1DPFA

Crystal structure of a mg-free form of rhoa complexed with gdp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
178
structure length
178
Chain Sequence
b'AIRKKLVIVGDVACGKTCLLIVFSKDQFPAVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRARPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTARELAKMKQEPVKPAEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHOA
publication title An open conformation of switch I revealed by the crystal structure of a Mg2+-free form of RHOA complexed with GDP. Implications for the GDP/GTP exchange mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation/signaling protein
total genus 63
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 1999-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1dpfA00
1KI7A 2ZRCA 4MKFA 3KKMA 4RFSB 4US0R 3VX3A 4Q4HB 3GLIB 3MWYW 4IKEA 1CJTC 2F3RA 4MRSA 5LB2A 1IN4A 1ETUA 1VIYA 2JIZD 2W00A 2CK3A 2W2VA 2E87A 1DEKA 1IY0A 1N0VC 1E99A 1DAKA 1KO8A 1SQ5A 1W48A 3AVVA 5AUPB 1IXZA 1ZBDA 4GRAA 1ZD8A 4IDNA 3F5FA 3PCRB 3BJIC 3CWQA 2F1IA 3RYTC 2DFNA 3TUZC 5AJYA 3W34A 2YOFA 4OQFA 2J59A 4JVNA 1XXHB 3MJRA 2F7SA 3K09A 4X8MA 3UWKA 4G3XA 4E09A 2W0MA 2XSZD 4ZKDA 4XWKA 1Q20A 3L0SA 4Q1DA 5CDFA 1TQ4A 5FBVB 1XMVA 5FH9A 3OIYA 4B76A 4D2IA 1OYYA 1KK3A 2FWRA 1IBRA 5GVSA 5JI3E 3LX8A 3GFOA 3TH5A 4DCSA 3ZD7A 3VQTA 4CEJB 3AF4A 2OSBA 2OCAA 1M34E 5FUYA 2HCBA 2IL1A 5HZHA 5KNCA 2J0SA 1GL7A 2IYQA 3MFYA 4PO8A 3VKGA 3K0AB 1E9EA 3ASYA 3GLGB 1V5WA 3IPXA 3I73A 3I1FA 4QGFA 3QKRA 1WXQA 3ADCA 2GVDC 3IHWA 3TSWA 3QJYA 4UNSA 1UEJA 3GFPA 4JT2A 2IS4A 4FCVA 4B6EA 3FHTA 2ZI7A 2IYXA 4RZXA 4JSYA 1C4OA 1S3GA 3RS5A 1GRNA 2ANBA 3ICQB 2MSCB 3AH8A 1W5TA 1E98A 2VF8A 1EX6A 4CGZA 1U81A 4C0HA 2BCJQ 3MWJA 2IXEA 4M2LA 4M1KA 2R8RA 3HDTA 2EYUA 1KI8A 2ORWA 4II7A 5JJIA 1P9NA 2HEIA 3N2IA 1WA5A 1OH7A 1DVRA 1E69A 3I5XA 4WOPA 2QQEA 2CHQA 3U2QA 4E5UA 1XJQA 2NZ8A 4A0FA 1VG1A 1ONBA 1WMSA 4RCYA 3MLEA 3UANA 2OAQ1 5JWHA 2VA8A 1OXUA 4QNMA 3QF4B 4OJQA 1E1RA 4NH0A 2D7DA 3KB2A 2JJ2A 3V4FA 4BLOA 4URXR 4KSBA 5KDDA 4OL0A 3K0FB 2XNDA 1RJ9A 5FOWA 4PX9A 1TQ2A 3OIWA 2GCNA 1IN7A 2FX3A 2OCBA 2KB0A 4IXMA 2QY9A 2ZJBA 2IT1A 5EP3A 1EFUA 1UDXA 2BCGY 5EXTA 2ZS9A 4QHTA 2RMKA 2WWHA 3BRWD 4RZ3A 4DXAA 2ZRPA 1KY3A 5AUOB 1F5NA 2WJVA 4QJ3A 1GL6A 1WCV1 2C04A 1XCPA 1K8RA 4B3GA 4JKYA 5J47A 1UKVY 1A1VA 1DE0A 4B43A 2MSEB 1SXJA 3W3ZB 1IY1A 1MR3F 4JLBA 4TSFA 5KPJA 1O87A 2FFHA 2ONKA 4KJZA 1XB2A 4CYMA 3IIKA 2LCFA 4XSGA 2ZQ5A 1E0AA 1KYIA 4D4JA 3QBVA 8OHMA 2R62A 3HPRA 2ODWA 3K70D 1KSJA 3IQWA 4HAZA 4XSHA 1UM8A 821PA 5KSYA 4HYYA 2QAJA 2WAYA 2CL7X 3SZRA 4BFSA 2ZR0A 1PUJA 2VL7A 4B3FX 1GSIA 1NRJB 2OAP1 4FMDF 4Q02A 4Q1FA 4TMVA 1LNZA 3ZJYA 5HPYB 5H70A 4XOIA 3LWNA 3WNCA 3SI7A 1Q0UA 4EPRA 4FINA 1Z0KA 4JVMA 1XEXA 3N70A 3KJIA 4QBGB 1VTKA 4CDGA 1ZW6A 2QEQA 1G1MA 4GP6A 2RKOA 2YZ2A 1XDBA 3WMGA 3JVUA 4JVLA 5EZ5A 1XMJA 2RGEA 3REGA 4C0QC 4M4SA 4ZV4A 1RRPA 3I61A 2C99A 5F9FA 2IXGA 1S4QA 5EJEA 4RD6A 4AI6A 5TXGA 1IJFA 2WIBA 4PAOA 5F9HA 3AF3A 4HLUA 4Q01A 2KWIA 1P4SA 4A2QA 1OHHD 1E2MA 3HU2A 4URYR 3HYTA 2XZLA 3AVWA 2QA5A 2J7PD 2XITA 3IPYA 2WWGA 1PUIA 3O8RA 3WHKA 1ZAKA 4NYJR 5CJ2A 4P33A 1VKJA 1S2MA 1XTRA 1X1SA 1CJVC 2VHTA 1E94E 2A7QA 3D31A 5G53C 2CLSA 3THYB 3GEEA 2RGGA 4G5SA 4NYJQ 2X1VA 5FBQB 1T9HA 4V0MA 3NXSA 4ZPXA 1DAHA 4A6XA 2NGRA 5B57C 5JJKA 2VSXA 1JR3A 1U90A 4JYBA 2WKPA 3C15C 2IYWA 3IEUA 4U02A 5E7MA 4BECA 3AVXA 2Z43A 1ZCBA 2ZXUA 1CS4C 3AKDA 2G88A 3EW9A 1QBKC 1DAFA 3RRNA 1NKSA 3AVQA 1DOAA 5EUQB 3X1WA 3TQCA 1Q1EA 4B35A 2UVQA 1KOFA 4DRZA 1E0KA 2DWOA 3EA0A 4ASUD 2NZJA 2YOHA 2ZYWX 3A4LA 2GK6A 4I4LA 1UKEA 3GEHA 3U3MA 5LDDC 2W6ID 1X3SA 4V0NA 3EG5A 4NYIQ 1IJEA 4YXWD 1U9IC 4TYYA 3SFZA 1UFQA 3A6PC 2J45A 3OE7D 1XTJA 5FBWB 5DYGA 1NG1A 1J7KA 2NO1A 3NBZC 1OB5A 2VP6A 4M1TA 1RRFA 3EX7C 1OJLA 2QRNA 2XB2A 4LPKA 2O8FA 1G19A 1AKYA 1KI1A 4OQNA 2LWIA 1JNYA 1VMAA 2H17A 1R5OA 5L3SA 1NN0A 4PPGA 3KZ1E 4I1VA 3ZVNA 1SVOA 1OT3A 4IRUB 1GILA 4TTPA 1XU4A 2YJTD 5JSZB 1G4AE 4FN5A 1Z28A 2GETA 1KI3A 1ZNYA 3V00A 1JAHA 1G8HA 1UDWA 2J9RA 3L0PA 2ZIAA 5TV2A 2ZREA 3OF5A 1XWIA 2FZ4A 3PV0A 4JS0A 1IY2A 4LSGA 3THWA 5KDOA 1N0WA 3L82B 2FSHA 3MRSA 5FOXA 3IIMA 2B6HA 1RIFA 4JLDA 1YJ5A 2KSQA 3ZYCA 5BXQC 4Q9IA 4EPWA 3DZ8A 2J87A 5FTMA 3MG9A 1Z47A 4PC7A 3NBFA 3BGWA 5GADl 4QFMA 1IM2A 2R6GA 1KK2A 3CPJB 2J0UA 1T91A 2CXXA 3GLHE 3RDPA 2V7QA 2BKUA 2ZJ2A 3T34A 3TRFA 1YR6A 1Z29A 3WNBA 4LRWA 1XP8A 4MYHA 4YONB 4LHVA 2IYSA 4OQXA 1IN6A 1XX6A 2WWXA 3ZD6A 1JJVA 2DB3A 4KBGA 4PO9A 3QKSB 4ZDWA 3CNOA 1Z07A 3NHAA 4IEEA 4AKGA 1N5LA 3TIFA 2PZGA 1RYHA 3KL4A 4F38A 2GJ8A 2X77A 3KFXA 2O5VA 5ANRB 1N6KA 4ITRC 4YMUA 1UBFA 4KXFB 1XD8A 5E7IA 4R2HA 4I1SA 1OKKA 3A1SA 4B3CA 5EXSA 2HJVA 1OXVA 1DG3A 4IOMA 5FOSA 3DKPA 3TAHA 1D2NA 2Q9AA 3VAAA 3D3QA 2KBFA 1NVVQ 1HYQA 3B5JA 2QUZA 5FUWA 4DLYA 2FN4A 5CB6A 5GJVC 3QXHA 3FOZA 1OIXA 4FIDA 4TLDA 2J0QA 2BKEA 2Q21A 2RGBA 2Q9BA 4JLOA 3AM1A 3DOEA 3RS7A 4FD2A 5AJWA 3AGQA 2JEOA 1KO7A 2PJZA 2JLRA 2W6JA 1R7RA 5BWMA 2P6RA 2GNOA 5DHFA 1G41A 1NLZA 1MKYA 4G5QA 4EFLA 4Z51A 2Q9CA 3K70B 3I32A 1NLYA 3VU9A 4X8OA 3T5GA 4Q9JA 1CTQA 1P2SA 1T4GA 3HPQA 3K9GA 3BK7A 1GFIA 1E9FA 1EXMA 3MSXA 3QQ5A 2EYQA 3RC3A 1FUUA 2ZTSA 5C46F 1IXSB 2YWGA 4JYCA 4TYWA 2XNSA 1P5ZB 1M8PA 3CF0A 1X6VA 1OIVA 5FPTA 3KQNA 3EPHA 1LVGA 4MYCA 3GLGE 5J4YA 1ZJ6A 2RHMA 1TU4A 4LJ6A 4RD3A 1SXJB 1DADA 4EPYA 1Z6TA 4QL3A 3I92A 4C0JA 4BLRA 2CL0X 1Q22A 3IHLA 1H8HA 5HKKA 3EZFA 5HCIA 3MWLA 5FTLA 4ZI3A 1Q3HA 2XTNA 4HI0E 2JLWA 3HR8A 3CRQA 4NDZA 1N6RA 4C9BA 4PC2A 1VCOA 1MO5A 1D9XA 1MO3A 1AQYA 5K8UA 1HT2E 3PUWA 1HE8B 1TL7C 4KFSA 1KO5A 1U8ZA 5FPSA 4ESVA 2BWJA 2EFHB 4K81B 4EPVA 5FL7A 3WBKA 4CRWB 1TEVA 1NN3A 3K9LA 2ZRAA 4MA4A 3IBGA 2ZITA 2QRZA 5C18A 1T3LA 2IHYA 4DLWA 1X86B 1Z08A 2N1BA 1M6NA 1AQUA 1R0YA 3P1JA 1GNPA 2JA1A 3MAAC 4F7WA 3K8YA 2MMGA 3OFND 1LY1A 5KPDA 1SKYB 1VG9B 4JL5A 1U0JA 3CZQA 1Z22A 3KKNA 3LQRA 2ZJZA 2F6RA 4BFUA 1Z5ZA 2ZE7A 4NBSA 4QJ5A 2AFIE 2HT6A 2NPFA 4E07A 2IYUA 1P2TA 2ZANA 1I4LD 2FZLA 4TMXA 1N6IA 5TMPA 1Z6XA 2FSIA 3CO5A 4QBFA 2RGAA 1F2UB 1Z0DA 1GP2A 3UMRA 1CBUA 3T15A 1XEFA 2JDID 1W4BA 3ZQJA 1P9RA 4DUGA 1KJZA 1MABA 2JLUA 3NC1C 3B78A 1M7GA 2J46A 2QMOA 2GXQA 2CNWA 2VF7A 4L5BA 2D3WA 4BGDA 3SN6A 4H1UA 4QBHA 3TSOA 1ZVQA 4GOXA 1Q1ZA 5A4JA 1ZD1A 3KX2A 5L3RA 3SJBA 3EWAA 1ZIOA 3Q9LA 3AVOA 3U7EB 1KK0A 2JASA 4RD4A 2R6DA 4AURA 1R0WA 1CR2A 4PQFA 3ICEA 4PO1A 4LJ5A 2QI9C 1YU9A 2ZSBA 4GDFA 2D74A 2VSFA 3LXXA 2QPTA 1OFIA 4N0EA 2QZ4A 4OYHA 4DKXA 3ZDQA 3GLFB 1F2TB 1TUIA 3TW8B 2QG6A 2O52A 3B7GA 2EQBA 4TN1A 5DO9A 4UXIA 3DM5A 4FWTA 4GSYA 1CJUC 1NN1A 2FJUA 1QHHB 3PEUA 2I3BA 4DDVA 2ZYVX 3HU3A 4PFSA 4UJ5A 4Q1CA 1V43A 4BLPA 1AS0A 5AJVB 1ESMA 3A1VA 2HXYA 4MGZR 4WZ6A 4D0NA 4F4IA 1VHTA 4OHWA 1KJYA 1D6JA 4G0NA 2B21A 1Q1QA 3LQQA 2I1VB 4WXRA 5JHHB 3NHBA 3LBHA 5AUNB 2YINC 3OIUA 3TVTA 4F4CA 4EFMA 2QM7A 4HZIA 1R5BA 4AYXA 3QSYA 1YRAA 3SHWA 3X1DA 1Z6YA 3KQLA 4TT3D 4DEYA 5BN3A 1E1QD 1G8YA 3BFVA 2GJAA 1XPOA 1G64A 1ZCAA 1QG4A 2OUKA 4Z54A 5DN6A 2R2AA 4A4DA 4ZI2A 1AIPA 5CIQA 2ANCA 3LVQE 2H5EA 4D4MA 1TTTA 3QENA 1CF4A 1MO6A 3GJXC 2VQSA 3WRXC 2C9YA 1G18A 2J7KA 1N6PA 2FGJA 1K5GA 2QU8A 1YKSA 4DDWA 1TX4B 4HZUA 5JWOA 3QUSA 1N3BA 1TMKA 2V6JA 3SYNA 3F8TA 3OEED 3AKCA 3ZIAA 1T8TA 3QXCA 4UQOA 3DKVA 1CXZA 4XD7A 3T1QA 4PHHA 4BLSA 4CT4B 2RGNC 4A9AA 3WP1B 4GL2A 1J8MF 4BZXA 3U6KA 3U5ZB 4OQLA 2Z83A 4GMXA 2QP9X 4LCBA 3H84A 1DAEA 2XB4A 3AP3A 3CRMA 3L0IB 2ZUDA 1NMYA 2C8VA 5EQTA 3AEZA 1YZNA 2X2FA 3W9YA 4DC9A 3A58B 3LH5A 3T12A 3PXGA 1RVDA 3CLVA 4AG6A 1E2PA 1AS2A 4GMDA 4JBXA 3KQHA 1HTWA 4C7OA 1BMFD 2ZJOA 1RKBA 1PVOA 3LFUA 3PUYA 5DI3B 1Q21A 3U3JA 4EFNA 4A15A 1RC8A 4LHYA 1XCMA 2OESA 2QTFA 1WE2A 5IRCD 2R65A 2ZRHA 4Z8YA 1E32A 3HWSA 5KUTA 2C9CA 3IO5A 1JB1A 4EPTA 2VHQA 5DYIA 2HJGA 1CRPA 3LW7A 3PR1A 2ZI5A 2Z4SA 2BVNA 3W6OA 4B32A 2WKQA 5AJXA 3WYAA 4DJTA 3WYGA 4Q4JB 5DHAA 3CB4A 3VU9B 3AB3A 4OI4A 5DE3A 1ZD9A 2IYZA 4HDOB 1NN5A 2JLVA 4XWAA 3T1VA 4PC1A 4X8LA 3SJZA 1II9A 1ESNA 2DFLA 2ZSFA 5EP4A 2VHJA 3LBNA 4D4LA 1RRCA 4CZ2A 1W0KA 3KKPA 5FTJA 2PCJA 2JIZA 2HV8A 2GZAA 1C9KA 3RRMA 3KTAA 2H16A 5JBQA 4PZLA 3HYRA 3VTKA 2VO1A 4AIIA 5A0FA 3QEOA 5D3MB 4URWR 1OV4A 3O8DA 2GJKA 4B47A 2F1JA 5EZ6B 2D4HA 2WMNB 4C2UA 3AP1A 3CPHA 4CEIA 1GUAA 2YC2C 2EVWX 3BB3A 4M8NE 3SBDA 3GPLA 1LS6A 1MO4A 2Z0MA 3AVUA 1GWNA 4TMWA 5KNDA 3KXIA 2C5LA 3REFA 1H8ED 2QROA 4A92A 2ZI4A 4S2EA 2QENA 1E9RA 4H1VA 2O8EA 4N1AA 1VG8A 1PLLA 4P31A 4W5JA 1YR8A 2DWQA 5BYJA 2A2ZA 4URZR 3RRYA 4IHQA 4FCWA 2XXAB 2X2EA 4DSTA 1DO2A 3CH5A 4UNQA 1G7CA 1UEIA 1XTIA 1FTNA 2WWWA 1GL9B 2NTYC 2RAPA 1G7TA 3B9QA 1YZLA 1MV5A 1I2MA 2GHIA 3RS3A 4QKQA 4LV5B 2CVFA 1Q44A 1DPFA 2NO9A 1E4VA 4G5GA 1G5RA 3B82A 2V8OA 1T3SA 1QF9A 3FPAA 3VX4A 5CITA 4YLGA 1E2NA 2CK3D 4WZAE 2FH5B 5D3QA 4P3YA 2EWVA 5P21A 3RS2A 2ZETA 1VCIA 1KO4A 3WYFA 4A6PA 2WICA 5FL3A 4LV6A 3NBYC 3VR5A 4C0AC 3NDPA 3C41J 4IFEA 2WPDD 1DS6A 2WSSA 1RW4A 3K0SA 1CJKC 3KJGA 4RKFA 1MOZA 1FL9A 2ODBA 1G8PA 2G0NA 1YVDA 2QMUA 3C5HA 5EP1A 4F92B 2KI5A 5FI1B 2AN9A 3IILA 3N2EA 4HLQB 3DZDA 1FX0A 3G5UA 4WAUA 5B2ZA 1DAGA 2WOJA 2VH5R 3ADKA 3S1AA 2A9KA 5LB4A 4ZKEA 1JXMA 2HDNB 4Q66C 5SZJA 2I4IA 1E2IA 2ZYTX 4S35A 1NSFA 5L3VA 4FI3C 1U8YA 5CM8B 4U7DA 2QORA 2ZJYA 2R6AA 2BMJA 4KU4A 4LDJA 3QY0A 1N25A 4KVGA 3FDIA 3QVUA 4HAXA 1PZNA 1N6LA 2O0HA 4MDFA 1U8AA 5GJBA 2P2LA 4TLBA 4I1OA 2LKCA 1YR7A 4LC1A 3B1VA 4DLVA 4ZO4A 3VHXA 4XVUA 4M9QA 1T6NA 4ACAA 3QXXA 2GCPA 2HYDA 4BWYA 2QNRA 4GZMA 4IXNA 4POAA 1F3OA 1P6XA 1MT0A 4PHGA 1QHXA 2ZJ8A 1KY2A 4DT1B 3U44B 1S3SA 3D7MA 2DHRA 2QE7A 5KOYA 3CRW1 4JL8A 4MQBA 4TL9A 2GCOA 2WWIA 4D0GA 4K8OA 1ZM4A 1II8B 2Z5FA 1XEWY 3OEHA 3ETLA 4M1OA 2GJ9A 1OFUX 2QSYA 2RGXA 4TWZA 4HB3A 3P26A 1WBDA 4Q4AB 2ZRFA 1M2OB 1G3MA 4XVRA 2PL3A 1HE1C 1KJWA 1XD9A 1B0UA 5IK2A 4EJSB 4LJAA 4A1FA 2IF0A 3AVTA 2VP5A 2WWYA 1FP6A 2EWWA 4G5OA 2QAGB 3FVQA 4P4SB 521PA 1E1RD 3BH0A 3H2YA 3CM0A 3GFTA 1VG0B 1OPXA 2JJ2D 4KV9A 4LJ4A 1G17A 4AD8A 2XNDD 1RE0A 4ARZA 2GBLA 3QPVA 4QG7A 2O8DB 3P4YA 4AKEA 4ERNA 3ADDA 2BMDA 2CCKA 4Q00A 2V55B 3K1JA 2DWPA 3PUZA 3LRPA 1XNJA 2QBYB 1P62B 3Q7QA 4LHZA 1US8A 2QQ0A 3KFVA 3QNUA 4MRVA 5FBLB 5LPNA 4A8JB 5C1BA 2NO0A 2ORIA 5FPYA 1YZUA 5EE3A 2A3RA 4W5WA 1G9XA 2HYIC 1KMHA 2OBNA 2O8BB 4KCGA 3TLXA 3R8FA 2H1LA 1P7CA 5L3QB 4DDUA 3QXSA 1YRBA 4IVQA 1SXJD 1XJCA 2J7PA 3TW4A 4LI0A 4TSFD 2Z6VA 5F3WB 2RHDA 3B85A 2IA5A 3NH9A 4ZCMA 4UXJA 2JLXA 5KO2A 3DMNA 2BM1A 3EWSA 4B48A 4M9SA 4J0QA 2YVUA 4Q7LA 1PLJA 4TZ0A 1R5NA 3DEFA 1QHNA 2C95A 1XTQA 4LBYA 1KI2A 1Q12A 4BFVA 5JEDA 4C7OB 3KUCA 2G83A 3T1TA 5J4VA 3U4QB 4F93B 1SKQA 1GNQA 4LJ8A 4M9ZA 3SDZA 3K70C 1CR4A 1A2KC 1R6BX 5EXPA 3TSZA 2WV9A 2RGDA 2ZS7A 4LUCA 2CCGA 1ANKA 4GZLA 3WMFA 3HJNA 5JI2E 1AJEA 1OXXK 3A1TA 1DBSA 1OFHA 4RFVA 1RZ3A 1S9DA 4CEHA 4M1YA 1VIAA 4RD2A 1P75A 5CK5A 4ZIRA 1N5JA 3VNVA 1ZNWA 3QF7A 4N3NA 3MWKA 5JWRA 3FTQA 1E79D 2W6IA 3L2OB 1D2EA 3PUXA 4NKRA 1U0LA 5EE5B 4B74A 4YXWA 4P4TA 4BQSA 2CJWA 1NY6A 1OXTA 4B3BA 1SXJC 5KTYA 4AC9A 2BM0A 3QE0A 3WBJA 1AZTA 2PBRA 1XPRA 1HH4A 4LHWA 2IBMA 3FYHA 2ZEJA 4AYTA 5K8TA 3KXKA 4PPFA 2A5DA 2QPOA 4KO8A 5B58C 2AD1A 2V1XA 1P9WA 3DDCA 1M74A 4B75A 3GJ4A 4HSEA 2OCYC 1LB1B 621PA 3FWYA 5JRJA 5JRZA 4JVSB 3CR8A 3AUXA 4Q1AA 4GPTA 2NO7A 1W36B 4RKEA 5F2EA 2E1RA 4KBFA 3KKQA 5L8VA 1JR3D 1NY5A 5EE0A 3SJAA 1LF0A 3AF2A 4XTCS 1GDDA 2ZSEA 2D62A 3PFIA 4RCZA 2HT1A 1II0A 1G5PA 2Q0HA 5G3YA 2VP2A 1EFRA 4V03A 1G20E 4DCNA 3A36A 3NEJA 2REOA 4M0LA 1U94A 1YZQA 2ZVQX 3BFXA 5TY0A 2F1HA 4IVRA 4CW7A 1LV7A 4PC3A 1TUEA 5SZKB 4TQUS 1ZUNB 1VYUA 4Y0AA 4QGAA 5JECA 3EIEA 4LZZA 2E9SA 4B33A 1KHTA 1R0XA 3F0TA 2G0TA 4M1SA 2R6CA 1W5SA 2J1LA 2Q3HA 5KYKA 3FKSD 2ZRLA 2DYKA 2PX0A 4D25A 2D06A 2F1RA 2GZDA 4LBZA 2B8WA 4LPSA 5KHOC 3HP1A 4IFBA 4R2IA 3THXA 3KUDA 3PEWA 2RH5A 4O2RA 2HLDA 4MRNA 5FOVA 4HLDA 3M0EA 2G77B 2DBYA 5J4HA 3QKRB 4IOJA 3NBXX 1FMLA 4Q48A 1X8LA 3KQKA 2OXRA 2C77A 4OHVA 4HAYA 5FUXA 2AXNA 5AK0A 2QTHA 1OH5A 3FHOA 3TKLA 3GLIE 4JLNA 4KVAA 1F6BA 1RFLA 2IUUA 2ZRGA 4IEIA 2GTPA 3P20A 5CLQA 3TQFA 4PC6A 3FE2A 5JJLA 5DH9A 5H8WA 3L8ZA 1GITA 2V7QD 3DPUA 3U7GA 2VP4A 2J5XA 3ONWA 4UNNA 3VHLB 1NVXQ 1LTQA 4Q19A 3M1IA 3R7WA 2DR3A 1X8JA 1HURA 5C4MA 3LO5A 3FMOB 2G6BA 3OAAA 3B1WA 3E5HA 1G7RA 1XXHE 2PX3A 2W83A 5JCZA 5JHGB 1XZQA 1F48A 1ZU5A 1COWA 2Q6TA 2QL6A 3FMFA 4RY2A 4BLTA 1RJ9B 4ZDIA 1IONA 1A2BA 2ZR7A 1JALA 2FPKA 1GOTA 4KFUA 1KNQA 2IF2A 4BFWA 1RYFA 2BDTA 5IHPA 1ZM3A 3T1OA 3PVSA 3ZVRA 3B60A 3PENA 2ORVA 3KJEA 4G5RA 3RABA 1OKKD 4BFTA 1P3JA 2FFBA 4R71A 4KLNA 3SQWA 3PEYA 1G7SA 3CNNA 3EASA 2IW3A 4LYHA 1XMSA 5UKDA 2IS1A 1J2JA 1E4YA 1G21E 1PV4A 3W5IA 3W8RA 2YV5A 2EFDB 3GLHA 4MGIR 3Q3JB 1T5LA 2UZ3A 3PQCA 1W0JA 3B2EA 1HUQA 4NMMA 2YHSA 3T5DA 3EZ9A 2W6JD 4KYIB 1LFDB 421PA 1CKEA 1UBEA 3U6BA 1GKIA 1I2DA 4B44A 3C14C 2OXCA 3K9NA 4RD1A 4DHEA 1ZIPA 1SHZA 4RD0A 1TQDA 4O2LA 4BFYA 3QG5A 1DAIA 4QNRA 4V0OA 3QKTA 3U61B 5LBIA 1YZTA 3LD9A 4NL4H 2FMXA 1ZNXA 3LA6A 1XEXB 1FQJA 1DAMA 4OBEA 3SS8A 3W6PA 3SBEA 2EFCB 5HR5A 2ZSAA 3ZGXA 1E2DA 4HEJA 2IWRA 2WWFA 1Z3IX 4MKHA 1H8HD 4X8HA 2D7CA 5HKKD 3CZPA 4WBSA 4PAQA 1ZMXA 3SYKA 2ZI9A 3U7FB 2FU5C 3UG7A 2PH1A 2O0JA 2JDIA 1KDTA 2GXUA 4JLAA 3V9PA 4PSAA 2C9OA 4MUBA 1E2KA 2P5TB 2GDJA 4Q9HA 1E2JA 1ZM9A 4TYPA 3IGFA 1U98A 1E9AA 2WBLC 3E70C 5HE8A 4U00A 1KI4A 1E2LA 1JR6A 5FL7D 5DISB 1LF5A 1T5IA 2A30A 2BEKA 4QGHA 2ONJA 3LW8A 4CEHB 3BS4A 3SJCA 2W58A 2R6FA 1P2UA 1M7HA 4US1R 3TUIC 4AG5A 4FMDB 3TR5A 2F43A 4ZIRB 4QGGA 2XEXA 3LVRE 5CYOA 3K0AA 2C78A 2QPAA 3GLGA 3D6TB 3DMDA 2WJGA 2FA9A 4C30A 1W2HA 2CJWB 3BE4A 4HAVA 3SFVA 4ACBA 5HTKA 3FGNA 4JLPA 2BBSA 3LV8A 2H18A 3PITA 2XTZA 4LC0A 3K0CA 2OM2A 4OI1A 2ZUBA 1X1RA 1U99A 3IKJA 2PT5A 4QRHA 4M9XA 3T06B 5AWFC 2IHBA 4FMBB 4LX0A 1Y63A 4DUGD 1XF9A 2ZJAA 3CF6R 3ADBA 3IDQA 4BLQA 2O8FB 1JEDA 1S1CA 4NU0A 4DCUA 2AK2A 4O3MA 2LKDA 4DB4A 3EIQA 2CNWD 2PZFA 2VBCA 5CIWA 2ZROA 1R2QA 2PEZA 2JJ8A 5L3SB 1NP6A 4LYAA 4PTLA 1KKLA 5F98A 4PZZA 3QPUA 3QOFA 1QHGA 1I4TD 2J3EA 4IOKA 1SVMA 3QF4A 5DGXA 2FGKA 3H0KA 1W44A 4Z1MA 2G9NA 1UBGA 3BAFA 2IWHA 1Z0JA 2ZRDA 2EFEB 3P32A 4Q18A 1KSGA 3WHLA 1QG2A 4DCTA 1JBKA 2C03A 2XOKA 3FMIA 1HV8A 2IYVA 5G3ZA 4DDTA 2HF9A 3THWB 3GJ3A 1E9SA 4TLEA 3WP0A 1T0HB 1EK0A 3CNLA 2IYRA 3I8SA 5EE1A 1SVLA 5KSPA 5M04A 1QVRA 3J81k 1HQYE 2CCJA 3VKWA 2GF9A 3BORA 5C4GB 4BEJA 2F3TA 1OW3B 2FOLA 2AD5A 3UK6A 4Q03A 121PA 1UKYA 2GWHA 3CX6A 3SQXA 1X8KA 5E7JA 4C0SA 2VYFA 721PA 2GXSA 1BOFA 2J0UB 4YC7A 1GNRA 4A2WA 1SGWA 4B2IA 1AGRA 2F55A 3LLUA 3VNUA 3FMPB 2CEAA 1IXRC 3AP2A 1ZM7A 3CX7A 3EA5A 1H65A 4C0KA 1GIAA 3RNLA 3Q5DA 1VCMA 2OLJA 4M1WA 3VFDA 1CRQA 5BN4A 1G3QA 2NMVA 4ZDKA 4CF7A 3B9PA 1Z63A 3M6AA 3NWJA 1MRNA 2VLIA 4EUNA 4LY6A 1HY3A 3BXZA 2QP3A 4D4KA 1UF9A 3C7KA 3PUVA 3W90A 4DIEA 2FFAA 5JLJA 3K53A 4Z8XA 3CRVA 2OEPA 1BMFA 2VSOA 1Z0AA 2B7CA 4JLVA 2VPPA 1FPMA 2XX3A 2YYZA 1BH2A 4A0HA 4PHFA 5TVKA 4L8GA 4JJKA 1G8GA 3UATA 3UKDA 3GMTA 2QMHA 4BPBA 1Y3AA 2OHFA 2UKDA 4RZ2A 4EQ6A 1KKMA 1KZ7B 3EIHA 1NBMD 221PA 4IDHA 1NIJA 2V9PA 4JJZA 1Q3TA 4QJ4A 2PT7A 4Q9KA 3EPJA 2Q3MA 1XBTA 4RVCA 2DPXA 1ZP6A 1NLFA 3BB4A 3CH4B 5JEEA 1DARA 2IXFA 2P65A 2VTKA 2BBTA 4O0MA 3KB1A 3RS0A 3ZIAD 4GT1A 5CJPA 3RAPR 3MCAA 3RVBA 2ZUCA 4XD7D 4KITB 4XIGS 5KNBA 1PLKA 2DY1A 4ILEA 1A5TA 1PJRA 1YQTA 3BD9A 5HZKA 6Q21A 2WTUA 2GJSA 2K5UA 3KDSE 3ZS8A 4EJSC 1TADA 3VR6A 1OF1A 3JVVA 2FNAA 3THYA 1OYWA 2JJ1A 5BN5A 3ECCA 3SR0A 2QAGC 1UPTA 3H4MA 1JEEA 3K9HA 4R98A 1BS1A 1OE0A 2PZEA 1Z2AA 5FOTA 4JL6A 1VECA 4AYWA 1XD2A 2FPLA 2PMDA 3CWZA 5FTNA 1NNEA 3FFAA 2JATA 4WVFA 2NO6A 1JJ7A 5H1YA 4CIDA 2YNMA 3TJZA 2GVZC 3B1YA 3NIBA 4IVPA 4NYMR 2A5GA 2G3YA 2ZU0C 4NCJA 2XJ9A 3SYLA 4KI0A 1HEIA 2ZRIA 3SHFA 1WF3A 4JLMA 3QBTA 4A8JC 1XMIA 1JI0A 3VR1A 3TNFA 2SHKA 2PJRA 3NC0C 2AXPA 1WRBA 2XTMA 2O0KA 4BEBA 2OCPA 4IDPA 2XSZA 1ZC4A 3AGPA 2R9VA 4OK6A 3BBPA 4NTZA 2YWHA 1E2GA 3C4JA 1D9ZA 4C3ZA 1R0ZA 2C96A 2JLZA 1TF5A 1W0KD 4M21A 1ODFA 3EZ2A 1Q57A 4M1MA 2AKAB 4FXPA 1GRQA 2ATXA 4DIDA 2V1UA 2VHCA 3I72A 4QOSA 1KDPA 3DM9B 2BBOA 3B1ZA 5FOUA 3AQ4A 5JSZA 5K8LA 3R9XA 3AVPA 2QGZA 4LYFA 2QGNA 4MRPA 1BO6A 3U3OA 3CW2A 2WPDA 3RANA 4A82A 1FZQA 2FSGA 4C2TA 2N46A 2ATVA 2ZJ5A 4BE7B 3SE0A 1ZINA 1XEWX 3DOFA 4E03A 5ELXA 1KO1A 4MRRA 1SHKA 4I1UA 4V0KA 2QTVB 3B1XA 3R20A 2ODNA 4Q1EA 1G3RA 1OH6A 3A8TA 2V54A 4Q5IA 4TTQA 3EPKA 1D8TA 1E2HA 4TL7A 3C8UA 3W6NA 5EE9A 2ZE6A 3NH6A 1SXJE 3BH6A 3M4YA 1CP2A 1YZGA 1MABB 2X8AA 1NI3A 1S1MA 3GQBA 4HB0A 4NHOA 2BV3A 4LGMA 2REBA 5EXXA 1EFCA 2FE4A 3U3KA 5JZVA 1WB9A 5EUMA 3A1WA 3LY5A 4ESHA 1WDTA 3LNCA 2L0XA 4JT4A 1KZGB 1Z83A 2WKRA 2AKYA 2F43B 2GXAA 2Q3FA 2CDNA 2EW1A 1KI9A 4W9MC 5FFMA 2G1KA 1KIMA 5LD2B 3QKSA 3HU1A 1Z06A 3UWOA 4TTRA 4BFZA 1MRSA 1U0HC 1JQLB 1UAAA 2IYYA 1NVWQ 3RRZA 3UPUA 4B6FA 1XRJA 4IDQA 2RGCA 5DIFA 2F9MA 2WSSD 1W36C 2GKSA 2AWNA 1KI6A 4P4UA 4LHXA 1OB2A 4WZBE 3IUYA 5TARA 2W2XA 5E95A 4HDCA 1BYIA 1XTSA 2WAXA 3UIEA 4OHXA 3PIRA 2ZAOA 1KTVA 4OI2A 1GKYA 2WMOB 3TMKA 2B92A 3CONA 4DLSA 1JPJA 5TB5A 4FMCB 1ZM2A 1SKYE 4WIAA 3RWMB 1VCNA 2W0SA 1G3UA 2RB4A 2BOVA 1JECA 2OFOA 2OLKA 4OHYA 1GM5A 4TQAA 1TF2A 3K09C 2BHRA 2WIAA 3KJHA 2OBLA 2ZRMA 1IHUA 1AM4D 4PZYA 3THOA 5IF9A 3E2IA 3WNDA 2OT3B 5AUQA 4D80A 2AL7A 1N5IA 3QPWA 2YC4C 2FSFA 1EG7A 4V02A 1IN5A 3E1SA 3GJ8A 5DI9A 3IQXA 1S96A 1AN0A 4PR0A 2P0EA 4V0ME 1S8FA 5BYKA 1ZUHA 4A36A 4I99A 3O8CA 2WVJA 1EFTA 2IEYA 2JLSA 2NPIA 1JR3E 3C5CA 4DLUA 4GP7A 4BASA 1AZSC 1W4RA 1Z8FA 2QE7D 2ZAMA 5BW8A 4D6PA 2FV8A 3AV0B 4TL8A 1E2FA 4GOJA 2QT0A 4BZPA 3QIAA 2X19A 3VR4A 1T3HA 4D0LB 1E9DA 1SULA 3DHWC 3RC8A 4D82A 3OEHD 4DSNA 2AHOA 4HZUB 4US2R 3BWDD 3B8HA 4W7SA 1G6OA 3MUFA 4QM6A 5IK2D 4CVNA 1U9IA 2ODEA 2PLFA 1OHHA 5DSZA 2IK8A 3BOSA 1ZU4A 3CUEF 4FW9A 3WXMA 4Q4LA 3GLFE 4UKDA 4B3XA 2JGNA 1FTSA 1OLOA 2QP4A 4TLAA 2Z4RA 1R10A 2JAQA 2HF8A 1U2RA 1JPNA 2YOGA 1IN8A 3WRYC 2IYTA 4R9UC 1XPUA 3X1ZA 2NQ2C 1ELOA 4LYJA 5DLQC 1W47A 3H86A 4LJYA 4Q47A 2IX3A 3Q85A 1E2QA 1ZRHA 3GJ7A 1GAJA 2AFHE 2P5SA 2CLCX 3BFKA 2CHGA 1VYTA 5FPHA 1KDRA 4D81A 3KXLA 4EQ6B 2BJVA 4CT5A 3TBKA 3SEAA 4YMVA 1VHLA 5AJZA 1JXOA 1K6MA 4Y0VA 4O25A 4Q21A 4DSUA 3PG5A 5A5GA 1L4UA 2YKGA 2IC5A 4GOKA 3Q7PA 4XH9B 3TR0A 5CYPA 4ZDJA 4PSKA 1E79A 5IT5A 3LX5A 1QVAA 3CX8A 1E9BA 1N0UA 4UNPA 1G3IA 2WJIA 4JKIA 4NONA 4URVR 3LXRA 1OSNA 1KAGA 2GF0A 3AF1A 1J90A 2FG5A 2GESA 3B6EA 4RSGA 1FP7A 3X2SA 3PEVA 2MSDB 2QSZA 3EARA 4ASUA 5J4KA 4Q7KA 5C2JB 4JLJA 4TL6A 1FQKA 3BERA 4A0GA 5FTKA 1CU1A 1F2UA 4KYUA 4NP6A 4NZYA 3KQUA 1D2MA 3QXJA 3TUJC 3EZ7A 2FF7A 4PXAA 3OE7A 1A4RA 4UXHA 2MMCA 4TLCA 5SZHB 4PPQA 2H7VA 4YDSA 3X1YA 2H92A 3B13B 4MGKR 2ZYUX 5GVRA 1XD2B 3ZVMA 3WY9A 2QMEA 1KGDA 4JZKA 2ZRNA 2GBLC 2VEDA 4H9GA 5G41A 5H68A 1E96A 3KTAB 1Q1BA 5FR1A 4ZCLA 2JCSA 2OZEA 4HB2A 2ZE8A 4HUQA 3W3AA 3JZMA 4MGYR 3FHCB 5BQ5A 5FUVA 5KDLA 4NYIR 1AA9A 1FUKA 1Z0IA 4DLZA 4OJKA 1J8YF 4RJLA 4DWJA 4B2PA 4CEIB 1WP9A 5GJWC 2DFTA 3CF2A 2P6UA 4LOAA 3SOPA 3H1TA 4URUR 3NVAA 3EC2A 3GLFA 1F2TA 5GJCA 5IDVA 1LS1A 3VMFA 3CPEA 4PPNA 2O8EB 1QHHA 1TPZA 3A4MA 1FFHA 3BH7A 3QVVA 2A5JA 4BRUA 3R9WA 2P6NA 3GEIA 4KODA 3Q5EA 4HLUC 4B73A 2OBMA 4JBYA 5K8IA 1T0JB 1GRRA 3FKSA 2VIIA 3G82C 4NCIA 3EAQA 3ZQ6A 3NEYA 2ZRJA 4IOLA 3L8YA 4KFTA 4DSOA 2WHXA 2ZS8A 3IEVA 1DELA 1KK1A 3QKUA 4V0LA 3WMEA 3MMPA 4PSVA 1KSFX 1R4AA 4F91B 4JSTA 1E9CA 1NJFA 1TAGA 5E3HA 1P73A 3I5YA 2RCNA 5JFGA 1P60A 2NOAA 3P27A 4AK9A 2BEJA 1E2EA 3FFBA 3V4RA 3GJ5A 4PQRA 1EFRD 2GEVA 4C0BA 1TU3A 1GVNB 4KSCA 3BIFA 5CLLA 2OILA 5HCNA 1SVIA 1KMQA 3DL0A 4QC2A 4TZ6A 4MUAA 1NJGA 4JLKA 4DCVA 4L9WA 2CBZA 4TMKA 2H8KA 2ASEA 1CEEA 4DLTA 1FX0B 2EU8A 1E6CA 4EDHA 4YMWA 3EC1A 1YE8A 5J4LA 4B2LA 1NIPA 4MYTA 2CE7A 3S1AB 1XTKA 1BKDR 1GZSA 5TDHA 1DTSA 1W49A 5HE9A 2ERYA 2ZI6A 3DO6A 4OI0A 3O47A 1NL3A 1W36D 3X1XA 4BZQA 4LBWA 4QHYA 4BRWA 3AF0A 1Z6AA 4HDQB 4ON9A 2HLDD 3U7HB 4IW3B 1C1YA 4PANA 2FFQA 3LLMA 1RPZA 1KI6B 1WBBA 4MYUA 4NPHA 1OIWA 1TF7A 1NVVR 2NG1A 1N2CE 2GK7A 5CM9C 5FBRB 3HR7A 3I3SR 4AKHA 3BB1A 4OK5A 4ABYA 3R9IA 1SVWA 1O3YA 4UJ3A 3UG6A 1CR0A 4F4JA 1QHSA 1P61B 3FB4A 2HXSA 4EIWA 1CLUA 3ND8A 2GCOB 1G291 2CMKA 3EPLA 5DI3A 2OFWA 4LV8B 2GA8A 1QRAA 4M53A 4G1UC 1M7BA 4MDEA 3CBQA 4DZZA 1VYVA 1YR9A 2FDCA 2D2FA 3RWOA 2OG2A 1CJMA 2TMKA 2WSMA 4RZUA 2GILA 4E22A 1FNMA 2N42A 2XZPA 4G01B 1JAIA 2C2HA 2F9LA 4Q4JA 4MKGA 1FNNA 2O8CA 3MD0A 2IUTA 3OAAD 1KSHA 1EWRA 4HATA 1R8QA 1COWD 1AGPA 5FR2A 4ARZB 3DVLA 2VP9A 3GJ6A 1M1YE 3W8NA 2FPMA 4JIMA 5E4FA 4PAMA 4KFRA 1UJ2A 4YDHB 4B3DA 2OV2A 2V6IA 3L43A 4LWZA 5KU1A 1R8SA 1A82A 3AKYA 3MJHA 4PHTA 1YHNA 2WJJA 1US8B 3Q72A 1W7AA 1FOEB 2J0VA 5DNYB 3ZVLA 3OFNA 3FKQA 3A4NA 4L9SA 4RFSA 5D3MA 3F3YA 4Q4HA 3GLIA 3BC1A 1KMHB 1OXSC 4XVQA 1N6HA 3OIVA 3ZLJA 1CR1A 3SNHA 2H57A 4OK3A 3TVDA 1QHYA 1P2VA 2B7BA 1DG1G 3NG1A 3I8XA 1AS3A 1LW7A 2CLDX 5J40A 1E3MA 4DLRA 4BFXA 1NKTA 2AX4A 2C98A 1W0JD 2CE2X 4QHSA 2A5YB 3D8BA 2P67A 2BJWA 2OO7A 4HUTA 2ZM5A 3P4XA 4A2PA 2DCUA 5J5CA 4LJ7A 1KNXA 2XXAA 1CULC 1AK2A 1XXHA 3O8BA 4KAXA 4KHZA 2GEDA 1GTVA 1CIPA 3I4LA 1QDEA 3L0OA 5FPKA 4UNRA 4L16A 1W4CA 3KKOA 3EXAA 4Q7JB 3A37A 1I4DD 5JS7A 1XCGB 4PQYA 2IEZA 2HUPA 4KLZA 1GG2A 3R8CA 4EAQA 3AUYA 4FCTA 4XTRA 1ZNZA 5SZIA 4CEJA 2EFGA 2GAOA 2AWOA 3ND9A 3NKVA 2REXB 2KE5A 5CK4A 1S0UA 4P0TA 1EX7A 1NVUQ 1E0JA 4FMCF 1NMXA 4C0LA 4N0DA 2Y8EA 1G8FA 2XZOA 1L4YA 1G16A 1SVSA 2CHVA 1EWQA 1QZXA 3RSLA 2HCJB 2JLYA 4WA7A 4HB4A 1NG9A 1NBME 3LBIA 3CRRA 2YWEA 4QBIA 5JS8A 2XGJA 4OHZA 3Q8XB 4IJMA 1TNDA 2ZVPX 4XJXA 4YMSA 1J99A 1UBCA 1SVKA 4AY2A 1JQJC 3C16C 2RGNA 1G6HA 4HUQB 4HAWA 1HQCA 1GKUB 2AR7A 1Z0FA 2DFKB 4Q9LA 3RS4A 2BMEA 3AKEA 3ASZA 4NCHA 5CB8A 2IS2A 1XJ0A 3IBYA 2D2EA 2FEMA 4YQFA 5KSOA 1WQ1R 4TT3A 4L4UA 1IAQA 5B30A 4BUJA 1OFTA 1E1QA 4JBWA 2R44A 4WW0A 2PMKA 2AK3A 1W46A 2VRWA 4TQ9A 5G40A 2NIPA 3MGCA 4WXPA 4LJ9A 3GP8A 1FMJA 2WJYA 4YMTA 1F60A 3K0FA 4Q1BA 3VKHA 3T35A 1BIFA 2QT1A 4NCNA 3ZS9A 4QM7A 2IS6A 4DT1A 1G5TA 3U44A 3UMSA 2ZRBA 3TGPA 4AKIA 3ZZTA 4ZCIA 2IYLD 2ZPTX 1II8A 1ZC3A 2ZRKA 4FWIB 1EGAA 1K5DA 1ZYUA 4Q4AA 3OEEA 5KSZA 4EJSA 3TK1A 4U5XA 1P72A 2CL6X 2ZE5A 3GJ0A 3JZAA 3VR2A 1BYUA 2OFXA 3EZ6A 4DVGA 4W5HA 2QAGA 2ZI3A 3THXB 4MKIA 3I62A 4P4SA 4TMTA 2ZR9A 4Z1MD 4C4PA 1NMZA 4TMZA 4OKSA 4GFDA 1L7VC 1L2TA 2JLQA 1AKEA 3ZZ0A 1EFHA 2XOKD 3N5CA 1W2GA 3A1UA 5JMTA 3PJRA 3W5JA 2O8DA 2B8TA 2P3SA 4TYQA 3SC3A 5EP2A 3UXMA 5LD2C 1W4AA 2V3CC 4DLXA 1UADA 3RLFA 5DN6D 2QBYA 2BMFA 1NBMA 2QM8A 1DO0A 2BIFA 1FW6A 1TQ6A 1KAOA 4HLCA 2VP0A 3CR7A 3QEJA 2A5FA 4A8JA 3K0CC 4AWXA 3QG1A 1YZKA 5JCPA 3U3RA 4EKDA 3RSOA 1L8QA 2PCLA 2WJHA 4NE2A 2OE2A 4B34A 2O8BA 2GRJA 5L3QA 1RRGA 4GI7A 2ECKA 3QI2A 1Z2CA 2GAAA 4I81A 4JMPA 2GZHA 1MH1A 1QHIA 1W1WA 3R7WB 3GCGA 4QXAA 2CVHA 4NCKA 2I1QA 3NTUA 1D5CA 1T8UA 2J41A 2UZIR 2XAUA 4D26A 3OHMA 4R7ZA 4MH0R 4L15A 1S9HA 1A7JA 1B23P 2A78A 5B64A 1Z6GA 3LAWA 5CDFE 2KBEA 1XZPA 4IDOA 2V4ZA 5FI0B 2VHUA 4TYNA 4OQMA 4EPXA 4LBVA 1N6NA 3IO3A 3U4QA 2FEOA 3VR3A 4GNKA 1N5KA 3CKLA 3ZH9B 3G0HA 2WM9B 2BBWA 2QN6A 3SU8A 3RHFA 3K0EA 3U60B 4B71A 2IUSA 2ERXA 3IIJA 2PLRA 3OZXA 3TAUA 2BC9A 1SZPA 1VDZA 2ZSDA 4K46A 1EESA 3LDAA 1VPLA 2ZU6A 2WZQA 4DB2A 1IOZA 2KJQA 3CIOA 1NSTA 5AR1A 3AVYA 4Q7MB 1IQPA 1ZUIA 4LK2A 3ZZUA 4A0RA 4GBMA 2XJ4A 3GLHB 2O8CB 4DEXA 1N6OA 1H8EA 2PEYA 3NDBB 4NYMQ 1HT1E 4P32A 1J70A 4DBLC 1NF3A 2G1JA 4M22A 4HAUA 1G4UR 2W2TA 4MITA 1OH8A 3T61A 1KDOA 1TEXA 1UKZA 2JJ1D 3OESA 3TE6A 2WOOA 1HA3A 2YWFA 3UMFA 1XFAA 2GEUA 4XWOA 1E0SA 3GD7A
chains in the Genus database with same CATH superfamily
4MKFA 1J8QA 4AQ7A 4RFSB 1I14A 4RSMA 5ICCA 2QVGA 1IHDA 4EK9A 5LB2A 1W85A 3F3KA 3AY0A 1P5JA 1WR8A 1IN4A 1DFGA 1KYZA 2AE1A 1B6RA 2W2VA 3D0OA 2W2LD 4LDPA 3EMVA 2QJTA 3TLAA 5IAEA 1V11B 3P0HA 4MZDA 1DAKA 2GZ2A 3HZRA 3M5PA 4R81A 1UKBA 3DVAA 4KE9A 1FU8A 2Y68A 1TAUA 2QMQA 3O6VA 4LEIA 4GRAA 2IHNA 2AR9A 1QLWA 3TFQA 3FPHA 4G0QA 3MS2A 3FKJA 3OLZA 4UCXA 3RYTC 1CUDA 3LC2O 3KYCA 4ZHQF 1I30A 2B4YA 4DSAA 4C7KA 3LUPA 2YOFA 4XPZA 4KOEC 3VPCA 4ND1A 1XXHB 2WZCA 4E09A 1TM1E 2W0MA 2XSZD 1U7UA 4G89A 1OX5A 4MDYA 4Z4CA 4XWKA 3U1VA 1OPRA 2H9YA 4LOJA 5DX1A 5BSFA 4WZZA 3DGFC 4NESA 3S5JA 5TR9A 3AOEC 4HWPA 2GTIA 3KKLA 2XV1A 3DE7X 3R5HA 4X62B 1UR5A 3D02A 2FWRA 5FV7A 5ES3A 2ARKA 3GFOA 3N0XA 3VR5H 3DE4X 3I3OA 3WLJA 2Y27A 3AF4A 4R84A 3AO0B 1Z56C 1QC5A 2YW9A 3MYRA 4FFSA 1RBZA 4FSDA 5KNLA 3LUAA 4AJIA 3A3OA 3VDRA 2NXEA 1JAZA 3GVCA 3PX3A 5IBCA 3MFYA 3VKGA 3K0AB 3ZZ1A 4Z7NB 3CB2A 3WGOA 3L7DA 2X0JA 1G21B 4QGFA 1E59A 3OD1A 2XDYA 3OO0A 4XYLA 2BY4A 1S2OA 4YUVA 2GVDC 1ZI6A 2GYWA 3CJTA 1ZL0A 4N54A 1DX6A 3QJYA 4YRTA 4B5KA 4FFPA 2WYUA 4Z0PA 4CN8A 1IE3A 4F9TA 4LYDA 4QDUA 3H5AA 3RU9A 4I9HA 1V8DA 2YV4A 1C4OA 1S3GA 4YCNA 1ULAA 1GRNA 2EV9A 3CWCA 3I2KA 1ZHHA 1LA2A 2IU4A 3AH8A 3HA2A 2AXEA 2NSJA 1EX6A 3JS5A 1A95A 2RB5A 3ZBTA 5KYYA 2Q5CA 3HDTA 1L8LA 5JZ9A 2J5RA 2PMWB 5JC8A 2IKQA 2ORWA 1I6WA 2XYVA 5LC1A 1FTGA 2HEIA 1KMIY 3UYKA 1DVRA 4CT0A 1Y98A 1W2WB 3T7EA 4ARVA 2XVYA 3U2QA 3ZLBA 4E5UA 2NZ8A 2OP0A 4PSCA 4S1PA 1ONBA 3MLEA 4UOEA 2I7XA 4ZAFA 4HDMA 1GZ5A 3PIDA 3B89A 4QNMA 1UZMA 4RSRA 1V9SA 4O2AB 3F8SA 1FLAA 4NH0A 3BGVA 3CGWA 4PEVA 3TXYA 2JJ2A 3V4FA 2R48A 4CM4A 3PXEA 4BLOA 5JQGA 3MHTA 1Z4PX 1D1QA 1GTL1 3HKCA 3OOEA 4KACA 4OL0A 1PR6A 3DBHB 3EQZA 1RJ9A 3ECSA 3H05A 4LS3A 4RJJA 4L74A 1TYEB 5FOWA 1R4NB 2WYOA 2GCNA 4ZVPA 5DP2A 1C9EA 4IXMA 5EP3A 5JD6A 1EFUA 5EXTA 5F3DA 2X3UA 5B3KA 2AZXA 3W78A 2C3PA 2QIPA 1BRTA 4NMXB 1WKCA 1YB4A 2NZ2A 8MHTA 3LTNC 2YJNA 2HIMA 2WWHA 1SELA 3DHYA 4L4RA 4DY4A 4LDQA 4DXAA 1PG0A 1PHRA 4RABA 2BFNA 1F5NA 4K03A 4U7TB 1C41A 2QM3A 2WJVA 3EDOA 4G0YA 3ADOA 4R8RA 5E6SB 2C04A 4EY4A 1XCPA 3L79A 5HHTA 4DARA 4B3GA 1TCVA 2JFOA 3L0CA 2GVNA 1NW4A 1UKVY 1K66A 1ZMTA 1A1VA 2UXBB 1BQ3A 3LP6A 5KQSA 1IY1A 2J8ZA 3DG9A 4JLBA 4R8KA 2CNLA 5B1SA 2CVPA 1XZAA 2Q41A 1QTQA 1OX6A 2P1RA 4R1QA 1R6UA 1JDJA 2FW8A 2JGFA 3ETCA 1S4MA 2A9RA 3CUUA 5PGMA 2V5AA 2D5LA 5BN4B 2VKTA 4EUEA 3LL7A 3VKUA 8OHMA 5FQNA 1XZCA 2O2YA 3EB9A 1LQUA 2P9FA 2B25A 3RUPA 1KSJA 5LDHA 2OHXA 4HAZA 1SU6A 821PA 1G9SA 4OMDA 2W11A 1E9VA 2QAJA 3GN1A 5AOBA 4BFSA 5LP6A 4M6WB 1PTJA 2WUVA 2A58A 2E7ZA 3EIXA 3V1MA 4B3FX 1IM8A 3MT7A 2DEUA 1NRJB 2F90A 4Q02A 4TMVA 4IS3A 3W8EA 5T7BA 1LNZA 1VPWA 2VJNA 3AR6A 1X80A 2ZIUB 4F6LA 1Y8RA 5GGYA 4JMLA 1Q2UA 5J2UA 4WNAA 3E82A 4JVMA 5D5QA 3T4PA 2JFHA 5KTTA 1XEXA 3EMKA 4YHHB 2HU2A 1BVRA 3OTQA 1T0UA 3G5LA 4X91A 3VHRA 1XG5A 2GEKA 4CF5A 5LWHA 5F3WB 2KLHA 4HWOA 3VR4D 3MQ2A 2RKOA 2VAMA 3GCDA 4J0GA 3WMGA 2RGEA 3QWIA 3MOSA 4QODA 5F1KA 4ALNA 4BCCA 2FMIA 4AI6A 1P0FA 2ADOA 2GJ4A 2Q4OA 1YJBA 1IJFA 4LWPA 4N4AA 3O82A 5DHUA 5F9HA 4HLUA 4OP3A 1GVHA 1UODA 2KWIA 1WHSA 4D9HA 2XZLA 1OTXA 3OCZA 3KUUA 4DG8A 2J7PD 3P0RA 3KM0A 2HNKA 3IPYA 2PSFA 5KCZA 4LOKA 1EB8A 5JH7A 3O8RA 5CDTA 1ZAKA 1N2EA 5IW8A 3X44A 3S5UA 5F7XA 3JWIA 5KQRA 1T2UA 2QJOA 3L6DA 4J4TA 4P33A 3V1KA 3AUUA 3AZQA 4KXQA 2W8BB 1VMIA 2ZSIA 4ZGGA 4ER7A 4EZBA 4CDRA 4L72A 3AEKB 4NABA 1SUBA 4NYJQ 1WIWA 2VF2A 3PNBA 1BQEA 2X5XA 3JXEA 4JOCA 1PQPA 2CY0A 1OU0A 3F9CA 4CNBA 1YOVA 1T9HA 1EP3B 2DOKA 3NXSA 2GPSA 4S12A 1U0BB 1WY7A 1WXEA 4H77A 2BEWA 4A6XA 2NGRA 1JDUA 2VUUA 2XB8A 1LPPA 2Q07A 3DMHA 5CEJA 2Q2WA 4LNUA 4CR7A 1U90A 4JYBA 3C15C 3IEUA 3JQ7B 4YRLA 5CFOA 2GRUA 2OGUA 2PD6A 2QL7A 2QQFA 1U3GA 2XDQA 3BCHA 1ZCBA 4GWLA 4IIJB 2G88A 1Y6QA 2W6OA 2PBLA 3RRNA 1U28C 3AVQA 3LPDA 1FC0A 3D8NA 1Q1EA 3KL2A 1ZUWA 1KOFA 4DRZA 5B55A 1NNLA 1NT4A 3F4LA 3RHTA 3GUZA 4ASUD 3WWEA 2QNBA 4JI5B 4GS5A 1WXDA 1U9ZA 1UKEA 5B2FA 5LDDC 1U65A 4OV6B 5KOHB 4V0NA 4B6OA 4GAEA 3SQMA 4AECA 3O74A 4Z2YA 3EXFB 4F46A 4ZVNA 3LOQA 3TW8A 3A6PC 2J45A 3OE7D 5FBWB 5IXJA 4CKWA 2JL1A 1NG1A 4NU5A 3V8VA 1RHQA 1ZVJA 3O8QB 3RAFC 2GCGA 4LPKA 4C4ZA 2O8FA 4YT5A 1G19A 4QAJA 4DC0A 3V2HA 1ZCFA 4L8WB 3TCKA 2VN8A 3ROPA 3ZDFA 4KB5A 4KV7A 1NN0A 5L3SA 3KZ1E 2FCRA 2H9AA 4R1SA 1OT3A 2OQRA 2H1HA 5HFNA 2B4KA 2AFHA 1XU4A 3ESDA 1U0RA 2O57A 1E1CA 1N8TA 3IQZA 3OLCX 3W3AD 4FN5A 5I4KA 1CIVA 1T1IA 1E7QA 1KI3A 1SU4A 1ZNYA 2GETA 3V00A 5DTQA 2B82A 3N0RA 3DWGA 1ENZA 2GLXA 1ZGBA 2OPBA 3LUJA 5FWDA 2M6SA 3IOEA 5JAQA 2FZ4A 1DWQA 4L85A 1QRRA 4GPBA 4JS0A 4F85A 5KTOA 4IHAA 1F6WA 3L82B 2FSHA 2IIVA 2WD7A 3RFVA 3IIMA 5IH7A 1TK9A 1EDDA 5BXQC 4FILA 1U7PA 2KSQA 1P33A 2JH8A 4GICA 2XQVA 3S2IA 4MI9A 2DUWA 1P81A 1CY2A 3PDIA 2G5TA 2G9VA 2GPYA 4YDRA 2G0AA 3KC2A 3L8FA 1LVUA 5ALPA 1MHTA 1KK2A 3CPJB 3GQBB 2UAGA 3RDPA 1NXOA 3TRFA 4MVJA 2ZJ2A 4OM7A 4DV4B 4BE9A 1SZDA 2EZTA 3HKEA 1XP8A 4NMLA 2PFKA 1XQ6A 2HIHA 4LHVA 1Z4LA 1C2YA 3FVRA 4TSKA 3EULA 2WWXA 5JDIC 1C3VA 4BOYA 1BN7A 3FBTA 4AMGA 3Q9NA 3QFRA 5ESWA 2NZYA 1WLYA 1PT8A 3IJRA 1JB9A 3CNOA 1FBNA 4OAPA 4D8XA 4KXYA 2XNCA 3NHAA 4YV2A 1C7EA 2PZGA 3EZXA 4JNKA 2B9VA 4WTOA 3HXTA 5AHRA 3RJTA 1O0CA 4C1NA 5K45A 7REQB 5ALLA 1T9KA 3KFXA 2BSXA 1S2LA 3KQQA 4MINA 3TB6A 3GU3A 1F4LA 4L51A 4D43A 4YMUA 3GH3A 3CNEA 3AEUB 3EUWA 3IUQA 4KXFB 5D8DA 2PGDA 3ANXA 3ES9A 2OBXA 4I1SA 3DE5X 4B83A 3NC4A 4XKJA 3HBFA 3Q7TA 4IOMA 1D2NA 2JD0A 4FUTA 2B1GA 3INNA 2KBFA 1RAGA 1NVVQ 3ZU4A 1BX3A 4LY3A 5L53A 1KQNA 3EYWA 3FYUB 2G09A 3F4BA 4GHWA 4DLYA 4CI9A 3R7NA 5GJVC 2Y1OA 3ZJUA 3IPAA 4YGXB 1NNUA 3FOZA 4TLDA 1YAHA 4KE7A 4QDOA 4KPYA 3M3HA 4HDMB 3G23A 2YWJA 1E3WB 1TM3E 2Y1DA 2HWKA 3DJYA 1U0OC 2Y0BA 5F21A 4B4DA 3NFYA 3U17A 2JEOA 3DE2X 3ONFA 2ACWA 1R7RA 3VV3A 2GPTA 3NAGA 1EUZA 2AG1A 3IRUA 5DHFA 3C5EA 3NOQA 2PUHA 2FF5A 4GP9A 3I61A 2JG3A 3K70B 3AINA 3HXKA 3I32A 4ZPJA 4M76B 4UAVA 3VU9A 2O8VA 3NHZA 1FFXA 2I03A 4X8OA 5GV8A 1P2SA 1T4GA 1XWFA 2BTOA 3HPQA 1GFIA 1EXMA 2WTEA 1X94A 3PXXA 4E21A 3U37A 1KTIA 4H2DA 3UHFA 1G8JA 1J9GA 1U0TA 2YWGA 3UTCA 3T5TA 2BFEB 1T5BA 4GZ3A 1RE1A 2YZGA 3EHDA 3CF0A 5EMHA 3EPHA 3U19A 3KQNA 1XZJA 2B37A 1EP9A 2NN3C 4N7RA 3P9KA 1IATA 3TCXB 3V1YA 4R1PA 3SF8A 4MYCA 1WVGA 4LYYA 4MV4A 4CCYA 4DS3A 5J4YA 4RE6A 4X3CA 3CZMA 3I2GA 4N5NA 3ER9A 2AZTA 3RSZA 4I6EA 2GI4A 4PVCA 1KARA 1MA0A 2AHRA 5DEIA 4D98A 4BLRA 1EUDA 1D09A 2W8ZA 2I4TA 3DULA 4J7XA 4L9RA 1H8HA 3S29A 1WDMA 3DZHA 4BKRA 3FW1A 5HCIA 3MWLA 2G9ZA 3UFBA 1WSAA 3PSHA 5BWBA 4AQYB 4HI0E 2JLWA 2QRUA 1QYIA 2LVBA 4R2MA 5DBIA 1RJEA 4OFWA 3DBLA 1VCOA 1D9XA 2QLFA 5LP6B 3O83A 1JG6A 1HZZA 2VJPA 1LEHA 4GL4A 2DH6A 4E5DA 3MRXA 2X1MA 4NECA 5BR7A 2BWJA 3TI7A 4K81B 4CQLB 1KOGA 4EPVA 4PLCA 3E48A 3N74A 1XRPA 1Z3CA 3WBKA 1Y8RB 3AIKA 3DMFA 4WSOA 2YWRA 4MA4A 4WNAB 1M1NA 2QRZA 1XQ1A 1W96A 1BH6A 2ZITA 4DLWA 1S2DA 1X86B 3DB1A 1NPYA 1SBHA 1M6NA 2BFMA 4IL5A 1LBSA 2P75A 2VNIA 4RGYA 5GZ6A 5KYUB 5IZCA 2C59A 1EI9A 5DSTA 4QIHA 4D6YA 4F7WA 1SCQA 2PD3A 1W4ZA 1LY1A 1PG5A 3ETHA 1VG9B 3I6MA 1U0JA 3KKNA 2ECPA 1AF4A 4INPA 1R74A 1SC3A 2F6RA 4BFUA 1KVSA 3P9QA 3MJVA 4ZVTA 5IVPA 4FFNA 3VR6H 2AFIE 2RBKA 4E07A 2QTVA 4LY0A 2IYUA 1P2TA 1Y6ZA 3BTOA 4EHNA 2FZLA 1JQAA 1Z6XA 2FPGA 2FSIA 3CO5A 4P2GA 5DGDA 2H4FA 5EIWA 4ZZIA 5FJJA 5A3VA 1Z0DA 2G04A 4XB6B 1BXRA 4M36A 1REQA 4R7TA 3IMCA 3T15A 1HX7A 1XEFA 3PC3A 3OIFA 5DIZA 3WGMA 5CVTA 2XGGA 2AI3A 3CX4A 4MYRA 3HVUA 4CIXA 5F2KA 2D0OB 4ND7A 5JD4A 1QIJA 5J43A 3F74A 3TDNA 4JC8A 2Q3LA 5LNK6 4J2TA 3ZHZA 4ZI5A 2VF7A 2AEEA 1MX3A 2JAWA 2D3WA 3DL2A 4L0MA 5EG5A 4L3VA 4LNUB 2LP4Y 4OQYA 5IJZA 1B74A 1JILA 3KT6A 3M4XA 4QBHA 4YI3A 3UN1A 3CSUA 3P2MA 3ZHXA 4V1CA 3EXEA 2FCAA 4HWTA 1YJXA 3G3EA 1NW8A 1ZD1A 2Q4TA 4UDYX 4ZREA 3UT6A 3WKCA 3HXMA 5H3HA 1Z38A 3KWLA 3UOAB 2KW5A 2DTEA 4IDAA 5EI5A 5TGTA 5LN1A 1JF8A 4RD4A 3QFCA 4YJKA 2Z95A 1R0WA 4INOA 2DFDA 2XXJA 4M86A 1U8CB 2QI9C 2ZSBA 1X7XA 4XYBA 2X5JO 4GDFA 3IEIA 2DLNA 3FLAA 1LPBB 3GAMA 3GRYA 1F2DA 5BMVF 3AC0A 5EQJB 1BWSA 1F2TB 1ND6A 2C92A 3TW8B 4LF5B 3O0TA 4CV0A 1IRXA 2O52A 1C0PA 2C2ZA 5IVIA 5HW0A 3KCNA 2VHZA 2O54A 4FWTA 3VPBA 3VGJA 3JW8A 4W1QA 2FJUA 3PEUA 2I3BA 2ZYVX 2E4YA 1YDFA 4Q1CA 4YAKA 4NPCA 5JNWA 3HJUA 2VFAA 4WZ6A 4F4IA 4G0NA 3LQQA 4RTJA 1OFVA 4RTMA 1E7RA 3J80A 1SKUA 1LGYA 3YASA 2CJXA 4Q3AA 2AFHB 4DV6B 1SUPA 4OQQA 4ZCPA 1E1CB 1TTPB 2YS7A 1N2BA 3WVNA 2QM7A 3RJMA 3KWJA 2SCUA 3MINB 4AYXA 4KQ6A 1RZUA 2VQ3A 1YWGO 2R60A 3Q1KA 3U4GA 2I87A 2O07A 4DEYA 2G8LA 1PFWA 1ONSA 5I9MA 3LWZA 4RTOA 5IP5A 3FNEA 4DMCA 4RJTA 5JPCA 1VBKA 1S01A 1GPLA 2GJAA 1G66A 1G64A 4NMWA 5E1BA 2WD7B 3ZXUB 2HRDA 2OUKA 2VWPA 4QXPA 4C7XA 5DN6A 4Z54A 5ERYA 3A4IA 3H5OA 2RSLA 3JARA 1UANA 1OTYA 1AIPA 3OBBA 2G8NA 3RPEA 4ZI2A 3DP7A 3PDIB 1KP2A 1DEAA 2HL6A 2VF5X 2WYWA 2J6CA 1RZRD 3K6SA 1E2BA 4MQFA 4M0KA 1K2VN 1CDEA 1K6IA 2OGZA 4QUDA 1ZXLA 1G18A 1VLMA 1N6PA 2A94A 2FGJA 2FMUA 2J7KA 1I0LA 1K5GA 4TWRA 4DPKA 2DX7A 4MK4A 5AT1A 1DEXA 4B4WA 3KVNA 3KVOA 1ECPA 1EK6A 2PUWA 4K2HA 1N3BA 4PS1A 3AL0C 2YMMA 3DD5A 4X1IB 1KZHA 1H0SA 5AJUA 5IULC 1Y6FA 3CF4G 1JEYA 5HWSA 4ZU1X 3FCCA 3ZW8A 1J8MF 4U2DA 3VDMA 4OQLA 5B3JC 4DLKA 3PE3A 1V35A 4GMXA 4E2YA 5BNIA 2AH5A 2QQ5A 4LCBA 5LA6A 1DWOA 2HBYA 4Z3KA 5JCXA 5GONA 4DUPA 2Q2QA 1DAEA 3AP3A 4R5MA 5H80A 1UEXC 1FQWA 5CG1A 4QYTA 2AF3C 4UPDA 1JIQA 5EQTA 3ONVA 5LZ7A 3ZWPA 4PINA 1YZNA 2X2FA 3W9YA 4BB0A 5K0TA 3LH5A 1AHIA 1RVDA 2O23A 3CLVA 3PXGA 4JBXA 3I2YX 1HTWA 3N7AA 1HL7A 1QIEA 2ZJOA 1CRZA 3SIRA 1MJNA 4GRIA 4EKGA 4WLVA 3LOPA 3O95A 3L3BA 4ZI7F 1XCMA 2QTFA 4W5NA 1WE2A 1KE2A 4BNVA 2ZRHA 3I42A 3L6OO 1EA5A 1FFCA 1DQNA 2ZTMA 3PX2A 5IRCD 4CMKA 3C5WP 5F7JA 4Y2TA 2HJGA 2OMKA 4G0MA 3R76A 3LW7A 3C97A 2ZI5A 3A1NA 3GARA 3PR1A 2XCLA 4Q9NA 3W6OA 4D1YA 4WX2B 5EHIA 2WKQA 5AJXA 1VI5A 3OLYA 3H65A 3IE0A 3WYAA 3WYGA 1PS9A 3CB4A 2H4YA 3VU9B 1WXHA 4YGYA 1ZD9A 1E2UA 3PJGA 2IYZA 1NN5A 1NU6A 2N75A 4O4HA 3SJZA 4X8LA 5KNBD 4I5DA 1ADCA 3OZWA 3IUJA 2RHGB 2V3VA 4G25A 2ZGVA 5LVAA 4RA6B 1E1YA 2AIRA 3BXFA 4BMVA 2O7VA 3P9IA 4I3GA 4EEKA 1T1RA 2HV8A 3HRHA 4PRKA 5FNZA 4C3OB 4YI5A 2GB4A 1P1CA 2H63A 5JBQA 3INTA 3NS7A 3V4OA 4EUHA 2B4QA 3O3CA 1WOYA 2B99A 2JIQA 2QUJA 2Z5LA 5A0FA 1Q50A 4AIIA 5CNKA 2EFYA 4U7JA 3I6YA 3SC4A 2PKEA 2F1JA 4X0EA 2D4HA 3EK2A 4OJTA 5IC5A 5M2QA 1C0IA 3HSKA 4HT3B 5JXGA 2YNMD 3V4PB 4CEIA 4YJFA 2A0YA 2GPAA 5ITSA 4CXMA 3DBLB 4M8NE 4D9BA 1SG9A 2CLKB 3JY6A 3ZJ4A 1GU0A 1NASA 1EQAA 3EFOA 4EELA 2JLBA 3HUDA 1YUBA 5I9IA 3R9KA 1BTOA 2OAEA 2QROA 4OFBA 3ZU3A 1KVTA 2ZI4A 2XKKA 2JAPA 4MIOA 2F8SA 2O8EA 5CA0A 3KHSA 3ELDA 4W5JA 3ROFA 3EN0A 3HY4A 1DX9A 4IHQA 4FCWA 2XXAB 5D87A 3K92A 4YACA 2ISQA 3Q4GA 4DSTA 1B93A 4ZAWA 1N2CB 4HX2A 4UNQA 1UEIA 1LSSA 1MC1A 3CIFA 1ZD2P 3E9DA 4EBFA 1GL9B 2NTYC 3B9QA 3QU2A 2B5WA 1H42A 1KYWA 1KRWA 1NR5A 4PZCA 4H35A 1LBEA 3S81A 2NO9A 2QSJA 3B82A 1E4EB 1T3SA 1QF9A 1U7TA 3NBKA 3VX4A 1QF6A 1F0NA 3AERB 4U8HA 3IAXA 4WZAE 2FG7C 4HEA6 1RI3A 4ZQGA 1QUEA 1NU8A 3RS2A 3IEMA 1WUTA 4JI4B 3FUCA 3K6RA 4YH1A 3W5CA 3HVKA 5FBKA 3Q0TA 4X92A 4I8IA 1RW4A 3H5LA 3H7IA 5EIBD 2W37A 2OZVA 1REQB 3DWEX 1MOZA 1GAEO 1D4FA 3E8XA 2ODBA 4K9RA 3CNQS 1YVDA 1QGED 2AG8A 2Q0XA 3E7PA 3R6TA 2NPOA 4WY5A 3WOHA 5C3MA 5AHKA 3KZXA 4AG3A 4Z7JA 2FZVA 1C3XA 3IILA 3NBQA 4NJMB 4G0UA 3UB2A 5E6RA 4HLQB 3DZDA 3KS9A 2VXOA 3GJZA 4TKUA 5KI6A 4XRRA 2VTBA 1CQXA 1E66A 3MCWA 1ACJA 2YJ6A 4ZHQA 4V1CB 1DAGA 2WOJA 2UYYA 4G36A 3JQBA 2PO7A 2VTVA 2HDNB 3ZGNA 3GPDG 5L3VA 4BO7A 2ZJYA 3CEMA 4O5AA 2ONCA 4OXKA 3UPTA 2FN9A 1N25A 5KNCD 5GWXA 4TXLA 1X7XB 3LVBA 3E0QA 2O0HA 4C89A 3DEKA 4BAGA 4EF6A 5HJ7A 2BELA 3BDVA 5GJBA 2P2LA 4I1OA 2LKCA 1IQRA 3T7KA 3B1VA 3DDUA 2Q4EA 5EMJA 3VHXA 1XWWA 4RVFA 3X2FA 1PK8A 3U1BA 1CDOA 1OUMA 2HA7A 4ACAA 4MPRA 1L4EA 3C98A 4GZMA 3TKYA 1O6GA 1MT0A 3KSAC 4PHGA 5A5DA 2ZJ8A 1S3SA 4JB2A 2XXBA 4OXIA 3CRW1 4JL8A 1JUDA 1I3NA 1QZZA 2HFJA 2ZYDA 1M2WA 4L02A 3IOCA 2W5UA 2V7UA 4LRTB 1AKMA 1PW5A 3IAUA 3K35A 4EB0A 3CLRD 4X6UA 4C03A 1ULTA 3OTGA 4C3UA 3QUBA 1U3VA 2Z8YA 8GPBA 2ZRFA 4MQ4A 2YFYA 4XIIA 2PL3A 1KJWA 1WV0A 1B0UA 1LK5A 4PLVA 1A8SA 4LXGA 2CEKA 5EHQA 4JJ6A 4BMCA 1YQUA 1RXSA 4NFSA 1FP6A 4G5OA 2MT9A 1CE8B 2BFPA 4HY3A 4BAZA 2WWYA 3DAOA 4V39A 1UDRA 3FVQA 1I9CA 3KEMA 3BH0A 3H2YA 5BPFA 4URFA 4D9KA 3GFTA 1OPXA 1V5IA 3WKBA 4LJ4A 2NLOA 3DMTA 3GWGA 3PU6A 2P77A 2P9YA 3WLAA 4AKEA 3LIPA 1QFJA 3IVGA 1VSVA 3EWIA 1CZNA 3BWXA 1J8DA 3PUZA 4NOMA 4P58A 1SOMA 1OLXB 2PRZA 2WWRA 3JAWB 2QBYB 4PQGA 1P62B 4BN4A 3U3ZA 1N1EA 2EHDA 3LQKA 4G5YA 2BPOA 1US8A 2TSYB 4NLLA 2VZLA 4ZV9A 5AKIA 2P4HX 3WYCA 4W5TA 2NO0A 4U6SA 3OTOB 1SUWA 1JIUA 5FPYA 2IY9A 3KQVA 3IXLA 4HGNA 4O59O 2O8BB 1PL8A 1UKAA 3TLXA 3J7AC 3L4JA 3R8FA 4JITA 4PYOA 4PF1A 2K2WA 3QXSA 4Y9TA 1K8QA 1ZJ5A 5DHPA 1SXJD 4FE4A 3G59A 3OP1A 1FYEA 4TSFD 3RT1A 4GX1A 1XQ9A 1QMPA 3PZRA 3S2FA 2IA5A 5C53B 2VK4A 4UXJA 4XCXA 4PYNA 3S4YA 4QDTA 3WIUA 4E5NA 5LA6B 2JLXA 3FYUC 4ROTA 2BM1A 5GONB 2CUZA 2PUFA 4TUYF 4I66A 4R9VA 1VE5A 2ZTLA 4NSNA 5DBGA 1XTBA 2FAXA 4GKVA 4DNXA 3MTGA 4TZ0A 2XYGA 4O33A 5CU7A 2AMLA 2YQZA 3PXBA 4JENA 4HRYA 2WY2D 4S0XA 4BFVA 1L7AA 3KUCA 3FG9A 4U7FA 1A96A 1SKAA 2B2NA 4FOPA 4MV7A 5J4VA 4UBJA 1IZ9A 4EITA 5FDFA 3K70C 1MIOB 1R6BX 3NYIA 4G4SO 3Q7SA 3QTTA 3VJRA 2H0QA 2UZ1A 1CJCA 2WV9A 3CH7A 4TM7A 1ULUA 2FW1A 2CCGA 3QTBA 1Q0SA 2BTEA 1AJEA 5CGZA 4AX4A 4KUEA 2AC2A 2RFLA 3GGCA 4WINA 1RZ3A 4FT2A 4M9UA 5CK5A 3VVBA 3ZK7A 4WMLA 3VNVA 4N3NA 5BVGB 2Z5VA 1JP7A 3IAM6 5AVWA 2RBEA 1E79D 1TA4A 4RKQA 1D2EA 1K63A 5EE5B 1U0LA 3FDJA 4MPJA 3RW9A 1O6CA 4YXWA 2HLHA 2XD9A 4BQSA 2O19A 1E6MA 3STWA 1NY6A 1M1UA 4EARA 5LU9A 4N03A 4AC9A 2BM0A 5CXQA 1K9VF 1AZTA 2PBRA 1TJ4A 4UU8A 1LRJA 1PZHA 2NZUG 2OPHA 1BFDA 1HH4A 4KEAA 4HXYA 4AS3A 4N9WA 5F7OA 2ZEJA 3PQ7A 4MR7A 4UUPA 4AYTA 4P3XA 2XQGA 1TGYA 1DIOB 2M98A 2QPOA 3BIXA 5K0GA 2AD1A 1Q2XA 2EC5A 1T5HX 2QTRA 3OKAA 3T3NA 4HSEA 5LQNA 1Z7EA 7MHTA 3AOGA 3FLEA 1EM8B 2BFCA 5LP6C 5HCUA 2BE7A 4JVSB 1QE5A 1FSGA 5L7WA 2DSNA 3GL9A 3LX4A 3L06A 3S2YA 1X0XA 1JT2A 4KBFA 1Y80A 1IG0A 3PGA1 4OM8A 5IBQA 1JR3D 5EE0A 5IVDA 5L8VA 3KLOA 3MCUA 3CEAA 3T3HA 4AY3A 1PFYA 2AN5A 2CMFA 4AJ4A 4EY7A 4YYZA 2C2MA 4EKEA 4RCZA 4G1FA 3DTVA 1RACA 4ATNA 1RXIA 2HT1A 2DT8A 2FVXA 4NV0A 4ZC1A 5EZYF 4QYSA 2VP2A 4V03A 4DCNA 2VDJA 4LF9B 5DCWA 4QX6A 4A6EA 5CT9A 4W4TA 2CW5A 4DIFA 1SVUA 3S7TA 4N9QA 1U94A 2NV2B 5GTDA 1WW8A 3MTBA 5AW0A 5AMXA 4I6JA 3QEAZ 4DA4A 1K8XB 1P44A 3VPFA 2H1FA 1P1KA 3PLNA 3G8YA 2PL9A 2JA2A 3G0IA 4LRQA 3TD6A 2WILA 2JD2A 3DKIA 1DAOA 3GVXA 3VSEA 4H0FA 2E21A 1EVIA 3CY6A 1R1DA 4DG9A 4E2XA 4BUZA 1JQ5A 3GK3A 1Z74A 4YP5A 4ZJYA 2Q3HA 3HVIA 2NU8A 1FVFA 2RC6A 3MOGA 4UHCA 4D25A 1QRTA 2P4SA 1NF9A 2Y93A 3EOZA 3CE6A 4G4IA 5F4ZA 2DZDA 4GO1A 4O4IF 2BGRA 2KMLA 1AT1A 3ET5A 3RVPA 2DHEA 5FOVA 1I0ZA 4HLDA 1JAXA 2JZNA 2DQ4A 3M0EA 1AHHA 1FFGA 1M2VA 1M5UA 2G77B 4IGEA 4EL0A 3ZKWA 4IOJA 3OHPA 1VJGA 3ET4A 5BNTA 2R85A 4AB1A 4PZ0A 2HIAA 4YXFA 5KYXA 2WFLA 1V6AA 4N7JA 1GAWA 4IHKA 1IIRA 1RMTA 5AK0A 4D4GA 1K06A 1N9GB 4REMA 4XD2A 3TKLA 1F6DA 1DQYA 3HCEA 3P2OA 3PNYA 2XIQA 4NZOA 4JLNA 1HLPA 3IAS1 3U9TA 3USES 4ZZ0A 3LT4A 3MZ0A 4LX8A 2ZRGA 3P20A 2C5EA 1X70A 5EJGA 4ZHQB 5CCBA 4FC7A 2GA9A 4QYIB 2QLLA 4RELA 4Z3DA 3WGTA 1FFBA 3O73A 3D7NA 4YK7A 5DH9A 3R0IA 2V7QD 5F33A 3DPUA 3I04M 4BNJA 1CZKA 3AR3A 2YVKA 1RS0A 2OENG 3N8GA 3R09A 5CB0A 3GOQA 1V1RA 2IIBA 2J5XA 3ILSA 1EDOA 3WKEA 3ONWA 2JCBA 2P9CA 4NXNB 3R7WA 1YHZA 4URHA 2HWXA 4BMPB 2DGDA 2NZXA 4ND4A 1P7PA 5LIPA 3FMOB 3KQYA 5IUKC 4QUHA 5KSWB 1XXHE 3GVIA 3VHXB 1RAAA 2FMHA 1LW6E 1GA1A 1ZU5A 1COWA 2Q6TA 1WXGA 1WUIS 2YVLA 4ZDIA 3ZY5A 1RAHA 1BD4A 2VXBA 1A2BA 1PGQA 2ZR7A 5ALJA 4A0QA 1AXEA 4KFUA 1IMOA 2EIHA 2IF2A 3C3BA 1QANA 2FYTA 1V5GA 3Q3CA 1RYFA 2QM0A 2BDTA 3IURA 5LJLA 5IEJA 4ZVQA 5DLYA 1T4MA 2OHHA 3PE4A 3T1OA 3WHIA 2GLTA 1WD5A 3OZGA 3V33A 3ZHBA 4ES6A 4BFTA 4KO2S 4HPWA 1R0BA 4EX6A 5H59A 4KLNA 3DO8A 3T3GA 2YWCA 2G17A 3QX3A 1QZUA 1XAJA 4MCAA 3IMFA 4CMHA 1D2GA 5UKDA 4CFSA 4I50F 1D7AA 4RHTA 4V38A 1G21E 5BWCA 1LBTA 2JLCA 5L4NA 3UK1A 1M0EA 1W88B 4HDSB 2UYQA 2VDUE 4MZXA 2QYOA 5HIJA 3W5IA 3I05A 3W8RA 4BX3A 3L4BA 2IFTA 2OWEA 4C2BA 3Q3JB 1T5LA 1UOPA 4KPFC 1DV1A 1YMUA 2F1OA 4J75A 5I7EA 1SHLA 1ZGGA 3L49A 5AI6A 1W0JA 2PSSA 1N2IA 1DO8A 1BWQA 4H4CA 5EJ8A 3T5DA 1NPTO 5GIOE 3ICWA 4KWCA 5KHLB 2W6JD 1ZAYA 3E7WA 3QE3A 4KYIB 2Z5GA 4AS1A 4S1OA 2N47A 4B44A 1VKZA 3G2MA 2OXCA 4OJMX 4DHEA 3V1TC 4HFJA 1SZCA 5JCJD 2Q4RA 3FPBA 4QNRA 1IN1A 4PXYA 3DXFA 1NX6A 4GQIA 5EEHA 1GPBA 3VPHA 4NL4H 2YZNA 5MN6A 2AYYA 4XYMA 3CUYA 1GZVA 2PY6A 4YREA 1ZOOA 2JCVA 4AWAA 5KWVA 1ZNXA 1K88A 2VYVA 2C94A 4MJLA 3WLTA 3OPQA 3WV4A 4FBGA 2EF1A 3AG6A 3CVWA 3WZMA 2PSJA 2CV0A 3U4HA 2H48A 3LRXA 1UP7A 3C7DB 5HR5A 1Y8ZA 1FNCA 1VE9A 3LJKA 2GN9A 4DM4A 1NW9B 1Z3IX 16PKA 4J7AA 4MKHA 2D7CA 3RVJA 3WLRA 1GG9A 4PAQA 3G8AA 4ZGBA 3U7FB 2FU5C 3RYHB 2Q29A 3V3TA 4DY6A 2JDIA 3ROZA 4K0KB 4E5SA 4JELA 3RIEA 4B17A 2Q3EA 1S2IA 1TYCA 4O8ZA 4PSAA 2C9OA 2ORYA 2FPOA 2Q7XA 4MUBA 3TOXA 1FLVA 2GPWA 3V2IA 5I4CA 2QVBA 1GPMA 2G1UA 5JBIA 1VMEA 4K6GA 4Q9HA 4F56A 5L40A 4ZOLB 5TMBA 2AKEA 4IIEA 4FGSA 2WBLC 1UXIA 5J5AA 1CY7A 4KNYA 1KI4A 2AQKA 5FL7D 1MDBA 5A7HA 3QHPA 1GO2A 2ONJA 4MGHA 3NT4A 4TGLA 2W2OA 2C5HA 5DOVA 2CMDA 2IP1A 1DBWA 4REOA 2DQSA 3Q11A 3COVA 2WVHA 4IO0A 1P45A 2W58A 4G0ZA 3FGPA 4RY9A 1M7HA 3H42B 4FGUA 4US1R 3A32A 4HNAA 1NQVA 1KOLA 3RU2A 4UMDA 4JOQA 4MS3A 3GLGA 1NXQA 3D6TB 4JYPA 1KFEB 2BGNA 3CTPA 2WJGA 3EAGA 4C30A 3TQIA 3H1FA 3BE4A 5DM60 2Z08A 1E1NA 2XRFA 1ODTC 4MWBA 3SFVA 3TRIA 4I1IA 4ACBA 3FGNA 4RMNA 2ZYGA 4JLPA 3PITA 4LC0A 3BMCA 1R5JA 2P2CA 4MR7B 2I29A 1WVIA 3A6GA 3DR5A 3NV7A 4PU0A 1CUXA 1X1RA 4MEBA 4O4JB 3WISA 5LMUB 1U99A 1HYGA 3PHCA 1A98A 4Y18A 2WT4A 2MHCA 1CNFA 3T06B 4HQKA 2J6HA 4ERXA 4LX0A 4N3CA 2OZLA 3QPAA 2P3QA 5DLEA 3VAZA 1XF9A 2VXCA 2BFCB 3CF6R 3LFTA 2O59A 1KAMA 1QPGA 1YZFA 2XWSA 1CDDA 4L0QA 4NU0A 2GZRA 2AK2A 4YASA 4NBKA 4O3MA 2LKDA 5AI5A 3EIQA 2CNWD 2QMYA 5A71A 3IEPA 1K7FB 1XTZA 1YDGA 4PTLA 1ZOPA 3S8MA 2VNSA 1W52X 1XMQB 2J3EA 5FNVB 1SVMA 3QF4A 3SHTA 4E1AA 2FGKA 1W44A 4B2YA 1N7JA 1UBGA 4CL8A 1KSGA 3P32A