4HB2A

Crystal structure of crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
204
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
total genus 59
structure length 204
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb2A00
3D8BA 5CYOA 3LBHA 1OFTA 1N5KA 5DE3A 4ARZB 4GMDA 3SQWA 4JVNA 2ZJ8A 3A1VA 3KJIA 1NVXQ 4R9UC 4ASUD 2OILA 2CCKA 2X2EA 2DPXA 1LV7A 1II8A 4Q02A 1KDOA 3WRYC 2P6RA 4R7ZA 1NMXA 2QU8A 2ZEJA 2DFKB 5SZIA 4QM6A 5JECA 3HP1A 3K0SA 1DE0A 1A2BA 4M0LA 4O2RA 1ZM7A 3IIJA 2J45A 2ZRFA 3R9WA 1Z0IA 3KUCA 4UNNA 4I1SA 1T4GA 3QPWA 3QNUA 2ZQ5A 2FMXA 4CEHA 5JHGB 4HUQA 4QJ4A 3PENA 4NYJQ 1R8SA 2OSBA 4LI0A 5AUQA 3GFOA 1P2UA 5C46F 5FTLA 2HT6A 5FPYA 2WJHA 3IQWA 4LUCA 4Q03A 4EQ6A 1MO3A 3NH6A 4S2EA 3GLHA 3T5GA 4WA7A 3SFVA 1TF7A 3THWB 1DPFA 1KDPA 2JLQA 1BYIA 1NY6A 2FFAA 1VECA 1L8QA 1BKDR 1VCNA 2AD5A 3BBPA 3UMRA 3PJRA 2IS1A 2QGZA 1RKBA 3CPEA 1WCV1 4EJSC 4M9XA 4HYYA 3QXJA 5JS7A 3N5CA 2EYQA 1KJYA 2O52A 4LHZA 3SBEA 4XTRA 3TW8B 5E3HA 5SZJA 3SEAA 5C1BA 4OI0A 4QKQA 1XMJA 1KI1A 3IIKA 2BCGY 4W5HA 2QAJA 3EA5A 1DAGA 2YHSA 4ZCMA 2R2AA 1WQ1R 1D8TA 1G18A 3R8FA 5HZHA 4DDVA 4LJ9A 2J5XA 2VSXA 4Q7KA 3LXRA 2CHVA 4ZDIA 2MSDB 1OB5A 3AKEA 2B7CA 1LTQA 1W36B 5KSZA 1ETUA 2Q3HA 1P3JA 5A0FA 3OAAD 3DO6A 2BEJA 3C4JA 1OXXK 5FBRB 3W5IA 2ZSEA 1KO4A 1V5WA 1R6BX 2JASA 1YE8A 1NRJB 4ZIRB 3TAUA 3VKWA 3NWJA 3EIEA 2D2FA 5BN3A 1AN0A 1XZPA 4G5GA 3R7WA 5EE1A 4NDZA 1EFRA 3ZZUA 1H65A 2H16A 1Z29A 3EZ6A 1G7RA 3ICQB 1KNQA 2RGNC 1SXJB 2ZRPA 4UXJA 3UWOA 2BKUA 1KAOA 4E07A 4C0AC 2HV8A 4NE2A 4POAA 3FTQA 1P9NA 1RVDA 3K9GA 4BFZA 1ZYUA 3I8SA 4A2WA 1MABB 1II0A 2WOJA 4JIMA 1KDRA 1KI7A 3KJGA 1JR3D 1DAFA 4G01B 4A8JC 1FUKA 2PBRA 1FQJA 1PLLA 4OHVA 2HXYA 1Q3HA 4NYIR 4E03A 5AWFC 2OFXA 1E79D 3G5UA 2W0SA 4WBSA 4KI0A 2QMHA 4M1KA 4LHYA 3SBDA 2O8CB 1DARA 3AVXA 4TMTA 2WKRA 1P61B 5J47A 3JVVA 3WMGA 4NL4H 1II8B 1KI9A 4NP6A 2CJWA 4IW3B 4F4IA 3UXMA 2IW3A 3EXAA 2CBZA 4TYYA 5JJKA 4I81A 1IOZA 3U61B 4DLVA 4I1VA 2IYXA 1IXSB 2DWQA 3OESA 1G8HA 3OIWA 4MYUA 4HAWA 4RZ2A 2GXSA 3T06B 1ZD1A 1UKZA 1XWIA 1Z63A 2ZYWX 2PEYA 2CHQA 3O8BA 5IRCD 4TMKA 3Q8XB 3SYLA 3UPUA 1XB2A 1JAIA 1KO1A 1VHTA 4HB2A 2CDNA 2BBTA 1DTSA 4IXNA 1G3QA 2CNWA 2FNAA 4PZLA 1YZTA 1W0KA 5D3MB 4EQ6B 3ZVMA 2VP9A 2EFDB 1CKEA 2D4HA 3GJ7A 3CF6R 4NCIA 2J0UA 1OFIA 1VCMA 2FSIA 4RKEA 1VIAA 4BZPA 1BO6A 2RHDA 4BPBA 2O8BB 2OCAA 1E9SA 1T91A 3FPAA 3LY5A 3NKVA 5HCIA 2JLWA 2WSSD 2QTHA 4PZYA 4FN5A 1VG0B 1E2FA 1I4LD 1ZAKA 2QMEA 2VHCA 3MWJA 3OEEA 5G3ZA 3RS4A 5FBWB 5ANRB 4LJ7A 1TPZA 3HPQA 2JEOA 2V8OA 1FNNA 3VKHA 4AWXA 4Q1FA 3OE7D 3ZYCA 4Q5IA 4ZDJA 1X8JA 1OE0A 1NG9A 1SXJD 1US8B 5G40A 3BH0A 3GQBA 1U8ZA 2CCGA 4FCWA 1KJZA 5AJZA 3TR5A 2OESA 5CM9C 3X1XA 1JPJA 2WWWA 1KK2A 1PUJA 1TF5A 4D80A 2GETA 3BK7A 2C03A 3KQKA 1C1YA 3EIHA 2CK3D 3GJ8A 4H1UA 2W58A 2QPAA 4DKXA 4TLBA 3KXLA 3FFAA 4C0HA 2IYYA 1LF0A 2QENA 4IVQA 1RJ9A 5D3QA 1CLUA 2IF2A 4FIDA 1F48A 2QQ0A 1ELOA 1BYUA 2AN9A 4O0MA 5HCNA 4CEIA 2OXRA 4L9SA 4MITA 2XZLA 1NBMD 1Q1BA 1A7JA 5EZ6B 2IUUA 4A8JB 2D7DA 2AWOA 4DCNA 2ZJBA 2IYWA 4A0HA 1SKYB 1ZM9A 2R6AA 2IYSA 1JALA 1B0UA 3F3YA 4PC2A 1RYHA 2BMFA 5EE9A 3VR1A 4D4JA 3EPKA 4B6EA 4Q1BA 2DHRA 1K8RA 4JLVA 3VNUA 4ZI3A 4XVQA 1YRBA 3FMIA 2GNOA 1TUIA 1E2KA 3QI2A 5G53C 2F1IA 2AFHE 1IXZA 1XPUA 4X8HA 2L0XA 3PUYA 3P32A 2A9KA 2A2ZA 3WMEA 2FA9A 2ZVPX 4Q48A 4Q7LA 2IBMA 3F5FA 1CJKC 3LLMA 1S9DA 3D31A 4YMTA 4BLOA 2QN6A 4RY2A 1DAIA 2IEZA 2R6FA 4DWJA 2O0KA 2XNDA 1RJ9B 1ZNXA 5L3SB 3AVUA 3QENA 1E4YA 2FG5A 2ZUBA 4OHWA 3CRVA 4P32A 4QXAA 3GFTA 3VQTA 1X3SA 2UZIR 3T35A 4C9BA 3B8HA 1F60A 4JT4A 4QHYA 4V0NA 2A3RA 2HJVA 4QOSA 5C4GB 1L4UA 1FQKA 1JBKA 3IPXA 4F7WA 1U90A 1KTVA 2AR7A 3NEJA 3ZZTA 4MQBA 3A6PC 4R71A 3U5ZB 3BB1A 3OEED 2AKYA 5JRJA 2YWEA 1PUIA 1XEWY 1KI4A 3SS8A 1AS2A 1KY2A 3M4YA 2RMKA 1E1QA 2V55B 4P4UA 1DOAA 2AFIE 5EE0A 4A4DA 3OIUA 2ZSBA 5L3QA 2X19A 2QSZA 2ZI7A 3OFNA 2KI5A 4JLOA 3I1FA 1KNXA 4ZIRA 1UEJA 2VSFA 2YV5A 1P5ZB 4IEEA 3U44B 1G19A 4AKGA 1WDTA 4S35A 3U2QA 4TT3A 1ZUHA 5FR2A 3K70D 1MH1A 1EXMA 2VP5A 4JLJA 4QHSA 2BVNA 3LQRA 4JMPA 4LHWA 4WZAE 4US2R 3JZMA 4XWOA 5TDHA 2CLDX 1GKIA 1E2GA 1VYTA 2GXAA 1M7HA 2YNMA 2Q9AA 1E2JA 4KITB 3BS4A 4Q7JB 2ZM5A 4OI1A 2IYVA 1UKVY 3GP8A 1X1SA 1UBFA 3SHFA 3D6TB 3IKJA 1TADA 2HF8A 2G0NA 1QBKC 4KBGA 4YMWA 2H5EA 1W2GA 3ONWA 1E4VA 1E9CA 5KNBA 1A4RA 1OIVA 3L0OA 3BB4A 3A4LA 3K1JA 4R2IA 3VR6A 3IBGA 4JS0A 1JR3E 1KKLA 1RFLA 2CE2X 2OFOA 4LWZA 2IL1A 1OYYA 1Z0KA 5FH9A 2WWGA 1J8MF 4YMUA 5DGXA 5LB2A 4U5XA 4B34A 1OT3A 1Z08A 5AUPB 1P9WA 3MFYA 4C0BA 1OIXA 4TTRA 3DM9B 4PZZA 3FMPB 4URUR 2F1HA 3R7WB 2DB3A 3CF2A 4K46A 3QIAA 5FTJA 1F2TA 3LRPA 2VYFA 1KO8A 1VDZA 1U2RA 1G8GA 1NBME 1U94A 4L5BA 3B7GA 3BWDD 4DXAA 3RDPA 1GUAA 4RD3A 1YZLA 2XSZD 4W7SA 5L3SA 2ZROA 3CB4A 2Y8EA 3DZ8A 4CRWB 3CW2A 3LXXA 4AG5A 4JJKA 3SHWA 3AKYA 2BC9A 4B3FX 1S1MA 3NBFA 2PEZA 4KFUA 2B8TA 2O8EA 3HDTA 4N0EA 2EFGA 1L2TA 2JLVA 1E2EA 4UNQA 1E0AA 2AXNA 4JL6A 2GZHA 2I1QA 3BH6A 2XGJA 1E2MA 3SYKA 3ZLJA 1ZM2A 1KZ7B 1KO5A 2PZEA 4QBHA 4IOJA 3KKPA 1JXOA 3DMNA 3MMPA 2CK3A 2QPOA 3CM0A 3NTUA 1AA9A 2PX0A 2RGCA 2ZYTX 2GZDA 1QHYA 3AF0A 3EZ2A 4FCVA 4JLDA 5DHAA 1P2SA 5DISB 3VR4A 1ZIPA 1TU4A 1AKEA 2WJVA 4R2HA 3B9PA 1FX0B 2WV9A 5FFMA 5FTMA 2WTUA 2OCYC 2BMDA 4MYHA 2HDNB 3CF0A 2V9PA 1VYUA 4U7DA 3D3QA 2C99A 2D7CA 3MG9A 3MLEA 1VKJA 2VP2A 3KJEA 4X8OA 4AKEA 2WJYA 4CDGA 2J87A 5EP1A 3AUXA 4Z1MD 1JI0A 5F9HA 5FI1B 2OFWA 4CZ2A 4M9SA 5G3YA 4AI6A 2RGNA 4MUBA 3EIQA 2H7VA 4JVLA 4RZUA 1IY1A 3GLFB 4JZKA 4PAQA 1UBCA 1YR7A 2NO0A 2FFHA 3TQCA 5FUVA 5B30A 3BFVA 1TF2A 3VTKA 3B85A 1N6OA 4MA4A 1Q21A 1YR6A 2QORA 3KKQA 4LJ8A 4TMVA 4XD7A 1UBEA 4XSGA 3RRZA 2G77B 4LV5B 4Q1CA 4HLQB 1S2MA 1Z0AA 3A58B 3DMDA 4E22A 3LO5A 1MO4A 4TL9A 4UXIA 1Z6TA 1U0JA 4BLQA 4KXFB 3CWZA 5KO2A 3QJYA 4C0LA 1ZU4A 3U4QB 1BH2A 1VHLA 3LLUA 2XEXA 1FPMA 3BH7A 4KCGA 4UJ3A 3ZS8A 2XXAB 4EPXA 1T3LA 3H86A 4MRPA 4M22A 3DOFA 1NKSA 4KLNA 2OE2A 5KDLA 3SJZA 4Q9LA 2P5TB 4YDSA 3SOPA 4YMVA 5B64A 4IHQA 2P0EA 2O8FB 3CZPA 1LFDB 2J0UB 1NSTA 3Q5EA 4BEJA 3FDIA 4NYMQ 4EJSB 1P9RA 4PC3A 3RS0A 3QF4A 2DFTA 1G4UR 2BV3A 3V9PA 2QZ4A 4OK3A 3EPLA 2WVJA 2WIBA 4WZBE 1UDXA 1EFTA 1Z6GA 4RD2A 3I8XA 1LB1B 4PHTA 5K8UA 2FSFA 3X1WA 3AF4A 1NJFA 421PA 1QHHB 3QKRA 2YVUA 2ZSDA 3KUDA 3DOEA 3LFUA 2QM7A 3BB3A 1OIWA 5HKKD 1E3MA 2F1RA 5H1YA 3GLGB 5EUQB 1E2NA 2F3TA 3X2SA 3A36A 3FMOB 1A2KC 4Z8XA 1DADA 1GRRA 1Z47A 1IQPA 2DFNA 2H8KA 2FE4A 3LWNA 3QKSA 1IBRA 4RFVA 3QVVA 1WBDA 3EPHA 4LC0A 2WJIA 4TSFD 1XMIA 4JLKA 4HLUA 2XTMA 5DYIA 4B2PA 1DAMA 3PR1A 4MUAA 3LX8A 4BFYA 4IDNA 4L15A 5GJCA 3JVUA 4BASA 1Y3AA 2WM9B 3VX3A 1AQUA 2ECKA 2ZJOA 3GEIA 2QBYB 1IJEA 4TZ0A 1B23P 1GL6A 2O8FA 3TNFA 4BWYA 3QBVA 4IOMA 4LJAA 1EFRD 2Q9CA 2WSSA 1MABA 2WJGA 1F2UA 1K5GA 2NIPA 4QGGA 1NVVQ 4QFMA 3B1YA 3K8YA 3V4RA 3QXXA 2IT1A 4DLZA 1NVUQ 1GL9B 1UADA 1ZC3A 4O25A 2ZTSA 4IKEA 1AJEA 4MKHA 2ODNA 3OE7A 1ZC4A 3GPLA 1BIFA 2NO9A 2GK7A 5AJVB 5C18A 1E99A 1HQCA 5EXPA 1E0SA 1GZSA 1NIJA 1XF9A 2J7PA 4HSEA 4NCKA 4UNRA 1VG9B 1CEEA 5GJBA 2PMKA 4DDUA 2RCNA 3GLFA 3MD0A 5KDOA 1CJMA 1GTVA 1SVMA 3WNDA 1FL9A 5CDFE 4XH9B 1G4AE 5KDDA 1S3GA 3W90A 4KSBA 3KQUA 3AVOA 3TJZA 4L16A 1P7CA 121PA 2CNWD 2EFEB 2OM2A 3K0AB 3FE2A 5CDFA 5JI2E 5SZKB 3O8RA 4B2IA 1ZMXA 4EPWA 5DSZA 2TMKA 4CIDA 2ZI6A 1EX7A 5CIWA 3PFIA 1FX0A 3GLFE 4JLAA 5FOUA 4OQMA 4XJXA 3FGNA 4YDHB 2OAQ1 4DBLC 2RGXA 1DG3A 2ZAOA 5ELXA 3FHOA 4TN1A 1G41A 4PR0A 5TV2A 2NZJA 5B57C 3EZ7A 1WA5A 3L0SA 1UJ2A 4LV6A 4EFMA 5HKKA 1KJWA 1Z6YA 2F6RA 1YZUA 3CNNA 3ZVLA 1KOFA 4D25A 4U02A 1JXMA 1SVLA 2G83A 3I72A 2WZQA 3NHAA 5GJVC 1OH6A 4TMWA 4NZYA 5EP4A 3WYAA 4KLZA 1W46A 1VTKA 2ANCA 4B33A 4QBIA 5DI9A 1X8KA 2EWWA 4HB4A 4HAZA 4IFEA 2LCFA 1CTQA 4QGAA 1KI6B 1MRSA 5DNYB 3AVYA 2QE7D 3QE0A 2EU8A 5C4MA 2FH5B 2R8RA 2XZPA 2FJUA 4GPTA 3R9XA 3RSLA 4EAQA 2XZOA 1OSNA 1D6JA 4HUQB 4NTZA 3I32A 2GVZC 4ACBA 2WMOB 1YHNA 1Q57A 2ZUDA 5TY0A 5CITA 4C0KA 3QKTA 4QNMA 3O8CA 2YOHA 4LBZA 4QBGB 1OFHA 4B75A 2CCJA 4JL5A 2GEDA 3DKVA 4TYPA 5E7JA 4GP6A 5BQ5A 2IS2A 2JJ2D 4IVRA 4GBMA 2QM8A 2A5DA 2FZ4A 4JL8A 4DB2A 5FBQB 5LDDC 3L8YA 3LVRE 2ZRKA 1TL7C 1M6NA 1SVSA 2QAGC 4GDFA 1E1QD 2HCBA 1NMYA 3AF2A 2G1KA 3RS3A 2D2EA 3K0EA 1A5TA 4KJZA 3K0CA 2J59A 5CJ2A 2ZYVX 3LBNA 3QEJA 3O47A 1YZGA 2ODEA 3U3KA 2C9CA 3UG6A 2HLDA 3QKUA 5F9FA 4D0GA 1NY5A 2BBSA 3WRXC 2BJVA 4BLSA 4DIDA 3RSOA 2F9MA 5FUXA 4PQRA 2WWXA 4L8GA 2WWIA 2YKGA 3AV0B 1TEXA 2RH5A 1OB2A 3MWLA 2YOGA 1NBMA 1KGDA 3BC1A 621PA 3PUVA 4A9AA 1G21E 2GKSA 4JLNA 4NCNA 3CX8A 2H92A 1ZNWA 2OBMA 4D82A 4G5QA 4RZ3A 4B3GA 2A5GA 2ZJAA 1P4SA 2QEQA 2FSHA 2J7KA 3KTAB 4JSYA 3ZQJA 1Z0JA 4DSNA 5CB6A 2ZS8A 4IVPA 3ZD7A 1OYWA 4B3XA 1YJ5A 2XTNA 5DN6A 4XIGS 5JEDA 4HAUA 2OLJA 4AURA 3TLXA 2R65A 3REGA 5E4FA 4AIIA 4EPVA 4Q00A 2G1JA 2WWYA 1PVOA 3CNLA 3THXA 4XOIA 5F98A 1DELA 1Z5ZA 4TTPA 3WHKA 4D0NA 4Q4HA 2A5FA 3RS5A 5DN6D 3R9IA 1G7TA 2YWFA 5DYGA 2FWRA 2GF0A 4FXPA 3N2EA 3BIFA 4C30A 1G64A 2BKEA 4EJSA 1E79A 3CZQA 1EGAA 4LJYA 3T1QA 3PITA 1MR3F 4URYR 3VU9B 1QHNA 2ZU6A 4PHFA 5FOVA 4D4KA 5B58C 5JRZA 3V4FA 2ORIA 4MGZR 2REXB 1CR1A 1DAHA 2FGJA 1WMSA 2G88A 3IHWA 1FOEB 1P75A 2V1XA 1D2NA 3CONA 5J4VA 3IO5A 2GK6A 4A0RA 2ZRMA 2WKPA 3H2YA 3CNOA 2C96A 3SFZA 2IUSA 2GDJA 4KVAA 1WE2A 2EW1A 5EP3A 5KHOC 2BMEA 4PO1A 2Q3FA 1AKYA 1W4RA 4WXRA 3T15A 4A92A 3NXSA 4YQFA 1YQTA 4TL8A 2ZRBA 2IS6A 3EAQA 3P20A 2ZRHA 2DBYA 3L0IB 1OPXA 2Z4SA 3LV8A 2QSYA 3KQLA 4ACAA 1JR6A 3WMFA 2VP0A 2CEAA 2IWHA 3W3ZB 3RABA 4ZCLA 2KWIA 3C8UA 1NVVR 3VR3A 3IEVA 3K70B 1HTWA 4FW9A 4K8OA 2CMKA 2D06A 2FX3A 2QTFA 1A82A 1S8FA 1IY0A 2QAGB 1NLYA 1QG2A 3CRW1 4NPHA 3GLIE 3QXCA 4O2LA 4NH0A 5F3WB 2P6UA 4TQ9A 4UXHA 2VF7A 3TK1A 3NBXX 4I1UA 3CRQA 5JFGA 4FMDB 2W6ID 1OKKD 4A15A 1KMHA 4PXAA 3SE0A 3KKMA 4C7OB 1N6RA 2UZ3A 1XJCA 2HXSA 5FR1A 4FMDF 2V4ZA 1XXHE 2KJQA 4MRSA 1OH8A 2JLRA 5CB8A 3FKSA 2J0QA 3AUYA 3NBYC 3TSZA 4A6XA 1ZINA 3B5JA 1OXSC 4MRNA 3QBTA 2B8WA 4M1MA 2QP9X 4PAMA 4CT5A 2W2XA 3OEHA 2V1UA 2XNDD 2ZRDA 3KDSE 4PHGA 5CIQA 4LZZA 3TE6A 2IA5A 4NHOA 2RGDA 4BFUA 5L3RA 1N6PA 4ZPXA 1R5OA 2QA5A 4V0LA 4N1AA 1JJ7A 3ZJYA 4BFWA 4M21A 4Q9JA 4JLBA 2O8DB 2BM0A 3FHCB 3N2IA 1KO7A 3LH5A 1R7RA 1SULA 1U8AA 2G0TA 2NOAA 4GMXA 3T34A 2GBLA 4HB3A 2VO1A 1HA3A 1J99A 2ZI9A 2IYLD 2WBLC 3B6EA 1NN3A 1V43A 1F2TB 3SN6A 3I62A 3TKLA 1W5TA 2NPFA 1F6BA 1UBGA 1D9ZA 1N0WA 2G3YA 2OHFA 3GCGA 1KY3A 3TUJC 2A5JA 3VU9A 4AD8A 3THYA 1OJLA 2W00A 1LF5A 1XTRA 4LCBA 4B35A 2NG1A 3OFND 3RRMA 4FMCB 3W6PA 4FD2A 4GI7A 3IEUA 1UFQA 3WNBA 4ESHA 5IHPA 1XU4A 2JJ1A 4KYUA 3KL4A 3H1TA 4M1OA 1HT1E 4M2LA 3AH8A 5CM8B 5SZHB 2QMUA 4LHVA 1CULC 4BLTA 4Q4HB 1RZ3A 5CYPA 2Z6VA 4RCYA 1I2MA 5F2EA 1YZNA 5EXXA 2DWOA 3R20A 3TUIC 1GRQA 4A82A 2H57A 1EX6A 3A1TA 2P65A 1AS0A 3U6BA 2E1RA 4A36A 4DC9A 4PO8A 4TMZA 1XXHB 5AUNB 3FKSD 5EZ5A 1H8HD 1YKSA 1CR2A 3ZIAA 4Q4LA 2CJWB 2QP4A 2FEMA 2QP3A 1KI6A 2WWFA 3GLGE 3HU1A 4FWIB 4ERNA 1U9IC 3SU8A 4QHTA 2P5SA 1OH7A 2ANBA 2YINC 3AVQA 5J4YA 1NI3A 1C9KA 3GLIB 2O8CA 1ZM3A 3B2EA 3IGFA 1ZJ6A 3B60A 1OKKA 4V0KA 5JMTA 2J0SA 4L9WA 3ZIAD 5KNCA 2G6BA 2J3EA 3Q85A 4PANA 4Y0AA 4URVR 5KU1A 2ZJZA 3FB4A 1OHHA 4OI2A 2JDIA 2AD1A 3TR0A 1OXUA 1IJFA 1XD2B 4FI3C 5JCPA 5KOYA 5JCZA 1IAQA 3MUFA 3LW7A 4LX0A 3U3RA 4LYJA 4B3CA 4Z51A 3MJRA 1WP9A 4B3BA 2EQBA 5KUTA 1QF9A 3P26A 3TGPA 2JCSA 5IDVA 2OAP1 1T8TA 3FFBA 2HEIA 5DI3A 3ADBA 2DR3A 1GSIA 3CX7A 3QG1A 3UATA 1E94E 4PC1A 2RGBA 2NO1A 4WOPA 4D0LB 4GZMA 3BE4A 2MMCA 3C5HA 4K81B 1FNMA 221PA 3AVWA 5FUWA 4EUNA 2AWNA 4JVSB 3Q7PA 4DLYA 2AHOA 4JBWA 4AYWA 3RNLA 1G5TA 1ESMA 3Q9LA 2ORVA 5HZKA 1XCMA 2VIIA 3Q7QA 4DCSA 4B47A 3FVQA 4BZXA 1NG1A 3NVAA 4Q1AA 2EFCB 4PPQA 3AEZA 1VIYA 1AIPA 2Z43A 1U99A 4OHZA 1N2CE 5IT5A 3RWMB 2SHKA 1FTNA 4M8NE 1IHUA 4IDHA 4M1TA 1KYIA 2VRWA 3DEFA 3SYNA 4LBWA 1GFIA 3BERA 2C78A 4P4TA 3LA6A 3K9NA 4EPYA 1P6XA 1Y63A 1CRPA 2F1JA 4KYIB 4RFSB 2ZANA 4Q9IA 2EFHB 4PPNA 5FPTA 1RRGA 4UJ5A 2I4IA 1HE1C 2VQSA 4KAXA 4P4SA 1E2LA 2ZRAA 3T1OA 1R0YA 2QBYA 4ZKEA 5FTNA 2P3SA 3E5HA 4HZUA 3U7EB 1Z0DA 3U3JA 4A8JA 5EXSA 1Q22A 1COWA 3A8TA 1TQDA 5BYJA 2IYQA 5JWRA 4LGMA 1H8HA 1XP8A 3ZQ6A 2FF7A 3I5YA 2XSZA 4OI4A 3AP2A 2VSOA 1M2OB 3T5DA 3GEEA 5KSOA 2LKCA 4P3YA 1SVKA 4RD1A 1T3SA 2QGNA 3KKNA 1M7BA 1NLZA 4LYAA 3UG7A 3ZGXA 2XOKD 4JYCA 2FFBA 4Q4JB 4BFVA 3PV0A 1RRFA 1R4AA 3NHBA 4TLCA 2WSMA 4ILEA 2GHIA 5FI0B 3QPUA 4RD6A 2HLDD 2ATXA 1X1RA 3LQQA 1N5LA 1I4DD 1QHHA 1GNPA 5UKDA 3BOSA 2ZRJA 1N0VC 1U81A 4GFDA 2GCOB 2PL3A 4HAXA 2ZPTX 1GL7A 4TYNA 4M53A 1XFAA 2V7QD 1XTSA 2OCPA 4MDFA 1M1YE 1JQLB 521PA 1T3HA 4A0FA 1JEDA 3F0TA 1J2JA 2B6HA 3PQCA 4DCUA 1G8FA 4HDOB 2WPDA 3X1ZA 4JBXA 2IXGA 4PPFA 2B7BA 2IUTA 4G1UC 3W34A 1MOZA 3AF1A 1QVRA 1YRAA 3B1VA 2XAUA 2O8BA 4I1OA 1HYQA 2F9LA 4DDTA 1T0JB 3NEYA 2C95A 3AQ4A 3AVPA 3VHLB 3Q3JB 4EFNA 1VG8A 2JLSA 3ZVNA 3C41J 2ZI3A 4KVGA 3KXIA 2O8DA 1Q1ZA 1UDWA 2ZJ2A 4A0GA 3AGQA 4DCVA 4CYMA 3TBKA 4B43A 1KI3A 1NMZA 4P0TA 4RKFA 3KFVA 1PLKA 5JWHA 2H17A 3ZD6A 3J81k 2ZITA 2PCJA 5AJWA 1EFHA 3WXMA 2JGNA 4DSOA 1KK3A 3MJHA 3CX6A 2A7QA 1TX4B 1K6MA 3MWKA 1F3OA 4JLPA 3HR7A 1CP2A 2OCBA 4Q18A 1U8YA 3EARA 4V0MA 1LW7A 4NCHA 2VHQA 3K09A 1T8UA 2QE7A 5TB5A 1II9A 2VTKA 2ZR9A 2YYZA 3C14C 3PXGA 1XPRA 2MSEB 2ZRIA 5JLJA 1E9FA 2ORWA 3B1XA 1R0WA 4CEIB 1ZIOA 3MRSA 2CL0X 4XD7D 4LJ6A 1QHIA 1X8LA 4HZUB 4D4MA 4DSUA 3LBIA 3NC1C 2JATA 1E1RD 2ZYUX 2GXUA 1SHKA 5JWOA 2QAGA 1XJ0A 2QG6A 4GZLA 4Z8YA 3C15C 1Z28A 3ZZ0A 4MKGA 4BEBA 4DT1B 3ASYA 4WIAA 1ZRHA 4DDWA 1EK0A 1TEVA 2OZEA 5CLQA 4OL0A 3GJ6A 4X8MA 1R2QA 1I4TD 3IILA 2IYTA 1QRAA 2QRNA 4GRAA 4KV9A 3BXZA 4IJMA 1OH5A 5FBVB 2ZR0A 2G9NA 3T12A 1W2HA 3ADDA 1GVNB 3KX2A 3EPJA 4GL2A 1AZTA 1HH4A 2GEUA 3NDPA 3CH5A 3VR5A 1TQ4A 1Z2CA 1YU9A 2DWPA 4MDEA 2FEOA 1G8YA 1TTTA 3TIFA 4GOKA 4HLDA 5H68A 1AK2A 2WIAA 4MKFA 4Y0VA 2IS4A 3X1DA 1BMFD 3Q5DA 1RYFA 3B78A 5FPSA 4RSGA 5DIFA 5A4JA 2ZXUA 3WY9A 4TL7A 2I3BA 4OK5A 1MV5A 3B9QA 5JSZA 3A4NA 1G3IA 1SXJC 1YR9A 3TUZC 2GEVA 3EX7C 1HE8B 2FN4A 2P6NA 2BDTA 3BAFA 1MO6A 1SVWA 2EVWX 3SR0A 5JEEA 1U98A 1BMFA 2HYIC 4OQLA 2ZAMA 1GG2A 4E5UA 3RC3A 4LYHA 5FPHA 4KU4A 2R62A 3WP1B 1SVIA 2BM1A 2ZRCA 1IM2A 3BD9A 1G6HA 1QG4A 3MAAC 4A2PA 4RJLA 2IWRA 2V3CC 5FBLB 4U00A 1HT2E 2BBWA 1ZM4A 1KI2A 4FCTA 3GLIA 5CJPA 2GBLC 3KTAA 1VPLA 1NF3A 4LOAA 3GLHB 5EE5B 5GVRA 1N6NA 2JIZA 3B1ZA 1GM5A 3ECCA 5AUOB 1E98A 1H8EA 2RB4A 5KPJA 1KMQA 2QI9C 2EYUA 2REOA 4RD4A 3T1TA 2AXPA 3K0FA 3H0KA 2XJ4A 4TQUS 5DLQC 4AKHA 4IRUB 4RD0A 4UKDA 2IK8A 4G3XA 2YOFA 8OHMA 4YONB 4F93B 2VL7A 3JZAA 4DVGA 4JT2A 2CVFA 2GA8A 4V03A 4L4UA 1IN7A 2NQ2C 4G5OA 2ODWA 3I73A 1ZNZA 1S4QA 4NKRA 1CXZA 4LBVA 4AKIA 1GAJA 1PLJA 3K0FB 2HYDA 3SNHA 2AL7A 3U7GA 2PT7A 1E6CA 2V6JA 1O87A 5A5GA 3IPYA 1KK1A 2ZJYA 3LX5A 4DLTA 2Q3MA 1TQ6A 2V7QA 3QY0A 5KSPA 1G6OA 1LY1A 5BN5A 3SZRA 1ZNYA 1E9EA 2O0JA 2W0MA 3EC2A 3MWYW 4JYBA 2HF9A 1OFUX 5AK0A 4DLSA 5DO9A 2C04A 4CT4B 1CRQA 2ZRGA 4I99A 1DBSA 1SHZA 2Z4RA 3GD7A 1X86B 4CF7A 1U0LA 1PJRA 4WW0A 4RCZA 5L3VA 1IN5A 2IYRA 2JDID 2RGGA 4Q47A 3B1WA 1KI8A 2YWGA 3P4XA 1UKEA 3CRMA 3OAAA 3BFKA 4HLCA 5CK4A 1E2IA 2IX3A 2ONJA 2ZS9A 3NBZC 3K9LA 2C9YA 2AK2A 3EC1A 2WHXA 3HR8A 2OEPA 1JEEA 1VYVA 4OHYA 1D2MA 2Q9BA 4NMMA 4B44A 2YC4C 4LJ4A 1IONA 4YMSA 2ZSAA 3ND9A 4DUGD 1U0HC 1OLOA 5K8LA 1W4AA 5G41A 4MRRA 4DZZA 3MSXA 3WYFA 3C16C 4Q66C 2P2LA 3A37A 4US0R 1ZUNB 3SDZA 4BRUA 3K70C 1G5RA 3EASA 4M1SA 2NO7A 3QKRB 1W0JD 3CPJB 3B82A 2C77A 4IFBA 2PX3A 3NG1A 1FP7A 2OUKA 3S1AA 3K0AA 3QF4B 4OBEA 2JJ1D 4DIEA 2JJ2A 2GVDC 2IEYA 2Z0MA 4PC7A 2ERXA 2R6GA 2REBA 5JHHB 3CIOA 1EFCA 3CH4B 5EXTA 2O0HA 2KSQA 3L82B 4JBYA 1W49A 4DHEA 5IK2D 2A30A 4MH0R 2F3RA 2HCJB 4NYMR 5EUMA 4B76A 3RWOA 4NYJR 4EPRA 1AZSC 4YXWA 2VPPA 3PVSA 4WAUA 2KBFA 2WWHA 4MGYR 5GADl 3LW8A 2CXXA 1W36D 1D5CA 2PMDA 3PEUA 1GOTA 4IDQA 4P31A 1RE0A 3LNCA 4ZO4A 3EG5A 2ASEA 1SQ5A 3BGWA 3KB2A 3SJCA 3SJBA 1ZU5A 3QSYA 5CLLA 5J4KA 3L43A 2IF0A 3NC0C 1G8PA 1XEXA 5K8TA 3RAPR 1M7GA 2BIFA 3DM5A 4G0NA 3QUSA 3W6OA 3THXB 4HDQB 2JJ8A 1QDEA 1CR0A 1E69A 1M74A 1XPOA 2ZVQX 1E2QA 1VG1A 1ZUIA 1G291 1AGRA 3MGCA 2J7PD 1DO2A 1LVGA 4C7OA 3U7FB 2JLXA 2HT1A 2GJKA 1M34E 5HE8A 3T61A 1COWD 2J41A 1XNJA 3DVLA 2AX4A 1QHGA 1N5JA 1W0JA 1LS6A 2PZGA 4TQAA 5P21A 1N0UA 4NYIQ 5FPKA 1G3MA 1Z0FA 4KBFA 4OHXA 3THOA 1DEKA 1D9XA 1NKTA 1NJGA 1WXQA 4QJ5A 4WZ6A 1UM8A 1XEWX 1F5NA 3KQHA 2ZU0C 3BJIC 2EWVA 1S3SA 4LDJA 4OQFA 4GT1A 3K9HA 3ADCA 4MYTA 3H84A 1R10A 3F8TA 5IK2A 5EJEA 3D7MA 1KSGA 1G7CA 4C2UA 4O3MA 1XEXB 2XB2A 4F4CA 5BN4A 1N6LA 4XVRA 4PAOA 1N5IA 4QBFA 3RRNA 4NU0A 4YC7A 2JIZD 4BRWA 2O8EB 3I92A 5EQTA 3CLVA 1J70A 4X8LA 3EW9A 4BFXA 1Q3TA 4PHHA 1T9HA 3KZ1E 2R44A 3G0HA 4NONA 3W6NA 4H1VA 4GNKA 1W4CA 3KJHA 1XCGB 1IN4A 3ASZA 1G7SA 4Q4JA 3RS2A 2K5UA 4TYQA 1E0KA 3VAAA 5LPNA 1UKYA 3PIRA 2XXAA 4KFRA 1XCPA 3RRYA 4XWAA 1VMAA 2C98A 3HU3A 4BQSA 1WBBA 2KBEA 2RKOA 1OXVA 3NDBB 2QT0A 4V02A 3W8RA 2KB0A 5J40A 2Q21A 2CE7A 5KNDA 1QVAA 2OBNA 3M0EA 2FDCA 2C8VA 3S1AB 2BWJA 5KPDA 6Q21A 4JVMA 4PPGA 5DI3B 4Q19A 4G5RA 2OLKA 1YZKA 3U7HB 1TQ2A 3OEHD 2XOKA 5FOXA 2H1LA 3AP3A 3WP0A 3AB3A 3AVTA 4FMCF 4HDCA 2ZI4A 1GKYA 1XD2A 4LSGA 3BRWD 3DPUA 1ZVQA 2XB4A 3WBJA 1J90A 3PUZA 1W4BA 3TVDA 4ON9A 4V0ME 2DYKA 2KE5A 1JAHA 1CU1A 2W6JD 1PV4A 4ITRC 1YVDA 1NN1A 3U3OA 1Z06A 2R9VA 1J8YF 2JLYA 1LNZA 3KFXA 2V54A 2WAYA 4XSHA 5AJYA 3I5XA 2ZE6A 3TW4A 3QXHA 1FFHA 5KYKA 2VF8A 1KIMA 4DSTA 2PZFA 1P60A 2QPTA 2QL6A 1TU3A 4C4PA 1Z8FA 2I1VB 4IOKA 1XDBA 1Z2AA 3CR8A 5TXGA 4CEJA 1DVRA 1G20E 4G5SA 4XWKA 2CVHA 3GEHA 5LBIA 1OV4A 3IIMA 4D26A 1BOFA 2BOVA 4J0QA 5FOTA 2CLSA 2HJGA 1DAEA 3C5CA 3W3AA 4PO9A 1KK0A 3LAWA 4URZR 4BLRA 4TTQA 1HURA 2CL7X 2RGEA 1HUQA 5L3QB 4OJKA 1XX6A 5HR5A 2ZIAA 4LPSA 3AVVA 1NVWQ 4OQXA 3IHLA 2OG2A 1EFUA 4NBSA 5FOWA 3HPRA 4TSFA 1EESA 3IBYA 4ASUA 2B92A 4H9GA 3B13B 3WHLA 2GILA 3P1JA 4DT1A 3PCRB 1CJVC 4M1YA 5K8IA 1XJQA 1ONBA 3M6AA 2BJWA 2DY1A 2Z83A 4HATA 2J9RA 2C2HA 1DAKA 3HJNA 5JBQA 3C7KA 1XZQA 4AY2A 2CHGA 4Q21A 5J4LA 4HAYA 4YXWD 2YZ2A 2GXQA 3SI7A 2O5VA 3IUYA 1FTSA 1M8PA 1YZQA 1Z83A 3DDCA 3KKOA 2QTVB 3OHMA 4D4LA 1Q1QA 5JJLA 1JJVA 4LK2A 1KZGB 1WB9A 4HAVA 1A1VA 1CJUC 3L0PA 3OIVA 4P33A 5E95A 2RAPA 2X2FA 2YJTD 1T5IA 5FL7A 4A2QA 4EPTA 2RGAA 3CO5A 4PSKA 1Q1EA 4PFSA 1R8QA 2BHRA 1Z22A 1JECA 4ARZA 1TNDA 1ANKA 2D3WA 1SZPA 1P62B 5L8VA 2VP4A 5DHFA 1W47A 2GWHA 2JLZA 2VHTA 3RS7A 1XMSA 2R6CA 1Q0UA 2MSCB 3GJ3A 4Z54A 1UPTA 4HLUC 2PLFA 2IYUA 2J46A 3KB1A 4F91B 4B73A 4CVNA 3AP1A 4GP7A 4W5WA 1BS1A 2NPIA 3A1WA 1XRJA 3U60B 4TYWA 2N1BA 3PEWA 4DLRA 3ADKA 1NL3A 4OKSA 1AM4D 1JNYA 1W7AA 3TRFA 3G82C 1KMHB 3ZVRA 3PEYA 4PSVA 1G17A 1XBTA 2P67A 4AG6A 5AJXA 3TVTA 3U3MA 2UVQA 3AGPA 5DH9A 1W36C 4D81A 1H8ED 2GESA 5BXQC 1XEFA 3TMKA 4BFTA 3VMFA 1Q20A 1GDDA 2CL6X 3R8CA 3SJAA 1XMVA 4EKDA 1XTKA 4D2IA 3NIBA 4OQNA 1CIPA 2E87A 5TMPA 3U44A 1OF1A 1E96A 3U4QA 3TAHA 4B74A 1DO0A 5E7MA 5JI3E 2ZRLA 4AYTA 4Q7MB 1DS6A 1MKYA 1E32A 1O3YA 2YC2C 3W5JA 1S9HA 1FMJA 2QUZA 1QHSA 2PT5A 1LS1A 2FPKA 3FKQA 3CUEF 4M9ZA 4C0JA 3EA0A 3AF3A 2Q6TA 3HYTA 1E2PA 5E7IA 4B32A 2YWHA 4QGFA 2BEKA 2XX3A 3EZ9A 4Q1EA 2LKDA 2XNSA 4PQYA 2VH5R 3H4MA 4ZDWA 1GILA 4QGHA 1CF4A 2V6IA 3WYGA 1GWNA 1EWRA 1FZQA 2FPMA 3QF7A 4US1R 3ZS9A 1CR4A 2WKQA 3TQFA 4V0OA 2ZE5A 3OF5A 721PA 2HUPA 3GJ0A 2FSGA 2J1LA 4IDOA 1JR3A 1NN0A 3GJ5A 1AS3A 5HE9A 1N3BA 4ZCIA 4DEXA 2QMOA 4GOXA 2ZE7A 3V00A 3OZXA 3VKGA 3L8ZA 1HEIA 4A1FA 5H70A 4LRWA 1E9AA 3MCAA 4TZ6A 4EFLA 4DRZA 3ZDQA 1G16A 2VBCA 4XTCS 4URWR 1XD8A 1XTIA 2NO6A 2ZSFA 3VFDA 3BFXA 3GLHE 1ZD8A 1HY3A 3CKLA 4DLXA 2GTPA 4IEIA 2LWIA 4RFSA 2VHUA 1GIAA 4D6PA 4IDPA 3GLGA 1SXJE 2DCUA 1E9RA 1KAGA 4ZV4A 3CR7A 2GZAA 2J0VA 3QG5A 3I61A 1G9XA 1R0ZA 4E09A 4N0DA 4M4SA 4KFSA 4AYXA 3TSWA 1Z6AA 1QZXA 3TH5A 1E2HA 2FPLA 2W83A 4QC2A 1XD9A 1ZCAA 2IXEA 3AKDA 3LVQE 4CGZA 1JQJC 2BCJQ 5BWMA 3CRRA 1YR8A 4M9QA 1P2TA 1TMKA 3DZDA 5GJWC 2F43B 2GJ8A 4TL6A 1RPZA 1GITA 1FW6A 1R0XA 1E9BA 4R98A 3KQNA 4QRHA 1IY2A 4UNPA 3DHWC 2OT3B 3ZH9B 3UWKA 1JPNA 1US8A 1C4OA 1GP2A 2PJZA 5BYKA 2N46A 5KSYA 2GAAA 4IXMA 1SGWA 4JSTA 2FFQA 2D74A 4KSCA 1TUEA 4QM7A 5LD2C 2QNRA 3O8DA 4KHZA 5LD2B 3DKPA 5BW8A 5JJIA 2H18A 1S1CA 3P27A 1IXRC 4ZKDA 1S0UA 1RC8A 3HU2A 4DLWA 4MYCA 1MRNA 2ZJ5A 4WXPA 4DB4A 4CEJB 3IO3A 1MO5A 4W9MC 4LHXA 1GNRA 1E1RA 4HEJA 1UF9A 2BMJA 2R6DA 2F7SA 1ESNA 3Q72A 4A6PA 1G3RA 1FP6A 1W1WA 5KTYA 1XTJA 5D3MA 3BORA 3VR2A 4ESVA 1CS4C 1L4YA 2NMVA 4HI0E 1ODFA 2ZRNA 3QVUA 1TAGA 1XXHA 4KO8A 3QQ5A 2C5LA 1NIPA 2D62A 4CW7A 4TLAA 4DJTA 1T0HB 2NGRA 4N3NA 2OV2A 2AKAB 5LB4A 2N42A 4P4SB 4BECA 4UQOA 4KFTA 4F38A 5J5CA 1OW3B 3GFPA 3RC8A 1J7KA 3QPVA 4DCTA 2BBOA 5JS8A 3FHTA 4OYHA 1KSJA 3UMFA 4B3DA 4QG7A 3SC3A 4RZXA 1GRNA 2X1VA 4B71A 4Q4AB 2W2TA 2GJAA 4TMXA 2QY9A 2ZI5A 3QXSA 3UMSA 3HYRA 4PTLA 3W8NA 821PA 2JA1A 1KDTA 1Q44A 3QEOA 3ETLA 1N6IA 2ZE8A 4B6FA 1ZCBA 4PSAA 2X8AA 3THYB 4LPKA 1G1MA 4EIWA 2IHBA 3NH9A 3P4YA 3I3SR 1S96A 2F55A 5FTKA 2ZETA 3CBQA 3N70A 4CEHB 4B48A 1Z6XA 3KXKA 3ND8A 1P72A 3CPHA 3X1YA 3K0CC 1PZNA 1XTQA 2NZ8A 2QROA 2RHMA 3EWSA 3T1VA 1T6NA 1ZP6A 2GAOA 4II7A 3ICEA 1SKYE 1Z3IX 3EWAA 4BE7B 4GOJA 4PQFA 1FMLA 5J4HA 1SVOA 1W0KD 2W6IA 4BGDA 2QT1A 2E9SA 4JLMA 5AR1A 3PG5A 4DUGA 5IF9A 2IHYA 2NTYC 4MGIR 2XITA 1SXJA 2OXCA 2GJ9A 3FYHA 4C0QC 4Q4AA 4WVFA 4TLEA 1G5PA 1IN8A 1NLFA 2ONKA 3PEVA 1CJTC 2ODBA 3UIEA 2GJSA 2VA8A 4MRVA 1NP6A 2WMNB 3PUXA 4DLUA 4Q1DA 2F43A 3IDQA 1MT0A 3GJXC 4BFSA 3U6KA 1E2DA 4MKIA 1UAAA 4GSYA 1GNQA 1ZBDA 1N6KA 3K53A 3OIYA 2WAXA 2ZREA 3REFA 2W6JA 5GVSA 2IC5A 3UK6A 1KSFX 1P2VA 1ZW6A 1W5SA 4JJZA 4ABYA 5JSZB 4DEYA 3TSOA 1NN5A 4BZQA 4JKIA 4FINA 5B2ZA 2PLRA 2QQEA 3GJ4A 4TWZA 4C3ZA 4AK9A 1E9DA 2VP6A 2ERYA 4XVUA 3E70C 4RVCA 3RHFA 4Q9KA 1N25A 1AGPA 4AC9A 3HWSA 3RANA 1HV8A 1EG7A 1R5BA 5TARA 2WJJA 1RRCA 5HPYB 1K5DA 3I4LA 4C0SA 4M1WA 3FOZA 2VEDA 4TT3D 1RRPA 4Z1MA 2ZR7A 3RYTC 2ATVA 1KSHA 2WOOA 1ZD9A 2PCLA 4FWTA 2PJRA 1N6HA 3CWQA 4Q01A 4HUTA 3LDAA 1FUUA 3RVBA 1T5LA 1JB1A 3K09C 4KODA 4LBYA 4C2TA 3EZFA 2X77A 2GCPA 3FWYA 2VLIA 1IN6A 2FZLA 3THWA 2JLUA 1I2DA 1RIFA 1WF3A 1Q12A 3UANA 3RLFA 3AKCA 1NNEA 2ZUCA 5FOSA 2OO7A 1X6VA 3A1UA 4BUJA 5FL3A 5JZVA 2CLCX 1F2UB 1CBUA 1R5NA 4HB0A 3A1SA 3A4MA 4YLGA 4QL3A 1GKUB 1VCOA 1OHHD 3M1IA 4ZI2A 4BLPA 3W9YA 2FV8A 4HZIA 1NSFA 1G3UA 1Z07A 4QJ3A 2PH1A 3L2OB 3VHXA 4F4JA 5C2JB 1KKMA 2ZS7A 4JKYA 1RW4A 2IXFA 1KHTA 4LC1A 1OXTA 5HTKA 3AM1A 5FL7D 2JAQA 4OJQA 2FGKA 2Z5FA 2GF9A 1EWQA 2MMGA 1SKQA 2GCNA 2GCOA 2Q0HA 2DFLA 3LD9A 3WBKA 4W5JA 1DG1G 5CK5A 2IYZA 2VHJA 1P73A 1VCIA 4ZDKA 3VNVA 2FOLA 5H8WA 4F92B 5FUYA 5TVKA 1U9IA 3FMFA 4IOLA 1E0JA 2XTZA 5EP2A 1WRBA 3PUWA 2B21A 2UKDA 3WNCA 5M04A 2WPDD 4MGKR 4URXR 4LY6A 1W44A 4EDHA 3E2IA 4QNRA 2WICA 4LYFA 2W2VA 5EE3A 2QRZA 1UEIA 2A5YB 2OBLA 2FU5C 1D2EA 2GRJA 1W48A 4TLDA 4Q9HA 1QHXA 1L7VC 4I4LA 3DL0A 1HQYE 4B2LA 2A78A 4NCJA 3SQXA 3QKSB 4OK6A 3IQXA 4PX9A 1AQYA 3E1SA 3GMTA 3QOFA 4LV8B 4UNSA 4LJ5A 3UKDA 3VX4A 2XJ9A 4FMBB 2AK3A 4PC6A 2C9OA
chains in the Genus database with same CATH superfamily
1YASA 3LBHA 4HYEA 3DB1A 3TW0A 5AYVA 3PI7A 3IOCA 1U1CA 3GU3A 5IAEA 3H5LA 4IGAA 2ZJ8A 2ZPAA 1NVXQ 1VFPA 2H9IA 3P94A 2CCKA 5E3IA 4ASUD 5C7LO 1LV7A 2O54A 2P6RA 3U7HB 2FZ5A 2CF5A 4MS3B 2X5JO 1NMXA 1RADA 2QU8A 2JFNA 4BMDA 1LCIA 3PYXA 2UVPB 4RF4A 2ZT8A 1O4WA 3OPNA 4I2VA 1UIRA 1YJCA 1DCFA 1SKUA 1WUIS 3FWHA 4M0LA 4K40A 4P54A 2FPUA 4RK4A 1GV1A 4B0OA 3KUCA 3L7OA 2LP4Y 2BP7A 4NX2A 1LPAB 3QNUA 3EXEB 5IFKA 1MJ5A 1V11A 5TQVA 2BFNA 4CEHA 4N3GA 2P11A 5TGTA 1U8XX 2JAUA 2VK4A 5HG0A 5IN5A 5JHGB 5AVVA 4AY6A 2W6QA 3DH0A 3H97A 3O2NA 4NYJQ 4W8GA 4IWNA 5AUQA 4PN7A 2BEVA 2O2DA 2FXVA 2G63A 2QV0A 5DEIA 1GZ5A 3F6YA 1UXGA 5FTLA 4G1EB 1KQ3A 2WJHA 1EP2B 4HGPA 3EHEA 4IIGA 1BDJA 1QK5A 4LUCA 3U0BA 2P2CA 1OFGA 4EQ6A 4F8EA 3U4MA 1M8JA 1RLMA 3NH6A 3GLHA 4UE3S 5KX5B 3T5GA 1R6TA 3SFVA 1KH1A 3AUFA 1Z4MA 1BYIA 2JLQA 1NY6A 4UOQA 1BKDR 1SKAA 3B7PA 4BNFA 1PIWA 4DFDA 1MT3A 1AKTA 4DV1B 2B4AA 4M9XA 1BC5A 2G25A 3WJAA 5E4JA 5LKAA 2V9ZA 1DQRA 4ZC1A 3SBEA 4ISCA 4XTRA 5E6RA 5SZJA 3SEAA 3TI7A 3UMBA 1XMJA 2BGIA 4MUNA 4WCFA 2BCGY 4DQKA 3KWLA 3RUCA 3AEKB 4E2YA 4EY6A 2Q4BA 3UAXA 2R2AA 2GBIA 2ON6A 3N0WA 1H1TA 4IO1A 1WQ1R 3R8FA 3MT7A 1UP4A 3LX4A 1N3IA 4DDVA 3TLYA 1A2QA 4F5DA 3UHAA 1XMXA 2OPBA 2VSXA 5J43A 3LXRA 1TJYA 5ALEA 1T6YA 4BNJA 2D1SA 3BRSA 2B7CA 3BIXA 5AW1A 3S1SA 4P0QB 1NTRA 4PZDA 5AVKA 4RADA 4RTRA 5ARCA 3ORQA 1WUYA 2Q3HA 3BMOB 1O6GA 3VISA 4BE4A 5CHYA 3JZFA 4LDRA 4ND5A 5A0FA 1LZLA 3MWEB 1ULUA 5I7SA 1OI3A 1YO6A 4Q16A 2VJOA 3EXEA 4D9MA 3C1TA 2P9GA 4Q6WA 4DLPA 1KO4A 1V5WA 1P7WA 1G8MA 1YE8A 3BZWA 4LZNA 1IOLA 2VJLA 3KV1A 3SZOA 2ZUTA 3CVOA 1OXKB 3WDLA 3TAUA 4ZIRB 4UHJA 3VKWA 3RODA 1PEAA 3EIEA 2QJFA 2OHHA 1XXLA 3F4KA 1TM1E 4G5GA 3F6BX 5EE1A 1AQNA 2WFAA 5EY5B 2VXOA 2EP5A 2YN0A 3C6QA 3DOUA 2HIMA 3EZ6A 2XGMA 3PT5A 1VKOA 5E4TA 5EAIA 2B2XA 4FSHA 1POWA 2ZRPA 4A6DA 2XXBA 1LC3A 3FYSA 4Z7OB 1YDEA 5FA6A 1YVUA 4MKXA 3NRJA 3PNOA 4PVCA 3PRJA 1CY6A 3QPBA 2IUFA 3BMQB 4M36A 1P9NA 1R0SA 1RVDA 2EHJA 2VXBA 4QXOA 3O92A 4BFZA 4DA9A 4DTIA 2J4DA 5I45A 1KDRA 5H02A 1RHUA 4PYMA 4B17A 3ONFA 3OIGA 1HR0B 2WU1A 3VU3A 3HI4A 4D41A 1K5PA 4WBSA 2QMHA 2JIBA 1V41E 1WEHA 2C57A 3GP5A 3SBDA 2AMVA 2ZSKA 4TMTA 2ZT7A 4FCCA 4G8BA 3K3PA 5ALVA 1VXRA 2DULA 5JISA 1NDQA 1P61B 4OYRA 3JVVA 3WMGA 3N6XA 2VK2A 1FRZA 4GM1A 2YWJA 3PNYA 4Q6BA 1KI9A 4CM3A 2NZXA 4IW3B 2ID4A 1OZHA 3SZMA 2PQ2A 2LDXA 1DWOA 1ACJA 1GLGA 5KC8A 1JDJA 4K9MA 4PV7A 1D3AA 4RZ2A 3RC1A 3W6UA 1Z63A 5A06A 1UKZA 1UP7A 1XWIA 3GUZA 5G0VA 3A6HA 1JEJA 4BRZA 2PEYA 3TQOA 2CHQA 3ZE9A 5IRCD 4CM8B 3T1QA 1BU5A 1QZZA 4HEQA 4CIBA 4X7MA 2B0JA 1JAIA 1KAQA 1U2PA 4NJEA 4HB2A 4LYDA 2NXCA 5ALSA 4B8WA 1WMAA 1QCDA 1HE4A 1RAHA 1GHTA 2VA9A 1T1SA 4Q3OA 4BC1A 4CM4B 4RZQA 3CKKA 2CNWA 1Y1RA 3LUFA 1RCTE 2UZ4A 4EQ6B 1GTL1 1YUBA 1WO8A 2FRDA 5ELMA 5A3SA 2IH4A 5FEUA 2A0UA 2DQZA 3CF6R 4A91A 1KYVA 1LDNA 1GN8A 2FSIA 2P2GA 4RKEA 4BZPA 3KHTA 1BO6A 2YMPA 5J63A 3GN1A 3CV3A 2OCAA 5JARA 1E9SA 1QUEA 3DTVD 2HK8A 3FPAA 3NKVA 1PJZA 3PC7A 4FOLA 5HCIA 2YHUA 4BCBA 4XEHA 1DI0A 2G7MC 2IBSA 1QIJA 3ROQA 1E2FA 2W6OA 3C7DB 4WSOA 3MWJA 4RE5A 3GBPA 3RS4A 5ANRB 6YASA 5LYYA 5AD1A 2BJHA 5DCYA 3VKHA 2CXTA 4Q1FA 4U6QA 4J94A 4TVKA 1PHRA 1S89A 2AF3C 3BM5A 1X8JA 3STXA 3CLRC 4OVKA 1OE0A 4KH1A 2QIOA 5T5QA 3DLIA 1U8ZA 3HB1A 1KJZA 1HOXA 1V1RA 3X1XA 2GZ1A 1Y6QA 1PUJA 1R16A 3QUCA 4UFOA 4Y1GA 1WVGA 1ECPA 3HDQA 3BK7A 2XH8A 1ZK2A 3I2IA 4LRXA 4PZCA 3EIHA 2CNKA 5BT9A 5SY6A 3WWCA 3GT3A 3GZNA 4HRYA 4H1UA 4C3OB 3S28A 3FYTA 5TT0A 2RK4A 2Y99A 1WMFA 2WIJA 3LTNC 3EYAA 3HKBA 5E9QA 3KAQA 2W2MA 1NJ6A 2PN1A 2VJAA 2IYYA 4B31A 1LF0A 3U80A 4BZWA 2J4FA 5IT9A 4IVQA 5J5VA 1TAQA 1CLUA 3TZEA 5ICFA 1F48A 2C00A 1BYUA 2E4AA 3GHHA 3DL2A 4TRRA 1L7AA 2OXRA 1KYTA 4MITA 1NBOA 4LF9B 4ZYXA 1WZIA 4U9UA 2CV0A 2IYWA 1XDUA 3GVCA 4QDXA 3E2PA 1ZM9A 3ORFA 2IYSA 3HKCA 4ND8A 4D8WA 1EHIA 3F3YA 1CB7A 4PC2A 4TX1A 2BMFA 5EE9A 3VR1A 4EGSA 5TRTA 2VATA 1EFVB 3BGDA 4G1BA 1K8RA 4Q1BA 1DQZA 4ZI3A 3TQQA 2P40A 1YRBA 1NM5A 4UVDA 3D3WA 4H3SA 4EABA 4CLOA 3UJNA 2AFHE 5C1PA 3GEDA 4LXTA 4FFRA 1MVLA 2PVCA 5JOQA 3CX3A 4QYTA 2A9KA 1NI4B 3FYUA 4LOLA 2EF0A 4OJNA 4WX2B 3QBEA 4IY1A 3JYOA 1Q11A 4Q7LA 2IBMA 2C42A 2XI4A 3RK0A 5ICCA 1A04A 1ISMA 1YB6A 2M2IA 3BE8A 4A8TA 1UPBA 2WVAA 1S9DA 3UEOA 3H2JA 1NXQA 1QNLA 1SBNE 3AIKA 1W52X 4ZO8A 5T6MA 3FAZA 3W0LB 5GONF 5GOZA 2HGSA 1J8FA 5ELLA 4RY2A 2E85A 1XHFA 1ISFA 3O6VA 2XNDA 1TGYA 3QIVA 3AVUA 2W7TA 4JJ6A 3NYWA 2NUTB 3CRVA 4P32A 4QXAA 5JNTA 1X3SA 2UZIR 3MTEA 1V7QA 4KN6A 2H2HA 3SIWA 1QGDA 4Y0NA 4KR6A 5DJ5A 1JHVA 5ESRA 1UZUA 2RJOA 3TIXB 4CLDA 2R0QC 3W6ZA 1NQ5A 2QMQA 1K6XA 4QOSA 3HO6A 4FFNA 4U0JA 5C4GB 2Q9UA 3LG2A 4F3YA 1U28A 5K0CA 1JBKA 1Y1QA 4DNOA 3UJ6A 4X00A 3H4IA 4F7WA 1KTVA 3EEFA 3VPSA 2F3UA 3G3EA 4WK4B 4MVJD 4XGNA 3WK6A 3A6PC 3KO8A 3U5ZB 2OBYA 4QECA 4X65B 3OEED 2AKYA 1HQDA 3PXBA 4HNAB 1OILA 5HDBB 1JHMA 2JVIA 5IHXA 4N82A 4OAQA 2HSEA 4P4UA 5M5BA 3D5EA 3HCDA 1SBHA 2R48A 2X19A 4KE8A 1OU4A 4ZV9A 4AY5A 4G0ZA 4NJEB 4U7WA 4BS9A 5CXUA 4EG6A 10MHA 4JLOA 1MJGM 3R44A 3EVEA 2QM3A 4X61A 4CF3A 2NXWA 1YE5A 3AHJA 4IEEA 5HUQA 3QJ5A 1G19A 2HV9A 1PG2A 1EFPB 3LPCA 3ISJA 4MP8A 1XTPA 3U2QA 3UMMA 5FR2A 2FRVA 1GZ7A 4LXYA 3HADA 4PLTA 2G8NA 4H4CA 2W43A 1U0EA 4JLJA 2BVNA 1RI3A 4MX8A 4YUYA 2IIBA 5EXDA 3HDYA 2D1QA 4WOJA 2BUBA 4US2R 5TDHA 1GKIA 1CY2A 4MS4B 2GXAA 1CX9B 1M7HA 1UJMA 4ZAGA 3BS4A 2IW1A 2UZ1A 4NIMA 1U9JA 3TEFA 5C1DA 4OI1A 2IYVA 1UKVY 4S24A 2C8LA 4KC0A 1UBFA 1ZH2A 2XOXA 3D6TB 1TADA 4ZALA 4NH4A 1O5IA 4DA0A 5K01A 2CLMB 3DHNA 4J0JA 4FEGA 1BXZA 2PY6A 5C35A 2D2VA 3HM2A 3ONWA 4RV5A 1VI5A 5KNBA 1NAHA 1A4RA 5NLLA 3UENA 1JQDA 3VR6A 5CFNA 5LUBA 1Y8RB 2BAGA 4BJ6A 1CY1A 4Z3KA 3Q11A 1VLLA 1O58A 2NWQA 3WOVA 2Y67A 5AKZA 2BZSA 1N7JA 1Z74A 3HL4A 3BSWA 3NJ4A 4JBHA 3TIIA 4CFZA 1PTKA 2QX7A 3FZEA 3B6MA 4JQYA 1CRZA 1OX6A 2MCFA 1J8MF 3UCXA 4PM4A 5MHTA 5LB2A 4M0UA 1OT3A 1HK7A 1OYVA 3A0UA 3MFYA 1TUBB 4D9FA 3X1JA 3CKYA 4URUR 5D51S 3WDKA 2A0YA 2F1HA 3R7WB 1ST2A 4K46A 2ZBUA 3NJ8A 4C21A 2HBYA 3AL2A 3OZWA 4EB0A 5CG2A 1KO8A 2G17A 1J0AA 1U94A 1M67A 1L4BA 1ZGJA 5JCOA 4CMBA 2OBXA 4BX9A 4IFIA 4DXAA 3R4VA 1GUAA 4RM3A 3EIXA 3LY7A 1X1DA 1A88A 1JA0A 1WZNA 4YQYA 5B1IA 2AH5A 2ZROA 3E4DA 3DZ8A 4WLFA 4GKAA 4BWVA 4LEIA 5A03A 1RXWA 2GLTA 4OREX 2HR1A 4AG5A 2D5IA 2WSLA 2X6TA 3NI2A 2B83A 2BW0A 2GYYA 1CQXA 3AKYA 2J0EA 3A6KA 3QITA 3CCFA 4FFWA 4IMRA 4IKOA 3I04M 4OUKX 2EFGA 3OZGA 4MINA 4CI9A 3ANNA 4UNQA 3VSCA 4JL6A 3JD3A 5A5VA 2XVZA 2IEAA 4A16A 2I1QA 3BH6A 2HTEA 2OD7A 3TPCA 4D02A 2C3PA 2OCDA 3SYKA 3AUAA 5CDUA 1GG5A 1KZ7B 1MVNA 4H08A 2P9QA 5EQDA 1N78A 5G0TA 2DT8A 4M6WA 2JFWA 3KKPA 5A6SB 1JMKC 2QK4A 2X0IA 3OQIB 5CVEA 5E8JA 2CK3A 5AXAA 4ZQFA 4EP1A 3CT4A 2RKWA 1TI7A 4L8LA 2QPOA 3I2GA 4D9EA 1DJQA 2REQB 2PX0A 2RGCA 5EZYF 4RMIA 5B6JA 1NNSA 3H1AA 1UXHA 1XLUA 5DISB 5KYXB 1TU4A 1SOUA 2ISCA 1FX0B 3B9PA 5CIYA 3DLBA 4Y6PA 1EHCA 1IU9A 1Z73A 2WTUA 1WWKA 2QVYX 1YAHA 2C7BA 3CF0A 1MA3A 1XZHA 2EC5A 3A32A 1R18A 3DUFA 3P2EA 1GV0A 5KTOA 2GF2A 1WB6A 3NAZA 4U7DA 1SCKA 2C99A 4LFBB 5KNDD 3MLEA 3VHQA 1AUQA 5K2OA 1MXHA 4Q15A 1Y4ZA 4ES6A 5CNMA 3KJEA 4X8OA 3UV3A 3WGIA 2NXNA 1FUYB 1CRLA 2WJYA 5CVUA 1Z39A 5F9HA 4F3KA 2I29A 2FUEA 3PGMA 3ERCA 3WSWA 2K4MA 5G3YA 4UUNA 1IY1A 1CUDA 1ZD5A 2FFHA 1GGMA 4BNDB 3BFVA 1TF2A 3VTKA 1I3OA 1TECE 1RLOA 1NXTA 4L6AA 1YR6A 2QORA 3EJWA 3GG9A 4QJIA 4M9UA 1K6IA 5LN1A 4MWZA 4EKGA 2M6RA 1DKNA 5EHZA 3VDNB 4O1MA 4LGYA 1N4DA 1S2MA 5HVNA 4MK4A 3PDCA 3CA8A 1IEQA 3FFWA 3M4NA 4UTPA 5DLYA 1MQSA 2C29D 5JYDA 2G5TA 1S2NA 3E5RA 4O4JF 4C0LA 5CFPA 1MB9A 4RV4A 5AVWA 1VHLA 4BB5A 1Y8AA 1FPMA 2CUNA 2XEXA 4KCGA 4KVZA 4LYEA 5DXJA 2AI2A 3WDMA 1OLXA 5ISMA 1HNWB 4NXNB 4BX8A 3H7IA 3DOFA 4W5NA 3KFLA 3T1YB 4C43A 1TVKB 1C7ZA 3M8KA 1QK3A 2P0EA 2O1WA 5AKKA 3PXAA 5AKGA 5HBGA 3H18A 1XNQB 2B8EA 4RQTA 4GOND 2EX0A 3B89A 4EJSB 5JH7B 4F5YA 3HCWA 2FLVA 3CUSA 4MW7A 4EB3A 5JSKA 2GAFA 3OCUA 3V9PA 4CNQA 3HJHA 2QZ4A 4OK3A 5BSKA 3S5UA 3E7XA 2HWYA 3LQYA 1EFTA 3KYBA 3K2BA 1RQ2A 3OZIA 5ALFA 5A9SB 3KLPX 2GS9A 3OQ1A 4PHTA 2FSFA 2AV6A 2Q0QA 2W6CX 1NJFA 3AF4A 5K8UA 1QMPA 3QKRA 4IMJB 1AKNA 1GNTA 1Q6YA 2Y4NA 4FNGA 5AM4A 3KUDA 1LK0A 3DOEA 3OP4A 1XZNA 2Z58A 5FDFA 4D9CA 1E3MA 4LE0A 5H1YA 2DUJA 1QIFA 5EUQB 1Q7CA 4RLQA 1MCZA 1O8BA 2F3TA 2CFSA 3OETA 5GOTA 1UEXC 4O5AA 1W1UA 2IZ5A 2PSHA 3FCXA 4K86A 5FWDA 1Z47A 2W2LA 2WABA 4WKPA 1CDEA 2HC9A 5ARBA 5AKIA 1KMIY 2O7QA 4I4CA 1QTQA 4NVRA 2ZUEA 1TM5E 1P8JA 2JGMA 3R5FA 3LKZA 2R5NA 1IBRA 2PZKA 3GDWA 3WLFA 3WC4A 1H2ZA 3EPHA 1WV1A 2WJ6A 2P1RA 2EKBA 4TSFD 1FRQA 5EJ7A 1Z8HA 3IB3A 1KJ8A 3DULA 2WZDA 2XTMA 5DYIA 1DAMA 2I1WA 3N6RA 4MUAA 3LX8A 4DGQA 1ATZA 1W76A 2IPLA 4Z49A 4FKZA 4BASA 3U48A 5HWSA 3IEXA 3MLAA 1TO6A 5F78A 2ZJOA 5CT9A 3VX3A 4E2FA 1RXVA 3FF1A 2QBYB 3WGOA 1AMUA 1UC5B 1YMVA 3KS9A 3W2FA 3T7DA 3N2LA 4LJAA 5AICA 4O29A 1USVA 4YRDA 3CGWA 2WSSA 2DBVO 4YJ2A 5CDGA 1LBTA 2GBGA 3SBXA 4DWVA 5DBEX 1VMEA 1WCWA 1ZH4A 2RAUA 4JI7B 5C8YA 4QFMA 3PWSA 3B1YA 3K8YA 1P1FA 3GCDA 3O03A 3PR3A 3GQBB 3SGLA 1SO8A 2FN9A 5D1HA 4OATA 2O3TA 3WKAA 3FHJA 2AC7A 2ODNA 3L6CA 1SD1A 1R9JA 3OE7A 3GPLA 3JALB 3PWTA 1I5OA 2C94A 1BIFA 2PGDA 3PPVA 1NXOA 2GK7A 2A4MA 2R5WA 1E99A 3DVRX 1PGOA 3OJLA 1Q2UA 3QKIA 4Q1VA 5EXPA 2WMYA 4E46A 1GZSA 1NIJA 4EJSA 5DN9A 3V4OA 4NCKA 3D8RA 4XARA 4BNIA 2WHYA 4DDUA 1TE2A 2I0FA 4C7MA 2JLCA 5G1PA 2F59A 2YXPX 4EZEA 5A2QA 3EXIB 1CJMA 1SVMA 3RFUA 3WNDA 1DCMA 5KDDA 1LX6A 1S3GA 3ZW9A 4JJ8A 4NFYA 4BKOA 3K20A 5IBCA 2GKGA 1LLFA 3IS3A 2FWPA 3DOCA 4HHEA 2CNWD 4YRRA 4GR4A 1EVJA 1PBNA 3A2LA 3I9KA 3NS7A 1NM5C 4I08A 2Q2WA 2ROQA 3BBLA 2JFYA 2OM2A 1IZZA 1PFVA 4JEMA 2WF7A 4KIFA 5SZKB 4LAFA 4EPWA 2TMKA 5ALWA 2ZI6A 1EX7A 5IJ0B 4D3ZA 4JLAA 4ZXFA 3K8OE 4C5CA 1Z7YA 4JI3B 1GA6A 1G4HA 1T5TA 3KKZA 3ZQKA 5TV2A 4PR0A 2C8JA 4ZEXA 3LUAA 2Q8QA 3NBQA 3L0SA 2GO1A 4MB0A 1UJ2A 4LV6A 3WR5A 1RWQA 5CA0B 3PXXA 1KJWA 3I1IA 4H3HB 3SHQA 3BEOA 1TJ3A 5BXYA 4WJZA 1M72A 1YZUA 1QC5A 4WI1A 1P1RA 3SEQA 1KOFA 2GFHA 1XVVA 2ACWA 1JXMA 3I9V6 2FW7A 3IMEA 3CLUD 3UYLA 4HJXA 1JIQA 4WESB 1PJ2A 1FDSA 3LE8A 4ZCRA 3WYAA 1YK0A 1J2UA 3MGAA 5ALIA 2I2DA 4B33A 5DI9A 3GLKA 4HB4A 4MWTA 3SF0A 4PYIA 5LZ7A 4F4HA 1JNXX 1MRSA 5DNYB 2NADA 2QE7D 4X3OA 5CFRA 3QSGA 4GLLA 2BRUA 2EU8A 4UE2A 4DMLA 5KTMA 1DFIA 2P68A 5J1SB 4P5PA 2FJUA 4PGMA 1JBQA 5A71A 3ZK7A 2Z56A 2JANA 3RSLA 4J29A 4ZVQA 4BBPA 2Y1LA 2XZOA 3DVSX 1K1EA 4P2BA 1YHNA 3TDKA 4ZU6X 3SIPA 1Q0PA 3DOOA 1KMNA 3QKTA 4XYGA 4CL3A 4BLUA 5EJMA 2JFZA 3OPXA 4HC4A 1VBNA 2QD4A 4LBZA 1CG6A 4QBGB 4RU1A 4YRCA 1OFHA 3HFRA 1S7GA 1XAHA 1HDZA 2E89A 3BKXA 3GNSA 3KLMX 4WFJA 4TYPA 4ZRNA 1AN9A 3GY0A 4GP6A 4M55A 1H4VB 5E7JA 4Q7EA 3HBFA 4WINA 5BQ5A 3VZPA 4DRYA 1LH0A 1W73A 2IS2A 2QB5A 3PA6A 1QB8A 2P2YA 1WIWA 3M83A 2QM8A 2WKWA 4B3IA 4DB2A 4UD2A 3LVRE 4AB1A 1DDOA 4C22A 1SVSA 2QAGC 4AWAA 4GDFA 1E1QD 4D99A 1X80B 3H1BA 4DRXB 2D2EA 4O59O 4X6UA 4YQZA 3T7RA 5JSUA 1ORTA 3LHIA 1Y8RA 3OLVA 4KR0A 1WSAA 1ISJA 2VWHA 3B9BA 2B1IA 4YP9A 1GZ3A 3QEJA 3AERB 1P0FA 3O47A 3U3KA 4ALKA 3FGOA 4RHYA 1IVSA 4WY5A 1JHUA 3IAAA 3K6KA 3RAFC 2Y68A 1EJ0A 3QKUA 3W9BA 4ZGWA 1H4TA 1NY5A 4ENVA 3B6IA 1PFGA 4KG7A 4AZ3A 1EWVA 1EP9A 4ENPA 3NKFA 4R0NA 5I9LA 2WWXA 4PF1A 3IV6A 5HFNA 5KC9A 2YKGA 3UPTA 1WTCA 2WFZA 1C0PA 4D4GA 4TTJA 1Y4DE 4GXRA 1KGDA 4PAGA 1Y1KE 3AHGA 3ELDA 5T3YA 1J4AA 2O2GA 3CX8A 3SY8A 5D01A 4U2CA 4MQFA 4EARA 1A0OA 4D82A 1QYRA 1L4NA 3FCCA 2A1UB 4RZ3A 4COOA 2R1UA 3TZ6A 1GXSA 1WY5A 2ZJAA 5HS4A 5AI4A 3SLRA 3ZD7A 3HABA 3N86A 3Q40A 5C8VA 4B3XA 2ZXFA 1VE6A 3SLGA 3NZEA 2Q0XA 2R6JA 3IT0A 1LWNA 5K8VA 4CHGA 2WUWE 2G1JA 3CNLA 1CVIA 1WHSA 2AUNA 2PL1A 3TFOA 2UUPA 2XKBA 3UCFA 1PYGA 3BL8A 3FGPA 2CYAA 1T43A 1NU8A 2W2LD 3BGIA 1H2RS 1AKWA 1XVTA 4Q4HA 1RWPA 5IDYA 1TEZA 5C8ZA 3PE4A 4NNOA 2JGLA 1FFWA 5DYGA 4AXXA 4PNPA 2GF0A 1U7WA 2ZWAA 3PZBA 4XYMA 4MVXA 3BIFA 5K0TA 3RVKA 2VRNA 1RHQA 1JLMA 3OCCA 1U1EA 1Y42X 1BWQA 2WDPA 5COAA 3ENNA 3NT2A 3CZQA 2QT9A 2PV0A 3DAHA 3K5HA 3ZWMA 5DGHA 3PITA 1RS0A 4XPIA 1CEXA 1MB3A 2FZCA 2WIKA 5DTEA 3VU9B 2PANA 3MBIA 3ESAA 1FDUA 4MGZR 1JIIA 3S5JA 4UHCA 1L4KA 2HOQA 2JD1A 1FOEB 4A5OA 2FVYA 4MQLA 5J4VA 1MGPA 4KUEA 4KTTE 2GK6A 1YUMA 3H2YA 1YULA 4WLNA 1RKQA 2JFQA 2C96A 5CH5A 1KJIA 2IZOA 2CFTA 4MS1A 2I87A 4WOCA 2GDJA 3OIFA 1L5VA 5ALPA 3TLEA 1YWGO 3G2KA 3DBRA 3HWX1 4PO1A 5K45A 3VR2D 5KWVA 1OQAA 4DLLA 3I6BA 1C0EA 4TL8A 4XEUA 5KYWA 1HDIA 1MAHA 2V7WA 5ED0A 3WGNA 3ID6C 2DBYA 3DEYX 1G8AA 5DYTA 3WFIA 2C5AA 1JR6A 4Z4HA 3EDCA 2VP0A 3AEUA 3GRRA 3Q0TA 4KXMA 5EWMB 5H5JA 2PXAA 4IQ8A 5LBUA 3GX1A 2R6R1 3MS7A 2Y05A 2PYIA 5TSDA 1X1BA 4QDTA 1HTWA 4FW9A 2NNWB 4H6XA 3WKDA 4D8XA 2CMKA 3I01A 2QAGB 1S8FA 1IY0A 3V1KA 1NLYA 1UMDA 3LC7O 3P9PA 1MGOA 4NH0A 4O2LA 2EWMA 2B8NA 4P93A 5HSGA 3ZU5A 1N36B 2RI1A 4N5NA 3H6KA 3NBXX 1DC4A 1G21A 4OXQA 3UOGA 4EUEA 1B8PA 2AN5A 3W06A 4WLUA 3ROKA 2CXOA 1RXYA 3DZIA 4ND6A 1PR9A 3EGIA 1L5HA 2AEFA 5IPFA 1UJ6A 3L7YA 3R5KA 3WRVA 4UHFA 4EG1A 3SC2A 3FSGA 3NCTA 4P7KA 1C8LA 3TM4A 2IYPA 2NTNA 3C3PA 3PDWA 3KKMA 4B87A 1REQA 3AUJB 3PA8A 4A03A 1JLSA 3D5TA 5FR1A 1Q0HA 4FMDF 4H35A 3O9MA 2I6SA 2Y77A 3CS3A 2KJQA 4J76A 4XI9A 1NPYA 4D9NA 2O48X 1GKLA 4C14A 2J0QA 1ZN8A 3AUYA 2Q45A 2DHEA 3CTMA 5JTUA 3RJTA 4CFYA 1OXMA 1ZINA 2E5FA 3B5JA 1C3LA 2V5VA 1NFFA 2NPOA 1XQYA 3E3AA 1EUCB 4GPBA 5DMXA 1I6KA 5ARDA 2V5UA 3JYNA 3A2KA 2ZRDA 3ZHSA 1GYQA 4XIFA 4HDKA 2KPOA 2J3MA 5L3RA 2HPVA 1BQ3A 2QA5A 4N1AA 1XA0A 1Y7TA 4JOBA 5HDQA 3ZJYA 1Q2XA 4M21A 2OGSA 2HSGA 4QREA 1RC1A 4E5VA 3KTOA 3L7JA 2V6FA 1GCGA 3DL4A 1KO7A 3LWZA 1SNYA 2C5EA 1FFSA 4FBGA 4YO7A 4U9HS 5EYPB 2ORYA 2DLNA 5JANA 1UBJS 4RZIA 1DINA 1DHRA 2JL1A 2P7HA 2V7GA 1ITZA 4N8SA 2R7MA 1Z5UA 2I5PO 1DIGA 4ND7A 1H1LB 1T9ZA 5GWXA 3ZI4A 3ZR4B 2CNLA 5JCJA 2NPFA 5DM70 3I62A 2RGUA 3HCCA 3NHSA 3QEMA 2G3YA 4CODB 5I7RA 2PS3A 3VU9A 2X3FA 4AD8A 1OJLA 2P91A 1LF5A 4EITA 3PLNA 3OFND 4F2PA 1VRCA 4KK3A 3E7FA 4OHFA 1E62A 4N49A 2Z3ZA 4JGIA 3VOAA 3WNBA 2AJCA 2JGFA 4LY0A 3BVPA 5D5PA 1KE2A 1XU4A 3H1TA 4M1OA 2FPXA 4EYQA 3A3KA 4KL8S 5CM8B 3EFEA 1J39A 3UK0A 1MU0A 1RZ3A 4Q4HB 5K8JB 3PQFA 3ENWA 1RBYA 1SBIA 3A1NA 4EELA 2Z6VA 5CAEB 1B6SA 3KVRA 4BNDA 1YZNA 5KYUA 1N7GA 3I01M 2DWOA 3FD8A 1GRQA 1EK2A 5KTSA 1YDGA 2Y2UA 3FMVA 1VKZA 3A1TA 2IZ0A 1AS0A 1VHQA 1FK8A 2E1RA 3WL6A 3I42A 4GF5A 4L5AA 2QYSA 2COUA 2V03A 1V1JA 2CJWB 2QP4A 4NZPA 2WWFA 4JGGA 4ERNA 3GLGE 3EK2A 3THRA 3CF4A 1MC4A 1IVNA 4W9RA 3ILYA 5DM1A 1Z36A 4I9HA 1G9SA 1Z4JA 3IUSA 2YXNA 3L8MA 1X2BA 3GLIB 2O8CA 3IOYA 1JTFA 1ZM3A 3B2EA 4V0KA 2G67A 5JMTA 3P2MA 2J0SA 5KNCA 5CX1A 5KU1A 4Y0AA 1K92A 2XDWA 2ZJZA 2QZSA 3FB4A 2QN7A 1OHHA 4IRMA 4MICA 3PC8C 1Z4LA 4G0WA 4ABTA 4C7KA 1XDDA 1XD2B 2YZNA 4FI3C 4K9NA 4KQ1A 3HE3A 5KOYA 4D74A 1IAQA 4HXFB 1H4SA 1ZHOA 4LX0A 4Z51A 1Q19A 1Y33E 2RHHA 5KUTA 3B48A 3WYBA 2VQ6A 3Q3GE 3ADBA 3I4CA 2XF2A 1Z3CA 4BB9A 4QQFA 1KP3A 1PS0A 1ADGA 1VE3A 3NR2A 5NULA 3C7CB 2EX1A 3KELA 1SQ0A 4D0LB 4E1BA 3MCUA 5A2GA 5AI9A 1T29A 1JG3A 3C5HA 3DEIA 1FNMA 3EF1A 2Q6IA 1D04A 2VYVD 2B7LA 2PJUA 2IQ5A 3HVKA 2B99A 4BWGA 1I14A 5FUWA 2W48A 2Y27A 3G8DA 3ITNA 3BZUA 5FJIA 1NJ1A 2NACA 3TBFA 5LP6B 3JD0A 2AWNA 5FA5A 1P29A 4JBWA 3OQMA 1JVNA 4PAWA 4R83A 2IXTA 2FB9A 3IT1A 3RVMA 3EFBA 2ORVA 2ZIXB 1YCFA 1P1IA 2AI1A 4R2JA 3UMCA 5HZKA 1GCAA 1ZVMA 4B47A 3Q7TA 5AHXA 2UUBB 2O2HA 4EW6A 4PPQA 4WRRA 4MV6A 3AEZA 1AIPA 2OXEA 4OHZA 2ODTX 5IT4A 2X5NA 3H2GA 2R1VB 4TTTS 5LQDA 3EZLA 5C4IA 2SHKA 4H1WA 5EGSA 3FGZA 1O6BA 4M8NE 3NOQA 4MPTA 1G2IA 4IDHA 1T1EA 2XMDA 3HKDB 3O4IA 2VRWA 4BAUA 2VDWB 3L8FA 4LBWA 1XA4A 2I6FA 4CV1A 3VPDA 5K0ZA 3U16A 4X66B 2C78A 4P4TA 1QUFA 3NHPA 3C3KA 6ADHA 1Y63A 2O4CA 3K94A 4KYIB 3E0XA 4PPNA 4MEBA 4ZYYA 3WYDA 2H2FA 1TD1A 1HE1C 1B4DA 1MB2A 1C4XA 2XECA 4FKMA 3V6MA 3OM9A 1QANA 3MTGA 2ZRAA 4P4SA 1IEWA 4BKRA 4QDOA 4CTJA 1IK6A 3H9GA 3T1OA 1GAWA 1JG1A 3KCQA 1FTQA 4W1SA 1D1SA 4ZQBA 5E8RA 3SHOA 3V8EA 2P0YA 3LUDA 5THKA 1JTEA 1Z0DA 2A1TS 2BGWA 2PKQP 2BUCA 4N7JA 1DC5A 4ESEA 6REQB 1YI0A 4LZAA 2DY0A 1EBFA 1GPUA 2Y1OA 4LRQA 2XSZA 3VU8A 3AP2A 5LBTA 2NN3C 1KRXA 1N5RA 2LKCA 4P3YA 4BUZA 5K4HA 5CR9A 4RHTA 2EZ8A 1NLZA 3IHKA 1T36A 3LZCA 2FMFA 1IBLB 3HZZA 1V47A 1QV9A 2FFBA 2YWXA 2FK7A 4LRUA 5K4AA 3INTA 1JHXA 3MCZA 3AF6A 4BFVA 4WMLA 1GZ4A 3PV0A 3RF7A 5AW0A 2Q7OE 1T1RA 4WXEA 2NYAA 4GX1A 4ILEA 2G40A 1JTVA 3JS5A 4RD6A 4UHHA 5FI0B 2DKNA 3LK7A 1I3KA 3THSA 3FYDA 4HS9A 4ZEOA 4F6RB 1U81A 1KTIA 4HAXA 1U65A 2ZPTX 1GL7A 3P2OA 3RKRA 5KYWB 4MI9A 4ZZ0A 1XFAA 1R50A 3GJTA 3LKBA 2Y9PB 4KK4A 4XGQA 4MDFA 1M1YE 1P8AA 1W5FA 4PFQA 3BWMA 1FLVA 4RVFA 1MC5A 5FLKA 4D3SA 3HYSA 4NZ9A 4O02B 1TA9A 4KQXA 4H7IA 4QULA 1THMA 4AXBA 1G8FA 2GN1A 1Q92A 3R6LA 1PTJC 2D00A 4X1IB 3NEPX 4ZODA 4J4HA 4G1UC 3BXPA 3KJFA 4OP2A 1QVRA 1YRAA 2PVSA 5IN4A 1QQ7A 4FT2A 2O8BA 3IPAA 4R7TA 4FJ0A 1U0SY 3E8MA 5EKUA 1T36B 2F9LA 4KQIA 5EHQA 2NVUB 4DDTA 3DE1X 1ULTA 3AVPA 3VHLB 4EFNA 3Q3JB 4N40A 5HJ7A 1VG8A 3K72B 2O0MA 3EXFB 2EDAA 3MA0A 2D0PB 2ZYAA 4FFBA 4FVTA 4KVGA 3OHPA 5EMHA 4Q93A 3VTZA 2I6XA 3HI6A 3O21A 1P17A 1NYTA 2Q5IA 4A8PA 1UDWA 4RJ2A 5HOEA 3EXG2 1OV6A 3AGQA 4XQ9A 4KWEA 2PGXA 1VP9A 4EOGA 2DUNA 3ZCSA 4Q3BA 1YOVB 3H4TA 3ZD6A 2ZITA 2C61A 2PCJA 1O6FA 5LXTF 3LQ1A 3L5KA 1Z4KA 2JGNA 1V71A 2C2OA 3U7QA 5B3JA 1H3EA 1KK3A 4JAVC 1P9LA 2FX5A 5AVTA 1F3OA 3H8JA 2AE2A 2PLWA 3JWJA 3DEZA 3KSZO 4Q18A 1CP2A 1U0FA 2OCBA 4ZANA 3WQSB 4B7ZA 4YQFA 3D6JA 3AX6A 3G8YA 1P4JA 2HMTA 3T9CA 4N12A 1QM5A 1LW7A 3IAS6 4QGSA 2ID8A 3KHSA 1C9NA 1WZEA 4NCHA 4AJLA 4Q3LA 3K09A 5JQGB 5TB5A 1CDZA 1NYQA 4CT0A 3BDIA 2GHTA 4KXNA 4Z4QA 1D09A 2C3MA 4PS1A 4NNJA 4J7CA 4UC0A 4YV7A 2PH5A 1ZZEA 3FPEA 3PUJA 4AJ9A 4BGVA 5BWNA 5JLJA 1ZIOA 4XD7D 2CBGA 3EXFA 4B6PA 5A4DA 5DNWA 4HN9A 1NURA 3D81A 3NC1C 2JATA 1E1RD 4HXEB 2R4TA 3HS3A 2FUKA 1SHKA 2QF7A 2CD7A 1SOVA 5FAXA 5JWOA 4TV9F 1DOZA 2QAGA 3JATB 2ZXEA 3WAJA 3PJDA 2RH4A 4GZLA 1YCHA 2D8MA 1QAQA 5U9CA 4MKGA 4B4OA 1Y81A 1RJEA 2J4CA 3T3EA 4BEBA 4DT1B 3U0VA 2PPVA 1HNZB 4QUHA 1GG8A 1UBTS 4RANA 4KE9A 4OL0A 3GJ6A 1CK4A 1I4TD 3F1LA 1TA4A 1QRAA 2IYTA 1F4LA 2QRNA 4UDNA 3N0RA 4GRAA 5JAMA 2AZ4A 3H11B 3H2BA 5JD3A 1UUFA 1YZ3A 4IJMA 3T54A 3OCWA 5A0VA 3HJCA