4HB2A

Crystal structure of crm1-ran-ranbp1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
204
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVLAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear export inhibition through covalent conjugation and hydrolysis of Leptomycin B by CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
total genus 59
structure length 204
sequence length 208
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4hb2A00
4URYR 3T15A 4TMVA 5EXXA 4CIDA 3NC1C 3CF0A 4O0MA 3AP1A 4IJMA 1KDPA 1W4RA 4C0SA 4IDPA 5EUMA 3CKLA 4NZYA 1DADA 4A2WA 5FBWB 1DG1G 3SBEA 5AWFC 3GP8A 2TMKA 3ADBA 4ASUD 4KYUA 4G0NA 1OKKA 1R0YA 1FQJA 3IPYA 1RVDA 4LV5B 1E6CA 1KSFX 1KMHB 1DOAA 1N5KA 1YKSA 2R6CA 2W0MA 4LJYA 2NTYC 1US8B 4QBIA 4B3CA 1DBSA 4ZDIA 3AVOA 4C0QC 2G6BA 1S4QA 3ZVNA 4IEEA 2BEKA 1U94A 1TQ6A 3I3SR 3BD9A 1L7VC 2CVFA 2ZSAA 4A6PA 2AFHE 3NEJA 4UNNA 4A1FA 2OCPA 1U0JA 3ECCA 5H70A 5G41A 3X1XA 2KB0A 1MR3F 1P61B 3LA6A 4I1OA 4EJSA 3UIEA 2FFHA 5P21A 1XEXB 3TK1A 1CF4A 3HP1A 3U61B 3RAPR 1RZ3A 1ZD8A 1Z3IX 2BJVA 3VNUA 3U44A 3DMNA 3DZDA 3LVQE 2E87A 5LPNA 2J45A 2GEVA 5JHGB 1KMHA 1U98A 4QC2A 4Q4JA 2CLSA 3AGPA 4LYAA 2O8DB 1K5DA 2XGJA 1EXMA 4B3DA 4AI6A 4PXAA 1I4DD 4BLSA 2V1XA 4M4SA 3AUYA 4C0JA 5JSZA 2ZI7A 3QOFA 2OFXA 4N1AA 1SKQA 3VFDA 1E2JA 5TB5A 4DDWA 4ZI2A 1OYWA 1J7KA 621PA 4NL4H 1P9RA 5EP2A 2BIFA 2OLKA 2W83A 2WJVA 4C0AC 3PFIA 5DE3A 5DHAA 4AIIA 4B2PA 3B6EA 3KFVA 4DEXA 4HDOB 4DZZA 2ZSFA 2QPAA 2CL6X 2ZI6A 3L0IB 5DI3A 2O8CB 3H86A 2YOHA 1U81A 4ZIRA 1KKMA 5FTKA 4LCBA 4A9AA 5CM9C 1DAFA 2OM2A 4OJKA 1E2KA 4DBLC 1X6VA 1DAIA 2ZR7A 5GJVC 3I92A 4B48A 2WJGA 3ZZTA 5JECA 2ZU6A 4Q47A 3DMDA 3K0FA 4EPRA 5LDDC 4QFMA 4KLZA 5JI3E 2RGGA 1EG7A 1XPRA 3Q72A 1V43A 1YQTA 4DLSA 2ZITA 1ELOA 1FP7A 1M2OB 3ZD7A 3BC1A 3L0PA 1VG9B 3NHBA 1G7CA 1KI7A 2AWNA 4F4IA 1N0WA 2OAQ1 1NLFA 1C1YA 1XCGB 4HZUB 1EFTA 4LSGA 2V9PA 5IRCD 2WJIA 5KSYA 4FCTA 3LRPA 1RIFA 2YWGA 1ZRHA 4DRZA 1U9IC 1E0JA 1Z0IA 4HAUA 5SZHB 1G6HA 3FE2A 1M7HA 2ECKA 2ZRHA 2KSQA 2ANCA 4IFBA 1GUAA 2YC4C 4BLPA 5CDFE 5CDFA 1UBCA 2AK2A 4LUCA 1GKIA 3K53A 4IEIA 3L43A 4BFVA 3GCGA 2ERYA 5CITA 3AM1A 3ZIAD 4TYWA 3U5ZB 3QXCA 2ZJ5A 2QGZA 2F6RA 4I1UA 1QHHB 3S1AB 4X8OA 3NBXX 3TSZA 1U0HC 1MOZA 2CMKA 5CK5A 2EFHB 1F60A 2A5JA 3D3QA 2IYZA 4B43A 2OBLA 2WPDD 1Z6AA 3GJ7A 5DLQC 3AP3A 2LKCA 1Q3HA 4U02A 3ZLJA 4OK6A 2ZJZA 2GETA 4ZCMA 2HYIC 4OQFA 4TQUS 5K8LA 1B23P 4DLXA 3PV0A 4Q5IA 1Z63A 4QHYA 1LS6A 1SVKA 1UBEA 2VYFA 1ZYUA 1NBME 4XSGA 2Q0HA 1I2MA 1IN5A 1SVIA 2OFWA 3CW2A 2IX3A 1GSIA 3E70C 5IT5A 1P4SA 1E2GA 1ZCAA 1D5CA 4TSFD 5EP4A 3VNVA 1W2HA 2BM0A 4JT2A 4GI7A 1MABA 2B7BA 4PC1A 5GVSA 4EIWA 1LB1B 3WYGA 2G77B 2IC5A 1KY3A 4G1UC 2R6GA 4XVRA 4AKGA 2D62A 3CZQA 4FI3C 2OBNA 2IXEA 2UKDA 1ZU5A 4W7SA 5FOXA 4PHGA 3NWJA 4M0LA 3EZ7A 4OBEA 2ZJYA 4JLPA 4C4PA 2ZRBA 2YYZA 2I3BA 1HQYE 4OHVA 3LO5A 4CEJB 2NO1A 2VSFA 4MYHA 1FX0B 1QG4A 2XB4A 1XX6A 2AWOA 1W4BA 2W0SA 1E2HA 1XP8A 2JA1A 2XSZA 3D8BA 3Q3JB 5K8IA 2F3RA 3KUDA 4LJ4A 4N3NA 3WRYC 2PX3A 3C15C 5L8VA 1Z08A 5HZKA 3OEHA 3B7GA 1EX6A 3LXRA 3RRMA 4PAOA 3TVTA 3W3AA 3IQXA 3CUEF 2ZJ2A 1E69A 5E4FA 1SULA 2CCKA 3SJAA 3WP1B 1W4AA 4LBWA 5M04A 2R9VA 3QG5A 4JVNA 2ZJ8A 3CIOA 2B6HA 3NBYC 5EJEA 1IBRA 4Q9KA 2D2FA 2V6JA 4I81A 2EFEB 2A5DA 3W8RA 2GXUA 1XEXA 3ICQB 3MFYA 1N6HA 4KFSA 5HE8A 4QG7A 3IHLA 3WY9A 1KAGA 1KTVA 2F1RA 3SEAA 4HB2A 2IW3A 2ZJAA 4R2HA 1U9IA 4BLQA 2AL7A 3KB1A 3EZ6A 2ZI5A 3IIKA 3VR5A 2QU8A 1MRSA 3BGWA 4XTCS 3SHWA 4DSTA 4FMDB 4EFLA 1E32A 3LX8A 4B47A 3A1TA 1A82A 2C03A 1D9ZA 2QP9X 3GFOA 1XMVA 5AUNB 5JFGA 1IXSB 3PEWA 2BEJA 2ZPTX 3EASA 2D2EA 1E4VA 4P4SA 1SZPA 3FYHA 1W36D 4OYHA 1XTQA 1PLKA 2HEIA 2E1RA 4Q1FA 2RGXA 4B6FA 3KUCA 4HSEA 2OESA 1DG3A 2DFNA 2Q9AA 1MO5A 4B75A 3U4QA 3RNLA 4BUJA 2H17A 4OQMA 4WXRA 1G3RA 1G7RA 3RS5A 1UBGA 2BBSA 4ZKEA 1NVXQ 2HF9A 1WBBA 2XTZA 1XMJA 4ZDWA 3RHFA 1ZW6A 4RZUA 1MH1A 2BBTA 3LW8A 3SYKA 1S8FA 2GZDA 3WNDA 4Z51A 4RZ3A 2DY1A 4YMSA 4HLQB 4NCNA 2IUSA 3CX8A 3CH5A 4OHZA 3DOEA 2IS2A 1T3LA 3QF7A 4A0GA 1NSFA 1ONBA 3GLGA 3FMIA 3BWDD 3AVXA 2F43A 5SZKB 3SJZA 3T1QA 3WNBA 1JQJC 1SVLA 4LRWA 5J40A 3KTAB 2ONKA 3K70B 2LCFA 3WP0A 3FFBA 4PQYA 4KFRA 4EQ6B 3UPUA 2CXXA 4U7DA 2GA8A 1G3QA 3AF4A 2ZRKA 4GT1A 1R5BA 2PL3A 3IHWA 3AB3A 4MDFA 1SVMA 1E2FA 4HAVA 4D0GA 3I62A 5KOYA 1LF0A 1ZINA 1NN1A 1SVSA 1XFAA 1QHHA 2QEQA 4R9UC 4LJ5A 1LS1A 2Z4SA 3RC3A 3NDPA 1BMFA 1OIXA 3QSYA 3SNHA 3SS8A 1YZQA 4A6XA 3B1XA 1O87A 2W2XA 3AQ4A 5GVRA 3AVVA 3IBGA 3FGNA 3IGFA 4IOMA 1MRNA 2Q3HA 3HR8A 3QVUA 2ASEA 5J4LA 2MMCA 1ZM9A 4NYJQ 4V03A 3Q7QA 1H8EA 4DLRA 1OXTA 3PUZA 2WTUA 4BFSA 2ORWA 3KKQA 3PJRA 1U99A 5JJLA 3OAAA 4JMPA 1GKYA 3K0SA 4UJ5A 3AF3A 3FHOA 2NQ2C 4JYCA 1VG0B 1TMKA 4C2TA 3PXGA 2WMNB 2AX4A 2JLQA 3M6AA 4DLUA 4IVRA 3TUIC 1OXUA 1U2RA 1Z0JA 1G8GA 4ARZA 1XEWY 4GOKA 2C96A 4XD7D 4OI2A 1QHNA 4LV8B 1UFQA 4O3MA 4JVSB 3A58B 5CYOA 3THOA 1FPMA 1KO4A 2BHRA 3KQKA 3IKJA 3O8RA 1N5JA 1I4LD 1NG1A 2GZHA 4RD3A 1FMJA 5J4KA 1G8HA 2QQEA 4E07A 3KQHA 5EE9A 5IF9A 1JPNA 2FEOA 2ODBA 1NF3A 3DO6A 4IRUB 1XZPA 3L0OA 2OZEA 3CPEA 4MYCA 5EQTA 1PUJA 3MJRA 3BRWD 4US2R 5L3QB 4Q7MB 1OFIA 2FSHA 5IDVA 1XXHE 3TJZA 2OFOA 2QTFA 1GNRA 3K1JA 3N2IA 4BASA 4FINA 3W6NA 1XXHB 2H57A 2HCBA 3HPQA 4RFVA 2B92A 4QGHA 4KAXA 1MO6A 4B34A 3KTAA 4LBZA 4Q18A 3PQCA 1XU4A 2GEDA 2OV2A 4HDQB 1VCIA 3K0FB 5F9HA 5FBQB 2KBEA 4QHSA 2QPTA 4HZIA 4I1VA 4KFUA 4QRHA 2AN9A 3GLGB 1S96A 1N6NA 2ZREA 4B74A 2VRWA 3PIRA 1IAQA 1TPZA 1VCMA 1Z0KA 2X2EA 4Q9HA 5EXTA 5FI1B 2RHMA 3QE0A 4XVUA 3LDAA 4KV9A 1SXJE 2ZUDA 1QZXA 2IYUA 1XJCA 4B3FX 4MYTA 5SZIA 1FOEB 1OHHD 3C41J 4MRRA 4LJAA 3SQXA 2JJ1D 2NIPA 1N5LA 1T91A 3AF2A 4CEHA 1OFHA 5FOVA 5AJYA 221PA 3FKSD 3MG9A 5GJWC 4US0R 1J70A 4IOLA 1KK3A 3WHKA 2P5TB 4B35A 2IS4A 4M1MA 3F3YA 3FFAA 4B33A 4WZBE 3LX5A 4FD2A 3HWSA 2CCJA 1X86B 1XRJA 2A5GA 2GJKA 2O52A 4JLVA 4P4UA 2B7CA 4LX0A 3BE4A 4OQLA 3W8NA 4QHTA 2CVHA 2WAYA 3OIUA 2W6JA 2FPLA 2QMUA 1PVOA 3GLFE 4LBYA 3RVBA 4RZXA 1XTKA 1VYTA 1SVWA 1OH8A 1Q1EA 4ARZB 4XVQA 4BFYA 3HU2A 2A2ZA 2BMDA 4Q66C 5TMPA 4F7WA 2JLSA 4HUQA 1HH4A 2H8KA 2GCNA 1SXJA 3LFUA 3HJNA 1JJ7A 1OSNA 4AC9A 4XIGS 1RJ9B 4UNRA 2FOLA 2ZUCA 2CK3D 3CNOA 5JZVA 3TE6A 1JI0A 4BFTA 1OB5A 1OV4A 2IYLD 1OIWA 1ZCBA 3LLUA 3SR0A 4BGDA 4LBVA 4HDCA 1P2SA 3W90A 4WA7A 4C0LA 4R7ZA 3TBKA 1P72A 3RS7A 3ADDA 1AA9A 2C77A 3B9QA 1AN0A 3OFND 3VX4A 4E03A 1E1RA 4XD7A 1NKTA 1W0JD 1QHSA 2Z83A 4LHZA 3U3OA 5B57C 1HY3A 2ATVA 1GZSA 1Q57A 2H16A 2FFBA 1Q44A 4Q00A 5L3SB 4O2LA 4DSNA 4CEHB 2JIZD 1YRBA 2FX3A 4P33A 2IEYA 3DZ8A 5HKKD 1KDRA 2WPDA 2XTMA 1TU4A 2ZTSA 4QBFA 4NYMR 1CIPA 1ZC3A 3KJEA 3PEVA 1WF3A 4Q21A 3ND9A 4JBYA 1GKUB 4BPBA 4HAZA 4F92B 2QSYA 1DAMA 3GJ5A 3ND8A 4DCTA 5JJIA 2BMJA 1SQ5A 3C16C 2OCAA 1GVNB 2O0JA 4XWOA 2PH1A 2WBLC 3MWYW 2BCJQ 4RKEA 1YVDA 4JL8A 2QMEA 5EE5B 4YMVA 4NCIA 3MLEA 3GD7A 1Q0UA 2IK8A 3A36A 3QF4B 3PUXA 1EFUA 5GJCA 2RB4A 2QPOA 5EE3A 5TDHA 2H18A 4KODA 2JLVA 1CTQA 5FUWA 2NPFA 521PA 3ASYA 4JLOA 1VMAA 1T3SA 3TMKA 4Q1DA 3CF6R 2IEZA 2P67A 3AV0B 3DDCA 4K46A 1OT3A 2F1HA 2ODNA 1XTSA 4NYJR 4TYQA 3SDZA 4CDGA 1JNYA 4DLYA 4CVNA 4IDQA 4A8JC 1TF2A 4GZMA 5AUOB 4HATA 3WYFA 1FW6A 3EA5A 3T61A 1ZIPA 2HLDD 5EZ5A 3VR3A 3TGPA 1F3OA 1W0KD 3LAWA 3R8FA 2FFQA 3VKGA 2FEMA 4DT1B 5FBVB 1KI3A 1B0UA 2FZLA 4HLUA 2NO9A 2GXAA 3WMFA 3AGQA 3IO3A 2R6AA 4KYIB 4MA4A 1YU9A 2WWXA 3SFZA 4H9GA 4ZPXA 3TAUA 2OHFA 4G3XA 3PR1A 2GAOA 4UQOA 5KNCA 3EPJA 2XOKA 1FTSA 2PCJA 2RGNA 2WWYA 5IK2D 3TH5A 5F3WB 1YZUA 2VEDA 2WWIA 1S3GA 1UPTA 4TLAA 1NP6A 4ERNA 1H8ED 1N6LA 5FTLA 1XPOA 2ZYWX 2JDIA 2ZRAA 4LHVA 4WIAA 2XJ9A 3FKQA 1S3SA 1W49A 1ZMXA 4IVPA 1R2QA 1T5LA 2QN6A 1GM5A 1UKEA 1RFLA 3TLXA 1OLOA 1N25A 1FMLA 4F91B 3JVVA 1J90A 3RWMB 1C9KA 2REBA 5DI3B 5KDDA 1FP6A 2ZE8A 1JR3E 1W36B 3KKOA 4BFWA 2P2LA 2PT5A 4OQXA 3GJ4A 421PA 3CNLA 3P27A 2RH5A 4ASUA 1R10A 5UKDA 1ETUA 2WZQA 2YOGA 3W3ZB 3HU3A 1JEDA 3AF0A 3ZGXA 1EFRD 2J5XA 4MYUA 3SJBA 3TUJC 3OE7D 5KPDA 2O8FB 4PTLA 1DTSA 5FL7D 5C4MA 2HF8A 3EPKA 4C0BA 1XD8A 3EIQA 3QG1A 2WSSD 2R6FA 1P9NA 4QJ4A 3L0SA 4YXWA 2GVDC 2QGNA 3EW9A 3MGCA 3THWB 4OI0A 3PUWA 2OCYC 3A4MA 3EC2A 1Z28A 1HT1E 2BOVA 1XD2B 5G40A 3K0CA 4WOPA 1CBUA 4JLNA 2JLZA 4AG6A 3I32A 2FPMA 3QENA 5EP3A 2Q9CA 1UKZA 2REOA 2O5VA 5FOTA 1GDDA 2FPKA 3O8BA 4QJ5A 1S9DA 3NIBA 3EPHA 2VQSA 4A8JB 4M9XA 1NJGA 1G8FA 3G82C 2QM8A 4BFZA 3T5DA 3EARA 1DAHA 1M6NA 3IQWA 3NKVA 1ZM4A 2AFIE 3REFA 4PSKA 4HUQB 2FFAA 2CLCX 2A7QA 3I5YA 2F43B 4CEJA 1Q1BA 1Z0AA 3CR7A 1PUIA 2EVWX 2KBFA 3OEHD 1VIYA 3Q8XB 1AS2A 1L2TA 4O25A 2J1LA 4I1SA 1G4UR 4M9SA 5TXGA 3CO5A 1BMFD 3HU1A 2QAGB 2DWQA 4XTRA 2BBWA 5CLQA 4II7A 2ZRDA 1P2VA 1E9CA 1JR3A 2IL1A 1AKEA 1CU1A 2WMOB 2ZM5A 1WDTA 4QBGB 4C7OA 2QUZA 4JLKA 4UNPA 3MWJA 4Q4AB 5E7MA 2F9MA 2XNSA 2WWHA 1EX7A 3CONA 4RD6A 3EZ9A 5KSOA 4A15A 3ADKA 2IYTA 4XH9B 5CYPA 4A0RA 5C46F 3NDBB 2G3YA 1MT0A 5AJZA 4KVAA 2PJRA 1COWA 2H5EA 4BZXA 1V5WA 3I4LA 1GWNA 2QAJA 4A82A 2ZAOA 3U3MA 2EFGA 4DIEA 1ZJ6A 1SXJD 3CRMA 5FH9A 5TVKA 1H65A 2XNDD 5DHFA 4OL0A 2PZFA 1DAGA 1NY5A 5FPHA 3F5FA 4KXFB 1FNMA 3TSOA 3BH0A 1E0AA 4BLOA 4TL7A 4IDHA 2OBMA 5L3RA 2XZPA 5L3VA 4KHZA 5FI0B 2RGCA 4DVGA 3ZH9B 5JLJA 1YHNA 2QT0A 4D81A 3DM5A 3F0TA 5JS8A 3AVPA 1JAIA 2RCNA 1P7CA 1DO0A 3V9PA 2GWHA 3EC1A 3F8TA 1NKSA 4PO9A 4P4SB 2G88A 1AZSC 1Q1ZA 4MDEA 1JBKA 4Z54A 5FBLB 4ZIRB 1H8HD 2VP6A 4DCUA 1T4GA 1U8YA 1EFRA 1X8KA 3RSOA 2JATA 4WZ6A 2WICA 1S1MA 3DKVA 5BN4A 4TLDA 4C9BA 2WV9A 3U60B 3AH8A 2GILA 1NVVR 4NH0A 5DGXA 1E9EA 4LOAA 2OO7A 4PX9A 2HUPA 4IDOA 1IJEA 1XMIA 4PZLA 1Z22A 4M1YA 2X2FA 5AJWA 3UMFA 1DS6A 1WCV1 1G5RA 1NRJB 2XX3A 1TF5A 4AKEA 1KSHA 2W6IA 1E9DA 1AGRA 4ZCLA 4QJ3A 2C98A 2HCJB 3BH7A 3CRVA 4TTRA 5JEEA 1G8PA 5K8TA 2ZEJA 4GZLA 2LKDA 5B58C 2VHCA 4B32A 4QBHA 1X1SA 2BKUA 4M9QA 2Z4RA 4LHXA 2O8BA 3HDTA 1Z5ZA 5HTKA 1BKDR 3CRW1 4HAXA 2B21A 2R6DA 3LV8A 1RYHA 3K0EA 3DHWC 3QKUA 4FCVA 3X1ZA 2IWRA 4IOKA 1KGDA 5LBIA 3W6PA 3GLIA 4IHQA 3RRNA 1BIFA 3EAQA 3KXLA 2BV3A 2JASA 1KZGB 3U4QB 1XBTA 1KO1A 2P65A 2C9OA 2WSMA 3SE0A 3B1YA 2ZI9A 3K0CC 3EXAA 1A1VA 3GJ3A 3H1TA 1JXOA 3ZVRA 2QRNA 2XAUA 1NBMA 2C9YA 4NCKA 4R2IA 4PPQA 1CJTC 2ZYVX 5JEDA 3HYRA 4Q01A 3MUFA 2P5SA 1E79D 2GESA 3EWAA 2KI5A 3TKLA 4BECA 4MITA 3KX2A 5CM8B 2C5LA 1YR9A 1A4RA 2YINC 5KSPA 1GNPA 4Q02A 1ZUNB 4NYMQ 3B1VA 2ZRMA 1NN0A 1BH2A 2A30A 1MV5A 4PO8A 2REXB 4TLBA 3CZPA 2OAP1 2AD5A 1IXZA 2RAPA 1ESMA 3CF2A 4PPGA 1P5ZB 4MGIR 4WW0A 3X1DA 3VR1A 5CK4A 1MO4A 5J5CA 4B2LA 3FVQA 5CJPA 5FPYA 3UKDA 2WIAA 3QBTA 1MKYA 4V0OA 4LHWA 4Q48A 1D2NA 4HUTA 2X19A 3ETLA 4JLMA 1ZVQA 2VIIA 1OB2A 2GCOA 1CR2A 2PBRA 2ZJBA 4GBMA 4ESVA 4DDVA 4Q4HA 5J4YA 4PO1A 2QNRA 2O8FA 4U5XA 1KAOA 1MABB 3QPVA 1Z47A 5KYKA 2ZAMA 4CYMA 5KDOA 1OH6A 4D4KA 1M8PA 3QXJA 5ANRB 3FOZA 1E2MA 3PITA 3X1YA 5DN6A 1E94E 2ZE7A 2AKAB 4Q1BA 2XTNA 1JJVA 3QKRB 2QA5A 2VH5R 3L8ZA 2WKQA 1U8ZA 2YNMA 5H1YA 2XZOA 4Q7KA 4NYIR 4V0ME 1S9HA 5DO9A 2BMFA 3CR8A 2IUUA 5KU1A 2VP2A 4C7OB 4HB4A 1UAAA 1WE2A 1Z6XA 2X8AA 4RFSA 3V4RA 1E9RA 2GZAA 1M74A 3UMRA 1T6NA 3LD9A 1OHHA 2HYDA 1N0UA 4W5WA 4FMCF 4M1KA 4Z1MA 3CH4B 4AWXA 6Q21A 3KQNA 3AKYA 2IYWA 2D4HA 2FV8A 2JLYA 1X1RA 3EWSA 4CRWB 1W46A 3OZXA 4LZZA 2IT1A 3ICEA 1YR7A 4P31A 2B8WA 2F1IA 2O8EB 2ZU0C 4P32A 3Q85A 4PAMA 1F2UA 2OE2A 5CLLA 3VU9B 4R98A 4M2LA 2J7PA 4TL9A 1KK2A 2QAGC 1E9AA 2IUTA 3QPUA 2DWOA 2OG2A 4JL5A 5C1BA 4Y0AA 4BEJA 2DYKA 1E96A 2ODEA 4FW9A 1Q3TA 3GLHA 1E9BA 2OUKA 3U7FB 3ZYCA 1NMXA 1F48A 2QORA 1IN7A 2JJ8A 2J59A 1QVAA 2ZRGA 4ON9A 3RSLA 3AVTA 3A1UA 1J99A 4JVMA 4XSHA 5KPJA 2XOKD 3QQ5A 1NY6A 4PC7A 2HXYA 3QPWA 4FMDF 3GJ0A 3QY0A 3MJHA 4KJZA 3C5HA 2MSEB 1AK2A 1UM8A 4NP6A 1RRCA 2LWIA 3K0AA 5FR2A 4TLCA 1EFHA 2BBOA 3B9PA 1U8AA 2FZ4A 3JZMA 1N6PA 2FN4A 2SHKA 1D2MA 4US1R 5E7JA 1UJ2A 1CXZA 4LC0A 3DEFA 1P2UA 3GFTA 5HCIA 2YWHA 1W47A 2QRZA 4N0DA 1GRRA 2CDNA 4G5SA 1NSTA 1CR0A 4DSOA 4Q7JB 1DELA 3BAFA 3TAHA 4PFSA 1W5TA 1E2QA 3L8YA 5CJ2A 2CLDX 4AKHA 2I4IA 2XXAA 3UATA 4TZ6A 2ZSEA 4P0TA 3LQRA 1NN5A 1U0LA 3V4FA 4GDFA 1R8SA 2CE2X 2JJ2D 2VP0A 4HI0E 3VQTA 3R20A 5FL7A 1WRBA 2O8EA 1KHTA 1A7JA 4QGFA 4OQNA 3N2EA 2P0EA 4EFNA 2X1VA 4YMUA 1RJ9A 2BC9A 1XZQA 3NEYA 3CPJB 3KL4A 4PPFA 1QG2A 1I2DA 3R8CA 2ZYUX 3KZ1E 1H8HA 2O0HA 3EG5A 3BFKA 1NI3A 4DC9A 4W9MC 2NO6A 2QE7A 2GJ8A 3DOFA 2YV5A 1TX4B 4A0HA 2ZANA 4YDHB 3T1TA 4IOJA 3IIMA 5JCPA 1E2IA 4WZAE 1N6IA 5GADl 4CEIB 4C30A 1P3JA 4FCWA 1VECA 2CCGA 4C3ZA 4BWYA 4HAYA 1ZUHA 4UXJA 1TADA 2ZS7A 3KJHA 4RD0A 4Z8YA 1AS0A 4ZO4A 4C2UA 3PUYA 2GKSA 1TUIA 1G3IA 1NMYA 4IXMA 4KLNA 1TNDA 5JS7A 5JSZB 5IHPA 5J4HA 3PEYA 3J81k 1YE8A 2ATXA 1XJQA 2YWEA 3P4XA 2D3WA 1OFTA 5E95A 1OIVA 2C78A 3PENA 1IN6A 1IQPA 3D7MA 4V02A 3WNCA 3RWOA 4FMBB 4TMTA 4AG5A 4MGZR 3KXIA 2GRJA 3OIWA 1HURA 1JR3D 2YHSA 3U3KA 1E2NA 4F4CA 2R65A 1A2BA 5F9FA 4DEYA 1NN3A 1PLLA 4WXPA 4JJKA 1AM4D 1G19A 1GRQA 1KDTA 3U6BA 1G9XA 3FMFA 1YZLA 3VR6A 1E9SA 3I72A 4LGMA 2DHRA 1KOFA 4EFMA 2JCSA 4KCGA 1RW4A 1CS4C 3TVDA 2ZQ5A 3TSWA 5G3ZA 2D74A 1SHZA 2UVQA 5DISB 1N0VC 1UKVY 4V0LA 1R5OA 3U3RA 2C2HA 4WAUA 2NPIA 1KNQA 4GOXA 1NLYA 2P6RA 3A8TA 2EWWA 2VP5A 1IONA 1A2KC 3GFPA 2ZS8A 3NTUA 1Q12A 4WBSA 1R0XA 5EE1A 2FGJA 2PLRA 4M8NE 1E98A 3BERA 1G1MA 2RHDA 4JZKA 2QAGA 2K5UA 1DEKA 1P60A 4TL8A 3V00A 4A2PA 1Z6TA 3IILA 1II0A 2GNOA 2QT1A 2ZE6A 3AKEA 1VIAA 2CK3A 5C2JB 1BS1A 2VHTA 8OHMA 2VSOA 1P6XA 4Q4AA 2GK7A 2ONJA 3VU9A 3EX7C 4BZQA 5KNBA 3RLFA 3U7EB 1II8B 2WAXA 2AK3A 3SHFA 2JAQA 3P26A 4B3XA 1CJKC 5D3MB 1GL6A 2GK6A 1BO6A 1G5TA 1KDOA 1VHLA 4D2IA 3AVWA 2O8BB 4A92A 4ILEA 5SZJA 3B85A 4LJ9A 5HKKA 2NMVA 1E2LA 1A5TA 1NVUQ 1YZNA 2CL0X 2ZETA 3OEED 4UJ3A 4CGZA 1N5IA 1XD2A 2ZRJA 1F2TA 4PPNA 4Y0VA 4I4LA 4NMMA 5CIWA 4BFUA 1FUKA 5DI9A 3BXZA 4IW3B 3A6PC 1ZAKA 4RD1A 1ZM2A 5JWOA 3NVAA 3IBYA 3OE7A 3K70C 2GF0A 4TMZA 3T1VA 1GITA 2QY9A 1N6RA 3NH6A 4U00A 4TTPA 2DBYA 2YZ2A 2IHBA 4HAWA 3TR5A 2QSZA 4E5UA 3LLMA 5AUQA 4NTZA 2Q3FA 4KFTA 3RS3A 4F93B 3BFXA 2GVZC 3LY5A 1E0SA 2F9LA 4PQRA 1FNNA 3B8HA 2P3SA 4LYHA 4EPWA 1E4YA 3GLGE 1T0HB 2F1JA 1M34E 3O8DA 4P4TA 3ZS9A 2VA8A 1KI2A 4M1SA 2EQBA 4BFXA 4QM7A 3UXMA 1VYVA 3DVLA 3EIHA 1JXMA 3P32A 3R7WB 2BJWA 2VP4A 3GLFB 2DR3A 4M53A 5HZHA 2GAAA 4QM6A 1XWIA 2BKEA 3W5IA 4PAQA 3DL0A 2FE4A 4RCZA 2YC2C 4CZ2A 5EZ6B 5FUVA 3QKSA 1E2PA 1QHIA 2C95A 2ZS9A 5EE0A 1DARA 2A3RA 2VO1A 4IVQA 2F3TA 4RZ2A 4DHEA 5C4GB 2A5YB 2QMOA 4G5OA 4LK2A 121PA 1K5GA 2G1JA 4LPSA 1OW3B 2D7CA 4MRPA 4Q1AA 5L3QA 5HE9A 3VR4A 1VKJA 2QP3A 2J41A 2HJGA 3QEOA 4CF7A 1SXJC 2OCBA 2PEZA 2WWFA 3CBQA 4A0FA 1CJVC 2GF9A 1R6BX 2ZRFA 2EFDB 1BYIA 2J0UB 3D31A 3G5UA 3NG1A 3GPLA 3E5HA 4R71A 2E9SA 1GP2A 1X8LA 1YR6A 4V0MA 3ZZUA 2YWFA 3HYTA 5D3QA 4LHYA 4NYIQ 5JWHA 1LTQA 4DCVA 4MGYR 3B60A 2WIBA 5LB4A 3WYAA 3CNNA 3K70D 1HQCA 1KI4A 1EWRA 3C8UA 3CLVA 3VKHA 5KTYA 3C5CA 3GLHE 5FTJA 3ZZ0A 4NE2A 4Q03A 4BLTA 4NPHA 1GL9B 4MUBA 3QUSA 1OYYA 3GMTA 5BW8A 2VSXA 2BM1A 1NIJA 2XJ4A 4D6PA 4NU0A 4LC1A 1CRQA 3QF4A 1K8RA 4PC6A 4E22A 4EQ6A 1JB1A 3KJGA 4GNKA 3RYTC 4D0LB 1IY2A 1KI1A 2I1VB 1AQUA 1O3YA 4DWJA 4PZYA 4KSCA 1IY0A 4UKDA 2BVNA 4EJSC 1I4TD 4JIMA 1KMQA 3HPRA 4PANA 4AKIA 1VDZA 3FTQA 1KI6B 4PR0A 1OF1A 5JRJA 1D2EA 2W00A 4JT4A 3U2QA 5KSZA 4B44A 5LD2B 1W36C 2RGBA 3K09A 1UADA 2J3EA 3QXXA 1CEEA 2C9CA 3QBVA 1NJFA 3A4NA 4EPTA 2BWJA 2B8TA 1SVOA 4URZR 1P2TA 1E3MA 3MAAC 1UDXA 1CJMA 2BDTA 1Z0FA 2VLIA 2ZI3A 3GEEA 3H4MA 4TL6A 2C04A 1QHYA 2FSGA 4O2RA 1P9WA 3VR2A 3OESA 1FZQA 4D26A 1G18A 4ZDKA 4LJ8A 3GJ6A 4OK5A 3ADCA 3LBNA 5BXQC 3OIYA 4TYYA 4TLEA 4GMXA 4ZI3A 1IHUA 1E1QA 3B1WA 3BORA 4Q1EA 2J9RA 5CIQA 2CHQA 1RRPA 4HLCA 2EYQA 3CX6A 2W6JD 4F4JA 2JLRA 5FPTA 2L0XA 3KFXA 3PUVA 2CJWA 4A8JA 3BB4A 2F7SA 1GL7A 3A4LA 5F2EA 4W5HA 3FDIA 1YR8A 2GDJA 2V1UA 1E1QD 2QG6A 2XSZD 3P4YA 3TQCA 2FGKA 1QF9A 3WXMA 4LJ6A 3W6OA 2FMXA 3M1IA 1ODFA 4HLUC 1G8YA 1PV4A 4RD4A 1G291 3BJIC 3LNCA 5A0FA 3W34A 3G0HA 1CRPA 2IXFA 4PHTA 4OHWA 5F98A 1TAGA 3AVYA 4ITRC 5TY0A 2JLXA 2VPPA 4URWR 1UEIA 3RABA 1G7TA 3D6TB 4QL3A 1P75A 3QIAA 4ZDJA 2DCUA 2GJSA 3RDPA 4AYXA 3I5XA 4X8MA 2ZSDA 3M4YA 3GLIE 2IS6A 2NZ8A 2J0VA 2IYVA 2WJJA 4TYNA 2H7VA 4URXR 3UMSA 3THYA 4ABYA 3FHTA 4GMDA 3CWZA 2GCOB 3TW4A 4HLDA 4TZ0A 2CBZA 3M0EA 2PT7A 1OXSC 3U44B 4LI0A 4X8HA 3B5JA 2Q6TA 4KVGA 1N2CE 2Z6VA 1ZP6A 3VHXA 3GLFA 2F55A 4QKQA 1DPFA 5B2ZA 1FQKA 2ZYTX 1NLZA 4JVLA 2D06A 1GILA 1VYUA 1T0JB 2PMDA 4KBFA 2ZR0A 4A4DA 3IIJA 2NGRA 1ZIOA 2VHUA 4TMXA 1HE8B 2PX0A 1L8QA 2Z5FA 4L4UA 5JRZA 4DB2A 5KUTA 4S2EA 3ZDQA 3VTKA 2CJWB 3FMPB 1EESA 1C4OA 5DH9A 1G41A 2RMKA 3ZVLA 2V54A 5JWRA 5KDLA 4RCYA 4YC7A 1JR6A 2V7QD 3QKSB 3MWLA 3B78A 1K6MA 4PHFA 3TRFA 3QNUA 3LH5A 2ZE5A 4V0KA 4WVFA 4YDSA 1OXVA 3VAAA 2PZGA 2XITA 1JEEA 3QXHA 4NKRA 4JSTA 1G3UA 1NNEA 4JBXA 1XTIA 1NMZA 1XTRA 2WOJA 2QENA 4KU4A 4QNMA 2G9NA 1IJFA 2G83A 1KK1A 1KNXA 1AKYA 2VHQA 4JLDA 5AR1A 4Z1MD 3S1AA 3RRZA 1TUEA 4UNSA 1W48A 1L4YA 1GTVA 821PA 2QZ4A 3I8XA 1ZD1A 2HJVA 2W2VA 4TTQA 1ANKA 1E2DA 1IN4A 1U90A 3IO5A 4M9ZA 4MKIA 3SOPA 5HPYB 3K09C 1W7AA 2ORIA 4FWIB 3RS0A 4URUR 4TN1A 1R0WA 2J7PD 3CM0A 2G0NA 3KJIA 1OFUX 4OK3A 3QI2A 1D9XA 2Z43A 4KSBA 4D4LA 1EWQA 3GJXC 1S2MA 4MRNA 2IYSA 2ZRNA 3GEIA 4AYWA 3UWOA 4L15A 4BLRA 2O8CA 2GBLA 5B64A 1GOTA 3NXSA 1Z07A 3THYB 2IHYA 1ZNXA 1Z6GA 4RVCA 2ZROA 1E2EA 3DM9B 4DDTA 3QEJA 2XB2A 4Z8XA 4KI0A 3REGA 1G5PA 3WRXC 3R9WA 1PZNA 5FPSA 3Q5DA 4ACBA 1G21E 3H2YA 1RRGA 2C99A 4GOJA 1HUQA 2YOFA 2YVUA 1XEFA 1T9HA 2HXSA 3VX3A 4KO8A 5BYJA 1TEVA 5EXSA 1KKLA 4LDJA 3ZVMA 4RY2A 3K9NA 5H8WA 3LXXA 3SBDA 2Y8EA 1OXXK 1SHKA 3BB3A 3LBIA 4AK9A 4Q4JB 3WMEA 4L16A 1M1YE 3LWNA 4NHOA 2JLWA 2MMGA 4ZCIA 4DXAA 5CB8A 2H92A 4BZPA 2R44A 5AJVB 2A9KA 3AF1A 1DE0A 3SU8A 1VG8A 5J47A 3QVVA 4YMTA 1WA5A 1X3SA 2GXQA 3OEEA 4DLTA 2NO0A 4DCSA 2V3CC 5TARA 1W0JA 3OHMA 1Q21A 3B13B 2WJYA 2PLFA 4TQ9A 2XEXA 3KKMA 3MWKA 5FTNA 1XEWX 5JHHB 4AD8A 5FL3A 4PC2A 4MKHA 3LW7A 3OF5A 3BBPA 4URVR 2QBYB 1G6OA 2JJ2A 3T12A 1QRAA 5JJKA 5LB2A 4PZZA 1KY2A 4L5BA 1XCPA 5TV2A 1R4AA 3OIVA 2EFCB 5E3HA 2CNWA 4BEBA 1Z6YA 4XJXA 4JBWA 1CLUA 3JVUA 4EPYA 4D80A 2RGEA 2OEPA 4DLWA 2CL7X 5B30A 4XWKA 3WBJA 2WWGA 1VCNA 1MO3A 4TQAA 4XOIA 5FOWA 4S35A 2QTVB 1ZNWA 2IYRA 1G64A 2ZSBA 5FR1A 2QMHA 1G16A 4MKFA 5D3MA 1GFIA 2CNWD 2ZR9A 3EIEA 1KI9A 5H68A 3IPXA 5K8UA 4G5GA 5J4VA 1NVVQ 2P6UA 1DO2A 1TU3A 3Q5EA 1T8UA 1G20E 4MGKR 4HB0A 1HT2E 4MKGA 3SC3A 1E0KA 3DKPA 5C18A 1JPJA 1KI8A 5FTMA 2WKRA 4IKEA 4UXIA 3H84A 2VBCA 1AZTA 3SYNA 4EPVA 1VTKA 2WHXA 3ZQ6A 1YRAA 4B76A 1LNZA 1R8QA 2QP4A 3EPLA 2R8RA 2DB3A 4UXHA 4TMWA 1J8MF 1GG2A 2FJUA 3GJ8A 1RPZA 3FKSA 4EKDA 3CX7A 2QL6A 4JSYA 3IEVA 1DVRA 3GEHA 1AJEA 4NBSA 1TEXA 2O0KA 4P3YA 1RYFA 4A2QA 1W4CA 4GRAA 1Q20A 4DT1A 1COWD 3MMPA 2HLDA 1X8JA 1KJWA 2GHIA 3T5GA 3QKRA 1R5NA 4DLZA 3A1WA 1XCMA 2CHGA 2IYXA 3ZQJA 4I99A 1WBDA 4PQFA 2BCGY 4JLAA 2GBLC 3I8SA 1QVRA 3EA0A 3RC8A 1XF9A 4A36A 1IXRC 3ZJYA 1W2GA 4OHYA 1Q1QA 2QM7A 4H1UA 1OJLA 5ELXA 2YJTD 4RKFA 2A78A 1P73A 3Q7PA 2Q21A 2G0TA 4L9WA 1US8A 1KSJA 3ZD6A 4MRVA 4M21A 2RGAA 1LY1A 4D4MA 5DNYB 4HB3A 1SXJB 3A1SA 4RFSB 1HYQA 3B1ZA 4DIDA 3W9YA 1YJ5A 2HV8A 3W5JA 1BYUA 2VTKA 3KQUA 1HTWA 4UNQA 2N42A 5BWMA 2FG5A 1GNQA 2ZVQX 3FWYA 4IDNA 5G53C 3BK7A 3SYLA 3I61A 2GXSA 1FX0A 1UF9A 4OHXA 4D82A 2P6NA 4DUGD 4ZKDA 1LV7A 2NO7A 3ZIAA 1N6KA 3GLIB 1VPLA 3JZAA 3WHLA 3PEUA 3QJYA 3O47A 3CRQA 1Z0DA 1TQ4A 1T5IA 1ZNYA 4GP6A 1KYIA 1Z29A 1EGAA 2DFLA 3DPUA 2ZUBA 4LWZA 5AUPB 4JKIA 1KSGA 3THWA 2AXPA 2QE7D 1UBFA 2XZLA 1ZC4A 2W6ID 4GSYA 4QOSA 1NL3A 2V55B 2CHVA 3GLHB 2W2TA 2A5FA 4KBGA 4YXWD 4X8LA 2V7QA 1TTTA 1FL9A 4D25A 5FUYA 3K0AB 3T1OA 2J0QA 2FWRA 1GRNA 3AP2A 2PZEA 5FBRB 2ZI4A 3MRSA 5HR5A 1E9FA 2JJ1A 2OXCA 5AJXA 2WM9B 4TWZA 3QXSA 2WWWA 3FB4A 4FIDA 4RJLA 4Q9LA 2J46A 3KXKA 4HEJA 3RS2A 4CEIA 2EW1A 4QXAA 2CEAA 5JMTA 4QGAA 2DFTA 5JCZA 2I1QA 2OT3B 3FMOB 2ZRIA 1RRFA 3SJCA 1JECA 2RKOA 1XXHA 1CR1A 2ZRPA 4DKXA 3THXB 5AK0A 1SKYB 3IDQA 4LJ7A 1E79A 2H1LA 3VKWA 1XNJA 1NVWQ 2BMEA 2V4ZA 2WOOA 3BIFA 4NDZA 2OLJA 1IOZA 4TT3A 2NOAA 1OH5A 2GCPA 1G4AE 4MRSA 1G17A 4ZV4A 3KQLA 1W0KA 2XXAB 1SKYE 1HEIA 4J0QA 2PCLA 4G01B 2XNDA 4CT5A 4Q4LA 3CWQA 4Q19A 1AGPA 2NG1A 1L4UA 4LYFA 1F2TB 3A37A 3FHCB 5BQ5A 2QBYA 4EPXA 4JL6A 3C4JA 4BE7B 3TNFA 4DJTA 1WP9A 3L82B 4Q4HB 1F5NA 2IF0A 1AQYA 1D8TA 2DWPA 3P1JA 4Q9IA 3TUZC 1TQDA 1FTNA 2CE7A 2IXGA 4JYBA 2FNAA 4M1TA 1Z8FA 1ZM3A 2V6IA 2OSBA 5GJBA 1GIAA 1XDBA 2IS1A 1E1RD 1AIPA 3UWKA 2Q3MA 3ZS8A 1R7RA 2EWVA 4ESHA 3AKCA 2R2AA 1XMSA 2GEUA 3AUXA 1G7SA 721PA 5JI2E 1YZTA 1F2UB 4OKSA 1Q22A 1QHXA 2ZVPX 4IXNA 1TL7C 2OXRA 4AYTA 2FA9A 1D6JA 1W44A 4Q1CA 1VG1A 1WMSA 3PG5A 3E1SA 4Q7LA 1GAJA 5A4JA 2FH5B 1IM2A 3TQFA 2HT6A 4YLGA 1JAHA 3CB4A 4NONA 3X1WA 3U7HB 2GJAA 2WVJA 2HT1A 4QGGA 3K9HA 1CJUC 4TYPA 4DUGA 3R9IA 3C7KA 1XPUA 4ACAA 1R0ZA 1LF5A 3SN6A 4NCJA 3RS4A 1KJYA 4GPTA 5E7IA 4DSUA 1WXQA 5DYIA 3CRRA 1IN8A 1KZ7B 4W5JA 1W1WA 1ZM7A 2WSSA 3U3JA 3ASZA 4YONB 4AY2A 4Q9JA 4N0EA 1J2JA 2AXNA 2EU8A 3SQWA 2VF7A 3N70A 4JKYA 4NCHA 2OILA 2J0UA 1KO7A 3IUYA 3UG6A 5DYGA 2MSDB 4GFDA 4LY6A 4FWTA 2W58A 5BN5A 3NHAA 3KKNA 1ZU4A 1II8A 2FU5C 2N1BA 3KB2A 4TMKA 1OPXA 4BQSA 5BYKA 3PVSA 3MSXA 5KHOC 4YMWA 3T35A 3SZRA 5LD2C 3AVUA 3BB1A 4EJSB 2ZXUA 3EZFA 1EK0A 4L9SA 1KK0A 4OI1A 1P62B 1DAEA 1KI6A 5FOUA 1EFCA 3X2SA 2G1KA 3CPHA 5A5GA 1XD9A 3UK6A 4HYYA 4M1OA 2WKPA 3VHLB 5G3YA 3TW8B 4KITB 3AKDA 1ZNZA 4TT3D 2FF7A 5EUQB 4B71A 2QQ0A 3Q9LA 2QROA 2PMKA 4D0NA 1ESNA 1CR4A 1II9A 1M7GA 2IBMA 4JS0A 4FXPA 3A1VA 3I73A 1UDWA 2N46A 4EAQA 3H0KA 5IK2A 2DFKB 4FMCB 1OKKD 1S0UA 2UZIR 2IYYA 3MCAA 5JBQA 1WB9A 2QI9C 4CW7A 1NBMD 2RGNC 2JGNA 5CB6A 1N3BA 3EZ2A 4GP7A 3OFNA 2GJ9A 2VF8A 2EYUA 1KO8A 5FFMA 1XB2A 4POAA 3VMFA 1Z83A 2FSIA 1OE0A 1YZKA 1M7BA 3RANA 1OH7A 2J0SA 4MH0R 1TF7A 2JDID 2JEOA 4GL2A 1XJ0A 1Z2CA 2DPXA 2JIZA 2IYQA 1LW7A 1FUUA 3IEUA 5DIFA 4C0HA 3C14C 3B82A 2ORVA 2Q9BA 3OAAD 4LPKA 5FOSA 3LQQA 4PC3A 1N6OA 1Z2AA 4B2IA 2KWIA 1W5SA 1XTJA 4DDUA 4K8OA 2FSFA 2VHJA 3K8YA 4E09A 1KJZA 3NBZC 2JLUA 3RRYA 5HCNA 2R62A 4LV6A 1Y3AA 3WMGA 4AURA 1BOFA 2PEYA 2IA5A 4HZUA 1AS3A 3GQBA 2NZJA 3MD0A 3ONWA 3QKTA 1ZD9A 4BRWA 2IF2A 2YKGA 1PJRA 2ERXA 2AD1A 1KIMA 3KDSE 3L2OB 2AKYA 3HR7A 5EP1A 3T34A 3U6KA 2ANBA 2Z0MA 3AEZA 2MSCB 3K9LA 5KO2A 1T3HA 1ZUIA 1HV8A 4RD2A 1CULC 3FPAA 5FUXA 3SFVA 4DLVA 1QBKC 2V8OA 3LVRE 3NH9A 3SI7A 2IWHA 3R9XA 2WJHA 2HDNB 3B2EA 3AVQA 1E99A 4PSAA 5DN6D 4DB4A 1UEJA 4XWAA 1KO5A 4TSFA 4B73A 5BN3A 4H1VA 2ZRCA 3LBHA 4D4JA 2ZRLA 1UKYA 1VHTA 3BH6A 1Z06A 2VL7A 1DAKA 4B3GA 4B6EA 1G3MA 3TIFA 4EDHA 1NIPA 3K9GA 4PHHA 1T8TA 2J87A 2ODWA 3KKPA 1NG9A 2PJZA 3E2IA 2AHOA 1WQ1R 3O8CA 2KE5A 1HA3A 1QDEA 1FFHA 4CT4B 1TQ2A 4DCNA 3I1FA 3NC0C 5FPKA 1CP2A 1Y63A 4OJQA 1VCOA 4LYJA 3NBFA 4G5RA 3U7GA 4V0NA 4M1WA 4YQFA 2GTPA 4B3BA 4JLBA 1JQLB 1YZGA 4JLJA 4PSVA 3PCRB 1QHGA 2J7KA 2RGDA 1PLJA 2ZJOA 3BOSA 3P20A 2ZIAA 3THXA 2O8DA 5KNDA 1JALA 3T06B 5L3SA 3BS4A 3TR0A 3N5CA 2AR7A 2VP9A 1RKBA 4JJZA 4BRUA 1RC8A 4L8GA 1J8YF 1LVGA 1S1CA 1ZBDA 4QNRA 4RSGA 5DSZA 2D7DA 3WBKA 4K81B 2KJQA 4MQBA 3UG7A 4C0KA 4F38A 3BFVA 2UZ3A 2FDCA 5EXPA 1LFDB 2QTHA 4OI4A 4M22A 1RE0A 2C8VA 1SGWA 4MUAA 4IFEA 4EUNA 4G5QA 1HE1C 1CKEA 2X77A 4FN5A 3UANA 3R7WA 1IY1A 1F6BA
chains in the Genus database with same CATH superfamily
5DRYA 5EXXA 1N5RA 4PLWA 1RHJA 4JC5A 5FI5A 3Q15C 3NC1C 2G9ZA 4HTFA 4AMGA 4J1NA 2PLNA 2YBEA 3GCZA 2C00A 3AP1A 3KD3A 3R0VA 3FCXA 4UDNA 4IJMA 1KDPA 1VPVA 2NN3C 5DNUA 5K3FA 1TFUA 1Y8QA 4JXXA 2BF4A 1BDHA 1X87A 4D1YA 3OUUA 2GN1A 1OFVA 2QG9A 3MQFA 4EUKA 4PIVA 4PR3A 3ADBA 4F3KA 1ISFA 1UMDB 4ASUD 4G0NA 1OKKA 4TTSA 4WOKA 3IODA 4LV5B 4XQGA 1N5KA 1NW7A 1YKSA 2R6CA 3M6LA 4LJYA 4WY8A 5IJXA 3UK7A 1SEPA 4DA0A 4G9BA 1VLVA 4DNFA 4QBIA 4BBAA 3EH2A 3JATA 4JAVC 1BE0A 4C0QC 2QPLA 2BL4A 2QJFA 3N5KA 3I3SR 1EFVB 1MHPA 4JOSA 5JARA 1YFLA 2RJ3A 4G1BA 4KMRA 5HM6A 2ZSAA 2AKEA 5K3BA 1YB2A 5TIIA 5IAJA 2O3SA 2J07A 4L4ZA 4DMRA 2GFHA 5G41A 3X1XA 2ATCA 5JOQA 1P61B 1XQYA 2YXBA 5F2OA 4I1OA 4NEGA 3RASA 4EJSA 1PX0A 4IX1A 2QMZA 4Z1OA 2FFHA 5K0NA 5P21A 1Y5RA 4NJMB 3TK1A 4O4JA 2YY7A 1NTOA 2R8YA 5CNMA 3RAPR 3U0VA 2H4YA 2CDAA 4X24A 3SEZA 2VUUA 3U44A 3HMQA 3NNNA 1DXQA 4JZYA 1JFRA 3F46A 3FH0A 2GWRA 3WOVA 5I4KA 3FNRA 2IYFA 4X1YB 1UMBB 5JHGB 3KG2A 5JCJD 1EP3B 1X80A 4LYAA 1NXQA 2HQ1A 3R7FA 4ATNA 3ERCA 3R7SA 2XGJA 3MWGA 4BU1A 3ZW9A 1NQVA 3ND7A 4C07A 2KLHA 3E1KA 5BP7A 4R68A 4YRQA 2XT9A 2NVWA 3AUYA 4C0JA 1YIAA 2OFXA 3U39A 1E2JA 2CXQA 4R40A 3U4DA 4WHMA 1OYWA 4H7FA 3ZCUA 3PZBA 3QELB 4NL4H 4XSVA 2HMSA 3EFBA 2HLHA 2OLKA 4J1QA 4ZP1A 4E2FA 1FC0A 5I9LA 5IKXA 1E1KA 1GQFA 4LSZA 2JHFA 5EERA 4DR3B 5KO2A 3N07A 3PHIA 4HWPA 2JAHA 4M0KA 4QOGA 4B7ZA 4BMSA 5L4LA 3H99A 4GGMX 4DZZA 3IL2A 4HX9A 3H2BA 3L7LA 2JLCA 1IZ8A 3L0IB 4W1RA 4AZ3B 4MZDA 3C24A 4OM8A 3H86A 2YOHA 4K28A 4JGBA 4I19A 2HNBA 4KACA 5JXHA 1JEOA 1L7MA 4A0SA 1QPBA 1DAFA 4U2DA 3IUNA 4R1PA 4AN1A 2IVZA 4K88A 3R5FA 1DAIA 2ZR7A 2X23A 4B48A 3KSMA 5B37A 1J0BA 4WOBA 3VH1A 4EPRA 2RE8A 4ZVSA 3AFMA 1VMKA 3MILA 4M8IA 2RGGA 4G1VA 3CEPB 2I34A 3RYCB 3ZQUA 2GAFA 4ZCPA 4ETWA 1REQA 4GUAA 4FB4A 3NIGB 5ICFA 3T95A 1DAPA 2O3UA 4KSYA 2OO5C 4JUAA 4F4IA 2R4QA 3HMKA 4ERXA 1M1YB 4ENVA 1U3CA 2WIJA 1BU8A 3CZMA 3EK2A 4PYIA 1DIAA 1UK9A 1PWZA 4L5AA 1F6WA 2BFMA 5KJFA 1XZFA 2C5HA 3E2PA 3INNA 3MOSA 4J6EA 2NU9A 2XCQA 2QVZX 3H3XA 3EZXA 3EGOA 1FW8A 1G6HA 2GYYA 2OB2A 3JS5A 4XB2A 5AOVA 4FYMA 4WLFA 3OWHA 2KSQA 2RKBA 2YH2A 4ND3A 3VPFA 4BHTA 5EQFA 4AECA 2OQ2A 4BLPA 3AOGA 3O9VA 3T1YB 2WFAA 1BEUB 1F14A 3O82A 5IZCC 1N9ZA 4QOJA 4I2NA 4NFYA 3ZY2A 4KXLA 4ZU3A 1TIPA 2RAFA 4U9HS 1POWA 3ZXSA 1YCFA 1C9YA 1LPMA 1G2QA 4HMOA 1J0CA 3RIHA 2C3YA 3KVVA 3ZDAA 4I4CA 3AU9A 3BHMA 4L7QA 5KX5B 3G0IA 2I4NA 2ERYA 2N3ZA 3ZD8A 5KQSA 2AOTA 3ZIAD 4GSKA 4J0DA 4I1UA 2QGZA 2F6RA 4G0QA 2YJZA 4IDAA 4UM9D 3SKXA 2CUNA 4TUYF 4N7RA 3SG0A 3FGPA 1J0XO 2Q29A 3STVA 2C2GA 4L9RA 5HQ3A 3P45A 4FFRA 1ETHA 1ECJA 4JI0B 2EFHB 1G2OA 2A5JA 4B43A 1L3BA 1M8KA 3EWNA 5ESXA 5KHLB 3ISVA 3QK7A 4FYKA 2VS1A 3UJPA 2Q45A 3NT5A 2O2EA 1BJTA 1AKRA 1NJ8A 3L1VA 4ROTA 2ID7A 3ZLJA 1BHJA 1GQSA 5A0TA 5JPDA 2XUQA 3RJTA 4LY3A 3PV0A 5DYTA 1U5BB 1WPXA 4IHJA 4QHYA 1SVKA 4A26A 4QT4A 4TKLA 4P4LA 2VYFA 3MWEA 1R00A 2G07A 5E2BA 5LYJB 4JI8B 3H16A 2AQHA 1WV0A 3CW2A 2IX3A 2BSXA 3A4TA 1JA1A 4XVCA 1L5FA 3E70C 3KYCB 3VR6H 5IT5A 1P4SA 2M6SA 1XNRB 3BGSA 1E2GA 3C3CA 4KQ2A 4KDCA 2J85A 5EP4A 5KHAA 3RG8A 3ZNOA 3PCXA 3VNVA 4JT2A 4MP8A 2B7BA 3AR2A 2XDAA 3PUKA 3OU6A 4MW2A 4NDAA 3WYGA 2H5JA 2QZJA 3PA6A 4G1UC 2DTDA 5T4HA 3TOSA 4C2BA 2CMDA 2PRSA 3CZQA 2OBNA 1V3VA 3QMPA 4CFZA 4DIUA 5I7EA 3N58A 4PHGA 5FOXA 3NWJA 4AS3A 3OPMA 4OBEA 2ZJYA 3A0UA 3BEDA 1CUGA 3ITKA 4X91A 3TCNA 4BEVA 4C4PA 5A4FS 1X1TA 2ZZNA 1FLVA 2I3BA 4OHVA 2YXDA 4JQYA 2VSFA 2AF3C 2O2XA 2XB4A 4QVKA 1MVNA 1GPLA 4UE6A 4HNAA 2DQKA 2XSZA 3Q3JB 3RYIB 2A92A 2F3RA 5DM60 4GE0A 2EJVA 3TX6A 4N3NA 4RM2A 1H1LA 1YDEA 1RDFA 3EDOA 4EWLA 1AA6A 3B7GA 4AQYB 2A4MA 4ZYTA 2E4XA 2YRXA 2WU3A 2N9UA 1UFKA 5J5AA 3TVTA 2D0IA 4DA8A 3OZCA 4GBJA 1K0UA 2FX2A 4RF4A 4CKCB 5JRDS 3STHA 1GARA 4FYXA 1JHAA 2C5SA 5BNWA 2R9VA 3QG5A 2ZAIA 4JVNA 3BRQA 5COQA 2GZMA 2ZJ8A 5L4NA 5MFPA 4ZGGA 3G2IA 3EDQA 3O6VA 2Z1DA 3FUCA 2BEWA 2BKVA 1IBRA 2NU7A 1L5QA 5H4HA 4BIIA 3FMVA 3AY0A 4I81A 4EI2A 3LUJA 4HRVA 3TI7A 2EFEB 2O8EB 2H9YA 4L0DA 5D2CA 1V11A 1V7QA 4LVOA 2C42A 3LBYA 3UAZA 4NCAA 5HE8A 3AI3A 1E9VA 1CQIA 1KTVA 3MK31 3FNFA 3PLAE 1H2FA 2FP4B 4E15A 4Y2VA 3E48A 4BLQA 1KZ9A 5CVJA 1QZZA 2HMUA 3CW8X 3IIKA 3FSGD 1AUPA 1FYFA 4AXXA 4B81A 2QU8A 4Z9BA 2REQA 2Y1WA 1MZVA 3BGWA 3BM5A 3SSAA 3TR6A 4DSTA 5L7TA 4EENA 2M6KA 4R6XA 4ZJZA 1Z82A 3IESA 1GPKA 3TLKA 3A1TA 2O1WA 4S3MA 5CBKA 1BJRE 2ONCA 4N47A 3SQOA 1M10A 5JFGA 3PWKA 4HDKA 1T0IA 2ZPTX 3MTEA 1MVOA 4JDPA 3I28A 4X66B 3NAZA 2D2EA 4OKNA 5ALZA 5B12A 4IKPA 1XRRA 3FYHA 1M6WA 2AJTA 3I5UA 1KAQA 3CURA 1PLKA 4TKUA 4BO3A 1X9GA 2WZBA 3ZBPA 4FJ1A 4M87A 4GI2A 3GUUA 1JJFA 2L82A 2CC2A 2E1RA 5TSDA 1VLZA 3KXDA 1PJTA 5DGDA 2IEDA 4PZ9A 3KUCA 2CXHA 2V0NA 2OD9A 1V1RB 3MRXA 3RNLA 4IJ5A 4BUJA 2H17A 4J16A 3MUEA 4WXRA 4YUWA 3G88A 5GGYA 3WRWA 3RS5A 3F9IA 4QUIA 3FYDA 3QX7A 3ICWA 4P4NA 5FEMA 3DDNA 2JAPA 1WBBA 2JZOA 3A9SA 2Q4OA 2YMMA 3SYKA 1XKLA 4YMSA 3UFBA 1DKLA 4NCNA 1GYRA 5CLJA 2IUSA 1RWKA 2MHCA 1JV2B 2FW6A 2XHZA 3LBAA 3O4FA 1T3LA 5KVSA 1NSFA 2BHSA 3DOHA 4JJ8A 1AKMA 1PW5A 3FMIA 2BD0A 2XF8A 1C3LA 3SJZA 4EUSA 3DE3X 4LRXA 2Q3LA 1GV0A 5J40A 3GLQA 3KTAB 3NHSA 2ONKA 1ESDA 2ZIVB 5ESWA 3V7FA 3WP0A 5SY9A 3FFBA 3UPUA 1A9ZA 4NAUA 4C04A 2YHIA 4WRRA 1HZZC 1G3QA 2YZNA 3D2LA 4OGGA 3T5AA 1Y1SA 3DHEA 2HBRA 4Y6SA 3MT9A 2JIMA 5KTOA 1VDMA 1GQQA 3AY6A 5I9TA 2CMHA 1OLXB 2FPSA 1OZGA 4C7BA 4G9EA 1E2FA 4MV8A 5KOYA 1ZINA 2Y2VA 1SVSA 2VNAA 3NJ4A 4CKEB 5IFKA 1P7YA 4KAAA 1JVBA 3M5PA 4EQZA 3QSYA 4P0PB 1B8UA 5BNFA 3RWBA 5U1PA 4R1OA 3EVNA 2EDAA 3OT5A 2QVLA 4BWFB 3AVVA 4Y6LA 1URPA 2Q3HA 4MHOA 3SIXA 1QPZA 1YS1X 5DGHA 1ZM9A 4NYJQ 3O5AA 4LQDA 3HRIA 5JFOA 2QN9A 4NRDA 1IWBB 1C1DA 1OXTA 3AJRA 1P2DA 3D7KA 3DDWA 4OHBA 1BC5A 3VJMA 4IJKA 5CMLA 3IDZA 3W3AD 4CCYA 2CHUA 3ZWQA 5HRAA 3EZYA 3OAAA 5LXTB 2CFSA 4TPKA 2DUNA 2VQDA 4YIKA 4OMFG 3FHOA 1LI7A 3T7KA 1VG0B 1I7PA 1OREA 4OXYA 2VPXA 4B7XA 1UJ6A 1PG5A 2W2PA 1MB0A 3KYCA 4DLUA 1L5ZA 4UCFA 5D7NA 3R0JA 1U3TA 4XI9A 4E1AA 1XTTA 3UMGA 1IWPB 4DQVA 2O0MA 4RHTA 4JJ7A 3ANTA 3HU5A 4LV8B 7ABPA 2AI3A 4BNZA 2C0PA 1KFJB 3CRNA 1IPFA 3I6ZA 1FVHA 2MYPA 3BJZA 4R9RA 5A1JA 3K94A 1EQ2A 3KZMA 1I4LD 2PSHA 3KUUA 4FGWA 1NG1A 1BE6A 2EG5A 4RD3A 1FMJA 3NV7A 1DKUA 4FGZA 1FNCA 3BGIA 1FU4A 1VLMA 3NC4A 4QOEA 5C1PA 2CYAA 3SSNA 1ZN9A 2GPNA 2ODBA 3PWZA 4NFLA 4CLOA 4K3UA 5LJIA 1CY0A 1XZPA 1A04A 4Q1VA 1EUZA 3WLRA 2OZEA 1RS0A 1VKRA 3GNQA 3B51X 1UXHA 1NW8A 2FSVC 4US2R 4RGVA 1ZO8A 4A23A 3TJZA 3N2IA 1V16B 1BX1A 4FINA 5JYCA 3BGVA 3G7SA 2ORYA 2YWJA 4RCVA 1XXHB 2QXUA 4CMAA 2IY8A 2HCBA 4W5RA 4RBNA 3OJEA 4KAXA 2AF4C 2B0CA 1TT5B 3BDIA 2ERCA 1X19A 3A2LA 4HMPA 2WYHA 3PQCA 3U1TA 4MW1A 3ZV7A 5FEUA 3BIJA 5KINB 2JPDA 4HDQB 5F9HA 1Y4UA 4FDMA 4QHSA 3OZBA 1U2QA 4MQEB 2WDZA 2JEZA 1JT2A 3K32A 2AN9A 4RLHA 3RKRA 1C3JA 4G4GA 5I7WA 3Q8KA 3GLGB 2XCIA 4RGQA 3ZKAA 3O9ZA 2Y93A 3PIRA 1TPZA 4NBLA 1JDJA 1MEEA 4GX2A 2L18A 3QE0A 5HMMA 1NNSA 2AR9A 3DONA 4MYTA 3KCNA 3VSDA 4D9MA 1OHHD 4RL4A 4CL0A 5F64A 4BNYA 4MCIA 2XA2A 1P91A 4KG7A 4G6ZA 4UVGA 1FXSA 3IERA 3NORA 221PA 2VJAA 4KX3A 5FOVA 5J2UF 5FUBA 5DM4A 3V2GA 2GTHA 1J70A 2P1DA 3IP9A 1L8OA 2ZULA 3CMMA 1MXHA 1I7NA 2P5TB 1JHDA 1VMIA 4FT4A 4ZREA 4BU0A 4D8TA 3N8KA 2IS4A 5IAOA 3TPFA 3HI4A 2FW7A 1T9AA 4QGBA 4WK2B 5KJEA 2JFVA 3T9EA 4CL2A 3UCFA 1QH9A 1MQ8B 3FR8A 2JJYA 2B7CA 1QH0A 3FPCA 5JYDA 1A8HA 1MA0A 3W2EA 3SYMA 1A0OA 2NO5A 3PWTA 4PF1A 4ZICA 3GZNA 2PQ0A 2W6JA 4IQ4A 3UUWA 1I7SB 2QMUA 4RORA 4X93A 3O8QB 3GLFE 3SBXA 2IEAA 3T1NA 4E7OA 4JNKA 1SVWA 1CUAA 2B0JA 5D85A 2PX2A 1WCYA 5FNVB 4ARZB 4U6NA 3T3MB 2A2ZA 3NAMA 2BMDA 3TZHA 2JLSA 2Z08A 2GCNA 2GD6A 3U4GA 3LFUA 4MWOA 4LA4A 1JJ7A 4AC9A 2Y1OA 3DVAB 1RKQA 2XUAA 1UMKA 1Y48E 3RC2A 3CNOA 2CUZA 3UOAB 5JZVA 4DTCA 3TI9A 4YRRA 1OB5A 2J9GA 1HZZA 4HWGA 3KTOA 1IQRA 3LLUA 2H07A 3MTJA 4LBVA 1CVIA 2WHRA 4HDCA 4TV9A 2AN3A 4D97A 1I01A 1MQAA 4WA7A 2WKWA 3IAFA 3TBKA 1P72A 3NHFA 2YRWA 2Q4EA 3ADDA 1AA9A 2R60A 1NQOA 1AN0A 1UMCA 3OFND 2C54A 2QV0A 1CRWG 1NKTA 2JZCA 4XD7A 3U3OA 3VR5D 1T5HX 4YJDA 1FDVA 3RFXA 3ZBTA 5B57C 2O3RA 4K6CA 5AKGA 3BWVA 2FFBA 2RONA 2GS9A 4CEHB 4H27A 1LQTA 2GPTA 2IYAA 3LG2A 4KOAA 1ACLA 1W85A 1O54A 2FX3A 1S2DA 2IEYA 6PFKA 5HKKD 1KDRA 5IJZA 3CVVA 3AFNA 4MIEA 3A2KA 1RRKA 2FZKA 2ZYGA 3IC5A 3KQVA 3LF2A 3FUVA 4NYMR 4FKMA 4OQDA 1IOVA 4RK7A 1YCDA 2AE2A 3TXXA 1Q19A 1WF3A 2OOSA 3LOUA 3ND9A 4JBYA 1ORIA 3JQCA 5A06A 5LQMA 1PU2A 3D8TA 4UCWA 4HWOA 1GEGA 1WG8A 2XUHA 2ZWMA 3ND8A 3DO5A 1I1OA 4G8BA 1H0SA 2QNIA 1SQ5A 3G5MA 4TKVA 1RJFA 5HG0A 4EJ0A 2HQBA 3OY2A 4MS3A 3KWLA 4XWOA 2IIQA 2FLWA 4MKRA 3ZHOA 3MWYW 4L5IA 3ZV4A 4C20A 3PPIA 1KMNA 2FYTA 2W2LA 2PM8A 4RKEA 4YP6A 3IR7A 1JX6A 4KRYA 1YVDA 3GLRA 1K6IA 1TM1E 2IFTA 3THRA 3DFFA 3L0YA 2YR0A 3I9FA 2EIHA 4W8GA 1D8AA 4D9HA 2IK8A 3HJBA 3L46A 1XCOA 2RB4A 3OQOA 3MOGA 4X54A 2SKEA 4QAQA 3AR5A 4KODA 1CVLA 1FTYA 2ODAA 1TTHA 5AKKA 1CTQA 4AF7A 1YIDA 521PA 1VMAA 4KO3S 4KK3A 5DTJA 5LC1A 2O48X 4DPLA 3F3SA 3IMCA 4YAFA 4YFVA 1GZ4A 3SLGA 3CF6R 2ABWA 5FTWA 1ZD2P 4DABA 1NOKA 4MA5A 5DNAA 4ZMRA 3AV0B 1OI3A 3AUJB 1EI9A 5AIAA 5FFFA 1OT3A 2Z9BA 2J4CA 4TZTA 3PRHA 4IDQA 4AUEA 1O94C 4GZMA 3TM4A 4C06A 4HATA 3WYFA 1BEEA 3FF4A 3EA5A 3O93A 3AKZA 5BSFA 2W2MA 3PLNA 3ORYA 3DC2A 2OQRA 3TGPA 2VZ0A 4AJLA 4BMOB 1HFEL 1PGPA 2QUHA 1F3OA 2IHTA 3LAWA 5B6PA 5I5GA 5BR4A 3AEKB 4ZQFA 2E4VA 5BT9A 3RVQA 2O54A 1TT7A 3GMSA 3VKGA 3A2MA 4RESA 1KEEB 4DT1B 2VDPB 1B0UA 2FZLA 1FTWA 4HLUA 4IDFA 4KE6A 4UATA 2J6HA 3ZG6A 4DEVA 4NZZA 4M8KA 4EMUA 2GXAA 4IGAA 5K0FA 5I9IA 3EEYA 4MA4A 1YU9A 4X7BA 4U7PB 1KVRA 1X74A 3FVRA 1Z88A 4ZPXA 2RFLA 4RDIA 2JFUA 4GP9A 1FRNA 4UQOA 4UFNA 1S2NA 4HGZA 4LZAA 4P3OA 1U04A 2RGNA 5CVUA 4RIFA 5F3WB 2WWIA 4HXGA 4IIFA 4TLAA 1DQPA 1OX5A 4EGQA 1E7QA 3IKLA 4QPPA 1U8CB 2OK8A 1GL3A 4WIAA 5LL6P 4QD3A 4NF2A 1R2QA 2QN6A 1N1EA 1TZBA 1UKEA 2FAXA 2AG1A 2Y05A 3SLRA 1AOXA 1N25A 4OLFA 1RQXA 3JVVA 3OX4A 3E18A 5KNBH 2HMAA 1C9KA 2VXYA 3MM4A 4ZODA 5JUWA 3ZE2B 1JR3E 3KQTA 1W36B 1RM4A 3C3BA 3KKOA 5HK9A 3RT7A 3BCRA 1WVMA 3LY8A 4ZVNA 2PT5A 3DYVA 4ZO7A 5E9JA 3GLKA 1P7ZA 3GJ4A 4Z7QB 1VE3A 5EMHA 3UGQA 1QFSA 4MW0A 3BGOS 3HWWA 5L45A 4RPIA 1XL1A 4BP3A 1SKBA 1Z8DA 1PZMA 1A8SA 1HBJA 5J1TB 3P2KA 1QYXA 5HUQA 2XNJA 3ZGXA 3EGEA 4MYUA 4TKUB 3RUCA 4ZEXA 3TUJC 5K6AC 4GX1A 5TF0A 2I5PO 3JRXA 3HRHA 1ZFNA 5C4MA 1P2GA 2PS0A 3JWJA 3VVMA 1RQ2A 3EPKA 2AQIA 4HNHA 2YJ6A 1WHTB 4CTKA 3EIQA 3QVWA 4N49A 2R6FA 4JUDX 4FM9A 3EW9A 3THWB 2C57A 3DDHA 3ENVA 2XT0A 2NWQA 2OCYC 1HDOA 3A4MA 2BOVA 2OAEA 3FRJA 4C7KA 2D6FA 1MZPA 4WOPA 3IXLA 1C0IA 3AEXA 4JLNA 2JLZA 1TZCA 2FPMA 1UL1X 5K8CA 2BSAA 1HNXB 3EEBA 2W6NA 4MQ4A 5EMNA 5BYAA 2GO7A 3MT8A 2FPKA 3WWPA 4ID9A 2HHHB 2DHQA 4QJ5A 3KBOA 1RIIA 5L95A 4H6WA 3HADA 4MWCA 4P6VF 3UTCA 3UB4A 1YTLA 1UFVA 2EGHA 3NTXA 2PX4A 2QM8A 4FZ3A 2OMKA 3T5DA 1F0PA 2P7IA 3N75A 2WU8A 1JF8A 2OCIA 3ZWYA 1M6NA 2ZTUA 2IKQA 2UZ1B 1ZM4A 1GGEA 3OU7A 3DNFA 2HX1A 4PSKA 4PLYA 4WECA 2SBTA 4HUQB 1ORDA 3T3HA 3X1MA 1SD1A 4B80A 1MD9A 3M2TA 1Z0AA 2AS0A 4UVDA 2Q0QA 1ESZA 2C4HA 2KBFA 3L4SO 1WPRA 3LT0A 3HA7A 1L2TA 1Z6PA 2J1LA 3MGGA 4HN4B 4O25A 4UREA 5HKBA 3CO5A 4QOIA 3AWIA 3B6JA 1AGXA 2QAGB 2VWHA 2W2QA 4ARAA 4J76A 4BRZA 4C3UA 2P0YA 3AIKA 4C1BA 5AJHA 1R9MA 3L7AA 5TX7A 1LC0A 1UP4A 3Q3GE 3KELA 3UV7A 4BNXA 1X1DA 1E1YA 3ZNQA 4TXHA 5KKNB 4N82A 3KVRA 4M3NA 1HYEA 1J09A 1IUOA 2F3SA 1IRIA 3UHFA 1AKEA 1CU1A 2WMOB 3WICA 4TMFA 4U9IS 4PGHA 1J49A 2QUZA 3QLEA 4R0NA 4UNPA 5HF5A 2DETA 3MWJA 4BBJA 1BGWA 2W6OA 4LYDA 2WWHA 3H7AA 1CQXA 4RD6A 3EZ9A 4E88A 3OICA 2FF5A 5FO0A 5C46F 1MT0A 3OKAA 2GLTA 5AJZA 1ZRSA 4BZXA 1GWNA 2QAJA 3FYCA 2ZAOA 3Q7TA 4DMHA 4BE4A 1ZJ6A 3I2KA 5I7RA 1EGQA 3CRMA 10MHA 1AZWA 3DULA 5FP0A 4CM4A 5FH9A 5HJ7A 1TKCA 1E3SA 5YASA 3ZW7A 1G9TA 4BX8A 4G85A 1DAGA 1M5TA 2ACEA 2VXOA 5IKOA 3P9CA 1KPGA 1R74A 2X8JA 2GHTA 2MYUA 3QITA 3BH0A 4LHSA 2JI8A 2NXNA 2QAIA 2QL9A 5CA0A 3S44A 4EG8A 3MJDA 3GA7A 2A1UA 5L3RA 1Q0SA 2XZPA 3L8MA 3TEFA 3IMEA 1F0NA 2I2FA 1V6SA 4KHZA 3O0DA 4UEKA 3TKAA 3OT1B 5JLJA 2HO4A 3S2ZA 5MGNA 1BS9A 1YHNA 2J67A 4QFBA 3FZYA 4D81A 2A58A 5JS8A 3NUGA 1JAIA 4G07A 2UXBB 4LF7B 1T4CA 5AXBA 4BN0A 2R0QC 1K3FA 2VJPA 2GWHA 1ORHA 5AVVA 4AN4A 1UM9B 2OOKA 4XWWA 2VDWA 5HA5A 4Z54A 3UXEA 2DERA 3WI7A 1ZN8A 3K4QA 2B61A 4ZIRB 3Q0IA 3FSJX 1DAOA 4CODB 4LWOA 4PLHA 5IU6A 1T4GA 1R6XA 3U1BA 1QRTA 1U8YA 1EFRA 1O5IA 3GJTA 1J00A 3CX3A 1Y42X 1T24A 4OREX 1O0CA 2IX9A 2IIPA 1S1MA 3DKVA 5HILA 1RAIA 3LXMA 4TLDA 1KRXA 2VKQA 4C9BA 3AH8A 2GILA 1SCNE 2BI8A 2BZSA 2CFTA 4F1KA 3EJWA 3ZWDA 3WAJA 3S0JA 1E9EA 1L9XA 5AM0A 5E6RB 1ITZA 1L5NA 3HCNA 3SVTA 1C50A 2BZ1A 1XMIA 4FUQA 4PZLA 3H2KA 4RAQA 5EGNA 1Z22A 4AB1A 1EZ4A 3VTZA 2QT9A 1T2NA 1EGMB 2G40A 2XV1A 2EZ8A 1ND6A 1G5RA 1NRJB 1XVIA 1P0PA 1TF5A 2C4UA 3Q12A 1KSHA 4I50F 1SIOA 4UHFA 4B2YA 4ZEWA 4LI3X 3KWMA 2H1HA 2C84A 1AGRA 4KOEC 3WSVA 5DHPA 3CLUC 4R2MA 1XT6A 2F17A 3AYZB 1Y7HA 1HRDA 2LKDA 2VNHA 5HDBB 4RS3A 2NUAA 1Y3DE 4B32A 1X1SA 4D8UA 1NBIA 4OMCA 1JG1A 3ZBQA 3M4ZA 4F4FA 2BGWA 2O8BA 1Z5ZA 2QE6A 1T8RA 2IPLA 1FXUA 3H4IA 4MWBA 4WACA 2W8BB 3QKUA 4FCVA 4GAEA 4ECAA 4IOKA 3DBIA 1KGDA 3G2HA 3PXCX 4IHQA 3O84A 3KXLA 3S8EA 3U56A 1KZGB 5KQGA 1XBTA 1KO1A 1PJ3A 3W7VA 2VWGA 4OFBA 1YR3A 2H8GA 3EXIA 2ZBDA 1EVZA 3FPHA 5IVPA 2ZI9A 2OHJA 3E6AA 4RQTA 5K5EA 1A1VA 2WFMA 4RA9B 1JG4A 3H1TA 4II2A 2P2SA 2PSEA 3NDJA 1UCFA 1UXKA 3OETA 5FD8A 4R2IA 4BVBA 4NCKA 4PPQA 5KWJA 1CJTC 2O2CA 2QN8A 4NMWA 4OA5A 1RNLA 3G3EA 1QCCA 1WMBA 4IIYA 4R1MA 3REQA 3WB0A 1T9ZA 2EHDA 4YALA 1ML4A 2ZGVA 3VDNB 1JIKA 4G5YA 1KMCA 2EZ4A 4HN9A 4L57A 4MPDA 2C5LA 3WJAA 4G1CA 3CTMA 1UOOA 3EXEB 2EHJA 4FR2A 2YINC 3BT7A 3GUCA 3C6ZA 4V2UA 1WDLA 3KB6A 2OD7A 4H7IA 3ENKA 1KYQA 3GUVA 3C70A 4TLBA 2REXB 4EW1A 4ZJPA 2RAPA 2VAPA 4NDNE 1VGRA 3CF2A 1GYQA 2H1OA 2H54A 2PZAA 4YO8A 2WT4A 2D1YA 4M0MA 4IMJB 3VR1A 3C6MA 1JSCA 2HA6A 3EXHB 1KFKB 3OJCA 2I0FA 3MLBA 3DE2X 4CR8A 4D42A 4B2LA 5CJPA 3FCOA 4N3CA 2CXTA 4XLZA 1JEAA 2WIAA 4CTNA 4X7MA 1N36B 5KYTA 3AZPA 4AKSA 2XYGA 1XC7A 1YJAA 4PLVA 1P29A 5TJHA 1ZAYA 2VT2A 1CR2A 1UDBA 5GP1A 3RODA 1IEVA 3PFNA 3TLMA 5BQPA 4DDVA 4ESVA 3F2VA 3MUNA 5J4YA 1JH9A 4PO1A 1KH1A 3RYFA 5A4DA 4HPXB 3V4SA 1EUYA 2MINB 2D1SA 2NXJA 2X0JA 1LFAA 1NJ2A 1Y5MA 2ZKLA 1M8PA 3PBKA 3DLIA 5DSTA 5B1IA 1CDOA 1FTQA 2I22A 3WYEA 2ZQYA 1ZGBA 4FC7A 4KXYA 1E63A 2AKAB 2ZE7A 2OD2A 2OGTA 3DGEC 3V1UA 5EHZA 1ID8A 1PT5A 3L8ZA 4LX8A 4NOMA 1TPYA 3T3IA 4L6AA 4JWKA 5KU1A 3CR8A 3PHBE 3I09A 3W1EA 2HHLA 3UQZA 3TDNA 4DF3A 5JQGF 4GM4A 1Z6XA 1TB4A 3PLRA 4M7WA 2X8AA 1Z4LA 1E9RA 3EUAA 5G1NA 2SNIE 3L5OA 1L7OA 4LWPA 2EX4A 3DDOA 1N0UA 1W1UA 4W5WA 2WG1A 4M1KA 4Z1MA 3R7DA 4MW4A 3VOAA 4AWXA 4C14A 4XYLA 4BFTA 2CUKA 2D4HA 2Q49A 1UPXA 4KQ1A 1AQIA 4BYMA 4XR4A 2C5BA 2L42A 4FNGA 4TWAA 4CLRA 3QLVC 3DFIA 2IT1A 3ICEA 1CUEA 2NUPB 2GNPA 2B8WA 2QS9A 1L7EA 3AMVA 4RC9A 1P19A 2ZU0C 2QV7A 4XCVA 1SUWA 3Q85A 1TM7E 5EN4A 5GAJA 3VBCA 1WD5A 5FLEX 4JI4B 3GLUA 5IVKA 2VRCA 4HG2A 1K9VF 4M2LA 2ZG6A 1KK2A 1WETA 4FKZA 4OHMA 1R64A 3CLSD 4F5YA 4Y0AA 3VYSB 5LZ2A 1LKZA 2CXSA 5DU2A 2DYKA 4JOCA 4XFDA 1E96A 2V5AA 5M2QA 1BVYF 1VL2A 3O03A 1D1PA 4LOLA 1R0SA 5E0KB 1E9BA 2WSYB 1JEYB 4CIYA 2XCUA 2DRIA 4FE3A 4ZMBA 3HXQA 4YEDA 2EEZA 3PX7A 2E48A 2WJAA 5IJAA 4K6MA 2B4AA 2J59A 1NF8A 2EKBA 2FSUA 4ZCTA 1GAQA 4ODIA 1N7HA 2A84A 1TRHA 4NARA 3GVXA 3UICA 2P8SA 4JVMA 5LWHA 4HDRA 4FFWA 2G0AA 1X7YA 4B9EA 2W48A 4PC7A 4UUQA 3JQ9C 2HRDA 1A69A 2IEIA 1A7AA 2GN6A 4B6OA 3GYBA 4NP6A 2X3UA 4RSHA 4EFDA 5IFLA 3HE3A 1DIRA 3K0AA 2B2XA 2PWYA 4TLCA 2BBOA 3ZDDA 3OIGA 3R5XA 1U8AA 4QT0A 1K86A 5IMSA 4KXVA 4R0MA 1TCAA 1YVRA 4US1R 4UBMA 4WINA 5F76A 3QMMA 1CXZA 3AJDA 1CUFA 3DEFA 1RR6A 4TOIA 1WCIA 3GFTA 2XHEA 3OQIA 2NVUB 2YWHA 4C3VA 1W47A 3DE0X 4EM6A 1YK1A 1GRRA 3A6GA 3P97A 4PRLA 5KBYA 3WNQA 4ZN6A 2PKXA 3EVAA 3JWEA 5HUHA 4W6QA 3FUXA 3MCVA 4PFSA 9MHTA 1QC5B 1EVQA 1XZNA 5C7YA 1XRQA 2FEWB 1GU7A 3IE0A 2CLDX 1Z4NA 2VJBA 2XXAA 3OZWA 3PWSA 4H77A 3IVCA 4ZAVA 2VK2A 1BOOA 3V4FA 1HNWB 4GDFA 2BEUA 2XCTB 2VP0A 3VQTA 3L0BA 3SEQA 5ITVA 1DO8A 1KHTA 4Q9DA 2I6SA 2O8EA 3ADPA 5ARDA 1IVYA 4OQNA 4Y9DA 1B8PA 4CMEC 5AW2A 2Q0SA 2X1VA 3F3KA 1RJ9A 1OU4A 3EY9A 3EYWA 3NEYA 3MMXA 3CPJB 5AMXA 1QG2A 4U8HA 1EVIA 5TT0A 3VNAA 2O0HA 3DZCA 4A73A 1PR1A 4LISA 1NI3A 1O6GA 3L92A 4W9MC 2QSUA 4UM8B 2QE7A 2ZT7A 3RU9A 1YA6A 1QVWA 2XOXA 3STWA 5DTRA 5FT9A 4BY9E 3GROA 3QUTA 2SKCA 2BGRA 5JCPA 1JEQA 5I8WA 2HA4A 4JB3A 4LKOA 5DWDA 1NR1A 3VA7A 4CEIB 4UEQA 2BFAA 5IT4A 1E8MA 1V45E 2QRGA 4TTTS 1IBLB 1RYNA 2CCGA 1EFLA 3AILA 3H19A 3RVNA 4C3ZA 4UFOA 3GUYA 4GKAA 4AMZA 3VI3B 1YRLA 4HAYA 1P9LA 1TADA 2ZS7A 3H05A 3JD3A 4KQ9A 2WUEA 2O3QA 5FI3A 1AS0A 4ZO4A 2KQUA 2HRBA 2WT9A 2Z2IA 4ZV7A 4CQMB 2VK8A 1DHRA 1G3IA 1TQ8A 2DJIA 2GJ4A 4YJGA 3DVAA 1G2PA 2QF7A 3PEYA 3D4OA 2UVDA 2PSFA 2YWEA 4N3BA 3P4XA 2EQAA 1YMUA 3QGMA 1OFTA 2ZIXA 3PENA 1IN6A 1IQPA 4ZT7A 3VOBA 1HM5A 4PRKA 2P1RA 4TMTA 1LXCA 4L3VA 4DNPA 2HHCA 2HRRA 2FW0A 3MA0A 3GRRA 1TTQB 4YRJA 3KSRA 3GOQA 1QQTA 1YQ9A 4HUJA 2O20A 2YHSA 4RXTA 3U3KA 1A5AB 1B2RA 3FROA 4F4CA 3BWEA 3OQJA 3VO2A 1FYEA 1Z34A 2FR8A 4DEYA 3K2IA 4RVDA 3DBHB 3QX9A 4EX6A 1V1JA 3EZNA 5C8VA 5LQUA 1HKHA 4EG4A 3RQIA 1JHMA 2HU2A 4ZYZA 1KEZA 4CETA 3VR6A 5A1TA 3DF7A 2QVBA 5G0VA 3HS3A 4A8HA 3DPIA 2UV8A 3TVDA 2M6LA 3TSWA 1U63A 5G3ZA 3ZGZA 4MK4A 1QE5A 5DISB 1RM0A 1A4IA 1UKVY 2OGUA 3DE7X 4RMIA 1R5OA 3U3RA 1BMTA 1K4MA 4LIPD 4CLHA 2X13A 1IZYA 1HDZA 4GOXA 4DV0B 3T0IA 2EWWA 3QLVA 5JC8A 3TIGA 4I9HA 3RE1A 3KTFA 3K92A 3F3MA 2VT3A 1OGIA 4EELA 5EE1A 3ZU2A 2J4DA 1T13A 4HQ6A 4RJKA 5EKDA 1T36B 3GVIA 4D96A 1E98A 2D5LA 5LZ5A 4KDEA 2Q5FA 4NK5A 1UAGA 4KL8S 4CLXA 5FA8A 1ZHFA 4AO6A 1MOSA 3PFCA 3FSGA 3QVGB 1II0A 3DBLA 3V1LA 5CBPB 4MA0A 4ZEMA 1DX6A 4Q6BA 1AY0A 1PGJA 1AHNA 2CK3A 5BQXA 3U7JA 1M6HA 4EI8A 1OWOA 3DMTC 2VSOA 4FKBA 3J7AC 1P6XA 1U7OA 2HA3A 2L19A 2O23A 3LO8A 4LS3A 4TS4A 4UTXA 2CD7A 5KYUB 3F5SA 4QTZA 3GA0A 3LCJA 3N28A 2YWXA 4B3XA 2A0UA 3AERB 3K1AB 1Z5OA 2VN8A 3OP1A 5DM1A 4XCQA 3AVWA 1LGYA 1EHYA 5EFZA 4ALMA 4ILEA 5SZJA 5PGMA 5HKKA 4HJXA 1A5TA 1HE5A 1NVUQ 2CL0X 2AT1A 4LAFA 4P7FA 1EEHA 2YV4A 1V8DA 3W9BA 3FPBA