP3A 1YRYE 3RJZA 2DY0A 4HAIA 2I7VA 2MCFA 2P3QA 4BO8A 3PX7A 2DBZA 3MCAA 2OCBA 4ZI7F 3WSVA 2P65A 5J4HA 2EC5A 2ROQA 4AY6A 2I2CA 8ATCA 3AV0B 2ON6A 3WGOA 4MKFA 2C9BA 1XPUA 1U9IA 2PUWA 4N65A 2AN1A 4P32A 3GJ3A 5LMZA 3ET4A 3P4UA 2I2WA 2J0SA 3H8VA 3FLBA 4NWIA 1ACMA 5HIJA 1EVEA 1TCAA 3SY8A 3RC9A 5IJ9A 1TCCA 1HV8A 1P5JA 3R7AA 1JR4A 1OX6A 2YXPX 5HIAA 4X65B 4MITA 4OAPA 2PSJA 3MELA 2PZAA 4ZJUA 1MP0A 4UUAA 4JWKA 3Q5GA 5A9SA 3AJDA 1EE2A 4QO7A 4QJIA 5EI5A 5KTTA 3U6BA 1NV9A 3MRSA 2BONA 4KO2S 2RARA 1Y4ZA 3LQYA 4E5KA 2DSTA 3KQQA 3QVVA 2H92A 1EX6A 1UJNA 3GBSA 1PWXA 1YDEA 3AG5A 3BJRA 4HVLA 5JCZA 3ZJVA 2C4KA 2V4MA 5GJWC 1NU8A 4WZ6A 1ID1A 2MJLA 3WL8A 2HJSA 1K98A 4ISBA 2YMPA 1GUYA 3CISA 2PO7A 2DCUA 1QZXA 2OFOA 1P7CA 1BGWA 4YRJA 3KVNA 3NV9A 1TZ2A 3BGWA 2XD4A 4G85A 4JL8A 3T9BA 1E1YA 3AKEA 3DUFA 3VPDA 4EUNA 4F5WA 4RIFA 4IWNA 1XTTA 3ZLJA 1QOPB 1TYBE 3KLMX 3RJMA 4JELA 1W5BA 2JD0A 3SSNA 4CW7A 3V42A 5EHXA 4BFXA 2A1UB 3NBUA 1LDMA 1PDWA 3OG9A 4QTUB 4R01A 4WCDA 2JFVA 2LWIA 1WIWA 1H5NA 2HGSA 7GPBA 2HMWA 4GPD1 4O4LA 1T13A 3M6VA 4WXRA 3REQA 3RO7A 2HFKA 2BGTA 2EQ5A 3ZE8A 1VL2A 3DT8A 3DKPA 1TU0A 4J6FA 2NMVA 5CK4A 1KHTA 2DERA 3OIUA 1QVAA 2SBTA 4LJ6A 4BNGA 2XYRA 1IPFA 3WLHA 4CKYA 4KIUA 1RXCA 4Z53A 3RC3A 1HFWA 2YWFA 2V45A 3NWOA 3L0CA 1BMQA 4HGOA 4Q48A 1LRKA 1Z88A 4QDTA 4F6CA 5LMUB 3LLUA 2WI8A 2NXNA 4FBGA 1C4XA 4S24A 2IEYA 3GY0A 4OGFA 3GNQA 2PKQP 3L0YA 3P71T 4I9NA 2PGNA 1AQIA 1QFXA 1YRQA 4PXSA 3NIFB 4HFMA 4LSZA 1E0AA 2DUNA 4KQ6A 4QO8A 4E6EA 4GRIA 4FKMA 5ITVA 5K3OA 1DKMA 1WV0A 2QT0A 1M72A 1M34B 1DC6A 3I01M 3IVMA 3N9IA 4Y9TA 4ASUA 1NMZA 2INGX 3VYSB 4EB6A 4PYKA 4S0ZA 4UUOA 5HFJA 2R1TA 3OIYA 5CA0F 4M0DA 2A4MA 2ZB2A 1X8JA 2HK9A 3KSRA 4ZEOA 1CUXA 3OESA 5ERXA 3V8VA 1J5EB 3LHIA 3PIDA 4TTAA 4FOOA 2EJUA 1M6WA 4TXNA 5EXSA 1JHUA 1LVUA 4IH9A 5J2UF 3PEFA 4XRRA 4N3NA 5LQRA 4LXXA 1W8DA 2XYQA 5DTRA 3B9RA 1PFUA 2XMDA 3MW8A 4TMWA 3OJXA 4HAOA 4D9IA 1LV7A 3AUAA 4BS9A 4MKHA 2UZ4A 1GDTA 5ALVA 2CXNA 3DWGA 4Q1FA 4YFYA 5DP1A 1M76A 1UAYA 121PA 1ZEMA 2YW2A 1FW8A 1JV2B 3CN9A 3DM5A 4BFTA 3V8RA 4D9MA 4RJJA 4L8VA 3WTCA 1SD5A 4G5SA 4EO9A 5ADWA 1QH9A 3CW2A 3B5EA 5JRJA 1AHIA 1CQIB 1GOTA 1QM5A 2R6GA 3EFOB 1RQGA 4KODA 3X2EA 4DZTA 1G42A 1KL7A 3MJDA 3K0AB 4P5EA 4URHA 4MDYA 4WOCA 1NDUA 4IS3A 1SXIA 5KSZA 1IVYA 2O9JA 4RD0A 2J5XA 3OQBA 1Q15A 1XAJA 4ZGBA 4NAUA 2YV3A 1KQFA 1XXLA 1BEZA 4G5FA 3HXMA 4X54A 4FUTA 3ZHXA 2VHVA 2OMEA 3E9DA 2ZIXA 3ZNPA 3ZU3A 1LLFA 1RLIA 4MUFA 5GZ6A 3V7WA 1VHJA 2XF8A 2ZYWX 1VC2A 1O4WA 3H7IA 4JU8A 3UAVA 3VPBA 5BSEA 9MHTA 3FGNA 1M7HA 1Y7PA 5CT4A 3GBPA 4Q3LA 1ZN8A 3FETA 2EKPA 1CEEA 5E6UA 1KI7A 2XMQA 1NXOA 3EGDB 1GZVA 3QLVC 1OFUA 1S2MA 4WL0A 1ZRMA 5EE0A 4LSGA 1Z5UA 4R69A 4LY6A 3VPHA 5G0SA 3HO8A 4ESOA 3WGTA 4ZAFA 1TZMA 4H7EA 2DULA 3ME5A 3OE4A 4G1VA 5A4JA 1CVIA 3DAFA 3A9UA 2PUAA 4WH0A 3FNBA 1PZGA 3WYNA 3SQWA 4GP9A 4RZ2A 5CIWA 5DHTA 4ZYUA 5LYJA 1RZ3A 1NT4A 5AI8A 2XJ4A 1DRJA 3TJZA 3NVAA 2WSIA 3G79A 3U7EB 2P11A 2BE7A 3GJZA 5JMOA 4GAEA 5MFPA 3B1KA 2VAXA 3MCVA 1JPJA 4LJAA 4DUGD 4BV8A 2B4RO 2IGTA 4DDWA 2AKEA 4EA6A 4HNTA 4RLSA 5KYWB 3GXOA 4D0GA 5A6SA 2ANBA 3WLLA 1BXGB 1TZBA 4M8IA 1V5IA 4PV7A 5LOVA 4TWJA 3SS8A 3X1WA 5L3QB 3GZTB 2O2XA 3WZ2A 1FNCA 4M38A 3W1VA 4I1YA 5C4MA 4RLHA 4L57A 4UAVA 2Z57A 1XU9A 2FY8A 2WZBA 1U0BB 2IWRA 4KK3A 1E9EA 3HK2A 1W44A 3ESQA 3MJTA 3ZEAA 1NONA 1L7OA 3KZOA 4R2JA 1HYEA 1EP2B 1QNLA 3LCUA 2TMGA 1RXVA 3O8NA 5C4GB 1U2SA 3GUZA 1P3DA 2O2YA 3G9XA 4F97A 1OYWA 4L78A 2VOJA 2Z5FA 4Y1FA 3TQQA 5H81A 5JNWA 1WZCA 2PRSA 1FUUA 3DE3X 1UBHS 5JI2E 1GILA 1KI6A 1WMEA 2YW9A 4LEIA 3RS3A 1IM2A 3NTQA 5JEEA 3ANLA 4LFBB 3BMNA 2I2FA 1LV8A 3CEAA 4LJ5A 5ALJA 3FWNA 3ZVKA 2QZ4A 3ENZA 1THMA 3F47A 1I3CA 1CQXA 3IJPA 2JJ2D 3GN2A 3LX4A 3PNVA 1MFPA 2BMVA 4GSKA 5DW0A 3ROFA 5AM4A 2DBQA 1TA0A 3D8NA 4JLSA 2ZR7A 5E1MA 3PF9A 4HWPA 3UK7A 4YCMA 4Q05A 2MIIA 1Q7TA 4FMPA 4MR7A 1LPPA 1V43A 2XCOA 3IMCA 4IQGA 4RPIA 4X95A 4DLWA 1Y8RA 4UULA 4FFRA 4O0LA 2H51A 1KQGA 2CFCA 3DLTA 3ENNA 4IDDA 3KVVA 2F67A 2Z58A 2BFNA 2VK8A 2P5YA 1EFUA 3OT5A 4QYTA 5IVIA 3ZV7A 4CYMA 1H4QA 2IBTA 4E51A 5IPFA 1KOGA 3PEUA 3UJBA 2EZ4A 1N2CE 3QVJA 4POAA 1U2ZA 1A4XA 2WWVD 3UWDA 1EFCA 4C3OB 2BKEA 1UK6A 3GJ7A 5DN9A 4BQIA 1UKVY 2IYZA 3O9VA 5DHSA 3RYFA 4EQ6B 3T5DA 3D5EA 1PI3A 4GPEA 5K0TA 2QM0A 5DN6D 1WU7A 4F2DA 1JEQB 2X6QA 1DCKA 3ILHA 4RPHA 1W47A 4KIJA 3NGLA 1X7YA 4BTLA 2N42A 1M2VA 3C1TA 1I6MA 3C7AA 2QAGA 3N6VA 4QUJA 2OBFA 5DXJA 3ZS8A 1YR8A 2H3EA 3UC9A 1ZA2A 4L4XA 3EIOA 4OJQA 4Y6SA 1HXHA 4YLEA 1H65A 1XZEA 2H07A 3R5FA 5GONA 1JQ3A 1OXKB 2YJGA 4G4SP 3RHZA 3SQMA 3I09A 5B64A 1S1MA 1OX5A 2P0YA 3IHLA 1E59A 4M0FA 4P82A 1VYUA 3J7AC 1VLJA 2HF9A 3MN1A 3OVMA 1ST3A 2GKSA 2HREA 3JASB 3T35A 1A96A 2RHCA 2QMOA 3ISTA 1UKCA 3KOUA 3DO6A 3LWNA 4RM2A 3OJEA 9LDTA 2PMEA 2D2FA 4HXEB 1LTHR 4LBYA 4A27A 2CHGA 1KJYA 5EUBA 3C1AA 1PJ4A 1YCHA 2HSZA 3E4DA 3R5SA 3UA3A 1T10A 3O9MA 3F6CA 2R96A 2DHRA 1JDNA 2ZDHA 5C32A 2JS7A 3DDWA 4BX0A 1FNDA 5DGTA 3EA0A 5AFSA 3VR5H 3O2QB 3Q1LA 4G9EA 4JXXA 2O48X 2PT6A 2VT2A 1PL6A 3PC2A 1DQZA 4OKIA 1SKMA 4EKNB 3A3PA 4XR9A 5AKHA 3DZFA 3HB9A 1GSIA 4JNCA 3IAHA 1T6YA 3DMYA 4GW3A 1SQSA 2QTVB 3KT8A 4Z8XA 1E69A 1QG6A 1SCJA 3G7NA 2R60A 4HUQA 1P0QA 4DJAA 3ADBA 4OSOA 2AT1A 1U0LA 4R4JA 2GKGA 4UM7A 3AJ9A 4WK4B 1KFKB 1TM2A 3TZLA 1ZH2A 4IIYA 3ROGA 1UFRA 2I3AA 1L5RA 4LTDA 4E46A 4YUXA 1THTA 1A5TA 1W88B 4ZHQB 4QRHA 1XWIA 2O1XA 3GNLA 4QYIB 4B7XA 3G2HA 2HMUA 2JAWA 3FF1A 3TNYA 1D7AA 2R7LA 4CL0A 1X8LA 2JF0A 3K9QO 3WB9A 3OZUA 4DAEA 1QRAA 4BNXA 3BMQA 5JJIA 3GVHA 3OFNA 3TLKA 5EMJA 1Q44A 2FEPA 3JQ9C 3KAQA 4UAGA 3TQTA 4EPWA 3WC4A 1Q20A 5C8VA 4E6PA 2JH9A 2JI9A 2XQJA 5ADVA 2FFBA 2VPYA 1ND6A 3VR3D 3ZDYB 1GQFA 3AIKA 4WZBA 4D9KA 1E1LA 1MB0A 3PFWO 5AIBA 3B3FA 2XGGA 3JARA 4OHFA 4BLSA 3D8HA 4ZIRB 4LFCB 3UAYA 3U44B 1U4NA 4TZ6A 3WL5A 4K03A 2FCRA 3PWZA 3AU8A 3EXHC 3FVQA 3NS7A 3PFBA 4IIEA 4W6ZA 4UU7A 1A9PA 1OAAA 2ZI9A 3R5JA 4L27A 2N75A 4TYQA 9LDBA 2ZSUA 3BUSA 3L1KA 2BMJA 5E9JA 5K0BA 1DWPA 5BMVB 2XUAA 1F2VA 1TUBB 3HCCA 1GPKA 3CW8X 1FTWA 3GP5A 3INRA 3LCCA 4J16C 2VJMA 4B6OA 2Q5HA 2VSYA 4IIJF 4QUIA 4E5UA 4GYKA 4YJFA 1NZDA 1Q7RA 1N8NA 2EFEB 3WGHA 2BAGA 4AKEA 3W79A 1DXOA 1MN6A 3STXA 1I3KA 1S8FA 4JLOA 4AN1A 1UEIA 4GZ6A 4FDAA 4MPDA 4MH0R 5TMDA 2IXAA 2QR3A 2RKOA 2FHSA 5FWDA 1WMBA 1RBZA 4OBWA 5DSXA 3S81A 4MW2A 5L45A 2OFXA 5FBKA 2B8JA 4NBVA 2VP5A 4RHUA 3SAJA 2QIPA 4HV4A 3QKRA 5K6AA 1SC4A 2WIKA 3G0OA 1Z6GA 3HB1A 1ETHA 2GJ4A 4X84A 3VR5A 1BDHA 4E22A 3D43A 4JROA 2VDUE 4ZZ2A 1TCVA 2NTNA 4O3FA 4HY3A 3FMIA 1Y9ZA 4WMLA 1B0PA 4NU6A 4Y9SA 4KFCA 1T15A 5EHQA 1DMSA 4KMOA 5C8YB 4PIMA 4A6DA 4DGQA 3DEYX 2FMUA 2VF8A 1FF9A 3NHLA 4O29A 4NV3A 4Z4EA 3BJIC 4L16A 1HRDA 2PMWB 3R7BA 2E4VA 2WU0A 5JUWA 1AUVA 1JDZA 2XE8A 4ZTBA 1WOMA 3GROA 1H2AS 3JQEA 2QSYA 2CXTA 4FM9A 2ZZNA 5F21A 1R6BX 3VKWA 3GZNA 4B6FA 1H42A 2H1FA 3LLCA 3UANA 4KUHA 2ERYA 1GA6A 3FYDA 1JSRA 3Q7EA 3WLSA 2ZZMA 2VHJA 3EIFA 2X86A 3IXMA 5TVKA 1Q92A 2XUKA 3NU1A 4IPTA 4GOND 3ZLVA 3IALA 4P31A 5A3SA 4JIGA 4JUDX 2C54A 2GK3A 2P7IA 2V6MA 1TC2A 4M1SA 1L5QA 4MKXA 4HUTA 3TFQA 7ABPA 1KIFA 3K9CA 4P36A 1ESCA 3BHNA 4PYIA 2QVGA 4R71A 3J7TA 5EZ5A 3U6KA 3LBFA 4HZUB 1Q19A 5BN4A 1EM8A 2HN9A 1E2NA 4UARA 1U7DA 3Q40A 1ZESA 4MI9A 3QV2A 4Q21A 1PLLA 4GOLD 1BW9B 2RI0A 3D8TA 1UFKA 3GLSA 3QU5A 1H2HA 2DFLA 3WX0A 4JBHA 1LSJA 2GJKA 3D8SA 4RL4A 2IXFA 4BP9A 1AH2A 5LQNA 2DTEA 2QJOA 1AXGA 4P4SA 1QAMA 2ZYTX 2JJ2A 4H7KA 3DONA 3AI3A 2EVWX 4H18A 3YASA 4CL3A 5M7EA 5BXYA 2YR0A 3HBAA 3AVUA 1M0TA 4I08A 5K5EA 4X6UA 1JBEA 1OOEA 5NULA 2X8JA 2PH1A 3PQDA 1T9GS 4S3MA 4I81A 5CNJA 4NG5A 4XJXA 2DWPA 3BERA 5TPWB 4G86A 4IHKA 3HJBA 1ZD4A 5HMLA 2B5OA 1IXRC 4IDEA 1E1QD 4QEDA 5KOJB 1I2CA 3EZYA 3I92A 1K27A 1FLAA 1ULSA 3O38A 1YV9A 1SR8A 2BMFA 2BJHA 4JA0A 5DHFA 4NYMQ 1AQNA 1XDWA 3MTJA 3CRRA 4PSAA 3W8RA 1QV9A 4BU1A 3QVOA 4HS9A 1IVNA 2YOFA 1NHWA 3DYBA 2GR9A 2BBSA 3NBXX 3P9KA 1KMCA 4MW4A 2R47A 3VUFA 5A7FA 1ZGZA 2HMVA 5DN6A 2XCIA 1RAGA 4QLBA 3IE1A 2O1WA 4UNRA 1EDBA 2QL6A 1SXPA 3O8OB 3DQQA 3QUCA 4IY1A 4EKGA 1RFLA 2HK7A 4UM9B 3FI0A 4K6KA 1P2UA 5FBZA 1B8VA 2IUSA 2P35A 3FHOA 1R8YA 2VNKA 1DV2A 3UWOA 3EUAA 5J9FA 2PKQO 4YJ2B 5JSZB 4LRSB 5H16A 5BSMA 1J70A 4CKCB 3S3TA 2HU8A 3SEZA 1D6NA 2NUBA 4CEJA 2YJNA 3KEMA 1KTIA 1RHQA 4BO1A 4CV0A 5JAUA 1Y6GA 2CMGA 3NM4A 4FSHA 4O1MA 3FNQA 1SPXA 4NICA 4C9BA 1XD8A 5K3EA 3KR2A 4P3PA 1YZLA 4LDRA 5B2EA 3RHFA 2ILTA 3MVEA 1GVHA 1ISFA 4K6MA 5IDWA 4KE7A 1TNDA 1ADYA 1P1JA 4CLDA 4YQEA 3NG1A 3TBFA 1Y4UA 3OLCX 1TK3A 1F9EA 1X1CA 2O2ZA 1LTQA 4CKEB 1CDOA 2Q6KA 4DDMA 2LKDA 3OZTA 1NE7A 1E2IA 3FHLA 4BGUA 3WGNA 2VA9A 5J43A 2VH1A 1AT1A 2C04A 4GH5A 3RU2A 2XCSB 2GZSA 4H1TA 1DIHA 4OH1A 4CMKA 2I4IA 3N75A 3QMWA 4E5VA 4GWLA 4UVHA 4UNQA 1JQLB 5DTMA 1AKRA 3H17A 4PCUA 4YJ3F 3PSHA 5CBPB 2AS0A 4ZALA 4N5LA 4OUKX 1ULTA 2IT1A 1DKPA 3AR8A 5AK6A 3G0GA 2A0KA 3UKDA 1O6GA 2H5JA 4H1UA 1GPWB 1C1XB 1O96B 3SJUA 4CQMD 4F4HA 1OD6A 3JD2A 4MV9A 4X5OA 4WT7A 5DCUA 5A3QA 2PD4A 2QWXA 2IC5A 2VHWA 1UBKS 4TTIA 1GLGA 4OQMA 5FI3A 3QGMA 3M9LA 2NOAA 3MINA 5FJJA 3T1YB 4ZAZA 3UKOA 1GCUA 3VMFA 2BGLA 3T7TA 4QTYA 3V6MA 3LP8A 3Q7IA 4G0YA 4KLNA 4Q03A 4TKLA 4MQ6A 1CX9B 3RK0A 2Q1YA 5LXTA 1ML4A 1K7FB 1O0CA 3MGKA 1XCPA 4XQEA 1QHHA 1RW4A 3FWPA 1NUUA 2D0IA 2P9JA 3G13A 4QD3A 3RFVA 1DDGA 4GWGA 4URWR 1RC1A 3MM4A 3OICA 4I1IA 1KBZA 2EKZA 3VA7A 3UMSA 2WYVA 3DEAA 4LMBA 2PO5A 3BGOS 3VH3A 4YRCA 2DETA 3OUUA 2V6IA 1RTTA 3KJZA 3ROEA 4GZMA 4I4CA 5A04A 4Q9IA 4JLWA 1UQTA 4GM1A 3DWIA 4DDKA 4C2BA 4CWAA 4HADA 4MS4A 4AN0A 5HRCA 3L6OO 1Y42X 2P4SA 1CC1S 5IUNC 4OX9B 1XN4A 5CA1B 2EP5A 1TCBA 3AP3A 5A1TA 1SGWA 4KO3S 3BB3A 4JP5A 2PYZA 1OKKA 1HNWB 1X6VA 3RD5A 2PUTA 4LE0A 1R00A 2AG0A 2HHAA 3IDZA 2GCOB 2CDRA 1HTBA 3RWOA 3BF7A 3U4IA 4FYIA 1NQUA 6YASA 1XK7A 5EMHA 1CZOA 1NV8A 2XHZA 4GGOA 4JCOA 3PSAA 4PAOA 2BDEA 4II3A 1GTRA 4ER6A 2DR0A 3R40A 2BH9A 1A2OA 2PZGA 3AVQA 1USUA 4W1PA 1WBJB 3A3NA 3GAAA 1Z35A 4LJRA 4RCZA 3HRIA 1PZXA 3EXEB 1YHZA 3T5MA 1WCXA 2UUBB 3O0DA 1S2IA 2CL0X 2EWMA 3G8YA 1P29A 3UAOA 4A8JB 1ULBA 4B4VA 4QBGB 3I28A 1UBRS 5CDFE 3I0ZA 3HSKA 3JYHA 4LW8A 3RS4A 4C6TA 4XLZA 4E03A 1HLFA 5KQRA 4I36A 2D5LA 4AUEA 2A1IA 2WWWA 1JVNA 3VX4A 4CKXA 1Z6PA 3GV0A 3C3CA 4J90A 2CSXA 3QITA 5CGQB 1M6VA 1L6RA 3PPXA 5EZYF 3SYNA 4MKRA 5FIUA 3ZKWB 2OV3A 2IYPA 4DLUA 1JZQA 4UTRA 4HP8A 3DCNA 5AUNB 4EWLA 3PIRA 1LS1A 4XDZA 4B3HA 1S1CA 2O5VA 5FRDA 3FWHA 3ZG6A 1QLWA 5DNVA 4MRRA 4UD6A 4BASA 2X0RA 3M5PA 3TRJA 3MYYA 3CPEA 1QG0A 4YUWA 1SG9A 3JYOA 3VAAA 2AN4A 2Y0PA 3PVZA 4KN9S 3EVFA 1U8UA 4LNUB 5F52A 2PL3A 1J0BA 1TO6A 3H2JA 3MD9A 2QRUA 1ULAA 4D4JA 4TV9F 4RTQA 1J00A 4NG4A 5LB2A 1CPYA 5I7AA 1Q14A 1U8EA 3ACCA 2J6IA 3EOZA 1MKYA 4LZJA 1BHO1 2CVPA 3V3KA 3QLVA 3PKJA 1GL9B 4JUAA 4PZCA 4U6SA 3HGTA 1NFFA 3HV2A 4R2HA 5H8WA 4X3CA 1GQ2A 1QGUB 5B2ZA 5THKA 1J1IA 1DFHA 3Q3JB 1J56A 1J0EA 1XEWX 3L6CA 3KKZA 4MW6A 5HKLA 2I9KA 3KUUA 3KYJB 1TYAE 4DMLA 1RWPA 5A4IS 2B7LA 1S7GA 2FXIA 3HUFA 3PGXA 3F5QA 1ZM9A 3O92A 1X39A 4Z1MA 4DM7A 4JX8A 2ZWVA 2W00A 5LMNB 3VPSA 1TAQA 1N25A 4DIDA 1T8SA 3U40A 2P4QA 1SB8A 1JKJA 2I62A 4BNKA 2DQZA 2E7ZA 1RPJA 3I4CA 4JJ4A 4K6CA 4DT1B 4ND8A 1GCOA 1XXHE 2VXCA 4BEBA 1FNBA 1PP4A 3GDHA 4MV0A 4AJNA 5B7GA 1EBFA 5F2OA 4RADA 4WESA 4KXFB 3G0DA 4Z9AA 3WGZA 4D98A 1MVLA 3KOMA 1GV0A 4UW9A 4CEIA 4JOSA 3I0NA 3NOQA 1X1DA 2WVHA 4NJMB 3PUJA 2NTEA 2BC9A 2GBCA 4EJFA 1HWYA 2BHRA 3BIFA 2AI2A 4G67A 2ZSDA 2FFRA 4DLSA 1VYHA 5ERGB 2AKYA 3IKLA 2IU4A 2J9FA 3E23A 4I4TB 3WNZA 4MV5A 3DR3A 1ESDA 3M81A 1K5HA 3G8CA 1OIWA 3A37A 3KLOA 5LYJF 1FMJA 3L9WA 1E1QA 3OE5A 1EP9A 3ROTA 1ZGAA 4FE3A 5CCDA 2KSQA 4NCHA 3HU3A 1X7WB 4I8IA 4C22A 1DDIA 2IP1A 2IPAB 3HMQA 5JD6A 5CB4B 1MORA 2FHPA 4NCKA 1BXRA 5MGBA 1JSXA 4BNMA 4C6RA 1JKFA 2CHEA 4NNJA 4TWAA 4PAQA 5G0VA 4HKTA 1V2GA 2GD1O 1NF3A 1GTG1 3OZAA 4HK4A 3DMFA 4NCJA 2JEOA 4WSOA 2Q5IA 5LP6C 1DBIA 1UEXC 5HFAA 2ZRGA 4BKPA 4XVCA 2TMKA 3WGKA 2AHOA 3VOTA 2YMMA 4MLZA 5D7BA 4KTTE 1EMDA 2W6JA 2ZSEA 3EXG1 3GVCA 4UCQA 2OCDA 5L6MB 4RA9B 4GZ5A 4CCYB 1EI9A 1Z0FA 2VSQA 4K86A 1ZOLA 2O06A 4RFVA 1J8DA 1JHDA 1VIVA 2BKUA 2LPMA 2ORYA 4O2RA 5IKPA 1EFAA 2R1ZA 2QP4A 3GA7A 2P77A 3KYDB 1VLMA 1JAZA 3O3NB 2XYHA 4C6SA 3IUYA 4L8FA 2C84A 1XD9A 4Q5IA 1EZ1A 1L1QA 2ZBGA 3RYIA 3O74A 4N8DA 4YAJA 1E20A 3OF5A 3WYAA 1X7ZB 5M2QA 1OXUA 2PTHA 1W0JA 2WOJA 3SU8A 2JGKA 4IX9A 1FS5A 2VPWA 3I9NA 4XVUA 2ZYGA 1TJNA 4KI0A 4LRUA 4BN4A 4MVJE 3IH5A 4RO0A 4EY4A 4B82A 4AAYA 2ETVA 3HDVA 5BRAA 2BZSA 4JYBA 2QJFA 5E8JA 3N2NA 1OBFO 4JJEA 1DBSA 3KHUA 4EKDA 2XZOA 3C8DA 3SQOA 1J33A 1OILA 1U7PA 3JX9A 3KJHA 5KHLB 3V1UA 1I2AA 4ZOLF 5IBRA 4BGDA 2BBWA 2PZBA 3RCBA 2O54A 4I50F 4RWEA 4RTRA 3ZD6A 3TOZA 3CRVA 3KKQA 5JD3A 2H85A 1Q2UA 4XTRA 1Z08A 2HLDD 5AVJA 2DZDA 1X1AA 3JZFA 3OCWA 3PXAA 4TTPA 3AEYA 5DNWA 2RGAA 5A9TA 3W06A 2DR2A 4O3MA 3ZV4A 1E6MA 1QIFA 3PENA 4HYYA 3ILYA 3TLGB 1KYVA 3WRWA 2A9FA 2C83A 2CLSA 4CN9A 4WJZA 4K9DA 4OJYA 4BNYA 2SCUA 1OLOA 2WT9A 3EVNA 3C45A 3D7SA 3MMZA 4RENA 1UP4A 3WDSA 1KZ6A 3CLHA 4OL0A 3FCUB 1FRZA 1GNVA 1PGQA 1JI0A 3QBEA 4PBTA 4XFDA 3RFFA 3HCPA 3MPOA 5E1DA 4RJIA 1ESZA 5HW0A 2QX7A 4PO8A 5TJ9A 3KK0A 3IAXA 1NVWQ 4LJ7A 2W11A 2PLRA 5L7YA 2B35A 2R6AA 1F2DA 1M8KA 5AOVA 2IL1A 4B33A 2Q2NA 2X7JA 4FMCF 4R1OA 1ZP6A 5JVDA 2IUYA 3FNIA 3T34A 4RXTA 3TVYA 4WKNA 4DCMA 1Q0LA 1CYEA 1JIIA 1Q0RA 1YDGA 1EUDB 2RGNC 1L9XA 1DE0A 3B9PA 3KETA 1N4AA 3VHLB 1Z4NA 4C4TA 3VJKA 1T6NA 3EQ2A 4DARA 1IBKB 2BEKA 4FGLA 4YLYA 3MUOA 4CLOB 1M5RA 1Q7EA 1EXWA 1G8JA 1V41E 3BH7A 4DBLE 3ZDAA 2QMUA 1GD1O 3DTVD 4XX1A 4MVJP 5L51A 1YCGA 221PA 5AHWA 1YB4A 5IF3A 1XN1A 3OQJA 2OUKA 3TZCA 4I1PA 3NVMB 1ZOOA 3D1VA 2NZXA 4JAVC 2WU1A 4WLUA 2XOXA 3D3NA 4BLTA 2E4WA 1H4TA 2G9VA 3AOEA 3W5AA 3BIWA 3IE2A 6NULA 1ECJA 3SQNA 1GNSA 3C39A 1NIPA 1KYXA 3K8YA 2Z56A 2HV8A 4F8EA 5CJPA 1XMIA 2GLXA 3HVIA 3FLAA 3MIIA 1U65A 3IIIA 4M3NA 4RVNA 5CFRA 3OFJA 4L3VA 4FFNA 4RVCA 4DV7B 1KPIA 4MYUA 1MAVA 5JIBA 2BELA 3IXLA 1C7RA 3EXHA 3SX4A 3AJEA 4FFBB 4QL3A 1KRWA 1LKZA 4YMHA 2I6XA 4WK2B 2R7AA 3HU1A 5FUWA 1XOIA 4F91B 3JQ8B 1PJQA 5AMXA 3LNCA 2AOWA 1U1CA 3A0RB 2HRBA 2QSUA 5AVQA 1CQJA 4ZARA 1VSVA 5ALGA 2ZT8A 2W6ID 4ZYWA 4J16A 3TAUA 2F9LA 2D1QA 3CNOA 5J4YA 2Q07A 1ZX1A 5CCXA 3WWPA 4L7VA 5DYIA 5I8ZA 3IP6A 4TTTS 3EQ8A 3LOPA 4M53A 3A7EA 2Q9BA 3EG9B 3EIEA 5AWFC 1ZJ4A 4QXAA 4HNAB 1VA5A 1FZTA 3X0DA 4N8SA 2II6A 2Q0HA 3PYXA 3ZNNA 2O0JA 4C5CA 3CCFA 4LWOA 2E3JA 3BXOA 1D6MA 3SHFA 3HNPA 1D1PA 4DCGA 2EGGA 4E21A 5B4UA 3ODPA 2P3LA 3M9WA 2B0JA 4IDGA 2KHZA 5JXHA 4HNUA 3TGPA 3B82A 4LTMA 2X3UA 1H05A 4ROSA 5BVHA 1V7CA 5I7SA 4TS3A 2W71A 4X63A 4FYKA 2OHGA 4UUQA 5BVGA 1J4AA 3LS2A 4QNRA 3RSSA 2QL7A 1FE8A 4DMUB 2D5BA 1H2XA 2REOA 2WICA 2BFCA 4NU8X 2DU8A 2I3GA 1YFLA 5FLYA 5MF6A 3KJIA 2QUAA 3BSWA 3Q0TA 2VXYA 2R48A 2PGLA 3MT9A 1MAUA 4IF6A 4TL6A 4YO7A 5AJXA 4DTCA 2DB3A 3ZC3A 4YAUA 2X42A 2X9VA 2ZRIA 1P9RA 3AW8A 1Y8CA 3H6GA 4MW1A 3KZKA 5EIOA 4HXFB 4DNOA 5KKCA 3EEOA 5DYYA 1VE1A 3ITEA 3FKSD 1RYFA 1KMHB 4P1ZA 4BMPB 3SZMA 5CH3A 3TMAA 4QOIA 5FP0A 4G23A 4KI7A 4ARVA 2UVQA 1RSZA 1XJ0A 4DMCA 1US8B 1YMQA 3CR8A 5ECWA 2AUTA 5U9CA 1E7MA 3AR7A 3H5IA 3LDHA 5DEOA 2WUEA 5DYGA 5BURA 1AN0A 2PT7A 5SZJA 1IPEA 1W29A 1CE8B 4NFYA 2EFYA 1OC4A 2VTKA 4L74A 4EL5A 4DHEA 5EJEA 1QG4A 3E70C 3WLAA 3B85A 2AFIA 2A5GA 1TW3A 1WU8A 2YJTD 3NFRA 1Z4JA 5FJIA 3FKQA 3CMMA 4ZEWA 1HGXA 2TMYA 3MWFA 1VOTA 1VDZA 3NZEA 3TLYA 1EXDA 1BJTA 3WV5A 4LF8B 2CB9A 4NJEA 2I5PO 1S02A 2V6GA 3G5MA 3IV9A 2JIOA 3N2YA 5AXAA 1Q21A 3VNVA 3CZQA 5JHGB 5HS4A 3SBOA 4OM8A 2H00A 1TIKA 1WE2A 5K8VA 4YP6A 4UUPA 1N0WA 3T5TA 1IBSA 2A5LA 4AJJA 2V97A 3CZPA 3IP8A 3ZWQA 3S6JA 2Q9CA 4IDBA 3SE7A 5IT0A 3CLTC 1UOPA 1NMYA 3SZOA 4NYIR 5AK3A 1AV7A 4PQGA 1LWOA 1LQUA 1K9SA 2GLTA 3PLNA 4WKOA 3ZE0B 4B43A 3FOFC 1XEXB 1N2CB 1TUGA 4S1TA 2JKYA 2PAFA 3LT4A 2CB0A 2WJJA 3SKVA 2HJRA 3WGGA 3FNFA 1J8FA 3VJMA 1QH8B 4ZI2A 1HQYE 1E2KA 2DUJA 3B7WA 2O4UX 3CYFA 5EMNA 5LFAA 4M76B 5D84A 4RDCA 3KYCB 4MEBA 3T9AA 3UAXA 2I9PA 4TKUA 2FNAA 3LCRA 3C3KA 4QQ8A 1NF9A 1YQDA 1GNPA 3F98A 5C1PA 2REBA 4UQOA 3I45A 3QBDA 3H04A 3JQCA 3KP1A 1CIVA 3ANMA 3OY7A 1IM5A 3MTBA 4AROA 1RZRA 1T6ZA 2ZIZA 1Y3AA 4ZOAA 1KMIY 1LPMA 5L3QA 3HE3A 4OXXA 1NG1A 4WOPA 5BV2P 3FPSA 4U2KA 1GEGA 4Q18A 1KZ7B 2NZYA 3W6PA 2XNCA 1U9YA 1UMCB 3QIVA 4LCEA 4P4LA 4U39A 3GI1A 1UDRA 1PV2A 3I2FA 3FFTA 4IILA 2W83A 4W6QA 4CF3A 4FT2A 4LBVA 4G4JA 3EF3A 3IPAA 4U5XA 2ZIVB 4E4RA 1YQQA 3C8MA 4B3TB 2C29D 2DFVA 3UH0A 1I2DA 1HTTA 2XA2A 3I8SA 4G26A 4NZZA 3B3JA 4JBLA 1SXJD 2GBFA 1TD1A 2F48A 1YC2A 1VPLA 3BMCA 1IIBA 4HNQA 2ONYA 4PSUA 2GAJA 4F11A 1PGNA 3NBAA 1Q1QA 1JFRA 3RAPR 1N2GA 3GJYA 3IUJA 1JIVA 3AFMA 1MD9A 3PDWA 3E0XA 3EEYA 3BPSA 1K88A 3MA0A 2Q0XA 3VJRA 5T3UA 2WJPA 3LUDA 1DCFA 1ZMTA 1EH5A 3EVTA 4ZICA 2ZTUA 5JECA 2IHNA 5FF9A 4ZAYA 3GEIA 3ZU4A 3WRVA 1HDOA 2DWOA 2VRBA 1E1KA 1F60A 2R7NA 1RT9A 3I9FA 3LHKA 1VHTA 4PTLA 5A3VA 5IF9A 2BFBA 1O95D 2VBFA 5I4KA 1V3QE 4Y30A 2IYAA 2O2SA 3L02A 2ZM6B 4V02A 5GV8A 4IFBA 5BSWA 4JP3A 1XI2A 5GAJA 1XIVA 2VDLB 1U1GA 2ISQA 2VXBA 5CMLA 1WNFA 3C3PA 4MUIA 3UTDA 4M89A 1KJZA 2FK7A 2XSZD 4UTOA 2CXRA 2XCQA 1H22A 1A98A 1VBKA 3P52A 4KRGA 5CTAA 3WNBA 4ZCRA 2ZATA 3HY3A 4XJVA 2V3VA 3C5CA 5C37A 4MHSA 2ZU0C 1V39A 2YS6A 1T25A 1MCZA 2HHJA 2QLJA 3TDNA 4D97A 1M8GA 5KNLA 4AF7A 4MGHA 4C0SA 5FXMA 4JB2A 2IOFA 4BIIA 1FUYB 3I6ZA 4GNKA 2Q27A 1W93A 3E15A 4JCCA 3GLHA 5FULA 4CEHB 4G2TA 3O4HA 3ETGA 3NC4A 3UB3A 1AGXA 1PG2A 3VI4B 1ZUD1 2AH5A 4BMNA 2C5SA 2NXEA 3GRUA 1U8ZA 5AHOA 2W48A 5L7WA 1S2LA 3BAZA 5CFNA 1QO9A 3JASA 4ZVRA 4DA4A 5JBIA 2NU9A 1UF9A 2AJBA 2NACA 3FZNA 1DI0A 5HKKA 1QC5B 1CRQA 1JQAA 2BLLA 4KAXA 5FAXA 5HIIA 4EJ6A 2G80A 1AGRA 2P6NA 1T8WA 4QUAA 2QYTA 3AY3A 3JQGB 2JD1A 2IV7A 3DOEA 1T1EA 1IXYA 2FB9A 4EKEA 3LL7A 1LNZA 1LY1A 4IO1A 3U7IA 2GM4A 3KU1A 4X00A 2JBAA 1E58A 2Y2UA 4JGBA 3BCRA 4OKNA 1CIPA 2B5VA 3BZWA 3KT6A 1GVNB 1WB4A 2BHLA 1GR1A 2F43B 4TXJA 2NZJA 4FK8A 4BVBA 3ZGOA 5K3DA 1ZGGA 1LEHA 2VHXA 3SBXA 5KTMA 1EA7A 1WXWA 1GQQA 2HL6A 1JJBA 3CRNA 4OQFA 3ROXA 1E79A 2PCLA 3AHIA 5BOVA 3EDMA 1C7JA 4OHKA 2IHJA 1DEOA 3FNGA 2ZUCA 4FYVA 1NJ8A 1U6IA 1VSQA 2N9UA 4HJRA 4LHYA 3LVQE 3IAUA 1N2XA 4Y7DA 5IDVA 2VTBB 4BNFA 3E3NA 4IM7A 4JVMA 4R1QA 3UT6A 3JD3A 1AZTA 4FLMA 4X1IB 5KVAA 4F2GA 5K2MA 3ZCVA 2YXEA 3D3KA 1ODSA 4ZHQA 2VJOA 5A05A 3FDFA 1LK0A 2GN2A 3KHTA 5AVKA 5CFOA 1USIA 3H6HA 4MLCA 5HOQA 3NOVA 4H6PA 4QSMA 7YASA 1B93A 4DQUA 3O4RA 3S44A 4AVYA 1W49A 3QKIA 2NADA 1SPBS 4UZEA 1AQJA 4LMRA 3HLYA 5HK8A 2JVJA 3TLMA 4CMIA 3AY0A 2QQ5A 2JFOA 5KTPA 1YJQA 3VKGA 2QOEA 1P9NA 1WM1A 4WOKA 1A5SB 5HQ3A 4G5YA 3FKSA 1C0IA 2X1VA 3AUFA 4ZT5A 3EWSA 3VO2A 3QFFA 1PZHA 3VQTA 4HT3B 4ZDKA 3U44A 4B48A 4OO3A 2B4YA 3PQ5A 1WZ2A 1DBRA 4EGFA 4TRRA 2PIAA 3TDKA 4J29A 1UZLA 3BB4A 1QSGA 2O7QA 4XWTA 1O54A 3CNLA 4RV4A 4AWAA 4B46A 1MC8A 3DTTA 2X5KO 3EW7A 3TR6A 3CUYA 4FIDA 1PSZA 4ROTA 1ELOA 4LGVA 1LSUA 4LVCA 2V9ZA 3FKJA 1II8A 3OZFA 3PNMA 4RPLA 3MYRA 4AQDA 4RY2A 3RYCB 3B38A 3VRHA 3S70A 3FSRA 3GGGA 4MUHA 4HH1A 4D3ZA 4Y2PA 3GUUA 1K2WA 5KNBD 1FDTA 3D3WB 5TDHA 1GCAA 1NVEA 3EVEA 4HDKB 3BJEA 2IPOA 2GJSA 3G5UA 4S04A 1AUQA 2V4UA 4M98A 4O6VA 3QYFA 4FMBB 3SEQA 5HOEA 4LF6B 1E3EA 2RHRA 1TAHA 4M9UA 1FBTA 1Z0SA 3DVAA 1LK7A 2P9TA 2ZIAA 1NF8A 3WRXC 4R5MA 3F7MA 3U13A 5AD1A 3T1TA 2QJTA 3MLAA 4L4YA 4NK5A 4GT1A 5TVGA 4IW3B 3M70A 4Y1GA 5JNTA 1K97A 3DOFA 1EUYA 2YV5A 3ENKA 1V9CA 5FBQB 4L9RA 3OUZA 1WXDA 2ODPA 2QJWA 3QVWA 2X6TA 3K9FC 4JI5B 4N41A 3ETLA 5C8YA 1HZZC 2HO4A 3HFJA 3ZDRA 3ZXUB 5ITWA 3LYUA 5ENDA 3EMVA 3L9XA 3D7LA 3G9ZA 2AOUB 4S1PA 4Y2VA 2HBYA 4NAVA 3WRYA 3R7SA 4TMTA 3TOCA 3IAM1 4LYFA 4ERXA 3EZNA 3X3HA 4LHXA 3UFXA 3B1VA 3FR7A 1TTQB 4P84A 2CGEA 3BCUA 4UBJA 1WLYA 1ZN9A 2BFMA 3T7AA 2VZLA 4DCSA 3Q87B 3QX3A 4QTZA 3HN6A 5LP6A 3DF7A 4TLDA 3SHQA 2D0PB 3DJFA 3QP9A 1WVMA 3FWKA 2ZIEA 5KNDA 3VHXA 3K30A 4BP8A 1E2MA 4PZEA 2AMVA 4DLNA 1TMKA 5K3AA 3SDBA 1VTKA 4TS9A 4MV4A 4KR2A 2LD4A 3V9PA 1U8TA 1T3ZA 4QICA 1IOVA 1SBYA 2RJOA 5UKDA 2DHEA 3ZV5A 5D6NA 1CUGA 2X0EA 3VZSA 5CG1A 3M3HA 5DTJA 1CBUA 4HOYA 1YBVA 4P0TA 4PG6A 4HB0A 1DAGA 3WNCA 1M6YA 3R3HA 2XE7A 5CLGA 3ZTWA 3C4JA 1K92A 4I14A 2Q0SA 1WDMA 2XA1A 2ZSJA 1SD2A 1JBQA 5CLHA 1RJWA 4YP9A 4X60A 4NHOA 3ABZA 2JHGA 3EDRA 1BYIA 4D9BA 3T7IA 2PJRA 4HAVA 3ICCA 5L4NA 3VNSA 3L8GA 2ZANA 2OBYA 3SD7A 3C5EA 4IH1A 1GLVA 4A1OA 3JWPA 2FWAA 1S4QA 2GBGA 5D51S 5DNEA 3WMGA 4MRMB 1BX1A 2QZJA 1LBEA 1YOVA 1VL1A 3AKDA 3O03A 4K7JA 4G1BA 4KGDA 1M7BA 3G6WA 3GFOA 3HR4A 3NW9A 2P1DA 1K7XB 4M0EA 2ZRFA 4PLGA 3HBNA 1U94A 2VQ3A 5HYVA 3THRA 3E2MA 3BD7A 2POQX 1IN5A 1QHEA 3E81A 3ZQUA 2Z0MA 4ZPXA 4KQIA 3TDMA 3I2GA 2YOGA 2B94A 2Q4TA 4F4FA 3NJ8A 6PFKA 5IHXA 5B3LA 13PKA 3CUTA 1UOOA 2QYSA 3M3PA 1RYMA 4MI3A 3T99A 3WLMA 1X1QA 3WAKA 2JZCA 1PZMA 2GA9A 2XSZA 2B1GA 2ZT6A 4YAWA 4EG7A 2OGZA 3WYFA 4PSCA 1W4ZA 2OCPA 4BE4A 1GL7A 2H5LA 2Q6OA 1VKRA 3CX6A 5JZSA 5FPSA 5KKNB 1WABA 3A6DA 3F6SA 3FUUA 2XWSA 1N9ZA 1IUPA 2YIMA 3PB3A 1KMQA 4QSHA 2XDYA 4JT4A 2REXB 2OVBA 1YA6A 3ZGZA 4JBIA 3QUSA 3VX3A 3VR4H 3IEPA 3VNQA 2GTIA 3H84A 4PBRA 1TVKA 5DOVA 3B12A 3R3VA 4GL4A 4HRXA 2W6MA 4GI1A 3VC7A 1Z4IA 3TLZA 3FNEA 1OYVA 3C3DA 3AM3A 2C7QA 2SHKA 2G0TA 2RGNA 3GVPA 5AH0A 3JAMA 4LHSA 1Y3HA 1ONBA 1YB6A 4INOA 5L9AA 5DH9A 1QQAA 3T7CA 3T7EA 5KDOA 3WSTA 1ZO8A 2BH2A 5ALZA 3O4JA 5JFOA 4U7GA 2Q6IA 1E98A 4C07A 3AG6A 2ZG6A 3WGVA 1DAMA 3MMSA 3ZU2A 2HA7A 3COZA 4GD3Q 4DPLA 4GZLA 4FB5A 5AVYA 4N7MA 4DMFA 4PC6A 4CIAA 5JFGA 4KFUA 4MPPA 3WGQA 2QTCA 3RASA 2A0WA 3SEAA 1M66A 2W43A 4GR5A 4M9XA 3CNQS 4TTSA 3P1JA 3WDLA 1IHOA 4PLYA 4LCBA 3WJ2A 3LUAA 3W1EA 3NOOA 2HBQA 2WZDA 1PR1A 2AFHE 3KALA 1EWQA 1GV1A 3RSCA 3HCBA 1UXHA 3GN1A 4KH0A 1Y1RA 2C7PA 2AXNA 4G01B 1U5CA 1FXUA 1ZEJA 3GYBA 1V1JA 2NP6A 2Y9MB 3G82C 1Y3CE 2ZVPX 1DLIA 3P9ZA 2ZR9A 3DE0X 1G41A 5SV2A 1ZM4A 3G89A 3DVSX 5T64A 3UMCA 4ISCA 4EW2A 2D1RA 3QI2A 1C2YA 1XL1A 3HA7A 4P9NA 4Q7LA 2H1LA 4DJEC 5KMGA 3KDSE 1H9AA 1RPTA 3STTA 4GXTA 3ZVLA 4AJ2A 4G41A 4F38A 1ZCAA 1GAJA 1QIIA 3SWWA 5A06A 4B32A 5JAMA 4IIBA 1P33A 2Y68A 5CNMA 3RWMB 4B2IA 4AFNA 3EA5A 2C8VA 2ORIA 2YJ5A 5CPFA 1DNPA 1CRLA 2FH5B 4HDNA 5ULLA 2VIIA 3R76A 4YXWD 1IBMB 4WLNA 2A92A 3T1QA 2EFGA 3GJXC 3DA8A 3UK6A 1P5RA 1W0CA 1FP7A 2W6OA 3GPBA 4J0QA 3A1WA 1BFDA 1XZMA 4N39A 4AP6A 4JT8A 5JAQA 2Q5LA 3PE6A 4G07A 1NMQA 1Q3HA 4YR9A 3F67A 3OEWA 1E2EA 3GUHA 2IY9A 3NEYA 4XJSA 4OP1A 1DXHA 3RYHA 4U3JB 1CJMA 3F4BA 2QYOA 3PE4A 4BJ5A 2ZM5A 5JATA 2H2IA 1FFGA 4KSBA 1H2BA 1KGDA 1GSAA 2HWUA 2OY0A 1XZGA 4V0RA 3RLFA 1GRQA 3URMA 4B34A 3LDUA 3IMEA 2VNHA 3LCVB 3NHFA 1PZNA 3PFKA 2OGTA 4D5EA 3NHPA 1XWFA 1XZ8A 3AUJB 3FHCB 1CS4C 1OLUA 1XXHB 3R4CA 4MJXA 4UHCA 1MJHA 1U1FA 2Q1UA 2Z2JA 3MZ0A 4HLQB 4RIIA 3TCXB 4Z4CA 4K3UA 1OLXA 1X19A 5JNVA 1Q1BA 1RI2A 2VDWB 4JHXA 4AUKA 1CQWA 1RBYA 3BRWD 5JSKA 4HJXA 3S2GA 4I6JA 4M9CA 1GARA 2IZ7A 1P2FA 3ENWA 3N2LA 3UHOA 2QNRA 5KOIA 2NNLD 3VYRB 4FJ0A 3RREA 1JL3A 4MB6A 4MQBA 4N54A 2YVLA 4OF4A 1MH9A 5CW2A 4U2FA 3U61B 1DBQA 4IYRA 4R2IA 4GKVA 5FBWB 2K7ZA 1E64A 2VRCA 4EELA 1W4BA 2V03A 4KKXB 3DPUA 4PG7A 3E27A 4HNRA 4N0QA 4O2BA 4OLHA 3ZDFA 1O9GA 2L17A 3AP1A 4NOMA 4XX0A 5A0FA 4EI7A 2C82A 4M0MA 1ZISA 4MS1A 4PIVA 2HF8A 4WBXC 4A2PA 4BMVA 4E2FA 4RELA 2IXEA 1ZY2A 1LI5A 3IUMA 1Y89A 4NCXA 3ZHQA 1KZ9A 1ZNQO 5BNWA 3FIUA 3PUIA 1FS4A 2UYOA 2VF4X 4G1UC 1G3IA 4ND7A 2C2GA 4FCCA 2H6EA 1RWBA 1C9NA 1LNSA 1KARA 2WE8A 3GGDA 2QN3A 3N3AC 5C8DA 2YWBA 3SE0A 5BW6B 4GPZA 1QGOA 1ONNA 3M6AA 4KPUB 1BMTA 2AW5A 5KQSA 3T3EA 3RWBA 1WUHS 1SVNA 4FOLA 3IAS1 4W1QA 4YDQA 4KNWA 2IP4A 2LNDA 1SCBA 4WERA 4S2UA 3P27A 4GHWA 4XRGA 2XE4A 3UMMA 5GV7A 2OVFA 4LV8B 1F0PA 5B58C 4LF9B 1EGAA 1ZOPA 2J7PD 3E03A 5SYNA 5CYFA 5AJYA 3NIBA 3BMOA 3TFOA 2YZNA 1EBUA 1RWKA 1W94A 1SRQA 2EBUA 3AHJA 4UM5A 1MC4A 3N7AA 4W7HA 1N2EA 2V7BA 2ZYSA 1BQ3A 3ZEIA 3CPSA 2JFGA 4YECA 1X0XA 2NO7A 3NUZA 2GK7A 4NU5A 2A9OA 3RV3A 5HIKA 2V1UA 1H5UA 4PN3A 4IZ6A 3G5LA 1QZUA 3FD8A 5L3SB 3DW3X 3UXEA 2HBRA 1JHPA 2HC9A 2P2ZA 3PKIA 1RJ9A 4XEHA 5JDIC 4FIZA 3H9UA 1RKVA 1M9NA 1JXQA 1QOQB 1SWVA 1ABEA 1COZA 1Z6YA 3NBYC 4EO4A 3KQLA 2CLEB 4C01A 1WL8A 2WY2D 1K7CA 4G37A 4DT1A 4DQLA 3TSOA 4ALJA 1G20E 1N92A 1Y8QA 2RGXA 1GTVA 4ZGWA 1D07A 5EJ4A 4FSXA 2CE7A 5A9RA 1HDYA 2CMHA 4Z9FA 1Q1ZA 1A7KA 2ZUVA 3WMRA 1YZYA 4BE7B 2O5CA 2GA8A 1NMXA 5FOSA 3P9YA 1UQRA 3F2VA 3IESA 4M1EA 2ORVA 3I5AA 4ZAWA 2PZEA 2WSBA 4PM4A 2ZBVA 1ODCA 1DUSA 2J9YB 1M2HA 1U0TA 4TM7A 4E5MA 1MX9A 3WAGA 2X6RA 4M6WB 3FPCA 2PX2A 3FVTA 5FFFA 2QD2A 3MUFA 3EWIA 2ZXUA 3MXTA 1EP1B 1U0FA 3VU3A 1X7WA 1KAHA 1WVGA 1XCGB 2ZETA 4D56A 5IDXA 3URKA 1OFUX 1YMVA 2ZBQA 3LXRA 3HYTA 1QIJA 5AK0A 3CZAA 4J07A 4DSZA 5ICEA 4OHOA 1E4OA 3Q1KA 1WBBA 3E35A 5D3QA 1ADBA 4AULA 3PEYA 3C7KA 5M34A 4MB0A 1EK1A 2ZRPA 1HEUA 1KS2A 2CUNA 2XNDD 1QRUA 4TROA 1FUEA 1B7GO 3Q8MA 1IM8A 1ND5A 1NULA 1UFQA 2ZJAA 4PPQA 4TL8A 2P9EA 1L3IA 3VJLA 5J23A 4LQLA 5AI6A 4D6YA 1NW7A 3PVCA 5AESA 2GT1A 2EV9A 3PQ4A 3H97A 1DQSA 3QVKA 1NATA 1N2OA 3V1NA 3OA2A 2BCJQ 2Q5CA 1VMKA 4ZRNA 5E9QA 2GVDC 2FPGA 2X2PA 5LWHA 5EXPA 4Q47A 4Y7CA 1SVKA 4OHBA 3A1DA 1QANA 4UNSA 4RMIA 1NOIA 3IOMA 3H42B 1SOMA 4KLCA 2Z8YM 3TRKA 3U0BA 1Z4OA 1KU0A 4KQGA 5BR8B 2IXGA 4GU5A 4IUBS 4MICA 5A5GA 2HD4A 2DUMA 3I12A 5A71A 3SBEA 2I8LA 3W4IA 3T94A 4R8KA 2ISCA 5LNK6 1TF7A 4RTPA 1CS0B 3JS5A 2B7BA 3DWEX 4WA8A 1SIUA 3TLCA 4PZLA 4AMUA 2Y05A 1OAOA 2H4HA 4P0PB 1FP4B 1E1CB 4V3CA 2UU9B 1Z2OX 3UJ3X 1KXJA 1EWKA 2Z9DA 5G41A 3E7PA 2WF7A 1RRGA 4KXYA 2O8FA 2O2DA 3GD7A 4TS4A 1AMUA 3U4QA 5LPNA 3SLRA 5E38A 3UMJA 2P3SA 3FYTA 4UPVA 1HO3A 2ECOA 3EUEA 2CEKA 3IR6A 4ZAGA 3ZY5A 1TK2A 1U8AA 3LUFA 4QDOA 4E30A 1ONPA 2C5LA 5I9SA 3UGQA 2W6ZA 2F00A 1CFZA 2HT6A 2J5KA 4M0PA 2Q3DA 2R85A 2G9QA 2DFKB 1LDGA 4H15A 1YB2A 5AT1A 3Q8KA 1NU6A 5KTSA 1HNNA 3EF1A 2F1OA 3KUDA 4NCIA 4TGLA 3X1XA 1S9DA 3KUKA 3V4OA 4Y1RB 1W48A 1YKFA 4W9RA 4S1OA 3ZQ4A 1KWGA 2IYEA 5T4HA 2N46A 1XKXA 2GNAA 1YGYA 1VE9A 1SCNE 1POXA 2OHXA 3FTCA 2H7YA 3GLVA 3OZIA 4Q00A 5T41A 1HMYA 1KHHA 2NSLA 1KEWA 4A5SA 2FMHA 2AW3A 1BO6A 1C0PA 4RSGA 4RVSA 5LDHA 4MV8A 4B2LA 1JAHA 4PC7A 2GPAA 1UPAA 2FEWB 1Z2PX 2NAFA 1VIAA 3F7TA 4L8YA 4OKSA 5M04A 2XGMA 4OB7A 5AYVA 2MHCA 3EZ7A 1MO2A 4ZGGA 2CFSA 3HJAA 5DX0A 3S2ZA 2ZBEA 4YQZA 3N8KA 3TTTA 1WP9A 1BYUA 2OMKA 3AEQB 2VDJA 4ZVVA 4TN5A 1Y5RA 3EZFA 2X9GA 1JDSA 4BJ1A 1QIGA 2BFFB 2LZ0A 5TQ2A 5DYNA 3WLPA 1YBAA 2H0QA 3HDHA 1B6RA 4QAJA 4QBTA 2WIAA 4E07A 2C0CA 4Q3NA 5CBKA 1GN8A 4D3YA 2QTMA 2F1JA 2GOYA 3OWHA 2WWRA 1H6AA 3M2TA 1Q95A 4GNRA 1E3LA 2F3QA 3L6UA 4RTLA 4ZQBA 1GYRA 2RGUA 1M2OB 4Q1EA 1OROA 5EPOA 1H3EA 1IYZA 3IOBA 3U7JA 1O9BA 2OC9A 2Y1EA 3DYVA 3OLQA 4MQFA 4P3KA 3U80A 1CWUA 4F3YA 4Q6BA 4ZOBA 2JGRA 3IBGA 5BOSB 4GXQA 2DOKA 1K1EA 1NXTA 1KAEA 2JHFA 3AVWA 3UB4A 5EZ6B 1ZJYA 5G2OA 4FFBA 3TCKA 3WQQA 4U2EA 1YDMA 1KNXA 2ADOA 2Q7OE 4COOA 3R7NA 4NS1A 4CKWA 3SQXA 4AKHA 2QB5A 3MRTA 4KAJA 4KWIA 4G4IA 3QOFA 1PSDA 3MGGA 1DOHA 2ZI6A 3E3LA 3FRJA 4K9OA 4UMEA 3SXUA 4M2LA 2JFBA 3WZLA 3ZE6A 3ZWYA 1BMFD 4DV6B 4H9GA 1W30A 1TT7A 2X4IA 4F6LA 1TLTA 3H2IA 3ZK8A 3DVLA 1CKEA 1O97C 1V6SA 3SX2A 2Q5OA 4D9EA 3K31A 1OYOA 1XZBA 2O7RA 4MRVA 3RSGA 1XEFA 3U48A 3ISJA 1M83A 4J3NA 1N5MA 3GLGA 1VXRA 4QU8A 2RJ3A 1YONA 5DLYA 2XCRB 2XUPA 4MUMA 3KTFA 3T61A 3W2IA 3QLUC 4CM4A 3Q85A 1G5TA 2H52A 3M4ZA 1UDXA 5JS8A 1FYXA 2X1MA 4A03A 4AZSA 3Q3EA 3U16A 2ATCA 3WRXA 2VJYA 3BL8A 1ODLA 5BSVA 3UICA 1AMNA 1FNMA 1GPH1 5JYCA 4DMKA 1LVHA 4M1WA 5LZ9A 2WJ6A 2IYSA 3FH0A 1JLKA 4LOAA 3QFTA 2HSJA 3PU6A 1WOYA 4IFTA 3WZMA 4F9EA 1K4KA 4YR7A 2J85A 3RQSA 3ANTA 4BFYA 1PBNA 4HG2A 4QGBA 5BMVF 1QE5A 2B37A 2FOIA 3HA3A 3IQGX 1U5BA 4REOA 1HZZA 4G8BA 1DC5A 2R1UA 5LLDA 4DB2A 1Y9DA 2HLHA 2HMTA 4RQUA 1GG2A 3N2KA 1KJNA 2QRVB 4RZ3A 3HVRA 2QQ0A 4KWEA 5JCOC 2WFLA 5CB6A 4EJ0A 3JWJA 3HZHA 1FQWA 2FEXA 3ILSA 1AS0A 3KU4A 3LC0A 1ULUA 1Z0KA 5JQGB 2VT6A 3H1EA 3K0EA 2NVUA 1ECGA 3IVGA 4L7QA 2ONZA 1ULHA 2GAAA 2HUPA 3OWXA 4YXFA 5KNCH 5BRJA 1BS9A 4RVUA 5KOHB 3FBTA 4L9WA 3LRXA 4KXXA 3VR0A 4F4JA 1AO0A 4CG3A 5FR2A 2QGFA 3BE8A 1CE8A 1FSGA 2C9YA 2W4MA 2B1JA 4KGVA 4ZTUB 5BSFA 2WA1A 5BXQC 3K5HA 4F5DA 4E2WA 4J43A 1YR2A 2PGXA 1ZUNB 3SYRA 4Z7QB 3ZLBA 2WSMA 4LISA 3T4XA 3J81A 1NVTA 3TS1A 3UK2A 3B36A 1S2DA 3FUCA 3QU4A 5C8YF 2O8DB 4WKBA 4L0MA 5BR1A 5C5EA 3HXTA 4QDKA 1PR2A 4NSNA 3O26A 5DIZA 5AW5A 4ZK6A 3FY4A 3UY4A 2J3DA 2WABA 3EISA 1DZIA 4KVAA 1UM9B 5ELXA 3DL7A 3ED1A 2Y0CA 2YRFA 4YRPA 1NRJB 3MJVA 4LDZA 5H70A 2Q6LA 4PLFA 1IOWA 2ZXEA 3E48A 3I04A 3V1TC 3G2IA 2FF7A 2Q2VA 4FNMA 4N6OA 4QWWA 1O03A 5C8ZA 3OIVA 2EGHA 4J1NA 1KGSA 2GK6A 3AVOA 1U2TA 5AI9A 3PTZA 4ENRA 2V58A 4RHCA 4W1SA 2M2IA 3QZUA 1Q0PA 4TXLA 1ZGBA 3K8OE 4FUQA 4TZTA 2QK4A 5GJBA 2PQ0A 1FRQA 2XUQA 2FUG6 3AEUA 1JRLA 1E3SA 1QH8A 3OSUA 1JJAA 1UMDA 2EEZA 4XSGA 3JZAA 1X92A 2FKAA 2IW3A 1MH1A 1NBME 1EHCA 1GFZA 1CUUA 2VHTA 1MJGA 1EAMA 2O23A 3TSYA 2XBLA 4E5YA 2OZPA 1EUQA 2O8VA 2J5RA 2A4KA 3M9XA 5TR9A 2O0KA 3BRCA 3ROKA 5E3JA 4EH1A 5I48A 3VBEA 1LPOA 3PXXA 5CU7A 1MAAA 4QKQA 3SQDA 1WB9A 1PLJA 4BLOA 1AA9A 1QWSA 2UUOA 4NMWA 4WCFC 4BZPA 3SR0A 2E82A 2DWCA 3HV0A 1BEUB 4IXTA 2IUEA 3KOWA 3MTQA 4PS0A 1JIXA 4F3KA 3C16C 3LWZA 2ZDGA 4HQRA 4UBLA 1SUDA 2ZULA 3BG5A 1D0IA 4G0MA 4F21A 5K03A 3A1EA 3IDSA 1P0MA 3M33A 3V8QA 3LLSA 4L4SA 1QK3A 2BOVA 3FUWA 1TW2A 4YX9A 1T2VA 2I2XB 5ADHA 5I9NA