1X9HA

Crystal structure of phosphoglucose/phosphomannose isomerase from pyrobaculum aerophilum in complex with fructose 6-phosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
301
structure length
301
Chain Sequence
b'SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLYISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDGLLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQMGVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPEGLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEFNENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEHQERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLAEIRGVNPLATPRIDALKRRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glucose-6-phosphate isomerase
publication title Structural basis for phosphomannose isomerase activity in phosphoglucose isomerase from Pyrobaculum aerophilum: a subtle difference between distantly related enzymes.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Isomerase
total genus 112
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.3.1.8: Mannose-6-phosphate isomerase.
pdb deposition date 2004-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9hA01
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1x9hA02
4OX9B 1N8TA 2PUVA 1GZVA 4DV5B 4KHPB 2CXTA 3C3JA 3J81A 2UU9B 2E5FA 1HOXA 2VQEB 5IWAB 1XMOB 1HR0B 1XNRB 2UUCB 1JEOA 3CVJA 1U0GA 3J7AC 1B0ZA 4TOIA 4B3SB 4DR3B 4X66B 4AMVA 3SHOA 1IBLB 4JI6B 1M3SA 2Q8NA 5LMUB 5LL6P 1IATA 4DR5B 5BY2A 2WU8A 4DUYB 3HBAA 1T10A 1IBMB 1Q50A 3JX9A 4DV4B 3NBUA 4DV3B 4B3TB 4DUZB 2PUWA 1X9IA 4JI3B 1U0FA 2O2CA 3TRJA 5FLXA 2J6HA 3PR3A 3Q88A 2ZJ3A 4S1WA 4DV6B 4DR7B 2CXQA 4GKJB 2UXDB 2CXSA 3KNZA 1VI6A 3EUAA 3T1HB 2AMLA 4DV1B 4B3MB 2CXOA 2V4MA 2VQFB 3I0ZA 3LJKA 1WIWA 3BCHA 4DR6B 1IRIA 5IT9A 4JI7B 3HJBA 1J5EB 1I94B 3IFSA 1TK9A 1HNWB 5A2QA 3ODPA 1JXAA 3UJHA 4DV2B 4B3RB 3BJZA 1G98A 2CXNA 4EM6A 4JI4B 4LF6B 4AQYB 3ETNA 1U0EA 2UXBB 4DV7B 2CXPA 4JI2B 1NRIA 1TZBA 1J5XA 4YY3B 4LF8B 3Q7IA 3FF1A 3T1YB 3OTOB 2YVAA 2CXRA 2ZJ4A 3G68A 1TZCA 1HNXB 4NXMB 1N34B 1N36B 1MOSA 2E5LB 3TBFA 4IVNA 1KOJA 1VI5A 2XHZA 3JAMA 4K0KB 2ZM6B 2PGIA 1XTBA 5BR8B 1XMQB 1XNQB 4JI5B 2DF8A 2UUAB 1C7RA 4YHHB 4LZJA 2POCA 1FJGB 1DQRA 4JI1B 1IBKB 1GZDA 3FXAA 1VIVA 2CVPA 1HM5A 1ZZGA 2X3YA 4X65B 4LFBB 4LF7B 4DV0B 2HHHB 2VF5X 5I01A 1X92A 4JYAB 5LMNB 1MORA 1X9HA 3FJ1A 4S12A 4DR4B 4M0DA 1VIMA 4X62B 3M5PA 1C7QA 2I2WA 3QKIA 1N32B 2CB0A 2A3NA 2I22A 4LFCB 4X64B 4LF4B 1NUHA 4LF5B 4LF9B 1MOQA 4U6NA 3J80A 4DR1B 2UUBB 2DECA 4JI8B 4NXNB 4LFAB 4JI0B 1X94A 2VF4X 2XBLA 1N33B 1HNZB 1JLHA 2CXUA 2UXCB 2PUTA 4DR2B 2O2DA 1JIQA 3FKJA 2F4VB 4JV5B 4GKKB 3OOJA
chains in the Genus database with same CATH superfamily
1Z74A 1Y48E 3UT5B 2XI4A 1Y0BA 3I5XA 1G6Q1 4E7OA 3RUHA 4CM8A 3PPYA 2N42A 3CIFA 1T2VA 2H4WA 5BN4B 1A69A 1ZNWA 2GESA 2ZWIA 2WSBA 3HCCA 4QARA 2LKCA 4X3CA 5JARA 4MR9B 4LMAA 4XVCA 1WBDA 1KI6A 3AK4A 4F2GA 4X66B 4FYYA 3ZIDA 1H8HD 5HGJA 3ERCA 4JI6B 3JD2A 4Q82A 4BPRA 1QQ7A 3OH8A 3A9SA 3S5JA 4EJ6A 1M6HA 1U8YA 2UVPB 4HJXA 1ZW1A 4L02A 3Q9UA 4IH9A 3WHKA 2JGRA 4HDNA 4QOSA 3DVLA 4QVGA 2ORVA 2VXOA 3NYQA 3TIXB 5AW6A 3N8KA 2J0VA 2MINA 5A7GA 4JB8A 5IP5A 1E79D 1RM4A 1QQTA 3ORRA 3L7JA 3RU3A 5BWOA 5BUQA 3FOFC 1E9CA 4LC9A 3GUCA 2PCLA 3OZAA 4RANA 1NR7A 1PZMA 3L18A 4QQ8A 1XA0A 2PR2A 4ZQFA 3WMEA 4BASA 1FSPA 3H2JA 3E0XA 3LP8A 3QVJA 3ZY3A 2F8MA 3N3AC 1OXKB 4E3WA 4E5PA 5H70A 3IB6A 4BNKA 4B1FA 3IHTA 3U4MA 4L5JA 4LSMA 3KT3A 3F8TA 3O03A 2AT1A 1GRQA 4KAAA 4QUIA 3SS8A 1U8AA 5KMGA 2B3DA 4WNYA 3CLRD 3ZE2B 3PX7A 3I6BA 4NE7A 4P82A 1CWUA 5CXSA 4K9DA 5F78A 4W1QA 3T3PB 1RPNA 3ESZA 4PYKA 3V6LA 1CJUC 4PSUA 1U7PA 3TB6A 1YBFA 5K6AC 2OCBA 3W5BA 4PR3A 1E2PA 1JHDA 3ISJA 5G3YA 3PPXA 4F5EA 2DUMA 5DE3A 1ZXBA 1EJ0A 2ZRAA 3F3SA 5TT1A 1LTKA 1P1JA 3GZNB 3MRTA 1P5ZB 5M34A 5CLJA 2P0AA 2H63A 4KG7A 2D0DA 3OJWA 4I55A 3H9CA 1TA9A 1UFVA 1SVKA 2JVJA 3T1YB 3FWNA 3VPDA 4IV8A 1Z12A 4Z0TA 2FR8A 2WB4A 5KI6A 1ODFA 2CLKB 3WGGA 2R8PA 4Q39A 4IXTA 4UBKA 3S1AB 5U1PA 1G4HA 1L5HA 1Z0SA 3NM6B 4R1UA 2WU1A 3F5QA 5HS4A 2O6LA 2QRVA 1XTBA 3U3RA 2ODNA 4OB8A 1C50A 1IC6A 1TJ3A 2OXIA 1L8XA 3B5IA 4Y2YA 3WIVA 4UFPA 3AL3A 3SZRA 5DCUA 1OFUX 1H3NA 1X1SA 4D41A 1GFWA 4LOJA 4B33A 1M7GA 3T6KA 2HU8A 1ZD5A 4F56A 1MNAA 5IX8A 2AN4A 3UG7A 1XXHB 3ORFA 2PBRA 5TPWB 4RZHA 1QRSA 2O5RA 3PVZA 1SXJA 1Z7BA 4MRNA 4XCXA 4E4YA 3RRFA 3BB3A 5D1HA 3RS3A 3ZY2A 2LUOA 4GGPA 4OLJA 2NU8A 2M6LA 5C51B 3QF4B 1QYVA 3LDHA 3WG9A 1E0AA 3K0EA 2H29A 5KNBH 2XGOA 1EG7A 2OHGA 2OFOA 3QKIA 1NVGA 1UQRA 2IPLA 3TTXA 1VE6A 4XR4A 1UZUA 1C3EA 4YECA 2A9FA 2JFUA 3TAUA 3O74A 4U6NA 4B4KA 3O5AA 4M0KA 5EJ2A 4FEAA 1QPZA 1YQQA 2QTLA 2DPGA 2ZBRA 2MTBA 3NNDA 3V46A 1NJ5A 1Y4AE 3P9NA 1KYVA 4G0ZA 2WNHA 4A8PA 2J6BA 4B6GA 5THQA 3RSLA 1RHMA 1L7XA 4ZZIA 2NIPA 4HQ0A 4GR9A 3QVUA 3TTVA 4PHHA 3V34A 2R6HA 4Y6RA 3RVSA 3NIGB 2AG1A 4HVAA 2PY6A 4ER5A 2WY2D 4QYIA 5LP6B 5BSKA 3BT7A 2QU8A 3LTNC 2ZIGA 2QROA 4WVFA 5I4IA 2JC3A 3T5TA 5CVVA 1PR1A 3G6KA 5IAEA 2FR8C 2HN9A 1QDLB 4OF4A 1AA6A 2O0JA 3BXHA 3LC7O 5AJHA 1C9NA 2E87A 3LW7A 3OF5A 3L6EA 5LL6P 2HHJA 1HMPA 5EIAA 1F4VA 1JHMA 2ZR7A 5K0FA 2X6TA 4UXIA 3LY8A 3DW3X 3NDPA 2B2NA 2CL7X 2NW6A 3RSZA 4DA7A 1P1CA 1CUVA 4XFDA 3FMOB 1AHHA 2R6FA 3MA0A 2W6OA 5ADHA 2QBYA 2QW1A 2Y99A 5K0TA 1ZCFA 3DZFA 1TAHA 2IYXA 3AM1A 5D5QA 3MTIA 1N75A 3NETA 4YUVA 4UE2A 3R9IA 3ZW8A 1PNVA 1SXJC 2CDAA 2PCJA 4DMKA 3L6CA 2G5GX 4ZOAA 1IDN1 2J08A 2HSJA 3HEMA 3RUAA 1TYDE 2DKNA 3BFXA 1XRMA 2GLXA 4MUBA 4F7WA 4RYDA 4B3MB 4RY0A 4Y1RB 5KJFA 2BFDA 4UNNA 4NBLA 4OJKA 4C05A 4HNSA 1D6NA 2RIRA 4IQ8A 1YBVA 5IRCD 3T0FA 4WKGA 5A9RA 2JB9A 1OW3B 2I1WA 3ETHA 1ZSVA 3SF0A 4HZIA 1XRQA 4NFSA 4RPCA 1U3UA 3BHNA 4REQB 4RF3A 1G7CA 3U62A 3FYTA 4X1OA 4PLFA 3NLLA 3Q5DA 4HO1X 4QDUA 5CAEA 1UQTA 4RJ2A 4YBZA 1ZJZA 2B37A 3INGA 4GL4A 4YRQA 2I2CA 3A1FA 3DMDA 1XDDA 4DUPA 3EIWA 3RIXA 4AY6A 1WDMA 5DM1A 2G9NA 2Y1LA 2VH5R 1U2EA 1F8GA 5JT1A 2F4NA 3KKLA 1OLOA 1S7GA 5GADl 3PWTA 3G3EA 1G8KA 3EMBA 4FJ0A 5F7JA 1NVFA 4RD6A 1XNQB 3TD9A 4ZKEA 3D7NA 3HA5A 4XIFA 3KVVA 3R74A 4EEXA 1Z0DA 2DBZA 3NBYC 2GPNA 4R9NA 5K3FA 3WYDA 4CV3A 3DLAA 1M1NA 4XARA 2XMRA 3TSYA 3GJ0A 1E9VA 3TPFA 3V4FA 1GPBA 1ANKA 2WG2A 2ZCJA 1WXHA 5JHGB 4TKZA 4AJNA 1Y63A 1UFQA 5JO0A 5FUWA 2BM8A 2RKBA 2IEBA 2ZKIA 2GEKA 2BDEA 4FD3A 3AB7A 1ZCAA 5LB2A 1ONBA 3T06B 3GZTB 1TL7C 5DT2A 4BB5A 4RK1A 3EIOA 4G1CA 5DPMA 3U1BA 3QKSA 5C0OE 5EP3A 4R2WA 4CIVA 3N9IA 2HV9A 5KREA 1RXVA 1JQKA 3I3OA 3RVDA 2GTIA 2A9VA 1ODCA 2HCFA 4PZYA 4R0NA 4N47A 2IS2A 5F2OA 3SMQA 2F59A 5C8VA 2VP3A 3EEYA 3F5FA 4CLRA 3QM1A 3EASA 3IEPA 4GICA 4DB2A 2BEVA 4ZWNA 5KX5A 1N0WA 1QP7A 3QWHA 2AZMA 3JCZA 4XWYA 2B25A 2JJMA 2OZVA 2IX9A 4OI4A 3IT3A 4JFRA 3BIOA 3U3XA 1TOAA 4J1TA 4POAA 4B3SB 2DTEA 1RQXA 3QVVA 3T4XA 2Y67A 3QXJA 1XWFA 4R1SA 1N2CA 4GMHA 1J2EA 3MPUA 3BKWA 3HWWA 3DLTA 3H1PA 1R15A 1C7FA 3DOJA 3I42A 4OBWA 3V1NA 3K35A 4I2NA 4H18A 1DEXA 1JU9A 1W75A 2Q0XA 4FSDA 2V3VA 4TTPA 1I36A 4FJ2A 1HNNA 2J3IA 1RLTA 4ZAGA 1EGVB 1K7YA 1LPMA 2H85A 1KO8A 1RXYA 2GCEA 2ZIXA 3WLEA 4L51A 2VDQB 3EEIA 4G8BA 5IJAA 3L7MA 1MT3A 2EZ9A 2H4HA 2Q07A 5DVZA 5SZIA 3WLMA 3U4QA 4QTTB 2J3KA 5LDGA 3TRJA 1IEXA 3F97A 5T4EA 3R76A 4QOEA 1G3QA 2G17A 5EE5B 5KUTA 2ZYWX 3LK6A 2O07A 5A6SA 1TW3A 4GYKA 3HZRA 5GPBA 4DCCA 1F4LA 2BZ0A 2H59A 4GM0A 3RI3A 5KTNA 3FDZB 2BBTA 4GP7A 4HDCA 4HDRB 2PVSA 1Z34A 4LMPA 1XD9A 4MB0A 2WYWA 1QIGA 5CR9A 1QB7A 1H9AA 5KWEA 2JEZA 3Q4GA 4QYTA 1A9ZA 1ODKA 4OHVA 4QBHA 3LPLA 3MB5A 1FS5A 4CF4A 2HCRA 1OGYA 3X1MA 1JXAA 4XIIA 3B5EA 1SVOA 2TMYA 2WWHA 1L4KA 1V35A 2RHCA 3JARB 3LKDA 3OZVA 2I2FA 4UD2A 4Y2JA 1AKNA 1FOEB 1G6OA 4E33A 3DCIA 4DC0A 3PTAA 1GSAA 4MQFA 1X15A 2FUKA 2OWEA 3V4OA 5K03A 4CKYA 1N6KA 3ED5A 4CTJA 1TUBB 7YASA 3QWAA 2AZXA 2JCGA 1K6JA 1QF6A 1E4EB 4QBKA 3CKKA 3SG0A 4NYJR 3WJ2A 3MF4A 2HBQA 4AQDA 1NT2A 1YE8A 2C2OA 3ORHA 1M8FA 3T4EA 3A04A 2XPCA 3IBCA 5E0KB 2XX3A 4BU1A 3LMKA 2BTQA 1UBSB 4D79A 3E9CA 4KVFA 2DBYA 4EOGA 3IDFA 1SJ9A 5E4YA 4O2BA 4NK5A 4QPZA 4R05A 4B7XA 3M6WA 1KVQA 4V3CA 2IBMA 2H1VA 4CV2A 3KAQA 3M2TA 2VDRB 3CA8A 4XYGA 1NVBA 3PIIA 3SC2A 4H7PA 3REQA 2HRCA 1O5OA 3HSSA 3M5PA 4HPWA 1RAFA 4XM1A 4YLEA 2FPSA 4IO1A 2Q4EA 3JZMA 1DQPA 1TECE 1KY4A 4CETA 1TLFA 1MABB 3W3AH 2AEJA 1ZVQA 3B3FA 4GPAA 4ZT7A 4B6JA 1LH0A 2DECA 1TE2A 4PIPA 1ADFA 1Y82A 2BFPA 4UZFA 2CWDA 1FDSA 2KBFA 2VF4X 1WLSA 3FUWA 3IDAA 4Q1EA 2BEWB 1S3GA 4ETIA 5B7GA 2NSYA 1JHUA 2AQ8A 4TWZA 2JIDA 1SKMA 2MSWA 3A05A 4CDMA 4AT1A 5KVVA 5LOVB 3RE1A 2L82A 2JLYA 1SHZA 3CH6A 3ZN2A 3OPYA 1CEEA 4QBGB 4NBUA 4CXMA 2FUG1 1LPBB 1KZGB 3K05A 3TZEA 3WGYA 2C7GA 3H65A 3THYB 3DTVD 5JI3E 4Y2TA 3S3TA 2RE8A 3ORSA 3ZHBA 5C5DA 2I9KA 1Z25A 1WXEA 2Q9UA 1TAUA 1J21A 3OQHA 4J4HA 4LOKA 1W4BA 2FRXA 1WW8A 3ZK8A 1ND5A 4WBSA 4JYBA 1L7OA 4GC9A 3W6OA 2XUAA 1SHKA 3EDQA 2TMKA 3AEQB 2OBXA 1IB6A 3MSXA 2IT1A 4JJAA 2QUKA 1B0UA 4MW6A 2FEPA 4WK2B 1XEAA 2A5JA 3A9VA 3FNIA 3OZCA 1VHTA 5DW0A 1V4NA 3D8TA 3VR2D 1RRMA 4BYGA 3OCUA 5CT5A 3II6X 4BDSA 1GTMA 2CB9A 2RGDA 3I73A 5H4HA 2SKDA 1P1KA 3C1AA 2O2CA 1KJ8A 3DDZX 4KH0A 3VZQA 1PSZA 3I9V6 3JQAA 3FOAA 5TS3A 2FJUA 2Y0DA 4S1NA 2Y05A 3FUVA 2V7WA 3MINB 2HZBA 3R75A 5EXTA 3WNVA 4IIJF 5FOVA 5IC5A 2Y9PB 3CX7A 3B1JA 1VTKA 2IF0A 3KYJB 5TB5A 3UMFA 4XDYA 3DR3A 4H6PA 3R5FA 4M21A 3PQ5A 5KJCA 4OM7A 4LXUA 4M0FA 4XWAA 1E4OA 2XCLA 3LCUA 1MU0A 1Y6GA 1YHYA 2BONA 2DBRA 1WM1A 1MBZA 1GFZA 1RKUA 2G71A 3FPSA 4LC0A 4PIVA 3GG2A 5AUQA 3OVMA 3ZQJA 2ZBUA 3TIIA 3U61B 3MFQA 1U7UA 1JLLB 1PZGA 4DLAA 4PTYA 4HX5A 1B8OA 3D2BA 4H7JA 2B2CA 3AINA 2FFJA 4HYTA 2JFWA 2JIOA 4PGHA 5F5LA 4BMVA 2JKVA 3U19A 1YVUA 4RTJA 4RENA 2D4AA 2HEGA 2QTWB 3TUIC 1B16A 1MLDA 1XZGA 2EZUA 2P2LA 5L6MB 2G4VA 2PS3A 5CEFA 2NZ8A 1XQ6A 3PGXA 1IN4A 5A3JA 4IKEA 5LZ4A 1GSIA 1DKOA 4RNCA 3SMVA 1E5LA 3W8FA 5AQ1A 2Z1NA 4KQFA 4A91A 1ZUIA 3AP3A 4ARAA 3O82A 1THMA 3DUFA 2XYHA 4YJGB 3GZJA 5GZ1A 3NHWA 3MS2A 2XQVA 1H1DA 3PB3A 3GIWA 4JZKA 1DBQA 1SELA 2WDZA 1RHJA 3G8AA 3IV9A 4XLTA 3WI7A 5I8PA 5JTUA 3WP0A 3NDJA 2G88A 4YH1A 5JO9A 1AS3A 1KH3A 1DVRA 1ADGA 1RCFA 2PSHA 3E3LA 4TKMA 3UZUA 3VH4A 4FI3F 1WSDA 4MEJA 3TLGB 3KC2A 3CEPB 2ZSFA 1QX4A 4HL6A 4F71A 5C3MA 3A3PA 1JJAA 5FLEX 3EJWA 5CA1A 2BMFA 5K1ZA 1UH5A 5BUZA 2B1JA 2I2WA 4S1VA 5JDIA 3ANSA 3MT7A 2HA7A 2VJLA 1XRRA 3ZGVA 1OR8A 2H1HA 3GA5A 2GPAA 4MV7A 1L1FA 4ZHSA 4F72A 2UUBB 1D0IA 5REQB 1QCYA 1R18A 1M5RA 4L9WA 4DCSA 1T5HX 1B8VA 1VCOA 3H5IA 4FINA 3HBMA 1EA7A 2JGDA 5B2ZA 4EHAA 4GMGA 4YRKA 4S2EA 4GLBA 3ENZA 1T3ZA 1COWA 3VR5D 1SPXA 2OFWA 4NNOA 4FLFA 4P31A 1KXZA 2BFMA 1OZHA 4QDOA 5L3QA 2ZZNA 3LQYA 4IDDA 1POXA 3TW8A 4LKRA 3M2PA 4ZOEA 4BMOB 5LQRA 1BKDR 3AJEA 3CEHA 8OHMA 5G2OA 1DV2A 1R0LA 2WUEA 5KPJA 3SWWA 3G0DA 2ODBA 4LNHA 3E2PA 1W52X 3WQHA 1TO6A 5IFKA 4QVKA 4DIBA 4ZICA 1DC6A 2NLOA 2YBDA 2ZAGA 3OFVA 4NJMB 1DG9A 2UYYA 3BH6A 1K9SA 2HWKA 2IVZA 3G2QA 1I6WA 4OXIA 4QYXA 5TRTA 5C81A 3FTQA 5JNLA 2I6QA 2V6MA 1A98A 3NHSA 2OMKA 4W9NC 2GHQA 5G0SA 1D4AA 2YC2C 1I5OA 3Q2KA 3GH1A 1NRJB 4FHZA 4BUCA 1PDWA 1K8ZB 1LJLA 2NNWB 3WQQA 5JH7B 1FFAA 1JDVA 2FEOA 2IUTA 3SSOA 3CMMA 4BN4A 2EKDA 1JSCA 2BGGA 4BLUA 1J24A 5IEBA 4CM4B 3K6JA 3LQFA 4Q4DA 4DMHA 2WUFA 3BG5A 4UHHA 1FC0A 2O8BA 2VJCA 5FV7A 1KEEA 2BIFA 1Y81A 3IA7A 5IAJA 4CQLA 1GZ6A 2IXDA 2YN2A 2ZBFA 3AGPA 1MX1A 1NURA 4DM3A 5I7HA 1JVSA 4FWBA 4JNCA 1YDFA 1QH8B 1RKQA 2YV1A 3W1WA 3K0CA 3P2KA 3D02A 1WZNA 5JDIC 2WVAA 1B00A 3I1FA 3WLNA 4ZI7B 1JILA 2VOJA 3IE1A 2IS6A 9LDBA 3KT6A 1XZ8A 1P18A 1YL5A 3DEYX 4BMDA 5BYBA 3EQ8A 2JHPA 2ZE5A 4G5FA 3TKYA 1B2RA 1YZYA 6GPBA 2JLAA 5JJCA 2J0UA 4PS1A 2AYYA 2A59A 3H97A 1PEKE 3NM5A 2XH8A 2GETA 3DDCA 5FTMA 3U6BA 4RTKA 5B3AA 2XUZA 4L6AA 4URWR 2VG8A 5BVHB 1NWHA 1TKCA 2QLLA 5IUJC 4BATA 1U8TA 2NQ2C 2REBA 3I05A 3E7DA 3A9CA 4HXYA 1PT5A 4DGSA 3AIOA 3QEKA 5KJEA 5JQWA 3RVNA 3O1JC 5EZYB 1UF9A 5T5QA 2A0YA 1QFSA 3T9AA 3VR3A 4WADA 1YNSA 2JIRA 2YFQA 1A9OA 1SRRA 3O83A 3GELA 1E0SA 1K3FA 2A8YA 2IYLD 1GEEA 3O21A 1A9TA 5DXAA 5ELMA 4JI5B 4N5LA 3E6AA 3KZCA 1YR3A 1Z35A 1T1EA 3KKPA 5HF9A 1CLEA 2Y0BA 4ARIA 2O8CB 1G5TA 2H11A 1OV6A 1IUOA 2HMWA 4FBMA 4J43A 3QFHA 4L76A 221PA 3SE7A 3A3YA 3MTJA 3R5SA 3WNZA 3RGWS 2BI7A 3T41A 1MORA 1IM2A 3ND6A 5DHAA 4XWKA 5AIBA 2XA1A 3PQFA 2YNMA 1M5UA 3H2KA 4X93A 3QWFA 3RS9A 1R4MB 3X1ZA 5HKBA 1P2SA 2DM6A 4FOLA 1D6SA 2Q5JA 1TIBA 5KC8A 1R0BA 1G21E 4JXJA 3CV3A 4ESVA 4NEQA 3L0YA 2RARA 2CMGA 1B23P 1V41E 1XCLA 3CUWA 4ZCTA 4LQDA 4KACA 4QUAA 4WBNF 1DV1A 1LDYA 3SYMA 4DXAA 4C7KA 4Q9AA 5NLLA 5DYGA 3S2IA 1RQLA 4XD7D 1B41A 2OG2A 4IHQA 3UT0A 4C4SA 3EQ9A 1XP5A 3ONFA 3ECAA 2PYIA 3IQGX 3NBAA 1ADYA 2DT5A 5L3VA 4C30A 2R8XA 3QUAA 2R8YA 3C85A 3T7KA 2PLWA 3RLIA 1VA5A 3ZHVA 1JWAB 1B43A 3MTQA 3NJ8A 4D0NA 1M8GA 5A2GA 3VSEA 4BQPA 3SHOA 3DOIA 4HDAA 3SAJA 2QLBA 5TEVA 1M3SA 4AVYA 1UWVA 3TGWA 4MQ4A 1S2LA 4TN5A 1VXRA 2FPUA 3FYUA 3C5EA 3T1QA 2IU0A 2XZOA 2GF2A 2XAAA 2JEYA 4EGSA 4F4UA 4B0PA 3RYFB 4FE3A 1VCHA 2E3JA 3G2OA 4GMXA 4PBTA 4Q3EA 5H1YA 2F48A 4HWPA 1ODSA 2ZJ5A 1O5IA 3QW2A 4A7PA 2I55A 2R6CA 2WP0A 1R6UA 2XE6A 3LQQA 4GEKA 1NG1A 1VCMA 2A0XA 3J81k 1QM5A 2RGNA 2R3SA 2IEYA 1KP2A 8ADHA 1IE3A 1JSXA 2FVXA 4CEHA 4Y2PA 2OFPA 5HJ5A 5B4TA 4Z3KA 1UP6A 1D6MA 4B8ZA 2YNMC 4YRNA 1QZTA 3K20A 1ZGAA 1R10A 1I2ZA 2WTAA 3I5MA 4M1TA 3VTZA 3LJKA 4GD3Q 2ZWAA 5IT9A 2QF7A 4Q9JA 4AP9A 1HQDA 2AF4C 1R9GA 3NAQA 3PHCA 2EKQA 3Q3GE 3A2KA 2Z8YM 1HLFA 4Z53A 3SQDA 2Q8QA 4FEGA 5I4KA 1Y6QA 2FE4A 3P0EA 3PEFA 1XKQA 3GEDA 1XI2A 4NMMA 4J0IA 1X0VA 5JS2A 2Z8YA 2FSFA 2FN4A 2PLAA 4N0QA 4Y7DA 2WMOB 1K97A 3C1UA 1VMIA 3KEOA 5BYJA 4DADA 5HZHA 3DTVB 5JNSA 3UMSA 1QP4A 2Q6VA 4ZDJA 5AM2A 2WW8A 3BK1A 2QI9C 3JQ7B 5DCYA 2GXSA 4K6MA 4AIIA 2AVDA 1KEZA 4AJIA 3E35A 1YHZA 1BS2A 1XX6A 3QUBA 4KXMA 4ZO6A 1L5LA 4YRZA 3KSDO 5BSRA 3S2EA 1A5SB 1VSUA 4FHFA 5H0IA 1SXPA 2B34A 3FYUC 2ZVJA 2CLCX 4CVNA 3RVQA 1EDOA 5I4BA 2GASA 1G5QA 1XTIA 2D5LA 2OPHA 2VYNA 2R4QA 2RK3A 2ZYVX 3BZWA 3KALA 4K40A 4XXHA 2N9UA 2QMYA 3U4CA 1GAXA 1ZGGA 3C5CA 2PXAA 4CGYA 4MWOA 2BBOA 4MS4B 4TKLA 2JJYA 3TWOA 1A8IA 2IDMA 4JBLA 4KDFA 4QXMA 5E6RB 4ZCPA 2RGNC 3I2YX 2VF5X 3WJ7A 2FUEA 2HZ7A 4F3CA 1PNTA 3LXRA 3K9BA 2RHDA 1X3SA 3C45A 5F23A 1ZM9A 6CHYA 2DETA 4YJFB 2PGXA 4IDQA 1IY2A 2BKEA 2WV9A 5HIMA 1S8AA 1HFWA 1ZITA 4I3HA 3CW2A 3FZEA 2JFOA 4BV2A 1F17A 1KGSA 4FU0A 1EXDA 2B5OA 2WWYA 1LX6A 2IXBA 2RJOA 2I6TA 3RG2A 2A0FA 4E11A 4W5TA 1E2EA 1QYWA 1DAMA 1N2GA 1RC1A 2EJCA 5TEWA 2PXCA 4KYVA 1K8YB 4NOJA 3ZC3A 1W5AA 2D00A 1W5TA 4PZUA 2WA1A 1U3FA 2FCAA 3R0JA 2I6GA 4HR7A 4O33A 5BSFA 5ELLA 2ONJA 5TJ9A 3UUGA 1ZESA 5CLIA 4US2R 1NVDA 2FLKA 2ZJ0A 1QHXA 1QNFA 1FZQA 3E82A 3B53X 4DUGD 2O7SA 3OLQA 4FE7A 4U7HA 4I1VA 3AL2A 2VTBA 2WE7A 2J85A 2WJGA 4WBXC 2XMGA 5TS2A 2FPWA 4YYEA 5E8JA 1LW6E 4HGOA 3BC1A 1QO7A 1U0SY 4RHYA 2CN1A 4MROA 2OXEA 3BGWA 1DTWA 1USUA 2O57A 1RE0A 3LP6A 4ZOLB 2QGZA 3ZBUA 2GN2A 2P9ZA 2GXAA 1H9CA 2C95A 2LRHA 2WWWA 3OQJA 3GX1A 2XTNA 3NVMB 2IZ7A 3QFFA 4FNMA 4D43A 3KZNA 1NYQA 2PRYA 4EPYA 1GHTA 5FOSA 3DWEX 4ECEA 4YMLA 3FHCB 4W5HA 2YVQA 3V3KA 4US1R 2DH6A 3DMGA 3OHPA 3TFWA 4QC2A 5K3DA 3U7FB 3M83A 3RF6A 5CDHA 1IK6A 1FRZA 1CQWA 1CC1S 3BE6A 2HF2A 4FW8A 1G60A 4FYPA 4KBYA 4Y2SA 3WXBA 6NULA 1KEVA 1P62B 1XIVA 2AJDA 3AYZB 5CP8A 4K6CA 5TQ2B 3CWQA 3LIPA 4M87A 3VC7A 4MYTA 1G5FA 5DV9A 4UTRA 3MGAA 3DT9A 3AXTA 4DYDA 5CX4A 2C99A 1C2YA 4LDZA 2YFYA 4RS4A 1E5VA 3HJNA 3B70A 4L0MA 1H2FA 2J3LA 1B3RA 4ZODA 4S05A 3L5OA 3ZXYA 3H3JA 5LQKA 4OAOA 3EXG2 1TZBA 3KQYA 2I99A 2A4MA 4U7WA 4K1XA 3A4TA 1SUPA 5ED4A 3RJTA 4ZVMA 1QIIA 3ESRA 3EXG1 4IHJA 3LT1A 5ITSA 3WLFA 4NXMB 5B5SA 1FDOA 1FQOA 3V42A 1R66A 3GRAA 2JLBA 2W5UA 3C24A 1GNRA 1CR2A 1C3XA 4YGXB 5TQ0A 5BN1A 3MIIA 1APBA 2Q45A 3WLRA 1KDRA 3FUCA 3Q7RA 4L73A 5CVCA 3V8VA 1C4XA 3PRYA 2BOVA 3AZPA 3CF4G 4HI0E 3D7SA 4L4SA 4IGIA 1UM9A 1XJ0A 5HSGA 1GZ5A 1EESA 3VVMA 4LOHA 4U7DA 1SG9A 2C83A 3ADKA 5CRIA 3Q3IA 4CMIB 1L7AA 1K6EA 2SCUB 3PQ8A 1D2AA 1Z4IA 3PQ7A 1XHLA 2Y1FA 4TQAA 2ZAMA 4GLOA 3NCHA 3A6LA 1PJCA 1NBAA 2PPVA 5DI3A 4B2YA 4ZQCB 3LA6A 5B3KA 4Z1OA 1ZRHA 1NW9B 1BWPA 2XUGA 1CEQA 4X71A 3TW0A 3AR2A 5KVCA 2J5BA 5FWAA 2HQOA 5CNJA 3G0IA 3RTGA 4FVTA 4KEAA 4RW0A 3N2EA 4X60A 3OT1B 2VNIA 1FSZA 1NFRA 4YP6A 4BKRA 2J4FA 1BGXT 2G8LA 3M6VA 3GPIA 4Q66C 4ZCIA 3WRWA 4D6YA 2QNBA 2R62A 3IVAA 1YHNA 3ZWVA 4D9CA 1SU6A 4EGFA 1D8AA 3AV0B 4JLNA 2Z2JA 3JWHA 1OWPA 5ED0A 3QEJA 2IYWA 4ZFNA 1TMOA 2XB4A 1FE8A 4NF2A 3LW8A 1KF0A 4S3MA 1IPEA 3B82A 1R4AA 3I8SA 3HKDB 4GE0A 4D4KA 1AUVA 2XDQA 3HRKA 3JPYA 4I1IA 4AWBA 1RZVA 2Q41A 2FU5C 1I33A 3C3WA 3V9PA 1RQGA 2HSGA 3AOEA 3BMNA 5DLYA 1M7BA 3ZZUA 1O3YA 4UTNA 3NI2A 4ZVUA 3JWEA 3L1KA 2FY8A 4V0SA 4L8FA 1U9CA 1NVWQ 1OROA 2J9FB 2VSOA 2XF8A 1NIPA 4PLHA 5B58T 4BC1A 3FVRA 4CCWA 2GEFA 1OJ7A 5K8JB 2A9OA 4IPTA 1Z8HA 3FIJA 4OMCA 4DDMA 3AR9A 4IDHA 5JXHA 1BJTA 1YZQA 4DBZA 3WB2A 3W8DA 1VB5A 1YRAA 4LCBA 4JDPA 1IZYA 5FNVF 1Y8QB 2EGHA 3F6PA 4TS9A 2D0IA 1EQAA 4P0QB 5K20A 5IBPA 4YONB 4C3OB 1XNHA 3F7OA 1JDJA 3QX9A 3QW4B 2ZLBA 2XV1A 4BGUA 2OTCA 5CA0B 2W2LA 3ROZA 4F3TA 1CRPA 4EQ6A 2I2BA 3VHLB 1R4NB 1ZK0A 1EEXB 1YI0A 1QYCA 1XG5A 4JVSB 3STXA 3F46A 4C43A 5THKA 4C5AA 1JGTA 3G7SA 4R01A 2CNWA 5AVVA 2DVMA 3HV2A 2X0EA 4D80A 3NHRA 4YT2A 1PCXA 1SQSA 1V8BA 2BHSA 3DHNA 3FNRA 1X1RA 3MBOA 4P7JA 4Q9LA 5GM2A 1PT7A 2VAMA 3KOMA 4LGYA 5AM5A 1FLDA 1BWSA 1PFKA 4DCUA 3H17A 3CJQA 3MJ4A 1E9DA 3HEBA 3ID6C 2IOFK 4ER3A 5JC1A 3YASA 1OB5A 4J0EA 3A1TA 1M2NA 4KWHA 2OFXA 1KY5A 4MV3A 4XH9B 4EB6A 3PUIA 2C0QA 3N2GB 4OKNA 3TBFA 4DQVA 4JUCA 1BRMA 3ZBTA 4JL6A 4EARA 1KSGA 1R7RA 1RJEA 2MYNA 5TMPA 2EKZA 4BKOA 5LD2C 1WPQA 4I0WB 3KSUA 5EYPB 2QY9A 3HYSA 2R751 1U6JA 1ZRMA 3HR8A 1FJ2A 3QE2A 4N65A 1C3LA 1NX9A 2JCXA 3RHFA 1X14A 2FP4B 4YXWD 2QRKA 1CVRA 1Z0ZA 4IINA 3I39X 3K5IA 2AQKA 3KLPX 4WESA 4YASA 2AI1A 1GYRA 2OORA 5TX7A 2Q6OA 2I4OA 4HS9A 4Q3LA 4XWTA 3LUKA 4JXKA 3RBXA 3STWA 1CIVA 2XQGA 4RLQA 1BIFA 3PC8A 4OKIA 4CKZA 3RC8A 4BGIA 4KFTA 3HV0A 3IP7A 4K3VA 2J67A 5LQAA 2HJVA 1DQZA 3P0RA 1WJGA 4GIBA 1VG8A 3MCAA 3FNGA 3EPJA 1F8UA 2OQRA 3EK2A 4ZMRA 1FPMA 1SXJE 3HDVA 3HXPA 1TRHA 2OBYA 3NPMA 4O59O 3T7CA 3GLFA 2V3CC 1KBQA 1LK0A 1AGYA 1TAQA 3WTCA 4ILEA 1NV9A 4KDCA 3ZJ5A 4DCVA 4Z7OB 1D0VA 4J91A 2BGRA 4UMFA 2ID9A 2QS9A 2RAVA 3ZLBA 3RSOA 3JASA 2GD2A 2GNAA 1EBFA 2DFPA 3NJRA 4MKZA 1ZP6A 3D3WA 3JQEA 3RSCA 3ITKA 2VNJA 2R84A 5CD9A 4WI1A 2Y4OA 4X1KB 5DLEA 1HZZA 2X9QA 3A6GA 4EABA 1ZVMA 3JVVA 3DHWC 2AR7A 1II8A 1XDBA 3PI6A 3GU3A 2FSIA 2IHTA 3D6TB 2JFQA 3I0MA 3GFVA 3G9UA 5BNTA 5I5EA 4XDZA 3OZDA 1A7JA 3P2IA 1Q83A 1LVUA 1XD2B 1TTHA 3EF3A 4YJ3A 5DSXA 5I6DA 1FVHA 3CN9A 2WIDA 1FIUA 3UK1A 5CG1A 3SDZA 4CKXA 1W25A 4K7JA 3HNOA 3QMPA 3G0GA 3NONA 3V80A 3PCRB 2YHIB 2LE0A 2OORC 3KM0A 3K0BA 3U81A 4DE5A 1RPJA 1CCWA 1Y3BE 2JIZA 1N2OA 1UIRA 1M76A 2FHSA 2HA0A 3PC8C 1T2CA 1P1IA 3Q6MA 1H4QA 2PNFA 4U7TB 3IUYA 1DRWA 4JQCA 5DRTA 1I1NA 3L8GA 3HGQA 1GQFA 4ND1A 3ZU5A 3FOZA 4M3NA 1U04A 2MDTA 4MGEA 3AVWA 3F78A 3HR7A 4TX1A 5KTTA 3I2HA 3AG6A 4CMCA 5CBPB 1V1MA 4KO2S 2Y1GA 1Z4MA 3RIGA 1F5SA 4GW3A 2WMYA 4OJTA 3HXTA 3JAKB 3OQPA 4NFYA 4YDSA 1NW8A 4HH1A 3V8PA 1FYWA 2QL5A 5LMZA 1GP2A 3UANA 2OAP1 5DBHX 3WIDA 2R2GA 2FJ0A 5ECDA 5TT0A 3JQBA 4FKBA 5BMVB 4DAOA 4IHAA 4R68A 5EWMA 3MM4A 3KR9A 4B6PA 2DR3A 4NBTA 3AHGA 4C14A 5IG2A 2PQ0A 3INRA 1ZVKA 5BV1A 1F4PA 1ZKDA 3UOAB 4J49A 2QV0A 4QEZA 5JJ5A 2OXCA 3H1FA 4C03A 1YA6A 4HNTA 3F7MA 3C3XA 1RJDA 4NX2A 4QICA 4RD3A 4XJTA 1YOVA 3GT7A 3RASA 4ND6A 1U3CA 2JGNA 4LHSA 2GYVA 4W99A 4H27A 3C7CB 4YHHB 1JZSA 1YR1A 3AR5A 4TLAA 1Z2EA 1N1DA 1W4LA 5AJZA 1JR3A 4UD6A 3MS4A 4RM3A 4F1JA 1Z16A 3AKDA 4JXZA 1BW9A 3PE4A 2B4RO 3A6DA 3QQ5A 3NEJA 2GB4A 2GERA 4M1KA 1DBSA 1KY3A 3U7HB 4ARZA 1UPFA 3N7TA 4YV7A 4L9AA 1K0FA 2WJ3A 1PE0A 4HZUA 1MOPA 4BUJA 3PG5A 3E1KA 3W5VA 1MJHA 1E1QD 5FF9A 3I8OA 3KXDA 3TLXA 1LNQA 1LSJA 5JZSA 3UAWA 1Q44A 1C1XA 3KBBA 3IBYA 3JD4A 1XCGB 4MPDA 4P3XA 4A3SA 1G41A 2RAUA 1MENA 2F6RA 3A4YA 5AI5A 2VQDA 5EMHA 2HAEA 3RARA 5JAMA 1FK8A 1S5PA 3BHIA 2C9YA 4RTPA 4KVZA 1X8JA 2IU4A 4N41A 4NCBA 5IM5A 3LOQA 1CQJB 1AUQA 2VSQA 5AI8A 1GPYA 2Q4RA 3QU7A 1Q6YA 3CBQA 4OHRA 1T2FA 1D1QA 1ARZA 1I6KA 1ZD2P 1SB8A 1XU9A 2GWHA 2JCBA 4E1AA 3GLIB 3L92A 2JIPA 3N0WA 4REOA 1UXKA 3VR6A 1VL5A 4RDHA 4C0WA 2VC2B 3JQBC 4ER0A 3VR5H 5JADA 5CEJA 2WLTA 3KBOA 1YBMA 5HKAA 5J3JA 4U5XA 3OZEA 2W43A 3AI7A 3LTEA 1XMJA 3MCZA 3VZSA 1X1QA 2E4AA 2HL6A 2LTAA 3WGQA 4CV1A 5KOJA 2HRBA 1NOKA 2ZTMA 2I34A 1CQPA 2XMZA 2Q8NA 3QJYA 4RK7A 5FP0A 1YRBA 4Y0VA 1Q6ZA 2CGEA 4RNDB 2B1QA 1L3BA 1SXJD 3DZHA 1JPJA 3DBVO 2OOSA 1P3Y1 4Z99A 4ZVTA 2ZDQA 3RRXA 5M2QA 3NGXA 1H2YA 4KQCA 3QG5A 1OVMA 2OVFA 1LZLA 5JMOA 4Q7EA 4IUBS 1USVA 4O4LB 1N2CE 5DHSA 4EUNA 1UJNA 4EMUA 4EVIA 1Z0JA 4H31A 2NXCA 1XCOA 3ABSB 2OLJA 2VZ0A 1KFCB 3PGA1 1P72A 4ALKA 3BIFA 1T5SA 5CDTA 4RCVA 2ZYAA 5HGXA 4M2LA 4OX9Y 1AHNA 1JQLB 2C4KA 3FJYA 4QNNA 3ZE8A 2P6UA 4O1MA 5LQUA 1TF7A 5LIPA 1NZFA 3RK1A 1RQNA 4MS1A 3X1YA 3OIFA 1LRKA 5JSUA 4E5UA 3OJFA 2BKAA 5BOSA 5KDOA 4DR6B 1SPBS 3O3MB 4KV7A 1FXWA 1LSUA 1GCGA 4F04A 1J5EB 5KCMA 1KQFA 1XTPA 2XWQA 3GCGA 5JCOA 2CLSA 4JVOA 3GRUA 2OCYC 4TLBA 3IR5A 1BHJA 2I5PO 3AGQA 3W6UA 3BD6A 3HZHA 4ZOBA 3R6WA 3RRNA 4IDEA 4IKOA 4C0LA 3OZFA 3D4NA 4Z4GA 3IO5A 1E1LA 1JLKA 4A2QA 1E2FA 4BJ5A 5ALMA 2JPDA 2V5AA 1OTHA 3VZBA 3WLOA 1NQAO 4HAWA 4UXHA 2K4MA 1HDYA 4QU9A 3RH0A 5HR5A 1EGMB 1AKUA 1KOJA 3GV0A 2XXAA 5DNUA 1T4BA 4CZ2A 4S04A 1I5EA 4ZKDA 2GPTA 1GJRA 1JAXA 3O2SB 1LPNA 4TWBA 2GYUA 2C8LA 3F7NA 3E8SA 4QFBA 3RVJA 2PX3A 3R9XB 1IJFA 3KWMA 2F00A 1F1JA 1W6UA 4GP6A 3TLAA 2FZVA 3QVGB 3SD7A 3KSAC 5ABPA 1TGYA 2VBIA 2B1RA 1HKHA 1R5JA 2QX7A 5JCPA 3DDSA 4A03A 2YZNA 2ZUSA 1TYAE 4KNYA 2DMRA 2RGBA 3QFTA 3K7EA 1FW6A 4IIHA 5ITZB 5BN5B 4AURA 1JDPA 4COKA 4GI3A 1NUHA 1BVRA 1RQPA 5DBOA 4G5SA 3RVLA 3ZDDA 3ETCA 5AK0A 2JATA 1C0PA 2QN6A 5K45A 1ZD8A 3EJ6A 1SEVA 4OQXA 1M0EA 3LX5A 1CW2B 3AJDA 3W9UA 1JQJC 3KPWA 4MP3A 4Z9AA 4CG1A 2NADA 3AR6A 4LBWA 1N9ZA 1NBHA 1PW7A 4PQRA 4D6PA 3STUA 5JCOC 3GQBA 1SUWA 5DOZA 4EO9A 1H5QA 4EYKA 3GT4A 3D8NA 3GDHA 1SC1A 4OOFA 3AESB 2XA2A 3DXYA 3UW1A 2O8FA 2QTFA 4FR2A 2VL7A 3TMAA 2C2BA 2HU7A 5JCXA 2IOFA 1JL3A 1ZSNA 3NBMA 4KH1A 1SKUA 4DLLA 3BHJA 5JSZB 4MEAA 3T1NA 3NOVA 4V0LA 4XJVA 4YAKA 1T1JA 2QYSA 1T35A 4H0FA 3G2NA 2IEIA 3TRDA 3HJGA 4RTRA 1N9GB 3ZD6A 1NXVA 2GMWA 4C7MA 1MB4A 3VZPA 2B0JA 2JKZA 2P2ZA 4DRYA 1BZYA 5DW3A 1I3OA 5C1OA 1D2EA 1GCOA 1W581 4GI1A 4LRWA 5GV7A 4C3VA 1Z82A 4F5ZA 1KJNA 2X14A 1F0KA 1E0DA 1JP7A 2A5LA 3I9LA 4O2AF 3TQFA 5JVDF 1QLWA 3MERA 1KXJA 3HWRA 3PSAA 1LD3A 5KYUA 2ZJ3A 4GP9A 4HVCA 2WJWA 3FVQA 5FWYB 1WSAA 3Q5GA 2X8JA 1YRWA 3B12A 1YB1A 3JQFC 3UYLA 1XDZA 4CFZA 1FZTA 5IDVA 2X40A 4LV8B 3HLYA 3BGDA 4B4OA 5TQVA 4YHBA 3BM5A 2P2DA 4W5OA 1B73A 2BSXA 3RADC 3LDGA 1RP7A 4GLFA 3RUPA 1WZIA 2BZSA 3ISTA 2QZ9A 2XB2A 5HDQA 4GMDA 2AOUA 2GAFA 4KIWA 1ZUNA 3ESDA 5H3CA 1J2JA 4CM9A 2AUTA 3NDBB 2AWNA 2C7BA 5DULA 1X7YA 4JP5A 5G4LA 3T15A 4YRJA 4EKDA 2IF2A 3F9IA 4WUTA 1EK0A 1SIBE 3IDQA 3FKQA 5HJ2A 5TC4A 4DTIA 3SJZA 4TQUS 1HDIA 2NUTB 3AR8A 3KPUA 4JR2A 3RBVA 1E6WA 5ICGA 1SU4A 1OBHA 1E3LA 3BH7A 2AFIE 4L50A 3RS8A 1U1DA 3KKOA 1NMYA 3UV3A 4Q4JA 2EZTA 4MQ5A 3TW4A 4HWRA 2XSZA 1T0HB 1FU4A 3ZHCA 2H4XA 2BEJA 5FJIA 3KJGA 3R7SA 2ZP1A 2D1RA 3W05A 1VB3A 3BRWD 5KYYA 1E7RA 2XXBA 3MD0A 1S4QA 3WKAA 2OAQ1 4EG4A 7AT1A 2BFEA 3AHHA 1ZICA 1IDOA 5CDUA 4FOTA 2HPZA 4N9QA 1AK9A 1C1DB 2IP4A 4ZVVA 4QFDA 4RX1A 3S2YA 2WSSA 3Q9LA 3CKLA 3H8JA 4R1TA 2LCQA 3HKBB 4TMXA 3OO1A 3WLLA 1IOVA 1AC5A 4YCNA 4PW0A 1JDNA 3IR7A 1VPTA 3C0KA 2BEUA 3RO7A 2WTBA 5IJ9A 3IULA 2X8WA 3MT9A 3MJDA 2GXUA 2VDWA 2O5VA 4EI9A 3WA6A 1C29B 1W8IA 2CLHB 2XCTB 4AMBA 2IIPA 3BHMA 4V0MA 1J0XO 3KQOA 1OBFO 3NC4A 1UZMA 3VKVA 3D8UA 1U0HC 1A5BB 2KWIA 4OHUA 3WLPA 1FRQA 4PX9A 4TUYF 1WSWA 1XA4A 3AT1A 3FOEC 1CZOA 3DH0A 3K73O 4I5GA 5JJIA 4PM4A 3UJ6A 4KUGA 1P6UA 1ZJ5A 5YASA 1QCCA 4YAJA 1S4MA 1TMKA 1LSSA 1UEIA 1PT8A 3FETA 3B1ZA 4BP9A 3FTFA 2FDCA 2QR3A 4UVGA 2FQXA 3B3GA 3JWIA 1R16A 1NQTA 5C80A 1JZQA 1Z75A 5KS2A 1KAQA 4WLVA 4F5YA 4JQZA 1TU0A 3N70A 1R0KA 1XVLA 1U2RA 4Y6SA 4C4YA 3D6VA 3E81A 4QTYA 5ARBA 2R1VB 3JATB 1T0IA 3ILYA 2YZGA 3IAXA 3ZLVA 3VO2A 3JX9A 3K8YA 1J56A 2CMKA 3CUUA 1MH9A 1MJFA 2G07A 1XRNA 2G77B 2O8DB 3HVIA 3FR8A 4OATA 2R25B 1Y5IA 3THRA 4KN6A 4QODA 2JVIA 4MGKR 1EM8B 2BGKA 3NO4A 1T6ZA 3BVPA 1D1SA 3T8YA 4ZOQI 2C4TA 2LVBA 3B6JA 1FNSA 4G56A 4B6QA 4I55F 1GEGA 3VPCA 1NI5A 2O23A 2PVPA 1NXTA 4R1MA 4TVBA 4U2EA 2FPGA 3TLBA 2FN7A 2XW6A 1KPGA 5LUBA 5EHXA 2YVLA 1QV9A 4KI0A 3PX3A 5LQMA 4OHXA 1UPCA 1SD1A 3MRXA 4R8MA 5TR9A 1L8AA 1SUAA 4D4JA 4JH0A 4EUHA 1N5KA 3AJRA 1BFKA 3EVFA 4YI5A 1FYVA 2HA2A 5EJ7A 1TF2A 3LGSA 5EKUA 1PZHA 4MOWA 3SS7X 2AR9A 5F1PA 4MPJA 2ES4A 3ZUGA 3NHBA 3LX6A 5TJHA 2IZZA 3H2YA 4IM7A 3T5BA 4PSKA 3SFZA 1GTJ1 3OA0A 2ZRQA 1NBMA 5BURA 4JBGA 2Q5QA 3PVCA 4K03A 3AOGA 2VHTA 4L85A 4RDIA 2B9EA 3E3NA 4Z4EA 1NBWB 3GA7A 1SCIA 3UB2A 1Z4QA 4TRNA 1I10A 2Q8PA 3VYSB 2PT9A 2VYVD 4ACBA 4BO5A 2NMVA 4I19A 2ZRHA 4WCVA 3DDWA 1SO8A 3LPDA 5DP1A 3H5TA 1NKSA 1Z5UA 3QOXA 2WT8A 2KS6A 5L7TA 4Z7NB 5LA6A 3KVNA 1B15A 1PS9A 1ZMBA 2ZB7A 3EVCA 2DJIA 4JMLA 1VPWA 3SEZA 3UPTA 1OLXA 1KZ7B 3JQAD 3LG2A 1JKJA 3V1LA 3TRHA 4GQAA 4KBGA 5BXQC 1M73E 4B75A 1HDZA 2OCDA 4L72A 1UXIA 5A1JA 2AWOA 1G291 3EARA 3OHMA 3CUSA 3EZLA 4GU5A 1II0A 4LZPA 5J4LA 2ADOA 1PVOA 1P73A 3IMKA 1M72A 2HBYA 1YVEI 2B99A 2L42A 3GJYA 4DLTA 2PWZA 3BWEA 1OX6A 4QJBA 4LF4B 2DERA 1DELA 2QN2A 2XMCA 3ZGZA 2ZUWA 3JZDA 3R4VA 4R3WA 4U7PB 4XYBA 3W6PA 3MCVA 1GQOA 2R8OA 2GZDA 4HNHA 2Y3IA 2C5HA 4TMFA 2I3GA 1FNNA 2B61A 1YA8A 3KUXA 1ZS9A 4NMHA 4XTRA 5EOVA 5AUNB 2AL7A 3OOJA 4Q9DA 5JPIA 1IMOA 1SR8A 2CXTA 2Y93A 4YT5A 1YIOA 5CFZA 3UQZA 5FUVA 3QPWA 3T9EA 4D44A 1NJSA 1SB9A 1ZFNA 3CR3C 1QTRA 1KR2A 3FCUB 4MEBA 5F9FA 3O8OA 2CL0X 2OVBA 3ZXIA 1IFXA 4PLWA 1XQ9A 1W5SA 2KJQA 3H4MA 1WMEA 2V45A 3FF4A 4RMHA 3M3HA 4R84A 1H4VB 4I8XA 1W0KD 2IVFA 2XUPA 1NI3A 2W2XA 3D2CA 3AEUB 3C8ZA 4DBLC 1DAFA 1LI4A 4DS3A 4P7FA 1XPRA 3W2TA 4W5NA 1BMQA 3HFRA 4PCAA 1R12A 1FDRA 3BRQA 1K06A 2GN0A 4FGWA 5ARCA 2ZYIA 2H2WA 4DUYB 4EW3A 3R3WA 1T10A 4KR7A 2VAXA 4BL5A 1W2HA 2Z5VA 1SMKA 1ZC4A 4DQ0A 5AW2A 1EK2A 3AVPA 3I2FA 1VYHA 1Y9AA 4LZAA 4DMGA 1DEKA 4NLLA 3ZHTA 6REQA 1B93A 5KTSA 3KFLA 4NCKA 2A7XA 3L8MA 4PC6A 3VR0A 1DX4A 2Y1XA 2WTEA 4XZ3A 7ADHA 1E6LA 1NJ1A 4RPKA 4AJ9A 3INTA 3V9AA 5FBHA 1V5EA 2Y92A 1KVUA 5GONA 4E1BA 1G4AE 4ARBA 4EY4A 5K0SA 1P2TA 2DPMA 4H4DA 3OZSA 1BX1A 5EE1A 3HUEA 4FUTA 1ZX1A 4UBJA 3A06A 1NR5A 1KI1A 5EHNA 4ANFA 3VI3B 4AO7A 4C4AA 1U1EA 5T7BA 1UM8A 4Y9DA 2COKA 2FUG6 2HMVA 3AHDA 4EKGA 3BA6A 2H9AA 3KOUA 4LJYA 2FPPA 3AIMA 4KPUB 4WGFA 3ZE0B 3O75A 5BNZA 1A9XA 2WZBA 1ULBA 3DPUA 3LS2A 1DFGA 2E5WA 4Q4HA 3PSHA 5DM70 5DNWA 3VNSA 2R87A 2GK4A 3QFCA 1DO8A 1HE8B 2C3MA 4MWBA 1XKXA 1E2KA 2GRUA 2ZSIA 2Z3WA 3FVVA 4P0PB 1E69A 3TI7A 1Q95A 3I37X 4WRRA 3PV0A 1KTIA 4BJ6A 5A5GA 2FXIA 2YWDA 1T29A 4C5BA 3CVUA 1T5BA 4NJEA 4MXDA 2QRNA 2CHVA 3CX8A 1QLJA 1NN5A 3CLKA 2QUJA 4EY8A 4E2YA 4UDYX 3B2QA 4CKWB 5ADWA 4F8JA 1CUGA 4W9RA 1VFNA 4NU8X 2CBXA 1WCXA 4X90A 1NF3A 1N3LA 1RM3A 4ZARA 2X4IA 4M53A 1ECBA 2OO5C 3CNOA 1LQUA 1PHRA 5A4FS 4JITA 3KJZA 2WQ7A 2NP7A 1WPGA 3PT5A 3AERA 1O95D 1OA1A 3FMIA 1BN7A 1YJXA 3L4SO 4JJGA 4LDJA 3TEJA 4EFMA 4ZJZA 4YAFA 2EFJA 3U2QA 1XEXB 2UZ1A 4M38A 4WK6A 3T0GA 4RD0A 1ZXLA 4B6OA 4EPVA 3GRPA 4ARVA 2Y1WA 2ATVA 5JQGA 3E9QA 4H4CA 4E6PA 2R5FA 4X64B 1W7AA 2JANA 2DAPA 3GFTA 1J7JA 1GPWB 2X19A 4YAWA 2OYCA 4TV8A 3G2KA 1KK1A 1RJGA 2Y68A 2ZQYA 5BVGB 1SVLA 3O2NA 3O6VA 4QM7A 1RRCA 1E5QA 4PAOA 5IMSA 3FSRA 3ETGA 4TVKA 1LBEA 2C94A 3GDWA 4BCCA 5JZOA 3NTVA 1GADO 2Z6VA 1OI3A 4O0MA 2VJNA 1QDEA 4TPKA 1FBTA 2QGFA 3RK0A 4GPBA 3EZXA 2GJAA 1CLUA 2O3TA 1R0SA 3FB1A 3I53A 4MVJH 3CVJA 3H4VA 3N8GA 2WAMA 3IPLA 4UPDA 3MJSA 3TR5A 3KQKA 2QE6A 1X6VA 1JF8A 3OTWA 4RULA 1Z4NA 3KHKA 3VC2A 2O1EA 1P4JA 1VE1A 1A50B 5DFAA 4Z3DA 3ILXA 2ID8A 3ANYB 3VA7A 2IL1A 1KP9A 1XXLA 2FX2A 5K0BA 3WB0A 5MFPA 2CVZA 3E48A 3MT0A 4YCJA 1JHYA 3NAZA 1Y3HA 1SOVA 2POQX 3VFDA 4LJRA 4PF1A 3GHYA 3QPUA 4Z54A 4RZ3A 3DR5A 1S7CA 3KQHA 2ZG6A 4B3TB 2OBNA 4WY5A 2O0HA 4KP7A 1EU1A 2JZNA 2J6HA 3SN6A 1JXQA 4CJXA 4HPXB 4I4TF 4JKYA 4NZPA 5DM0A 3RS5A 2J9ZB 4MJXA 4RVHA 2ZS7A 5HE8A 2Z09A 5DEIA 4UQLA 3IIKA 1NBEA 3KOWA 4G86A 1U4NA 2D54A 3PCXA 4PO3X 3H84A 4HQ6A 4D9EA 1NW6A 4S1TA 4YRPA 5LU9A 3HYNA 1FDUA 4CFYA 1VBKA 4WLUA 4M46A 3HU3A 4BNFA 3ZD8A 1KI9A 3JS5A 4H7DA 3MWEA 1TA4A 3D6HA 1O96A 1YJQA 2BUBA 1Q0PA 3R4CA 4HTFB 4LVUA 5ER9A 4LJ6A 2R97A 1PJRA 4CT5A 2QJRA 3MXOA 1CZLA 1Z6GA 1SCUB 4YJ2A 2HEIA 3N76A 3NORA 2QVBA 2V0NA 1JDTA 1ONOA 1QCZA 2AW5A 2HSDA 2HO4A 2L18A 1KZYC 3DXFA 3H2SA 4C3ZA 3GY0A 3VM6A 5HILA 3NGMA 1PVDA 1QNLA 2GHRA 1W29A 2RC5A 4HQRA 1RQ2A 2J59A 2UZIR 1CFZA 4RHEA 4BBZA 1PEDA 4L8WB 4HADA 4EF5A 1KIFA 2HTFA 2XCIA 4HBGA 1PSDA 1QQ6A 2PL9A 2V9PA 2ZI3A 3EXEA 3FKSD 1CR1A 3FW1A 3CN7A 4HDKA 1G38A 3C39A 1J49A 5JPCA 2E18A 3ASVA 3UPUA 3E4CA 4DLVA 1WQ3A 4WN9A 3ER9A 2FPIA 2FOXA 4RIEA 1L5GB 3QYFA 4Q5IA 2P3LA 4UBMA 1SRQA 1Z0FA 2X58A 4YIKA 4DSTA 3LCCA 4DWWA 1SIOA 2NP6A 4XSHA 3HVKA 2R0QC 4Q9IA 5ENDA 2WHQA 1M34E 1U9ZA 4RSRA 1WHTA 2ZEJA 1Z2OX 3BMQB 4EJ0A 3UKOA 3KQSA 2VP9A 3PLRA 1KJJA 3UUWA 2E1RA 5HTKA 3JZFA 1KEKA 2R60A 3BGSA 2I8AA 1OY1A 2J4DA 3DTYA 3GUVA 3IO3A 4MLPA 4OLFA 4P98A 2BFCA 4MIEA 3GFGA 1UKYA 1VIMA 5H7XA 2GPWA 5HBRA 5HJEA 2F8LA 5EJEA 3H2BA 3MMNA 3H99A 5AW4A 4N48A 3SHFA 1UC9A 2ZYHA 1WEHA 5IZCA 1CETA 2PZMA 1RIIA 3DAFA 1EK1A 3LNTA 3WISA 4ZIRB 1G7TA 3VMFA 4AMZA 3ZW9A 1CRWG 3KAJA 2WSIA 4C87A 2RG7A 3E84A 2X5NA 4NS4A 4PVCA 3RSSA 2PUFA 2F4VB 4LXYA 1OH6A 1CPYA 1N92A 3Q0IA 1UDWA 1NY5A 4FMPA 4I99A 3DYBA 4ESEA 1TD1A 1IL0A 2CHUA 1EVIA 5CFRA 1SVIA 1VKHA 3IIIA 4ZO7A 2AUNA 4JLKA 1VKNA 1R5BA 3FPEA 2YMQA 5EZ5A 4AECA 4IIJB 1JN0A 3AUKA 3DMPA 3ROPA 4QTZA 2RJ3A 3PWKA 4A1FA 1Z17A 4RIIA 1SU8A 2P8SA 3IBSA 1OMOA 2V6IA 4LHVA 3WKDA 3LYLA 4OKSA 1HRKA 4QPJC 4WGGA 421PA 4PG8A 2VK2A 1UBHS 2CMDA 2E4VA 1F2UB 2Q27A 4TMVA 3MJTA 4D9KA 1QF9A 4IDAA 4P54A 4EG8A 5ILOA 3KSBC 1IY0A 3Q85A 1MPTA 3AR7A 1LV8A 1YJ8A 3A58B 4FFVA 4MKGA 2PD4A 1WOMA 4AAYA 3I9NA 5LZ7A 2FOLA 1S89A 3C3DA 3R7FA 3IKMB 3VPSA 3EXIA 4L8GA 3V8QA 1F0YA 1BQ3A 4MGHA 4M22A 4KDEA 1SKAA 1ONNA 1WHSA 1Q7BA 1QMPA 5EZ6B 1F60A 4OMFG 4ZAVA 5JLAA 1L9XA 3HL4A 4GZLA 5EJ6A 2WF8A 3GLHA 1BWQA 4ICIA 9MHTA 2GM9A 1JDUA 1U4OA 1UJCA 3AM3A 3IAM1 4U39A 7MDHA 1JFSA 1C8VB 1P6QA 5FBKA 3BB4A 5ILGA 1J1IA 4P4SA 2R6GA 3FTDA 5IKPA 4AWXA 3LQ1A 1RYYA 2JJ1A 3LHIA 4AKEA 2Z0MA 4KQEA 3ZXSA 2BJVA 1GUZA 3DBIA 4UMEA 5G1OA 2OQVA 5LQSA 3BWMA 4HAOA 3V1UA 3VHXB 3F4LA 1UK7A 5I7RA 2Q3EA 3NS7A 2XUIA 2AFIB 2HSEA 1U80A 2JARA 2LXNA 3C5HA 3KD3A 3L0ZA 2C5FA 3PQEA 1XF1A 4G36A 4LOIA 4RL6A 5ALNA 4YQEA 3GD7A 1U1GA 2AMFA 3SBOA 4D1YA 4R2IA 1HX7A 4ILKA 1WXGA 1G0NA 1WXDA 4HG2A 4KTTE 4L27A 2ZGVA 1NXQA 4J07A 1WB6A 1DUVG 3SJCA 3IT2A 3H6KA 2IKSA 4KXVA 5FBLB 2O05A 2DU8A 4WKBA 3Q41A 3VBEA 5I7OA 3RHTA 4OXRA 2R7LA 2FW1A 3OX2A 1A76A 4XE5A 3JW8A 4M98A 4MW7A 4NNJA 2QJWA 3TNJA 2QLMA 1VJCA 5CA1F 1PJZA 1QH1A 2PX0A 2ZIVB 2GTPA 3MGKA 2FSVC 4OYYA 3RFVA 1J0CA 5IHPA 4YMWA 4N6GA 2UVQA 3U7RA 4M8SA 1N5MA 4A0FA 4H1HA 4EYOA 4HX9A 4RQTA 5B36A 4PG6A 3FJOA 1TVKB 1RRPA 2R9VA 4RH0A 3FZYA 3GK3A 4Y9UA 5A0VA 3WV5A 2FJPA 4TYQA 4UUPA 5HBGA 3CVWA 2QGNA 3KJNA 2VH1A 2BUCA 1VIVA 1YFLA 4YDHB 1ZY2A 3PWZA 1NM5A 5H5JA 5B53A 1OA0A 3K32A 4R7ZA 2R8BA 2AF3C 2P9YA 1JJ7A 2P77A 1Z2DA 2DQKA 3TB4A 1GO2A 5HKKA 2FWBA 1EP9A 3CXRA 5JWRA 4J29A 2C7QA 2Q4DA 3TZBA 4M0DA 3PFHA 3DQZA 1W76A 5G3ZA 1LS6A 3PIDA 4GOMD 4NAVA 4K6FA 1B14A 5IASA 1Q1NA 3A9UA 1TUGA 5HK8A 3FM9A 4NICA 5ADUS 2IDJA 5DNCA 2M2IA 3UXHA 5E4FA 2BKVA 1T4CB 3QUCA 4HS4A 3BEDA 2HMUA 4MAAA 5BSUA 5BV7A 5CCDA 2IOHA 1G20B 4QG3A 3ROXA 2PWPA 5IULC 2IXFA 3T7EA 4E5MA 1RNLA 1P9LA 4ZT3A 5C46F 1C9JA 1QS0A 3G9ZA 4LE1A 4ZYZA 1HYQA 1VIAA 4DIMA 2PUVA 1UQUA 1QV7A 1QVZA 4P3OA 3IESA 3RVBA 1W59A 4HUQB 3UC5A 3C7KA 3K0FB 3C7TA 3JYLA 1WKBA 3SM3A 4EY7A 1RDFA 2UUCB 3NH9A 4G4IA 1GGKA 1N57A 1U0GA 4OI2A 1OI2A 3N2YA 1PO7A 3E9MA 4TOIA 1ZNXA 3M4NA 3QA9A 4W6QA 2D1QA 3RJ9A 2QQEA 1XAGA 4CMBA 3DO8A 1PX2A 5KKAA 4DCGA 3RKUA 4MV0A 1DP4A 4I1YA 5AFSA 3PIRA 2WTNA 5CFMA 4EB0A 1Q12A 3OOWA 3CSSA 3L6DA 4IYRA 2Q3LA 1UOQA 3KXKA 1EZ4A 4YJHB 5FO1A 3T3MB 1YB2A 2J4CA 3C2QA 1E89A 3HY3A 3K1JA 3ODGA 4CF3A 2VUHB 4IDNA 4M1EA 2BV3A 4JI4B 1V95A 2FP3A 4X0EA 3F6BX 1X9IA 4A2CA 3HJRA 4MV8A 3WLKX 1YR8A 1NM5C 2CF6A 1KGDA 3DEJA 3EXFB 1OC4A 4Q7QA 2XWPA 1R0CA 3O8DA 1E7SA 1OFVA 3D0OA 2X1MA 3HH8A 3DT8A 2GRJA 1FQWA 4IEIA 3U0BA 3ZI4A 4L28A 3ZWNA 4LA4A 5IS2A 1IMJA 3L01A 521PA 3ZS8A 2ZRCA 2ZIEA 1E2QA 3ICVA 2XA9A 4RZSA 1Q0UA 1XP8A 2YWCA 3OLYA 4TQ9A 4XIJA 2A5FA 1KO1A 4HYEA 4XVRA 1P9NA 1RJ9B 2ZWVA 1H8EA 3CHYA 3COZA 4DIUA 4UOQA 6Q21A 2ZIZA 2H08A 4YRTA 3QQPA 5JS1A 1C7EA 1QGUA 2BKXA 2GFHA 3LDAA 3TOZA 3TZ6A 3UICA 4C6TA 1DJOA 1DMRA 1CG6A 1MGOA 1RHQA 2W6PA 2YJ6A 4MV6A 3DPIA 1SVWA 3GWZA 4X94A 3WZMA 3R8FA 4BMYA 1M6VB 4TZKA 4MGYR 1ODTC 4AQYB 2B7CA 4N6NA 2CLIB 3ZVRA 1JEQB 4QLAA 2GM4A 3PNKA 4CHTA 1D07A 1JQ5A 1A27A 3H2ZA 4RETA 4KLZA 4D9IA 4G0QA 5HYVA 1AXRA 1T0PA 5CJ2A 4RA9B 3T9FA 1KZ6A 3PX2A 3HB9A 3V6MA 5CURA 3QVWA 1R0YA 1R4ZA 2O2XA 3DVRX 3VNVA 4WBNB 5HJ7A 4HXGA 5IU6A 2YYZA 1G9XA 3IAHA 2RBKA 3ILSA 3EN0A 3K0AA 3LT5A 4LK2A 4QGGA 3CE9A 3GCXA 3VHRA 1KRHA 1Q1AA 2OCXA 1BG6A 2CL6X 4MMYB 4RHUA 4URFA 4EHKA 2EJUA 2C31A 1TZKA 4RFSA 1NGSA 1VYTA 3C3BA 3LLCA 1Q22A 1X7ZB 4GVPA 3OI7A 4YUXA 4FB4A 2XD4A 3GOQA 2FR0A 1ELOA 3LUGA 5KHLB 1M75A 1V71A 2BMVA 2RHGB 1J0AA 4IRMA 4KDRA 3UT5A 1XFAA 1NF8A 5EP2A 4W5RA 2AG5A 2ZTLA 2ZSBA 5D3QA 2C92A 2V03A 4BX3A 1W34A 1WMDA 3JWJA 4GBJA 2QN1A 1H6DA 1JB1A 1RCTE 2CDRA 2IKQA 3L43A 4G5OA 4LPKA 4MR9A 1IHOA 3VU1A 2ZE6A 4OXYA 2VRCA 2VF2A 2J7PD 2NV0A 4XQCA 4Q6BA 3FPLA 1E99A 5GGXA 3W2HA 1NLUA 1NHWA 1P2GA 2GD6A 2XYQA 3ZDAA 3LKZA 4D26A 4ETWA 1BOFA 2UVPA 3K6KA 1JAYA 4R8KA 3D8BA 3GXOA 4UOZA 1ESZA 1H23A 2VRNA 1GGJA 2ORYA 3AYXB 1UL1X 5BW8A 3MJRA 5LYJF 4LYJA 3G2PA 3SPXA 5CW1A 3K3PA 3P9YA 4GM4A 1V43A 1D4OA 1L9KA 4WINA 2DUNA 2GKOA 1P45A 3SGLA 4FSXA 1KQNA 2A57A 3OWOA 2ENUA 2QD3A 2RH4A 2G1KA 4EGCB 4GYWA 1HGXA 1SXIA 2NZWA 2P9FA 1FP7A 1U0LA 4MGIR 3KSRA 4AZ3A 4F86A 5AW8A 2WOJA 2NPIA 3ZEIA 2CNBA 3RVRA 3QUTA 1ZMRA 3DEHA 1FSGA 1SY7A 3MOSA 5DLQC 3JY6A 4Y2GA 1F7UA 3EQZA 4R9UC 5L40A 1NLYA 4TSFA 1UDBA 1V25A 3O8RA 1PGQA 1VPEA 1T9GS 2PFKA 3VRHA 5KWIA 2YQ4A 2LCFA 2VF8A 2A1UB 2VHZA 4L6CA 2NPOA 4DQDA 1NJFA 4F97A 4KRFA 1YZGA 4PQEA 4E2XA 1MA0A 1QKIA 2SKEA 2AMVA 4ALNA 3P52A 3WGKA 1M2KA 1VZ3A 1EBUA 2BM9A 3T7AA 1LA2A 4ZO4A 3DFFA 3OEWA 1UJ4A 2DWUA 4NVRA 1HDGO 2IUEA 2QG4A 3NPAA 4ZREA 1R64A 3O3CA 3C3PA 3G1TA 2PJUA 1QHSA 3S1AA 1YCDA 3ZWXA 2J41A 3SC6A 1Q0LA 5LWQA 1REQB 5BNIA 2C4MA 4OA8A 1D8TA 3L8FA 1GU0A 3DEZA 1ZGHA 2YUTA 3GBPA 4PPNA 4IMJB 4WKPA 4V2IA 2V7BA 3A8TA 1BVYF 3R23A 1TU4A 3PFNA 4I6EA 1IY1A 1CX9B 4DSNA 2O2SA 2QT9A 3V2GA 1HT3A 1P31A 1XXHA 1BCSB 5TPWA 1DXQA 5HIAA 5KYGA 3ACCA 2C8VA 2XADA 1XTUA 1SBHA 1U98A 2W22A 1I2DA 4IXMA 1Q0SA 3KLNA 4QPCA 4NPHA 4XGKA 5D7BA 3EH1A 3SCZA 3QF4A 3QFRA 3ZIUA 3B8HA 5E6UB 3NC0C 1RYFA 4X7RA 3DE2X 3V4VB 2J0SA 1BO6A 2OP1A 4LOLA 3HC7A 5ALYA 5K3AA 5JSHA 2FK8A 3WSWA 5DJ5A 1ZGZA 1D7OA 2POCA 4O63O 4QOHA 1SOMA 5AXAA 3ZPXA 5AKJA 4OGGA 2ZT5A 2CD7A 4G5RA 4N9WA 1LK5A 4AK9A 2AC4A 3UKDA 1LGYA 1PQPA 2DE0X 4RXTA 3I23A 3PJEA 2HHHB 1GN9A 4L8YA 4HB4A 2D5IA 2XVZA 2GCIA 3W1EA 5JS8A 1VJ1A 2VO1A 1WCV1 4FQ7A 4WZBB 2FPKA 2FMKA 4UUNA 3KAKA 4KIUA 3MHTA 2Q3FA 3VNQA 4JC8A 3AZOA 3OFJA 1GXSB 3B7GA 4L4UA 3AF5A 4C6HA 4UEWA 1T6YA 1XU4A 2E4UA 4D3YA 3E2IA 2VEDA 2JGFA 4OJQA 1FFXB 3IQZA 3RHZA 2XTJA 2OBLA 2C97A 4Z7JA 2ZJ7A 2ZSHA 4M6WB 4PXSA 2FEKA 4F5DA 2HNKA 5AKLA 2G6BA 5KNDA 2IH4A 4AYTA 4BV9A 2GK6A 2NU6B 2VPZA 2VQSA 4L8VA 4HFMA 4BVEA 1XO1A 2HY7A 4FQ8A 3RIHA 1DRVA 4XYMA 3DKKA 3VXKA 1FCJA 1IN5A 2GAJA 4RJLA 3SQXA 1K4KA 4YROA 1PG0A 3MJVA 1NXPA 3R3JA 3HJHA 4U9UA 2CDCA 3NIFB 4QNRA 3AVOA 1P8JA 3I6ZA 1A8SA 5CLLA 4EA9A 1G8JA 2ZPAA 4C20A 8LDHA 3R5KA 5A05A 3DLPX 2VPQA 1PR0A 3I2GA 4Y1RA 3EIHA 4F9FA 4UU0A 2AZDA 4IOJA 1UCFA 1PBNA 2PFSA 3LBIA 4HAXA 4K9QA 1UMBB 3HN7A 3PUKA 5D84A 5ALKA 4NNPA 5EXXA 3TQTA 1RZRD 1H66A 1YRQA 1XAHA 2XMQA 5A7HA 4I1SA 2BR3A 2YJ5A 3EEBA 1BYIA 1ICEA 2CZQA 2NXEA 2HMSA 2WJ4A 2GA9A 4E2ZA 2RDMA 3W5SA 2PMEA 4GPTA 4REQA 3WWYA 1MIOB 1AIPA 1VIYA 4UHKA 1LF0A 1TEZA 1KRXA 5ITVA 4XUDA 3A3KA 4LZZA 4BQRA 1UMDA 1IZ9A 3Q5EA 4HN2A 3RRYA 4FYMA 2C1XA 1T3HA 2XKJE 4KXWA 4X61A 5GV8A 1AUPA 1T4DA 5LP6C 4BRUA 3RS0A 2CKMA 2QZ4A 2HFKA 4RGQA 4D0GA 4V24A 4OY3A 1VLZA 3BCHA 3DFIA 1CSEE 4TZ6A 2WJJA 3CUEF 1WOYA 2WZCA 3PXXA 3QEOA 4QRDA 1D04A 5T4FA 2AHOA 5FPPA 4J1SA 3T5DA 3UFBA 3GLGB 1Z29A 3WVNA 4QEKA 4CW7A 3VR6D 2L69A 3C48A 1G2PA 2ZQZA 2RHJA 3L05A 2WJHA 2I3ZA 3Q6NA 2ZAIA 4JLPA 1KMIY 1OGIA 2FWNA 2N0SA 3DUWA 3S2SA 2B4KA 3U3DA 5C52B 4JFAA 2VK1A 2QMEA 4QEDA 1H85A 4HQLA 4LCEA 4FMCF 3VR4A 1YB5A 4EGAA 3FDFA 2YXNA 5ALDA 4XX0B 4UM8B 2D2IA 3U4IA 4P1ZA 1RBZA 4RLFA 2DG2A 1QG2A 5BYAA 5C8YF 4K46A 3FSEA 3KELA 4BO7A 1KEWA 1WBJB 2JDIA 5D2CA 2P3SA 1YU9A 2VP4A 1MV5A 1Y4SA 3EY9A 4N49A 3A6JA 3L77A 3LHKA 3KR1A 3FTCA 3AMVA 3P9XA 1KYTA 3SF8B 4EZIA 1H0KA 3QRWA 3WE7A 2FWRA 4PVDA 4MNTA 3W79A 2WHXA 5E8RA 3ZWYA 3NOQA 2VWPA 1Y9EA 4JXXA 4LISA 4D9GA 1CZKA 2JAOA 5L4NA 2ZI9A 2JEOA 4MB6A 1DXOA 4BQIA 3GRCA 4NU0A 3FJ1A 1HT2E 4BDTA 4LTDA 2JAHA 3GFOA 1V9SA 1QFYA 4GOND 4N5NA 3QXGA 3KT8A 3FFTA 2GAOA 3ANXA 3ONEA 4QRIA 3PXGA 1OU0A 1I6LA 4QPPA 4Y30A 5C37A 4XRRA 1U5CA 3VPBA 3VJKA 2N3ZA 2MCFA 5KTMA 4YMHA 2O6HA 1J20A 1N2SA 4FOSA 5BXYA 3VH2A 2DFVA 4ETMA 3NAGA 1HK7A 3VPAA 1T5DX 1J8YF 4BP3A 4ZANA 3VDNB 5KYKA 3C43A 2ZI6A 5HE9A 4ZVKA 1STOA 3WOVA 2C7OA 5D3KA 1SU7A 1IEVA 1YZHA 2QLFA 1U6IA 2MYUA 3EGIA 3IV7A 4Q3KA 3UHOA 1I9GA 2AG6A 2HGZA 5FNVB 2A5GA 4PIMA 3FX2A 4LZWA 1JDZA 1CJBA 2Q4OA 4GPD1 2W6CX 5U9CA 4DOMA 4KPEC 1N2EA 2ASEA 1VM6A 3B5JA 1MB0A 4JCOA 3RTBA 5EEHA 3UTDA 3BWDD 3VOTA 3M1IA 5MHTA 4HATA 1WMAA 1ABFA 3IE0A 4NECA 2DSTA 5B1DA 1QMGA 3CLUC 2FPMA 2PWYA 3FDZA 1KDOA 2JI7A 3IBTA 2BGJA 3U37A 1U7ZA 2JGLA 3TD2A 3LQ2A 4ZN6A 5IAGA 5ICMA 3T1TA 1JKIA 3DZGA 2OUIA 4G5XA 3JV7A 4GZMA 5EWLA 3QY0A 4KX5A 1N9KA 2P9CA 5AOVA 3IIMA 2R6ZA 3KQVA 1N2IA 1QHIA 3NYRA 1FRVA 5E0OA 1JA1A 5E38A 1FTNA 3JARA 3KKMA 4Q1BA 4A2WA 4YPOA 2HD4A 4C7OA 4GR4A 4MKXA 2GBIA 2XCQA 3BAZA 3EFBA 1PZNA 4PZDA 3CX3A 4TTSA 3IP3A 4PRZA 3EPHA 1KMNA 4KR6A 3GFRA 3G0CA 4Z8YA 1H1LB 2UXDB 3KB1A 2NU7B 3PR2B 5BSVA 3O0DA 1TUBA 1P9RA 2NTNA 4JS0A 3EAFA 1VL2A 1N5OX 3RC2A 2Q29A 1H8HA 4UEKA 5EMMA 1E4EA 4CV0A 5A4JA 5TQJA 5IDXA 1JBKA 3MMSA 5DTIA 3DSRA 3K70D 2PMKA 3FNHA 1Z3IX 5P21A 1YS2X 3UJHA 2A35A 4YQYA 3FHTA 5FL3A 4LRUA 3D6NB 4TXHA 2V7EA 4PFQA 1PL8A 2REOA 2V65A 2C4UA 4PX5A 1EDZA 1L4HA 1S2NA 4XLZA 3CVVA 3P8ZA 1E79A 4JJ4A 1TEXA 1U7WA 3PUHA 4IOMA 5ELXA 1LWNA 1WO8A 3PGLA 3EDCA 4JP1A 3OT5A 2W8ZA 4AIRA 3W4IA 3LBAA 4QL3A 5D86A 4EFDA 3CVYA 1FFGA 2P6OA 2FEXA 2AZTA 2FZ4A 2PM8A 2Z2KA 2GK7A 5EQFA 5EXDA 4C7JA 3GMSA 4P3PA 1H5UA 4EHNA 3Q9NA 2H4JA 3CH7A 5CFOA 2ZM6B 3FN4A 5I8WA 4OP3A 4RIFA 1V1JA 2NZXA 3EULA 1O6GA 2X22A 1P6XA 1P3DA 2PSDA 1XPUA 2XGGA 1QH0A 3UK2A 5E6SA 3CG4A 2J5RA 4NAUA 3I6MA 2BEWA 1T9GR 2YRXA 5DSTA 4DBLE 2PUGA 4YRDA 1Z0KA 1R9NA 2DJ5A 2ZSAA 5LOVA 2X9GA 1WLYA 5CYGA 2WWRA 4LX8A 1SHUX 4PZPA 3S27A 4ZEMA 1NHGA 3JVEA 5T57A 1DZIA 1ZC3A 3NHPA 4F7DA 4EJSB 2QTBA 3EMDA 7REQB 3THYA 3C6ZA 4DR4B 3BGIA 5EFZA 2EW1A 3CNBA 3L0BA 3LC0A 4AY4A 1YIDA 1TC2A 2CB0A 2NTJA 3PBKA 4OHPA 5AVKA 4PY2A 1UKCA 1XLTA 2IJGX 1OIVA 3NKLA 2GJKA 4JI8B 2B4YA 1D4ZA 2Q2WA 3X1XA 1ABEA 2DFTA 4UNSA 4J7XA 1BRTA 1YAJA 2AX4A 3ZY6A 3VKWA 4K9KA 3EGDA 5H82A 4CIXA 4I66A 3OCYA 5IF3A 5DHQA 2XQKA 2FI1A 2HJSA 2Z1MA 1O9GA 4NDZA 2P6NA 4WTOA 5KTOA 3GP8A 2WT9A 2X0KA 2X42A 2XQFA 3P9ZA 3PFWO 4I5DA 4D42A 2K7FA 5KVQA 4QATA 1C0LA 1KC3A 4AY5A 4QLOA 4KFCA 1Z88A 1FYEA 2CNKA 3KPJA 2ZBEA 1SUDA 1ECJA 2I78A 3VMMA 2QXUA 4EYEA 4XDHA 1VG0B 1XZFA 4ERNA 4F8EA 1YZVA 4C01A 4QJ3A 2F1OA 2O2GA 1HFKA 3NHJA 4RGYA 3KQTA 2Q1WA 3W8EA 4COOA 2PH1A 5EIWA 1WS6A 2ZU0C 2FZEA 1AS0A 2P9HA 4N76A 1Q50A 3FSGD 2AB0A 1V2HE 2REQB 3ZHRA 4CHGA 1JEEA 3BDAA 3OAAD 1JLLA 3ZWKA 3N1UA 2WSSD 4EVQA 5JMTA 1ZHOA 4D3ZA 3K8OE 1ULZA 3I9JA 2XECA 1TQ8A 2GKSA 5LZ8A 3T3EA 1QK4A 4D57A 4J03A 1T5LA 3F6CA 2QLJA 2OCLA 4LN1A 2QRPA 3W3ZB 4BE7B 4EUKA 1GCIA 1YL7A 1IUNA 2XZDA 1M5TA 1XZEA 5AK4A 4TT3D 1XEWY 4RK4A 2JGIA 1GG5A 3OCWA 4KXYA 1PLLA 3BYZA 3HRIA 3HYLA 2G7ZA 4KIGA 4J3NA 2DPLA 3DMHA 3O31A 5GQSA 1NMXA 4P8RA 1XLTC 4G63A 3UENA 3LLVA 1KHHA 3COWA 1BX3A 1K7CA 3P97A 3OIUA 4PANA 2VDVE 1KFJB 4M1OA 3WBBA 4UEOA 2FMHA 2F43B 3AILA 3AI3A 4YJGA 2CL5A 4C0AC 3SU8A 2QTRA 4EVRA 4YX9A 4B43A 4I50F 1QPGA 3I72A 3K09A 4FYKA 3S0JA 3NTQA 1VPLA 1AZWA 1P5HA 1DPGA 1X38A 2HA6A 3WP1B 5GVSA 3THXB 1SOUA 2C78A 3PNPA 5AK3A 1QP0A 4LF8B 1FUUA 2GXQA 4JEHA 4W7HA 3WRYA 1XZBA 3EGEA 2QR5A 1SC6A 1KI7A 1TX4B 2MT9A 5FYDA 4DHEA 1NQXA 3KU4A 5G53C 3A28A 3X1KA 3KYDB 3GEMA 4LOAA 2Q1YA 2Q9CA 4BNIA 2E5LB 1P60A 3GAAA 4KXNA 3SR0A 1VI5A 1DEAA 4B35A 4MYDA 4RKEA 2TECE 4UUAA 3SKXA 2YYAA 1SK9A 3B8EA 1MGPA 3LLMA 5HMLA 4EWLA 4BFLA 3UUEA 4WMLA 4ITUA 2XMPA 5REQA 4A6DA 1IQRA 2Z6AA 1DQRA 4GRIA 2R7AA 3JRNA 4OGKA 4JI1B 3HGMA 1B76A 2IYUA 2ZE8A 1T9AA 2C00A 2HIGA 4GOLD 4Q05A 5AVRA 3HZZA 1MKYA 3O1LA 4AD8A 2W93A 2R1ZA 1LEHA 1VLHA 2PYZA 3RT1A 3OC0A 5C32A 2A78A 1N6LA 1X92A 1I9CA 1XUOA 2BGTA 4L74A 1FJXA 2KM1A 3M6MD 2Z04A 3PF8A 3ASUA 4AJ1A 3B7PA 3CINA 2W2MA 1ORIA 5CUQA 1WV0A 1W5BA 1DQYA 1U8ZA 4DQLA 3RD5A 4NCIA 4RVOA 4LF5B 3CTPA 3NUZA 1BHSA 2ONKA 4XYEA 5JEDA 4FE4A 5I7UA 4IQ0A 2C42A 4R4JA 2Z1DA 2QXTA 4J3FA 1ZCZA 4NJMA 3PXDA 3I34X 4CTNA 1KDZA 2OZKA 4OH7A 1W88A 2J3HA 4XGNA 1BEUB 3RNLA 3IJPA 1B4DA 3C6KA 2ASVA 3FDIA 4HGNA 1NA5A 4QNMA 5KNCD 2HFJA 5FFNA 1E8MA 3SR3A 2OCKA 5JROA 5JH7A 1VJTA 2Y66A 4KHPB 3K15A 5FOUA 3K09C 4G5QA 4C7OB 5DEOA 3WMWA 2BHNA 3QE3A 1J0BA 4CM4A 2BM0A 1J23A 3KTOA 4BFUA 3SFVA 3WRYC 2IY9A 3AKEA 2PKQO 3LWZA 4XEHA 3F5SA 4ZC8A 1K3TA 2XNSA 5EI5A 1GAEO 4UUOA 2C82A 1RAEA 4J0DA 5CLFA 1QKKA 4MHSA 3HFGA 1QH8A 4YCDA 1F38A