1DPFA

Crystal structure of a mg-free form of rhoa complexed with gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDVACGKTCLLIVFSKDQFPAVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRARPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTARELAKMKQEPVKPAEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHOA
publication title An open conformation of switch I revealed by the crystal structure of a Mg2+-free form of RHOA complexed with GDP. Implications for the GDP/GTP exchange mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/signaling protein
total genus 63
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1999-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dpfA00
3DDCA 3BRWD 2WWYA 1Q21A 3RS3A 5L3SB 1D2NA 1E2LA 2Z83A 4B35A 2OM2A 5B57C 2VIIA 1KKMA 3IIKA 1VCOA 1XZPA 2XAUA 3RRYA 2ZI9A 1T8TA 3VU9A 4A8JA 4TYWA 1LVGA 4UNNA 2CDNA 2W6JA 4PXAA 1G21E 4KBFA 2IS6A 3PCRB 4ZDJA 2JLSA 5FBLB 1WBDA 2O8EB 4LDJA 4HLDA 2YHSA 1MABB 4YONB 4WXRA 2CCKA 1S1MA 5EP3A 2H18A 1YZNA 2ZUCA 4AYXA 4RD3A 3SQWA 3LV8A 1QHXA 1M1YE 1VIAA 1F2UA 1UBGA 1JR3D 3LA6A 2OHFA 2QY9A 1KKLA 1OHHD 2BCGY 3GEEA 2AL7A 1G3UA 4DSNA 2CLCX 1ZYUA 2K5UA 2ZRNA 2JLQA 3CF2A 4PPQA 5KU1A 3HYRA 5FTLA 5F3WB 4MGKR 4NMMA 1Z6GA 3QNUA 4LWZA 3EX7C 3I62A 3AP3A 3BJIC 4ZI3A 4TLAA 2ZRKA 4R71A 1E0SA 3G0HA 1XJ0A 4Q1FA 3B9PA 2VPPA 4Q03A 4XJXA 3GEHA 1E9RA 2ZR7A 4TLCA 1Q57A 4LUCA 4V02A 1KJZA 3UWOA 4EJSA 2ZETA 3E70C 4HUQA 3LVRE 3B13B 4PPGA 3SN6A 4MYUA 4EFLA 4FINA 1PUJA 2ZRMA 3L43A 4NL4H 5CIWA 3LW7A 2O8DA 3QUSA 4D4KA 1AZSC 3K0AB 5IF9A 5FI0B 1AQYA 2LKDA 1U9IC 2J7PD 1XMVA 4TLBA 4CGZA 2J0SA 3KDSE 1PLJA 2QMOA 4HLUA 2OV2A 3QF4A 1X3SA 4HUTA 4ILEA 4MKIA 1U98A 2WWWA 3LLUA 1F6BA 2IYRA 4I1SA 3IBYA 3GLFE 1Q0UA 4NHOA 5CK5A 1XEXB 1EWRA 2OE2A 2Q6TA 1KK3A 3VR1A 4DC9A 5HPYB 1JJ7A 3CRMA 4B3FX 4PFSA 3L0SA 1IJFA 1KJWA 2BC9A 3TK1A 4QKQA 2YOFA 3U44A 2IF2A 4KAXA 2ZTSA 3QSYA 5LB2A 5K8UA 4TL7A 4HYYA 3B60A 4HATA 1IY1A 4II7A 4TMWA 1EFUA 2ZVPX 2VP2A 4FW9A 1Q20A 5HE9A 1LS6A 2A3RA 221PA 2V1UA 3UWKA 4TLEA 4EFNA 1TQDA 5FPTA 2AWNA 1JEEA 2ZE8A 3B1VA 4LYFA 3AVPA 1JPNA 1ZAKA 2ODNA 1LF0A 4YC7A 3LQQA 2GXQA 3C5CA 3ZD7A 1Q1QA 1R0WA 3THXA 1JQLB 3JZAA 2O8BB 3DM9B 1S2MA 1FQKA 2ZRHA 4PHGA 5FOTA 5B58C 3WXMA 1LS1A 1M7BA 2ZE5A 3GLIE 1NIJA 2Q3HA 2GVZC 2XOKA 3Q3JB 1TNDA 4L8GA 4B44A 3CF6R 2ANBA 2GAAA 3K09C 1ZW6A 3A1SA 2Z4SA 4Q1AA 4QG7A 3FHOA 5CJPA 5A4JA 4B33A 1DOAA 4FXPA 4NDZA 3GFTA 2LCFA 1VCIA 2OXCA 1E96A 3M4YA 3QXCA 4QBGB 1GL6A 2I1VB 3QJYA 4TMXA 3U3JA 2ERXA 1WP9A 1QRAA 1HV8A 2NO7A 2C03A 3DPUA 4D0GA 4GOXA 1N5KA 2IBMA 2ZSEA 5TMPA 3IKJA 3MWJA 4IXNA 4Q4AB 3I1FA 3GFOA 1S4QA 2QM7A 4GSYA 2C2HA 2FV8A 5EXXA 2CCJA 4MQBA 5IDVA 4LV8B 3JZMA 4LI0A 4HAZA 2ZRPA 2F43B 4OJQA 3MWKA 4DCTA 1SXJE 1V43A 3HU3A 1XPUA 4Q1BA 2YC2C 4D80A 3CPEA 3FMPB 2XTNA 1RFLA 2OFWA 3ZH9B 1ZM4A 4ZCLA 3ASYA 2ZITA 3QPWA 5AJZA 5LBIA 4DCVA 4KVAA 1ANKA 1MOZA 4DBLC 4F92B 2HF9A 3I72A 4QNMA 1O87A 1U99A 2HCJB 4OKSA 4R98A 5AR1A 3C14C 621PA 5D3QA 1XCMA 2XXAB 3E5HA 4HSEA 4PC2A 2GETA 2ZS9A 4O2RA 1P2VA 3SR0A 2GCNA 3QE0A 4JLPA 1Z6YA 3LQRA 4PSVA 2ZANA 4CZ2A 3DL0A 1ZMXA 2GJSA 4ESVA 2O8FB 4MUBA 4DEXA 4DUGA 4C9BA 2QP4A 5HZKA 2ODBA 4KFTA 4K46A 4Q7JB 3A1UA 4G5OA 4JJKA 4RZXA 4PSKA 2BBOA 3TAHA 2BOVA 4PHHA 3TSOA 1FMJA 1KNXA 2EFDB 4Q4HA 4CT5A 4C2TA 121PA 2GTPA 2JEOA 1DAHA 1W46A 3AKCA 3ZLJA 1YR9A 3K9GA 2J46A 2PMKA 1J70A 2V1XA 3T15A 4UQOA 1KK1A 1G6HA 4LHXA 2OFXA 1N0VC 2UZ3A 1IONA 4LSGA 4YXWA 3K0CA 3SBEA 2GZAA 4F93B 3PEWA 1TF2A 4FCWA 5BXQC 2GESA 3CRRA 1CS4C 1VYVA 3KXLA 1OLOA 1CKEA 4BZPA 2EFHB 5G41A 1CXZA 4CEIB 3O8RA 1QZXA 4GZLA 4F38A 2OESA 4I1OA 2ORWA 4IHQA 1HTWA 2FZLA 1XRJA 4LJYA 3SJAA 4MDEA 1GOTA 1X8JA 4UJ3A 2J87A 4IDOA 2VL7A 4XTCS 5F2EA 4LC1A 3AH8A 3LDAA 4EKDA 2XSZD 1P2SA 2QAGB 2YWHA 3ECCA 1NMZA 2JJ2D 4BFTA 4LV6A 3VQTA 1E9AA 4QBIA 2BMEA 3TH5A 3OFND 1YZQA 4U00A 1XEWX 5EE9A 3I4LA 3UKDA 4A0RA 3WYAA 3ZD6A 4DB2A 1ZIOA 4AKGA 1JR3E 1W0JD 1UKYA 3QI2A 2LKCA 2W2XA 1I4DD 1E2NA 1DVRA 3V4FA 3W8NA 1SVMA 1ZUHA 3BERA 4DLWA 4R2HA 1EFCA 3BFKA 4YMUA 1E32A 2NO1A 3ASZA 3WHLA 4IDQA 5EXTA 2GHIA 3T35A 4BFWA 2NMVA 2ZRAA 2QGNA 1R5OA 1NLZA 5H8WA 2Q3FA 3CLVA 2GF0A 3WBKA 2J9RA 4RD2A 5G3ZA 1G8HA 1NMXA 2ZI4A 3GJ7A 4L4UA 3FFBA 5DISB 4JLKA 4YMWA 2Q9CA 2YV5A 3EZFA 4FMDB 1KY3A 3P4XA 4FWIB 1P5ZB 3PITA 1OFIA 2VBCA 3KJIA 1KO7A 5G40A 3SNHA 1S1CA 4JLMA 3T1TA 1TTTA 3BXZA 3DMNA 1SVIA 3FKQA 2P3SA 2QQ0A 3GQBA 1TU3A 2GJ9A 2WPDD 4HLQB 4MKHA 1Q3TA 1G4AE 4I1VA 4C0AC 2C9CA 1A82A 1A7JA 2YWEA 3SJCA 1N0WA 2JASA 4C7OA 2O0KA 1KI3A 3RS0A 2ZUBA 2PX0A 1L7VC 1OT3A 1R7RA 4IVRA 1UBCA 2GKSA 2RGEA 1OIWA 3IPXA 3EWSA 2W0SA 4TWZA 2G0NA 4BQSA 4A36A 3PUZA 4B2LA 1JXOA 1TPZA 4I99A 4NCNA 2XJ9A 1EFTA 2V7QD 3B82A 1XPRA 1CULC 4GL2A 5H68A 4QJ3A 5ELXA 4ZKEA 5DGXA 1XTIA 2W00A 1OH7A 3N2IA 5K8TA 3PFIA 2ZAOA 4IKEA 4MUAA 1E79A 4DDUA 5P21A 1G7TA 4TSFD 1R5NA 4ZO4A 4V03A 3OESA 5FTKA 4TZ6A 2RGNC 4LJ7A 3P1JA 1PV4A 3KXKA 3DKVA 2JGNA 5TVKA 5JEEA 1E1RD 2FA9A 4MRNA 2NIPA 5C4MA 2ZJ8A 1OW3B 2PEZA 4ZIRB 2QTHA 2CK3A 5L3QA 2ZJ5A 4KYUA 4QJ4A 2FFHA 4GOKA 4Q00A 5CDFA 3T1VA 4TQAA 2D06A 3K9NA 2V3CC 4D4JA 3NHBA 3CONA 2JLXA 4DSTA 1ZD8A 3RVBA 4DSOA 1RE0A 3NG1A 2QROA 1RRGA 2HXYA 3EPHA 1G5TA 1Z06A 4MYHA 2RGXA 1GIAA 1EESA 3ND9A 4O25A 1Z2AA 4BFSA 2P6NA 1G8PA 1N6LA 2CCGA 2ZE7A 3WRYC 1HY3A 3VFDA 1E1QD 1COWA 2FSHA 3NEYA 4ARZA 4I81A 1XU4A 2GWHA 5J5CA 3OIYA 1J99A 2IEYA 2ZUDA 3REGA 3RNLA 5JSZA 4OQFA 4F7WA 5FBRB 3A6PC 4RD1A 4LBWA 4XSGA 2CXXA 2WKQA 1DELA 3DOEA 3KFXA 4M22A 3FMIA 2WWGA 3A4NA 5DNYB 3U7HB 4QC2A 4F4IA 1X1RA 4MRRA 1LNZA 3RRNA 1TMKA 5EXSA 5F98A 2GCPA 4IDPA 2IUSA 4Q02A 3GLHB 1G16A 3W3ZB 4BEJA 1W4RA 1SVKA 3FKSA 1NN1A 2RAPA 3R7WB 2R2AA 3BGWA 1W0KD 3IGFA 4OHWA 3A1WA 4B71A 1DADA 1OYYA 1GUAA 1Q1ZA 4MGIR 4B34A 2QBYB 2H92A 3CO5A 4TT3A 3UANA 2A5GA 4LZZA 4B73A 3AGPA 1XD8A 3AVWA 1ZD1A 2WJGA 4A6XA 1MR3F 5KSYA 2KI5A 1M7GA 4PHTA 2P5TB 3BB3A 3OEHA 4V0MA 4M8NE 3H84A 2R6CA 1G17A 1G20E 2KJQA 5FUWA 5LD2B 2ZXUA 5C2JB 1VCNA 3U7EB 1AS3A 2ZS7A 3OE7A 4HB3A 4QGFA 1KDRA 2C9OA 1FTNA 1C4OA 5KTYA 3ZQ6A 4URYR 2QENA 3ZVRA 1IN8A 5E3HA 4UXHA 4ESHA 2D2EA 1R0ZA 1US8A 4MYCA 4EQ6B 1NVVR 2CL7X 1OXVA 2F1IA 1MT0A 3DZDA 2WTUA 1UDXA 4XWAA 3GP8A 1W36D 2OFOA 1XTKA 2W2TA 1P73A 4FMCF 5DI9A 2Y8EA 1ZCAA 3DO6A 4URUR 1T3LA 3U2QA 4C0JA 1P2UA 3LRPA 4UNPA 3R9XA 2GK6A 2GK7A 1U81A 1TU4A 3GLGA 2E9SA 2HYIC 3VKWA 4KLZA 4PSAA 2FJUA 3VNVA 1T0JB 5J47A 4A1FA 1XPOA 2C99A 3TE6A 3KTAA 2QAGC 1P7CA 1V5WA 5HCNA 4M1SA 1E9EA 1NN5A 2ZRBA 1A2KC 3ZIAA 4LJ8A 1I2MA 1VG0B 1E2EA 4DRZA 4ZCIA 4RVCA 4B3CA 1P9WA 3KB1A 4JVLA 2ZJ2A 2I4IA 3EZ9A 2CEAA 3PENA 1OYWA 4TQ9A 1NBMD 2P65A 1E0KA 2ZRFA 1IQPA 2FN4A 2IX3A 3VKGA 4RZ3A 5FTMA 2F1JA 3A4MA 2IYLD 5JEDA 4XD7A 1PJRA 3A1VA 2RGBA 3P4YA 5E7IA 4LJ5A 1ONBA 4UNSA 1UM8A 2YVUA 2WV9A 2VP0A 2WJHA 2CL6X 2PJRA 2BHRA 1F3OA 3Q7QA 4RY2A 1M8PA 1NN0A 2R6DA 3AP1A 4PHFA 1HQYE 1X86B 4HB0A 4M1OA 1P6XA 2JATA 1IN4A 1S9HA 2O52A 4D25A 3KQLA 1NJFA 4FN5A 2WSSA 4AK9A 2QT1A 5HKKD 1FOEB 1YZLA 3AF0A 4U7DA 2OO7A 5FPYA 1XCPA 2IS1A 1YR6A 1NY6A 2VHQA 3IIMA 5G3YA 1TQ4A 3THWA 4P32A 3NBXX 1KMHA 5A0FA 4OHZA 1GKIA 4LYJA 3TJZA 3VR5A 3ZS9A 1UF9A 2ZJAA 5TDHA 1SVLA 3QKSB 4I4LA 1AIPA 5J4LA 1JB1A 3SYKA 1NKTA 2PEYA 4A9AA 3B1YA 2I3BA 3TNFA 3VR6A 3SC3A 4WZAE 4BEBA 2ZI5A 1E9DA 1SXJD 4HB4A 4G1UC 4Q7KA 4H1VA 1N0UA 1UKVY 1K5GA 4M0LA 2V4ZA 1EXMA 2RMKA 2P67A 4G5QA 3ZZ0A 4JLJA 1M7HA 3EZ2A 3CWZA 3IDQA 1SULA 3VR3A 2XX3A 1L4UA 3KJGA 3LW8A 2NG1A 2IWRA 3CB4A 4F4JA 4JSYA 3GJ8A 3QPVA 3TIFA 3ZZTA 3EASA 4YLGA 1SXJB 1VMAA 4LBVA 2VH5R 3TSZA 4URWR 2E1RA 1P4SA 4H9GA 4A15A 3U7GA 1MO6A 2ASEA 2VSOA 1KO8A 2WJYA 2EU8A 1XMIA 4QGAA 2H57A 3NDBB 2CNWD 4WIAA 2V8OA 2VLIA 3K0FB 2QE7A 4GNKA 2XZOA 2GEDA 3X1WA 3L0IB 4PO8A 4NYMR 2IYWA 4D82A 2C5LA 4EUNA 1AK2A 4NE2A 1Q3HA 4OBEA 5AJVB 2IC5A 2VQSA 2FSGA 2ZSFA 3I61A 3GPLA 5JLJA 1OPXA 4P4SB 1ZM9A 2A5FA 8OHMA 3SFVA 2D7DA 4B76A 2C98A 3HPQA 1TADA 3B85A 2C77A 3MCAA 1RJ9B 1I4TD 4AI6A 2C8VA 2KB0A 3T12A 2AFHE 1NN3A 2ZJBA 3CZQA 3MJRA 4M53A 2DFNA 3EC2A 4KYIB 5FOSA 3SOPA 2Q0HA 3CIOA 1N6PA 3EARA 5CDFE 1FP7A 1GKYA 2HDNB 3PG5A 4WA7A 3H86A 1G8FA 3NH9A 4GP6A 1R8SA 1GNPA 4NZYA 2FE4A 2F3TA 3UMFA 2JLYA 1P2TA 2W6IA 1QHYA 2R9VA 3D6TB 3X1DA 2A5YB 1E2HA 4PR0A 3H1TA 5KYKA 1VDZA 3PVSA 4PO1A 3TMKA 1N6NA 3KKMA 4LYAA 4C0KA 4Q21A 1H8HA 5GVSA 1KK2A 2W6JD 1FUKA 2GZDA 3W9YA 3C15C 1KSJA 4ZDIA 5JHHB 1XJCA 1UBEA 2PZFA 2QORA 2XNDA 2GBLC 3GLHE 2YNMA 3CPHA 1TL7C 3DOFA 3OEEA 1VG9B 2QEQA 4BFZA 5F9FA 2HT1A 1XEWY 1Z0JA 4TYQA 4WXPA 4FCTA 5DN6A 2C95A 3QBTA 2XEXA 3EA0A 3VU9B 4A8JB 1ZNWA 2XNSA 1Z0DA 3B5JA 2XTZA 2YZ2A 1YZUA 4NYIR 4AKHA 2FSIA 2WJIA 3CNNA 3TR5A 2D7CA 2WOOA 2OBLA 3RHFA 4NKRA 1NSFA 3LH5A 3QBVA 2ZS8A 5EUMA 4O0MA 4UXIA 1BKDR 3GJ6A 2CE2X 3GJXC 3IUYA 5CB6A 2PBRA 2ZE6A 5JS8A 1NG1A 5FUVA 5GJCA 1MRSA 1E9BA 1F2UB 5UKDA 4B3BA 1KI6A 1S9DA 2R62A 5AUNB 4AURA 1FMLA 1XF9A 4L9WA 4P0TA 1XMSA 2E87A 3WNBA 1G64A 2PJZA 2BKUA 1IXSB 1CP2A 1XZQA 3BORA 2CVFA 3L0PA 3SU8A 1Q44A 2B7BA 4TMTA 3L0OA 3LD9A 4A82A 3AVVA 2DWPA 4IOJA 3C5HA 3NH6A 4DVGA 2V54A 1U8ZA 3P20A 3NXSA 1KO1A 5FL7A 4FD2A 4YDSA 5KNCA 4RFVA 2IYVA 3WMEA 1G8YA 1G19A 1IM2A 4ZI2A 2A30A 4QHYA 4EJSB 1OF1A 3MMPA 3LX8A 1NI3A 2BBTA 4HUQB 3T1QA 3ZDQA 1W36C 4WVFA 5FPSA 4OHYA 3RRMA 1CJKC 1IJEA 2B8WA 2O8DB 3OIUA 2R6GA 1ZM7A 1JJVA 2NPIA 2JLVA 2YYZA 4XVQA 1NNEA 1I2DA 4DB4A 2AWOA 3IQWA 2HJVA 3AUYA 3RYTC 3W6NA 1X8KA 2EFEB 3QF4B 4U5XA 1Z6XA 1QHHA 1GWNA 1KAGA 2HT6A 3CR7A 3P27A 2IEZA 4RFSA 1C1YA 4R7ZA 2BWJA 4KFUA 821PA 2V55B 5EE1A 4GFDA 2OEPA 2DHRA 2GCOA 3VAAA 1E94E 2JAQA 5BW8A 2VP5A 5LB4A 2B8TA 2AD1A 4BLSA 3BC1A 5IT5A 1O3YA 1KDTA 3D31A 4YQFA 2EYQA 1NBME 3RWOA 1J7KA 2C9YA 1M6NA 3U44B 2R44A 1XNJA 3W6PA 1UBFA 2X2EA 2G88A 3EXAA 2F3RA 2R6FA 2YINC 3GJ3A 2FNAA 4JLDA 4B2IA 1QBKC 3H4MA 3KKPA 3TGPA 3VX3A 3UMSA 4HAXA 3U3RA 2AXPA 4LJ6A 5SZJA 3MRSA 5JBQA 4C0SA 2REBA 2AR7A 5G53C 2C78A 2KBEA 3SI7A 1EFRD 1BMFA 1FUUA 1T5LA 1T91A 2XOKD 4QGGA 4G5RA 2A7QA 5TARA 2ERYA 4TQUS 3MAAC 2OCAA 5JJIA 4HZIA 5EJEA 4IOMA 3RC3A 1S0UA 1E99A 1KZ7B 3K8YA 1ZC3A 3KL4A 2J1LA 2ZROA 3THXB 3VTKA 1EG7A 4US1R 1ODFA 4Q47A 2Z5FA 5DI3A 2JDID 4TMZA 2ZYUX 4HB2A 1B0UA 1JALA 3FWYA 2G0TA 2VA8A 4ZDKA 1IY2A 5JRZA 5DSZA 4Q5IA 2PZGA 1E2IA 4LOAA 4EPYA 1RIFA 1AKEA 2C04A 4UNQA 1OXUA 3PUXA 2P2LA 1XD2A 3BE4A 1SXJC 2FPLA 3V00A 3T61A 1MKYA 2A78A 3L82B 4QBHA 3W34A 5C18A 4CEJA 4JLOA 4MRPA 4ZCMA 5M04A 1NLFA 2ATVA 3R20A 4NH0A 1Z63A 2FFQA 4LBYA 4NYJR 3T5DA 1HE1C 1H8EA 2L0XA 2YOHA 4OK3A 3PJRA 5C1BA 1G291 1Z07A 4Q7LA 3VHLB 1UDWA 1EFHA 4LJ4A 4MRSA 3HPRA 4Z1MA 1E2DA 4RD6A 4UXJA 5J40A 1TEXA 4PQRA 4GP7A 3U61B 1DARA 2DFLA 5FBWB 5FBQB 4JL6A 2RGDA 1X6VA 2CMKA 1JECA 3U6KA 1PZNA 3Q9LA 2IF0A 2PZEA 2QP9X 3IPYA 4D6PA 5FH9A 2FH5B 3H0KA 4UJ5A 3THYA 5JI3E 3WP0A 1EX6A 2ZRGA 2GXSA 4URVR 3W6OA 5FR2A 4C0QC 5IK2D 4BFYA 4FI3C 3AF2A 4DXAA 2O0JA 1ETUA 1MH1A 3MUFA 4JZKA 2R65A 2JJ1A 421PA 4DUGD 4HZUA 2NO6A 4R9UC 5AK0A 4DIDA 2OSBA 2QZ4A 1XTRA 1AS0A 1P72A 2FZ4A 1Y63A 3KX2A 1GM5A 1FTSA 4MGZR 4ASUD 3IEVA 1ZNZA 1CTQA 3ZQJA 1II9A 2F6RA 4GRAA 2BKEA 4PAMA 2ZJYA 1VG8A 1W4AA 4CF7A 3QEJA 3HYTA 1GDDA 1R4AA 2XITA 4GBMA 4E09A 5E7JA 3ADKA 3FDIA 2G77B 4Q4HB 3QXSA 4FMCB 5DYGA 2OZEA 3N2EA 4C0BA 1CJMA 4YXWD 4V0OA 2B7CA 3W8RA 2NOAA 4HAYA 3PEVA 2HV8A 1W2HA 3AF4A 5CB8A 2JJ8A 4LGMA 2WIAA 1CR2A 3FE2A 1ESMA 2KWIA 3OAAA 1R10A 3QKRA 2AN9A 1KIMA 2DWQA 4ACBA 4AG5A 3ADCA 2IYUA 1FZQA 3FFAA 1J8YF 2G83A 4X8OA 3ZVLA 1T9HA 2ZVQX 2AHOA 1ZINA 4A6PA 1WMSA 2QMEA 2GNOA 2PLRA 2G1JA 2W2VA 4JKYA 5C46F 2I1QA 4BRUA 1HH4A 1II8B 5BQ5A 4NP6A 4OHXA 5FI1B 4IJMA 2DPXA 5D3MA 3WYGA 2ZPTX 1GRQA 1GRRA 4BFUA 4E5UA 4IDNA 2C96A 3C4JA 3K53A 5HE8A 3KKOA 4QFMA 1GITA 1W0JA 4NTZA 5SZKB 5KNDA 1E4VA 2AK2A 3KFVA 5KO2A 2ZRJA 2OUKA 2HYDA 5J4HA 1KDPA 3CNOA 3KUCA 2J0QA 1VYUA 3DKPA 1W4CA 1JQJC 3CRW1 1N6OA 4XVRA 3TSWA 3X2SA 4EJSC 4CEHA 2ZR0A 2FGJA 4O2LA 4QL3A 3AVTA 1N5LA 3EZ6A 2QTFA 4OQNA 5KDOA 2GEUA 4BWYA 4DLRA 3RDPA 3SJZA 1GSIA 2OAQ1 3AV0B 5CLQA 2QPTA 1GP2A 2RGAA 4DWJA 4MDFA 1FX0A 1NMYA 4OI4A 3DM5A 3LXXA 4OYHA 2QL6A 4JVMA 4LYHA 4NCHA 4BASA 4HLUC 5FPHA 3BFXA 4BUJA 2IYSA 1D2EA 1OXTA 1WXQA 3F5FA 4IXMA 5CM9C 4KODA 1W2GA 4D4LA 1IOZA 1D9XA 2CVHA 4NU0A 3BB1A 3X1XA 3K70D 5AJYA 5ANRB 4DLSA 3B6EA 3R9WA 4DLUA 4Q66C 4LK2A 1OFHA 3ZYCA 4HAUA 4C7OB 3GD7A 2NZJA 3A58B 1ZP6A 2XB2A 4L5BA 1P75A 4G0NA 1QVAA 1E79D 3U3OA 4P4TA 1P3JA 2OLJA 1T0HB 1W7AA 1IN6A 1XXHA 3K70B 3VKHA 5EUQB 2FGKA 3MFYA 521PA 4HEJA 5CLLA 4Z54A 1SQ5A 5BYKA 3QPUA 1XBTA 3MG9A 2CK3D 2P6RA 3B1XA 2AFIE 3I32A 3S1AA 2LWIA 2O8CA 4AIIA 3EPKA 1BYUA 1E1RA 4A2WA 3T5GA 2GILA 3IEUA 3G5UA 3EIEA 1QDEA 2B21A 1SKQA 1Z83A 3NWJA 1NLYA 3AVOA 4PC7A 5CIQA 4Z8YA 1NL3A 1Z0AA 4NCKA 2PCLA 5KSOA 3U4QA 1TUIA 4LHZA 3B1WA 1IHUA 4DLVA 3I73A 2OILA 3AEZA 5L3QB 4IEEA 5JCZA 2ORVA 1X1SA 3OHMA 3E2IA 3PIRA 3Q72A 2VF7A 4LPKA 3NEJA 3BAFA 4RKFA 1LF5A 1LTQA 1COWD 1RC8A 2WMNB 2QNRA 1E2JA 3SHWA 4RZUA 3TR0A 4AKEA 4DLTA 1W44A 3KQKA 1DS6A 4M4SA 5BN4A 2PT7A 2EW1A 3IBGA 4XVUA 5EE0A 1VTKA 1G3RA 1E3MA 3PUVA 1YZGA 2IYQA 1P62B 2GJAA 5E4FA 3CPJB 1UFQA 1Z8FA 1QHSA 3A36A 1AJEA 1AGRA 1L4YA 2GXUA 3CBQA 2VEDA 2WKRA 3W3AA 4GPTA 1EGAA 5CITA 4ARZB 4BE7B 4JJZA 1A5TA 1NVUQ 2ATXA 2GBLA 1WF3A 1LV7A 2XGJA 1VECA 3DMDA 1KNQA 3EG5A 4JKIA 3TVTA 3EZ7A 1N6KA 1T4GA 3QXXA 4KCGA 4C2UA 5JSZB 1KTVA 3REFA 4HDOB 4Y0VA 3FKSD 3JVVA 4C30A 5JCPA 1U0HC 1T5IA 2BBSA 2ZRIA 4CW7A 3I5YA 2BJWA 1F2TA 1XTQA 1ZU5A 2JIZA 2TMKA 5C4GB 2F1RA 3BB4A 4TT3D 4D0NA 4A92A 2PLFA 5DE3A 1UKEA 1W5SA 4RCYA 1DO2A 2IUUA 2VP9A 1XJQA 3I3SR 4BLPA 1P60A 5TY0A 2X2FA 4KHZA 5SZIA 2MSDB 2J0UA 2FFBA 1E4YA 1G1MA 3OEHD 2J41A 3HJNA 3CM0A 4RSGA 3WRXC 4N0EA 4LPSA 4KLNA 2ZREA 4QGHA 2DR3A 1R6BX 1DTSA 5JZVA 1D2MA 1D8TA 3ZZUA 1C9KA 2G1KA 3EIQA 3OE7D 5DHFA 1VG1A 1S8FA 2UVQA 2CHVA 4A0GA 4B74A 1KGDA 3UG7A 3HR8A 4A0HA 1IBRA 3SE0A 1G7SA 3D7MA 1HYQA 1G5PA 1MV5A 2HLDA 3Q85A 2JA1A 1U9IA 4PC6A 3RS5A 1U90A 3R8CA 4F91B 5IHPA 2FPMA 4JVNA 2YC4C 4W5WA 4C0LA 5DYIA 5B2ZA 5E7MA 3CKLA 4KU4A 4V0LA 4EDHA 4RD4A 2F55A 4KV9A 1H65A 3QENA 1L8QA 4LJAA 1US8B 3L8YA 4X8MA 3M1IA 3GLFA 1E69A 4HAWA 4JL5A 4LRWA 2AKYA 4XSHA 4BLOA 4PZLA 2R6AA 2ZAMA 2BM0A 1FP6A 4L9SA 3VR4A 3L8ZA 2OCBA 1GRNA 3ZIAD 3NBFA 2QMHA 3LWNA 3FYHA 3M0EA 1KDOA 1E0JA 3MWYW 2CLSA 4EPTA 3GLGB 3L2OB 1Z28A 3LAWA 1KI9A 5FR1A 1XWIA 3THOA 2WZQA 1AA9A 4EFMA 3FMOB 1UKZA 2WM9B 1S96A 3NTUA 2CJWA 2ECKA 3KTAB 1OH6A 3O8BA 4XD7D 1NF3A 4PTLA 5AUQA 4PAOA 2NTYC 3N70A 2MMCA 2OXRA 4Q7MB 2IL1A 4DT1A 5KPJA 2Q9AA 3AF1A 3HDTA 2RHDA 4GMXA 1JR6A 2J0VA 4B3XA 2JLRA 2XZLA 2QG6A 4PPFA 3NHAA 5KNBA 1YZKA 3EC1A 4MKFA 2EQBA 5DHAA 1SVSA 2FMXA 3RSOA 3QEOA 3BS4A 4QM7A 1N5JA 2WSSD 3GLIA 3B2EA 3ETLA 1ZU4A 4Q4JA 2BJVA 3BIFA 1TF5A 4LHYA 1NVWQ 5FFMA 4DIEA 3K09A 2WBLC 4P3YA 5KPDA 4HLCA 1MO4A 4KI0A 2QM8A 3AP2A 1YZTA 4DJTA 4M1YA 1JBKA 2QSZA 2DYKA 2QSYA 2Z43A 3KB2A 1GNRA 4IFEA 4RD0A 1OB5A 2FWRA 3SJBA 4Y0AA 4K81B 1BS1A 1HE8B 3FOZA 3C16C 2Q3MA 4V0KA 3VR2A 3WY9A 5AUOB 1NVVQ 1NJGA 2HUPA 1NRJB 1WQ1R 2H8KA 4WZ6A 1D9ZA 2QUZA 4AG6A 1FL9A 4BFXA 3U3KA 1CRPA 4D2IA 4E22A 2ZRDA 3THWB 1OKKA 1KMHB 1G4UR 3QG1A 2GA8A 2X77A 3KJHA 4NCJA 1G7RA 4S35A 3BH6A 3FHCB 1GG2A 1XEFA 5JJKA 3BFVA 1LY1A 2H7VA 2PMDA 3QXJA 3KKQA 3NBZC 1Z47A 4J0QA 1KI2A 2QGZA 2QP3A 1WB9A 2KBFA 5E95A 4ITRC 3LXRA 3LY5A 3K70C 3CNLA 2ORIA 3ZGXA 3H2YA 3UK6A 4H1UA 1N3BA 5JS7A 4PQYA 1YJ5A 2QPOA 4W5HA 2HXSA 4X8LA 2PX3A 4EPRA 1IY0A 2IXEA 3TUIC 2QE7D 2EWWA 1P9NA 5BYJA 3I8XA 3ADDA 2Z6VA 1YHNA 1G8GA 1OV4A 2QTVB 5A5GA 1TUEA 3N5CA 2N46A 1CR0A 2ZU6A 4MYTA 5EZ6B 3B1ZA 3WBJA 4Z51A 2R8RA 4OL0A 4RZ2A 3MJHA 1CRQA 2H16A 1Z6AA 4M1MA 5DO9A 1OSNA 1IN7A 3PR1A 3SYNA 2RGCA 4Q18A 1OFTA 2OAP1 4KFSA 3BK7A 4DLXA 1OH5A 2FX3A 4PC1A 1PLLA 2WMOB 1AQUA 4LBZA 3EPJA 5FUYA 3QF7A 5L3SA 2ZJZA 1ZD9A 1ZIPA 1F48A 2SHKA 4ZKDA 4F4CA 2D4HA 1Q1EA 2ZIAA 4JVSB 1CEEA 4JBYA 2A5DA 4TN1A 3AVXA 1SKYE 3D3QA 3AKDA 2J45A 3BBPA 4JYCA 1VIYA 4Q48A 3EIHA 3U3MA 2GXAA 5TV2A 4TL9A 1ZBDA 2W6ID 5BN5A 4CYMA 5BWMA 1JEDA 4OK6A 3VHXA 4CVNA 2O8EA 1SVWA 2WICA 3I92A 3SYLA 4XIGS 1MABA 2GRJA 4KBGA 3AF3A 3C7KA 1H8HD 3NC1C 4ACAA 2XNDD 3OEED 1WBBA 1DG1G 1KAOA 4QRHA 2RCNA 2F7SA 2JLZA 5JWOA 1QF9A 1DO0A 3Q7PA 5DN6D 1EWQA 2REXB 1XB2A 1UPTA 1JXMA 2IYXA 3IILA 3LFUA 2IT1A 2NQ2C 2V6JA 4QHTA 4TYYA 4LX0A 5L3VA 3CRQA 2ZYWX 4JMPA 2JLWA 1VKJA 1KSHA 1JR3A 4QNRA 3CUEF 2RKOA 5LD2C 1AGPA 2CL0X 1N6RA 2YJTD 3DHWC 3HP1A 4A0FA 5EXPA 2AK3A 1OHHA 4BZXA 1M34E 1E9FA 1X8LA 3K9HA 4YMVA 4NBSA 3AUXA 4KXFB 4A4DA 3ZVMA 3GFPA 1UAAA 1T6NA 2MSCB 3AVQA 1ZNXA 2VHTA 4BLRA 2GZHA 2WKPA 5EP1A 4BRWA 2O5VA 4IW3B 1G18A 1T3HA 2B92A 4V0ME 5L3RA 1WA5A 3K0AA 4NYMQ 1G6OA 3ZS8A 1RRCA 2J3EA 1ELOA 1CU1A 1KI6B 3NKVA 5FL7D 5DLQC 3IIJA 3CF0A 3RAPR 3TKLA 4LY6A 4Q01A 5JHGB 3MGCA 4KVGA 1WE2A 2O0HA 2IUTA 1U0JA 2EFGA 2QU8A 3X1YA 3IQXA 1XP8A 4IEIA 5KDDA 2VSFA 5K8LA 1XEXA 2PT5A 5EQTA 3CH5A 1NIPA 2J7PA 3LVQE 4URXR 1GL7A 4BPBA 3LLMA 2W83A 2ZRLA 3A8TA 4FCVA 1HQCA 4P33A 3U60B 1RPZA 3UMRA 3I5XA 2DFKB 1HT2E 1RRFA 1GZSA 1W4BA 2GAOA 5EE3A 1WDTA 1Z0FA 1Z2CA 1A2BA 1D5CA 5HCIA 1JPJA 4WAUA 1CJUC 3GLGE 1RYHA 2P6UA 2ANCA 2OG2A 2OBNA 1VHLA 2YWFA 3LNCA 2FSFA 3NBYC 1W5TA 4UKDA 5EP2A 1QG4A 1ZM3A 3F8TA 2VO1A 4DSUA 5JECA 5CJ2A 1BO6A 3TW8B 1KZGB 3KQNA 2WVJA 4GZMA 4OI2A 4W5JA 2DBYA 1E9SA 3BWDD 3HWSA 3K1JA 2VRWA 2QPAA 1G5RA 4TYNA 4TTQA 4DDTA 1DEKA 2RGNA 2FFAA 2IW3A 4FWTA 4KITB 5JMTA 5FL3A 1E0AA 1P61B 1QHHB 2ZSDA 3SS8A 4IFBA 4RFSB 4L15A 4NYIQ 4TYPA 3LBIA 2O8BA 5KUTA 1FNNA 2HEIA 4JL8A 3AVUA 2UZIR 2GCOB 4PC3A 5JI2E 1Z08A 1QHIA 3P26A 1VHTA 4Q1DA 4NPHA 3T1OA 1Z29A 1ZM2A 5FTJA 2YKGA 1BIFA 1YR7A 2XJ4A 4EPWA 5TXGA 4G5GA 4I1UA 2ZYVX 5JFGA 3WP1B 1CJTC 3LO5A 1NP6A 1ZUIA 1BMFD 4Q1CA 3TQFA 4D26A 2CHGA 1XCGB 3WMFA 3RANA 4B2PA 3AM1A 1E6CA 4QHSA 4OQXA 4YMTA 1OE0A 1EFRA 2AD5A 3VX4A 3KXIA 4Q4AA 4DEYA 1E9CA 1DAIA 3BD9A 2YOGA 4U02A 2D74A 3CR8A 5GJVC 2Z0MA 3W5IA 3IHLA 1YE8A 3GEIA 1E2MA 2MMGA 3GCGA 4DKXA 4DDWA 4GMDA 1AM4D 2F43A 2JDIA 3DVLA 2FOLA 4JBWA 3B9QA 3LX5A 5CYOA 3TBKA 3B7GA 2DCUA 5DI3B 721PA 4QXAA 2G9NA 4TL8A 1KY2A 3GJ0A 4CRWB 5JRJA 1QG2A 5F9HA 4JT2A 4R2IA 1GL9B 1OFUX 5EE5B 4DHEA 1H8ED 3M6AA 2EVWX 2XXAA 1KI8A 1OJLA 4XH9B 4ERNA 1W48A 4Z1MD 4FMBB 2BDTA 1XD2B 4CEJB 2IHBA 5FOXA 2O8FA 4MRVA 1BH2A 2W58A 3TVDA 2IS2A 3WYFA 3Q5EA 3KQHA 3GMTA 2BMDA 3QVUA 4Q19A 4M9XA 4YMSA 1QVRA 6Q21A 1KI7A 1E2GA 2ZR9A 1GKUB 1T8UA 2JJ1D 3QY0A 3PUYA 1KO5A 3NC0C 4TMVA 3QXHA 5J4VA 3BH7A 3RABA 2NO9A 2IA5A 5LPNA 2VSXA 5TB5A 5IK2A 3THYB 1QHNA 2IXFA 4MKGA 3LBHA 1VYTA 5HR5A 4HDQB 3SFZA 2J5XA 4EAQA 4B3DA 3QOFA 2DFTA 4US0R 1E2FA 4HZUB 1N5IA 1W47A 3ICQB 1ZVQA 4PX9A 4ASUA 4M1KA 2ODEA 1N25A 4ON9A 1ZNYA 4CEIA 2GF9A 3A1TA 2FEOA 4M9SA 2H5EA 4W7SA 4DCSA 2J59A 5J4YA 4WOPA 2X19A 3AKYA 2GVDC 1SVOA 3UG6A 3IO5A 3KKNA 3NVAA 4JYBA 3CX8A 4GT1A 4DZZA 4BFVA 4A8JC 3EPLA 5CM8B 2EWVA 2VP6A 4BECA 4B3GA 5H1YA 1XMJA 2FF7A 1XTJA 2QAGA 3OAAD 4WW0A 1W49A 1Y3AA 2B6HA 5JWHA 1NSTA 3W90A 3TUZC 3RC8A 1GVNB 1R0YA 1KSGA 4QJ5A 1Z0IA 3R8FA 4AYWA 2ZI3A 5FOWA 3T06B 4AYTA 1UJ2A 3E1SA 5GVRA 4GOJA 4KSBA 1A4RA 4CDGA 1II8A 1AKYA 2XSZA 2IXGA 4NYJQ 3QKRB 1L2TA 1R2QA 2BVNA 2JJ2A 4C0HA 2N1BA 1AZTA 4IOKA 3J81k 3RLFA 3OFNA 1U2RA 2QI9C 1II0A 5CYPA 4N0DA 4Q1EA 3CX7A 3X1ZA 1D6JA 4JLBA 3TQCA 4AWXA 4M9ZA 5AUPB 2IYYA 2OBMA 2N42A 3OF5A 2FG5A 1HA3A 3Q8XB 3SEAA 4PZYA 4GI7A 1NG9A 4PANA 3ND8A 4ZDWA 1EK0A 2XZPA 3CZPA 5D3MB 1YR8A 4Q9JA 2BEJA 4MGYR 3UPUA 4JLNA 4B48A 3TAUA 5HZHA 2RHMA 4Z8XA 1R8QA 1EX7A 3JVUA 1RYFA 1NVXQ 2DB3A 2AXNA 3PUWA 2H17A 5K8IA 1FPMA 3V4RA 4G3XA 2OCYC 2WJVA 5H70A 1CBUA 3CW2A 1ZJ6A 4EPVA 1DAKA 3MWLA 2MSEB 1CR1A 5JWRA 2ZEJA 2KE5A 1DAEA 3CX6A 4B6FA 1QHGA 1DE0A 3UATA 4CEHB 2BIFA 1A1VA 4W9MC 3RS2A 2WPDA 1KOFA 1N2CE 2QN6A 5CK4A 3Q5DA 2G6BA 4A2PA 1FX0B 2NZ8A 4URZR 4K8OA 4OQLA 4BLTA 1SGWA 1JI0A 1GAJA 3HU2A 4JS0A 3FPAA 1ZCBA 1P9RA 3T34A 4ABYA 4DCNA 4GDFA 1DBSA 2BV3A 1JAHA 4BLQA 2V7QA 1TEVA 5J4KA 2FPKA 1GFIA 4AKIA 2GJ8A 1TF7A 1ESNA 4A2QA 1XX6A 3IO3A 4ZIRA 4TTPA 3EA5A 1NY5A 5LDDC 1KYIA 2IYTA 2J7KA 2V9PA 4TSFA 4EIWA 4QM6A 2UKDA 1U94A 1E98A 1FNMA 4NCIA 2F1HA 3UXMA 1OXSC 1XDBA 3MLEA 3AQ4A 3TW4A 2PH1A 2GJKA 1DG3A 2EYUA 2QT0A 4B32A 1YVDA 1OXXK 4TMKA 3RS7A 2RB4A 2WWXA 1OH8A 4HDCA 3C41J 3AKEA 4XOIA 1U0LA 1TQ6A 1K6MA 1XXHB 3KZ1E 4M1WA 1B23P 2A2ZA 1VCMA 1E2PA 1FW6A 1LFDB 2IHYA 3EWAA 3A37A 3AB3A 4N1AA 3TLXA 4XWOA 4JSTA 4PAQA 4NONA 5KSPA 3PXGA 4US2R 2BEKA 2BMFA 2QMUA 2ONJA 3S1AB 2O8CB 4XTRA 2VHJA 2OT3B 4PPNA 4DLZA 1SKYB 4JT4A 4AC9A 1Q1BA 4CIDA 5KOYA 2BM1A 3NDPA 2IWHA 5EZ5A 1G3MA 3PV0A 2FU5C 3U4QB 3FHTA 2Z4RA 3TUJC 4LHWA 1E1QA 3C8UA 2ZSBA 4Q9IA 1J90A 1AS2A 4FIDA 3VMFA 4EPXA 2ZM5A 3GLHA 1Z5ZA 2PCJA 3QKUA 1R5BA 5FOVA 1OB2A 3IHWA 3QIAA 3FMFA 3OIWA 1T3SA 4TTRA 1KMQA 3R7WA 1GILA 2VTKA 4Q9KA 3W5JA 2OCPA 1W1WA 1FQJA 5AJXA 2QBYA 2HCBA 4IRUB 4DCUA 4Q4LA 2VP4A 4M21A 1XFAA 3FB4A 3FGNA 4B47A 3RWMB 1YRBA 3SBDA 3F0TA 1U8YA 2JIZD 1DAFA 1W0KA 3U7FB 2IYZA 4BZQA 4D4MA 1IN5A 3PQCA 4L16A 5AJWA 4ZPXA 1VPLA 5FTNA 5FPKA 2YWGA 4IOLA 1J2JA 1F2TB 1TAGA 2F9LA 4P31A 3PEUA 4D81A 2A9KA 4IVQA 4EQ6A 1ZC4A 2KSQA 4D0LB 5KHOC 3U6BA 3A4LA 4WZBE 3ZVNA 4IDHA 3KQUA 4N3NA 3WNDA 1Z22A 2J0UB 4C3ZA 5FOUA 1E2KA 2VHUA 3GJ4A 4IVPA 2HLDD 4KSCA 3QKTA 1FFHA 2WJJA 2NO0A 1G3IA 2GDJA 2WAXA 5FUXA 2WWFA 3V9PA 1KI4A 3QVVA 2WAYA 1E2QA 3WMGA 2ZYTX 1G9XA 2EFCB 3PEYA 3K0CC 2ZI6A 1K8RA 3G82C 1KHTA 1TQ2A 1SHKA 2REOA 3KUDA 4G01B 4KJZA 4UNRA 3O8CA 2QAJA 5EP4A 2X1VA 3K9LA 4MITA 4YDHB 1K5DA 2WSMA 1BOFA 2XTMA 3R9IA 3MD0A 2QRNA 1CLUA 2AKAB 5B64A 4BGDA 1MO3A 2ONKA 4LHVA 4G5SA 4M1TA 3CWQA 4TL6A 5DIFA 1LW7A 1RVDA 4KO8A 3WNCA 4XWKA 2PL3A 4X8HA 1G3QA 2OLKA 1RZ3A 1ZRHA 3GLFB 1W36B 4AY2A 3B78A 4KFRA 4OI1A 1GTVA 2Q21A 4TLDA 1IXRC 4C4PA 1XTSA 1Z6TA 1YRAA 1RKBA 2WHXA 1NBMA 3RS4A 1UEJA 3ADBA 2HJGA 4PO9A 5KSZA 4AD8A 3BOSA 4B43A 3MSXA 3O47A 2D3WA 2FDCA 1F5NA 2A5JA 2ODWA 1YQTA 1JAIA 3BH0A 1PLKA 2CBZA 1R0XA 1UADA 1XD9A 2CHQA 2CJWB 4TZ0A 4OK5A 3RSLA 5GADl 2D2FA 1TX4B 1Q12A 2QA5A 3AGQA 3K0EA 4CT4B 3GJ5A 1Q22A 4DLYA 4OQMA 4DT1B 1OIVA 2QRZA 3CH4B 4WBSA 2P0EA 1HEIA 5BN3A 1PVOA 1N6HA 3HU1A 1DPFA 2P5SA 5HKKA 3QG5A 3B8HA 2VF8A 3QKSA 4QBFA 4FMDF 1DAMA 1KK0A 1LB1B 2VHCA 5AWFC 2G3YA 2WWHA 4LCBA 2FEMA 1WRBA 2ZJOA 1M74A 4LC0A 1HT1E 4E03A 1MO5A 3GLIB 1IXZA 2ZU0C 1HUQA 1S3GA 3SHFA 2QQEA 4Q4JB 4RJLA 1CR4A 2ZI7A 5SZHB 3UIEA 2F9MA 4MH0R 1IAQA 3D8BA 3O8DA 3DEFA 4B6EA 5FBVB 4POAA 1OIXA 3ZJYA 5GJBA 2CLDX 1AN0A 1G41A 4M9QA 4OJKA 1NKSA 1CIPA 3OZXA 2HF8A 3FTQA 2NPFA 1OKKD 5DH9A 2D62A 1SXJA 3U5ZB 5IRCD 3AVYA 2JCSA 1CJVC 1JNYA 1I4LD 1S3SA 1BYIA 2RH5A 2W0MA 2WOJA 2NGRA 4OI0A 5JJLA 3EAQA 4Q9HA 2CE7A 4ZV4A 1YU9A 1ZUNB 2Q9BA 4RKEA 5KDLA 3TRFA 3SQXA 3WHKA 3FVQA 3KJEA 2DY1A 4HI0E 4HAVA 1GNQA 1UEIA 1J8MF 2AX4A 2BBWA 3K0FA 4S2EA 2WWIA 1KO4A 2X8AA 4B75A 2V6IA 2XB4A 2WIBA 1M2OB 2ZRCA 4JBXA 4JLAA 2JLUA 3P32A 4DDVA 3HR7A 4O3MA 2GEVA 3ONWA 2IS4A 2CNWA 1RW4A 3F3YA 4JIMA 4PZZA 3LBNA 1YKSA 1KI1A 1PUIA 3ICEA 1XXHE 4OHVA 4QOSA 1HURA 3DZ8A 4P4SA 4E07A 2RGGA 4M2LA 1DAGA 3NIBA 2VYFA 2BMJA 4RCZA 1SZPA 4V0NA 1KSFX 1RJ9A 1MRNA 4PQFA 1G7CA 4LJ9A 1Z0KA 1WCV1 3CRVA 3QQ5A 1CF4A 3OIVA 3EW9A 3I8SA 5L8VA 4JLVA 5HTKA 3RRZA 4Q9LA 1U8AA 2IK8A 3K0SA 2H1LA 2DWOA 3VNUA 2ZQ5A 4P4UA 5GJWC 2BCJQ 3SZRA 1KJYA 2ZSAA 5B30A 1RRPA 1N6IA 4MA4A 1SHZA 4LV5B 3SDZA 1Z3IX 1F60A
chains in the Genus database with same CATH superfamily
4YCAA 4EGAA 3H8VA 1QS0A 1J0BA 4RW0A 4HRAA 3ACBA 4B35A 4HVCA 5JTTA 5LLTA 1JLLB 1ZN7A 3QFCA 4HWOA 3WLFA 1TQ8A 2EBUA 4BCDA 1RWXA 3IIKA 5FDFA 3ICWA 3L4EA 3N8HA 4WLOA 3WLSA 3ZUPA 1JDTA 4Y9RA 1XVUA 4A8JA 1HSOA 3MMXA 2CDNA 3DE6X 1TQHA 1TKCA 2VRNA 2CJYA 4WACA 1TM1E 2XQVA 4MDHA 4L50A 4Q3EA 5DMHA 2IS6A 4ZDJA 2GCGA 5FBLB 2PXAA 1DSSG 1X77A 2EC5A 2O8EB 3C1UA 3V55A 2XUOA 3H83A 2PN1A 1R27A 3DLAA 1HFJA 1A9SA 1EFKA 3ET4A 2H18A 1YZNA 2IYPA 1MB0A 3RK4A 1A76A 1WZ2A 1BTOA 1G8JA 1XQXA 3AUAA 3G7NA 4GMGA 1V9LA 1B0PA 2BFBB 1QZUA 4ARBA 4RA6B 3LDGA 1MF7A 5F1KA 2HBQA 2IKQA 3LA6A 2QY9A 3BICA 3WGMA 4LK3A 1HTTA 1Y8AA 2IP2A 2XF8A 3GEEA 3R77A 4NARA 2XYQA 1N75A 4NZNA 2AL7A 2VDWB 2VTEA 4UFOA 5HMMA 3RSFA 4BMZA 2CV0A 2JANA 2CLCX 5EL0A 1JQ3A 4J7CA 1WUKS 4K9SA 4TVSA 5FADA 3DE3X 1XMQB 3BKXA 2VZ8A 1S2OA 2C9ZA 3HYRA 3P0JA 4KN8A 5D2CA 2GKOA 5ELMA 3K9BA 5FTLA 3IP1A 2IU4A 3BF8A 4RMHA 4PVCA 4RDXA 5CB0A 4YACA 4TLAA 2ZRKA 3OZIA 2LCQA 3PFBA 3VKFA 4MKZA 4I55A 2IHJA 4Q34A 3UCFA 4EG4A 1TZCA 4XJXA 1DWOA 1RVV1 2P30A 4URHA 1E2UA 1Q57A 5IDYA 4EJSA 2WJZB 3GLUA 4ZAZA 1XRRA 3E70C 2BFEB 3WK5A 2BHSA 3DTVA 1WHTA 3B13B 4PPGA 1BXGB 1U28C 1R6TA 4FINA 1M54A 1E7YA 3DWEX 3R76A 4EFLA 5AW7A 5HP4A 1WXDA 1AK9A 2IU0A 2GOYA 2P9BA 1V11A 1WUTA 2H1SA 3BXFA 5IUJC 3QUSA 3DDOA 4LDQA 4FQ8A 1E89A 2O7RA 4TWRA 5IF9A 1TZMA 4AJLA 2RI6A 4EI9A 2OY0A 5NULA 3HSYA 3TFQA 4CGZA 4CFSA 1PLJA 1T2FA 4GVLA 4M7PA 2QMOA 4HLUA 4NU6A 3ZCSA 2R8EA 1FX1A 3EQ6A 4AICA 4K7JA 1OYVA 3E1GA 2Q1TA 5GPBA 3JYNA 1XZIA 3FR7A 4MKIA 4DTIA 5A5FA 1WG8A 3JQ6A 1K4KA 1U98A 2JAUA 3PVZA 1VE9A 4QODA 5I4BA 1F6BA 1VZ3A 1VOTA 4HWPA 4QTYA 3U5TA 4J2HA 1LUAA 1Y5MA 1M72A 2P4HX 4MQ4A 3WB0A 1KK3A 1YR3A 2YFQA 3KTDA 3VPAA 3VR1A 1BQEA 1KH2A 2F90A 4ARCA 1JJ7A 1I4EB 1SUAA 3CRMA 4QA9A 2WSIA 3L0SA 4PFSA 2PQMA 2YOFA 2PV7A 4BNLA 4AMYA 5CXUA 4PGGA 2OXFA 2FOIA 2ZTSA 2F8TA 3NR2A 1HZZC 1KEKA 1PSWA 4GSLA 1Y6FA 1E1DA 2DG2A 2I55A 1RJFA 4HATA 1IY1A 2TS1A 2YUIA 3BJZA 4JWTA 4NSNA 4TMWA 4FGWA 4B4UA 2VP2A 1JAZA 4FW9A 2Z2JA 2YWXA 1EH5A 3UOWA 5HE9A 5AW6A 2A3RA 5GZ3A 1D07A 2W2LA 4IJKA 5JJ5A 3DLPX 4TLEA 4EFNA 3K5IA 4FYJA 3V8QA 2ZDHA 1ORWA 3K6RA 2AWNA 1JEEA 1CY0A 3VO8A 2AFIA 3FH0A 3IALA 1QXSA 3D7SA 3OLVA 1GCAA 3FZYA 1JPNA 4J0DA 3U3XA 3TSYA 2QG4A 3ETDA 5LP6A 4AJ1A 4K2HA 4BQEA 5KJEA 4CTOA 5GQSA 3DDNA 1LPOA 5AESA 1YS1X 3PYXA 3T38A 1Q1QA 1R0WA 4D98A 3DLTA 3THXA 4KQJA 2D00A 3RIEA 3GNQA 1FQKA 1M66A 3DB2A 3O1LA 4ZQGA 4H7HA 5FOTA 3PUJA 4B84A 1OB2A 4L8GA 3IXLA 1MTOA 1N9GB 5BW4A 3M49A 3FTFA 2JFUA 3RVLA 5BSEA 1XYGA 1JKFA 1DDGA 3E9EA 5A4JA 2JIDA 2NACA 2OCGA 4FFLA 4H1TA 1DOAA 1NONA 4R2JA 1EFPA 2QMYA 1HDIA 1N1DA 1PJ3A 2L17A 3CUUA 3GFTA 3FCEA 3MJCA 4NDZA 5HS6A 4ZTZB 4H3SA 4PU0A 3BWVA 1GL6A 1VJGA 2PMCA 1G5FA 2NVWA 2Q45A 1YH3A 3PBKA 3U1TA 2NO7A 4IJWA 4O1HA 4D0GA 1FMTA 3PDUA 1N5KA 1QDUA 3PX7A 3TKYA 2GN0A 3ROMA 3EUFA 3I1FA 4OQEA 4UEOA 3GFOA 1PGPA 1Y8QB 5AP9A 2XE8A 2C2HA 1DWQA 3CF4G 2FV8A 3OZAA 4Y67A 4HDNA 1ODLA 1VKZA 1OJ7A 4FPXA 4KMRA 5EXXA 3UGQA 1VXOA 3TCXB 3QOYA 4DR2B 3Q6NA 3P52A 4MQBA 1Z75A 3DC2A 3PWSA 2SCUA 5IDVA 4XWGA 4BWVA 3HGQA 3JZMA 3L8DA 5FEUA 4HAZA 4OJQA 3K4QA 5E6UA 1WD7A 3MWKA 1NHWA 3NORA 2XRFA 3INGA 3JASA 1NMEA 2CWWA 3L1HA 3FMPB 1RFLA 1SUFA 2OFWA 3W6UA 5ESWA 3ASYA 1E20A 3QPWA 5AJZA 5LBIA 2G07A 4DCVA 2VRBA 4KVAA 2V0GA 1MOZA 3JYLA 1ZK1A 2HF9A 2G7MC 3EH1A 4YQYA 4D02A 1U99A 3PHHA 1F9EA 1Q0QA 2J32A 4R98A 5ALRA 3SZOA 1NT4A 1RWMA 3ZBPA 5K01A 2DBQA 4F56A 1SUEA 3FDZB 4HSEA 3Q3CA 2GETA 5GOZA 2Q27A 5CTJA 1LVHA 1TKAA 1SOWA 2NTEA 1PDVA 2YASA 4PSVA 3SC4A 3L07A 3IUMA 1M2NA 4EVIA 2XF2A 1LV8A 3FIUA 5K99A 2QLJA 5HRCA 1M2WA 4MUBA 1IHPA 2DERA 1NXTA 3F9RA 4G4SP 5AI8A 3ER8A 1Y3CE 4BNKA 2ODBA 2W98A 3L77A 4JJKA 5DLYA 4FI3F 3AHFA 1UM9A 3H8WA 2BBOA 1WAMA 2WU1A 1OI4A 2BOVA 1VC2A 4PHHA 1AMUA 4CT5A 1TJPB 1X1TA 121PA 4HNUA 4ZWNA 2JEOA 1ISIA 3IUNA 4DV4B 2HRQA 1W46A 3HRHA 5DW0A 3QFTA 1U6IA 4Q24A 4P53A 1U4SA 3DS8A 4CM8A 2PS9A 3RKUA 4L8WB 5T64A 1DT5A 5IVHA 4EUEA 5B2FA 5IC4A 1KK1A 2IZ7A 4LZLA 5HNKA 2A6PA 1N0VC 1V39A 3JVDA 9ATCA 1PGOA 1NF2A 2D59A 2JHPA 3L7IA 3O31A 3E18A 4YXWA 2O2XA 4N6GA 3K0CA 4BP3A 5HK9A 2EP5A 2JKZA 1TF2A 2WAAA 3GP5A 2GESA 4X63A 4EX6A 5IAAA 3BT7A 1VYVA 3I30X 4U7PB 4BRWA 1FEZA 3KXLA 1EUDB 4CEIB 3UJ9A 2NNLD 3ETNA 4FGSA 1HDZA 1N2BA 4GZLA 3QU7A 4F38A 4AQ7A 5LIPA 1EHCA 4LQ4A 4GI1A 1XRJA 1KFKB 1MFPA 1WKBA 3S70A 1U9CA 1AO3A 1X8JA 2X3YA 1OWOA 2VL7A 2Y0EA 3IBFA 3LVBA 3MFQA 4IDOA 1D7AA 4LC1A 2QTNA 4GEGA 1LW6E 3PPVA 3ZDDA 3E3MA 1ACJA 1DC4A 3PC2A 3IKVA 2GH1A 4HDKA 2FTKE 3MF4A 3NZEA 1NMZA 4FBMA 4KXWA 4ITVA 5J1TB 3OQOA 4BVBA 5BY2A 4LAFA 4CQJA 3S27A 4FB5A 3H0CA 3MGBA 1T1SA 1YZQA 3DDSA 2NO5A 3N2KA 4A0RA 5EE9A 4ZVTA 3UKDA 3CVVA 2ZWIA 4OMUA 4TUYA 1T1EA 5DYNA 1W0JD 1UKYA 1JU9A 3IPLA 1ULUA 2HSWA 2Q3JA 4G5HA 1E6KA 4L73A 3GHHA 1GPMA 4WASA 2YRXA 4YRGA 3H2BA 5LA6B 2C2OA 2DUWA 3AIIA 4UMEA 4EF6A 2OVBA 3MBKA 4G81A 4M54A 3KYCA 5CEEA 3F1KA 3BFKA 3KU4A 4YMUA 1YASA 4RA9B 3OQ1A 4BFWA 2JKVA 4UUAA 3T35A 2X22A 5EJFA 4UCXA 2CB9A 2I2AA 2J9RA 2XCRB 3UMYA 1F8GA 4PWYA 4EHDA 2JG3A 4XIIA 3EFHA 4L4UA 3FFBA 4X0EA 4H08A 4J1SA 4YMWA 5DISB 1NTRA 1AV6A 2Q9CA 1RIIA 3EZFA 3O8LA 3V7YA 3PFGA 2AOUB 1P5ZB 2AUNA 2IHUA 5LZ4A 3O3MB 1OFIA 5G40A 3KJIA 2G4LA 4RTNA 1T5OA 2IRWA 2V7WA 3U4HA 3T1TA 1H05A 3PTLA 1K63A 3BXZA 1KMMA 1V8FA 1YZ3A 3DMNA 3N59A 4PRZA 1YAHA 4J1NA 3CCCA 2QQ0A 3ZE8A 4E5YA 3GQBA 1KFCB 5I9TA 4HLQB 4LTNA 4MKHA 4WK0B 5EMHA 4LISA 4LEIA 1G4AE 5A7HA 3ZJ4A 1NBOA 5AKYA 1A7JA 2GD6A 5EMLA 3FUCA 2ACVA 2JASA 4GICA 1SZCA 2AHRA 1U8XX 2CNDA 1UWKA 1U2EA 2ZUBA 4Z4QA 3KJFA 1E1MA 3NYRA 4L02A 4OH7A 2VCHA 3EY9A 4MYDA 3MM4A 2HLPA 4TWZA 2G0NA 4DV3B 3PUZA 4R8VA 3PGXA 5JZ9A 1EE1A 1EVZA 2I7TA 3GPCA 3SC6A 5ELXA 5JROA 3L1JA 4ZKEA 3FTEA 1UH5A 3RH0A 3IAS1 1RWVA 3GJRA 3PFIA 2ZAOA 3MT9A 4MUAA 4OU4A 1E79A 5F2OA 3QOXA 3X3HA 4DDUA 2G25A 1R5NA 4GKAA 1NRXA 3W2IA 4ZC1A 4RKRA 4AUNA 1ZJ4A 3KU1A 3K1YA 1PV4A 2JGNA 3HUFA 4V1CA 4E30A 3QVXA 3TXYA 3PXCX 5JEEA 2FA9A 4MRNA 5KWIA 1RYBA 2NIPA 1SUPA 2HFKA 3O2JA 5HQ3B 4IS2A 1EVQA 1DHTA 2QTHA 1SR8A 2E85A 1D6NA 2B1QA 1PW5A 5LC1A 1D04A 2I0FA 1TKRA 3CC8A 4OO3A 3TSAA 2FFHA 1GA1A 1Y82A 2UVPA 2YQ5A 3FPLA 2NXWA 3O4VA 3GRKA 4PXYA 1UOEA 1JBQA 5BQOA 1C9YA 2XGSA 3P71T 4QQKA 1WIWA 5EIBD 3IRVA 1TAHA 3NHBA 5CB4F 1KBOA 1RLOA 1ZD8A 1YHYA 4J3NA 1RE0A 3NG1A 3VSAA 4QOFA 4P38A 3B8EA 1W2WB 3LNTA 1CQIA 5CM2Z 1EFAA 4MYHA 2RGXA 5IM4F 3A4IA 1T5HX 3G9UA 3HJAA 3ND9A 2JFYA 1Z2AA 2P6NA 1G8PA 4GC9A 3WRYC 4F5DA 1FTQA 3WGNA 3IEXA 2AFHB 1COWA 1HNXB 1WZEA 1GEEA 1XDWA 1CZHA 2EHJA 2GWHA 1SU8A 4WY8A 4E32A 1J99A 4KNWA 2XV1A 4U39A 4ZO9A 1VE1A 1CEXA 3RNLA 3FOFC 1F51E 5DGTA 3GFBA 4QRIA 3ZW7A 2L69A 3CNHA 3IXMA 2TSYB 4YHBA 5FBRB 4LBWA 1XU7A 2A4KA 5DHUA 1HLFA 4QPJC 4CTKA 3ZLUA 3IELA 1MIOB 3A4NA 3JQEA 2I3AA 1FNSA 1X1RA 2O3JA 4FBLA 4JGGA 1TMKA 1E3TA 3BIJA 5CVCA 2H2FA 2IUSA 4IDPA 1SKAA 1XTVA 3GLHB 1QO7A 3IAXA 4U3JB 3W3ZB 2VHEA 2HWXA 2XRMA 3QVGA 3FZQA 4BEJA 4C4TA 2QG9A 3OOYA 2XGGA 1I13A 2AMJA 1W4RA 4AXBA 4LRQA 1Z25A 2CVPA 3PGMA 5MGBA 3QEMA 2MU1A 1MW8X 4ZZ2A 2YJ6A 3PSHA 1SQ0A 3R41A 4KWIA 4C2BA 3UCXA 1ORIA 1LFAA 2H92A 4TT3A 3UANA 2WUWE 2QR3A 2JD0A 3KIPA 3QVTA 4B73A 3DE1X 3GN1A 2JH9A 4DC0A 1TVKB 4G97A 4U7WA 1TYZA 3AESA 2KI5A 4UZEA 3DQPA 2GPSA 4CIWA 3NIGB 4U7TB 1I80A 4WPGA 2NZUG 5EZYF 3HQ4O 3ZQ4A 1DXOA 2DTEA 5LD2B 1KRHA 2F62A 1VCNA 3HCDA 1IVNA 1CNMA 3K1TA 3KPVA 3OE7A 5HQTA 3CWCA 3KLOA 2C9OA 1FTNA 3DTTA 3PC6A 1W19A 2QENA 1SD2A 4GGOA 2IHKA 4QOIA 2Z3ZA 4ESHA 1E3SA 1CPYA 3LHSA 2VSQA 1SXIA 1UIMA 1YZVA 4L5AA 4EQ6B 1NVVR 4ER0A 1ZBQA 3L0DA 2I8LA 1OXVA 1MT0A 4MJ3A 4UTPA 2WTUA 3VHRA 4D46A 4RPJA 1AXRA 4FKBA 4PLZA 3OP4A 1FSSA 3E82A 3EWIA 5EVJA 3REQB 2WF7A 3VKVA 4NG5A 2FMTA 1P73A 4QSMA 1QU2A 1CV2A 1NW4A 1C8BA 1T8WA 4ATNA 3GMSA 1KE1A 2PZLA 4DNOA 2EZTA 2OGWA 2GK7A 2FY8A 4AUKA 4UUBA 1N2GA 2JGEA 3QU5A 2JH3A 5LDGA 4MVJE 3OM1A 1ZDMA 5JIBA 1XTTA 1T8YA 3A6KA 4G4SO 4YJHA 1WCIA 2WJ3A 4BIIA 4ZAYA 1XPOA 1F9AA 1PWXA 5DLDA 2P75A 2WIFA 2ECFA 4FE4A 2IW1A 1E9EA 1PVDA 5HCNA 3L4JA 2BD0A 3GXOA 4DRZA 1TIBA 1BA3A 2ZJ2A 2PBZA 4DSAA 2GHQA 4MMXB 1RCUA 4IDCA 1B2RA 1DTWA 2FRDA 2X7JA 2FN4A 5JVDB 3W9UA 3OJWA 3A06A 1Y89A 3CW8X 3E1KA 3E4CA 3KXDA 3PKJA 3UK0A 2QX9A 5JEDA 5JY6A 5LMUB 4LXUA 4XD7A 4R1OA 1YMQA 2RGBA 3KQVA 2OXTA 4LJ5A 5CDGA 5HGXA 3L8FA 4NFHA 1I0ZA 1J56A 5JAMA 1B6GA 1TFUA 2VP0A 3M83A 3P9XA 4YECA 2PJRA 3S29A 3DVSX 3Q7QA 5CVVA 4PN7A 1NN0A 4WT7A 2Z3WA 2A8YA 2QLBA 2ZBDA 4FR2A 4PHFA 5JSKA 1MU0A 2ARKA 5EC8A 4DREA 2BFFB 5FUBA 5LWQA 5LMNB 2JATA 3QW4B 3S7TA 1G2QA 3EVTA 1EVKA 5IZCC 3DFKA 5EESA 3GRAA 3SEQA 3H2IA 3KSMA 4FN5A 4B7UA 2RAUA 4LXGA 3WJ1A 3DLCA 4D3ZA 1TCBA 4EHJA 5HKKD 1FOEB 4PYQA 1XMOB 1IZ8A 3A25A 2BN4A 1R88A 1Y5NA 3G1TA 5JE8A 2IS1A 4YV7A 2TMYA 3MWDB 3CGWA 3VVMA 5F2KA 4G25A 3O8NA 5KTOA 4P86A 1TQ4A 4UPDA 3NBXX 3DXFA 2FI1A 2EFYA 2VP3A 1FDOA 1X13A 1OGIA 1GKIA 3VR5A 3I4FA 4ETMA 1SVLA 3QKSB 3BUSA 3DO5A 4I4LA 5J4LA 4B1FA 3SYKA 2PEYA 1NYRA 3B1YA 3TNFA 3VR6A 4BEBA 3SVZA 2VH2A 4HB4A 1P4RA 2C0QA 4D8UA 4H1VA 1RWNA 3IC5A 4ZYLA 5DYWA 1QTIA 3RYIB 4TV9F 2BRUA 2FOXA 3DUFA 4V38A 2YWJA 4X1YB 3TLYA 1LH0A 5HMLA 4OMCA 1WO8A 4FE7A 2FR1A 4TQGA 3AQIA 5B58T 1WOMA 4JSYA 2GI4A 3LSTA 4QRDA 3LHKA 3M3DA 1SXJB 1OMOA 3IV9A 1K6IA 2XNHA 4P54A 2VTDA 5IZ4A 1HG1A 2D54A 1NYQA 1ULBA 2YMPA 5C8YF 4H9GA 5IVKA 3IURA 2YXLA 3VH4A 2LIPA 4WFQA 1KO8A 3H2GA 2WJYA 1MJHA 5HVNA 1EX1A 3HDGA 1KVUA 2P27A 1I1HA 2V8OA 4FGJA 2BGMA 3K0FB 4JK3A 1XE3A 2PX8A 4AL4A 3CUVA 5FA8A 1PJ8A 2DWUA 1CUDA 4ZYXA 3PDIB 2X3UA 4DA6A 3VPSA 2Z9DA 3WYNA 1JG6A 4TV8B 4NYMR 1L7RA 2C5LA 1G55A 2WAOA 3BDVA 4II3A 3ZU3A 4D82A 3V4LA 3FVRA 2GAJA 2R8YA 4J0JA 4NZPA 4NE2A 4J0GA 1Q50A 2IC5A 4H16A 1FJXA 2PL9A 4IO1A 1NUTA 2ZSFA 3LRTA 5BV0A 3GCDA 3JAWB 2J9FB 3HB0A 4GLBA 5K0SA 1BW9A 3L7CA 2XKJE 1OPXA 2JFHA 1ZL0A 2A5FA 2WP8J 4W8HA 3N9IA 4ZEVA 2D7DA 1GA4A 5I3ZA 3MCAA 2D1RA 4K0KB 4C21A 1I4TD 2RC6A 3C3JA 1JKMA 5EIBC 1RKXA 1XVTA 3A9WA 3OI7A 2IBTA 3V8EA 3SOPA 1P17A 2DFNA 2OC4A 2J48A 2ZJ1A 3OBIA 5FOSA 4GUAA 1N6PA 1NBHA 5JH7A 4BQRA 2FLVA 4NEHB 3N28A 1R8SA 3BD7A 1M1NB 4I5EA 3K6SB 2FE4A 3IQDB 4PZCA 3UMFA 2RAFA 2JLYA 4MWEA 4PX5A 2Y93A 3T5CA 3BF7A 3RSZA 1J7JA 1A04A 2BDUA 3G02A 5ILGA 1VDZA 3RTEA 2WJWA 4GF5A 1OZAA 3TLZA 2PLAA 5CG1A 5K2MA 3LUBA 1BN7A 3ROPA 3I76A 1H8HA 2O5EA 1FUKA 2GZDA 1X74A 4GWGA 3HI4A 3KK0A 5JZMA 2PZFA 2QD5A 1NA5A 2GBLC 3UQZA 4UTZA 3TIIA 3STWA 1K7EB 3PXXA 3TCKA 1F14A 2X8BA 2X86A 5TSDA 1K5PA 4FCTA 1ISFA 4JT8A 5DN6A 4BZZA 2C95A 3NYIA 3WLHA 3HVHA 4AN0A 3V1LA 4B6JA 1ZNWA 3SLGA 2WJ4A 4XDZA 3AXTA 3IVCA 2WM2A 2F8SA 5A4IS 2NYAA 3CNNA 2HTFA 3SHTA 3TR5A 2D7CA 1K7SN 2WOOA 5T8KC 2OBLA 2PWAA 2PLNA 3VNSA 4QTUB 4OOFA 4O0MA 4IICA 1BKDR 3GJ6A 2B35A 2B4KA 5CB6A 3R9KA 1SOAA 1N3IA 2K4MA 2GEBA 3D0OA 3T99A 1OTHA 4RH1A 2AJDA 2QQGA 3IQHX 1CE8B 4MR8B 4OA5A 5FUVA 3IA2A 5I7WA 4B3SB 1CUXA 2HZBA 2V5VA 1JRLA 1KI6A 5I7UA 4WXMA 1I3LA 3M7IA 1X87A 3WYBA 1ZEMA 2GPJA 1NMSA 1XF9A 3EXIB 3VUEA 2E87A 2M32A 5EWJA 2PJZA 2BKUA 3HJFA 1CP2A 4UVHA 4EY6A 3CZ4A 3R3UA 2HA3A 3ROTA 1WW8A 2DRIA 1Y4UA 2B7BA 5E9AA 4RXMA 4N4AA 4A82A 3KAPA 2DWPA 2GAIA 3NH6A 5J2TB 2BH2A 2V54A 1LI5A 3I1YA 1U8ZA 5BW6B 3KB8A 3P4UA 3CZ9A 3NXSA 4JGIA 4N18A 5FL7A 4YDSA 1SZDA 3MCUA 3QYPA 5H82A 1E1YA 3PR3A 4TYNA 3PD1A 4QT0A 2QU7A 1VL8A 4QHYA 1OF1A 3J7TA 3KJZA 4G63A 2BBTA 4BU1A 3IMGA 3NM4A 4H59A 3ZDQA 1QX3A 2H1RA 2R79A 1WCXA 1EK2A 3BXPA 3G9TA 3JR7A 3LYHA 4GVXA 4ZT6A 3RUFA 2NNWB 2ZZKA 1ZEJA 1MPXA 3RRMA 3W8EA 3NEAA 4F4FA 4MHTA 2IIQA 3NNSA 5IFLA 2O8DB 3ORSA 4OY3A 4U8GA 1ZM7A 2CXTA 2RSLA 3I6MA 2VHZA 3LWDA 2IGTA 1ZIXA 2FG7C 1V45E 2WTXA 1YFZA 3NRCA 4FDAA 2GZRA 4HKTA 4XVQA 5AKGA 2GF2A 1S2NA 1RXIA 2HJVA 3RYTC 2OP0A 4BGIA 4DM3A 1N77A 4CMAA 3W6NA 2EFEB 3QF4B 4JJFA 1Z6XA 4HR7A 3H87A 4X71A 1G6KA 4R7ZA 1FFSA 4KFUA 1ZOSA 4IWYA 5JDCC 1JYFA 4Q9AA 3ND7A 2JAQA 4K26A 4NBVA 3IP5A 1L4FA 3WA6A 2DT8A 1WPQA 5IT5A 4YRIA 5C53B 4XLZA 2E89A 3D31A 3HA5A 2Q6LA 3TL3A 4YQFA 2EYQA 5IMSA 1GN9A 4NICA 4BP8A 1VLLA 4ODIA 3IXQA 4OBWA 3TD6A 4Y2TA 1J7KA 3DKIA 2R44A 1XNJA 3LYUA 4LNAA 4X85A 5H4HA 1H5UA 3TMAA 1AD2A 1JKJA 2R6FA 3GJ3A 4HWGA 2Z6UA 3AUSA 2FNAA 1X1CA 7AT1A 3VU1A 1GUDA 1EGQA 1RQXA 1W88B 2Z8ZA 3H4MA 4MJ7A 2JLCA 5FORA 2YHAA 3TGPA 1XZNA 1U7ZA 3DG9A 2AXPA 1K7YA 4WMLA 3CMCO 3IH5A 4F1WA 3PWKA 4B31A 5SZJA 1MVLA 3MRSA 3ZZ1A 1XP5A 2EG5A 3F9CA 3HYCA 2J3IA 4MVWA 4WADA 3SI7A 3VNAA 3ABIA 4D79A 2R0QC 1FUUA 1NQXA 1O96A 1T5LA 1XDGA 2XOKD 4F1JA 4PTYA 4CLRA 1MZPA 2O54A 1E2BA 3U31A 2HN9A 3R0XA 4N01A 1JIUA 1VKRA 5ECGC 4G6ZA 3MMSA 4GI5A 4JUFA 2VAWA 4L4XA 3OETA 3RC3A 3LS2A 5HGJA 1DBPA 1YSCA 2R00A 1EG7A 1GPYA 1WUIS 1EJ6A 1VSUA 2ZB7A 1B8PA 2PFKA 3B20A 5F23A 1SG6A 1HORA 2JDID 2W6NA 1Y6GA 4YASA 3LCCA 3H9EO 1JALA 3LL7A 4RCVA 3RUPA 1BCRB 4C7VA 3E61A 4TTSA 5DSZA 2CV1A 1R3UA 2AMFA 2QUBA 4KC0A 1DC7A 5C5DA 1E2IA 5K0GA 3DHYA 3ZY2A 2WJAA 3R5HA 4XJSA 1MO2A 1RIFA 2GQ0A 3WISA 1XKXA 2VNJA 3F8WA 4KQMA 1AKEA 1W34A 4UNQA 2CJXA 4HH3C 3NNDA 1A77A 1X7HA 1XD2A 4ND8B 2A78A 2QM0A 3H2SA 3K6JA 2Y6VA 3VISA 4JYPA 2QSUA 4LHSA 1X1BA 1NLFA 2FFQA 4LBYA 3MTBA 1QYXA 1EDDA 4Q6WA 3UHFA 4AJ4A 4B8WA 4UCFA 3ETHA 2ODPA 5C1BA 3U9TA 1G291 4IHJB 5BWBA 1UDWA 3M9LA 1EFHA 4WX2B 2PUFA 1W85A 1WMEA 3U4AA 3H2JA 4Z1MA 1Y4SA 4P6VF 2OHIA 3QHAA 3H5AA 3B5EA 4RD6A 4UXJA 4RVOA 4AECA 2VDLB 3OWOA 1DARA 1L1EA 5FBWB 3U61B 5FBQB 4EELA 1DPGA 3ZIDA 3R3WA 3HVUA 3FIJA 2CMKA 4RACA 3RK0A 4BGVA 5A5VA 1SXGA 1M6VB 1X7WB 2OCXA 2QP9X 1N0HA 1NE2A 1YKFA 2PZEA 3HJRA 1D2AA 1YFKA 3OF3A 4JUDX 4N5DA 4YRFA 1V5FA 4QPZA 3WLIA 4BKPA 3VC2A 1GYPA 2BY4A 4UM8B 4URVR 3F7OA 3W6OA 5FR2A 4MMYB 2F8LA 5JMWA 3AF2A 4DXAA 3E0QA 1CT9A 1TK9A 2D0DA 1M6YA 3HO8A 4N03A 4WZBA 5K3DA 1GDTA 2NO6A 4DIDA 1BWRA 2QZ4A 3A27A 4D9EA 1AS0A 1ZA1A 1GM5A 5E4TA 1DQSA 4GX5A 1ZNZA 4BNNA 4BQFA 3LT0A 2OV6A 5M3BA 5M7EA 1II9A 1GU0A 4E3WA 2X0DA 1SEVA 1KAMA 1XVIA 3DCIA 3C87A 1VG8A 4PG5A 3G89A 3KDAA 4CF7A 4XDGA 3R7FA 4P34A 4MVJD 1T0UA 1A2OA 3FMVA 3FJ1A 2PD4A 3MT8A 1X8XA 3M4JA 3FDIA 1WSAA 1H6DA 4A2CA 4Y1GA 5G0VA 4Q4HB 2PQ2A 5KYWB 2WD8A 2WUEA 4RPHA 5CA1B 3NJRA 4HAYA 3WAJA 2ZIXB 4AP6A 1L8LA 1L4GA 2FEKA 4XM1A 1W2HA 4D3FA 4CODB 3ICPA 1XK7A 2YDYA 2RONA 3NV7A 1ISMA 1CR2A 3FE2A 4I8IA 3WIUA 4EB6A 2FK8A 5TR9A 4KDCA 5BVHB 3OAAA 3AYXB 3E22B 3PT5A 4DCMA 4NRDA 3ZDYB 1NJ1A 4ZO6A 4ACBA 4QEKA 3STUA 3FFAA 1FZQA 2EZ8A 4X8OA 1C30B 1T9HA 1Y5RA 2QB5A 4UARA 5GV8A 3Q8KA 1L7EA 2BP7B 1QZZA 1F1JA 3AU9A 4C5CA 1D2CA 2G1JA 1NBAA 2HD4A 3PCXA 2VXCA 4JKYA 3WWPA 4ZVPA 5C46F 2HMYB 3KXPA 4KGZA 4MS1A 1NHGA 1R6AA 2CJFA 1G42A 2YZ7A 3MOGA 3VU8A 4E70A 3M6LA 5L95A 4NP6A 1EP3B 2C82A 2OVFA 2J07A 1V96A 1CW2B 5IJAA 5ETJA 5I7OA 1VE6A 4LA4A 4IDNA 3OWHA 2VF5X 5KS2A 2O19A 1ZICA 2C96A 3H8SA 1IJKA 4E1AA 2JGRA 2G71A 3L9WA 3NOXA 5AJHA 1OPRA 4NTZA 5KNDA 2AK2A 2XKBA 3O9VA 1JB9A 2BEUB 4IV0A 3UW3A 4DNPA 4EFKA 2ZRJA 3QEBZ 2HCRA 2HYDA 1RYMA 4QTTB 2OYRA 1C9MA 1REQB 1YR2A 3MUEA 3OC0A 3W7AA 4E08A 3KUCA 4EK9A 1H42A 3HV0A 2ONYA 4I19A 4DLAA 1VYUA 3DKPA 1Z6QA 3DZFA 3LPMA 1JQJC 1U65A 1K8QA 1LDBA 2GAFA 2X3FA 4XLLA 3TSWA 3GYGA 4BCBA 4QL3A 3QUBA 2J5KA 3KZXA 3U1VA 3EZ6A 3KEGA 4OQNA 4AWBA 4OTZA 2PUAA 3N0XA 3AHHA 2NQTA 4BWYA 3C3CA 4LDPA 2OAQ1 3UGTA 4EYKA 1V1MA 1RWBA 4DS3A 4MDFA 3DO8A 5JS1A 3WVNA 4OI4A 4Z0NA 2VDNB 3UWPA 4MP8A 4A27A 4HT3B 3H17A 4LYHA 3O4JA 2R1TA 5EEHA 2DM6A 1Z4MA 4WLUA 2LUOA 2EHDA 5FPHA 2EBHX 4BASA 4BUJA 2GERA 5LJIA 1IBMB 3OOWA 4DY6A 1I7NA 4ED9A 4M8IA 1DBRA 5F21A 1OXTA 1OAOA 4E33A 4WBNF 3DOCA 3F5FA 4BMDA 3ZE1B 2G4VA 3PHLA 4ZO7A 5CM9C 1RHRA 1DCKA 2GN2A 4KODA 2PUGA 3IMCA 1M73E 3WZLA 2JZOA 1IOZA 4Q3BA 4EJFA 4Q3OA 2CLHB 1U3GA 2RJOA 4U9UA 3K70D 5AJYA 4DLSA 2AEFA 2WTAA 2XE6A 3ZYCA 1Z33A 4QREA 4U2EA 1DB3A 1SPXA 2PO7A 2R7KA 3GD7A 4W82A 4DQLA 1ZP6A 3DE0X 3KCNA 1P75A 3RSCA 1KFEB 1GGFA 4RV4A 4LS3A 4P4TA 5ALDA 3NAZA 4O6VA 1K75A 2ZYRA 3Q6MA 1GV0A 4PLHA 3PL1A 3GA7A 2YJNA 1YNOA 2YN2A 2PZAA 2XUIA 3EIUA 2W48A 5CLLA 1F4VA 4Z54A 3U80A 2OXIA 4XIFA 1O8CA 5E9QA 4AY4A 3NAQA 5DRTA 3B1XA 3I32A 1VIDA 2LWIA 4TZKA 4RLSA 1BYUA 1BEUB 2XKAA 1E1RA 5JNWA 5HHTA 2GCEA 5B37A 2GILA 1JHXA 4GQAA 3C6YA 1NLYA 3AVOA 3HHEA 3L7BA 4LOKA 4WCFA 2FUKA 3O8OB 1NL3A 4WNAA 5T57A 1FYWA 3DBIA 5DSXA 1SZJG 3GPBA 3UA3A 4XPIB 3B1WA 3C0KA 2C2ZA 1USUA 2JCVA 5L3QB 2MJLA 5JCZA 4ALMA 4EJMA 1U1CA 5AHRA 3D43A 1J09A 2H7CA 2VZ9A 5P8WA 3U1BA 3F73A 1NQ5A 3OU2A 3WV5A 1YV9A 3T7DA 2VTBB 3G8YA 4NV1A 4DZRA 5HYVA 5G4KA 4OBBA 5KSWB 1OX4B 4YT8A 3QU2A 2FB9A 1Y7TA 2PUBA 4JOSA 2I7VA 1R4MB 2HJWA 3K16A 3QJGA 1VTKA 1G3RA 4MUGA 3PUVA 3INRA 4XGIA 3QX3A 4GWLA 1L7BA 1C80A 2XYPA 3P2JA 4LN1A 2C0PA 5E4FA 3WICA 2YY5A 3FOCA 2KMLA 1Z8FA 3DBLB 3R5SA 1CQJB 4PS1A 1AJEA 1DNPA 3WIEA 1YL7A 2HSEA 2G9ZA 1S2LA 2WKRA 2JGDA 2VNSA 3CBQA 3W3AA 2G09A 2J5QA 4ARZB 3MGKA 4PBTA 4JJZA 4ZYVA 4LZJA 4MWSA 1U02A 3RSSA 4AKTA 1HE4A 1XALA 2RKBA 1R1DA 3GZNA 5CVJA 3UMCA 5K05A 3W5AA 3ZNQA 2XGJA 1W1UA 2HCFA 5EZ6B 1JDJA 1I1OA 1N6KA 3EXEA 3QXXA 3SS9X 5JSZB 2IZZA 4EG7A 3FKSD 3L1UA 2I67A 4J75A 4L8LA 4C30A 1I2BA 1U2GC 1PFWA 2XMPA 4QYIB 1IB6A 4J03A 3WWZA 5JCPA 5LKAA 4CMIA 4D44A 1ILEA 1T5IA 4DWVA 2IX9A 4CW7A 5BWCA 3I5YA 4CL0A 2B20A 5SYAA 1CUJA 2BJWA 2TMKA 3RKRA 2JIZA 4JZYA 4QUGA 2FPPA 2YS7A 2Q2OA 5HG0A 1W5SA 4R5MA 4U6QA 2IUUA 4PLTA 1VI2A 4OF4A 3H1PA 3PHCA 3N7UA 2FKAA 5TY0A 5JAUA 2X2FA 2BGGA 1SC1A 1YGPA 2BFNA 2FFBA 2RBEA 3KQPA 4K1LA 4RSGA 4B2YA 3WRXC 4N0EA 4QGHA 5CFMA 1X7ZB 1KEEB 1AMOA 3TSCA 3ZDXB 3T9DA 4DRXB 5JZVA 1WXHA 1CHDA 2FPRA 1C9KA 4O4HB 4BU0A 4HEA6 1PAUA 1S8FA 3UG7A 3HR8A 1EVJA 3K4PA 3SE0A 3RK1A 3TZEA 1VJCA 3FN4A 4FGLA 4WKBA 1D4AA 3D7MA 5ICCA 1HYQA 4ENTA 2QZSA 3JX9A 3D3NA 3UJPA 1Y81A 1I30A 1RR6A 1YI1A 4BMCA 3RU2A 2AF3C 4UD6A 1XHFA 5E7QA 4EMTA 2QRQA 4RPGA 3FRHA 3NDIA 3ICVA 1SRQA 5ELLA 1MVNA 3K15A 3EBLA 4YAUA 4H4DA 2LTAA 2P77A 3Q9SA 4J7AA 3ONFA 1H65A 4E1VA 1US8B 1BU8A 2TRSB 2C0CA 1YOVA 4E2ZA 2ZYHA 3ZX5A 5AVZA 1Z8DA 2R2GA 3PNKA 1HTBA 3PRJA 5DBHX 1V1RA 5EYPA 3JQ7A 4LRWA 1B8NA 4YRMA 1ZGBA 3FVWA 4NNJA 3TRIA 1F2DA 2QJRA 4OCZA 4PZLA 4DAOA 2CWDA 4R8KA 1FP6A 1N1GA 5FEMA 3VR4A 3B3JA 1GRNA 3DJYA