4BV3A

Crystal structure of sirt3 in complex with the inhibitor ex-527 and nad
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 91
structure length 270
sequence length 270
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bv3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bv3A01
4UUAA 4MZXA 5BWNA 2NYRA 4RMGA 2C31A 1YHZA 3LQ1A 2FN3A 1N0HA 4HDAA 2UZ1A 2VBFA 5K2OA 3CLTD 1SZDA 2AG0A 1OVMA 1S7GA 3HWX1 4COKA 1U2DC 4BVHA 1U28C 1PNQA 2JI7A 4RJKA 4RMHA 2H4FA 4F56A 1M2GA 2FSVC 3F6EX 5D7NA 2JLAA 2Q28A 2Q29A 2H2GA 4JD5A 4KPUA 1UPCA 4FVTA 4RJIA 5K6TA 5MFPA 1Z8NA 4F4UA 4X3OA 1PO7A 1YBHA 1YHYA 2H2HA 4GG1A 3ZGVA 4JUFA 1PNOA 1J8FA 4BUZA 4ZP1A 1YC5A 1UPAA 1T9AA 2A1UA 3EYAA 4BVBA 4KGDA 3ZGOA 2FRDC 4BVEA 4V1CB 4C7BA 4MPJA 4JT8A 2JLCA 1Q6ZA 1JSCA 4UTNA 1ZPDA 3CLUD 2AG1A 1BFDA 4O8ZA 2OD7A 2V3WA 4ZZIA 4GM1A 2HJHA 1U31A 2EZUA 2H4JA 5EJAA 1D4OA 4FZ3A 5BWOA 5EJ7A 1V5FA 5DGTA 3GLSA 4FEEA 4K9PA 2VBIA 5EJMA 2JI9A 4QQ8A 2IHUA 3K35A 2NXWA 1YC2A 1T9CA 1POXA 4BV2A 4TWJA 2JI8A 2PGOA 2VK4A 4K9QA 4K9OA 2VK8A 2H2FA 1M2KA 3RIYA 2WVAA 4GPEA 4QPZA 4D5GA 4BV3A 3EY9A 2OO5C 4BVFA 3E9YA 2OORC 5EJ8A 4I5IA 1XLTC 4K9NA 4X3PA 2FR8C 4MQ5A 3GLTA 2DJIA 4FEGA 3IAFA 4K9MA 5MGNA 5K6RA 4JU8A 3D7KA 1OZHA 1MCZA 4JUDX 1E3TA 4MPPA 4G1CA 1Q14A 2JI6A 4GM0A 1YI0A 2Q5LA 2Q5JA 4HD8A 4UTZA 4V1CA 2H2DA 1OZGA 1V5EA 1YTLA 1M2JA 2X7JA 2IHTA 4L2IA 2QQGA 4KXQA 3OE1A 1U2GC 5DEIA 2UZ1B 4V1CI 4JUAA 4RJJA 4D5EA 2OD2A 5DGDA 4K9LA 5AHKA 3FZNA 5MF6A 3CLSD 1T9DA 3U3DA 4UUBA 3D4BA 4BN5A 1PT9A 1QPBA 2WVHA 3ZG6A 2EZTA 4JUCA 4Q9DA 1S5PA 2OD9A 1M2HA 1PI3A 4L3OA 4R8MA 5IMSA 4RMIA 2Q5OA 3GLUA 1O96B 2W93A 3CF4G 4GP9A 4K9KA 4BVGA 1EFPA 2FWNA 2VJYA 2PANA 4Y6LA 4Y6OA 4J16C 4BN4A 2A1TR 2WVGA 2JIBA 2PGNA 4UTVA 1PVDA 1MA3A 4JSRA 1T9BA 4IG9A 1EFVA 1NM5C 2EZ4A 4C78A 4IAOA 1O97D 2QQFA 4GM4A 2H59A 1YI1A 3PKIA 4J1TC 1Y9DA 2VBGA 4RMJA 1V5GA 4UTRA 3D81A 4UTXA 1M2NA 1DJLA 4QELA 3HWWA 5MFZA 4JU9A 4UU8A 2Q27A 5BWLA 5EJ6A 5EJ9A 4JT9A 1Q17A 4IF6A 1YNOA 1PTJC 4JUBA 3PKJA 5FYQA 3CLRD 4MPRA 3FSJX 1ICIA 5EJ5A 2EZ8A 2H2IA 3U31A 3GLRA 4TWIA 3RIGA 1SZCA 2H4HA 5EJ4A 2BRUC 1UPBA 3PDHA 2VK1A 1Q1AA 3FLMA 5FEMA 2B4YA 1HZZC 1OZFA 2Q5QA 3F6BX 4UU7A 4Y6QA 2IHVA 3EA4A 3JWPA 2EZ9A 3JR3A 5K3SA 1PYDA 1POWA 3IAEA
chains in the Genus database with same CATH superfamily
3R5XA 5DNWA 2BM8A 4L4RA 1NBOA 3UMBA 4G5QA 4RD3A 3AF6A 2FN3A 4H1UA 3VPDA 4A92A 1RQ2A 2H7YA 5K2OA 3B8EA 1FE8A 1JXAA 4D80A 2G5CA 2C9DA 1H1TA 3H7AA 3GFPA 3E23A 3KS9A 3REFA 3OJFA 4EM6A 4REQB 2NO5A 2JGAA 4NYIQ 4UBIA 1FA9A 3EA5A 3WLMA 4CMHA 2O2IA 3EXHA 3PPXA 4M87A 3DPSA 1Y1SA 1MW9X 1XQ6A 4QOEA 5ARDA 1Z0ZA 3UPDA 3HCPA 3ZCSA 1CNEA 5LD2B 2J4DA 4L50A 4LVNA 4BVKA 5HM6A 4OHCA 4DLBA 3KOZA 4YAGA 3OQHA 1P62B 1Q95A 4GS5A 3KKNA 4QDJA 3BE8A 1WQ3A 5ALSA 1JNYA 5BN4A 1JEOA 3AF0A 1RI5A 3I2HA 2AZXA 1PSZA 4O2LA 2PKRA 3WIBA 4ITRC 1OWOA 5H68A 4DKJA 3MCVA 1JHQA 1QIHA 2OBMA 2XITA 1WZCA 2JZOA 1NX6A 3LC1O 4IQGA 1F2TA 4FMBB 2CD9A 4KDCA 3UGQA 4F46A 5JSZB 1KAQA 1T9CA 4TWJA 4LDRA 5CH3A 5H5JA 1QH1B 2NT3A 3C1AA 4AF6A 4AX4A 1ICEA 4MUMA 1FFWA 1Y7IA 4L22A 1GCUA 4MIEA 2A7XA 3OQNA 4ZCRA 2AEJA 2Y1OA 1NJ6A 2AEFA 4UCWA 5HPYB 3OCCA 2GF9A 2QP4A 3VNBA 3UAXA 3WIDA 4HFJA 1Q20A 1DIHA 4FWTA 3UUEA 2QM8A 4LXQA 4QHSA 2VQFB 2JHPA 4Y18A 2OYRA 3PGVA 3MXTA 2Q9AA 2WABA 4F21A 2HH9A 4AP5A 4INZA 3ZWVA 4C06A 3QLEA 4ALLA 1R16A 5REQA 4YCSA 1JTEA 3FDZA 4KHPB 5DGDA 4NCAA 4ETMA 1FK8A 2IWRA 3WC4A 3M1IA 3T7EA 4KTVE 3K9HA 1E4YA 1EHCA 4KMMA 3DVQX 4R2MA 1MFZA 5JTUA 2FZ5A 2AFHA 3TFOA 3OZDA 4RVNA 5CT9A 4AK9A 2XOEA 3DCNA 2PIAA 3CE9A 2WFMA 1EVLA 3KLBA 3GW8A 3DFIA 1TM1E 5F5NA 5JO9A 3ZVKA 3OWOA 5HFAA 2YS7A 3D4OA 3ESRA 2I34A 2PUTA 3F3YA 3QE3A 1IUKA 2FAXA 4UQPA 5FI1B 3MYYA 3V8BA 3H9CA 1G0NA 3PNYA 5C0OE 1UKCA 3LQYA 4NOMA 2WSSD 3R0ZA 4NHEA 5KYNA 3PS9A 4J9VA 4NCIA 3TOCA 1V5IA 2FK8A 3A4IA 2ZRKA 4OBBA 1PFQA 4LYJA 3VU1A 4A4DA 2HIAA 4Z4EA 4LZNA 2MYPA 4OAOA 3BMOB 1J1UA 4IMPA 2ZM5A 1L5NA 4FMPA 1JLKA 3ITKA 1T2CA 2IHJA 1OLUB 1P0PA 2BELA 2JNWA 1SVUA 3DOOA 3TLBA 3DKPA 4JBLA 1YA8A 4WZZA 5E8JA 4DDUA 3UEOA 5I7WA 4EITA 5ER9A 2XDQA 2WF5A 1JXQA 1H6CA 1K66A 4MAMA 4RD2A 3ZZUA 2IEAA 3IJ5A 4OK5A 2FWMX 1QFJA 1KJ8A 5A7FA 1JEDA 1Y42X 2O2YA 3CF6R 4GFDA 1YZTA 1K5PA 3BHNA 3NWJA 3OZEA 1C1HA 4JSYA 3VSAA 1QG6A 3CU5A 4B8YA 1EA7A 2GFQA 2XQIA 1OTHA 2ZTUA 4WKCA 3BN3A 3QFRA 1K75A 3LHIA 2V7XA 4WOPA 3V9PA 1U6IA 1N2XA 3FGNA 4HRXA 4P4UA 5CFZA 2WJGA 1FF9A 4MV0A 3U4IA 2OPBA 2QL5A 4BGIA 1PFVA 1GPJA 4G5SA 5TMBA 2GAAA 2QTVB 1PHRA 1R9JA 3BRWA 3G8CA 4LVOA 4POAA 5BP7A 1GUFA 3PI7A 5ADVA 5L3ZA 4MQ4A 1BAPA 2Q45A 5HKKA 3UJ7A 3TZHA 4C6HA 2VHXA 2W6ZA 3W2TA 1NATA 3B1KA 2HN9A 2WKQA 3PNMA 1AUXA 2C5SA 4OQEA 4V0OA 4Z1MD 5BSFA 5CA0F 3HUDA 5M29A 2AK3A 4KO3S 1D5CA 4DGQA 4NJEA 2PX8A 1L6RA 3L7YA 4M2LA 5C31A 5F77A 1ECGA 3U9LA 1S2GA 3EVFA 4RF2A 1VBNA 2YJ3A 1DAMA 2N47A 1SCKA 5CDFA 4TKUA 4BMVA 2GEFA 2I55A 1NIPA 4KE6A 3QUQA 1D1SA 3ENQA 3TQIA 4I6EA 5DGHA 4OHZA 1X1CA 2JF0A 5FAKA 1CUFA 1ZC4A 3HJHA 1CQPA 3GI1A 4Y2VA 4DREA 1EFLA 1ZW1A 2BBTA 1G38A 2REQB 3MJDA 4GXNA 1DOHA 5F1YA 1TMKA 1R5OA 3MRXA 4QO7A 4OMUA 1D2CA 1JHXA 1H23A 2JZNA 2OK8A 2PS9A 4AMUA 4DMFA 3I4LA 4QYWA 5HRCA 1ZJYA 4YP6A 3RTEA 2RHTA 4XWOA 4LBZA 3S81A 5T5QA 1J99A 1II0A 2AF4C 2PKYX 1T26A 1T5OA 5CUQA 1C14A 3DWEX 4XB2A 2CLFB 1NMXA 3UQYS 2G4CA 4X3PA 4H3HB 4KK3A 4WXHA 3S2YA 1KBQA 1NYRA 1XZIA 4NPCA 1KQ3A 3HR7A 1B6SA 3IHTA 2K4MA 1ZNYA 1X42A 5JCPA 5KC9A 2GEDA 4CKWA 1PZFA 4FX5A 2C0QA 3WX0A 1M34E 3FBTA 3H1TA 2ZJFA 3HJCA 3I6ZA 4FGZA 5EP3A 5GM1A 2ZBFA 1XHFA 2IYQA 2EXXA 1VKJA 2GN0A 1IJFA 1QLWA 3AI2A 4YR9A 2E55A 4BNNA 4KLNA 5KSYA 4M8IA 4PE5B 4BQEA 5IUJC 4RTJA 4DB4A 2WMNB 4B6JA 3VPHA 5JEEA 3NANA 2R85A 3FPGA 1GU1A 2D1SA 2BDUA 2D5BA 3K72B 4S12A 3EC1A 3SYNA 1JDTA 2HWUA 3JZMA 2BBOA 4PYQA 3W8FA 3RBZA 1XRQA 3IJEB 5E2IA 2DWQA 3RVOA 4LV5B 3SX4A 4J4HA 3E0XA 4MULA 4J16C 3O2NA 1IE3A 1ZM7A 1RI2A 5ALQA 5LYJA 2HKIA 2CDCA 4HDOB 2MR5A 3MERA 4HV4A 5BUCA 5CEEA 2X1VA 4LYEA 5A1TA 1WL8A 3CTPA 2PZ8A 3RS2A 3JCZA 1XA4A 3OU7A 1COWD 2C7GA 2WQ7A 2XVXA 1AC5A 4D02A 3E5RA 4JBYA 5B2ZA 1JVSA 3OPVA 4WL0A 4YACA 4IEEA 3ROMA 4EFMA 1KK0A 2QN3A 3HEBA 3PD0A 3FUVA 3TZKA 4KDEA 1Y6JA 4TMZA 3T3IA 3NDIA 1THTA 1ZUHA 3E84A 2AD5A 1GCAA 1OAOA 2QROA 1VGQA 1GUBA 4YRKA 4DLPA 2ZIGA 4MXDA 4ALJA 4E5VA 1E79A 3WGOA 5ENVA 2D54A 2WJPA 3T5MA 2JDID 3GAAA 2J9FA 2OP0A 2IU0A 3AR8A 4XQEA 2Z57A 2O2HA 1NG1A 1EFAA 1CLEA 4PG8A 2VCHA 3D4BA 4ZQGA 3BMCA 3QKSA 2F64A 2DXIA 4MZXA 3WGMA 2GDZA 4QZVA 4C08A 4AULA 5J2UA 1G9SA 1MX3A 2YQZA 3P2OA 3VSBA 3HA5A 5BUSA 4W5WA 5KQMA 1IEWA 1ST3A 2C92A 3BB4A 3KJHA 1PJ3A 3BWYA 3GWGA 3NM6B 3TUZC 4ND2A 2GPJA 3VR4H 1W49A 5PGMA 3H1FA 2QZSA 4YCCA 1C50A 4PX2A 4R2WA 3R0IA 3T9FA 4JZYA 4HRYA 2YMQA 1XZAA 3MWEA 2VJMB 3ZDXB 2PMWB 1IHXA 1P61B 2ESRA 2F48A 2R6GA 1L5HB 5H9WA 1M7HA 2CHFA 3HCOA 5BQFA 2XUFA 1QHNA 3I9OA 1UKAA 1UOPA 2OXRA 1SO8A 1VCIA 1V4NA 3C6ZA 4JJEA 3RS0A 1P9RA 2X9NA 4LSMA 2EKZA 3ZHUA 1D4OA 1CVRA 1U3CA 2ES4A 3WK7A 1SOUA 2EGUA 2FZVA 4HTFA 1IXZA 4PYNA 1IZ0A 1SB9A 3D2BA 5ALNA 3Q0IA 1TE2A 5TRTA 1C7IA 2J0UB 3H2SA 5IYZB 3N39C 1JIJA 3EVTA 3DL0A 1UM8A 1UADA 1K8QA 1XO1A 4Y2TA 4BKMA 3CW9A 3TS1A 1XD8A 4QEDA 1SXJE 1XA0A 3GH1A 2IYAA 4I08A 4BIIA 2I4MA 3G5UA 3PLNA 3I05A 1N8KA 3RRMA 3T9BA 1G8FA 4CLRB 3KXIA 1DP4A 1MO3A 5CT4A 3V1KA 5A1JA 3KEGA 1VBMA 2EJTA 1E32A 5JXGA 2HLHA 2EHJA 3MD0A 3RYCB 2ZUFA 4DN6A 2WYOA 2BE9A 3PDJA 1IUOA 4KU4A 4KL8S 4HNVA 2RHOA 1E2EA 1WU7A 1RKQA 1T8YA 2HQRA 5B3AA 4CF3A 1Q3HA 4L73A 2NYVA 3VPGA 3ZVMA 4YLYA 1T8SA 1JQLB 1XJQA 5HDBB 4EG1A 2VDJA 2ZDGA 4P5PA 1J42A 2GKSA 3WGNA 5JNUA 3V4LA 3QUBA 1KFEB 2GA9A 3F8SA 3LY5A 4Q7KA 5TGTA 2W4QA 3R7WB 4H17A 4I1IA 3CF4G 1QCDA 1H2YA 3NM5A 3DVLA 1N92A 2Y6VA 4JLKA 1UKZA 4O4IB 5JVDB 3F6RA 2WKWA 3VZRA 5U9CA 3HK2A 3OEYA 1QGDA 4JOSA 3LA8A 2GGSA 5IJ9B 4LJKA 1GNTA 4GMHA 2DVMA 1QH8B 4V0NA 4HVTA 3UJNA 1Z2AA 3HI6A 2FSVA 2G9UA 4OQPA 2NU8A 2FUG6 4DR3B 4JNCA 2QTHA 3IBFA 3EMVA 1S1MA 1ZOIA 1R4AA 1SM4A 2P1DA 3KBBA 3ONEA 4H4DA 5DASA 3AFMA 4U2GA 4OGGA 2IPMA 4N0PA 1PS9A 3R3XA 2TECE 1D7AA 2HD4A 2VPWA 4XCVA 2QRUA 2XB2A 2XEDA 3R5JA 3P0JA 2ROQA 1MAAA 2V74B 3U7QA 2P9ZA 5ALHA 1E2UA 4LCJA 3TR0A 1NYTA 3ISTA 4QYSA 4C3VA 3G1WA 1BWPA 4CV2A 2B69A 5FQOA 2WAAA 4Y1EA 2GK6A 1XCGB 2R8OA 3KJQA 1CUCA 1EFCA 1TUEA 4O2AA 3O95A 2RI0A 1FDSA 3AC0A 1EUDA 3HY4A 4U7JA 1WU8A 5EKUA 2V7BA 4Y98A 1B00A 1UQUA 5LUBA 1HE3A 1LZLA 2QX4A 2VDVE 5KVSA 1VFNA 4QTXA 4RFVA 3G6WA 4IS3A 3QKTA 1XKQA 5DMHA 1X38A 4Z2AA 3UAWA 1SAYA 5I5GA 4GI7A 4Z4GA 1ZHFA 3KLNA 4M36A 2ZBDA 4GZ5A 4LXXA 2A0FA 1IOZA 4NVRA 3U13A 2GJ8A 3TAHA 4OGFA 4CIXA 1WXIA 3Q15C 2SCUB 3NOVA 4CTJA 2CVFA 4ZU3A 2QG4A 1RKXA 2P4UA 1F8YA 2XUKA 4Q7MB 3UCFA 1TM3E 1UPXA 1N7HA 3VRHA 3E1GA 5LKAA 2W4MA 4JI1B 3JALA 2JLYA 1E9CA 2HA7A 1GTG1 2NX2A 1H8HD 1V4BA 2DC1A 5AR1A 1E92A 1E63A 2D5CA 2VZ8A 1RPTA 5E6SB 5BMVA 1GSOA 1UR5A 2WTAA 1E2DA 2IDMA 5ICSA 2PLFA 2IEBA 3CF4A 3IBTA 4RIIA 3TQTA 2HMYB 4K9QA 3CLSC 2YJ5A 2AOWA 4AWXA 5G4KA 3FHLA 4WESA 5EFZA 5LLSA 4KRXA 4PLGA 3JVUA 1QDEA 4W63A 5AJXA 4CMAA 5KDDA 1E94E 1MGOA 3KHTA 1JJIA 4OKIA 2Q7XA 3DH0A 3URKA 1DVRA 1NKVA 4MP8A 3IBSA 1YTLA 4W82A 5G0VA 4MCIA 2CXXA 3KVNA 4E2FA 2DPGA 1UPTA 3EEFA 4PC6A 2GM9A 4FX2A 4ZYWA 1DCKA 3OE1A 4E13A 2P6MA 4V1CI 1W44A 3A06A 2YN2A 16PKA 3UNXA 1P2VA 4YRZA 4PNZA 5LP1A 2J5KA 2EZTA 4IVNA 4AKIA 1H1LB 2I4LA 1L8QA 3OHSX 4FUTA 2WKPA 3N75A 4G8JA 2C4NA 1PV1A 2VRWA 4M0DA 4PQYA 4GMKA 3ZU2A 2FZGA 5IMSA 5IXJA 4HTFB 4HXFB 4TROA 4CLOB 2P2YA 1CUIA 3FOEC 2ZFUA 3DB2A 5DPMA 5G0TA 3GZNA 4OI1A 2QRVB 1XMPA 3FM9A 1OWLA 5FI0B 2YHBA 2WY2D 1ZH6A 2G7MC 3HM2A 1SHKA 2GKGA 3QVXA 3U17A 4J1TC 4IIJB 2P9CA 1JA0A 5FUYA 4EYKA 5F21A 2JLQA 4K3VA 1YT5A 2F17A 4ZAYA 5AXBA 1FQKA 1NZJA 1INLA 2GWHA 2JGJA 1D4FA 3TF5A 1XPRA 1N57A 3QXHA 3N2IA 1ZA1A 1IAQA 3D6AA 1X3SA 3ZBPA 1GU0A 1CF9A 1ZJWA 1H2ZA 1PDWA 3A25A 4C5BA 3PUXA 2C1ZA 1QHSA 2GD0A 3H2YA 4IGIA 4LJ7A 4OLFA 4TM7A 3TPFA 1PX0A 4AECA 4QOJA 1C29B 3GLHA 4MCAA 5K8JB 3T1TA 1GARA 2HHJA 4R1TA 4OU4A 1DELA 4HAIA 2LKCA 1M2OB 3QVTA 3WIOA 3ZD7A 3AH8A 5BYAA 4ZIRB 1TMOA 1VYUA 3MZ0A 1OAKA 3IB3A 3FIJA 3KOOA 4CGYA 2WMDA 4PAWA 3RIMA 1BWRA 3SF0A 4AMZA 5IWCA 3F5SA 5JXHA 1PCXA 2UVPB 2UYGA 3O6VA 4NTZA 4TMYA 3UPUA 3PNQA 2X58A 2ZTHA 5I4BA 5J2UF 5CA1A 4RLQA 1U0OC 3Q12A 3EDRA 4PG6A 4QUJA 1A4UA 2VOEA 1NVAA 1EUYA 4NCXA 2QBYB 2IPAB 3F9RA 2WWFA 3W5SA 2R00A 2IGBA 2CXUA 1KF0A 5TQ2B 1UT8A 3HDHA 4EW1A 4ENVA 1UJCA 1KRWA 3EAQA 3CM0A 3UHPA 4B4KA 1FDUA 5G2OA 1N9ZA 1SKQA 3NEYA 5I7UA 1GR1A 2FPPA 2ZIEA 3MCZA 4MRMB 4MW7A 3LH5A 1AG9A 2QLMA 3GGOA 4P92A 4HVCA 2O8VA 2X4GA 4BBAA 4NQRA 4Q66C 3RU7A 3DOEA 1U99A 3T4UA 3EISA 5DM70 1SXIA 1R4MB 1NF9A 1OFUX 2HZBA 2X8JB 3FCXA 3QJGA 5FOUA 2A0KA 3DXXA 4JGBA 2HWYA 1BYIA 2A2ZA 3P94A 2X5KO 1JPJA 2PLRA 4R0VA 4LXIA 3UB4A 2YV1A 1ANKA 1IHYA 2NV6A 5IT4A 2FKNA 2EKQA 3AXTA 1BW9A 4Y1FA 2Y4NA 1R6BX 1USUA 3ZCTA 1PV4A 3B2EA 1QHIA 1B41A 4FIDA 3VC2A 3WV5A 1FRFS 3PNVA 2OCAA 4XDHA 4AP9A 4ZEVA 4EF6A 2XYRA 2FZEA 3JARB 3KUKA 3QUAA 2DJIA 1O89A 4G86A 5GONB 1TUGA 2DLNA 2NUAB 4DOMA 4UAJA 1A4RA 3NTLA 3CE6A 4UVIA 3K15A 3IQGX 3MB5A 2J6HA 3K8YA 3WKAA 4C7XA 4OBWA 2ZYUX 4EUHA 2FPUA 5DIFA 4C22A 5BWBA 4OXYA 3VVCA 4MDYA 3OX1A 1F1JA 2FSIA 3L77A 4B6OA 2HSWA 4LJ4A 4Z1OA 5JROA 2AOUA 4XX0B 4RTSA 4WK2B 4JJGA 4JHLA 5ARBA 3SHFA 1Q1EA 1NW9B 1PW7A 2VDOB 3K1YA 5FPKA 1NLZA 4D98A 4MB6A 3BRQA 2VTBA 3GLUA 1NL3A 3WL3A 4L5YA 2ZVPX 3OM9A 5JT1A 4G8DA 2GZ3A 2FPXA 3PQCA 3W78A 4F4FA 3FLBA 1QIEA 3IC5A 5C7OO 2FWBA 2QUAA 4R8LA 4F8YA 3RYIB 1J23A 2Z2YA 3RH0A 3GRZA 1I94B 4BNFA 3P4UA 3SJBA 3ZWAA 4BNKA 1KY2A 5IAOA 1Z2OX 3TIFA 1YDFA 3EXHC 1M2NA 3ZJUA 1Q7GA 3QBVA 4WY2A 1WVMA 3VTAA 3LUKA 3SNKA 1YZLA 4MI1A 4ECEA 3I5AA 1OGIA 4KNYA 3OA0A 1VRVA 2XQKA 1UPFA 4HDKB 1KSJA 2Q8NA 4M8NE 4FT4A 4OGWA 1NBIA 2HC9A 4ZO7A 2QUBA 2P3QA 3G0IA 5F9MA 1F2VA 5ULLA 3I37X 3WDLA 5LQJA 1R50A 3FOBA 3I42A 2QE6A 4KO8A 2IYUA 1J56A 3X43A 3DDOA 3UV6A 3FYDA 1N1MA 2BKAA 5P21A 5B57C 3N58A 4DAOA 1OLOA 4PVCA 5K0BA 2WA1A 1J90A 2IZ7A 4QLBA 1NTOA 1N0WA 4ER6A 3KL4A 1ZBQA 2WC1A 5T7BA 3FYHA 2YDXA 3H4VA 4M0KA 1Q7RA 2HJWA 4MUJA 2QPTA 4O2AB 3NDBB 2X19A 1RQRA 4CN8A 1GGKA 3O9VA 1C7EA 2X3FA 2EERA 4W9NA 5K45A 1T6XA 4CBVA 2IODA 4ZOAA 4ARCA 3H5NA 1GKUB 1FQWA 1P1RA 3ZDEA 2PXCA 2WJJA 2CDAA 4QFCA 5H7XA 4GH5A 1UMDB 4OHOA 3C15C 1EGMB 2GMWA 1YR8A 3FROA 3Q7TA 3GRVA 4BP9A 2PA3A 3PEWA 3JZIA 5ELMA 4W7HA 1JHUA 1QHYA 1E98A 4YJ3B 2P35A 3HN6A 1IY8A 4DC9A 4JT8A 3LHSA 4DEVA 3PRYA 2MYTA 2OVBA 4YPOA 5CA1F 2NZXA 4MQLA 1LVUA 3R3SA 1QFYA 3AFIA 3L2OB 3H3XA 4MUEA 4WLEA 4Q9LA 2A86A 5EJAA 2X0FA 4DW8A 4IFTA 5ALZA 2R97A 2XW6A 1YR6A 3QM1A 3TZCA 3QMWA 2BHLA 4BFCA 4PN7A 4D1YA 4GLBA 4B71A 5H4GA 1V41E 3P9NA 4G2TA 1I9CA 3KDSE 1P5JA 1N5KA 3KKZA 4QSHA 3ETDA 5LB2A 4Z7JA 5JMWA 3UWOA 1C2TA 2FPSA 3ND8A 1J1IA 1V8FA 4UAVA 1IM5A 3L8FA 2P7HA 4IOMA 3CBGA 1MU0A 1TRKA 1E1DA 4LK3A 1U0TA 3OC6A 3TIGA 3ZE9A 4LG1A 2XMZA 4RJ2A 1MVLA 3DUFB 3BZUA 5DGIA 1GUZA 1GT91 4A7PA 4L28A 5E95A 1S02A 3ADKA 3F71A 2RGDA 3IRVA 3G2HA 5EPUA 4CMGA 4CPDA 4AY6A 3B3QA 1XKXA 1C30A 4M0FA 4CJXA 3K9NA 4KH0A 4U39A 4TS4A 1H5UA 3D8BA 1CY1A 1NW5A 3AHFA 3JVDA 5ICEA 1VSQA 1DNPA 1M0WA 3PVZA 5JHGB 2GVZC 3GDFA 3ONNA 1CYEA 1ZIPA 3KQKA 1WSBA 2N1BA 1LDBA 3L0CA 2CCKA 3PJFA 3TAXA 2JVIA 1XZHA 4EFKA 1GRVA 2YBDA 1NW3A 3QKRA 3ZQKA 4DIKA 5F2NA 3KE9A 4QLAA 3MGAA 2ZAYA 4UE2A 2QD5A 3NC0C 3NWPA 2YH2A 2DR3A 4TTPA 5FBQB 2XUQA 4HSGA 2YRFA 3K32A 4HFRA 4XDYA 4ZT3A 4DDHA 4KYTA 3V7WA 2IW1A 2VJKA 3EPPA 4HDKA 2VG8A 5EY5B 5GJWC 5BY2A 5KNLA 2Y71A 4XGRA 3K4PA 4UZEA 3U4GA 4W5OA 4BXOB 4NJMA 2ZI4A 3U0BA 2X2OA 2PSFA 5LZ7A 1G66A 3V4VB 3V5NA 3BK2A 1RFLA 1KERA 5A5EA 4GYYA 5TGDA 4YRAA 2ZJ7A 3N7UA 1P60A 1XEWX 5COQA 4B45A 4EB6A 3ORQA 3QY9A 2W2OA 4HYEA 4YS6A 2B0CA 1UQTA 3T3OA 3QF4A 1UMCA 3EBLA 4YMSA 4M53A 4C3OB 1RXYA 4RTRA 2H2IA 2O8CA 5FXMA 1OWMA 3U62A 2CYBA 1YDHA 3L4JA 4YWHA 3MS2A 4TTAA 1P9WA 2KS6A 4JBIA 4KXMA 3K53A 2QRNA 3OCXA 3DMRA 2GJAA 5I6DA 5DNYB 3OQMA 1O1YA 2GERA 5FEMA 4DQVA 2R25B 1N5IA 2NU7B 2PT9A 4WNAA 5K3SA 3TLZA 5LD2C 2YICA 3I30X 3GJYA 3OWHA 1H66A 1ZC3A 2HRCA 4RTMA 1CD5A 1R0KA 3TFWA 3IVCA 3AW9A 4G1EB 3K1ZA 1W0CA 3OFND 3GR6A 2FPMA 2ZU0C 5DNDA 4ZI2A 2IITA 4PAGA 1DTEA 1D09A 2XD9A 3B52X 1P1IA 1NAIA 1YBFA 3QLUA 1QB8A 2RG7A 2CMGA 4CMCA 2O8FA 7ABPA 1A2OA 3TMYA 2CL5A 2DR2A 4TKMA 1YKSA 3EGWA 4R98A 2R84A 3W2EA 3RT1A 3OJXA 4DV7B 4RHYA 4TTSA 1U2ZA 3EFOB 2ZI7A 5L3SA 4UASA 1D2HA 2FX3A 2MSNA 1XKLA 2HA4A 1YASA 2OBNA 3KCQA 4FYXA 1DQNA 2O1WA 4KXYA 5DTEA 3NOQA 2VYVA 3NXSA 1NKSA 4JJ4A 4UNQA 3JPYA 1XNJA 2WEKA 3BJRA 4OU5A 4CIBA 4Q9IA 5LN1A 1KZHA 3KPUA 5BNTA 2GETA 1H8HA 2GRJA 3WLQA 1LJLA 3AX6A 3PENA 4OSOA 2BH9A 4BKPA 4OQXA 3KEOA 3H3JA 2ZYRA 4P80A 3W5IA 1DMRA 1YL5A 4ZT6A 1E9VA 2G77B 4RGVA 1YL6A 5FT9A 3JQFC 4KH1A 4CQJA 3VKGA 1EXNA 3IODA 5JDIA 3A4TA 1Z63A 3Q5EA 4JIMA 4WINA 1LBTA 2EWMA 2NZUG 4UM7A 4LI0A 4GX0A 4J2HA 1FC0A 3WL8A 1CZOA 1RJEA 3AV0B 4E4YA 1I33A 1E1RD 3A9SA 3CX7A 4E15A 5F7XA 2DQKA 1QH0A 3A6ZA 3IXQA 5C7YA 1S96A 4KR6A 2ZBGA 1U6KA 1UXIA 3FJOA 1Q1QA 1L4YA 2R8ZA 5DKFA 4C6TA 1GT6A 2ZZKA 3KWMA 4QGAA 4RV9A 4TV8F 4UXIA 2QUIA 5JZ9A 3VVLA 3EB9A 4FUQA 4ZVKA 2OCGA 3C0KA 3T4EA 4IHKA 4OJKA 3UV7A 4B7ZA 1QOZA 3GUCA 3Q9UA 2WIJA 3BF8A 2PLWA 1P29A 3NEAA 2ZR7A 3STVA 3SU8A 1Z3IX 3ADPA 4TN1A 2O8BA 4QQRA 2WYUA 4ZIRA 1OXVA 4TWAA 1FX0B 3WK8A 4WNIA 4D56A 4HI0E 2ZIVB 4EHHA 1AB6A 3P2YA 4GMFA 3ZPXA 3CSUA 4DVJA 2BUAA 3IQHX 2NIPA 5EUMA 3B85A 3AP2A 1SUWA 1I4EB 1WDLA 1HE4A 4NICA 4G1BA 5LP6C 3O1JC 3ZCPA 1ISSA 3I23A 4IW3B 2XKJE 1MB0A 2ID9A 2O06A 2Q3HA 4QFDA 5DIZA 4C07A 2ID8A 3GZTB 3PVSA 1UK6A 5LQKA 2N1MA 4BO2A 2BTQB 1E7SA 1M66A 2AS0A 1RTKA 4X71A 4LF5B 1E6CA 2VBGA 3DTVD 4JBGA 2XBUA 4DGSA 3W5VA 4IRMA 4QUAA 1VI6A 1R8QA 1B0PA 2KWIA 2I33A 3F5QA 5EJ9A 4CIWA 1W4LA 1DIBA 3DL7A 3BWEA 1Z6YA 1IVNA 3L06A 1NTRA 3UXHA 3BWCA 2CF5A 1M6VA 3JWIA 3STWA 1IM8A 4J6FA 1O57A 4G5YA 1CQXA 2AMFA 2WUGA 3OUTA 2KBEA 4EY4A 3GA7A 3WNVA 4KNWA 3THSA 4WACA 4M0UA 4R8SA 3IOBA 3VJKA 4K6HA 1GA4A 1H1LA 3RF6A 3G0DA 2YZKA 4IOJA 5K3AA 4G41A 3RTCA 1XRMA 1Q5PA 1RYZA 1XTKA 2PJDA 3AM3A 3B3GA 4EGSA 1GL7A 5KVAA 3PFGA 4FZRA 5HCNA 3RS5A 3S2ZA 1UAAA 1RS0A 2PSDA 3LWBA 3ROFA 3T9DA 4ARVA 3F7OA 4Q34A 1FTQA 1HDIA 4PSVA 4BNVA 2HJ9A 2VYCA 3HACA 4CGZA 1GNSA 3PFBA 1YE3A 4OXIA 2BDEA 1YQTA 1AUVA 3KT3A 4B9AA 4DRXA 1V7CA 5K0TA 4YJFB 2OFOA 3DBOB 5AK0A 4LV8B 3K0SA 3Q7SA 3GP8A 2ZGVA 1H85A 1WW3A 2WJ4A 3C3CA 1GPKA 4KHZA 5EP4A 3LMKA 3DD5A 3QU4A 4KXFB 5KX5F 4Z3DA 3GRFA 4HYTA 4J76A 1E5TA 2FRDC 1KWKA 4M0CA 2PVSA 2XDQB 3K31A 2AL7A 4IJWA 2VDUE 5K0SA 2ZZMA 1A8UA 2QRHA 4J1NA 3O4FA 1EFVB 2JLRA 1SKAA 3K0KA 2AN5A 3ZE8A 4QBIA 1OYWA 4NOLA 5BOSA 4R2IA 1FIUA 1Q0ZA 1BQ3A 1QC5A 1ZJ4A 2ZCUA 3FWPA 5I4KA 1RWVA 2Y0BA 3JALB 5LQAA 3WGIA 5HRUA 4QM7A 2ANBA 2GAIA 2Q2VA 3N0TA 1SQSA 3AU9A 3M6WA 4LHYA 5KVCA 2FG7C 1H0KA 1I5EA 4Q3LA 1ZH8A 3X3HA 5F51A 4D3DA 2J6IA 1H05A 5B55A 3SKXA 2XKAA 4RK7A 4P4SA 3SFTA 3UMRA 5DU2A 1O94A 1ESCA 3C97A 3KR0A 3LHFA 1UXKA 1RACA 3AETA 4BVFA 2H1LA 5JJKA 2B61A 3OZWA 4UE6A 2IP2A 4TLAA 4ZJYA 2HBRA 4HDSB 4MO2A 3EIOA 3IUBA 3U3JA 2MHCA 5K6RA 2YYSA 2C4TA 4I99A 3G0HA 2V6BA 2FGKA 3FYTA 2O2GA 2VJBA 3LW8A 2NUPA 4CKBB 2C5LA 6ABPA 4MW9A 1JIUA 3V8RA 3EXEA 2H17A 3V32A 4B48A 1T3HA 4L2IA 4DIEA 1YULA 3UKJA 3HV2A 4BU1A 5C1IA 5KNDD 2O2EA 2Y1GA 1JDPA 1ZK4A 2PS1A 4LYAA 2HJRA 4TL8A 2Z58A 3D4LA 7MHTA 1L1QA 4W7SA 3OY7A 2XKKA 3E3NA 3W6PA 1N1GA 4YJDA 2PX6A 3FETA 1KI1A 3R75A 2PQ0A 3KM0A 5EIWA 3V4RA 4BN4A 2F4NA 1P5ZB 4IFBA 2ZUBA 2D74A 1SHLA 4K03A 1SKUA 3UJPA 3VJRA 4PSAA 1NUSA 1UM9B 3VC7A 3ZWOA 3BCHA 3WGYA 3H86A 4YRTA 4OI0A 1FMFA 1QGOA 2CLOB 3NTVA 3CNOA 1HO3A 4ISBA 4US2R 4O63O 1O3YA 4LDAA 5LZ4A 3GY0A 4XR9A 1JQEA 1VL0A 3S2GA 2V0NA 1R8JA 3LWZA 2HUPA 3WWZA 3O4RA 2QRMA 3JYOA 3LYAA 5ICGA 4ON9A 3BEOA 5IJ9A 1QHHB 5EIEA 2UZAA 3LVFO 4R3NA 4AMYA 1Z88A 3RIGA 4G09A 5D2CA 4ENPA 2V1UA 4EYEA 2BHNA 2DG2A 3S55A 1E3MA 4I0WB 3CS3A 3P27A 1BC5A 3A04A 1TA0A 3OICA 1YQWA 2GPAA 2OESA 4L95C 2QT0A 3FMOB 1Y5LA 4U5XA 4DT1B 5K8UA 3UXMA 2DE0X 1MO5A 1PL0A 1UOOA 2MSEB 1K7EB 1U2RA 4LE2A 1ZBDA 4D82A 4G5HA 5LMNB 1ODJA 3M6MD 3NMUF 3J80A 3EH1A 1UFRA 2Z9CA 1PFYA 1GPH1 4MV9A 1ZP6A 3CNHA 4B3JA 3QYFA 4IMIB 1PNQA 4JVNA 4OP3A 1RXCA 3URMA 3DYIA 5KSZA 3B3FA 1VI2A 3NLLA 4IMRA 3VR0A 2WSYB 3E3MA 4C87A 1TCUA 2AUNA 3OPYB 2D2VA 1H69A 5B53A 1ZJZA 5LYYA 2QSZA 3EDOA 3ZUPA 3DQPA 1N2JA 4UBOA 4QGGA 4BMXA 2V97A 1NVMB 3GIWA 3ISVA 3PDIB 2GFHA 3K4QA 4C3UA 5LDHA 3CZQA 2J67A 2BR5A 1EPUA 4DM3A 3T99A 1XIVA 2CLEB 3TNLA 5J4VA 1F17A 5JS6A 1BXGA 3MIZA 3GVHA 4B73A 2Q6VA 2E1RA 5DTIA 3BREA 3VR1A 1K8YB 1Z9BA 3DE6X 4NMXB 1DRVA 3OIWA 2QYOA 4U7FA 2PQ6A 2BHSA 5ALIA 4BBZA 4D9NA 4Q9KA 2ZDQA 1ZD8A 1F8GA 2V65A 4XLZA 4GD3Q 5EHNA 3WDKA 3V6LA 2IYPA 3N6RA 1XSEA 4B2IA 1RAHA 4IRUB 2A88A 1E3QA 1XDWA 2Q6OA 3SQWA 1RNLA 1UDRA 2N75A 2ZATA 4FYYA 4YV2A 4I5FA 1Y6FA 1EB9A 3QUSA 4G4GA 2BIFA 1TJ3A 1UBLS 4FMCF 2WSSA 5KOIA 2WDPA 2JKVA 3GLKA 3LT4A 4ZA2A 1I7QB 1SXQA 3ENWA 1X7XA 1T5LA 1U1CA 5HCIA 3GMTA 3DDZX 4IPTA 2EQAA 3F9IA 1SCJA 4FZVA 4BNWA 4MPPA 2IBTA 3T5CA 1QJCA 2P9JA 4DCPA 5B7PA 4EYQA 2G67A 3PK0A 1JU4A 3PYMA 2A94A 2H11A 2XYHA 3RLIA 1IN5A 2RGEA 4BFTA 2P5UA 4P82A 3LAWA 4HOYA 4W7IA 3WHLA 1XTIA 4TPKA 4NECA 1MA0A 4HH4A 5IEJA 2IXTA 3BMCB 3QKSB 2EJBA 3W5CA 1IB6A 1RVDA 2HEIA 1S5PA 1NVVQ 2A5DA 3AI1A 3H5LA 4WEQA 1NP3A 4YY3B 3AHJA 4B80A 3QU9A 1PYGA 2V0CA 4M9SA 2ID7A 1VJCA 2FE1A 3D54D 3H1BA 3VU9B 1DQRA 4J90A 4YRJA 4TXHA 4KWTA 1WUKS 2JHFA 1OX5A 3LIIA 3NIGB 2FVXA 2G0TA 1K3TA 3QOXA 4JAVC 4W4TA 4WDRA 3A6HA 3LY7A 1X7WA 3F1KA 3U80A 4LTMA 3VU0A 3GT3A 3TSAA 3SC2B 4E46A 4X62B 3NKVA 1TTHA 2B8JA 1J20A 1C9JA 1JW9B 2AUTA 3DTNA 4HLNA 4Y0NA 4FDUA 2I4TA 4KQIA 4BAGA 1NMZA 3EXIB 2IUYA 3QJ5A 3FPKA 4GDFA 2I2XB 4YJKA 1J07A 1DUIA 4EYOA 1E20A 1NF8A 4NFLA 5FOWA 2P67A 1E2MA 4Y9TA 1FRVA 2C03A 4GRIA 2ZM6B 2Y9MB 2V4MA 2FLVA 4RK1A 4ROSA 4GP6A 4M0PA 4AICA 4QDOA 1O4VA 2X5JO 1YI8A 1P4JA 2BGTA 5LYJF 1O9BA 1PD1A 3ZU4A 3TVTA 3IULA 3PT9A 5BNZA 1C7ZA 1W29A 1NC3A 2PMCA 2Z56A 3K09A 3PF8A 5EERA 1IC6A 3HKDB 2YC4C 1T9GS 4GOND 2DCUA 4Q93A 3JWEA 3N7TA 1KJ9A 2I1QA 4YMVA 2VTKA 1L1RA 4IIDA 3GYGA 3TW8A 1IK4A 4ALNA 5AOCA 1TQHA 4ZT7A 2FMXA 2BAGA 4WEOA 1E2HA 1KDZA 2P6PA 3A14A 1SXHA 5T3UA 3AL3A 4A26A 1LJUA 1TKRA 3GROA 1QF6A 7AT1A 3G85A 5DLQC 3H9EO 3ZY5A 3PC8C 5T64A 1T5HX 4ESEA 3KOYA 3PGKA 3V1TC 3M9WA 4RKFA 2F8TA 4AY3A 3AJEA 1PP4A 3G5LA 3FYSA 3AT1A 1FFCA 3L7IA 5LP6F 1L7PA 1YMQA 4DPMA 2CJXA 1CDZA 5I3ZA 2R68A 3V4SA 4NG5A 3H2JA 2O48X 3ILVA 3RS3A 1YIOA 1E3SA 2VNJA 3N6XA 5DXFA 3SC2A 1PFKA 4F97A 4RTLA 4XTCS 4G5OA 1JLSA 4RZSA 2CSXA 2VKTA 3GCGA 1HDGO 1IPEA 4E33A 3LJKA 2XXAB 2YFKA 3Q72A 1OFIA 4FD3A 4GXQA 4IDHA 2MIIA 3GLIB 3TTUA 1ZD3A 5CD1A 2YRXA 1DARA 4URXR 5I7RA 1BMTA 3E7DA 2Y3IA 4J4TA 1IU9A 2PGOA 4JX8A 4MUAA 3OHMA 4P38A 3SOZA 2VK8A 1B8NA 1QTRA 3OT4A 3PC4A 2UUCB 3NV9A 2AMJA 5BO5A 3QVLA 1RJ9B 2HY7A 1F1BA 2L19A 3QLJA 3CEAA 3EW7A 4J0FA 4LZZA 1N4DA 5IFKA 3GLGB 1ABEA 421PA 3RR2A 1QE0A 4GKVA 3G2OA 1FEZA 1OHHD 1PWHA 1PUIA 3MEQA 3OTIA 4CCAA 1J8MF 2XKBA 4MA5A 1NLUA 3L92A 3LO5A 4IOKA 1AS2A 4ND4A 1BVYF 2QRGA 4I4TF 4JGGA 1A69A 1RC0A 1J00A 2AOXA 2HLNA 5T8KA 4AZTA 1KYVA 1JL3A 1X0XA 4KXWA 5DEIA 2R1TA 1G8SA 2V6GA 1Q74A 2DKFA 3GIDA 3JQQA 4KFRA 3IAS6 5B5SA 1SUBA 2ZAIA 2NUTB 4ANFA 4YMTA 2PY6A 4TMKA 5DN6D 4M7RA 4NENB 5BSMA 3IKMB 1RMQA 3UN1A 5K6AA 3DE0X 4LPKA 3GFSA 3FKSD 2WU8A 4CTNA 4JZKA 4MVXA 1V25A 1AURA 1TZJA 1FYEA 1ZMRA 3BA1A 1SPBS 2MDTA 4FFSA 4I1OA 2QV0A 4GYJA 4O6VA 5HMMA 3RUEA 5IVHA 1QE3A 2AOTA 3O9ZA 2A6PA 2JH9A 3PXUA 4G85A 4PYLA 1FJHA 1FL9A 3MILA 3RVPA 5NULA 3SMVA 1H4QA 3SXUB 3JPWA 1Z0FA 4DSTA 5EXTA 1CS0B 4FYJA 2X77A 2RONA 1BEZA 2JGNA 3SC6A 3ZC3A 3QWHA 4GUAA 1RLUA 3N28A 4U6QA 5C7LO 3PU6A 3EFEA 1L4HA 1WDWB 2YFYA 3W5DA 1W35A 1M1NB 2JLUA 4KQEA 4C6RA 1Q15A 3CCFA 3U31A 3GLRA 3RK0A 2BI7A 2C20A 3NVMB 4CQMA 1XVIA 2CZQA 1UPBA 2CE7A 5ARCA 4Z51A 5JLJA 4WN9A 3QPDA 1FYVA 4KQ1A 3BFXA 4XSGA 3FGOA 3I8SA 4J16A 4UUAA 2OHJA 1LRLA 3AJ9A 5FRDA 1S3FA 1NVKA 2FPOA 4AZ3A 2VP4A 2QSJA 3GLHE 3VR4A 1D9XA 2OAEA 3EZGA 1XQVA 4IQFA 1LDGA 2J7PA 1GZ4A 2OVFA 4LRUA 5I7FA 3E9QA 3ZE7A 3OEED 4G9GA 4K87A 4QPNA 3WL6A 1NMEA 1W85A 3F7NA 4YUVA 1GGJA 2DLCX 2QRPA 1YJXA 3AEUA 5CXUA 1D2EA 2OQVA 2R62A 2HPZA 4CI0B 3QFTA 3TTXA 4BFZA 1SR8A 1F9EA 3C5EA 2GD6A 2ZP1A 3ZYCA 2O59A 3KCNA 5EIBD 1N2BA 4MRPA 1JG6A 2VDNB 4LX0A 3DO5A 3K6RA 5L53A 2HHAA 3HB0A 1JBEA 3KB2A 4MUYA 1RAIA 2REBA 3JQAB 2I76A 4Z0PA 1SUFA 4C5CA 3A3KA 4NP6A 1UF9A 4WCVA 2C8VA 1F9AA 2CSUA 3QVUA 3FCUB 1DQZA 2RKWA 3NNSA 1G5QA 4MV8A 2P62A 4HUTA 1I1HA 1FLAA 3N7AA 2GOYA 1Y48E 1CUBA 3PE6A 3RWOA 5BRJA 2BC9A 4GSLA 2ATCA 4E31A 2YC2C 4GOLD 4N39A 3AVUA 1QAMA 5ECDA 3PGJA 3NXKA 3H5TA 4EG0A 2OAQ1 3BK7A 5EJ8A 4YJGB 2NN3C 3SYRA 4ZVVA 5E3HA 2JBAA 3NFYA 4UATA 2HJSA 4B0OA 3AB8A 3BX1A 3DM9B 4N40A 2C57A 2YYYA 3NV7A 5BV1A 1J0EA 2ZBQA 4ESHA 3THWB 1OU0A 3H9GA 1FMLA 1LSUA 1WULS 3O1HB 3U26A 3II6X 1NI4B 4TX1A 1R0YA 2ACKA 1JG1A 3GN2A 3DAGA 3QYAA 1JEQB 2GCNA 4O33A 2M2IA 5TT0A 3I8OA 2XF8A 3JY6A 3GP5A 3NALA 4WAUA 3L7JA 4EJ0A 1DHTA 2QPAA 2Z9BA 1WB4A 5B58C 1ZR2A 2ZRAA 1K08A 2QP3A 3LYUA 1JR6A 1QVWA 2CE2X 1Y6QA 1CUWA 2P9FA 2QRJA 3LDAA 1O8CA 2AB0A 1QC5B 3MBIA 4C4XA 1N32B 1J5PA 3TBKA 5AK5A 3OPYI 5BOSB 3LTEA 1FSPA 5JAHA 1PVDA 2CHUA 3HVUA 1XT6A 3ABZA 4IVRA 3T1OA 5BSHA 1EFVA 4RSGA 3DLPX 4MJLA 2QQFA 4AUMA 5AK3A 3H1GA 2YJ4A 4OHXA 4Y0VA 2PNJA 3SK0A 1L7MA 3FWNA 4UREA 4R8KA 3B7PA 3FMFA 3KDPA 5HF9A 3DDUA 2C5EA 5BQXA 5J4YA 1FFYA 7MDHA 4MPTA 1K8XB 1W4RA 2RJNA 4XDGA 4D4MA 1N0UA 3LXRA 2Q41A 3U9SA 5JDCC 3IESA 1PFWA 3QELA 1JFFA 5I9TA 1K0FA 1HF3A 2X7HA 4JY7A 1ORHA 3DV0B 5FHRA 3UHOA 4QXRA 4OQQA 2GAJA 4CUZA 2AG8A 1VBFA 1ODTC 4G97A 4HNHA 5CFLA 3NHJA 3U39A 3WLTA 3WMFA 4KQHA 2G1AA 2C42A 2HYDA 3FR7A 1KL7A 3BMQA 1OV4A 1FUYB 1XZGA 1KI2A 3SLKA 1R0BA 1QOQB 2G25A 4BQNA 4BZXA 3CRMA 4RIFA 1CUUA 4CE6A 3JZAA 1YHZA 4YASA 1MXHA 2QL7A 3DMDA 3K70D 3N5CA 3RGWS 1ZR4A 3REQB 1A9XA 3AVWA 4NS1A 3UK7A 1OB2A 3WZLA 4BPBA 2GBIA 4GRAA 1OMOA 4KAFA 1NJSA 1KH1A 2B6NA 4F9TA 3ZCQA 2VLIA 1X8JA 4F93B 4DLLA 3KD3A 1JVBA 2XWJI 1AF7A 4AZ0A 3VKUA 1BFKA 1OWPA 1XPOA 4JDUA 5C52B 2GUWA 3A3OA 1JAHA 4DV0B 2JK0A 1CYDA 3PJDA 1OTYA 1TA9A 2TSYB 3MIIA 4ZP1A 2A1UA 2NPFA 2N0SA 4DCNA 1L8XA 1BCRA 3QW4B 4MRRA 2J9GA 3RFUA 2FPIB 2BTQA 1REQB 1PJ2A 2TRSB 3WYEA 1RM4A 4I9NA 4CW7A 2C8LA 5F2EA 2AG1A 4ZI7A 3L18A 5D86A 2C83A 2HJGA 2KI5A 4RYDA 4AO8A 1KP3A 3KKKA 2B30A 5AW0A 1L7QA 3DD1A 2OC9A 5G40A 5FJJA 4ENWA 4B3GA 1RQPA 1G6Q1 3FCSB 3GFFA 4JITA 3N8GA 5DCWA 2ZSKA 1ESMA 1RWPA 3D6FA 4L75A 4QE3A 2PJZA 1A5TA 3EDMA 4NZZA 2JI8A 1WB6A 4KI0A 2Q4BA 1SQFA 1JZSA 1XTJA 2H1SA 3N2GA 4EVQA 4CIYA 1ZRMA 1YUMA 1GL3A 3EG9B 4Q4HA 1ITZA 3VDMA 1KVQA 2QUZA 4RA6B 4GPAA 4CDGA 4HQLA 4XUGB 1TKBA 2FP4A 3ID6C 2ONZA 2R4TA 2WE8A 3LVRE 1QZUA 3LUAA 4BZQA 5L51A 2IOHA 2DB3A 1OY1A 3CB2A 5K0LA 3V46A 1WZEA 1KA9H 3NOOA 3OP1A 4X41A 1IBKB 4TUYF 5ABPA 1UL1X 1QANA 2V59A 4NBSA 5B37A 5YASA 3VQTA 2IU4A 2VF2A 4PCUA 3VPXA 4DCGA 1GUDA 1TJNA 4X1KB 2W6OA 2YKGA 1TB4A 5K09A 2DSNA 1UXGA 2ODEA 4G0NA 2IHYA 5HZKA 2RAVA 4LOAA 1PW5A 2QI9F 3GGSA 1T6NA 4YUYA 1LTKA 1ND5A 2H85A 2A14A 4LGYA 1CUJA 3C4VA 4ZEMA 2W6JD 1U0HC 1VYHA 3ZBTA 5DHUA 3U3MA 1N6OA 3NAZA 2DU8A 2F90A 5ER6A 1U8ZA 1YB5A 3P9SA 1HV8A 1UBMS 4IF4A 2QN8A 4TL7A 3UYLA 3W05A 3VTKA 4DMRA 4O08A 4A9AA 4JP2A 2VNIA 1P6UA 4G3XA 1PEDA 5IVPA 4IKEA 2ZE7A 1F6WA 1NRWA 1QIDA 3HFJA 4GQBA 4IG4A 4MQEA 4ODIA 1OLXB 3C87A 1G6HA 1GP2A 4TN5A 3B8HA 4MQ6A 2E5LB 3G2JA 3TNYA 1GPDG 3DLIA 3KOUA 4PGHA 4R7ZA 3SEZA 3TSOA 1PGNA 2H52A 3PKJA 1P1FA 1NRXA 1WUYA 2I4NA 3C16C 1RYBA 3RIEA 4GZLA 4ADSG 4MS3B 3PDCA 4YAUA 5IKMA 2FWJA 4CLDA 3SIXA 1UT6A 3CT4A 1R88A 3WMWA 2EFJA 3AHCA 3FKQA 2QD1A 5CM9C 5JNLA 1KMHB 5TX7A 2BEKA 3ORFA 2DWOA 3GLFB 3OKAA 1I2AA 4Z3OA 2F67A 3OX3A 2GVNA 1R8SA 1Z25A 2EJWA 4AJ4A 2J87A 3WA7A 4D8VA 1VI5A 1SU4A 5EXEA 1C3JA 4M1TA 1WX1A 1JLLA 3LK6A 1J1ZA 4Q19A 4LFCB 3W2GA 3ZHZA 4O4JA 3ANSA 3ASZA 3RC2A 1F2UB 4Y9RA 4GLJA 3D9QX 3BFJA 2D2XA 5D7NA 2Z4RA 3MT0A 4ZVRA 2FDRA 1GPNA 5DXJA 5HUQA 4J75A 2PV7A 3RO7A 3LPLA 1PO7A 4QXMA 1DEKA 2JBAB 4G0ZA 5AM1A 4MUHA 2K7FA 3SZOA 1A3CA 1ZITA 4CV3A 3KXPA 2HOQA 1O77A 1M6NA 3EPLA 4K8RB 4JLBA 2CCJA 1E0KA 3QIAA 3DQZA 1KDTA 1DFGA 4XWGA 2EJCA 4O4LF 4WECA 5K3DA 5FBVB 1A9SA 5C9ZA 3MTQA 1QVZA 4G0OA 1CV2A 4EMTA 3R4VA 4YCDA 1FJGB 3QV2A 2GDJA 1TEZA 1RWMA 5B64A 1HI9A 5NLLA 2HXSA 1TLTA 3HVKA 4HWOA 4JSTA 3HJAA 4KXLA 4LGMA 3RB8A 3HXOA 4JQYA 3PIRA 2OXFA 1CUAA 2GO1A 1RIIA 4EAAA 3WLJA 4EFNA 1WS6A 5SY9A 4L27A 4HEJA 4QOFA 2GHRA 4QGFA 4ZQBA 5G3YA 4DZZA 2RK4A 4PSDA 4DYDA 3PXBA 1TVEA 3A2LA 1VSTA 4JVMA 1NXTA 2DPXA 3OPMA 4LHWA 5ALRA 1KDVA 4GPEA 1SY7A 4O4HB 4RD4A 2PHZA 3AEQB 3OJEA 2M1ZA 1XV5A 2YZNA 2YWFA 3HY6A 5KVVA 1RC8A 2OHXA 3PDWA 1IMJA 3NBFA 2QE7A 3AUUA 3IUJA 4RY0A 2C98A 2PUHA 4WBSA 1PL6A 1OZHA 1MAHA 1B14A 5EIHA 4KI7A 4MR9B 3TRKA 2QLFA 4DWOA 1SZJG 1DWQA 3PZRA 2O6LA 2QW1A 4MVYA 4R40A 1NQ5A 4K9RA 4AP6A 1P45A 4KXQA 4YRGA 5LQDA 4IFIA 1XC7A 4XWYA 5ALUA 5IAEA 1UWLA 4UM8B 3UIEA 4BNUA 4FKBA 1PT7A 4LK2A 2HIGA 4C0XA 4JJKA 1UIRA 4HB4A 4HFMA 3ILHA 4GMGA 1X3LA 3UWKA 4ARBA 1V3UA 4Q7LA 1JPVA 221PA 4OOFA 2ZJ2A 1EFRD 4RV5A 1R8XA 4Y2RA 1HSZA 3BAZA 3LPNA 4AWBA 1IJBA 1W6RA 2XGGA 3NYQA 4N65A 2E21A 2C2XA 1EVJA 3AY6A 4XQ0A 1CVLA 5HGXA 3DYBA 5K4AA 2BISA 3ZE1B 4FDAA 4HDRB 4OATA 1FRZA 1KPIA 1YR9A 2P9TA 4RCVA 3HJNA 1EJ0A 5KX5A 5K3FB 2R65A 3AF2A 4H3SA 2XBMA 1ZCJA 3R77A 2QVGA 2C82A 1H93A 3USES 2WWWA 2JC3A 3H8SA 1UT5A 2LP4Y 1E6EA 1I6KA 2P4SA 1Z56C 3BZWA 3O3MB 4O0LA 5A4AA 4R6XA 1A8SA 2PTHA 2ZQZA 2JJ1D 1EG2A 1XDDA 1RTTA 2V1XA 3CT6A 2EZ8A 4KQ2A 4FYVA 5FBWB 3MTGA 5C1OA 2D3WA 2NLOA 1AKMA 4UTPA 3TE6A 1B76A 1YS4A 4QGHA 2UVDA 2NSLA 2RDMA 3O2SB 4BYGA 2LGJA 3WAJA 1EK0A 3E9CA 3H2ZA 1Q1AA 5LA6F 1G21A 4CF7A 1UJ4A 4DAEA 5MHTA 1GPUA 3PHCA 3JWPA 1UXHA 1JEJA 1XEFA 1PYDA 2ONCA 3ABOB 3GJTA 4Q3DA 1SOWA 2HRZA 3MGBA 1EP9A 1QUEA 3PIDA 4G56A 2J0QA 2BP7A 2OLKA 1HRKA 1YB7A 4BLPA 4FZ5A 4WHMA 5I8PA 4BLRA 5C8DA 1M6EX 5E0OA 5IH7A 1HE5A 4LOJA 5EUQB 1YGPA 3HY3A 3L8DA 1E5XA 2GXQA 2C58A 2ZJ5A 3OOYA 4RHTA 4QNMA 3HEMA 1JEYB 4O8CA 5A4DA 1E3EA 2HWWA 1SH7A 1JDJA 1IB0A 3GFRA 3U81A 2HAEA 4R3WA 3ADCA 7YASA 2GJ4A 4FYMA 1ML4A 4YPFA 5BVHB 1CRZA 1YE8A 2B21A 3K0HA 1F06A 1V16A 5FTJA 1CQWA 1CUZA 4E2WA 1PR9A 1WCV1 3NHAA 1RYHA 1G5TA 4WY8A 3JQ6A 1EXDA 5JMPA 3HRHA 3QTBA 2V3WA 1IL0A 1H2WA 3HYTA 3Q11A 2HJHA 1W0JA 4M55A 4MYRA 2F62A 1QFSA 1IY9A 2IYSA 1R0LA 1DWOA 2PYZA 2QK4A 1E7RA 1LLDA 2WWRA 1Y3HA 2VP6A 2WLSA 2H2AA 2X5OA 3DBRA 3ME5A 3MWDA 3NAQA 1F6DA 1SCAA 4OJNA 2ZRBA 4P22A 2C7VA 1RRGA 5IASA 4PLYA 3CMMA 4JS0A 1Y1TA 3GGGA 1VZ3A 3ZZ0A 1V37A 1IIRA 2OLEA 1DRJA 3U56A 3ZOKA 1VMAA 2JB9A 4QASA 4QDKA 3A36A 3EFHA 2P5YA 1GNLA 4GF5A 5E4YA 3WK6A 3E9YA 1X74A 3PEUA 3K1JA 4TTJA 2F3TA 4Q24A 2JJ2D 2R7MA 3BICA 3IJPA 4FQ8A 4UJ3A 5FO1A 4A0HA 2AN9A 3UMVA 1H0SA 3K6SA 4EOGA 2J5RA 2RGNA 2YHUA 3MFYA 4UZFA 1PEAA 4DG5A 4PFSA 5HYVA 1NG9A 3EPKA 3PNLA 2OCKA 4KREA 1GQ2A 1X7GA 1ZH2A 4AT1A 3UGJA 5JSQA 2IHTA 1GRNA 3HVIA 4E2YA 3L82B 3C74A 1ZLXA 3MJFA 1FLVA 1N0IA 3BS4A 4P0TA 4HHEA 4RS3A 1PJCA 3KZ1E 2EJVA 3TI7A 5BPFA 1BDIA 4ALIA 2ZYTX 5JRZA 4M60A 2B8EA 3LZDA 2FTKE 4IGEA 2P77A 5JYDA 1EK6A 1R4MA 3GO4A 1RCUA 1ZICA 2WP0A 1YAHA 4DV4B 3KJIA 3GYBA 3NRBA 4TXJA 3PLAE 4FINA 3PQEA 3RJZA 1Q91A 2PIDA 1EM6A 3BL6A 3MMPA 4ITUA 4QUIA 2OA0A 3SS7X 4A5SA 4OLBA 1TYAE 2FPPB 2CUKA 4MRMA 3UJ8A 3PGXA 4AYXA 2C2MA 4JC4A 5KKAA 3JQBC 2G17A 1IJEA 2NTNA 3ZIAA 1SBHA 1OF1A 4CKEB 2Q27A 4W8OA 3DZHA 2QBYA 3B9PA 3S2SA 1P31A 3Q3CA 4H35A 5IJ0A 5TE9A 2DZDA 1U3UA 4X9XA 1KO7A 1U8FO 2OV3A 3D6NB 3F3SA 4GDMA 4Y1RB 5EJIA 5DT9A 2BGUA 3KUDA 1EJ6A 3DEJA 3HFSA 4EY7A 1J0CA 2P0YA 1J5XA 3JQ9A 2HLDA 3VMMA 2G71A 4KMRA 2HO4A 3GNLA 4C1BA 1BE6A 4DADA 1EQAA 1BX1A 1HURA 2E7ZA 3NEPX 2B7LA 4I3GA 2VJPA 3IPXA 4J94A 5DNEA 4KVFA 3SQMA 1ORTA 1WDKA 3WB0A 3WLSA 3MJSA 3PFCA 1H2EA 1KIFA 3O74A 5CHYA 2H4XA 4NDZA 2FZLA 1S2IA 3HYCA 4OA8A 3JYHA 1J9GA 2IEGA 3WYFA 4XOIA 1T9ZA 1R2QA 2H4FA 2OECA 1G5IA 5JISA 3AYZB 3D0OA 1AGYA 4HYQA 4QPCA 4V0QA 5JAPA 3KZKA 2PWPA 1NX9A 3PHBE 1H4TA 4I8XA 4W8GA 2XUIA 4PW0A 1KMCA 3PXCX 3QTLA 1IATA 1YC5A 3O5AA 2CV0A 1A0OA 2Q62A 4FMDF 3FDFA 2Y6UA 2BSXA 3GHHA 4OREX 2XCIA 3ENVA 2VHVA 3DEAA 3ND5A 3OZIA 4L08A 3E4CA 1GUYA 1WG8A 4JFRA 4QM6A 2FQYA 4M1KA 1KO1A 1EVEA 4QRHA 1MJFA 2ZU6A 2F3PA 3IHKA 2G5PA 3X1XA 3R2JA 1PBTA 1LDYA 3CX4A 3CVJA 4YRPA 5U4XA 2UUAB 2X4DA 1LTHR 4RY9A 1Y3BE 2IKQA 2WAMA 1TVMA 1CUXA 3BWBA 2YVUA 3W5BA 2ZB3A 3EGEA 1KI7A 1CQIB 4LXUA 5K9ZA 1UOQA 2DCMA 2ORED 2J7KA 3HCWA 1RRVA 1YACA 2EEPA 3JQGA 3U2QA 1Y5MA 5D7BA 2OV6A 3IO5A 3P0EA 2QAGA 3PEVA 1LH0A 3CC8A 1MQ8B 1QS0B 1ATZA 2GZ2A 4RXMA 4AG3A 3SIPA 2FI1A 2G28A 1L5MA 2IXDA 2WINI 1Y1PA 2QX7A 3KQLA 3FZEA 2ADFA 5DI3A 1OAOC 3LUJA 3CYFA 3F5MA 4RH1A 5IBCA 1L1FA 3KR1A 1YS7A 3PV0A 4LTDA 4UDOA 3N86A 3HA7A 2VH1A 1FBTA 4D9BA 4Y7DA 4X60A 3FWKA 3ZXSA 3OZUA 1I4LD 1V5WA 4M9RA 3Q8KA 3VPFA 3NTOA 3WBKA 5B1YA 1P4GA 1JT9A 1Q12A 4GPBA 4ZJZA 2C7PA 2OG1A 3COJA 4TWRA 3DOCA 3K6KA 2VYND 3EZYA 5TPZD 3U5ZB 1A72A 4PBTA 4DQKA 4IIGA 1VGVA 2IZ1A 3B82A 1JQDA 1TL7C 5DLEA 3U6KA 2IYNA 1SXGA 1T9BA 2WDZA 2XI4A 4PC7A 5JQGA 1RKVA 1DRUA 4HZIA 1KPHA 2VSXA 2O2SA 3FZGA 3KEMA 3PFKA 4KYVA 2OK7A 4RPIA 3T7TA 4TYQA 1FPQA 1BMFD 1E1QD 3Q85A 4FCCA 3RTGA 3RWMB 3VDRA 3KVYA 1X1TA 3EUFA 4CM3A 4HEQA 1JQ3A 1TU4A 1UINA 4JBNA 4YQYA 2H1OA 1GTSA 2NVWA 3D8TA 2BF4A 1HYGA 1QSGA 1UM9A 1YDGA 2WMYA 1WE2A 3AFGA 4HQFA 4IY1A 4BFLA 5FYQA 1IM2A 2J3QA 4IEIA 1U0LA 1U0FA 4TWIA 3FFBA 3FMVA 4MB2A 4B3CA 3WP0A 4ZPJA 3GNTA 3ZNQA 4HPWA 4PZCA 1BD4A 4U1RA 1U2PA 3HLKA 4JEIA 3M6UA 1NM5A 2QD3A 2XCSB 1Z06A 3TCNA 3TKYA 1TYDE 3BIWA 1ZUIA 4MVJI 3VHRA 1K6JA 1U2TA 1ZAYA 2BFFA 1S8NA 4IXNA 3CZRA 5EKDA 1HFWA 1Y1QA 1DIRA 4RV4A 3GH3A 1A5AB 5KQRA 3G7NA 5A03A 5D00A 3OCZA 1V6SA 1DAGA 1KOJA 5LJLA 2VFAA 1Y7LA 2WIFA 3LCCA 4FNMA 4OUDB 4TZTA 4YRDA 4C20A 3R7DA 4Q9HA 3KQNA 4ZALA 2AF3C 2JA1A 1EFHA 1WHTB 3OZGA 2QQ0A 4FVTA 4WKOA 2B2CA 2W6MA 4WOJA 2OR3A 2CVHA 3VGJA 4YC7A 1U7OA 2AFIA 3PVCA 4GOXA 5LVAA 5IW8A 3FTEA 4BMCA 1MAWA 3I12A 2A1TS 3BHIA 1NE7A 1PIWA 3G0OA 1NUHA 1QH8A 1T2UA 1KE2A 3OQIA 3W6NA 4WCFA 1U7HA 3UJ3X 4R2LA 2IS4A 4ZWNA 1SKBA 5A3QA 2QOEA 3QEOA 4F3KA 5ALDA 1LPSA 2HSEA 4XSHA 4WKGA 4BB0A 3O7MA 4I66A 1CUSA 2DPHA 3V7FA 5IBPA 3GPBA 3IKJA 1F14A 3QOWA 5DN9A 1AE1A 1NDQA 2JIDA 1NF2A 5EXPA 3PHIA 3PEYA 3K2IA 3ANTA 5ALYA 1TC2A 5F5XA 4DNOA 4YXFA 2NXEA 1QAOA 1QG2A 1QMGA 1DKMA 5CYGA 2N42A 2WJIA 2ZE5A 2R6CA 4YRMA 4UC0A 5AW4A 3KOXA 4G9BA 3JX9A 3JWHA 1K06A 1ECFA 4GUDA 2OILA 3D59A 5CNIA 1KZYC 3FPSA 3E5HA 4IJ6A 3IT2A 4KAXA 5CFPA 2GNOA 2KQUA 2E85A 2AFIB 4MIKA 1GPBA 4TRMA 5F1KA 1DT3A 1T6BY 4FJ0A 4YRCA 2H6EA 3T7RA 5IF9A 3QWAA 3AR3A 1O97C 4JI3B 1WHTA 4BJHB 1KJIA 1XOIA 2PS0A 3O91A 3ISJA 1F2DA 3A58B 2OP1A 5ENDA 1Y4DE 1WKVA 3TZ6A 4NK4A 3KAPA 1U5BB 4OH7A 3DT9A 5C7IO 4WFKA 4H7DA 1RIFA 4XEUA 3INYA 3TLGB 1AGRA 5GGYA 2ID4A 2BEJA 2Z2IA 1JHPA 1I9GA 3CNBA 3IOYA 3MC1A 3NASA 5JO0A 2I66A 5DHFA 3WGGA 2HSZA 2PBFA 1ZLYA 3QFCA 5BNFA 2AKAB 2X9VA 5CDTA 4W5NA 4UOZA 1MABB 4MW5A 5U1PA 3ED1A 3KYDB 1HXHA 4KZKA 2JFNA 3AR2A 4H77A 1DJLA 3B1JA 1SEPA 5K8VA 1QO0D 1OXMA 3FFWA 5GIPE 4KBYA 2B82A 5IT0A 1MT3A 5FKJA 3DAPA 3D6UA 2OBLA 4H4EA 4JR1A 1XMIA 3CLRD 4OV6B 4JC0A 2A8YA 4H08A 5DM1A 3SZ3A 3KQUA 2AC4A 2FOIA 4EPWA 4DXHA 3PQ6A 4LHZA 4YFYA 5D6OA 3AZPA 3T8YA 1IYZA 3AEZA 4KJZA 4OXXA 3REOA 4F12A 1L5VA 2PEZA 5J2UB 2G1JA 2IHVA 2JJYA 2FYTA 5H3LA 2RK3A 1EEXB 4UDXX 4N18A 1FMTA 3ZW8A 1OREA 1GTZA 2Z8ZA 1U7TA 2Z5VA 2AFIE 3RVKA 4ES6A 1Q16A 2R1VA 3I1YA 3QNMA 4JMLA 4KIJA 5D1NA 3T12A 1F8XA 1OPXA 4PX9A 4ZQHA 5L6MB 1RWQA 3WA6A 4EUKA 3JXEA 4IGFA 1WZUA 3K0CC 2OYCA 4NRDA 3CUKA 4PV7A 4I8IA 2OCIA 2F8LA 1QUFA 2QN6A 1EM8A 1JX6A 3GUYA 2DWCA 1RYNA 3FUTA 3OPQA 4IDGA 4XJTA 1JHVA 4FE3A 4QTZA 1U7WA 4L9WA 1C1DB 2UYCA 3PCRB 1KI4A 5AKYA 3T52A 5J2TB 1MW8X 1ZOLA 1CEXA 2AI3A 1PWZA 1OB5A 5AVXA 5BW5A 3MA0A 2J0VA 3AFNA 1L1EA 2QVCA 4I9FA 5D6NA 3WMRA 1PQ4A 4QPPA 3ZIDA 4HGRA 4DG8A 5JRJA 1KKMA 1VJTA 1SVOA 4L1KA 5AVJA 2I6UA 3HWRA 2BHTA 2A0UA 3K35A 1C3LA 2CJPA 2V0GA 1H2XA 1OYVA 1F4PA 2QRKA 1N6LA 1CG6A 1FZQA 2WKSA 3A6EA 5JAQA 2MSDB 2VPIA 4K9NA 2ZBUA 1HKHA 3IEXA 4TVKA 2P78A 1SBNE 2AJTA 1Z4QA 3LCMA 5ECYA 2HR1A 3DMPA 1E3TA 1XMVA 3KEFA 4PGMA 3S1AB 5KYYA 1LNSA 1T9HA 5H3CA 4GR4A 5L40A 1DXHA 1TM7E 3DKVA 4RX1A 1KZ1A 4MP3A 3VR5H 2M6SA 4UE3S 5L7TA 4E3WA 2CKDA 1S0UA 3EGIA 1EUCB 2JS7A 4OHVA 4EELA 3A0RB 1GZ5A 3BWXA 4ZZ0A 1I7PA 3ORYA 4EKNB 1V4VA 3TRDA 2NUBA 2ZR8A 2C94A 5GINE 1RBMA 2Q1UA 4QAJA 4YAFA 1OQAA 3DZGA 3NCHA 1P2SA 4GI1A 4RQBA 2GCEA 2W43A 4P9NA 3R9XB 3ZDCA 1PBNA 1Z4MA 3HB9A 4M1YA 4N6GA 4OXKA 2BM1A 3CB4A 3UWDA 2X1HA 1XYVA 2X6QA 4RLSA 3QF4B 5BXQC 1II8A 1UJMA 2RAUA 3KC2A 4ITVA 4UEJA 2PYDA 1K4MA 1Z35A 3FCEA 4HAOA 2M6KA 3D4PA 1AM4D 3ELWA 5B2FA 4CQMD 4MVJF 3RREA 3WO0A 6YASA 4HLDA 1P81A 4ZKEA 4UTRA 4AS2A 3WYAA 3IP6A 4EY3A 1HT3A 1H42A 3KT8A 1H9BA 3QK7A 1XVLA 4NJEB 4IGAA 3KSZO 3HADA 2B83A 4UU8A 3L4EA 3QPAA 2FP3A 5BVGB 4EF4A 3DAOA 2PRSA 2JGKA 2VYNA 5DBFA 2OB2A 4W5QA 1QB7A 1S2DA 2HI0A 2QJWA 4PGFA 2XIJA 3WFZA 1RQLA 8ABPA 4RM3A 3TW6A 1Y6GA 1YUNA 2NU6B 3I73A 4M54A 1L9XA 3HUTA 4FFNA 4J2TA 2E82A 4MUIA 4AX8A 1EVIA 3AEKB 3UA4A 5CCBA 3QKRB 3G8DA 4D96A 2J85A 3EZ9A 1G63A 1GKYA 3BIXA 1WMBA 2CNLA 4K6MA 1IBLB 1EINA 1U2QA 1IWPB 4ZGBA 2VZ0A 4UCFA 4AZVA 1CB7A 1JHRA 3EQ8A 4HAYA 1ILEA 5JECA 4D44A 2P6UA 5U4QA 5FWYA 1OA0A 1RP7A 1Z5PA 3OFVA 2E37A 3FOCA 1PS0A 4HBZA 4N5DA 3WKBA 1O2DA 2FZWA 4ND6A 3SZUA 2CD7A 3FTQA 1DBIA 3MOGA 3R9IA 4HVLA 4RMHA 1SBQA 2XCOA 2LE0A 3MAJA 3IUMA 3SFZA 2P6RA 3WK9A 3BE5A 1GCOA 3FHOA 1GQQA 2WF6A 4GNKA 1F4VA 2HPVA 3OSUA 4HT3B 4CWAA 5JH7F 3FVTA 4TSRA 3BRCA 2LD4A 1V7PC 2B1IA 2PK3A 5IK2A 3X1JA 1SXJC 2PS3A 2QNRA 4DM7A 5TEVA 4DQDA 3P0HA 2BL4A 4R8VA 1Y5RA 4FLMA 4X94A 5HF8A 3TDMA 1E6MA 4LZWA 4RFLA 2ZDHA 1AKVA 3KKMA 3N3AC 3CO5A 4LN1A 3F3KA 4MVJM 3RE1A 1S9DA 5E1BA 1Z38A 4B7XA 4E3ZA 1XZCA 3OZCA 2X9LA 5EUBA 3SYKA 5TJ9A 3OFKA 2VAMA 3E9NA 3JVEA 2HA3A 3SR4A 1M0EA 1D0IA 3DDWA 4MROA 1AUOA 1IQUA 13PKA 3NT5A 4II7A 2WVAA 3D4NA 3DZCA 2NXCA 3COWA 4EZIA 2DHDA 4U7PB 5REQB 3OZBA 3DEZA 3MWDB 1LFAA 4J7XA 2NWQA 1SJ9A 3ML1A 4U6NA 5IM4A 3R76A 1K6EA 4PLCA 1CRQA 4DUZB 1MCZA 4BE7B 2BFDB 1XXLA 1RYMA 1ZD2P 4Y67A 5A3SA 4Z6KA 4TMVA 2JCGA 3PRJA 3TZQA 5A6SA 2Y68A 1ZKMA 1AKYA 1JIIA 4HN9A 4IUYA 5HDQA 4F11A 5B36A 5K4HA 3AI7A 3A9VA 3G17A 3PICA 4QWMA 3KJFA 4ZQFA 1MC8A 2RHWA 5FHQA 1OFTA 1G2OA 2XWQA 4LV6A 1YFLA 1QIJA 5EQJB 4H7KA 1H2FA 3MM4A 2GSWA 2A4MA 3KKEA 1JEYA 4X20A 5CFQA 1X0VA 4BIMA 4RMIA 1V9LA 3NGXA 4Z9AA 4CEJA 1GOTA 4J43A 3EZ7A 1I5OA 1CBUA 1M8PA 3IXMA 4R9NA 1V95A 3SJCA 3VDQA 2FFQA 3VR4D 3DMYA 3ZY4A 4URHA 4CVNA 4DKXA 2QENA 5CX1A 4YP1A 4ZYXA 1Z2NX 5BN4B 4MKXA 1DJPA 2Z4TA 3U7JA 4HB2A 2PZKA 3F0TA 3BH7A 1E64A 2OGTA 4NOKA 3R74A 2FPGB 2JLSA 5DCYA 3G3EA 3X1KA 4YP9A 1JPNA 1ZSVA 3T7AA 4B1FA 2YV2A 3QVJA 5L3QA 2IA5A 3Q6IA 4B46A 2GSDA 3A11A 3M4NA 4QYMA 3TVYA 1KIAA 4F04A 2ACVA 4CG2A 1PZXA 5KDOA 3G89A 1S2MA 4N0QA 3R8CA 3WJ2A 3CUSA 4A8HA 4ILEA 1N33B 4PU0A 3RGGA 1M2VA 3T5BA 1VLLA 4KFCA 1MEOA 1Z45A 4JWTA 1FNCA 2I99A 2XXJA 1QX4A 4MVJA 4U7WA 1F38A 3G49A 3OF3A 4NPHA 3FLMA 5CEJA 2DM6A 1W75A 5I5EA 3UJCA 2PH5A 3EODA 1USIA 3ET4A 3B1FA 4I5EA 5DV9A 1RQXA 1X86B 1XRRA 4ZAXA 4BKUA 3I1JA 3VR5D 2CYCA 1ZMBA 2NADA 3R6WA 1GNRA 4RVGA 1IQPA 2FB9A 1E2IA 2GO7A 2OFXA 5CP8A 3RT9A 1PE0A 4BQOA 5CAEA 5F7OA 5HHTA 5AVOA 3K4HA 1Z4OA 2O2ZA 2QS9A 3UMYA 3R8FA 1DJMA 1EZ4A 3RHTA 3KTAB 4CMIA 5DJ5A 1RRCA 3EGDB 4TQGA 2GUGA 4LUCA 3Q7EA 2CJWB 2NUAA 5HILA 2OCLA 3HLTA 3Q3IA 1B6RA 2PO5A 5GADl 3OTWA 3R0QA 4QJIA 4FDLA 1XK7A 5EVJA 3OVMA 1RHKA 1XLTA 1SBZA 1MLDA 2QQ5A 3LZ6A 2Y99A 3S29A 4ZAGA 3HH8A 1K5DA 5IF3A 2GPBA 3SR0A 1UWKA 5ICCA 5K6AC 3KFLA 2FMKA 2FOLA 2X8JA 2QA5A 2XA9A 3L6UA 3UB3A 3SX2A 1EDEA 4O3FA 5EE1A 5K4GA 5IDVA 3DW1X 4WVLA 3JV7A 1CRLA 1TADA 1TW3A 1BHSA 1WUHS 2HJVA 1KU0A 4NAHA 4PCAA 1YNSA 1SHTX 2JAOA 3VJLA 1E6LA 3ZHSA 4IHJA 3MS4A 3NTRA 3OEHA 4ZHQB 4XCQA 5KOJB 4TYWA 3KV3O 4ZEWA 2NU6A 3UFXA 1A8HA 4I3HA 3KHKA 1UBKS 4LNHA 3NHUA 2XE4A 4CMKA 1WY7A 3S2EA 4C29A 1NLYA 3A1TA 1E18A 3NYRA 1OBHA 4K9DA 2UXBB 1YH3A 1HGXA 1ZO8A 3I9NA 2H51A 4LCEA 4DQXA 2Q4RA 3BRSA 4B3RB 4RKWA 1PJBA 2UVPA 2GZHA 2ZQYA 1K3FA 1WUIS 5HKKD 4JV5B 4G07A 2OD2A 4ATNA 1WBDA 1BCSA 1T9DA 5JYCA 5KKCA 2WILA 3UHJA 5DBIA 4MV7A 4R7GA 1PQPA 4QO8A 2F3SA 4Q9DA 4F5YA 2BUBA 4WCFC 3LDGA 2I7TA 3KYCB 4OM8A 1JFSA 4I4NA 3E7WA 1YQQA 3MS7A 4MRNA 2WI8A 3Q8WA 5EEHA 2BUCA 1OLSA 3I83A 1X7ZA 5IN5A 1JLLB 3J81k 1QHFA 1JHDA 2X9GA 2PKQO 1X2EA 3U9TA 1PD0A 4N12A 1ISRA 5IX8A 2FJUA 4KE8A 3R0JA 4GMDA 4P58A 4QDXA 4CMEC 2R60A 3WL5A 3HDVA 1GD1O 1HE1C 1TCBA 1TM4E 1PNRA 3FAZA 1U2EA 1OIVA 1E5VA 1EUCA 1O5IA 5HOQA 4PGGA 4U7TB 4Z9YA 4BWGA 4QKQA 4MV5A 2ECPA 4KXNA 3OQOA 3AZQA 121PA 2IK8A 5IAKA 1AQJA 2JD0A 3HWWA 3SDBA 3FOWA 1Y4UA 3U37A 2A3RA 3BXPA 1CULC 2QJFA 2ZRFA 3EVCA 3GZNB 2QTWB 1QBGA 3PQFA 5BSEA 5FWXB 5JBNA 3SSNA 4ZTZB 1T0PA 4DR6B 3FFXA 3LQQA 3ZJTA 2DTXA 1W88B 3GARA 5HK8A 1AA9A 1LF0A 1NUUA 3DOUA 3M6XA 5EN4A 2CUNA 4XARA 1D0VA 2G80A 4OHBA 3KQWA 4D42A 3T1HB 1KRXA 1K5GA 2X3UA 2R4UA 3H42B 3GQBA 3MJHA 3TG2A 3JZFA 4WE3A 2LZ0A 3DPUA 1WW8A 2WTNA 3L93A 4GWLA 3SS9X 3TTVA 4C6SA 1CUHA 5EIAA 4EARA 4A6DA 2VBFA 5LIRA 1JAZA 5DMXA 1GG5A 1LPAB 4QU0A 5EIXA 3V42A 3E8SA 2HBQA 4MVJH 4X44A 4CDNA 3E5NA 1QV9A 5CPFA 5DSXA 3QVKA 4G0MA 1VOTA 4TKVB 1G0OA 4I19A 2VF4X 5I48A 3BYZA 2ZIAA 2OMKA 2PBLA 2XJ9A 3MTAA 2ZWVA 4Z49A 4EGFA 1ARZA 2EV9A 1XWFA 3IERA 1GWNA 5GOTA 1X80B 1SC3A 1UBNA 1LSOA 1YGYA 3LRXA 3R1IA 1ZUNA 4BVEA 1PS8A 2ILVA 3GEEA 4HNGA 3T0IA 3WWCA 3RANA 3ROZA 4KKXB 4D3SA 3WHPA 5T4BA 5JEDA 1L4LA 2FP4B 1SEVA 3IP9A 3QPBA 1OE0A 4DB2A 3MJCA 4LRSB 1UJBA 3TI9A 1OT5A 5B1HA 3CX6A 3V1UA 5HWSA 1IY1A 1V0JA 2AVDA 3QEKA 3SAJA 5J47A 5FX2A 4FYKA 4HQ0A 4UHJA 2V6IA 4IRXA 1XZQA 3CF0A 3IIJA 4U2EA 1PKXA 2ZRNA 3GEDA 4FTWA 4J0QA 1YBMA 5E7MA 3N0VA 4J0CA 4DBLC 4WQMA 3E4DA 2OORC 3AWIA 2OFPA 4LFAB 1XEXA 4O59O 1Z82A 4XRRA 3ZHXA 1GZ6A 2W00A 4HX5A 4QHTA 3R40A 3RUFA 1M34B 4OO3A 3TTTA 1B26A 2P9BA 3C8HA 3ZWCA 2PO7A 3ZDRA 2DECA 5KHLB 1IONA 2JI6A 2PL3A 3GFTA 3IDZA 2XUDA 4B6FA 1JFVA 1ADJA 2B3TA 1N3LA 4WX2B 3OZRA 3NPAA 5JDIC 2PH7A 1FVFA 3BAFA 3V48A 1SKYE 3L41A 1JIVA 2P9QA 4ARAA 2RGBA 1GPMA 4AZ0B 2M1XA 3VZSA 1A7AA 1AUQA 2RBEA 1FUEA 4FMDB 4I46A 3OM8A 4I6GA 3C6MA 2I91A 3FZYA 4R8MA 4KUGA 1PZHA 3V1NA 3C98A 1V8OA 3T4XA 5KNBA 2RGRA 4KXVA 1E2FA 1XRNA 2I2BA 2VWHA 4V0SA 2NU9B 1FP6A 3GVPA 4CDMA 2QHXA 4WW0A 1BU8A 4ND1A 4UEKA 5ESXA 4EA8A 4TXNA 1OXTA 5B30A 1LRKA 5AW6A 2F3UA 1O9GA 4R5HA 4W1SA 2HCJB 1MP0A 3HXPA 1YCFA 3OC0A 5DP1A 1SCBA 4E5NA 1U5AA 1UH5A 5JNTA 1UIMA 4S1WA 3U4CA 1L7OA 4J0GA 4UKDA 1YVDA 3AQIA 1A2KC 5IVKA 3C8ZA 1BHJA 1JFFB 2ZTSA 1D8AA 5BWLA 4MR7B 2DHRA 4MS1A 4KJXA 1RWBA 3EWAA 3K0FB 4UMVA 1U2DA 2I80A 3C3WA 4JKOA 3B9BA 3LRPA 3BJMA 1AGPA 4N0DA 4TS9A 3SI7A 3VR6H 5JY6A 3ASVA 4JJ8A 1FFXA 3R6DA 4QGSA 4N5IX 5C8YB 1R64A 1N0VC 4ZKDA 5JTTA 4F71A 3QOYA 1HEUA 3ZJYA