2BDTA

Crystal structure of the putative gluconate kinase from bacillus halodurans, northeast structural genomics target bhr61
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
176
structure length
172
Chain Sequence
MKKLYIITGPAGVGKSTTCKRLAAQLDNSAYIEGDIINHMVVGGYRPPWESDELLALTWKNITDLTVNFLLAQNDVVLDYIAFPDEAEALAQTVQAKVDDVEIRFIILWTNREELLRRDALRKKGERCLELVEEFESKGIDERYFYNTSHLQPTNLNDIVKNLKTNPRFIFC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords BH3686
publication title Crystal Structure of the Putative Gluconate Kinase from Bacillus halodurans, Northeast Structural Genomics Target BhR61
rcsb
source organism Bacillus halodurans
total genus 54
structure length 172
sequence length 176
ec nomenclature
pdb deposition date 2005-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bdtA00
2ODWA 1FQKA 1F2TA 2CE2X 2BCJQ 1CR1A 2OHFA 4II7A 4ZI2A 4FCTA 4KI0A 3R9IA 4XOIA 3GCGA 1KMHB 1KI6A 1E2QA 3H1TA 4QXAA 5L3RA 3UMSA 1JXOA 2RGNA 2ZU6A 4LJ7A 1TQ6A 1ZUHA 2WJJA 5J5CA 3C5CA 1NLZA 2ZR9A 2BCGY 4B74A 1BO6A 1N6HA 1GRQA 1CF4A 3GLFB 4IVRA 4WBSA 4TL6A 3U44A 2P6NA 2V6IA 2AR7A 1RKBA 4IDOA 3I32A 3DO6A 3VHXA 4M1TA 5FTNA 2RCNA 4D0GA 1G8GA 5EE1A 2PZGA 3FKQA 1CBUA 5JLJA 2BMDA 2AFIE 5FTLA 1ESMA 3C8UA 1CULC 3AP1A 1F5NA 2ODEA 5AUQA 2Q9AA 3EIHA 4D2IA 2P6RA 4V0LA 2ZR0A 3M4YA 3SBDA 1OE0A 3UWKA 1E3MA 2XTZA 4QJ5A 1R10A 3JVUA 4JT4A 2O0KA 4MRPA 4R9UC 3ZD6A 1D9ZA 1W4RA 3MRSA 4ZCIA 5J4KA 1G41A 4BFZA 3AH8A 4WZBE 3K09A 4AKHA 5FPSA 2QMHA 4A6XA 1UKYA 2R6FA 1R5OA 2KSQA 2O8CA 4G0NA 2W58A 4DJTA 4EQ6B 1VG9B 2DR3A 4BLSA 2DFTA 1ZU4A 1ZRHA 4JT2A 3IIKA 5AWFC 4P0TA 1CP2A 1OXXK 2QBYA 3IQXA 2V7QD 2ZROA 3NKVA 4DDWA 3U60B 1IM2A 3LXXA 3Q5DA 4JLBA 1FNMA 1GL9B 3ICEA 2O8DA 1TEVA 4MKIA 3IEUA 4PPFA 1EX6A 3TUIC 1L2TA 2NZ8A 4BWYA 3B1ZA 3TUJC 3CF2A 2PEYA 4CZ2A 1X1SA 5JECA 1NVVR 3W5IA 3LW8A 1LF0A 1II8B 3PIRA 5DI9A 2GEVA 1YZGA 1V43A 2ZU0C 1XJ0A 3FGNA 3VR3A 3EX7C 3BERA 2J41A 4L9WA 1DO0A 1RIFA 3Q9LA 1R7RA 3QKRA 3QKTA 2ORVA 1DAGA 1NKSA 1OFUX 1TPZA 4HYYA 4TQAA 3UKDA 1KDRA 4JLOA 4QBIA 4WXRA 1E94E 3CX6A 1Z6AA 2ZRFA 1T8TA 1VMAA 3BWDD 4MKGA 3TSOA 3EA5A 3ZZUA 4B3DA 3MSXA 5KU1A 4QBFA 2V6JA 3WMEA 1E1QA 1N6OA 3KJEA 1GL7A 4DLYA 5E7IA 2OG2A 2CVHA 2BEJA 4NL4H 4PC2A 2QN6A 5KSOA 5DN6A 5KNCA 1I4TD 1CJMA 1WA5A 1ZIOA 1W36B 3CM0A 2A30A 2CHQA 1HQYE 5FOSA 3LV8A 3A4NA 2NO6A 2WOJA 2QM8A 3P27A 1UEJA 3VHLB 4QJ4A 1SVLA 3VAAA 3W6NA 1E9FA 2MSDB 1Q20A 4RVCA 4B2PA 1BH2A 1YR9A 3CLVA 4RKEA 2ERYA 3THXA 2HLDA 2X77A 1NP6A 1H65A 4YONB 2FEOA 3UXMA 3FOZA 3U61B 1Q57A 3W3ZB 4GP6A 4C0AC 4KJZA 5HE8A 4DB4A 2FSGA 5K8LA 3KKMA 1RJ9B 1ZD1A 3AGPA 5TVKA 2GK7A 1E0SA 4XWOA 1SHZA 5F9HA 5A0FA 1GITA 1E2NA 3NDPA 3R7WB 4XWAA 3U3MA 1IXSB 2XITA 4IFEA 3HYRA 3GJ3A 1Z6TA 2JCSA 4BLTA 5CIQA 4KITB 3SJBA 3AVTA 4KCGA 1BOFA 4UQOA 1HT2E 1NNEA 2V3CC 1EFRD 3NEJA 2C2HA 4LSGA 5FPKA 5FTMA 5D3QA 3TH5A 5JSZA 1ANKA 1LFDB 3OZXA 4CIDA 2CE7A 2D2EA 4HAXA 5FUWA 2JJ1A 4AD8A 5KSZA 4C2UA 1TQ4A 3TKLA 2WJYA 1CR4A 4OQMA 2G0NA 1AZTA 1ETUA 2PCLA 2ZRNA 3GJ5A 2QPAA 3KB2A 4X8HA 3QNUA 2WPDA 2R6GA 3MJRA 1DVRA 2NOAA 1Z3IX 4PAOA 4TT3D 2FN4A 1D2EA 2ZITA 2FZLA 5EP3A 3CRW1 2W6JA 4HUQB 3ZQ6A 1DAMA 1F6BA 1PLKA 4TYQA 1ODFA 2JLQA 4Z51A 4U7DA 2RGCA 3Q7PA 1FFHA 3IBGA 4EJSC 1CR2A 3KB1A 3AV0B 2NPIA 4Q48A 1CJKC 2C9OA 3FWYA 4NBSA 3ZYCA 2CEAA 4QKQA 2FZ4A 2HF8A 4QGFA 1VHLA 4B75A 1KAOA 2FGJA 4NKRA 2ZE6A 3KKNA 3CX8A 5EJEA 3LH5A 3IDQA 3OIYA 2RHDA 4JLNA 1W0JA 1GTVA 2R6AA 4PC3A 1KO1A 1NY6A 3LO5A 3N2EA 4HAWA 3KJHA 4R2HA 5FOUA 4A2QA 1E1RA 1N5JA 3WY9A 4PR0A 2J87A 4B44A 1XJCA 1IY0A 2GF9A 1B23P 2YOGA 2V1UA 3BXZA 3NHAA 3DHWC 1VIYA 2GK6A 3ND8A 4LY6A 1HQCA 1XXHE 3S1AB 5GJVC 3B6EA 3EZ7A 3WXMA 3RABA 1G5TA 3A4LA 2IL1A 5EXPA 2FPMA 4QHSA 4RD2A 2GZHA 1E2HA 3EXAA 5A4JA 4QHTA 1AJEA 4Q18A 4EDHA 4U5XA 1T3HA 2QG6A 3HJNA 2OXRA 5IRCD 1Z08A 5KNBA 3FTQA 2O8BA 3I5YA 1WBBA 2UZ3A 3AVWA 3W5JA 1VG0B 5BW8A 1TMKA 3BC1A 3EW9A 2NO9A 4JSYA 4D4KA 4DXAA 4ZDIA 2G88A 5CDFE 1UJ2A 4Q4AA 2LWIA 3EPKA 3TVDA 3GPLA 1R0ZA 3MLEA 5HKKA 3DM5A 4PSKA 2HT1A 3RDPA 1MH1A 4LV8B 2X2FA 4C2TA 4DCNA 5DGXA 2YC4C 1IOZA 4KLNA 1OLOA 2JATA 1OH8A 1A82A 1YQTA 2IYYA 3SS8A 5B57C 3X2SA 2GBLA 1TAGA 3L0PA 1SXJB 4NCHA 3ZIAA 1WP9A 4A8JB 5JI3E 1Q22A 4KU4A 4GMDA 4Q7MB 1JJ7A 4A4DA 4PHTA 3IO3A 2CCKA 3DEFA 3A58B 3MMPA 5AJZA 4A0GA 2AK2A 2QENA 4K46A 2B7BA 2C5LA 1E2MA 2QAJA 4OJKA 5EZ6B 4O2LA 4EPXA 2EFGA 3FKSD 1RYHA 2F7SA 2ZQ5A 3LLMA 4OBEA 2BM0A 3SC3A 3P1JA 1II0A 3BB3A 3DMDA 2F55A 2ZRIA 5E4FA 2NO1A 4OI2A 3G0HA 5FUYA 4AYXA 2ZAOA 1UPTA 4OHXA 3GFOA 2W0MA 1C1YA 4Q5IA 1NN5A 4JLPA 3JZMA 3L82B 4L4UA 3WYGA 3ZVLA 4C9BA 4JL5A 2PJZA 4TLDA 1HE8B 2CHGA 1Z47A 3GLHE 2GJAA 4JVLA 3TMKA 2IT1A 4DDTA 1UAAA 1P9RA 4Q7LA 5CYPA 1ZCAA 3PEVA 2CJWB 4IDQA 4M1MA 1QHYA 4FXPA 3GEIA 2XZLA 4B3XA 1FX0B 2D7DA 5JHHB 5FFMA 2H57A 5E3HA 4PFSA 3DL0A 3U3KA 1MKYA 1HE1C 2QE7A 4IEIA 3W90A 4CYMA 3E1SA 2J7KA 2OO7A 2OCYC 1JR3A 4BLRA 2RGDA 4JMPA 1OHHA 1JEEA 1YRBA 2D2FA 2I4IA 2QT1A 3O8BA 5LBIA 5BYKA 4NZYA 4PQRA 3PFIA 1Z22A 5D3MA 5HE9A 4LZZA 3A1VA 2J46A 2OT3B 2W00A 3WBJA 1GZSA 3CX7A 5C1BA 4WAUA 1AQYA 1KY3A 1XU4A 1VDZA 2BBOA 1FW6A 221PA 4YC7A 4ZCMA 1HT1E 3NBYC 2J7PA 2J0UA 4FN5A 4MH0R 3TUZC 4XD7D 2ZRJA 3E70C 4R71A 3UK6A 2D74A 5TV2A 1O87A 1UBEA 3MCAA 1E0AA 4B3BA 1W36C 4QM6A 2A5DA 1F60A 1KDPA 2Z0MA 3QBTA 2QUZA 1GP2A 4GZMA 3U7HB 1V5WA 1UFQA 2OXCA 2DFNA 2AXNA 2QPOA 1T0JB 4Q4LA 4AG5A 4PSVA 3AVPA 1A2BA 1RW4A 3K0FB 1OFHA 2GEUA 2ZRLA 1RPZA 3GLGA 2CXXA 2F9LA 1AK2A 4ZO4A 5J4HA 4G5SA 1CRQA 4KBFA 1NKTA 4C0HA 2ODBA 5CJPA 1T9HA 2IA5A 1CJTC 4V0ME 3AP3A 2R44A 2WVJA 3SYKA 1HV8A 4DRZA 1XXHB 5GJBA 5F2EA 1Y3AA 4O25A 3RANA 2OM2A 2FA9A 2BJVA 2ZI9A 1T6NA 3HWSA 3U44B 4DKXA 1QHNA 3I73A 1KKMA 5M04A 1U0HC 1XNJA 5DYIA 3RRNA 1J8MF 1XZPA 1HA3A 3ECCA 2FFAA 4EPWA 3QPUA 4HLQB 2FFQA 3UG6A 1EX7A 3OIUA 1G4UR 2GZAA 3CR8A 4MA4A 3DM9B 1KK2A 3JVVA 1P2VA 3NG1A 2B6HA 3RS0A 2NQ2C 2ZRCA 5FBVB 4O0MA 1OH6A 4RFSA 2WHXA 2YWEA 4PPQA 4URWR 4G01B 4NH0A 2XXAA 1RE0A 2ZJOA 4JZKA 3ASZA 5EE3A 5JEDA 3AVQA 2ZRHA 4WW0A 1U8ZA 2F1HA 2H1LA 3U3RA 3FDIA 2O8DB 1J90A 1W46A 5FUVA 4JBWA 1TADA 4QGHA 1ZC4A 2BMJA 3T1VA 1KI2A 2CCGA 4NONA 4NTZA 2PLFA 1DOAA 2J1LA 1Z29A 3KUCA 4LHYA 2ASEA 3L0IB 2WMOB 1XMSA 4N0DA 4FMBB 1AA9A 4F93B 5FPHA 4JKIA 4FD2A 4RZ2A 2BHRA 4ABYA 5G3YA 2C77A 3HU3A 4JBXA 1P6XA 1U98A 1D8TA 1G7SA 1SVMA 1QHHB 3B9QA 3CZQA 5J4YA 2ZE5A 4RY2A 1LF5A 2P0EA 3NHBA 4P3YA 2R62A 3GLHB 4XJXA 1QHXA 2YJTD 5EQTA 2VP2A 2LKDA 1NVUQ 4ESVA 3D8BA 3DOEA 4GMXA 5DO9A 3KKQA 1VYUA 5EP4A 3M0EA 5TY0A 2BBTA 4YMUA 4TSFD 2QAGA 1YZKA 3U7GA 1FOEB 1ZC3A 2Q9BA 4BLQA 3PR1A 4OQLA 1P3JA 2C98A 3ZZ0A 2AWNA 1NVWQ 1JALA 1TEXA 3A36A 4WIAA 1OFTA 3LLUA 1IY1A 1X8LA 1ZU5A 4QL3A 4DSOA 2OESA 3GEEA 3OAAD 3QBVA 2QU8A 1GL6A 2F3RA 3WRXC 1K8RA 2ZAMA 2BC9A 1I4DD 1SZPA 4A8JC 2Z43A 3TGPA 3I5XA 4PXAA 621PA 1XB2A 1KAGA 2QRNA 2ZM5A 3B2EA 1YZLA 1DE0A 2F9MA 2IYRA 3KXLA 1VG1A 4M9QA 2E9SA 3BH7A 3OEEA 4G5QA 3F5FA 1COWA 1IJFA 5AUNB 1XEWX 4HZIA 1ZM4A 1U8YA 2F6RA 1G8HA 2G77B 3IILA 3SQXA 1EWRA 5FL7A 3EC1A 2ZYTX 4LHXA 1A1VA 2GAOA 3AVOA 3GJ6A 2A5JA 2OCAA 2VIIA 1KHTA 2GJ9A 3KQLA 1G17A 1NY5A 1GNQA 1UF9A 1G16A 4PAQA 3QSYA 3QENA 5L3QB 4MRNA 3KQHA 1KJZA 3BIFA 4PO1A 1I4LD 2NO0A 4A15A 2OAQ1 2KJQA 2QP4A 3THYA 1ZIPA 3AQ4A 4OQNA 2VHTA 2IF0A 3AKYA 1RFLA 3RS7A 721PA 2J0SA 4NCKA 4PPGA 1DADA 3REFA 1IHUA 4TN1A 2FE4A 4C0BA 3JZAA 1WB9A 1E2DA 3SHWA 2P5SA 4KFUA 1P4SA 3MFYA 4TYNA 2ZE7A 1VTKA 2Z83A 3EPJA 2CCJA 3AM1A 3ND9A 4EPVA 2DPXA 3X1YA 4HB4A 5GJCA 2G6BA 5FUXA 1Q44A 1ZW6A 4DIDA 1ZM9A 3AF1A 2QORA 3I3SR 3K1JA 3PV0A 1M8PA 1XCMA 3QF4B 1H8HA 1OKKD 3CW2A 4AY2A 4CEIA 4JJKA 1OIWA 1A7JA 4R98A 4QBHA 5HZHA 3ZZTA 3CH4B 2FSIA 3OE7D 1P73A 3NVAA 3RWMB 2OEPA 1IN7A 2V8OA 4TTQA 3IPYA 3GJ7A 2EWVA 2NG1A 2C03A 2RKOA 4NYIQ 4JLAA 3AF3A 1KIMA 5H8WA 3CO5A 3KJGA 1BMFD 1S1CA 1E2PA 4I1VA 2BMFA 2GKSA 4I1SA 4BE7B 4NMMA 1GVNB 1CS4C 5CK5A 4BLOA 4YQFA 1M1YE 5FPTA 3TNFA 1XZQA 5SZIA 4D81A 2WJVA 5B58C 2IX3A 4TMTA 1N5IA 3LA6A 2GRJA 4HB0A 2VHCA 2GAAA 3K0AA 5JS8A 2HXSA 4F92B 5K8UA 5FOWA 5AUPB 1ZMXA 1W4BA 5EXTA 1TTTA 1LS6A 4RZUA 3FKSA 4AYTA 1R0WA 4URUR 3RS2A 4B43A 2J5XA 2O0HA 2HCJB 2VHUA 2C9YA 1US8B 4HEJA 1CTQA 2OFWA 1F3OA 1MT0A 2O52A 3B8HA 4L16A 4MRVA 5BQ5A 3CPEA 4A92A 1AM4D 2R6CA 4S35A 1N0WA 2O8FA 4JLDA 3B60A 4PC6A 3RSOA 1EFCA 1IXRC 3DMNA 4MITA 3WNBA 4GI7A 1E69A 1E2KA 3IIJA 4Q1FA 4GZLA 3WMFA 4DZZA 4ZI3A 1YZNA 4DLXA 2OFXA 3K70D 2PH1A 2WSMA 3CB4A 4XVRA 5DI3B 5JJIA 2GJKA 4OHVA 2XNDA 3EG5A 1AKEA 2BBWA 2CL6X 2CL7X 4XTRA 1CR0A 2YOHA 5DHFA 4DLZA 2D3WA 4A0FA 2ZR7A 2X19A 2ONKA 2XJ4A 2OBLA 4PANA 4W5WA 2ZJZA 2GCOB 3PUYA 5KO2A 2WIAA 3REGA 5BYJA 3FE2A 4D6PA 3SZRA 4QOSA 3TIFA 1NBME 1XTJA 1R6BX 3BK7A 1PJRA 4KLZA 4DDVA 3QXXA 4GBMA 5EZ5A 2XTNA 4DEXA 1HYQA 4RD6A 4CW7A 3TR5A 1Z8FA 1Z0KA 1OIVA 3TR0A 5ANRB 3X1DA 2O8EA 5CK4A 3OFND 1SVKA 2DCUA 2GCNA 4CRWB 5L3SB 4QGGA 1JI0A 1G3RA 1KI4A 2FG5A 1W36D 4DHEA 4IRUB 4DT1A 2ZVQX 2GTPA 3PUWA 1PLJA 1LW7A 2EU8A 1ZUIA 4LHVA 5A5GA 3PEWA 5D3MB 1KO7A 3V4RA 2WSSA 1XTIA 2FNAA 4D0LB 1G19A 3GQBA 3SHFA 1KSJA 1U8AA 1X3SA 3IIMA 1OB5A 3FFAA 2QGZA 5GVRA 3GJXC 1U99A 4DUGD 3FMOB 1KDOA 3CNNA 4M1OA 4UXJA 2ZI4A 3SE0A 4LYHA 3LVRE 5FBRB 3RS5A 3K70B 2FGKA 1KDTA 2ZRAA 2YWHA 2ZRDA 3ADKA 2J3EA 4TWZA 4A2PA 1W4AA 4D80A 1TU3A 3VR1A 1FMLA 4GOXA 2ECKA 2VHJA 2Y8EA 1SXJE 4URXR 1TX4B 3VX4A 3KL4A 3H4MA 3GMTA 2EFDB 2CLSA 3VU9A 1P75A 2BWJA 3KTAA 2J9RA 4OI1A 3ICQB 3FMIA 3GLGB 3P4YA 1E79A 1J2JA 5BWMA 5HCNA 4E03A 2ZETA 4PO8A 3VFDA 3EWSA 1EFUA 4LJ4A 4JVMA 1LTQA 4AURA 3ASYA 4OYHA 2V1XA 2PLRA 1CRPA 3CWZA 4LYAA 3THWA 5KHOC 4LJAA 2BV3A 1OF1A 1G5PA 1DELA 2R9VA 1YJ5A 2EWWA 1S8FA 4AC9A 3EASA 3ZD7A 2VSFA 2BBSA 4IVPA 2E1RA 2AD5A 2IF2A 3CRRA 5E7JA 3CRVA 3WYAA 2BKEA 4HLCA 2AKYA 4BEJA 3K0CC 4UXHA 3EAQA 1A5TA 3MUFA 2WWGA 4D26A 3DOFA 2CLDX 1XTQA 3MAAC 4MDEA 3TJZA 1II9A 1YU9A 1KK3A 4M4SA 5CLQA 1R4AA 5JHGB 1E4YA 3KFVA 2A3RA 2C04A 1HUQA 5L3VA 2DWQA 4DLRA 2FWRA 2QEQA 3O8CA 1AGPA 5KSPA 4CEJB 3NBZC 1QRAA 2XB4A 4HLUC 2LCFA 1XD2B 1GRRA 4WZAE 4EPRA 4Q1AA 2IHBA 1YE8A 1XTSA 4OI4A 4R7ZA 1ZM2A 2WJIA 1XEXB 4M1WA 2JLVA 1DO2A 4CF7A 2AD1A 2ZS8A 4XH9B 4AKIA 1R8SA 3MWJA 1TQ2A 1FQJA 1WDTA 3DZDA 1XBTA 4BEBA 2WJGA 2YOFA 2P3SA 1XMIA 4TTPA 4ZIRA 1SVOA 4BQSA 2XXAB 1PUIA 5DLQC 2WWXA 4PZYA 2DFLA 2QSZA 3VKWA 4UNPA 3A6PC 4AKEA 1Z83A 3DPUA 4LBYA 4M9XA 4C7OA 3KXKA 2ZREA 3HU1A 5AJVB 3LRPA 1ZINA 4URVR 1T91A 2OV2A 3A1SA 3OHMA 2FPKA 2GZDA 2F43B 1EFHA 1F2UA 2CDNA 4A0RA 2VSXA 521PA 4UNQA 1T5LA 2VP6A 4TMWA 3NDBB 2JDID 1YRAA 4A0HA 4C0SA 3I1FA 1P61B 1S9HA 2VLIA 2WV9A 3KX2A 4PTLA 1KO5A 4TSFA 3GFPA 5H68A 3GLIA 1ZNYA 2XAUA 4US1R 1XD9A 1UEIA 2JGNA 4F38A 4ZDWA 1SKQA 2IXEA 1SXJD 2QA5A 3WHKA 1AZSC 1KK1A 3U5ZB 4B71A 1AS2A 1E96A 3QXHA 2F1IA 4UKDA 5FBQB 2D62A 3H84A 5JRZA 2V54A 4P4SB 1UKZA 2Z4RA 3BFKA 4HUTA 3QOFA 4HDCA 1KI3A 4H1UA 3WP0A 1N6LA 2ZRBA 4BPBA 4CDGA 3KKPA 4YMVA 2RGEA 4PPNA 2IUUA 3PENA 1XFAA 2IYXA 3SN6A 4LDJA 4RKFA 3T61A 5FOVA 2QMEA 2KWIA 5K8TA 4AYWA 2P67A 1Q1EA 2REBA 1MABB 3FHTA 3AKEA 1T4GA 4LYJA 3TK1A 3B13B 1XF9A 2W2XA 1QVAA 4MYTA 4DSNA 1BYUA 2K5UA 5B30A 2DHRA 5LDDC 1NSFA 2FEMA 3LD9A 1YKSA 1KY2A 1H8EA 2OLJA 1GKUB 4Q47A 1AQUA 3P32A 4KV9A 4A36A 3SJAA 4LV6A 2IXGA 3TVTA 4U00A 4LBZA 2VTKA 2FV8A 4V03A 2VP5A 1MR3F 3GFTA 2MSCB 4V0KA 4DCVA 4EJSA 2H92A 4BFWA 3K9LA 5JWHA 4I1UA 4EAQA 2KE5A 2XEXA 1W5SA 1S2MA 1GWNA 4B32A 1ZBDA 4BFUA 3B5JA 3QKSA 5LB2A 3BOSA 3AKDA 2GDJA 1KGDA 3NH6A 4IHQA 3U2QA 1TL7C 1PVOA 1U90A 2Z4SA 5TARA 1HH4A 4C30A 3QG1A 2XB2A 1P62B 1Z06A 2XNSA 2OE2A 1G8PA 4P31A 2ZI6A 1O3YA 4GP7A 4ILEA 4YMTA 2JJ2A 3PEYA 5JWOA 2W0SA 4F91B 1YR7A 4Q00A 1Z2CA 2XOKA 1Q21A 2DBYA 1K5GA 1JECA 5TXGA 5E7MA 3ZJYA 1RC8A 1N2CE 2ZRKA 3DDCA 5AR1A 3ADDA 4G5RA 4Q4JB 4TYWA 3IGFA 1GILA 2IEZA 2B8WA 1JAHA 2QM7A 5AJYA 4FWIB 3IO5A 3ADCA 4D0NA 5CB6A 2OUKA 1SVIA 2HF9A 2MSEB 3EA0A 3W6OA 3HR7A 1EK0A 2PL3A 3VTKA 5KSYA 2UKDA 2JA1A 2QTVB 1ZYUA 2QL6A 3NEYA 4S2EA 1XX6A 3SFVA 5IK2D 1GRNA 5KOYA 3KQKA 1KMHA 4K81B 5J4VA 1IQPA 1E2EA 4RD3A 3X1ZA 3UIEA 1XWIA 1S4QA 1WE2A 3B1YA 1JPJA 1C4OA 2GVZC 1GNRA 5J47A 1QG2A 1JQLB 4TMVA 1N25A 4URZR 1NJGA 4HAVA 3KXIA 4Z1MD 3GLFA 4HB3A 4NYIR 3OE7A 5CIWA 4ASUA 4HI0E 5H70A 1Z2AA 1NRJB 2EQBA 2G83A 4C0QC 2WTUA 2O5VA 1NMXA 3P26A 3FYHA 3OESA 1W48A 3QPWA 3I4LA 3K70C 1KTVA 3OEHA 3V00A 4PO9A 2NO7A 2B8TA 5F9FA 1F48A 2FH5B 2BMEA 2RGXA 3UATA 3IQWA 3L8YA 4IEEA 5HZKA 1EG7A 4A82A 3NC0C 1ZD9A 1P7CA 5G41A 1SVSA 4W7SA 4O3MA 1DAEA 1DEKA 2AXPA 2FX3A 1ESNA 4LJ8A 3RRMA 4ACAA 5GVSA 1ZNXA 2UVQA 4G3XA 2YINC 3ZVMA 2DWPA 2ZS9A 4JIMA 1U9IC 2XZPA 1L8QA 4NCNA 3R8CA 3ZVNA 1E32A 3K0EA 4AI6A 4NYMQ 2J59A 2FDCA 3BBPA 1TF7A 3QVVA 1NI3A 4PAMA 4F7WA 2PBRA 1Q1BA 2R65A 1W44A 4EQ6A 1JBKA 1NSTA 3K0AB 4FCVA 1P2UA 3KJIA 1X6VA 1ZCBA 2H8KA 4RCZA 5UKDA 1KO8A 4GSYA 2ATVA 2NTYC 1F2TB 2IYUA 1G18A 1KSGA 4M21A 2HT6A 5FR1A 1C9KA 4KVGA 3LW7A 1S9DA 3K53A 5SZJA 3W6PA 2YZ2A 3ZS8A 2RMKA 3W8RA 1HURA 3C16C 1SQ5A 5G40A 1E99A 1KI6B 4QG7A 1DS6A 2O8FB 2GJSA 4FCWA 4MDFA 1AN0A 5JCZA 2ZEJA 3WRYC 4KFSA 3QQ5A 1P72A 3L0SA 2J45A 1DAKA 1KI1A 4DVGA 4BECA 3BAFA 5HPYB 2IYQA 2VP4A 2JJ8A 2WAYA 3B82A 2BM1A 2JASA 1WMSA 3BH6A 2Q3HA 1VHTA 3NIBA 2OFOA 4RSGA 3RC3A 1KYIA 1M2OB 4LX0A 1UBCA 2OCBA 1G3UA 3B1VA 2R8RA 5FTKA 3HP1A 1E9DA 3OFNA 3X1XA 1MOZA 4BFYA 4PC1A 2F1JA 1ELOA 2WKQA 2Z5FA 1YZQA 1J70A 4ARZA 1OFIA 2RGAA 4MGYR 1E1QD 2D4HA 2JLZA 3VKGA 1NMYA 1S96A 5FH9A 2O8EB 1SHKA 1W4CA 1I2MA 1XRJA 2V7QA 4HATA 2XGJA 1GAJA 4QRHA 1D6JA 2VF7A 4FW9A 2VO1A 1IBRA 4M2LA 4KODA 3KKOA 2O8CB 1E9CA 2HDNB 1Q12A 1Z28A 5JJLA 3SDZA 2PMKA 3KFXA 3PG5A 1RJ9A 4TMZA 2QBYB 1P2TA 4DUGA 4UNSA 4Y0VA 2IS2A 2HLDD 2WOOA 5BN3A 3TSZA 4AKGA 4JJZA 1LY1A 3QEOA 1PZNA 5H1YA 4LPKA 4EUNA 1IN6A 4RD4A 3J81k 4GRAA 2WWFA 1QF9A 2RH5A 1G7TA 4RZXA 3P4XA 2D06A 4KFTA 3WYFA 2OAP1 1RVDA 4FMDB 5C2JB 3PUVA 1JAIA 2FOLA 2FJUA 3MJHA 4URYR 3TBKA 3K8YA 5CITA 2QPTA 2VPPA 3VQTA 3EIQA 3QKRB 4KAXA 1EESA 3AGQA 2QTFA 1Y63A 1FZQA 1G6HA 1KZGB 3HU2A 3QF7A 3IUYA 2YKGA 2KI5A 1DARA 3F3YA 5FPYA 1VIAA 2IYZA 2NIPA 3LWNA 3VU9B 3LBHA 3W34A 1U2RA 2JJ1D 4HUQA 3A1TA 2GXSA 4DBLC 1M6NA 4AIIA 4BFTA 1GDDA 2HUPA 4JL6A 1PLLA 4WZ6A 1GG2A 3SNHA 4MYHA 1OYWA 1X86B 4X8LA 2JLUA 2NMVA 1SKYE 3M1IA 5IT5A 2WWWA 2VQSA 2A78A 4KO8A 5HTKA 5CM8B 2QP9X 4HAUA 4ESHA 4Q1BA 5FOXA 1OXVA 1OSNA 3T1QA 2HV8A 1W0KD 1SXJC 3THXB 3DKPA 3U7FB 1ONBA 2VHQA 2CL0X 4Q7JB 1D2MA 1OJLA 3EARA 1DTSA 2HYIC 4OI0A 3MWLA 1M34E 2ZSAA 1UBGA 3TQFA 1E2LA 4JLVA 4JVSB 2I1QA 1IAQA 4L5BA 1EFRA 1Z6YA 2X1VA 3S1AA 1IN8A 5AJWA 3RS3A 4JSTA 3QIAA 3BH0A 4C0JA 3PCRB 1N6NA 1E1RD 1HEIA 1NMZA 1AS3A 2WWIA 3CRMA 4Q4HA 4A1FA 3IEVA 1ZM7A 4OHZA 1FTSA 3WMGA 1XMJA 4KSBA 4B76A 3C41J 3A1UA 2ZRGA 1AKYA 1UDWA 3EIEA 3ZQJA 1JR3E 5JSZB 4YMWA 1ZP6A 5BXQC 3A37A 3TE6A 4TT3A 3QG5A 4LCBA 5IF9A 2C78A 3LBIA 1XJQA 2YYZA 1E2GA 4BGDA 4MKFA 5B2ZA 1W7AA 1W2GA 4IXNA 4E22A 1X1RA 2QMOA 4D4LA 1YZTA 1R2QA 2Q0HA 2YHSA 2JDIA 2ZTSA 2BJWA 4LJ5A 4GL2A 3TW4A 2RAPA 1WRBA 2FFBA 2Z6VA 4BZPA 5F3WB 1G64A 3KUDA 2R6DA 4EFMA 3AVUA 4B73A 2OZEA 1GFIA 2A7QA 3CR7A 1FNNA 3WP1B 1UADA 2GHIA 3UANA 4E5UA 1XP8A 4A8JA 5FOTA 1W47A 3RRZA 2QT0A 3SQWA 2WAXA 4F4IA 3BGWA 1FP6A 3T12A 2A2ZA 3W3AA 2ZYVX 2ZJ8A 1OXSC 4UJ3A 3AF0A 1SVWA 2IW3A 3I92A 5KTYA 1FL9A 4DLTA 3WNDA 3MGCA 5EE9A 1J8YF 4YXWD 1OH5A 4JL8A 4CEHA 1G4AE 3GLGE 5J40A 4V0OA 4TL7A 2ZRMA 1NLFA 1MO3A 3T1OA 3AKCA 3HYTA 2VRWA 1P60A 4U02A 3CZPA 4A9AA 3ZVRA 1VCOA 2C9CA 2IUTA 3TSWA 1RYFA 2ERXA 2BOVA 2AHOA 1X8JA 2PJRA 4ITRC 1T5IA 4LHWA 5GJWC 4LJ6A 3FMPB 4HB2A 4MGIR 1Z0DA 4QFMA 2QQ0A 3I62A 1R5NA 1X8KA 2ZUDA 2O8BB 3GD7A 1N6IA 1TUIA 2YWFA 6Q21A 2G3YA 4RD1A 3R9XA 1XTRA 3I8SA 1CU1A 3SJZA 1FX0A 1VCNA 4IDNA 1G21E 4Q4AB 4NE2A 2G9NA 3R8FA 4XSHA 4EJSB 2GXQA 2RGNC 1JB1A 4US0R 2C8VA 2V55B 4OHWA 3HDTA 2PT7A 5BN5A 3T15A 2N46A 2N1BA 4NCJA 1YR8A 1Z6XA 2QE7D 3U6BA 2WJHA 5KYKA 1NJFA 1MV5A 4JLMA 1G3QA 1KNQA 3FHOA 4I99A 3SYLA 1ZJ6A 2AFHE 5CJ2A 3CF6R 4B2LA 4EPYA 1OHHD 4TZ6A 1JEDA 2PX0A 2WIBA 1EWQA 2CBZA 2LKCA 2NZJA 4BRWA 3ADBA 3B1WA 4TQUS 2VP0A 4QNMA 5P21A 4W9MC 2IS4A 1OW3B 3U3OA 2HCBA 1N6RA 4UNNA 1VYTA 4IOLA 5IK2A 3CF0A 4M0LA 3CUEF 1SKYB 4Q1CA 2J7PD 3Q8XB 2YNMA 3D7MA 2IUSA 4QHYA 4C4PA 2WWHA 2OSBA 4XSGA 1XPRA 1WF3A 4FMDF 4GOKA 4DIEA 4IDHA 4PC7A 1JNYA 5FI1B 2JLWA 3K09C 4LC0A 3K0FA 2WZQA 5JI2E 2WKPA 2IXFA 3BJIC 2ZSFA 3MWYW 5FR2A 4Q1EA 4Z1MA 1IXZA 1T0HB 2IC5A 1XTKA 2GVDC 2XSZD 2JIZD 5EXSA 5JBQA 1RRCA 4NYJQ 2BEKA 2J0VA 2KB0A 1XXHA 2W6ID 4LJYA 5DHAA 3Q5EA 1J7KA 1G7RA 2QROA 2WBLC 3EPHA 2G0TA 1QBKC 2ZS7A 3QI2A 4TL8A 1KJWA 4D25A 4NYMR 3WBKA 1QDEA 3EWAA 2DY1A 2GXUA 5CDFA 4FMCB 1DPFA 2OBNA 2ZXUA 2F3TA 3UWOA 1QG4A 1U0JA 1QHGA 1E98A 2B21A 4Q21A 4EIWA 3N2IA 2YWGA 1M7BA 1UKEA 2QZ4A 1S3GA 4XD7A 1TU4A 3VR4A 3QXSA 4DLVA 4G5GA 1EFTA 3LVQE 4DCSA 3B9PA 4POAA 4B35A 4DLWA 2QGNA 4DC9A 4N0EA 1P9NA 2DWOA 2J0UB 3N70A 1XPUA 4PHFA 1U94A 3R9WA 2GA8A 1OXTA 4FI3C 4Q02A 3TAUA 3FB4A 3LAWA 5C46F 3U4QA 1DAIA 1LS1A 4KYUA 3RHFA 4PZLA 5L8VA 1G291 5CYOA 1E9AA 5TDHA 821PA 2L0XA 2Q9CA 2IYTA 2RB4A 5G53C 2REXB 1CIPA 2C99A 1NF3A 4GFDA 4Q9LA 4KBGA 1NN0A 4Q9KA 3Q85A 2EYUA 4L8GA 2XJ9A 2OILA 1TF5A 3PQCA 3L43A 4BFVA 4N3NA 1TUEA 4OL0A 4ACBA 1VG8A 5C4GB 1QHHA 3B78A 2GJ8A 3LBNA 2AKAB 3AF4A 3OIVA 4LGMA 4C3ZA 3GLHA 1Z07A 3MD0A 4W5JA 3UPUA 2PX3A 3QUSA 2PCJA 3L0OA 4QM7A 3I61A 1XPOA 1W2HA 3O47A 4K8OA 4ZV4A 1HTWA 2GEDA 4D82A 3SU8A 1P5ZB 2R2AA 4AWXA 2EVWX 2WM9B 2ATXA 4KHZA 2GXAA 3N5CA 4M1SA 2A5YB 1DAHA 2IHYA 4WVFA 4ARZB 1NBMD 3M6AA 3I8XA 3CKLA 3GJ4A 2IYLD 3AUXA 4X8OA 4I4LA 5C18A 1MO5A 1CLUA 1HY3A 3KQUA 2P5TB 3HPQA 3SFZA 4PQYA 4OHYA 5EUQB 3CWQA 1JQJC 4RFSB 1N0UA 3SBEA 2BDTA 4P33A 1ZAKA 1ZD8A 2H5EA 3PUXA 1UBFA 4TLAA 4UJ5A 3Q3JB 4RJLA 3NWJA 5DYGA 4B3FX 2GESA 4I1OA 1JPNA 2ZI7A 1NLYA 5LD2B 1E2JA 4E07A 5EP1A 4B2IA 3B85A 4HAZA 4C0LA 1RRGA 4M22A 1OB2A 2RGGA 1JR6A 3T06B 1G3IA 421PA 3D3QA 1UM8A 2F1RA 1TQDA 3L2OB 3MG9A 2GF0A 3BFVA 1KKLA 1Z0FA 3OEED 1OIXA 4JBYA 4XVQA 4LHZA 1COWD 3K0CA 4PSAA 2GWHA 2CK3D 1WBDA 2B92A 2UZIR 1IONA 1E9SA 1KMQA 1MO6A 1NVXQ 2ZANA 5DNYB 5HR5A 3QKUA 4OKSA 5L3QA 3CH5A 4P32A 3SOPA 1P9WA 3O8DA 4M8NE 2Q6TA 5FL7D 1OV4A 4MYCA 4QNRA 4V0MA 3AB3A 3ONWA 4HLUA 2FMXA 3H86A 2GETA 4BLPA 3QVUA 3A4MA 4Q66C 3BE4A 3GJ0A 3WNCA 2WKRA 3BRWD 3SI7A 3OF5A 4I81A 2QAGB 4NDZA 4BFSA 5BN4A 4DSUA 4KXFB 4Q03A 5TMPA 3VNVA 3OAAA 1E0KA 3U6KA 4FWTA 1Z6GA 1R5BA 1W0KA 2IYVA 2PZFA 4GNKA 4MGZR 3T1TA 2QP3A 1NG9A 2ZJBA 2CNWD 3TQCA 4Q9JA 2QMUA 5IDVA 2QY9A 1GM5A 2HYDA 2H7VA 5K8IA 2GBLC 3VX3A 4ERNA 1T3LA 3AVXA 2CLCX 1KI9A 4PZZA 1KOFA 2VSOA 2ZPTX 3LXRA 2P65A 4HZUA 4LRWA 3AVYA 1AS0A 3IHLA 5CM9C 1A4RA 2AK3A 3VKHA 3LFUA 4HDOB 4B3GA 2PZEA 2DB3A 3SYNA 4BRUA 4A2WA 4OJQA 3VR2A 2HEIA 3QF4A 4TLBA 1Z63A 4BFXA 2DFKB 3OIWA 3QXCA 5JFGA 4Q4HB 4BZXA 2YC2C 2ZIAA 2MMGA 1Z5ZA 2RGBA 4M9ZA 1UDXA 2JAQA 1Q1QA 3X1WA 2A5FA 4AG6A 4MRSA 3RVBA 3LQQA 3UMFA 4DWJA 4DLSA 1H8HD 1B0UA 3DVLA 1IJEA 5FI0B 4ZKEA 1XEFA 3D31A 1EGAA 4FMCF 3W8NA 4BZQA 2EW1A 1S1MA 2H17A 2ZUBA 5GADl 2ZUCA 1DG1G 3AVVA 3CNLA 5FBLB 1E9RA 4NHOA 1TF2A 2REOA 1VKJA 3ZGXA 1AIPA 3THYB 2JEOA 4A6PA 4BUJA 1N3BA 4UXIA 1KZ7B 1LVGA 3K9NA 3RSLA 4TYPA 1DG3A 3C5HA 3FPAA 1KJYA 3IHWA 1JJVA 2A9KA 3A1WA 2QNRA 2ZSDA 2EFHB 4OK5A 3W9YA 1M7GA 4YXWA 1US8A 2I3BA 4F4JA 2IS1A 2AN9A 4LYFA 4GT1A 2JLYA 2JLSA 5KPJA 1TNDA 3K9GA 5KNDA 2VF8A 4YDHB 2QRZA 3C4JA 3SEAA 2XZOA 3ZDQA 5AJXA 4CEHB 4IJMA 4RD0A 1OKKA 1NL3A 1CJUC 1K5DA 1GKIA 3BORA 5FBWB 3TAHA 4D4JA 3IPXA 1EXMA 2ZYUX 1QZXA 3RRYA 2H16A 3QPVA 5DI3A 4Z54A 3E5HA 1QVRA 4TTRA 1W5TA 1ZM3A 3ZH9B 4CEIB 1BMFA 4R2IA 1FP7A 2CMKA 2GCOA 2JLXA 4W5HA 1L4YA 3BB4A 3CPHA 3G82C 3RNLA 2G1JA 2ZJ2A 1DBSA 1XCPA 3PITA 4GOJA 5KDDA 1WCV1 4QGAA 1NN1A 2XNDD 2FSFA 3LX5A 4WA7A 1KK0A 2J0QA 5EUMA 5DISB 1ZVQA 3CNOA 2FSHA 1FPMA 4KFRA 1XD8A 1KO4A 2EYQA 3SR0A 3NXSA 1N5KA 1XEWY 1Z0AA 3U7EB 4D4MA 5CB8A 5KPDA 1P2SA 1XMVA 5L3SA 2QTHA 1GOTA 1ZUNB 4CT4B 1OT3A 5JCPA 1ZNZA 4G1UC 2ANCA 3TW8B 3IKJA 1S0UA 5CLLA 3LY5A 4B48A 2EFEB 2FFHA 1G6OA 2IWHA 1YR6A 1CEEA 2V4ZA 4RFVA 3FVQA 4Z8XA 4ZCLA 4UNRA 1UKVY 3QXJA 2CHVA 4C0KA 4MUBA 3KQNA 4IXMA 4TMXA 1ZNWA 3T34A 5FL3A 1FUKA 4Q19A 4PHGA 1IN5A 4JYCA 4XWKA 2ZI3A 1WXQA 1II8A 1E2IA 1FMJA 3EZ2A 3L8ZA 2WSSD 3K9HA 5LB4A 1XCGB 3I72A 4IOKA 4M53A 4NYJR 4V0NA 2DYKA 3E2IA 3LDAA 4Q1DA 5KDOA 2Q3FA 2XSZA 2JIZA 2N42A 4LBVA 4LUCA 3QY0A 4TL9A 2KBFA 5EE0A 1WQ1R 5TB5A 1NIPA 2W83A 2ZJAA 4B6FA 2W6IA 1NVVQ 4L9SA 3PVSA 3EZ9A 1RZ3A 3GLIE 1M7HA 4J0QA 1U9IA 1N6PA 4XVUA 2ONJA 3R20A 1SULA 1OYYA 4B34A 1PV4A 3CONA 3TRFA 2WWYA 3RLFA 4MYUA 1GUAA 2BKUA 2ZI5A 2ZSBA 1S3SA 5DIFA 5LD2C 4X8MA 4H1VA 1CXZA 4TMKA 3QEJA 1E79D 1MRSA 4MUAA 1G8FA 4RCYA 3GEHA 4M1KA 2OLKA 3T35A 3WHLA 3LQRA 3VR5A 2TMKA 2VP9A 3VNUA 4Q9IA 2GILA 1N0VC 4XIGS 5DN6D 1E4VA 4DEYA 2V9PA 4DT1B 4V02A 2D7CA 3C7KA 3PUZA 4LK2A 1XDBA 5JEEA 1QHIA 5EE5B 1E2FA 5DH9A 4LBWA 4JLKA 4ZPXA 4EFNA 3KDSE 4US2R 5SZHB 1LB1B 3THOA 4CEJA 1A2KC 3R7WA 3LX8A 4NCIA 2IYWA 4Q9HA 1XD2A 1Q1ZA 3CIOA 3NTUA 3H2YA 1KSFX 4Q7KA 1T8UA 1MRNA 2QAGC 1XEXA 4IDPA 4TQ9A 4CT5A 4OK6A 4B3CA 1J99A 1D5CA 3BS4A 3H0KA 1E9BA 4H9GA 2OBMA 2XX3A 4LWZA 4LJ9A 5DE3A 3ZLJA 3IBYA 5JZVA 3U4QB 5J4LA 2IK8A 3QJYA 2IEYA 4HDQB 1OXUA 4ZKDA 1NG1A 4ZDJA 3A8TA 1Q0UA 3B1XA 1DAFA 5JJKA 4QC2A 4ON9A 5EP2A 2QQEA 2IYSA 4JVNA 1NIJA 3KTAB 2F43A 4PX9A 3NC1C 3AUYA 4OQFA 4WXPA 4KVAA 4N1AA 1G5RA 1GIAA 5JS7A 4TLCA 1Q3HA 5LPNA 2G1KA 2WPDD 1Q3TA 2BIFA 3NH9A 4QJ3A 2ZVPX 2VYFA 2ZJYA 1E6CA 3O8RA 4E09A 2ODNA 3EZ6A 1LV7A 3PXGA 2W6JD 3THWB 2ANBA 1IN4A 3D6TB 4YDSA 4IW3B 2E87A 3EC2A 4CVNA 1GKYA 2ORWA 4P4SA 1G1MA 1YHNA 1U0LA 3VR6A 2FF7A 4MQBA 1NBMA 1VCIA 1K6MA 1D2NA 2QI9C 4IOMA 4JLJA 1W49A 4MGKR 2IBMA 1IY2A 1KSHA 1E0JA 2PMDA 3P20A 4GDFA 1G9XA 3F8TA 3GP8A 3BFXA 3G5UA 1MO4A 4EKDA 1OPXA 1W0JD 1RRFA 2AWOA 4M9SA 4JKYA 4KSCA 1YVDA 4LV5B 1MABA 1T3SA 4OK3A 4EPTA 2VL7A 5KUTA 1KI7A 3GLFE 2EFCB 4Z8YA 3CPJB 1D9XA 1JXMA 2B7CA 3F0TA 4IFBA 4IVQA 2WMNB 3BD9A 2WICA 1BYIA 4FIDA 3Q72A 2BVNA 3CRQA 3VMFA 2KBEA 4MRRA 4P4TA 1GSIA 4F4CA 3HR8A 4ZIRB 1CJVC 2C96A 1W1WA 4Q01A 3RAPR 1G20E 4NU0A 4NP6A 4L15A 1SGWA 5IHPA 3KZ1E 2PEZA 1RRPA 3NBXX 5FTJA 2PT5A 4FINA 1H8ED 5ELXA 2ZRPA 4C7OB 2CK3A 4NPHA 4DB2A 4KYIB 2MMCA 3V4FA 4DCTA 4Y0AA 4EFLA 2FPLA 3DZ8A 5JRJA 2HJGA 3MWKA 4B6EA 1L4UA 1LNZA 3UMRA 1F2UB 2A5GA 5HKKD 1G7CA 4WOPA 2QSYA 4TZ0A 5SZKB 1SXJA 3RYTC 1N6KA 4BASA 2P2LA 2SHKA 5KDLA 3QE0A 1BS1A 3FHCB 1N5LA 3ETLA 4YMSA 1FUUA 1E9EA 3BB1A 4PHHA 3ZS9A 5JWRA 3GLIB 2JLRA 5AUOB 3AF2A 1R0YA 2VEDA 1PUJA 1Z0JA 4DSTA 1QHSA 4DDUA 4M1YA 1G8YA 121PA 2X2EA 1I2DA 4Q4JA 3T5DA 1VCMA 2GNOA 3UG7A 3ZIAD 1R0XA 3EZFA 2JJ2D 2XTMA 1L7VC 4HAYA 1CKEA 5B64A 2CNWA 4JS0A 5C4MA 2CVFA 1U81A 4AK9A 2FU5C 2XOKD 5AK0A 3FFBA 5EXXA 2ZYWX 3FMFA 3B7GA 1BIFA 1KNXA 4JYBA 4IKEA 1OH7A 3TLXA 1R8QA 2RHMA 4B47A 2NGRA 4MKHA 4YLGA 2NPFA 3SJCA 3PJRA 1BKDR 2W2TA 3GJ8A 1VPLA 4IOJA 2ZSEA 4CGZA 3K0SA 3DKVA 5JMTA 2ZE8A 2H18A 2CJWA 3V9PA 1KI8A 1Z0IA 4LPSA 4ZDKA 3AP2A 5HCIA 4LC1A 8OHMA 4HZUB 3C14C 4HLDA 5DSZA 2I1VB 4RZ3A 3EPLA 3NBFA 5G3ZA 4P4UA 2C95A 2VBCA 4O2RA 2HJVA 2GCPA 4G5OA 4DLUA 1FTNA 4PQFA 5F98A 1M74A 4OQXA 4XTCS 4TYYA 3RWOA 3QKSB 1NN3A 2VH5R 4HSEA 4LI0A 4TLEA 4DCUA 2HXYA 3LNCA 3T5GA 3RC8A 2AX4A 1YZUA 2W2VA 1VECA 2O0JA 3C15C 4ASUD 3HPRA 4GPTA 2ORIA 2Q21A 2OCPA 1AGRA 4QBGB 3Q7QA 3U3JA 1JR3D 3OEHD 2Q3MA 3PEUA 3AEZA 4LOAA 2YV5A 2ZJ5A 3CBQA 2VA8A 1G3MA 2YVUA 2X8AA 2IS6A 5E95A 3RS4A 1VYVA 2P6UA 2AL7A 4B33A 1GNPA 2IWRA
chains in the Genus database with same CATH superfamily
2BP7B 3K4PA 2QRVB 3LF2A 1KEKA 3HO8A 2IY9A 4OUKX 1UC8A 3MHTA 3RC2A 4WKBA 2ZUWA 4XDHA 5D7BA 4GF5A 4FEYA 4EX6A 1VSBA 4AZ0B 4ZEMA 5BR1A 1HDOA 4CMBA 3OJLA 3PEEA 5FCDA 3SSNA 4KACA 1UBHS 1D4ZA 3DQPA 3CNEA 3H1TA 3T7AA 5T41A 1M8GA 2RGNA 5EIHA 4LJ7A 1XDGA 2DPYA 1TQ6A 1Y89A 2WJJA 3CINA 3BHJA 4MP3A 3K9BA 1ZHFA 3C5CA 4HEHA 2Q4TA 1NLZA 3P0IA 4N5HX 3ZGOA 4DM3A 4JP8A 1ISMA 1N6HA 3WK7A 4D3SA 2NVUB 3ZDXB 3SYRA 3UK2A 3B5EA 4IVRA 3VH2A 3P9IA 4WPGA 3C74A 2AR7A 2Z04A 1K75A 1LBQA 2NW6A 2ILVA 2D0IA 1B6GA 2H4FA 3O1JC 1NQOA 4M38A 8LDHA 4QEKA 2H1HA 5HJ5A 4CGYA 5FOQA 2BSQA 2CNLA 4WN9B 3UK1A 1CBUA 3QGMA 1GGEA 1CY4A 1E5VA 2AFIE 3KPJA 4QFBA 3MRVA 5EAIA 1C3VA 1O95A 4R7GA 4ZC1A 2NU8A 5JW6A 1CSEE 1RM0A 1W25A 1AZLA 4E5PA 5IN4A 3M4YA 4WRRA 3G1TA 4IUDS 3I2JA 3SBDA 3UWKA 1V26A 2XTZA 3LCMA 1L4FA 3TLZA 4R9UC 1KDZA 1GZDA 3D7RA 1P2DA 1DC5A 1D9ZA 7GPBA 4RMGA 2LTAA 4IHKA 1G41A 1PP4A 4BFZA 4GLOA 4AKHA 5CD9A 1M72A 4QTZA 5FPSA 2DUJA 1UKYA 4JU9A 3DG9A 4RY0A 2KSQA 5COQA 2R1UA 4BLSA 2DFTA 1RZRA 2H7CA 3GAFA 1O57A 3D0OA 5AWFC 2ZUVA 3BGVA 5LA6F 1CP2A 1YDFA 4F3YA 2ZROA 5MN6A 4TYYA 1WXGA 4JP3A 4OEHA 1JLRA 2FMHA 2Q8PA 2ZDQA 4G9GA 1GL9B 1PFWA 1EINA 4E12A 4LF6B 4XFDA 1P7PA 4OTZA 4C20A 4PPFA 1EX6A 4YREA 1L2TA 4I5EA 3TUJC 4BN4A 1M83A 4E08A 4CZ2A 2RJ3A 2YHAA 4RSHA 5CX4A 2AS0A 1NVVR 3W5IA 3LW8A 3RREA 1ENPA 4RZHA 1VJTA 1FP4A 1II8B 3Q40A 4UZSA 3L1KA 2GEVA 3FCAA 1P29A 4PN3A 3MWDB 1Y6QA 3BN3A 2HDHA 2G1UA 4RK5A 3HVUA 3EX7C 4JC8A 5K01A 1NWCA 4C22A 1VA5A 1RIFA 3REQB 3DWIA 3QKTA 4BP8A 3FJ1A 3WNVA 2DVMA 2PX2A 2OZLB 1H2YA 3QSGA 4COOA 4MAFA 5FWNA 1K98A 3R74A 1Q1GA 1LK0A 4WXRA 4GRIA 4BKPA 3CX6A 1Z6AA 1I3MA 2ZRFA 1T8TA 1UBNA 2QD3A 1ZCFA 5I3CA 3EA5A 1AXEA 3MSXA 3NU1A 3PYLA 4KDRA 1K6XA 1IZZA 3WMEA 1IDN1 3CQ9A 4PSCA 1QS0A 3WZLA 4YLEA 1GL7A 2X9GA 5IUNC 3B1JA 2CVHA 5EJ4A 4L74A 2V7UA 2BEJA 3H99A 1BDBA 2QN6A 3CPSA 4U3JB 2Q1SA 1CJMA 1EXVA 4JBGA 2A30A 3SC4A 4M0KA 1HQYE 3EUAA 3TZBA 1DINA 2WOJA 2FZ5A 2PVCA 4JJ4A 3P27A 1CWUA 4EZIA 1OT5A 2YYYA 2BSXA 5IJ9A 3VAAA 3GFFA 3W6NA 4B2PA 1Q20A 5AK6A 1JG1A 3GAAA 2XDQB 2ERYA 1ZHHA 3CCFA 3H1AA 2DBQA 4Q6BA 4ZT4A 3I6IA 4A2CA 3O93A 3FOZA 3N59A 5G4LA 3GRZA 3U61B 4Y98A 3NNDA 5JCXA 3W3ZB 5I4IA 1U80A 3L0CA 4GSKA 4I66A 1EXDA 5TQ2B 5AW6A 1CK4A 3QFCA 4TVOA 1P9LA 2DTDA 1UMCB 1YFZA 1ZD1A 1UXKA 3HMKA 5JLAA 5MDHA 1J8FA 3QU2A 5A0FA 4P92A 1GITA 1E2NA 1Z2DA 4S1WA 1KDYA 5DKFA 1I6MA 2XITA 1OXBB 2H1WA 4GMKA 4IFEA 4XQ0A 1IAVA 1Z6TA 3AVTA 4MQMA 2CB0A 1DTEA 3SC2B 1RP1A 1BOFA 3V6MA 4C6SA 1FLNA 1NVTA 4M55A 4DLBA 1C9DB 2FEWB 4UVEA 1EFRD 1ULSA 1HMYA 3DD5A 5DCLA 1GAXA 1EB8A 3QUBA 3QFFA 2QD1A 3LK6A 2A58A 4INJA 5BSGA 5JS6A 3OZXA 1GG9A 4H6VA 3V2HA 2CE7A 2D2EA 1KPHA 1SY7A 1XL1A 2I8AA 3EZYA 4ZO9A 2JJ1A 2E4XA 4FYYA 5CDHA 3FTEA 4H0FA 5JSKA 1PN3A 2WJYA 3F8SA 3TKLA 4JDPA 1KH1A 4CLOA 1PT8A 4GPAA 1RXCA 1ETUA 3SZLA 3EVDA 1CVIA 3KB2A 3W3AH 3QNUA 4ID9A 1ZD5A 2WPDA 2XE8A 4M0DA 1UBRS 1DVRA 2NOAA 2X5OA 3KG2A 4BUCA 3DBLA 4J43A 3GLVA 3A70A 4PAOA 1XQ9A 2C88A 2OCIA 2W6JA 1L5HB 3O1HB 4JFAA 4LTDA 4F7DA 4EG1A 1TZBA 1DO8A 3L7DA 3NYQA 4X3PA 2RGCA 3HU5A 1VMDA 1BAPA 3IBGA 1UC5B 3PDJA 4EJSC 1M0WA 5FQOA 1MIHA 2TMDA 3M1AA 1XMXA 4GR5A 4H7HA 3W90A 1UMKA 2C9OA 1OX6A 4A26A 1DCKA 1VE3A 2EJUA 1VHLA 2GCGA 4QGFA 3WLAA 5KTNA 4HNAB 2C20A 3U9TA 2QLLA 5CLIA 3OIYA 1S7GA 4MS3B 4N7MA 2ZB2A 4J0KA 3JQ6A 2KQUA 2BKXA 2R6AA 5B6IA 1KO1A 1NY6A 3BRQA 5DHQA 3VVLA 3G7UA 2H5IA 3W3AD 2LZ0A 4PR0A 2J87A 4B3JA 3UQYS 4B44A 2V1UA 3WL6A 3H7AA 3FGZA 1GTJ1 3VNQA 1A8IA 2Q1XA 3ND8A 4LY6A 4G26A 1R4NB 3S1AB 3V1LA 5LLDA 5G1OA 3FCXA 1Z73A 3A4LA 5F23A 2JFNA 4PYIA 2QZSA 4H18A 4JVOA 1CUGA 1JT9A 5TPWB 1GUBA 3GFGA 4QHTA 4CCYA 1U8UA 4Q18A 4JT8A 4DSAA 4U5XA 2QG6A 1ID8A 3HJNA 4OAQA 4CTNA 1Z08A 2Z5VA 3EXFA 5IRCD 3V8EA 1LRKA 2QJRA 4ZT7A 2EBUA 4CU2A 2NXCA 3DH0A 4EJMA 5AVRA 3FWNA 3I5YA 5CH5A 5LZ2A 1I5EA 3RFUA 3HYLA 3WGJA 1V4BA 4JSYA 3V8PA 4D4KA 4DXAA 4ZDIA 1HDEA 4X60A 1UJ2A 1V8PA 1CEQA 1RBYA 2LWIA 4I3GA 3TVDA 1SUBA 1R0ZA 3VVCA 2O6LA 4RYDA 1OI2A 3MLEA 3DM5A 2HT1A 4Y2VA 4LRSB 4WNIA 2AZXA 2X2FA 3FYUC 1J1IA 5EKSA 3STYA 1P6UA 3ECSA 2EBFX 4ZWNA 4DA9A 4DCNA 5BR7A 2QX4A 4HLNA 2IRWA 2PZAA 5DRTA 2F8MA 4PPYA 4LXQA 3ISTA 4P82A 3SS8A 1MAVA 3X2SA 2VSYA 2I2BA 3MINA 2KLBA 4XPZA 5KOIA 1ZGGA 4D9IA 1MOQA 4NXMB 1FVOA 1NONA 1WP9A 3OLZA 1CS0B 3D59A 2VZLA 4OU5A 4GMDA 1WSDA 2HJRA 4G4IA 1JJ7A 4NG4A 4RANA 1DMSA 2R8PA 4PW0A 3RYHA 3H1EA 4J1TA 4WBNA 1FYXA 4FZ5A 2DM6A 2B83A 1UOEA 3FBTA 1SBQA 2PPVA 1Z5OA 1TQHA 3I52A 5EYPB 3QBDA 1E63A 1G2IA 2P4SA 2QAJA 3ND7A 4OJKA 5K03A 4O2LA 2PX6A 1W34A 4FSDA 4BNDA 2PUEA 1I3KA 1Y1TA 2XQIA 4D4GA 4WCVA 2ZQ5A 3L7LA 2EDAA 4OBEA 3DLPX 3HSSA 4O02B 1II0A 1WP4A 2R11A 4NU6A 4ZT3A 4OI2A 3RTDA 5JDCA 1XA3A 3KWFA 2ENWA 3AL0C 1A8HA 3DUFB 1SG6A 1SMKA 3VNBA 1N4DA 5CEFA 1A88A 1MEOA 3L82B 4JLPA 2G36A 4L4UA 4C9BA 5KQSA 1JLLA 4RSMA 3PFCA 5G02A 3I5UA 2HM7A 2PJZA 3QPDA 1HE8B 4TLDA 5DSTA 4JVLA 4GR9A 4AUMA 1M34A 2IT1A 4EY5A 4YCJA 1USVA 2P3OA 4A23A 3PEVA 1MN6A 2CJWB 4DV7B 2GBPA 3KAKA 2FPPB 1MD9A 3AB8A 2XB9A 1TAHA 2FR8C 1RXYA 5COAA 3D8UA 1R9NA 2FPUA 3INNA 5FFMA 2H57A 4N5LA 5E3HA 1HKHA 1MKYA 1HE1C 3JRXA 4IEIA 4PWYA 5KAPA 3STUA 1XTPA 2J7KA 1M1NB 3EVTA 4E5VA 1EFVA 3ZE9A 2OCYC 5IG2A 4BLRA 1DC3A 1FTWA 4JMPA 3FI0A 2CJFA 1YRBA 4JEHA 1S01A 3DKRA 5BYKA 3JD1A 3PFIA 1Z22A 5D3MA 1ZMOA 3O9ZA 2BFCB 4EW1A 1VM6A 3A1VA 1C30B 3NWOA 5JATA 2AYXA 3UB4A 4YMIA 1N7HA 3IV6A 2WQ7A 1PEDA 3JCZA 2PIAA 3KQMA 1J00A 4OV6B 221PA 3ND6A 4YC7A 2J7PA 3NT4A 3R0JA 4MH0R 4YJFB 4LGVA 2PWZA 2ZRJA 3GBPA 4CCSA 1H0RA 4CIBA 5D86A 4UCFA 2OQ2A 2YL2A 5TV2A 1B6SA 4L28A 3AT1A 1A77A 2EZTA 2P2GA 3T0FA 4BIIA 5JOQA 2FW1A 4BNZA 1FJHA 1U0SY 4HN4B 3V4LA 4HDRB 4EEXA 4GZMA 3T52A 4Z4IA 1WNTA 5BNWA 2I8LA 5DDIP 4YO7A 4PSVA 1IHPA 4MS4B 3OT1B 3Q1KA 3WGNA 5LQSA 2GEUA 2ZRLA 2CXXA 2F9LA 1AK2A 5J4HA 2H0AA 5B6PA 1RQNA 1CJTC 3FCCA 3AP3A 3GF4A 2PUGA 2R44A 4ZFNA 5BV7A 1RPAA 2UVDA 5PNTA 3VJMA 1J5XA 3AFHA 2I87A 1ZGZA 3BFJA 3HFJA 3DSRA 3RANA 3D1VA 3MTEA 4YRPA 4F5YA 4YRCA 4D92A 3OX3A 4ZYZA 1M5TA 2Q7XA 2VP3A 2O7NA 3FCUB 1W6UA 5AKIA 2IOQA 3G17A 3FDZA 4DKXA 1YKGA 3Q9UA 5KQGA 1QHNA 3I73A 1VIMA 3KB8A 5ICMA 2BEVA 1N8NA 2I4LA 2QX6A 4FR0A 2Q5OA 5L6MB 5M04A 1X1EA 1XJWA 3ECCA 5BV8A 4RPKA 3TZ6A 4EPWA 1RDFA 3SZUA 4B4KA 1HNXB 3M4ZA 4L5AA 1RLIA 3M1LA 1EX7A 4WDQA 2OMKA 1JG3A 4UTPA 4L95C 2GO7A 1IPHA 3RADC 1QRDA 2BFPA 3D5QA 1QV9A 3NG1A 4JEMA 2NQ2C 2MINB 1UC4B 4UTZA 2OQVA 3RS0A 3OPYI 3UWDA 3A1EA 5FBVB 2IYFA 1OH6A 3TEMA 4YAGA 4CKBB 5A5EA 5B2FA 1T35A 3HLTA 3OTHA 4C29A 3HKBB 1FSZA 2AFHA 4G01B 1ORVA 4DANA 2VHEA 4NH0A 1CVLA 1RE0A 1TJ4A 1Z5VA 2R79A 1K0FA 2ZJOA 4JZKA 4EK9A 4GZ6A 4JOCA 1AMNA 1SUPA 3W7VA 6YASA 4M0CA 5K0NA 3U16A 2CJXA 4KPYA 3BFPA 2O8DB 4WVLA 4JBWA 3E82A 3P71T 4QGHA 2JFFA 4XDZA 4NTZA 4RF3A 4FPXA 2FPIB 2J1LA 4RMIA 1XV5A 4DGQA 3KP1A 4ZALA 3BIJA 1LU9A 3DONA 2WMOB 1VL6A 1LLCA 1SEVA 1DXOA 4FMBB 3IDSA 1JA9A 2VJDA 1K68A 3ZDAA 4L8VA 1NXTA 1P5FA 3IALA 3ROXA 2J9ZB 2JGIA 4J1NA 3NALA 4LJSA 1WY7A 1MQ9A 1G7SA 1SVMA 2O05A 5A4DA 1Y8CA 3CZQA 3IUEA 2WABA 1JLMA 2XVZA 2ZE5A 2J3QA 4WCFA 1Z7EA 3FPJA 2I71A 2P0EA 3ZOZA 2R62A 1EVYA 3M9WA 1QVWA 4PLYA 4ZTBA 5K51A 3CLHA 2LKDA 3MS2A 3NWBA 5SY6A 4GMXA 2XEDA 3DOEA 3KKQA 1TC1A 2Q6OA 3GVPA 1KTIA 3IQDB 5DW0A 1RCTE 1Z13A 2BBTA 3KT0A 4TSFD 3REOA 4YMUA 5ER6A 4ZI7A 2F3QA 1E1KA 5IN5A 3UT0A 3WGYA 1H1DA 5J2UF 3U7GA 4IDDA 1XTUA 3RU2A 3PR1A 1JU4A 2IPAB 1P3JA 3EQ6A 4GNRA 1KMIY 4OQLA 4ZVLA 3U3DA 3VPFA 2PYZA 3ZZ0A 3H87A 3FM9A 1TEXA 3JYOA 3A36A 2C9ZA 2I4OA 3LLUA 5J5AA 1QPZA 4ZVQA 3CVYA 3UAXA 2P1ZA 1X8LA 3FXAA 2WJWA 4HXGA 1DIRA 4ZICA 1H5QA 1PNTA 4ZRDA 3N2GB 3Q7TA 3AR2A 4R9NA 4RTQA 3NDIA 1HR0B 5HG0A 3GGJA 2BFEA 2CGEA 4M83A 5JH7A 3QBVA 4GP9A 1CERA 2EKLA 1K8RA 4RLSA 5ICFA 3RM3A 4NMXB 1FP1D 3E48A 1SZPA 4Y1FA 2IUYA 3QWAA 2O2YA 1GGHA 3LDGA 4W1SA 4DZRA 5FBHA 2BFAA 1PX0A 3O83A 1KAGA 4K3UA 3TI9A 1GTRA 3E3NA 2AX3A 1GQ2A 3RGGA 2ZM5A 3BSFA 1H5UA 1DE0A 4ZOEA 3GH3A 3LY7A 4UCQA 1SBCA 1VG1A 2QXUA 2E9SA 3HCEA 3BH7A 3N75A 2OV6A 1Y33E 2P1DA 3F5FA 3LBYA 1COWA 3OEEA 5FD8A 4DV1B 1NTOA 2TRSB 4FHFA 4HZIA 1U9CA 5FEUA 1E62A 2F6RA 2Q8QA 4HBZA 4NBLA 2YHBA 3IILA 1RKUA 1XCLA 3SQXA 3A4TA 4H17A 3TF5A 1I13A 3ZI4A 3EC1A 1RRVA 3EGXB 4LHXA 2GAOA 1KVUA 3AVOA 3JPWA 2DHQA 2QLNA 2CV0A 3A4YA 3D54D 2BH2A 1WUJS 2VIIA 1DQZA 2DOKA 5HVNA 4F1JA 4UUMA 4AECA 1P81A 1UF9A 1H66A 3AUJB 1TK2A 4U9IS 4HSGA 3OLVA 2OUIA 1XQ1A 3AJAA 2OPBA 3NUZA 3JYQA 4BMNA 1VLQA 2IPLA 1KJZA 2O3SA 1Y82A 2CNDA 2EZ9A 2Q2QA 4C3OB 2QP4A 1QZ3A 4OQNA 4P93A 2IF0A 3L3BA 1RFLA 1XN1A 3PGXA 3RS7A 3TZHA 4DUPA 1DADA 5BN4B 4XWYA 3ROZA 1YI8A 2VRBA 4KXUA 4DMFA 5I01A 4Z9YA 2YIJA 2CKMA 4CQLB 1VKNA 2FPXA 2QN8A 1JU9A 1HNNA 2C1ZA 5EKTA 5T67A 3NVMB 5FYDA 5C8YB 2FMTA 5CBPA 4C0BA 4AF7A 3VUFA 4R2JA 2VAPA 4EB6B 4NMWA 1M6VB 1U3GA 1U7DA 3WLKX 2O2XA 2WLSA 1M6EX 2VDQB 3GPCA 4MLZA 1N75A 4P84A 4CF3A 3TSAA 4M98A 4MXDA 2IU4A 2Q3EA 5L53A 2I91A 2C84A 4F86A 5KREA 1X7WB 1P1BA 4O4HB 1T1GA 3D4LA 4C5BA 3OCJA 3PRJA 1GG8A 1PR4A 3L84A 4KQ2A 4LFAB 2ZPUA 3CUKA 1ZM9A 3QLVC 2CFIA 4H08A 3GIWA 3S7ZA 3KTFA 3TLYA 4DIDA 2D5BA 3ORFA 1HLPA 4L72A 1KU0A 2I2FA 4BY9E 2C82A 1NR1A 2G6TA 3KK0A 5IVHA 4KVFA 1P0IA 1XCMA 2HLHA 2BFMA 3G23A 1H8HA 4Z0PA 1NW6A 3JWJA 4N01A 5D3ZA 4BMYA 1OIWA 5EG5A 4R98A 1QF7A 1CF9A 2XT0A 4AWBA 5HZHA 1Q7CA 1U8FO 5LNK1 2NT3A 3UGQA 5CLFA 3G0CA 3EULA 2P9GA 2OKCA 2EWVA 2C03A 4D0RA 1J0EA 1V5GA 2RKOA 3B3QA 1KIMA 3MGGA 4ENWA 1CFZA 2JFXA 2DQYA 4GC9A 4I1VA 2RKBA 5LMNB 4GLJA 4OXIA 4RU1A 1GVNB 3RIMA 4HHEA 3F4LA 2GN9A 4H16A 4BLOA 2BE9A 2JIOA 2XDWA 4ND1A 3RAJA 4BN5A 4YCNA 3IAFA 1C3OA 2WEKA 4YRTA 3GPBA 5SZIA 1A8PA 4CHGA 5AVWA 3VBCA 1J9EA 2A9JA 1N5IA 2C7OA 2GRJA 3B3AA 4HB0A 2QTAA 4MJLA 2GAAA 3K0AA 5DVZA 4EPYA 2HXSA 3KSBC 3I2GA 3FWKA 1KS9A 4KLCA 4CMIA 5FFFA 1Y4ZA 3THSA 3CJRA 3ZVRA 1ML4A 1C0PA 3CN9A 4Y2YA 1HOTA 4RHTA 3RS2A 1CY8A 2ID7A 3FMGA 4FGWA 2J5XA 3LY8A 4X6UA 4I1YA 4J03A 2O0HA 2HCJB 2W90A 3AK4A 1US8B 3EC7A 3AR5A 4PYMA 2OFWA 1MT0A 1MW9X 1OA1A 3CSUA 4X00A 4NBNA 3WQRA 2VNSA 3OZRA 1EJ0A 1ONPA 3CPEA 3EFOB 1QC5B 3KHKA 4A92A 4EMSA 4PC6A 4GPZA 2VNJA 2HNKA 2VHWA 1KQOA 1A2OA 2NV6A 4WLFA 4KR0A 3T3OA 4FE3A 1XZIA 3N05A 4MYSA 3WNBA 1JEYA 3FPKA 5E8JA 3OQIA 1NP3A 2YXNA 3AFOA 1L5RA 2C2BA 2MYTA 1WVGA 1YZNA 3P45A 3P2YA 3LLCA 4GUAA 4HBGA 4X6YA 4ZI3A 4IQ0A 3N3AC 1NQAO 3WSVA 2BR5A 5B2EA 2GJKA 5JPDA 2B3DA 2IQIA 2R7MA 4DDHA 3L40A 1J25A 1CR0A 2VN8A 1CDZA 5LLSA 2DH5A 1M2OA 4YHBA 5DHFA 3OO0A 5IXSA 1KEVA 2QUJA 3FPEA 2WSLA 4KTTE 3GDGA 3LC2O 2IDMA 2XJ4A 3BEDA 4RTPA 1S2NA 1L7AA 1TIKA 2H1SA 1GADO 3UJNA 3ZWNA 4HDSA 4BMZA 3ZE2B 2Q4BA 4D6PA 3SZRA 1RWOA 5BQ3A 4QOSA 3W2HA 2GF2A 4M0MA 2JFPA 3WKCA 4ZU6X 3I1IA 4NOKA 2HHHB 1OLXA 1Z8FA 1AA6A 1OIVA 5ANRB 5CK4A 3OFND 4BFLA 3BMCA 4QGGA 1G3RA 1KI4A 1DCFA 1LH0A 1PL6A 4G37A 4ZXPA 5DM60 5AKKA 4DHEA 1BW9A 2DGDA 1BNCA 4FEAA 4IRUB 2CLIB 1NPTO 2O3RA 4WN3A 2P35A 2GTPA 3O75A 2C7QA 2TSYB 1QAOA 4I4TA 3ZHRA 2PRSA 1E3WB 2WK1A 1LW7A 2HPZA 2WB4A 4IDAA 4LHVA 1ZRSA 4I5FA 3PEWA 2JI9A 4PZAA 1T34A 3ME5A 2VBIA 3QNWA 2XT9A 4D0LB 4DAEA 3NOVA 2A84A 2E55A 4AICA 1KSJA 1YL6A 4KSYA 3UMBA 1XEAA 2AOTB 1VJGA 1U2GC 1AO0A 3D4NA 1Q6YA 2A92A 1X7XB 4B3IA 3UM9A 4H59A 5LZ9A 2Z2YA 2L42A 4M1OA 2IXTA 4L7VA 4UXJA 4LYHA 3QYPA 5FBRB 3RS5A 3ELBA 4A2PA 1L1RA 3NV9A 4D80A 3SX2A 1XIVA 3HJGA 5B3AA 1XMQB 2GHTA 1Y8QA 4MLPA 3A9TA 2ECKA 3KQOA 3MN1A 4F11A 3DOOA 3WLNA 3VX4A 1B8UA 2K7FA 1BDHA 1PJ2A 1V8ZA 1G6KA 3C1OA 3GMTA 1NC1A 2KPOA 1N5DA 3RJMA 4DCOA 1WXWA 1ZDMA 3CG4A 1MAUA 5BUQA 3WVNA 1NUAA 4ENTA 1TTQB 1V39A 2WTBA 4EGSA 3O4VA 4O2AB 2Q27A 1N2GA 4AFNA 3IUJA 3VKVA 3UCXA 4I9GA 2R7KA 3KCQA 2ONCA 1QMPA 4FS3A 1YK1A 3MMXA 1D7OA 4AURA 1JHQA 1LBSA 3DMFA 2O7QA 4FEEA 3RBXA 4OYHA 3CCCA 1CRPA 3THWA 1WR8A 1GXSA 1OF1A 2G70A 5I7HA 1G5PA 1P18A 1G66A 4K7JA 4LSMA 2GHRA 5TPWA 3DUWA 3EASA 2PWYA 4UASA 5EWMB 1QLJA 3RIXA 4AMUA 4YRAA 5C8YF 2DPHA 2IF2A 3WL4A 1UWVA 2NXJA 2V5UA 3IR5A 4NJOA 2BKEA 2WNHA 3RFCA 2GNPA 5A9SB 4CM5A 3CA8A 3OCYA 3MUFA 1Z0UA 4AF6A 4D26A 2HRBA 3D4IA 2CLDX 4QNNA 1XTQA 1NR5A 4CKCA 5I45A 2I4MA 3HSYA 5BR8B 4R8VA 4II3A 2QKYA 4QYIA 1XHFA 4RLQA 1HUQA 1SCUA 2CVPA 2ZULA 3TTSA 1IRXA 2FWRA 1J0XO 4QJIA 2FW9A 1WULS 3NBZC 1QRAA 3FOAA 4O4HF 3GK3A 5I9IA 2NUPB 4FX5A 1GRRA 4OB7A 4J90A 4EPRA 4Q1AA 1EGQA 1YE8A 1NRWA 2VDVE 4GU5A 4IWYA 2PMCA 3PTLA 5D2CA 2WUVA 3HLYA 1NI4A 4PYNA 4HMPA 4PV7A 1RE1A 2WPNA 2C2KA 1PKEA 5KTTA 1JXQA 2BDEA 4U6SA 4RIEA 3MFQA 5BUZA 1WCXA 4NAUA 2P3SA 2XXAB 3O4IA 1SVOA 2OGSA 4MPJA 4ZTUB 3E53A 1I2BA 2K2QB 3C24A 3JQBA 4ZCQA 5B64A 3K0KA 2IEBA 3PNPA 3C4QA 2DFLA 2QSZA 1M6YA 1EHYA 2B5VA 3VKWA 4V0SA 4F5DA 3L0YA 4C7OA 3HU1A 3L7YA 4BKQA 5A5DA 5EZYA 2B1QA 2CNNA 4DIBA 3ZU6A 1YIAA 4G84A 4KRYA 2F43B 3M3HA 2H2FA 1F2UA 4MROA 1UT8A 2X5XA 3WWEA 4MUMA 4YPOA 1IM8A 5AW0A 3K71B 5JR3A 1QX4A 2J31A 1SELA 3DE6X 3NCTA 1QE0A 4OOEA 2JDID 4TMWA 4W1PA 1PNQA 4GHWA 4X7RA 4EJ2A 1QNLA 2B36A 4I08A 2WMYA 3PFGA 4RDCA 4XGQA 1FIUA 1P61B 5H68A 2JFGA 3L79A 1DWOA 1KO5A 4JQOA 3EFEA 3LLVA 2P3QA 4US1R 1UEIA 1JQBA 2JGNA 2WUGA 2ZATA 1NOKA 3A2LA 3GAZA 3O5AA 4BKUA 2FG6C 2PD4A 1G0OA 2QA5A 3IKLA 1EDDA 4K5QA 4DMMA 4L0MA 3QXHA 5JRZA 2D62A 4LNUA 2NM0A 5AK3A 1UKZA 1Z7GA 4HWOA 4QXQA 4RHYA 3IP9A 4RS3A 1KI3A 1VLVA 4MWZA 1W9MA 4FBGA 3KKPA 2GN6A 4O5AA 1RHQA 2QTZA 3QELA 4KPGA 3FFWA 3ZD8A 2A0KA 1FDOA 1AE1A 4LDJA 4RKFA 4DR3B 3T61A 4EI7A 3ZY2A 3WBFA 2BPOA 4DNFA 5DOVA 5K8TA 2P67A 3U80A 2CFSA 3P52A 5A0TA 4GLBA 2IP4A 4G41A 4TROA 5AW3A 4L6IA 5LL6P 1QVAA 2PUFA 5FA5A 4DSNA 5EIAA 4C08A 3W8DA 2FW6A 2YZNA 1X7GA 3DP7A 4Q47A 3WBBA 4D9FA 4KV9A 2O7SA 3NX4A 4K26A 4K1XA 1V8FA 4LV6A 4ZPJA 4CL2A 1Z6PA 2DHCA 2H0QA 2OC4A 2EKZA 4LBZA 4V03A 4HAOA 3R3JA 5LOVA 2ABWA 4JGGA 1CUBA 2EKBA 3ENWA 3LQ4A 5JWHA 4BFWA 1W85B 1QRSA 1GWNA 4BFUA 3V55A 5EOVA 3B5JA 4R9VA 1Y9EA 1DKQA 2JARA 5LB2A 4RAQA 1KOLA 2VJNA 2GDJA 5IZ4A 3DYBA 5ADWA 1TL7C 3E22A 1XLTC 2ZGVA 2ZVJA 5TARA 1HH4A 3AR8A 2WUWE 3QG1A 4E14A 2OCGA 3W5CA 1P62B 1U04A 2XNSA 2II6A 2YHUA 2OE2A 3RVDA 3DL4A 4P31A 4AO7A 4D8TA 3QLJA 1WHTA 2ZI6A 4GP7A 2JJ2A 3NHKA 3SEQA 4F91B 2KLHA 4Q00A 1Z2CA 2GM3A 2H85A 2QHXA 3A3OA 3MD9A 3ONNA 2L69A 5FPQA 4EA7A 3CKKA 1JECA 3DMTC 4IIDA 4E2ZA 5E7MA 5DX0A 5AVTA 3ZJYA 2WM3A 4UHDA 2WM8A 1YBHA 5IC6A 4G5RA 1ZZEA 3EY4A 4KXNA 1VPTA 2IEZA 4DBVO 2B8WA 3AHFA 4HCJA 2VWHA 3WWYA 2OOSA 2QM7A 3OOEA 2GZRA 4R16A 3TFWA 1ID1A 2BUBA 5CB6A 3KALA 4RF2A 1T4CA 2ZZNA 3HA7A 3ZVLA 4I9FA 3ZV6A 5A02A 1MB3A 3EFHA 3W6OA 1A96A 1IN1A 3AERA 3Q3IA 2HU8A 2PL3A 3FCEA 3VTKA 1I14A 4R0MA 2JA1A 2QTVB 2JRCA 2RHHA 1X87A 2WP0A 3U1TA 3SFVA 1GRNA 2DPLA 3K5WA 2B4TO 1BS2A 1JT2A 3EGDB 3I64A 4K81B 5HMMA 3RUAA 3BD8A 3ID6C 4DLPA 1IHXA 5EHIA 2NU9A 1QQ6A 5FKJA 1E2EA 1FUYB 3AEUB 1IU9A 3OE5A 1S4QA 2VAMA 3IURA 3PC6A 1WE2A 4B7CA 1C4OA 1D2RA 1BU5A 1RTTA 2GVZC 1GNRA 4FEGA 2GN8A 3EY9A 4PVDA 4UULA 2MCFA 3SYTA 1D3AA 1ECPA 3TLEA 4TMVA 2HEGA 2W4MA 4URZR 3ZGVA 1X7ZA 4Z1MD 3YASA 5CIWA 4O2AF 2EQBA 4QDXA 4CLRA 1PBTA 2YWCA 2WTUA 2NVWA 5FX2A 5KYTA 2ZCJA 4X0EA 3EXEA 1Z2NX 3T4PA 3VOSA 3CNQS 3ZPXA 4CG2A 2BMWA 3I4LA 2BYTA 4FDTA 4NBKA 2B1GA 4ND4A 1RYZA 3I30X 3V00A 1NBWB 1T4MA 1IRIA 5BMVA 5JD4A 5KJ6A 2BMEA 1TU0A 5F9FA 4DMGA 3FCOA 4RDHA 1G20A 1RMQA 4BB6A 1IOWA 3AUFA 3JWGA 1V9SA 3KEMA 1QYRA 4A82A 1P7CA 5G41A 1SVSA 4KGXA 1DAEA 2V59A 3RARA 4ACAA 2D3TA 3AY6A 3B1FA 5L4SA 1ZNXA 3D4OA 2UXBB 2UVQA 2P7HA 1AKNA 1DKOA 1DKRA 3COWA 2JGKA 3ZVMA 1U9IC 3R8CA 3ZVNA 1RCFA 3FKJA 3PE4A 3K0EA 3OP4A 4ENVA 5DX1A 2XWJI 1H3FA 1TF7A 3JATA 1NI3A 4RK0A 3V2UA 5K20A 2FDCA 1R6DA 2PBRA 1Q1BA 4BKRA 1ZPDA 1V16A 4PBSA 4Q15A 1E7WA 4WFJA 4EQ6A 1JF8A 5CCXA 2X23A 2HA0A 3AFMA 3OJ0A 1WXIA 1XAGA 3C3XA 5EIXA 1TO1E 2I22A 3TXAA 5BPFA 1XELA 1UXGA 2ATVA 1POXA 3HADA 4HAIA 4G2TA 5T6MA 3VZBA 2XQGA 4LW8A 2HT6A 3ZY3A 1O94A 5ECGC 2GFQA 5FR1A 4UFOA 3O03A 4KVGA 4ISCA 3LW7A 1GZHB 4Z4EA 2JFUA 1EHIA 3ZS8A 3Q3VA 5KZMB 4GAEA 4HH3C 3EWNA 4X44A 2GYUA 5K4GA 4A91A 2A88A 1LPSA 4MPRA 4UEKA 2A9PA 1H9CA 5K4HA 1T3GA 4QG7A 2VH1A 3G6KA 2FZEA 3RG2A 2EKPA 1XWWA 2GJSA 4FCWA 4OHOA 3RAFC 5JCZA 2B4YA 3UTCA 3UH0A 3PUIA 4K0RA 3WNQA 2X9VA 3P9KA 4PGFA 1N5OX 1T3ZA 3DTNA 4Y2SA 3L0SA 3WOVA 2J45A 1QNFA 1DAKA 3HGTA 4AULA 4DVGA 4BECA 1L4NA 4RKQA 4JROA 1OA0A 3R23A 1A27A 3E61A 3RWBA 2IZOA 3NOOA 2A9RA 3SQDA 1VFPA 3F46A 4S1VA 2E0IA 2TMYA 1NVFA 2GEJA 2IOFK 4LX0A 1UBCA 4I5IA 1QOPB 3JYPA 2VRCA 5TX7A 3CG0A 3ZW9A 4O4JB 5HSGA 3B6MA 4L75A 5LBTA 3NONA 4NCAA 2WZBA 2VPTA 2R751 3NFRA 1CNEA 2PMWB 2R85A 4WEQA 3KELA 5E4JA 4BFYA 1OR8A 1T2UA 3LCUA 2F1JA 2QDXA 2UYQA 3MQ4A 1Y6FA 1YZQA 4ARZA 5ITZA 4DR1B 2VT7A 1OFIA 4B4DA 1MRZA 1E1QD 4KQIA 4F4HA 4PVCA 3HUTA 1MTOA 5TF4A 3LP8A 2NYUA 5CAEA 4WGGA 1SHKA 1W4CA 2JFBA 2XE7A 2ZTUA 1FSFA 3GARA 2XGJA 2FCRA 1D6JA 3I2IA 3MBOA 4KO3S 4QRHA 5I6DA 3D8TA 5HS4A 4FW9A 3ZEAA 2E4ZA 4M2LA 2R4UA 1A9XB 1K5PA 1Q12A 4OQDA 5DMXA 1Z28A 4GICA 4K6FA 1BU8A 2I80A 2LXNA 2X4GA 3CNHA 5TS2A 3ACBA 2CD9A 2P4HX 4ZO8A 5D00A 1YQDA 1XKTA 5ALMA 1CZOA 3ZGZA 2CZQA 1QH9A 2YJZA 2HLDD 3WICA 3ZBUA 5BN3A 2YJGA 5BOSA 1QQ5A 4AKGA 3D9QX 3H8VA 5H1YA 1F0PA 3HDGA 3IUBA 4LPKA 4ZVPA 2DUUA 5B3JA 1A8SA 1WDLA 2IE0A 3MM4A 4CHTA 2VH2A 4COKA 2PSSA 3V7UA 3SMVA 4GRAA 5A2QA 2JB9A 4R3WA 4U7HA 4CMAA 4KFTA 5E2AA 1BROA 1SXHA 3V7NA 1JAIA 2FOLA 2O0MA 4URYR 2F8SA 3TBKA 3K8YA 1R00A 4ZODA 1VZ3A 4QQFA 1VPEA 3PI7A 5TVGA 5BWNA 3T5CA 2X8JA 5FIUA 1YQEA 4KAXA 4CR7A 4LXHA 3H2ZA 2QTFA 1U7OA 1GGMA 3LLSA 4OMCA 3A6JA 3SHVA 3OOYA 4AZVA 4DADA 2Z2JA 4BCCA 3QF7A 3D7SA 4O33A 5EJ7A 4X65B 3ZWBA 5AKHA 3VH1A 1DARA 1X74A 5FPYA 3GJRA 2YV2A 1LA2A 5B7NA 2IYZA 3GY0A 4FGJA 1D2HA 1YONA 2AW3A 3IHKA 3LBHA 4GM1A 4JKOA 2JAOA 3DBOB 3LPMA 1X0VA 4YQYA 2IIPA 2IZ0A 3A1TA 2GBIA 4HXEB 4W8HA 5H7XA 2GXSA 4DBLC 2PKWA 1Z5NA 4AIIA 2FZGA 1QS0B 4JDUA 3Q7IA 4JL6A 1PLLA 4WZ6A 1GG2A 4MARA 2FDXA 5EC8A 1OYWA 4B6SA 1J9GA 4YAFA 5BV1A 2JBWA 2J6HA 2QD2A 4FZJA 4MJ3A 2JLUA 3WWCA 1FTYA 5BWLA 2FN8A 4WOBA 4ALKA 4KO8A 5HTKA 3A6DA 3U4GA 5IJ9B 5AO9A 1KZHA 3GEPA 1FRQA 1PWHA 2YIMA 2PS1A 4TKZA 1SXJC 4C04A 3U7FB 4MW6A 2PRYA 1VHWA 1SUFA 3EARA 3JSXA 5FEMA 3KB6A 4O6VA 5M3BA 3VISA 1J5PA 3WLOA