4HB2A

Crystal structure of crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
204
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 59
structure length 204
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb2A00
4LJ7A 1FTNA 2BHRA 3O8CA 3K70B 4M1MA 4ESHA 2ZSBA 2BKEA 1NN1A 1AS3A 4NYJR 4LBYA 2C9CA 1CJVC 4AK9A 2QBYA 1CU1A 3R8CA 3TUIC 1DE0A 1NMYA 4JJKA 5JLJA 2JJ8A 1UJ2A 2QNRA 1K8RA 1F2TA 1VCOA 2GJAA 2QROA 2ZSAA 3ZVRA 2WKRA 4QBGB 4ASUD 3UMRA 1CULC 3EARA 1E9AA 1M7HA 1TQ6A 3EW9A 4ARZB 2VLIA 4IVRA 3V4FA 1XMSA 4TMVA 4OJQA 2BOVA 3U3RA 2O8FB 4LGMA 4DT1B 4LC1A 1HURA 3BH0A 1K5GA 5EE1A 5DI3B 4PPQA 4AC9A 5G3YA 2J0UB 1U81A 1N6RA 2OBMA 3BBPA 4JL5A 4QJ4A 5CIWA 3SJCA 4EFLA 1AQUA 2MMCA 2BJVA 2ZRLA 2AL7A 4KHZA 3GFOA 3ZGXA 1KTVA 2B7CA 2VPPA 3LVQE 4HLUC 4M9QA 1N3BA 4R2IA 1TF7A 1E2NA 2B8WA 4KI0A 3RYTC 1ZM3A 1KNXA 1S96A 3SFVA 2IS4A 3CX8A 3ZQJA 1R5NA 1NJFA 3UIEA 1K5DA 3SQWA 1ZAKA 5F98A 2KJQA 2P65A 2Z4RA 4V02A 1XD8A 5DI3A 3TBKA 3BRWD 2BWJA 3TAHA 2J0UA 1SXJE 4RJLA 1CIPA 3GJ5A 3GEIA 1YZUA 4QKQA 3B1YA 1KO4A 3DM9B 1DAIA 1M8PA 2QI9C 3LA6A 4X8OA 5L3SA 3T5DA 3I5YA 2R6CA 1P7CA 4B3XA 4P0TA 2JLRA 4NYJQ 2JLYA 1FOEB 1G3QA 5EE0A 3WNCA 2BEKA 3PUYA 1J8YF 1VIYA 5CIQA 3GMTA 1H8HD 1KGDA 1X86B 2IEYA 2Q9CA 4DB4A 2B92A 3AKYA 1AQYA 2W00A 3JVVA 4DZZA 2J59A 4TSFA 1S2MA 2A5JA 4GOXA 4TQAA 4F4CA 5LPNA 1NG1A 1VIAA 3IQXA 3GLFA 4POAA 1II0A 1U9IC 2YWHA 3QKUA 1FW6A 3QQ5A 4R7ZA 1UKYA 5KPDA 3SYKA 4MRRA 2C9YA 3THYA 3AVUA 2QMOA 2JLXA 2ZU6A 3HJNA 5TXGA 2QPTA 1FQJA 1Z06A 1OF1A 2ZS9A 4TYQA 5B58C 1FNNA 4E03A 2DWQA 1GRNA 2Q0HA 5JEEA 2CCJA 4CF7A 1EFRA 4KV9A 4B75A 1GVNB 2F43A 4B6FA 5DN6D 2V8OA 4Q9HA 4FCWA 1DADA 1SVSA 3WBKA 3SN6A 2PCJA 1FUKA 5AJYA 3B1XA 2Y8EA 3AF4A 3LFUA 1SXJC 2WSSA 1JJVA 1Z6XA 4G5SA 5KDDA 4NH0A 2QY9A 1NIPA 4YMVA 4ZI3A 5G41A 4A0HA 2FFHA 2A9KA 3K09A 1TU4A 4Q1AA 4V0NA 3ZIAD 4PTLA 1R0ZA 3X2SA 1LB1B 1OB5A 3SU8A 1WB9A 1E99A 3GFTA 1UADA 1BIFA 2G6BA 3KJGA 3JZMA 2CEAA 1D9ZA 3I3SR 1QHGA 4RY2A 3BH6A 3FTQA 1G7SA 2ZRKA 4JSTA 5E4FA 4IKEA 4D0NA 1XXHA 2VQSA 1F60A 1VG1A 2Q6TA 1P62B 2YVUA 1QHSA 2HF8A 3PCRB 1OXSC 1ZU5A 3PEVA 1W47A 1WP9A 3QNUA 3D6TB 4Q48A 1NVXQ 1SXJD 3WRYC 1Z08A 4D4MA 4DLUA 3FMIA 2X2FA 3I73A 2ZRIA 4Q01A 2GXUA 1XFAA 3CZQA 4ZCMA 2IWRA 1OH6A 1GDDA 2REXB 2WWXA 3E2IA 5DLQC 2HCBA 2JIZD 3VR2A 2DHRA 4BLRA 1HEIA 4XTRA 2VHTA 3OIYA 2RMKA 4TYNA 1WBBA 1KIMA 4KSBA 3SHWA 1ONBA 4XSGA 3X1XA 3DVLA 4DCVA 3L8ZA 2PT7A 4BLTA 3P20A 4QRHA 5HTKA 4DHEA 3W5IA 1FNMA 3CZPA 4PPNA 4JL8A 1BYIA 4Z51A 821PA 5KNBA 5JRJA 2O8DB 1RJ9B 5DISB 5EP4A 4GNKA 1E2KA 3LLMA 4P4TA 2JCSA 3NWJA 4R98A 2JLUA 2VF8A 3CB4A 4QC2A 2PL3A 1Z0IA 4PPFA 4DLZA 1W4BA 3C4JA 4KBGA 2RGGA 1BH2A 2YC2C 3H0KA 1CTQA 4PHTA 3SNHA 3WXMA 4PC2A 1XPOA 5KSOA 1GKYA 3D7MA 4V03A 3K0AA 4FMDB 5FBRB 3P1JA 4KBFA 2IYVA 2QM8A 2O8DA 1RJ9A 1DPFA 4LRWA 2JA1A 2R65A 4PHHA 3THWA 3Q7QA 3VU9B 1KSHA 1M7BA 1US8A 4QG7A 4Z1MA 2R6AA 2TMKA 3ND8A 3TGPA 4RD0A 1NLFA 4YMSA 3IILA 3QXJA 4LJ6A 4C0HA 2VP9A 1NBMA 1HTWA 4HZUA 3RANA 5D3MB 4URUR 2OLJA 4BASA 3TQFA 4TL7A 3G82C 5JS8A 3KQUA 1IN6A 2NO1A 3B1WA 1U8AA 3U4QA 4GBMA 3QI2A 2OFOA 1AZSC 2X8AA 1MABB 1NP6A 1X8LA 4Z8YA 3ICEA 3K0CA 1GG2A 2C95A 1RYFA 2LKCA 2IW3A 1S8FA 1T5IA 2JLZA 2A5FA 2BBWA 3CUEF 4W5JA 4P32A 2IUSA 3RRZA 4B76A 4DB2A 3PEYA 4FCTA 3Q3JB 2EW1A 2O8EB 1FFHA 4G5OA 621PA 3PUZA 4D4JA 2ZSEA 2ANBA 3ZZUA 1R0YA 5FOUA 3QIAA 3EG5A 3RDPA 4U00A 1G18A 5J4KA 1XCPA 4NCHA 3OIVA 3DKPA 4CVNA 4HB2A 3R9IA 2GBLA 1H8EA 3NBYC 4E07A 4CGZA 4CEIA 3QXHA 1KJYA 4JVNA 5FPKA 1WE2A 4HATA 4F92B 4OQMA 2FSGA 2IK8A 3GLFE 4FI3C 5DHAA 1PVOA 1FMJA 2HDNB 3U60B 1OW3B 5KSZA 1RZ3A 2QMEA 5LDDC 2O8EA 2AXPA 1W4RA 1E2JA 3K70C 5JZVA 3FHTA 1XU4A 2ZRGA 5HKKD 1Q44A 3IBGA 4XD7D 3MFYA 4XWAA 4QNRA 1G8FA 4L5BA 3ASZA 3HDTA 1GKUB 2ZR7A 1IQPA 3KFVA 4LUCA 1N6HA 3BK7A 4MKHA 2XSZA 2F9MA 1QHYA 1TAGA 3DEFA 3VR5A 3VAAA 5FTLA 4EFNA 2VHUA 3GP8A 1EXMA 2XNSA 2J87A 3OESA 4IDOA 1CR0A 1N5JA 3OFNA 4B48A 1RFLA 3QXCA 1UBEA 1ZINA 3KDSE 4D80A 1FQKA 1E4YA 3DL0A 4MKIA 2E1RA 1T91A 3AF0A 4PAOA 4ASUA 4OQNA 3S1AB 1SHZA 3FKSA 4BFUA 1OSNA 1NSFA 2CE7A 1GIAA 3UATA 1EWQA 3A4NA 4OI4A 5CM9C 3K70D 2BKUA 1I2DA 2WJJA 4LJ9A 5HE8A 4URVR 1AK2A 3RS0A 3AVPA 3IPYA 2L0XA 4TWZA 1P9RA 2KBEA 1IN7A 2JASA 2H1LA 3QEJA 1OLOA 4DXAA 3B82A 2ZI7A 4NKRA 4H1VA 4MRVA 3THXB 1CF4A 1MT0A 3CRVA 1COWD 1Q22A 4AI6A 1W49A 2ONKA 4Q7LA 1WXQA 2GXSA 3W8NA 1BKDR 4TTRA 3RHFA 2LWIA 3N70A 4WBSA 4DDWA 5DYIA 2AHOA 5HCIA 3O8DA 1U8YA 3C5HA 4DVGA 1Z3IX 3FDIA 5E7MA 3VX3A 1C9KA 1G8PA 1MO6A 4X8MA 5G3ZA 3SOPA 1OKKA 1NVUQ 2VA8A 4Q4LA 5DIFA 1MO5A 1OIVA 3HYRA 3W6OA 5E7JA 1KI1A 3FFAA 1XP8A 4WXRA 5IK2A 4UNPA 1VYTA 4M22A 1T9HA 4LI0A 1RRCA 3WNBA 2FEMA 3K0FB 2EYUA 1P73A 1GILA 3LAWA 3QPUA 3PEUA 1W0KD 5DYGA 3PUVA 1E9FA 5CJ2A 3RS2A 4HLUA 3TH5A 4DCUA 3EZ7A 3TSOA 2CHGA 1LV7A 3NBXX 1RYHA 3GLGA 1LNZA 3A36A 3IUYA 2E87A 1RW4A 3P4YA 1ZD1A 2GNOA 3DPUA 1KK2A 3ZZTA 2GXAA 2IHBA 5DI9A 1QDEA 2BEJA 2GK7A 3ETLA 5J4HA 3WP1B 4OK3A 4M4SA 3C7KA 2GKSA 1W36B 1T3SA 2MSDB 4KJZA 3KQNA 3U7GA 2WWIA 3LBNA 4YMUA 1UM8A 3WHKA 2ZETA 5C46F 5JCPA 4FMDF 3SZRA 4TYYA 4ITRC 4A9AA 2BMDA 4E5UA 2QGNA 1XDBA 1DO2A 1GRQA 5FBLB 4R71A 3X1ZA 3O8RA 4HLQB 2R6DA 3GJ4A 1E0SA 2FSFA 3ZYCA 2JLSA 5FOXA 5LB4A 5FFMA 1VPLA 1N6OA 1Z6TA 4DDUA 1EFRD 2IYXA 2B6HA 1HQYE 2OG2A 1W1WA 1M74A 1DVRA 1MO4A 4LYJA 4M9SA 1G5TA 2CNWA 3CPHA 4GP6A 3HU2A 3CM0A 1N6KA 5DN6A 5GVSA 2JLWA 2QA5A 3MSXA 3OEHD 4M9XA 3TW4A 5JSZB 4OHXA 1KKLA 1XD2A 2YZ2A 3CIOA 4KLNA 1DBSA 5J40A 4EJSB 1U9IA 2WSSD 4JLMA 2QL6A 2NZJA 4US2R 4UXHA 5IHPA 3KKQA 2EQBA 1TL7C 4L8GA 4A1FA 5JWRA 2WTUA 4AYXA 1JJ7A 3CH4B 4LY6A 3IO5A 1BS1A 2X19A 3OF5A 4TMTA 3U44B 3QENA 3ZIAA 4MGZR 1RE0A 4IJMA 1MRSA 2ZPTX 2PZGA 1T4GA 4IHQA 4UNQA 1UBGA 4MYTA 4IDNA 1NN3A 3LW7A 1TF2A 4MKGA 3NBFA 3AF3A 4FINA 5EXTA 1II9A 4IDPA 5JSZA 3CO5A 2C99A 1G3UA 1XJQA 2HJGA 4BRUA 3SDZA 5FUXA 1HUQA 3VTKA 3GQBA 3NG1A 2G9NA 1J8MF 3AVQA 2CL7X 1KI4A 1W44A 2VP6A 2NQ2C 1U90A 3AUXA 3CF2A 3EZ2A 4QGGA 3BOSA 5EUQB 5FTKA 2GJ9A 2HF9A 2XITA 1AGRA 1R5BA 2IYRA 3AKDA 3U44A 1NY5A 3R9XA 3BB4A 3GJ6A 4UXJA 3GLHB 1MOZA 1G17A 4A6PA 1RRPA 2VH5R 2A7QA 5DO9A 3R7WA 5UKDA 2JIZA 1KDPA 5CLLA 1M2OB 4QHTA 2IS1A 4JVLA 1XWIA 2OO7A 1TUEA 2VO1A 1DG1G 2WJGA 3AF1A 5FUVA 2AK2A 3AP1A 4PQFA 2IYZA 3ZVLA 5JWHA 4D4LA 1Z8FA 1CJKC 2X2EA 4YDHB 1RPZA 4CEHA 5JWOA 4C9BA 4DLYA 4Z8XA 5BWMA 1M6NA 4KAXA 4MDEA 4TTPA 3RSOA 3D8BA 3HR8A 2XB2A 1W46A 3UXMA 2AFHE 1PUJA 3ZVNA 1ETUA 1FP7A 3NHAA 1XCMA 3I92A 4D81A 1FX0A 4BLQA 3QVVA 3GLHA 3MMPA 4PZZA 3ONWA 3KKPA 4MGIR 3FE2A 3B78A 2QSZA 3M0EA 3PV0A 2ZITA 4DLRA 1BYUA 1QHNA 5TARA 4DDVA 3O8BA 4X8LA 5KUTA 3FWYA 4Y0VA 2YWFA 3KXIA 1JB1A 2F1JA 4C7OA 2JJ2A 1YJ5A 3A1VA 2OAP1 4Z1MD 1UEIA 5JI2E 1NN0A 3W6PA 4IXNA 4PR0A 1HT1E 5CYOA 2MSCB 3U6KA 4TYPA 4Q5IA 2J5XA 2ZM5A 3KX2A 2GF9A 4BLOA 5L3VA 2ZI6A 1ZUHA 2C78A 3DKVA 1XB2A 2GBLC 3KFXA 4GOKA 4AG6A 3Q8XB 2V6IA 1Q57A 5JFGA 3RRMA 2FPMA 3RLFA 4JT2A 4Q4HA 3LH5A 1XRJA 1SULA 3THOA 5EXSA 4LBVA 1Z63A 1XEWY 3BORA 4OQLA 4TLBA 2O8CA 2OFWA 2IXFA 2HUPA 4AKGA 3WYGA 2YKGA 1QHHB 3NEYA 2O52A 3EC1A 4B47A 1C1YA 1E2QA 1EK0A 2BV3A 2O0HA 3LXRA 4UXIA 4TL9A 3VHLB 2FF7A 2ZTSA 4NU0A 4D82A 3HU3A 3N5CA 3AVVA 421PA 1I2MA 1SHKA 5FI1B 2P5TB 3E1SA 2WWHA 1H8ED 2ZRNA 2IYWA 4KCGA 3IEUA 3WYAA 1GAJA 1T5LA 2DB3A 3TE6A 2FN4A 3UG6A 1TUIA 5JBQA 2XJ9A 4GZMA 1TQ4A 3N2EA 4HLDA 4MRSA 3AQ4A 4KFUA 1ZUNB 2W2TA 3FKQA 4TN1A 3I1FA 1ZRHA 4GSYA 4A0GA 5C1BA 1XTQA 3TR0A 1ZYUA 4XD7A 5TV2A 2VEDA 5LB2A 3T1VA 1IJEA 3SE0A 2Q9AA 2XSZD 4JS0A 5SZKB 1Q12A 5EP3A 3T1QA 2B8TA 4YQFA 3TRFA 5AJVB 4F93B 2ZE7A 3W90A 3CF6R 2NMVA 2ZROA 3OFND 4GMDA 1SVKA 5DH9A 3UMFA 5JCZA 1QG2A 2FFAA 3QY0A 5IRCD 3FKSD 2IC5A 4C0LA 3AVYA 1OXTA 4B44A 3QKRA 4ZCLA 5FOTA 2D3WA 2D4HA 5HE9A 4HLCA 3EIQA 2ZRMA 3WHLA 2H16A 4IW3B 3B8HA 3C14C 2V6JA 2RGNC 2V54A 2ZI9A 3D31A 2ZJAA 1C4OA 1GUAA 5JS7A 1YZNA 3LXXA 4CW7A 1XF9A 3F3YA 1F5NA 1XMJA 4IFEA 1E69A 3FYHA 3C15C 1COWA 4LHZA 3W3ZB 4RCYA 4MDFA 1YR8A 2H8KA 1KDRA 4X8HA 4DBLC 5TDHA 4QOSA 3U6BA 1OHHD 2WJHA 4UNSA 3ZQ6A 4ARZA 1NJGA 2ZJYA 1H65A 1XJ0A 1ZNWA 1TEVA 4GMXA 4KU4A 2FPLA 2O8FA 4DT1A 2VP0A 2F3RA 1OKKD 4QL3A 4Q4AB 1NSTA 1ESNA 4IDQA 2WOJA 2WIAA 4NHOA 4JKIA 4B3GA 2HT6A 4AWXA 3B85A 2RH5A 4TZ6A 2ZIAA 4XVQA 5EP2A 2AWOA 5IK2D 1FMLA 2QQ0A 5CB6A 2BJWA 2XEXA 2CLSA 2CK3D 1DAGA 2P6UA 2YOFA 1VHLA 5KYKA 1NIJA 2HLDD 1KI2A 5B30A 1GFIA 1W0KA 1HYQA 3HR7A 3SQXA 2YV5A 2I3BA 1FPMA 4GOJA 4WOPA 4DWJA 4LV6A 1CR1A 1XZPA 5JMTA 4G01B 4PZLA 1W36C 5BQ5A 3QSYA 1ZU4A 4JLKA 5E7IA 1IY2A 3GLHE 1KDOA 1R0WA 1VYVA 5EE9A 5BN4A 1RC8A 3FVQA 3WP0A 5BN5A 4DSOA 2IYSA 4XWKA 4Q1FA 5IF9A 1NNEA 4DCTA 1LTQA 3CNOA 4Q4JB 4BZXA 2QAGB 4TLEA 3IGFA 4BRWA 3HYTA 2VF7A 1QZXA 3ZD7A 1E1RD 2GF0A 3W3AA 4Q7KA 5CYPA 2RGBA 3GEEA 1OXUA 1MO3A 1ZC3A 4PC1A 3KQLA 3C8UA 1IXZA 3SR0A 3TAUA 3QPVA 3TNFA 3MCAA 4IVPA 2IHYA 2WVJA 4EJSC 2VIIA 1W36D 4MUBA 2CNWD 3IHLA 2B21A 1T6NA 4A0RA 3IEVA 1W2GA 4Q4JA 3OEHA 4DIEA 2P67A 1Q1QA 3B7GA 1JR3E 1ZW6A 2OCBA 2WJIA 1CR4A 3RS5A 2J0QA 4TZ0A 2PMKA 4BFZA 1T3HA 4N0DA 1BO6A 4L16A 1YVDA 1G8HA 2G3YA 2IS6A 1NI3A 2ORWA 1Z47A 3B5JA 3GJ0A 3KKMA 4GT1A 5FTJA 5B57C 2FSIA 1R5OA 4KFSA 1E2PA 3K9HA 4W5HA 3ICQB 1KO7A 3UKDA 4ZKEA 3ZZ0A 5HR5A 4GFDA 4M1YA 2FG5A 4UJ3A 2QRZA 3BAFA 3I8XA 4CEJB 1II8B 1YR6A 1W5SA 4O2LA 4IRUB 521PA 1KO8A 2FGKA 2ZR9A 5FPYA 1GP2A 4WW0A 5SZJA 3TW8B 1G6HA 4XTCS 4ZKDA 1F2UB 3A37A 5FBWB 1DTSA 1CP2A 4TMKA 2KBFA 5AUNB 1P4SA 1WDTA 4JYBA 1J2JA 1WA5A 1NKTA 4G5GA 3T1OA 3SS8A 1HH4A 2UZIR 1GL6A 4LHYA 4GRAA 1II8A 2QT1A 2VTKA 4GP7A 4LYHA 1KJZA 1G4AE 3QG1A 4HDOB 5LD2C 3T61A 1JAHA 4HEJA 4Q9IA 4OI2A 3SBEA 3IO3A 4DLTA 4Q1BA 2VSXA 4QM7A 1Q3HA 1NLZA 2EVWX 1TEXA 2UKDA 1F2UA 2WZQA 2NO7A 2IBMA 2QAJA 4HZIA 3LY5A 4NCNA 3QKTA 4YLGA 4ZDWA 2ODNA 3X1WA 3GJ8A 3UMSA 1WRBA 2QE7D 2G88A 3OE7D 1Z0FA 4NCJA 3RWOA 1RRGA 4O0MA 4EAQA 2OCAA 4HB3A 4G0NA 2XNDD 2BIFA 3ZS8A 2WKPA 3DZDA 2YOHA 3KL4A 2RB4A 1M7GA 3GLIB 4I1OA 4IOLA 1AJEA 5CM8B 2HXSA 3U7FB 2YINC 4XVRA 2C96A 3QXXA 4KODA 3WMFA 2QPOA 2NO0A 2RGXA 4JBYA 1XMVA 4UQOA 1NF3A 1Z2CA 2CE2X 2D62A 1D9XA 3K1JA 1OPXA 3CW2A 2FWRA 4C0JA 1CJTC 1Q3TA 1P3JA 2JJ2D 2H7VA 1EFTA 2DYKA 1OH5A 2VBCA 1Z07A 1Z28A 5A5GA 3GCGA 1XCGB 4JKYA 4HDQB 5DHFA 3W9YA 2FMXA 3QBVA 4RD2A 3MGCA 1E9EA 5H1YA 3VFDA 4UNRA 3C16C 2W0SA 3VQTA 3CBQA 5K8UA 5KPJA 3B13B 1OV4A 2JAQA 1D2MA 2GJ8A 1A4RA 2WIBA 3T1TA 2UZ3A 2GCOB 3PIRA 3AP3A 5FUYA 3EA5A 2W0MA 3I4LA 4PAQA 1E9BA 2GK6A 5AJWA 1J7KA 4HB4A 3KKOA 4ERNA 3ADCA 3F5FA 1JXMA 4TMWA 2J0VA 5L3QB 3QKSB 4PC6A 3K53A 4HAWA 3VU9A 1S3SA 5H8WA 1RRFA 2G83A 2PEYA 3AEZA 3M4YA 3QVUA 1IN5A 1AKYA 4ZDJA 2W83A 4LYFA 1LF5A 1I4TD 4E09A 5D3MA 4OBEA 3I8SA 3PQCA 1SQ5A 1Z83A 2LCFA 2ZJ5A 4HAVA 1CR2A 3VKGA 3TVTA 4HAZA 3NC0C 2HCJB 2F6RA 4EPRA 4BQSA 5D3QA 2ZS8A 1MABA 1K6MA 3CX6A 1XEWX 2HJVA 2ATVA 4B74A 2H92A 2CL6X 2XZLA 1Z29A 2RGEA 1GNPA 2KB0A 3KJEA 1CKEA 1XBTA 3MAAC 4V0LA 3DOEA 4QNMA 5KSPA 2IS2A 1A5TA 4NP6A 3OEEA 4QGAA 1YRAA 2CMKA 4WA7A 2J7PA 2R62A 2YWGA 4IOJA 4A15A 1G8YA 3U3KA 1E2LA 1JI0A 1U0LA 4TLCA 4UJ5A 2ZRFA 2OBLA 2OSBA 2ZI4A 4BLPA 3T06B 1OJLA 1OFIA 4ZPXA 4RD4A 1DAMA 1KAGA 4JL6A 4DJTA 3PJRA 2V3CC 2W2VA 4JLDA 3H2YA 3M6AA 1FTSA 1OFHA 3QUSA 4IFBA 2Z0MA 1U0HC 4C0BA 2Z6VA 4A92A 4PQYA 2CXXA 5GJVC 4XWOA 3UPUA 1DAKA 4N1AA 2ZU0C 4LK2A 3PITA 3BB1A 3VHXA 5TY0A 1P9WA 1ESMA 5IDVA 2XXAB 2XZOA 3H86A 2GCPA 4AG5A 3N2IA 1NY6A 4RKEA 2AKYA 4LHVA 4Q66C 1JXOA 1R10A 3B6EA 4EPWA 3QF4B 3L43A 4OKSA 3CRMA 3OZXA 3CPEA 4PZYA 3BC1A 1M34E 1AGPA 4RCZA 4XH9B 1OH8A 2REBA 2CHQA 1U98A 1VG8A 4TLAA 2ZVPX 5EP1A 2QG6A 3FMFA 1AIPA 2ODEA 4Y0AA 2O8BB 3FMPB 1FP6A 4QBHA 4URWR 3W34A 4BZQA 2XXAA 3BH7A 1O87A 3U61B 3A1SA 3ZLJA 1YZQA 1S4QA 3S1AA 2WWYA 1OHHA 4M9ZA 1RIFA 4RZ3A 4EPVA 721PA 2ZI5A 3VX4A 1UEJA 3QF4A 4WZ6A 4I99A 3RABA 2OM2A 4URZR 1GTVA 3TKLA 1RKBA 2F1HA 3TJZA 2IT1A 2BMEA 5HKKA 4W5WA 1Z0AA 3LO5A 2JJ1D 4MRNA 5GJBA 1MH1A 3THXA 4BFSA 1TQDA 1N0WA 3AP2A 1OT3A 2IXGA 3KKNA 2RGNA 4M53A 3CRW1 2DBYA 3SYNA 2CK3A 1XX6A 2IF0A 4RKFA 2ZAOA 1W0JD 3VR4A 2ZUCA 2DWOA 2HLDA 1ODFA 3FFBA 4II7A 8OHMA 4RFVA 5JJKA 1P75A 2PX3A 3LQQA 3MWYW 4Q03A 5FL7D 3EWAA 1JR6A 3WYFA 3G0HA 4GDFA 1Q1ZA 4PFSA 2ZUDA 4PSKA 1YU9A 2GTPA 5F9FA 1DAFA 3V4RA 3T12A 1NVWQ 2A2ZA 2IA5A 4HUQB 4Q1DA 1HQCA 2QAGC 2PT5A 3K0FA 1KY2A 5DGXA 4UKDA 4RD1A 4AKIA 5EQTA 4YMTA 2Q3HA 4O3MA 2BDTA 3T15A 1E0JA 1WQ1R 1Z6GA 3VR3A 5ELXA 3ADDA 1P61B 1KZGB 4G1UC 3EPHA 2G0NA 4DCSA 2ZQ5A 3G5UA 2QENA 4D6PA 2OAQ1 1E1RA 2WICA 3W5JA 1PZNA 1X6VA 3GLIE 3T34A 1SKYB 3RC3A 4E22A 1IXSB 1OYWA 4HUQA 5JEDA 1U99A 4OQXA 1LW7A 5J47A 4HDCA 3MD0A 1F6BA 1LY1A 3A4MA 2GAAA 1IHUA 1S9HA 1JBKA 3E70C 1XTIA 1SZPA 3R9WA 2VL7A 3PR1A 1IN8A 4UNNA 1YHNA 1E1QD 3C5CA 2ZJ8A 3EIHA 2ZVQX 2FSHA 4JJZA 1JECA 2PJRA 2BM1A 2EFDB 4JIMA 4D4KA 2CVHA 2QP4A 3BD9A 4FMBB 3SJAA 1CLUA 4P31A 2QTHA 4JLVA 2HYDA 2OE2A 4QGHA 5EXPA 2ZAMA 1S1MA 1IXRC 1WF3A 1Z0DA 5EZ5A 4H1UA 1QRAA 2UVQA 4PX9A 2DFNA 1KSGA 1QHXA 1J70A 1T0JB 2GJKA 3EWSA 2Z4SA 2P6NA 4TMXA 3Q7PA 1GOTA 1IOZA 4I1UA 5FR2A 3I32A 4B35A 5DE3A 4EJSA 1SKQA 4DLVA 4CRWB 1V43A 5JJLA 4V0OA 1B23P 2V9PA 4NYIR 2RGAA 1UKEA 3CLVA 2VHCA 2JLVA 1L7VC 2EFHB 3IIJA 4AIIA 1E98A 4IOKA 3HU1A 2OILA 3LD9A 1TADA 2GEVA 4KSCA 5TB5A 1YKSA 5KHOC 1IY1A 1JEEA 2D2FA 3VNUA 2OCYC 1YZKA 4AURA 1GITA 3VKWA 1TQ2A 3CF0A 1U94A 4K46A 2F1IA 3ASYA 1IY0A 2VHQA 2H17A 3EX7C 1A82A 2IYYA 2QM7A 3A58B 2CCGA 2VHJA 3WY9A 5A4JA 4P4SB 1IAQA 1AM4D 2YWEA 2Q21A 3EIEA 3HPRA 2EU8A 4DSUA 5JI3E 2HYIC 1EX7A 2JLQA 2QE7A 2ZRHA 1KI6B 3B1VA 3OE7A 4TL8A 1XZQA 3CNLA 2OV2A 4O25A 1ZM2A 3TSZA 2XNDA 5KNCA 3P4XA 1MR3F 4C4PA 3PVSA 1TPZA 4FWTA 3PEWA 4TLDA 3O47A 1EX6A 3K9LA 1X8KA 3ADKA 4ZDIA 5BW8A 2Z43A 4EUNA 1HY3A 1GNQA 3PG5A 4WZBE 1VCNA 4ZO4A 1AS0A 4M1SA 4DLSA 4M1KA 3U3MA 3TK1A 2VRWA 1OFTA 5CLQA 4RFSB 5KOYA 2FZLA 3WRXC 2ZRAA 4IDHA 2PEZA 3FPAA 4DCNA 4M0LA 1G7TA 2ODBA 3T5GA 4D0GA 5AJZA 5H68A 4BUJA 2ZYTX 4DUGD 2ECKA 2LKDA 3NEJA 2RHMA 1R8SA 2A5DA 2CCKA 3R20A 4NYIQ 4WXPA 3GJ3A 5FR1A 3CX7A 2QP3A 3B9QA 4GZLA 2O0KA 5AUOB 3IQWA 1E2EA 1VTKA 3EASA 3DDCA 1GRRA 2R44A 3BIFA 3BS4A 3L82B 3IIKA 2EFEB 2ERXA 2A30A 2ERYA 4TQ9A 4NBSA 1JR3A 1DS6A 3E5HA 1TNDA 3L0OA 2NPFA 3KTAB 1E2MA 1KHTA 5FH9A 4EDHA 4BLSA 2WV9A 3L8YA 1KK3A 1ZM4A 1ZVQA 4BFXA 5FPHA 2HXYA 2P2LA 4MITA 2C9OA 4IEIA 3TIFA 3UG7A 1Z22A 2FPKA 2V55B 3GJXC 4A2WA 4F7WA 3AVOA 4OHVA 1XEFA 1EFCA 4AKHA 4US0R 2QUZA 4RZUA 1ZUIA 2YHSA 3QPWA 1G291 2EFCB 1XNJA 4TL6A 2FU5C 3MG9A 4Q21A 2PBRA 2O5VA 1KSJA 5KDOA 1YQTA 1Q21A 2XB4A 1G3IA 2ZR0A 3BERA 4P33A 5CK4A 3OEED 5G40A 2ZSDA 2J7PD 4PHFA 3BWDD 4MQBA 4PO9A 3ZH9B 1FZQA 2BMJA 4Z54A 2GZHA 1QHHA 5FUWA 4BEBA 2G0TA 1N25A 2XZPA 4DIDA 1MKYA 2ONJA 4D26A 4C0KA 1Z0JA 2SHKA 5JHGB 4U02A 3C41J 3VMFA 2R8RA 1Z2AA 3EZ9A 4BWYA 5EUMA 4YONB 4A8JB 1SVIA 4FIDA 5GJWC 3A8TA 5BXQC 2CLDX 1G6OA 1HE1C 4D25A 2WPDD 3AB3A 2QU8A 2BCGY 1JEDA 4HAYA 1SGWA 5K8IA 2H18A 2C5LA 4Q00A 3TMKA 5C18A 4IOMA 1U0JA 1XMIA 1Q1BA 3BB3A 1I4LD 4P3YA 3SEAA 5CITA 5GVRA 5HCNA 2HT1A 1F2TB 2NTYC 2WOOA 5ANRB 3QF7A 2F3TA 3L2OB 4KVGA 2ZE5A 4XVUA 4DSNA 2ZRBA 4KITB 2XTMA 1R4AA 3AKCA 1OFUX 5K8TA 1G20E 1F48A 2NZ8A 3RSLA 2A3RA 1MRNA 4KO8A 3FGNA 1E0KA 4QGFA 1UPTA 4NPHA 4ZV4A 4MYHA 2IF2A 1FUUA 3H4MA 3RWMB 1KK0A 3NVAA 1JAIA 2ANCA 1DG3A 1R2QA 1SKYE 4B2PA 3FB4A 2WM9B 4C2TA 1KZ7B 2D2EA 3U2QA 2QMUA 3ND9A 4TT3A 3I62A 2WMOB 3IBYA 2JDIA 4JZKA 2XTZA 2RCNA 4LDJA 2J45A 1GZSA 3D3QA 2HEIA 1VCIA 1X1SA 4BFTA 4L15A 5SZIA 5AJXA 4B43A 5J4LA 2NO9A 4IVQA 1KI7A 3CPJB 4MGKR 3ZD6A 1EESA 4PXAA 1GL9B 3CKLA 4DDTA 5EE3A 3QOFA 1WMSA 4JLBA 2JGNA 3SFZA 4EKDA 2J0SA 1X8JA 1E9SA 1XTSA 4JVMA 2W6JD 4LJ8A 2F9LA 3CWQA 4CDGA 5JECA 2PJZA 2JJ1A 2V7QA 4OI0A 2ZRJA 4NONA 5L3SB 2WBLC 4PC3A 3B2EA 1P2VA 3P27A 2KI5A 1KYIA 1SVLA 2OLKA 4EFMA 1PV4A 2QZ4A 4LPKA 1RVDA 3HWSA 1E94E 3MLEA 1W0JA 2ZJBA 3IDQA 3B9PA 4Q9JA 1AA9A 4FN5A 3LLUA 1PLJA 4JLOA 2PZFA 1G41A 1E9CA 1UKVY 3A1UA 2J9RA 4I4LA 4IEEA 2ZE6A 3UWKA 3ZS9A 5FL7A 4NZYA 4Q4AA 4BFVA 5KU1A 4P4UA 2YNMA 2AD1A 4M2LA 4JYCA 3RS4A 2B7BA 4A36A 3A4LA 5FBVB 3GLFB 3MJHA 4PPGA 1S0UA 2ZREA 4OHZA 4FXPA 4N0EA 5EXXA 5BYJA 3BFVA 4LJ5A 2DPXA 3THYB 3FHCB 3JVUA 5BN3A 4JLAA 1CEEA 2RAPA 4NL4H 4MYUA 4M1TA 1CJUC 1ELOA 3MWJA 1JALA 4GPTA 2VP2A 4KFRA 4YMWA 3VR1A 2ZE8A 4BECA 3EXAA 3I61A 3BFKA 4G5QA 3AKEA 2V1UA 3PXGA 2FFQA 3AUYA 1BMFD 5EE5B 2PX0A 5CB8A 1OXVA 4JT4A 2F43B 2WWFA 4YDSA 4ESVA 2J1LA 2E9SA 2XJ4A 3QE0A 1A2BA 1V5WA 3KQKA 2C8VA 4HI0E 1ZIPA 4ZI2A 2GEUA 4H9GA 1AS2A 2BBOA 4OL0A 3JZAA 4JBWA 1WBDA 2QAGA 1HA3A 1E1QA 2G1KA 5KO2A 2C77A 1I4DD 1N5LA 3NC1C 3SYLA 2ZRDA 4LWZA 2XX3A 3CRRA 2WWGA 1AKEA 3W8RA 1GL7A 1KK1A 2ZJOA 2IEZA 4PSVA 2FEOA 2DFTA 1IBRA 5B64A 3DMDA 5EJEA 2FOLA 3PUXA 1QBKC 1G3RA 1DAEA 3I72A 2GETA 6Q21A 2XOKA 3EPJA 3PFIA 4BGDA 2OCPA 3CNNA 1JQJC 2GHIA 4Q9LA 1ZCBA 1SVMA 1GNRA 4R9UC 2OESA 4HYYA 4OK5A 2P5SA 1T8TA 1Z5ZA 5C4GB 3KB1A 4EPTA 4F91B 2W6IA 4JSYA 1XTRA 1CXZA 1XXHB 1JPJA 3CONA 2VP4A 3KXLA 3TUZC 3KJIA 4URXR 1A1VA 1UFQA 5CDFE 2GRJA 3EZ6A 2AX4A 2ATXA 2ORIA 3QJYA 4MGYR 2ZEJA 4DLXA 3NH6A 2RGCA 2JEOA 3K9GA 4JLNA 1UAAA 2FX3A 4K81B 2QGZA 4B34A 5FOVA 4QM6A 4NCIA 1P9NA 4B2LA 1P5ZB 1W2HA 3LW8A 5FPSA 3MUFA 1UBFA 2VSFA 1XPUA 1W4CA 4CEJA 1KO5A 1M1YE 4MRPA 4ABYA 3PENA 4KYUA 5JRZA 3LBIA 3KUDA 1YZTA 2VP5A 2ZYWX 5JHHB 5C4MA 4QJ3A 3VKHA 1DO0A 1NVVR 2AXNA 1JQLB 3BFXA 1IN4A 1G7CA 2G1JA 1XTJA 1T8UA 3P26A 1G7RA 3RS7A 2RGDA 2YC4C 2NGRA 2OBNA 3K8YA 4AD8A 4Q7MB 3Q72A 3KB2A 4V0KA 2H5EA 2O0JA 3SJZA 3TQCA 1KY3A 2R6GA 2AN9A 3LRPA 1G1MA 1HE8B 3NH9A 3EPLA 2DFLA 1ZC4A 3UK6A 2ORVA 2OUKA 4ZIRB 2MSEB 1ZCAA 4DRZA 2ZYUX 3K0AB 1E9DA 2BM0A 3CH5A 4S35A 2G77B 1DELA 2H57A 4LSGA 2HV8A 2FJUA 2IUUA 5DSZA 5LBIA 3THWB 4DEYA 4O2RA 3L0PA 1DARA 4QXAA 3WNDA 1US8B 4JBXA 4Q19A 3CR7A 5F3WB 2EYQA 1UF9A 3NIBA 4I81A 4QHYA 3GLIA 2J41A 2QN6A 1N2CE 2PCLA 4GI7A 4HZUB 4DUGA 1KMHB 4XOIA 3SI7A 1G21E 3OAAA 4ZIRA 2AR7A 5KNDA 5HZKA 3U4QB 5G53C 3EC2A 1YR9A 1E2DA 2C03A 4G3XA 1JR3D 3R8FA 5H70A 2DCUA 2QQEA 1EFHA 1EG7A 4LHWA 1CS4C 2J7KA 4M1WA 4BEJA 2I4IA 3F8TA 4YXWA 1KAOA 5J5CA 2CJWB 1NG9A 3M1IA 3PUWA 4K8OA 1UDWA 3KZ1E 4A2QA 3AM1A 2PLFA 1G8GA 1NVVQ 1UDXA 3FMOB 3RVBA 5CJPA 4BFYA 1N5IA 3IPXA 1KMHA 5L3RA 2F1RA 4NTZA 3DZ8A 4LX0A 5E95A 2GCOA 2WHXA 1E3MA 2EWWA 3DM5A 3U3OA 3SC3A 3K9NA 1L4YA 1LFDB 1P72A 2A78A 2REOA 3LDAA 4L9WA 5KTYA 5L3QA 3EZFA 4Q1CA 3QKSA 4MUAA 4CEIB 2CJWA 5BYKA 1E2IA 2D7CA 1E79A 4HB0A 1OXXK 1F3OA 1VDZA 3TR5A 4IXMA 4N3NA 1VECA 2CL0X 2W58A 3A6PC 1XPRA 1KOFA 4LHXA 1LVGA 2CVFA 4LC0A 3LX8A 4A8JC 1KI8A 1S1CA 5E3HA 1N0UA 4M1OA 5F9HA 2P6RA 3CR8A 3FHOA 2OZEA 4L9SA 1TTTA 2GESA 3EA0A 4TYWA 1UBCA 3X1DA 2FV8A 1IJFA 2ZUBA 1L4UA 4Q18A 4F38A 2X1VA 2IYQA 3NTUA 2OXRA 1VHTA 2WPDA 4AKEA 3EAQA 4XIGS 4MA4A 1KJWA 2KSQA 2ODWA 2AWNA 1UKZA 1Z6YA 1KDTA 1XEXB 2NOAA 4NE2A 1KO1A 2YJTD 4R2HA 3U7EB 1TU3A 1EFUA 1ANKA 1XJCA 2CDNA 2K5UA 3GJ7A 1OH7A 1QG4A 4LBWA 4B3DA 1P2UA 2YYZA 1G3MA 2GCNA 1NMXA 2WWWA 1DEKA 1VCMA 2NO6A 2ZRCA 1U8ZA 3K0EA 3IIMA 4M21A 1E96A 5HPYB 1Y63A 4B3BA 1QHIA 2WAYA 1ZNZA 4EIWA 4F4JA 1X1RA 2V1XA 3WMEA 2N1BA 1XEXA 2FH5B 2FDCA 4TT3D 2GZDA 4OHWA 3BJIC 1B0UA 1VKJA 2JDID 4DSTA 2J46A 3QG5A 1G4UR 3TVDA 1N0VC 4V0MA 1Z6AA 3OIWA 4KVAA 4CT4B 1JPNA 1QF9A 3QBTA 4MYCA 1ZNYA 5A0FA 4B33A 5C2JB 4KLZA 1E2GA 3ZJYA 1G9XA 2WKQA 4D2IA 4OHYA 1R0XA 3CRQA 4TTQA 4FMCB 3GFPA 2FZ4A 2R9VA 5FI0B 4RSGA 3L0IB 3U7HB 1E2HA 2F7SA 2W6JA 4JLJA 2V7QD 3U5ZB 2O8BA 2GDJA 5AK0A 1G16A 4I1SA 3H84A 2A5YB 1LF0A 4DC9A 1HV8A 1CRPA 1XTKA 2P0EA 4M8NE 3K0SA 3QEOA 2ZXUA 1XXHE 1SVOA 3TSWA 2FNAA 4BZPA 1KI3A 3EPKA 4B32A 1OB2A 3GLGB 5KSYA 3GEHA 3DO6A 3Q5DA 1NKSA 1GM5A 3VNVA 3FOZA 1W5TA 3A1TA 3U3JA 5GADl 1E0AA 1A2KC 1VG9B 1NMZA 4DKXA 1W7AA 1AN0A 4Q9KA 1D2EA 3KQHA 3J81k 4NMMA 4QFMA 3W6NA 3P32A 2PLRA 3LQRA 2QT0A 2IYUA 4CT5A 1JNYA 3LBHA 1VG0B 1NRJB 2BVNA 2I1VB 4C3ZA 2KE5A 2A5GA 1D5CA 1KSFX 1Q1EA 2GVDC 5FL3A 1P2TA 2P3SA 1T0HB 3MWLA 2XGJA 3NDPA 1H8HA 1ZP6A 4A0FA 1PLKA 1WCV1 3BGWA 1OIXA 4TSFD 2GA8A 5GJCA 4A2PA 3F0TA 3VR6A 1YZLA 1NN5A 1NLYA 4XSHA 5AWFC 2GVZC 1VYUA 1BMFA 2FGJA 4HSEA 3SJBA 4F4IA 4DEXA 1MV5A 3UANA 2Q9BA 3REFA 2QEQA 1N6NA 4JLPA 3Q5EA 4HAUA 1KI9A 1FL9A 1ZD9A 1XD2B 3DHWC 3K09C 4LOAA 3T35A 3AH8A 4ZCIA 4NYMR 2OFXA 3DOFA 4B73A 3L0SA 4AYWA 1E9RA 1YE8A 2VYFA 2YOGA 3KUCA 4ILEA 1GWNA 4CIDA 2ZS7A 2OEPA 1L2TA 2N42A 4OI1A 3HPQA 1Y3AA 1NBME 4I1VA 1P6XA 1X3SA 1L8QA 2D74A 4US1R 5EZ6B 2C04A 2BCJQ 2EFGA 1EWRA 2Z5FA 2ZANA 2XOKD 2ZI3A 2IXEA 4PANA 4D0LB 4BPBA 4KXFB 3KXKA 4NDZA 3A1WA 2ZJ2A 4ON9A 1PUIA 4LJ4A 1E6CA 3TLXA 5HZHA 4WZAE 2W6ID 2IWHA 3I5XA 3SHFA 3ZDQA 4LCBA 1DOAA 2ZSFA 1A7JA 3IKJA 1YZGA 4OYHA 1E4VA 2Q3FA 4HUTA 1TF5A 1OYYA 1SXJB 2PMDA 2IYTA 3WMGA 4BE7B 4CZ2A 1W4AA 1G19A 2GILA 2W2XA 3TUJC 4B71A 5M04A 5AUPB 2OHFA 121PA 1YRBA 4FW9A 3R7WB 3QXSA 3REGA 5L8VA 2MMGA 2FE4A 1R7RA 3OIUA 4LPSA 2BBSA 1R8QA 4LV8B 1PJRA 1N6PA 3GD7A 1DAHA 3AV0B 1YR7A 2AFIE 4LV5B 4PHGA 4CEHB 5F2EA 2DY1A 3AGQA 3MJRA 4S2EA 3ZVMA 1LS1A 5TVKA 4RD3A 2WJYA 2WSMA 4QHSA 4CYMA 1Q0UA 3NKVA 4B3FX 4GL2A 2GXQA 5CK5A 4U7DA 1SXJA 4ACAA 3RC8A 3AVWA 4HAXA 2DWPA 4B6EA 5JJIA 1FX0B 2QP9X 5SZHB 1ZNXA 4LJYA 4NYMQ 4WVFA 2NPIA 2ZYVX 1G5PA 4QBFA 1N6IA 4OQFA 1J99A 4EPYA 1N5KA 3LNCA 3KJHA 2QTFA 2Q3MA 1P60A 3BE4A 3BXZA 3RAPR 1CJMA 2BC9A 1ZIOA 4A6XA 1QVAA 1XD9A 3MRSA 3RRYA 1OE0A 1TX4B 2C2HA 2GEDA 4KFTA 2D7DA 1EGAA 3MWKA 3RNLA 1G64A 2X77A 5IT5A 5LD2B 3V9PA 4C7OB 4P4SA 4ZDKA 4RZXA 2BBTA 4TMZA 4MH0R 4PC7A 1KI6A 2Z83A 1IM2A 4JVSB 3ADBA 1J90A 1U2RA 1O3YA 1IONA 4PO1A 5FOSA 4Q7JB 1R6BX 2QMHA 2IX3A 2GZAA 2QPAA 1HT2E 1ZBDA 4C2UA 2I1QA 4AY2A 2BMFA 4OJKA 4LYAA 2IL1A 3OAAD 4Q1EA 4RVCA 2JATA 4V0ME 4JMPA 1S9DA 3NHBA 1GSIA 4EQ6B 3RS3A 5J4YA 3K0CC 3LWNA 5FPTA 1E32A 3DMNA 4C30A 1KNQA 3ECCA 3SBDA 4RD6A 1TMKA 1ZM7A 3GPLA 4PAMA 3CWZA 4RFSA 3B1ZA 4OK6A 2RHDA 4FMCF 4Q4HB 4YXWD 2DR3A 5DNYB 2ZJZA 2PZEA 1T3LA 2WMNB 2RKOA 5AR1A 4AYTA 1N6LA 1Q20A 1NBMD 3AGPA 2J3EA 1NL3A 4W9MC 2O8CB 4LBZA 2FFBA 4KYIB 4URYR 2QTVB 1ZD8A 2QORA 2PH1A 4L4UA 5FTNA 4W7SA 2NIPA 2XAUA 2CBZA 4FCVA 1E2FA 2NG1A 4WIAA 4PQRA 2CHVA 2CLCX 4EQ6A 2R2AA 1CBUA 4FD2A 4NCKA 4C0AC 3HP1A 5FBQB 2KWIA 2IUTA 4WAUA 5J4VA 3V00A 4YC7A 1D8TA 1BOFA 1W48A 1PLLA 1SVWA 2XTNA 3KTAA 5AUQA 5CDFA 2DFKB 3Q9LA 4QBIA 1E79D 4LJAA 5KDLA 2VSOA 1D6JA 2C98A 4TQUS 2ZRPA 4MKFA 4DLWA 4EPXA 3LX5A 2QSYA 2FA9A 5FTMA 2ASEA 1Z0KA 1S3GA 2OXCA 5P21A 4A4DA 4B3CA 4FWIB 4QJ5A 3AF2A 3NBZC 1ZJ6A 2OT3B 2V4ZA 4C0SA 2F55A 3GLGE 1OIWA 4XJXA 4C0QC 4Q02A 3B60A 1ZMXA 1QVRA 2R6FA 1ZM9A 3Q85A 3AVTA 3H1TA 4G5RA 4U5XA 2AD5A 3LVRE 4PSAA 5FOWA 4LZZA 5K8LA 2AKAB 2EWVA 2WAXA 2QRNA 2WJVA 2QBYB 2GJSA 4B2IA 1AZTA 4J0QA 4RZ2A 5B2ZA 1P2SA 3NXSA 3OHMA 2AK3A 4Q47A 1CRQA 4BFWA 221PA 1LS6A 1D2NA 3X1YA 3NDBB 3IHWA 3UWOA 1KMQA 3AVXA 2N46A 1VMAA 3WBJA 2IYLD 1G5RA 2D06A 2GAOA 5TMPA 4PO8A 3QKRB 1KKMA 3LV8A 3RRNA 4ACBA 1GKIA 4A8JA 2GWHA 4A82A
chains in the Genus database with same CATH superfamily
1PG2A 1MOPA 3E4DA 1LLDA 1O94A 4LJ7A 3FKJA 3BSWA 3HSYA 1PR4A 5FRDA 3O8CA 2J3MA 1JIXA 5GGXA 4RY0A 4LY3A 1NN1A 4IMPA 4AK9A 4UU8A 4EBFA 5BW6B 2FZ5A 3R8CA 4F0JA 5JLJA 2H2DA 1T6XA 2AN4A 1PBTA 4W8OA 4N41A 2E7ZA 5BWCA 1KR2A 3ZVRA 2UU9B 4JI4B 4QBGB 1T25A 1PTJC 3LS2A 4AZ3A 3OCYA 2JPDA 2B9VA 1AUOA 1CJBA 1M7HA 4MW4A 3PTZA 4ARZB 4QU5A 2JS7A 2IHKA 3HN7A 1U0RA 3PXEA 5FLKA 4AJJA 5A1TA 1GQ2A 4R9SA 2BOVA 5EKDA 2O0LA 3U3RA 4RHTA 5JAHA 4CKWA 1UC5B 4OHKA 3BH0A 5EE1A 3CLUC 3MWEB 4TTAA 5DI3B 4M0EA 5KC8A 5D7BA 3BRCA 2J0UB 2JANA 3SJCA 5K6TA 1KFJB 3GT0A 1GUBA 3M6XA 1RSZA 1TFRA 3KJFA 3LC7O 3NFYA 4DZRA 2BJVA 1L5LA 4AW9A 5AVKA 4HPWA 3GFOA 1DTEA 3ZV7A 1NF8A 1MMFB 1ZO8A 2B7CA 4M9QA 1N3BA 2X0RA 3TAXA 3OM8A 1QTQA 4FEAA 4R1UA 3NYRA 1CEEA 1QIDA 3GVPA 1L7MA 1N8NA 1Y80A 1KNXA 3DZGA 5CNKA 2OKGA 4E0BA 4FB4A 5IJ9A 3RSGA 3L1JA 2CNOA 1RACA 3NUQA 1R5NA 4ZV7A 4BNWA 4OPMA 2VLBA 1K5DA 2JAXA 3MQ2A 1ZAKA 2AEFA 5TT0A 4BGVA 3SQWA 4BMDA 1Q14A 3LBFA 3C5VA 3QU4A 3TAHA 3ETEA 1Z75A 1SD1A 2N3ZA 3L6OO 2ZM6B 3TTVA 3BVPA 1N7HA 4KXYA 2I6QA 2CLLB 4QO8A 5BN4B 1XCOA 3B1YA 3ZK8A 2DETA 2QL5A 1KO4A 2V8BA 3TPZA 2MR5A 1S89A 3V42A 2YICA 1DAIA 3KVNA 1M8PA 1OX4A 4FXOA 1O6FA 3GLSA 1EUZA 4LOKA 3KJZA 1V35A 4MPJA 4X8OA 2R6CA 1IB6A 4BRSA 1P7CA 4B3XA 4C06A 5AVTA 4IQGA 2JLRA 4ROTA 4HOYA 1L4FA 6REQA 1HKHA 3PUYA 4CCYA 5EMMA 1LRLA 1J8YF 2GM4A 2OP0A 5FWYB 2HMVA 4W82A 5CIQA 3I9KA 1OGJA 3DDHA 1RJDA 2IEYA 2ZBGA 1Y9EA 2Q5HA 2GA9A 3AKYA 3BAZA 3I6YA 4LMRA 2W00A 3DGEC 2GAJA 1KFKB 2WF8A 4B87A 4M9CA 4G09A 3F1KA 2HBQA 4KK4A 1V11A 1S2MA 2A5JA 3OTQA 1SQFA 4FHEA 3VR6D 1NG1A 3D7LA 3IV7A 5HWSA 3QFCA 3IQXA 2VATA 1EFVB 2JH3A 3G02A 3WGQA 2A3NA 4UNIA 4E7PA 3GG9A 2FWPA 3QQ5A 4Q9AA 2ZDGA 4RK5A 2VZ9A 4ZHQA 1FW6A 4B7CA 1BC5A 5JVDB 3PD0A 5C1OA 4KLAA 3TD6A 5CYFA 1DWPA 4CL8A 1DEOA 1X74A 1T43A 1UBRS 3A10A 2GN4A 5DB4A 2J3DA 3ZWYA 1QJCA 2HLPA 2CSUA 2CW5A 2BONA 4L07A 3W6UA 1L5SA 2JH8A 1AKVA 1OF1A 5HF5A 1MNAA 1DEHA 4YRMA 4E03A 4JEMA 4R1MA 4UHCA 3PJFA 1UWVA 4OXXA 2CCJA 1EVJA 1GRCA 4IJQA 3S2ZA 2GCIA 3A4TA 3O4IA 4KV9A 4XQEA 1JB9A 1POWA 3E7XA 5CH8A 3V1NA 3EUFA 4CN9A 1IBMB 2IE8A 4HTFA 4QDOA 2JRLA 1RXEA 5C0OE 2FK7A 2WT9A 4MS4B 4QU0A 4B6FA 1ACJA 1Y8QA 4YRNA 4FCWA 4KWIA 3GJRA 4C6TA 1TMOA 1DGQA 1FUKA 5CBPA 3V1LA 1DXOA 1GQSA 3A6ZA 3B1XA 2Y8EA 3I2KA 3OO0A 3BXOA 4E5DA 5DNWA 1T35A 4E31A 2R47A 4NH0A 4RACA 2QY9A 1GGJA 2G1AA 4ZYUA 2B0CA 5FWXB 3MLAA 5G41A 5H4HA 4A0HA 1WTCA 3CTPA 2A9KA 4GDMA 2HMAA 2GQ0A 3W5HA 2AEEA 2XNKA 4CMBA 1HDCA 4PTLA 3WWOA 3O8NA 2EARA 3ZWWA 3CLTD 3ZY4A 2OECA 4BATA 4IDBA 5FFFA 3I4CA 2BFBA 3WGMA 1WB9A 3KV1A 1MH9A 2G6BA 4D9JA 4M0UA 3LKZA 3KYIB 1C8LA 3M3DA 1XLUA 4BRZA 3KJGA 4IHKA 2WM3A 1GTRA 1QG0A 1U3FA 2I1WA 1KL7A 3OEWA 3RWBA 3S0JA 3W05A 4EQZA 3F4BA 4M6WB 3R3WA 4RY2A 1JFFB 3FTQA 1TLTA 1GEEA 2FSPA 1YUNA 4IIJA 4MUJA 4Q9DA 4CV3A 3IVRA 4CL2A 2DP4E 4EG7A 4KNWA 1PG0A 4J1TA 2C9BA 2HF8A 3G8BA 3PCRB 3PEVA 3U9SA 2DF8A 1RWXA 3AHFA 1WP9A 1KAEA 3QNUA 1NVXQ 1L1RA 4OFBA 1DMRA 1YI8A 1X87A 3ECSA 4DLUA 4MMXB 5AMXA 1DQZA 2E2WA 2ZRIA 3Q4GA 3JQQA 3GLVA 4RTQA 1XFAA 5G1NA 4B79A 1OH6A 1GDDA 4A6DA 4AKSA 3D8SA 5ICEA 3S81A 1K08A 2DHRA 2VHTA 5DFAA 5G4KB 4M86A 4H77A 4M0MA 1ODIA 2VDMB 1DWUA 4P3KA 1T1EA 2VNSA 3SSMA 3STWA 4S0ZA 3ZS9A 4A03A 2OG1A 3TGLA 1NBWB 3L8ZA 3VU8A 2FSVA 3D4PA 1U3TA 2QN7A 1AOXA 1NYQA 2FVXA 1JYSA 1TYCA 1Y4ZA 821PA 5DYNA 4K6CA 3PNPA 4O59O 5DISB 1NZFA 2FW8A 2JG3A 4GNKA 5HOQA 2GPAA 3CINA 5K3OA 2PSHA 3JZIA 2P3QA 4I8IA 4RVUA 3WGGA 2YWCA 1Z0IA 4PPFA 3EDCA 3RAFC 5CXUA 4KBGA 3AEXA 1U1IA 1J8VA 3FA2A 3WKAA 1BH2A 2PXHA 2QW1A 4HDSB 6GPBA 3SNHA 2VJBA 5B3AA 2YFQA 3ZI7A 4ILKA 1XFDA 3Q15C 3THRA 1X3LA 3M1YA 4EHHA 2XUIA 3DXZA 5HFAA 3F9RA 1YJ8A 2AV6A 4GX2A 4C29A 3P1JA 1UEXC 1ORRA 2MU1A 2RGWA 4KACA 3NIWA 3GXBA 4DG8A 4MA0A 1AX9A 1RJ9A 2Z6UA 2O8DA 1EAYA 5DYWA 2CXHA 4Z4IA 1DPFA 5KQGA 2R65A 3UCEA 1Z2NX 2C5AA 2P62A 1T5TA 5A0TA 2WNHA 3VU9B 3V7UA 1M7BA 3A04A 4Z1MA 4DF3A 1RE1A 2IRWA 4OHMA 3VVBA 2YZNA 4RD0A 1NLFA 4YCBA 3IILA 3QXJA 3RQIA 1BX3A 3EOZA 2PAAA 2VP9A 5JDIA 3IRUA 4KLNA 2GJ4A 3C74A 5I7OA 4OB6A 3TQFA 5KYXA 5DVZA 3R4CA 1CF2O 2B78A 4DMUB 1YB7A 3SICE 2Y0CA 2M6SA 3O4JA 1IQRA 5K3BA 1AKQA 1GTJ1 1JKXA 5H80A 3U4QA 4NWIA 3QI2A 3A28A 4KRGA 4MWCA 4DR6B 4N7RA 5I51A 1KQOA 1DXYA 1U8FO 3K6SB 2X8AA 5FLEX 2QLMA 1A95A 4LX8A 1X8LA 1TM1E 4U7GA 1W76A 4RHUA 3HTXA 2O5EA 1CUVA 5ILGA 3GR6A 2E6KA 3BGIA 1SUDA 5GM1A 5M5BA 3ESYA 3QPCA 4S1OA 2CV1A 2QX6A 2LKCA 5BUSA 2YV1A 3U7JA 4BTLA 2PGIA 1RZRD 1O57A 1JX6A 4F4UA 1LWOA 4ZYTA 1LI7A 1T36A 1Z12A 2BSAA 2YS6A 4RMJA 1MHTA 1DI0A 3JQFC 3GNSA 4MJLA 1BXKA 1AKNA 1LKZA 2CMFA 4OLJA 2GZ2A 2OD9A 2W2MA 1R0YA 4RGQA 3ZD8A 3RDPA 2AFIA 2ISQA 1QIKA 1IIBA 2YZGA 1A96A 3FY4A 1GCOA 4U00A 4WNAA 3DLHA 4CU5A 1P5JA 1XCPA 3DDZX 3KUXA 4KWHA 4D1YA 3DKPA 3MF4A 1J7JA 2PD6A 4OCZA 4CEIA 1FJ2A 4E07A 3DSRA 5KAMA 3SOZA 4AZ0A 1GQYA 2VBFA 4NJOA 1NT2A 3I6IA 1ODSA 4OQMA 4FT4A 2AG1A 2IK8A 1RDFA 2PMFA 3TCXB 1ZESA 3MT0A 5DHAA 4DNFA 1T2UA 2C0QA 3GDOA 3PPYA 1T10A 1MIOB 3JQPA 5AKLA 3LPNA 5TEWA 3ZHSA 1RPNA 1PP4A 2EAUA 4U2GA 2AXPA 5BWBA 5KNBH 4G9EA 2O8EA 1W4RA 4KOAA 2AEJA 4K9DA 4KRXA 3K70C 1DCFA 3OQVA 3FN4A 3PYMA 3IE2A 5HJ5A 1RHJA 3TQQA 1O94D 4ZN6A 3AW9A 3KO8A 3EZYA 4XWAA 1G8FA 1U8EA 1IOWA 2D0DA 4IV5A 4YMLA 1PK8A 5J2UA 1GKUB 3DULA 3FYSA 4U6NA 4BAGA 3P8ZA 1FTGA 4UAGA 3UC5A 1J21A 4GZ6A 1XRRA 3DEFA 3VR5A 3DYBA 3HBJA 3JALA 4BX9A 1C7QA 1FA9A 2G6TA 4ZZ3A 3GP8A 3ZWDA 2J87A 2O1XA 1E7SA 3HO8A 3OFNA 1N8TA 3QXCA 4YPOA 5AQ1A 3N5KA 4TVOA 1ZINA 3KDSE 4YJFA 1YAJA 3NANA 2BYTA 3DL0A 4ASUA 1PFYA 3KLBA 2B4KA 1WXDA 4OQNA 3S1AB 3TXXA 4BFUA 4UOZA 5KWSA 3KOMA 5ILOA 1A9XB 1TQHA 5LQAA 4GLOA 1KR5A 3JPYA 4KH1A 3C3PA 3FI0A 3OD1A 4NFSA 4P58A 1T1RA 3P9CA 3PI7A 1P5RA 3GHYA 3NLLA 4I6GA 3KTFA 4KQ1A 4ZC1A 2WJJA 4URVR 4JKOA 1DCMA 2R68A 4P92A 4AP6A 3F71A 3L06A 2JIQA 2HK7A 4UEKA 2JASA 2H1LA 2N1MA 2Z04A 4FDLA 4JROA 3T3DA 2WWVD 3B82A 3HACA 4NKRA 1TVKA 1K1EA 2O07A 1CF4A 3EGDB 1BXGB 4AI6A 1COWD 4RPJA 5F76A 1R0SA 3RJ5A 2GXSA 4PIVA 3FUTA 4YCNA 5ALVA 1C3EA 1WIWA 3GMSA 1BDIA 3HVUA 2XA2A 5F23A 2PVSA 4WBSA 4ARUA 2AHOA 1I6MA 3A4IA 3O4HA 4HNGA 5D51S 5HCIA 3ED5A 4XX0A 1RAGA 4J90A 1U8YA 4DVGA 3L84A 4YTEA 3T9BA 1Z3IX 2G4CA 3SQNA 1BN6A 1SOVA 3FDIA 1N0IA 2O1SA 1C9KA 1QFJA 5E7MA 1G8PA 3GPCA 4X8MA 4X9XA 5G3ZA 3SOPA 1OKKA 4B9EA 4M83A 4Q4LA 3M3HA 1IBKB 5IFLA 4UTXA 1KZ9A 5E7JA 2W48A 1B42A 3DAGA 2UYCA 1LV8A 1U4SA 3PQFA 4LJRA 1OQAA 4MIEA 1IOVA 1VBKA 4LJSA 1VYTA 2QJFA 2HLNA 4M22A 4C87A 5JYEA 1RRCA 3WNBA 4HV4A 5KYWA 3K0FB 5CDGA 1TVEA 2EYUA 2PGXA 2HV9A 3JYQA 1P73A 3EOAI 1D07A 2REQA 3Q8KA 3LAWA 4L08A 5AICA 3ER9A 1E92A 5K8JB 2BMVA 3PUVA 5LZ9A 2VCHA 5CJ2A 3WLRA 3ZWPA 3RS2A 1DKRA 2VRNA 4IBOA 4HGYA 2DWUA 3HN6A 3TH5A 4DCUA 4UE3S 2CHGA 2GBIA 4BJHB 1RYHA 2ACEA 3MNFA 1LNZA 3A36A 5T4BA 5KQMA 3OM0A 4MWDA 3I9LA 1JEJA 4PCLA 3L7IA 1U4OA 3A3KA 3P4YA 1UPAA 2GNOA 3I04A 2FPGB 5BNZA 2IHBA 5DI9A 2GXAA 1RU3A 2UUPA 5ALJA 4ZT3A 2ICAA 1KERA 3MTDA 5J3JA 1DKPA 3UICA 2ID4A 1O97C 2YQ5A 4DV7B 2VTDA 1OXMA 5LA6A 1MA0A 1PL0A 1TTHA 2EW8A 2W2PA 4M4SA 2GKSA 5EHQA 4CTKA 2PQ0A 1T3SA 2NV6A 2MSDB 2F48A 1HLFA 1IBLB 3WR5A 3KQNA 1CUXA 1JMYA 1AHIA 1SXHA 3B9BA 1UM8A 4U9HS 3WHKA 2PVPA 3F73A 1AU9A 4FMDF 3WA6A 1BJTA 1SZCA 4ITRC 4JIGA 4DMKA 2ZLBA 4U2BA 5KKAA 3JQGA 3P2IA 3FAZA 4QU9A 1PNTA 4PRKA 3KPWA 2DPMA 3DHEA 3JYLA 3X1ZA 1N4DA 1CPYA 3M83A 4CF5A 1E20A 3PQ3A 1XCBA 3SQLA 2FSFA 2HM7A 3ESQA 5E8RA 3ZYCA 2JLSA 1ZUWA 3DNPA 5FOXA 3FSJX 2HL6A 2QR2A 3OLVA 3P9YA 1XZCA 2IYXA 4XARA 4E5SA 3VKUA 3P2EA 2DPHA 2WYIA 3IQZA 1R4ZA 1RC1A 2V0NA 3H9CA 3WLAA 4ETNA 3HDQA 3ZVKA 4GP6A 2CNWA 2H1RA 3CM0A 2B2CA 2WV7A 2BT4A 4UCFA 5KC9A 4R31A 4UARA 5CDUA 2BFCB 2JFZA 1MW9X 4BN0A 5JSZB 3M49A 2ZUEA 2A9JA 4CNBA 4WV3A 1HZZC 1TMGE 1U9IA 2ZSIA 2EJWA 3UV7A 4ZJPA 1QTIA 1MGPA 2NZ2A 5I7HA 3LO8A 3LKVA 4WLOA 3KKQA 4EMUA 1TL7C 2OR3A 1R4MB 2DHEA 3RU2A 4X1KB 4FJ0A 4EJ6A 4G0MA 2X19A 3T95A 1Y3BE 3LUBA 4AS3A 2R8XA 1K6IA 5TQ2B 3QENA 3TPFA 3U44B 2BI4A 4MGZR 5FIUA 3TQTA 4GPBA 2PZGA 3OQPA 1O95C 1HQDA 4M0DA 2RE8A 2P75A 1MCZA 3SF8B 2ZBEA 3LW7A 2JL1A 3SEQA 5HF9A 3C45A 3LT2A 5HGXA 2WSBA 1KETA 4QFCA 3AF3A 5EXTA 1T5SA 3QFTA 4J49A 4B8WA 4W6QA 4BE4A 1JH9A 5B53A 1X9HA 4JC5A 1SXQA 3SDZA 5FUXA 1HUQA 4OAOA 2X0DA 1DUVG 3VTKA 1KI4A 1D0SA 3ABSB 2VXCA 2A7XA 2P9GA 3WS7A 1WDWB 3BOSA 1AMUA 1GA4A 4L73A 4BMVA 1R3DA 3MJVA 2O8VA 2HF9A 2WE8A 4KQHA 1AGRA 1T9BA 5CVCA 1R5BA 5DHUA 3AKDA 4BNHA 1NY5A 3LI2A 3R9XA 4TLLB 5KQSA 1QCYA 4EHIA 4GR9A 3I1JA 4MR7A 1J4AA 1G17A 4IILA 2QZ9A 2AIRA 3REOA 3N05A 2XY4A 1QCDA 4QHTA 4JVLA 5LYJB 5KYYB 2HTFA 1XWIA 2OO7A 2VO1A 1FFGA 3AF1A 3LUAA 3MGBA 3LQ4A 5FUVA 4UBLA 3SYRA 4GE3A 3GRAA 5JWHA 1U0EA 1CJKC 1R64A 4CEHA 3FOWA 2HDWA 2DRIA 5JWOA 2OQVA 1M6NA 2R60A 2CNDA 2PSFA 4KAXA 4TTPA 1W85B 4FB5A 1N5RA 4UPEA 2IP2A 2AFHE 2RAFA 4DMCA 3ZVNA 3MIIA 3AKZA 2AS0A 4RM2A 5KQRA 3QQPA 1AXRA 4D81A 1ADJA 3QVVA 3GLHA 3JVIA 4LRUA 2QRVA 3FFTA 3QX3A 3LA8A 4BGIA 1N9ZA 1QC5A 2HK6A 4RHEA 3HLTA 1XZHA 4D9CA 1MW8X 1XR3A 2ZK7A 4C0XA 3PV0A 3DWFA 2ZITA 4HC4A 5TS3A 3RVRA 1BYUA 3HNRA 3HSKA 3OLCX 4DLRA 3ZXXA 1ESCA 2GTHA 3WGOA 2YWFA 4N0PA 2IIPA 1BKYA 2HBZA 3MOSA 5J47A 4MUIA 1JB1A 4R2LA 4C7OA 5IH3A 3MT8A 4Z1MD 2XMZA 3M2TA 1RWPA 2GZ1A 3FNQA 3M9XA 5HVNA 1KH1A 3HJCA 1RYDA 4RUKA 1A9YA 3EVTA 4IIUA 1A88A 5JATA 4HNSA 1RJEA 4Y6RA 3NYWA 4GE0A 4U2DA 5E1OA 2H31A 5FI5A 4TYPA 3KX2A 4HFMA 4IEFB 1A8IA 3VDMA 1RXYA 2WFLA 4AZSA 1G1AA 2EF0A 1T8SA 4J2OA 2HMWA 3DKVA 4CR6A 1RWMA 4R3NA 3GRZA 1V3UA 1CUAA 1FJHA 3JSAA 3KFXA 4R1OA 2O59A 3PDHA 3RUHA 2ZYRA 3H83A 2L42A 2YXBA 4MWOA 2V7GA 5IAKA 1B8NA 5C8YB 1SULA 3CN7A 3HXMA 1V4NA 1JJIA 5AXAA 3H65A 5MGNA 5JNLA 5BT8A 1Z63A 4S24A 3BORA 4OQLA 1B1AA 1SUWA 1WZNA 4EKGA 2OCDA 2YKGA 1QHHB 2WF9A 1L7RA 4GLJA 4DY4A 4MHTA 4LFBB 4O2AA 4G67A 2BV3A 5ES3A 1K63A 1CUEA 2C7GA 3PF9A 3T9AA 2QMYA 1TRKA 4PPYA 5IUJC 1HMYA 4QRIA 1WZIA 2GD1O 4DQ0A 3DS8A 3VAYA 4N5MA 5IXSA 1I32A 2VP3A 3N5CA 3FPLA 3O9VA 5C37A 3AVVA 4F2DA 3HVHA 3OF3A 3DKIA 1T13A 3HP4A 1YS4A 3FLEA 4ENWA 4CFYA 5FCDA 4KCGA 1T9DA 3L0CA 1YA6A 1YU6A 1BHQ1 3IEUA 4XPIA 4YO7A 4D3FA 5HX7A 3WYAA 1X7HA 1GAJA 2I2DA 2CDRA 1XDDA 3ZHRA 2DB3A 1TZJA 1TIPA 1ZGHA 2IH5A 1TD1A 1ZVMA 5DBFA 2JEYA 4DG9A 5G0WA 1K8ZB 4YLYA 2R00C 1WV0A 3M6UA 4G4SP 4XR9A 4HLDA 5KWIA 4RHXA 3T7IA 2QHXA 1SA0A 1XL0A 4TN1A 3I1FA 4KWCA 2JA2A 4TROA 1Z7GA 1K5HA 1OU4A 1J6UA 1MAAA 3TR0A 4XB2A 1KJ8A 3ICCA 3ZHYA 2PO5A 2RKWA 3HJTA 1Q0SA 5LB2A 3T1VA 1IJEA 1UOPA 5CCDA 3SE0A 3LIPA 3MT7A 4XLLA 3Q0EA 2C5GA 4J16A 4RIIA 4GW3A 4JWTA 1JA1A 5AKHA 2C5EA 2I2BA 3B3GA 4YJDA 5AHOA 4EG4A 5EHXA 3OFND 1SVKA 5DH9A 3UW3A 3UMFA 4U8GA 5JCZA 4EUFA 2G82A 5IRCD 2QF7A 4EAAA 1I4EB 5AI0A 1DWOA 1CDEA 2ZIGA 1GN9A 4HRYA 4C0LA 1VRVA 5LKRA 4TM8A 3GZJA 3TCKA 3PDUA 1YJBA 5DSXA 3ZQ4A 2DBRA 3ZXSA 4KE9A 3QJ5A 3SYTA 1YR2A 4UDOA 2Q7DA 2Z9CA 2V6JA 3UJ3X 2X4DA 3AETB 3IUPA 3KNZA 2RGNC 3ZCRA 1NW7A 2IPNA 4ALNA 4TKZA 1KS9A 1E5QA 1K3UB 1YZNA 2FVYA 3LXXA 3ONEA 4OHRA 5JS7A 3COJA 1RC0A 4B6JA 1F5NA 1RXUA 1EJ2A 1E69A 2FMHA 3FYHA 4BP1A 4D9KA 3WC4A 4RA6B 3FGZA 1UZAA 5EJ9A 4RCYA 3VU1A 1JHAA 2B3DA 1KDRA 1E1DA 2JCXA 3MAJA 3E5NA 4FFNA 4X8HA 3U6BA 1GR0A 2PWBA 1HTBA 4TSRA 4UNSA 4X84A 4Y2QA 2ZJYA 1MEJA 4ARZA 1IZ0A 5LU9A 2FK8A 2O2ZA 3WK5A 4GMXA 3V3KA 4N8EA 3E3NA 5T6BA 2C2BA 4ND3A 1B8PA 2VP0A 2R96A 5FAKA 1OKKD 2LP4Y 3MWEA 2RI0A 3C39A 4FZVA 4MR8B 1KXZA 1MU0A 2Y67A 2WD8A 3K7EA 4NG5A 2RH5A 1SCNE 2Q7XA 4XVQA 3FCUB 4J7CA 1H6BA 1PQPA 1RLUA 2XZTA 1W9MA 3OC0A 4IZOA 4TS1A 5JRDS 3U31A 2IOFK 4LMPA 4AJ2A 2ZBRA 3BZBA 3FPKA 5FLXA 4JSRA 1QJ4A 2CK3D 3VAZA 2EZ4A 4MP3A 2O0MA 1NVMB 4JFAA 4Z0PA 1P7PA 3ME5A 5KWVA 4AULA 2QQFA 2EFYA 4R69A 5JNVA 1PDOA 4V38A 1V8ZA 3HR7A 4AMZA 4KR7A 1XN4A 3VC3A 3K5PA 1I7DA 3F8SA 4WOPA 4DWJA 4EY4A 4LV6A 4B6SA 3ASUA 4G8JA 4RVSA 2GN8A 4PX2A 1M2WA 3FNIA 4MNTA 1RRVA 1IVSA 2NO4A 3WB2A 5E7IA 3GLHE 5BN4A 4EG3A 5HW0A 1PNVA 1I8TA 1S2DA 4MMZB 4WH0A 3O3NB 4TV9F 1CY1A 3HYCA 4MINA 4ZO8A 2IYSA 4CMHA 5IXYA 4H0FA 1CQJB 2QZSA 5JSFA 5FUBA 2C9ZA 3MTEA 5IDYA 2RJ3A 4DCTA 5CG2A 4MW5A 2Z95A 3JWJA 3CNOA 4Q4JB 1J23A 3D9QX 3E27A 4BZXA 1E4OA 1UMDB 1N36B 3M5CA 3WDMA 5FWYA 1HTTA 1QIHA 2WQ7A 1WDMA 2VF7A 4L0QA 2OMKA 4XKJA 3SIXA 2IHJA 1NW3A 1F12A 3C3EA 3DH0A 3T0GA 4QLBA 1MC8A 2C29D 4HJXA 4O5AA 2X15A 4Q7KA 3BFJA 5E9AA 1C4XA 3WK8A 4JH0A 1M34B 1XGKA 3CUSA 3GNQA 2V5UA 1ZC3A 2CD7A 3KQLA 2DERA 1LPBB 2IFTA 3HKBB 3ILHA 1I0ZA 3QLEA 3QPVA 3MCAA 3DPSA 2IHYA 4E4YA 1EFVA 3Q6NA 4Z99A 3H2BA 3HBFA 2CNWD 1Z4IA 2BF7A 4UBMA 4KDEA 2G5PA 3DWEX 2QSUA 1T6NA 4M54A 4EX7A 3IEVA 3WLPA 4ARVA 5JVDA 3L1KA 2I7CA 1GRVA 3BXPA 3DMRA 3CSDA 4K0RA 4ND8B 3FD8A 4I9NA 2EJUA 1CR4A 1YF3A 2XRYA 3ROPA 2J0QA 3TTSA 2IVFA 2QIOA 2A9QA 1AF4A 3MTGA 2JFXA 1HDYA 4X3CA 5KNCA 5B57C 1DBWA 2IS6A 5FEUA 2FSIA 3N3AC 4Y2SA 3O2QB 2IEDA 3T9CA 4EB8A 4KFSA 3IT3A 3ICQB 2NWQA 1VKZA 2Y1CA 1KO7A 1XDGA 4CMCA 1ZZGA 2XTAA 2FG5A 3PYLA 4UJ3A 1B6TA 2FW0A 1E6KA 1Q0HA 2PUJA 1II8B 1I10A 3STVA 3ELDA 2FRXA 3MTBA 4MS4A 4O2LA 3FHLA 4E13A 2QU7A 4TXMA 4LG1A 4K3VA 2JI7A 1MB9A 4WFQA 4J8PA 5G0UA 4NECA 2ZR9A 5FV4A 3MINB 1F2UB 3DR3A 1GCUA 3P2JA 1DTSA 2VNAA 4NCBA 4INZA 5U9CA 4Q15A 5FWXA 3ND5A 3M1LA 5BR4A 1J2JA 2QX9A 3JVEA 1U6JA 3WYDA 5EYPA 4FFBB 5ICFA 3T1OA 1R6TA 1ZQ1A 5LQCA 2UZIR 4LHYA 1SUIA 2C4NA 2IPMA 4BO5A 1E5DA 3KT6A 1CT9A 4DR2B 1DC8A 2MDTA 2QV7A 3ITDA 3QG1A 3QWHA 2XB9A 4N8DA 5CT5A 1A7AA 3T61A 1JAHA 3WYBA 3HV2A 2AE1A 4QM7A 4M6WA 3MBKA 4YUWA 2Z8YA 4HLNA 4NCNA 4OEHA 2NO7A 3RW9A 4YLGA 3SZLA 3X1WA 3PX3A 1NQWA 4X6LA 1OFVA 3UMSA 1Q95A 5DMXA 4O0MA 1Q50A 1RQLA 2DQKA 1MDBA 4HB3A 5YASA 2BIFA 2HQRA 5E0KB 3W77A 5LNK6 2YOHA 1AE1A 3KL4A 4S1PA 3R75A 2ORED 2RB4A 1UBKS 2H08A 1P9OA 5CM8B 4I46A 1Z62A 5AVXA 2LDXA 2C2KA 2JARA 2C96A 3QXXA 1A69A 4IPTA 3B51X 4ENQA 4YYEA 4NC9A 4W9NC 2ZWAA 4HGRA 4UQOA 1TK3A 1NF3A 1S2IA 1Z2CA 2CE2X 2RGRA 2Y4OA 4XD2A 1W4ZA 1OPXA 3TINA 5IBCA 4CKBB 5K6AA 1RM3A 2Y1LA 2W42A 5KVAA 1ZMOA 4EEZA 5IX8A 2G5CA 3CMMA 1JR2A 1EFTA 5AT1A 1Z28A 3GCGA 1H9CA 5L95A 1O9HA 4HDQB 4DQXA 4UNRA 4FSDA 4BVJA 1YQQA 3VFDA 3HCCA 3TZ6A 5I7VA 1MB0A 3ST7A 4BNDA 4ZO7A 5K8UA 2BKXA 3GNLA 4FHDA 4HG2A 3B13B 4MUKA 5AOCA 1IL0A 2JAQA 5JY6A 4Q93A 2GJ8A 1A4RA 2Y1FA 3ADOA 3T1TA 2IOHA 3IHKA 1P1HA 1Y5NA 3MUOA 1BVUA 3PIRA 4H1TA 5LZ7A 5FUYA 3EA5A 4BX2A 2QMQA 1E9BA 2P4HX 1P1BA 1J7KA 4MV9A 3T5PA 2J85A 3OTGA 1WOYA 4TMWA 4B6GA 1KEUA 4C2AA 2J0VA 2GLUA 3N8KA 5L3QB 1JG2A 2AR0A 3QKSB 1KORA 2DUWA 1YBHA 4HAWA 1W96A 1S3SA 4HQ0A 4IO0A 3VU9A 2P9HA 3I2FA 5GONB 5H8WA 3QVUA 3M4YA 3IQIX 2B4QA 4P84A 4AJKA 3WRXA 2J09A 1GADO 5TLSA 3W04A 1UP7A 3BTOA 3PQCA 4YXFA 3ROEA 3GFRA 1B0PA 3KUKA 5F5NA 2X0KA 3DVQX 3IEPA 3TVTA 2XLCA 2Y93A 3GN1A 1ZS9A 4HDRB 3VDQA 3NC0C 2IBSA 4JX8A 3FF4A 2XAAA 4EPRA 3K6SA 1UDBA 2QYTA 2C1XA 2ZS8A 1VJGA 3DE6X 1XLTC 2WK1A 1GARA 3QKWA 4NMLA 2XZLA 2P2DA 3FPEA 3W2EA 2QZJA 5LMZA 2KB0A 3KJEA 1C3LA 3NGLA 5JC8A 5FTWA 1XAHA 2B35A 3DOEA 3PJDA 4NV3A 4MHOA 4C0WA 3TECE 1A5TA 3OEEA 4RPLA 4RKYA 2FPWA 1I94B 3WGJA 3N76A 2J7PA 2XMRA 1AURA 2R62A 4V3CA 3JD3A 4IOJA 4P83A 4D74A 2PUBA 1C2TA 1QO9A 3G2PA 2YYYA 1E2LA 1U0LA 4TLCA 2H7XA 2ZI4A 2GZSA 3T06B 3UHOA 4ZU3A 5BQPA 1EWYA 2Q6OA 1KBQA 1QR2A 2HZ7A 3CVVA 1D8AA 3JQ6A 4WZBB 3ZZUA 1MGOA 3PJRA 2V3CC 2C2GA 1H23A 2W2VA 4FLEA 1AKWA 5JMWA 1OFHA 1CUYA 3QUSA 3G8AA 3ZCPA 3H9BA 3L7JA 4IFBA 4TRNA 4AO8A 1BVHA 5TJ9A 1TZ2A 2P4QA 1E66A 1WP4A 2WUVA 4RETA 1J2TA 1F20A 2CXXA 3OP1A 5GJVC 4XWOA 1DAKA 3DTVA 4N1AA 2XDQA 4X1IB 3BB1A 1C4KA 4RANA 1ESMA 1S3IA 3D5QA 3H86A 2GCPA 4N6NA 4RL4A 4ABTA 1VE5A 4LY9A 3NTXA 3RI3A 3CIFA 4UU7A 1J8FA 2YIVX 3BK1A 3O21A 2CJPA 4EPWA 2QYSA 4PLZA 2MYUA 4QOEA 1U0NA 1K7EB 3CPEA 4NFHA 3HBMA 4RCZA 3VRHA 5BSEA 4HP8A 4XH9B 3EG9B 4RJ2A 4W5RA 2REBA 1WB4A 4DDKA 1VHQA 2Q2NA 1CUIA 2QG6A 2ODEA 3AJ9A 1EJ0A 2XCSB 4JI7B 1SCUB 1V16B 2F4VB 1AG9A 1IM5A 1JZTA 2QYHA 3JQ9A 2VPTA 4URWR 3LUCA 5DNAA 3BH7A 1Z8NA 3LIIA 1FYDA 1FXWF 1XNHA 2CF5A 4JOSA 1YZQA 3ZLJA 4QXMA 2ZBVA 1Z35A 5GVSA 3S1AA 1J5EB 2I2FA 2PZJA 5AI4A 3BTSA 3ZGVA 4RIHA 4PGGA 1DZIA 2IQ5A 4GYWA 2YNMC 5IKXA 4Z3KA 2F9FA 1HL3A 4MAAA 3P9SA 3T4PA 1UEJA 3VX4A 1A9RA 1Y5IA 2DKNA 3PD1A 5EMLA 1P18A 4XWYA 2TMGA 5I5GA 2BMEA 1D4AA 1AB5A 5FV7A 1WCWA 4C03A 3C24A 5CX1B 1WF6A 1CHDA 4PLWA 2OLEA 3HYLA 4EFDA 4LF9B 1JZQA 2Q1UA 1G98A 1TQDA 1BXGA 1RKVA 3V1MA 4FX2A 3LT0A 4F12A 4LXXA 1AH2A 2W37A 1SBZA 2IF0A 1VE6A 1UFKA 1ZNQO 4CLEA 3VR4A 3C3JA 2ZUCA 3JWGA 2HLDA 3MJDA 5JYDA 2WF5A 3FFBA 5C80A 4RFVA 1SCDA 2AXEA 1WUKS 1XG5A 4HKTA 4M8IA 1DQYA 3AR3A 2QRLA 1EINA 2PU7A 3C97A 3LQQA 1SXIA 3U4IA 4Q03A 5FL7D 3VOTA 3MOGA 4ZT2A 3UO8B 4WY5A 1KZHA 1YNSA 1YQWA 1YT5A 3R6GA 4KMMA 3C3MA 4AJNA 5F9FA 1L5HB 4DV0B 3BEDA 2HLHA 3ZLVA 5A3JA 4F5EA 4YAEA 4WFKA 2XOEA 3D3KA 4NCAA 3K0FA 1KY2A 2DKFA 4X93A 5DGXA 2WY2D 4AKIA 1TOAA 4H0CA 5DXFA 4XYMA 1LK5A 2AOTB 4QDXA 4YMTA 3KPVA 5CEJA 2O14A 1XHLA 2BDTA 3KLMX 3L7OA 1O5IA 4H17A 1U8UA 1E0JA 3L9XA 4DJJA 5H4GA 3U4DA 4Q24A 1P61B 4NEQA 4Q4CA 3TQOA 4I1IA 4J29A 3EMDA 4GPD1 5LP6C 2B1IA 2I66A 2AMLA 1QUFA 2VDVE 3OZTA 3G5UA 3ENWA 4ZGWA 1GPNA 2QUKA 3PSHA 4J4TA 1SC1A 1E1RA 2OAQ1 2WICA 2X0NA 5DHRA 5BSHA 1ONPA 1MJGM 1DBRA 2YHAA 3K5IA 1SKYB 3DNMA 4NNOA 3T34A 2XRMA 4EO4A 2H1WA 4QWMA 4OQXA 4ANFA 4XFJA 1BWPA 2H1FA 4UPDA 5EHNA 1EFDN 2YVAA 4WT7A 1S9HA 1ZUD1 1PD0A 3E70C 3R9WA 4UMFA 3PR1A 5JCJA 3I9FA 1L8OA 3IPLA 4UNNA 5JOQA 3SLKA 5JE8A 3EIHA 3SGLA 2C5SA 4JJZA 3AFHA 3E8SA 5F12A 4KXLA 2O2YA 4K86A 5LBIA 4QEDA 4E2YA 3AO0B 4FFVA 2QPLA 4FMBB 4JJAA 4BJ5A 1WCIB 1CLUA 1NMSA 1BFUA 4P31A 4N0QA 4ZODA 3I62A 1SZJG 4QOFA 1UXGA 1KIAA 4FYWA 1Y3CE 4EGSA 2WVAA 1WF3A 2IUYA 4IXTA 2V7PA 4YBZA 1Z74A 1QRAA 3WWEA 4PX9A 5EWJB 1KSGA 1G2IA 1RI5A 1LBIA 4B3RB 4UQPA 3D3NA 4TMXA 3T7SA 1PD1A 2PYDA 1BNCA 3ZCVA 1IOZA 2R2GA 3HKEB 2RGUA 4UTPA 2BFCA 3D7RA 5FR2A 5KOHB 3I1IA 1HPLA 1SKQA 4E5MA 3ZY2A 4BFCA 5IN5A 1E6WA 3GVXA 1B23P 1VQ1A 1DPGA 3CNEA 2QOEA 3VU3A 4N0MA 4OO3A 4AP5A 3EQ7A 4X1KA 4HQKA 3FUVA 2A57A 3IA2A 4KSCA 5TB5A 5TQ2A 1V7PC 1YKSA 2QUHA 5IARA 3Q3HA 2ZXEA 5KTSA 3INYA 1MG0A 4X71A 3PNOA 3R3SA 1YZKA 1PR1A 4ID3A 2D5IA 3P9PA 3SF8A 3VKWA