4BV3A

Crystal structure of sirt3 in complex with the inhibitor ex-527 and nad
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
total genus 91
structure length 270
sequence length 270
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bv3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bv3A01
4UUBA 2AG0A 2AG1A 4I5IA 1HZZC 4GP9A 1U31A 5EJAA 4BV3A 3EY9A 4RMGA 3U31A 5BWLA 3HWX1 2QQFA 3PDHA 1S7GA 1Z8NA 1PI3A 1M2JA 2EZ4A 3HWWA 1ZPDA 4UTVA 2PANA 2H4JA 2A1UA 2EZ9A 1BFDA 3LQ1A 3D81A 1Y9DA 2Q28A 4BN4A 2IHTA 3EYAA 4K9PA 1OVMA 2UZ1B 4JUBA 5MF6A 1Q1AA 4BN5A 4BVBA 2QQGA 2JI8A 2JI9A 4MZXA 4F56A 5DGTA 5AHKA 5K6TA 5EJ5A 4BUZA 5D7NA 4X3OA 1J8FA 2W93A 4TWJA 1PNOA 4BVFA 1V5EA 2EZUA 2JLAA 2Q5OA 4GM1A 4IF6A 4GM0A 1PYDA 4K9LA 2HJHA 3CF4G 5K3SA 2OORC 4K9QA 2H2GA 4FZ3A 2FN3A 3CLRD 5FEMA 2H2IA 2VBGA 1PO7A 2VBIA 2OD7A 4C7BA 4JUCA 1M2HA 1YNOA 2A1TR 1ICIA 4UTXA 2C31A 4RMHA 4Y6LA 4V1CI 4RJIA 4X3PA 4COKA 1YHYA 2IHVA 4JU9A 4Y6QA 5IMSA 4JT8A 1S5PA 4G1CA 4JSRA 1NM5C 2OD9A 4UUAA 5MGNA 2NYRA 3IAEA 3ZGVA 4BVGA 2H2HA 1E3TA 1OZHA 2Q5JA 2JI7A 1PT9A 4QQ8A 4UTRA 1YC5A 5DGDA 2VK1A 3U3DA 4RMIA 1YHZA 3CLSD 4BVHA 2B4YA 1U2GC 2PGOA 4J1TC 3IAFA 4Q9DA 4UTNA 1M2KA 1PTJC 2V3WA 4K9OA 4MPPA 3ZG6A 1T9CA 4HD8A 4FEEA 3FLMA 1DJLA 2OD2A 3PKIA 2JI6A 4UTZA 2VK4A 4L3OA 1POXA 2WVAA 4GM4A 4QPZA 2VK8A 4RJJA 4MPJA 3ZGOA 4UU8A 5MFZA 3F6BX 4BV2A 1JSCA 2FSVC 1POWA 2IHUA 4K9KA 3D4BA 3GLSA 3JWPA 4MQ5A 5BWOA 3F6EX 4IAOA 1MA3A 3GLUA 2OO5C 4JU8A 1MCZA 2JLCA 4KXQA 2H4HA 1V5FA 2Q27A 4KPUA 1UPCA 1XLTC 1N0HA 3PKJA 4QELA 4O8ZA 4KGDA 4RJKA 1QPBA 2PGNA 1Q17A 1UPBA 5EJ8A 4JUFA 4GG1A 4K9NA 2FR8C 3GLRA 5EJ7A 3JR3A 2H2FA 4BVEA 1T9AA 1PVDA 5FYQA 2JIBA 5DEIA 5EJ9A 1YBHA 4FVTA 4V1CB 1YI0A 2X7JA 2Q5QA 1T9BA 2VJYA 1EFPA 4GPEA 4Y6OA 3GLTA 1T9DA 4ZZIA 1UPAA 2BRUC 3EA4A 1Q14A 5EJ6A 4JT9A 4JUDX 4D5GA 1OZFA 2VBFA 1O96B 2WVHA 1YTLA 1M2NA 1YI1A 3RIYA 4HDAA 1Q6ZA 2H59A 5K2OA 4J16C 1EFVA 2DJIA 4L2IA 1M2GA 5MFPA 1SZDA 1D4OA 3D7KA 3CLTD 3FZNA 4TWIA 4ZP1A 4C78A 3RIGA 4UU7A 3FSJX 5EJ4A 3E9YA 4D5EA 2Q29A 2EZ8A 2UZ1A 1YC2A 2Q5LA 4R8MA 3OE1A 2FRDC 4IG9A 4JUAA 1O97D 2H4FA 2H2DA 5BWNA 4FEGA 5K6RA 1U28C 4V1CA 3K35A 5EJMA 4F4UA 1OZGA 1V5GA 4RMJA 2WVGA 1PNQA 2FWNA 4JD5A 4K9MA 2EZTA 3CLUD 2NXWA 1U2DC 1SZCA 4MPRA
chains in the Genus database with same CATH superfamily
3L8HA 2ZKLA 3MPUA 4PVDA 3EVBA 1VIVA 3E70C 4AJHA 1KF0A 1E5TA 2PCLA 2XNSA 4WLFA 2JGFA 3F4KA 5KIAA 1ZM3A 3FVTA 2DP4E 2PZFA 2ZZMA 1DJNA 2CVHA 1XEXA 4G84A 3KBBA 4AS1A 4PQYA 5KOHA 4FX2A 1Q1NA 3W5UA 4B48A 4AJ4A 3TDKA 4M0LA 1ONBA 5DWDA 2V97A 3GY0A 1VGQA 5FYDA 2DPXA 5AOVA 1XLVA 3F74A 3A04A 1E99A 3M4JA 4V0OA 4CNBA 1IQPA 1Y1PA 2BP7B 2JAPA 1CJVC 2OHGA 4A16A 5TXGA 3KELA 3PD0A 1DEXA 2VJNA 4I4TA 1NVKA 4MDEA 4K81B 5AUNB 4I4IA 2Q9UA 3R3ZA 2GFIA 5DNAA 2O50A 3KJHA 1ZMTA 3PEVA 3ZX5A 4LWOA 4MR8B 4B44A 1M2HA 3N5KA 1Y98A 1YBMA 4OQDA 3GFTA 3BTVA 5P8WA 1D0VA 5JBIA 4ETNA 2NYAA 4B4UA 3LUGA 1V26A 2C2BA 2YN2A 1RMTA 4Q9JA 3KLNA 4FLEA 4O59O 5K0SA 4BQIA 1U7ZA 2NN3C 1HMYA 2R97A 3HCCA 3ZKWB 4E15A 5KYTA 3UXYA 3CVVA 3V6LA 1PR0A 1IUKA 1DL5A 2JKYA 4HY3A 2VQFB 2C2MA 4BNDB 4L75A 4MVJD 2QUJA 3ZXYA 4YRMA 1RADA 1E7SA 1KAGA 2RONA 4PPQA 1T3HA 4X7BA 2Z95A 2X6QA 3UUFA 3W4JA 3LBAA 2IA5A 5BMOA 1POXA 3NOOA 3RTEA 1C4WA 1K89A 4WFKA 1S4MA 3UJHA 5E4YA 3IKVA 5GINE 3QPCA 4IIGA 5AW8A 3SQLA 3ZK7A 3NBYC 1LPSA 2O2EA 4W7IA 4AZVA 3UO8B 2QT1A 1TADA 3CNBA 3DOJA 1ECLA 3FMPB 3DP9A 3AM4A 5GOTA 5KTPA 1YZTA 1PJQA 3TL2A 4AKIA 2M6RA 1JGTA 1JR3E 3U4AA 1SQ5A 2G06A 5JNRA 4MPTA 3VBEA 4HDSB 3T3MB 2C03A 3EXEA 4IOMA 4TLBA 1FCJA 3W5DA 1JUDA 4BPBA 1QG0A 4MWZA 4PPYA 1C4KA 4TVKA 5CNIA 4BX9A 2ZJ1A 4CGZA 1TM2A 1TU3A 4MICA 1BDBA 1GU1A 1ZUHA 2W48A 3NW9A 1A7KA 1TYZA 4FKZA 4F4FA 3IV6A 4OG2A 4LPKA 2BGLA 3S29A 4F8EA 1R10A 1QTNA 3MZ0A 3SBOA 2JFFA 2E37A 2OP0A 2ZRCA 4FI3C 2QGZA 3M89A 4WX2B 3GYGA 1N5OX 1QDUA 1VZ2A 5ADWA 2BEUA 2CLFB 2DR0A 2GARA 4XIYA 3QH4A 5F98A 1KI1A 4G41A 1C8LA 1QRAA 3K2BA 3MWKA 3D8BA 3IBGA 2VTDA 1SZJG 3UCEA 4GOXA 5HZHA 3LP6A 3KPUA 4TKUB 3EIHA 3FMVA 2OLJA 2VJBA 3GHHA 1KDRA 3LX6A 5C81A 3O8OB 1Z83A 4D4GA 3PKZA 3GXOA 5JNVA 2AFRA 1GL9B 4A5OA 3RVOA 4XGKA 5ED4A 4MRMA 1QG2A 3ZK8A 2Y1DA 3ETNA 4BKQA 4DA9A 1BSVA 4G2TA 3O4JA 3QNUA 5AVOA 1EHIA 2CSXA 3I32A 3EEIA 1A50B 1UAAA 2AG1A 1ZWLA 5DLYA 3OC6A 5F2KA 2WJ3A 5FBQB 1JB9A 1Y3CE 2A0XA 3GDFA 4NZPA 4ZYVA 1SN7A 4W99A 1PIWA 2GM5A 5JRDS 4IX9A 5J4VA 2ZRLA 4CKBB 3I83A 4QDZA 3TAHA 3H11A 1G8PA 2YOHA 2VSQA 2J3MA 1HF3A 1JWBB 2ES4A 1AUPA 1TVKB 2JA1A 2XBUA 5EE1A 5MF6A 2C98A 3I2JA 3ABOB 4BWGA 1Y6JA 1ZH4A 5G4KA 3N39C 1EP2B 1V1MB 4EYSA 1W1WA 3MFYA 1BS1A 2X1LA 3BRQA 4YIHA 3D7RA 3LOPA 1UXKA 4CETA 1LPNA 2YZ2A 3CF4G 3VSAA 4L73A 1BEUB 3L43A 3WA7A 621PA 4O63O 4D82A 1CE8A 2Z3ZA 1RQNA 3AY0A 1GPJA 2GD1O 3JQ8A 3P71T 2ATXA 4RXUA 3RF7A 3C6YA 4MYCA 1RI1A 1QH0A 3LUFA 5AVYA 2FE1A 2FPIB 3NC0C 4A0HA 3W5VA 3LHDA 5FOUA 4UCQA 2R5NA 3W5BA 5A4MS 3NR2A 3CVYA 1HBJA 4OSPA 4IJ6A 1JEAA 2D0PB 2H57A 1GV0A 3UGQA 4BNFA 2PUVA 2AMVA 3UFXA 5LFAA 3AI7A 1AF4A 4I5DA 2OCYC 5CYOA 5BOSB 4G0UA 3TDMA 3RTDA 3A6ZA 3OJWA 4EKNB 4ECEA 5F7JA 2C8KA 4LHEA 4MGEA 2YWXA 4JX9A 5IJXA 3K72B 4WBXC 3QKWA 1NJGA 4P7FA 4WKBA 3WLKX 1EFRD 3EUFA 5BSUA 2YWCA 1JSCA 1PGPA 2YBEA 5JZBA 3ICOA 4LY3A 1RT9A 3DF9A 3SHVA 2ZI7A 5K4GA 3ZCSA 3PWSA 2PL5A 1UWKA 1D8TA 1K6JA 2PLRA 3ODPA 2EVWX 1E9DA 3GBSA 5H83A 2P2ZA 2BR5A 4RE5A 1FDWA 4MV0A 4RK5A 3DVSX 2ZCVA 4LXYA 3GNSA 5REQA 3T99A 3PC8C 1IM5A 3IMKA 4KXMA 4LGMA 2RHBA 5IVIA 3U39A 4MA0A 2EFGA 3QG1A 4RD6A 3HDTA 3R8CA 1WD5A 1EM6A 4DB2A 2J6HA 3FDIA 1JDUA 4IW3B 3UG6A 2GHIA 3GLIB 1XTUA 3SXPA 3BMNB 4Z8YA 3ON5A 1RRMA 3THOA 3HNOA 2C7RA 4G5XA 4B3TB 3WL5A 3CN9A 3KCQA 3C45A 4KUEA 3WBKA 5BYBA 2QRPA 3TIFA 4W4TA 2YJGA 3OF2A 3WGOA 3ZY2A 2BL4A 2NSHA 3QA3E 4YHBA 1H22A 2OT3B 2R84A 1ILEA 1VSUA 3WNQA 2UZ4A 2XUFA 4Q15A 2PLFA 3OCZA 2FW9A 4CFYA 3GZTB 1L7DA 2IXAA 2W4IA 5HQ3B 2I2DA 3RS7A 4ZKDA 1Y8ZA 3CLKA 4KPEC 4CMIB 1JHZA 4JBWA 5AM1A 4Z7OB 3JWIA 1BAPA 4D8YA 2CJPA 4FQ5A 1J97A 4ZCQA 5GGXA 2EJUA 4WJLA 2XMSA 1YE3A 1YJAA 1Q77A 3ET5A 1QO0A 1I4DD 1QONA 4G4IA 5E6SA 3RC8A 4WNAB 2HSGA 3CVOA 3E23A 4ISCA 4EPTA 3DZIA 2IYXA 4BY9E 1HA3A 2GA8A 5DP1A 1MO5A 3IPAA 4RS4A 4WDRA 1XAJA 3AEKA 4YP1A 1OU0A 1G5RA 1U5CA 4O3FA 4H9GA 3ZK9A 3OM8A 1Q2UA 3TLMA 4LDZA 3OTHA 3WMGA 5G0TA 1AQJA 1UQTA 1BVRA 2WJVA 5JUWA 3EOBI 4EVIA 1QPGA 2OV1A 4KUGA 3BYZA 3FVVA 4BNMA 2J5KA 2J7PA 3MB5A 3GJSA 3ZR4B 5LL6P 3ND5A 4JIMA 2Q5IA 1N1EA 2P6MA 3I2IA 2X4GA 1S2LA 2AH5A 4QO7A 1FTQA 1R6XA 1TUGA 4RC9A 3UTCA 4CIAA 4C89A 2SCUB 4Q1EA 4KKVA 2ZYGA 3A6KA 3WXMA 1OIXA 3RBXA 4NE2A 1C3XA 1H8EA 2REBA 3WAKA 2AFIB 1O95A 4HXEB 1UC5B 3ZYCA 1JILA 4O2LA 1Y4DE 3OLWA 5EN4A 1Y6FA 4OBWA 4ARVA 2XODA 5A6SB 1RKVA 3SZOA 3AEKB 1GILA 4WI1A 4CKEB 1V9LA 2Q3BA 1RC0A 2R68A 3MMXA 5EIXA 3EQ7A 2HHLA 1B16A 1KYZA 3ZH2A 3C1TA 3A28A 1U9IA 3KOMA 2CC2A 4DJAA 1VJ5A 1YR3A 3BJMA 4AJ9A 3ZJVA 2PGOA 1Z88A 3G6KA 1Z5PA 3IOBA 5C1IA 4B3CA 4L8WB 4UOEA 1UODA 1E60A 3G9TA 3GQBB 3H1FA 1Z6GA 2C8VA 3H17A 5SY4A 1JLLA 3TW6A 3VO2A 2CNOA 3WQSB 4KR0A 1ZJ5A 2WA1A 4ZQFA 3OQVA 2HJSA 4NFYA 3F6EX 3O2SB 4AECA 5J43A 2V96A 5HQJA 1H8ED 3AW8A 3VSCA 1FLAA 3T52A 2XADA 4C0KA 4B4VA 4ZMSA 2W2LD 3T7CA 2YC2C 3FZQA 3LSTA 4GZ5A 1GLGA 3PKJA 1AGYA 4OKIA 1H2FA 1JX6A 1JIVA 2P40A 4QYIA 4CL2A 3FWZA 4Q7JB 3WHIA 2NU7B 2PK3A 5IP5A 2CKDA 4PGHA 3OCVA 1PKEA 1ZD4A 2ZI3A 1E89A 3CLHA 4NJMA 2H4YA 1N3LA 1LRJA 3MILA 4QT0A 4Q4DA 3ZU2A 1YBHA 1YNSA 5B1IA 3EAGA 1QUEA 5GOZA 3RGWS 1YF3A 4RIIA 2WDPA 3SSOA 2H00A 1H5UA 1LLQA 4ZZ1A 1UKEA 4CMJA 1YQXA 2CXRA 2P0YA 1RJGA 4ZJUA 5D3KA 3UUGA 1VM6A 3Q9NA 1D0SA 1L9XA 4LWQA 4M9CA 5ENVA 3RPEA 3C74A 1T4GA 5JS2A 2OV3A 3Q40A 2HJ9A 4RWZA 1SZDA 4HLUC 2QTNA 3FLEA 3Q5DA 5F52A 5CLFA 1T5TA 1B0UA 2OP1A 3E82A 2OMEA 4L28A 3IKLA 3OJOA 1I3CA 5LXTA 2GXSA 1ID8A 1ISFA 2IH2A 1O6CA 4D9NA 2I5PO 4HLCA 3FUWA 4ZHQB 4J2HA 2AR9A 3PEEA 1W581 1I13A 1J0CA 2N46A 2PAAA 3PFNA 3ZWYA 3QVGB 4BKPA 3QOFA 5K01A 3WQQA 3HZHA 4D80A 4PGMA 1RP1A 3D3KA 3NO4A 3JASA 4RZSA 4PSKA 1FVOA 4GLBA 1XMOB 4MI9A 4EATA 2B6HA 1SD5A 4DRXA 5CIQA 3ND8A 1TQDA 4OBEA 4L08A 3P9PA 3OZIA 2I8CA 2A35A 3WZ2A 4C0BA 2G36A 2J4FA 3HN6A 3ENQA 5EUCA 3N0RA 4R1SA 3CGWA 1D6JA 4FEYA 4JLNA 4ZOCA 1X2BA 3AZOA 1LFDB 4RFLA 4QREA 1U2GA 4LZNA 4Q1DA 1HO3A 1A4XA 3LHIA 4UUMA 2AYXA 4MQMA 3U56A 5C5DA 4L6IA 1NMEA 1RWXA 4RVFA 2OVFA 4BIIA 4F71A 3HCWA 2P4QA 3FYUC 3LHFA 3O92A 2NU8A 1YDGA 1HYBA 1LBQA 5F3DA 2HY7A 3QJYA 4Q4JA 3INTA 1PYDA 3JVVA 3GHYA 4WNIA 1CUFA 2A57A 1KEEA 1LWNA 4MCAA 1ZJ6A 2ZSUA 4DLYA 1FRZA 1C9JA 1C8VB 1QGOA 4QOFA 1QYVA 4EA8A 3CZRA 2GJ4A 2FFBA 2J08A 5ERXA 1CR1A 1N8KA 3P96A 1VPLA 4L16A 1OXKB 1Z34A 4LV5B 1FX0B 4XDYA 3NOXA 4ZT3A 3KUDA 4TXJA 1SRQA 4BAZA 1Q3KA 2ZWPA 3ANLA 3HCRA 3ZNOA 3QIAA 2YDYA 1DMRA 1T26A 1Z22A 2QMYA 5KWVA 5JE8A 1K75A 2FRDA 3K0HA 4S1OA 1SXIA 2ZULA 5FULA 2XCSB 1VKRA 3QF4A 3LU1A 4KP7A 3WIVA 1F3LA 3V42A 4YV7A 3ILHA 1JG3A 3OD1A 4DDHA 3CYFA 2YW9A 1T6YA 2JIZD 1CFJA 1NQWA 3L04A 4LG1A 4YNBA 2CN1A 1QXSA 5I9IA 1IDN1 2H1CA 3HDGA 3IJ5A 3PDCA 4TKMA 4BUCA 4UTPA 4GKAA 4FGSA 3PJDA 2MCFA 1AG9A 1YJ8A 5BVGB 1XMPA 5HKLA 4RE6A 3L0YA 4OXIA 5D3QA 3DAOA 4U2KA 3TEFA 2OXCA 3M6WA 1A8IA 1T2FA 2QYOA 3HBLA 3KXIA 3AFOA 2GJ8A 3CZMA 4ZOLA 4O4IF 1J6UA 1C7QA 4PNPA 5AFSA 2MR5A 6YASA 1OREA 1GG5A 1P29A 2DFVA 2XYGA 1KEPA 5FQNA 4QARA 2C9BA 2H65A 2OB2A 4DSTA 3K2IA 3LWZA 4DCPA 3LW8A 5CDTA 2CSUA 1DJMA 4N40A 3AP2A 3TXXA 3RS0A 2EERA 3I4CA 2TECE 1YZGA 2BRUC 3UXMA 3G5AA 2YFYA 2JASA 2GBLA 1JRLA 4I9UA 1YU6A 3BCSA 2IYTA 2DFNA 2DG2A 3OZRA 2ZG6A 4NENB 5HCUA 5BW5A 1AUOA 2IYRA 1L7AA 3FYSA 4ON9A 5JPDA 5DBEX 1GARA 2M1XA 3ZE6A 1ZCJA 2ZJBA 1QKIA 2DH5A 1PCXA 4NP6A 5AQ1A 1IZYA 1X80B 1JHVA 2PSFA 1XDDA 1T2EA 3KS9A 3C7TA 5ILQA 3VTZA 3GIWA 2Q29A 4FB4A 1G66A 3RI3A 2VLIA 1T6ZA 1TW3A 4CM4A 4J03A 3LDUA 4W6ZA 5L3QB 1AKUA 3QFFA 4EVSA 2JANA 4R40A 3S28A 4BFUA 3U09A 2WT9A 1P4AA 1OI3A 4QYWA 3SZUA 1JFFA 1MBZA 2EGGA 2Q0QA 1Q7TA 2G07A 3KB2A 3OIWA 4EAAA 1SU8A 4M9XA 4G24A 1Z0JA 4TT8A 5HPYB 3IEUA 5KKNB 2I2XB 4GICA 2VT7A 1O0CA 3JYQA 1PUJA 1B8NA 3E9MA 1K8RA 1EFVB 3AF4A 3KJNA 4BWYA 1SIBE 1J70A 4NCHA 1M72A 3VDQA 1VL8A 2QM7A 1KSFX 1BFDA 3DMRA 5DBHX 4LHWA 4B8WA 1T8YA 2GM9A 2HDOA 4OQ4A 3RVQA 4XGIA 3OHPA 2GRUA 5A9TA 3VYWA 4KR3A 1BW9B 2RI0A 2FN7A 1WXWA 3UV6A 4Z51A 3EPJA 1EDOA 2FMHA 4F96A 3UJ6A 2WM8A 3HKBB 4TWJA 2FSHA 4QULA 2A9RA 2QKYA 2B4KA 2X0RA 4CIBA 3VPFA 4DV2B 2OO7A 1F2TA 2CF5A 2O2SA 1T8UA 4XM2A 1HOXA 3MA0A 3QOWA 5BNTA 2EKDA 4LJ9A 5A9SA 1IHYA 5A02A 2ZR7A 3MRTA 1OHHA 2R8ZA 4XQ0A 1YHYA 5HILA 4WY5A 4LX8A 1CJUC 1N8SA 1OFTA 4G1CA 2AUNA 3O7WA 2IY9A 1G1AA 4IO1A 3SC6A 1GTJ1 2BFDA 3NRBA 4P80A 2H2HA 2J31A 3I09A 5LQRA 3L1UA 4YUYA 3ABIA 4KWHA 3AIIA 4CM5A 2VJMB 1M67A 2XEXA 2OZEA 3RT7A 1P77A 1AUXA 1W2WB 3G13A 1VA4A 1M6YA 5I7WA 2FZWA 2YNMD 3IGFA 1E79A 3P9RA 5K8TA 5TF0A 4OP1A 2POQX 4OYRA 3AYXB 3STVA 3ROTA 1FFGA 5JZSA 3WA6A 4OQLA 4EPXA 4HN2A 2AN3A 4G23A 3BF8A 4HAVA 1GUBA 1YCHA 3CGGA 4GC5A 4NYIQ 1Y80A 2Y6VA 3A9SA 4G4GA 4MGYR 4X8HA 3ER9A 4ND8B 4C0XA 1Z6ZA 2IS1A 5IC4A 3IAM1 4CIWA 2AJLI 1QTIA 1JALA 3GH3A 5JVDA 4TWAA 3P27A 3A3PA 5A1JA 2RG1A 3JYHA 3IR5A 3O26A 3PA6A 2CKMA 2ZJ6A 4GVXA 1JYFA 4R8LA 5EHXA 1M5RA 2GEKA 3R75A 5LJIA 3FCYA 5J5CA 3QXSA 4QBKA 1GPNA 2C7BA 4C7OB 3WLOA 4RTLA 2CL6X 1NDUA 3PUHA 5BUSA 1BN7A 1QZTA 5L8VA 5DMHA 2YZNA 4R5MA 3WFZA 2E55A 4W5NA 1M76A 4NXMB 1Z4PX 3M6UA 3AWDA 3BXGA 4FYJA 4TRMA 4MLDA 1SY7A 3LF2A 5DNVA 3WLIA 3T5TA 4U8HA 3UB3A 2V6GA 1DRWA 3NHSA 1R8YA 4YDRA 3RT9A 4JITA 1XNQB 3UM9A 3BERA 1L5HB 1JAXA 2ZE5A 3ZDZB 1C0KA 5BSRA 4C6HA 1T2UA 2PL9A 3GCGA 2ZRPA 4LMPA 5GZ3A 2AD1A 2AMJA 2I4LA 5D01A 1JHYA 2NVBA 2BVNA 4MAFA 5KQSA 4D9IA 1QVWA 3HKCB 3VR2D 2PH1A 1DBQA 1I5OA 1R3DA 3PF9A 4R1LA 4Z9AA 5PNTA 4BNVA 1J8YF 4BO9A 2HIAA 1B0AA 2PO5A 3MTDA 3B6MA 4MKGA 1NNI1 2CV0A 3DDCA 1QU3A 1P7ZA 2HWYA 4ZQBA 3AIKA 3BSWA 4JL8A 3MGCA 5ICGA 2DYKA 1ENOA 4IEEA 4QTTB 1IE3A 3CNLA 4D3ZA 3HXOA 4QJ4A 1F14A 1H8HD 2VHUA 1WEKA 3NHWA 4JYZA 2UZ1B 5KWEA 4KQ1A 3FSGD 5KYYA 2QRMA 1PRYA 2XQKA 3EZ6A 1BWSA 3QLTA 1VJ1A 4HLDA 5CFQA 1RQLA 2W42A 1EWTA 1GJRA 1TAHA 2FR1A 1JPUA 2H48A 5BN4A 3DZFA 8OHMA 1E6WA 4DNFA 3M5WA 5TNXA 4X61A 1CZHA 2QUBA 5IXSA 1OBCA 3JD2A 4Z0PA 4LF6B 1V41E 3O8DA 1GAXA 3CURA 1H3NA 1QORA 2BISA 4I14A 4IMRA 2ZI4A 4GT1A 4HF7A 1KKLA 4JU9A 5AI4A 4DUGA 1NL3A 1EG7A 3LFTA 1M0EA 1U99A 2HA5A 3I52A 4XWAA 2CY0A 1IHUA 1V3TA 2ZS8A 3NATA 4DG8A 2NG1A 1MB3A 1IG3A 4O4JF 1PG2A 4YRJA 3NWPA 3VZRA 3ZXIA 4GECA 3W5IA 1W85A 3ABQB 3KXPA 1XTZA 3D43A 1XRSB 3U81A 5KX5F 1UXIA 1OKKD 2N0SA 3K92A 4UM7A 1ADCA 3I28A 4C07A 4CR8A 2YYZA 4CLRA 3WKCA 1NFRA 4HZUA 1T8RA 3D6AA 3IP9A 1CHNA 3II6X 3IAS6 4X24A 3EXG2 5IKPA 4DLPA 1V8PA 1L5ZA 3IB6A 3QA9A 9MHTA 4D3XA 3CXUA 3UGTA 3O6VA 3O1JC 3BXFA 3GCWA 3ORHA 4CMKA 3PQ7A 1ESCA 1T0PA 1V7QA 1Y7PA 2J33A 2RHJA 2WIFA 3NIFB 4EBFA 5C8ZA 5IUKC 3S7ZA 3Q15C 4H1TA 4YMTA 1H65A 4OU4A 4QQFA 4F5DA 1M54A 5IJAA 2PX2A 1JHXA 3HZOA 3KFXA 5EJ2A 1E3QA 3RRJA 4B4KA 4C9BA 4D02A 5ELLA 1E7MA 1JU9A 1XA4A 3H5OA 4F9GA 4FHZA 1RLJA 4OJMX 4L57A 1NKVA 1PGOA 1Z74A 4UHBA 3TRDA 3S27A 1AT1A 1TYBE 4JLJA 4URXR 1ZR4A 2ZSHA 1T9GS 3DOCA 1GXSA 2QT0A 2DR2A 3JQAD 3VPAA 3PYLA 3AWIA 3ND6A 1IATA 4M1EA 1JA0A 3ZV6A 1N6HA 2QTGA 2C54A 3WISA 4AROA 3JPWA 3HA5A 5CFOA 1USIA 1EXMA 4P86A 3WWYA 5SZIA 2K2WA 2RFLA 1NJSA 4ND8A 2PS3A 1JYEA 2XCUA 5K0TA 2BGUA 5L3ZA 3LDGA 5K6AC 4WEOA 4X44A 3ZD7A 1B6TA 3V8QA 3ZQKA 2OKGA 1W46A 1EUZA 1E1RD 3ZTWA 2VPWA 3OLZA 5LZ7A 3W90A 1FNSA 2QRHA 4QXPA 1GAJA 5C2JB 4QA9A 4ZPXA 4WD3A 3SS8A 4B71A 5I4KA 2Y99A 1PTJA 4OA8A 1P45A 1A2KC 1EH5A 1WXXA 1YE5A 4HWRA 3K0FA 4S2UA 4C6TB 1K6IA 1M6VA 5H9VA 4C7OA 1Y6ZA 3AERA 3ZWVA 1EWRA 4A7PA 2GAIA 3PE3A 4C0JA 4BTEA 2PE5A 3S2YA 1C3VA 3IIJA 5JW6A 2GM4A 1JR6A 5A7GA 1X3LA 4JLAA 1F20A 1K06A 2ZYHA 4DANA 4EEXA 1X9IA 3BIOA 2IH4A 2FFHA 2VG8A 1VSVA 1FYFA 3VR3D 3OICA 2O8DA 5L4LA 4IH4A 4DCNA 3ZJYA 4ER6A 1KDTA 3OQIB 2UXDB 4UTVA 4B17A 4J4TA 4I5EA 4ZIRB 4OK3A 4RL6A 1YOBA 1H4TA 4IIJF 5TEWA 4CV0A 4B3XA 4CR6A 3EXFA 1Y1QA 4C2BA 2MT9A 2PY6A 2ZIUB 3TR6A 4EF5A 1SM4A 2HW8A 2IZ7A 3TIGA 1KGDA 1KK3A 3FDFA 2FLKA 2O7RA 4LVCA 3LTEA 4QUGA 3SBXA 5A4JA 1Q50A 2ADOA 4QECA 4NDNE 2DBYA 4G5RA 2HD4A 1QHEA 2ECFA 3R5JA 3WIOA 3GVPA 4JVMA 2X0NA 1OB5A 2ZI5A 5C7LO 2AN1A 1RC8A 3LVQE 1BXRA 2UZAA 2GN1A 3ZWKA 4KRYA 3DJYA 4OMCA 5I3CA 4MHTA 2VP9A 3RGGA 3VOAA 3CQ9A 5HJ2A 5TARA 2B3TA 5KYYB 1JE0A 1NXQA 1WMDA 5GQSA 1PU2A 2CBGA 3QVSA 2XB9A 3IOMA 3ADKA 1FW6A 3V2HA 1CKEA 4WK4B 5I9MA 4TKVB 3HRKA 2LZ0A 2VJPA 5LZ5A 4JQOA 4TWZA 3AT1A 3WAGA 1KDPA 4ZYLA 2Z6AA 4LZPA 5FPSA 1C3JA 4WXYB 1PJ2A 1P1JA 3P20A 1FC0A 4IIFA 1UT6A 2VPXA 4LYEA 1ZCAA 1H5QA 1U9JA 3QOYA 3GFBA 5DI3A 4BKOA 4DZTA 2WF9A 1K92A 3H75A 4BO0A 1H05A 3L07A 1AV6A 3DOOA 4LN1A 5LQSA 2YVUA 4AWXA 5CB0A 2BAGA 1AKMA 3M1LA 1V3UA 3FOAA 5HOEA 3E22B 3DSRA 3B2NA 1RWWA 1KY2A 2QLJA 2ZJAA 5GP1A 2XHEA 4B7AA 1JFSA 3T1HB 1QIGA 3VC1A 5AI9A 1OW3B 5A2QA 2QMUA 3HXQA 3A1CA 1L4YA 4TGLA 1Y81A 1MKYA 4OQEA 2GPYA 1BHO1 4PX2A 4L5AA 4V1CB 5ALHA 3RBAA 2R6JA 4LNUA 1EFPA 1WMAA 2AE1A 1E66A 1T2NA 1J20A 3FNEA 1L8LA 1ZOPA 1EUDB 2RHHA 1G8YA 3C8UA 1G98A 4OXNA 4R0MA 1HWYA 4PG8A 3DH0A 3K4QA 4YI3A 2B21A 1Y9AA 2R1UA 3AVQA 2A5YB 3EZGA 4FXPA 4LGCA 4FMBB 4F84A 1OR8A 2R1TA 4ZV4A 1E9AA 3E7XA 4HNSA 2NTVA 3SNKA 3EXEB 4PYRA 1SWWA 2C7QA 4FGLA 2IJGX 3G0OA 1QF9A 1ZL0A 3RYHA 1UK9A 2BGNA 2W2PA 4K86A 1QRTA 3LRTA 2IXFA 4G5HA 3H2HA 3CHYA 4I1IA 4M9SA 1QIKA 1MR3F 4UNSA 3RC3A 1HLDA 3WNDA 2WMOB 4UNNA 4Y0VA 1JVBA 1W44A 3OQ6A 3QE0A 1CY1A 4I3HA 4KQCA 4FDVA 3GAZA 4GVPA 2G77B 5D3MA 2YHSA 4MS4B 5GONB 2CXNA 1YQWA 1YDFA 1IPHA 5EJ5A 2Q5CA 3ZTTA 5L7YA 2JJMA 1JZTA 5IDQA 4KAFA 4BWFB 3RC7A 2QVBA 4D74A 1SUFA 3O91A 3STTA 2RJOA 5HIKA 2JEYA 2QMZA 4LKRA 2OZPA 4KGXA 3EULA 4B5KA 3CNQS 3MJTA 4X45A 3KVYA 4Q6WA 2OV4A 2VYVD 3ZWOA 3EC1A 1WDKA 3IS3A 1FXSA 1X7DA 4HMOA 2W0MA 1X92A 4S0XA 3MWDA 4M89A 2FEPA 3PL1A 4PAMA 3ANMA 1BVHA 3EDYA 1BJKA 1R2QA 4L4UA 3GN2A 2EFCB 1GITA 3GDOA 4MLPA 3DTNA 3OLQA 1BMDA 2MYNA 2PWZA 3IMEA 1I30A 3LE8A 1VE5A 2VHEA 3LO8A 1JIUA 2GEUA 3GCZA 1YI8A 5B58T 4OX9B 4ZVVA 2XZPA 1C30B 1H1TA 4Q4AA 2RIPA 1UADA 3ZCVA 4BNGA 2G5CA 5A4DA 3NWBA 3GLHB 3FETA 5CTJA 4DJEC 1JA1A 1D03A 4NK5A 3WC4A 4TLDA 1WL8A 2NTEA 2R3SA 3LDAA 4HMPA 5KQMA 1I4LD 2WWXA 4DUZB 1K27A 1FTSA 1YCDA 1DAOA 2RARA 1ZC3A 3IKTA 1AGNA 3GO4A 1L4MA 2BV3A 1PTJC 3ORRA 3W8RA 3WX0A 3VO8A 3KAKA 1E2DA 3AHIA 4NULA 5KTYA 3A4MA 4RNCA 4W63A 4P3XA 2WY2D 1J4AA 1W52X 2VWPA 1PHRA 1T1GA 3GG9A 4U6QA 1X8JA 3TTUA 5HKBA 3TPFA 1QZZA 4Z0HO 5MFZA 1ISGA 1QLHA 3VPBA 4ACBA 2QJRA 1DAIA 3U4IA 4K9KA 5BWOA 3DTVA 4WT7A 2P2NA 1GYPA 1TU0A 2FP4A 5LZ4A 4J0DA 3O9VA 4H7PA 2A5JA 3DXYA 3G9XA 2AWNA 2Q0SA 4U5QA 1VHDA 1VYHA 1E5QA 2XMQA 3FCOA 1IOZA 3C2QA 4MPDA 1Q0UA 5IZCA 1U0JA 2FMKA 3UA3A 3U6KA 3UICA 1D6MA 3RVBA 1EDZA 1LFAA 3G9ZA 3M49A 3URKA 5LOVF 2IS6A 4RADA 5LYJB 2I91A 3B6ZA 4F85A 4ZT4A 2B34A 4ASUA 2CBZA 2QN7A 1BXZA 4ZI5A 2XGMA 2CD9A 3AYZB 3T7RA 3QFHA 1SUCA 3GLTA 1D6NA 4R68A 3RRZA 3D6MA 4C6RA 4QOEA 5H02A 3FF4A 3NNSA 3MAAC 4FN4A 4HQLA 4ZAGA 3ZLBA 3VH2A 4AYTA 3GJYA 1GNLA 3HB0A 1ZUNA 2WR8A 2C3UA 3GP3A 3JD4A 1PJRA 3FMIA 4KYUA 4N18A 5JCPA 2HEGA 2YYAA 3FH0A 3D7KA 4HN4B 4QU9A 421PA 5AW2A 2JGIA 2BGKA 1Q2XA 2BFPA 2ZBQA 3W3AH 2WF8A 3NWJA 1YC2A 1A5AB 2QR2A 4DV0B 4FOOA 2XCQA 3QP9A 4DGSA 2NPOA 4F5EA 1ZH2A 1XRLA 2DPHA 2CFSA 2FWMX 1LK5A 3PDJA 4Z9FA 3PFKA 2JJ1D 3SKXA 1ICEA 2SCUA 3BA1A 1A72A 3IEIA 4TUYA 2F1HA 2B2XA 4TYQA 5KSYA 4P3NA 3DBLA 3GFFA 4OGKA 3MWEB 4WFIA 4YUVA 3FPLA 3THRA 2CB0A 5YASA 3ZU4A 1Z0AA 4DM4A 3K09C 4N8DA 4KX3A 4G9BA 5SYNA 3ZOKA 2MINA 4JKYA 4UBMA 2ETXA 3VGJA 4BO7A 1DFGA 3C4QA 5CDFE 4UQLA 2XQVA 5J58A 2YVAA 1FYWA 1RKUA 2HAEA 3CKYA 3HWX1 3WZLA 1X14A 1D2CA 2OQVA 3KPWA 4TQUS 5U1PA 4OFBA 4R54A 2Q1UA 4EGSA 3RAPR 1N7HA 4O2BF 1PWZA 2YHIB 4RH1A 4G9EA 3VH3A 1PS9A 4IZIA 3CG0A 3X1ZA 2ILTA 5CEEA 3EGOA 5J5VA 2JLUA 4AN1A 4DR2B 3RYHB 4YJ2B 2YFQA 4JVLA 3SX4A 2WQ6A 1PT7A 4KN9S 4LVNA 4PO9A 4XSGA 2PNJA 4KQ9A 4L8FA 4YRRA 5JAUA 2ZSKA 1N2EA 4RZHA 4GYWA 1FF9A 1VL5A 3CEHA 3N5CA 1B6SA 5H7XA 4IRXA 1DQSA 1XVLA 2D3TA 4XJSA 3HDYA 4RKWA 4DWOA 4EAQA 4LYGA 1X15A 1IN7A 3CIFA 3ETDA 3MD0A 2E4WA 3B1VA 3E9QA 4COKA 3MC1A 4JS0A 3UC5A 4NONA 2FZKA 2Q3LA 1RACA 5A3JA 1Y7IA 1XU9A 3PU6A 5FBHA 3HJTA 2QPOA 1D1TA 1CERA 3EFBA 2ZJ0A 2A9QA 1UZNA 1YB2A 1YA4A 3CLSD 4IFIA 4H3HB 1QIDA 2I9PA 5FF9A 4BRUA 4Z3DA 3MWDB 4KLZA 3JZFA 4MQEA 5IKOA 5FNVB 3MJRA 3VI3B 4CLHA 1WBJB 1SCJA 2C77A 3DVAA 4Z7QB 1E7WA 2BCJQ 4GGMX 1II8A 1OYVA 4I4TB 4RU1A 1A4IA 1CUDA 4DREA 5LIPA 4M98A 4CDNA 1QMPA 3EVDA 3KYCB 5BR8B 1YCGA 3KKLA 5FWYB 4BRSA 2KB0A 3F8TA 4FFBB 1FS6A 2XCRB 3JQ9A 1IY9A 3OEHD 4LRYA 4YP5A 1E9FA 2B3DA 3L5KA 1WX1A 1YZYA 3OEEA 4WESA 1AV7A 1H5NA 1F7UA 4MVJP 3D02A 1G5FA 3FRIA 3SSNA 2XB4A 4OO3A 1CUJA 2AUMA 4FE3A 3GZNA 1RR6A 3QVLA 4A0RA 5JNTA 3NDBB 1T9HA 4BNYA 1TZMA 3U40A 4K7JA 2UUCB 1NXVA 1SUIA 4RPLA 3IT1A 3KT6A 1VZ3A 1AU9A 4QATA 3LUBA 4XEHA 1Z7EA 3K9HA 4PSVA 4FILA 2DHDA 1K8QA 4ALKA 3T7EA 1DELA 2BGJA 1XVUA 5K1ZA 3HLTA 3S5JA 5HUHA 2FEXA 1Z17A 2FZVA 1CQXA 3BHIA 1Y63A 5JSHA 2B0CA 1USUA 1ZRNA 4MUYA 1TZBA 4E70A 2QTWB 1TQHA 3TXAA 2P9CA 3W6PA 5HGXA 4GGOA 1DO8A 2WFLB 1PBNA 2HLNA 1NG9A 1L1EA 4TWRA 2BHNA 3V2IA 1YR1A 4ZCPA 1SUDA 1AO0A 1E9BA 2C2OA 3DEAA 3I45A 1NXTA 4RY0A 2I2WA 1MH1A 2VNKA 3FFAA 4MUIA 4GPIB 1D8AA 5C1BA 2OLEA 5LKRA 3TGLA 2QAIA 2AXEA 4NATA 3OEHA 3SZRA 2OLKA 2JGAA 1QOZA 4C04A 1SBNE 4FN5A 3STXA 4QRHA 3VU8A 4KCGA 4N5HX 1EXDA 1PN3A 4JSYA 2BKUA 4D1YA 2V5UA 1MA0A 2QXYA 2RHWA 4I1YA 4MJ7A 3A1SA 2FQ1A 3DDNA 2NO7A 3BJRA 4N49A 4N7RA 2ZFUA 3PUIA 2TRSB 3BTOA 3FGZA 1OFUA 1IDOA 5CH5A 4WA8A 4BDSA 4N54A 5SZJA 1M1UA 4OHCA 2YCBA 5GAJA 3IDOA 4FSXA 4KGVA 1ZU5A 1TD9A 2RH5A 3G1UA 4BNDA 2OQRA 3AY7A 1CIVA 5DYYA 5A5FA 4GUDA 4M4SA 1FE8A 3MBKA 4MRMB 2Z5LA 4G0XA 1O3YA 1NN1A 3CN7A 3HHEA 4TMVA 3NGXA 1XP5A 1AH2A 1V8FA 3IEVA 1R9NA 1UXJA 3EXHB 5ESDA 5JZMA 1NFQA 1W6RA 3HK2A 1CLEA 3RU3A 2JH9A 4K6KA 3DE6X 5EPOA 3UT6A 1VI6A 4E5UA 1BWPA 3E81A 5AW0A 2JLRA 2DSNA 4QFBA 1UQUA 3TTWA 1MQSA 3B1FA 5HDBB 1XKLA 5EQTA 1KQFA 1Z6XA 3Q9UA 4JHXA 4L07A 4AJ2A 1ODJA 4XX1A 2ZIGA 2K7FA 3X2FA 1SCKA 5K0GA 4M83A 4P93A 2WSSA 2ZB4A 2J5RA 4JJ8A 4UVHA 5AJZA 5FBZA 4AY4A 1EQUA 4ZOLB 3IEKA 2Q5EA 1N8NA 4KDFA 1D2AA 1P75A 1ZVJA 4RLQA 4UDXX 3O73A 2QRLA 1P81A 1UDXA 3M3PA 4XFKA 3PX7A 1NRXA 1WZ2A 4TV8A 2GK6A 2O23A 1M0SA 3FSGA 2Q0HA 2DFDA 3HUUA 5F35A 1BE0A 3RYCB 2MDTA 5JJIA 3A1UA 4HQKA 4GNRA 4OI0A 1IVSA 5E6RA 2I66A 3PXEA 2FPOA 3GXBA 2H4XA 4US1R 3ZV7A 1PFWA 3AHGA 3AXTA 3PBKA 5AM0A 3UV7A 2FG5A 1NNSA 2ETVA 1NVGA 1Y7HA 2IOYA 1PQ4A 1G20E 5EHIA 1Z33A 4BB6A 3FOCA 3PC3A 1G64A 4GW3A 5J5AA 3E8XA 1L5NA 1OD6A 1GRNA 2W22A 4FR0A 2Z2ZA 3H42B 1SXPA 4QXAA 4D3YA 3T15A 4LRWA 3LWNA 2XTMA 4XQGA 2JZCA 1LF5A 5LB4A 1C7RA 5ALKA 5HSGA 2D2VA 1BEZA 2X3FA 3F2VA 2AQ8A 3H3JA 4FGWA 5K4AA 3MIIA 5EJ8A 3DO8A 2HRBA 4HGNA 4ZJZA 1E1YA 1N1GA 1SVMA 3KX2A 3KZXA 2D62A 4DGQA 3MGBA 4C6TA 4A0FA 2BM1A 4QG3A 3PFFA 1QRSA 4F93B 3B13B 4RY8A 3EUWA 2N1MA 1XLWA 2NSLA 1VKHA 4QVIA 2I29A 3FFWA 2D2FA 1MABB 1NHGA 1NF9A 2PM8A 3UUEA 3ZXUB 2XAAA 3VZPA 3HBAA 4HDQB 3THXB 3GK3A 2EGUA 4UBNA 1K7FB 1XK6A 1XRRA 4LW8A 5HK8A 3RS9A 4IVRA 4JC4A 4KIJA 1PR4A 2LCFA 4B3BA 3A32A 2IIPA 4YRAA 2HRCA 4KMRA 5FNZA 2QG6A 3D3JA 3TLZA 1EUYA 4DDTA 1FOEB 1P60A 1KRXA 1PK8A 1NOIA 3MCWA 3QYAA 1V9CA 1WQ3A 2KQUA 2F62A 2Y93A 4R51A 3I5XA 2BGTA 3VI4B 1V25A 4QAQA 2R7AA 1DEOA 3W06A 3OLXA 1E2BA 5B36A 2QRGA 3TR0A 4JD5A 1R1DA 2DFPA 3LRXA 3W1VA 3R3WA 1Y1RA 2PT9A 4JC0A 2X3YA 2YBDA 2E85A 1VHWA 2FFAA 3DE5X 4BE4A 1Z0DA 1XL1A 4M1SA 1NV8A 3HM9A 1CJBA 3M33A 4Q7KA 1S2GA 2ALJA 2G63A 4FDTA 5FPKA 3GI1A 4A2PA 3AVVA 2I4MA 3AVWA 2P4EA 3LQKA 4ZC8A 2EWWA 4MW5A 2NSDA 3IV9A 4IGEA 2NIPA 1E79D 4E0BA 2YNMA 1R8SA 2BKEA 4FGKA 5B4VA 3IERA 3S1AB 1GPYA 3EGIA 4XD7A 2ZK7A 2IY7A 3B7PA 1W9HA 3C6XA 4D6YA 4EOGA 4LY9A 3TMYA 3V4OA 1ID1A 1JEQB 5EUMA 4FHCA 4CQLA 4S3MA 1EBFA 4IINA 4NVRA 4FI3F 4I4TF 3OOEA 3NTQA 2VS1A 2YZGA 3R24A 2AL7A 1C7EA 2RC5A 3B9QA 4HFJA 3OIFA 5B64A 5GJBA 4UAUA 3WRXA 3PXBA 3Q0IA 5AMXA 4D9HA 2GZ1A 3NFYA 3VYRB 5LWHA 3UMBA 4H1WA 1L6RA 3EMDA 1N2IA 4BVGA 1M2FA 1CUGA 3CR8A 3UK1A 5ANRB 2WUEA 5B2FA 4GPTA 4IP0A 3P26A 3QVVA 4EG3A 1A9SA 2XSZD 5HR5A 4O1MA 1T34A 4KU4A 3RT1A 3U0VA 3BWBA 3FZGA 3KEQA 4JLWA 2JW5A 3NJRA 3R8XA 4A36A 4Y18A 1IOVA 3FI9A 4JKOA 2FPRA 2QAJA 2VRCD 5D3ZA 4EB6B 4IBOA 1DIAA 3E5NA 4PNHA 1MAHA 3HVHA 1UEIA 4WOBA 2EL7A 2Y77A 2UAGA 2ZW9A 1E0DA 3OZBA 5THXA 2QLMA 2VAXA 3Q8LA 2V1UA 5AJVB 2B7LA 4RFSB 1Z6PA 4CM6A 1EXWA 2FK7A 3OIUA 5DIZA 5F7XA 1XZEA 1IEVA 2XA2A 1NSFA 3NQ41 1V5FA 1OJ7A 3OWHA 1RJ9B 3EZ2A 5CYFA 4IDPA 4TSKA 3RK0A 2IEGA 2YZ7A 3GRZA 2WTEA 4QYSA 3FLAA 1PQYA 1EP3B 5EIOA 5IBPA 2X0DA 2WOJA 1JKMA 2XCTB 2FHSA 3QFSA 4K9NA 3FTQA 3GUHA 2B1JA 2WEKA 5DNDA 1Q11A 2QX8A 1FMCA 2ID9A 2QB5A 4WV3A 3U5TA 1QV7A 3NV7A 2VNHA 1S8OA 5TPWB 3G5TA 1WMSA 1HT3A 1JR4A 4JX8A 1FFDA 4RPIA 3Q85A 2F43A 2OMKA 3DLBA 1ESNA 2HWUA 5FPHA 1D2NA 1PJCA 4LDAA 3EBOA 5L3VA 13PKA 3C3DA 3JQBC 3OIYA 2C0QA 5DK6A 1H9CA 3E48A 1U0TA 2O2XA 1SB8A 2JI4A 4Q7LA 3SYMA 3K71B 1UBEA 2VDNB 2YFHA 3U7RA 5MHTA 1DKLA 1M83A 5JZOA 3KOWA 4WXMA 2DEUA 3STYA 1U0GA 4LYFA 4XGRA 4U7PB 5FKJA 821PA 4JQCA 1CD5A 2VDOB 4MQLA 3DC2A 4PC3A 1HZJA 2QDKA 4L4XA 4A8JC 3AKYA 4ND4A 5LP6C 3D9QX 4TMFA 1VE7A 1OLUB 2NQ8A 2VT6A 2I2FA 4PFKA 3VAAA 3ZWWA 3ZIUA 5A4FS 1BQ4A 2VOJA 2W6PA 3L6OO 4RMJA 1P19A 1G7SA 3M5PA 1XHEA 1YHNA 2O3UA 3DCJA 2W5UA 3H9JA 4P5PA 3WIEA 3T7IA 4E03A 1RVDA 3E9ZA 3Q2KA 2FPWA 1NU8A 3OT1B 1AB5A 2D4AA 3ROPA 1SXJA 3FUVA 4BP1A 3W8NA 4J9VA 5L3SB 2AZMA 3E2IA 1Z0KA 2BUBA 2VYFA 2XJ9A 1JE1A 1V6CA 3L1JA 3A05A 1E9SA 4BDTA 3S55A 3ISJA 2P5YA 3UHJA 4KXWA 2KW5A 3I0ZA 2QEQA 1OKKA 4MYTA 3CVXA 5EI5A 1P31A 3PHLA 4X3OA 4JKIA 5LN1A 1WPQA 4NCXA 5IAGA 1DKPA 4LHXA 3TOCA 3H8VA 3RFVA 2FB9A 2V74B 4AMGA 4XSHA 4W9MC 5ECYA 2B25A 2FPUA 3G2KA 5K3FB 1RI5A 1ZNWA 2WT8A 1NUAA 4H7FA 2OXRA 3K0CA 2SICE 4FE7A 1QVRA 5JYBA 4L4SA 3BMCA 3OQOA 1X7YA 1NXXA 2PS0A 3LZ6A 3SIRA 4HUQB 3DBOB 4EKIA 5C37A 1NR7A 5E1OA 3IVAA 4NU5A 4ARCA 3HEMA 5JOQA 4FDMA 3ZLVA 4OLAA 4PZCA 1ZYUA 2BC9A 3G2IA 1ITZA 3I1JA 5AOBA 1SQSA 3ESXA 1BW9A 3K9LA 3TLGB 4CDRA 2VNIA 2IU3A 2OFWA 2X0KA 4JL6A 1FY2A 5EE3A 4FEEA 3L8MA 3DV0A 5JEDA 4WOCA 2ODBA 3N2NA 4RX1A 4KL8S 5ALWA 1W93A 1MFPA 3L0IB 1UMBA 4AUKA 4ZYZA 5DW0A 5BVHA 3K32A 2NO9A 2GPTA 3OCJA 4N0DA 3TFWA 1JB1A 3VPCA 1BE6A 1ISIA 4ZXPA 4P4SA 1G9SA 4L0MA 4TV9F 1CZLA 1B3BA 1NOKA 3PVSA 3Q3GE 4DR3B 2BMDA 3CO0S 3F46A 4M8IA 3Q3CA 3QJ5A 2BFBA 1HL3A 2BTQA 5TQ2B 2DQYA 2DU8A 4FHEA 4BX3A 5JSUA 1OGIA 5AVTA 2G1JA 3G7UA 1EGHA 1DXHA 1LB1B 4E5KA 4KBYA 2IUFA 2QF7A 2VSNA 3U7GA 1UBJS 5BR7A 3ITDA 4X8LA 2R5WA 2VHCA 5EWJB 1ABEA 3EC2A 2D7CA 3DS8A 4UNIA 4TUYB 4E5DA 1NZJA 4BZWA 3V2GA 4I55B 1TM3E 3QX9A 3LP5A 2A9FA 3M70A 4YAOA 4QPDA 3IUEA 3SS7X 2JLSA 4JN6B 1OT5A 2HCFA 2YZKA 1BA3A 1JBEA 3BH0A 1SD1A 2K87A 1XA3A 4II7A 4PLCA 3EVAA 2B2CA 3IQGX 4XAQA 5CMLA 5FBVB 1LSJA 4PO8A 2C78A 3CLSC 3CSSA 5FI3A 3ETEA 4PGGA 4BL5A 5J2UF 5H8WA 3PUJA 4B45A 1ZI8A 4KHPB 7GPBA 1CB7A 1WKVA 4O0MA 4YEDA 1UZUA 4PQFA 5DN9A 1A1SA 3ZJUA 1OTHA 1DTEA 1KSJA 3URMA 1Z36A 5KVCA 3OKAA 5BMVA 2ZT6A 5E3IA 1J1ZA 4XQEA 2OR3A 4GBED 4PO1A 2N9UA 5E2BA 4Q93A 4DIOA 3HWRA 5K51A 4I4NA 3DUWA 5F4BA 3TSYA 3ZLJA 3FKSA 1ZRSA 2W2LA 3EW7A 3B7GA 4OQXA 1N6NA 2QI9C 5C9ZA 3C98A 1J5PA 2G1AA 2AJCA 2J0UA 3RTCA 3DWIA 2RGBA 2HLPA 2BFOA 3LQ2A 4KSYA 1S8FA 4IUYA 4R2MA 4DM3A 5IT9A 4M49A 1P5RA 2R4QA 1K4MA 1TE2A 3GGGA 1NR5A 2EZ4A 4K0RA 2O8VA 5DP2A 3G2MA 3KHUA 4ZOBA 4COOA 1JKXA 2BDTA 2ZANA 4D5EA 3DM9B 4X1OA 4CTOA 3ROFA 3HCAA 3KEGA 3WP1B 1KJJA 5JDCC 2ZQZA 3I9NA 4HJRA 3SQMA 4RTJA 1D5CA 2GAJA 1CQIA 3ZZ0A 1ABBA 3DF7A 3HGTA 2OFFA 1NVFA 5CB8A 1BX3A 4FZ3A 5TQ0B 4AICA 2V6IA 2BMFA 3CLRD 1SIWA 3RVDA 2H1SA 4WJKB 1KY4A 1UDBA 2H9AA 1CJSA 3ED1A 4JI4B 1XJ5A 2MSWA 4NMWA 4EUSA 5BVGA 2AN5A 1ZVVA 2P90A 4QSMA 5FO0A 3TTSA 3GJ4A 2IPLA 1XEXB 3LUPA 4UPEA 1OHHD 2XH8A 1GG8A 1UZMA 4LJAA 1E77A 5BUQA 2ADFA 5JJLA 3TH5A 5BW6B 1F9AA 5ALOA 1S89A 4FFOA 4G36A 1N9ZA 4PRYA 5A06A 2VP3A 3V3KA 1LX6A 1V11B 2A86A 4QUAA 1SCIA 2XUDA 3OUUA 4HAYA 3FLMA 2GKSA 3CPEA 2P78A 4EVRA 2I9KA 1X42A 1YU9A 4CTJA 5AQEA 3PT5A 2R8EA 2PYDA 3R74A 4O4IA 2ZPTX 1N0VC 1KDOA 1QIEA 2I7CA 1ZJ4A 3A4VA 3BL6A 3N6VA 3WMXA 3TZLA 2AG5A 5IM4A 4L51A 5F5XA 2Q99A 3OU6A 1I36A 1H0HA 4MWEA 4LC1A 2O2JA 4D42A 3OY2A 3PNQA 3C7AA 3NBFA 1CQJB 1TA9A 3D64A 1DC6A 2Y1XA 1UR5A 3I6YA 2V5AA 5EE9A 3AB3A 1LC0A 5BOVA 3TOVA 3I6ZA 1E2NA 3KTOA 1HNNA 1TIPA 3BREA 1ANKA 2DFKB 3OEED 2BLNA 1ZJYA 2I1VB 3WGJA 1COZA 2QTLA 2JGLA 1P5JA 3F90A 3KWFA 3L05A 5HJ7A 2C84A 2EBUA 3AUKA 3EXIB 5EMMA 4Q9LA 4N5NA 1LSSA 4QX6A 4AJPA 4D26A 1KZ7B 5TEVA 5B1YA 1SOUA 5EUBA 1LBTA 4G1UC 4A92A 4JMLA 4C20A 5EPEA 1H0RA 2OESA 1CHDA 3HI6A 4GMFA 4WQMA 5FPPA 3FNIA 3E18A 4UCXA 3AGPA 3R0XA 1KVRA 1II9A 2BI7A 4ER5A 1W36D 1DC8A 4R7TA 4AK9A 3A0RB 5KSPA 1SQ0A 4BNZA 4YUZA 4JOCA 1NLZA 1ODSA 4QHTA 5AKXA 4AKSA 5HYVA 4U5XA 3IXLA 1DO0A 1GR0A 3KJFA 5EQJB 5JZ9A 5KTRA 4YJ2A 4PWYA 2ZJ3A 3OE7A 3V32A 4CL8A 3GCDA 2Z3WA 4D56A 3D4NA 4Q4JB 2GJAA 1DBIA 2WYWA 4CE6A 1D2EA 2X0JA 5I7EA 4I5FA 3N75A 3SQNA 3DB2A 3OBIA 4K2AA 3OZGA 3BJZA 4UHEA 3U37A 4MULA 4Y9SA 1TO1E 4HMQA 3OPQA 4TX1A 1PUIA 5J2UB 3VH1A 2C5FA 5EJFA 3SVLA 1AA9A 5CLIA 5DRTA 5TS3A 5A6SA 1OI7A 2JLQA 1S02A 3X2EA 4D97A 1UDRA 4H27A 1DRJA 4II3A 3UZUA 1JXOA 4WRRA 1C0IA 2YWRA 3A9UA 1TJPB 2L17A 3MWFA 4REMA 3GAMA 1ZDMA 2B1QA 2ZUTA 4RNDB 4YRTA 1P9LA 1L1QA 1C3OB 4Q7QA 1ZH0A 2EX0A 3PGVA 3QWHA 4NZNA 4ZZ3A 2Z2KA 1FUYB 1WTCA 2PFKA 3FCXA 3ZCRA 1QAMA 1MLDA 1BHJA 1W4BA 3G0CA 2BE7A 4AF7A 5JARA 2YASA 3QU7A 5A5VA 3VNVA 1RRPA 3ZU6A 4LZZA 5H16A 4AZSA 4E5YA 3RK4A 1HG0A 2W8BA 1R37A 3MJHA 4M9RA 4QXOA 1WUKS 2D1QA 1FXWF 3C6MA 4RMHA 2GSDA 3D6TB 2PZEA 1U2SA 3HSYA 3QHPA 4DLTA 5CYGA 5FX2A 1XNHA 3KHKA 4JT8A 1QH8A 3K05A 4D46A 3I01A 2PPLA 4OAPA 4Z0TA 3DBRA 4XFDA 3WJ2A 4XVRA 1JNXX 2EHDA 3PENA 5F9FA 2JAXA 4C4ZA 3TD9A 4WKOA 3K8YA 1GWNA 2OHOA 1M0WA 1ENPA 1F0YA 1VIMA 2I7DA 1S2NA 1T2VA 2I78A 3NIDB 3WNVA 1ZH6A 4MROA 1VB5A 3F7OA 1KTVA 2EJVA 3L7AA 4IDHA 4YXFA 2IZ0A 3E3AA 3VAYA 4CBVA 5K0LA 3EVCA 5LQCA 2QZ9A 2WAXA 1C7JA 1TF7A 2ZBGA 2H1HA 2ZS7A 3BMQA 2EP8A 2GB4A 3AEZA 3DFKA 3O0DA 3QVWA 5ELMA 2JBHA 1FYXA 2YH2A 5EC8A 3NALA 2GKOA 2ODWA 3F5SA 3K8QA 5CTAA 4UFPA 2BZSA 4AXXA 5J4YA 2WIGA 3KT0A 4DOMA 3HYNA 5IYZA 1R0ZA 4DW8A 1P7YA 4QLBA 2P7HA 3VKGA 3BX1A 3HYLA 4AXBA 4EECA 4REOA 5FXMA 5KHAA 4CN8A 4GI3A 3ZI7A 2I4RA 1E5VA 1W85B 4GLOA 5EJ7A 4KJZA 3DO6A 4Z4FA 1FFWA 4QVKA 3PIRA 1Z45A 1S4QA 4EELA 3NM4A 2VH5R 4TRRA 3VHXB 3HKEA 1IUOA 2XY4A 2H51A 4F2DA 4ESHA 1JR3D 2PSDA 2CL0X 2VSXA 5D7BA 1S2OA 3U7IA 3EF0A 3M4XA 3HZRA 2LTAA 3ZGXA 4B43A 3TMKA 3O75A 2NW6A 2GUGA 3QF7A 3EIEA 5E4JA 1Q6ZA 1JA9A 1YOVB 4EHLA 1E2QA 4KTVE 4BJHB 4C7KA 4JLOA 3E2PA 1ORRA 1SHLA 4LRSB 2E4XA 3ETHA 3TLCA 3TQSA 4UTOA 1EEXB 2IELA 5GV8A 1X9HA 2V7WA 3BGIA 3S2EA 3D4OA 5HRCA 2XE4A 3K53A 1P0PA 2F3SA 5FUQA 2D5BA 3K0BA 3KO8A 3EG9A 3AJDA 5AVKA 5G40A 2Z6QA 2RGNC 5JI3E 2WFAA 1EX9A 2D8MA 1PR6A 3VV3A 1H6AA 2JHPA 4F4UA 1WSAA 4LI3X 2GVDC 1E7YA 3H19A 4QBFA 3VYSB 1SXHA 1WJGA 3R77A 1KOLA 4BLWA 3V9AA 2I7TA 1IJBA 1WY7A 1SXGA 2C94A 1TZJA 2RGGA 4H17A 4XX0B 5A5GA 2HSEA 4OUDA 4MCIA 4ZOAA 3WMFA 3C3BA 4CW7A 1JT2A 3BRCA 3KVOA 3BWEA 4HX5A 3TTVA 4ERXA 1RBZA 1N77A 2GEBA 2B0JA 1UJ5A 3ZBPA 3AEQB 4E3WA 3R7NA 3NIGB 1IN1A 4R9UC 1KKMA 4AAYA 3IVGA 1V95A 2R6CA 3O8OA 2HV9A 4R9NA 1R9MA 4Z7NB 2RHTA 1HDGO 2M6SA 2Q1SA 3OWOA 1KKUA 3Q4GA 3BC1A 3FCSB 5EYPB 4YRPA 3WHLA 4E09A 1R3UA 2QY9A 2XE7A 3ICVA 1Q1GA 4IKOA 5CJ2A 1H6DA 5HK9A 1T4CA 2PMFA 3AERB 3HM2A 4R1UA 4RENA 1Z2OX 3T3DA 3ZDYB 4DC1A 4E88A 2C2HA 1XNRB 4E33A 1G60A 3GR6A 3R9XB 1U8EA 1XSEA 1M7GA 1C9KA 1FTWA 1LNQA 4UTXA 2A1TR 5KMGB 4X20B 4EJMA 1MU0A 2J6IA 3K1TA 3FOFC 1WA5A 2WMNB 3P0JA 1IMJA 4OU5A 4HNAA 5E1BA 4L74A 4ZD6A 1N2BA 1TCAA 3GA0A 2ZIAA 3OPYB 1N2OA 4LZJA 4YRCA 3GBVA 3IDFA 4FWIB 2ZAMA 1XHLA 2Q5JA 3BK1A 1ZD3A 2Y05A 3MJSA 3R5FA 4O02B 1YC5A 1E2PA 2DPYA 2FE4A 3U3DA 2GJSA 4AY6A 1XB2A 2QX9A 4TV9A 1G4AE 4W9NA 3F7NA 1E9VA 2IH5A 1Y9JA 3K96A 2FUKA 4XYMA 1VPDA 4Y1EA 1L5GB 4HRXA 1PSZA 5L6MB 4PU0A 4TRNA 5JY1A 4KO4S 3LL7A 1FMJA 3OQPA 3UK2A 3Q2IA 2GJKA 3DE4X 1SU7A 1KI6A 3R23A 1E9RA 3H1PA 3UOWA 5KTOA 1N36B 3ROEA 3DNPA 1MABA 4HBZA 1TCUA 2Q3EA 2XUPA 1UMCB 3QPVA 4RTSA 4LFAB 4XARA 3QY0A 1N1MA 4NBWA 5EEGA 1YQDA 1N1DA 3CF4A 2Q1XA 4WZZA 5E2AA 1L1FA 1W2GA 4CKZA 1OAKA 5F3WB 2UU9B 3D31A 3WLFA 3LLUA 5A0VA 1Z2CA 2QZJA 1TX4B 2HGZA 2X86A 1M1ZA 3BB3A 3EQ6A 4CM3A 5LNK1 1KC1A 1QO0D 4QUDA 3ZJ5A 1TUBA 3IUJA 3ITEA 4QOJA 1QHXA 1W94A 3PRKE 5A0FA 1YS9A 3NTXA 4D96A 1ZKMA 3HHPA 3U9SA 3CPHA 3DNFA 4UE6A 1TYCA 2WJIA 3EC7A 5KNCA 4EPRA 3P5SA 2GD0A 1ZW6A 4BFTA 4JFAA 3KALA 4BC0A 3RTBA 1VE9A 2TYSB 4LBYA 1Z26A 4AN4A 1YIDA 2R751 1XTJA 2V9ZA 4KXUA 2HA0A 4ZV7A 3U4HA 1QHNA 2J67A 1EK5A 4M1MA 3Q11A 6ADHA 3OOSA 1SIUA 5AXDA 2P5TB 2V59A 3AR3A 1CQJA 1IEWA 3OQHA 4GZ3A 3FSJX 1V4BA 2WAMA 3WDKA 1CF9A 4O4HA 2GBCA 5IKMA 2CVOA 2V4MA 1VRCA 4RTNA 2DCMA 3AFNA 3HYTA 4MRNA 5J23A 4EHFA 3QVTA 4NJMB 4MUJA 1F8XA 3ETLA 1P74A 2VQ6A 4RCYA 2WWVD 1SQFA 3LUHA 3V6MA 2RBKA 2HGSA 3PYMA 4RF4A 3MS2A 4IJMA 4MYDA 2VF2A 4KPGA 4HSGA 4IIJA 3RS3A 3VPDA 1Y3DE 4UW9A 1V6SA 1N0WA 1FDIA 5HJEA 2XB8A 5JI2E 4FIZA 1E4YA 1NQVA 2NXCA 3GRPA 4J3JA 3TNLA 4CLOB 4WCDA 3VYVA 5JEEA 3C6ZA 1K1EA 3AJAA 4TL9A 3P0EA 3DDHA 1QGYA 3Q8KA 2O8EB 2FGKA 3DZKA 2W6ZA 3COPA 3F98A 1GT6A 1MD9A 1RU3A 1ZOSA 1L9KA 2NVUA 2G7MC 3KJGA 4GIBA 4Q16A 4Q7EA 3CRMA 1XRPA 3MHPA 2HCRA 1NUHA 1W87A 5EOVA 2D0OB 3U1BA 2D0DA 3UAXA 1QFZA 2AXNA 2ANBA 3CB2A 2G7ZA 3C8DA 5E2IA 4ZGGA 2AW3A 5IDYA 5MGBA 3BXXA 5L95A 1HOTA 2ZBEA 4QDKA 3B1YA 3YASA 4FOTA 3CPSA 1ZIYA 2ZE7A 2NGRA 4BB0A 3H1GA 3N3BC 5C46F 4WKCA 3U1TA 1U6IA 2GNAA 3LC0A 2DZDA 4HGOA 3ICQB 4N39A 1GKKA 3ASUA 3ZW8A 1AGRA 4IIXA 4FYIA 1GPDG 4TQ9A 2JH8A 3RSLA 1UUFA 3BUSA 3MJEA 1O95D 3D5QA 4NXNB 2FF7A 1E3TA 4M9UA 2Q0XA 4RV5A 4E2ZA 3T4PA 1J07A 4E12A 3VZDA 3K8ZA 3QEAZ 3BZWA 3PHGA 1HFEL 1L5WA 1YAHA 4JFRA 1PL8A 2WSYB 1Z2AA 3HSSA 4BZPA 4PCUA 4YRIA 5BQ3A 3LUCA 1OBVA 1T8SA 4OJTA 4RETA 1E1RA 1TCCA 2RAUA 3PRYA 3AB7A 4KQGA 3HMQA 1O8CA 4EY7A 2YKGA 4EYGA 4AI6A 1FJGB 1A96A 4KODA 2F55A 1LV7A 1QYRA 2IWRA 1LLFA 5TVGA 1HUQA 2NU9A 5JY6A 3KIPA 5ELXA 1GAQA 2PZJA 3X44A 4R83A 3F7MA 4MB0A 5ED0A 1XTTA 4MWTA 4C29A 4F60A 2BKXA 4C2UA 1IWBB 3C3YA 3QKRA 4K6GA 1KI2A 3V4SA 3WNCA 1EX6A 2PH7A 5AVVA 4DAEA 2QPTA 4ENTA 2FOXA 2G1KA 4Y2GA 5HZMA 2IBMA 3QXGA 1NT2A 1P73A 1N2CB 4YCJA 1P2BA 5EUQB 5IT4A 2HMSA 2AW5A 2CLLB 3AP3A 3LYUA 4F3KA 4URFA 4MVWA 3T5MA 1V6AA 3L8YA 5BP7A 2C07A 3KOXA 1V2HE 1N34B 4ZT7A 1NNEA 2XQGA 3NEYA 4AW9A 1W1IA 5I7VA 3JQBA 4TYWA 4RF3A 4JUDX 4YCDA 1DDIA 3JWJA 4PLFA 4PO3X 2P9FA 4R0VA 1YCFA 2QE6A 3A3KA 4B75A 2FRXA 2BKAA 3EIWA 4WK2B 2BIFA 4L4RA 5CVJA 1NTRA 3RKRA 2FF5A 3U48A 1U1CA 2VUIB 3UKJA 1ECJA 1SBTA 5DHSA 1H2WA 4PLZA 5T57A 1ZGCA 1TDJA 4FJ0A 4CMHA 5BORA 5JFOA 5C1PA 1TVKA 1D4AA 1MB4A 3JD3A 3BA6A 5G1PA 3H4IA 2BD0A 4MYSA 3SOPA 1E7RA 1X94A 1SNYA 2ANCA 2PWAA 3TW8B 2W98A 5ADVA 1ZMOA 2O8FA 1S1CA 1LPAB 1VQ1A 3H8SA 4YYEA 1RZVA 3HKEB 1JHOA 4KXFB 4FSDA 5BV8A 2K7ZA 2V7VA 2OZKA 2ZVQX 4MVJM 1BKDR 1N7IA 5JNSA 5ALPA 2XJ4A 3JQ8B 4I5GA 3RFTA 2NUAA 3MLAA 4PCAA 2I3BA 4MGHA 8GPBA 3FMGA 2VJOA 5DHAA 1UFQA 5FQOA 1SC6A 3G85A 1XCJA 2QZZA 3RK1A 1EXNA 1R9JA 4HRAA 2UXCB 3RQIA 4BMSA 4F3CA 2OZLA 4FZVA 3L7KA 1IY2A 1VHJA 3BJEA 4DLZA 4B46A 3REFA 3CO5A 3DMTC 2JVJA 4F11A 2R0QC 2IKQA 3I9FA 4DZRA 4NE7A 4DSAA 1N0UA 4OREX 3TBHA 2XT9A 1NBHA 1ST3A 2Q5OA 3INNA 1KZ4A 4QDTA 1OE0A 4M1QA 3DBLB 4FYVA 4G5QA 4G86A 4BVKA 1FX1A 1NULA 4M7PA 4FEAA 1RM4A 2P6PA 3UMYA 1WCV1 2IDJA 4JL5A 4RPKA 4ZVNA 3V7WA 1U1FA 1DIRA 4EG5A 4UCWA 4RJIA 3VDNB 1UT5A 2HCJB 2NUAB 2GZDA 1RYHA 3UCXA 4YT4A 4GPAA 3OJ0A 4DMUB 4RVHA 4LCJA 1JHQA 1W19A 3D1LA 3FE2A 2FPGB 4MMZB 1IZ0A 4EKYA 3BEDA 3HZZA 5DKFA 1XVAA 1NU6A 1UIMA 2O2CA 3QKSB 4WKPA 2PKRA 4ZEWA 1QQBA 5EP3A 2PXCA 1OUMA 4TVSA 4MWDA 3WBBA 2QD1A 4ID3A 2J07A 4KZPA 4XB6B 3CZPA 5BNFA 1UBUS 2IX9A 3NM5A 3TRFA 2YL2A 4DLLA 4ZYUA 3F78A 3PNBA 3AJEA 3DW3X 3FYUA 5GM1A 3X1XA 4NOKA 5KINB 2LDBA 2GZ3A 3ZJ4A 3MWYW 1KS2A 4XVUA 4MQ4A 1HQDA 1QRDA 2R87A 3H9CA 3K9GA 5EEHA 5T7BA 4JV5B 3JQAA 5ICCA 1YDMA 1QE0A 5I51A 4LJ6A 2GK3A 3NVKI 3R7BA 1RYMA 3FHLA 3JYOA 3EXHC 3D0QA 3DZCA 5P21A 1ZFNA 4F04A 2VJQA 1IJFA 4QOGA 1YS1X 4YRSA 4I1SA 4GG1A 5FI5A 2XTJA 4OM7A 3WS7A 3WOVA 1W6UA 3GJ7A 5FNVA 2F1KA 1ZY2A 1DWPA 2GK7A 2PPVA 3GC6A 1VFPA 4L6AA 5H9WA 2X58A 3R44A 1DBWA 5HRUA 1YJ5A 5SYAA 2C1ZA 3IJPA 3KAJA 4HYTA 3OZXA 1TEVA 3R3SA 5FJIA 4JEUA 5HFNA 5IK2A 4YXWA 1P7CA 1QGZA 1EQ2A 1E2LA 3PPIA 6GPBA 2QU7A 2MR6A 2J0UB 3DFFA 3N8IA 4B09A 4FINA 1TJ4A 1DJPA 3EA5A 3RWMB 4PG4A 4RAQA 3ZVNA 4QHSA 5DLQC 5HIIA 1U94A 4O0LA 3N07A 4UVDA 4U7TB 2OV2A 1TB4A 3I72A 4MI3A 2QW1A 2OHIA 1EWVA 1JXAA 1GT91 3ACDA 3CH6A 4NOJA 4U00A 3RYIB 3G0DA 3NHKA 3GMSA 1Y6RA 2J9FA 5AJHA 1KDVA 3GUUA 4O4LA 3R7SA 4U8GA 1QYWA 3ZDBA 4OX9Y 1VIDA 3LYHA 4HDNB 4TS9A 4QPJC 1Q3HA 7REQA 4F91B 5KYKA 1H2HA 3E5MA 3TE7A 4AG5A 3NT5A 4JDPA 2WVGA 5BSHA 2YXLA 3V8BA 2Q7OE 1G8JA 2F43B 5FCDA 5I5EA 2A8YA 3RKSA 4BXOA 4DCGA 2Y1CA 3ZHTA 3WL6A 3AU8A 1WZEA 2QLTA 3EK2A 4X8OA 4GOND 1TT5A 2HKIA 3I9V1 3SNHA 3PHJA 4GI7A 3SLGA 4CKCA 2O4UX 3W04A 1ADYA 5CGQB 1LEHA 1N3YA 1VI2A 4PBSA 2WTAA 5I9NA 4I1PA 3CVJA 4GP7A 1RKXA 2ZVPX 1A97A 1NPYA 1NMZA 1ZD2P 2D5IA 3W3AA 1NPTO 5LYJF 1XDWA 1VMIA 2CHGA 3CNOA 4PR3A 1ATIA 1ONSA 2FN3A 3C5HA 2C8JA 3D8TA 3F8SA 4L3WA 4ZODA 5IASA 2PZ8A 9ATCA 2VKTA 3W1EA 4EZBA 4DPMA 3V00A 3RQSA 3ZIDA 4E4YA 1YFJA 3ROQA 5TGDA 3VR2A 2X19A 3JR7A 5C5CA 1TQ4A 3E8SA 2BTQB 5B7PA 4JLUA 1P0FA 2VPQA 1IOLA 1V1RA 1PLJA 3I1YA 4GX2A 3L0PA 5DGXA 2QE7D 5AIBA 2ECOA 1H2AS 1Z7YA 2AI3A 2XTNA 5H4GA 3GT7A 4MINA 2ZRMA 2VAMA 5DHRA 2V55B 2L42A 1W4AA 5CU7A 4IYRA 2QX6A 3TOSA 1CYEA 3QWBA 1D2MA 1T5DX 4UVEA 4XI9A 1J0AA 1NQ5A 1W30A 1UKBA 1BCRB 1I5RA 2GN9A 2ICAA 1U8TA 1GKIA 2OYSA 2P2SA 3BRWA 2W7TA 3GD5A 4NCNA 5ECGC 2PMEA 4DCOA 3R6TA 2GF0A 1DOAA 2Z58A 3SJAA 3D2CA 3E1GA 5DTRA 3K4PA 3AFGA 2DLNA 1RLUA 3PVZA 5FOVA 1V39A 2UZ3A 1HK7A 4QNRA 4A10A 1L4EA 5EZYB 1HL7A 4WIAA 3EG5A 4MUNA 9ABPA 2VCEA 4QTXA 1I6LA 5A7HA 5CP8A 1HNZB 3WWZA 4TL8A 1H4VB 1CETA 2EFEB 2WE8A 1OLSB 4E2XA 1SHZA 3KPYA 2B98A 1Y5MA 2EQAA 2NUTA 1NAHA 3TRHA 4UMFA 1GQ2A 3WRYC 4MV9A 1ZD8A 2VF7A 3PB3A 1GRCA 2C2KA 1CNEA 4A91A 1AX9A 1E6UA 4PN7A 4P4UA 2BGRA 3I39X 3QKUA 2XWBF 4WSOA 3SYRA 1BX1A 2YIVX 2P62A 2RK4A 1IPFA 4DJTA 3BT7A 1XU7A 2Q8PA 2DECA 1NI4A 2QTFA 5ARDA 1NXWA 4ITRC 5TQ2A 3DEFA 3QENA 1ETUA 4HUJA 5KYGA 2GBPA 1BDHA 3VPSA 5C5IA 5C31A 5JVDF 4BQNA 1I5EA 2CD7A 5CDYA 1YL7A 4K5QA 1R00A 3SGLA 1H4SA 5IWCA 4LZWA 5LUAA 3ZWBA 3PLRA 1FP6A 4NICA 3C43A 1USGA 1G6KA 2IPNA 4HX2A 1YK0A 3ZU3A 3EMVA 2FSIA 5IEBA 3BQ9A 1FNBA 3OY7A 1PFYA 5JAQA 4I55A 4EZIA 2V7TA 3HE3A 3ME5A 3PGMA 2WG2A 4JYPA 3SN6A 2B35A 1E3DA 1GTZA 4EG8A 4LJRA 1HLGA 4MUBA 2ZAIA 2CNBA 2J3QA 1H1DA 2WYHA 3PPYA 4Q01A 1R0LA 1REQB 1RHJA 4P3OA 3WIUA 5IANA 3NNDA 1NC3A 3MINA 4KVGA 2DQZA 2O2IA 3V4VB 3WLAA 5CBKA 1VE3A 4CFZA 1Y9DA 2XKBA 4BN4A 3B3QA 5C8YA 2O1EA 5EIFA 2CE7A 2H0AA 2XKAA 3OHSX 4RZ2A 2OBNA 5T64A 1NPDA 1G5HA 1WZNA 2B8NA 4HT3B 1J8FA 3UBTA 4MRPA 1PW5A 3O8LA 4YAFA 5KVSA 2HJHA 4WL0A 4OFXA 2P6UA 4M88A 5AW1A 2RK3A 4U0JA 4PTYA 3ITKA 4A8JB 3DL0A 4S35A 3UW3A 3W7VA 4JI1B 5JCJD 1LS1A 3QSGA 2G83A 3CU5A 4UBJA 4Z86A 1PFVA 3HY3A 1VECA 1ECBA 3GAFA 3AVYA 4EA6A 4HNRA 4EG0A 5HFJA 5K8LA 1CY2A 5JECA 1E2FA 4G01B 2F4NA 4ND1A 3IMGA 1FJHA 2F3TA 3MXTA 5DGDA 1CVRA 2P6OA 3DFMA 4CEJB 1A8HA 1L7QA 3H5RA 1B8OA 1RAEA 1Y1TA 4O8CA 5BT9A 2EL9A 3FOWA 2PUHA 3LPAA 5LKAA 3AVPA 3NRCA 5G3ZA 5H81A 1T9CA 2X5OA 3GRRA 2ZYRA 3H3FA 1MRZA 4DUYB 2FUNB 4H6VA 5D5QA 1WCXA 3EAQA 4Z1MA 1WSBA 1SCBA 4C0AC 1L7BA 3RJTA 3WHPA 3K9BA 4HYYA 3B6EA 1L5QA 2VK8A 2EP7A 2M1ZA 3F6BX 4PAQA 1ZMBA 3P4YA 4IMJB 4FHGA 2Z3VA 4GBJA 1XTPA 1Z12A 4PS0A 4PGAA 5H59A 5ALGA 1OBHA 3Q7RA 3PI6A 5J1TB 5FV4A 5C18A 1I24A 3WO0A 1U63A 2J6BA 3AF3A 3QEJA 1MGOA 3CCFA 4ZO7A 3GLFB 2J9RA 4Q9HA 5EHNA 2VTKA 4AB1A 1IBCA 1VPTA 1YS7A 3LP8A 4CM8A 3LKDA 4JBHA 1RPTA 3HKDB 3ORSA 4N0QA 5TMEA 4DSZA 2A4KA 4RCVA 3UW1A 1J49A 4OY3A 4W9RA 4XWTA 2HMVA 4IIJB 4R7ZA 5DW3A 2JHGA 5BWBA 1MDBA 4ND7A 4AS3A 1SCUA 4PZPA 3GGPA 5JLAA 2WSSD 2IE8A 3SQOA 4ANFA 3WGUA 1AC5A 1XFDA 3HUEA 1KI4A 4Q3LA 4X7MA 1LD3A 5DI9A 3SDBA 3T9CA 3VR6D 4EIWA 4IJ5A 1S2DA 2DWCA 2A30A 1IHOA 1Y3AA 2QZ4A 1VBNA 3LCCA 1U7HA 3UAZA 5GVSA 4PX9A 1DPFA 2AV6A 2OGSA 3E0QA 1FP1D 4W9NC 1X1EA 4PFQA 3RUAA 3AUTA 3SDZA 3SEZA 3KQPA 1KJNA 1W0JD 3TZHA 5CITA 1JG2A 1IH8A 4Y2YA 3WRVA 3DE0X 3ER6A 5KCZA 5EKSA 1DRVA 3MCVA 3EZFA 4X5OA 3T5DA 1Y4ZA 3N8KA 4A6DA 3UK6A 2XGJA 5T8KA 4F2HA 5D6OA 1W36B 1ZQ9A 1T6XA 1WUYA 1LZKA 3FX2A 2VP0A 5EJAA 3BXZA 5I7RA 2DHQA 3LHKA 4WZAE 4KO2S 2BI4A 2JFOA 2PWPA 2BGWA 1YZ3A 1UBHS 2FMFA 2R4TA 1ORTA 1U3CA 5BSMA 2EZ9A 3R6WA 1ZGZA 1BYUA 1E3JA 3Q6MA 3JXEA 2AOUA 2IYOA 2OAQ1 1LQTA 2JI9A 4R84A 3H8WA 5JZVA 4O4LB 4JOSA 2D3WA 1E4VA 1MHTA 2FMXA 2C96A 2L82A 1GCIA 3O7MA 3TUIC 3HL0A 1FU7A 4K05A 2BMVA 4U9UA 2HRZA 1H6BA 2FZ5A 2ZQYA 2O54A 2D74A 3K1YA 4LZLA 2Q4EA 3OOJA 4YLYA 1J2RA 4N3AA 3EPHA 2X5JO 3KQWA 5IWAB 1WULS 1K5DA 2QNBA 1G2IA 2ZUVA 1YK1A 1FNCA 2WUFA 3WRYA 3TG8A 3JVIA 3ORFA 1LDYA 3ZGVA 2RHMA 3VGPA 1KBQA 1UJBA 1XQYA 3FTEA 4EMBA 4FMDF 4WESB 5JCOA 1BDMA 3U3MA 4JI8B 3P9KA 4C3ZA 4RF5A 1FQKA 1RC1A 3GFPA 5BMVF 2GZHA 2XB2A 2AK3A 3PLNA 2PG3A 3R9IA 3QUCA 2G17A 1NW7A 1P9NA 1I0LA 1EBUA 2F8SA 4J07A 3MT9A 3B53X 3V3TA 4BV2A 1O0BA 5LR6A 3ECAA 1EUQA 1GL7A 1UP7A 1QM5A 2XLCA 5AK4A 4E51A 1RLIA 1JQ3A 1OXMA 5LXTF 5BSKA 4QE3A 1F4VA 3KTAB 2VXBA 3C3KA 2OBLA 4GXTA 4LQDA 2CEAA 4RJ2A 2AN9A 3E9NA 1QJ4A 1EP1B 3RV3A 3DD1A 2P9YA 1RMQA 2C5HA 3DLIA 3H5WA 3AOEC 3D3NA 2BFEA 1M1YA 2I6FA 2P1RA 2FUCA 2IU0A 3PQFA 1WU7A 4BNTA 4ENRA 3SE0A 4BBJA 3WMWA 3O9MA 2H2FA 2N75A 1ZNZA 4ENQA 1AKNA 1RLOA 4MAMA 2FVXA 4C7VA 4KNYA 3NHYA 1HNWB 4MW4A 5LCXA 3NCTA 4J4BA 1WVMA 1Z28A 1Z7BA 2FVYA 4OI4A 1T15A 5HZKA 3BDVA 1AHHA 4W5RA 1AHNA 3E8MA 1W29A 4KIUA 2JHFA 1AXRA 3GEBA 4MUAA 4OHRA 4YRDA 3C3EA 2DTEA 3K5WA 2DWQA 1CX9B 4HX9A 1VLMA 4AIIA 3OQBA 3ST7A 1WXIA 2PA3A 5M5BA 1UEXC 1O94A 4HXGA 4MITA 3AF5A 4DLBA 3ADCA 4CDGA 1DLIA 4R8SA 2ZYVX 3WK7A 4BATA 1AMNA 1GL3A 2VNAA 4JXJA 1F12A 5IXJA 1JYSA 5C1OA 3AHCA 4IXMA 1GD1O 1EK1A 1Q6YA 2CNKA 4RTRA 1GUYA 3K8OE 4DSOA 2XE6A 1BA2A 2PMDA 4OATA 4KLRA 5ECDA 2HU5A 3FTFA 2ST1A 1IMOA 1X86B 4LISA 1Y89A 5A9SB 1RAHA 3WFJA 2O1XA 3ZHBA 3K6JA 3SS9X 4C03A 3U3OA 2EHJA 2YIMA 3BJIC 1RWKA 2QOEA 3GRKA 2HJWA 5TGZA 1RXVA 4JQZA 2WDZA 4OHKA 3KU1A 5KS2A 4DLVA 2G4VA 1S9HA 4OAQA 1B26A 4X6UA 1IBLB 2A1UA 4JJIA 4YJHA 5EZSA 4OP2A 2X2EA 3DZGA 2QTAA 3OOHA 5IEJA 4U6NA 5K99A 5DGIA 4F56A 2DPGA 2VUSA 1NI3A 3RAEC 2ZJ2A 1GCGA 2X8JA 4X7PA 2MTBA 1H2RS 3PTZA 3PQDA 4EJSC 4ZIRA 2JS7A 4MCHA 2F3RA 2VF5X 4FT2A 4XVHA 3RSQA 3AJRA 1G9XA 5IN5A 5BRJA 2QS9A 1DX4A 1G0NA 1OV6A 4YJDA 5ER6A 1CK4A 2MINB 3BK7A 4XX0A 2XWJI 3BTSA 1JU3A 4XM1A 5D8DA 2JCXA 3SX0A 4LJYA 2HK7A 3DHNA 1ZVKA 3GF4A 4RVCA 4NYMR 3W4KA 5CDUA 2QMOA