1X9HA

Crystal structure of phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum in complex with fructose 6-phosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords glucose-6-phosphate isomerase
publication title Structural basis for phosphomannose isomerase activity in phosphoglucose isomerase from Pyrobaculum aerophilum: a subtle difference between distantly related enzymes.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9hA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9hA02
4DV3B 2XHZA 5IT9A 1TZCA 4B3TB 4YHHB 4JI0B 1B0ZA 1X92A 1C7QA 4U6NA 2CXOA 2UUAB 2UU9B 2PUVA 2I22A 4NXMB 1U0GA 4KHPB 1VI6A 4JI3B 4AQYB 4B3RB 2YVAA 2DECA 4DV5B 1U0EA 1HNWB 4JI6B 1IBKB 1G98A 5IWAB 4DUYB 2I2WA 3G68A 4LZJA 1T10A 2VQFB 1GZVA 1JXAA 1KOJA 3PR3A 1N33B 2O2DA 4DV7B 2DF8A 1U0FA 4OX9B 1J5EB 1IBMB 2ZJ3A 2X3YA 1TK9A 3TBFA 2XBLA 3BJZA 2CXTA 4EM6A 2VQEB 2WU8A 1NRIA 1VIVA 3I0ZA 1XMOB 2Q8NA 3KNZA 2PUTA 1N36B 1VIMA 2CXUA 3OTOB 3TRJA 1C7RA 3ETNA 4JI2B 1WIWA 2VF4X 1HNZB 2CXSA 4S12A 4DV2B 1N34B 4JI1B 4LF5B 4LF9B 5LMNB 4DV4B 4DR6B 4X65B 3Q88A 5BR8B 2O2CA 3HBAA 2ZM6B 2V4MA 3M5PA 4X64B 4JI4B 1IATA 3IFSA 1GZDA 2AMLA 3FJ1A 2CVPA 1X9IA 4LFAB 3EUAA 2UUBB 2POCA 4JV5B 2CXNA 3FF1A 1Q50A 4B3MB 3T1HB 4JI8B 1XNQB 1HM5A 2A3NA 1JEOA 4JI5B 1XNRB 2PGIA 3J7AC 1J5XA 1IRIA 3J80A 4GKKB 5LL6P 1NUHA 4TOIA 4DR3B 4B3SB 2VF5X 1JLHA 1TZBA 4AMVA 1IBLB 4LF4B 2E5LB 4DR5B 4DV0B 2F4VB 4NXNB 1HR0B 2UXBB 4LFBB 3OOJA 3UJHA 2CXPA 4JYAB 2CXRA 5LMUB 1XMQB 5A2QA 3JAMA 2UUCB 4M0DA 2E5FA 4LF7B 1X9HA 4GKJB 1HOXA 3T1YB 4JI7B 4X66B 3CVJA 1MOSA 2PUWA 1N8TA 5FLXA 1ZZGA 2UXCB 4X62B 4LF8B 4DR4B 4YY3B 1I94B 1N32B 2UXDB 2ZJ4A 1X94A 4DR2B 3JX9A 3ODPA 1M3SA 1MOQA 4IVNA 4DR1B 4DR7B 4LF6B 1VI5A 1XTBA 3BCHA 3FXAA 3QKIA 4LFCB 5I01A 3LJKA 2CXQA 3NBUA 4DV6B 3HJBA 2CB0A 3Q7IA 5BY2A 4K0KB 3FKJA 2HHHB 3SHOA 1DQRA 3J81A 1FJGB 4DUZB 3C3JA 4S1WA 4DV1B 2J6HA 1HNXB 1MORA 1JIQA
chains in the Genus database with same CATH superfamily
5CFNA 4WDQA 3IJPA 1NZDA 1TJNA 4PZYA 4Z86A 1E1RD 3ACBA 5C35A 3QVJA 3NUQA 5BYJA 5BRNA 4D1YA 1E4VA 3RS3A 3X2FA 1AMOA 3R6LA 4X54A 1H8ED 4Y7DA 5C81A 4IUDS 4PVDA 5BSKA 4OB7A 4POAA 3ZQ4A 1GSAA 5ALRA 2FZLA 2HWKA 3P9SA 1QYDA 5IM5A 1SKYE 1KI6A 3CNQS 4O29A 5GOZA 3TL3A 5K45A 2A88A 4TSFA 2X4GA 3USES 1T4CA 4BO9A 5MFZA 4EMSA 2O3SA 3OZAA 4B80A 1F3LA 4N39A 3SBEA 4C7JA 1V11A 4QDZA 1HFKA 3TD6A 3KWMA 3H2GA 1XF9A 3U7FB 3ABRB 1T9KA 4TS1A 1SG6A 1GTVA 1YQ9A 3R0ZA 1IXZA 1KYVA 1W4AA 16PKA 3DE3X 4QO8A 4CCYA 3ZJUA 4OHFA 2WPNA 3BICA 2AOUB 4NK5A 2A94A 4G24A 3ZD9A 3AM3A 2L0XA 4V1CA 1H6DA 3D8SA 4FR0A 3MJEA 1SIUA 1JEEA 5CBPA 1GCAA 3EYAA 3WIUA 2HU7A 2ASVA 4ZRDA 4YCAA 3GUCA 3T5MA 1YZHA 3ONNA 1VXOA 4BGUA 5LUAA 3KV1A 4S12A 4UXHA 4H31A 4OIFA 3MGAA 3HEAA 1NVFA 1MPXA 4ZODA 5HJ2A 3VPHA 3HMQA 1KY2A 3HXTA 5TRTA 3WRVA 3FYTA 4X64B 5D3ZA 4CT4B 2I4IA 2YOFA 4IR7A 4KN6A 1YFKA 2ACVA 2NTJA 4WN9B 1ARZA 3FLMA 3SZRA 2CDNA 1TPZA 4MYHA 3EC2A 2YC2C 2XUQA 4RF4A 5CGQB 1BKDR 2JASA 4GMFA 4XZ3A 1PDWA 5IBCA 3CRNA 5DGXA 4E5MA 3UJ8A 4ENTA 5B6IA 4JKYA 2IKSA 4P5EA 3PHBE 4M1MA 1GSOA 2H2AA 2C5GA 3CH5A 4G26A 5GONA 1NHGA 3LA6A 4QAQA 3D3WB 1K27A 1NHWA 3RVDA 3HK2A 5IC5A 3B1JA 2HA5A 3QPVA 3WQSB 1IBLB 1M2JA 3DZIA 4HPWA 4ND7A 4RA6B 4W1SA 3TTVA 1UF9A 4HAXA 4XSVA 1JFFA 5BSWA 1HYGA 2IV2X 2O7NA 1SQSA 4C7MA 3N8NA 1G8FA 2W2PA 3JATB 4W9RA 3BQNB 4QU9A 3UMBA 1I3KA 3ZYZA 521PA 4CUJA 3PFWO 2UVPA 1IOVA 1DX4A 1GQ2A 3OQ1A 4LDZA 4C87A 5AUOB 5FEMA 3QV2A 1FRVA 1QQAA 5FDFA 3FYUA 2FFHA 1CY6A 3HB9A 4BKOA 4F2DA 1N32B 2BGJA 3R5HA 2WKPA 1XXLA 5GJWC 1T8UA 4X93A 3V2IA 1C50A 2FPSA 4KIWA 4PBTA 5DM1A 3EEOA 2BGIA 5KQRA 5M5BA 1QVAA 3U0VA 5KB3A 3UJNA 1WMSA 3EUWA 4LCEA 2ZAOA 4M9QA 3F46A 3KVNA 2PUCA 4JJAA 2X8BA 1TTQB 1LLFA 4A23A 2DJIA 1BVHA 1T8RA 1E3SA 2NACA 2VK1A 2IC5A 1HH4A 1NVBA 1Z0SA 1OSNA 1DJNA 1OQAA 1PR9A 4BFWA 3E61A 2B8TA 2EZ9A 3IQIX 4Z2AA 3K4HA 1G21B 1E3TA 4JODA 3RC2A 2OCIA 2BKVA 2JBAB 2G8LA 3EDCA 4LNAA 4MMYB 4CNBA 4Z3OA 4WCDA 1VJCA 1X1EA 2Y1EA 5FF9A 4W9NC 1E1YA 3UQZA 4FE3A 3P94A 4YCDA 5T3UA 4GLOA 1YA4A 1JLLB 1KAOA 1Q11A 1RAAA 1GAJA 4KQHA 4CL2A 4LWZA 1KI2A 7MDHA 4HWGA 3N0RA 3AM5A 4E1VA 5GTDA 4F6CA 2EZTA 1X7ZB 4V02A 3JR7A 1IZYA 4DDHA 4YS6A 1J8YF 1KJNA 2Q3JA 3GH1A 3CZQA 4NL4H 2ZB3A 2IPAB 1DMSA 2I0FA 1F5NA 4WSOA 1G55A 1N5RA 1H85A 3KC2A 2KBEA 3LPLA 4LY0A 4O2AA 5EWJA 1EB9A 5IBRA 3I6ZA 3PQCA 3RK4A 1E3MA 3PZRA 3PJEA 4P82A 3I2HA 3ZI4A 2QL5A 3CX4A 2H1IA 2H4YA 2AF4C 2Q5QA 3II6X 3LKVA 4I1RA 4U39A 1OFTA 5E6SB 4Z9YA 3KEFA 1E4EB 1MQAA 2I71A 4UU7A 3T15A 3T3GA 4DTCA 1REQA 3WV4A 4K8RB 1K89A 4Y8VA 2BKAA 3V80A 4AJPA 2I8LA 1PJBA 3GHHA 1ZOIA 3MJSA 4QELA 2AXQA 2ZG6A 5JAZA 2QI9F 4CI9A 4RIIA 4AZ0B 2JARA 3NHAA 1EZ1A 1YVPA 1DFGA 1Z6ZA 4R2HA 1ZINA 3FY4A 3QSYA 3UG7A 1G1MA 2HWXA 3G8CA 4L4ZA 4U7HA 1EWVA 4IWNA 1IN7A 3K1AA 1PJ2A 4BQFA 1SXJC 2F1KA 4RGVA 2WHYA 1Q1NA 3VHRA 4P35A 5C1OA 3CNHA 3L1JA 2LKCA 2A30A 3LQ1A 2MYTA 1XRNA 3MQ4A 4FVTA 4NBUA 5DYGA 2DYKA 1D8TA 1FSZA 2JIPA 1IATA 1MV5A 1UEIA 1TMYA 3H19A 3VC2A 2TMGA 4I2VA 4BYMA 3W9BA 2E4ZA 3A4LA 3IIMA 1KYIA 1LZKA 4H1HA 4NECA 2YICA 4L4YA 3H2JA 3EAFA 1XJWA 1EGAA 2R00C 3CZAA 4D6XA 3A1VA 1E5XA 1XMVA 2PDAA 4MVJE 2H59A 3G5MA 1YJCA 2XAUA 3ED5A 3KM0A 5TQ2A 4PO9A 2B94A 1B0AA 2W6OA 5EIOA 4QGGA 2IX9A 4P4GA 3IYLW 1PDVA 2PBRA 3F3YA 3I62A 5I8PA 1U11A 5DTJA 1JQBA 2AUNA 1ZG3A 2C9CA 2QKYA 2Z1NA 3L7KA 4JY7A 4MMXB 4TSFD 5CNJA 5DOVA 4FYPA 4JJ4A 3HJRA 3DCIA 5LQSA 3SOPA 3GEIA 4J1NA 4LZLA 4N3CA 1SCUA 3KR0A 1AC5A 5E0OA 4WFQA 3N6RA 3VU0A 3ZJ5A 1IK6A 2Q5EA 3RVMA 4MVJP 2IZZA 1MRSA 3PUJA 1JIJA 4DNQA 4G36A 4FFDA 1E3EA 3QELB 4LS3A 3IHWA 4B3JA 3C24A 3DLCA 2SBTA 4B8YA 2RHRA 1NULA 4OXIA 4BGVA 2VAMA 1NQ5A 1NI4B 4MVCA 4DKJA 1HOXA 1OREA 3OETA 2CLFB 4Q7JB 5CLQA 3EQ6A 2PWPA 4RZUA 4TKVB 4F46A 4E7PA 2UXCB 1QRAA 2B1RA 2F43B 2OV8A 2VLBA 2BBOA 4PLWA 1ZGHA 4GW3A 3RIMA 3WIBA 4BX3A 4NF2A 4J7AA 2PT5A 4QYMA 4X63A 2O0JA 4OJMX 5ELXA 3AR6A 1J1IA 2ETVA 3V7WA 4BUCA 3ZHCA 4N01A 4R8RA 5IDXA 2DR2A 3C3PA 4U6SA 4HQRA 3EC7A 3AFNA 9LDTA 5ALGA 4FPXA 2ZRBA 2ZRKA 3A1UA 4F21A 3QOYA 4MYDA 2Q5HA 4OMCA 4HTAA 4GYJA 4OGGA 4HYTA 1MC4A 2QTFA 1ZN7A 3EXHA 3LPAA 3QOXA 1NWHA 4MR7A 2ZRFA 1QHFA 2X7HA 4MQEB 2CSUA 2UZ1B 2K87A 1Q1QA 4A15A 4TYYA 1RRVA 3GLTA 4YRLA 4BUZA 5J47A 5JFOA 4GICA 4DN6A 2WU4A 4PX9A 3GLUA 4QNRA 3ZWCA 4RELA 4F7DA 1B15A 2FKNA 2RB5A 3EXFA 2OENG 3DEAA 2N46A 1DKPA 3IELA 4Y0NA 2FFRA 1WM1A 3NHWA 1G42A 3SYKA 5AKIA 1UT8A 3L92A 1DTSA 4ZI3A 1NW6A 3K6JA 3A1WA 2QOEA 5TF4A 1H4VB 3ORHA 4QG3A 2F1IA 4MRMB 3IV6A 2HRZA 2I3ZA 4FWTA 3UJDA 4AU1A 4PAQA 5A7HA 1NMYA 1G8PA 2Y6UA 2X6RA 4AY5A 1B4DA 3OZTA 1Q1BA 2Z2XA 3L8EA 1SAYA 1CNMA 3W8FA 3ZDFA 1PZHA 1JDVA 3G3EA 5H16A 3S1LA 1UOEA 4KDRA 1XQVA 5JCOC 3U37A 3BH7A 1Z9BA 2QLLA 1MO4A 1VDZA 3IQDB 3VOTA 4XAQA 3L5OA 2RAVA 4JBGA 4WPGA 1T0UA 1C7RA 5EQDA 4ZJYA 1V7PC 3A3OA 4XYGA 4AF8A 2ODEA 4XDHA 1DSSG 2N3ZA 3L4JA 2HBYA 3O83A 3SHVA 4ZGBA 2C4WA 1ZVKA 1VYTA 1IZ9A 2ZPTX 3EVNA 4IDDA 1KXZA 2P9FA 1H4SA 2VJNA 4JVNA 4WZBB 1DG3A 1TO2E 3R09A 2GEDA 4YYZA 2K2WA 1AF7A 3C98A 4P4TA 3ER6A 4RETA 1HYBA 3AL2A 1QRRA 1SCIA 4HYYA 3BXXA 5EUQB 4GX0A 4H1UA 3WL4A 2ZAYA 4LHEA 3RKSA 4M0UA 2AR0A 2BFDB 3VSAA 2CBGA 5A7FA 2F9MA 5B6JA 4XPIA 5H9WA 2GJKA 4MHOA 4MV5A 1UJ6A 1T2UA 2JZCA 4C05A 5A1TA 1NUHA 2ZZKA 1H22A 7MHTA 1XRMA 3BGDA 2WNSA 3OX1A 4PX5A 5COBA 4CR6A 4RU1A 4MLZA 1NNEA 1RFGE 5M7EA 4GEKA 3PTZA 2HDWA 3S8EA 1WPXA 2A5GA 2KW5A 4KE8A 3W1VA 1T29A 1CY7A 1C9YA 1XKLA 2IIBA 1Q1GA 3B1KA 2ZI3A 3R0JA 1M6VB 1YNOA 3NOVA 5EZYA 3KQNA 4LK2A 5E3JA 3JQRA 1X1QA 4M88A 3LYLA 4HQNA 1XLTC 3ANNA 1GKUB 1OVGA 1ZMOA 3E7WA 3N59A 4ZPXA 3T5CA 1TFUA 1JIIA 2NU6A 4G8DA 5BSMA 2I6SA 1UODA 3JQ8B 1QHIA 1EA5A 1LF5A 2FHSA 4ARUA 2HEIA 1PO7A 2WG0A 4QTXA 4N76A 3VNBA 2Q41A 2JIMA 2GYYA 2XUJA 1M3SA 3GJTA 1HTTA 3RKUA 2NU7B 5JS1A 3S81A 1Y4SA 4LOIA 1T3HA 5BQ3A 4FZRA 2FP4B 1J1UA 3DONA 4UTVA 3AP2A 4U2BA 4R9VA 1D2HA 1NSTA 1J8MF 1Y3IA 1YCFA 3W77A 1RJWA 2R8EA 3RGGA 4N5IX 2VUTA 4OTZA 4G86A 3VNRA 1A4XA 2QX7A 2WLTA 3ZUPA 5AW0A 3GEPA 4MGHA 1IXRC 1JKJB 1NBAA 1YS9A 4S24A 4DLAA 5I3ZA 3QXJA 3I5YA 1JEDA 2JLQA 3RK0A 1KA9H 1ZJYA 2F00A 4ALIA 5EA2A 2D1SA 1GT6A 1QQ7A 3WB0A 4BS9A 3KJQA 2VSFA 1CETA 1W48A 4TM7A 2JLZA 2GN2A 2LNDA 3U3OA 2SNIE 4KR9A 4OHCA 3SS8A 4A8JC 1J0AA 3ROTA 4BNKA 4U0JA 1PUJA 4JYMA 4ZARA 3W9SA 3HDTA 2WZDA 1Z39A 3KB6A 5KHOC 1D2EA 2ZUUA 4BLPA 3MWLA 4PGGA 4EUEA 9GPBA 3VR6A 3T5AA 4DRZA 1IU9A 1FP4A 5CX1A 1SA0A 2ZYWX 1A2BA 3CS3A 3HB7A 3PJRA 1L4EA 3RSGA 2FMUA 2H0AA 3A7EA 5F2KA 5CCBA 2AJ8A 2I33A 2TMYA 2W8ZA 1ESCA 2X3YA 2ZAMA 3HVIA 2VK8A 2YY6A 4I4TA 4GI7A 3WLIA 2VQEB 4OQXA 2E1RA 1NUAA 4EKNB 2XCUA 5KYYA 1THZA 3KNZA 2H5LA 3RRJA 2CCGA 2ORWA 3W9YA 5EJFA 4CM9A 5SICE 4OB8A 4I6GA 4OK5A 5TE9A 3RIGA 4MRAA 3V7YA 1ZKMA 1ZNXA 3G85A 5T6BA 3ZQUA 1E9DA 4LJLA 1PFKA 4K6CA 4KTVE 2IH2A 1OFVA 4D8YA 3L7NA 3LBIA 3RHSA 1WVIA 1B8UA 1EDOA 2C2YA 5F1PA 4Z54A 3KP1A 3EN0A 1V3QE 1GT91 2G28A 4I9UA 4N0MA 1W2GA 2DSTA 3OLQA 4PG4A 4QODA 5EZQA 2C9MA 5KMGA 3WIOA 2MDTA 4DIDA 3FTDA 1M6HA 3WYGA 1KEZA 3DV0B 2XQKA 3IKMB 5F3RA 2OV2A 4INAA 3ZBTA 4KRFA 3ZGOA 1WPGA 1KYWA 4Z4CA 3ZXXA 1BW9B 3ROPA 2X5XA 1YD7A 2BFPA 4ZT7A 4TWAA 1R6XA 1FS5A 2FYTA 1RHRA 2PLRA 1QP8A 3GY0A 1AKWA 3H3JA 3VR5A 4XCXA 4D8WA 3RREA 3RNOA 2KPOA 4PLPA 1UWLA 5CDYA 3KSRA 5HJ7A 3GHYA 3ONWA 4AY4A 5IEJA 1Z36A 4KR0A 3I42A 3X1KA 1YDMA 4P2BA 3PITA 1Z0IA 2ARKA 3LUAA 4DGSA 2X9VA 4DBVO 4IIXA 1JB9A 4YRDA 4OG2A 5K3OA 2AE1A 2LZ0A 2VJAA 4UDOA 1QH1A 1H5UA 3B3QA 4DLSA 5TLSA 1XD2A 4J0JA 4JJKA 5DPMA 4EA9A 1Z82A 1QX3A 1ISFA 3FUCA 1PJSA 3DT9A 3HWWA 3PFBA 5T67A 4B7AA 5JZ9A 2QTHA 5FTJA 1A8IA 5T64A 3ZGZA 2JAUA 1YWGO 4FFSA 5JC8A 2Z9CA 3OI7A 3OT1B 4YRFA 1CDEA 1A7AA 2XWBF 5JHGB 1I4DD 1YFZA 3WGZA 3UY4A 4W8GA 4QYIB 5HQ3A 1XKTA 2A4KA 3LD9A 5DBOA 1GPYA 4ZVVA 3U62A 3V6LA 4R2WA 5A6SA 4M53A 3B9RA 2WDPA 3W3ZB 1EG2A 2ZE8A 3OLYA 5TS3A 3LXXA 2FUG6 3FUUA 1X0VA 3I1YA 4DMLA 4F6RB 1J97A 3TKAA 3CRRA 1QYCA 5EJEA 1ILWA 5L45A 2GZ2A 6GPBA 1J00A 2W90A 4TS4A 5EJ4A 2HJGA 3ZU2A 1XG5A 4PNPA 3PXAA 1ZN8A 4UDYX 3KFXA 3LUDA 5EPUA 4A16A 4TVOA 1MZPA 4LE2A 4EB8A 4D2IA 2VA9A 4PQEA 4W5WA 3E0XA 1UT5A 3REQA 5DASA 5FP0A 4MO2A 2PX2A 4UUOA 4J7XA 3PSAA 1VI6A 1TL7C 5ADVA 4A4DA 3G8BA 4DPKA 1M34A 4ASUA 1S7GA 1WAMA 2QUJA 2WYOA 4IEFB 4FD2A 4ALNA 4DVJA 2IIQA 4ZCQA 4Z6KA 1QTRA 5M04A 1EX9A 2AOVA 3O8BA 1DFHA 1QOZA 5LXTA 4X1KB 3KSUA 5F51A 4G0WA 1ZIOA 4OLFA 3TTWA 2V54A 4BP9A 5BMVB 1H3FA 2ZIAA 4EMUA 3HR7A 4RW0A 3IAUA 1IDN1 5DTQA 2ZJFA 1H0RA 3UFXA 3P71T 1GPBA 3PDIA 3PNVA 3Q7PA 2ZYIA 3AF5A 3X43A 1QHNA 3DXYA 1WF6A 3LW8A 2XUFA 4BO2A 2CFIA 3PGA1 3RVSA 2OBBA 3NBXX 2FMTA 4IJKA 2XITA 4QUHA 3KZVA 2OORA 3GZ4A 3WQBA 1H0HA 3ETNA 4C1NA 1SUAA 1EKXA 1TM3E 1Z2EA 3PU6A 4EI9A 4MPPA 4YBZA 2JHPA 2H65A 1LBEA 3D4PA 4UFPA 1MFZA 3ZV4A 4N82A 4R2IA 3ZZ1A 3BF8A 3HYTA 2EFEB 3ETCA 1X9IA 2K4MA 3KPJA 4RHTA 1W19A 3JW8A 1OBVA 4PHTA 3WSWA 1G4HA 2B1IA 2PU7A 4EG8A 1M73E 3MWDB 4E2FA 3VR6D 1T8SA 3M81A 3VC7A 1UJNA 4ROTA 5BV8A 3QPCA 2XKJE 5K0SA 5DWQA 2QV7A 1KMHB 2P90A 4GLFA 5K1ZA 1EDEA 621PA 1TC2A 3DS8A 5CT9A 4GNRA 3OWHA 1V3UA 2E5LB 4XIIA 3FNBA 4IQ0A 4KDEA 1OXTA 2C4TA 2HH9A 3TJRA 4AW9A 2OSBA 2O4UX 1UOQA 1K92A 5G0WA 4EJ2A 1I01A 4Z3DA 2IF2A 2GEUA 4YJHA 5A4FS 5DXAA 5LUBA 2GPYA 2OSVA 2V1XA 1RI2A 1VBFA 2VUUA 1H1DA 5CIQA 3WSVA 4FSXA 4CM9D 3MRVA 3SR0A 4IWXA 1WQ1R 1UIMA 1VLQA 2AEEA 4JBNA 2C8JA 1E3WB 2ONKA 3H75A 3KXDA 4QPJC 1XHLA 4BP3A 3CLSC 4ZREA 4TLDA 4LV8B 5E3IA 4ZO9A 3CT6A 2ZI6A 3Q2KA 4M0KA 1SXHA 1N0IA 4A2QA 2RIRA 3N5KA 2OHOA 1FDTA 1LSJA 4UHEA 4C6SA 2FR8A 3C7AA 1CX9B 2ZJZA 4C2TA 1T3GA 4ZQCB 1JZTA 2IL1A 8GPBA 1NPDA 1X8KA 4IMPA 3KQUA 1E20A 2B34A 2C58A 2WNHA 3OCVA 1DV2A 2AZDA 1WA5A 2PFKA 2VDWA 3I37X 2DWQA 4I19A 3S7TA 3SU8A 2ODAA 3VR5D 4BVLA 3HVRA 3G2LA 1T8PA 3EXIA 2D3TA 2FX3A 1RRGA 3L9WA 5IKXA 1A98A 1Z7BA 5CK4A 1YZKA 3LCJA 4TV9B 3WFJA 5B2EA 1NVVQ 4OJKA 4BBZA 2Z5GA 2X42A 2V9ZA 4DAEA 2H1LA 1SCAA 1K4MA 2PWYA 3DH0A 5AJZA 2VBCA 2CVOA 4WZAA 2FY8A 4XJTA 3V4SA 4YV7A 1VLZA 3IILA 2D5LA 3NBMA 1Y0BA 3NTVA 4MWOA 5KWSA 4UBNA 3AI2A 5EHZA 1TU4A 2VSNA 1R9NA 1Z07A 1AO3A 2C5LA 3EZYA 3F5MA 4XASA 2J3DA 1R50A 1N2XA 2YZ2A 4HWTA 5H83A 3RUEA 3W6PA 1WBJB 3AY6A 4NNPA 5L7YA 2PUBA 4PLVA 1QHSA 2JJYA 4HEA6 1V6CA 4ZQEA 4BJ6A 1I4WA 1UMKA 3O9MA 4RABA 5K0JA 4D9KA 2PRJA 5J2TB 2ZIWB 1GN9A 2P30A 4P6VF 5EMNA 5TY0A 1SVMA 1RC0A 1D2AA 3FAKA 4YMGA 4XDZA 1ZGBA 3GEEA 3MXTA 1ACLA 2CYBA 3OLVA 1YB6A 2VQ3A 2XRMA 5D3MB 5FOVA 2CEKA 3QWIA 2NXCA 3RRXA 3HCCA 1N0WA 3ZWOA 1FU8A 2EDCA 2Q3EA 2GXAA 4BMSA 1XYVA 1R4NA 4JVSB 1I4OA 1RADA 2C2WA 3KVYA 1B74A 2ADOA 3G5LA 4GMKA 1OR8A 1X80A 1SVLA 4J9UE 3KD2A 2YYSA 1SOWA 1X1SA 3E5MA 1IQPA 1E5VA 4PO8A 1YK1A 2B9EA 2VP5A 1A9PA 2QQGA 4PLHA 4UD6A 5I8ZA 1V43A 3UB2A 5C8DA 2R11A 2G1PA 3A04A 5KOIA 3B8EA 4ZAFA 3HDJA 1KJYA 1OYVA 3SS7X 3KSBC 2G5CA 2P5YA 4NAHA 2D7CA 2HYDA 2W37A 4RTKA 1H2XA 1SWWA 2IK8A 2RAUA 4X85A 3KXIA 4ASUD 2ZETA 8OHMA 2LKDA 4IF4A 3KKMA 2Z4TA 2PD6A 3RQSA 1IBRA 3L8FA 4RNDB 4LOLA 2PRKA 2IEYA 3GRAA 2O0MA 1SFRA 1N9KA 3BL5A 4HC4A 3AU9A 5DSZA 5BMOA 2IW1A 3C6BA 4KQWA 2W93A 2J67A 3QEMB 4G37A 4HZUA 3EVTA 4IRMA 1EVJA 3RUDA 3UH0A 3W8NA 3HVUA 4LRXA 1K3FA 3IBFA 1JU3A 5T4HA 3WKCA 2ZRPA 1HL3A 2IHJA 2RGNC 1BS9A 4JJFA 5ENDA 4LZAA 4IXNA 4YRBA 5SYAA 1XUOA 3TLEA 3ON5A 2EKDA 3PL1A 1ISHA 5K0BA 4C6RA 4E94A 1K1EA 3AEZA 3R8XA 1POWA 4M1TA 4QREA 2ZB2A 4KWIA 4J0IA 2Z6VA 4RIHA 3D6AA 4HEHA 1DIGA 4R8VA 4G0XA 1KRWA 5ALJA 1ICEA 3HDQA 3OZVA 2YINC 1JJBA 1PTJA 2AJLI 2CWWA 2N75A 3SOZA 3GLIA 1XVAA 2ZJBA 1DOHA 2JLSA 3ERCA 3UXEA 2JH8A 5AKJA 5HZGA 3Q4GA 2HDNB 1P1KA 2ZBVA 4N5DA 5KAMA 4B9AA 3R0IA 5KWVA 2WVHA 5I7SA 4HLUA 4B2PA 1BS2A 2IH4A 2HHHB 3FUTA 3GQBA 4EA8A 1O08A 1LPNA 4IKEA 5AK6A 2Q3BA 3DHVA 4DV1B 1OT5A 2PBZA 2VJMB 1RCUA 2JGFA 1YZ3A 4HFRA 5ALUA 2BGUA 3RFTA 4EL5A 4WADA 4L5AA 5BSGA 1VKZA 1O0BA 3VPBA 2O8CA 5BYKA 5AM4A 2IEZA 3WO1A 1QKKA 2GJSA 2IDJA 3T35A 2XD4A 1V7ZA 4YHHB 3U4QB 3ZZUA 1DT5A 1UFKA 4ZD6A 4RTMA 3QYFA 2DY0A 3KJXA 4PBRA 3FMIA 2H63A 2M6SA 3KKLA 2WWVD 4PG5A 4ARZA 4AYTA 1X7DA 3WB9A 4BAZA 2E55A 1YU9A 5ICSA 4F2HA 3I8SA 2J5BA 3I5MA 1ORHA 3G13A 3K0AA 1W30A 4ZYTA 3LCMA 4MRVA 1XMIA 2CFSA 2WSLA 4PRZA 2XGMA 3WIDA 1HX7A 4P33A 2CNNA 3DKVA 4J76A 3V4OA 1AO0A 2XB2A 4AQDA 3NWPA 2DF8A 3P5BA 5I5EA 4RXMA 3DBRA 4MV8A 1WZUA 4OFZA 1HDCA 2H1OA 1GUAA 3HNPA 3LTNC 1CVIA 3VTKA 3LWZA 4HN2A 4I66A 2JKVA 1ZVMA 5FL3A 4WINA 5C5EA 1DTWB 2FWMX 5A05A 5BN4B 4CF4A 1TE2A 1EDDA 3CV3A 3OZXA 2W43A 2XIJA 4ZAXA 3X1WA 4OP3A 3IUMA 5FJJA 4ZGWA 1ZBDA 5EHNA 3D8BA 2CJYA 1SQ0A 1CWUA 1KAHA 1NXVA 4ENRA 1Y33E 5EJGA 3V8VA 1SUPA 3O8QA 4WWHA 4ODIA 3TTSA 3USCS 5AWFC 2NXEA 721PA 4AVYA 3IAS6 3ZDAA 3ILXA 4Q3EA 4KQMA 3HE3A 3QE0A 5DYYA 4CKWB 1BO6A 2FW9A 4PNHA 3N8DA 1ADJA 1JT9A 4FDLA 4QT0A 3TSYA 5THXA 1ZAYA 4L4SA 1U7HA 3PGLA 3H1TA 1NV9A 2FPPB 4RIGA 5ES4B 3U7RA 2BKUA 2WF5A 3WGOA 4RX1A 4C0QC 1YRWA 3ET4A 1Z45A 1KDZA 1VGQA 1IRIA 1N5KA 1W5BA 2VT6A 3P5SA 4KGDA 5FO1A 3ZNNA 3JASA 3W90A 3TSWA 1JTVA 3JCZA 3DHWC 2KYRA 1DXHA 1E7QA 4UAUA 2ZXFA 2NTEA 1OASA 2V3VA 3DYIA 4NEHB 5FPTA 5KQSA 4J6FA 1EWYA 5E0KB 2UAGA 2V03A 3RIHA 3PUHA 3CTMA 1T4MA 4CCWA 3V1MA 1Z7WA 2DERA 2OHIA 3IOYA 3ZOKA 1MR3F 4GBGA 4QOFA 1JWAB 1V8OA 2B99A 3C3WA 3GLFA 3KLNA 3G0OA 3NAGA 4R1SA 3STVA 3W2IA 1GSHA 2HV9A 1W4ZA 1BRMA 2F3QA 1N3IA 4AKEA 5B30A 2R1TB 2J9YB 2PYZA 4HYEA 1MX3A 2AFHA 3JWEA 4UREA 4EY3A 2QBYA 2E4AA 1GG5A 4XLLA 2IODA 4BO3A 1G8GA 2PWBA 4ESHA 1JMKC 1U9IC 1SBNE 2I34A 5LQDA 3GRZA 3UATA 4A8HA 1ZC3A 2NUPA 4ZI2A 4D8TA 5HYVA 4MV1A 2ZCJA 1P80A 5FTWA 4I14A 2NSHA 1K2VN 4ND5A 1E1DA 3CLRC 2XCTB 1EFPA 1JIUA 1S01A 2IOYA 3FUXA 1FRQA 1R2QA 3GRVA 3KG2A 5TPWA 2AC2A 2C9BA 4EARA 1LBQA 3P4YA 3T3IA 5U1PA 4A1OA 4CMBA 3FDZA 2AUTA 2BHLA 4ZMBA 2NAPA 1W1UA 2QQFA 3BFJA 5F7JA 3WL3A 3ANXA 4IQ4A 3AEUB 4KCGA 3T1VA 4B3CA 1NBWB 2QTBA 4L72A 4YJ3B 2P68A 3RLIA 4KQ6A 1X1DA 3NU1A 4J0GA 5IS2A 2J30A 4BMXA 1OTHA 1YE3A 1NBME 2YASA 2JIDA 2XTZA 3DULA 3T7RA 1TUBA 3ZZ0A 1KSJA 5CYGA 3L05A 2YMMA 1ESMA 3D6HA 4F12A 1WHTB 4RZ2A 4YRNA 5JECA 4W1PA 5KCMA 1E99A 4FCWA 3BMQB 1AU9A 2W2XA 4BZPA 1Z7EA 4MKIA 4MI6A 4ZV9A 1GO2A 3R6TA 2EGHA 3BJEA 3HPQA 4BQSA 1U31A 1PSWA 4TL6A 5FUXA 3RTCA 1TVMA 3JPWA 1OH6A 1D2RA 1X2BA 1MA3A 1V1MB 4C7KA 5AVOA 1DBRA 3BM5A 1QZUA 2WAXA 2DUMA 1E2BA 1SPXA 1HT3A 2Q9AA 4FILA 4EHHA 1W85B 4KJZA 3SFVA 5CG2A 4CG0A 1U1GA 4ZEVA 4XD7A 3IR7A 4ZT3A 4G5SA 3QX3A 3CONA 1J99A 3CN7A 4ZU1X 1P5RA 2XMRA 3A6JA 4PVCA 1F2TA 2E1PA 3Q3HA 1B16A 2AZTA 4NYJR 3V4LA 4YT8A 1DIOB 1KERA 1OW3B 3PNYA 3KYCA 3QXXA 3K0FA 3GEGA 4GM0A 4NNJA 3VHLB 3GRPA 4QEDA 1M2EA 1ZH6A 2TRSB 1N2JA 3U44B 1B6GA 4X65B 2G1AA 2Q0XA 3PPWA 3O8OA 1NW4A 5FT9A 3CY6A 3RO7A 4IXMA 4QTUB 1TT7A 1Y9JA 3FJ1A 1XZHA 3KQWA 1F12A 4JHLA 4COOA 2FLWA 4RADA 5KYVA 4YLYA 4DE5A 2OUKA 2VKQA 3U48A 4DG5A 4ERXA 1W4CA 1Z2PX 1TZJA 4L0QA 5LBIA 1L9XA 1Z33A 4RVOA 3GLVA 4JH0A 1B8OA 3ZZTA 3DZFA 2V58A 4R81A 5DNEA 1CSEE 4O8CA 1H1LA 5F9HA 3RHFA 2EJBA 1E2NA 3RTAA 3RIXA 3SM9A 4F92B 4RH1A 4B3SB 1KU0A 1ZO8A 5AI0A 2VH2A 1Y9DA 3PDJA 1CQIA 2H5JA 4TWIA 1HQDA 4G81A 4MCAA 3ZR4B 4QPNA 4JN6B 4EKGA 4F5DA 2GN9A 3WTBA 5F76A 3AUTA 4CM4B 4URXR 1BCSA 2UXBB 5HE8A 4BVKA 1EX6A 1OC2A 3UJPA 3OSZA 3R3SA 4JLVA 3S2ZA 3U7QB 2F55A 2O7RA 2MT9A 1XMQB 1F8XA 4I08A 2YYYA 1W4RA 2PZMA 2XNCA 1NVXQ 4ZO4A 3QY0A 1BJKA 1KZ4A 4Y2HA 1ZR4A 5JH7B 2PRIA 3N53A 4HDAA 5EY5B 4YAWA 4REQB 2IYYA 2BD0A 5G4KB 5C8VA 4DR2B 1ECPA 4H77A 2IELA 1CUHA 2GCEA 2Q1TA 3THRA 4AJOA 1Z6QA 4CLOB 3UPUA 5C1BA 3NVKI 4OF4A 2Y67A 5C1DA 3CH6A 3HR8A 2XHEA 5EGNA 4X1IA 4C7OB 1T5HX 1VG1A 2XGSA 3ZHRA 1KZGB 5TC4A 1JAHA 3MIZA 1ZX1A 4WL0A 2O2HA 5D7NA 3WMWA 4KH1A 2Q6IA 2WAMA 1I3NA 4I1VA 4YASA 4DS3A 4ZCMA 2WR8A 2JVKA 4JOQA 5HIIA 2WTUA 2Z0MA 3K70C 4KUHA 5KJCA 3EHEA 2ZBDA 4JFAA 4ZCPA 1PR0A 4UM9D 5JQGB 2NO1A 1B0ZA 1KHHA 4R41A 2AOTA 2XVZA 4XD2A 4UHKA 4E5DA 4RMHA 1W94A 5ALVA 5DHUA 1DJMA 5B1IA 3USZA 1BWPA 1Q91A 4YRGA 3EAQA 1CZOA 4ND2A 4GHWA 1RBZA 1UEJA 5I5GA 2Y1OA 2GEBA 3RSQA 2GAOA 1SUEA 1XCGB 2O1XA 2ZYTX 3D6FA 5EJ2A 4OHYA 3E5HA 2GUWA 1IY9A 4BE7B 4UMDA 2J33A 5ES3A 1UMCA 3HB4X 1WMAA 3JQQA 2JRLA 3VRHA 2DXIA 4K9RA 1GTMA 3ML1A 3IT1A 1J22A 4ZWNA 1H0SA 5CBKA 2QYHA 3P9CA 2Z04A 4CMCA 2W6NA 4P5DA 1DQSA 3WLKX 2J48A 4NULA 3D7MA 1FNNA 3AK4A 2PQ0A 5JAMA 2BEUB 1R6AA 1U1DA 4XW2A 2YJNA 1OGIA 3GGGA 4XLZA 4Y9TA 3UXHA 4EMTA 8LDHA 5BN5B 3WBFA 1T9ZA 5IXYA 4JI2B 1I2MA 2NUBA 2DEUA 1E6LA 2C9YA 5DM60 3LFHA 2XB4A 1W88B 1RAFA 2O2JA 2VSYA 3K5HA 4YYEA 3JQBA 3WO0A 2PNFA 1SVNA 3AF4A 2A3RA 1N6LA 3NOXA 1ECCA 3SIWA 3ANTA 3VFDA 4E4RA 2R7LA 1F8YA 1DZ3A 2O9JA 3F6EX 3GD5A 2CNBA 4M99A 5KTKA 1GUFA 4YQEA 3W5AA 4Q02A 3WNZA 1PQ4A 1DBPA 1SC1A 3PWZA 1F6WA 1VJ1A 2A3NA 2Z3WA 1N77A 1TTTA 1Z0AA 2I67A 5KYXA 1P0QA 3GCZA 1TTPB 1X7XB 4LMPA 2B5OA 5IDWA 1T2CA 4IUYA 1M6WA 4K2HA 5L9AA 4PG7A 1L5MA 2JLRA 1D9XA 4AAYA 5DNCA 3LSYA 1KYZA 3AFOA 4TLLB 1IHOA 2O3TA 4CKBA 3WYEA 3ZWQA 4B3DA 1GGJA 3IDAA 3U3JA 4BWYA 3RYHA 3LT4A 1CP3A 3FBGA 2CMKA 3QHAA 4TMZA 1I7SB 4OI4A 1HDYA 3CVWA 2ZRJA 1EUZA 3JVDA 3A1NA 4QIHA 3QFRA 4XD7D 5BYBA 3OO1A 4E2ZA 3PQ6A 3IVGA 5BWNA 2SCUA 3Q7QA 4LSWA 1QRSA 4GKJB 3H2IA 5BUQA 1FTSA 2GLXA 4H1WA 2ZBGA 4LJ9A 1HY3A 1HG0A 1NJFA 3U5TA 4FHEA 3IODA 4DSUA 2QPLA 3QKRB 1MT3A 1D2CA 1PR2A 2IHKA 4HX2A 4UUPA 4AURA 3MJDA 5HKBA 3EMVA 3HL4A 5HILA 5DV9A 1TT5B 4LNUB 1VMAA 2BGTA 4IILA 3VNUA 3V1LA 5BV7A 1NVWQ 1UL1X 3NEPX 3QTLA 4DSZA 3UT0A 4X00A 2I4LA 5AVSA 1CU1A 4XWGA 1PRYA 3S3TA 1LGYA 1N3YA 2BFBB 1LEHA 2L42A 2Q4DA 2X1MA 3I1JA 1Q3HA 2Z83A 5KNBA 2PJZA 3EIUA 2JAPA 3M0EA 5IAGA 1LRKA 1ZMRA 5A06A 2SKDA 3DBLA 3NP7A 4MNTA 1INLA 2C7PA 4FZJA 1PGJA 2HK9A 3HYRA 5A2GA 2YIDA 1Y9AA 4H7IA 2B8NA 3BWMA 1H9AA 3RC8A 4HN4B 1F14A 4L8GA 2MINA 3L2OB 1Y6ZA 3EGWA 4B6JA 4F91B 3ABZA 3V7FA 1OLXB 4NCBA 1W2HA 1WDMA 2WUEA 3K31A 1ADFA 1QGAA 2A84A 1RPTA 2FEWB 4FFMA 5KI6A 3TM4A 2PV7A 3BIOA 4K28A 3VAYA 4E2YA 5JNTA 1VCMA 3EQ8A 2AG8A 1XXHE 9ATCA 3O93A 4KDFA 4NMWA 4P54A 1ZI8A 2HLPA 2ZSUA 4FXPA 4NIMA 5H3LA 4EY7A 2WUDA 1NDUA 4LXIA 2FHPA 1L5HB 2EGGA 3FFAA 2PZKA 4ZOQI 5EKSA 4WN3A 1OBHA 2XH8A 5ALLA 1BCRA 1NPTO 4ZZ2A 5IUKC 3G2JA 3RYIA 1YE8A 4RLHA 5C4IA 4OOEA 5I7WA 2EL7A 1FNMA 2PYDA 3L8HA 4LGYA 4CM3A 4BXOB 1YB7A 2D0OB 1U3FA 3RTBA 1ZD2P 1G9SA 4JJIA 2LPMA 2VP2A 3TN7A 3ACCA 2HGSA 1ZDMA 1Y4ZA 4KN5A 1OA1A 2NXJA 3RS2A 3NTRA 4D4KA 4HDNB 4BNLA 4LXGA 2CJFA 1NQWA 1KZ6A 5FULA 3TEMA 2H9AA 2WSSA 2DTXA 2GD1O 2ZWIA 3IB6A 5JV5A 5KOJB 1CLUA 4ZJUA 3T5BA 3M9LA 1H6AA 2IEBA 3ILHA 4NAUA 2EJCA 1Z62A 2NT4A 1ZNYA 2C2HA 2PVPA 2PL3A 3OPMA 4IJWA 3AI3A 3FGZA 4NHEA 3LX4A 3SY8A 5A3RA 1JSCA 4DHWA 5IZ4A 3HWSA 1ESEA 1Q6YA 4NBSA 4S1OA 1KJ8A 4LRQA 3L7AA 3PNSA 4ER0A 5KKNB 3AVWA 4KREA 5E7JA 4JEUA 4LZOA 2BEVB 2X2PA 5CT6A 3AFMA 3FHLA 1MO2A 4YCMA 4LQ4A 1WBDA 3EISA 1U5CA 4TN5A 3CA8A 1U99A 1WDLA 2AXNA 3NLLA 1DJPA 1MT0A 3KUCA 5D87A 1WDKA 4K81B 2X5OA 2OTCA 3TLMA 4B8WA 4QGAA 4DB2A 2G17A 2NU8A 1WZIA 3OQJA 4WD3A 1J7KA 1S8AA 2JFUA 2FRXA 2ZB8A 2PCJA 4N1AA 1W7AA 2C3UA 3HHEA 1Z63A 3OICA 2PGNA 2R8PA 2A7QA 5AK5A 3WIVA 3U9SA 4DC1A 5B6PA 5AXBA 2F8TA 1Y42X 5PGMA 1US8A 4LYDA 4TQ9A 1R9GA 4QEKA 3C8DA 3IXMA 2VYNA 3PI7A 1Y5IA 2JK0A 2Q0HA 1EE1A 4OFWA 3UUGA 3S4YA 2YHIB 1NVMB 2Q8PA 4RAQA 4E1AA 2HCBA 5ALEA 3IUQA 5IFLA 1Y6FA 1EVLA 1N8TA 7ADHA 1RMYA 1USWA 2BHSA 3DOCA 3I73A 1OD6A 2UXDB 1NBOA 1X1BA 5FYQA 2C99A 1XCJA 4Q3NA 2CMDA 1FNDA 4JIGA 3OUTA 3EA0A 4JJ6A 3HL0A 5BMVF 3DFKA 3KJGA 3KBOA 1QIIA 3U4MA 1JHMA 2ZBPA 4A6DA 3LDAA 4MICA 5GM1A 1L8OA 3BH6A 4LQDA 2CHGA 1J42A 4M1ZA 4RD1A 4DQXA 4D8XA 4N49A 4PYLA 3THXB 5CW1A 1OWLA 3HLYA 3BRCA 4FN5A 3WGNA 4EJSB 4AUMA 4J03A 1SCDA 1Z4QA 4G85A 3GUUA 2B1JA 3M6MD 1IZ7A 1KVRA 2PPVA 1XA0A 2TSYB 3BB3A 5EIBC 2UYCA 1CT9A 3CSSA 2GN0A 1K66A 1R0CA 3AJ8A 4OFBA 1I14A 4PYOA 2WWFA 1CQJB 5GMOA 1A9XB 2ZVPX 3QLUA 3G2QA 2OD9A 5FQOA 1CQXA 5EE0A 1KFBB 1K6MA 1YVRA 2DLNA 4AI6A 2FUG1 2H51A 4LDQA 2ZSKA 1YBVA 4BCBA 4YQFA 2NYAA 1HYHA 3A9TA 4GI2A 3NR2A 3Q6NA 4Y2VA 2XMDA 2I9KA 1QFYA 2PXCA 2O07A 1E9FA 2OMEA 4LZZA 2BKEA 3RM3A 1SHLA 5FTLA 1M54A 3I6BA 3DGEC 4NV0A 1IE3A 4UW9A 2PX8A 4ZDWA 2IPXA 1JDPA 1Z0FA 3HXLA 4F3CA 2AFIB 4MR8B 4IMRA 4FMPA 1JAZA 4IOMA 2B92A 4PC3A 2Y0DA 3JRWA 3FZNA 3GG2A 3DDOA 3DPUA 3JYOA 4B44A 4C0AC 2I4RA 3I0ZA 2Z8ZA 1HV8A 1ZJ5A 3L1IA 4HNGA 3OOYA 1MO3A 1QIMA 3AEQB 2TS1A 4YMUA 1P9LA 5UKDA 3RVQA 1CXZA 4QGFA 3LFUA 4JXKA 5CXUA 3KDPA 2CWDA 4WN9A 2G09A 4X5OA 5D01A 5J2UB 4R7TA 5KNBD 2JW5A 2R0QC 3JD2A 4LRUA 5J5VA 5C8YA 4KBGA 3LIPA 1JXQA 1J0BA 5IHPA 3AG6A 3HBAA 1ZCFA 2PRYA 2ANCA 3EXEA 3GN2A 4FZVA 4P81A 4U1RA 4J91A 1TYCA 2JI4A 1KPHA 3QKTA 4XIFA 3D3WA 5C34B 3SJCA 1FDVA 3EF0A 2UUBB 2P62A 2I3DA 3DVAA 1UJ2A 4A2WA 3AHCA 3JD4A 4P53A 3DKKA 2HWUA 3KVVA 5AOCA 4NI5A 2VHTA 5DW0A 4CV3A 5H68A 3LGAA 4JYBA 1CDZA 3K09C 3U9LA 1I5EA 3FCUB 4XRRA 3DMTC 2V8OA 1DKUA 3H8JA 3RF6A 1C4OA 1SBCA 1OLUB 3T1QA 2QSZA 3I2FA 4PAWA 4DR3B 1AS3A 1UMDA 1MLDA 3JATA 4ZHQB 2C7QA 4LTMA 4P2GA 4CG3A 1Z29A 2VTDA 1YRLA 3EGVA 2C29D 1ADBA 1UWCA 2YRXA 1E1NA 2DPHA 3DJYA 2FJ0A 4PPFA 3IVRA 4TV9F 1VHLA 4Y2UA 5L53A 3NO4A 1ZD1A 3ESAA 3BIWA 3F4BA 4DRYA 1EUDB 1UDCA 4X20A 3A1SA 4EYEA 2NOAA 3ROKA 1E5QA 2BCJQ 3MTAA 4GH5A 1KZ1A 4L4UA 3EPLA 4LOJA 2DH6A 3OM0A 1QR2A 4HB3A 5H3HA 2WSSD 1CFZA 1I36A 2YIVX 3LPNA 1YH3A 5FOTA 1P4SA 4OMUA 2BH2A 1G5TA 2ODNA 3TXYA 1G21A 2P5SA 4MGYR 1W5AA 4L2IA 3BWEA 4KH0A 4E5VA 2BLLA 2IS6A 3VZCA 1NJ1A 1IULA 2QD4A 1Z16A 3L7CA 3G88A 2PLWA 4JLMA 5BSRA 5K0TA 3GOQA 2HIHA 2BT4A 5J2TF 1QG4A 1JLLA 2C1ZA 3AW8A 4FCTA 1AA6A 1KK3A 3QVXA 3C3YA 2E2WA 2XSZA 1QDUA 1COZA 3ENVA 5J40A 2BM9A 4LBYA 3TS1A 4GC9A 1L5QA 4C7VA 5LOVA 1MVOA 3SBOA 3DPIA 1A50B 1L0BA 3P7MA 4K3VA 2EWWA 2WDZA 1FRNA 3H2SA 1KGDA 1NVTA 3AZQA 1U3DA 2BFFA 2ZEJA 4J7UA 1F8UA 5F52A 4B3TB 2KB0A 3OPYI 4XCQA 1XGKA 1Q83A 3D9QX 2GGSA 3BJMA 5E6SA 2VTEA 2A0YA 1WUHS 2ZULA 3TAHA 4FHCA 1OXVA 1DC3A 4TUYB 1QWOA 1J56A 4LMAA 4IDEA 3ZV5A 2INGX 3PNPA 4EFKA 2VYND 3R5TA 1R0LA 1D04A 1CIPA 5FPPA 1W5FA 3R6DA 3T5TA 1II9A 3D2CA 5NLLA 3RGWS 4AZ0A 1E98A 2Y0BA 4I36A 2FX2A 4O4JB 5EP3A 5ILOA 2D6FA 3UTCA 4US0R 1GYPA 3F8TA 4RD6A 4QA9A 4TSRA 3ESDA 3MELA 1G3QA 4YAKA 3KUXA 3KZMA 1U7PA 1M6NA 3TBKA 3AGQA 3OWXA 4Q4JB 3ZLTA 3IDFA 3JTEA 1ZL0A 2V0CA 3QPUA 1UMBB 4EGCB 3URKA 3OPVA 1CW2B 1PFQA 1QH0A 2I6XA 2GRJA 5CD9A 2W6PA 1XD8A 4P4LA 3U4HA 5K2OA 4GPZA 3B48A 4IJ5A 1EBFA 3L1KA 4EQ6B 3HJHA 2RD2A 2OLKA 1ORIA 4REMA 4OBWA 1CPYA 2RC6A 2EBHX 2AYXA 1ZOPA 2QG4A 3SBXA 2WHPB 2FEPA 3LP6A 1KKMA 5CPFA 1DKNA 3PA8A 6YASA 5EJIA 1Z17A 3UZUA 1VZ3A 4DPLA 4MHTA 3VH1A 1I1HA 2Q3DA 4POOA 1DEHA 3Q7TA 4GDFA 4X9XA 2P9BA 4GVLA 1C7EA 3NBKA 3WMXA 3IQZA 4WQMA 3ZNQA 3RG8A 3ASVA 2P9JA 1UBCA 3AKCA 3RHZA 4D3DA 2C42A 1C0LA 3C97A 3LWNA 4BZZA 4CT0A 4BOYA 1DAKA 3RS0A 4J0DA 5FUBA 3KAPA 3MMXA 3NBZC 2X0DA 1QGOA 1Z0UA 1ZXXA 3EARA 2CT8A 2H57A 1K7YA 2ZIEA 4MAMA 4EW1A 4B7UA 3NGLA 4DLRA 5EJ8A 3K1ZA 2C97A 4CIDA 4HGZA 4B3HA 5KYKA 4MVJI 4W9MC 1K7SN 3GAAA 4W8OA 4F0JA 1KTVA 3CEAA 4Q93A 5A4DA 4N8DA 2C9DA 3CZRA 3N2NA 1Z5GA 3SEAA 4DIEA 3IIKA 1ZNWA 2XWJI 3A4TA 1S1MA 1GOTA 1KETA 2JA2A 3O03A 3AVPA 3ZCXA 3WA7A 1W29A 4DMGA 3BQMB 2G88A 3F5DA 4Q48A 1LBHA 2R44A 4R8KA 4EPRA 4PHFA 2V96A 1SXJE 3IKJA 1P9RA 3UK7A 1ND5A 5FADA 2AK3A 2NVUA 2FXVA 1KE1A 1U6KA 2PKQO 1E7SA 2R65A 1Q7CA 3IA2A 4CEJB 2QLFA 2OVFA 1H66A 2JI7A 4NBLA 4DNXA 3VYTB 5AM3A 5FWNA 3TEJA 3BMCB 1CZHA 1KKUA 2ZQZA 3OF2A 3MN1A 3E7XA 2BEJA 3GFSA 3P2YA 3PGVA 4NABA 4QDOA 2DQ4A 1MORA 2ZWVA 2B7LA 4KFCA 5JDIC 4YCBA 5CG1A 1HL7A 1M8JA 5AW3A 4F96A 5JMOA 4HP8A 5LLDA 1GJRA 2WFZA 3INRA 4J0QA 5IJZA 1G8KA 1KMMA 3M33A 1RYHA 2XNHA 4FW8A 1IAVA 5KVCA 1KWGA 1A5AB 1OTXA 4YO8A 1YQXA 2ZRCA 3DOHA 4B71A 2EFCB 4BVJA 3A32A 5D5QA 1ZW6A 5BW5A 4MRMA 1OWNA 3QVUA 1P4JA 1YJXA 2QS9A 4PF1A 2JAQA 3BRWA 2ZYUX 4KXNA 2H06A 3ZG6A 1U0EA 3IT2A 4DV5B 4ZV4A 1YIAA 3ZDEA 4C5BA 4RV5A 2BUCA 1F0YA 5F5XA 1N3BA 4UMVA 1Z0JA 1YBMA 1JYEA 4YMWA 4BV9A 1YZGA 2FI1A 3FBWA 1QQ5A 1L3IA 3V8EA 1H42A 2P7IA 5IT5A 4UTRA 1MG0A 4FB5A 1LPBB 1Y1LA 2XBLA 3EDOA 5E1OA 1IQUA 2ZOSA 3BMNB 4QTTB 2F64A 2O19A 1GTZA 3RUFA 3SJAA 1QXSA 1WB4A 3EW9A 3NH6A 1VHWA 2V55B 2GK6A 1EXMA 3ENNA 2QN6A 2XSZD 4WZBA 2ZRMA 2G5GX 4KI0A 4XM2A 4QJ5A 3DBHA 3L8DA 3H5AA 1E9RA 3CRW1 3AJEA 1U8FO 3E7FA 2VYVA 5BSVA 1KP9A 4KX5A 5GZ3A 4NBNA 2WJHA 1V25A 2YJ3A 4MULA 4MRSA 1ZYUA 2EZUA 2ZUEA 3NH9A 1XP8A 2QM8A 2BFDA 3FMGA 3FB4A 3M4NA 4FGWA 4GOKA 4HXEB 1NXOA 3K7EA 4J4HA 1GCGA 1OZAA 2RHTA 4IIFA 4Z1MA 1EZZA 4ZMRA 2CVFA 2NSDA 3PV0A 5DGDA 2WUVA 4GRDA 3HV0A 5AKKA 1E58A 1QANA 1M1ZA 5JYBA 3WKEA 1AV7A 2QRVB 2E18A 1B43A 4HDKA 3ZWPA 2IXFA 2AN4A 5AI8A 4HTFA 3IVCA 4HXGA 3MYYA 1N6IA 2MSNA 3KXLA 5ESWA 1EXDA 1M1YB 3FOBA 2ZROA 3LS2A 2ID7A 3A4VA 5E7QA 2DQKA 3S2UA 3TVDA 3W2HA 1JL3A 2XRZA 1AKQA 2BONA 7GPBA 4FDVA 3U7JA 4JYCA 3DDWA 3UCXA 4A5SA 1I1OA 3JQ8A 1HZZA 4CDNA 3FIJA 4QLAA 3DAHA 5HBGA 3U26A 1X86B 3E3AA 1QUEA 2Y4NA 1P7ZA 2O2EA 4YJ3F 1XDDA 2NU7A 4S05A 3CKYA 2F17A 4TTRA 5FUVA 4I3HA 1NYLA 1CEEA 3VPGA 2LUOA 3QWFA 1D09A 1P44A 1EA7A 4F3RA 4CQLA 4NPAA 5FLXA 1D2GA 3LC1O 2PLAA 3GC6A 3H83A 2QDKA 1EVQA 1CUIA 1JI3A 1UBTS 1IJBA 3C39A 1J39A 1HDEA 3AHJA 3LX5A 2HIAA 3WYBA 5I4BA 2C96A 3G79A 4DR1B 4M55A 1K5HA 4EFLA 4TKUB 5EWMB 4M54A 5A0FA 1FIUA 3M6XA 4ANFA 1C1DA 4CKXA 4MH0R 1LXCA 1K3TA 1KOLA 1AGPA 2H17A 5FWXA 5T6MA 5FORA 1OYYA 4ZRNA 4BVGA 4YTEA 4DSTA 5EXEA 3L93A 2J3LA 1WF3A 2DU8A 3VAZA 4S1WA 2PMCA 5AUNB 4JJ8A 1TM7E 1BKSB 3UAGA 1FYEA 3R7WA 2W00A 1G18A 3Q3VA 4CIBA 4CEHB 5IM4F 4RDCA 3FPAA 4KAAA 1MX9A 1OI7A 1PS8A 2ACEA 3BXHA 3DTYA 3HN6A 4NE9A 1LQUA 4FDUA 3VPDA 4CL0A 1QWSA 3QNUA 1L4YA 2DC1A 5KPJA 3TF5A 1EGQA 3UV7A 3GPCA 1ZUWA 1AUXA 1L5OA 4ABYA 3A4IA 1NXQA 3QE3A 2I2XB 4JQCA 4QO7A 1AKTA 3QFCA 4MW7A 3R9KA 3MJHA 1RJDA 2BGNA 2QL9A 3NYQA 2EC5A 1Z13A 2ZJ5A 3ND6A 4RS4A 4FT2A 4Q9HA 1VL0A 5TQ0B 3BE5A 3N3AC 4KOEC 4M9ZA 3F7MA 1QV9A 3AJ9A 2FA9A 5F4ZA 4EX7A 2PSSA 2QRKA 3ZS9A 3FTQA 3BS4A 2RHOA 1U7XA 3FG9A 4BDSA 1I0IA 1M76A 4DLTA 1ULTA 4G8BA 3ZLVA 4EG3A 4TRJA 4W5TA 1XF1A 4OA5A 4PLZA 2WKWA 3DZHA 4Q3LA 3D64A 3LRPA 3OMWA 5FA8A 3C8MA 3MM4A 4WESB 3B5EA 1DTEA 4LMBA 2V74B 3OTWA 2RKBA 1U5BB 5DNUA 3DV0A 1Z37A 2V7BA 5BW6B 3TQFA 4BKMA 4DJDC 2OV4A 2PVSA 2XF8A 3BAZA 2ADMA 4KPEC 3ZXUB 3ZJVA 3EG5A 3G8AA 3LMKA 4IZ6A 5JH7F 3TG8A 2FR0A 1TCVA 4Q9DA 1LH0A 1YBAA 4KPYA 2IRWA 2NZVG 2HDHA 2OZLB 5CDUA 1P7VA 3U1BA 5HW0A 1IVSA 1WSBA 2QZZA 3A1TA 3LBFA 4KJXA 1YL5A 4GR4A 4NU5A 3GOHA 4XSHA 4RSRA 2FEMA 2HWWA 3KDSE 4MP3A 3WRYA 4CMEA 2C5AA 3BRWD 4E6EA 5AVYA 2CHUA 2Y71A 3ZLUA 3PUXA 2HT6A 1VKOA 2FNAA 3U5ZB 1KZHA 2DPLA 1E7YA 4KG7A 2M6KA 3AVXA 4OU4A 5EVCA 2YW2A 3VTFA 3ANSA 4CF5A 1M2GA 1S02A 1JHUA 3DLBA 1FJHA 4I8IA 5JU6A 1UPFA 2ZRLA 2D2FA 1LKZA 1KS2A 3PZBA 4K6HA 1UFOA 3U60B 4ZQGA 5CDHA 4HDMA 5JQGF 4YO7A 2JEYA 3L46A 3OT1A 1U1EA 3PUWA 3ND7A 1Z28A 4DMKA 1SVOA 3MINB 4QOGA 3GPBA 1U0NA 4C0KA 1TUIA 1YJBA 3FI9A 2VDRB 4RK4A 2VFAA 4AT1A 3UG6A 1O6BA 2DQYA 2EKPA 2WNIA 2W2QA 3CVJA 2W6ZA 3IULA 3BSSA 5BRJA 2BZ0A 1T8WA 2JGMA 4IDOA 1KMQA 1OAAA 1NI3A 3MD0A 4F6RA 2J3MA 1JXOA 3O91A 5A6VA 3HLKA 4UDNA 3YASA 2G07A 2FSGA 1Y5RA 3NANA 1MIOB 4I4CA 4IVNA 4TROA 3UOAB 1OFUA 1VLLA 1HURA 2XDWA 4PQRA 3AR7A 4TRMA 3TAXA 4Z1MD 2I76A 3LT5A 1FDSA 2DRIA 4OM8A 1S8FA 3I09A 3VO8A 1I4TD 1QBGA 4IOLA 2CLEB 3H3XA 4JLJA 2P6RA 1QF6A 3BRQA 4J2HA 2CW5A 1PK8A 4L51A 2DG2A 1QK3A 4Q3DA 3VTAA 3B89A 1Q7GA 1XDWA 1U8AA 1DKOA 2RCYA 1V1JA 1J33A 1T2NA 3PUZA 2IE8A 2GTIA 5COQA 4IHJB 3RF7A 1YASA 4R3NA 1R5NA 1E8NA 2PTGA 1HT0A 4UU1A 4RPJA 4N5MA 1U8TA 4UUMA 4TXNA 3KPVA 3N8IA 5BMVA 2NV0A 2AFVA 2NVBA 2OYCA 3R41A 3PXEA 3W3AA 3GARA 1U9YA 1UXHA 4RDIA 5HCUA 4CMIB 4DG9A 1W1IA 2M98A 4NBTA 1OLSA 1R8XA 2OD7A 2QRPA 2W8BB 4PSUA 3A58B 1PWHA 4KO3S 4CV1A 2VZLA 2PMKA 3PR3A 1JSLA 1ZRNA 2PD3A 4XR9A 4EGQA 5HCNA 1U0FA 4L0CA 4BNUA 2AEMA 2FWJA 1IBMB 2X7XA 4YROA 3VH4A 2YOHA 4DLVA 4U2GA 4F4FA 3OE4A 4MUFA 3BJZA 4B76A 3OE5A 3N8GA 3SYLA 4IUBS 2XWSA 1G60A 4YAEA 3WMRA 1QS0A 3N2YA 1OU4A 2MSLA 3QE9Y 1J2TA 2YZMA 3WGMA 3E18A 3LQQA 4KX3A 4NWIA 1E7WA 3GPDG 5EMJA 5J43A 1ODFA 1Q95A 2NO5A 2WWWA 5D3QA 3DSRA 1FDUA 1L7VC 3BDIA 3RJMA 2BFEB 4DV2B 1PLKA 2PH1A 4ENUA 3IHLA 3QXGA 1NW5A 1YZLA 4LF9B 3KEMA 3A3YA 3BTSA 3U17A 3HUFA 5IK2A 3UJ3X 4NEGA 4HV4A 2CBXA 3CUVA 4BPRA 1MEEA 2ZSIA 3BGVA 3UKJA 1A2KC 5K8CA 4J0EA 3QVGB 1QOQB 3O31A 1WPRA 3O47A 5GZ6A 5JZVA 1OGJA 3QVLA 1P91A 1LSUA 3E9ZA 2R4UA 4HNAA 5DI9A 3WK4A 1V8ZA 4N5HX 3PC6A 4X41A 3S1AA 2FPMA 3NKVA 3S6JA 4C4TA 3TDNA 4TTSA 1IH8A 4CMGA 3O8DA 4HAOA 2AQIA 2AI1A 3DHYA 3NHLA 4J8PA 4K9SA 2G7MC 3ZUGA 4C1BA 2KI5A 3WNVA 1E3WA 4IH9A 1Y1SA 2UYHA 4Y1RA 2Q4BA 2KLBA 2R1VB 3K71B 2Q4OA 4G67A 1EFVA 4ID9A 1DQYA 3NAZA 4PE5B 4UNPA 1JHAA 1XRSB 1FXWF 3SC2A 2PFGA 5CCEA 3K53A 4PX2A 3O9ZA 1DAOA 4R54A 4ECEA 4O4LF 4WH0A 3PNQA 4OGKA 3SF8B 4AG3A 1LNSA 1X9HA 3WSTA 2I7CA 2VJKA 3LVFO 4LTDA 4NOJA 3W5DA 4X24A 2EG5A 4C9BA 5DHRA 1QCDA 2A4MA 1EFAA 1AKMA 2R6HA 1EHIA 2GA8A 3AP1A 3LBHA 3N7UA 2FN7A 4J94A 2IVZA 1VP9A 4CE6A 1QUFA 4B79A 4ER3A 1IOZA 1E2PA 1XWIA 3SDSA 2QN9A 1H2HA 3LOUA 4KYIB 3K4PA 3OJLA 4BO0A 3F9IA 5GM2A 1KDRA 5J5CA 2VOEA 4QC2A 4TV9A 3ZCRA 3CNEA 2FG6C 1VHJA 2QIOA 2IEAA 3IT3A 3PF9A 1DS6A 1N9ZA 2FKAA 4S1PA 5BR1A 3NKLA 2ORED 2Y1XA 3AUYA 5E6UA 1L5RA 3M82A 1IMOA 4ZAVA 2CFCA 4L0MA 1NJ5A 4TPKA 1G8JA 1JILA 2I65A 2SECE 5E2BA 1OH5A 3TSZA 3B3JA 4GYYA 3Q85A 3EWNA 3H97A 1M10A 1ML3A 5L3ZA 3UOGA 5A03A 3A10A 1U2RA 4N7BA 3A9SA 1P5HA 3C3EA 3M6VA 4RVFA 5F2OA 4ZYXA 1WZEA 1I8TA 2JJ2A 2QMUA 1TVKA 1UZMA 5CFPA 1E1KA 1UBEA 2AD5A 4HAZA 4CR8A 5J2TA 1QH8B 1S2DA 3Q5EA 4NDAA 2XUKA 3I9MA 4RHFA 4YRQA 3RU2A 3WB2A 1U2DC 2RFLA 2CSXA 1YR3A 2P8JA 2RONA 1RQPA 4M8LA 4NZ9A 5D3MA 3RW9A 4X61A 2QI9C 4Q9LA 2NZ2A 3D8TA 3TZQA 1OPXA 2Q6TA 1EJ6A 3ROGA 1CLEA 4Z2YA 1WKBA 5DVZA 1RAIA 1IJEA 2OK8A 3JQPA 4A8PA 5F77A 1WU8A 1M0TA 4P7JA 1W35A 4PHGA 5AUPB 5LYJA 3P0EA 2WAOA 4A2PA 5U9CA 3DDNA 4H0NA 3RSSA 3T7TA 2Q2QA 1T8TA 1T6ZA 4A0RA 1NNLA 1RQRA 3AOEC 4ARAA 1Q44A 4CLDA 3AVOA 2WD9A 5LIPA 1DWPA 3ABSB 3D5QA 3QLVC 4KVFA 5DO9A 1OV4A 4C5CA 1MBZA 3QITA 4IH1A 4V0ME 1R4ZA 4YRIA 1UBUS 5KVSA 2F1HA 3OA2A 2J0UA 5HGJA 5AKYA 4AO8A 5LKRA 1V8BA 4XDGA 2A5LA 2P2YA 1C4XA 4JUFA 1I3OA 3U3XA 4JX8A 5BSFA 5F7OA 5L3VA 3OVMA 1GPUA 2OZEA 2OQIA 4AX8A 1J6UA 3ER8A 1GUBA 2VBGA 5ICEA 1CZLA 1EJ2A 1HM5A 2OCKA 1F2DA 1ZVQA 2VXYA 2G0NA 3MMPA 3OZWA 4HB4A 4ZU3A 1JEQB 4HMOA 4FFVA 1CJCA 2W71A 1ZESA 3AJDA 2FZCA 4RCZA 4UTOA 3W04A 3DL7A 4IUCS 1ZXBA 1CR6A 1DWUA 1NPYA 1FMCA 4FSDA 4OHRA 3UV3A 4L8WB 3AYXB 1TU0A 2P2SA 4R8LA 1JSZA 2V0GA 3GGDA 2VT7A 2BE7A 3QPBA 4G0QA 2VF2A 5BWCA 1U8XX 1YRQA 4MIYA 2VCEA 5J59A 3F96A 1NVVR 1I1QB 5I8WA 1BWSA 2FZVA 1LRJA 1UOPA 1JEYA 3H13A 3U1VA 2XZTA 3EMKA 3H1AA 3L8ZA 4G97A 3TTYA 2JHFA 4I8XA 1G17A 2HFJA 2C94A 4B34A 3PEYA 5JAOA 2HY7A 3C43A 4ER6A 2WAYA 4XFKA 4EA7A 2CLDX 4BUJA 4NOMA 4NCIA 4GRIA 4IGAA 2VJQA 4Q01A 4XIJA 3WLFA 2RBGA 1YJ5A 2Y66A 4Q12A 1WBBA 5JPIA 1XOIA 5HF9A 3RU9A 3SMVA 4R9RA 3QI2A 2GAAA 2VJMA 5IK2D 2O8DB 3RANA 1E92A 4DSOA 1A4IA 3NQ41 4DSNA 2R68A 4LI0A 1JLRA 3IH5A 4G1FA 4L9SA 3PQ4A 1OXKB 1NP6A 5A5FA 5AVTA 1A76A 2ZCUA 1XRLA 3SD7A 5A0VA 4PFJA 3OIGA 4P3NA 1Z15A 3SFZA 1RZRA 1CR1A 4QQRA 3TR0A 3UK1A 3SEQA 1N2CE 1G2IA 3FIUA 3QXHA 5CXXA 3WLJA 2GN1A 5C4GB 5J2UF 4TYNA 2Y1DA 5LP6B 1WV0A 3OE7A 4PCAA 4D0RA 2ATEA 1KYQA 1BD4A 1I9GA 4JB3A 4ZVQA 4BLOA 2QYOA 1BHJA 3K8QA 4YP9A 4AMBA 5I9NA 2XKKA 4LDPA 2VK4A 1F06A 4V03A 4B8ZA 1OXUA 5TPZA 2WSYB 3U4IA 1VCNA 3FETA 3DR5A 4Y2JA 4ZO8A 1SBYA 3AB8A 2FDCA 2NZXA 2OP1A 2IH5A 2REQB 4UHDA 3SDZA 4C0JA 1OJLA 2FW8A 2QLNA 1C3JA 4YQYA 1UBNA 3H04A 2JCVA 3W1WA 1J24A 1N25A 2BFAA 3LFTA 5DLDA 3ZWXA 4HN9A 4ZZIA 5JPDA 1H0KA 4BAUA 1DP4A 3O3NB 4A27A 4EA6A 1QO7A 1OAOC 5FUWA 5ALYA 1XP5A 4KO4S 3G2MA 1Z2NX 1Y81A 2EAUA 3AJRA 3IP5A 4RZ3A 4WZZA 3FOFC 3C5WP 2CHQA 4ZHQF 1VYUA 4Q4HA 1WMDA 4R40A 5FR1A 5IAEA 2EEZA 4C7BA 1XPRA 1OWOA 1GQFA 1WS6A 3ABIA 3GU3A 3IRVA 3MYRA 5P8WA 4CKWA 4OSOA 3QW2A 3FHOA 4HDRA 1ESDA 2Y9MB 3BYZA 4KI7A 5HX7A 4G0PA 1EP3B 1V96A 1NRXA 3KAJA 2VDPB 4PNZA 3R9XA 1KH3A 4XWWA 2IHBA 3KLPX 4IGKA 4DMCA 2ZJAA 1LW7A 4A36A 3D1LA 1CE8A 4FM9A 3ZQKA 2R2AA 5FBRB 3OTIA 3CW9A 4CG1A 5A0TA 4RPKA 4ZA2A 3ENQA 2GJAA 1I32A 3LO5A 3P9PA 4MW0A 1V8PA 1CS0A 3H1FA 3PXGA 4WZ6A 5A4MS 4MS4B 1B42A 1ESZA 2JJ2D 1TXGA 3IAFA 4URZR 4ZICA 1QVWA 3LM8A 2WD7A 5ALHA 2HA6A 1IN6A 3F49S 3QY9A 2YY7A 1LFDB 2WJPA 3ZHBA 1J8DA 1ECLA 2X13A 4E5PA 1QYRA 1D4OA 2WUFA 4M86A 4DW8A 1CVLA 1RKBA 2V6MA 2IP2A 2JS7A 4MJLA 3QHQA 1BKYA 3HEMA 4ZYYA 1LDMA 5L3SA 4XTRA 2BFWA 1L4HA 4BECA 1JKMA 3T3OA 2BR4A 1VE1A 2I54A 3I2GA 5IX8A 3ENZA 2HV8A 3MCAA 4WEQA 3UICA 1O57A 3ADOA 4QUJA 3C85A 4TUYF 2ZQ5A 1XEAA 4JMPA 4LPSA 2Z98A 2Q1XA 3Q1LA 2D1YA 2V0NA 1RYNA 2AQHA 1CC1S 3CKKA 4RTPA 1E96A 4MTLA 4O4JF 5F7ZA 1K7CA 3QPDA 4AO7A 2J59A 3FWYA 4UMFA 4WE3A 4MA5A 1DU4A 1P8AA 3PG5A 4BNMA 2AUMA 1R64A 2FPIA 1EBUA 1S7CA 4HX5A 1JQ5A 2QW1A 3CU5A 1E6CA 2ET6A 2J85A 1VSQA 2ATCA 2N1BA 3GEHA 5K8TA 2IOHA 4FOTA 4QTYA 1ZRHA 3TGLA 1FU7A 3H2ZA 1RHMA 1G8MA 4PTZA 3QWAA 4RZIA 1EHCA 1FUYB 4BKPA 5ICCA 4PZLA 4WA7A 1U7UA 4L8FA 4FYXA 3CF0A 4RSGA 5ECDA 2DQSA 4UPVA 4EHDA 3CQ9A 3FVTA 4ILEA 3BD7A 3BMQA 1KI6B 2QZ4A 4L16A 2W2KB 2WYVA 3EIQA 3UWOA 1TJYA 3H11B 1NI5A 4GP6A 3G6KA 2WVJA 2HSDA 4X7PA 3H5IA 1V11B 1KR5A 1M0SA 5I6DA 3SR4A 3QBEA 1BN6A 1PZEA 1TQ6A 2GEJA 2IDZA 1A1VA 2OESA 2YZNA 3BUSA 2HRDA 1IBCA 4MDHA 1XSEA 3DEIA 4CCYB 1N8SA 1Y9EA 4FW9A 4Z0PA 1DBVO 1P81A 1SVWA 1EH5A 1N6HA 2IEIA 3OJOA 2R5FA 1T9DA 4FN4A 1NMEA 4EY5A 4ZFNA 1BOOA 4HEQA 3ZXYA 4BQNA 4Q03A 1PQWA 1LA2A 3NJ8A 4QASA 2CF6A 3Q2IA 1ORDA 4TWZA 1Y8ZA 2A9FA 3H1EA 4UM5A 5HKKA 4E33A 2OXTA 1CF9A 4FK8A 3SXUB 4CN8A 4NFLA 2AE2A 4YPFA 3KT6A 3G9ZA 4IDAA 3R8FA 1XPUA 3H4VA 3G0GA 2J1LA 1Z75A 3KFVA 3TRKA 5JQWA 2YQ4A 3UMGA 3Q5DA 3ZI0A 2V6IA 1C9JA 3DNPA 2YQZA 4PXAA 3AI1A 2VYCA 4DIMA 1LLDA 3AYZB 4WRRA 2C04A 3RIEA 4BN0A 4BO8A 2QAGB 3DFUA 2NO0A 1DLJA 4RTRA 2VHZA 5LNK6 1TEZA 3OE7D 3D0KA 1QDLB 3KFLA 4QSHA 1VJGA 5C4MA 4PYMA 5GONB 1GZDA 3RFXA 3F3MA 1T9GR 3URMA 4EDFA 3EUAA 2H2HA 3QV1A 1WW3A 5TPZD 1J2EA 2Q7OE 1P1RA 4EUHA 5JDCA 2IZ6A 2YWEA 4WECA 3L82B 2BBWA 2YVLA 4CM4A 2XBMA 1QGDA 3BWCA 1R6TA 1WUIS 4GAEA 1JFFB 1PZXA 3KD3A 4JEIA 4MQ4A 3RTDA 5B2FA 4ERNA 3U7QA 4PG8A 3UHJA 2LP4Y 3FDJA 3GB9A 3NBQA 4HGQA 1JHVA 1G2QA 1UDWA 2VDUE 2G1JA 4UBKA 1R0YA 5JH7A 3BGSA 3NWOA 4MDEA 3FYUB 4F72A 3KX2A 3LC2O 2PKQP 3EHDA 2BC9A 3MCZA 3QQPA 5D5PA 1GGHA 1N6OA 2C4KA 5EESA 5B57C 1V9CA 4IDNA 4XCVA 2ORYA 1E0AA 4CLOA 1DAPA 4F2GA 2HADA 2IOQA 3KU1A 4F06A 5JEEA 5LSAA 3DA8A 2GEVA 4J43A 1TQ2A 4MITA 3MPOA 2UVDA 4KR6A 4Z8XA 4EI8A 4GG1A 3WZLA 3WHPA 3ZBQA 1D6SA 1RQ7A 4LIPD 1DFIA 1P0MA 5IBQA 5BR7A 3NB0A 2HSZA 1P2FA 3OKAA 3TIVA 3KQHA 1RYYA 2HMVA 1B93A 1H9BA 3LZDA 1X74A 4W5QA 4E7OA 3AIOA 3LJKA 3EXG1 4DQDA 5LKAA 1DO2A 5JQGA 2GNOA 3QYJA 5BY2A 1ZMTA 3D7LA 2XQGA 3QI7A 1OX4A 1V9LA 1RPAA 4KGXA 2LV8A 1HLDA 3OPYA 2C98A 4I9FA 2V7PA 1FZTA 3L18A 4OBEA 1BMTA 1QM5A 1I24A 3OZUA 4L74A 2VG8A 5EWJB 1K0UA 4P7KA 2ZTVA 1EGHA 5I48A 2ZBEA 2QD5A 4XX0A 5I9TA 3QVSA 1GQYA 1KYTA 3JRXA 2PXXA 4KIFA 3SE0A 2ZE6A 1S2OA 2XTNA 5EL0A 1TQHA 3OF5A 4MKRA 4EY8A 4B5LA 4XH9B 3WLRA 4D0NA 1AQLA 3EWIA 3J7TA 4IYRA 4ZVKA 4JI6B 1G98A 2FN4A 5HOQA 3PUVA 5D1HA 3EEYA 1TJ4A 2QRMA 3PGXA 3RLFA 4F56A 1P2UA 4HZGA 4EFDA 2JNWA 1NR7A 3JU3A 2O8BB 2HLHA 3B2EA 5CVUA 1SBHA 3OOSA 4PRYA 4YP5A 5BN5A 3MSXA 4BMNA 3K1AB 2OFOA 3ZBUA 5DIZA 4N7JA 3BMXA 1RZUA 4D9BA 1JHZA 1KQ3A 1VE5A 1OXSC 5E95A 5BSTA 3L7OA 4DA8A 2EQBA 1FNSA 2EIXA 4IWYA 3CF2A 4R1OA 4PC7A 5EEHA 3GGSA 1O8CA 3IBTA 5GV7A 4DFDA 5I7VA 5ITZA 4HK4A 3OO0A 3IEMA 1CFJA 1G64A 2ZTSA 2IYQA 4D79A 1SEVA 4R8SA 2JF0A 3ZE8A 2HNBA 3JAKA 4IX1A 3BE8A 4V1CB 4AECA 2BTEA 4DLLA 1KJWA 1UKZA 4XQ0A 5ILQA 5TQ2B 4W5JA 3ZXSA 1JA9A 4FXOA 3EZ6A 1X6VA 3HO1A 5JYCA 2RGWA 2ZBUA 3OT4A 2J5XA 3D1VA 1JHOA 3KLOA 2ZJOA 5A3SA 3NW9A 3NTQA 1R6BX 1YO6A 3EEFA 3E1SA 1Z8NA 2Y4OA 1TU3A 5IT0A 4LVOA 3AXTA 4MV9A 3E8XA 2BH9A 3G82C 1SCUB 1Z73A 4EX6A 3DVLA 1SN7A 4G5HA 4H08A 5IVDA 3VX4A 2B4RO 2W4IA 3I0MA 1TW3A 4DCJA 2A0FA 3ANLA 4YGYA 4X7MA 5FPYA 2DM6A 2HBQA 2M6RA 4H17A 3NWBA 3AESA 3PPIA 3VVMA 3HDHA 1IG3A 3FVVA 1UBSB 4QWWA 5JSZA 3OG9A 4KSYA 5IT4A 3A37A 3F7TA 5AVRA 1TC1A 1Y3FE 3C3AA 4LCBA 1WY5A 3ESYA 2Q1WA 1QOPB 2OXCA 4MI9A 3SZLA 3HM9A 1KF0A 4B40A 2CMFA 2OECA 4G9EA 5HKKD 1HR0B 3PPXA 4KUGA 3UO8B 1NX9A 3Q8KA 3CLKA 3OM9A 4JXZA 2DTEA 2FMKA 5AXCA 4JENA 1Y63A 4YRSA 2QX9A 1G3IA 1UP6A 1TT5A 2PX6A 2RK3A 2PJDA 3M3PA 2GXUA 2PZEA 3FDXA 4TQAA 1O5TA 1OCEA 2VAWA 3K73O 4XQGA 1PGNA 1O5OA 1W0KA 2JJQA 3QX7A 4TTVA 3DE2X 4U7WA 4RVGA 8AT1A 4RTOA 1JAXA 4HB2A 1AVTA 4KGVA 4KLZA 4PAMA 4DCSA 2O14A 3QVKA 1B6SA 4QLBA 4KMSA 1Q74A 1M2KA 3FJYA 3L79A 3A6ZA 3PR2B 3EXHB 1B73A 4JQZA 2VDJA 4NRDA 4DILA 3RFCA 4IMIB 3GUZA 3PFHA 3O1JC 3N0TA 3IJ5A 1BA3A 1U2ZA 3KJIA 2J3JA 3EE6A 2NSLA 4DRXB 4ZXFA 4CKEB 1Z8HA 4O4LA 3SQXA 5A04A 3EXFB 2X2EA 1AJEA 4DIOA 2A14A 4AJ2A 2C8VA 3KJHA 4LXXA 4NYIQ 3EWSA 1KK1A 3DLPX 3TZBA 3BL6A 1NR1A 4Z7QB 2KQUA 1M5UA 1M6EX 2V3CC 1EP1B 1YFLA 5IF9A 1MCZA 1VBNA 1WLYA 2N1MA 1V35A 2H5IA 4N0PA 4V0KA 3UPDA 1DCKA 2A5JA 4DLPA 5LQAA 4MW5A 3N5CA 4WXYB 1GL6A 3PB3A 3V4FA 1RTKA 4IQFA 1WCV1 3FGOA 1YA8A 4O5OA 1EUQA 3C6YA 4BXOA 4R1UA 1ZJ6A 2Q0QA 1KOGA 4LAFA 3RAPR 4RDHA 1YIDA 1Y6JA 4BNJA 5LQNA 1O1YA 1L1EA 1P0PA 3HJTA 3BGWA 4NZZA 4JVMA 5A5DA 4JYZA 2O8FB 4DREA 3ORYA 1BMDA 1I2BA 4P83A 2HHLA 5C2JB 5KOJA 4EEKA 4QDUA 3E9MA 4JOSA 5H4GA 2FF5A 4TKLA 1ODJA 2XNKA 3AF1A 1Y7IA 1DPFA 2FQQA 2EATA 2B37A 4Z8YA 1B1CA 3OZBA 3SHFA 1RWXA 1U0OC 4C07A 1ZUIA 1E9SA 5EWLA 1KQGA 3AL3A 3W0LB 3JSAA 2BEVA 4MJ3A 3FYDA 3NHZA 2FSPA 1GLGA 4DCPA 3WDMA 4CU2A 3PLNA 2X3UA 3TL2A 1E7RA 4M7OA 4G4SO 4Q1EA 4Z51A 5DGIA 1ZM9A 3C3DA 3QWBA 1U8UA 4A0SA 1J8QA 4R2XA 3M5CA 4XPIB 3CLUC 2PT6A 2OFXA 2LW7A 3PL5A 3M5DA 3BDAA 3TLBA 4B3BA 3F6CA 1DUSA 3AW9A 3GG9A 4DMRA 1YR9A 5FBKA 4JP3A 2PXHA 3WGUA 5ED4A 1J2RA 4JITA 4M9UA 4N0DA 4EJ0A 1TDJA 3IO5A 4KKVA 3B38A 2YJ5A 4S1NA 4EHIA 1JHDA 3DYVA 1G8SA 1U04A 2E6KA 1IUKA 1N6NA 2FZEA 5EZYB 4ZVSA 3N2LA 4Y6LA 1JHRA 3OPQA 3RBVA 3U3RA 4DT1A 5LL6P 5CXSA 2XTAA 4KC0A 4WV3A 3U56A 3UT5B 1S3FA 1H5QA 2HU2A 3S5JA 2QNRA 4CEIA 3HFSA 5CVDA 4IHJF 1NN5A 3GFRA 3DB1A 5EEGA 1Y4DE 3SZUA 2B82A 5B4TA 2H6EA 1WUJS 2IYAA 2Z2ZA 2WT4A 3LT2A 4EW2A 1IUOA 2QRJA 3H0EA 4KYVA 4TSKA 1GPNA 3COVA 3UKDA 3W6UA 2Q1YA 5KNCA 3TG2A 4EJ6A 1IEXA 2XRFA 1NM5C 1QLJA 3OH8A 3AVTA 1EX7A 3ZDYB 1SC9A 3SHWA 1L7XA 2QRHA 1D4AA 1J2UA 3AO0B 4RD4A 4RE6A 3UAYA 3RUAA 1UIRA 3THXA 2GEFA 4EJSA 3HQ4O 5DM2A 2FR1A 3B3AA 1JFTA 1TF7A 2GO1A 4GPBA 3VVCA 5DBHX 1O94C 4MV3A 1NFFA 1X8LA 3C45A 3PNMA 5EMLA 1D0VA 1JMVA 4D9NA 3SVTA 5FTMA 1O97C 1CQJA 1EK0A 3B1FA 1B0UA 1ST3A 3NHPA 2W70A 2FRDA 1G1AA 1SC4A 3DPSA 3ETGA 4RK1A 3WYFA 4HUTA 2Q6LA 4MEAA 2X3FA 1IN1A 2B69A 4G1VA 1QQ6A 5GADl 3DR3A 5D86A 4N4AA 2O06A 2YXDA 4LMRA 4IJVA 2GCIA 4F04A 5BT9A 2QG6A 5JRDS 3VYSB 1A9RA 3HDYA 1FJXA 4RHCA 1FP4B 5G1NA 1L5SA 1N1MA 3NFYA 3QIAA 1JPUA 4XSGA 1ZL2A 3M8KA 4QOJA 5MHTA 3CWCA 3DLAA 3SFTA 4FFPA 1CY0A 1Y1KE 3QA9A 4LZWA 1WVGA 2AFIA 4MR8A 4L28A 5F33A 4RGQA 4Q18A 4U5XA 3QE2A 3LNTA 3BWYA 3BHJA 1K8RA 3D3NA 3LGXA 3UV6A 3PBKA 3W6ZA 4ESOA 3D3KA 3GJ7A 3QLTA 5FKJA 1MTZA 1UPCA 1UC4B 2A5YB 3HRIA 3PICA 4E5YA 4RDXA 1T6XA 5KYYB 2I2DA 3C5EA 3CNOA 3KETA 4PSVA 2BMWA 3VO2A 1O6ZA 1W0KD 3AUXA 2A1UB 3OPNA 2WIDA 1F8FA 5AVQA<