4BV3A

Crystal structure of sirt3 in complex with the inhibitor ex-527 and nad
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
270
structure length
270
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-3, MITOCHONDRIAL
publication title Ex-527 Inhibits Sirtuins by Exploiting Their Unique Nad+-Dependent Deacetylation Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 91
structure length 270
sequence length 270
ec nomenclature ec 3.5.1.-:
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4bv3A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4bv3A01
4BV3A 4GP9A 1EFVA 2JLAA 5EJAA 4D5GA 4IAOA 4JUCA 5MFPA 5D7NA 1Z8NA 1V5EA 1Y9DA 3CLTD 4MPRA 1POWA 2FN3A 4GM4A 4FVTA 4GG1A 1Q6ZA 1YNOA 2EZ4A 2OD9A 2UZ1B 4MPPA 3RIGA 2H2IA 4JD5A 4UTZA 4TWJA 4RMHA 5BWNA 4J16C 1S5PA 3JR3A 5FEMA 4G1CA 2EZ8A 2X7JA 3HWX1 5EJ5A 2IHTA 2FR8C 2VK4A 1PT9A 2OO5C 5EJ4A 1YHYA 1D4OA 5K6RA 3CLSD 2C31A 3U31A 4C78A 4RJKA 4RMJA 5MFZA 4HDAA 4GPEA 1M2NA 4BVGA 2JLCA 4F56A 3OE1A 1S7GA 5DEIA 4KGDA 4F4UA 1NM5C 4K9PA 5AHKA 1ICIA 1PI3A 2H2FA 4BV2A 2JI9A 4FZ3A 1M2KA 5DGTA 2PGNA 3GLUA 3ZGVA 1N0HA 4Q9DA 4UTNA 4BN5A 2VBFA 2QQFA 4HD8A 1MA3A 3FZNA 5K3SA 3EYAA 1PO7A 3GLRA 5EJ8A 1T9CA 1BFDA 4JUAA 5FYQA 1Q1AA 2A1TR 4L2IA 2VK8A 4GM1A 4UTVA 4RJIA 2H4FA 5EJMA 5EJ7A 2JI6A 1U31A 1OVMA 4D5EA 2WVGA 2UZ1A 4UUBA 1V5GA 1UPAA 4V1CI 4O8ZA 1UPBA 3RIYA 2H4HA 2FWNA 2Q5QA 2VBGA 5DGDA 1J8FA 4QQ8A 4MZXA 4FEEA 4Y6LA 4UUAA 3HWWA 1Q14A 3GLTA 3F6BX 2VBIA 1PYDA 4X3PA 2AG0A 1M2JA 1O97D 3IAFA 1SZCA 2JI8A 4FEGA 1V5FA 4QELA 4K9LA 2H2GA 4V1CA 1OZGA 1T9BA 2VJYA 1PTJC 4BVHA 3EY9A 1U28C 4KXQA 1M2HA 3ZG6A 4UTXA 4BVFA 4RMGA 3D4BA 3EA4A 1YC5A 2Q5JA 4MPJA 4JU9A 3FLMA 1O96B 1YBHA 2V3WA 4UTRA 4BUZA 1YC2A 4JT8A 1POXA 4K9QA 4UU8A 2Q27A 4TWIA 3GLSA 3PKIA 1YI1A 2PANA 5K6TA 2EZUA 5IMSA 2W93A 1HZZC 2EZ9A 5MGNA 2VK1A 4JU8A 1OZHA 2H4JA 1M2GA 3CLRD 2IHUA 3JWPA 2H2DA 3D7KA 4MQ5A 2WVAA 3IAEA 3CF4G 2HJHA 5BWOA 3LQ1A 2NXWA 2Q5OA 4K9NA 2B4YA 4X3OA 2JI7A 4Y6OA 1DJLA 3FSJX 2OD2A 1ZPDA 2FRDC 1SZDA 4BVEA 1PNOA 2A1UA 2Q29A 4Y6QA 1JSCA 1EFPA 3CLUD 3U3DA 3PDHA 2Q5LA 1Q17A 1T9AA 4ZP1A 4K9OA 2Q28A 2H59A 5EJ9A 1MCZA 1QPBA 2EZTA 1U2DC 2NYRA 1U2GC 4K9MA 4IG9A 4JT9A 5K2OA 4RJJA 1YHZA 4KPUA 1T9DA 2IHVA 2FSVC 4V1CB 2AG1A 1YI0A 1UPCA 4R8MA 2QQGA 1E3TA 2JIBA 5EJ6A 4COKA 2H2HA 4IF6A 4QPZA 2BRUC 2OORC 3K35A 5MF6A 4I5IA 4JUDX 5BWLA 2OD7A 2WVHA 1OZFA 4GM0A 1YTLA 2DJIA 1PNQA 4L3OA 3F6EX 4JUBA 1PVDA 4UU7A 4JSRA 4RMIA 1XLTC 3D81A 3E9YA 4C7BA 2PGOA 4JUFA 3PKJA 4BN4A 3ZGOA 4K9KA 4ZZIA 4BVBA 4J1TC
chains in the Genus database with same CATH superfamily
5LWHA 1MVNA 2JLAA 2YQ4A 1LCIA 3AHIA 3KVRA 2BGLA 4Y30A 1L5SA 3GFBA 1KFKB 2VYNA 4NE2A 2BZ1A 5MFPA 4RQTA 5L7YA 1XO1A 3P9PA 2O5RA 1FNBA 5DRYA 3NHKA 2QORA 2GSWA 1DBIA 1L4MA 3GJRA 4X24A 2QBYB 2C4UA 3OX4A 1Z4OA 4KPGA 2FPGB 1Z5UA 1NC3A 2XQJA 3QOWA 3KT6A 2YJ4A 4F4JA 3E5MA 4MGYR 5AHWA 3T1OA 3IJPA 3TB6A 3NIDB 2V8BA 3JQCA 4ZI7F 2SBTA 5KYWA 1OH8A 1SUAA 2GRAA 3HO1A 3B3GA 4IIYA 4MPRA 4B6GA 1UBUS 2OKCA 4HNGA 1DKOA 2YXBA 1YIOA 4DCJA 2QXYA 1M1NB 3KQSA 1G41A 3F8WA 2OD9A 3CPJB 4R9VA 3V3KA 3WLQA 2FLWA 5A04A 4ZEVA 5CG2A 1R6UA 1G59A 1KJZA 1ZAKA 2YY5A 1E20A 1FQJA 3SHFA 4J0DA 4Q1BA 5DBIA 1FBTA 3TZ6A 3S8YA 3PR3A 3J81A 3DOJA 4BVKA 4DN6A 3REQA 1ZVJA 1UC4B 2VHWA 2WWIA 1NQAO 2EEZA 2O1EA 2X22A 3RKRA 5KHAA 4MUYA 4UDOA 5ALQA 1A7JA 1HYGA 1WTAA 3K2QA 4HWSA 4J3JA 3VPBA 1U2TA 1PUJA 5BWNA 1WXQA 3BQNB 1XHFA 1Z2OX 3DZFA 3NH6A 1SO8A 3FNBA 3L1UA 2E4UA 5K03A 3BK2A 2FPXA 4YA6A 5A02A 1NZDA 2DLDA 1HYHA 5BW8A 2ORED 1FQOA 2DCUA 5A0VA 4Y9RA 5G02A 4WEOA 1MV8A 4GSLA 3ZE7A 4YEDA 2ZJ3A 2VK4A 3SZLA 1UPUA 3O3MB 4J2TA 2ZU0C 3WQHA 4UQPA 2FCAA 3ZU2A 2FPLA 4BNXA 4PZ9A 1N2HA 4XIJA 1PS0A 4F06A 1EU1A 1Z5GA 1QGUB 4TRNA 1QHIA 3EVDA 5DE3A 4BZZA 1DBVO 3FUTA 1V7ZA 1S3GA 2PRJA 2P2NA 1Q7TA 3CLSD 1AZTA 3FCEA 3SJZA 3UUGA 3C97A 2WSLA 1EEXB 2P41A 3ST7A 5LP6F 3TINA 3TG2A 1PR3A 4GO1A 4KL8S 1GYPA 1T1SA 3B3AA 1J09A 3B6JA 4X6UA 1Z33A 1NX6A 3VKFA 1N78A 1L4EA 1VCMA 1N6HA 3PQ8A 4MHOA 4PN7A 1KP9A 3V1NA 3KBBA 4NBUA 2Z2YA 1GSIA 3NTQA 5I3CA 2XMGA 3VAAA 1TMOA 2BZ0A 2I7CA 5ADHA 1S7GA 5KVQA 2TMGA 3VU9A 1QIIA 1Z0ZA 4PLVA 1OTYA 4NU6A 4AY4A 1W4ZA 1XTKA 1OIXA 4M8LA 4YP5A 4HDKB 5EE1A 1E8MA 4KMRA 4RU1A 4FMPA 1UXKA 3NCTA 3BT7A 3MOGA 1PV1A 2D0PB 3KAQA 4HAXA 5I7UA 4MQFA 3GJQA 4GFDA 3L7AA 4NULA 5BQ3A 3H13A 2JGFA 2NADA 1P18A 4WVLA 3F78A 3FB1A 3WGGA 4W1QA 3OT1A 1XQXA 1KZGB 3B7PA 5U4XA 3BD9A 4FHGA 1IJEA 4RTMA 5HKOA 2EX4A 2FSHA 3CM0A 1L9XA 2RI1A 3IR6A 3SHQA 1ORHA 1D2CA 5TEWA 4N48A 4GPIB 3O91A 2DBZA 4UCXA 3S5JA 3QE4A 3S1AA 1BA2A 3HJUA 2GVNA 1FRZA 3N1UA 2GN2A 5KSPA 3WYDA 3ZH9B 4CR8A 4J76A 1VGRA 1XTJA 2JBWA 4KMOA 3V7UA 3R9XA 5KWEA 4GZ3A 5AKZA 1XA0A 2GCEA 3KCQA 3L4BA 3TO5A 3TQHA 2P9QA 1MABA 3KLMX 4P86A 5C4MA 3MIZA 1K2VN 1NL3A 1IPEA 1UFKA 4D4KA 2W5UA 1AV7A 1CUJA 2A0WA 4PBRA 3WLPA 5J4KA 1J2UA 2ZTHA 4EMBA 3GA7A 4MMZB 2A58A 4FBGA 4OAPA 2QRPA 1BDIA 3G0OA 1N1DA 4IJVA 2FPIB 1KQFA 3DLIA 5F73A 4IQ4A 2A1IA 5A6VA 1RIIA 2ZYTX 4RVSA 5CDFA 3WB1A 3PA6A 5EMKA 1Q15A 1XJCA 2O1SA 3IVMA 1N0VC 3WQBA 1JX6A 1T6YA 2GZ2A 4KI0A 3ZBQA 3Q3EA 4J3NA 4X66B 1T9GS 3PR1A 1WIWA 2Y1DA 2VHXA 2WHXA 3FDZB 4YDRA 1KOLA 1PFKA 1A8QA 4RWZA 1OWMA 4E2WA 4YRRA 5KSWB 5ITWA 3VTFA 1NPYA 1ISSA 5A71A 1W47A 4GXNA 2DWCA 4OHCA 2WAYA 5HMMA 3GVHA 3S28A 4EL5A 1XA4A 2VTEA 3EW7A 3FPSA 3Q3GE 1OYVA 2JD0A 421PA 3CNEA 3GUYA 3OFKA 3GZTB 1ZRSA 4Q7QA 4G81A 1C0PA 3W6PA 1KAHA 1CZOA 2RGGA 1SVUA 2GLUA 2WSSD 3FSRA 4HEJA 1YA6A 1Z5WA 2P2YA 1T3TA 3RG2A 4KRYA 4ALKA 3O0DA 5K0EA 3ZHBA 1L9KA 2PKEA 4C89A 5DWQA 3T9DA 1T36A 1VG0B 2XUFA 3VZRA 5I8PA 2C2MA 1IXZA 1ESEA 1R4AA 3CZMA 3F90A 3P9CA 2FF5A 4QO7A 2XMPA 1DAEA 2R2GA 3NHAA 4PZZA 4WOPA 4X20B 3UAWA 3N8HA 2J9ZB 3ID6C 3R7AA 1PEAA 1Q92A 2IOFA 1QDLB 2LDBA 4CLOB 3F98A 1X1RA 1PWHA 4FSDA 2YXDA 5CEJA 3BXZA 3EQZA 5JHHB 3MTQA 1I3CA 2QN8A 1U9JA 3GW8A 2IYLD 1HFEL 4R9UC 3TTTA 2BKAA 4UUAA 1P7ZA 1FMCA 1BS2A 2DUWA 3HNOA 4BX3A 4GKAA 3GLTA 4DQVA 2OFXA 2Z8YM 2QN7A 3ER6A 1X7HA 2YNMD 3E9MA 1V8ZA 1WXGA 1VIYA 4EMSA 1KI8A 4UJ5A 4LSZA 5ALNA 4EELA 4MVJM 4YVFA 4D3SA 2W6CX 3QMWA 3RWMB 1GCGA 2H63A 4IDQA 1UCFA 3GPBA 3L6RA 121PA 1BDMA 1M76A 1K7FB 4J2OA 5KNDA 1TTQB 1BOFA 2G9NA 1M83A 4WOKA 4DDKA 2DP4E 3JAWA 2A6PA 5CB4B 4LECA 3BMQA 2GM9A 1F8GA 1QHEA 3HVJA 4MKIA 5GOZA 2OLJA 1O4WA 4MVJI 1NULA 3TX6A 2H2GA 3ZXSA 3EBPA 3ZNPA 3R6WA 2AS0A 1DCKA 1R0WA 2BR5A 2Z30A 5CLLA 1I51A 2PIAA 4ZV4A 1SFRA 3OQIA 4HNUA 2WSBA 1U4NA 4F6RB 2ZZKA 4BDTA 1E0JA 4FWIB 3KSDO 4KXQA 5BYJA 1JTVA 3B20A 2QN9A 4JELA 1BXZA 1SCDA 2O48X 2CLMB 1KPIA 2XOKD 4NKRA 4B6EA 5I4IA 3E0QA 1KEZA 2WR8A 1OZ0A 2BDTA 2QUIA 4BX2A 2LKDA 2Q5JA 2V7XA 3I9MA 4KMSA 1XZAA 3UUFA 4D92A 5JXJA 1JAZA 3AR6A 2JIQA 1PJLA 5A7HA 3BMCA 4N7BA 5CYGA 3KJNA 1EX6A 1OXUA 1RWQA 2XUHA 1T8TA 3ZUGA 2AOVA 1H6AA 5EOVA 2OZEA 5JCJA 1SC6A 2AXPA 4L50A 2GDJA 2Q3FA 4WX2B 3DC2A 3TNYA 4X44A 1AKMA 3ESRA 1Q83A 3EMKA 3BHMA 1L5KA 4QM7A 4P5PA 3GQBB 4DG5A 2A9RA 3U7QB 1NMXA 1YU6A 4NMXB 3TCXB 1ILEA 1N3YA 3PFBA 3H5VA 5E2BA 1MHTA 3SS9X 1TMGE 4U5QA 3F9CA 3KKOA 1OI7A 2AR7A 4L72A 1J4AA 1G8GA 4UPVA 1G38A 2N0SA 2V5UA 2UUCB 3ZU3A 3LK6A 4F60A 5EHZA 1XMXA 2F90A 1UAGA 1CNFA 1LUAA 2V6FA 3DHNA 3ICVA 2ZULA 2VDMB 4LV6A 4N01A 4A36A 3KUCA 1QMGA 3W04A 2YJ3A 1YRQA 4RF5A 1DX6A 1JFFB 2Z5FA 5AM2A 1ZCBA 3IUQA 2ZR7A 1YJ5A 3NM4A 3N5KA 1PZGA 3AVYA 3PBKA 4DUGD 1QGAA 1Y1TA 3G89A 5LXTF 1UOEA 3JARA 4X60A 1NRWA 5DNCA 2AFHB 1US8B 4CEJB 1B41A 5I01A 4XOIA 3U4QA 4DLNA 2F8SA 4H6VA 1HDXA 1X7WA 3OOEA 2XZOA 1QIGA 4LCJA 3K1JA 1SBHA 1NW9B 2GEUA 1OUMA 2QRVA 3H1GA 4AKSA 1CY8A 4D9JA 4RPJA 4YR9A 5LMUB 4JL8A 3J7AC 2CWWA 1HC7A 2FZ4A 1RBYA 3QKUA 3EGWA 3DJFA 1RE1A 3LHFA 1T9KA 4JBYA 4L4YA 3PYXA 5TS3A 5DXJA 3ETHA 1SXJC 5DXAA 2YWXA 4PTZA 3R0JA 4R2LA 4D02A 1ZXBA 3A1SA 4GEKA 3PZRA 1IN1A 3ETEA 3L1JA 3I01M 2GN0A 3ZN2A 4XD7D 3RREA 4G24A 1YZQA 1WCXA 2P2GA 2IEAA 3I73A 5LMNB 4UULA 4NEGA 4QIHA 4YT8A 5B2ZA 2RCNA 3OCCA 3LZDA 4RGBA 1ML4A 5L3VA 1M3SA 4OHRA 8ABPA 1VOTA 1HNZB 5G4KA 3IOBA 5BUQA 1JJFA 5DP2A 4XI9A 1F0KA 1GPYA 1RVDA 3OKAA 5BWOA 3G0BA 3HWSA 5IAKA 5L53A 1T29A 1ES9A 2HUPA 2Q5OA 1L8QA 1N0WA 2HH9A 4JSTA 4HFNA 4FJ1A 5DNAA 1JG1A 2OXRA 5T4EA 2WA1A 2VQ6A 2NT4A 3VU0A 1CJBA 1NXSA 2G1AA 2IL1A 3A25A 4HQNA 5JG7A 1OYWA 2FRDC 1EMDA 3B89A 3CEPB 3BRWA 2JIMA 4Y6QA 3HA5A 5AESA 4FFLA 3V4SA 1YKGA 3I61A 1AE1A 3PEWA 1KA9H 1JAXA 5E9QA 4BBAA 2FG7C 1HE1C 1MORA 1ZX1A 4IWYA 4ON9A 5HK8A 2FG6C 3SR4A 1NI5A 1ZK1A 2YS6A 2P0YA 4EKIA 4FYYA 1E1KA 1Z5VA 4JVNA 4KO4S 5DCWA 3HYSA 3X2SA 4YXWD 5DMHA 2XQIA 2GXSA 2QL7A 3RIHA 1PFQA 1Q6YA 2C9BA 1ULBA 1AN9A 1DUVG 5EKSA 2VAPA 2O20A 1YVRA 1UKEA 2B7LA 3Q9NA 3MB5A 2PSJA 1XGKA 2C7GA 2QVYX 5LFAA 5ENDA 3R9WA 2DECA 3OZBA 2DWOA 2WU4A 2FN9A 5JCOA 2XAUA 1YXMA 6LDHA 1RYBA 1X74A 4LJ5A 3DMDA 1JJIA 4BX9A 1U3VA 2I80A 3EZNA 4WT7A 4DQ0A 4DUPA 5K6AC 1HT2E 1UJBA 3W9BA 5C5IA 1OFVA 3ODPA 3OZAA 4KHZA 2NTVA 2PS9A 1XTSA 4I6JA 4QXMA 3L1KA 2O2GA 3P32A 5G1PA 2EKQA 3BXPA 4N39A 1Z5ZA 4RD4A 4OXYA 3NHJA 4QG7A 2I33A 5ALUA 1SD5A 4K2AA 4DPKA 3JVEA 1QP0A 1SZPA 1Y89A 3MPOA 3LIIA 3P0JA 2NZUG 1OV6A 2YZNA 1VBKA 4M6WB 5LQMA 3NYQA 2ZUDA 2AC7A 1P74A 1C0LA 2YUTA 4EB8A 1DAHA 1OFUX 4DIMA 3TFOA 4LAFA 3JS5A 3OUTA 2VDJA 5CT9A 5FPYA 3E9CA 4NS4A 4PLFA 4ESVA 2FF7A 3AJ8A 1XYYA 3HSKA 1H0HA 3RRBA 3ZDQA 4YFYA 2W11A 4AP9A 1L7XA 4HH0A 2DG2A 1ODCA 1JQEA 3GBSA 3I64A 4S1NA 5IXJA 4GMHA 1KMCA 3PENA 5EHNA 3ZTYA 4AIRA 4AMZA 2JCBA 5EJ6A 2HHCA 3V7FA 5TE9A 5LKAA 2R6GA 1JFSA 1XYVA 5BWMA 4W4TA 2PUTA 2VHEA 1GFIA 2FQQA 5EFZA 1NBIA 1UWKA 3Q2KA 3QV1A 4RETA 5GV7A 3WE7A 1Z6ZA 4JP8A 3ZDCA 1NURA 4PZCA 4QE3A 3SIRA 5K7SA 5ALZA 1EB9A 4OGGA 1XVAA 5AWFC 1MNAA 2CEAA 3BCHA 1Q3HA 3W3AA 1JXAA 2RGWA 3AYZB 3CIFA 3F6PA 3QX8A 2A94A 3I30X 3AU8A 2QDXA 3JAKA 2B83A 1YWGO 2C2OA 1E3WA 2HQOA 4BNDB 3TGPA 5F98A 1XPOA 3OC6A 2OK8A 4G4SP 1EHYA 2V45A 3RVRA 3Q7RA 2BGTA 2WY2D 2FW0A 3BWYA 2LPMA 3V42A 4ETNA 1NJGA 4LIPD 5KQGA 1K8QA 1HUQA 4R2KA 4QOFA 4ZN6A 2HFKA 1M1YE 4ZA2A 2QPLA 3AF2A 4C7BA 3KOYA 1XK6A 4XH9B 5HIMA 2EKBA 3UKOA 4CMBA 3AUTA 3D54D 3Q41A 4PNPA 3ZGOA 2RH5A 1WW2A 2GPSA 2QLJA 2YJ6A 3C3YA 1YB7A 2JFGA 3M82A 1T8PA 1A4RA 3UA4A 1QKJA 1EH5A 5AK0A 4OAQA 2C0PA 3DZ8A 1KBOA 3WGJA 4FLMA 2G7ZA 1FSFA 4QOHA 3T5GA 2CVFA 3FWYA 5DX8A 4G09A 4YV1A 3FSGD 1ZEJA 1FVFA 1GDHA 4U7GA 3WRYC 5JMWA 4M0UA 1JIXA 3LZ6A 1ZS9A 2BISA 4YP6A 2VUIB 3RS2A 4KE8A 5REQA 1YK0A 3SU8A 4B3FX 2BP7B 2IRWA 3BILA 4CV0A 5IASA 2BSXA 3LA6A 1IVNA 2PYIA 3V8PA 5IS2A 4GXTA 3O0TA 1HEYA 2F3RA 4JMLA 2KHZA 1L5FA 5JCXA 2JNWA 3RUCA 3UTCA 1M8GA 2PZGA 4F9FA 2IYOA 4Z7OB 2J67A 1KO8A 5BSKA 5CVEA 1O77A 2P69A 4XFJA 1WMSA 2HPAA 4OB6A 3TUJC 1MRSA 2UZ1B 1B93A 2Z9BA 3K0AA 4U00A 2CLOB 3A6FA 4G0UA 2ZCVA 3DYVA 4P4SA 1XT6A 2X1HA 5EMHA 1EP1B 1FYXA 1ONPA 5FV7A 3ADBA 3CXRA 2XF8A 5CFZA 4QTYA 1EAMA 1CHDA 3V2UA 4A1FA 3ZCUA 1P7WA 3OLYA 4EB3A 1Z18A 3FPJA 1ODKA 3BFPA 1TA4A 4KDEA 4PQFA 2GHRA 4QWMA 4XFDA 4ZI7A 1F9EA 1VG1A 2QLTA 1Q50A 3GFPA 4M38A 4PAQA 5BXYA 4AUKA 1H4SA 5B3JC 1QM5A 1WUHS 3OECA 4Y9DA 3JR3A 3CUVA 3V4ZA 4BV9A 4DLSA 5HSGA 1I7DA 2V8OA 3BB3A 1GNSA 5I7RA 1K63A 1Z2EA 4O2LA 5JNSA 3MAJA 4FT4A 2MYPA 5JR3A 2Q5IA 3RF6A 4DE5A 3GL9A 5HF9A 2GN8A 1WKCA 1XP5A 3SF0A 1FMJA 2O0HA 1XU9A 3FJYA 2Q5EA 3Q87B 4QATA 2ZETA 1BX0A 5FORA 4UCWA 4LEIA 1YE8A 5EJ4A 2PUFA 4HHEA 3QVMA 4C5BA 3DKKA 1MJFA 1TJ5A 3H9JA 1TTTA 4TSFA 3GRKA 3T15A 4DR4B 4B74A 4CMKA 1UJ4A 3D3KA 221PA 2ATCA 1JTEA 1GZ7A 3L6UA 2NW6A 4B6RA 3JX9A 4ETIA 4DBLC 2QTFA 4WBNF 3I2GA 4IQFA 4KVZA 3NBKA 4YECA 5FBKA 1M2NA 1AIPA 5BNTA 1DIRA 2JS7A 3AEQB 4OMDA 5BN4A 3ENKA 1HGXA 3KVVA 4HYTA 3PSHA 1OXKB 2OCYC 4JV5B 2PH3A 3C7DB 2M1XA 3JRNA 1VIVA 1WNFA 2QB5A 3FXAA 2D2VA 1RABA 3GFFA 3OJXA 3KPYA 3QGMA 5JE8A 4O3MA 3AETB 1WZCA 2WJJA 4FYPA 3JWHA 1XZEA 2OCGA 2DSTA 4K28A 4OBEA 3R24A 5FWXB 1DAGA 4Q93A 2QMZA 1JT2A 1UKYA 4QBTA 1VA4A 2ZWIA 5GJVC 5L3QB 2Y67A 2HLNA 4V3CA 1VRWA 4ND1A 3K9BA 4QPPA 3RADC 3G2QA 4NOJA 3NBMA 4DWVA 1SOVA 4PYMA 5LP6A 2AWOA 5IDYA 4TUYF 4TV9B 3CZQA 4JJ7A 2X23A 1G5FA 1OBCA 2YRWA 4D9GA 5DLQC 2OSVA 5IJ9A 1CJVC 2FUG1 3EAFA 2E48A 1CK4A 4DQKA 2G1UA 4CF4A 3KKEA 4QL3A 3ZGVA 1Y63A 2DPYA 4D97A 2FOXA 4G4IA 1WRBA 4TRRA 1OJLA 3LQFA 3DG9A 3TKAA 3SC4A 5JNRA 3MTDA 2C9YA 4TZKA 1NVDA 4PGMA 1OOEA 4GPAA 2VBFA 4HI0E 5FNVB 1TOAA 3K32A 1PV2A 1UXIA 3H99A 3L7BA 4MGKR 4MR8B 4NCIA 5D7BA 1LPMA 1XCLA 5IKXA 1GKLA 3LUPA 2PQ6A 3I53A 4I4NA 4AO7A 4KX5A 4EHBA 3K6KA 5E6RB 2R6AA 1NI4B 2BBSA 4FHCA 3FVWA 4BQPA 1N6IA 2DKNA 5K3SA 1ZD2P 4QFMA 2YHIB 3EYAA 3ZZNA 1YGYA 3BTUA 4D41A 5LU9A 1DPGA 1C1HA 1SVLA 5FQNA 5A3JA 2W43A 1H3FA 4QJBA 3DP9A 4TOIA 2VAMA 3E05A 3GJSA 5AMXA 3IP7A 4KTVE 1CUBA 3DGFC 3AGQA 3IH5A 3TD9A 5JLJA 3WLSA 1G8SA 1L4UA 1AA6A 2R8EA 4CMGA 4YRPA 4S0ZA 3BFKA 3KCNA 2JLVA 2JATA 5DTQA 3EXHC 2FQYA 2ZRPA 4LNHA 1H66A 2G5GX 3A7EA 3ICOA 3UK2A 1SD1A 4RFVA 2IS1A 4N65A 3SZ3A 2GNAA 1N2BA 4OJTA 1PR5A 2QP9X 2RGYA 2ZSEA 4Z9YA 1YZGA 2VNSA 2XRZA 5JFGA 3U4MA 1NXVA 2FEXA 3TLKA 2Q49A 1NUSA 3GFSA 3H3JA 1PSZA 4R0VA 2WYVA 4TVKA 3TLGA 3VZSA 2JIPA 1E1RD 2OR3A 4ES6A 3W5VA 5IM4A 1BHSA 4C2TA 3IDFA 4HNAA 3DTTA 3B51X 3FMPB 4HC4A 1P3DA 1CUFA 2BE9A 2VLBA 4WGGA 1XD2B 1FPQA 3CUEF 5JH7B 5TGDA 3Q8XB 3UAZA 1OBVA 1N7JA 2PD4A 2JFBA 2VDPB 4FFMA 4X7RA 5GZ3A 1OD6A 3I5MA 4MWCA 3BH0A 4E51A 5DXFA 1LDEA 3MCWA 3VHRA 1G21A 2QN3A 5FUMA 1XMOB 5A4IS 3L8EA 3H9BA 1FFAA 3INGA 5DNEA 2JGKA 4R51A 3DLCA 2BMDA 2G28A 4NBRA 4ZVMA 1USKA 1XDSA 2IW1A 3ISVA 1A77A 3IJEB 3KYBA 3ZWKA 5GADl 1R9GA 1SK9A 2JGDA 2PRZA 3H6KA 4JASB 1YZYA 4NR0A 3TEFA 4YUWA 3M6XA 3NALA 4BASA 3W2GA 1IDOA 4BO1A 3HBMA 2F55A 5ICEA 1U0JA 1I2AA 4A0RA 3BQMB 1P60A 3L3BA 2HSJA 2JJQA 1JLSA 3UHJA 1Q14A 3W8RA 4BMPB 1WDKA 3QF7A 5E4TA 1N2CA 2ARKA 2IOYA 1H93A 3DOFA 5H68A 3UV7A 2ZJOA 1RKUA 1NVFA 3DTVD 1WHTB 4XGRA 4C30A 5JROA 3SVTA 3IP6A 3EZ7A 1Y8RA 2Z6AA 2EGUA 1A8PA 2JVKA 3W6ZA 4O2AB 2W2NA 3WKCA 2BEKA 1M0WA 2J6BA 2IU3A 5J2UB 3ANSA 3EAQA 3QE0A 2WD7A 1W36C 1Y8AA 3PFIA 4EMTA 4LJYA 1L7PA 2XDQA 1XSEA 3CKKA 3HCNA 1QVRA 4E1AA 2VWQA 4XCXA 3DAOA 5E4FA 2Q8QA 4NK4A 2A2ZA 3SPXA 3DA8A 4BECA 1NUQA 1T9BA 1TQ6A 1QSGA 1WB6A 3PX7A 1E4OA 4QYIA 4UZSA 3U0BA 3L7YA 3DNMA 2WM9B 1T0PA 1LQ2A 2E5WA 2FWPA 3NIBA 2QUKA 3ADDA 2APJA 1KR5A 2QTWB 2X6RA 2ZRFA 1AKYA 5EGSA 3RRYA 4HP8A 3U7FB 3AVOA 4BFUA 4X71A 3CW2A 3BZBA 1G98A 1MW9X 5ITSA 1SXJB 1A98A 3TW8B 4A16A 4NEHB 4MHSA 4KFCA 2R4UA 1XWWA 2E5LB 2KW5A 2NU9A 5P21A 3ZOKA 4CKBA 1Q0TA 3G5UA 4ND4A 4CM9D 4WNAA 5HFNA 2CHUA 2W42A 1DAIA 2C59A 4NYIR 1NR5A 4PPQA 4QUIA 5DW3A 3G2NA 2K87A 3IOCA 1YS7A 1RBMA 2R8PA 3LHIA 4MCIA 4N3BA 4GX2A 2HAEA 4QEKA 3OWHA 2WPNA 3P4XA 4AKGA 4ENUA 4DMFA 3EDQA 1VPTA 3LBIA 4EQZA 4XDHA 5CXSA 4DDHA 1FTGA 1SXIA 2PS0A 2YVUA 1NUTA 4CTKA 4Y9UA 2RB4A 1NDHA 4G2TA 3RC9A 1W59A 3PX3A 2D62A 3KYIB 2C4WA 3KQOA 1AUVA 5HKBA 1DP4A 2C5HA 4IJMA 3CCBA 5C34B 3NG1A 5FBHA 1RWKA 3OX1A 2IU4A 4LF7B 3KG2A 4C6TB 2A35A 2CHQA 1JPNA 2X40A 1TB4A 3RHTA 5JDIC 3WFJA 1A9ZA 2W6MA 1SNYA 1BEUB 1AVTA 4O29A 4Z4FA 2QLFA 4V39A 1V35A 5HVNA 2PKQO 4ZYZA 1CJMA 3EXIB 2L0XA 1E6LA 2WWFA 1UDAA 4IXWA 2VXBA 3HYCA 3EN0A 3PNQA 1P6UA 5K0BA 4DV0B 3V34A 4L75A 3DDSA 1QP4A 3THYA 4K1XA 2VDNB 3DE0X 4Q9JA 2GZ1A 3RQSA 4E6EA 2CJYA 1RP1A 3IJ5A 4QULA 5CDUA 2RD2A 1BHQ1 3ZDDA 2CE7A 2YFQA 5D85A 2BM8A 1QPZA 3HRIA 1S9HA 1A7KA 3TNJA 2IYNA 4OEHA 4D82A 1I7QB 2IPAB 5ESRA 2J3JA 2FOIA 3WYAA 3OJ0A 3ZCQA 1E3EA 4L4ZA 1Y0BA 2E1RA 1A2BA 1E89A 2WHQA 5BN3B 5KYKA 1DNPA 1E7SA 3EGEA 3ESQA 3Q2OA 4GZ6A 1FYDA 3BJZA 1W0KD 3R3VA 3C3XA 1MO5A 1JEAA 4PZEA 5E4YA 3OE4A 3GDWA 4AT1A 5JSFA 1EXDA 4N49A 5LXTA 4OMCA 3GPDG 2R8XA 4XD2A 3LVQE 1TD1A 4ZRMA 4CTNA 2QZ9A 3U5TA 1FZQA 4MS1B 1QQ7A 4BO8A 2ANCA 4KQ2A 3ZPXA 7GPBA 3ZDBA 4FMBB 5G40A 2IZ1A 4RM2A 4NBKA 2BTOA 2X5NA 1C7IA 2VTKA 2GKSA 2ZWVA 1Y9EA 3C87A 5SYAA 5I7EA 3T3IA 3F97A 3VBEA 4AMUA 3IIKA 2H0RA 1IHXA 2EJVA 5EKXA 4F8YA 3OM1A 2QTVB 5HTOA 1YS2X 2V7EA 3LQ1A 4MUEA 3O95A 5FOSA 1KQNA 3UWOA 3WDMA 1L8AA 5EE3A 4QTZA 4DM7A 1D6NA 4Y6OA 4YRFA 4RZHA 5BVHA 4OP1A 2JI4A 2R84A 2A1TS 3MJVA 3OPYB 3E8SA 2QMOA 4ND5A 2EFCB 1H2AS 1SQ5A 1UJ6A 3MJTA 3ND8A 1GTVA 3OF3A 1ZNQO 3R3SA 1RMYA 4MTCA 1TW3A 4H4EA 4Q37A 4IRMA 3WHIA 4NYMQ 2GM5A 5BVGA 2IODA 4FINA 4KVFA 2C9CA 2V5AA 4TXJA 4JEHA 1SN7A 2ODQA 2WHPB 1LJ8A 1Z7BA 1AKWA 2FW9A 1JR4A 3Q12A 4RCVA 2HSWA 3DZBA 3L4BC 5DOVA 1ZISA 2HADA 2Q3BA 4X7PA 4Z3OA 3ICWA 2D0IA 4K87A 3AUSA 3QH4A 4Y2HA 4DZZA 1P4JA 1VDMA 3K0BA 3AFGA 1WW8A 4INAA 4RV5A 1WETA 1CJTC 1TFRA 2Q8NA 3ILSA 4CHTA 5HJ7A 4KNWA 2XXJA 5FBQB 2D5BA 1EINA 4B3IA 2UVPA 3SZUA 3SEQA 4G5YA 4QHYA 5FWDA 4QSMA 5KCMA 4LC1A 4RHTA 3ICCA 4AZWA 1ESZA 3PPIA 2O2ZA 5CLIA 1R88A 3M2PA 1M8FA 3PL5A 3QEKA 5K3EA 1JIKA 5IAJA 4AZ3B 3TTWA 3M2TA 2ZJ0A 1GPH1 1EXNA 1MCZA 1T3ZA 3BXHA 3MD9A 3GCZA 4JN6B 5GP1A 1E1LA 1I3MA 2ZSKA 3THRA 4FYJA 4MA0A 4BXOA 4KBFA 1EFRA 3BMNB 4RVHA 2BW0A 3K53A 1HZZA 3UMGA 5LYJF 1N2XA 3PUYA 4N0MA 4C29A 1IXKA 3KL4A 2A0KA 1W7AA 2J6HA 1C9YA 3BC1A 5ELMA 3WDSA 3JQ7A 1VJ0A 1EUCA 5L7TA 4AECA 1A5SB 4H4DA 3GMDA 4KJZA 1LQTA 1QO0A 3HFGA 4ZVRA 4P33A 1FTSA 1UBMS 3B9PA 1FQWA 1BHO1 3NDBB 1LBEA 1XVLA 3P2OA 6ABPA 1MVOA 1UPCA 1XNRB 1X8JA 3D1JA 3L8DA 5I7OA 1QHSA 1E5TA 1MUUA 2A5LA 2OGWA 2VH2A 1QS0A 3Q1KA 3QNWA 4P4NA 4FN5A 3KE9A 4XKJA 1RRVA 2OFPA 1ULUA 1X7YA 4IM7A 2BHRA 3RG8A 1W9HA 2GYYA 2XVAA 4NZNA 3FHLA 3MBKA 3KKLA 2E1PA 5ALLA 4EJSC 4RL6A 1O54A 1C9EA 4I99A 1V4NA 5MN4A 3DZKA 1Z4LA 4EO7A 1P77A 1B23P 2AK2A 2WTNA 4QFDA 2BRUC 4NJOA 4PLCA 5I9MA 3SJBA 4K6HA 3HXPA 3EBLA 3EGDA 4KU4A 2WVHA 3FTPA 1I3OA 4M9ZA 4WZBE 1PZHA 1BMTA 3UW3A 5JAPA 5FPKA 4ROTA 1V3QE 4J0GA 4LI0A 4U8GA 1TQ2A 3MUOA 3FTNA 4BQIA 4GM0A 2PBLA 3W79A 3DLTA 2NNLD 3WZMA 4MDYA 2ZBRA 2B34A 4L3OA 4KLAA 4N03A 5JW6A 3A9UA 4JC4A 1USGA 2NZYA 2P40A 2DKOA 2Y0EA 2XBUA 2X0DA 5T41A 1D03A 3IR7A 4TSRA 1QK4A 2QVCA 3WBFA 4AUEA 5F4ZA 3N2GA 3FNRA 1VPWA 2NUBA 2YYAA 5FO0A 1KH3A 1WHSA 1ZIOA 3D5QA 2FUKA 2PGOA 1NBEA 2E2WA 2IE0A 1VL2A 4CF6A 4R3UC 3H0EA 3LPCA 4YFVA 7MDHA 3LC0A 5DASA 3N07A 4J03A 1P81A 3ZZ0A 1JL3A 4YO7A 1XTPA 3GB9A 4CEIB 2LVBA 3FZYA 3OE7A 1I2BA 3QFHA 3T52A 2QM0A 4OI0A 5FHRA 3ZCVA 2D5CA 3DCJA 3LFTA 1E2DA 1FTYA 1ID1A 1X7XA 2I6XA 2WKWA 3MMNA 4L4XA 4UHDA 4RH1A 1GPNA 1K3TA 2JLBA 4GZLA 5FTJA 3REGA 3TJZA 1REQB 4ZCTA 1F06A 3B2QA 5HR5A 3JSXA 1TZCA 1TEVA 2YHAA 4GRIA 3S2UA 1Q16A 1JR3A 2D2IA 2G1PA 4MQEA 3UMYA 1C3LA 2BKVA 3HDJA 3KP1A 4BNWA 4N9WA 3WXMA 1UWLA 1J7KA 1IXRC 2CNLA 3KLOA 2GYVA 3U4DA 2FHSA 1C3XA 2XCIA 5TQ0B 3IOMA 1NUUA 1YBAA 1NF2A 5AM5A 1GDTA 3BE4A 4O33A 5K2MA 1TK3A 4JC5A 1ZUIA 4B3BA 2P2ZA 2HW8A 1OT3A 1Q2UA 4RVCA 2YWDA 1YGPA 2EZ4A 1W4AA 3GLGE 1F4PA 2WG1A 3NVMB 2QQ5A 3GA5A 3NS7A 1W2HA 4G2NA 5KDLA 4CDRA 4ETMA 5LNK1 3OZGA 2VQFB 2CSXA 3W7AA 4BB5A 3TVYA 1QNLA 3SD7A 1O0SA 3SKYA 1RJFA 3HDTA 3A1DA 1EI9A 3PHGA 1N5MA 4N41A 5F12A 5FL7D 2Q6IA 2F1JA 4KRXA 3MHPA 3GYGA 4LXTA 4AKHA 3PPXA 4DYHA 5SYNA 1VI2A 2XCSB 3UGQA 2ERYA 2G7MC 5ITVA 1ORWA 2ES4A 1VJ5A 3TDMA 2O3TA 4H3HB 4RY2A 1PNRA 4E22A 3A3PA 1XOIA 4AW9A 2B4RO 1XNJA 3CB2A 3EIQA 1TYAE 3CYFA 4OQYA 3VXKA 4YLEA 1GAEO 4NENB 1JUDA 1GL7A 3ZH2A 1KYTA 3IMEA 1PVVA 1N9ZA 4MP8A 5HZMA 2IHTA 2HFJA 4RKEA 5KNLA 4KWEA 2OHOA 3FYDA 1D7OA 4FMCF 4QXPA 4ZT5A 5H0IA 1BE1A 1NN1A 5B1EA 1VKJA 2EFDB 3MEQA 4HEA6 3P94A 2Q1UA 4C04A 4J3FA 4PQYA 1SJ9A 1M7GA 4R8SA 5JATA 1P4SA 2XE7A 1RJ9A 3WRVA 2O7SA 3BE8A 4Z7QB 5KINB 4WKCA 2IXBA 1C4WA 4K40A 2AN3A 2XB8A 2P6MA 5BT9A 2NO6A 4KIFA 4RABA 4EB0A 4P3PA 2REQA 3GJ8A 3UWKA 1JXMA 3PFKA 3DZJA 3FDFA 3K96A 4IDCA 2DSNA 1F2VA 2FPUA 1AQYA 4HGPA 3BE6A 3E61A 2NIPA 3E5HA 2EFEB 4UREA 4WJZA 1PJZA 3HEAA 4X1YB 3T7DA 3HA3A 2XYHA 1ECBA 4L0CA 3RYHA 1TX4B 4M1SA 4LDQA 1CY1A 2QKYA 4J9UE 2M98A 4RO0A 1QTRA 1KIFA 4HWTA 4WESA 3BWEA 4ZQBA 1XAGA 1NU6A 3EXHB 3IBSA 1TM1E 2HSDA 4DIUA 4FQ7A 1XCGB 3NH9A 1Q0HA 1OXVA 2VFAA 3A3OA 3TIFA 4CIXA 1ICIA 4IIUA 1H65A 4UDYX 2EJCA 2V58A 3S40A 1RNLA 2IFTA 3RARA 5JXHA 2X5OA 4FC6A 5IJAA 4RK6A 5K8TA 2XNDD 1YE3A 3HDHA 2FWRA 2VZEA 3FNQA 4D81A 2H16A 1WP4A 1T8UA 3ENQA 1SB9A 1OAOC 2RAUA 4BV2A 3QFTA 1DX4A 2YXEA 5AVOA 1LFDB 1BA3A 4E2YA 4KH0A 1KNXA 2Z56A 2ERXA 3P9ZA 3IEMA 3CRVA 4DT1B 4LISA 4MRSA 2ZI5A 1JEQA 2GPAA 2ZBDA 3F71A 4P80A 4RYLA 2YMQA 3EVAA 1Z0UA 3DZHA 1NOJA 3T7EA 1RZRD 2P2CA 1DG1G 4QFCA 3HL4A 1IY0A 1WCYA 3O31A 4L5BA 3VHXA 1JKJA 3BMOB 3C8DA 2K7FA 3T1NA 2QEQA 2XZLA 1IWPB 3JYHA 4QWWA 3O9VA 1ZCFA 1PU2A 1A4UA 2WMYA 3TOSA 4KGZA 6REQB 4GOMD 1SCNE 1Q0LA 1M34E 3LO8A 4U5XA 1Z6AA 2VT3A 3U49A 2C7VA 2PKYX 3B36A 1FS5A 1T3GA 1T9CA 3KAPA 5LZ5A 1LWNA 2ZBGA 2ZS8A 4QOSA 1RMTA 3PB3A 3O73A 4LMRA 4KIUA 5I48A 4KWIA 1ZI6A 2GK4A 3LFUA 1Q1AA 3S27A 1VPVA 3RU9A 1U0TA 2WU3A 1VCNA 3IBCA 2QMQA 4YAKA 4QD3A 3LQ4A 3G0IA 5DIZA 1W36B 4HPJB 3DFZA 3VR5H 4BLPA 3RSQA 5FTLA 5FFMA 4NVRA 5BUZA 5DB4A 1IHPA 4NU8X 1NW7A 4W7IA 2FYTA 1JIUA 1KI6A 4EHJA 3IQFA 3KR9A 1GTZA 3AXTA 3ESYA 3QX7A 4JBHA 4KAFA 4FSHA 2JLRA 1EK0A 2QD3A 1TK2A 1VQ1A 5CLHA 2PJDA 3WNVA 3NVKI 3LHDA 5FCDA 3SQXA 4XYBA 4OLAA 1CVLA 4JWTA 1XZLA 1XKXA 3BCSA 2X0FA 1B7GO 4C03A 3PNPA 4FFNA 5IAGA 5KJ6A 3A0UA 5FUVA 4GLJA 2II6A 3QLVC 3AF1A 1C3EA 1E66A 2EV9A 4P1ZA 4BMZA 2YWEA 4UNRA 1BIFA 2FPRA 4O2RA 4GSKA 5AVQA 3MJRA 4OQ4A 3S7TA 4OXQA 2FW1A 2UXBB 3W7VA 3K5WA 4AVYA 3RVSA 2I1WA 2IEZA 3ONFA 4W1SA 4DVGA 3WB2A 3TZCA 2NYVA 1A7AA 1V7CA 3HS3A 4EABA 4H35A 4A6DA 3HWWA 4MKGA 2GB4A 1JHMA 1F3OA 1HEUA 1MO2A 2O07A 2DUJA 1EFPB 3DUFA 3OH8A 4LHSA 4ZXPA 1FX1A 2ZCUA 2DFKB 3NASA 3N8IA 4FDAA 3UJAA 4IVPA 5FHQA 3N70A 4BE9A 3ONDA 2O4CA 2RK4A 5KTNA 3O4RA 3C7AA 3V4PB 2GNPA 7MHTA 1TYBE 3QVUA 2YWFA 1NIJA 2G63A 3IS3A 3QUCA 8MHTA 1O97D 1X70A 1W1WA 3FYUA 5A3QA 4EPWA 4B3GA 2EIXA 2HPHA 3OTOB 3IAFA 1PNTA 4HGZA 3BSWA 5EHXA 5IKMA 3NFYA 1ETUA 4WFIA 4ZQEA 3NOXA 3H05A 2IYRA 2MYTA 2QX4A 1IEWA 1SGWA 2D2XA 3K9HA 4P7GA 1GP2A 4X45A 4MVWA 5C5DA 3IKTA 3T06B 3ZVKA 3WX0A 2G76A 2VJYA 4L8GA 4TKZA 4YK7A 4ER6A 3TGLA 1KZHA 1EHCA 4YYEA 2UAGA 1P4GA 4ER3A 4Y1RB 4HYQA 1UC9A 2L17A 4MAMA 5H3HA 1DTWA 1XXHB 2OBYA 1J5XA 2Q3DA 2QRHA 3LX4A 1M0SA 1AB6A 2GVZC 3G5AA 3CR7A 3LFHA 3QPVA 5GPBA 2Q6VA 2IDKA 4LJ4A 2PG3A 1G5QA 4GOLD 2XDYA 4A2PA 4HGOA 3VISA 1P2GA 4LJLA 4NXMB 1VG8A 3FNFA 5DGXA 2F59A 2I71A 1PL8A 5AM3A 1AK9A 1N6KA 1PSDA 1WPXA 3MT0A 4E08A 4Z4GA 1CEYA 3ZE8A 3ITEA 5CJ2A 3NWOA 5IZ4A 3I8OA 4AXBA 4YHBA 1Z3CA 3L7NA 5JZOA 2LBPA 1I3NA 1YC5A 1OXMA 8GPBA 3V2GA 3MWDA 1P1RA 1QQ6A 2Z5VA 2WKQA 4UVEA 1YZFA 5AOCA 4JYMA 3KQPA 4XLZA 1IK6A 4MIEA 5B1SA 3T54A 4IVNA 3PEVA 5A9SB 1GNLA 1FXWF 1QK5A 2MU1A 4BNFA 4FCTA 4EG3A 4Q19A 1YBHA 3H8WA 4DIKA 5A6SA 4LWPA 5K05A 1VXOA 5SZJA 1PBNA 1F8XA 4MQFB 5AW7A 5ARCA 2OCKA 2JB9A 3H4TA 3FCXA 2EFJA 4KYUA 5DNWA 4HUQA 3BGOS 5HNKA 1UBCA 2WFMA 2R86A 1RAAA 4WL0A 4K88A 3SHOA 4HLUA 1E2MA 2J3IA 4O59O 1V1RA 3LXRA 2QSUA 1JDBC 5I6DA 4DRXB 2IYAA 1R0BA 2Q2QA 1WB9A 2VNHA 5AHXA 5CCBA 1Y4SA 3KWFA 1YASA 1XD8A 2BJWA 1YI1A 3ICPA 4PVDA 1K3FA 3UATA 4C0QC 4M9QA 2XUGA 4EFDA 1P6XA 1C0KA 1SBCA 1VTKA 2XNKA 2SCUB 5SYMA 1MABB 2YMPA 1G4HA 3NYIA 2HV8A 1JJ7A 3V9PA 3OMLA 2WG2A 4B8YA 2CBXA 2HWWA 4I4TF 3KXPA 3QF4B 3R7WA 4HY3A 2GEVA 4RWEA 1E61A 2AQIA 2C83A 4EHNA 4YCNA 4F6LA 1BVHA 1HXHA 4EUEA 3AF4A 2FZEA 4DANA 1EPUA 1DV2A 2KWIA 4A91A 1TJ3A 4MJXA 2HI0A 1D9XA 2Y2UA 4C7VA 3LUBA 4G01B 1DCFA 1UBNA 2ZI3A 3QXCA 4RIEA 2VSXA 2XY4A 1GG8A 3AZQA 3PC3A 2Q7XA 3DE5X 4R1PA 2H4ZA 2ZYHA 3TIVA 4DQDA 2FG5A 4DEVA 3BVPA 3D8RA 4HAIA 1UXGA 3QBDA 4PZPA 4YS6A 5ALGA 3EIWA 1MG5A 1T2FA 2E85A 3NBAA 4LRUA 1RTTA 3HDYA 3ANXA 3MJCA 4HJXA 3VPAA 1R5BA 1I4LD 1D1SA 2GCIA 3ETLA 2J0UA 3ZHTA 1Q91A 5NULA 3IELA 4EP1A 3O1IC 3WVNA 4JT2A 2E4YA 3ILHA 4IOKA 4X00A 5LP6C 1GA6A 3QRWA 2TMDA 1XFAA 3PNMA 2YN4A 3VAZA 1X1CA 5JS7A 4N8DA 3G1WA 3A14A 2NXWA 4P08A 2I03A 3N2KA 5JS8A 1HURA 1UWVA 4C0LA 4E2XA 1RACA 3U37A 4Q9AA 4NU0A 4TS4A 1KZ1A 4TLAA 3O1LA 3ZGLA 2E4VA 4LSMA 2QUZA 4WKPA 4EJSB 2VQEB 3T12A 1K6EA 4BVEA 2YTZA 4IIBA 4WZAE 3I0ZA 2XKJE 2VBCA 2VCYA 3HJCA 2AYYA 2B4TO 2O2XA 3FFAA 4L8WB 3RNOA 3P1JA 2XT9A 2FE4A 3IMKA 1WSWA 1R9JA 2BUAA 5DWDA 3Q3IA 4G8CA 4L8FA 1P2BA 4B33A 3IMGA 4MYTA 3U3KA 3O83A 4IMRA 3O8RA 1FMFA 3LDGA 1RCFA 1ZP6A 3RT1A 2BH2A 2ST1A 1EVJA 4GSYA 3GLFE 3RHZA 1XTBA 3LDHA 4IWNA 5A4DA 1MKYA 1JG4A 2XUZA 3NRBA 4K9OA 3TSAA 4YALA 2VJQA 3QE3A 4AL4A 1Z5OA 4G8JA 2OHFA 2AF4C 2Q28A 2FZGA 4B45A 1PQYA 1QPBA 4YMSA 1U2GC 1M5TA 3OA2A 5JD6A 4E31A 3TCKA 5ICCA 3JWIA 1I7SB 3H1AA 3KVYA 3ZXXA 1FOEB 3G49A 2PU7A 3S3TA 2GX6A 4R8VA 5FOVA 1UJ5A 1QE0A 2SKDA 3BGVA 1EQ2A 3ZCRA 5GZ1A 1EUQA 2J9GA 3DLAA 3BMQB 3LUFA 1NBMA 4JXJA 3WY9A 3G9TA 3SC6A 1PYGA 4FNMA 2IHVA 1WD7A 3AVTA 4TYMA 4D74A 2G4VA 1N5OX 4DZTA 3H8SA 4N3NA 1IL0A 1BS1A 2REXB 4ITVA 1NP6A 3USZA 2Q99A 5BW6B 1IOZA 2XOXA 1Y3AA 3KT8A 1O8BA 4K1LA 5GINE 2AFIE 3UB4A 4LNAA 3OQIB 3ITNA 1E3TA 1RWNA 2VS1A 3ZJTA 3ZWQA 4ZIRA 1H8HD 1NONA 1M6YA 2I6TA 5LYJA 1QJCA 4JS0A 3I2KA 1PD1A 4BQFA 1N57A 3IXLA 1RYEA 3L4KA 1G66A 2FGJA 4PQGA 1X8KA 5COQA 1FMTA 1UK9A 1W5SA 3K35A 2AG5A 4H15A 1QP8A 2O8EB 1J9EA 3KR2A 2CVQA 4PSDA 4X92A 1OZFA 3F9RA 3ZK8A 3WLFA 3D6AA 4Z9XA 4ARCA 2Y68A 4ZVUA 4CMIB 5IYZB 3RTGA 2GILA 3TBKA 1EA5A 1OHHA 2DJIA 1ZK3A 1IONA 2GBCA 3GGDA 1NAHA 4I6GA 4CLXA 5FTKA 4CCWA 1SEVA 4ZMSA 1PT5A 3VPSA 2IEYA 4JEMA 2V3VA 2CLCX 4B32A 1FFXA 5D6OA 3T1YB 4HFMA 3AFMA 2Q3MA 3WC4A 5CLQA 1Q3KA 3CX3A 1BVUA 1QH8B 2BI7A 4R9NA 5CB6A 2XTJA 1ZGAA 2B92A 4O4LF 5FBRB 1JZTA 3Q8LA 1Z4QA 2VPWA 3SIWA 3NEAA 1K86A 2QM8A 2J9FB 4C1BA 3A1VA 3G7SA 4IKPA 4EW6A 2AOWA 4A8TA 3DXZA 3ECSA 4H60A 3KLPX 4KLCA 1S8NA 3AMVA 3EFBA 2PZAA 2BFBA 5HJ2A 2PUAA 4EUHA 3TS1A 1W0JD 3UEOA 4P58A 3MVEA 1JU9A 3E03A 4UHFA 3ZI7A 2YN2A 3IALA 3I9V1 3OT5A 4RAOA 4EVRA 1IQRA 2BGKA 1E4YA 4KLRA 1IJFA 2ACVA 3JARB 3S6JA 1OILA 3E15A 3PJDA 5ILGA 1I33A 3VRHA 5EHGA 2W6NA 1AGYA 1NC1A 1NW4A 3CONA 4YMVA 2E4ZA 1Z8NA 3STYA 3KZMA 4TMTA 4TMXA 3G8YA 1SG6A 4HX2A 3MS2A 3TDKA 2A5JA 4KE6A 1C8VB 3G82C 2I3ZA 4M8SA 4ZEOA 5HHTA 2KYRA 3MWFA 1F7UA 4N5LA 4PEVA 2JGLA 2I54A 4H7HA 2BDEA 1JE0A 2ZOSA 1CRQA 4KTTE 3ENNA 2Q41A 1YKFA 2XMBA 4PRYA 4W8GA 1QHYA 2CK3A 3JQAB 2F64A 2BLNA 3K70D 4O08A 1NI3A 4BNIA 4LJRA 4HUJA 4I9HA 4YRBA 1E9RA 3B85A 4H16A 5JSZA 1OLSA 3C3KA 2P8SA 4RFSA 4GLFA 4L02A 3WNBA 3CWCA 1C3JA 3KUUA 1NG9A 3OPMA 2FETA 4OGWA 1OX4A 1J97A 1LBTA 1T4GA 3NAZA 4MNTA 2FPMA 3EVNA 4HGNA 4QICA 1JJBA 1K7CA 5CNJA 4BMVA 2E7ZA 1TAQA 4QXRA 2XYVA 3B6MA 1QZXA 4DYVA 4LY6A 2B6HA 4V0KA 2ZXEA 3RHSA 3VHLB 1BFKA 1PP4A 1YB6A 1KSHA 4OFBA 1R6TA 3I5AA 2FDCA 1MXHA 5LBIA 4GWGA 2O19A 2QD5A 5KVAA 4M9UA 2JJ2A 1F5NA 2BT4A 3V46A 1MX9A 3FOFC 1HG1A 3N2ZB 3OZXA 2PZJA 1ZM7A 3NT4A 4KO8A 5A4MS 2LW7A 1KWKA 4ZODA 1BMQA 1CHNA 4JJIA 4OGFA 5JY1A 1FFHA 4WCVA 5J5AA 3LGAA 1JN0A 5KVCA 1EQUA 3ZBTA 4CZ2A 5A4JA 1KJNA 4GPEA 4D99A 2JD2A 4DCMA 3GRCA 1HL3A 1QBKC 3KJGA 1ZD3A 2C8JA 2FXIA 4YDSA 4EYGA 1VIAA 3UFXA 3JD2A 3DAHA 4JAVC 3RS0A 2Z3WA 4I1UA 2MR5A 2ZSDA 2IITA 1TZKA 1R10A 1V9CA 2OMKA 3L0BA 2BFFA 1CQJA 4KUGA 4IIFA 4Z9AA 4O1HA 1QQTA 2TMYA 5FB3A 4DXHA 1KZ9A 1BVRA 3DQPA 1NQWA 4H2DA 4HLQB 4BTEA 1RLMA 1TVKA 4INJA 4LC0A 2WIAA 3C6ZA 1E18A 3Q3HA 1SC1A 4ZO9A 2JIZA 2JEYA 3BICA 4HYYA 4LZWA 1U3TA 3HI4A 1NNI1 1ORIA 1JKMA 1PDOA 3K6RA 4ZEXA 3IQDB 1I80A 3PHCA 3T7IA 3ZZMA 1JGTA 1RWWA 1BDBA 1X1BA 3MT9A 4QDUA 3WQSB 4C0JA 2OAEA 1J1UA 2FA9A 2W6ZA 1MA0A 3DXXA 4L08A 3ZHZA 3N7TA 5CVUA 1QOPB 1JDTA 3ETJA 3TE7A 1FJHA 3WKAA 4HSGA 4MJLA 4F86A 2Z4TA 4UEJA 3GLFB 2LZ0A 2WYWA 3BIOA 5J43A 4U2GA 3B53X 3JQ9A 2F1IA 4NG4A 1R4MA 5DYGA 2AN1A 1NMYA 5JSQA 3NRCA 5AKIA 3EEQA 2W70A 5B1IA 5E9WA 1ZU4A 2QQFA 2H7VA 3Q9LA 1W2WB 4JKYA 4KN5A 5C8DA 1C1DA 3AJRA 3BD6A 2IU6A 2DR0A 4OHOA 4C0WA 4DRYA 1XJWA 1E77A 1G1AA 1KEEB 1EZ4A 3OPYI 4UOZA 2P27A 3E1KA 4QLBA 1XDZA 3DXFA 5BRAA 2Q8PA 4Z86A 3CLHA 3OC0A 1CRLA 1YFZA 1PO7A 3A6KA 1YKSA 2QG4A 1NP3A 1DRVA 2ZITA 3FTDA 2WDPA 1LEHA 4RSHA 4YRMA 2PT6A 2ZRBA 2NLOA 5ED4A 3MMSA 2QS9A 4PSVA 2HA4A 3AKCA 2ZJ4A 4NCHA 1J8VA 1TUBA 1RRMA 1AO0A 1SBIA 4MAAA 1YQWA 2C9MA 5TXGA 1QFMA 1ELOA 3VUEA 2RHHA 4L0DA 3T7TA 1MD9A 3WR5A 5HQTA 2CUKA 4QDJA 1P0MA 2MSWA 4TLMB 5BXQC 1GU7A 1S2OA 4GR5A 3MFYA 2ZRJA 1JG6A 1ZD4A 4ZZ2A 3DMRA 5IH7A 4S1WA 1M74A 3OOYA 3RFTA 2E4XA 4O0MA 2IBSA 2B8NA 4BAUA 4TQ9A 4II2A 2CE2X 3HHEA 2B7CA 1E63A 4EW2A 1LDNA 1VZ3A 3NYWA 4C7JA 1QGDA 2EYUA 4CF3A 5C81A 2GSDA 2V59A 4F97A 3ZJYA 3FGNA 5B53A 4Q4LA 2YBDA 2IYUA 3LLSA 3SXJA 4TM7A 2GD2A 3QX3A 2DQKA 1Z4MA 3MELA 4LBYA 4Z5XA 3L7LA 2CDAA 3IR5A 4XQCA 2ISQA 3LWZA 3FCSB 3JQFA 1BZYA 3HA7A 1LBHA 4XOUA 4BEWA 5HWSA 4RLQA 5FBLB 4OUKX 4LOIA 4O8CA 2A9KA 3T1TA 2A78A 3MIIA 3U39A 2H4HA 2H5IA 2J32A 4HH3C 3LOPA 2RHCA 1UEIA 1Z25A 3DM5A 1DDGA 2OHIA 4BZPA 2JJ1A 4PC6A 4UE2A 3D59A 2HBZA 2IPNA 2XYQA 2E89A 2L42A 3LPMA 3MPUA 1JA0A 1MB3A 1L4HA 1XTIA 3EDRA 3QXGA 2IOFK 3NHPA 4Y6LA 3UT5B 2JAPA 1KSFX 3O4HA 3CEHA 4UVIA 2CLSA 4MLDA 1QQAA 1I1HA 1GAXA 1Z73A 4UVDA 1O94C 4IIXA 4YO8A 4OBXA 3KEFA 1ZUNA 4UQLA 3C1TA 4FGJA 4ZI7B 3MINA 3G5LA 1RHUA 4RVDA 1TLTA 3IUPA 4JDPA 4P5EA 3GEHA 4P8RA 3ZIUA 4BFTA 1ZK4A 4QM6A 4QDKA 1JDBB 2O8DB 1GGVA 2EKLA 3S1LA 3EEOA 1XRMA 2WHYA 1Z2AA 4ZOLF 1IZYA 1SZCA 1CEQA 4CF7A 1UOQA 2QIPA 5KQPA 5DEOA 3D6VA 1HQKA 4Q02A 5CA1F 4V1CA 4OL9A 1Z36A 3DD1A 4BC1A 3GGOA 1EFDN 3ELWA 4EECA 3THXA 1S2NA 3P9QA 4QUBA 4ZOBA 2FY8A 4BHTA 2R85A 3R7BA 3U5ZB 1VE1A 1Z29A 2D7JA 2G9RA 2PLFA 4DDUA 1DC5A 3TRFA 4RHFA 3E4DA 1P2DA 1Q1ZA 2WT9A 3OSZA 3CE6A 1BQ3A 2HQ1A 1HBJA 2P2LA 3DEAA 3N6RA 1QCYA 3P4UA 4ARBA 4YMLA 5I4KA 4G86A 1EDEA 1AUPA 3HDVA 5GOTA 5BN4B 3FUWA 3QWAA 2Q0XA 3DHVA 1VYUA 4FYIA 1NXOA 3RAPR 3VV2A 1QR2A 5KQLA 3B12A 2BPOA 2V4UA 1L4GA 2WWRA 3OA0A 2J59A 2AWNA 4G85A 5HFAA 5K3BA 3SAJA 2PBFA 3AVXA 4NBVA 3KEGA 1BX3A 2FMIA 2BIFA 4ESEA 3CN9A 4JEIA 5J4LA 3N0XA 1HTWA 1XTRA 2X2EA 3U56A 2IZ0A 3TFWA 3G2OA 3OZUA 3CW8X 5AKKA 5THQA 2J3QA 3H86A 2Y1XA 5J2TA 5LP6B 1NYQA 1U7WA 1VP3A 3PU6A 3EX7C 4HQRA 5TC4A 2NP6A 4U2BA 2NXEA 1PR2A 4DR7B 4D6XA 1G18A 5DHSA 1T5DX 2XCOA 2XUOA 3GFTA 1J1ZA 3GRYA 1F2TB 4RPCA 4CQMD 1XQ1A 3OQJA 1GLNA 5IJ9B 4WLFA 5DOZA 4JLJA 2HLHA 3QI2A 4PLZA 5DN6D 1A3CA 3DE1X 5DNYB 3KFLA 3OIWA 2VEOA 4OM7A 1RRFA 3B9RA 2BKUA 1KC1A 2MSEB 2XODA 4O3FA 2FOLA 2R66A 3CT6A 3M5PA 4O4HF 1IQ0A 4F2GA 1QVZA 4R3NA 4A6PA 2C1XA 3UMMA 1O9GA 4LGVA 3SBXA 1CC1S 2ENUA 5KCZA 2QAGC 5ES3A 3VZDA 2QAIA 3RS7A 1TU3A 5CJJA 4XZ3A 3UCXA 1F0NA 1V48A 4YJGB 5JAQA 3FIJA 3GYBA 3PRJA 4UUMA 5LQNA 1TCBA 2HD4A 2HJGA 3D8HA 3G2IA 3TVTA 4AQDA 5HGXA 1EFKA 2PL9A 3CLRD 3BPSA 1OFHA 4PANA 1R64A 4ZZ1A 1H4TA 4MYCA 1GZ4A 4ZC8A 1A69A 4D3FA 1V6AA 1IRXA 2ACWA 1CR0A 3G3EA 5IX8A 4D80A 5KO2A 4D3XA 1N34B 3W78A 1EP3B 3SJUA 5A5DA 1UF9A 2BE7A 4E07A 2IELA 3TXAA 1W88B 2RJOA 1TI7A 4IPTA 4CIAA 1N8SA 4MQ5A 2MSKA 3K05A 3QXHA 5AXBA 5K4AA 4AF8A 2V7QD 1CX9B 1IK4A 1K0FA 1NX9A 1MDFA 1TPYA 4OFXA 1X0XA 4R1LA 4DCUA 5BT8A 1JNXX 2WAOA 2QTHA 1TPZA 2W2XA 4OB7A 2W8BA 3FKQA 3RIEA 3W2TA 1HLPA 1E5VA 3DV0A 3RU3A 1SOWA 1QHFA 3C6QA 3KX2A 3ZGZA 3RV4A 3RTEA 1CNEA 3TLGB 3OBIA 1N3BA 1RMQA 5NLLA 4KQIA 3RR2A 3TLAA 3TZEA 3RUAA 2AZTA 2P5TB 5TS2A 2ZYGA 3AIMA 5EJ2A 5JECA 2PY6A 3NWBA 1BW9A 3Q3JB 4Z0HO 1HMPA 3QEOA 2BTQA 2HPZA 4O4JF 1YOVA 3O1JC 2OQRA 1EM8B 1P5RA 1PT8A 2OCAA 2P4HX 1S8FA 1QFSA 4W5HA 5FFFA 4ENVA 5DCUA 3OOWA 3N59A 5A2QA 3M3DA 3E81A 3TTYA 4KQCA 1ZOSA 4WY2A 2AA3A 2RGCA 4LJ9A 2QIOA 4GWLA 4Q3LA 3RC7A 4BGEA 5HKKD 1QVVA 1VMAA 1DHRA 3IEXA 1DT3A 1E2GA 3G2PA 4JYBA 4O5OA 3U3DA 3V8NA 1ZM9A 3BWXA 4WDQA 5FUQA 4FGLA 1JFVA 4BCCA 1LPNA 2JGDB 1Q17A 3HR8A 1HE3A 3MTGA 3OEHD 4FFSA 2X0EA 4OH7A 5AXDA 4DARA 4XRGA 2B1QA 1H5QA 1ZLYA 2IUFA 4NH4A 3KWJA 2E6KA 3LVFO 1JDUA 2PX4A 2R62A 3BWMA 4CF5A 4KZPA 1JG3A 1V9LA 2VR1A 3IT0A 3FOEC 1CKEA 1NYLA 1O6GA 1N2CB 1PX0A 2WTUA 1VHTA 1S2LA 1UMDA 1VL8A 4YQZA 4CT4B 1E6EA 4ZYLA 2FFHA 2VTBA 1SUCA 2XQVA 3L04A 4Y2GA 2I62A 3FWKA 1Y8RB 3GC6A 3HKCA 5K2OA 1ADCA 3TW0A 3O74A 5CGZA 2FPPA 2X15A 4XTCS 1J1IA 2O5VA 4QOIA 2I78A 4G0OA 1LPAB 1X94A 4LCEA 3HM9A 2V7TA 1U11A 2AJBA 5BO5A 2XDQB 1U7ZA 3LY9A 4YGXB 2CNWA 1OREA 3AM5A 1XVVA 3B1ZA 4PLHA 4E5KA 1UZLA 1O95D 4YWHA 3SZMA 4F5ZA 1W73A 3DFFA 3HU2A 3VMMA 2JAQA 3GOQA 1Q2XA 1XF9A 3F4LA 3DVLA 4LQDA 3LL7A 4JHLA 1VZ2A 2OT3B 3Q7TA 3LK7A 3MRSA 4L7QA 1MFPA 1LJUA 2GAIA 2AKAB 3QJ5A 1SCUB 1Z2PX 1ZXXA 1OV4A 1GHTA 4HPXB 3RYFB 5KNBH 1VKOA 3AUFA 3KR0A 3IYLW 4KYVA 1D2RA 3CZCA 1R7RA 4EUKA 4NARA 1TAGA 2BUCA 4CU5A 1LDMA 2ZB4A 3TKYA 4Q15A 4LWZA 1SEPA 1Q74A 1WW3A 4FM9A 2XYRA 3G9ZA 1G6KA 1T9GR 1PZMA 2FJ0A 3NUGA 3JD0A 4BMCA 1TLLA 3P52A 3M4NA 4INZA 3CNLA 3IUEA 1H8ED 3S7ZA 3RVJA 1QE3A 1L4KA 2CLIB 2QLMA 1M73E 4IX1A 2ONJA 4YCCA 1DBSA 3GVXA 1YTLA 1QZTA 1UJ2A 2ECOA 4FI3F 1XZCA 2BFDA 3HG7A 2NU7A 4URXR 4D25A 4YB8A 4E0BA 1WUJS 1KYWA 5L95A 4CQLA 4L3WA 4AJIA 4L6CA 2FZLA 1PR1A 1ADYA 5JZ9A 4C05A 3F2VA 1Z5NA 1D1TA 2X9GA 2G77B 1KOGA 4KKXB 1O5OA 1VLQA 5GONF 3U44B 2YDXA 2V6JA 2HIAA 3RAFC 3I45A 5GGYA 1B2LA 1NXPA 3ZHSA 3DEJA 5CJPA 5D6NA 5HKLA 1B0PA 8AT1A 1XROA 1OTXA 1P1FA 1Z47A 2VZ0A 2ZDGA 4NI5A 1ODFA 4Z0PA 2X0IA 1UK7A 4YT5A 4DC0A 3B1JA 1Z16A 1GPKA 1TGVA 2Y9PB 3DVAA 4JVMA 2B0JA 1DOZA 4JNCA 1E58A 1C30A 1GRNA 1RM4A 5AM1A 2JLYA 1GTG1 3FHCB 1DI0A 3HN7A 3TL3A 4N4AA 3VNSA 4JUCA 4F8EA 4HNRA 5D7NA 1UFOA 1GKKA 4GT1A 3RF7A 1AO3A 5LBTA 3O90A 4WW0A 3ZU5A 3G02A 3Q98A 1BXGA 4XJXA 3QE2A 3R5KA 3PICA 3EGCA 3QPUA 5EZYB 3WTBA 1P8JA 2GEJA 4K81B 4B48A 3VNBA 3H2JA 4ZGBA 3GCWA 1VLLA 2C5FA 1IZ0A 3ZEIA 4F2DA 3FA2A 1NJSA 4D79A 3UWDA 5BSRA 5A3RA 1QX3A 1JLKA 1UQUA 1MJ5A 3K2BA 4BNJA 5DCLA 2LIVA 4CKCA 2H29A 2HT6A 3NATA 4JIMA 5IWAB 3ZW7A 3HJTA 2VZLA 5LXTB 3T3GA 5ALEA 1AS0A 1EVLA 1FXUA 1RR6A 4Y6SA 4X91A 2WT4A 4UDNA 1P5JA 1ISIA 3KKKA 1NZFA 1Q5PA 2O50A 3PL1A 3VU3A 5KC8A 3FROA 4RTQA 5JASA 1KZ4A 3LPNA 5HF6A 5KC9A 2AN4A 3FJOA 4LYFA 3N39C 5H81A 4UTZA 4PO8A 5CDTA 4NSNA 3E1SA 4YUXA 5A4AA 1F7VA 4BBJA 4PM4A 3SEZA 4EKDA 3UMBA 4RMHA 3HYLA 3WICA 5H8WA 3BTVA 3NW9A 1QHXA 4BCDA 4E3WA 4F2WA 3WWCA 3MWYW 3GP8A 1GT91 2NYAA 3SYTA 1HFWA 2NZ8A 4EFKA 3DL4A 1VLHA 1RBQA 2VDQB 3A3NA 3PXAA 3Q7IA 3IUNA 4NMHA 3DDOA 1R2QA 1XU7A 1E9BA 1SA0A 5B57C 3V48A 5ARBA 5EP1A 1TUIA 1YE5A 3P5SA 2KB0A 1CV2A 3MT8A 4EG7A 4B3JA 2F9LA 4D9MA 4TLDA 1EBFA 2BR4A 1H2XA 4LRYA 3M6LA 3OPQA 3O3CA 1PDWA 4ASUD 1Z2DA 4M1MA 1N3IA 3U31A 2DBYA 1XCMA 3G85A 3KTAA 3O6VA 3QKIA 4Y7CA 5BNZA 1PV4A 1IWOA 3R20A 2ABWA 3RRXA 2GHIA 1Z12A 3ME5A 3SHTA 4DIOA 5AVXA 5DYWA 2DPGA 4P4GA 4TYWA 3ANNA 3D6NB 1I7NA 2B98A 1YD7A 2HEIA 2NO4A 1TW2A 1VMKA 3CUWA 3DPIA 4MVJH 4Q03A 1QC5B 4QNMA 5F64A 5HW0A 3EVBA 1H9AA 4PZDA 1R1DA 3TRDA 1P9WA 4YV0A 3IUMA 4OKNA 2ET6A 5CT8A 3QU4A 2JLCA 2AXNA 1UT8A 1R9MA 3SZGA 4CE6A 2ZT5A 3B1XA 3KSRA 3NU1A 4RK4A 1LDYA 1DADA 1XAJA 4O6VA 2FKAA 5DEIA 4X84A 4CG3A 1QO9A 2HHAA 5A2GA 1FZTA 4FOOA 2YZMA 2AE2A 2GGSA 2ZJFA 2QTAA 1HL7A 4PHFA 3K0CA 4E2ZA 5H1YA 1E4EA 4XIFA 3U6KA 1NVVR 3UA3A 4EPRA 2HWXA 2OV6A 2OHVA 4HDMB 3TOXA 5LZ7A 1RYHA 5BSFA 2IYZA 2PFGA 4CR6A 3GMSA 3CEJA 2YV4A 4G5SA 4I08A 5EIWA 3JATA 2KJQA 1Y34E 1WXIA 1SPXA 3BK7A 3EXEA 4XAQA 5B2EA 2CLFB 3LPAA 5JMTA 2H1VA 4E4YA 3ROXA 4FZ3A 1EDOA 4E03A 1XKTA 2XW6A 2WYHA 2WFAA 4UNIA 1TYZA 5BR7A 3GWGA 5T4FA 4AKIA 2BV3A 4S04A 3F7OA 2H18A 4M53A 4KR9A 5LOVF 1NOIA 4NYJQ 3UOAB 3FZGA 3ND6A 4OQFA 3JZMA 5LDDC 4DV5B 4MUJA 2OCPA 4KDFA 4MUKA 3WYBA 5IBCA 2XGOA 3CEAA 1MA3A 1ZR2A 2QE6A 2ZI9A 5F77A 4IUBS 4J16A 1JG2A 1RXCA 2PTHA 4KXWA 4YRSA 5KNCA 2DTEA 4FNOA 2J9XB 3C4VA 3WGQA 3OUZA 1M1UA 3NWPA 3F3KA 3TZKA 3R23A 3A4LA 3DMPA 2R00C 3FMFA 2NV0A 4RIIA 5IVIA 1CIVA 3FMIA 3OKCA 3DR3A 4JUAA 2AZMA 1HETA 3K5IA 4LZOA 4YQEA 4M49A 3L0PA 3VR0A 3LWDA 1BMFD 4BTVA 1OYOA 4E33A 1ND6A 2X14A 4BOYA 2QLLA 2Y1EA 1IEVA 1OXTA 1NRXA 1HY3A 1O5TA 3WV4A 3W5DA 1A95A 3KHTA 2BMVA 1JS1X 4MTLA 4UTVA 2VSFA 3VDNB 2XCRB 4AQYB 1FIUA 3EC1A 1Z7YA 1H94A 4MLCA 1IY9A 2W6JA 1L3IA 3EWIA 3E84A 4BGIA 3ABZA 2FPGA 4JOSA 3GJ6A 1RD4A 4N5MA 2ZJ1A 3FRHA 3I6YA 2PR7A 1V39A 2XGSA 4W9NA 2X5JO 1U2EA 2OUIA 2WWWA 4X61A 4F92B 1OVMA 4KQFA 1OH5A 1G4AE 1E9FA 2C5LA 3N2YA 5B1DA 3RSZA 4D4LA 5BUSA 4ZOAA 3JASA 1M1NA 4QUKA 4FE3A 4D3YA 3DYBA 3BN3A 1JI0A 5JZVA 4R2XA 2FSGA 3FLEA 5IANA 1OLOA 1ZM2A 5JFOA 2A0XA 1G3MA 1NRIA 2H5LA 1GZDA 1CZNA 3EQ2A 4GI5A 3L0CA 2MSCB 3HO6A 1MRZA 2DQSA 2P0EA 1J25A 3AR2A 3QWHA 4LXQA 2BHLA 3W1WA 3BXXA 4MP3A 1Z62A 3JTEA 1SHLA 3QW2A 4AKTA 4C1NA 1KJ8A 3KQTA 4EFLA 4MVJG 1C3VA 2FWNA 2JK0A 2XKBA 1HKHA 4HRXA 4D56A 2C5BA 2ZYVX 4PXYA 3ZI0A 6NULA 1NY6A 5HX7A 3KPWA 1ABEA 3OM9A 3PQCA 1SKAA 2G4LA 3QY0A 2NACA 4EDHA 1J8FA 4F45A 5DIFA 3A6HA 4GQBA 2PXCA 4D4HA 3VPFA 1B26A 3IMCA 1P75A 1P0IA 2VP5A 5JSYA 3RSSA 1X80B 1A0OA 2KQUA 3GT4A 4I1SA 4F9GA 4R40A 4B5LA 4M0DA 3Q7EA 1BS9A 1S1CA 4I66A 2WUGA 2ZSAA 3LXMA 3WGUA 4CI9A 1CQXA 2FEKA 1QGUA 2GZRA 2NUPB 3R5XA 4ETWA 3L05A 2QTZA 3NFRA 3ZGXA 2TSYB 1R5OA 1DUSA 1M2FA 4B34A 4RTOA 1X7DA 3OWOA 3I5XA 1PT7A 1T6BY 4TYQA 3LY7A 1LB1B 4I8IA 1E7YA 2DY1A 3PQ2A 1UXOA 4H1UA 4EVIA 3UWMA 5LB4A 1FLNA 1VL5A 1EEHA 2XA2A 4JSYA 1R6XA 1CIPA 3FRJA 2GESA 1YVEI 1TAHA 3I9OA 4HGRA 4UAUA 5LD2C 3HFSA 4HAUA 4IYJA 2FZCA 5FI1B 3NM6B 3AHEA 1I2ZA 2W2MA 3HKBB 4Z1MD 2QAGB 4PSKA 4B84A 4DMMA 2OAGA 3QXJA 4PXSA 2QENA 2REQB 2AEFA 1GN8A 4EVQA 2CZQA 3M8KA 4EQ6B 5BY2A 3BB1A 2GI4A 1DARA 3NTLA 3HFRA 4HDKA 4Q1DA 5IFKA 3LX6A 1UZUA 3LH5A 2FTKE 1OR8A 2XLCA 2Z2KA 3LQRA 1MENA 1U9IC 2EJUA 2PPLA 4ZQFA 5JANA 5EXSA 2UYHA 2GPBA 5ER9A 4GZ5A 2ODWA 2UUPA 3ZE2B 5KTRA 1E7RA 4WESB 1J2TA 2PXXA 2X77A 4K26A 3ROZA 4XWWA 2A57A 1MLDA 2DH6A 3BGSA 4IXTA 3SM9A 3JYLA 1FUKA 2N47A 2PS1A 2XITA 3C1OA 4WADA 3I4CA 4JI2B 2JVJA 2HK7A 2GO1A 3CF4A 3OZFA 1QK3A 3Q7PA 2W2LD 4LDNA 1PZFA 1E2PA 2V9ZA 3VH2A 4KR6A 3X44A 4PFKA 3Q8WA 4A03A 2YXLA 3CG0A 1M9NA 4NL4H 4WBNB 1MZPA 3W8EA 1A1SA 2NXNA 1OA1A 3GJTA 1EZZA 1NXQA 2I6QA 2YBEA 3JQRA 3GLHE 1XQ6A 4H0NA 4MYDA 1KY5A 4IGFA 5TT1A 1Y9ZA 1OAKA 1UK8A 3MUEA 3L6OO 4IDBA 5CM9C 2E87A 1L5RA 2RE8A 4ZI2A 4ID3A 1U7XA 5BYAA 3SLRA 2QI9F 1JEEA 1Q12A 4BPBA 1E1NA 1NQOA 4ZAVA 4PTLA 2FPIA 1QGZA 1BHJA 3CLVA 4YRKA 2H1RA 6YASA 4PV7A 1ZOLA 5D84A 4JBNA 5BSWA 2W93A 1JKJB 3V33A 1P91A 1KAQA 1PBTA 2B61A 2ZRCA 2F3TA 1QH9A 1H2WA 2PBRA 4O1MA 1LV7A 2H4JA 2C58A 1M1ZA 3HABA 3URMA 2GR9A 2YL2A 2CDBA 4TUYB 2ISCA 2WWTA 5BNWA 3A37A 5L3ZA 2PGAA 1SHTX 5EY5B 1AQ6A 3STXA 3A1WA 2B2XA 3A9CA 4D0GA 2JHPA 1X3SA 2FSUA 5I7VA 5JVDF 1QP7A 1ZW6A 2P5SA 4Z99A 5C1PA 1TVMA 1XDBA 4XM2A 1WPRA 5HUJA 2W6IA 4NAHA 5FBZA 4M3NA 2ZRAA 3EQ8A 4ISBA 3BXEA 1B1CA 5JMOA 4UC0A 1EM6A 1T2VA 1DBPA 2J3HA 2NO1A 4PGAA 1V11B 4JI6B 1FDOA 1T4DA 3NC1C 4HMPA 1WVIA 3ROFA 5FA5A 2CKDA 1Q19A 1CEXA 1L7RA 1KOFA 4DUGA 3E53A 3I83A 1Z82A 4HF7A 4D8XA 4CVNA 1JF8A 4PNEA 1DAOA 4BC0A 2JHCA 1TKRA 5FTWA 1A4XA 3FUXA 4YUAA 5CFPA 1PF7E 1J70A 5BYBA 4XWGA 5K9ZA 4UUPA 4XGQA 3UQYS 3IESA 1EFLA 4CLOA 3V4VB 5EP4A 1JQLB 4MDEA 1DJLA 1JYSA 4DTIA 3LF2A 1U1EA 3L93A 1DRWA 1G9XA 4EJ0A 3U09A 3AP3A 4WWHA 4DABA 2WOOA 2J9YB 1A5ZA 4PAOA 3DFIA 3PDWA 1J8YF 3AY0A 2A1UA 4RD0A 3QTTA 4PRZA 4X95A 3RVMA 3KSAC 2HRBA 4X7BA 4KR2A 1ZM4A 2V6GA 1YCHA 1ZBDA 3IDSA 3UC5A 2BSQA 2RMKA 1QLJA 3NBXX 1UFRA 3DHWC 4C14A 3BTSA 4IINA 2KMLA 5KJ1A 3A2MA 3BKXA 2R4TA 3EODA 4S2UA 3SHVA 4DC9A 2R97A 4GVLA 4D9NA 3GXBA 3ND7A 4MRVA 3QHAA 2QA5A 3ZI4A 5DFAA 2DFPA 1P7CA 3R4CA 4XUEA 4X41A 1ONOA 4GC9A 4K7JA 5BPHA 4YIKA 5CB4A 4FD3A 2FZWA 2RHWA 3HGMA 1PG0A 1IOVA 1PUXA 5A06A 1GFSA 1YVDA 3Q5DA 2VF2A 3C16C 4O4JA 3W9SA 5KWVA 1TO2E 3OFNA 4W7HA 5ALPA 4ZCLA 4BO7A 2PUBA 3KYDB 4ZT6A 2KPOA 4JT9A 2OVFA 5DNVA 4FQ5A 2PL1A 3ITKA 3LPDA 1CUVA 4KRGA 4AMYA 4C6HA 2XV1A 3DTYA 7ABPA 4MVJF 1Z6XA 3UB3A 4BMYA 1X9HA 1V16A 1WR8A 2OV2A 5DM2A 3NHBA 3NETA 1IYZA 4YN3A 4EW1A 1PW7A 1VLZA 4L3VA 2KX7A 1IU9A 5FFNA 3ZWDA 5CDFE 2I6SA 2NAPA 3AUUA 1GYRA 2OXTA 5C52B 1U0FA 3QOYA 3U4IA 3FMVA 4OHVA 1BEEA 5TJ9A 1O0CA 3I0MA 1RFLA 1DEKA 2EU8A 2PX2A 1DTWB 2AC2A 4X85A 2B8JA 1X19A 1PTKA 2P1RA 3IBTA 1W6UA 2WVJA 3HJRA 3EGIA 4OJNA 5C1OA 5CBPB 4DLXA 3HB1A 1U4OA 1VRCA 4LXIA 4WLEA 4COKA 3JQFC 3W5JA 2H2HA 1II8B 1LLDA 2IUSA 4ZGGA 3ZD9A 1GUYA 2DHEA 3U7QA 4JBGA 3ZD6A 3ELBA 5DBOA 1E6KA 4W5QA 4L9WA 4N82A 3FLBA 5BWLA 1JXOA 3JU3A 3HU5A 3L18A 4IWXA 3ZQKA 5B7QA 4F3YA 3MWGA 5CK4A 1V8PA 4MV7A 3SXUB 3HBLA 4RDXA 5EZ5A 3DEKA 1Z8FA 1SU6A 4DLVA 3EEBA 5ITZB 3EWNA 1ZOPA 1P1BA 1PNQA 3N3BC 4PZLA 1JFFA 3G88A 3L6EA 3OZSA 4W63A 2D0OB 4FOTA 1RI1A 5K3DA 4ZVTA 2O1WA 2SHKA 2HWUA 3AESB 1PVDA 1GGHA 2CSUA 2J3DA 2B82A 3LQQA 3W2HA 2HBYA 4BRUA 4DLWA 5EUMA 2AFHA 2GWRA 5MDHA 3NOOA 4HUQB 4XM0A 4U0JA 1NXXA 4CEJA 3C3PA 3OLWA 1AZWA 3I52A 1EVIA 2CT8A 3S81A 1LVHA 2XIQA 3IBFA 3MGBA 4J49A 3TXYA 4GQIA 3NBUA 2FMHA 4UOEA 5AVJA 4I1OA 4WY8A 5HG0A 2EOAA 1C4XA 5EC8A 9GPBA 4LV8B 4BNMA 2XB2A 3IHKA 5DM0A 3MGGA 2PZFA 3VNRA 4K6CA 2RHOA 3PUIA 3W5HA 5ALVA 4UJ3A 3CHYA 4FX2A 4Y2UA 3WWYA 3S55A 4LGMA 4KSYA 4V02A 4QQKA 1U2DA 5FLKA 5TMDA 1FRNA 5CDSA 5EMLA 1T5SA 1CVIA 2AKYA 4MV4A 5LU8A 4B6QA 4QXQA 1SC3A 2WSIA 5FXMA 3WMRA 2FEMA 1XZHA 1IXYA 4TKUB 4RXTA 1YDFA 2XTAA 1YR7A 4URYR 1G4UR 3LKZA 3S99A 1C7QA 1BGWA 1WMAA 4NC9A 5TQVA 3T0FA 2RAVA 2IDMA 4LDJA 3UT0A 1K92A 1YACA 1DWOA 2BGIA 2P75A 3CLTD 4M1QA 1AXEA 3UOWA 4E12A 5AW1A 3LLCA 2PYDA 3I9NA 4HO1X 3T5AA 2IXGA 5F7XA 1K7EB 1FDSA 1IH8A 2PIDA 2H52A 3D4NA 2ILTA 3R7DA 3ROPA 2B4QA 4BFVA 4DY6A 2QX7A 1ZH2A 1JHYA 2AQHA 4NX2A 2BGMA 1SULA 1EVYA 1YNOA 2Q9AA 2UZAA 3GLHB 3GFQA 3PC6A 2D59A 4X8OA 4YMWA 3SBDA 1JU4A 3N8GA 3ZCXA 4RTPA 2O3UA 3K31A 2R8ZA 2C5GA 1XG5A 4ZARA 2MMCA 1G2PA 2ZJYA 4G36A 4L9RA 5IEBA 1RKQA 4DILA 3RIGA 4L78A 4R2IA 2PL3A 1F14A 1K0UA 3TLBA 1JFRA 2O6LA 1RWMA 3Q1LA 1EB8A 1Z0FA 1R4NA