2BDTA

Crystal structure of the putative gluconate kinase from bacillus halodurans, northeast structural genomics target bhr61
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
172
Chain Sequence
b'MKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKGERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFIFC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3686
publication title Crystal Structure of the Putative Gluconate Kinase from Bacillus halodurans, Northeast Structural Genomics Target BhR61
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 54
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bdtA00
4HDOB 3TUJC 4P4UA 4G0NA 2PEZA 3DHWC 3K0EA 4QBGB 3BIFA 3RS7A 3WMFA 1O87A 2CCKA 4G3XA 4B33A 3BH6A 2J0SA 4HB0A 4P33A 4M1SA 1U9IC 1UKEA 2SHKA 2I4IA 3M6AA 5JCZA 1BH2A 2ZRLA 2OT3B 3R7WB 3P20A 1I4DD 4XVQA 1MH1A 3W8NA 1C4OA 3ICQB 1ZMXA 1ZNZA 2NGRA 5KU1A 2IYTA 1HEIA 3K0CA 2EW1A 3BRWD 4JLDA 1QVAA 1YZTA 1ZUIA 5AJXA 4B3FX 3GJ7A 5FOVA 3ZZUA 2O8CA 1YZQA 1A82A 3MMPA 2JA1A 1JJVA 3TR0A 4M8NE 4LGMA 1QHSA 4BRWA 1U99A 2VSFA 3C5HA 2CVFA 5FOSA 3CX6A 1LTQA 4MGZR 1P4SA 3CLVA 1OE0A 1Z6AA 2QMUA 1ESMA 2ZR0A 3G82C 4XVUA 3SQXA 4PC6A 1ZUHA 4E03A 3AVVA 1L8QA 3WYAA 3C8UA 1NBMD 1E79A 3DOFA 4LV8B 2E9SA 4DVGA 1W1WA 2ZUDA 4UNQA 4JVLA 4RD2A 4TYYA 4DHEA 3R8CA 1QG4A 2O8BB 5M04A 3U61B 1KO5A 1N0UA 2D3WA 1XZQA 4A15A 4UJ5A 4O2LA 4W7SA 1MOZA 2J87A 4Q1EA 4JLVA 4QGGA 3DL0A 1OW3B 1QHNA 4HDCA 1G20E 5SZIA 3RANA 2J0VA 1E3MA 3NC1C 2XAUA 4BUJA 1VG0B 3LXXA 2GTPA 3I62A 3X1YA 5L3SB 2VP0A 2IYSA 1FZQA 2W2TA 1EFRA 4TT3D 3ZVRA 1A1VA 2O8EA 3THWB 4UQOA 1CJTC 1J70A 1LV7A 4OKSA 3WBJA 4DWJA 3RS3A 3SU8A 2ZI9A 3WNBA 4ASUA 3GEHA 2QSZA 1FFHA 4WBSA 1QHXA 2ZVPX 3CPJB 1SVKA 1E96A 2QROA 3EZ7A 2HUPA 3HU3A 4B35A 4IFBA 4I1UA 4LJ6A 1XXHB 3OIUA 3EAQA 1RW4A 4XWAA 2NPFA 3BH0A 1G16A 2VSXA 3SYKA 2CBZA 1TU3A 2AR7A 1CJVC 1OLOA 1P6XA 2MMCA 1CR4A 1EG7A 3CIOA 2G9NA 5HKKA 1KY3A 4PANA 1W4RA 4JL6A 3CF6R 3GLHB 2QU8A 4CEJB 1P72A 4F38A 1E2MA 2I1QA 5AUNB 2EFDB 4G1UC 1Z0IA 1Z0KA 3Q72A 4MGYR 1NVVR 4NPHA 2OBNA 3PJRA 3EIQA 1G7TA 3KJHA 2VEDA 4OK5A 1WDTA 2E1RA 3R8FA 2IWRA 1UADA 1KI2A 4NDZA 3QBTA 4OQMA 3KQLA 1GL9B 3TMKA 4GT1A 1L4UA 3QQ5A 4W5JA 8OHMA 5EQTA 1R4AA 4Q19A 5BW8A 1PJRA 2IEYA 1GNPA 1TAGA 3E1SA 4HLDA 4Q4AB 4AG5A 2DHRA 2IA5A 2H18A 1DPFA 3X1XA 3QXCA 4URZR 1WA5A 3KUDA 4LHVA 4RZ2A 1S9DA 2KBFA 2CLDX 1QG2A 1YR6A 1DTSA 4JT4A 5EP4A 1NNEA 2CL7X 1CR0A 5DI9A 3LX5A 2CHQA 1E2EA 5JS7A 2ZXUA 1RRCA 4RY2A 3C16C 2GAAA 4LWZA 4MRVA 2IXGA 1TF7A 1P61B 1VYTA 2FGJA 1M6NA 4PFSA 1HH4A 4JYCA 5DYGA 3IBGA 2KWIA 2FSGA 4ILEA 4D26A 4LHXA 4FMBB 4BFSA 1SVIA 1T0HB 4ARZA 3BH7A 3B6EA 2XJ4A 5EE1A 1D5CA 5KTYA 3KKMA 1WMSA 2C9YA 3OAAA 3L82B 1XP8A 3DZ8A 2BKUA 1CLUA 4YONB 1OJLA 3GLFE 2QGNA 4S35A 1RZ3A 3B5JA 2BMEA 5EP2A 4BFXA 2WZQA 1NI3A 3Q5EA 2K5UA 2CMKA 3NEYA 4MH0R 2ZE6A 1F60A 5EE0A 3FKSD 4QRHA 5EJEA 5K8IA 3VMFA 1HTWA 2R6DA 3RSOA 1WXQA 2BEJA 4LYJA 4TLCA 2JLZA 4YMVA 4N1AA 3MUFA 2O8CB 1MKYA 3LX8A 3WNDA 3VNUA 3QBVA 5EXTA 1CR1A 4C0KA 4LJAA 1BMFD 3CX7A 3ASYA 2XSZD 3LVQE 4KV9A 2OBMA 4AD8A 2WWFA 2HCJB 1OXUA 3K70D 2IS4A 4BFWA 1E9AA 1N6OA 2C78A 3QXXA 5FBRB 1G3QA 4CT4B 3MWKA 3TNFA 2GCOA 2HF9A 5FTJA 1PUIA 2ZI7A 2JDIA 4B6EA 2RGAA 1KI3A 1NN0A 1TQ4A 3LY5A 4EPXA 2DBYA 4QJ5A 1V5WA 3QVVA 3B85A 4EKDA 3P4YA 4IDHA 3UMRA 2WWHA 5J4VA 1XWIA 1ZC3A 4JKIA 1SKQA 3X1DA 2J5XA 5FUYA 5JLJA 1Q1BA 1Z3IX 2O0HA 2WKRA 3A1SA 3SFVA 5KDOA 1W48A 1X8LA 2CL0X 1TF5A 3OEHA 3GMTA 3TUIC 3KQUA 5BXQC 3SJBA 2R8RA 1E98A 1P2UA 3CM0A 4NYIQ 4O3MA 5HZHA 1FQJA 2FEMA 4I1VA 1YRAA 1AN0A 2C8VA 4RSGA 3CH4B 4QBIA 3HPRA 4DZZA 3KJEA 1VG1A 4MDFA 4NU0A 3BERA 4CYMA 2QSYA 1SKYE 4PO9A 4GMDA 1X3SA 1KO8A 4DDUA 2O8EB 2NZ8A 1Z0JA 1XJCA 1JAHA 4Q1AA 1Q44A 5KSZA 1ELOA 1ZNWA 4B3CA 4BFVA 4BFUA 5H70A 3LH5A 5K8LA 4TZ0A 3CONA 5J4HA 4X8HA 1TL7C 4ITRC 1E2DA 4XSGA 5AJYA 5JBQA 3VHXA 3CR7A 3AGPA 2FEOA 2IYQA 1QRAA 3OFNA 2VP9A 1XNJA 4OBEA 2GJKA 4R98A 4HI0E 4ZI3A 3KUCA 3PUVA 2IYUA 1KK1A 2ZROA 3T1QA 5GADl 4D0NA 1T8UA 2ZYVX 721PA 3GPLA 1ZM4A 1IBRA 2P0EA 5TV2A 3R9XA 1JR6A 1JI0A 2QM8A 2IK8A 4FWTA 1AS2A 3DDCA 2KI5A 4UNRA 4MITA 2DWPA 4Q18A 5CJPA 1HYQA 3FPAA 1RYFA 1OIXA 3DVLA 2EFGA 4AI6A 5FPTA 2WKPA 1LB1B 1FTNA 2QG6A 3VQTA 2R6FA 1UM8A 2OUKA 3KJGA 1CJMA 2Q21A 3OESA 3OZXA 2NO6A 2R62A 4PHGA 4BZXA 1NLFA 3OIVA 4OL0A 2ZJ5A 4LC1A 4JVNA 3EZFA 4Q1CA 2C99A 1ZIPA 2ZRBA 3ASZA 1KDPA 4Q7KA 5HCNA 3D7MA 6Q21A 4BFZA 1OB5A 4XTCS 1ZUNB 1QVRA 3BXZA 3QKSA 3KKQA 2GETA 2OSBA 3L0PA 3T15A 2FDCA 1T0JB 5KPJA 2XX3A 1E2HA 1BKDR 1EK0A 1J7KA 4ZO4A 4M53A 1YZGA 3W9YA 1SULA 2IS6A 4XJXA 4NE2A 4AK9A 3MWJA 2LKCA 4M9XA 2XTNA 3EC1A 1ZD8A 2JLVA 4HAZA 4JYBA 2GILA 3B1ZA 4OYHA 1GFIA 1W2HA 2Z43A 1S0UA 3QE0A 1Q3TA 1OFIA 3L8ZA 3J81k 4ARZB 4MYHA 2CCJA 1Z0AA 4M1TA 1NBMA 1JR3E 2GF0A 3ZS8A 3BFKA 3UMSA 2J7PD 2BMFA 3M4YA 4MDEA 1S96A 2RHMA 2RGNC 2QM7A 3IIMA 3FMOB 1XXHE 2OCBA 3BFVA 3EIEA 3NVAA 1W0KD 4FCWA 3WP0A 2GHIA 3I8SA 5F98A 3EARA 3IBYA 5BWMA 1W4BA 2RGEA 3I8XA 3L0OA 1U0HC 1Q3HA 4MRPA 3ADDA 1WBBA 1KKMA 2FPKA 4IOJA 2PJZA 3GJ8A 1Z6TA 2P5TB 3VAAA 4TT3A 1M7HA 3PXGA 4F91B 1Z22A 1XBTA 1LY1A 3QKTA 3TLXA 1HE8B 1UBCA 3IILA 4KFUA 4WXRA 4M4SA 4XD7D 2ONJA 4KFSA 2QZ4A 5AJZA 1BIFA 4KSCA 3ZYCA 5HCIA 2GCOB 2XB2A 1QHHA 1KJZA 4RZUA 1COWD 1GTVA 2OFOA 3DMDA 2YWFA 2CLCX 2Z5FA 1KKLA 4RVCA 1KIMA 4A2PA 2X2EA 4GMXA 2WWXA 2V54A 4FCTA 4BE7B 4OQFA 4ZCIA 4IVQA 5FI0B 2ATXA 4IEIA 3I73A 3QIAA 3CH5A 3ADKA 1HUQA 4IOKA 2QPTA 5BYJA 2N1BA 2IF0A 2WSSD 4B3XA 2BKEA 2OCYC 1M8PA 2UKDA 2OZEA 2P2LA 3TW4A 2QNRA 1AA9A 3UG6A 1JPJA 2X77A 3EA5A 4HATA 1J2JA 1K5DA 4EPWA 3JZAA 3BC1A 1AS0A 2Q0HA 5AR1A 1UJ2A 4FWIB 4ABYA 4EDHA 3K09A 1NIPA 2AX4A 1XD2A 2IEZA 3OIYA 4II7A 4TTPA 1DG1G 4OHZA 2UZ3A 1FMJA 1NVXQ 2ZU0C 4YDHB 5KNCA 4URWR 3LRPA 4FINA 1N6RA 4DIEA 1NVUQ 5FBVB 2BMJA 3UXMA 3WXMA 3LLUA 4DLUA 2GJ8A 3NHBA 1KSJA 2R9VA 2D4HA 5DLQC 4EIWA 4D6PA 1Q20A 4UXIA 3MWLA 2FPLA 1UFQA 1OFUX 3KZ1E 3T61A 2VP4A 1NVVQ 2GEVA 4PXAA 4WOPA 4XWOA 4DBLC 4LBZA 4ZV4A 2W6JD 1GRQA 4OQXA 4ZDIA 4CF7A 2QTHA 4TYWA 4BLRA 3GLGA 1FP7A 1YR8A 3IO3A 1AZSC 1RKBA 4TMVA 2H1LA 5F9FA 1DAEA 3Q8XB 4Q4JA 2TMKA 1XEWX 1X6VA 4P31A 4DIDA 3ZGXA 2FGKA 2IYRA 2UVQA 4UXHA 5FBQB 2GZDA 4ACAA 2J1LA 3KQNA 2Q3HA 2A9KA 1PUJA 5CIQA 3UWKA 2J7KA 3CRQA 1T6NA 2BJWA 1S3SA 2IF2A 4GOJA 1FNMA 1MR3F 1JEDA 3FKSA 4B71A 3ADCA 3AVQA 4HYYA 3QKSB 2YWEA 3IQXA 2F9MA 3CRRA 3PUZA 5AUPB 3KQKA 1J8YF 1G6OA 2CE2X 5TARA 1BMFA 4GZMA 3QEOA 3IUYA 4OK3A 2XSZA 4KI0A 4WZ6A 4LC0A 1G291 1DADA 1T9HA 1TUIA 2G77B 3TAHA 4D2IA 4URXR 5JWOA 1XEXA 2GXAA 3V4RA 4KYIB 2ZRAA 4LJYA 4NYJQ 4PAOA 4IEEA 2VL7A 1E2FA 5JRJA 2GF9A 2EFCB 1E1QD 1E69A 3U7EB 3K8YA 2G83A 1GRNA 3FMFA 4LJ9A 3LA6A 2WICA 2ZR9A 4RKEA 1W47A 1SZPA 2NG1A 4ZI2A 1BS1A 3N70A 4QJ3A 1CS4C 821PA 4JVSB 3REGA 1W5TA 1ZC4A 4IHQA 3EPHA 1UBGA 2JLWA 4OHXA 3HWSA 2WIAA 4Q9KA 4BQSA 2RKOA 1RRGA 1G8PA 4KITB 3LBHA 4EJSA 2BVNA 3B1WA 1P2TA 1ZJ6A 1CBUA 2H16A 3AKYA 4M9SA 2JIZD 4PQFA 3SYLA 5LDDC 3F5FA 2WWIA 3IHLA 1WCV1 3AEZA 4L9WA 1NJGA 2ZRCA 1S3GA 1OYWA 4RD6A 4IDPA 3I61A 2DFLA 3PVSA 5E4FA 4NYMR 3C41J 1SXJD 4GOKA 3LNCA 1QHHB 4LBVA 5SZHB 3I5YA 4LSGA 1GNQA 4IDNA 1X1RA 5ELXA 1AKYA 4KU4A 5EXPA 3U2QA 1RPZA 4NCHA 3LFUA 3AQ4A 4K81B 2WWWA 4LK2A 1G1MA 1OXTA 4RCYA 2NTYC 2OCPA 2VO1A 2W2XA 2C96A 3TIFA 3VR3A 4AY2A 4JS0A 3KTAA 3A4NA 1GUAA 2CLSA 1EFCA 2QY9A 4EQ6A 1U81A 2VP6A 4X8LA 4JJZA 2GXUA 2Y8EA 1M7BA 1TQDA 3VR4A 2O5VA 2OXCA 2YKGA 2MSCB 1ZD9A 1TNDA 2AFIE 1IXRC 3SHFA 1U8YA 3U7GA 4IVRA 1H8ED 4UXJA 4PAMA 4A0HA 2GESA 2D62A 2NO7A 2V1UA 1WQ1R 2XGJA 2ZRIA 1MO4A 3H2YA 2GKSA 2ZYWX 1E9SA 1UEIA 4JMPA 4EPTA 2FZ4A 1VPLA 2F1JA 4KSBA 3MCAA 5EXXA 5CYPA 5B58C 5A4JA 3LVRE 4Q1DA 4BLQA 2ZAOA 2H8KA 4C0BA 1SHZA 2IXEA 2FSIA 1TEVA 2WOJA 3FMPB 3QVUA 1YZKA 2EVWX 2NIPA 4TYNA 3NBXX 4DLYA 4PQYA 3IIKA 4KO8A 2HYDA 2ZI6A 1W0JD 3OF5A 4HLUA 3O8BA 5F2EA 3BE4A 5IRCD 3VKGA 3EZ2A 4IVPA 5B64A 1YKSA 4DB4A 2ZPTX 1HT2E 2KSQA 3VHLB 2LKDA 3B9PA 4DLWA 3T34A 3Q9LA 1IY0A 1UF9A 1YZLA 2WJJA 3GLGB 3A6PC 5JJLA 2ZIAA 2GXQA 2BHRA 3FFBA 2IC5A 1TX4B 3Q7QA 4W5HA 5DE3A 2IUUA 4A6XA 4Q4JB 1XEWY 4JLNA 4F4CA 2RAPA 3WMGA 3FHOA 3FOZA 2FX3A 1KYIA 2HXSA 2EWWA 3H84A 3WP1B 3GJ4A 4PHTA 2XXAA 4PPGA 4PO1A 4JBXA 5BQ5A 3SNHA 1VIAA 4ESVA 2J7PA 2G0NA 2ZRNA 1P2VA 3DMNA 3K9GA 4NONA 5FPKA 5L3QA 2FG5A 1IN5A 1KSHA 4P4SA 1P5ZB 4PPFA 4KYUA 2WAXA 4OQNA 1C1YA 1W0KA 1DAIA 4KODA 1I2MA 3VX4A 4TL7A 1G19A 1QDEA 1Z6XA 5GJCA 1OV4A 2ZJAA 5DISB 1CJKC 2QA5A 2HLDD 1GNRA 2ZSDA 1Z47A 4S2EA 4CIDA 2ZEJA 3CRVA 5EXSA 4XD7A 3K70B 5FOWA 3M1IA 2LCFA 1XEXB 1LVGA 5E7MA 5KPDA 4E22A 3K0SA 2D2FA 3C5CA 1KHTA 2B8TA 1COWA 3FDIA 3I3SR 2ORVA 4WA7A 2QAGA 3TE6A 1JBKA 2I3BA 3VR2A 1K8RA 3U60B 4Q1BA 3MJHA 2NOAA 1G9XA 4D4MA 5SZKB 1T5LA 3W34A 1II0A 5KDLA 2CL6X 4LJ7A 2WV9A 5CLQA 3BOSA 3CO5A 2F6RA 1X86B 2A30A 2JLUA 3KJIA 1JALA 1YVDA 4B48A 1HQYE 5DYIA 1E2GA 3UMFA 1YR9A 4DDTA 2C2HA 4DUGD 2WSSA 1JNYA 2QAJA 4C0AC 5J5CA 1W36B 3KKNA 2GZHA 3KXIA 4EJSB 1HA3A 3BB1A 3VFDA 2GBLA 1XMIA 2CVHA 2GAOA 4YXWD 2ZQ5A 2BMDA 4A8JA 3MRSA 3CNNA 2RCNA 2Z6VA 2ZI5A 1E2KA 421PA 3HPQA 4I99A 1IN8A 5IHPA 3RC8A 1N3BA 4K8OA 3TQFA 3LBIA 2BJVA 3IHWA 4FMDB 2N42A 1E0AA 3U44A 4RKFA 3EPLA 4TN1A 4QHYA 2RH5A 1IN4A 2YHSA 4OJQA 3TSWA 4D81A 4HUTA 1FTSA 2WVJA 4C0LA 2OESA 4ZKDA 4Z8XA 3K70C 2P6NA 4YMSA 5BN3A 3CWZA 1D2EA 4NH0A 4QGAA 3A1WA 4TTRA 3PEUA 2ZRKA 4YC7A 4E09A 2X19A 3TSZA 5KOYA 4US1R 2OLJA 5BN5A 3C15C 1ZINA 3RYTC 2IUSA 4R2HA 1TADA 1R5NA 2OAQ1 3KTAB 3B13B 1X8KA 5KHOC 3CR8A 5DNYB 2W6JA 2XTMA 4TYPA 4EQ6B 1FMLA 4B6FA 4A2QA 2J46A 3U4QB 3CKLA 5AUOB 4V0NA 2D74A 2OHFA 1X1SA 2ZJOA 2GZAA 2IXFA 1OHHD 2ZRFA 4LYHA 4QXAA 2W00A 1W36C 3KDSE 4QFMA 4EJSC 1DS6A 1JEEA 5CDFE 3A4MA 5JECA 3KX2A 4CZ2A 5G41A 1KTVA 4JSYA 3AP2A 3MLEA 1D6JA 2V6JA 4FXPA 3V00A 5C1BA 3AVYA 4D0GA 1CU1A 1JXOA 5HE8A 5FR1A 5L3RA 3GCGA 4PPNA 4RFSA 3I5XA 1IXZA 1S9HA 3BBPA 3NBFA 2J9RA 1E0JA 2FSFA 5FOXA 2VP2A 3B82A 3HU2A 1T8TA 4LRWA 5FUVA 4GZLA 3U7HB 3BK7A 5C4MA 1NP6A 2G1KA 2WWGA 2WJGA 2ODWA 3Q3JB 1T3LA 3O8DA 2QN6A 2CJWA 3OEED 3GJXC 1NF3A 4Q01A 3FGNA 1OB2A 2QENA 4U5XA 3SHWA 3S1AA 1PVOA 2GCPA 2P6UA 3KXLA 1OF1A 3LO5A 3P32A 2WKQA 1R2QA 4M2LA 4Q03A 4ACBA 3U3OA 4IFEA 4NTZA 3HDTA 3PIRA 1ZD1A 1V43A 1KI9A 4D4LA 1IQPA 1E1QA 1ZBDA 1Q1ZA 2GA8A 4Y0VA 5BN4A 2PX0A 2HF8A 4GL2A 1RRPA 2YYZA 4GPTA 2XZPA 3CWQA 3KKOA 3RWOA 2Z4SA 2QQ0A 2V7QD 4Z51A 4NYJR 5H8WA 4DDWA 1W49A 1T4GA 4HLQB 2FPMA 1JQLB 4US0R 3AVXA 2V55B 1KDRA 5JWRA 1KK2A 4AKEA 4MRRA 4P4SB 5DN6D 3B60A 4LJ5A 4OK6A 5JZVA 3NXSA 3HJNA 3NG1A 2A5JA 2B7BA 4P32A 3SZRA 2F1RA 3QPVA 4MYUA 2JIZA 2KJQA 4BWYA 4B47A 1J8MF 4V0ME 4EFNA 5K8UA 4LJ8A 1U8ZA 2JEOA 1AJEA 3BORA 2AWNA 2F1HA 4TLBA 1MRNA 3UK6A 1WRBA 4L4UA 1YQTA 4PSKA 4US2R 3AF1A 1CRPA 2VLIA 4QC2A 4PTLA 1G5PA 2CK3D 3THOA 2ZUBA 4CRWB 2QP4A 4KJZA 1SXJA 1NN5A 1Q21A 1CKEA 3K9NA 3D3QA 2QL6A 1NLZA 2VTKA 2WJHA 3H86A 4HLUC 3OIWA 5FFMA 5DHFA 3CZQA 1E0KA 3CF0A 1NMXA 3VX3A 1SVMA 1P7CA 1GAJA 1X8JA 2QAGB 3PUXA 5G53C 2BC9A 3AVTA 1U90A 3DO6A 2O8DA 4L8GA 4KFRA 3TRFA 5FL3A 1NMZA 1ESNA 1Y3AA 1G17A 1G7RA 1VYUA 1OT3A 2FF7A 1EX7A 2PZFA 2ONKA 2X8AA 4GNKA 3WHLA 4DC9A 1ZM2A 2W0MA 1R0ZA 2XJ9A 1AM4D 1ZU5A 3UPUA 3AUXA 3E2IA 1NJFA 2F3TA 1E9EA 4G5OA 1Z6YA 1KO7A 2JLSA 2PZGA 2DCUA 4NYMQ 1XU4A 3SR0A 4IKEA 2XB4A 1KI1A 2VPPA 3CNLA 4A8JB 1H8EA 4TMWA 1ZRHA 1IAQA 3QY0A 1D2NA 3EW9A 3K0CC 3KFXA 2WIBA 3L2OB 3GLGE 2PL3A 3U44B 5A5GA 4DSUA 2ODNA 3AM1A 1GVNB 4Q9IA 1W4AA 3X1WA 1UEJA 5FPSA 3B78A 1T3SA 2PH1A 3EWSA 5EP3A 1PLLA 2Q9AA 4OI4A 1ZNYA 4B44A 4K46A 2QAGC 2D7CA 5EZ5A 3K9HA 2VF7A 2JATA 2VHCA 3QF4A 4PHHA 3THYA 4LJ4A 4I81A 4LX0A 4TWZA 3VU9A 1FUUA 4V0LA 3WMEA 2ATVA 4X8MA 1W0JA 2HT1A 4TMZA 4RZXA 5P21A 1RJ9A 1F3OA 2J3EA 3NDPA 4FIDA 4JLPA 2AKAB 3IDQA 3WRYC 5JI2E 1RVDA 2A3RA 2Z83A 5AUQA 4QM7A 5K8TA 4JLAA 3ZS9A 5F9HA 2BM1A 2GBLC 3TW8B 1SQ5A 3PV0A 4PZZA 4DLXA 4RZ3A 1QHGA 4C0QC 2ZYUX 3DM9B 2JCSA 1R8QA 2YWGA 1DAFA 5JSZA 3TUZC 2G0TA 4N0EA 2QPAA 3RNLA 1W5SA 4RFSB 3TR5A 2RGBA 4LPKA 3T1VA 3CZPA 2ODBA 2Q6TA 4QGHA 3WBKA 4M22A 1VG9B 2H7VA 3O8CA 1FW6A 3EC2A 2A5YB 1H65A 1IONA 1E32A 1TQ6A 4A0RA 5DIFA 4PHFA 4N0DA 2ZITA 4NP6A 5FTLA 4DSNA 2HLDA 1GG2A 2CJWB 3SBEA 5KO2A 1QF9A 1VMAA 5KNDA 121PA 5DO9A 3S1AB 1FQKA 1MABA 4XIGS 2QRNA 4IRUB 1OKKD 2QPOA 1R0YA 3RSLA 4Z54A 1Q1EA 1VHTA 3F0TA 4KBGA 2FH5B 3ZDQA 1G18A 1G6HA 2ZTSA 1P2SA 1YU9A 2I1VB 1US8A 3FB4A 2C77A 2QQEA 4D80A 4NCKA 1UKZA 4Q00A 5JWHA 4UNSA 4JLBA 1E99A 2PMDA 1YHNA 4DB2A 1KZ7B 2IT1A 4HAWA 4I1OA 3SOPA 3KQHA 4UNPA 1TUEA 4MUBA 1KMHA 4A2WA 2QMOA 4DUGA 2MSDB 3B8HA 4JJKA 1DEKA 2XEXA 1AK2A 1G8YA 2GEDA 4C0JA 3AF4A 2QP3A 4POAA 3A1VA 4YXWA 2YJTD 4L5BA 5AJVB 2MSEB 1ZAKA 4WW0A 2AHOA 4C3ZA 3ICEA 2OFXA 3EG5A 2DYKA 1DAHA 1GKIA 3BFXA 1UPTA 3GLHE 5GJWC 1T3HA 2ECKA 5C18A 4GP6A 2AD1A 3UIEA 5AK0A 4UJ3A 2QT0A 3TKLA 1KGDA 2FU5C 1WF3A 1ODFA 1SXJB 5B57C 4KLZA 4NHOA 4FMDF 4JVMA 3EXAA 1F2UA 5KUTA 1EFHA 1XX6A 3TAUA 4DCVA 2MMGA 1P73A 4JBWA 4TLAA 1YJ5A 2D06A 2O8DB 2YV5A 3H4MA 2PMKA 2W0SA 1G7SA 1LS1A 5JHGB 1I4TD 3GQBA 2PT5A 3OHMA 3AVWA 4BZPA 2AWOA 4F92B 2AXPA 4QHSA 4X8OA 3BD9A 3C14C 4Q9JA 2ANCA 4JLMA 2R6CA 1U2RA 4LZZA 1NKSA 4DEYA 1I2DA 2DFTA 1N5JA 3W6PA 4B3BA 1N6HA 1NSFA 1OHHA 1Z5ZA 2FV8A 4LOAA 1W44A 2OLKA 3F8TA 2C98A 4NCIA 2GCNA 4TMKA 5F3WB 2VHQA 4NZYA 3SJAA 4D4KA 3ZD6A 2IYYA 2A2ZA 2ERXA 1HT1E 2EU8A 2HV8A 1XJ0A 2GK7A 1TTTA 3LV8A 1F48A 4JBYA 4AG6A 1R8SA 4R2IA 1GIAA 2V4ZA 4DT1A 4LYFA 4RJLA 3MAAC 4IXMA 4QBHA 1SXJC 4HSEA 1FOEB 5FUWA 4EPVA 3HYRA 1B23P 4Q48A 2YOGA 4BASA 3TH5A 1ZCAA 2BBWA 1ETUA 1SHKA 3GJ5A 4WXPA 3EPJA 4B76A 2RGXA 1Z06A 4B2PA 1XD9A 4DCSA 3OEEA 1XFAA 3QF4B 2XITA 5BYKA 3THYB 2IYVA 4A4DA 4LV5B 1OPXA 3VU9B 5JHHB 2ZRPA 4NL4H 5GJVC 3ZZ0A 1RJ9B 1TF2A 1U94A 1NLYA 1G7CA 3CX8A 5CB8A 1CULC 4A0FA 3IIJA 1OSNA 3K1JA 5D3MA 4M1WA 1A2KC 1TPZA 4LHYA 3RWMB 4CEHA 5FTNA 5IDVA 2Q3MA 4DSTA 4L16A 4N3NA 4G01B 2WJVA 4AKIA 3ZZTA 2V7QA 2IWHA 3ZQJA 3P26A 1ZM3A 4B43A 2N46A 3VKHA 3X1ZA 4LCBA 5DN6A 1Z2CA 2QGZA 1XTIA 3EWAA 4YDSA 2ZYTX 3BB3A 2VIIA 3PITA 4MA4A 1UAAA 2RHDA 1PV4A 4M9ZA 1ZM9A 4ZDJA 1M1YE 2Q9BA 2JJ1D 4EFLA 4JKYA 1KO4A 1OYYA 5J4LA 1KI4A 1KY2A 1GZSA 3QG5A 4KVAA 3NDBB 1MABB 3UWOA 2ORIA 2CK3A 3KB1A 1EFUA 4PC3A 4M1MA 3I32A 2IS2A 2PBRA 1XMSA 3THXA 1HV8A 3U3RA 1SVWA 2BDTA 2F3RA 4L9SA 2H5EA 1F6BA 1NY5A 4Q66C 2AN9A 1A5TA 1XF9A 1LF5A 1IHUA 2A5DA 3QUSA 1JAIA 2GJAA 3AKDA 1XRJA 2W58A 4MYCA 4NBSA 4TL8A 1G3MA 1US8B 621PA 1E9DA 1KSFX 1R6BX 4E07A 2VQSA 3PR1A 1UKVY 4WIAA 4JL8A 2DFNA 4RD3A 3AH8A 3G5UA 1KMHB 4MGIR 3PENA 1ONBA 521PA 3W8RA 1HY3A 5CK4A 5CITA 2O8FA 3V4FA 2JJ2D 3FE2A 4OI1A 2FFHA 3TSOA 2FMXA 1N5IA 2P6RA 3CBQA 4IDOA 4ON9A 3SJZA 2CXXA 3CRMA 4I1SA 2O0KA 3SFZA 1KI8A 3PQCA 1MV5A 4RD4A 3MGCA 3QOFA 1VCMA 4LPSA 2WHXA 4A0GA 3IPXA 2ZE5A 3NKVA 4AWXA 3K0FA 2AK2A 1JQJC 1YE8A 4O0MA 1F2UB 4TSFD 4OHWA 1VHLA 2C04A 3T06B 3FTQA 1N6NA 4Q7LA 4DSOA 3V9PA 1GWNA 3GP8A 1E2PA 3U5ZB 4BEBA 3NH6A 4MKGA 5KSYA 3SS8A 3EX7C 1LW7A 3M0EA 4B34A 2ZJBA 1KNXA 1DG3A 3N5CA 3NIBA 3TGPA 4KHZA 2J41A 3W90A 4C0SA 2ERYA 4A82A 3Q5DA 5FPHA 3RAPR 1XMJA 5FR2A 1O3YA 2AKYA 1KMQA 3GFPA 5JEDA 1XJQA 4G5QA 2OM2A 3TJZA 1TEXA 1VYVA 2VRWA 4ZIRA 1CR2A 2ZR7A 5KSPA 1B0UA 3JVVA 5FTMA 5JCPA 2JGNA 5HE9A 3TBKA 2REXB 3GJ6A 1QBKC 4OHVA 1RE0A 1XD2B 4BECA 3QF7A 1E6CA 1CRQA 3NBZC 4KCGA 2GDJA 2ZM5A 2D2EA 4B2IA 1LFDB 1GL6A 4Q9LA 4AURA 1GSIA 4Q7JB 5TB5A 4OJKA 4DT1B 3RRYA 3PUYA 1VTKA 5HZKA 5CLLA 1ZIOA 1NG1A 1A7JA 4PQRA 4TQ9A 4AKGA 1RC8A 5GVRA 1VCOA 1G21E 2IYZA 2BM0A 1L7VC 2QUZA 4G5SA 4HAVA 2ZI3A 1W46A 2AK3A 1EFTA 2IYWA 3KB2A 3QXJA 5EE3A 1N6KA 2QTVB 1AQYA 5FL7D 4AYWA 4H9GA 1OKKA 2BOVA 3AGQA 2XNDD 2GJSA 1G8HA 1S2MA 2C9CA 2VYFA 2PZEA 4YLGA 4QNRA 2ZAMA 5JI3E 4QBFA 1TMKA 2FSHA 4MKFA 5D3MB 3GFTA 1DARA 1KAGA 2YOFA 1GRRA 3ND9A 4CEHB 4M1OA 4G5RA 1DAKA 4MUAA 1CP2A 3HU1A 4MKIA 1SXJE 3NWJA 3ZQ6A 2F43A 1WBDA 4URUR 3T5GA 2HYIC 3PCRB 1VCNA 3B2EA 2OBLA 2QRZA 3F3YA 3K09C 3T12A 3IKJA 4WZAE 3BWDD 3NEJA 2YINC 4JZKA 1SKYB 2CEAA 2ZSAA 2WWYA 2KE5A 3RS4A 4CW7A 1FUKA 1P9NA 2D7DA 4BEJA 1FP6A 2PEYA 4PPQA 1MT0A 1SVOA 4PX9A 2IHBA 1FPMA 2GVZC 4DLZA 4JIMA 3RABA 1CF4A 3QI2A 2B6HA 4AKHA 2XOKD 2YVUA 2ZRGA 1KAOA 4BRUA 2JLXA 3DOEA 3WYFA 3RDPA 4NMMA 5E3HA 2YC4C 4A6PA 1P3JA 3NBYC 2WJYA 2PT7A 3K9LA 4P0TA 2R44A 1OXSC 3BS4A 1KI6A 2AXNA 3THXB 1XEFA 4E5UA 2IW3A 3AUYA 1IJFA 1XZPA 3CNOA 1I4LD 2VHTA 1N6LA 3RS5A 1AGPA 2O0JA 4D25A 4BFTA 2VA8A 5L3VA 2P65A 2REBA 4HB4A 4B73A 5D3QA 5AJWA 2G88A 2Z4RA 5FUXA 1C9KA 4LDJA 3C7KA 1KDTA 4QL3A 5KSOA 4V02A 1G4UR 2O8FB 5GVSA 3EZ6A 1VIYA 3AP3A 3NC0C 2BBSA 1G5RA 5CJ2A 1IY2A 4O2RA 5J4YA 1GL7A 3QNUA 3REFA 2WPDD 2ASEA 4ESHA 4LV6A 3KKPA 1N6PA 2CNWD 4FMCB 1G4AE 2CE7A 3KXKA 1EX6A 2ZANA 4Z1MD 2R6AA 1AZTA 1R10A 3MG9A 3SJCA 1Q57A 1U8AA 2DFKB 4Q4HA 3GFOA 1DVRA 2YC2C 3K0FB 5HTKA 1Z6GA 1E4VA 4PZYA 5EUMA 5TMPA 1VDZA 4UNNA 1KI7A 1KNQA 3ETLA 1OIWA 2V3CC 1N5KA 2C9OA 4MRSA 3Q7PA 3FHCB 4DLVA 3L43A 3H1TA 4JL5A 4PAQA 2WJIA 2VHUA 1A4RA 1E1RD 1XTQA 5LB4A 1XCPA 4FCVA 3NHAA 4GDFA 4ZIRB 1GM5A 5E7IA 3VKWA 2JASA 3MD0A 4FI3C 5C2JB 2QTFA 4YMTA 1XCMA 4DLTA 4DJTA 3BJIC 3VR6A 1Z0DA 4HAUA 4QOSA 4MGKR 2ZE8A 4M0LA 4BGDA 2VSOA 4IW3B 3RHFA 1HURA 4I4LA 5A0FA 1P75A 4F7WA 1L2TA 2LWIA 2W6ID 4M1YA 4IXNA 3ADBA 5AWFC 2DWOA 4NKRA 1NBME 2WMOB 1NMYA 3EASA 3FWYA 2EFHB 3W3ZB 3ZIAD 1N0WA 2RB4A 1P9RA 4MRNA 3A4LA 4YQFA 3QG1A 3A58B 5JRZA 2ZRDA 1ZU4A 3GLIA 2JJ1A 2KBEA 3AVPA 4HLCA 1Y63A 2RGNA 1Q1QA 1YR7A 2FNAA 1E2JA 5LBIA 3RC3A 1YZNA 3QJYA 3GD7A 1DAMA 2XTZA 5FOTA 3SI7A 3T1OA 4L15A 1G64A 4D82A 1Q22A 1W2GA 2VH5R 1VG8A 3T35A 1F2TA 1EWRA 2BCJQ 1S4QA 3FKQA 5G3YA 5ANRB 2IUTA 1XPUA 3B1YA 2XXAB 2F43B 2A5GA 1F5NA 2CHGA 5E7JA 4TQAA 1M34E 3PG5A 1DELA 2V8OA 1K5GA 5L3QB 1IJEA 1XTRA 1IXSB 4TLEA 4XSHA 3SEAA 4H1UA 1XTKA 4C2UA 3B1XA 1FL9A 3CPHA 4HAXA 1LS6A 4Q21A 5DSZA 4ZCLA 2ZS7A 2JJ2A 3VTKA 2RMKA 2IX3A 4CDGA 3W3AA 4Q9HA 2YNMA 1JPNA 1KZGB 5H1YA 1PLKA 1E9BA 2X2FA 4JLOA 4LI0A 1TU4A 2FFBA 2QEQA 3LW8A 3ZJYA 5TXGA 4CEIA 1UDXA 4GFDA 1NVWQ 5KDDA 1AGRA 2YWHA 2ZSFA 1KI6B 5DGXA 3WRXC 3U6BA 3CW2A 4B32A 1UBFA 4R7ZA 1M2OB 2ZE7A 1OFHA 1KDOA 1KJYA 3LD9A 1Q12A 4TMTA 5G40A 2B92A 4TSFA 5JMTA 3GJ0A 1IOZA 2ZETA 4AYXA 3G0HA 4W5WA 5FOUA 3AF2A 2ZJ8A 4HB2A 5FI1B 3TQCA 4J0QA 4DCUA 4BFYA 4Z8YA 5DH9A 2IS1A 1MO5A 2QORA 2PCLA 1YZUA 3O47A 1NL3A 4EPYA 1R5BA 4HEJA 4M21A 2ZU6A 2WOOA 4GOXA 2HEIA 4MQBA 4Q7MB 1FNNA 4KXFB 2FZLA 3NH9A 4QHTA 5JJKA 3A1TA 1XTSA 1WE2A 5JJIA 3N2IA 5IK2D 1Z29A 2IYLD 4ZPXA 1CJUC 2OO7A 2OV2A 3A8TA 3AF3A 3UANA 3KL4A 2PLRA 1HQCA 3TVTA 5HPYB 1T91A 3GEEA 2REOA 2V6IA 1QHIA 3C4JA 4Q4HB 3LLMA 2VBCA 1W36D 5JEEA 5JS8A 2AFHE 2V1XA 5FPYA 3L0SA 1E9RA 1KK0A 4GSYA 2BBOA 1NY6A 2RGDA 1D2MA 2J0UA 3AB3A 4C7OA 2ZJYA 1OFTA 3OE7D 3CF2A 5CK5A 3UATA 4TYQA 3W5IA 4LHZA 3RS0A 1E94E 5FL7A 1YRBA 5C4GB 1JR3D 1XPRA 2OE2A 3I92A 2XNDA 2ANBA 3N2EA 3PEVA 4B74A 5EP1A 1M74A 4U02A 2ODEA 2EYUA 3SYNA 4CT5A 4QGFA 1IN6A 3RLFA 5CYOA 1G41A 2F55A 2C03A 2ZRHA 3W6NA 1AQUA 3QXSA 2OG2A 2YOHA 3DEFA 2JLQA 3GEIA 3HYTA 1GILA 5UKDA 4A8JC 4EUNA 2IBMA 1NG9A 2FOLA 3UG7A 2QBYA 3R9IA 2FWRA 3ZD7A 4PR0A 1SVLA 3KFVA 3DKPA 4M9QA 3ZH9B 1OH8A 1LNZA 3LQRA 2CHVA 1Z8FA 1IY1A 4PC1A 2GK6A 1KK3A 4EPRA 1BO6A 1NIJA 2BWJA 1G3UA 4JLJA 3A37A 2GJ9A 3GLIB 1JXMA 2QT1A 3ECCA 2XOKA 1XD8A 3FMIA 3EA0A 3U3JA 5C46F 5FH9A 3FYHA 3R20A 1II8A 5DHAA 2PX3A 2WSMA 3QENA 1IM2A 1XCGB 3QKRA 4HB3A 2ORWA 4HZIA 3CUEF 4PC2A 3TVDA 1MRSA 3R9WA 2F7SA 5G3ZA 2HJGA 4XTRA 2PLFA 3FFAA 2DY1A 2DB3A 2NO0A 2DR3A 3IEVA 2BEKA 1H8HD 3QPWA 5L8VA 1Z83A 2XZLA 3PUWA 2EFEB 1F2TB 3H0KA 1N6IA 3W5JA 1G5TA 2QE7D 4C9BA 1NN3A 4IJMA 4ZDWA 1D8TA 1CXZA 1N0VC 4YMUA 2E87A 4HZUA 1AKEA 1ANKA 2ZS9A 5HR5A 5DI3A 1DO2A 2QMEA 3EIHA 2VHJA 3AV0B 5CDFA 3ZLJA 5EUQB 4FW9A 1D9XA 3LBNA 3DZDA 221PA 4LYAA 4D0LB 1G8GA 1N25A 4P3YA 4PO8A 3DKVA 2IL1A 3I72A 3PEWA 4H1VA 3MJRA 2BBTA 4F4IA 1K6MA 4DKXA 4B3DA 2A78A 2FE4A 2WPDA 1PZNA 1E4YA 1D9ZA 2CNWA 1TQ2A 1II9A 2NO9A 1FX0A 2J0QA 5EE5B 4Z1MA 1R7RA 1DO0A 2GXSA 1VKJA 4LBWA 4CEIB 1RIFA 4FMCF 3K0AA 3EZ9A 4MYTA 1DAGA 2R2AA 4XOIA 4WVFA 4RFVA 5LD2B 3W6OA 2HJVA 1ZM7A 1MO3A 1XB2A 3LAWA 4FD2A 4LBYA 4U00A 2G6BA 1N5LA 1ZP6A 2AD5A 2EYQA 5CB6A 2ZUCA 1JB1A 1OXVA 2GEUA 4TL9A 4C30A 1R0XA 5TVKA 4DEXA 3SQWA 4HUQA 3I4LA 1OH7A 1NN1A 5LPNA 4DCTA 1E1RA 4QJ4A 2HT6A 1S8FA 2BCGY 4HAYA 4R71A 2B7CA 3U7FB 2GNOA 3BGWA 3GLFA 2ZJZA 3RVBA 4TQUS 1VCIA 2F1IA 3L8YA 5J4KA 4ERNA 2J45A 4OI0A 3LDAA 3DM5A 3K53A 1E79D 3DPUA 2YZ2A 4AC9A 4QG7A 2W2VA 2ZREA 4O25A 2X1VA 4URVR 5CM8B 5JFGA 5J40A 2NQ2C 1HE1C 4ZCMA 4V0MA 3HP1A 4W9MC 3B1VA 4B3GA 5IT5A 2W6IA 5SZJA 1GKYA 2PJRA 1EWQA 5LB2A 3HR8A 4OHYA 1ZCBA 1W7AA 4IDQA 2H92A 4R9UC 5LD2C 2WBLC 3ZIAA 1L4YA 2H57A 1DOAA 4EFMA 2J0UB 3FHTA 2DPXA 4C7OB 2C5LA 4ZKEA 2G3YA 1EFRD 1U9IA 5EE9A 1JJ7A 1KSGA 4IOLA 1R0WA 1OXXK 3RRNA 4V0KA 4DRZA 4TMXA 3EPKA 3Q85A 3UKDA 4XH9B 1SVSA 4A1FA 4ASUD 4CGZA 3I1FA 2IYXA 4HDQB 1R5OA 5E95A 3QXHA 3MFYA 2CDNA 2FA9A 3LQQA 4KAXA 3AP1A 2L0XA 2O52A 5TY0A 4IOMA 1E2LA 1KOFA 3L0IB 2RGCA 3T1TA 1G3IA 4D4JA 3A36A 3SN6A 3P1JA 4MKHA 4LUCA 3SDZA 1G3RA 1OIVA 2RGGA 3NTUA 2OCAA 2OEPA 3VR5A 5JSZB 4QNMA 2QBYB 5HKKD 1A2BA 4BLSA 2ZSEA 2WMNB 1GOTA 4M1KA 4F4JA 4ZDKA 2ZRJA 1SGWA 3LXRA 4LY6A 4DDVA 1Z07A 4DLRA 1PLJA 4P4TA 5GJBA 2GWHA 2ZJ2A 4OI2A 4YMWA 4A92A 3IPYA 5TDHA 1M7GA 2NZJA 4RD1A 2HCBA 2VP5A 4KLNA 2HXYA 4TL6A 1CEEA 2WTUA 4Q5IA 3WYGA 4DXAA 4EAQA 4F93B 4U7DA 1II8B 4GI7A 1XMVA 5CIWA 2B21A 3P27A 3QKRB 4BPBA 1N2CE 2Z0MA 3MWYW 1NRJB 5KNBA 1J90A 1E2IA 4Q1FA 1XTJA 1U0JA 1WP9A 3R7WA 1BYIA 4GP7A 4DCNA 2DWQA 2A7QA 1ZNXA 1AS3A 2J59A 2V9PA 4PC7A 3RRZA 1DE0A 3AVOA 1GP2A 1QHYA 2ZI4A 5FTKA 3AKCA 1MO6A 3P4XA 3IEUA 1AIPA 1Q0UA 2WAYA 1QZXA 3MSXA 4HZUB 4V0OA 1J99A 1T5IA 2QP9X 3U3KA 2ZVQX 1E0SA 2C95A 1S1CA 2IHYA 5DI3B 3WNCA 1UDWA 4NCNA 2A5FA 4JT2A 1CTQA 3PFIA 1S1MA 1RYHA 2FN4A 4Q02A 1GDDA 1JECA 4JLKA 2VF8A 1EESA 4TZ6A 4A36A 4CVNA 5CM9C 4LHWA 1P62B 5IK2A 2JLYA 5B2ZA 3BAFA 3OAAD 1FX0B 2FJUA 5IF9A 2OILA 3WHKA 3LWNA 1G8FA 1E9CA 1ZYUA 3BB4A 2O8BA 2R6GA 3K0AB 1BYUA 4BZQA 1XPOA 3E70C 1IN7A 5H68A 3QEJA 3PEYA 4GBMA 1U0LA 1GKUB 2KB0A 1E2NA 1W4CA 4A9AA 3JVUA 3U6KA 5B30A 1BOFA 3ZVMA 4C0HA 1EGAA 4PSAA 2P3SA 3ONWA 2NMVA 1OH5A 2OFWA 5L3SA 3OE7A 1NKTA 4NYIR 4B75A 3VR1A 2QMHA 4URYR 3E5HA 4NCJA 3THWA 3QPUA 2CCGA 4HUQB 3RRMA 1RFLA 2BV3A 2OAP1 2XZOA 1JR3A 4KVGA 3B7GA 1P9WA 2JDID 3B9QA 3D6TB 3QSYA 3GLIE 4JSTA 2EWVA 3GLFB 3ZVNA 4G5GA 1ZW6A 4RCZA 1XXHA 4WAUA 1UKYA 2GRJA 5FBWB 2JJ8A 2P67A 3VNVA 2WM9B 2UZIR 4WZBE 3ZVLA 2F9LA 3OEHD 2R65A 5EZ6B 3U3MA 5KYKA 1EXMA 1VECA 1OH6A 3O8RA 3AVUA 3D31A 3GLHA 3QKUA 2NPIA 2P5SA 2BIFA 4PSVA 3U4QA 4CEJA 4QM6A 4FN5A 3X2SA 3D8BA 2OXRA 1XDBA 2JAQA 2JLRA 1CIPA 2Q9CA 2ZRMA 3IO5A 3CPEA 3IGFA 3WY9A 4XWKA 1LF0A 1ZVQA 4Q4LA 3CB4A 1KO1A 3FVQA 4Y0AA 3RS2A 1P60A 3LW7A 3ND8A 3SC3A 1U98A 4UKDA 2NO1A 4GRAA 3SBDA 4TTQA 1Z2AA 4Q47A 4PZLA 4C2TA 2HDNB 2FFAA 4KFTA 4RD0A 4B2LA 1RRFA 2B8WA 4QKQA 1Z28A 1H8HA 4BLOA 2H17A 2G1JA 4BLTA 1Z63A 3OFND 1NSTA 4Q4AA 2ZS8A 2W83A 2Q3FA 2QE7A 3AF0A 2GVDC 4C4PA 1KJWA 3SE0A 4XVRA 5J47A 4KBFA 1Z0FA 3IQWA 1E9FA 3TK1A 1UBEA 2AL7A 2QI9C 3JZMA 4V03A 3AKEA 1WB9A 2FFQA 2PCJA 1E2QA 2XNSA 2EQBA 3A1UA 3CRW1 2ZSBA 1DBSA 3HR7A 4AIIA 1GITA 4BLPA 1Z08A 4OQLA 4TLDA 4DLSA 4AYTA 5FBLB 3T5DA 3GJ3A
chains in the Genus database with same CATH superfamily
1U7DA 2Y1DA 4C03A 1F20A 2G5CA 1Z88A 2PQ2A 1RPTA 3GX1A 3IS3A 3SG0A 5JIBA 1JIIA 4IKOA 4RHFA 4WGGA 2Q1YA 3MAGA 3LLSA 5J23A 5KI6A 3BIFA 5BQFA 3RS7A 3WMFA 4EGSA 8MHTA 2RIRA 4WECA 3SZLA 1PT6A 4G3XA 1WHSA 3BH6A 4HB0A 4KIJA 2BFOA 3GJYA 4N7RA 4P1ZA 2J0SA 5G0VA 4AMZA 4YRLA 5AICA 4CLHA 5CBPB 1U9IC 1L5MA 1UKEA 2SHKA 4LDQA 4OXQA 5U9CA 2CFTA 1D7OA 3W8NA 3GVHA 4DDHA 1K89A 3K8ZA 2I0FA 1IAVA 4XWGA 3ICQB 1ZNZA 4IS3A 4L3VA 3WK4A 4FLEA 1HEIA 2FPWA 1RLIA 2EW1A 3FA2A 2NTVA 4F3CA 1L3IA 1YZTA 1ZUIA 2W37A 2NU8A 5FOVA 2O8CA 1YZQA 4GI3A 1YFKA 1A82A 4JB3A 4U2DA 4UTXA 2P7HA 1P17A 1M6HA 1KQPA 3CR3C 4HQFA 4LGMA 4M8NE 3TR0A 3NEAA 4NARA 1ZQ1A 3HKDA 4BBAA 1DX9A 1LTQA 2WINI 3KWLA 4MVYA 2JA2A 1W4LA 3CLVA 4OP2A 4I4IA 4BPRA 4ARCA 4X44A 1K86A 4UHBA 3T3DA 4GPD1 3C3CA 1J0BA 4XVUA 2FSUA 4PC6A 3EWIA 2BZ1A 4E03A 2XCOA 3RVSA 1V45E 1IFXA 2JRLA 2ZTMA 5ERXA 3CNBA 1PFVA 1U5AA 2I3AA 3ORHA 5JH7B 1PU2A 2E9SA 3V80A 4RD2A 1J00A 3I04M 4NK4A 2EX4A 4DHEA 4Z6KA 1JHMA 1QBGA 3AY6A 3EGXB 4KQHA 4UQPA 4E88A 1U6KA 1B8PA 1U0SY 2HWUA 2IY8A 3ESCA 4GG1A 4OLJA 4QT0A 5EERA 4A15A 4KAFA 4OY3A 5LZ7A 1XMOB 1T9CA 4Q1EA 2C2YA 1XPJA 3OPVA 4MKRA 3ESYA 4IIHA 1OW3B 4XGIA 3RANA 4BTVA 3NC1C 3LXXA 1XKTA 4B45A 3E15A 4BMZA 2QVBA 3R5SA 1DIAA 3TIIA 1QKKA 2BR5A 3ZVRA 1A1VA 4J7CA 3ZBQA 4ER6A 2H1FA 3NHYA 4QLBA 1L7DA 5L6MB 1BHQ1 2QHXA 4ARBA 4OKSA 1YAHA 1U63A 4YAKA 3C5VA 4IF6A 4ZQCB 4PVDA 3N6RA 3WNBA 3GEHA 3PNLA 2Y6UA 2QN8A 4PYOA 4WBSA 1P0MA 1QHXA 4MWBA 3CPJB 4O6VA 4MAMA 4X6LA 1SVKA 3HU3A 1TCBA 2HUPA 3JZIA 3WIVA 4F9GA 5ESRA 3PGJA 5LQNA 3PDWA 3ZZ1A 1KBZA 1W5FA 1LPNA 5C1DA 4CFYA 3GPCA 1E7SA 3BH0A 3QX8A 3PDUA 2CBZA 2O7VA 4Z4CA 4EVIA 2IEAA 4JI2B 4M7OA 5K4AA 1P6XA 2PRSA 1EG7A 3ME5A 2G9NA 2OO3A 4IINA 2EKLA 5DFAA 3D5QA 4PANA 1W4RA 5IBCA 1UOPA 1W94A 3CF6R 3GLHB 5EJIA 1D6MA 1GGKA 2QU8A 4OP1A 1P72A 4UMDA 4YJHB 2WF7A 3FOBA 4HGZA 3ZHUA 1Z0KA 1TTHA 3Q72A 1Z8DA 1MVLA 2QVLA 2CJPA 2J3MA 2RJNA 4NPHA 2XBMA 3F6CA 3MWEB 3VTFA 3EIQA 3BCHA 4HL6A 4CUZA 1TA0A 2AMYA 3FZYA 3S2YA 4ND6A 3VR5H 4FFLA 4KGDA 3EVTA 4OQMA 3QBTA 1CSEE 1YB4A 1JHQA 3DTVA 2C4HA 5E2BA 3D3KA 1Z75A 3ZHZA 2XHEA 4UZFA 4F1KA 1L4UA 1JWLA 2MR5A 1UBJS 3ETCA 1K4MA 1R4AA 2P79A 4Q19A 5BSHA 3ZGLA 5BW8A 1VFNA 5FV7A 1XZFA 2IEYA 3E1SA 4Q4AB 5FX2A 2AHRA 3V42A 1I8TA 2Q5LA 2SCUA 4RPCA 3ORQA 5JUWA 3QXCA 1WA5A 4MKXA 4RQTA 5TGZA 1S9DA 3KYBA 2OVFA 5IW8A 4HG2A 3B2QA 1C30B 3FTNA 1NUAA 3COVA 1NNEA 1BJTA 2G25A 2XWJI 2QX8A 1FRFS 3NTLA 5DI9A 5DWQA 3KJQA 1M8GA 4JP1A 2JD0A 5TMDA 2IXGA 2WM8A 1QRSA 4R3UC 2NACA 3NZEA 1YVUA 4L0QA 4CCYB 3CY6A 3UW3A 3KK0A 3K8OE 4GM4A 4HDKB 4DV2B 3GUYA 1LWOA 4HGPA 5JQGA 2O48X 4DCOA 1XZAA 2VYNA 4LHXA 3T5MA 4BFSA 1SVIA 2A4KA 4UE2A 4ARZA 1XP5A 2WUFA 1QYXA 1EKXA 3B6EA 1JSRA 3BF7A 2P9EA 4NBNA 3IERA 2WJZB 3OAAA 4GKJB 5LNK1 1I7DA 1XP8A 1BQ3A 2QTAA 1O08A 1IEVA 3F3MA 4DMRA 4HTFA 2H4WA 5KVVA 1H22A 1U3CA 5TPWA 1UPCA 2I2XB 1DJOA 5JAPA 4BFXA 2WZQA 4NWIA 4QQRA 4UVEA 3PNPA 4MH0R 2C7RA 1KZ4A 2XKBA 3QITA 4W63A 1IXYA 2DPGA 1X0VA 3VMFA 3DAYA 3RSOA 2PNFA 5CFPA 4ARIA 5BMVF 5FUQA 3PA8A 3L8DA 1NXXA 3ODPA 4IAOA 1X80B 2H29A 2RONA 4JUFA 4TKUB 2B4AA 2XWSA 3VNUA 5EXTA 5GPBA 1CR1A 1ESEA 3HNRA 1WUKS 2D00A 1E5DA 1T24A 4KR2A 5ICFA 4AD8A 2E1PA 2OBMA 2WWFA 1O95A 1W5AA 3AR5A 3RREA 2FFRA 5FBRB 5A5FA 1BD4A 3GGCA 1G3QA 4D9IA 2IUYA 1PUIA 2OV3A 2ZI7A 3AFGA 3E18A 2RGAA 1TQ4A 3LY5A 2DBYA 3IUBA 1QO7A 3GB9A 4EKDA 3QVVA 3B85A 4JBHA 2WJWA 4BNTA 3F7TA 2F67A 1JDPA 3PDHA 4IDHA 3UMRA 4KUEA 2B7LA 1TZCA 4A03A 4IGKA 3K6JA 1XWIA 1ZC3A 1D0VA 4JKIA 3DVAB 1EHYA 1YBAA 2VTEA 2HC9A 4WK6A 1WQ4A 2PTHA 5JC8A 5JLJA 1Z3IX 2C5BA 2QI9F 1Y9EA 3A3YA 3WYCA 3TFOA 5FLXA 1QO0A 2ZZMA 3CYFA 4KXLA 1M1YB 5BXQC 3ZWNA 1S4MA 1V4NA 4I7EA 4JI6B 3JXEA 1JHOA 1XQVA 2FEMA 3DULA 3OJWA 4QRIA 5BR8B 1AN0A 2C8VA 2XYPA 1OX5A 3GG9A 2BI4A 2Y71A 1FVXA 4RSGA 3NX4A 4QBIA 2FE1A 1NPYA 5JDCC 3SX0A 3HK2A 1VG1A 4LSMA 2JFBA 4CYMA 2WA2A 1D03A 3MWGA 5F1OA 5HFJA 1XLUA 1KO8A 1QIEA 2NZ8A 3GFFA 3LCRA 3FZEA 1Q0ZA 3FB1A 5C37A 5I7WA 4PLYA 2X40A 2XDYA 1ELOA 1HETA 1ZNWA 2B0JA 3W5UA 4B3CA 2COEA 1V25A 1SHLA 1UL1X 2XUJA 2EJBA 2XIJA 3VC2A 5J4HA 1TL7C 1N8TA 4ITRC 1E2DA 4JGGA 3BRCA 3RYHB 1CQIA 2CVOA 3VHXA 3CR7A 3LQ4A 2J33A 7REQB 2IYQA 4QPCA 1QRAA 3KZCA 2JGDB 1SCQA 4NS1A 2WZBA 3PC8A 1LD3A 1OWPA 1Z5NA 4IEFB 4BJ5A 2GJKA 4R98A 4ZI3A 3UC5A 3ABZA 1YQWA 2A1UB 1E6MA 2F90A 2OBBA 2X8JA 4GQBA 3GROA 4NK5A 2EEZA 4NNPA 5NULA 2ZROA 3GGOA 3KAQA 3WE7A 5MF6A 5GADl 3B6KA 2CV2A 4B3RB 3OHSX 2O5RA 3OUZA 3JVDA 4ZQBA 5FBZA 3R9XA 1JR6A 1JI0A 2GPAA 1J23A 4IUCS 1G4HA 1UJMA 2D2VA 3OZSA 5TQ0A 4I4TB 5DMHA 2Z6UA 3VDQA 3EFEA 4BCCA 2DLDA 3PICA 5CJPA 2UU9B 4JZYA 4Y67A 2PKYX 3ZGYA 5LZ4A 4KR3A 2Z2YA 3VQTA 2QG6A 5JV5A 4NENB 2ZUSA 3O1IC 1N5RA 3C2QA 2PZKA 4Y6SA 4QOHA 5FA6A 1CJMA 1L5RA 2Q21A 3F6BX 3CSDA 3O3NB 1MDFA 2I4NA 2MR6A 3WAJA 4BZXA 1WV1A 2E6UX 3W2GA 4NNJA 3SLKA 5DEIA 4OL0A 1ZLYA 1EEXB 1PQUA 2GK4A 1ZI8A 4JVNA 3B51X 4ISBA 4PGHA 4PYKA 4YX9A 2HR1A 2OB1A 3SBXA 1Y9ZA 2A94A 1M6VA 1VJTA 2FRDC 3H7AA 5HCNA 4DA9A 4PU0A 5JZSA 5B12A 1FFYA 3A9CA 1QVRA 5ALTA 1KJIA 3QKSA 3PRYA 5IPFA 3VAYA 2GETA 2OSBA 3L0PA 3S2FA 1NX6A 3T15A 1F5SA 2FDCA 1T0JB 3LNTA 1S7CA 1KZYC 2NYUA 2XX3A 2YHIA 3NJ8A 1VZ3A 1W34A 3W9YA 2JFGA 4M53A 3WGLA 4NCBA 1SULA 1SZJG 4NE2A 4C20A 1CJSA 5LMCA 2INGX 4L2IB 4M9XA 5KYWA 3EC1A 3DD1A 3MMSA 1OD6A 3AHHA 2VDWA 2WQZA 3HE3A 4D43A 1YMUA 3QWBA 1CUXA 4CFSA 2GILA 3RIGA 2HQBA 1R8YA 4F86A 4Z2AA 4Y2UA 1Q3TA 5LR6A 1A9TA 2Q4EA 3L8ZA 3J81k 3UJBA 1E6KA 3Q10A 3QM1A 3G8BA 1MLDA 3I9NA 1YV9A 1GEEA 5CB4F 3ZS8A 4R1SA 1TAHA 4MDEA 1NR1A 1D4OA 4NOKA 5ITWA 4MEAA 2QL7A 2RHMA 2V7GA 3GT0A 4X7MA 4WXEA 1TAQA 1YS7A 4I50A 5A0TA 4HGOA 2E4ZA 3W6ZA 1K7FB 2O2XA 3L6DA 3WP0A 2B94A 3C8DA 2GHIA 3I8SA 4A10A 3EARA 2AF3C 5KSWB 2QUKA 3IBYA 2EAUA 1W4BA 4QAJA 3E82A 4ZYUA 3LPAA 3L0OA 2AG0A 3M6IA 4MRPA 4QXPA 4MCHA 2YN0A 1WBBA 3ADDA 1T35A 1KKMA 2PJZA 3PQ8A 4TUYF 4G4SP 2P2GA 2F8MA 1F6DA 1Z22A 3QKTA 2CXSA 1PG5A 1M2NA 2ICAA 2I2AA 2PKQO 3IILA 3L92A 3LUAA 4XD7D 2ONJA 2QMQA 3UJ6A 2QD1A 3ZHCA 5B1YA 3H9GA 4MV5A 3ZCPA 3N6XA 1BIFA 3DS8A 5FHRA 3ZU6A 1T6BY 1KJZA 2EJCA 2R8ZA 1YZYA 4ZTBA 1O0BA 5TJHA 3R5TA 2CLCX 3F8WA 2Z5FA 3WB1A 4DGQA 2CXTA 3W7VA 1KIMA 2PSHA 2XXBA 3LCCA 3Q7IA 3BJEA 4FFBB 3V1YA 2P6PA 3Q0IA 3G3EA 3H5RA 1QWOA 2BRUC 1MNQA 1GD1O 2A86A 3F5MA 3OZAA 4IEIA 1L5NA 4EB0A 1V6AA 2Z1MA 1QGUB 1MP0A 1G0OA 3D6MA 3E3NA 1CUJA 1P44A 4FYVA 2N1BA 4FOPA 1EA7A 2CD9A 2IF0A 1E7RA 1Q3KA 4MVJG 1SIWA 3AWIA 2IZZA 1Q6ZA 4B7CA 2BKEA 2OCYC 3GGDA 4LY0A 2P2LA 4MI6A 1UBUS 4LJLA 5ALXA 2QG4A 5EZSA 5K2OA 4Y2XA 3GH3A 2WDPA 1K5DA 1SUPA 3KLOA 3FCSB 3JZAA 3EOZA 2FSVA 1ZN7A 4MP6A 4R4JA 1YFJA 2WM2A 2JK1A 2JZNA 4AJNA 2IEZA 4TTPA 3VU8A 3PS9A 3EMKA 3ZBTA 2UZ3A 4YDHB 2J4FA 4G37A 2C4WA 2QT9A 3OC0A 2NZ2A 4E21A 1QZ3A 2DTDA 3G2PA 3JV7A 1N6RA 3KSRA 2OYRA 4DIEA 5FBVB 4ETWA 5IJ0A 4LFAB 1MJFA 3HB5X 4D56A 3WXMA 3M4JA 5CLJA 3W8DA 5AW7A 1WPRA 3PNSA 2GJ8A 4REQB 3LBYA 4E4YA 1N5OX 3PJFA 1KSJA 1PTJA 5GM2A 3AYZB 2XVYA 3RVLA 2VK8A 2GK3A 2R9VA 5AM5A 3EEOA 1H4TA 2JL1A 4MKZA 1HNNA 1T0PA 4ZQEA 4D6PA 4UXIA 3JYLA 2ONYA 2FPLA 2J3KA 4RE6A 2PKCA 1ZUWA 3I05A 4Y1EA 2HJRA 3VOAA 2C9DA 3PP8A 1A8HA 1VLLA 2QDKA 4YN3A 5G4LA 3MYYA 4BO3A 5AYVA 1DV1A 1IJKA 1MZPA 2RGUA 3TBHA 1J07A 4ZDIA 3UXEA 3P52A 5D5QA 1KQNA 4D6YA 1MJNA 2O2GA 2ZBDA 1RKBA 4AY4A 2H1LA 2GBIA 4M7RA 1ADYA 5COAA 4YP1A 4D45A 1V1MA 2ID8A 2P9HA 3NTXA 3W5HA 4U7HA 1XEWX 4C7VA 1W4ZA 4P3PA 5C9ZA 3AR9A 4DIDA 3AFIA 3PJDA 1QOPB 2X5XA 5FDFA 4NY1A 3O95A 3BIJA 3RTGA 3QIVA 1HNXB 1T9AA 1RD4A 4MQFA 2B2CA 2W6QA 4OJMX 2GT1A 1QH8A 5M29A 2IU4A 3NV9A 3IEIA 3SVZA 4P38A 3KQNA 1NTRA 2A9KA 3O3MB 2OBFA 4HRXA 4RUKA 1JG4A 1GYRA 4QQ8A 3PF8A 3RGWS 2IF2A 3NVDA 4GOJA 3MCTA 3FYUA 4FGUA 4B71A 1IBLB 4HYYA 2PFGA 1L1EA 1S8OA 2FY8A 3EDMA 1HFKA 1UJBA 1NF8A 3HVHA 2F9MA 2JGAA 3CRRA 4NZ9A 5B1SA 1IMOA 3LYUA 1JG7A 2WFMA 2I8AA 1JFLA 2OECA 1A88A 3MRVA 4IR7A 2CT8A 1YC2A 5SY4A 4LC0A 3EVAA 4W6QA 3O31A 2G77B 4R1UA 3TAHA 2FYTA 1D1PA 3FZGA 3OTHA 5EHNA 2X5NA 1EFVA 1RRVA 4UUQA 4EYGA 2GXAA 1EVZA 4DV5B 4IEEA 1DG9A 4JQSA 2XQKA 4OHUA 7GPBA 1E69A 3K8YA 4CKEB 3FMFA 4F84A 4LJ9A 3LA6A 2WICA 3ORSA 3QLJA 4Y2HA 2F00A 2TMYA 4NE7A 1IK4A 2P0AA 1E4EB 2CL5A 4DA7A 1PL7A 2VXYA 1SZPA 3GUCA 3ZCXA 5BNIA 2BONA 4XM2A 4V0QA 3FGOA 4I3FA 4QJ3A 1C14A 2WF5A 1CS4C 1RQ2A 4FFRA 4BNZA 3EPHA 5TS2A 4W7HA 1P33A 3TQTA 2IZ6A 3CZAA 2A7XA 4LRTB 2WIAA 3GRFA 4PLCA 3FNBA 1G8PA 3LBHA 1YOBA 3B1WA 1MAWA 3AKYA 3FGPA 3O94A 4M9SA 4BNVA 4EO4A 4FE7A 3TTYA 5IC5A 4UHDA 1ZGCA 3MFQA 3AEZA 4W7IA 1S3GA 1Y6JA 1ZJYA 3ZN2A 5HUQA 1DQPA 4EYKA 3BULA 2F62A 3BWEA 4M38A 1EFAA 1QCDA 3PVSA 5E4FA 5JBNA 4LNUB 1QPBA 1AGYA 3ZDAA 1KE1A 3EUWA 5AHWA 1K0UA 1VSUA 3L0BA 1LK7A 3OH8A 3D6AA 4GOKA 4ZHQB 3FAZA 1H9AA 2HIAA 2XQIA 3TR6A 3FDZA 3PFWO 4OBBA 5ELXA 3DUFA 4IDNA 5EIAA 1CIJA 3T95A 3U2QA 3D3JA 1PSWA 1E1KA 1MC5A 2Q4TA 1VLZA 4YI3A 1E1NA 3WLMA 1YGPA 1W25A 4OIMA 4CCSA 1EVIA 1V8DA 2VHZA 4F6RB 5CR9A 3L05A 2IITA 2QLJA 5D7NA 4RCYA 5C7YA 2NTYC 2HBQA 3A6JA 2WVAA 3CLSD 1LZKA 4JS0A 2GO7A 3TLCA 3C4VA 2M9MA 4TN5A 2QY9A 3P9ZA 4O4IB 4QEDA 4EQ6A 3BYZA 4WBNB 1U81A 3K96A 3FRHA 3UEOA 3FN4A 4W5QA 3STUA 4K6OA 1M7BA 1TQDA 1AKWA 2HJWA 4MINA 1SWVA 3JY6A 3UJ7A 4AZTA 4BZZA 5CA1A 1JKJB 2A0FA 1R6DA 3U7GA 1H8ED 1ZEMA 1XZ8A 1IRIA 2RGYA 2GESA 2WYHA 2QLTA 3M8KA 4FILA 4K9SA 1J0EA 3TD6A 2V1UA 4UCWA 4WZZA 1MO4A 3GPDG 4C4ZA 4HJXA 4RQUA 4V0RA 1SKUA 3I39X 4AF8A 1XTTA 4IUDS 2R4QA 4HRVA 3AXTA 2F1JA 1T2NA 5CU7A 5CYPA 1E1LA 2C59A 5T4HA 2X8WA 3LVRE 3I2FA 3LY7A 1UAYA 1M72A 3E7PA 4Q1DA 2H8KA 3UVEA 2JCXA 3HFGA 4C0BA 5IDXA 2RGRA 3RUPA 3HJHA 1UQTA 2JLAA 3OY7A 4BP3A 1EXDA 1UXIA 2V0CA 1U8EA 1X7DA 4QYIA 3FMPB 4CUJA 3E8XA 1V1RA 1DXYA 2NIPA 4TYNA 2CFRA 3HDHA 4FBGA 4PYMA 3RUHA 2CMGA 1C9NA 2AB0A 1H4VB 2HYDA 4AECA 2VF5X 2BYTA 3WRXA 1N9KA 4YJDA 1JT2A 4COOA 3VKGA 1T36B 3IB6A 4A26A 3O8QB 1P1RA 2KSQA 5JAQA 3I09A 2YXDA 3T34A 3GLGB 1UF9A 1YZLA 2NU7B 1P6QA 3C3XA 5DE3A 4RK0A 2IC5A 1TX4B 2ECOA 3RU9A 3U37A 4C08A 1RKXA 4HC4A 4X94A 1XEWY 1EHCA 5FNVB 2RAPA 3FHOA 4Q7EA 1HYHA 1X7GA 2EWWA 1N57A 3GJ4A 2MT9A 2GO1A 4PHTA 1ZJ4A 1P0FA 4L57A 4PPGA 4D9CA 2BZGA 3UJAA 5KWVA 1TM1E 2BISA 3H2ZA 3CH7A 1IU9A 1AKQA 1YDGA 2BF4A 2FG5A 4QUEA 5G1OA 3G17A 1JB9A 1KSHA 2GCIA 2QTLA 5DLEA 2P9YA 4P4SA 4QOJA 4KYUA 5HCUA 4DR6B 2Y0CA 2I6TA 2ZBRA 4V1CB 1JT9A 3ND5A 2GM9A 3NO4A 5KVSA 4TL7A 1XSEA 3MOSA 1MJGM 4RLQA 4ZREA 3TI7A 2V7WA 4DC0A 1YR2A 1G19A 4M55A 1Z6XA 4PG7A 5GJCA 1MOQA 4CM1A 4LS3A 1J5PA 3LRTA 5DBGA 3RD5A 3O84A 3R4CA 2ZSDA 3FVRA 3VPSA 4EVRA 7YASA 1SBTA 3HLKA 3IXMA 1DFIA 1DIGA 2FR1A 2IYPA 3LF2A 1J39A 1OC2A 3GRYA 4XD7A 3AI3A 5COBA 1P77A 2Q46A 1T8RA 2YUIA 4AJLA 4F06A 1LVGA 4Z1OA 3NBQA 2VS1A 5DK6A 3I34X 3PPWA 4E22A 2D2FA 2A9OA 1KHTA 4ZZ3A 1G2IA 2ORVA 4WA7A 1K27A 3WIBA 3IEXA 4IWNA 5JXJA 3DMRA 1K8RA 3U60B 4Q1BA 2DUMA 4HYEA 1G9XA 3GDOA 2HV9A 5SZKB 5C8DA 5PGMA 5CVTA 1D2RA 3PHLA 1V71A 2WV9A 3CO5A 5A6SA 2F6RA 2EL9A 3KJIA 5HJEA 4XB6B 1FSSA 5DYIA 5F35A 4QZVA 3HH8A 5FLYA 3UMFA 1YR9A 2VJOA 2C2HA 4PF1A 4DLKA 3RVJA 2QAJA 1H1LA 1O4WA 3L0YA 2JBAB 1JDTA 2C1EA 2IZ5A 3LI2A 2DWCA 4C0AC 3C6MA 3KXIA 4EJSB 4ZFNA 2KW5A 4X3PA 5H7XA 2CVHA 1X77A 1PQPA 4JQCA 3V8MA 3N8KA 4A8JA 2RCNA 3Q15C 1BCSB 3SICE 4M60A 3OQNA 2QN7A 1DCMA 5BSFA 4W5NA 1SZDA 3EXFB 1IN8A 1OI7A 3D6UA 2A58A 3IALA 3M81A 3MTIA 4MXDA 2PGLA 3RC8A 2WIKA 5DNCA 3ET4A 2WB4A 2N42A 3H5IA 5HF5A 1UPFA 2H2FA 4FEEA 2VTBB 4TN1A 3VKUA 1IN4A 4OJQA 3SQNA 3ZK8A 4P0PB 4Z3DA 5I5GA 1LJUA 2C7VA 1L3BA 2WVJA 2WHEA 1ZRSA 1FYEA 1UPUA 4L9AA 4Z8XA 4CV3A 2P6NA 3RSSA 5BOSA 3GCWA 3LXUX 5EJ4A 1J2YA 1L7EA 3CT6A 2VCYA 4XUDA 4ZU6X 2OWEA 2WTXA 1DAOA 4MPTA 1ZR4A 1G2OA 4DM3A 2PGXA 1XYGA 3EFBA 3KVNA 1FDIA 3GDFA 3RTBA 5KNCH 2PFSA 1GPMA 1NNSA 4H3SA 4EKEA 2K2WA 1Y3DE 3KTAB 1YF3A 4MS4A 5B7GA 3KQTA 1N4AA 1MPXA 3LYAA 4KUGA 4GI2A 2HU8A 5B3LA 2WD9A 3ACDA 3ENQA 2D74A 2OHFA 2VLBA 1X1SA 3NHWA 2ZJOA 2GZAA 3GP5A 3PFCA 4Z0TA 3L6UA 3BK2A 1QE0A 1BE0A 4QXAA 4WH0A 1Y5MA 3KDSE 1QRUA 1PJCA 4GLBA 1DCKA 4EJSC 4ER7A 1DS6A 2P2DA 3JZFA 5B3JC 5I8PA 5IULC 5JECA 4OQYA 2ZXFA 1MXHA 5ENVA 1KTVA 1IJBA 5KTMA 2H2DA 2PMBA 3AP2A 2V5AA 5IAKA 1JZSA 4FXPA 3V00A 3FVVA 4GPBA 2G82A 4D0GA 1CU1A 1UMDB 3CKYA 1F06A 1SEPA 3DBLA 1GPLA 3GCGA 1YS4A 2FPSA 5HF9A 3T5TA 3VSDA 1IXZA 4AY6A 2HA3A 4IX9A 2NVBA 5DHPA 2J9RA 2WFAA 2WNHA 2FSFA 5FOXA 4CIVA 2ZULA 2OHHA 5KJEA 2B30A 1T8TA 1GHTA 2ZJ7A 3QLEA 4OB8A 1P1CA 2OO5C 5GV7A 3VU3A 2G1KA 2ODWA 1TIBA 1UBRS 3PFNA 3L4SO 2Q8NA 4RH3A 3O8DA 1QP8A 5JNTA 1XNHA 4PR3A 1G60A 4RFLA 3AL0C 1JQEA 2Y05A 1R9GA 3I2GA 4J0IA 4MR8B 4Q01A 3ZLBA 2QENA 2YCLA 3R5JA 4U5XA 1MOSA 3S1AA 2CSUA 3V48A 1T4BA 2P6UA 1CQWA 3KXLA 3N2GA 3JYHA 3DHYA 2VOJA 4NTZA 3JSAA 2PL5A 3PIRA 1GPAA 3BG5A 2Q1WA 4B82A 5K0SA 1LRLA 2HN9A 3HKBB 2X9GA 2N3ZA 3E5NA 4Y0VA 4YRPA 2HF8A 2ZTVA 3MVEA 2Q5QA 3OPMA 3HWWA 3V7YA 1PCXA 3NONA 1IULA 1K7YA 2B5WA 2QQ0A 2V7QD 2Z4SA 4RF5A 2B69A 3EIXA 4DDWA 2W2QA 4KQ1A 1SB9A 4HLQB 4US0R 3VVCA 1TLLA 3BTVA 4J07A 1KK2A 4I9UA 1AUVA 1D1TA 1UBSB 1Z2PX 4FP9A 3B60A 1KDVA 1RC1A 1WLYA 3NXSA 3NG1A 3I2HA 5JZVA 5B53A 4P32A 2NXEA 4RA9B 3VPAA 2DP4E 5LA6F 3TL6A 4ZEXA 4D5EA 2OMKA 1NUPA 2G8LA 2OKGA 2X58A 2CJYA 2OGWA 1H2AS 4FYHA 4B47A 4EFNA 5EY5B 4O4LA 3RTDA 3L7JA 3BCSA 1Y6FA 2AWNA 4GVLA 5K9ZA 1MRNA 2JC3A 2XUPA 4IF4A 4IIEA 1N75A 3MZ0A 1CRPA 3OG9A 1P2GA 4HDMA 4BV2A 3T94A 1GQSA 1RXCA 4KJZA 3WK7A 2GZSA 1KVSA 1NN5A 4AZVA 2VF2A 3GLQA 1LDMA 4QO7A 3GAAA 1P31A 4PRZA 3OIWA 1GPKA 1RHUA 1XELA 5DHFA 1RXYA 4WZAA 5FFMA 5JBIA 5KPDA 1CWUA 1LQUA 1QLJA 1SEVA 3IKVA 1TM4E 3OLYA 2PUBA 5EWMB 5ESXA 4WNAA 4D3DA 2O8DA 1XVLA 4KFRA 4LIPD 3TRFA 4B87A 3N5KA 1VYUA 3HJTA 1OT3A 1XHEA 2ONKA 5G02A 4MR7B 3KSZO 3DHVA 1ZM2A 3TOSA 1B3RA 3A9UA 3QU7A 4XW2A 1MZVA 4KWEA 3A10A 4YRAA 1NNI1 3WB2A 1E9EA 1RLOA 1UANA 2HEGA 1KO7A 2QTZA 2AG5A 1JQ3A 3GF4A 3TX6A 1FZTA 1LSJA 1HT0A 3SR0A 3RW9A 1JLSA 3WWPA 4Q93A 1KI1A 2OBYA 1CJBA 3INTA 1QB8A 5IJWA 5IXJA 1OROA 2LVBA 1H8EA 4NESA 1GPJA 1IB6A 1XOIA 1X2EA 2WJPA 3EW9A 4MW7A 2WG2A 4N0MA 3GNTA 2I7VA 3GLGE 5TE9A 2CXNA 3WLFA 3U44B 5LQSA 1B6TA 3P2MA 4YBZA 3OOWA 5A5GA 4D8YA 1YO6A 1E3JA 4AO7A 4Q9IA 2J07A 3WKEA 2C3UA 2V7TA 3Q3IA 1CQXA 2W2KA 3BE6A 3P5SA 4AY3A 1IUOA 1Y3FE 3CN7A 3EWSA 2BE7A 2IPOA 5E2AA 1ULZA 3TE7A 2Q9AA 4YT2A 3GRZA 3QYJA 3RPEA 3VDNB 1JVBA 1USWA 1FFEA 4AG3A 3KLMX 4B7ZA 5JAZA 1NF9A 5BN5B 4OD0A 1WXFA 2FFJA 3GHHA 1FUUA 2CZCA 3D0QA 4GNRA 1HSOA 1ZGBA 4TMZA 4WEOA 3V1UA 5P21A 2IOQA 2WTAA 2J3EA 4ALIA 2D8AA 3VV3A 1B6SA 2YN4A 1A3CA 2NXNA 3HCCA 3WRYC 2YJNA 3ZWWA 3LUDA 4EZIA 1HE4A 2Z83A 1OLSB 3TZHA 5C3UA 5K8TA 3HR4A 2BM1A 4BC0A 2F3QA 3KLNA 2Y1OA 2NXCA 4CGYA 1SQ5A 3L84A 2HWXA 3ORRA 1SXIA 2GHRA 4C0QC 4W99A 3O0TA 2I3GA 5BT9A 2Y9MB 1GN9A 2YWGA 5JSZA 2IPMA 2G0TA 3A70A 3H2GA 4HF7A 5H4GA 1NYQA 1QU2A 1C4XA 3RNLA 1W5SA 4RFSB 3TR5A 3GXOA 3H17A 5AW4A 3L7AA 1NR7A 4M22A 4LYEA 4YDRA 5LL6P 3EC2A 4E13A 2A5YB 3G2JA 5A9RA 4JI0B 2QTWB 3NHLA 1N8NA 2OQIA 4BEWA 3ONFA 4PHFA 3ITKA 1B4DA 1GA4A 2ZITA 1LVHA 2X6RA 2BZSA 1VKZA 1PQ4A 2PWBA 1JEQB 1E92A 121PA 1YONA 1L7OA 2AN5A 4OHMA 1O94D 2VDQB 2NWQA 1D07A 1MABA 3U1BA 4PIMA 1L5YA 1KC3A 1DZIA 3ETGA 4IZ6A 4XIGS 1OKKD 3TL2A 1NJ2A 1O97D 4DV7B 2Q07A 3NHPA 4HWOA 4IFTA 3EEQA 3TINA 2HRRA 1VHTA 5E6SB 1CFZA 2XNKA 3F0TA 4KBGA 2BKXA 3HCRA 1G18A 1G6HA 2R2GA 2GQ0A 2ZTSA 1EIZA 1P2SA 1YU9A 3HP7A 4PS1A 3OQ1A 3U16A 3FB4A 2C77A 3VO9A 4JI7B 1BS2A 1DJPA 3AO0B 4G26A 3ILHA 4YRDA 3WWDA 3EQ6A 4Y9RA 5JWHA 1BVRA 1ZXBA 4I14A 4YH1A 2PMDA 4WXHA 1VL0A 5LLDA 3V8BA 2PGAA 2IT1A 4I1OA 4QFBA 3KQHA 5H4HA 2VUHB 2RK6A 3JQEA 1Z73A 4UNPA 2HQRA 2RH8A 5TNXA 4BP9A 2OA0A 1KMHA 1UMKA 4BKQA 2ZBQA 4CDMA 2QMOA 5AK4A 4JOQA 1T9BA 1DEKA 1I1HA 1WB5A 2RG7A 1G8YA 2GEDA 2Y76A 3C0KA 2GPNA 3AF4A 1WUHS 3KXDA 2XCQA 3WRVA 1Q7EA 3FW1A 1TKRA 1DEHA 5ERGB 1VMKA 3PPVA 4L5BA 3V2HA 4FI3F 2YW9A 1DWQA 1ZAKA 4KREA 2OFXA 3EG5A 4KVFA 1RYBA 3BFXA 2OP1A 1O2DA 1T2UA 1V1JA 1WOMA 1WZEA 2NNWB 2R8BA 4L27A 4ZYVA 2AD1A 5AK0A 1RQPA 1Y4ZA 3EMBA 3L6OO 2FU5C 5A7GA 1WF3A 3VYTB 1SXJB 4Z9BA 2D5BA 4FMDF 1CUAA 2YV1A 3DLAA 5K8VA 2GBPA 4MRAA 3MHTA 3TOXA 4GBED 2DH5A 1PL0A 1P73A 3DHNA 3HSKA 1KH2A 4MLDA 8AT1A 2D06A 1XQ9A 3BF8A 2QRKA 3QNMA 3M9XA 4G5XA 4C7JA 5B6IA 2W0SA 1Q5PA 2H3EA 4Q7QA 1GQOA 1IBSA 2DPLA 3OHMA 1IUNA 3GLVA 3A1DA 1DRWA 1IE3A 4MIEA 5ADUS 3E3OA 4X8OA 3ZDYB 5M3BA 3CCFA 2ANCA 2FQ1A 5GONA 5B1EA 2B20A 4LZZA 3H5NA 4YJFB 1PYDA 3O03A 1I4EB 2JGKA 4IIUA 5FEUA 1N5JA 1RXWA 5CNMA 2X6QA 4OHCA 1N6HA 2B2NA 2I6QA 1NSFA 3FCUB 3OETA 2FV8A 1Z5ZA 4LOAA 5DPMA 2W9XA 1XAHA 3TB4A 1A7AA 2Y1KA 2JJMA 1TECE 3EZNA 3KQYA 5CEJA 2VHQA 3N9IA 1ICIA 2FN9A 2MWMA 4NZYA 1XROA 4URVR 1XL1A 4LF8B 1EFPB 1HT1E 1Z4PX 2V65A 2JIMA 3LYHA 4RULA 1E59A 2KQUA 3EHEA 1TTTA 4OREX 4RMIA 2BTQB 3LV8A 1PK8A 3OMWA 1E4OA 4L85A 4WFKA 4AG6A 4ER0A 2IDMA 1MTOA 1R4MA 1R8SA 4R2IA 3TBFA 3B5EA 1T34A 2JS7A 3OOHA 4LYFA 4RJLA 3GN1A 1PF7E 3MAAC 4IXMA 1SXJC 4QBHA 4DTIA 5BV0A 4EPVA 3HYRA 4JJGA 1KFKB 3VVLA 2I67A 1NE7A 3O2QB 4FJ0A 3KR9A 4RJ2A 3TH5A 4GUDA 4CF4A 5CFLA 1TT5A 1SHKA 4QTTB 5ULLA 2B61A 3EPJA 2GD0A 2RGXA 1VRCA 3JALA 3USZA 1XFAA 3QF4B 3JQAD 5BWNA 2XITA 3EIUA 2P90A 2IYVA 4OL9A 1DKMA 3C6YA 3ELYA 3LF1A 4LV5B 1OPXA 5DF1A 4ZMSA 1WW2A 3QOWA 3V9AA 2E89A 4GWGA 1SPXA 1SOVA 4EYQA 5JAMA 1L5KA 3EXIB 3OVMA 2ORED 3P4UA 4F5DA 2M6LA 2FG7C 3FDFA 3CX8A 1TM7E 2OHIA 4C6RA 5CB8A 1VGVA 5HKLA 3OF3A 1NQ5A 4UM7A 5HOQA 4RX1A 4OIFA 3GXBA 1RI1A 4D9KA 1T2CA 5F3DA 4H0FA 6NULA 4EHDA 1A2KC 3AVTA 1FDUA 4CEHA 3VR6D 1M1XB 4DSTA 1AZWA 1BEUB 4R9VA 4KZPA 3ZNPA 2CLFB 1Y8QB 2O7NA 2V7QA 2LIPA 3G9XA 2FETA 4RIHA 5CCBA 1W87A 1C0KA 2PX8A 5KYVA 4DLNA 1TJ4A 4B43A 3WWCA 3EQ2A 2N46A 4UUMA 4C7KA 3VKHA 1CK4A 2BR4A 3EEYA 1QX3A 2QJOA 1H23A 1YUBA 2AR0A 4IIJA 3BB3A 2VIIA 3PITA 4GLFA 4ZCSA 3SGLA 3AOEC 1QIKA 3I4FA 3QZUA 3ZE1B 2RHTA 4XGKA 4ZDJA 4R9NA 2QW8A 3AUSA 3MGBA 4QSHA 1NNLA 3NV7A 4JKYA 4L7QA 4EFLA 2WNIA 4ZYWA 1ZCFA 4OX9B 1OYYA 5J4LA 2P2SA 3L7MA 3OZEA 1KI4A 1RJDA 3Q41A 4XUEA 3KZVA 3THWA 1UIRA 1P8JA 3H5OA 1P80A 4PC3A 4L0CA 2P91A 4LOIA 3O5AA 1UBTS 3ZHYA 2PBRA 1XMSA 1AQIA 3THXA 3U3RA 4YYZA 2DU8A 4A16A 3ANXA