4HB2A

Crystal structure of crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
204
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 204
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb2A00
2JCSA 3P4XA 1P2UA 1W2GA 4G5RA 2R6CA 2WJYA 2G1KA 1FOEB 3U6BA 2AN9A 1M7GA 3AKEA 3I5YA 1Q0UA 1VHTA 1XJ0A 2CK3D 3PUZA 4AKIA 2ZE8A 3CW2A 4HDQB 1W46A 3LVQE 3QXXA 4Q4HB 2Q21A 3KB2A 1II8A 5FOTA 2RGNC 2PX0A 4URYR 4Y0AA 2JLQA 1G41A 4OQLA 5BWMA 1P9NA 2NGRA 3T1TA 1II0A 1OFHA 2XEXA 3QPUA 2REBA 3OE7A 4Q7LA 3P1JA 5JWOA 4M1KA 2BEKA 5IHPA 1AKYA 3KXKA 1N6RA 4TL8A 2XNDD 3AVOA 1XTSA 2A5YB 1P72A 2VF8A 1N6IA 5SZKB 1ZNWA 2HEIA 5LD2C 2X8AA 1FNNA 5AJZA 2IS1A 4Q01A 1M74A 3VKGA 1P9RA 2IHYA 2C9YA 3KUDA 3NKVA 3VR1A 4Q4AA 1NSFA 3B1YA 4G01B 4ZDKA 1DG3A 2GWHA 2ZRFA 3O8CA 2GJKA 4HI0E 3LX5A 5IK2D 4ASUA 1FMJA 1BOFA 2AD1A 2EWVA 2MSEB 1HE8B 3AKYA 1UKZA 4NL4H 5JJKA 4FI3C 3CWZA 4LCBA 1G3QA 1GNRA 1N6PA 4TMXA 1LS1A 2O0JA 1KSGA 4IW3B 2O8DA 1EWQA 4PSVA 1XU4A 4Q9LA 1YZLA 1PLKA 3TR5A 4BPBA 1NIPA 1BYIA 1BYUA 1E99A 4A6PA 4L15A 2CHQA 1OYYA 3QEOA 3UMSA 2CCJA 3LXXA 2FWRA 3BFKA 4M1WA 4NCKA 3AVQA 3KQNA 3K0AA 3NG1A 4Z1MA 3HWSA 3NBFA 3RHFA 2KI5A 3U7EB 1JXOA 3QEJA 4M53A 2ZSFA 5BN4A 1XPOA 2IEYA 3EAQA 3CNOA 4QGFA 1IN8A 1OF1A 3BGWA 5ANRB 3WYAA 3OHMA 3WHLA 1Z08A 1X1SA 1ZUNB 1KK2A 2V6IA 3U7FB 4DCUA 1CR4A 2FFAA 2ZVQX 1R5OA 3NHBA 4TYWA 2JLUA 4C7OA 2ZI7A 1UBCA 2HJVA 3A4LA 4JYCA 1R6BX 1PUIA 2AR7A 1AJEA 4EQ6A 2IYTA 5EXPA 3VU9B 4LJ8A 2QROA 3B1WA 4I1OA 2Q9AA 1T6NA 2QZ4A 4MH0R 5EZ6B 4YMVA 1W5TA 2Q0HA 5DHAA 1FX0B 1KSFX 3EPKA 3SJAA 4DDWA 2VP4A 5CK4A 4CEIB 3GLIB 1OFTA 5BYJA 1EX6A 1YVDA 4PFSA 1W4RA 1OXSC 1J7KA 4PX9A 3S1AB 1ZIPA 3ADKA 3ZS8A 2V3CC 4CEJB 1UPTA 1OHHA 2ZRIA 3CUEF 3IPXA 4Q9HA 1ZNZA 4M1SA 4U02A 2ZRJA 4XD7A 2QUZA 2V1UA 4A9AA 3E70C 5FTMA 1VIAA 4Q00A 5EZ5A 1CR2A 5JSZA 4U5XA 1RFLA 1TL7C 3QKTA 1HUQA 3DPUA 4RZ2A 5JI3E 2CNWA 4NPHA 3G0HA 3ZVMA 3L2OB 2YKGA 2W6ID 5E3HA 2NZ8A 2AWNA 1QHHA 1DO0A 2KBEA 2WVJA 1IAQA 3LD9A 3MD0A 4WBSA 3TBKA 4EIWA 2ZU6A 4PC6A 5DGXA 5F2EA 3ZZ0A 2JA1A 2XSZA 3LXRA 3B78A 3OIYA 1GM5A 1ONBA 3PEYA 5EJEA 4K46A 5CIWA 1HE1C 4B32A 4N1AA 1IXSB 2IXFA 2RH5A 1P62B 1TQ6A 2OCYC 3K09C 4ZDWA 4A0FA 1KSJA 2QSZA 3CR8A 1J90A 4C4PA 4NYMQ 4PPNA 5KSPA 4DDTA 5KSOA 3CF0A 3T15A 1W47A 2G0NA 4Q1CA 1ZC4A 4ZIRA 5A0FA 3FFAA 4EFMA 3U4QB 3CX6A 2G0TA 5KHOC 3BD9A 4OYHA 2IUUA 1RZ3A 4A8JB 1YZNA 1T5IA 4NYJQ 3GEHA 2AXPA 1PV4A 1HV8A 4PQRA 2F1IA 4QM6A 3R20A 4D80A 4WA7A 3CPEA 3PENA 3IPYA 1KI6A 4IJMA 5HZKA 3Q5DA 3U60B 3T5DA 2AD5A 4MQBA 1KO8A 1Z6YA 3RRNA 1S3GA 4US0R 2W58A 3ECCA 3KXLA 1E1RD 5HE9A 4Q1BA 4XTCS 1AQYA 1ZNYA 3LBHA 2ZI5A 1IN5A 2IS2A 1ZUHA 1ZCBA 2OESA 2L0XA 3SC3A 1N0UA 1KNXA 1JBKA 2J0UA 5EP4A 2B92A 5FFMA 2OEPA 4G1UC 1ZINA 2PMDA 5ELXA 2VP6A 1P9WA 1EFTA 3OZXA 4XWAA 3RS0A 4D0NA 4ARZA 4PSAA 621PA 3SJBA 1DOAA 1U9IA 4HLQB 1HT2E 5KU1A 4WVFA 4C0LA 5FUVA 4TLDA 1VYUA 4MUAA 1S0UA 1NG1A 3J81k 5LB2A 3ZQ6A 2PJRA 3NDPA 1N6KA 1OIXA 4AKHA 2AL7A 1CULC 2QRNA 4FCTA 5HKKA 2O8EB 1DS6A 4YXWA 4BLOA 4G5GA 1G20E 1U2RA 3KUCA 2YC2C 4OHVA 4GOJA 4FMDF 5J4KA 5AJXA 1K8RA 3DDCA 1UBFA 1DELA 5KNCA 3BK7A 5H1YA 1V43A 1VPLA 3PUYA 4QGGA 4M21A 2ZI4A 4EPWA 1UBGA 1UKVY 2HCJB 1J99A 4HEJA 1R4AA 1KYIA 2W2TA 2WSSD 1ZJ6A 4B6EA 2YWEA 1YZGA 4Q4JA 5L3QB 3TMKA 1ZUIA 3SYLA 3O8DA 4MYTA 4MRRA 4A15A 3ICEA 5TXGA 1TQDA 3PR1A 2KWIA 2BWJA 1H8HD 2WV9A 2WJVA 3ASZA 3CIOA 4LV8B 3U3RA 4JJKA 2PZEA 4EPVA 4MGZR 4C0JA 3K9GA 1GILA 5K8UA 3PG5A 1SVIA 3THWB 4IDQA 1XTQA 4KFSA 5IF9A 2F1HA 1DAKA 3X1DA 4V0OA 2GRJA 3LY5A 1Q3TA 2V9PA 4QHYA 5FBVB 3T5GA 4LK2A 5FBQB 3OE7D 4PR0A 1UADA 1JPNA 5FL3A 2XXAA 4US1R 4QNMA 2IYZA 2PEZA 2JLWA 2NPIA 3VHLB 2IX3A 3DEFA 4G0NA 2QMEA 4HB2A 4H9GA 3UMFA 4B6FA 1AGPA 4BFYA 2E1RA 2WIBA 5LB4A 3I61A 2QMHA 3A1SA 2IUSA 4KBFA 4EJSB 1D9ZA 2QBYB 1RIFA 2ZJAA 1N6NA 3THXA 2D06A 2WTUA 3HU3A 3X1YA 4ASUD 1KMQA 1ETUA 4RZXA 4Y0VA 2EVWX 5CIQA 3LRPA 4C0SA 4DLSA 3DM9B 4JL6A 2XTZA 2FG5A 4KJZA 3RS7A 1FQKA 5TDHA 2G1JA 2B6HA 5JRZA 1RRFA 2GVZC 4V0ME 3B7GA 3U6KA 3QG5A 2RGAA 3EIEA 3M6AA 3W3ZB 3T1OA 2ZRCA 3K0SA 4C3ZA 2I4IA 4RD2A 5FOUA 2AK2A 4RSGA 1OSNA 4Z1MD 2RMKA 5B2ZA 1YZQA 2GZHA 2VBCA 4EDHA 1FW6A 2J45A 1S9DA 1CBUA 2F7SA 4O25A 1XEWX 2ECKA 3QNUA 2GJAA 3LLUA 4DLWA 4PHTA 4DVGA 1DAIA 4LV6A 3RS2A 3AQ4A 2CMKA 4UNQA 3IIKA 2ZJOA 2OAQ1 4JLJA 2H7VA 1DVRA 1HYQA 2Z4RA 4HLUC 3B5JA 1QVRA 1G3IA 1E79A 4BEBA 3Q7PA 5JEDA 1YU9A 3TW8B 1LTQA 4GMXA 4TYNA 4CGZA 3SZRA 1G7SA 4RD3A 4AKEA 5LPNA 4RD4A 2YNMA 3NBZC 2VHJA 4HB4A 4MA4A 4R71A 1KDPA 1OH8A 1A5TA 3MGCA 1CKEA 1VG8A 2H18A 4C2TA 2HYDA 2Q3HA 2ZTSA 2IYQA 3LQQA 4PQFA 1RKBA 4WW0A 4TQAA 3KKMA 3P27A 1QHNA 3AF1A 5BXQC 2W83A 4P0TA 2VIIA 1D6JA 2JAQA 1E0SA 1E2HA 4TQUS 1RPZA 4E22A 1KI4A 1KJZA 5JWHA 1YR6A 3EZ6A 1E0KA 3IDQA 2FF7A 1GL9B 4LPSA 4QOSA 1TU3A 3P20A 1OXUA 1ZCAA 2KBFA 1OT3A 2DCUA 1ZD9A 3QVVA 1S1MA 4JT4A 4LDJA 4XD7D 5CLQA 3W6PA 3KFVA 1ZBDA 4LJ4A 5G40A 1KDRA 2GAAA 3TJZA 4MKIA 4JLVA 3EC2A 1XRJA 3TVTA 5JRJA 3GLGE 1SULA 4A2QA 4KVGA 2A5DA 2ZRDA 4DJTA 1U8AA 1IY2A 2XNSA 1FNMA 3KJIA 4BLTA 3L43A 1D5CA 3OFNA 1SXJC 4F91B 3QBVA 2HF9A 4LPKA 3CWQA 2H16A 2VP2A 2PCJA 2YWFA 1NRJB 3QIAA 1ZD8A 3GLGB 1N5KA 1I2MA 5M04A 2FZLA 4BFUA 2ZR9A 5TARA 3UKDA 1Z06A 3A58B 3IIJA 1W4AA 1G3UA 1NN0A 4RFSB 2VEDA 4EPTA 3U44B 2REOA 1VG9B 5SZJA 3CNNA 1CXZA 2ZR0A 4LBWA 2QM8A 1Q20A 5BN5A 4TYPA 3VMFA 1TF7A 1XF9A 4DWJA 1E2DA 1NKSA 2BMFA 1G16A 4GPTA 3DOFA 3LV8A 1JQLB 1EFRA 2DYKA 1NMZA 4QGAA 2ANBA 4AYWA 1H65A 3AVUA 2ZRGA 1DO2A 1SVKA 2QI9C 4QHTA 5AUPB 4JVNA 1TX4B 2O8BA 2A30A 1OB2A 3QPVA 1C9KA 4NZYA 4MKFA 1ELOA 2YHSA 3TK1A 2PCLA 4KFUA 5JZVA 1G5TA 5G41A 1U0JA 3GLHE 4F92B 1XD8A 2YYZA 1OH6A 1VCNA 1ZVQA 3MUFA 1E98A 3FMPB 3K0FB 5C1BA 1PLLA 2F6RA 3K9HA 3U2QA 4DLXA 2FE4A 1DG1G 1UJ2A 2JLVA 3RABA 3I8SA 3OEED 2WWYA 1ZC3A 4Q48A 421PA 1CR0A 4AIIA 2ONJA 1W36C 3U3JA 3Q85A 3BFXA 1Z3IX 2O0KA 2BJWA 2CJWB 4DLUA 3NHAA 1F2TA 5SZIA 3H0KA 1G3RA 4HZUB 1XMVA 3GLHB 5J40A 4KAXA 3UG6A 4ABYA 2ZQ5A 4TN1A 1LV7A 3ZGXA 1S96A 5B57C 1JJVA 5CDFA 2WIAA 4B2IA 3ZIAA 5HKKD 2CEAA 4LJ5A 2DWQA 1U81A 2Z0MA 2IYSA 4YXWD 1TF2A 2OFXA 3C7KA 4CRWB 1NJGA 4FMCB 1F2UB 5FI0B 3ZVRA 3K70B 4AG6A 1T8UA 2H5EA 2J41A 3CX8A 4Q66C 3THYA 1OFIA 2OILA 3FVQA 2ZANA 3KKNA 4IFBA 4BFXA 2SHKA 2IA5A 2GXAA 2FN4A 4L9SA 2ODWA 2XJ4A 2AXNA 3F5FA 4JLAA 3TW4A 2VSXA 3GLFE 2ZM5A 3R9XA 4HSEA 5FBLB 3QKSB 1YR9A 1ZM3A 1EX7A 4C0AC 2QM7A 1AZTA 3WYFA 1M7BA 2C9CA 2J7PD 2QA5A 1E94E 2VPPA 2HLDA 3KL4A 4RCZA 5AJWA 4K81B 1KI2A 5EUMA 1G64A 2PT5A 3I62A 2IW3A 2XJ9A 1T3SA 2C77A 1L8QA 3LBNA 1FL9A 3GLFB 3UMRA 5F9FA 1SKYE 2ZU0C 3EC1A 2VHUA 3I4LA 1OW3B 3RLFA 1O87A 2PZFA 2JLYA 2QSYA 3LDAA 3W34A 3R7WB 4ESVA 2FGKA 3BIFA 5EXTA 3TKLA 3CR7A 3K9LA 3RANA 1SVWA 4US2R 2HV8A 4D81A 4NCNA 1SKQA 2PZGA 1XZQA 4B3FX 4NYIR 2ZI9A 1N0VC 1SKYB 2W6IA 2IS4A 2QAGC 4RCYA 4AG5A 2NQ2C 4UNPA 4BZPA 1D8TA 1NVWQ 5K8LA 3X1ZA 1S2MA 3BC1A 3WXMA 4KITB 2YZ2A 5FPSA 1GAJA 5FL7D 5J4HA 3AP2A 5CYOA 2CLCX 2A78A 3C8UA 1EFCA 1YZKA 4JYBA 1XXHA 4OQMA 3W3AA 4PPGA 1E2EA 3AV0B 2BOVA 4TL7A 3GJ6A 4KFTA 1R7RA 2ZRLA 3DKPA 2FPKA 2WMNB 4QNRA 1IJEA 4BE7B 1E9BA 2D3WA 1T3HA 3FHOA 1JAHA 3JZAA 4Q19A 3TQFA 2NIPA 2V1XA 4PC3A 3K09A 2ZSEA 3IQWA 4D0GA 4ZI3A 1KKMA 2Q3FA 4MUBA 3NVAA 5SZHB 1T0HB 4NCHA 5TVKA 2OZEA 4FW9A 2CLDX 1FUKA 2QP4A 3HR7A 1AM4D 1CIPA 3OIWA 1NG9A 2FFQA 5GVRA 1Q44A 4LOAA 1E79D 3FTQA 4NDZA 2ZS9A 4HDCA 2VP5A 4LYHA 2CE2X 2ODNA 3NWJA 3MJHA 1IXZA 2C04A 2QPOA 2WPDD 3LA6A 5E7MA 2JJ8A 4F93B 2G9NA 1R5BA 1N5JA 2PLFA 2QP3A 4LY6A 4AKGA 3SHFA 1WQ1R 3SR0A 5JBQA 2D7CA 2QL6A 5EUQB 3UANA 1R10A 1NIJA 1J8YF 4UQOA 4YQFA 2O8CB 2GJ8A 3EXAA 4DBLC 2C9OA 4BFVA 2Q9CA 2R44A 5LBIA 2RGCA 4MRPA 4AURA 1OIVA 2IYRA 3HPQA 3SN6A 4DSUA 5JJIA 4LI0A 1Z6XA 1KIMA 4RD1A 2GCOA 1KZGB 2AKYA 5C2JB 4DCVA 3ND8A 3BORA 2NMVA 5G3ZA 1US8A 2QTHA 2YC4C 4TTQA 1QVAA 3NC1C 1LVGA 1MKYA 3GJ8A 1OXXK 4LJ9A 4B76A 1LF5A 5L3SB 3N5CA 4BRUA 2AHOA 2FEOA 1U99A 2CVFA 2UVQA 4HAYA 3SJCA 4DB4A 1W4CA 2FSHA 3LNCA 2WSSA 4NP6A 1Q1EA 4NU0A 3OFND 3NBYC 1U0LA 1CEEA 1H8HA 4M0LA 4URUR 2F43B 3K0EA 4YLGA 3N70A 3THOA 3TAUA 4B44A 2ZUCA 1DBSA 3GJ4A 2DR3A 2UZ3A 4GT1A 1SVMA 4GBMA 4M1YA 2WHXA 3B8HA 1UEJA 4EPRA 2JDID 3F8TA 2FPMA 2PBRA 3HPRA 5E4FA 2ZJBA 3WP0A 4OQNA 2EYQA 3SHWA 3EASA 2W2VA 5DI3A 5JS8A 5DE3A 3PXGA 4C9BA 1PUJA 2DFNA 3P4YA 2GEUA 1RJ9B 1TU4A 1W44A 3EX7C 2X2EA 5EE0A 2EFEB 2EQBA 2R62A 4JLDA 1ZMXA 2AFIE 2H17A 3I73A 4O2RA 2C78A 2O8FA 3VTKA 2IYXA 4OK3A 4IVQA 1EFRD 3JZMA 1AN0A 4I1UA 4M1MA 3O47A 2WJHA 3B1ZA 4TT3D 2ODEA 2R6GA 2V4ZA 1P6XA 1YJ5A 2AKAB 1NP6A 2PL3A 4TMVA 2JLSA 3MWKA 4D0LB 1XTKA 1C1YA 3KTAB 2GCNA 3W8RA 2MSCB 4DLVA 2WWFA 4GNKA 3HU1A 1BMFD 3BERA 4XWOA 1Q1ZA 2RHDA 3B9PA 821PA 3T06B 4CT4B 1YRAA 3EPJA 3DL0A 4K8OA 4F4CA 2J0QA 2CE7A 4BFWA 4ZDJA 1DAGA 2GJSA 3KQHA 3ZLJA 2ATXA 2BMJA 3Q5EA 2OT3B 4H1UA 1FPMA 2ZJ2A 3H86A 5AUQA 3TSZA 3VNUA 3SU8A 3ZS9A 1AS2A 3ZIAD 4V0LA 2AX4A 2DBYA 4X8OA 1XX6A 1ANKA 3DZ8A 3SYNA 3EIHA 4RKEA 5FR2A 4HUQA 1S1CA 2NG1A 2RKOA 3W5IA 4BUJA 2OAP1 1ZAKA 3AEZA 4WXRA 4URWR 1G21E 5JWRA 3RS3A 2DPXA 4M9ZA 5D3MA 1YRBA 1GKIA 4TZ0A 4Z51A 2OCAA 2QTFA 3BBPA 2FDCA 3VX4A 3E5HA 1LF0A 4B3BA 1A7JA 1N5IA 3AF2A 1AZSC 2QU8A 3EZ2A 4HLUA 4AC9A 2QY9A 1JEDA 1NNEA 3GP8A 2IXGA 4Q18A 2HLDD 3LX8A 4KBGA 4KHZA 2IYYA 2XX3A 3OF5A 4OHXA 4LHWA 5CK5A 4GRAA 1XD2B 5CJPA 2QORA 4TL6A 2CXXA 4OBEA 2QMUA 3CLVA 5FTKA 3WP1B 1KOFA 2BMEA 2RGGA 4KLZA 3V4RA 3FWYA 4WZ6A 1T5LA 4V02A 5FUWA 1KDOA 1XEFA 1W4BA 2GAOA 1QHSA 1QHXA 1IJFA 2ZYUX 2XGJA 1UEIA 4C30A 4C0QC 4TSFD 3CH4B 4QBFA 4BQSA 3NTUA 1VCMA 2EWWA 3JVVA 2VHQA 4KCGA 4CDGA 2RHMA 1B0UA 2QE7A 2NO7A 4JVSB 2YVUA 1JR6A 2WWIA 1MO3A 3SNHA 1WP9A 4P4SB 1W49A 4CEHB 5DO9A 1RRPA 1FZQA 3G82C 2XOKA 2CL7X 4IKEA 2Z4SA 2CCGA 4ZPXA 4B35A 4KXFB 1WBBA 2ERYA 4KYIB 4M9XA 3W6NA 3UG7A 5KO2A 3QF4A 4AK9A 3ZVLA 2J0SA 1DPFA 2GTPA 3PEUA 4NE2A 4PC1A 3CF2A 1G6OA 1LNZA 2NO1A 3D7MA 4O3MA 4A8JC 2A2ZA 1RC8A 2J46A 2IF0A 3ND9A 4FIDA 5EE5B 1ZM4A 2O0HA 3Q9LA 1XEXB 2WJGA 1NLFA 2GEVA 4BRWA 4JSTA 4LBYA 2A5FA 2JEOA 1HQYE 4X8LA 1VMAA 4NTZA 4PC2A 4Q7MB 5KDOA 3GFPA 1IN4A 1TMKA 2N1BA 1FTNA 2UZIR 1A2BA 2FV8A 4FXPA 3TSOA 5FR1A 4CT5A 2P5TB 2QGNA 1P73A 4UJ5A 3AP1A 4MDEA 1SHKA 1DAMA 4GZMA 3ZH9B 4B3DA 4PO1A 4KSCA 3RRZA 4GSYA 4TLAA 3OEEA 4LJ7A 3MRSA 3SE0A 4WAUA 4G5SA 1JR3D 3GJXC 2VL7A 5AJVB 1UBEA 3UWOA 1WXQA 2QMOA 3EWSA 1E9EA 4QL3A 4BZXA 1AS3A 1COWD 2D62A 3H1TA 2VP0A 1F6BA 4JLMA 1M34E 4M1TA 3A1UA 2WICA 3KZ1E 3MWYW 1QDEA 2VH5R 1XCGB 2OBNA 3EA0A 4UXHA 4EKDA 1NJFA 1NSTA 3MLEA 3A4MA 2H1LA 5K8IA 4M4SA 2OSBA 1HURA 3IEVA 5E95A 2XTMA 3I1FA 1X8LA 4PTLA 3QKUA 1IONA 4DT1A 1MABB 4ZKEA 1ZRHA 1NN3A 1QF9A 2GBLC 3ICQB 2FNAA 2F55A 3ADDA 4EPXA 2P65A 2BBSA 1XD9A 1Z0KA 4Z8YA 3LWNA 1TF5A 3QE0A 3L8ZA 5CB6A 2J7PA 4W5HA 1KI1A 2J1LA 2OCBA 4FCWA 4ACAA 1OLOA 3KFXA 4A4DA 4C0HA 3H4MA 4QGHA 3WNCA 4DZZA 4U7DA 1NY5A 2EFCB 2PEYA 4TTPA 1Q1QA 2ZE6A 1S8FA 1CS4C 1KI3A 1KY2A 4ACBA 5KNDA 2IS6A 5B30A 1W5SA 3CNLA 2ZRBA 2ATVA 3QKRA 1Q3HA 2J7KA 1VTKA 4LHVA 1G6HA 1Z6GA 5FPYA 3L8YA 4BWYA 4JKIA 2P6NA 1II8B 3ETLA 3ONWA 5HTKA 2VQSA 3RVBA 4EJSC 2QP9X 3AUYA 3BXZA 3OESA 2VO1A 3LFUA 2VSOA 4QFMA 5JHHB 1KK3A 1ZM9A 2YWGA 3OEHA 3SFZA 5DYGA 1ZIOA 4IDOA 2FX3A 4OQXA 1QRAA 4JL8A 1NLZA 5J5CA 4OI4A 1X1RA 4ITRC 4PZYA 3ZVNA 4DB2A 1WDTA 2QQEA 5FL7A 1CJKC 3CRQA 5FOVA 4Q7KA 1FP7A 2ZRNA 4H1VA 2BKUA 4HAWA 4MYUA 1GZSA 4IVRA 2QAGA 4Q4AB 2IT1A 4XVUA 3GQBA 3AVVA 4FN5A 1ZM2A 5AUOB 3A1TA 4EUNA 4NH0A 4OJQA 4PO8A 4JLKA 1CJTC 2MSDB 3A8TA 4EFLA 1F3OA 2HDNB 5J4LA 2O8DB 4NMMA 5FOXA 1YZTA 4URVR 2PLRA 2IWRA 4A0HA 5KUTA 1KMHA 2BM0A 4E09A 1R8QA 2HF8A 4ZO4A 5C18A 4GI7A 3K0AB 5JEEA 1E1QA 1AK2A 2Q6TA 5FTJA 4B48A 3RYTC 1OXVA 2XZPA 5D3QA 2P2LA 5A5GA 2KE5A 1OPXA 2FOLA 3QQ5A 2Q9BA 3RRMA 1GG2A 5KDDA 2IXEA 2TMKA 2WPDA 4L5BA 4TLEA 4KLNA 3ZZTA 2C96A 5GJBA 3PEVA 2RCNA 4Q5IA 2GXUA 4LV5B 1N5LA 2ZYTX 2WJIA 2OLKA 1AS0A 1ZP6A 2B8TA 1HQCA 3M1IA 5CYPA 5H68A 4C7OB 4DCTA 1PVOA 4PPQA 1P2TA 4CYMA 1G8YA 3B60A 3NEJA 5FOWA 4EQ6B 2O52A 4TMTA 4E5UA 4TYYA 4MRVA 3PIRA 3HDTA 4KFRA 1Z2AA 4KI0A 2N42A 2EU8A 3DHWC 4M9QA 4P33A 4W7SA 2A7QA 3UXMA 4M22A 5DLQC 1FQJA 5G3YA 1X6VA 2WWWA 3REGA 1MV5A 2E87A 3TSWA 2IUTA 4ZCLA 4NYIQ 2RAPA 4YONB 1VECA 4KSBA 4CIDA 3CONA 4YMSA 2FFBA 2QPAA 3TGPA 5DHFA 5DN6D 5FUXA 2QE7D 1TUIA 1XTIA 4QBGB 1WB9A 2Z6VA 2WWXA 3EW9A 2J3EA 4B34A 2HXSA 2W00A 4G3XA 1Z07A 5GVSA 2XOKD 4PZZA 4AYTA 1TAGA 3PJRA 4RZ3A 5JSZB 1E9CA 1X86B 4BECA 1DTSA 1P5ZB 1N6OA 3VR5A 3PEWA 3IGFA 3ADBA 1O3YA 4F4IA 4Q9KA 2VRWA 4TLCA 2JDIA 1QHHB 1SXJD 2YWHA 3UWKA 3CO5A 2JLZA 1EESA 1LW7A 1Y63A 2JGNA 3FKQA 3D31A 3DVLA 2OFWA 2ZUDA 5DIFA 2VP9A 4LC1A 3IILA 2W0SA 4Q4HA 3N2EA 3EARA 1P2VA 2IYLD 3AVWA 5E7IA 4GOKA 2GF0A 2FU5C 2RGNA 1L2TA 5A4JA 4MDFA 5HPYB 3Q8XB 4B74A 3FMOB 1DAFA 3AVXA 2UKDA 3OIUA 1RYHA 3FOZA 4V0NA 2CHVA 4TT3A 3H2YA 3DMNA 2C99A 4ZIRB 1KI9A 5EP2A 5KYKA 1Z0JA 3HYTA 1UKEA 2JJ1A 1W2HA 2WZQA 2QQ0A 5IRCD 2OFOA 3C16C 3T12A 3VX3A 2FSFA 4I4LA 5FPHA 3AB3A 2BMDA 3PUXA 1BMFA 3U7GA 1KI6B 2YINC 1G1MA 2HCBA 1TUEA 1DADA 3B13B 1RVDA 2ZYWX 4YMTA 4DLTA 1E4YA 5KSYA 3OAAA 5C46F 2QTVB 2HXYA 2GZAA 5AJYA 1E9AA 1H8EA 4KO8A 3MJRA 2J0UB 1VCOA 3ZQJA 1N2CE 2EYUA 4BLSA 3RAPR 3PVSA 1MRNA 3WHKA 1W36D 4Q21A 1Z6TA 1Z28A 4Q1EA 3K70C 2WOOA 4ARZB 4JLNA 4YDHB 2XTNA 2B8WA 3SJZA 1G5PA 1I4LD 4B3XA 1Z8FA 3KDSE 4E03A 2GA8A 1N6LA 2NO6A 2ORWA 1E2JA 2FPLA 3IO5A 3TUJC 2W6JD 4N0DA 1P75A 3Q3JB 1EFUA 2ZRPA 4Q02A 4QHSA 4P4TA 4BFTA 5HZHA 4HAVA 2FGJA 3L0SA 3EZ9A 4IDPA 1W1WA 1U94A 5EE3A 1G5RA 3DO6A 1G7CA 2LKCA 5EE1A 3PCRB 1TNDA 3VU9A 3QXCA 3SBEA 4DT1B 2FMXA 2BBOA 2IBMA 4Q4JB 6Q21A 4DCSA 3PV0A 221PA 4OL0A 1UKYA 3AH8A 4FMCF 1FX0A 3K0CC 1M1YE 3QG1A 4DKXA 4LWZA 4R9UC 5HCNA 1E6CA 1G7RA 4OK6A 1Y3AA 4HB3A 4OHYA 3GLIA 3M0EA 4LBVA 3WYGA 3S1AA 4TSFA 1DE0A 3CZPA 4BGDA 1E2PA 3B1XA 2ZPTX 2FA9A 4TL9A 4CEJA 5LDDC 2FZ4A 1KO7A 2FEMA 1DARA 5C4MA 2XXAB 3OEHD 1OYWA 1NL3A 1CJMA 2ZUBA 4RY2A 5TY0A 1VIYA 121PA 4CW7A 3U7HB 4DSNA 3MCAA 5BW8A 2DB3A 5DSZA 4P31A 3CRW1 8OHMA 4IXNA 1R0ZA 2DWOA 3NH9A 3MWLA 3R8CA 3BH0A 3GJ0A 1N6HA 4YDSA 1NBMD 1G3MA 2GJ9A 5AK0A 3FYHA 2WOJA 3WBKA 5EE9A 2V8OA 1G8FA 1XMIA 1G8GA 2W2XA 4NBSA 4B2LA 1U98A 5EXXA 4AD8A 3PUWA 3THXB 1UFQA 3P32A 1OE0A 3AUXA 4PQYA 4IEEA 1E9FA 2YOHA 3FMFA 1V5WA 3RDPA 1GL7A 3FDIA 5CM9C 3SYKA 3X1XA 1B23P 2ZAOA 1QG4A 2I1QA 3CZQA 2N46A 3I72A 3RRYA 2F3TA 1T9HA 1E2NA 1R2QA 1TTTA 2G88A 2CCKA 2V54A 3U4QA 1KK0A 4Q47A 2CL6X 2H57A 4L16A 3R9WA 4IEIA 1E1QD 2NZJA 2GNOA 4A8JA 4AYXA 3KX2A 1EWRA 4QKQA 4WXPA 4QBIA 4MKHA 1FUUA 3FMIA 3NC0C 1XJQA 3EPHA 2PT7A 3RNLA 2BM1A 1G291 3V00A 3NBXX 2R65A 2BIFA 1CTQA 2X2FA 5FI1B 4JL5A 3R9IA 1UM8A 4O0MA 3B85A 4TQ9A 3DM5A 1T91A 1KZ7B 2AFHE 4Q9JA 2OUKA 2RGDA 1JR3A 1R5NA 1XCPA 2JIZA 2K5UA 2YV5A 4BZQA 5JMTA 3IHWA 4X8HA 4IFEA 2CLSA 4IOLA 4KU4A 1UDWA 4TMKA 1AGRA 1COWA 4UNNA 1KO1A 2E9SA 1P61B 1E4VA 3HU2A 2BKEA 3QY0A 4MGIR 3GJ5A 3BOSA 3AVTA 4P4UA 4A2PA 5L3RA 1D2NA 1TQ2A 5TV2A 1IM2A 2O8EA 1A4RA 1NF3A 2ZR7A 4YC7A 3CRVA 2QEQA 2ZE7A 1EFHA 4UKDA 2Q3MA 1G17A 2YOGA 1SHZA 3I8XA 4MKGA 3CH5A 5KDLA 1JEEA 2NPFA 1JI0A 4S2EA 2AK3A 4FWIB 3VHXA 4B3GA 2XZOA 2C8VA 3U61B 3WRXC 5L3QA 4QG7A 2OHFA 3QI2A 2JLXA 3A37A 2D4HA 3FPAA 1QHIA 2GBLA 1Z2CA 2Z43A 3LW8A 5JJLA 5JS7A 2GHIA 1M2OB 2J9RA 4Z54A 3T1QA 4DSOA 3THWA 4XH9B 3GEEA 4LYFA 4HB0A 5EQTA 1ZU5A 1OKKA 3VR3A 3K9NA 4KV9A 3VR4A 2C2HA 2X1VA 4JVMA 2OXRA 2ZE5A 3EA5A 2PJZA 5KOYA 3C41J 4PPFA 5AWFC 1IN7A 4ESHA 4LHZA 1JALA 4LZZA 4NKRA 3LLMA 4TTRA 4WIAA 1GDDA 3A1VA 2F1RA 3CM0A 2ZJ5A 1XTRA 3SOPA 1NVVQ 3KQUA 5DH9A 4NCIA 3CPHA 3X1WA 3AGPA 1Z0AA 4F38A 3D6TB 3L0IB 4URXR 2JJ1D 5DI9A 2OM2A 4EJSA 1KI7A 3WMEA 2QBYA 3BRWD 3ZD7A 4LGMA 3I5XA 4JZKA 1IOZA 2O8BB 1W0KD 3DKVA 4LX0A 2WAYA 3LVRE 1NVUQ 1KHTA 2C95A 2AWOA 3QVUA 3VR6A 2OCPA 2V6JA 1II9A 1WCV1 3K8YA 3OAAD 4PAMA 4HLDA 4DLZA 1GRNA 2GK6A 2OLJA 3I92A 3TR0A 5LD2B 2OBMA 1DAHA 5TB5A 1H8ED 3ZJYA 1QHGA 5CDFE 4EPYA 4IOMA 2G77B 4OI2A 1TADA 1NI3A 1P4SA 4CZ2A 3AF0A 2Z83A 5FTLA 1UF9A 1FFHA 4P3YA 2NO9A 1CRPA 1A2KC 1E2MA 1F48A 1Q22A 3GEIA 4PHGA 1F2TB 4A6XA 4V0MA 5CM8B 4HAZA 2ASEA 3NDBB 4ON9A 1U90A 1NMXA 3ZD6A 1AQUA 2IYVA 3W90A 2BC9A 5BQ5A 3C5CA 4JBWA 4WOPA 3RSLA 1I4DD 4C0BA 3EPLA 3QSYA 4BLRA 2BJVA 2ZRAA 4QC2A 4YMWA 3THYB 2C03A 2DFKB 4KVAA 4RVCA 2J87A 4MITA 2ONKA 3T61A 1PLJA 2ZI3A 4LYAA 3BB3A 3D3QA 2JJ2A 1AA9A 1JNYA 3CB4A 4HLCA 2NTYC 1I2DA 3RS5A 1OH7A 1JAIA 1EGAA 3GLIE 1XPRA 1XNJA 4JVLA 4M9SA 3A36A 3OIVA 2IK8A 2YOFA 4A92A 1D9XA 4M2LA 1PJRA 1MT0A 4HATA 2G83A 1CLUA 3WBJA 2GKSA 1U8ZA 5DN6A 2OXCA 3SQXA 4PC7A 3RWMB 2KJQA 4URZR 4GP7A 1XBTA 5GADl 3WNBA 3BAFA 4IDHA 4W9MC 1A82A 5JHGB 1T4GA 2BDTA 1Z22A 2BVNA 1XXHE 3T35A 1XPUA 4R98A 4ZKDA 4DDUA 3PFIA 1SVOA 4OQFA 4L8GA 2A9KA 2JLRA 4HAUA 2R6FA 3TIFA 3MFYA 1IN6A 1SXJA 1T3LA 4CF7A 2WWGA 3AVPA 1T0JB 1EK0A 1E0AA 1KDTA 1GVNB 3U3MA 4I99A 2QN6A 4M8NE 4B47A 3GLGA 4KODA 1QZXA 3R8FA 1E0JA 4FWTA 2GETA 2ZYVX 1XXHB 2PX3A 1NMYA 2CL0X 4G5OA 5UKDA 4FD2A 4RFSA 4JLPA 4OJKA 3U44A 1K6MA 2QG6A 5BN3A 1GITA 1R0XA 3B1VA 4HZIA 3BB1A 5KTYA 3IBGA 4PSKA 5JECA 1Z29A 1X8JA 3B2EA 2R2AA 3W8NA 1CJUC 2GESA 2DHRA 4DIEA 1NVVR 4IHQA 3IUYA 3IKJA 4DLYA 4ZDIA 2WSMA 3EZ7A 1YR7A 3BS4A 1NN5A 4LBZA 3CPJB 1KKLA 3TUIC 2EFGA 2FSGA 1BS1A 2ZS8A 3GCGA 4GOXA 4I81A 1JR3E 1Z0DA 1XJCA 3BWDD 2MMCA 1VKJA 5B64A 2OG2A 3AP3A 3K0FA 2JIZD 3W5JA 3BFVA 1FP6A 1QHYA 1W0JA 3FE2A 4QRHA 3CKLA 4FCVA 4Q9IA 3LO5A 4FMDB 4RJLA 3P26A 3IIMA 2IHBA 5GJCA 3DOEA 3FKSA 2CJWA 4IOJA 3MAAC 1JECA 4MGKR 5H8WA 1DEKA 4D26A 4DHEA 2IEZA 4HZUA 1E9RA 1P7CA 1YZUA 3CRMA 3GLHA 1XFAA 2VLIA 1WRBA 1LS6A 2RGBA 4D4JA 3E2IA 3VAAA 1GL6A 1K5GA 2WAXA 3EIQA 3KJHA 4JLOA 1J70A 4JKYA 1U8YA 4II7A 4Q1DA 1F2UA 1LY1A 2I1VB 4D4MA 1P3JA 2W6JA 2GCOB 3LW7A 4XTRA 1KJYA 3TE6A 5L3VA 4UJ3A 1US8B 1Z0FA 3AM1A 4AI6A 3EG5A 1WA5A 2GZDA 4O2LA 2WKRA 2IWHA 3QXHA 2YJTD 2QAJA 1EXMA 3EWAA 3TAHA 3KKPA 1E2GA 2ZI6A 2ZREA 4F7WA 2ZRHA 2JATA 1QBKC 4TMZA 4Q4LA 3QKSA 2XZLA 2HUPA 1HTWA 3FFBA 4LRWA 3GD7A 4LJAA 2A5GA 1U0HC 1YQTA 4LHYA 5GJVC 4FINA 3C5HA 3UK6A 1ESNA 4IDNA 2QRZA 1OKKD 3WMGA 2ZETA 3WNDA 3AKDA 5JFGA 2LWIA 1M6NA 2RGEA 5J4YA 1G4UR 5HE8A 3GLFA 1F60A 1S3SA 2KB0A 1XDBA 1CR1A 2G6BA 1MH1A 3Q72A 4HAXA 5P21A 2BHRA 1M7HA 3K0CA 5DI3B 3C15C 2GCPA 4MYCA 5DYIA 1GNQA 3R7WA 3L0PA 3RC3A 3HYRA 2GVDC 2J59A 2KSQA 5KSZA 4AWXA 5FPKA 5JI2E 2O8FB 4QJ4A 3KKOA 1BKDR 2V7QA 1IY1A 2NO0A 1KO4A 3VFDA 1NBMA 3KQKA 2B7BA 5C4GB 1E2FA 3V9PA 1NVXQ 5CB8A 1L4UA 3I32A 1J8MF 1RRGA 3BH6A 2ORVA 1YE8A 4TYQA 3TLXA 2I3BA 3QUSA 4N0EA 1GRRA 3FGNA 1G18A 1MOZA 3CBQA 2ZSAA 3AGQA 2ORIA 3K1JA 4BEJA 3T1VA 2VTKA 1F5NA 3WMFA 3LH5A 2QNRA 3UIEA 4LHXA 1I4TD 1E9SA 3FHTA 2ANCA 1BO6A 2V55B 4DXAA 4UXJA 1KY3A 1KGDA 3KB1A 4LJ6A 5H70A 2ZXUA 2GILA 3H84A 3E1SA 2BBTA 5AUNB 2A5JA 5F3WB 4OHWA 2CVHA 1E69A 2WM9B 3NH6A 2QT1A 521PA 2IC5A 2ZEJA 4HYYA 4NYMR 2RGXA 4W5JA 4B2PA 4HUQB 1HA3A 4I1VA 4XSGA 1GP2A 1HT1E 2EFDB 2P67A 2VF7A 1KSHA 2BCJQ 1Z83A 2DY1A 2ZIAA 4IOKA 5HR5A 2LCFA 2R6DA 1A1VA 3VR2A 1XB2A 3NIBA 4B43A 3Q7QA 2H8KA 3PUVA 3ZZUA 5FTNA 4NYJR 5D3MB 1JQJC 4C2UA 2D2EA 2QT0A 5TMPA 1WBDA 4NCJA 3KJGA 5BYKA 1TEXA 4P32A 4RFVA 2X19A 2NOAA 2REXB 3GFOA 2OO7A 1CJVC 4IRUB 4A2WA 4DDVA 2HYIC 1YR8A 2JJ2D 4D6PA 3KXIA 2O8CA 1HEIA 4IVPA 4QJ3A 3BJIC 3LQRA 3T34A 4JJZA 2VHCA 1K5DA 2X77A 2B7CA 4WZAE 4DLRA 5KNBA 2RB4A 3ZDQA 4DUGA 5HCIA 3A1WA 4X8MA 4ERNA 4LUCA 2QENA 3ADCA 4PHFA 5K8TA 3KQLA 4E07A 4OK5A 5L3SA 1IQPA 5CITA 2GXQA 4Q7JB 1E2IA 1ZYUA 1J2JA 1KAGA 4B71A 1Z47A 4BFZA 1R8SA 1KNQA 1WE2A 1ZNXA 2WBLC 4W5WA 3RS4A 1OHHD 1G8PA 1XTJA 2A3RA 1YHNA 4LC0A 1G9XA 2R9VA 1CP2A 3LAWA 4Q1FA 4Q03A 1NY6A 1Z0IA 3MSXA 4A82A 4DCNA 1SXJE 1VHLA 1Z6AA 1MO4A 3W6OA 3SI7A 3PITA 1JB1A 2F43A 3IO3A 1G8HA 2CNWD 5GJWC 4BLPA 2WKPA 2XB4A 3VKWA 4PAQA 1GIAA 2OBLA 1XEWY 1Z5ZA 4PAOA 2OV2A 2VA8A 1KO5A 2FFHA 4L9WA 4LSGA 3QF4B 3KJEA 1ZD1A 1AIPA 1E32A 3AF4A 5EP3A 4GDFA 1IBRA 2XSZD 3FB4A 1E96A 1Q12A 1SXJB 1RJ9A 1E2KA 2C98A 2F9LA 3ASYA 4JBYA 2CK3A 3BE4A 2HT6A 3GJ7A 3GFTA 2VSFA 3L0OA 4JIMA 1RW4A 1SZPA 2LKDA 4Q1AA 5KPDA 4TWZA 1GRQA 1P60A 1TQ4A 1VG0B 1LFDB 1E2LA 4XWKA 2JASA 2D74A 1X8KA 3A4NA 3N2IA 5JCZA 1XCMA 4HUTA 1TEVA 2CDNA 3O8BA 5AR1A 1L4YA 4JSYA 1Q1BA 1UAAA 2ERXA 2BV3A 2XNDA 4XSHA 3SEAA 1W0KA 3KTAA 3PQCA 1XMSA 1P2SA 4R2IA 4PZLA 4XJXA 1ZM7A 1DAEA 4YMUA 1T8TA 1XWIA 3W9YA 1W0JD 1JXMA 4CVNA 1SVSA 2Y8EA 2P6UA 5IK2A 1CU1A 3QJYA 3FKSD 4UNSA 1S9HA 1U9IC 4LJYA 1AKEA 4U00A 3B6EA 4MYHA 4UNRA 1X3SA 2H92A 1XMJA 1GKUB 2ZROA 3SFVA 2ZSBA 5IT5A 3BH7A 4GP6A 2GDJA 2IF2A 2ZRMA 3TNFA 4XIGS 5J47A 2J5XA 2ZJYA 2WJJA 4MGYR 3X2SA 4PANA 4WZBE 4XOIA 1W36B 4RZUA 1GWNA 3K70D 3MG9A 2ZJZA 1FTSA 4C0KA 4ZCIA 1NKTA 4POAA 5JLJA 2F3RA 3NXSA 4GL2A 5EP1A 1N25A 5E7JA 1E2QA 1JPJA 5CJ2A 1ZU4A 2FJUA 2G3YA 3K53A 5EXSA 4ZCMA 2FH5B 4A0GA 1N0WA 4DSTA 4BFSA 1QG2A 3IEUA 3ZYCA 4A1FA 4TZ6A 1N3BA 2VHTA 4DEYA 3B9QA 4TMWA 1KTVA 2J0VA 4DIDA 4F4JA 1CRQA 2QPTA 5F98A 3BB4A 1E3MA 1XD2A 2BBWA 1G19A 2DFLA 4EAQA 2O5VA 3U3OA 4JMPA 1PZNA 5J4VA 5JCPA 3CX7A 3UPUA 1L7VC 4CEIA 1WMSA 1R0YA 3TQCA 2HJGA 3GPLA 3FHCB 5IDVA 2ODBA 3U5ZB 4LYJA 3SS8A 4J0QA 721PA 2WKQA 1OXTA 2ZRKA 4JS0A 2VYFA 4V03A 5DNYB 4ZI2A 3RSOA 2EW1A 1IY0A 4XVQA 1ESMA 2D2FA 4AY2A 1D2EA 2IL1A 2WMOB 1RYFA 4D4LA 4A36A 3QKRB 1E9DA 3M4YA 4JLBA 2F9MA 1NBME 4N3NA 4V0KA 3C4JA 2V7QD 4P4SA 4D82A 2P0EA 4CEHA 4XVRA 1JJ7A 5CLLA 2GF9A 3TRFA 2OE2A 3TUZC 4A0RA 4D2IA 4GZLA 5KPJA 2HT1A 2Z5FA 3AVYA 2IYUA 4B3CA 1GSIA 4G5QA 1M8PA 1GUAA 3UATA 4TLBA 1C4OA 5FPTA 1SVLA 4JT2A 3C14C 4GFDA 3NEYA 3RWOA 5G53C 3IHLA 1IXRC 1CF4A 4BLQA 4R2HA 3U3KA 2B21A 2QAGB 4B75A 3O8RA 1OJLA 2XITA 5FOSA 1GTVA 1HH4A 1RRCA 4RKFA 3JVUA 3TVDA 1NN1A 1MO5A 4RD0A 2DFTA 4PXAA 4PHHA 3B82A 4QBHA 2XB2A 3EZFA 3V4FA 3SBDA 1VDZA 4I1SA 1XEXA 3QXJA 2W0MA 5B58C 5L8VA 2ZSDA 2D7DA 2MMGA 1UDXA 1MRSA 4OHZA 4B73A 3F3YA 3QXSA 1FMLA 2IYWA 2R6AA 1XZPA 4BASA 1BH2A 4DC9A 4L4UA 1OB5A 2PMKA 4QJ5A 2F1JA 2BCGY 1KMHB 2GEDA 5FBRB 3DZDA 1G7TA 3IBYA 1OH5A 1D2MA 1OIWA 1G4AE 2QGZA 3MMPA 3GMTA 1HY3A 1SGWA 3HP1A 5FUYA 1VYVA 1GOTA 1KI8A 1SQ5A 4D4KA 2P5SA 3LBIA 2XAUA 1ZW6A 4DRZA 2ZVPX 3QPWA 4D25A 1MR3F 3VNVA 1VG1A 2PH1A 4HDOB 4KYUA 1Z63A 1E1RA 1KK1A 5FBWB 4ILEA 4FMBB 3AF3A 1GKYA 2C5LA 4NHOA 4R7ZA 5F9HA 1BIFA 2DWPA 2ZAMA 1IHUA 1MO6A 4PO9A 2BEJA 3CF6R 3AKCA 1TPZA 4UXIA 3HJNA 3SQWA 2P3SA 2GXSA 5FH9A 3F0TA 3QF7A 4EFNA 1R0WA 3VKHA 1KJWA 4DUGD 4GMDA 1RE0A 1OFUX 2ZS7A 3TH5A 3G5UA 4RD6A 1Q57A 4NONA 4B33A 4JBXA 1YKSA 3DMDA 4QM7A 1VCIA 3MWJA 3REFA 1KAOA 3RC8A 3QENA 1GFIA 2CHGA 4OKSA 3WRYC 4Z8XA 3KKQA 4QXAA 1EG7A 3A6PC 2ZJ8A 1VYTA 1MABA 4OI1A 1W7AA 1GNPA 2ZITA 1LB1B 1NLYA 4OI0A 1Q21A 1ODFA 2GK7A 3QBTA 3QOFA 4MRNA 4S35A 1WF3A 3WY9A 2CBZA 3D8BA 2P6RA 2EFHB 2WWHA 2FSIA 2R8RA 4ZV4A 1W48A 3SDZA 1XP8A 3VQTA 4DEXA 3I3SR 3HR8A 4IXMA 5DISB 3L82B 3GJ3A 4M1OA 3CRRA 1OV4A 4MRSA 1S4QA 3IQXA
chains in the Genus database with same CATH superfamily
2IXTA 4OLFA 3R8XA 3U4IA 4J0KA 3P4XA 5BSFA 4YJFB 1W2GA 2PLWA 5T57A 1QGYA 4WLFA 2VDMB 1Y7IA 2MHCA 2R6CA 3IAXA 3GCDA 3EXG2 4Z9XA 3U6BA 2AN9A 1TYDE 3AKEA 3BWYA 1ZZGA 4OJYA 3W5UA 3ECAA 2Y4OA 3I5YA 2CK3D 2I2BA 4WNYA 3RVDA 3VOBA 3WLOA 3N6RA 2J4CA 1CY0A 2YZGA 3D6FA 3JZFA 3KB2A 3RKSA 2PZLA 4CMJA 4ETMA 1R8XA 4JJEA 3ROQA 4URYR 4Y0AA 2JLQA 5MGBA 5HRUA 4BNJA 1B43A 1CUIA 2VQDA 2GT1A 2XEXA 3ENVA 3L49A 4YRCA 4CMBA 1D1TA 4M9RA 2GBPA 3T9CA 4EHAA 3G3EA 4TQGA 1AKYA 4X41A 1SXQA 2JEYA 1RNLA 3QUQA 1N6RA 4UARA 3FTEA 1V26A 1BE8A 4B0PA 3ABRB 2HMUA 4WCDA 1S7CA 1FP1D 4TSRA 3TZ6A 4DRXA 4HHEA 5CCBA 2JHCA 4ARBA 3RVRA 5EUBA 3BEOA 3O84A 4OGWA 2QTWB 5E8RA 1LEHA 3AOEC 1KQOA 3VKGA 2C9YA 3KUDA 4EG4A 4Q4AA 2V74B 1JFSA 3J7TA 4MV3A 2UXDB 2ZRFA 5CG1A 2GJKA 5CFMA 1GG5A 5IK2D 5L40A 2WUDA 1FMJA 1T43A 2DJ5A 4AMYA 3AKYA 4W63A 5E3IA 1HDXA 4LCBA 1GNRA 2Z58A 2ZB7A 2O0JA 3IUMA 1Y5LA 4LOHA 1JKIA 1J2TA 1I5RA 1AQNA 1IBSA 1QV9A 5JU6A 4PSVA 3STXA 2E5LB 1NUUA 2BUBA 1PLKA 3PGKA 3PRKE 1NIPA 1BYUA 2PR7A 2OXFA 4QLAA 4RELA 5F21A 1JLSA 1PS8A 1RQGA 3K6KA 3QEOA 4F8JA 5LQAA 1PJCA 2CCJA 3WWCA 3CLUC 4UTRA 5LQUA 4BNUA 3PLRA 3HWSA 4RZSA 2FF5A 3ETDA 2I7VA 3M1LA 3T52A 4R2WA 3QX7A 5JALA 3BK1A 3QEJA 1XTBA 2J3JA 3EXEA 1O94A 3DBHA 2NN3C 4PYLA 3REQB 5F7ZA 1M2KA 3TNJA 3A28A 3GDFA 3JQGA 3BGWA 1QIEA 1SCAA 1TB4A 1YB1A 3KB8A 3LZ6A 5EKUA 2JZNA 3RW9A 4JB0A 5HJ2A 4FFBA 4L08A 4XD7D 3FH0A 4EMSA 3PHBE 1CR4A 4F0JA 5FLKA 5DMHA 4NV3A 1XDUA 2D8MA 1R5OA 3LZCA 1AMNA 1YRLA 4TYWA 3EGIA 1KVTA 3T0GA 5JAMA 4RTOA 1I7QB 4DGQA 2JH3A 2BMAA 5I45A 3ZCSA 2BH2A 1OTHA 1M6WA 1UDCA 3FPJA 3KHTA 3DVAB 1AJEA 1UINA 3WL8A 4OM8A 3B6KA 4LJ8A 3SNKA 2R86A 4EO4A 5F5NA 3SHTA 1I5OA 2ZK7A 3B1WA 1C7QA 3C3JA 2Q9AA 3NT5A 4I1OA 5JSQA 1S01A 3RJMA 3PNOA 4MP3A 3AYZB 4NPAA 1CUVA 1Q6YA 1W5TA 1DKPA 1NJSA 2Q0HA 3N8GA 1ODIA 4OQZA 4IHAA 5E7QA 5ADHA 1QCCA 3DVRX 2FW9A 3IV9A 4K9NA 4CU5A 1ZXLA 3SJAA 3EXIA 4IGAA 5K3AA 4CEIB 1O6BA 3ANLA 2C2KA 2DP4E 4QDZA 1YVDA 4RA6A 3M6LA 4OHCA 4PX9A 4RHFA 2VH2A 3MGBA 3ZK8A 3DF9A 3KXPA 1UPTA 3H13A 1OHHA 3UGKA 4DR2B 1RFGE 2E1PA 2UUOA 1C29B 3KM0A 2G1PA 3AY3A 10MHA 4FJ0A 3AR4A 1W30A 2I4TA 2Q07A 2VCHA 4XD7A 1JQAA 3ZY4A 5KJFA 3M81A 1XRQA 4G0MA 5FTMA 4MUFA 3KK0A 3FZEA 3ZU6A 5FAXA 1RFLA 1TL7C 5ITWA 3DPUA 3EUEA 5L9AA 4ZQGA 1KVQA 2CNWA 1XN4A 1M1UA 1OZAA 1CDZA 1MEEA 1J2EA 3HY4A 2W6ID 5TS3A 4PRKA 4FQ8A 3IJEB 4EIWA 3QP9A 4QASA 5AO9A 3RNOA 3TBKA 2ZU6A 5HVNA 3EMBA 1DC5A 2C8LA 3H5TA 4QQRA 2XSZA 3CUWA 3HKBA 5C0OE 2G71A 5CA0B 1T4CA 3MMXA 3BPSA 3NS7A 4N49A 4A91A 2QXYA 4AO8A 4I7EA 1DB3A 2GBIA 5JDIC 1BEZA 4QE3A 1KSJA 1R3DA 1QH8B 1F0KA 1ZGAA 3I2KA 3NM5A 4TYMA 4PPNA 1SIWA 3G6WA 4RBNA 4C4PA 3CF0A 4JI3B 4DDTA 1QAOA 1W47A 2EJVA 1HNWB 2G0NA 5BT9A 1RI1A 4Q1CA 3GD5A 1AO0A 3PPWA 4GKVA 4IMIB 3FOEC 4WMLA 1B3RA 4TV8B 1BNCA 3CX6A 1XZ8A 3DULA 4NMLA 4Y1RA 4CL3A 2ZOSA 5KHOC 2NACA 4A8JB 1NKVA 4GR9A 1T5IA 2OK7A 4M0DA 4PQRA 4WK0B 4QM6A 3R20A 3VC7A 2XVAA 1UANA 2DR2A 1U0EA 4WA7A 3IPYA 1KI6A 3GK3A 2ZWIA 3Q88A 3DD5A 1P5FA 1UT8A 4RUKA 4CLRB 3PEFA 2MSKA 2TYSB 4F3NA 4GYWA 1D8AA 2OZVA 1O4WA 1L5QA 2FQWA 2QUKA 3R9KA 1R6XA 4NV1A 5HE9A 5DTEA 4XTCS 1XMQB 2GSWA 2YCBA 4HVTA 4JX8A 4JQOA 2ZI5A 2DHDA 3VC3A 5IHXA 2IS2A 2HPVA 2QTVA 4IS2A 2GN0A 1ZCBA 2L69A 3LPDA 1MX9A 1HDGO 1KNXA 4BGEA 4YQZA 1BVHA 1PVDA 5FNZA 4HNUA 5MN5A 1MP0A 4OFXA 2PMDA 1P7YA 3A31A 2B9EA 3FW1A 2M6LA 4QXRA 4O33A 1AA6A 4B84A 3I9OA 1JA9A 2HRDA 2OZLB 1AO3A 4Z4CA 2WUFA 5IBRA 4TLDA 1VYUA 1J6UA 1M2JA 4MJ7A 1NG1A 5LQSA 3J81k 4JJ7A 3V6MA 4D45A 4DCPA 4AKHA 4EY3A 3PKIA 4YRBA 1CULC 5KNBH 3GBPA 5HKKA 1N2CA 2O8EB 1PRYA 1TM3E 3MZ0A 9ABPA 2CGEA 3K32A 3NX4A 3UOGA 3JVEA 2CFOA 3K16A 1VI6A 4CMAA 2GWRA 3S8MA 5LOVB 5JRDS 1ONNA 3V7UA 3ZCQA 1FDUA 2GMWA 3B5EA 2CYAA 3BK7A 1IFXA 1RTKA 2ZUFA 4M21A 1BVRA 1J99A 1BA2A 2B2XA 2P9GA 3AB8A 4RWZA 3DE1X 3Q98A 4MROA 2EKZA 5LA6F 3SYLA 2GOYA 2GKOA 3S5JA 1G20B 4KXWA 2Q5JA 1UC5B 4XUEA 5IKOA 4L5CA 1MT3A 3VVLA 3TB6A 5HFNA 4EPVA 2PMBA 3SXJA 5K8UA 2OP1A 4H0FA 3ZDBA 2PJDA 3PFCA 3S44A 4F04A 1NV9A 3VU3A 3DAPA 3GLRA 2OECA 1E60A 1DAKA 3X1DA 3S28A 3DL4A 1KJIA 3A26A 4YJHB 2A9JA 2AZXA 2PAFA 1VRVA 1X8XA 1TVKB 2J6HA 1Q3TA 2B83A 2V9PA 3CF4A 1VSUA 2RC5A 1V3VA 1VCHA 2X2PA 2BFEA 3R24A 4LK2A 3T5GA 4F6LA 3BRCA 2PS3A 1DJNA 2R66A 5FL3A 3H1GA 4US1R 5CVTA 3N6VA 4BATA 4J1SA 3KLPX 2PRSA 3GT7A 2NPIA 4YAJA 3DEFA 4HB2A 3UA4A 5IJZA 4Q4CA 2ZAGA 2E1RA 1T4BA 2VKTA 1PFUA 4TKZA 3LYAA 1ARZA 1SD1A 3GZJA 5ECWA 1H1LA 4COKA 4GHWA 1D9ZA 3EVTA 3FJYA 4RYDA 4CM4B 4EJSB 1RIFA 1Z25A 3RAFC 1KJJA 3MWEB 4UUAA 3N0WA 1EYZA 1ZH8A 5FRDA 2D06A 3E22B 1S02A 4L8WB 5ALKA 1KMQA 4NULA 4Y0VA 5CIQA 3Q0IA 5ILOA 1H66A 2F1KA 1A4IA 2XADA 3DM9B 3DQPA 3LPAA 4G25A 4RF5A 4XAQA 4LG1A 2QTLA 4AQDA 4U7GA 2G1JA 4DQXA 3IR7A 1O57A 2AF4C 3B7GA 4ENWA 3OZTA 1PFQA 1V5EA 2LCQA 3ZDXB 2RGAA 1U4NA 2O3JA 4I66A 2QTZA 2ZRCA 3ASUA 3BE5A 2I4IA 4DG9A 4RD2A 5C7IO 1P4HA 4NE7A 3K0SA 1OI7A 2AK2A 2DKFA 1YD7A 2YTZA 1A9XA 3SIRA 4MYDA 1PWXA 3AJRA 3PICA 3D6VA 2VBCA 1X19A 4EDHA 1S9DA 2J45A 1CBUA 4GPZA 4P7GA 1VMIA 3KQOA 3JU3A 2ECKA 4FX2A 1M76A 1Y1RA 2GJAA 1KZ4A 1WL8A 2OLEA 2QTMA 4U2BA 4ZJUA 4OLBA 5AW8A 1CEYA 1KZ6A 4PHTA 2D4AA 3KJFA 4LV6A 5LFAA 2SECE 3EG9B 3U1VA 4HWGA 2BFCA 4DLNA 4UNQA 2VTDA 2RKBA 2D1FA 3B7WA 3I83A 2OAQ1 3EJ6A 3VSCA 2GN8A 1S6YA 4Z0PA 5LQKA 1JE1A 2Z4RA 3B5JA 4D9IA 2YXBA 1PT8A 1ZRMA 4EB3A 1ZMRA 5AVXA 5JEDA 1BCSB 1U0OC 3TW8B 1GCUA 3G2MA 2JFFA 3OEWA 4GMXA 3TQFA 5AKLA 4Y2JA 4RD3A 3SZRA 5KVQA 1VSVA 3AJEA 1PZGA 2XYHA 3DE4X 4B85A 3NBZC 4Z3OA 1L5WA 1F8GA 4E32A 1T1RA 3VA7A 2W2KB 4MJLA 1VQ1A 4BP3A 4ENPA 1VG8A 2J08A 5JASA 1YDMA 1DCTA 3TAXA 3LQQA 3PNVA 1QK3A 2PT9A 1FUEA 1RKBA 2TMGA 2I22A 3B9BA 4ZWNA 1HLDA 4MP8A 4Y1GA 1D2RA 1QHNA 3YASA 1XZJA 1FVXA 1KEZA 1V6AA 4BU1A 1XV5A 3UJDA 5KAPA 2HJSA 1DXHA 1E2HA 4N82A 3HYSA 4AF7A 5C1DA 3ZUPA 1EI9A 3H11A 3TS1A 2B3DA 3Q3HA 3VNRA 3EZ6A 3NCTA 4B6QA 2HR1A 1K66A 4QOSA 3ZGLA 1TU3A 2WU3A 4OSPA 3P20A 4MV4A 4D3SA 4IIHA 3IT2A 4EEXA 1AX9A 1OXUA 3OM8A 4JT4A 3NJ8A 1OT3A 1GUDA 5SYMA 3W5SA 4GBGA 3W6PA 4UTNA 2FY8A 2O8VA 3NXKA 3RD5A 4BRZA 1ZONA 2A92A 4MKIA 1GJRA 1VGQA 4JLVA 1XNQB 5DNDA 1N1DA 4KQ2A 1XGKA 4LVCA 2FMTA 4D02A 3INYA 4UTXA 5DM1A 3TLCA 1CR6A 2P8JA 4CLDA 1QQAA 2ZRDA 3DBRB 4C0WA 4QOGA 5LR6A 4MPJA 3AHEA 2WSBA 2XNSA 3KJIA 3KZKA 3LNTA 4BLTA 1ID1A 3OFNA 1ZISA 2GAIA 4F4DA 3TLZA 1F8YA 1GR1A 5DNUA 1RP1A 4ZYVA 4H60A 5DTRA 1NQWA 4X93A 1XO1A 3OOEA 3OCVA 2VP2A 1MQ9A 2PCJA 2YWFA 4EFDA 2O0MA 3GFQA 4XW2A 1J8FA 2JFNA 3TIGA 3QBJA 3GLGB 4NPCA 4DA8A 3GDHA 3UKDA 1LSSA 1Z06A 2GFHA 3A58B 4P3NA 1V96A 1CE8B 1YR2A 1QZ3A 1WY5A 3DW3X 5D86A 1NN0A 5MFZA 3F97A 2VEDA 4IH9A 4R1PA 3K4HA 1DQYA 4Z99A 3ZWXA 4O1IA 3CNNA 1FYWA 1VL6A 1QNLA 1WDKA 4YEDA 1ZVVA 5K5EA 2LBPA 4RO0A 3TKYA 1AKMA 2PR2A 4IDOA 4BV9A 1B16A 5BR8B 1HDRA 1Z26A 2WWTA 4CV3A 2FN7A 4AKTA 2DLDA 1RQ2A 2PKQP 1V7ZA 2B98A 3KE8A 4QHTA 2QI9C 4MO2A 3DCIA 2EZ8A 4DYVA 4ZAZA 4H6WA 5KVAA 2O8BA 3W6ZA 3OP4A 4C22A 2BSQA 3ZIDA 2H9YA 1CY7A 3T6KA 4GX1A 1U3TA 4GG1A 3ZV5A 3GDOA 4GGOA 4N5HX 4RV9A 4WKGA 4WXYB 5D51S 4ARUA 2FW6A 3ZWQA 5JZBA 1XFDA 4OAPA 3K0FB 4R6WA 3PQ7A 2I66A 3EF1A 3O4IA 3U2QA 4DLXA 5AW3A 2ZVJA 2X8WA 3CJTA 3RABA 2GRAA 3AFIA 4ZI7A 3I8SA 2WWYA 3BFPA 2YFYA 4Q48A 421PA 1CR0A 4RESA 2ONJA 3Q85A 3BFXA 5D7BA 4RQTA 3JVIA 3D7NA 2O0KA 3GCZA 4DLUA 5EWLB 3EQZA 2PX2A 2ZB8A 1UIMA 4LDNA 1G3RA 3H5WA 1K86A 3GLHB 4KGDA 3JPYA 3T7EA 2ONYA 3IDSA 2J3HA 3L4EA 4KAXA 4DJAA 1FLAA 1L7RA 1Z38A 4LDPA 2IXAA 1S96A 3ZGXA 5B6IA 4BN5A 3ZIAA 2IIVA 4WFIA 4GR4A 2NSLA 1BTOA 2PXAA 3AC0A 1F2UB 1KMNA 4CM7A 5JBIA 2DLCX 4H7IA 4MMXB 3K70B 4P2GA 2JHAA 4ZK6A 4HYEA 1YL7A 4X62B 3KS9A 2H5EA 3I52A 1QOPB 3EDQA 5HIIA 4GOLD 4EG5A 3HSKA 1X42A 1BN7A 1ODTC 2JGRA 5CDSA 1FRNA 1LSUA 4OB8A 4RIGA 3JQAB 4BFXA 3I8OA 4OQPA 4P81A 2FN4A 5GAJA 2GXAA 2BGIA 2XJ4A 2AXNA 5ELMA 2JLCA 1Y1KE 2E0IA 2VSXA 3R9XA 2PNFA 4HSEA 1EX7A 4L5AA 4M0FA 1RM4A 1Z3CA 3TTWA 1YT5A 1EGMB 2J7PD 2J3KA 3HBFA 4WOCA 2FK8A 5K6RA 1P7VA 5AJWA 1RI2A 3J7AC 2GD2A 1KORA 3DZKA 5EUMA 4KRFA 1Z5NA 3MILA 3PEEA 2VSNA 2UYQA 4NU8X 3PT5A 3PNSA 1I80A 3VU0A 1CUFA 5CDYA 2B3TA 1DJLA 2FR0A 1L8QA 3HLKA 5JXJA 1YS9A 1WG8A 1XLUA 3EC1A 4DF3A 1OW3B 2P9YA 2UZ0A 1O87A 1J2RA 2OHXA 2ATEA 3INNA 4GLLA 1SNYA 2C4WA 3WDKA 4I2VA 1E18A 1NYQA 1X0XA 1YK1A 4B4KA 4ESVA 1POWA 5CNJA 5EXTA 4S1NA 1SUAA 3RANA 2X9QA 1ODLA 5AK5A 1SVWA 1FNDA 2HV8A 3FYUB 4RVGA 2YBEA 3V4PB 4FZ3A 1YUNA 4C6HA 5EG5A 2F1OA 4YQEA 2W6IA 1DQPA 1TO2E 2QAGC 4RCYA 3UB4A 3V8VA 4AG5A 4UNPA 3ZW9A 4BZPA 5LYJF 1H2YA 2NXNA 1D8TA 1H22A 2IBSA 2AGVA 4BGIA 5CEJA 4KITB 4XR4A 5M29A 1ZI8A 2PN1A 5LZ7A 4R3NA 3CCFA 4KN5A 2G07A 1SIBE 3NWPA 3NIGB 4C14A 2VT3A 5F1PA 2DRIA 2A78A 5JNLA 3C8UA 2BL4A 4ZGWA 4YQYA 1SBTA 2WIFA 3K9WA 1YOVB 4PPGA 3LQ1A 4OAOA 1K6JA 3MMZA 3NDRA 3PKJA 4GP9A 4RZQA 3TE7A 2RGRA 2ZRLA 1KBQA 3DKPA 3U3ZA 2WMNB 4J94A 1IJEA 5E9QA 4ZAGA 1NR1A 3MMSA 4CF5A 1GCGA 1L7DA 2A9RA 3RBAA 1FB5A 2NZYA 4XGNA 2C2MA 1YZFA 2V1XA 2H1CA 1MEJA 3BTOA 3IQWA 4D0GA 4Y8VA 1FTGA 1MAWA 2O14A 3NVAA 5IYZF 2A59A 1NAIA 1T0HB 4HDRB 2H85A 4UZFA 4IR7A 2W98A 4MICA 5FFFA 2C57A 3TZHA 5GONB 4GRDA 5DNVA 1L7OA 1N5MA 4RIIA 5CVCA 1AM4D 3Q10A 1LDYA 1PL7A 3GAMA 4P4LA 3V2GA 2OO5A 3LTEA 2PKYX 1H0HA 1SBZA 3KQVA 1QIFA 4L50A 1Z16A 2VSYA 4U9IS 5G1OA 5E9WA 1FC0A 1JFRA 2OM6A 6REQA 1WX1A 1CVLA 1J2UA 1PDOA 2VP5A 4LYHA 4QQKA 4CL2A 1SZDA 2AB0A 2CE2X 1U0FA 3QWIA 2ODNA 4Z9FA 3V4OA 4LJSA 1IXZA 1AQIA 2QPOA 2RG1A 2JJ8A 1CERA 1WBJB 3UAYA 5M2QA 2G9NA 4QECA 1N5JA 2K87A 4QWWA 4X0EA 3WO0A 1VB5A 1A8QA 1IC6A 3UAGA 3HFSA 1T0BA 4YJ3F 3MNFA 1WQ1R 3SR0A 1EP2B 5AW2A 5JBQA 3CR3C 2BI7A 4QSHA 4OU5A 1DX9A 1GA4A 1NIJA 4UQOA 2O3UA 5KCZA 2GPNA 1NX9A 2HN9A 3BCHA 1CIJA 4BNMA 5T3UA 1CD5A 3TG8A 2SBTA 3PE4A 2RGCA 4MRPA 5CNMA 2HQSA 3HPQA 4DSUA 3KR9A 2YASA 4G81A 2CBGA 3OBIA 5AMXA 1KIMA 3RAEC 5JQGF 1HQDA 2GI4A 3UWMA 2AKYA 1DT5A 4DCVA 2HF7A 5HILA 1E1CB 1J9GA 1QG0A 1H6CA 4B3IA 1WV1A 2YC4C 2YYSA 4TTQA 2H2IA 2SCUB 4CBVA 4ZFNA 1MKYA 4XUGB 2WD9A 2P9CA 1OXXK 3IULA 2ADMA 2C4NA 4LJ9A 2HAEA 3I9LA 4B76A 1LF5A 1HGXA 4LE1A 3WAGA 4F4UA 3FROA 4HAYA 4J16A 4DB4A 1OX5A 3SQOA 3F2IA 1JN0A 2FSHA 2NVUB 4BV3A 3WYNA 1RC1A 1CZLA 3CZ9A 4MQMA 1NXPA 1JL3A 3CPSA 4EJ0A 3DBLB 5KQGA 3QU4A 2BFFB 5CGQB 4EL0A 3E7XA 2PU7A 3LHDA 3T9EA 1U8EA 1M2VA 1QYRA 4U7PB 4YLGA 2OG1A 1RYMA 2PMCA 3N70A 4O4HF 3THOA 4Q1VA 3E18A 4ERXA 3GJ4A 4NEHB 4PIPA 5H02A 3RAGA 1TA9A 2I0FA 4ZT6A 2IYAA 5BNTA 1IM8A 4R40A 2JGKA 4EPRA 1W96A 3OETA 4LRYA 1FFGA 3FGPA 3HPRA 3W79A 1U0SY 5E2AA 4HGQA 1XCJA 1YKGA 1YQWA 1CY8A 4BCCA 2A4KA 1J20A 2DFNA 1ULBA 1E6MA 1EJ2A 4PNEA 1RJ9B 3I30X 2DLNA 3FYDA 1Z0SA 1IBLB 1WXEA 3DWFA 5EWMA 3WLQA 4DRYA 3V55A 5EE0A 3EX7C 2EQBA 4RPIA 2E4XA 4G0OA 4LQCA 5BQXA 1E92A 1F0PA 2BFMA 1OLXB 4I4TF 4JU8A 4UAUA 2O9JA 4KX3A 4BV8A 2Z2XA 4LMRA 4UU1A 4X1YA 2J67A 3OPQA 4I14A 5BPFA 2XB6A 3A0UA 3HKCB 1AUOA 4DLBA 5I4BA 1IUOA 1T9GR 2PL3A 1N9KA 3OTIA 1SBCA 1FPQA 2DBQA 5BN5B 3TLEA 3VZPA 2JLSA 1QO7A 1ZNQO 1G8KA 3MWKA 3BE8A 5ALRA 1V8OA 1AHIA 1OC2A 1A9PA 2DFDA 4C76A 2GCNA 4DLVA 1HDEA 2JKVA 2WWFA 1E9VA 3OQIB 4JNCA 4GNKA 3HU1A 4XWOA 3B9PA 3GZNA 3UKJA 3WK8A 4AXXA 2VTBA 3OE1A 2QE6A 1YRAA 3Q12A 4J91A 4NVRA 3U7JA 2C4VA 3DL0A 3IMGA 5REQB 4MR8B 3TPZA 4F4CA 1FYVA 3PNMA 3GR6A 4P4GA 1DAGA 1O2DA 2GJSA 4QU0A 4DNXA 3N8IA 3NEPX 3PPVA 5LQMA 3TG2A 3KQHA 2OT3B 3JQBA 1OWOA 2HSJA 2XMQA 5F1OA 4N5LA 3DH0A 3E48A 3HC7A 3PTLA 1V41E 3I6YA 4OHOA 1DWUA 1SRQA 1T4MA 2I2DA 3SU8A 2PUGA 3V4LA 4HNRA 1AS2A 2RKWA 3L40A 4X8OA 1ANKA 5DV9A 3R0VA 3Q3VA 2JIBA 3EIHA 1GGHA 2R11A 4KE6A 5T64A 3ON5A 5JJCA 1V3QE 1W85A 1U1IA 2RKOA 1EFLA 5F1KA 1HLPA 1JQBA 4U2DA 3EDRA 4H7KA 1O95D 2QMZA 3HO1A 2DPXA 2IKQA 1HG1A 2YN2A 5CLFA 2WT9A 3PR2B 4E4RA 4M83A 2OCAA 2C3PA 1JA1A 1N32B 2V3WA 1GPLA 4GX0A 4YH1A 3W05A 3O5AA 2QU8A 3PFHA 1T36A 3DB2A 4K40A 3I0MA 1M2WA 1WUYA 5KNCH 2WFAA 1JEDA 4P8RA 1HRDA 4FS3A 4Q18A 3R7SA 3LX8A 3OX3A 1CZNA 2PYIA 1NQOA 1G21B 2XX3A 2GN1A 1TLLA 3OF5A 3PQ5A 4MV0A 4OHXA 3QVGA 4IV5A 4DFDA 3KEQA 3U13A 2E2WA 3CE9A 1OAKA 4C3UA 2ISSD 1PEAA 3AXSA 3GROA 3ZHYA 5FTKA 5K7SA 4QZVA 1KEVA 2RGGA 4KLZA 4ZC1A 3EVAA 3FWYA 4WZ6A 3ROZA 4B5KA 4EI2A 4XPIA 4ZHSA 4UUPA 1QHXA 2ZYUX 4ZMRA 2XGJA 3H9JA 4C0QC 5LNK6 4EKGA 1W29A 3CH4B 4INOA 4Y9RA 4BQSA 3CVJA 4WZAA 1Z45A 2X22A 1LLUA 3IVGA 4GQAA 5JISA 1VCMA 2EQ5A 2RHMA 2A94A 2JHPA 3KYBA 4YRDA 4G65A 1A97A 1JR6A 5EKDA 3VSBA 1P1KA 1L7MA 1Z5OA 1UDRA 3DTTA 5KOHB 4QXMA 4DSZA 4X7RA 3F6PA 5GINE 2XVMA 3B3QA 1DLJA 1AUQA 1RBMA 5CX4A 5HDQA 2AJTA 3G82C 2XOKA 4IKEA 4R1UA 4ZVLA 3MS7A 3LUFA 4I8IA 2A6PA 2FSUA 1XDDA 2JGAA 2C4MA 3C2QA 3ONEA 4M9XA 4DBVO 4YR7A 4NESA 5KO2A 3QF4A 4RKWA 3TTXA 3IAM1 5DX1A 3ZVLA 1N1EA 5JJBA 3WK9A 4NI5A 3EMDA 2GTPA 4RA9B 3BD6A 3TRKA 3PEUA 4PC1A 3QA9A 2BDUA 3CF2A 3UT5A 3ZKAA 2HMWA 2WWRA 4FYKA 4KQ6A 2NVWA 3WGOA 4GUAA 2WD7A 4QDUA 2QN2A 3EA4A 3D7MA 4LY9A 5J59A 4D41A 7YASA 1RQRA 1TGYA 1E1DA 3OQMA 1YFLA 1SO8A 1RBYA 2FMKA 2V7UA 2P9JA 4RIHA 5FLXA 3ND9A 4FBMA 4ZVSA 3AHHA 4REQA 7GPBA 1L3BA 4BMXA 3FLAA 1XEXB 3HVJA 1NLFA 3DYBA 1X7XB 2OBFA 3U56A 1I2CA 2HZ7A 1ND5A 2G7ZA 4DUYB 4C21A 1GGVA 2QDKA 3WLRA 1D1SA 5I7SA 2PZJA 4UULA 2FPGA 2FVYA 1TMKA 5HP4A 3TL6A 1DTWB 2UZIR 3SG0A 4OVKA 5IWCA 2ZYIA 1MVNA 5FR1A 4B8WA 5JVDF 2OP0A 3GHYA 4N5IX 3EOZA 2O1XA 3K2QA 4MQFA 5FBZA 2I34A 2EKLA 4O4LA 4UJ5A 4WGGA 5TQ0A 1IBMB 1ZGBA 5HZMA 1EE9A 1G60A 3WKAA 1D3AA 4ZTBA 3ZH9B 4B3DA 5ITZA 3E9ZA 3WHIA 3OICA 4WUVA 7REQB 3M3DA 4KSCA 4WL0A 4TLAA 4FR5A 2YH2A 2RI6A 4LJ7A 4XIJA 3UQZA 4K6CA 4MQ6A 3RFTA 3ZJ5A 5DHPA 5A62A 5HSGA 3SE0A 5F23A 1SHUX 3R7NA 3AU9A 1CHDA 4OMUA 2VL7A 1L1FA 5JBNA 4ARIA 2FPIB 4V2UA 5AJVB 4F86A 1AB5A 1CX9B 4E2XA 4QL3A 1VL1A 1YBMA 4BZXA 4DS3A 1O0CA 1DJQA 1NFQA 1YL5A 3I04M 4MWEA 3H1TA 2VP0A 1F6BA 3PGLA 4JLMA 3PL5A 1FRFS 3MWYW 2WICA 2VHVA 3VC2A 4O2BA 1YJXA 4UDYX 2VH5R 3Q3EA 1BC5A 1XTVA 1EM6A 1NJFA 4NG4A 3A4MA 1ISIA 2H1LA 4KH0A 2BGNA 2GD0A 3MJVA 5C5CA 1X8LA 3G2HA 4WZZA 4RFLA 3NTRA 1IONA 3NOQA 2F3PA 3PGJA 4DWOA 4W6ZA 1E7YA 3LBAA 1NJ1A 1QF9A 3IYLW 3KE9A 2HJWA 3OJ0A 5AJUA 1FFDA 2VQ6A 2F55A 4Q7EA 4DM4A 1V1RB 2P65A 3KV1A 3Q6IA 1PT5A 2IPOA 5I8ZA 4EPXA 1ECPA 2BEWA 1GTJ1 3I0ZA 1TPYA 3NM4A 3NORA 1DJMA 2I62A 4BNLA 2J7PA 1QAMA 3ED1A 2X0IA 2J1LA 5FNVB 4K9LA 3USES 1MD9A 2O1EA 2UYGA 4NIMA 5FWAA 3H9CA 3QVLA 4ROTA 2R7NA 3OD5A 3R7LA 1RMYA 3L0YA 4AROA 1FSGA 1WB6A 1NY5A 3PRHA 4ALMA 3MELA 1NU8A 4TTPA 2AJBA 4JDUA 2C0PA 3G0BA 3N8KA 3WL7A 1KY2A 4RCVA 4ACBA 2IS6A 5KNDA 1L6RA 3VPGA 3CNLA 2ZRBA 3TCKA 1B8VA 2Z57A 1NW7A 4LZJA 4G36A 4PLWA 5D7NA 2P9HA 3N5KA 4JKIA 3ETLA 4UHFA 1PDVA 2VQSA 3RVBA 2QP9X 4E94A 3AUYA 2GEJA 3BZWA 2G17A 2CXSA 4CJXA 5H59A 3DO8A 3FPFA 2VYVD 3QRWA 4MJXA 1MA0A 5K6AA 5KTMA 1WF6A 2Y93A 2R47A 2VSOA 3LFUA 3UNXA 2YWGA 4MQLA 2P79A 4S1OA 5DYGA 3SFZA 2JEZA 4UHJA 2FX3A 1CF9A 1OA1A 1QRAA 3CN7A 3T5MA 3B36A 3HACA 3U4MA 2XIQA 4YP5A 4OI4A 1V6SA 1XZMA 3ZVNA 4PZYA 4KGVA 4ND4A 4CUKA 1YQ9A 7ADHA 3FPCA 1XZKA 3G2JA 1JDSA 2CHFA 2J3LA 4CKXA 1QPGA 3WIUA 2CZQA 4UAGA 1O03A 3ZHCA 1NV8A 2VRBA 3RIXA 3UMYA 3C3CA 1FP7A 1H93A 3DUFB 4Q7KA 2BKUA 4MLDA 4PXSA 3GUUA 1GZSA 3IXMA 2Q28A 4MYUA 2NYRA 4PN3A 3E1KA 2IT1A 1S2IA 1B74A 3GQBA 1TT5A 1U02A 2IDJA 3ZY6A 4ZXFA 2JANA 2HWWA 5AUOB 1Y98A 1JI3A 4QU9A 4NH0A 2GPBA 2MSDB 3QJGA 5KTSA 1F3OA 3DE2X 1SCNE 2NXCA 3EK2A 4QYXA 4CCYB 2O8DB 4K87A 5EL0A 5D6OA 1WWKA 3G9XA 5IKXA 4N65A 4NMMA 3HCNA 3U9LA 2E5FA 2ACKA 4QBTA 3EFOB 5B1DA 4MI1A 1C30A 2IWRA 2Q4RA 2BM0A 2ZUEA 3AW9A 1R8QA 3CVOA 2VZLA 3ESAA 3H6HA 1GVHA 1U1EA 3K0AB 1E1MA 2Q6TA 2YFKA 4DMMA 5EY5B 5SY4A 1JFVA 2DF8A 3HABA 2P2ZA 2X40A 2HCFA 1LRLA 2R7AA 3U4HA 1T6YA 5B1EA 2KE5A 3O26A 3AYXB 1OPXA 5CA1A 5I9NA 3E3NA 5BN4B 3OZDA 2EJUA 4FHZA 5LU9A 3MJ4A 3L5OA 3T5CA 1ZCZA 4WXHA 5TT1A 4NBLA 1GG2A 4LVOA 4QGBA 2TMKA 4L6AA 4L5BA 5AK6A 4KLNA 3HUUA 1GXSA 5GJBA 2IYOA 4Q3AA 3QSGA 3EEFA 1U80A 1K3FA 1FX1A 2QTGA 4LF7B 2OLKA 1IHOA 1ZP6A 4X44A 2B8TA 4ER3A 1YZYA 5H80A 3KAQA 2HA2A 4M9CA 5I9MA 1BJKA 3WZMA 5EMHA 1PVOA 1F2DA 1UPCA 2GQ0A 3EGXA 1OR8A 4PPQA 1G8YA 3B60A 3NEJA 3I9KA 1JIUA 1F8UA 4PYKA 1QC5A 2YXNA 4UPDA 1W5EA 4TYYA 4MRVA 2NUPA 2HL6A 3PUJA 3ZBQA 3ZW7A 4KFRA 1Z2AA 2N42A 2EU8A 2UVPB 4P33A 1BJRE 5JD3A 2A7QA 5DB4A 4M22A 2PUEA 1AXRA 1KQPA 3F4LA 3KZVA 3MQ2A 1X6VA 3A6EA 5ERGB 3UHFA 3ZNOA 4GF5A 2WWWA 3EVFA 1MV5A 5EQJB 3GZ4A 2ZIXA 3OMXA 1LJLA 3BDAA 2RAPA 4NYIQ 3O94A 4CIDA 4YMSA 5HNKA 2FFBA 5FWYA 1ZH4A 1PT9A 1XTIA 2CY0A 2CYBA 2RI1A 2VFAA 4OGFA 3HB7A 3K3PA 2TMYA 4TWIA 1WB9A 2EW2A 3OPYA 2G08A 2GN2A 4FNOA 1Z07A 5FLEX 4DDKA 2IOFA 5GVSA 3A25A 1G0NA 3PJRA 1CEXA 1UBKS 3VOAA 4NZ9A 1FDOA 1I7LA 3FM9A 4RLSA 1E89A 1GA6A 4WN9A 2WY2D 3PGMA 3EVDA 3LC2O 2D3TA 3JRNA 1HSZA 2FE1A 3C70A 2F2TA 1XKXA 4AMUA 2A5LA 2RAUA 1O97D 1DOHA 3R6LA 5GZ3A 1QHHB 1SXJD 2FQYA 3ZHZA 2UZ4A 4MPRA 1Y63A 4MW5A 4YUXA 1MG0A 1L3CA 3DVLA 2HA4A 5EIWA 3BWVA 4Z4QA 5J63A 2VP9A 4A3SA 3UXHA 2OVFA 3CW8X 4Q4HA 3CLSC 3VC1A 4D9HA 4K86A 4DCMA 2QDXA 2ID4A 5K0CA 2XKBA 5E7IA 5FX2A 2GF0A 3LCJA 5COQA 1M0WA 2O3TA 5A4JA 5JZOA 2PMWB 2OO3A 2XUFA 1QB8A 2H5JA 3K9FC 4Q93A 2PD4A 3GLTA 5MF6A 1P2BA 3OIUA 4D5EA 3Q7RA 4BIIA 4F5YA 5FV4A 2CHVA 3OC6A 4WWHA 3C98A 1FLNA 3H2YA 3KSDO 5EZYB 1R5JA 2I3DA 2V3VA 5F3DA 3VKUA 1V7QA 5HKAA 4X1KA 1Z0JA 2XGSA 3HQ4O 3HYTA 1R4NB 1UKEA 3P9ZA 5IRCD 1X3LA 1YK0A 3BWMA 4Z4IA 4AB1A 1HFWA 5FPHA 4BVLA 3E84A 2D2IA 2YYAA 3EC7A 2YINC 1G1MA 2ZB3A 3I01A 1ZD2P 2YICA 2HCBA 1UKBA 4M0MA 4KAJA 1RVDA 1UFKA 2BEUA 3DVQX 2ZDGA 3L04A 4FN4A 1OAAA 2HJRA 2W2NA 4DLTA 1PFWA 4ZCQA 5KSYA 4OXYA 3COSA 4YAFA 1GARA 3VDQA 4XARA 3WJ2A 2N3ZA 3QVTA 3EFBA 2HXYA 1DRJA 4PWZA 4DKJA 1H8EA 3RPEA 3HCOA 1PSZA 3U5TA 3PVSA 4UDOA 1MRNA 2XDAA 1UJBA 2B30A 3A27A 3EXFB 1QS0B 4Q1EA 3HHEA 2Y76A 2YXDA 1RKQA 4YDHB 3FUXA 1YFKA 5TPWB 3SJZA 1NXOA 2QI9F 4ND8B 3VPSA 1I4LD 4TT8A 1FDWA 1N0HA 3GMSA 2WV7A 4E03A 1L7PA 2BE7A 3GJQA 3MT0A 4K1LA 3VZBA 1IQRA 2GA8A 2IYFA 2E18A 3IBTA 2NO6A 4YMIA 5B58T 2FPLA 1EJ6A 3UWPA 1P75A 1ZBQA 2C7BA 1OYVA 1ZUNA 2I2XB 3EGWA 1RPAA 4AF8A 3OOWA 3Q6NA 3AX6A 1VPTA 3QLEA 3PLAE 5FWXA 1Y1SA 4EUKA 1BMTA 2FGJA 4S24A 1SC4A 1UXJA 4IDPA 1W1WA 2IZ7A 1C4XA