2BDTA

Crystal structure of the putative gluconate kinase from bacillus halodurans, northeast structural genomics target bhr61
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
172
Chain Sequence
MKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKGERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFIFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3686
publication title Crystal Structure of the Putative Gluconate Kinase from Bacillus halodurans, Northeast Structural Genomics Target BhR61
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 54
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bdtA00
4DLSA 3EASA 2VTKA 1WMSA 4EJSA 2Q9CA 2AXPA 1OH7A 4QG7A 5BXQC 1GILA 4MRPA 3BFVA 1GOTA 3HYTA 3C15C 2NOAA 4XJXA 1DAEA 4BFYA 3AQ4A 3HPRA 3T5DA 5H8WA 1G3IA 2WJVA 2WOOA 1E1QA 2F1JA 3T1TA 3U3JA 2QA5A 3L0PA 2JLZA 1N2CE 1Z06A 1I2MA 1KI3A 5KOYA 3U60B 4DLVA 4D80A 2NO1A 5G40A 5D3MB 1J90A 3W6PA 3V00A 4BEJA 4MH0R 3CLVA 3K0SA 4QJ3A 2GWHA 1Q21A 1E4VA 1OFHA 1E9SA 1V43A 2CE7A 4GZLA 1XZPA 3ZJYA 2ZTSA 3U4QA 4AKHA 2ODBA 2WSSD 4RFVA 3RLFA 3TQFA 1D6JA 5KYKA 3B7GA 3EC2A 3AF3A 4Q4HB 2VSXA 2XEXA 1DOAA 4Q21A 1GNQA 4M8NE 5BYJA 3AVXA 1ZCAA 2C9CA 4V0KA 4B2PA 5DIFA 5ELXA 5IDVA 2O8EA 1LTQA 1T4GA 2FSHA 3CB4A 3LWNA 3AVWA 2YOFA 1TQ2A 2AWNA 2AX4A 1LFDB 2P0EA 4QL3A 2QSYA 1KO5A 1XEXA 3KB2A 1FX0B 4RD1A 2ZRGA 1Q0UA 3NBFA 2VF7A 5L8VA 2QN6A 4DLXA 1WP9A 4M1YA 4XSHA 4WIAA 4MGIR 1NVVR 4B33A 2OCPA 3IIJA 3GLHE 1N0WA 3THYA 1GSIA 1NBME 2IUTA 4QGGA 2D06A 3EZ9A 3MUFA 4F4CA 5KNCA 5JSZA 4NHOA 2GF9A 5JWOA 1ZP6A 3KL4A 4KSBA 4II7A 4F7WA 1GFIA 3MLEA 1SHKA 3EIEA 3G82C 4PC7A 3KQUA 1HEIA 3LX5A 3BORA 5H1YA 1IJEA 3AGPA 4M1OA 3DHWC 5EE0A 1RYFA 5CDFA 4WA7A 1WQ1R 4ZV4A 2XX3A 3E1SA 3VFDA 4C2UA 4M1SA 3ICQB 4BLSA 4M9QA 1JAHA 2ANCA 1TF2A 4UKDA 3MWYW 3RHFA 3SEAA 2ZREA 4TL6A 3M4YA 4KVAA 1L8QA 3NBXX 3TQCA 4RD3A 3AF2A 3A1SA 1TF7A 1OIWA 2AKYA 2FZLA 3W5JA 1G5RA 1DAKA 3M1IA 4PTLA 2RHDA 2AFIE 1D5CA 1XJCA 2BM0A 1WXQA 3HU1A 3LX8A 4HLUA 4F92B 4URVR 4GOXA 2ZROA 3OE7A 4ABYA 3RAPR 4MRNA 3U44A 1AIPA 2ODWA 3BJIC 4FD2A 3ZQJA 3IQXA 2GCOB 4P3YA 1O87A 4HZIA 1M7GA 1OJLA 4C7OA 1SZPA 2A2ZA 2X2EA 4NU0A 1W44A 1DPFA 2WVJA 4EPTA 3B82A 1T91A 5FTKA 2QY9A 3AF1A 2KWIA 3B78A 2IWRA 1NBMD 1R0ZA 2BWJA 1W0KD 4Q1AA 3RS2A 3VHLB 1JPNA 1XEWX 5CIQA 3X1ZA 3MD0A 4A8JB 1WB9A 2IS6A 4DSOA 1UBCA 1P9RA 1R8QA 3PR1A 2VLIA 2F3TA 4IOKA 3SC3A 5FFMA 1KHTA 1KO4A 3AKDA 2VP0A 3LD9A 4U7DA 2EW1A 2OUKA 4EPRA 2ZI4A 1TF5A 4PHHA 2C96A 4LY6A 1XU4A 3QXHA 5IK2A 1N0VC 5FBQB 4YXWA 2ZEJA 5HKKD 4HZUA 5DI3A 3IPXA 1RRCA 2QTHA 1G8YA 2DBYA 4ASUA 3DM9B 2FEOA 1O3YA 3AH8A 5KDDA 2RMKA 3U7FB 5GJWC 4TYNA 1FPMA 1KYIA 3CPEA 1U94A 1KDOA 4US2R 3FHTA 3GCGA 2XSZA 3NDPA 3VKWA 4JLBA 1JI0A 3FDIA 1R0WA 3IO3A 3LXXA 2QT0A 2ZJ8A 5JJLA 4MYCA 1YQTA 2GCNA 1F60A 2N46A 4DT1B 1SVWA 1IN5A 1EX6A 1E2MA 5EUMA 1PLJA 1KI8A 4GT1A 1CEEA 1E2EA 1SKYB 4CEIB 3SJCA 2QQ0A 4UNRA 2W2TA 2ZI5A 4LV5B 3GFTA 2PLFA 3OFND 4OI4A 1NNEA 1VIAA 3K1JA 4US0R 3CF2A 1XX6A 2VQSA 1Z6TA 1ZW6A 4UNNA 4DC9A 1P3JA 1YR7A 3BWDD 4NE2A 2ZRJA 4A8JC 4DIEA 4IFEA 5H68A 1OHHD 4JBWA 1PJRA 2AK3A 1BMFD 1A5TA 1LVGA 1YR8A 5EXTA 4ZDJA 1YVDA 4HAZA 3ZS8A 2CLDX 5TXGA 1Y63A 1U9IC 2IA5A 2IYSA 2MSEB 3E5HA 2HT6A 4V02A 2IYXA 1R10A 3O8RA 3TLXA 1U8AA 3KQKA 1H8ED 4NCNA 1PUJA 3CM0A 1EFHA 5EXPA 3RANA 3GPLA 4TYWA 1N6NA 1Z0JA 4JSYA 4PC1A 2FNAA 5DO9A 3U3RA 2Z4SA 2P2LA 4DEYA 1VHTA 1OH8A 2Z4RA 2MSDB 2LKDA 2OM2A 3ZVMA 4AG5A 1M1YE 3FMFA 2YHSA 4EPWA 4WZBE 1EFCA 3ZD6A 1KMHB 1IOZA 1S3GA 1WE2A 2FH5B 3VR5A 1CJUC 3TUJC 4KXFB 3DKVA 2AL7A 3BC1A 4QNRA 4QRHA 4HB2A 1HY3A 2E1RA 1S9HA 1UDXA 3IDQA 4O2RA 2PCJA 1P9NA 4A0RA 3OEEA 5TV2A 2VP6A 4TLBA 1KZGB 3DL0A 2OT3B 1EFRD 1HUQA 3L82B 1E6CA 4Q7MB 1QVRA 1KDTA 2J3EA 4IRUB 3WYGA 4D4JA 5AJVB 4JLJA 1NKSA 3LFUA 5JFGA 4Q7LA 5HCIA 4AKEA 5K8TA 3SNHA 5KDLA 2OILA 3U3MA 5FUWA 2DR3A 5TARA 1AS2A 3KFVA 1KK3A 1S96A 3QXXA 1E96A 4AY2A 3BERA 3Q8XB 2OFXA 1NKTA 3ZVNA 3TR5A 1XBTA 3F3YA 2XNSA 4FW9A 1ETUA 2CK3A 3D7MA 3WRXC 4RY2A 2WV9A 1E3MA 1N6HA 3GP8A 1RIFA 2PCLA 2GCOA 3LAWA 3QKRB 3HDTA 5JS7A 5A0FA 2H5EA 4ZIRB 4XOIA 1VECA 1P61B 1IN4A 2Z43A 2VO1A 5DYGA 1T8UA 3AEZA 1NVXQ 1CBUA 2QL6A 3V9PA 1Q22A 1S8FA 2I1VB 4LCBA 2OBMA 4US1R 2J7PD 1W4AA 4NYMQ 1ZD9A 1E1RA 5EJEA 4H1UA 2DFLA 2P67A 1T0JB 5JCZA 1PLLA 3CRRA 2V1XA 3VKGA 3GQBA 1G9XA 3DDCA 3PEWA 4DDVA 2C04A 1N5IA 1F2UB 1UBFA 3KXIA 4MRRA 1OB5A 4B3XA 2D2FA 4FXPA 2BKEA 1E2KA 1L2TA 5GJBA 4JZKA 2V7QD 5CJ2A 3UANA 3AVUA 4LX0A 5F2EA 3A1VA 3GLGA 3U6KA 3ZVRA 3GLIE 3OAAA 2DYKA 2V3CC 1NMYA 2F3RA 4JT4A 1NY6A 1YZUA 4JKIA 3CRQA 4DCUA 1OT3A 2MSCB 3AP1A 1R5BA 4TYQA 3SYKA 4P4SB 2VPPA 1VCNA 1BS1A 2HYDA 4YMTA 4IEEA 3K9LA 4FMCB 1FP7A 1N6OA 4MKIA 4C0AC 3TMKA 4UNPA 2ZUDA 1XJ0A 2XZLA 5BN4A 2JIZA 2VHCA 1G1MA 3KUCA 3MRSA 1JXOA 5DN6D 3ASYA 4KFSA 4V0MA 3B6EA 5JI2E 1ZCBA 3MMPA 4JLNA 1XCPA 4OK6A 2Z6VA 3CH4B 2G0TA 3AGQA 4IHQA 4W7SA 2QORA 2ZI3A 3LDAA 1ELOA 1Z22A 4AWXA 1E94E 1TPZA 2HF9A 3B13B 3D8BA 4NPHA 1YRBA 5AWFC 1AS3A 3WP0A 3FKSD 4D81A 2BV3A 4ZDIA 2BIFA 1H65A 4ZDKA 1CKEA 2RGNA 3MGCA 5KDOA 4HAYA 1GZSA 4TTPA 5BYKA 2BEKA 4LZZA 4QXAA 3LRPA 2WWGA 3I92A 5CLLA 3T5GA 3SQXA 3KJIA 4QGHA 2HLDA 4LHXA 3A36A 4NYMR 2XOKA 3P27A 5FH9A 3WYFA 2IHBA 2GXAA 3IGFA 2WWHA 1II9A 5FTJA 5G41A 4Q5IA 2WPDA 4M9XA 5BQ5A 1W2HA 5B2ZA 2GXUA 2YWEA 1BKDR 2QEQA 3MG9A 2VEDA 1SVMA 3EPKA 2CL0X 4LPKA 5E7IA 2PMKA 2ZITA 3ADCA 4EKDA 3EZ2A 2FFAA 4OJKA 1U8YA 3ONWA 3ZDQA 5FL7D 1X8LA 4D0GA 5EQTA 4DDWA 1UEIA 5F9HA 1TX4B 1Q1BA 2P5SA 1RFLA 4Q19A 2G83A 3IBYA 2FPLA 2GEVA 4D0LB 2BCGY 1V5WA 2CDNA 1MO3A 2V4ZA 2DB3A 1IY2A 1XWIA 4CIDA 4TMWA 4TTQA 2GNOA 1KI6B 4B74A 1QBKC 2CL6X 3TRFA 3JZAA 3GJ5A 4D2IA 5L3QA 2MMCA 4DVGA 1GNPA 2B21A 4MDEA 4B3DA 1FP6A 2W2XA 2ZSEA 3B2EA 1T3LA 1XDBA 4MRVA 3C7KA 4Z1MD 2OAP1 1B23P 2D3WA 1AZTA 4RD0A 4ZI3A 5E4FA 1IXZA 2P6RA 1F3OA 3NH9A 4RKEA 1SULA 2ZYVX 4Q9LA 4ZPXA 1HURA 1OLOA 3VTKA 3W6NA 3TGPA 1G21E 2KBEA 3K9HA 4NYJQ 2QBYB 1W48A 5K8UA 4EQ6A 1U8ZA 4JLOA 4B32A 1X8KA 1AGRA 2SHKA 1Z5ZA 3AVPA 5J5CA 2F43A 3BH6A 5HR5A 4TMZA 2ZI7A 3QKSB 1KI2A 2IF2A 1BIFA 3TVDA 1COWD 4EJSB 1E99A 5CK4A 4X8MA 5E95A 3RNLA 3SJZA 4EPVA 4LC0A 5FPSA 1JECA 1H8HA 4HLDA 2ZVQX 4I1SA 5HTKA 1JJ7A 4A0FA 2CCKA 1F2UA 1DBSA 1EXMA 4DHEA 4DDUA 2IBMA 4RZ3A 5FPTA 4R9UC 3PUYA 3LQQA 2DWOA 4KSCA 3ZVLA 3DMNA 2GESA 2HT1A 2XXAA 4JBXA 1G16A 4MKFA 4TT3D 1WBBA 1BO6A 3FKQA 3QXSA 3QPUA 4X8HA 2QENA 3C5CA 4HLCA 1YR6A 2W6ID 3X2SA 3LQRA 2PL3A 2HXSA 3UG6A 4A0GA 3GEIA 2V9PA 1IY0A 1I2DA 2VL7A 4PQFA 3EARA 2ERXA 4XH9B 3VMFA 1Z08A 1L4UA 4NONA 3Q3JB 1A82A 3G5UA 3A4LA 2D2EA 1E0AA 4TZ0A 5EP4A 3U4QB 3QBVA 1G7RA 1NIPA 1OV4A 2EYQA 3KQHA 1OH6A 1E2LA 2R44A 3BH0A 3T61A 4B71A 2PZGA 1E9RA 2JJ2D 5C1BA 2KB0A 1Z07A 2H17A 1W47A 1X1RA 1X6VA 2XNDD 3TAUA 4B43A 4M9SA 3ZYCA 4LBZA 1SVOA 4A9AA 4JMPA 3ZLJA 621PA 1LS6A 3L2OB 4B73A 4DSUA 2WWFA 2RKOA 1ZYUA 3P4XA 1CLUA 3SDZA 3SE0A 3FB4A 5JRJA 1TQDA 1YJ5A 4KJZA 2YC2C 4PPNA 4DCSA 3CF0A 4QNMA 1QHXA 4Q1CA 1AM4D 3IEUA 1E98A 4NTZA 3VAAA 3R8FA 4XD7D 4EJSC 4DLUA 1XXHB 2AN9A 3I32A 2EFDB 4AD8A 2WJIA 2WZQA 3LW7A 4LDJA 4LYFA 2GEDA 2RCNA 4TQUS 1K8RA 3THOA 2JLWA 3ADDA 2YNMA 4BZPA 2RGAA 4DSTA 4KCGA 3THYB 4DRZA 4RVCA 4NYJR 1Z6GA 1N5LA 4RD6A 4BFSA 3K53A 1ZU5A 4WW0A 2FFBA 3BD9A 4PHFA 3CPJB 1C1YA 3K09A 3CKLA 3SBEA 5AUPB 3WNDA 3F8TA 5CM9C 4BEBA 1NY5A 4FCTA 1IQPA 3CNOA 4BPBA 5AJWA 1Y3AA 5GJCA 1KNXA 3WHKA 2OCAA 3FOZA 5L3SA 2UKDA 4M4SA 5FI0B 1FNMA 5HE8A 1KO1A 4F93B 3C4JA 1R5NA 1ZINA 1Z0FA 4YMVA 3TJZA 3ZS9A 3GJ7A 2CXXA 1A2BA 1E79D 4Z8YA 2CL7X 1N25A 1AS0A 3L0SA 2QE7D 5LB4A 4FWTA 1NLYA 1UADA 1CF4A 3U6BA 4QBHA 1A1VA 4C0JA 3KQLA 4EDHA 1UKVY 4AK9A 4UJ3A 3WNBA 5BN3A 2QZ4A 2A5GA 1VKJA 2TMKA 3HU2A 3I5XA 1MABA 1KSJA 3H2YA 4PPQA 5TY0A 1KK0A 5J4VA 2C03A 4OHWA 1OKKA 1G3MA 4PC2A 1P5ZB 1CJKC 1XPUA 5JHHB 2P6NA 3U44B 2IF0A 2XITA 2WKRA 4JVMA 4XTCS 3CH5A 5K8IA 3SOPA 1QG2A 4OHVA 4DUGD 4C7OB 2O8FA 3NVAA 4GFDA 1J70A 4JLDA 4E5UA 3I61A 4KYUA 1NVVQ 1CULC 2F7SA 3IIMA 2JJ1A 2VF8A 3G0HA 1G6HA 1OB2A 3SR0A 4ON9A 2QT1A 3EPJA 3Q7PA 4WBSA 3C41J 5TVKA 1RZ3A 1W36B 2F9MA 4V03A 3Q5EA 4GBMA 4WXPA 3I5YA 2O8CB 2JLQA 1I4TD 2Q9BA 2C77A 2FE4A 2R2AA 1NN1A 4QC2A 2JLUA 4U02A 5LPNA 1E9AA 3EWAA 2J46A 1NMZA 1DAGA 2DPXA 3MJHA 4L16A 5AJXA 1XPOA 4HZUB 1N6KA 4GNKA 5DI3B 1E1QD 1G19A 5EZ5A 4YLGA 3VQTA 4O0MA 3E2IA 1TEXA 4JJKA 5L3RA 5TB5A 3K0FB 1NG1A 2BMDA 4EFLA 4ACAA 2C2HA 3LNCA 1TL7C 2CNWA 2OE2A 2OFOA 1R0XA 4AG6A 4B3FX 1R6BX 1ZIOA 2GJAA 4HLUC 3K0CA 3CR8A 2CMKA 1VG1A 3WYAA 4LYAA 3ZIAD 2FJUA 4G5QA 4D4KA 2WJHA 2J5XA 1GKYA 2ORVA 3CR7A 3THWA 1PUIA 2WJJA 4IVQA 4OK5A 4PHTA 2ZR9A 4IEIA 4C0BA 1W2GA 4IOLA 1Z3IX 2WJYA 4BLPA 2V8OA 2QUZA 2ZYUX 3A58B 2BBWA 4GRAA 3CIOA 4LK2A 4QHSA 1JR6A 4EAQA 2ORIA 3F5FA 1OFTA 3PQCA 1U98A 1W36C 1Z6XA 2CHVA 4QOSA 4M9ZA 2J0SA 1UM8A 3NG1A 4OHZA 4A4DA 1RRGA 1VG8A 3B1VA 4OQNA 4TQAA 1YZLA 4GL2A 1VCIA 3LW8A 2G3YA 3MSXA 1IAQA 1XTSA 1XXHA 2GA8A 5JMTA 2HXYA 4MGZR 4Q1EA 1SXJA 1U90A 1DAMA 1ZNWA 2A3RA 1SVSA 2QPAA 3K0EA 2H1LA 2CVHA 4RZXA 4J0QA 4FN5A 4D0NA 2ZUCA 3ADBA 2OHFA 1Z0DA 1OIVA 3JZMA 3RWMB 5IT5A 4Q48A 4CYMA 1S9DA 1L7VC 1T9HA 2I4IA 1FTNA 4PHGA 2IEZA 3NC1C 4JS0A 5DYIA 3IHLA 4LHWA 4XWKA 4MDFA 2BEJA 1XJQA 3SBDA 2YWHA 1HT1E 2IEYA 2V6JA 2WAYA 2IXGA 2NZ8A 1CS4C 2ERYA 4TMKA 5BW8A 1TTTA 3F0TA 5K8LA 1ZUIA 2Z83A 3KDSE 4KHZA 4URUR 1ZMXA 2P5TB 2ECKA 4TMXA 1FQJA 3VR2A 4RJLA 2BMFA 1G7TA 1R4AA 1ESMA 2JJ8A 4ZI2A 3RDPA 4DB2A 3OE7D 4AC9A 4A36A 2FX3A 1VG0B 3R7WA 4G1UC 4G01B 4M1TA 3AM1A 4LBVA 4LJ4A 2OSBA 4MKHA 2FFHA 1Q20A 1A2KC 2ORWA 3FFAA 4L4UA 4NCJA 2FDCA 4IKEA 1E2PA 3VKHA 3PITA 3IUYA 3QIAA 4C30A 4KLZA 1P62B 2VP4A 5FI1B 3SJBA 1XTRA 3TH5A 1ZVQA 2OZEA 2BMEA 2LWIA 4R7ZA 5J4LA 2ZRMA 4TLDA 2WTUA 3GEHA 3DZ8A 1E2DA 2B92A 4M1WA 3DEFA 1Q1ZA 3FWYA 2ZE7A 4TMTA 3E70C 3SYLA 2KI5A 4XTRA 4E07A 4QM7A 1QHIA 4I1OA 1RRPA 2J1LA 3LA6A 1DADA 4HB0A 4QBIA 5IK2D 3C14C 4U5XA 2G1JA 3EC1A 4YXWD 3MWLA 4TQ9A 2O8CA 4V0NA 5G3YA 4EUNA 4ASUD 3BB3A 2DFKB 3W5IA 2RHMA 3TUZC 4IDQA 2GK6A 3RWOA 2PZEA 2ZU6A 4Q47A 2YKGA 1XEWY 4F4JA 4HUQA 4LJ6A 1B0UA 2BJWA 4L8GA 4C0SA 4QBGB 4Q4LA 2OEPA 4TL7A 1Z2CA 1K6MA 2XSZD 2IWHA 3U5ZB 3GLGB 1D2MA 2QP9X 3LH5A 3PUVA 4Q1FA 5TDHA 2V6IA 4NZYA 1LS1A 5FBRB 3L0OA 3K0FA 2R6CA 1RE0A 1AQUA 4LUCA 4MGYR 3GFOA 4OQMA 1Z28A 3AVQA 2EVWX 2WWYA 1IN8A 2IC5A 3BAFA 3KTAB 4BASA 3MAAC 3RVBA 4CF7A 1NJFA 1KJWA 1E2HA 1T5IA 2CVFA 3NTUA 2CEAA 4OQXA 3LO5A 3PEVA 4B34A 2X19A 1GIAA 2W0MA 3WY9A 2OLKA 1VPLA 4RSGA 2C98A 1CR2A 2H7VA 1AGPA 2ZSFA 3DMDA 2NG1A 2PJZA 2IX3A 4OBEA 5J4KA 4HAVA 1HQCA 3QJYA 5LDDC 2C9OA 1JQJC 1N6LA 4BGDA 4CEHA 3BB4A 5CIWA 1YZGA 2JA1A 3QKUA 5SZHB 2VP2A 4MYUA 3U61B 4B35A 4V0LA 1E9FA 1NL3A 3BRWD 1BYUA 3QPWA 3U7HB 2GCPA 3VX3A 2KSQA 3M0EA 3HR7A 4O25A 1E0SA 2GF0A 3JVVA 2BHRA 2BM1A 4PANA 4OYHA 2PLRA 5JEEA 2YC4C 3CUEF 4BUJA 4LWZA 1KIMA 1UF9A 3TSOA 1KAGA 2JDIA 2PBRA 3U3KA 2ZE6A 2HCBA 3QUSA 3LLMA 2C78A 1EGAA 2GJKA 2REBA 1YKSA 1E2FA 3OEED 2R6AA 3VHXA 4LOAA 3W8NA 4A82A 3L8ZA 1OHHA 2D62A 4QGFA 2HDNB 2C95A 2DY1A 3THXA 3ND8A 4IOMA 2ZRPA 5LD2B 1XF9A 2R6GA 1LF5A 2F1RA 2ZRKA 1UBEA 4DLYA 1JR3A 1IM2A 1A4RA 4DIDA 3BB1A 4Q7JB 1S1CA 4FCVA 4RD2A 3KKPA 1E9DA 4D25A 1JEEA 2O8DA 1MV5A 2CK3D 1KJZA 4I1VA 1OYYA 4TN1A 5L3QB 2HJGA 2JCSA 4LHVA 3EZFA 1SKYE 4TSFA 3N2EA 4WAUA 1Q57A 1YZQA 1KI4A 1VCMA 4HDOB 4V0ME 1VYTA 1LB1B 3KJGA 3VX4A 4U00A 1F2TA 2IUUA 2RGNC 4GP6A 4MA4A 4A2PA 2Q6TA 2WJGA 5FOWA 4K81B 3HR8A 2ZJOA 3RC8A 1UKYA 3DPUA 1ZC4A 1JNYA 1CP2A 4Q03A 1ZD1A 1E1RD 2XJ9A 3DOEA 5FPHA 4PQYA 3X1WA 3SHWA 1G41A 3LLUA 3BK7A 1K5GA 4EQ6B 4NP6A 4DCTA 2IS4A 1GUAA 2FN4A 2IUSA 4AI6A 4ZCIA 4ZCMA 2F43B 3WHLA 1MO6A 4XVQA 1QG4A 2J0VA 2WKQA 1X3SA 1FQKA 3MCAA 2ZI6A 2R8RA 4KO8A 1T3HA 2D74A 3ZH9B 3V4FA 1KOFA 4BWYA 3EA5A 3QSYA 5HZKA 1E0JA 1QDEA 3FYHA 4IDNA 4A2WA 4OHYA 1P2VA 1ZNXA 3OAAD 4JBYA 3KJHA 1XNJA 1OXVA 3R9IA 1G18A 5F98A 2GXQA 3PV0A 5E7MA 2XXAB 2QSZA 3AF0A 3CX7A 2PX0A 1WBDA 3VNVA 1NMXA 5HE9A 1DEKA 1HV8A 3DVLA 4JLMA 2ZRCA 3QNUA 5P21A 2X1VA 3BE4A 3OIUA 5FR1A 1QZXA 1VCOA 4HATA 3QOFA 4DZZA 4UNQA 5FUXA 5CB8A 3EPHA 1W0JA 5L3VA 1I4DD 1AN0A 3TE6A 1E2NA 2JIZD 4B6FA 4GSYA 3KTAA 1SHZA 1D8TA 3HU3A 4MYHA 4M53A 3GJ3A 4CRWB 2A7QA 1SVKA 5AUNB 5FR2A 5JCPA 4M21A 4X8LA 4ACBA 4MGKR 3WRYC 2IXEA 3QF4B 4Z8XA 1NVUQ 1KGDA 3OESA 1DG1G 1ZIPA 2XZPA 5FBVB 2JASA 1Q12A 3DOFA 5CITA 3AVVA 2IS2A 2R9VA 2X8AA 4DEXA 2VHJA 1KSHA 4IXMA 3T15A 3UWOA 1TUIA 4KYIB 5C2JB 4Z54A 4OI1A 3W8RA 1YZNA 1EWQA 3AF4A 3U3OA 3IBGA 4HAWA 5J40A 2ODNA 3GJ0A 2CE2X 3LVRE 4PC6A 5J4HA 1G8PA 5JS8A 4TLEA 3QE0A 2QU8A 2HLDD 2XOKD 3R20A 4Y0AA 1ZU4A 4JJZA 3P1JA 3LBHA 1QHYA 1QF9A 1G4AE 2XB2A 1AKYA 1IN6A 1IONA 1W5TA 1IBRA 2DWQA 2NPIA 3H4MA 4YDSA 3CZPA 2ZAMA 2JEOA 1NF3A 2A5YB 2WPDD 4JLVA 5G53C 3SZRA 3A4NA 3KXKA 2A30A 4L9WA 3UWKA 2QAJA 2VA8A 4DDTA 1E9BA 2F55A 1CXZA 3OZXA 4JLPA 3VU9A 1NSFA 2FG5A 3OEHD 1US8A 2PH1A 4MRSA 5CJPA 5L3SB 2PX3A 3NXSA 2QRZA 4WVFA 5SZJA 3L43A 2NPFA 1S1MA 3S1AA 3IEVA 2FZ4A 3FKSA 2IYVA 3NEJA 5DSZA 3REGA 2RH5A 3CWZA 2EFHB 2H18A 2MMGA 2IW3A 3AB3A 1Z29A 2YVUA 3B85A 3GJXC 4PPFA 4TTRA 1A7JA 1IY1A 1P2UA 3RC3A 3ZD7A 1QRAA 1OFIA 1TU3A 2P6UA 5DHAA 2ATXA 1M7BA 4LYJA 2FPKA 1JEDA 3CONA 1MABB 4OJQA 5KU1A 4LJAA 2VHUA 1TMKA 1KSGA 6Q21A 1JAIA 2WMOB 3T1OA 1ESNA 2HCJB 4P31A 2GRJA 1KKLA 1T3SA 1G5TA 1WF3A 1M7HA 2QAGA 5FTNA 3B9PA 3NEYA 3QBTA 1XRJA 4FMDF 1N6RA 1Z0KA 4QJ5A 3NBYC 3REFA 2GKSA 2XAUA 5AR1A 2O8FB 2FOLA 2OCYC 1MO5A 4KFUA 4IW3B 4TWZA 3ECCA 2E9SA 3QQ5A 2OLJA 1ZM3A 2A5DA 2NO0A 5JECA 2JLRA 2VP9A 3TW8B 1W7AA 2VH5R 2ASEA 2QG6A 4Z51A 2WICA 3JVUA 5JI3E 1E69A 2UZIR 4LV8B 1M74A 2G88A 1NI3A 3ASZA 3IO5A 1DAFA 3K09C 4L9SA 2JATA 4LHZA 1UAAA 2GETA 1E9EA 5B30A 1BOFA 2L0XA 3CNLA 3RRZA 3B1ZA 1CRQA 4Q9HA 1BH2A 2W6JA 1FW6A 3Q5DA 3VNUA 3PEYA 3OF5A 2OESA 1GITA 5C46F 4B3BA 4AKGA 1W4BA 1FUKA 1LY1A 5UKDA 1EESA 3BXZA 4QHTA 2DWPA 3D3QA 5SZKB 4CEJA 2EWWA 1J7KA 1E4YA 2F6RA 3BH7A 2WM9B 4HDCA 5KO2A 1PLKA 4P32A 2FPMA 1M6NA 5AUOB 2NZJA 1JBKA 1XD2A 5EZ6B 2I3BA 2ZRAA 4RFSA 1RKBA 4AIIA 3LBNA 4V0OA 4YDHB 1T6NA 2ZJZA 1CU1A 2GZDA 3UG7A 4ARZA 4QFMA 4N1AA 4E03A 1S0UA 4FMCF 3THWB 2FA9A 2EU8A 3LBIA 4KITB 5TMPA 5KSYA 4BZXA 3BFXA 2B8WA 3QF4A 1XD9A 1QHGA 4M1KA 1HT2E 4MUAA 2YOHA 1EK0A 2ZRBA 3QY0A 3FFBA 4LHYA 5JWRA 3KKNA 3UXMA 1XMJA 3KJEA 2WHXA 5FBLB 4AKIA 2HV8A 4NMMA 3H0KA 4PO9A 4D6PA 3NBZC 4C0KA 2RAPA 5GADl 3HWSA 1CJVC 2C99A 3NKVA 2AHOA 3FMPB 3R9XA 1OE0A 3NIBA 1ONBA 3ND9A 1UEJA 4CT4B 4HB3A 4URZR 4RZUA 4S2EA 2IL1A 4DKXA 4PO8A 2HYIC 5J4YA 1SXJB 4I81A 1CRPA 2OFWA 3TIFA 3GLFA 2QP4A 2Z5FA 4TMVA 4LJ8A 3A1WA 1G291 4IDOA 1G8HA 2WSMA 2NQ2C 1FNNA 1Z63A 1S4QA 4N0EA 2ZVPX 4PSKA 3CX6A 1OXSC 521PA 4HAUA 1RVDA 3RSLA 5FL3A 5JWHA 1LW7A 2IYTA 4RD4A 5EXSA 4JVNA 1G8GA 4IXNA 2CJWB 1CTQA 3K0CC 1AKEA 3CPHA 4M2LA 1E2IA 1ZBDA 2J41A 1AJEA 5FTLA 3AVTA 3GJ6A 4Q00A 1ODFA 4B2LA 2QTVB 1KO8A 1G3UA 3OIVA 4WXRA 1DO2A 1OKKD 2GDJA 3M6AA 3RS5A 2YYZA 2KBFA 2GBLA 3P26A 4JYBA 2R6FA 1II8A 4A2QA 3R7WB 3EW9A 1VDZA 2BMJA 5H70A 3B60A 2GVZC 4C0LA 4KFRA 4O3MA 2R62A 2QGZA 4LJ5A 2AD5A 2XZOA 1HH4A 2A9KA 1CR1A 1YHNA 2ANBA 1BYIA 1NVWQ 4W5WA 2FMXA 2O5VA 4PX9A 1YZKA 2AFHE 3Q9LA 4A15A 1DARA 2CBZA 1IN7A 5AJZA 1I4LD 3CNNA 1G20E 1GRQA 1SXJC 4ILEA 1P60A 3EWSA 1XMIA 4UXIA 3SN6A 2ZS9A 1Z47A 2QMHA 1ZM4A 2ZJ5A 8OHMA 1W4CA 1W1WA 4GZMA 3AVOA 1JJVA 4HDQB 2BKUA 5DH9A 3TKLA 5KPDA 3KQNA 3B1WA 2IYZA 3QG5A 1XXHE 4B2IA 1GL6A 4BRWA 5E3HA 3IQWA 1KK2A 2Q3HA 3QXJA 2ZUBA 5GJVC 3RS7A 2GJSA 4Q1BA 1MH1A 2OXRA 2OAQ1 4B48A 1XZQA 4HUQB 3C8UA 1Z6YA 2P65A 4JSTA 2WWXA 4DLRA 4LJYA 2GXSA 3NHBA 4KODA 4BLQA 1FMJA 2REOA 2CNWD 5JLJA 4JL6A 2DFTA 4OK3A 1ZM9A 1Q3TA 1ZD8A 3QKTA 4LJ7A 4MQBA 3KUDA 3SU8A 2K5UA 4Q4AA 5GVRA 5B64A 1PV4A 1NG9A 1NIJA 4FIDA 4YQFA 3U7GA 3I8SA 1PZNA 4G5RA 5CDFE 5GVSA 2WMNB 3D31A 4K8OA 4URYR 1KDPA 1UPTA 4PAMA 1AA9A 2QPOA 2GVDC 3GFPA 3PCRB 5CK5A 3WXMA 1VTKA 1FL9A 2B7BA 1MRSA 1M2OB 4IOJA 3GJ4A 1PVOA 1UFQA 3PVSA 4WZAE 1VMAA 3T06B 4GDFA 2RB4A 4Y0VA 2ZRHA 1JALA 1XMSA 4B3CA 4OI2A 3T34A 3SS8A 2AD1A 4CEHB 4IVPA 1AQYA 2PEYA 2AKAB 3IILA 3OIWA 2AK2A 4ESVA 4BLRA 4MUBA 4D4LA 1SXJD 3KXLA 2V1UA 1XB2A 4HSEA 1N6PA 1L4YA 2ZRLA 2LKCA 3X1YA 1Q1QA 821PA 4C0QC 5AK0A 3ZIAA 4KFTA 4TYPA 3I4LA 4RZ2A 4Q01A 2QROA 4B6EA 2FEMA 1MR3F 3KX2A 1KZ7B 3SHFA 2ZYTX 4IJMA 4DCVA 5EE3A 2WSSA 4P4TA 1KI7A 5FUVA 2Q0HA 2OXCA 4D82A 3NH6A 2KJQA 2OBNA 2CCGA 2O8BA 1J2JA 3QENA 2J0UA 2ZETA 1W46A 2J9RA 3KKQA 2C8VA 3VR3A 4LRWA 4PAOA 5JBQA 1ZUNB 3EZ6A 4XIGS 5EE5B 3THXB 1QHHA 2EFGA 2CJWA 4PZLA 2HUPA 2O52A 5FTMA 4JVSB 4Q4JA 4LI0A 4Q66C 1NSTA 3HPQA 5C4GB 5B57C 1E2JA 1QVAA 1GKUB 4GPTA 4JL8A 3KFXA 3B8HA 3GJ8A 4LBYA 1ZRHA 2ZANA 2ZJAA 4PO1A 4BFZA 4HAXA 1XCGB 4PSAA 1RJ9B 4PR0A 1FZQA 2O8DB 2PT7A 1TADA 4R98A 4UXJA 4R71A 2NIPA 2W58A 1GRNA 1N0UA 2YWGA 3C5HA 4NCKA 3I3SR 3L0IB 5FOTA 4G5SA 1GM5A 3RRMA 1GVNB 3FTQA 1RRFA 1YU9A 1ZM2A 3SI7A 2BBSA 3V4RA 5DLQC 1F2TB 1D2NA 1OF1A 721PA 3QVVA 3CRMA 1NLZA 5JZVA 2QPTA 2QMEA 2EWVA 3FHCB 2QNRA 1W36D 2IK8A 4ZKDA 2GZHA 5JRZA 3RS0A 1C9KA 2ZSBA 2VSFA 4C0HA 1TU4A 1XTKA 3L8YA 5KSPA 2WWWA 3BIFA 1NN0A 3CO5A 4BFTA 1GP2A 1P9WA 2BBTA 2DHRA 2R65A 1KI9A 3K8YA 4N0DA 3TSZA 1KNQA 2C5LA 4Q02A 2RGGA 2BBOA 4LJ9A 3BOSA 2Q3FA 3QEJA 1TQ6A 3H1TA 3UIEA 4XWAA 4A6XA 1DAHA 1D9XA 121PA 4HI0E 2AR7A 5CM8B 5HCNA 1E2GA 2GJ9A 3TUIC 4H9GA 4D4MA 2X2FA 4PPGA 1AZSC 2JLXA 1KAOA 5FUYA 1XTJA 1IJFA 3GLHA 1R7RA 5BWMA 1NBMA 4JLKA 1W0KA 2QMOA 3Q7QA 4QKQA 3LVQE 4B3GA 2XTNA 3W3AA 3MWKA 2ZQ5A 1KJYA 1Q3HA 4OI0A 1JR3E 3UPUA 4Q1DA 3N2IA 1P72A 3X1DA 3R9WA 2CCJA 1X8JA 2FGKA 2J87A 2ZPTX 2PZFA 3WMFA 1UKEA 3IIKA 5JJKA 5DE3A 4LV6A 1KSFX 5HKKA 2CLSA 2HF8A 1YE8A 1N3BA 5A5GA 2QP3A 4Q9KA 3ZQ6A 1WCV1 1NRJB 1Z0AA 4XSGA 2WIBA 1W49A 1X1SA 3GEEA 1ANKA 1P4SA 2JGNA 1DTSA 2A5JA 4HEJA 3TAHA 2ZS7A 4HYYA 4D26A 2NMVA 5D3MA 4L15A 4CT5A 1SKQA 3QEOA 3QVUA 3EIQA 1G7SA 4A0HA 4CZ2A 4URXR 1FFHA 4PFSA 4KI0A 2JDID 1OSNA 2NTYC 2GILA 3AKCA 3RABA 3B5JA 3SJAA 3WP1B 3AKEA 1OXTA 2OO7A 3RS4A 2QM7A 4Q4HA 3HJNA 4E09A 4B44A 2F9LA 2O0KA 4YONB 2UZ3A 4QHYA 3EG5A 4GMDA 2G0NA 3OFNA 3N70A 3UMSA 3MJRA 3K0AB 2WAXA 1GNRA 3VU9B 2NO9A 1ZNZA 1US8B 3NC0C 1G4UR 3EIHA 4BECA 1SQ5A 2VIIA 1Z83A 1KKMA 3BS4A 3CW2A 5KPJA 3RRNA 4K46A 1FX0A 1SVLA 2IYQA 4NCIA 4RKFA 4TZ6A 3S1AB 1G7CA 1JR3D 3EXAA 4G3XA 1GL9B 1G8FA 1BMFA 1P2TA 3QG1A 3TR0A 3GLGE 5FOSA 1NN5A 1DE0A 2A5FA 4JYCA 3ZZ0A 3BGWA 2OV2A 4MYTA 4G5OA 1ZJ6A 3AV0B 1NJGA 3HP1A 1R8SA 3RSOA 3B9QA 1R2QA 5EUQB 5D3QA 1H8EA 3W6OA 3IHWA 4JIMA 4LYHA 4UXHA 5E7JA 2LCFA 4TSFD 3GLIB 1RJ9A 5FPKA 1G6OA 4FWIB 1HYQA 1GKIA 1KMQA 3FHOA 1HQYE 2QAGB 3Q85A 3U2QA 4B75A 5FBWB 3AVYA 2JLYA 4W9MC 3I72A 2B6HA 1II0A 4E22A 4I99A 1YRAA 4NYIQ 2G6BA 4G0NA 2D7CA 1EFRA 1IXSB 1RC8A 1DELA 5EP1A 2GK7A 2IYLD 2HJVA 4KAXA 4KBGA 2ZM5A 2WBLC 1U0HC 1Z2AA 4OL0A 4FMDB 4KBFA 4RCYA 1SVIA 2G1KA 2GHIA 3A37A 3QPVA 4NDZA 4UJ5A 3U7EB 3KKOA 3KZ1E 2B8TA 2FSGA 1FOEB 4BLTA 2ZXUA 2C9YA 4IDHA 2ZE5A 4C3ZA 1KTVA 4HLQB 1GG2A 5KSZA 1XTQA 1XTIA 3TNFA 3A1UA 3EAQA 5ANRB 4ESHA 1TQ4A 4X8OA 1U0JA 2ZU0C 2WKPA 1XMVA 4KU4A 4BQSA 1IXRC 5C18A 5G3ZA 1W0JD 5LD2C 2ZE8A 4CEJB 5KNBA 5EE9A 2EYUA 4DWJA 3PEUA 5DGXA 4A8JA 5IF9A 2AWOA 1N6IA 2XJ4A 3K70B 3SFZA 2QM8A 2VSOA 4Q7KA 4H1VA 3WBKA 2QI9C 1XD2B 5BN5A 4RFSB 4ITRC 3TSWA 1Z8FA 3FPAA 3WMEA 4S35A 4HB4A 3B1XA 4XVRA 1OIXA 3P20A 1U9IA 4GOKA 4LSGA 2J7PA 3UKDA 2QRNA 4CDGA 3GMTA 3NHAA 3P4YA 4LBWA 4ARZB 4Q9IA 2ZJYA 2QAGC 2RGEA 3LY5A 1G17A 3EPLA 4O2LA 3FVQA 4P33A 3O8DA 5KTYA 2FF7A 3CRW1 3ETLA 4YC7A 3AUYA 4HUTA 2ZR7A 4BRUA 4DXAA 5DI9A 2V7QA 2V55B 3W90A 3A6PC 5CYOA 1FUUA 2RGBA 2YWFA 1F5NA 1CJMA 3KB1A 3SQWA 3P32A 3J81k 3RRYA 4Q9JA 3AUXA 4GMXA 3IKJA 1MKYA 4DCNA 5SZIA 2PT5A 3EX7C 5FOVA 2XTZA 3BBPA 4DT1A 1J8MF 1D9ZA 5CLQA 3A1TA 4F38A 1OFUX 1OPXA 2AXNA 4ZO4A 2IXFA 1GAJA 1VG9B 2GTPA 4JL5A 3WNCA 4DLZA 2XTMA 3NWJA 5KHOC 4CEIA 3GLFB 1UJ2A 2ZS8A 4W5JA 221PA 1F6BA 1J8YF 4NYIR 1OW3B 2BJVA 4WOPA 1OH5A 4Q18A 1ZUHA 3OHMA 4PZYA 4NKRA 3W3ZB 2ZRDA 5DN6A 3ADKA 2OBLA 2OCBA 2J7KA 1Q1EA 3PFIA 1KY3A 1DO0A 2G9NA 1ZAKA 2Q21A 3K0AA 3K70C 3PIRA 4TLCA 1CIPA 4L5BA 4XVUA 4RCZA 3I62A 2J59A 3O8BA 2KE5A 2Z0MA 1JXMA 3EA0A 4LC1A 1RPZA 5IHPA 3MFYA 1DG3A 3LXRA 2D7DA 1RW4A 2VBCA 2RGCA 2ONJA 1UDWA 4BFWA 4YMUA 5KNDA 1W4RA 1JQLB 2DCUA 5CB6A 4URWR 1CR0A 4TL9A 3PXGA 1XCMA 1E32A 1II8B 2O0HA 1UBGA 1GL7A 2B7CA 5AJYA 2RGDA 2QMUA 4TLAA 1KMHA 2H16A 3GLIA 3SYNA 4C2TA 1XEFA 4R2HA 2RGXA 4KV9A 4UQOA 3UK6A 3PUXA 4YMWA 2FFQA 2QGNA 3H86A 3QI2A 4OQLA 4QJ4A 4R2IA 3OEHA 3AKYA 4FCWA 4EFNA 1U99A 2N1BA 4ZDWA 3ZZTA 1Z0IA 4DJTA 1WA5A 1CR4A 3C16C 2HEIA 2W00A 4PXAA 1LV7A 1QHNA 1FTSA 1SGWA 2A78A 1C4OA 2WWIA 4LPSA 2IYUA 4F91B 5FL7A 4ZCLA 2EFEB 5KSOA 3PG5A 1EWRA 4PZZA 4FMBB 1P2SA 1E0KA 1J99A 2R6DA 5LB2A 1ZC3A 2W6JD 1HE8B 4M1MA 1H8HD 4MITA 3X1XA 4DSNA 1G3RA 3B1YA 4EPXA 4I4LA 3MWJA 2VYFA 3FE2A 2DFNA 1MOZA 5HZHA 3GLFE 2PJRA 4BFUA 1FMLA 1NP6A 3PJRA 4AURA 4QGAA 4BFVA 5HPYB 1IHUA 3UMRA 4C9BA 1JB1A 2N42A 3QKRA 1D2EA 1ZM7A 5CYPA 4F4IA 4ZIRA 4IFBA 1OXUA 3CBQA 2P3SA 3QXCA 3I73A 2CLCX 4XWOA 2ZYWX 4EIWA 3K70D 4Z1MA 4IVRA 4FI3C 1AK2A 5J47A 1U2RA 2QQEA 3NDBB 2ZI9A 4Q4AB 3LV8A 4FINA 4CW7A 1CJTC 2ZIAA 3EZ7A 3AP2A 3DO6A 2ZRNA 5M04A 1GDDA 2GBLC 4AYWA 2XB4A 1Q44A 4DLWA 2GAAA 1K5DA 4W5HA 3O8CA 4BE7B 2IYWA 4LGMA 4UNSA 1T5LA 1P7CA 3UATA 4QM6A 4PQRA 1LF0A 1KY2A 2H92A 4CGZA 3AP3A 3W34A 2YZ2A 4PC3A 1S2MA 5B58C 3ZGXA 1R0YA 1OXXK 2CHQA 3KKMA 1COWA 5LBIA 2YOGA 1JPJA 3I1FA 3A8TA 3QF7A 1DVRA 4N3NA 1G3QA 3PUZA 2XGJA 2FU5C 4A1FA 4YMSA 4TL8A 4WZ6A 3VR1A 1S3SA 3W9YA 2W83A 2CHGA 2PEZA 2ODEA 3CF6R 2Q3MA 3CZQA 3T1VA 5JJIA 1EFTA 4TT3A 4NBSA 2ZJBA 2OG2A 3R8CA 1TAGA 4P4SA 1U0LA 1F48A 2YJTD 3IPYA 4AYTA 2QTFA 5KUTA 1WRBA 4M22A 1XPRA 1T0HB 5DHFA 5DISB 4ZKEA 4DBLC 4BZQA 2IS1A 2W6IA 2BOVA 2EQBA 2FV8A 3SFVA 3D6TB 1T8TA 1KI1A 1G5PA 2VRWA 1VIYA 2W0SA 1DS6A 1VYUA 1MRNA 5IRCD 2I1QA 2Q9AA 2Y8EA 3CWQA 3OIYA 4P4UA 1DAIA 3N5CA 3T35A 1HTWA 5JEDA 4MKGA 5DNYB 4M0LA 3K9GA 1KO7A 3UMFA 4A6PA 2O8EB 1HE1C 2JJ2A 3DZDA 2O8BB 1GTVA 3BFKA 5EXXA 4B47A 1EX7A 5JHGB 2F1IA 2J0UB 2XNDA 1GWNA 4GP7A 3WMGA 2JLVA 4JLAA 1M34E 1WDTA 1XEXB 3H84A 2ONKA 2J45A 1ZNYA 1XP8A 2ZAOA 1W5SA 1KDRA 4PSVA 1QHHB 5A4JA 2G77B 5F3WB 2E87A 2D4HA 4JVLA 4Q4JB 2GEUA 2NO7A 3HYRA 1N5JA 4GOJA 4BLOA 4XD7A 2NGRA 4NL4H 4TYYA 1P75A 1NLFA 5JSZB 2O0JA 2EFCB 2UVQA 5AUQA 3PENA 4OKSA 2ZR0A 2J0QA 3TBKA 2FSIA 2NO6A 3VR4A 5FOXA 2ZRIA 1Z6AA 3K9NA 3ICEA 4B76A 2REXB 3CX8A 4JT2A 3FGNA 3TW4A 1NN3A 1TEVA 4DLTA 3RS3A 2VP5A 1TUEA 4OHXA 2H8KA 5EP3A 4I1UA 1E2QA 2GZAA 1MT0A 3O47A 2ZSAA 2PMDA 5FOUA 3A4MA 2H57A 3T12A 2JLSA 2JJ1D 1QHSA 1P6XA 4DB4A 3DKPA 2ZRFA 4GI7A 4EFMA 2IHYA 1XFAA 1E9CA 1LNZA 2IYYA 2BC9A 4KLNA 2JAQA 1RYHA 2FSFA 4ERNA 1VHLA 2YV5A 1TNDA 3FMIA 2FWRA 3Q72A 1GRRA 2X77A 3T1QA 1E79A 4POAA 1VYVA 1YZTA 5EP2A 2WIAA 1XD8A 2BDTA 2QE7A 3PUWA 4JKYA 3VR6A 1R5OA 4P0TA 4G5GA 5F9FA 1KI6A 4NH0A 3DM5A 3RYTC 4CVNA 1MO4A 1P73A 4NCHA 1EG7A 2GAOA 1SXJE 2VHQA 2YINC 3WBJA 1YR9A 5C4MA 2BVNA 2ZSDA 2BCJQ 5FPYA 1N5KA 1G64A 1EFUA 1HA3A 1M8PA 2IYRA 3FMOB 3GD7A 4AYXA 4QBFA 4A92A 1UKZA 1X86B 3I8XA 4EPYA 2W2VA 4IDPA 4PAQA 3TVTA 4DUGA 2WOJA 4OQFA 2ZJ2A 1KK1A 2QBYA 421PA 4BFXA 2F1HA 3TK1A 2V54A 3ZZUA 3GLHB 2GJ8A 4KVGA 5EE1A 4C4PA 3CRVA 2FGJA 1U81A 2VHTA 1OYWA 2IT1A 2ATVA 3QKSA
chains in the Genus database with same CATH superfamily
3LLVA 2VTKA 4EJSA 2PYIA 16PKA 1U9YA 2Q9CA 2BFPA 4L8LA 1PK8A 1GGKA 1QIKA 1T9AA 3O2NA 3NP7A 3G8CA 3JQFC 2JI7A 1E7SA 4IICA 2FRXA 3L6BA 1DAEA 2NTJA 4TKLA 2H06A 3WKDA 3D2LA 1U2ZA 3TB4A 3DHYA 2RIPA 2WOOA 1VIMA 2NVBA 1BRTA 1E5VA 1FTGA 1R64A 4COOA 4KNWA 2HK9A 1NMSA 2J9ZB 3WK7A 4MARA 2WB2A 5CNJA 3IIEA 5TC4A 1L3BA 5TGTA 3HNPA 2QA5A 1O95D 3L0PA 3EHDA 3GJSA 2JLZA 3VNRA 1N2CE 3IAUA 1DXHA 2RGUA 4S1PA 3PP8A 5KOYA 2R7KA 1YB6A 4O8ZA 2ZCJA 2AFIB 1UJ6A 2OUIA 5G40A 5CHEA 1J90A 1PEKE 1JA9A 3UT0A 3W6PA 3V00A 1H0RA 3EDQA 3CLVA 2CW5A 1Q84A 5CLJA 2FPOA 3NAMA 5KYUA 3DDOA 3PD1A 4YROA 3ZHVA 2BY4A 4MR8B 5IJ0A 3U4QA 3TLYA 4QPPA 3PQ3A 3TQFA 7AT1A 1D6JA 2NQ8A 4R7TA 3CTMA 3AF3A 2YV3A 3IUJA 1JHXA 3EIOA 4Q4HB 2ZM6B 2W90A 2XEXA 3A6DA 1MA3A 5BYJA 1GYRA 1RAFA 4TZTA 4TSRA 5ELXA 3WLQA 2X13A 2O8EA 4NFYA 3LWNA 1KETA 1B73A 1L8OA 3AVWA 2EZTA 3FZGA 1O57A 3L1IA 2J8ZA 2PIDA 4L76A 4QL3A 3BD6A 2QSYA 1KO5A 3OPYB 1GPUA 3ZY3A 5LQRA 1XEXA 3EFOA 3OO1A 2BYTA 4RD1A 2BFEB 2XCUA 4GR4A 3C39A 4M8KA 2VF7A 3E5RA 1J07A 4IO0A 5IDWA 1FNDA 3QJ5A 5IBCA 4WIAA 2I2DA 3OF2A 4Y9DA 3WWEA 1BEZA 3GLHE 4I2VA 4HLNA 2DZDA 1JEYA 1GSIA 1LSUA 3CQ9A 3ZCQA 2PVPA 3V8BA 1PS0A 4I2NA 2GF9A 2DG2A 6ADHA 1ZP6A 4KSBA 2AIRA 3I30X 1EIWA 1M67A 2A8YA 2AX3A 4X97A 1STOA 2NU7A 1PNVA 2EW8A 4QXMA 2J5QA 1B8PA 1Z35A 3G82C 2CLLB 3CIFA 1JG6A 4J3JA 5H1YA 2I6SA 4CMGA 2NVWA 3NEPX 2JVJA 5BUSA 4XFKA 1NT2A 1DWPA 1UP6A 3K6JA 1UXIA 1PHRA 2VQEB 4HEHA 4ZV4A 1DKLA 1IPFA 3CUKA 4FFBA 2CMDA 3B2QA 2DFDA 4HQKA 1MA0A 2NT3A 1D04A 2M1XA 4M1SA 1JAHA 4R6XA 4WKGA 1K88A 2O2DA 3SK0A 2ANCA 4S1OA 2O6HA 3KV1A 3NVDA 3WGUA 2ZREA 2WD7B 2DQSA 1L8QA 2HR1A 2BFCB 4LRSB 4N5LA 4LZLA 1TF7A 3L84A 3HVHA 4XPIB 2PH7A 3N8DA 2HOQA 2Q3DA 3M1IA 2AFIE 1D5CA 2IHTA 1XJCA 4RFLA 4YJ2B 4ZJUA 5CBKA 4HLUA 3VYWA 2PKXA 3ABIA 3PGJA 5KS2A 4HH4A 1WB4A 4URVR 3AERB 4GOXA 4IV0A 2Q5QA 3OTQA 4JP8A 4RY0A 4UUAA 3ICCA 1RYDA 2V7GA 4IGIA 3OE7A 4NARA 3RU3A 1SCJA 4ABYA 5DM4A 4HVAA 5LYYA 1M73E 1NDUA 1GT6A 1R0BA 1WUIS 2Z5GA 3J7TA 1M2GA 3FBGA 4X9XA 1M66A 2XBUA 1NQXA 4HZIA 4RHEA 4WOKA 4XWGA 2WVJA 5L95A 1GGHA 3VAZA 2PHZA 4CMAA 1WXDA 3JWGA 2Q5JA 4IIXA 4KIUA 1DEAA 4NDAA 5JXJA 4LQLA 4K0KB 1A76A 1R0ZA 4MROA 3VHLB 1ZL0A 2XF2A 3LXMA 1XEWX 3U40A 1GR1A 3MD0A 2WVGA 5A3VA 4E5SA 1Y8AA 1A69A 1TW3A 4XWWA 4XDYA 2JFUA 1UBCA 1KMCA 3L4SO 4Q6BA 1QO0A 4BVJA 3H4VA 1EUDA 1KHTA 5CB0A 4U7DA 4ND7A 4DWVA 1L5WA 1OGJA 3NHUA 3OZGA 1AUXA 4JT9A 1M1YB 4TS1A 4WH0A 2BFFA 1IUNA 2XVAA 5FBQB 5PGMA 4CJXA 3HUTA 1IUPA 2Z2XA 4I50A 2NN3C 3QVTA 2IBSA 5IC6A 1RRCA 1J6UA 3A7DA 1G8YA 1P7ZA 1YDGA 3PQEA 1Y34E 5L4NA 1X7YB 1H42A 2XMDA 3OZBA 5KDDA 4TKVB 1JDJA 2FWIA 5CEFA 1FRNA 3GFRA 4KK3A 5GJWC 4EHFA 4US2R 4V24A 4QELA 3FHTA 2ZB8A 3FNIA 1KC3A 3PHGA 3VKWA 5CH5A 3PFKA 3LOPA 4HH1A 1JI0A 4PZ9A 5F5LA 4DOMA 1A8SA 2ZJ8A 2HQSA 3HKEA 4II3A 1H2EA 4RYLA 4TKUA 4F8JA 1YQTA 2GCNA 3FBWA 3UOAB 5G1PA 4F1JA 4LTDA 2PVSA 1YJ8A 5AKJA 3SXPA 1BHQ1 1DBIA 4KYTA 3ROQA 3UMGA 1E2EA 2CFRA 2PTGA 3HDJA 1J25A 1JHQA 2WP8J 1C14A 1DBRA 3KAKA 3P9KA 1J0CA 1UPXA 3OFND 1P2FA 1ZD4A 2M6KA 5EJ8A 2FKNA 5L6MB 1VIAA 2X7XA 3K1JA 4CM1A 3CF2A 1WG8A 2WNHA 1X87A 4LE0A 4G97A 3BWYA 3BWDD 3OURA 3QJGA 4I5IA 4NE2A 4R1TA 4KIWA 4MHTA 2ZRJA 2BN4A 3MUNA 4QDZA 1EFDN 5K3BA 1V1JA 1ZLYA 2FN3A 4YCAA 1ZVKA 5CDGA 1YR8A 1TJ4A 5KU7A 2XVXA 1SK8A 5HM6A 4HWTA 2HMSA 2GZSA 1QCDA 2HPZA 4XOUA 2ODAA 2PL5A 3E5HA 3E2PA 4F2PA 4YUWA 4CL2A 3O8OA 1R10A 5HFAA 3TLXA 4X64B 1U8AA 4D02A 5JAHA 3SIWA 3NIDB 3RANA 3RKRA 3OPVA 3R0JA 3FPSA 4JSYA 4WERA 4PC1A 1FSZA 5DO9A 4DEYA 1VHTA 2QLNA 5CBPA 1FK8A 2Z4RA 2MSDB 3S68A 3ZVMA 1TGVA 2Q1WA 2W98A 1NUHA 1IOVA 1M1YE 3FMFA 3W04A 1O0CA 5J23A 3LWZA 4UBMA 1WW3A 2PS0A 3WSWA 1F20A 2IOFK 1K97A 4KXFB 3DKVA 4MCAA 2AL7A 3ZDEA 5CA0F 1RRKA 5EHXA 4QRHA 2ONZA 5M7EA 2A35A 4KG7A 3ZHYA 1N2EA 2I67A 1KEPA 4EO4A 5KOIA 2E1RA 3TIIA 1S9HA 1D3AA 1UM9B 5IDXA 4DHWA 1N7GA 3IV9A 2R8YA 3A3PA 5EWLA 2O05A 1DIRA 2DFPA 4GYJA 4J75A 4TLBA 5F4ZA 5TV2A 1QIMA 2B8JA 1B1CA 4BNLA 2BFOA 1E6CA 3L82B 5AXAA 2XE4A 3G02A 2WY2D 1CUYA 1LDEA 2H1CA 3GRKA 4TWRA 4C4RA 4IRUB 2JC3A 3B6IA 1Y3DE 3I5AA 4WFJA 3WYGA 5J58A 2BMAA 2QM3A 1JYEA 4FKBA 4G6ZA 4NZPA 5CX1B 2BTQA 2OZKA 3P9YA 4YAOA 4E4TA 2FJPA 4AKEA 5K8TA 3EQ7A 1OAOC 2Y1FA 2OILA 3FVVA 5D86A 5AKZA 3UHPA 5J1SB 1SRQA 5FUWA 1KEUA 3KFVA 1WZCA 3ITEA 2J3KA 3V46A 4V38A 4I1PA 1L1RA 1NKTA 2GYYA 4IDCA 4QDOA 4I36A 1XBTA 3F3YA 4LQ4A 1MB0A 1OJ7A 4XUEA 3D7MA 3U9TA 3ZHZA 4RY2A 1JWLA 1RKXA 1ZOSA 3X44A 4ZN6A 3GP8A 1FNBA 1QIGA 2WI8A 3KWLA 2GCOA 1TVEA 3LC2O 5JS7A 3LQ1A 5ERYA 1K6IA 2JGRA 1E59A 5A0FA 1UODA 1BW9A 1VECA 3NLLA 4QVKA 1ISHA 1P61B 1KC1A 5DYGA 2VO1A 2XCIA 4EI8A 1SR8A 1XNRB 2YQZA 4ER7A 1NVXQ 3T1HB 4K2AA 4KNVA 2QYOA 1GSAA 3GRVA 3V9PA 3NBMA 3B51X 1O54A 3PVZA 1X70A 2VYNA 4US1R 5A4KA 3FPHA 1D7AA 1E1RA 3LPLA 1I3KA 2VOEA 3A9RA 2GSWA 4L6AA 3VKGA 3GQBA 1G9XA 3UW3A 4BJ3A 2Q62A 5AK6A 3DAGA 2I7DA 1H0KA 1YDFA 1PT8A 4NAHA 1X7ZA 1CRWG 3TJRA 4DDVA 3EQ9A 2H3HA 4QWMA 3PQ7A 4QARA 4MUFA 3YASA 1L6RA 3KXIA 3GXBA 4MRRA 1TTQB 3BTUA 3M83A 5I7EA 4CL0A 1OB5A 4TM8A 4FU0A 3DMYA 1ECFA 4FXPA 1VHQA 3ESAA 4XGRA 1NXQA 1WBJB 1L2TA 3DTYA 4I5FA 1KZ6A 4PSUA 5CVJA 1Z5UA 4PG5A 1M2NA 1NF9A 4OP2A 4NBNA 2ZT6A 1E3TA 3A1VA 3L41A 2Y99A 1CS0B 4FYPA 3ZGLA 1JDSA 2B2NA 3H5NA 4P2GA 2B3DA 2QW1A 4DCUA 1N2IA 2FR8A 4J1QA 4XCXA 1XWFA 4BP3A 1UOPA 1VL0A 1WKCA 5BSVA 2VPPA 2HYDA 3EEBA 1G0OA 1Y1TA 3LUFA 4G36A 1I7NA 1B76A 3H5VA 1FP7A 2YJNA 3AR6A 1B2RA 3K9LA 1WCWA 3V8RA 1PNOA 1HFWA 3TMKA 2Q8NA 4AN0A 4B7ZA 1EJ6A 2ORED 1EP9A 1CCWA 1JSXA 1QANA 3AZPA 2VHCA 4G5YA 4TTTS 2D00A 4B5LA 3KUCA 1DEHA 2PAAA 1JXOA 4P92A 3ASYA 1O5IA 1X0XA 1UUFA 4QFCA 3L4KA 1FSGA 1QIIA 5JI2E 1QAOA 2GX6A 4YI3A 4GIBA 1NOJA 2KLBA 3KJXA 3COZA 1WPRA 1JXQA 1X80B 2Z6VA 4F96A 1U0BB 2G0TA 4W7SA 1S2DA 4OGFA 2QV7A 2ZI3A 4JC8A 2B5OA 3UYLA 3ZLVA 4AWXA 2HNKA 3D8BA 1RFGE 2Q4TA 3GPBA 2X4GA 4ALKA 3WYCA 2O5RA 2FP4A 5JARA 2W4MA 2BEVA 3FKSD 4ZDIA 1JMYA 3K2BA 2BIFA 3USCS 4DG8A 1NM5A 3BXGA 4FOTA 5AICA 4ZDKA 5CDSA 4IHJF 1T29A 2G4VA 3DCNA 4NV3A 4EA6A 2FYTA 3WYEA 6PFKA 4MCIA 2WD9A 1UMBB 1L5SA 3DNFA 4ZVNA 4C5CA 4QT4A 5K5EA 4LZZA 2RD2A 2I7TA 2FUEA 5F1OA 3QX9A 2Z3WA 2DOKA 3I04M 3UWDA 5CLLA 2PPLA 2WWGA 5A3RA 2BP7B 4G1BA 4TPKA 1FP1D 2BEWB 2G5TA 3TQHA 1I94B 4QGHA 4EA8A 3HKCA 5IABA 3UUFA 1KZ9A 5D3KA 3SR4A 3DQQA 5JATA 3QEKA 2DUMA 1RQRA 5LDHA 5MN4A 3IIIA 3RS9A 4OAPA 4B7CA 5HUHA 2JH9A 4GBED 5ALQA 4NVRA 4YJ3F 4EHLA 4GKBA 4CM4B 2GXUA 3IPLA 1HC7A 1DINA 4O4HF 9ATCA 1MO2A 2VEDA 2B1IA 4U7FA 3L04A 4UHHA 3QNWA 2PGXA 3O1IC 5ALGA 4WA8A 3PI6A 3ONWA 3OU7A 4TV8B 5EQTA 1J42A 3JTMA 1UEIA 2AT1A 1TX4B 2CHFA 4LF7B 1C3VA 4RMNA 5BMOA 4YV0A 3IBYA 4DUZB 3UMYA 4BS9A 3RSFA 3JQRA 3PRKE 1L7DA 3VSEA 4N41A 1YF3A 4QEKA 2BCGY 3FCAA 1V5WA 4AUKA 2DB3A 3OEYA 4INJA 4MVCA 1XWIA 2V03A 4RLFA 3UJ8A 4TTQA 2EGHA 2GNOA 4EGAA 3PE6A 4O4JB 1IZZA 3GJ5A 2PKRA 3WNZA 5L3QA 1RLIA 1QV9A 4OHUA 4OMFG 3NHJA 3LKVA 1DRVA 1SCQA 4MDEA 1N9GB 4Y67A 4QXPA 1XDBA 1OILA 4EF5A 2IUYA 3Q15C 5IMSA 3CGWA 3DQZA 3GX1A 3C85A 4OQZA 3IRVA 4OXNA 4J2TA 1FVOA 4I6JA 4WE3A 3E9YA 4ZI3A 1IXZA 4JP1A 1FLAA 1QDLB 3ANTA 1SULA 2BSAA 3CO0S 4IKPA 4ZRNA 3TGPA 3W6NA 3OT1A 5I7HA 5CT4A 4F04A 3P9CA 4GYWA 4YJKA 2H0QA 2BH2A 4BVGA 1U8ZA 2Y1DA 1PJSA 1X8KA 1GG8A 2J3DA 1GPH1 4J49A 1NQWA 5J5CA 5HR5A 1XTVA 2GZ1A 2ZI7A 4HGNA 3GGJA 4NFHA 4B6JA 4AZVA 4I3FA 5BSTA 4EUFA 4EJSB 1E99A 3H13A 3W6ZA 3IV7A 4CCAA 1CVIA 5JQGF 3QVWA 1DOZA 1ACMA 3F4BA 3RNLA 5FPSA 1UFOA 1UJ4A 1EZ1A 1JJ7A 4EVSA 1PJ3A 1WLSA 3P9NA 4JGBA 3KJFA 5I7FA 3PPIA 2OD9A 5IC5A 5JYBA 5FPTA 5LMCA 4PNZA 4AMUA 4YMGA 3PUYA 4HAOA 4JI5B 3ENQA 4IX1A 1SEVA 3UJBA 2JFPA 3E9NA 2HT1A 2AYYA 2GESA 4I55A 1G16A 3UWSA 4FYXA 3X2FA 5KYWA 5AO9A 3TTUA 4D3XA 4MWBA 2VK8A 3MZ0A 3FKQA 3QXSA 4YALA 3WQRA 1YJQA 3IEPA 4FOLA 2HMVA 4P0PB 2A88A 4X8HA 2EBFX 1NUPA 4IFIA 1W94A 4ZJZA 4CDRA 4O5AA 3RBZA 1PFWA 4QDUA 3RHSA 3CZAA 3LHSA 5B53A 3R5JA 3SXJA 3TZHA 1KQNA 4Y2VA 4YIHA 3DAPA 3KWFA 3VU0A 2VL7A 1V5FA 4EKGA 3Q3JB 1A82A 1DUVG 1GGFA 3ABQB 1XZFA 5KYUB 3DEHA 1B6GA 2HA6A 3NANA 1KZ4A 5EP4A 3U4QB 4TZ0A 1DKNA 1EXWA 1LLFA 2QRJA 4A1OA 2OHIA 5FTWA 4EZBA 4WT7A 5ITWA 1PWEA 1Y1LA 4GUAA 5D51S 4YRKA 5HSGA 2PZGA 1E9RA 5C1BA 3RRBA 1X1RA 2G4CA 3ZV6A 5I45A 1BDJA 2XNDD 4GICA 4MX8A 1Q77A 4M9SA 3IMCA 1I7LA 2INGX 4ZAZA 4B43A 5AVJA 1J2EA 1M0WA 4A9AA 4UCFA 3L2OB 4B73A 4DSUA 2WWFA 2F4NA 2PD4A 1EBBA 5CFNA 1Z0UA 1TCCA 2GK4A 3OMXA 3P4XA 4G8DA 3SDZA 4BVLA 2FZWA 3FB4A 2QLMA 3ZV7A 1TQDA 1KEWA 1ONOA 2G80A 5JJCA 3G8AA 4W4TA 3R4VA 2YC2C 3KBOA 3M2TA 4PPNA 4QNMA 3UTCA 4DCSA 2IPNA 3N5KA 1CUBA 1E98A 1R3UA 2CLFB 3PC6A 4J3NA 3VAAA 1X1AA 4J43A 4YECA 4EJSC 1XXHB 2REQA 3A9CA 1RI2A 3PFHA 4KWIA 4MYSA 4TQUS 2N0SA 4JLSA 4KPFC 1Z0SA 2P30A 2AKEA 2JLWA 1FUIA 3ADDA 3A2NA 2ZSHA 4KCGA 3VR4D 1HDCA 1JEYB 3GRZA 4DRZA 4RVCA 5LNK6 2HK7A 2X0IA 2Q6KA 3L7CA 1ZQ9A 4NYJR 2OHOA 1IIBA 3G59A 4RPGA 4MEJA 4DQDA 2VPQA 3FYUA 3BD9A 3GRCA 1U0FA 3DEAA 4PHFA 5C3UA 4HWRA 2AUTA 3R4CA 3T3HA 2C92A 2JK0A 1JFVA 3PICA 4FYJA 5CM9C 2OKGA 4JT8A 2FZKA 5G0UA 3L1UA 4NIMA 4BPBA 5AJWA 2O4CA 3RC9A 1E60A 3VZBA 4BJ5A 1NXVA 3ISVA 2OCAA 4FFBB 3JQ9A 4RX1A 4FFDA 4L6IA 1R5NA 2W93A 1I1QB 5AK3A 4R1QA 3X1JA 1N2JA 2GD1O 4BKUA 1FA9A 3GJ7A 4L8VA 3WWZA 5TPZA 1NV8A 3WG9A 2IZ5A 5MF6A 1ZSYA 1EK6A 2GLXA 5IUJC 1CF2O 2C00A 3GGSA 3L0SA 4N7JA 2QE7D 3VR6D 4FWTA 5FBKA 4YFVA 3R2JA 4EDHA 4AK9A 4W1SA 5DHTA 4C06A 1U6KA 2QZ4A 2MOKA 1VKJA 1J0AA 2TMKA 2WIJA 5BNWA 3DR3A 1Q92A 2A67A 3H2YA 3HADA 2P79A 3HXTA 1M1UA 2C03A 2I78A 2ID8A 3M1AA 3JATA 4X3OA 1ZEJA 3C7CB 5JHHB 5FA6A 3LHFA 2P6NA 1P81A 4E1VA 1SHTX 5DXFA 2Q6IA 3SYRA 3ECSA 3SOPA 3A4YA 3ZXUB 2XUFA 1GAEO 3BA6A 4FFNA 4ZVMA 1ESCA 3AUAA 5JNVA 1QZ3A 1OVMA 5TLSA 5JT1A 1J70A 3OA0A 1WUKS 3L8FA 4RGVA 3DD5A 4AICA 5JFTA 5C5EA 1FJ2A 1U80A 4JITA 1NVVQ 1THGA 4HBGA 3V6MA 2Q2QA 5CGQB 2O06A 2JFXA 1OB2A 2ZJ7A 1MZPA 2C2MA 2Z8YM 2NVUB 1VPWA 3EPJA 1EHCA 3Q7PA 5TVKA 4TTAA 4EKIA 1D2CA 1HDRA 1E7MA 1AURA 3Q5EA 4KIGA 4J94A 2A59A 1OGIA 3FDFA 4OQDA 2P4SA 2FE4A 3R8XA 1NN1A 2ZW9A 3VYSB 2JLUA 1E9AA 3JYQA 3VYTB 4J0IA 3EWAA 3CVVA 2J46A 3LDHA 2BFFB 1PT9A 4K9KA 3GFQA 4L16A 1CB0A 1E7YA 1VMIA 2V58A 5LQCA 1I36A 1CUJA 1G19A 4NMHA 4UDNA 4GOLD 1KEZA 4QRIA 1DRUA 1TEXA 3AJEA 3GUCA 3BGDA 3HVKA 1LRKA 5L3RA 1IQ0A 2QUKA 2IVFA 5LC1A 3ELDA 4EFLA 4QUGA 2ONCA 2HJSA 3ZE7A 5CXUA 6ABPA 1H0SA 4FP9A 4RKQA 2IP4A 5BUCA 3LNCA 4YCSA 3ZGOA 1GZ4A 1PF7E 1R0XA 2JLCA 3EAGA 2ZB3A 2D5LA 1ZIOA 1SKUA 4HLUC 3JSXA 4TKUB 3HJRA 1VG1A 3PPVA 1WJGA 4ER5A 1M5UA 4YCJA 1H1LA 1NULA 3I9OA 4L73A 1GAWA 2WJHA 1DDOA 1XLWA 1GKYA 4D4KA 3C24A 1I2CA 2UZAA 2DPMA 2O07A 2NUBA 1OLUA 1UIMA 3V3TA 3THWA 3KVNA 3QQPA 1MAWA 1VHJA 3ORRA 2H00A 3E7WA 5COBA 3JAWA 5LQDA 4ZO9A 4Y2RA 1T3GA 2CLHB 4JK3A 2P1ZA 3D8UA 2V8OA 1G8SA 2A57A 4XQCA 2ZYUX 5IBPA 2AFHA 2BBWA 1QLWA 4LK2A 1T35A 4ND4A 3F9IA 1IK4A 1IEQA 4BEVA 2GMWA 2PX8A 3G8YA 3GA7A 4KACA 3R5FA 5ED0A 2ZIXA 3R75A 4BQRA 1BU8A 4G8JA 2BFBB 3EXIA 2RHTA 2W11A 1QP0A 3OJXA 3I37X 3N6XA 4IXTA 1EFVA 1YZLA 5FB3A 2Q0QA 5EUBA 3O8OB 2H59A 5FWAA 1XTSA 5KNCD 2R751 1O7JA 4Q1EA 1PJAA 4UEQA 1SVSA 4UCQA 4OB7A 2Q46A 5BW6B 1E3JA 3BE6A 1NUTA 5KIAA 5EHIA 4W6QA 1GDHA 5CBPB 1OIVA 2X2PA 1L5NA 3T3MB 4UTNA 1KS2A 1NKVA 2I4LA 1NOIA 1PKXA 2FDRA 1N7IA 1P0MA 2J3JA 3LDFA 5K0GA 3BIOA 1FTNA 1CUFA 4PU0A 2ZIEA 3NM4A 3B9BA 5D5HA 4LHWA 4RZHA 5L4SA 4MDFA 4FSDA 2HRQA 2A6PA 3ACCA 3GWGA 4JYZA 2XTAA 5IJAA 3ML1A 4KGXA 2BW0A 3DD1A 4WXYB 3O4RA 1HT1E 4KXNA 1ENOA 2JGMA 1AB5A 3W5AA 1C8KA 3KG2A 1IBLB 1HL3A 5DSXA 1A7UA 5BW8A 5JROA 5EWLB 3HJAA 2Z83A 4EJ0A 4MEBA 3MT7A 1EM8A 2R11A 4WJLA 3ZTYA 2QDXA 2P5TB 3QWIA 3R0XA 3UA3A 1TVKA 2I4MA 1T1SA 4HNRA 2IRWA 4J0GA 5C3MA 3VR2A 1NI5A 3MTAA 3PLAE 1JKJA 2I87A 3LPCA 3A3KA 3RVPA 1NQAO 1ZXLA 4N6GA 1Q3KA 1SCBA 1YJAA 2BMFA 2X6TA 4IIUA 1NW4A 1R4AA 2BTQB 5BSGA 3W5DA 2ZIZA 4QBTA 3FWKA 3H1GA 4UBOA 3VDQA 1JQBA 4GPZA 2DKFA 2CFOA 4X3CA 4G01B 1H05A 3AM1A 4P83A 1O9HA 5ALWA 3JWIA 5CT6A 3V7NA 1VL8A 4NFLA 5L45A 2ORWA 3D7RA 3VKHA 2RHWA 3IUYA 4B0OA 1BZYA 4LFCB 2ZUTA 2IU4A 4DNQA 4X45A 4EZIA 1B00A 1DQPA 3SJBA 3TH5A 2FK8A 1ODIA 2BMEA 4K9QA 4R7ZA 1BW9B 2ZRMA 1O9BA 1W35A 1W9MA 4Y98A 5AOCA 3U4GA 5JJBA 3ZWPA 3AHCA 3GEHA 3AEQA 3DZ8A 1H2HA 3EOBI 2R6JA 3K5PA 2ZE7A 3AIIA 1V25A 4WTOA 2CLKB 4OFBA 3O4FA 1N5DA 3NOQA 4GI3A 1F3LA 2J1LA 2ZUVA 3KQTA 1EX9A 3IP8A 3PGLA 1HFKA 1ZGAA 1GCIA 2EX4A 2QXYA 3EC1A 3CUVA 4FJ2A 4P54A 3GQBB 3ROPA 1NTOA 3NTVA 1RAAA 2O8CA 1X7ZB 4V0NA 2B5VA 3SXUA 3UFBA 4DCMA 3NHZA 3UHAA 4MQMA 3W5IA 3BMQA 3D7KA 2RHMA 3S2ZA 3Q2OA 4IDQA 3DMFA 1YMQA 4Q47A 3DQPA 1L1FA 4BN4A 2P35A 4CQJA 1B0UA 4P98A 4GH5A 5EIFA 3VVBA 1V41E 1EQ2A 4QBGB 3UT6A 4CCSA 1LRJA 4DIBA 1HZJA 1U02A 1TLFA 1Z2CA 2XSZD 1X94A 2LCIA 2ZJ4A 3HKBA 4FDVA 3F7OA 1SHLA 4G41A 4OQYA 4CV3A 5IUNC 1M1NA 1WVGA 5J9FA 4NZYA 2DQKA 2ZUFA 2IPMA 3L0OA 3SLRA 2OC4A 3GDFA 4I14A 3G2IA 1T36A 2G9UA 1C7FA 2BPOA 4MGYR 1EB8A 4PPYA 2X0EA 4YO8A 5ELMA 1IN8A 4M83A 4BASA 3KTAB 4J76A 5ERGB 3WA6A 4J1NA 5HIJA 4PYLA 3LCRA 4LK3A 5GY7A 1T5IA 1E2HA 3SHVA 5FWYB 4OFWA 3NTUA 2CEAA 4MK4A 1O03A 3OZSA 4DV4B 3LO5A 4MAFA 1V3QE 4B34A 4HR7A 4JJ4A 5ARCA 3JYNA 1EVJA 1GIAA 4L85A 3T52A 3KFLA 1XAIA 4MQFA 4EAAA 3Q2KA 2C2BA 1RBZA 4XKJA 3TDNA 2QRPA 4FZ5A 2JD0A 2P78A 3RADC 3DMDA 4M86A 4UUNA 1KWKA 3VDMA 4Q3BA 4W1PA 3PFGA 3WDMA 2IX3A 4E2WA 3STWA 1BVUA 4G4IA 5J4KA 4FGUA 2OYCA 3QJYA 3ZU2A 3ANMA 4XI9A 4ZC1A 1JQJC 3PGXA 2GLUA 3QKUA 2FP4B 2VP2A 3DTVA 4OM8A 2BEVB 2J3LA 4B35A 1CE8A 1NL3A 3BRWD 4HPWA 4QTZA 1BYUA 3AIMA 3GC6A 2F9FA 3I6BA 3MOSA 2P9BA 3DVAB 1SZDA 3QPWA 4LE1A 3QOYA 2NXCA 2KSQA 5B3JA 3UGQA 2P2GA 4FFPA 1RQPA 2AZTA 4OYRA 5IARA 4PSCA 4WLUA 4RUKA 4IP0A 1P7WA 3DPSA 5IFKA 5GONA 1JHAA 5TIIA 1QRTA 1JJIA 1RWMA 3M4XA 5H82A 1O96A 1GPMA 2JANA 2QU7A 4TKMA 3QE9Y 1RAHA 4LWZA 3HVRA 1K5PA 3PSAA 1CHNA 1PDWA 4KDEA 3VR5D 2XXJA 1XHLA 3KSUA 1I0IA 5DGDA 5U4QA 2ZE6A 3U3KA 5F12A 3UXEA 1UBNA 3TLGA 3RSZA 2C78A 2HU5A 3WLAA 1MAUA 1DHTA 1EFLA 2YHAA 4BWVA 3FOWA 2IXAA 1E2FA 2ZFUA 1LZLA 1YOVA 3UPDA 2P0YA 4ITUA 4LOAA 2FR8C 3VHXA 2WIGA 2P2YA 2VJOA 3VR0A 1ZUNA 3L8ZA 1Z6PA 1ORDA 4GQBA 4DDHA 5HX7A 5IEJA 1DC8A 1W6UA 2PUBA 2C95A 2MIIA 3THXA 1TEHA 2BR5A 4F8EA 1V6SA 3ND8A 4F7DA 2ZRPA 4HPXB 4RIFA 2OFFA 4LISA 4MQ6A 3FVRA 4A26A 4HNSA 1N33B 1CZLA 4RZQA 3DDSA 1SFRA 1JPVA 4ZVSA 4WESA 1Q19A 4DLYA 1JR3A 4S1VA 4HO1X 5KVCA 3JD1A 2N3ZA 1ST3A 4FD3A 3NALA 4K9LA 4FCVA 4RK7A 3WC4A 1WTAA 3SSNA 3ZV3A 3RHTA 2OBYA 4D25A 1YS1X 3E9ZA 3GROA 4XDHA 2CK3D 3MWEA 4CBVA 1GZ7A 1KJZA 4I1VA 1OYYA 1V5GA 3D3EA 5L3QB 2HJGA 2XADA 4IMPA 2RBGA 2Q0XA 3EZYA 2Q45A 1SKYE 3DOOA 5A4IS 1T0PA 5I7RA 3C3KA 1JN0A 4HWSA 2CMFA 4JBGA 4FMPA 4BTVA 4XAQA 3KJGA 2ZUEA 1NM5C 2IUUA 5JCJA 4GP6A 4A2PA 5K1ZA 3FNEA 4K81B 4QUBA 5BT9A 3W4KA 4O33A 3RC8A 2TYSB 1N8KA 1QX3A 3LQ2A 3PQFA 3GGDA 4HPJB 3KP1A 3OT1B 4X20A 1BSVA 1MPXA 5FPHA 1TIPA 4WGGA 1QYIA 1T8WA 2PY6A 3FPBA 1VPVA 3BK7A 3VR4H 1NUQA 4NP6A 3AMVA 3BDAA 3LDGA 1TA4A 2OK8A 2PM8A 2QRUA 4XVQA 1NXSA 4MI1A 2QUAA 3BRQA 3N58A 1FQKA 3L4EA 1QQ6A 1PU2A 1VE6A 2ZI6A 2GFHA 5JMPA 5C0OE 4C6RA 2VI5A 4EUKA 4COKA 3SIPA 3RFFA 3HACA 2HHLA 4IDNA 2QN8A 4JBYA 3Q11A 3OAAD 5C81A 2QNBA 3WLKX 1SKBA 1XCBA 3PC2A 4I66A 3RU9A 4AP9A 5F98A 4UDYX 4GS5A 5F1YA 1W8IA 4I55B 5KYWB 1C8VB 5BO5A 3VNVA 3ZXXA 2XZDA 3PPWA 1P4AA 4I4NA 5JU6A 1NOKA 3ESQA 1JJFA 4CR6A 3QNUA 4CMCA 1Z2DA 5FHQA 5P21A 3E18A 4U0JA 3VR6H 3BE4A 4EJ2A 3TTSA 3EPHA 3B3FA 3QOFA 4UNQA 4R81A 5TS2A 2CNKA 1W0JA 2HA4A 5C5DA 1AN0A 1B8NA 4UTXA 4ZT5A 1SHZA 1R0SA 2H8GA 4CFZA 2A7QA 2IOYA 1GNTA 4OQ4A 1T8SA 1A8UA 4YRLA 3LPAA 5FR2A 5A05A 1REQA 3HJHA 3H8WA 1BD4A 1EK5A 2VRCA 4FR5A 4M21A 5E9QA 4X8LA 1KDZA 5BUZA 3P71T 2V98A 1ZXXA 1C3XA 3FOAA 2YBEA 2GARA 2QTCA 2X0DA 3WTCA 4MGKR 3ICQB 2IXEA 2EERA 4Z8XA 3UO8B 2Z9DA 4KP7A 5DM0A 3OESA 1A04A 4DMRA 3OY7A 4JX8A 4O8CA 1YRWA 2JASA 1RC0A 2NUTA 5DHUA 3AG5A 4I9GA 2QX7A 3EGOA 2X8AA 3JQAB 4DEXA 1XTZA 1YRLA 3TIVA 4M0CA 1KSHA 2AMLA 5IYZA 2VK1A 5AW7A 3UWOA 1EDZA 2XLCA 1BHSA 2I54A 3P4UA 4OI1A 1V39A 2JAHA 2YW2A 1EWQA 3BF8A 1JG2A 3IBGA 4HAWA 4QU8A 5ADHA 2OL4A 4ZVRA 3QHQA 3NYWA 4ETMA 2REQB 1PRYA 4FHZA 5HOQA 5LKRA 3KLBA 3DO8A 1G8PA 4M60A 5JS8A 3RAGA 3VC2A 3PWSA 5FA8A 2QU8A 1HT3A 5DU2A 2XOKD 3UAVA 1QF9A 2PRIA 1FDUA 1CX9B 1AKYA 1IN6A 3KYCA 3P2YA 1IBRA 4JUBA 5IKMA 3V33A 5EIHA 3C3PA 1KJIA 2PWZA 4RVSA 1WEHA 1GYPA 1J97A 4UASA 3KQMA 5C8VA 1HWYA 2M9MA 3C7AA 3CZ9A 2QAJA 4TTSA 3WQBA 3H5IA 1QBGA 1JB9A 4Y2UA 1S8OA 3OZXA 1YTUA 3VU9A 5DTJA 1U5CA 4ZT4A 2FG5A 2DP4E 2VZ8A 3ND6A 1KFCB 2JHCA 3U4DA 1UZNA 2P9CA 4ARSA 2FSUA 1RWVA 3SYTA 1FLVA 1SO8A 4CKYA 2WYWA 3REGA 2RH5A 5LN1A 2VQ3A 3P5BA 3UB4A 2EBWA 1A5SB 3AB3A 4WASA 2JPDA 1IBSA 3HRHA 3S2FA 2CVOA 4TTRA 1IWOA 3PGMA 4UULA 4MW1A 3FTFA 4BLVA 5IJZA 1FDVA 3R6LA 3W8DA 2MT9A 5IUKC 3ZHCA 1M0TA 3G0GA 3BSWA 2RC6A 2XYVA 5IAOA 3DYVA 3FSJX 1RYYA 3CONA 1BGWA 3ENVA 2YTZA 3DMRA 4MOWA 1QIHA 3B52X 3KU1A 1V5IA 1TAQA 2XA9A 4HC4A 5JLAA 1CUHA 1JVNA 1KSGA 6Q21A 4XGIA 3JATB 1DEOA 2QZZA 3FPLA 1HMYA 2H1IA 2HCJB 4ZOAA 5F35A 5TMDA 4P31A 3WFJA 3F47A 3FYCA 3F73A 1G5TA 5FTNA 3NEYA 1XRJA 2O2EA 4QJ5A 3AR7A 2ZQZA 3CXRA 2XAUA 3WS7A 2IOHA 4IW3B 4TWZA 2FEWB 3QQ5A 3ZLBA 2IYPA 5KNCH 4E5DA 5BVGA 3ETJA 2GSDA 4DTIA 4B3RB 2QG6A 2UU9B 3JVUA 2N1MA 4GI1A 3CF4G 4XIFA 1G1AA 4E13A 1QOPB 4GZ3A 3SG0A 4S1WA 1SUIA 3ZXYA 2C2YA 5JS6A 3QIVA 3TL2A 4DABA 3P9RA 3ZDRA 3FYUC 4ZTZB 4EMBA 2YZNA 3ESDA 1J2TA 3IO5A 3JD0A 2XKJE 3QUCA 1VJ1A 5JS2A 1UAAA 2XMBA 3KUXA 2PSEA 3H2BA 3E0QA 2L0XA 3CNLA 2NUAB 4EY6A 4DA6A 4A03A 2HNBA 2WC1A 1FW6A 3IQHX 4DR1B 4RENA 1KJ9A 4PE5B 3PEYA 5C46F 2I9PA 3JQ9C 5CXXA 1W4BA 1HNNA 3I76A 3P19A 2D1RA 4L6CA 5AKYA 1EESA 1S2GA 4DVJA 1DG9A 1VE7A 3KYDA 2CXTA 3L6DA 4K28A 2X2OA 1TEZA 3E6AA 2EJUA 3OQBA 5LR6A 4KR6A 1PLKA 4CKBB 5E6SA 2FPMA 3IUQA 1RNLA 1RYEA 1M6NA 5JYEA 1PDOA 5FQOA 2DSNA 1I7QB 1XD2A 2P8SA 3KVOA 2I3BA 5EZ6B 2AOXA 1RKBA 3LBNA 1XIVA 2V59A 1M3SA 2ZJZA 4ZCRA 4ZYLA 2F2TA 3O83A 1H1LB 4DWWA 5LQNA 4ARIA 4K6FA 2FOXA 4KRXA 3KEFA 2HC9A 4XRRA 4ARZA 1ZN9A 5LZ5A 4B4WA 2HLNA 1OLUB 1Z16A 2FCRA 4YI5A 2UXBB 3THWB 2W2OA 2HJRA 2Q0SA 4S2UA 2UZ1A 3BFXA 3QF4A 4N6NA