2BDTA

Crystal structure of the putative gluconate kinase from bacillus halodurans, northeast structural genomics target bhr61
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
172
Chain Sequence
MKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKGERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFIFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Putative Gluconate Kinase from Bacillus halodurans, Northeast Structural Genomics Target BhR61
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords BH3686
total genus 54
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bdtA00
1GL9B 1CR0A 1S1CA 3EPHA 3QI2A 2OXCA 2BWJA 4HZIA 1NIPA 4UKDA 1TPZA 4A6PA 4B48A 1SVWA 5FOXA 5IRCD 1ZU4A 1XEXA 2ZANA 4U02A 1J8YF 1DG1G 2XNSA 4LCBA 3C41J 3GLHA 1O3YA 3BH7A 1J8MF 1Z63A 4FN5A 3K0SA 1E2QA 1JQJC 3PEWA 3LH5A 4QHTA 1T5IA 3S1AA 4BLPA 4PO9A 4US0R 4MGZR 3T1VA 4XSHA 2C03A 1XPUA 2GJAA 5TMPA 1SVMA 1BKDR 1UEIA 1ZUNB 4BECA 1GKYA 3IO5A 5FI1B 2BBSA 4KVAA 3ZVNA 4C9BA 2J7KA 4GMDA 4A15A 1V5WA 2PLRA 2IK8A 3T06B 4CRWB 2XTMA 1P75A 1Z6AA 1ODFA 1XD2A 4HAYA 4UNNA 4A2WA 1GFIA 4XIGS 1NBME 2AL7A 1XMIA 3BJIC 3FWYA 5DIFA 5FL7D 3EIQA 5AUQA 4DHEA 5CM9C 2NOAA 4I99A 1PVOA 2W00A 1W36B 2KJQA 3EXAA 1J2JA 621PA 4NHOA 3LWNA 2GHIA 3AVOA 2ERYA 1UKEA 1HTWA 3BOSA 4PC6A 1GKUB 3EC2A 5JHHB 5CB8A 2PZGA 3WYAA 3R9XA 5KO2A 2CCJA 3C7KA 2FPMA 1HQCA 3DKVA 3DPUA 4JIMA 4URUR 5H70A 3V9PA 1TNDA 5JECA 3CZQA 4IOMA 4AG6A 2JA1A 2GTPA 2Z83A 3ZGXA 3QNUA 2QE7D 4TMZA 1G3UA 4ZDKA 3W34A 3SS8A 4W5WA 1N5IA 1ZAKA 2C04A 3QXXA 4BQSA 4O2LA 2MMGA 1G6HA 3LXRA 4AURA 5AJWA 1CR2A 1DG3A 1DAIA 1ZM2A 1GNPA 3DOEA 3S1AB 1OH7A 4AC9A 4HI0E 3LQQA 4DKXA 5FTKA 4RKEA 2LWIA 3I73A 3OESA 1DARA 4PC2A 5CJ2A 4PC3A 2DY1A 4X8MA 1YJ5A 3AF4A 4A6XA 4L8GA 2EWWA 5EP4A 3K09A 3IPXA 4EKDA 1UDWA 2HCJB 1UBEA 1FW6A 1E0AA 1FMLA 2BMFA 1CULC 4Z51A 1AIPA 1FOEB 1QF9A 4M1KA 1W2HA 3AM1A 1J90A 1ZINA 4C7OA 2F55A 2PZEA 4C4PA 1N6HA 3P27A 4BZQA 2WAYA 4BLRA 4JSYA 2QI9C 1JPJA 1ESNA 1TU4A 4JS0A 4IFBA 4I1VA 2VEDA 1KTVA 3TNFA 4AWXA 1UADA 1G64A 2W0SA 3A1TA 3PIRA 1G8YA 2C95A 1AGPA 1NMXA 1ZCBA 4AD8A 1ZD1A 5EE9A 4DEXA 5B57C 3KQNA 5FI0B 4NCKA 2V1XA 2ZUCA 4DT1A 5EE0A 4ON9A 3QJYA 4YMUA 3L0SA 1TEVA 4ESHA 4LJ4A 4KYIB 2GZDA 1MKYA 2Q9AA 2AK3A 2QQEA 4BWYA 1LS1A 2FX3A 4YC7A 3ZYCA 1NG1A 1Q21A 4V0ME 4C2UA 1BMFD 2P6NA 4URXR 1W0JA 1HURA 5SZHB 3PVSA 2HV8A 4GFDA 1OLOA 3DEFA 3SYNA 2F7SA 4M1OA 5DH9A 4B3FX 2YKGA 5KDOA 2BCJQ 4EFNA 4EFLA 2ANCA 1S8FA 4MYUA 2WWYA 3EWAA 4OJKA 3VR6A 4Q1AA 5GVRA 3TUZC 1YZTA 2GXSA 4B44A 3PITA 2C9CA 3G5UA 3NC1C 4DSNA 4P4UA 5CDFA 4HZUA 5JS8A 1SXJC 1ZC4A 4NYIQ 2GDJA 2AKYA 4M9SA 4D80A 5BN5A 1VYVA 2JJ2D 2IW3A 2R6AA 2VP0A 2ZI9A 1RYHA 5FPYA 2CL6X 1EGAA 5FUWA 1AM4D 1SXJA 3CWZA 1P72A 2F1RA 1KKLA 4NMMA 2QRNA 5L3QA 2EFEB 4M0LA 4NCIA 2REBA 4NZYA 3X1YA 3THWB 4Q19A 4LYAA 1YRAA 2JATA 5HCIA 5C46F 1AQYA 2GRJA 4CIDA 3U61B 2JLRA 3GQBA 3N70A 1IXRC 2P2LA 1SHKA 2D62A 4M1SA 4GZLA 3RRZA 3LW7A 3H4MA 3TSOA 4C0QC 1OIWA 4LJ7A 4TSFD 1MO4A 3U7GA 1Q1ZA 1IQPA 2IEZA 2ZU6A 2BJVA 3T34A 5KSOA 3U6KA 3MLEA 2PCLA 1OJLA 4W9MC 4ACBA 3GLIE 2D2EA 3N5CA 1AZTA 2CL0X 5F2EA 4W7SA 2J0SA 1Z47A 1RJ9A 3BIFA 3FB4A 2CJWB 2ODNA 4NYIR 4Q1FA 4QKQA 3I5XA 1U9IA 4KBGA 4DUGA 1FP7A 3IBYA 4PTLA 2WTUA 4TZ0A 1G7SA 2WJGA 3BK7A 4AYXA 4B74A 1UKYA 2EFCB 4J0QA 2RKOA 3I62A 1E94E 3KB1A 1FTSA 1YZKA 3GJ6A 3MD0A 2NPFA 5FTLA 3VKGA 3L0IB 3BE4A 3KL4A 1YRBA 1YZUA 4B34A 2E9SA 4I4LA 4TMVA 2J59A 1XZPA 4TLDA 4V0LA 2WOOA 4XVQA 3IIMA 3AGPA 2OFOA 1L4UA 3QF7A 3PUVA 1WBBA 1HYQA 1YZLA 2OUKA 4WZ6A 4OHZA 4Q4AA 1CS4C 2QORA 5GJCA 4HAXA 1TQ4A 1OFHA 3SI7A 5G3YA 3RRMA 4CEIA 2KBFA 3T35A 3L8YA 2IXFA 4QHSA 2GZAA 2A7QA 2GAAA 1XP8A 2ZRIA 3GJ0A 1XMSA 3ZS8A 3K1JA 5IDVA 5KNCA 2VHJA 3B2EA 1KNXA 3LVRE 2EFDB 3ZD7A 2YWEA 4A92A 3K70D 1U99A 1L7VC 1JEDA 3C15C 2WKPA 3VKWA 3SE0A 2O0KA 2Z4SA 5KDDA 4HDOB 3IKJA 5CK4A 3D8BA 4BFSA 4PPQA 3IGFA 1IXZA 4TTQA 2VIIA 3NH6A 4ZDWA 4WVFA 1P62B 1WDTA 1KJZA 2F3RA 5G53C 4QM6A 1QG2A 5CK5A 4FCWA 4DLYA 1TL7C 2W6IA 2AD1A 4ZKEA 2JLXA 1JJ7A 1G5TA 1KI9A 1QG4A 3T61A 1KI6B 1U8AA 3FKSA 1OB5A 3PUWA 4NL4H 2WWXA 4M22A 1GNRA 2RGXA 1XCPA 2FFAA 3I8SA 1JALA 1XXHA 2PEZA 3DMNA 3BRWD 1KK3A 1U81A 4M2LA 4QG7A 3RANA 4TTPA 2QP4A 3B85A 4HUQA 2PBRA 1PZNA 5BYJA 4E07A 3I72A 5DHFA 2CHVA 2ZE8A 2P6RA 1S9DA 1Q0UA 4B47A 2RGCA 5HKKA 1EFRA 1AS2A 2UZIR 2OILA 4ILEA 3EA0A 2CE2X 2TMKA 2YWHA 3RDPA 4IEIA 5KSZA 1S1MA 2QGZA 3Q7QA 4JBWA 1W7AA 1SVLA 3I92A 2AN9A 3HR8A 4KBFA 4EQ6A 1SKQA 3KJEA 1KOFA 1E9RA 1RW4A 2E87A 2MSEB 3BBPA 2X1VA 4TTRA 2W6ID 4PANA 4URYR 2YYZA 1QHGA 4HAUA 2NZ8A 4EPYA 3PR1A 1Z2AA 4LBYA 1Q22A 3T5DA 4HB4A 2ZRJA 4UXHA 2KI5A 4UJ3A 3L2OB 4GZMA 4D4KA 1NL3A 2G1KA 1JB1A 1EK0A 1NVUQ 4B76A 2NO7A 3O8DA 4D4LA 3WMEA 1GM5A 2ZJAA 4B2LA 2GJ9A 2CL7X 4HB3A 4TWZA 4Y0AA 2Q0HA 2OXRA 2HT6A 2J7PD 4IHQA 3KUCA 1E2JA 3VNUA 5JSZA 3QXCA 3GPLA 1ZCAA 3SQXA 1TF5A 3QPVA 2G9NA 4CW7A 5BN3A 1Z3IX 2AFIE 2MSDB 3R8CA 4C0LA 5KOYA 4C0AC 2AD5A 2XSZA 4ZCIA 2XX3A 3P32A 2GEVA 3SNHA 5TXGA 5KDLA 5FOVA 2O8EA 1EFTA 3GEEA 4P4SA 3U5ZB 3K9LA 1GWNA 1P61B 1XEFA 2B21A 3EPJA 1GKIA 4LYFA 2D4HA 4N0DA 2XXAB 3ICEA 3W5IA 3P20A 4WBSA 3TLXA 4JLDA 3T5GA 2IHBA 2J1LA 5A0FA 1PLKA 2ZREA 1XZQA 3BD9A 2J7PA 5KTYA 2ZJYA 5EZ5A 2PZFA 1WBDA 1E9AA 3FVQA 3QKSA 2IT1A 1W44A 1AS3A 1QHHA 4FCVA 4M9ZA 2JLUA 3GMTA 3WNCA 1TADA 4WOPA 1KHTA 3IBGA 4RCYA 5JI3E 2CXXA 3WYGA 3DZDA 1D8TA 1S0UA 3R20A 4KITB 2V7QA 2YHSA 3MSXA 4O2RA 1OXVA 4PZLA 2ZROA 3LNCA 5JJLA 2CCKA 1G5PA 2VQSA 3AEZA 4JLJA 3B6EA 4IXNA 4W5HA 1XBTA 2DR3A 2RHDA 1KO8A 2ZAMA 4L9WA 4TN1A 2IF0A 2QE7A 2X8AA 3EARA 4B35A 3SFVA 4GPTA 4DEYA 5TVKA 2VBCA 1Z0IA 1A2BA 2XB2A 3VU9A 3I1FA 2ZJZA 3H84A 1WF3A 2BM1A 4JJZA 1D9XA 1X8LA 4DCNA 4IRUB 1RRFA 1ZNYA 3C8UA 4R2IA 4OI2A 3W6OA 4ZI2A 2PMDA 3MCAA 1NKSA 3MMPA 4TMXA 5J47A 4Q7KA 2CK3D 4PO8A 1GL6A 1F2UA 1XX6A 4TMKA 4DB4A 2J45A 3AVQA 2IUTA 3NKVA 4GOXA 4HAVA 5DI3A 5JWHA 4E22A 1VYTA 4TYPA 2EVWX 4MRNA 1K5GA 3VX4A 3OE7A 5J4HA 5BWMA 1Q1BA 4NE2A 4DLRA 2XEXA 1GG2A 5K8TA 2ODEA 3DKPA 1T91A 4M4SA 4IDHA 4TT3D 5C18A 1CKEA 2QTVB 4ZPXA 2QY9A 4GOJA 4QC2A 4JBYA 1R8SA 4IDPA 5LD2B 2GXUA 2H57A 5C2JB 2VF8A 3FPAA 2WJJA 4PQYA 5JRJA 3BAFA 4DXAA 5GADl 1OSNA 1T3HA 2G1JA 1G17A 1XD8A 2O8BB 2Q3FA 2AWOA 4CYMA 1KYIA 5CIWA 4LC1A 4IVRA 1Z6TA 2ZJBA 2QN6A 4NYJR 2WV9A 3IIJA 4D0GA 4IOJA 5FBVB 2D3WA 5GJVC 1NSFA 5EXTA 2ZRKA 2CE7A 4D4JA 3IIKA 2ZI5A 4DLVA 4OL0A 4LY6A 4XTCS 1X1RA 4PAQA 3D31A 1U94A 4B3XA 1KSJA 1WE2A 5A4JA 2I1QA 5E7IA 1AZSC 2A2ZA 4EIWA 1NN1A 3SJAA 4ZI3A 3QVUA 3TAHA 2BKEA 4OHYA 1ZUHA 2H16A 4BLSA 4F92B 4QJ5A 4B6FA 2GVDC 4EJSA 2DCUA 3ETLA 5EUQB 2YINC 3IUYA 2WWWA 2ZXUA 4TMWA 1E9DA 2GCPA 4QBGB 3R9IA 2V3CC 4AKIA 4A0FA 4P32A 2JJ2A 4L15A 1NNEA 1G9XA 1XCMA 1R8QA 4Z54A 2CJWA 1OH5A 2HF9A 3W3ZB 4B32A 5H8WA 3RS4A 1Z28A 3H1TA 5DSZA 4RZ3A 3Q72A 4G0NA 4MGIR 4BFVA 3KB2A 3UK6A 3MWLA 1JR3A 2Z5FA 2BV3A 3K0CC 3X1WA 3CB4A 4M8NE 3ZH9B 3ZJYA 5J5CA 3HJNA 4W5JA 1I2DA 2HYIC 3TJZA 3ZVRA 4TL9A 3QUSA 1X8KA 1TMKA 2R6CA 1YR7A 2QROA 4Q4LA 1TAGA 4JLPA 1XEXB 4OJQA 4Q4JA 4RD3A 1EXMA 3WP1B 2WKRA 3QIAA 3EX7C 2NO1A 2CVFA 5KSYA 1KY3A 4LBZA 4U00A 2ORWA 4C0HA 5JCZA 3QKUA 2JLQA 4Q21A 4IDNA 5FBLB 1CJTC 3C4JA 4DLUA 4Q1DA 1AK2A 1IJEA 1W0KA 1US8B 1MO3A 1NSTA 1Z5ZA 2IC5A 2VP4A 2ZVPX 5KPJA 421PA 2ECKA 1BO6A 2EYQA 1NN3A 2FMXA 2ZS9A 4HLQB 5DO9A 2UVQA 2ZR9A 2J0QA 1F6BA 1G16A 4MYTA 2GJSA 4M9QA 4Q9KA 2DWQA 3AGQA 1B23P 4P0TA 3TSWA 4OBEA 4URZR 1DPFA 5FOSA 2W2XA 4PSAA 2IHYA 3KJIA 3NG1A 4JMPA 2QPAA 1R0ZA 1P2TA 4D0LB 1P60A 3N2EA 3TW8B 2FV8A 2ZRGA 4IVPA 4ZO4A 3TQFA 3AV0B 1Z2CA 5HZKA 1D6JA 3PQCA 2QRZA 5TDHA 3HP1A 2XJ9A 1QRAA 1S4QA 3RWOA 2R44A 3FDIA 4E03A 2JLVA 1EWQA 3VR4A 2ZS8A 4HYYA 2NPIA 4BLOA 4QGFA 4QHYA 4MUBA 1GVNB 1HT2E 3QG1A 1Z07A 4MYCA 1KAGA 2Q3MA 4Q5IA 1KK0A 4D0NA 1Z08A 4YXWA 4NYMQ 3LFUA 4WA7A 3TH5A 3U4QA 3BC1A 4IW3B 4IFEA 1KSGA 1NIJA 4ZDJA 2WWFA 4H1UA 1N6RA 1TUEA 2QMOA 3EIHA 3CH4B 1G21E 2BC9A 5J4YA 3M6AA 4GP6A 1WP9A 2ZE6A 2WKQA 4ZCMA 1OT3A 3ZDQA 2B7CA 4LZZA 5DLQC 2NG1A 1UM8A 5FR1A 3X1XA 2P3SA 2XZLA 4RFSA 1IONA 3GJXC 5CITA 1LY1A 1LW7A 1AGRA 1OKKD 1SVIA 3CR8A 4A82A 4DDUA 5AJZA 4CZ2A 4U7DA 5DYGA 3AB3A 2AXPA 4Q66C 1N0UA 5CLQA 5JBQA 4CGZA 1E3MA 4OK3A 3BWDD 4FMDF 2BCGY 2GBLA 3TKLA 3N2IA 4FXPA 4PHFA 4R9UC 1JAIA 1U0HC 4QNMA 4TQAA 4OHXA 1S3SA 2VTKA 1G7RA 1T8UA 2DFLA 2PH1A 3TAUA 4WW0A 1MT0A 4BGDA 3UWOA 1XXHE 4C2TA 5B30A 2PX3A 4V02A 2W2TA 4TMTA 4WXPA 4LJ6A 3LBNA 5CM8B 1E96A 3UMFA 2C78A 4DSTA 3OAAD 1OE0A 1RVDA 2C8VA 3TW4A 1G8PA 4QGAA 3NDBB 4M9XA 4QXAA 3PUXA 4ESVA 1DE0A 1G6OA 2ZR7A 1NVVQ 5EJEA 2A5YB 2V54A 3U3JA 4S2EA 2AHOA 4MDFA 4JBXA 2ZM5A 821PA 3P4XA 2F1JA 1TF7A 3W6NA 4RSGA 4XD7A 2OCAA 4GSYA 4POAA 4EDHA 5JZVA 2FEMA 3H86A 3KDSE 2JIZD 3CX6A 2V6IA 5DHAA 3K70C 4FMDB 4G5SA 5SZIA 1TQ2A 2VA8A 1UJ2A 3ECCA 2BM0A 3HDTA 1E0JA 1Z0AA 2EW1A 1LTQA 1N5JA 2IS6A 1CP2A 4R98A 4QJ4A 4JVSB 4KYUA 4LYJA 2RGEA 2YV5A 1E2DA 2RHMA 2NO9A 1JJVA 1E4VA 3MJHA 1E98A 4KLZA 2G88A 3VHXA 2R8RA 4Q18A 4TT3A 5JJKA 1Q44A 4TYNA 5FTNA 2QAJA 3A4NA 1ZMXA 3GEHA 1BMFA 1IY0A 2GXQA 3WBJA 2QAGC 3RAPR 5IK2A 3O8BA 2R6FA 2FDCA 3TMKA 1OYWA 1N6PA 2V8OA 3T1OA 1GUAA 2VHTA 4JVLA 1VCOA 2ZU0C 4IDOA 1OFUX 1W1WA 3ASZA 4TYWA 3RC3A 4QGGA 3DL0A 1Z06A 5K8UA 1Z0DA 1ZM9A 1BYUA 3ADKA 4O0MA 2VPPA 1KO7A 3BFVA 4UNSA 1O87A 1XTRA 2YOHA 1B0UA 1P9RA 1KDPA 1CLUA 3KKQA 3Q85A 3V00A 1KZ7B 1P5ZB 4BFTA 1G19A 1X3SA 3O8CA 3TQCA 1NN0A 3NIBA 1FPMA 4JZKA 1G8FA 2WZQA 4KI0A 3M4YA 1Q1QA 3FHCB 1G8HA 5HE9A 3THOA 4DLXA 5AJYA 2H18A 3L8ZA 4Q48A 5EP2A 4D6PA 2Y8EA 3I61A 1ZM7A 1XMJA 4PZYA 3TE6A 2W6JA 2WSSD 3F5FA 4Q4HA 3K9NA 2OAP1 2D7DA 3B13B 2X2FA 3IQXA 2FOLA 1OH6A 2WBLC 4B71A 3GLGB 2KB0A 1DVRA 5JWRA 4YMSA 3EZ9A 3OHMA 1A82A 1JQLB 2W58A 1VPLA 2HCBA 4FD2A 2DWOA 2IS4A 3TGPA 1KKMA 2ZSBA 4C0JA 3Q5DA 1N25A 1EX7A 5K8IA 2OEPA 2LKDA 3HYTA 1NMYA 2CCGA 4F4CA 2MMCA 3SBEA 2WPDA 1DBSA 3IHWA 3VFDA 3I5YA 1VCIA 5KNBA 2QMEA 2OESA 2O8FB 1MH1A 4XJXA 2W83A 3SJBA 2YZ2A 4OI0A 4Q4AB 4D26A 1E2IA 3AP3A 1KI3A 2ATVA 2XXAA 1SVSA 2W6JD 3LY5A 1C4OA 4QGHA 2YOGA 3EAQA 1W4AA 1S9HA 1KY2A 1ZW6A 3FFBA 3L0PA 4DLWA 2GZHA 4G3XA 1PLJA 4CEHA 2WICA 1KDOA 3AKEA 1KAOA 1W5SA 2J0UB 2Z0MA 2P6UA 3CNLA 4WXRA 2O8FA 5ANRB 2WPDD 3GLHE 3K0AB 1N6NA 4LK2A 1UBCA 4N3NA 3E2IA 4ASUA 1LFDB 1SULA 4DSOA 2C77A 2ZAOA 4ARZA 1W47A 4UXIA 4GI7A 1H8ED 1XEWY 2ZSAA 5L8VA 4ERNA 2QQ0A 3B1XA 1TF2A 2QENA 4PSVA 3GLFB 4QOSA 3LDAA 3TUIC 2P5SA 4V0NA 4NDZA 3MJRA 2BBWA 2R65A 3U7EB 5DI3B 1KO5A 1QHXA 3ND8A 1COWD 4M21A 3ICQB 3UKDA 4KJZA 2IYQA 1N6IA 3I4LA 3K8YA 3IEUA 3O8RA 2Q9CA 3ADBA 3PJRA 1YR6A 4X8LA 1CRPA 2Q6TA 1EFHA 2PMKA 4EPVA 4ZIRB 2WJVA 1JR6A 2WHXA 1UAAA 1XTJA 3FKSD 5FUYA 2WWIA 2HDNB 1Y63A 1NKTA 3SYLA 2OAQ1 1R0YA 5AUNB 1OHHA 3F3YA 5B64A 3JVVA 1CU1A 4A2QA 2O8DA 4D82A 3WRXC 1E9FA 5EZ6B 1SVOA 4LHVA 3KZ1E 2FH5B 1EESA 5EP3A 5EQTA 1QHNA 1MABA 2EYUA 3IQWA 4RFVA 1T0JB 3KQUA 1F2TA 2WVJA 3B1ZA 2ASEA 4IVQA 4LBVA 4DT1B 4YMTA 3ADDA 2IS2A 1DO2A 4KLNA 5JS7A 2Z6VA 2O0JA 1GRNA 5JLJA 3UG7A 2QAGA 3NEJA 3DHWC 4JL5A 4JYBA 4LI0A 1SZPA 2QU8A 2CBZA 4JKYA 3TVTA 3LRPA 1XPRA 2BBOA 4KO8A 4EJSB 3HU1A 1E0KA 5BQ5A 3C5CA 4A1FA 3LBHA 3BFXA 2CLDX 4LJYA 5HE8A 4MRVA 4XWAA 2GEUA 4AKHA 2B92A 2JDID 2OSBA 3R7WB 3VR2A 3U60B 4B33A 4G1UC 3VNVA 4K81B 5FTJA 3I3SR 3TVDA 5JEEA 1E6CA 2A78A 1ONBA 5C4GB 1Q1EA 5J4VA 4B2IA 3EASA 3P26A 2CK3A 2OBMA 4ITRC 2F9LA 2QM8A 3LLUA 1J7KA 4BZPA 4DLTA 2FZ4A 2NQ2C 1HEIA 4URWR 1U8ZA 4O25A 2F6RA 4RCZA 2FZLA 4Z8XA 4DLZA 1W4BA 8OHMA 2C2HA 4F93B 1Z29A 1M7BA 1QHIA 1T8TA 1TU3A 2WJHA 3PFIA 3RVBA 3WXMA 5HCNA 5FPHA 4NCHA 4EPRA 2RGDA 2GAOA 2HXYA 3LO5A 2ZETA 2R2AA 5HKKD 4KFUA 4M1YA 1W0JD 4YXWD 5GVSA 1DEKA 1G7CA 4WZAE 2IYRA 2ZRBA 3CRMA 1OXTA 4D4MA 2ODBA 1OW3B 4LPSA 2JLWA 2IEYA 2NGRA 1NP6A 3DZ8A 4UJ5A 3LX8A 1EFCA 5CB6A 3Q5EA 4OHWA 1FFHA 5FH9A 4PAMA 4JL6A 2RGBA 1KI7A 3E1SA 3VTKA 3JZMA 4TZ6A 2NO6A 1XTIA 4BFXA 3GLHB 1FTNA 2ZYVX 5IHPA 2CLCX 1RKBA 1Z0FA 4JVMA 3CIOA 2ZR0A 1OKKA 4LOAA 4PX9A 2ZIAA 2GF0A 4L4UA 3B78A 4Q7JB 4BFYA 5L3RA 4A0GA 2IYLD 1II8A 1KK1A 2D2FA 1G1MA 5JEDA 2O0HA 2VHQA 2ZRPA 3QXHA 2RGNC 4OKSA 5FPKA 2BEKA 1OIVA 4BEBA 5FPSA 4V0KA 2BOVA 4YQFA 2IYSA 2WIAA 4XVRA 5LDDC 1XTSA 1NMZA 4PAOA 3AF2A 1F3OA 4P4TA 5JJIA 2FN4A 4DZZA 3OEHA 1OXXK 1F2TB 3NWJA 3OIYA 3OE7D 4L9SA 3OAAA 4MGYR 5FBRB 4DUGD 4XVUA 2RH5A 3E5HA 4FIDA 1OXUA 1Q57A 3MG9A 2ZI3A 4QNRA 3ONWA 1CBUA 1R4AA 2BBTA 1YHNA 2VSOA 2D7CA 2FFHA 4Q03A 5TV2A 3SU8A 2WMNB 4F4IA 5HTKA 4I81A 2DFKB 3K0AA 1U8YA 3HPQA 5C1BA 2FSGA 3CNOA 4HUQB 3THYB 2IUSA 3LX5A 4UXJA 3CH5A 4LX0A 1KDRA 2IYVA 4AIIA 3ZQJA 3Q3JB 4CEHB 3GJ3A 2AWNA 3AKCA 4NCJA 1KI6A 3PG5A 3B60A 4GNKA 2OBLA 2O8EB 2QZ4A 3ZS9A 2EFHB 2ZQ5A 1E32A 4NYJQ 5LB4A 2GJ8A 3R9WA 4NBSA 2C96A 1CJMA 2JASA 3B82A 4MITA 1GITA 4RD0A 1VKJA 3U3OA 3AKYA 1ZD9A 4Q4JB 2J46A 1M34E 2OFWA 3O47A 3GLGE 1KI2A 4G5RA 5JI2E 1KO1A 1MO6A 2QMHA 3KXLA 5CIQA 1XEWX 4LHWA 3BB1A 4RKFA 5H68A 1TQ6A 2JAQA 1AKEA 1W36C 2GJKA 1CR4A 1SVKA 2CNWA 2KWIA 3QPWA 4HB2A 1KSFX 4HZUB 5DGXA 4GL2A 1OH8A 1TQDA 5AJXA 3NVAA 1L8QA 1JNYA 4QM7A 1W46A 3WHKA 4DDVA 3GJ4A 1PV4A 3X2SA 1YR8A 1G3MA 2H8KA 1X1SA 1G4AE 4KFTA 1ZNXA 3HWSA 4YMVA 3CX8A 2ZS7A 3RRYA 4MH0R 3G82C 2V1UA 1U90A 2ZJ8A 3CPEA 1IN7A 1VG8A 2CEAA 4LJ8A 4LHXA 4V0OA 5EXXA 4CVNA 2ERXA 3A1VA 3ASYA 3RS5A 3A6PC 1Z83A 1N5KA 4FMBB 2C98A 2IL1A 4WZBE 5KYKA 4HSEA 2A5FA 4A8JA 5G40A 4LDJA 1CTQA 2P0EA 1E2KA 1T9HA 2HJGA 3AVWA 4DBLC 3FHTA 5FUXA 4WAUA 5EE5B 1TTTA 1G3RA 1YVDA 1Z22A 3LV8A 2FA9A 4N0EA 3THXB 2W0MA 3U4QB 2RMKA 5LB2A 5TARA 4EPXA 4RZUA 5CJPA 2FPLA 5L3QB 3QXJA 4PPGA 1UBGA 2FU5C 1KK2A 1SXJB 3LQRA 3NXSA 1WRBA 3KQKA 4G5OA 2R6DA 3B9PA 4URVR 4LJ9A 3EPKA 1W36D 4IOLA 3UMSA 1E2GA 3ZZTA 1HQYE 4G5QA 4OYHA 2ZTSA 1W0KD 3IHLA 3PEUA 2ZRLA 4MDEA 1VHTA 2FF7A 4RY2A 3U6BA 3AQ4A 2XNDD 1T0HB 5L3VA 2D74A 5LPNA 4G5GA 1CJVC 2HLDA 4XSGA 4Y0VA 2V6JA 2ZSEA 4UNRA 2XAUA 2IYZA 1DOAA 2QTHA 2AR7A 2FSHA 5E7JA 1KI8A 2ORVA 3UMRA 2KBEA 2GCOB 4CEJB 1G3IA 3FGNA 3PENA 1BH2A 4TQ9A 1P9WA 3OEED 3KTAA 4JLMA 4KFRA 4LJAA 4Q02A 3RSLA 3TR0A 4XWOA 2O8CB 1VIAA 3AP2A 2FSFA 3H0KA 3KKMA 1R0WA 4KFSA 3LW8A 2ZJ5A 2XZOA 4KAXA 4YDSA 3IEVA 2PT5A 4B3CA 3U3MA 1UF9A 2C9YA 2XGJA 5DN6D 2QP9X 3B9QA 3OFNA 4LHYA 4NTZA 2UKDA 1BIFA 4C3ZA 2HLDD 2IYTA 4JLAA 4OQLA 4MYHA 1EG7A 3RHFA 4TYYA 4HUTA 1N0WA 3SOPA 2XJ4A 4XD7D 1Z8FA 2O52A 4A8JC 1DAEA 2QGNA 1NVVR 5DYIA 2GKSA 1T5LA 3HYRA 4K46A 1GIAA 3SC3A 5F98A 4AKGA 3OEEA 1R10A 1BOFA 2JLYA 4HLCA 4IKEA 2I4IA 2O8DB 1IN6A 4JT4A 3UANA 4DB2A 4RFSB 4BFZA 3FMFA 3LXXA 1FP6A 1UKZA 3CW2A 3PUZA 3ADCA 3F0TA 2X2EA 4US1R 3K53A 4JYCA 1LB1B 1W48A 4OQNA 1G41A 2B8WA 1D5CA 1XF9A 4F7WA 4CEIB 2JJ8A 3W6PA 1LS6A 2O5VA 4JJKA 4QBHA 3U44B 3WHLA 3GP8A 3NBFA 2ZSDA 4NCNA 1VDZA 1E2HA 2GESA 2OM2A 3EC1A 1MO5A 2IWRA 1ZNWA 5AWFC 3T1TA 2ZYUX 2J5XA 1GDDA 2DWPA 3VR5A 4B3BA 3WP0A 3G0HA 5JSZB 2REOA 1YZNA 4V03A 2CVHA 4A9AA 3VKHA 3TIFA 3KJGA 2WSSA 1CJKC 1S96A 2OCBA 3B7GA 3U3RA 4IDQA 2Q9BA 4LV6A 3MAAC 2QBYB 5KPDA 1RRGA 2ZRNA 2RGNA 1GRQA 4NONA 1NBMD 2H7VA 5KNDA 3CRVA 4NPHA 2ONKA 3EIEA 1ZBDA 2RB4A 4LGMA 4LSGA 3EWSA 1FNMA 2KSQA 3TSZA 1QHYA 4ZKDA 3K9GA 1Z6YA 2AK2A 3WMGA 1F5NA 1KI1A 3OEHD 1V43A 2VO1A 3KFXA 4JLKA 1SXJD 3FYHA 4OI4A 2N42A 2EU8A 2ZVQX 1TUIA 2OCPA 4Q1EA 3KQHA 3KX2A 2FFQA 3CPJB 2ZI7A 3ZVMA 3D7MA 2QM7A 4OI1A 2ZRDA 3RS2A 3EW9A 1CEEA 1FQJA 2DHRA 4PPFA 3KKNA 1N0VC 1N6LA 5ELXA 2HF8A 4JLOA 4AG5A 2GETA 2ZI4A 2ZRHA 3LA6A 3PV0A 4MUAA 1A5TA 3TR5A 3FE2A 1XJQA 3QPUA 1KMQA 1KI4A 3CKLA 4Q00A 2D06A 4C0SA 1WB9A 4V0MA 2NZJA 3NBZC 3A1WA 2QPOA 1F48A 1FX0A 5BN4A 1ZIPA 1DADA 1KMHA 2QUZA 1A7JA 3W9YA 2DYKA 5F9FA 1G18A 4Q1CA 1E1RA 1R5OA 1E9CA 3GEIA 3HR7A 4ASUD 3SR0A 1LF0A 4PR0A 1KSHA 4TL7A 4B2PA 1S3GA 1IBRA 1NN5A 1XD9A 2K5UA 1GRRA 4Q9JA 1E2FA 1DAHA 2YWFA 3T1QA 1H8EA 1NY6A 4RVCA 1Z0JA 5F9HA 4PC7A 5L3SA 3KXKA 3QKRB 2FFBA 2RGAA 4TL8A 4I1UA 1RJ9B 4XTRA 2ZEJA 3VHLB 2BKUA 3CRQA 2DB3A 5JCPA 1U2RA 1COWA 4BUJA 3M0EA 1G20E 4PQFA 1IY1A 1I4DD 3AUXA 3FKQA 2Q3HA 2DFNA 1AQUA 5TY0A 4QJ3A 3MRSA 3IILA 1IOZA 1L2TA 1R7RA 3KKPA 4NP6A 4XOIA 1HH4A 2IXGA 4JLNA 1IN4A 4DCVA 3VAAA 2IYWA 4PHTA 3QF4B 3A58B 1YR9A 4BPBA 2GK7A 3ZIAA 1YQTA 2EWVA 3Q8XB 5AR1A 2GEDA 2QNRA 2FGKA 1D2MA 4KSCA 3FMIA 1JBKA 3ZVLA 5IF9A 3UWKA 3GLIA 1CIPA 3SQWA 2ZUDA 5IK2D 4MRRA 3BFKA 1VHLA 4TLCA 1K6MA 5FUVA 1TX4B 5FL7A 5HR5A 3GFTA 2FG5A 3VR3A 4A8JB 2GF9A 2JGNA 1PUIA 2N1BA 2RCNA 4PFSA 2Z43A 2G0TA 5D3MA 5EXPA 3REGA 2QT0A 4PQRA 2N46A 4A2PA 2QBYA 4MRPA 4Q1BA 3E70C 5FBWB 5GJWC 2XZPA 3UIEA 4DCSA 1II0A 4A0RA 1SQ5A 3KQLA 5CLLA 5JRZA 1LVGA 1E1QD 1VMAA 1NF3A 1FX0B 2GWHA 2W2VA 3B1VA 2C9OA 3ZIAD 4OQFA 4AK9A 5BYKA 1P2VA 4MKIA 1VECA 2EFGA 2FSIA 3K0FB 4MA4A 1W4RA 4QRHA 4GT1A 3A4MA 1ESMA 4OHVA 1ZU5A 4TLAA 3AVVA 4PHGA 1QDEA 3QXSA 2IWHA 1EFRD 2OZEA 5EP1A 1SXJE 1F2UB 2B6HA 1CRQA 4P33A 4EAQA 1GTVA 4Q01A 3AVUA 3PEYA 1GL7A 2AX4A 3A37A 1P2UA 2VYFA 4LYHA 1NJFA 2J3EA 2NTYC 4PPNA 5P21A 3WRYC 4DCUA 3RS7A 3V4FA 2FGJA 4B73A 5LBIA 2JLZA 4NYMR 1CXZA 4HATA 2LKCA 3UXMA 3QSYA 1FUKA 1E2LA 2XTZA 1ZJ6A 3KUDA 2VP2A 2FEOA 4FI3C 1H65A 1CR1A 3CRRA 2WJIA 3P4YA 3OFND 3RRNA 3RSOA 2O8BA 3SN6A 1D2NA 4A4DA 2H17A 1P2SA 1P3JA 1RZ3A 2XITA 3CPHA 5JFGA 4L5BA 5L3SB 4UNPA 1FNNA 3RYTC 5FR2A 3GLIB 2OLJA 1Z0KA 2H5EA 1WA5A 3FTQA 3A4LA 3K09C 5EE1A 5J4LA 1W4CA 3EG5A 4MKFA 3CF2A 3QF4A 2EQBA 2FPKA 2P65A 3TRFA 3QG5A 3NHBA 4TQUS 4LV5B 4R71A 4LBWA 2B7BA 2VP5A 2IXEA 2VRWA 1DAMA 1UPTA 3JVUA 4I1SA 1XB2A 1P7CA 4JKIA 1XTKA 1JEEA 1X86B 2F43A 1XWIA 2J0VA 2PL3A 4LWZA 3SYKA 1ZM3A 2E1RA 1GSIA 2BMDA 1RE0A 4TLBA 2OO7A 3EZ2A 2OG2A 5LD2C 1G8GA 2GNOA 1KNQA 4IEEA 4C0KA 1Q20A 2JDIA 3CM0A 3KTAB 3T15A 3R8FA 1SKYB 1XRJA 4F91B 3ZD6A 5JWOA 2ZE7A 3F8TA 1M7HA 1DAGA 2JIZA 4DWJA 4JLBA 2ZI6A 1OFTA 3VR1A 1U98A 4PO1A 2A30A 3DOFA 3GJ8A 4C30A 4A0HA 2V4ZA 2F43B 2R62A 3LAWA 4D25A 3GJ7A 5KUTA 5FOTA 2WSMA 1VTKA 1EFUA 4H1VA 1D2EA 1E79A 5DISB 4DCTA 3GFOA 4B43A 3PEVA 3AVXA 1A2KC 2BMEA 4GBMA 4Q47A 1MABB 2GA8A 4AYTA 1IM2A 3QVVA 4FCTA 2ZJ2A 3NDPA 3QKSB 1X8JA 4YLGA 3BB3A 1MRSA 1GILA 1Q12A 2OFXA 4Q7LA 3SJZA 2ZSFA 3ND9A 4TLEA 1II8B 1OXSC 1ZVQA 4U5XA 2QG6A 1M6NA 3A1UA 3L0OA 2LCFA 2PCJA 3TUJC 2REXB 4P3YA 1E2MA 2AFHE 3HPRA 4GOKA 2ZRMA 2J0UA 2X77A 4XH9B 2IF2A 3TK1A 2XSZD 1QZXA 3BS4A 4E5UA 4FWTA 2QSYA 4GRAA 3A8TA 2H92A 1ETUA 2OCYC 3CNNA 1DTSA 5E7MA 1YKSA 5EXSA 4N1AA 4HB0A 4I1OA 3B8HA 1G7TA 3C14C 1KGDA 2NIPA 4LPKA 2QT1A 4HLUA 2CLSA 2WJYA 3A1SA 1WCV1 4OK5A 1WXQA 1R5BA 2CDNA 4ACAA 1QVRA 1DAFA 1LV7A 3KKOA 4P31A 3BH0A 2YJTD 2BVNA 1S2MA 2OLKA 4GP7A 4MRSA 4PHHA 1RYFA 2BHRA 3REFA 4MGKR 4F4JA 3SJCA 4KU4A 4RD1A 1N2CE 4QFMA 1ANKA 2IYYA 2J9RA 2FWRA 2WWGA 1E2EA 3C5HA 3RABA 3CONA 3RC8A 4KHZA 1E4YA 1GP2A 3CO5A 3Q7PA 4OK6A 2OV2A 1LNZA 1SGWA 5EUMA 1ZUIA 3WBKA 3ZZUA 5BW8A 1XPOA 3A36A 2F1HA 4PXAA 5JMTA 5DI9A 3D6TB 3B5JA 4KV9A 1UEJA 1VG9B 1NRJB 1SHZA 1WQ1R 3FHOA 1DAKA 2BJWA 2H1LA 4KXFB 1W2GA 5KSPA 5K8LA 1ZC3A 3W8NA 1G5RA 3AF3A 3B1WA 1BYIA 5G3ZA 1KJYA 3D3QA 4X8HA 1ZRHA 4AI6A 3DDCA 4GMXA 3K0EA 1HT1E 3FFAA 3NH9A 2QP3A 3WY9A 5E4FA 1D9ZA 4TSFA 3GCGA 1C9KA 3GJ5A 3K0CA 5J40A 2GXAA 1A4RA 3QBVA 4YDHB 5DNYB 5D3QA 4DVGA 3EZ6A 5E3HA 1Z6GA 2ATXA 3NEYA 4DC9A 4US2R 1P6XA 2SHKA 3AF1A 1H8HA 2QL6A 4C0BA 5B2ZA 1P4SA 4B6EA 4DLSA 1DO0A 3AUYA 5A5GA 4Z8YA 2O8CA 3QBTA 4MQBA 3SHWA 4M53A 3GLFE 1KIMA 4DIEA 1RRPA 4UNQA 4YMWA 1VCMA 2XB4A 1KZGB 1F60A 2UZ3A 1AA9A 1EWRA 2GBLC 3NBYC 4HDCA 4O3MA 4WIAA 2G83A 4BFWA 1KMHB 1NJGA 3FMPB 1K5DA 2KE5A 4DIDA 3ZLJA 4Q9IA 1M7GA 1XDBA 3H2YA 2L0XA 4D2IA 4RZXA 1UKVY 4B75A 5BXQC 3BERA 3K70B 4HDQB 2QEQA 3CF6R 1FUUA 1H8HD 1U0LA 1R6BX 1I4LD 4BLQA 2IYUA 3DM5A 1E1RD 3DO6A 3UATA 2WIBA 2DBYA 3GFPA 4ZDIA 3UG6A 1MRNA 1T4GA 2ZYWX 2VHCA 2ODWA 4FWIB 3C16C 3LVQE 4BRUA 3THXA 2J41A 4KODA 2G77B 3X1DA 2A5GA 2DFTA 2VH5R 1OHHD 3ZQ6A 3EPLA 1KDTA 3SDZA 3QKTA 1HE1C 2IYXA 2QTFA 4EFMA 3SHFA 3W8RA 3IO3A 4TYQA 2HYDA 3VQTA 5FOUA 2IUUA 3AVYA 1HY3A 1YZQA 5IT5A 1CF4A 1E9SA 2PT7A 2WM9B 3CF0A 5SZJA 1RRCA 1JAHA 2BDTA 4HLDA 1QHHB 3BB4A 4ZCLA 3OF5A 3HU2A 4KSBA 4ABYA 2GK6A 4JVNA 2AXNA 4OQMA 3CR7A 2JJ1A 5TB5A 3PXGA 4H9GA 1E0SA 3CUEF 2G0NA 1R2QA 4M1TA 2ZE5A 1RC8A 1N6OA 3NBXX 4HAWA 2YVUA 2XTNA 2F3TA 1JR3D 1YZGA 4BEJA 3RWMB 1PJRA 3CZPA 4M1MA 2YC4C 1ZP6A 4HEJA 4KCGA 4R7ZA 3WYFA 4Z1MD 5M04A 4PZZA 2G6BA 2XNDA 3CBQA 3OZXA 1JI0A 1HV8A 1M1YE 5AUPB 1ZNZA 2WWHA 2XOKA 1T6NA 4MKHA 4Q9LA 5CYPA 4HAZA 1IAQA 4UQOA 3FMOB 3QQ5A 5FBQB 3U7HB 1OFIA 2NMVA 2BMJA 1XMVA 2P67A 4BE7B 4CT4B 3U44A 3CLVA 2ONJA 4RZ2A 3THWA 5AUOB 1W5TA 1Q3HA 3I32A 1P9NA 3LD9A 4G01B 2ZPTX 2ZRCA 2JJ1D 3I8XA 3IDQA 1XNJA 2C99A 3OIVA 1XTQA 2GCNA 1NLZA 4BASA 1E1QA 3FOZA 1FL9A 1VG0B 1N6KA 1M8PA 4X8OA 1Q3TA 2V7QD 3DVLA 1P73A 121PA 5C4MA 2OBNA 2PJZA 1Z6XA 3SBDA 1XJ0A 3ZZ0A 4Z1MA 2ZJOA 3RLFA 2Q21A 3Q9LA 1CJUC 1NVXQ 3QENA 1E99A 2QAGB 2IX3A 1M74A 4JL8A 4JSTA 1DS6A 2XOKD 3WNBA 3CX7A 2CHQA 1MR3F 3WMFA 3MWYW 1IY2A 3V4RA 3AH8A 4FMCF 2PJRA 1AJEA 2A9KA 2QA5A 1NVWQ 1OV4A 2A3RA 3L82B 2CHGA 2J87A 2ORIA 4DDTA 1A1VA 2GILA 4DDWA 1MV5A 2F1IA 2B8TA 3SZRA 1E9BA 1ZM4A 3RS3A 1NBMA 5FOWA 4JT2A 1QVAA 2YWGA 1AS0A 1UDXA 1HUQA 1NLFA 2FE4A 3RS0A 1E79D 1OYYA 521PA 2PLFA 1GZSA 6Q21A 4OQXA 3EZFA 4YONB 1SKYE 3L43A 3BGWA 3RNLA 1XXHB 3SEAA 1QHSA 3AP1A 2NO0A 5FL3A 3IPYA 1HE8B 4A36A 2VHUA 3CRW1 2WAXA 2QMUA 1JXOA 3AVPA 4RD2A 5UKDA 1G4UR 1G291 3AF0A 2VSFA 5AJVB 4ZIRA 1OF1A 721PA 2GVZC 1I4TD 4LUCA 4S35A 4AY2A 1J70A 2AKAB 1WMSA 4DSUA 3MWJA 2WMOB 2ZITA 2C5LA 3WNDA 1IHUA 2P5TB 4M1WA 1E2NA 4EUNA 2JCSA 3QY0A 2ZRAA 1XD2B 5DN6A 1L4YA 1T3SA 3OIUA 2RGGA 1XFAA 2GCOA 1IN5A 3DM9B 4BZXA 2G3YA 4FINA 4CEJA 1JPNA 3K0FA 3VU9B 4HLUC 4NH0A 3B1YA 3U3KA 4AYWA 1BS1A 4II7A 1E2PA 2V55B 2ZUBA 1MOZA 3KJHA 3U2QA 2ZYTX 4D81A 5F3WB 4QBIA 4CDGA 2VF7A 3QOFA 1AN0A 1K8RA 2HUPA 1OPXA 5KU1A 1YU9A 2YNMA 1XCGB 3M1IA 4B3GA 1NI3A 5D3MB 4E09A 1N3BA 3BXZA 3U7FB 3CWQA 2FJUA 1IN8A 1NLYA 2HXSA 4P4SB 4CT5A 4FW9A 1FZQA 4IOKA 3QEJA 3JZAA 2IS1A 2IA5A 2OT3B 4L16A 4LC0A 1HA3A 3NC0C 2QSZA 1GOTA 4GDFA 2ZRFA 3TBKA 4QBFA 4LRWA 1VG1A 2OHFA 4B3DA 4F38A 1NG9A 2MSCB 1GAJA 1X6VA 2F9MA 1VIYA 2IBMA 4IJMA 3R7WA 1J99A 1VYUA 1JECA 3AVTA 1II9A 4AKEA 5DE3A 5G41A 3MWKA 5GJBA 4QL3A 1AKYA 4EPWA 2YC2C 3GLFA 3LLMA 5SZKB 4PC1A 1IXSB 1XU4A 3VMFA 4ZV4A 2ANBA 3GLGA 1FQKA 4ARZB 4LHZA 2VL7A 2X19A 3KXIA 2VLIA 5EE3A 4MKGA 1G3QA 1Y3AA 3AKDA 3K9HA 3PUYA 4Q4HB 1JR3E 3MUFA 2R9VA 1PUJA 2HT1A 2DPXA 4NKRA 5H1YA 2R6GA 1VCNA 4TL6A 1M2OB 4RD4A 1N5LA 1ZYUA 4EQ6B 3PCRB 3NTUA 2A5DA 1E69A 5CDFE 5HZHA 4XWKA 3W3AA 5JHGB 2VP6A 4RD6A 2A5JA 4LJ5A 4BRWA 3BH6A 1R5NA 2YOFA 1DELA 5AK0A 1RIFA 2HEIA 5HPYB 3SFZA 2OE2A 3UPUA 1QBKC 4RJLA 4BLTA 4EPTA 1KJWA 3LBIA 4NU0A 3BORA 4DRZA 1YE8A 2VP9A 3QE0A 1EX6A 2CMKA 3EA5A 1LF5A 1PLLA 1U9IC 4JLVA 5E95A 3X1ZA 3GD7A 1GNQA 3QKRA 3DMDA 4Q7MB 1JXMA 3VX3A 1C1YA 1TEXA 1RFLA 4Q9HA 4DJTA 3HU3A 3MGCA 5FTMA 5B58C 4LV8B 2I1VB 1W49A 1KO4A 1R0XA 2VSXA 5KHOC 4EJSC 2WOJA 2Z4RA 1XJCA 1ELOA 4K8OA 2I3BA 1U0JA 2RAPA 1UFQA 3THYA 2BEJA 1FMJA 4PSKA 5FPTA 3OIWA 5J4KA 2PEYA 2HJVA 2JEOA 2JLSA 1T3LA 2QPTA 1ZIOA 4FMCB 4KVGA 1ZD8A 1OB2A 3NHAA 5FFMA 1NY5A 2CNWD 1IJFA 1E9EA 1I2MA 3W90A 3W5JA 3T12A 2BIFA 4BFUA 221PA 4CF7A 3QEOA 4IXMA 4R2HA 1US8A 3MFYA 2FNAA 1RPZA 5CYOA 1OIXA 1UBFA 2PX0A 3EZ7A 3KFVA 4C7OB 3P1JA 2V9PA 3J81k
chains in the Genus database with same CATH superfamily
3EPHA 3QI2A 4RIHA 1I1NA 1NPTO 2BWJA 3Q3IA 2XUKA 4M8SA 3IKVA 4A26A 1YOBA 4A6PA 1VB3A 1UDRA 1G9SA 1O96A 1OZGA 1RYDA 1NU8A 5FOXA 4U02A 1BSVA 3VOSA 1YZFA 3H9CA 2FUKA 2IPOA 3HM9A 3BH7A 3UAGA 3D4LA 4CLRA 4PRZA 3FMVA 1IXYA 3E48A 2EC5A 3O95A 4M9RA 5JALA 4FKMA 1PN3A 1TO2E 3ZJUA 2DPHA 3NGXA 3JVDA 4CFYA 2H06A 3O7MA 2VXYA 4PZUA 3S1AA 4P86A 4PO9A 4TUYB 1TYDE 3SF8A 2AW5A 2V0GA 5AJHA 4XSHA 2AXQA 4G24A 2GJAA 1SVMA 1UEIA 4IYJA 4X7BA 1GPWB 4X66B 1EVQA 5LP6F 2BBSA 4U63A 1Z7BA 4RIGA 3FDZA 5KI6A 2WJAA 4KNWA 5KTPA 3QEBZ 2OHGA 3IBFA 2JGJA 3T06B 1RLIA 2ZBRA 4XDZA 4BNMA 1T1SA 2XTMA 3IB6A 3EUFA 1Z6AA 1U3WA 3MS7A 4WOBA 4C6SA 2I7VA 3G9UA 4LOHA 3BJIC 1Q0HA 1XA4A 4GVXA 4PZPA 4RQUA 1C0LA 4OQZA 3RBXA 3EIQA 5AUQA 4DHEA 5CM9C 2GZMA 1PVOA 1ESZA 1SK8A 3O8QB 3AUSA 2CXRA 4HPWA 2TMYA 4EUSA 1F14A 1W36B 3TTYA 2KJQA 3CJRA 1XQYA 3EXAA 1CJSA 621PA 2CLLB 2E0IA 1H23A 1KEEB 3ISTA 2QY6A 3DGFC 2Q7DA 4M8KA 3AFGA 1L5HB 2YY5A 2QM3A 4BNFA 4RTSA 5JHHB 1X80A 1X70A 3WYAA 1MZPA 1X7ZB 2Q5LA 2CCJA 3UQYS 1KDZA 1FYEA 2JBHA 5SY6A 4YJFA 4KR9A 2PZAA 3RGGA 4FYMA 3Q7EA 1USWA 5CT5A 1DIHA 3B1FA 1XAHA 1ZCZA 4BY9E 3D6MA 1AX9A 4JXZA 2PJDA 4RPJA 3GAMA 2FPXA 3EZGA 2H2FA 2HA2A 3DYVA 3NFRA 4ZP1A 5JYBA 3FPKA 2E85A 1SKBA 1GV1A 3WRYA 3QTTA 2Z83A 2GQ0A 3K5PA 3QRWA 3RKUA 1MNAA 2IZ7A 4WERA 1XDSA 5EJ8A 4FDAA 4JBGA 1U3FA 3L0DA 2DPMA 3BGVA 1N7IA 3W5BA 4WT7A 3E23A 2H85A 3F5MA 5AO9A 4O2LA 3D3WA 2MMGA 5C8XA 2FX2A 3EVAA 1IZ0A 3K1ZA 3C6KA 1EGHA 1CR2A 4RVOA 1DAIA 3FA2A 3OM1A 1JE1A 4QBKA 1GNPA 4CKXA 4DSAA 3BULA 2C8JA 3OZIA 4AN0A 2CJFA 4HI0E 4MVXA 4ZI7A 1YK1A 2XBUA 3L5KA 4RKEA 1SPBS 1EFPB 1ENZA 4U6NA 4PC2A 2N0SA 4D97A 1I0IA 3BGDA 3IE2A 4R6XA 4WQMA 3OZDA 2YWCA 1J00A 3AF4A 4L8WB 2CKDA 4L8GA 5EP4A 4ES6A 2AYZA 2C07A 4QYMA 1V47A 1UDWA 2UVPA 4YLYA 4PICA 5CYGA 4J0IA 1AY0A 2A0YA 2HCJB 3DZKA 1FW6A 3RKRA 3WQRA 3DOJA 4RIEA 2QE6A 4CG2A 1QE3A 2GN2A 3VSAA 1X9IA 1QGUB 1FW8A 1X7ZA 1XMXA 4R8RA 3CZ4A 4EB8A 2A88A 2IOFK 4UHHA 1N6HA 1C81A 1GL3A 3COYA 1QNFA 2Q2OA 1GCOA 3IAFA 3ACBA 4JS0A 1Y1LA 1T34A 3VHXB 2VEDA 2UYYA 2AQIA 2VDJA 2EKPA 3DMTA 4K9SA 1M72A 2JCBA 3PIRA 4NBKA 4X91A 1G8YA 1MEJA 3RARA 4ETWA 3MN1A 4AD8A 1ADGA 2XQFA 1PGQA 2YFHA 2YS6A 1MC8A 4NCKA 3SC2B 3ENZA 4DT1A 1CE8B 2B78A 5HJ2A 4X85A 2BFCB 4ZHQB 4UTPA 1D2RA 1TEVA 1T8YA 4IIXA 3I39X 1P1RA 4WNAB 1IJBA 5CT9A 2J6CA 4MQFA 4MAAA 3WDSA 4DNFA 5AW5A 2FX3A 1VLMA 3GDFA 4Y9SA 2QJWA 4YC7A 3IJPA 3HWRA 4V0ME 1EU1A 1VKOA 2ECOA 1QFXA 3KFLA 4TOIA 1E3IA 2HV8A 3QKIA 2ISCA 2R8YA 3OHSX 4GFDA 2DX7A 3ETJA 2YW2A 2P68A 3GLQA 3R9KA 4CKCA 2YKGA 5H9WA 1YB5A 4LF9B 4JJEA 2R7MA 2WWYA 2AUNA 4HK4A 3HXPA 3HXKA 4G5HA 2YXBA 4Q1AA 5GVRA 3K1AB 4BB9A 1FXWF 2GXSA 2Q50A 2TECE 4L07A 3WTCA 1AVTA 3PITA 4B44A 4BN4A 2PV0A 1IZZA 3G5UA 4LSZA 1C7FA 2OP0A 3RTGA 4DSNA 3GLRA 1SXJC 4YRNA 4MV9A 2GDJA 3P9YA 4M9SA 2Q5CA 4ZV9A 1WHTA 1DRVA 2CXTA 1WDKA 2R6AA 4CI9A 1M75A 4OKIA 4OYLA 2ZTVA 3CWZA 4F1KA 1JDZA 1KKLA 4NMMA 2QRNA 5EMNA 4RSRA 1QDUA 2CGEA 3X1MA 4JVOA 4NZYA 4EL0A 5DU2A 4F1WA 2VUHB 2JATA 4CNBA 1O95D 4REQA 3U61B 2Q29A 2JLRA 5CFNA 3GZTB 3EDMA 2G07A 4BQOA 5A02A 1IXRC 1DHRA 4M98A 4OFWA 4CLHA 7REQB 4GZLA 3TSOA 3LW7A 5KNCH 3OSUA 2DLDA 3DTVB 1N9ZA 4IH4A 4TSFD 4XFKA 4CTJA 4HQRA 3GLIA 1FRZA 3FIJA 4S1OA 1KOLA 4G8CA 4X20B 1PFWA 3PDIA 2YXDA 3P9QA 4HCJA 4XM1A 3K9QO 1L7DA 3LX4A 2ZWMA 3A1NA 2J08A 3JRXA 3ROXA 4R8VA 4OB6A 3K6JA 5JPCA 4W9MC 3GLIE 2D2EA 3OTIA 1BXKA 1PJ8A 1TPYA 5ALHA 5LLSA 5JO0A 2MT9A 3GT0A 1T9ZA 4OEHA 4V2UA 4KBGA 3RVKA 1ODIA 3RIHA 4YA6A 1U2DA 3BZUA 3VPGA 5K6RA 1A9OA 4AYXA 1K7SN 1UKYA 1B6RA 2F2TA 4J0QA 1YHZA 1PZMA 1X7YA 2DSTA 4RTRA 4O6VA 3AY0A 2BR5A 4Q3CA 3A3OA 5SICE 2HRDA 2NPFA 1Y6GA 1LK0A 4UU8A 2XQJA 4B3MB 1YRBA 5JYCA 4B34A 1Y8ZA 2J59A 3AO0B 3T4XA 1XZPA 4CL8A 3QBJA 3B3FA 4XVQA 4GDMA 5AD1A 1L4UA 1P6QA 4NMHA 3UHFA 1G20B 1RYBA 4JEHA 1YZLA 2O2HA 2Q5IA 3ISJA 4J1QA 4Q4AA 3NNSA 3I09A 3W1VA 1TQ4A 2HGSA 1OFHA 3SI7A 3VOBA 1RJWA 2A0KA 5G3YA 2KBFA 1NW9B 3L8YA 1NW7A 3GN2A 5CNJA 3LHSA 4PE5B 1R3UA 2GZAA 3JWPA 5JBNA 2ZRIA 3LX6A 2P5YA 3H8VA 3W9BA 3QLTA 1P4AA 3Q3CA 2O2ZA 2PRJA 3HDHA 1Q7CA 3N59A 3HY3A 4FHZA 5G1OA 3WYCA 5KREA 4XPIB 1MOSA 5FD8A 1D09A 4HRXA 2WKPA 1I3MA 1CUXA 4M88A 2H1SA 3VKWA 2QR2A 4JFRA 5K0CA 3HNOA 5E6SB 3SE0A 2HHHB 3VKVA 4DQUA 1BOOA 5TR9A 3WADA 1Y1KE 2RH9B 2HMWA 3MS2A 3UPDA 4A10A 1PWHA 4B40A 2P69A 5CK4A 4DIUA 4V0RA 3H18A 2W2NA 4PPQA 3IGFA 4OSEA 2VIIA 3L7OA 3NH6A 3VDMA 3CCFA 4ZDWA 4C0XA 1XMPA 5IN4A 4QQ8A 4WVFA 2AMLA 3OCUA 1KJZA 1ZD2P 3Q7RA 4KQ6A 5J63A 1V8PA 1VI6A 2X9NA 4U9IS 3QITA 1TK2A 2W6IA 4MTCA 1B7GO 1PR5A 4G8JA 5D1HA 4JUFA 1JG7A 1D4AA 1QG4A 1ML4A 3PQ8A 3W5SA 2RHBA 4NL4H 2WWXA 2VBIA 2Y66A 1XCPA 1EHYA 2LDBA 2BEVB 2FQQA 5C8DA 4N0PA 3DMNA 4Z0HO 5I7RA 3U7RA 4BZWA 2QP4A 2OWDA 1IXKA 3DEHA 3NZEA 3EHEA 2VKTA 3WLLA 5DHFA 3T41A 3EOZA 2P6RA 2GD0A 3EN0A 4BVHA 2RGCA 1PWXA 4BTLA 4ZOLF 4F3NA 2XTAA 1KH3A 1Z8NA 2YWHA 3RDPA 5A3VA 2DBQA 5KSZA 1Y34E 1H66A 2QGZA 4JBWA 3K72B 3O21A 1TAUA 1L4LA 1PR2A 1WXIA 4XB1A 3H1PA 1PWEA 1SM4A 1SKQA 1WY5A 3DE3X 4G0QA 1BN6A 1B6GA 1KOFA 1E9RA 1RW4A 2E87A 3H2IA 4Z4CA 2Y76A 5HM6A 4D3XA 3SZLA 3W1WA 1X7HA 2YYZA 3TLBA 1HI9A 3DUFB 3WLQA 1QYIA 1CC1S 4TV9A 2ZXFA 4EPYA 1RI2A 4YRGA 1UBKS 1T5TA 4WOKA 4BNTA 3PTZA 3UV3A 3T5DA 4HB4A 1RJFA 4N6GA 3KKZA 4PAWA 1SQGA 4UXHA 4LRXA 4O4HF 5J2TB 4N8SA 3OOSA 1N5RA 2SBTA 3GJSA 4NNPA 3H5IA 1JB1A 1EK0A 1O8CA 10MHA 3FW1A 2NO7A 4D4LA 3BXPA 3WMEA 1WUJS 2F3QA 2QTCA 4LISA 3ADPA 4AO6A 4UEKA 5I7AA 4ARVA 1XNGA 2OXRA 2J7PD 1Y1PA 3O8OA 3VZPA 1WUYA 1AV7A 3KZXA 4XPZA 3VNUA 2FUG6 2P2GA 4O4JF 3C85A 2DHDA 5E9WA 3C6BA 4EBBA 2UYGA 4ME6A 4EM6A 4HNAB 4IV0A 2AD5A 3GW8A 4ZCIA 2XX3A 3GCWA 1L7NA 5AVQA 3P32A 1TD9A 2PVPA 1C2TA 1FVFA 3FAZA 2DERA 2HD4A 5G1NA 3A6GA 4DQ0A 4Y2HA 5K0JA 1LH0A 1EFTA 4JZYA 3GEEA 4MA0A 5TQ0B 3F1LA 3SLKA 3MINB 3AF6A 1KEKA 4LYFA 2JZCA 3NWEA 3PUJA 4PNPA 4KQ2A 1T36A 5CDSA 1VSQA 2QXYA 3H8SA 3KQSA 4IEFB 5AOCA 5EJ2A 1WF6A 2X4LA 4H7HA 1EFVA 3T5GA 4YCCA 3PE3A 2HIGA 2OQIA 4HUJA 1Z6PA 3MGKA 4DG5A 1RTTA 3FUUA 4P7GA 1FLVA 3DYBA 3ETDA 1R00A 3LOPA 3TPZA 4LHSA 4DR1B 1E9AA 2RHWA 3FVQA 3QKSA 3KB8A 3OPNA 2V5AA 4FCVA 5EYPB 2IKSA 3JWGA 4NFYA 5TC4A 5JAQA 3S8MA 5BR4A 1BG6A 5MFPA 5HJ5A 3GMTA 3HN7A 2PGXA 5A04A 2VHYA 3ONFA 3OIFA 2ZWIA 1TADA 1Z3CA 2B69A 2BGIA 1IOWA 1XWWA 2YJGA 3DOOA 2JAWA 3R20A 3MEQA 3WYGA 2V7QA 1MB0A 2YHSA 4BL5A 4H7PA 3QYPA 4XGRA 2CWDA 5AXAA 4WLUA 1XBTA 4GPBA 4TN1A 2JGFA 5IAEA 2QE7A 1JE0A 3T3IA 5JQGF 2IUFA 4KN9S 4O63O 4UHBA 4ZGGA 1MQ9A 1L1RA 1W29A 1R8YA 5HIAA 4PZCA 2WSBA 4COKA 3TS1A 1ST3A 2G06A 3WGHA 3LCRA 1USKA 4L73A 4NZNA 2G4LA 4UTRA 2IV3A 5LQAA 1M6EX 1YR1A 2KPOA 3STYA 3V8BA 3W6OA 3V2UA 2R00A 2EJUA 3OJ0A 2D00A 5GZ3A 3KETA 1F8FA 3WK6A 4PO8A 3OZUA 4TMKA 2O2IA 3O8LA 4YV2A 2J45A 4GOXA 1MOPA 2IUTA 3OKCA 2HNAA 5JWHA 2BEWA 4E22A 1VYTA 1UBTS 3CG4A 5CPFA 4M38A 3SK0A 2EVWX 2Z2XA 5T4FA 5J4HA 2XZTA 4RVGA 1C0KA 1GFZA 1Q1BA 4BMCA 3GELA 3BMOB 3SX4A 4RYDA 2C1EA 2ODEA 3DKPA 1T91A 4M4SA 4D3FA 4YUAA 2HRCA 5C18A 4Q12A 1CKEA 4XIFA 5AK4A 1L5NA 1TUBB 3V4ZA 1KEEA 4XSVA 1TM4E 4JBYA 1R8SA 2PYIA 5K05A 4JXKA 2AI3A 1BW9A 1V8FA 4JR1A 4Z9XA 4NBVA 1LGYA 5JRJA 2VNJA 3M70A 4DV2B 4M46A 5GADl 1OSNA 4J16A 2AG5A 2AJCA 2W2KA 2V4UA 4JGIA 5HOQA 2MSWA 2O8BB 3LC7O 1O94C 5JYEA 1IBLB 3IV9A 4CYMA 5HQ3B 3AI2A 2A9JA 2R1TA 3ZQUA 4E7OA 2A67A 1SURA 4IVRA 1KZ6A 1UJBA 3DE6X 3V97A 1Z6TA 2AMYA 2ZJBA 5DM0A 2YX1A 5J5AA 3C1AA 2F1OA 4IJWA 3CTMA 3LVBA 1UZNA 3FVVA 4D0GA 5FBVB 1IQRA 3AL2A 4L50A 4IJUA 3LC2O 1NSFA 3HUTA 4NZOA 5GJVC 1LVHA 1M8KA 5IG2A 2GO1A 1ST2A 1E59A 4MQ4A 1EFDN 3SF8B 3T9DA 5B6JA 3AOGA 1IEQA 1KSJA 3GEBA 4MWGA 4QFBA 4UZFA 2WTXA 1W76A 5E1MA 4FBLA 1AZSC 3Q7IA 1A9QA 5BT8A 3SJAA 4ZI3A 3KALA 1A4XA 1GZUA 3IOBA 1WHTB 2FZ5A 2FWIA 4BE4A 2V58A 2HPZA 4C0WA 5NULA 1T13A 1Y8RA 1V3UA 1H6AA 2HSDA 3ETLA 4QU9A 1CNFA 2ZXUA 1ZBQA 1JVNA 2XVAA 1I9CA 3IP1A 1A04A 1M1UA 2V03A 3RVDA 3R9IA 3VGPA 2V3CC 2HU8A 3K15A 3W5VA 1PWZA 3R24A 1BE6A 4L15A 1G9XA 1XCMA 1XZJA 1ECCA 4UUQA 4C20A 4Z54A 1SUDA 4W9NA 4BU1A 4XDGA 4UFNA 3PYXA 2NPOA 1BFUA 4BNUA 3ZU6A 4DYVA 1EKXA 4BFVA 1SH7A 4XJSA 2H4FA 4A8PA 3DE4X 2Q99A 3OOWA 4G0OA 1MTOA 1ZRNA 3G2LA 4L1KA 4KVZA 4DBZA 2XWSA 3K0CC 5K0BA 3NP9A 4TXJA 2NVUA 3JQAB 1WR8A 3BD7A 3HJNA 4RAQA 3P9XA 4MCHA 3TI9A 1RWOA 2HMYB 2HFJA 3TJZA 3ZVRA 1JDSA 2P4HX 3QUSA 1I7DA 3ICWA 3R2JA 4YASA 1YR7A 4Q4LA 4X93A 1ACMA 2ENWA 2LPMA 4JLPA 2JKYA 1H0KA 4IIGA 4ZVNA 3WP1B 2WKRA 3EG9A 4WK2B 5IXJA 1L5GB 4E15A 5KSYA 3DTVD 2XUGA 3BN3A 2VNKA 3AHGA 2B8NA 3HGQA 4LBZA 5JCZA 4C0HA 1XE3A 4EB3A 3QKUA 2AFIA 2BLNA 4ZRDA 5A06A 1XLUA 3SZOA 1CY6A 1ZD3A 4DLUA 9LDBA 1AK2A 1W0KA 2Y1OA 1US8B 1MO3A 3PFNA 2ZVPX 4RVFA 3W05A 5K9ZA 1JEYB 2PSHA 1L4MA 2R6R1 4G56A 4RH1A 3W3AD 421PA 4RDCA 4BMYA 3CUUA 5IT0A 2ZS9A 1QKKA 2QL9A 5DO9A 4ZVSA 3JAMA 3WK4A 1B8UA 2EEZA 4PSCA 5A4MS 3DJYA 5EIBD 9GPBA 5DYTA 3E0XA 3WISA 4Q9KA 3GGGA 2W37A 1J5EB 3OLCX 3Q3VA 4P0TA 2XOEA 3G85A 2AN1A 1ZG3A 3EEYA 1DPFA 3IE1A 5YASA 3S2GA 1PDWA 3BHIA 5F73A 4WBNA 3KJIA 1ULUA 2FWAA 3CPSA 3TGWA 3U7JA 1T9GR 2VF2A 2XCOA 3WWDA 3AEUB 4UVEA 5IH7A 5CCEA 4EGQA 4JELA 2B35A 2ZRGA 4IVPA 2R6HA 1W9MA 1U2GC 2IGTA 3AV0B 2VT7A 4NOJA 3WLFA 1QGAA 2QRZA 2JFVA 2E6UX 3K7EA 1RP1A 3RFXA 1E3JA 1QRAA 2OAGA 4INPA 4XA8A 1B1AA 3KT8A 3ZI7A 2W2PA 2DZDA 4HQOA 3QLVC 3JQRA 1Q7EA 1JYSA 2OXFA 4MUBA 4QHYA 1GVNB 4RHTA 5JO9A 3ZV6A 1SMKA 4K0RA 4BKRA 3LP8A 2PUDA 3EY9A 2SICE 1DNPA 3JQAD 4I5FA 3NT2A 1S02A 4JDPA 3ZHYA 5HKOA 3KAQA 1V8OA 3EDYA 4BNZA 4NYMQ 1LX7A 1IC6A 3JD2A 3HE3A 1PZHA 3KE9A 3EMVA 3U4QA 3PC4A 3MT9A 3DE0X 1RR6A 5AHWA 3JQPA 1DKLA 1A5BB 2UVDA 4IFEA 4F06A 2BMWA 4RDHA 4ZDJA 4LWQA 1KHHA 2QMOA 3L1UA 4NBWA 5JSFA 4MAMA 2CDAA 3HR4A 5GP1A 2BC9A 2J5BA 5J4YA 3NHRA 2VSNA 2ZE6A 4EVQA 2JJMA 1B8PA 2WKQA 4QUGA 2C3YA 3NIGB 4HX2A 3ESXA 4L9AA 3ZDQA 1L4EA 4DREA 4OQ4A 3BRWA 3GJQA 1UM8A 3RH0A 1TFRA 2XZLA 5TGTA 1A71A 4I5DA 1IONA 1IBSA 4E70A 2GLTA 3EJWA 5K6AC 1LY1A 1MG5A 2P9FA 4E5DA 3FCUB 1EXVA 1RWQA 2PUTA 3I2KA 1OKKD 2XUJA 3TEJA 2AMFA 4CDRA 5JD6A 2CLMB 5AJZA 4Y3UA 4CZ2A 4U7DA 5EZYF 2W2QA 4P2BA 1Z13A 2D6FA 2OYSA 1ZOSA 4HEA6 5GV7A 3B1JA 5JBQA 1N2XA 1QNLA 3G79A 3JARB 4JJIA 2J6BA 4OK3A 4QT0A 3U1BA 2ODTX 2BCGY 3UUWA 4G26A 1EEXB 5AOAA 2O59A 3CIFA 4FXPA 3UMJA 1JAIA 1DKMA 2DJIA 3EUEA 1KOGA 2GPSA 1OXMA 4LEIA 1S3SA 4MV5A 4D5GA 1WB6A 3K9FC 3Q88A 3TAUA 1MT0A 4IRMA 2WT8A 4U2CA 4DLBA 4RESA 3DTYA 3V4LA 4C2TA 4MYSA 5B30A 2W2TA 4MICA 4M0EA 5KOHA 1TK9A 4HAIA 3WICA 3M83A 3LBNA 2JZOA 1KAHA 3SKVA 1P0IA 4DSTA 2W90A 2HSJA 5CDUA 1PO7A 2VDRB 1OE0A 1RVDA 2C8VA 3EBOA 4M9XA 4QXAA 2GUWA 4XR9A 4YI5A 1G6OA 2ZR7A 1NVVQ 1DWPA 2HSGA 4R4JA 5JCXA 2XCRB 1A3CA 2V54A 4RPIA 3S27A 4MDFA 4IKPA 4OQDA 2PS0A 3P4XA 1UXGA 1Z15A 1X8XA 2FDRA 2XKJE 2F1JA 3Q1KA 4WKCA 4ALIA 4DV0B 1K3TA 4NNOA 1XK6A 4GSYA 2BMVA 3PGXA 4POAA 3UT5A 2FEMA 4CQNA 1DWOA 1R6XA 4C04A 3FGPA 3K70C 4G5SA 1BQEA 5SZIA 3ECCA 2DLNA 1IRIA 2FCAA 2EW1A 2HJ9A 1N5JA 1C0IA 2J3QA 2IS6A 2IHNA 5I4KA 4E2FA 5JZBA 3AIKA 2OV1A 1KBZA 3JWIA 4EA6A 1AXEA 1P5FA 1PAUA 1OU4A 1E2DA 2E7ZA 3H99A 2RHMA 2NO9A 4MVJH 2CFOA 1M2WA 1SKAA 1FU7A 5AM1A 1E98A 1J06A 3HCCA 5AOBA 4DIBA 3ZD8A 4TT3A 4HWOA 1WM1A 4WN9A 5F77A 5LZ5A 2QAJA 3A4NA 1ZMXA 3BD6A 2G4CA 3DBHA 3VH3A 4LE0A 4WDQA 3FTNA 3FYSA 4IR7A 3WBJA 3UAVA 3H05A 5IK2A 1NHGA 1I6KA 3O8BA 1B00A 2JNWA 2R6FA 1DC4A 1K1EA 2WJZB 3SS7X 1NXTA 2FYTA 4AZ3A 4HVCA 3W8FA 2VHTA 5LQSA 4ETNA 4QG3A 4GECA 2ZU0C 2K6GA 3D6UA 1W1WA 3ASZA 4TS4A 5I3CA 3RC3A 3RVPA 3DL0A 1ZM9A 5AVJA 4EHHA 2Y4NA 5HKBA 1QUFA 3KYCA 2IEIA 2NU9A 2Q8PA 3M4ZA 2UXCB 3BSSA 1VMIA 4H4CA 2JGEA 2ZBGA 3Q85A 3V00A 1FUIA 3WK9A 4EYEA 5CFQA 1JSZA 4EB6B 3LPDA 3PFKA 3DOUA 1X3SA 3O8CA 1JLLB 2C97A 4MR9B 4UTOA 3NIBA 4FONA 4JZKA 1G8FA 2WZQA 1K08A 1RP7A 1C29B 3M4YA 1G8HA 3Q12A 4DBVO 1Q74A 4FFWA 3NQ41 4LMBA 2HAEA 2WSIA 4BX9A 3GFFA 2FR8A 4PZYA 1N0HA 3OSZA 3SXJA 3STVA 3TE6A 3NUGA 2YASA 5E6RB 4C01A 4D9GA 1OTYA 3K8ZA 4U8GA 2HQSA 5KNDH 4Q9NA 4EJ2A 4YJGB 5HW0A 1M0WA 2OAP1 4B7UA 5JZ9A 1JAYA 1EJBA 3BK2A 1Z7WA 2W8ZA 5DCWA 4X7RA 4YMSA 4U1RA 2CL5A 1W1IA 3IA7A 3OA0A 1LTHR 2W58A 1VPLA 3OX1A 1U2EA 1DL5A 2VJBA 4E14A 1YDMA 2ZSBA 3LU1A 4C0JA 3E9CA 3AG6A 1MW9X 3N2ZB 2OEPA 4I1IA 2LKDA 2PBFA 4P5DA 3UT5B 5C35A 4F4CA 5M5BA 1PJSA 4IILA 1AXGA 3DZCA 3ESZA 1FTQA 1YR2A 2IEGA 2X5KO 1HETA 1C0EA 1NXQA 2OESA 1EI9A 2XADA 3AXTA 3CN9A 3R6DA 1JFLA 4L0DA 1LK5A 1V7QA 4IDFA 4KAFA 5JS6A 2CZQA 3I9KA 3H04A 1P2GA 4ZCRA 4A8HA 5H83A 3G17A 1QK3A 3AM4A 4XWTA 3ZWXA 3M4XA 4WJKB 1X94A 1QQ5A 3EAQA 2OA0A 3JS5A 1MGOA 1ZW6A 3I9OA 2C2KA 1JHUA 1V7CA 2BEWB 3EFBA 2OXTA 2PWYA 3O73A 2RHJA 2UZ1B 2I03A 3IT3A 3VUEA 2VTBA 5GV8A 2WICA 4CEHA 3GA0A 1P1FA 3ITEA 1U7ZA 3DDOA 1PR6A 4U7HA 2J0UB 2L19A 1WETA 1OZAA 4EF5A 1PS8A 3DDWA 4X94A 2WUGA 3KAJA 5H80A 2H52A 2B7LA 1LSJA 3ZKAA 1UPXA 1E1CA 5ALUA 2KS6A 1X9GA 3V7UA 2K7ZA 3H0EA 1LFDB 1PK9A 1O0SA 4OFBA 3ZV7A 3COVA 4ZARA 5F23A 1H9CA 1PFGA 1GY8A 4WJLA 2VPTA 4Z86A 3WIUA 1W47A 2YBEA 3G89A 2Q1TA 3HB9A 1LPMA 4UXIA 1H8ED 4M99A 4DR2B 1XEWY 2FVXA 2ZSAA 3KWJA 3JQBC 3T8YA 3N8HA 2PU5A 2QQ0A 4G67A 3B1XA 3EVEA 2I2AA 2QENA 4C5CA 1RLJA 3VH1A 4R3UC 1OAOC 3GLFB 2ADOA 3OCYA 3PPXA 3IALA 3MJRA 1Z5GA 1V5EA 2WR8A 4HMQA 3T5AA 1XZBA 1N0IA 4DNOA 1COWD 4M21A 5FEUA 3WYBA 4NENB 3UKDA 2LNDA 2XKKA 1DG9A 1N6IA 3ZWMA 1V48A 3ZHUA 2OZVA 4A0QA 4ZQIA 4EI9A 1PW7A 3VJRA 1CRPA 1JS1X 2Q6TA 3VRHA 1EFHA 2PMKA 3F97A 4HGYA 4LXYA 3S1LA 2WJVA 1JR6A 4CQLB 3S2SA 1CRZA 4WKPA 4ZOEA 4CHGA 3BT7A 2ZIGA 4WPGA 2NM0A 2CNOA 2VDOB 2XCSB 2LW7A 1YZYA 5I9BA 1SU8A 5F7ZA 5B7GA 1PFUA 1U0FA 2WWIA 4TXLA 3OT4A 2ZT6A 2GI4A 1Y63A 3SYLA 2DMRA 2YIVX 4FE3A 4Z3OA 5KAMA 3D02A 3NONA 5AW2A 2XRZA 1Y6ZA 3F3YA 4ZRMA 4Z4GA 3TFWA 3CUSA 3EGXA 3ZLTA 1ZVKA 5ED4A 1I6WA 1LV8A 1GQQA 4JBLA 1AUQA 3WRXC 1ZWLA 3TZLA 2ZYIA 4OXRA 2OOKA 5EZ6B 2O2DA 3UWMA 3EGDA 4E12A 5REQB 1X1CA 2C2GA 1YKFA 2GHRA 3WLIA 3HJBA 3IFSA 5BSFA 2VS1A 1Q6ZA 4ZXFA 2V6BA 5AW3A 2QIPA 2G71A 1MABA 4HDAA 4EKNB 3QVTA 2O5CA 2ASEA 4IVQA 4LBVA 2Y1GA 1DBQA 3MA0A 3PC6A 3IQFA 2PLNA 4JCCA 3MJSA 1FFCA 1YI1A 2D1RA 1GRNA 4GPZA 4RA9B 2OYRA 3UG7A 4MWBA 1XHFA 1ZIXA 3R7FA 1ZJYA 2VZ0A 2WV7A 1UT5A 4J7UA 4JL5A 4O2BB 4Y2QA 6REQA 3CVUA 3AM5A 2FFRA 2ZK7A 4FW8A 1G1AA 1UZMA 2HHCA 4DV4B 1JEYA 1QVVA 1F0PA 1RCTE 3R5HA 1QYWA 5BQ5A 3R3HA 3S4YA 4MV0A 2CLDX 4U9HS 4XWAA 2GEUA 2B92A 2JDID 5JSYA 3QYAA 1TCAA 4J16C 3VR5H 5F1OA 5AKKA 3N0RA 3MS4A 2HBQA 3GDHA 1CUEA 4XYGA 3MWGA 1S8OA 3LZCA 4P93A 2C4WA 3EVTA 1FP4A 4GBJA 4MIYA 5D84A 2DEUA 2X0NA 4MWZA 4IIUA 3PC8C 5C4GB 1C7IA 2R84A 4KN5A 5TVGA 3NJRA 3RHTA 3P26A 2IBSA 1A50B 3E22A 3OX4A 5F21A 2FZ4A 1TVKA 2HMAA 1HEIA 4IHJF 2B0CA 1U8ZA 2RBKA 2ZAIA 2F6RA 3HACA 1NI5A 4ICIA 4RCZA 3WDMA 1W4BA 4DLZA 3R9XB 2YWRA 1VE1A 3ZGZA 1A5ZA 2JBAA 1TU3A 3FVRA 3K0HA 3QVOA 3KXDA 1J9ZA 4NCHA 2ZTHA 1A69A 1J8FA 1X1DA 2XWQA 4BO9A 4EPRA 3LO5A 1GDTA 1PYDA 2A7XA 3V46A 3DFKA 2P5UA 4KFUA 3U40A 4MPJA 2X5JO 4YXWD 1G7CA 2D2XA 2WZCA 5LWHA 1EQ2A 2BI4A 5D5QA 2XI4A 2VFAA 2FW0A 1ZIYA 3HNPA 3QWHA 2EWMA 2ODBA 4MINA 1LC0A 4FKBA 3TPFA 2IEYA 4DQLA 1PNRA 3T7TA 3DZ8A 3N87A 5F1PA 3LX8A 5HBGA 1LZLA 3SP1A 2Z2JA 2O3UA 5CB6A 5EIAA 3Q5EA 2QK4A 1ZLXA 3HDQA 3KYDB 1Y42X 2H11A 3UC5A 1QV7A 2BKLA 3CQ9A 3JZMA 3VTKA 1ZJ4A 3VVBA 2PL9A 2ZB2A 4D3ZA 5J58A 1NRWA 3I3OA 3ZDFA 2RH8A 1JHRA 2LE0A 1DXOA 2JGAA 2RH4A 3OIGA 1QYRA 4UD6A 4CKBA 5IHPA 4E51A 1LI5A 4XYMA 4P0QB 4O8ZA 3PYLA 4LWOA 1JHOA 4PLVA 3EGVA 3WKCA 4D9CA 1U5CA 4OP2A 5AMXA 3HKDA 4D57A 4HTAA 2GH1A 3WWPA 3B78A 1AO3A 2HRZA 2WLTA 4DSZA 5AKXA 3J80A 3RFVA 4J1SA 1HQKA 1II8A 1YK0A 4MI9A 4LMAA 1LQTA 2EJCA 3L01A 1YE3A 5JEDA 5C52B 2ZRPA 3E3AA 2WJWA 3PHIA 5FPPA 1J22A 4H17A 4V0KA 2C00A 1FRFS 2H1WA 3CEHA 1P91A 4YQFA 2XMBA 4XCXA 4XX0B 1T1JA 1F0KA 3H5NA 4DV7B 5KJCA 1XMOB 1OI4A 3HDYA 3GH3A 1V9CA 2BFDA 3ODGA 3PGLA 4R3NA 4UE6A 5JJIA 2A59A 3JQFC 4J0FA 1F2TB 2NZYA 3OIYA 3RVNA 4L9SA 4DUGD 3G7SA 3OAAA 4MGYR 1MA0A 3FPJA 2RH5A 3C8DA 1EDEA 4RVUA 4TKUA 3U3XA 3E5HA 3GUYA 4EVIA 1QIMA 2EHDA 4KXUA 4UBLA 3T0IA 2I34A 2XMCA 2I7CA 3EF3A 2ZI3A 5EZSA 3BM5A 4QNRA 1IBCA 1R4AA 5DBIA 3E9NA 1SHLA 3ZHXA 5ER6A 2WMNB 1P7VA 2FX5A 4G1MB 3T5MA 5EIWA 2Z56A 4DKJA 4CR7A 4I81A 2KQUA 3NALA 3Q87B 1U2GA 1N33B 1BU5A 4LNHA 2R87A 1V1MA 2IY8A 3GAFA 2FSGA 2QSUA 4HUQB 4ZEMA 3THYB 3BX1A 5IC6A 4R8LA 3CH5A 1KDRA 3BAZA 5AVWA 3FBWA 1N4DA 4K9RA 1HE4A 3ZHRA 4RNDB 3TJRA 2WI8A 3A6DA 3AKCA 3GJ3A 3VOTA 1KI6A 2OBLA 4K1XA 2PRSA 1ATIA 2EFHB 2LIVA 3Q8WA 4BC0A 3H7AA 4J2HA 1E32A 2JVJA 4NYJQ 1DDOA 3G8DA 4TV8F 2OB1A 4MITA 3TZKA 5JTTA 1Z8HA 3ICOA 4DCOA 3RSGA 4MS4B 3LT5A 4JI4B 1ZD9A 2FE1A 1UK7A 4Q4JB 2EKBA 4H6PA 4LHEA 1M34E 3GK3A 4J8PA 1ZGBA 2OFWA 4OU5A 4F4DA 3MK31 4O4JB 2ENUA 1PZGA 1QE0A 3I0NA 4XUDA 3ZGLA 4C4RA 3PVZA 4BN0A 1T0UA 3BB1A 1B15A 2VF4X 3I1IA 1TQ6A 3FCOA 3I30X 4RKFA 2XE7A 1ADFA 2C5GA 4G25A 3S40A 4KPFC 4JK3A 4JP8A 3UY4A 1N1EA 1Q11A 5BMVF 2KWIA 3MLAA 1WSWA 4GO1A 5DGXA 1PL8A 1ZJ5A 2C7PA 3AERB 1E5XA 3AC0A 4Y67A 5AJXA 4OX9Y 1XAGA 3K16A 1L8QA 1JNYA 2X86A 4QM7A 4JN6B 4O4HB 3HVHA 5J2TF 1O6FA 5A3SA 2GM4A 3GJ4A 5LP1A 4RK5A 2IZZA 1PV4A 3MYRA 5F7JA 3X2SA 1G3MA 4KFTA 1G4AE 1Q0TA 3HWSA 1Y3FE 1E7MA 1O58A 3BXOA 3OTQA 4BVBA 3GGSA 3H1FA 4TRRA 2V1UA 3CPEA 1Q14A 2CEAA 2R97A 3MAGA 3O93A 4HADA 3WKDA 3CVYA 3AQIA 4L5JA 1ENPA 2FK8A 2XIQA 4QTZA 1JDNA 3HWX1 3O0TA 3OCJA 3HY6A 4LDJA 1CTQA 4PYLA 5G40A 3TCNA 2P0EA 1YBFA 4BPRA 1E2KA 3BGOS 3ZD9A 1NQAO 1ZD5A 3DBVO 1Y4AE 1CB7A 1WW8A 3BE5A 4GSKA 1YVDA 1D1TA 2EHJA 2O2EA 3LV8A 1KDYA 2FA9A 3THXB 4BZZA 1E1NA 3AL0C 3KZKA 5EGNA 2RMKA 5TARA 4G4GA 4RZUA 2LD4A 4PPGA 1DDGA 3LQRA 1KK2A 2X6RA 3NXSA 3HO1A 1KJ9A 4G5OA 1GYRA 5KNBD 4URVR 3EPKA 4RIFA 5L9AA 1OLSA 1PR3A 1E2GA 1YMVA 3GUVA 3ROZA 1XZAA 1K4MA 1R4MB 1VL2A 4OYHA 1KQFA 1W0KD 3GBVA 3PEUA 4KWTA 3D4IA 2NZ2A 1IVYA 5KYXA 5D01A 5IBPA 1R9JA 4MZDA 4Q3LA 4CODB 5CYFA 4HWTA 4NJEA 1MVOA 4OXIA 4ALMA 4MIEA 1PK7A 5JNUA 5L3VA 4ARCA 4P7JA 1BXRB 3P96A 4DMMA 1UBOS 1T9DA 2V3VA 2XQVA 4ZGBA 4P53A 1DOAA 4D46A 4WJZA 1JA9A 1PT6A 4EFKA 1UIRA 3ZE2B 4X3CA 1KJNA 3P71T 3W2HA 4KR3A 5IAAA 2KBEA 4D43A 4EWLA 1J42A 2HPVA 2GCOB 3FGNA 3GNSA 2HZBA 5KKAA 1N1MA 2WE8A 1BHSA 3T7K