3KQMA

Crystal structure of hpnmt in complex adohcy and 4-bromo-1h-imidazole
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqmA00
2NP6A 5H02A 1KYWA 5E1BA 4RTQA 5HIKA 3DR5A 1KPHA 3SSOA 3TM4A 4AZVA 5E1MA 3EMBA 2PV0A 1L1EA 3TKAA 5DM0A 4DCMA 1KR5A 4OA8A 2AOVA 3ANXA 2OXTA 3DLIA 4XUCA 4FT2A 5FWAA 4CTJA 3FPEA 2P41A 3PFHA 2DPMA 1L3BA 4Y2HA 5EPEA 4YMGA 2HNKA 3ORHA 3LL7A 4UOEA 2CMHA 2NYUA 3DXYA 2YTZA 1NW7A 2C7RA 3NMUF 4PYMA 1Y8CA 5EG5A 1BC5A 3QV2A 3H2BA 4P7JA 4GOMD 1R18A 4AUKA 4PGHA 5HEKA 3I5UA 3SM3A 1VE3A 3UJ7A 4QVKA 4FSXA 2JH8A 4K6MA 5DTRA 5FUBA 5EHIA 3DMHA 2O05A 1YFJA 1RI4A 2BR3A 3CKKA 1YZ3A 1RI2A 4FGZA 5CVUA 3G8BA 4YUWA 3HVHA 1FJXA 4CTKA 5DXAA 4BP3A 2PT9A 5CCBA 1M0EA 2HV9A 5DX8A 2FYTA 2PY6A 3BWCA 4KRGA 2GPYA 2AS0A 4MTLA 1KPGA 2OYRA 1KP9A 3KU1A 3EVAA 3EGEA 1DL5A 2GLUA 3DMGA 3IEIA 2ZBRA 2VZ9A 5LQCA 2IBSA 3GRVA 5DXJA 3UA3A 1M6EX 2EFJA 1TPYA 3EVDA 5ERGB 3O4FA 1UFKA 3LBYA 2BM9A 3GNLA 1L9KA 2BR5A 2GA9A 3EPPA 4GOND 3ELDA 5EMLA 4B17A 4RTLA 3CJRA 3FPFA 3PS9A 4GBED 4RVGA 3HA3A 4DCGA 4BY9E 2VDVE 2ZIGA 3UJAA 3ER9A 1R8YA 1EIZA 3GWZA 2Z6UA 5K03A 5LQRA 1G8AA 4M36A 1NBIA 4ER7A 3FUTA 4FZVA 5BW4A 2PWPA 3ID6C 4C03A 3NWBA 3OE4A 4E2ZA 4KDCA 3KPUA 2ZWAA 4A6DA 3HM2A 2P7IA 5FHRA 2IFTA 5K0LA 4PYJA 4QTUB 5DSTA 5DRYA 2IGTA 2Z6QA 2VP3A 2OZVA 3GXOA 4WVLA 3HCEA 3EVFA 2IIPA 3LSTA 1N7JA 4P58A 5CVVA 3O7WA 2H11A 3LGAA 5GP1A 3EEOA 2I62A 3MERA 1B42A 1TW3A 3EVCA 3JWGA 3SR4A 2GAFA 3OZTA 5EEHA 2P8JA 3SX0A 1ZG3A 1PJZA 1R6AA 5HFJA 4QQNA 2WK1A 1JTEA 4GC5A 3A7DA 2XYQA 1G6Q1 3ELWA 3G5TA 4OA5A 3M6UA 4RVDA 1SQGA 5FTWA 3T7SA 4KVZA 4YUVA 3CC8A 1VBFA 1JTFA 3KR1A 5EC8A 3OZSA 4BP1A 1UIRA 2PGXA 2YVLA 1D2HA 3PFGA 1JG4A 2AOUB 4AX8A 5LSAA 3KQVA 2NXEA 4P7FA 3VSEA 3P8ZA 1XDZA 5LQKA 2NNWB 3P9NA 4IKPA 5LQAA 3DXXA 3T7TA 8MHTA 3P9IA 1L3CA 2OO3A 2YR0A 3KR0A 1X1AA 5EGSA 2G1PA 4X1OA 3B3GA 5GIOE 5K05A 2O0LA 2YQZA 2C7OA 1XCLA 3R0QA 4KIGA 3FUWA 4PWYA 5FA8A 3D2LA 1XCJA 3B3JA 5FQNA 4YUYA 2AOWA 3HA5A 3AXSA 4BLVA 3IHTA 2H00A 4ATNA 4RTMA 2PKWA 3RW9A 4X63A 2BM8A 4C04A 2AOUA 4U7PB 2P3LA 5EIFA 3PT9A 3BGIA 3S68A 3G5LA 2QM3A 3MTEA 4BLUA 2PXCA 2P40A 4BLWA 3G7UA 2ZZKA 1OR8A 5C9ZA 4RTRA 2AZTA 3GRZA 3LKDA 1WXWA 4OX9Y 4LWPA 5HOQA 3OZRA 3MCTA 5K0BA 2IH2A 3NVMB 1VQ1A 3GJYA 5K0EA 3R9XB 4MWZA 3AWIA 3P2KA 2IH4A 4HSGA 2B25A 1BHJA 4HH4A 4X61A 1IM8A 3OFKA 5T64A 4KWCA 5F2NA 3LECA 5GM1A 1WG8A 3BXOA 2N47A 3EVGA 3TKYA 4IV0A 1RJGA 2Y1XA 3FUXA 3G8AA 4YMHA 1VIDA 3M33A 5C1IA 2K4MA 3M6XA 3A26A 4E32A 4LWOA 5DX0A 1JSXA 5DT2A 4C06A 1SUIA 5EMMA 4YV0A 1X1DA 2G72A 2NXJA 3KR2A 3R24A 2JHPA 5ICCA 2V7EA 3FYCA 1VP9A 4XUEA 5EQJB 3ME5A 4EK9A 3CGGA 3T0IA 3RIEA 1N7IA 2HTEA 2QY6A 4OBXA 3TFWA 4ER5A 3B3FA 3NDJA 3ELYA 3KPWA 1Q0SA 4RVHA 5HIMA 4E70A 5ICEA 5K0GA 5T6BA 5T67A 2E5WA 2ZULA 1Q0TA 2OPBA 3REOA 2ZIEA 1NW8A 2XVAA 5DM1A 2GS9A 2QRVA 3EVZA 1KHHA 1NV9A 4QDJA 5E1DA 5FQOA 3UFBA 5IKMA 2BH2A 5F2OA 4RVFA 1F3LA 4RTSA 5DPMA 3TRKA 4E2WA 3G2OA 1M6YA 3GRRA 3ERCA 1JSZA 4HGYA 3KPJA 3BZBA 1JR4A 3NJRA 5E9WA 1ZGJA 2A14A 3TOSA 5C0OE 3M4XA 1P1BA 2HWKA 3HCFA 9MHTA 3F4KA 3JWIA 3SMQA 2FK7A 3G2QA 5CIYA 4P7GA 3MGGA 5E9JA 2ZTHA 2YXEA 3C0KA 3B7PA 3LCUA 5BW5A 1BOOA 3T7RA 4AZWA 2AN3A 2AVNA 2ONYA 5FHQA 4C07A 4EKIA 5GINE 1NW5A 5DLYA 5LQUA 2FRXA 3E8SA 1XDSA 2VDUE 3A7EA 2G71A 2G8NA 2PLWA 4RTNA 3OU7A 3KR9A 2AR0A 2ZLBA 2P3OA 4KW7A 5EZSA 3FTEA 1R00A 4PGGA 4PYQA 5EOVA 2YXDA 2KW5A 2ZBQA 3THSA 3PTAA 5CVDA 4FR0A 5DTMA 4GC9A 4C05A 5DRTA 4PCAA 4E31A 1V39A 1WXXA 1UWVA 2JJQA 3BKWA 3KQMA 4V0RA 5FADA 4HTFA 3R3HA 4MHTA 3HA7A 4L7VA 3BGVA 4DF3A 4E2XA 4ISCA 1X1CA 3Q87B 2I9KA 3NW9A 5D1NA 3DH0A 1G8SA 3LDUA 5U4XA 2P35A 1JG3A 1D2GA 1SG9A 3NDIA 3R6TA 3U81A 4PINA 5EMJA 4Z2YA 5ICGA 3DMFA 1MHTA 5IH3A 2XVMA 2BZGA 4OQEA 5M5BA 2ZBPA 2ORED 1ZQ9A 2OY0A 3I53A 3KQQA 1HMYA 1JQEA 3MB5A 5KYGA 3HP7A 2IDJA 2FHPA 3UA4A 1H1DA 2AVDA 4RTPA 1EJ0A 4AZSA 2IBTA 2UYOA 4FT4A 1AQJA 2LD4A 3HCBA 4GOLD 5DM2A 2JG3A 1YZHA 4CXMA 3GRUA 1VL5A 4JXJA 1ORHA 4DMGA 3TMAA 3AJDA 2VDWA 3CCFA 3KQWA 4MQ4A 1X19A 2R3SA 1I9GA 2GH1A 3C6MA 4OBWA 2ESRA 3QOXA 3VC1A 2YXLA 3FUUA 3KQPA 3SXJA 3GDHA 5E2BA 4QVGA 2CKDA 3DLCA 2P3QA 1JG2A 1MJFA 1X1BA 3P97A 3K0BA 1RJEA 2PX4A 3CJQA 3MTIA 4PYNA 4R05A 4RTOA 1NBHA 5EKUA 5E9QA 1XJ5A 5FWDA 5GIPE 2G70A 2GB4A 3I58A 4E33A 5E8RA 2I7CA 2ADMA 5GOZA 2P1DA 2YUIA 1ZKDA 3THRA 3BWMA 4HG2A 2XYVA 5BP7A 4IWNA 4MIKA 1QAOA 1ZGAA 3BUSA 1G55A 4KIFA 2PJDA 1WY7A 2B2CA 1XDUA 2VS1A 5EZQA 1QANA 3KQYA 1Z3CA 5FA5A 1SKMA 3C3PA 3VC2A 4PIMA 5KVAA 2IP2A 1N2XA 3LBFA 4CWAA 1DUSA 1SQFA 3LPMA 3OE5A 1KPIA 1I1NA 1TW2A 3LDFA 3P71T 4LG1A 5CVEA 3ELUA 2ZVJA 1VLMA 4AZTA 3BKXA 5EKXA 4FS8A 4DA4A 3HVIA 4ER0A 4DKJA 2PXAA 1L3IA 3GGDA 1RI1A 3L8DA 3DP7A 3FZGA 3LHDA 3EEYA 4HRAA 4RTKA 4DQ0A 3FRIA 2P7HA 10MHA 3KQTA 3KQSA 1ORIA 1XVAA 5DM4A 2CMGA 3AY0A 2OKCA 2PT6A 2ONZA 4R6WA 1FP1D 1VP3A 2AOTA 3E7PA 4RYLA 3RODA 4DZRA 3KPYA 3I9FA 1WZNA 1FPQA 2QRVB 3DTNA 4QQKA 3BGDA 4QPPA 5G02A 3TQSA 3B5IA 4EKGA 1FBNA 3C3YA 3UWPA 3E05A 4EVIA 3P2EA 3CVOA 1FP2A 4PYKA 4CKBA 5HIJA 2QE6A 5D1HA 3WSTA 4R6XA 3NWEA 4LECA 5EVJA 3HTXA 5DX1A 2NP7A 5B1SA 3HCAA 2Q41A 4H0NA 4ER3A 3TM5A 4YUXA 3CJTA 2PX8A 3C6KA 1R74A 3HVKA 4C4AA 2ZZMA 4E2YA 5LR6A 3VYWA 3EMDA 1R8XA 5KS2A 1F38A 3P9CA 5GWXA 3FUVA 3DULA 2PX2A 3NTVA 3UJCA 2PSSA 2ZW9A 3B89A 1NV8A 2PXXA 2OB2A 2DULA 3A27A 3BWBA 5EIWA 4PYIA 4CKEA 3PLAE 1D2CA 2PBFA 3FPGA 3UZUA 3DUWA 2OB1A 2WA2A 3EGVA 4YUZA 5CM2Z 4EMSA 4HGZA 3FPHA 4XCXA 3EVEA 3FYDA 5GM2A 1T43A 4O29A 4YV1A 1QAMA 3CBGA 3M70A 4HTFB 2AN5A 3LDGA 3TLJA 5LQNA 1RJFA 2IDKA 3I64A 4Y30A 3HNRA 3MCZA 4FSDA 1RI3A 5K0JA 4V0QA 1KXZA 3O31A 1AQIA 2AOXA 1NT2A 2EJUA 5BXYA 3KQOA 1NW3A 2O06A 2FCAA 4GEKA 4RX1A 5K0FA 3HCCA 5DSXA 5P8WA 4X60A 4POOA 4YV2A 1BKYA 3JWHA 1PRYA 3JWJA 4PONA 1EAMA 3G2PA 2ZSUA 4IV8A 7MHTA 4GF5A 5HILA 3GCZA 5JUWA 2NXNA 3FTDA 3M6VA 3G88A 3TPZA 3OU6A 1O54A 5K09A 5CCXA 2ZZNA 1O9GA 3KHKA 1SUSA 1YB2A 5FCDA 2UZ4A 1P1CA 3KPVA 4GQBA 2WA1A 1WS6A 3Q7EA 1RJDA 3QOWA 1XTPA 1YUBA 5KQRA 3LCCA 2ZIFA 3FTCA 2PWYA 5E2AA 4QTTB 3ER8A 4KDRA 3SSNA 4PIPA 4OQDA 4EQZA 2XYRA 3LCVB 4M7RA 1O9HA 5K01A 1KYZA 2F8LA 4X41A 5K8VA 1JQDA 3HCDA 2UYHA 2BR4A 3OPNA 2HR1A 3FTFA 2V74B 3V8VA 1JQ3A 1ZHFA 2PVCA 2H1RA 4PYOA 5E1OA 1NKVA 4ER6A 3G2MA 4R8RA 3MHTA 2XBMA 5ICFA 1EQAA 3BWYA 3EGIA 2O07A 3K6RA 2I6GA 5HIIA 4F86A 5KQSA 5CD1A 3MAGA 2ZCJA 2FPOA 3SGLA 3BT7A 5LQJA 4U7TB 1AF7A 3HEMA 4C08A 1IXKA 4PCLA 3UJ8A 4RTJA 3SVZA 5EMKA 3PX3A 4CKCA 3HVJA 2OBFA 4ZTBA 2IPXA 3NVKI 3A25A 2QYOA 1QYRA 1NE2A 2R6ZA 4R8SA 1G38A 2O57A 2UYQA 4XUDA 2JH9A 4WXHA 3KKZA 3X0DA 3FRHA 1XXLA 2EG5A 1INLA 4PYLA 3IV6A 3UJ6A 5EEGA 3OCJA 2B3TA 1P39A 4RWZA 1EG2A 1NW6A 2AOTB 4RSRA 1RI5A 4PNEA 3G89A 3UJDA 3GIWA 2NXCA 1QAQA 5K0NA 2ZFUA 3SSMA 3OU2A 2EJTA 2CWWA 1VPTA 3E23A 2C7PA 3A4TA 1DCTA 4M38A 1YF3A 2B9EA 5MHTA 3UJ9A 5K0CA 1IY9A 3M6WA 2UYCA 1SVUA 4G56A 2Z6AA 4HC4A 1JG1A 3DOUA 3GO4A 5HZMA 2PX5A 1AV6A 1U2ZA 3MQ2A 4GOOD 4QPNA 5F2KA 3V97A 3PVCA 2Y1WA 2ERCA 4GUAA 5CUQA 4DM3A 4A6EA 1HNNA 1G60A 4F84A 2AN4A 1KIAA 3LKZA 4E30A 3GRYA 5EHGA 5DWQA 1QZZA 2JHAA 3GU3A 2C7QA 4M37A 5CVJA 2FK8A 2YX1A 3P2IA 4P7KA 3AXTA 5FULA 3FPJA 3UBTA 1YFLA 3UJBA 5E8JA 3EVBA 4F85A 1EJ6A 2EX4A 4QDKA 3IYLW 4FP9A 1I4WA 3PX2A 4RV9A 5JR3A 3OFJA 2B78A 2ZWVA 2CL5A 3LX6A 4NECA 2JHCA 3TR6A 2HMYB 2IH5A 3P9KA 1P91A 3DXZA 5DTQA 3PB3A
chains in the Genus database with same CATH superfamily
2CNBA 3CH5A 5J63A 3JQ9C 2VHTA 3BIWA 3VTKA 4ZU1X 4L73A 1NRIA 4GYWA 4CV0A 2AF4C 1I01A 1WKBA 3KHTA 5DHRA 4CZ2A 1RWQA 3V4LA 1YHNA 2BH9A 3QF7A 1JHQA 4HDMB 2AD1A 4QJ5A 3CWQA 2QIOA 4C0HA 2QAGB 2UVPB 4WW0A 5CCDA 4HYEA 2IEDA 5AIBA 1VMIA 2PA0A 3KAJA 1U2GC 4MS4A 2IK8A 5J2UA 4YJ2F 4MIYA 3EY4A 2V6BA 4BVEA 4XE5A 3LVRE 4P7JA 1QO7A 3BH6A 3GRCA 1ONSA 1ZNYA 4K0KB 1NVWQ 4P3YA 4LXGA 1ML4A 4PGHA 3RV4A 5BOSB 3WWZA 4HATA 1B2RA 2TMYA 1BE0A 2IZ0A 1MDFA 1Q77A 1WVMA 2NZUG 1XKXA 5AXAA 2WINI 5AIAA 3H16A 1ISRA 4FMCF 4WFKA 2ORVA 3QEMA 1L7OA 4LOLA 4RM2A 4DDHA 1VYVA 4UNPA 3QPCA 1U3UA 1G6HA 3G82C 3UNXA 3ZLUA 1R4AA 4WFJA 1RMYA 5TDHA 1T0UA 5T4BA 2AFHB 3NYRA 3V3KA 2R5NA 3EGEA 2WIKA 3ZW9A 5LQDA 1JDUA 5JWOA 1OBCA 5CYGA 3AFIA 4I4TB 1DXOA 3NUQA 4LDNA 2JFUA 4J16A 4N7JA 4PS0A 4BB0A 4D0GA 4QU0A 1HRDA 1XYYA 4F2WA 3ZIDA 3BXFA 4AM8A 3FVVA 1PD0A 1NWCA 1XK7A 4Q4JB 5SV2A 1TKRA 2YN0A 3DMPA 3I23A 2VDVE 4BB9A 1ZICA 4IVPA 1PJTA 5E0OA 1DMSA 4M0EA 4M36A 1NBIA 1PR2A 2BFOA 2FN9A 2IZ5A 2MJLA 4XYBA 1SNYA 3QELA 1T4BA 4HXFB 4RV5A 3PF9A 1CUIA 1ZEJA 3D81A 1U2GA 3CURA 1X14A 2Z6QA 1VHLA 3G68A 1V3TA 2CLFB 3BDIA 3G02A 2ZRLA 2XY4A 3DDZX 1UMCB 1RRPA 2AHOA 3QQPA 1DBQA 2FZCA 4JB3A 4P84A 3W90A 5B2EA 2ERYA 1HQYE 3L4EA 4S3MA 1KMQA 2X2OA 2IL1A 4Z8YA 1PS9A 1BCRA 2L2QA 4LFBB 2WE8A 1CS0B 1PUXA 3K09C 5FUMA 5KX5B 1R6AA 4CTMA 2HZBA 5D5PA 1DKRA 1SQ0A 4HSEA 3STVA 4B32A 2TS1A 1EWTA 2IE8A 2XE7A 4L9WA 4RZXA 5HR5A 4J0DA 1HE5A 1X7GA 2ODPA 1L5KA 3MEQA 2BHTA 3KYCB 5LP6B 1NR1A 4C0BA 2TMGA 4NMHA 1RC0A 3CYFA 3VBCA 1PFQA 2XBUA 3FSEA 4IKPA 1N7GA 4ABYA 4F9FA 1K8RA 2VK2A 1J9GA 2I2WA 5BQ3A 3PWZA 5EGSA 4GEGA 4IIUA 1CUEA 5HHTA 2RHWA 3THWB 5HM8A 3WV5A 2G88A 3BMCA 3M3DA 3IJEB 4RWEA 2GRAA 5LA6B 2OA0A 1PK7A 3TLZA 4E13A 5C7IO 4HY3A 3WGTA 1SB8A 1E61A 1EYZA 2VKQA 2QB5A 1C7ZA 4ILEA 4F1KA 3OEYA 4OLFA 1E99A 2DU8A 2ZYTX 1XQWA 1FDVA 2GSWA 4Z9YA 1KSHA 2H7VA 2G1AA 1E9BA 4GR5A 5BR1A 1ID8A 1PJSA 1Q1GA 2ZI7A 4CMEA 5I51A 3S40A 2IY8A 3FOAA 3W2IA 1O4VA 4BLWA 2CSUA 4P83A 2ZZKA 3UWOA 2DXIA 5B58T 5JYEA 1CZRA 5BUSA 3BXHA 2KBEA 3UOGA 1W36D 3MA0A 5ADUS 1D0SA 3HBNA 3BD8A 3CVXA 1DJOA 4Y1GA 3CV3A 1X80A 2RHHA 4J2OA 3RHZA 1M0SA 1C41A 3GELA 5AP9A 1GGHA 2RB4A 1VG8A 4KFTA 3PUKA 3TXYA 4EGFA 1WG8A 5ENVA 2FXVA 3P27A 1RJGA 3D6HA 5BN3A 4TPKA 3DAOA 3KVVA 1H66A 2ZE7A 1F6WA 4ZI5A 3M33A 4KYTA 4A03A 4E51A 4QU9A 3ZY6A 1RBYA 3LY5A 4DC1A 1OTXA 2HH9A 1KZGB 2WJIA 2VBCA 4QECA 3IJRA 3DFIA 4D99A 1QRSA 2ZR8A 3R24A 1W8DA 3BXEA 5ICCA 1E2FA 2ZWOA 2G06A 1OB5A 2QUZA 2XQVA 3RSGA 3HY3A 2VAPA 5DNCA 3SOPA 1YFZA 2IWRA 3RIEA 5H68A 4EFMA 1FF9A 3G0GA 4JY7A 4N41A 4B3GA 5KZMB 4IIVA 1ZP6A 1YZQA 4F06A 1IZYA 2G40A 1GITA 2I76A 2E5WA 5T6BA 4CLOB 3MBOA 2Z0MA 5HIAA 2REBA 3GVHA 1U2SA 2VL7A 4JYBA 3K5PA 2P78A 4QDJA 5E1DA 4H3VA 2AL7A 1NXSA 2GYWA 3IVMA 5AK4A 1E32A 3R5FA 3ZBQA 1XPUA 2F1JA 5IJAA 3H4TA 4CT0A 4O8ZA 2P9HA 1EINA 2JL1A 1H2WA 2WWGA 3OPQA 3ICWA 3ESYA 3LC2O 4GX0A 3USES 3ZDAA 3NONA 4N0MA 3NATA 4MWEA 3AR6A 2V3CC 3NHLA 4TRNA 2HWKA 5FI1B 1H2XA 3JWIA 3QE2A 2FK7A 4QZVA 2BGIA 2WF9A 1VI2A 1UK9A 2AUMA 3USZA 3F1LA 4B6OA 2DSNA 3DMDA 2QGNA 1XCOA 1BOOA 4IIHA 4E7OA 4KXLA 3NWPA 4D8XA 1Y4SA 4BMXA 5FHQA 4C07A 4EKIA 3RT9A 2FW8A 5LQUA 3COJA 4M0UA 1A9SA 1V26A 5K3CA 3W8RA 5ES4B 1YI0A 1KFKB 1NVGA 3DOHA 3OQ6A 1CY7A 5EKDA 1E2HA 9ATCA 2ZRQA 3EWNA 3QYPA 2R4TA 4ISBA 4EKEA 1OU0A 3P9XA 2JI7A 2PQ2A 1C3OB 3G2IA 3Q0EA 2H2GA 4HZIA 4XGRA 4XARA 4C20A 4RXTA 1MORA 1WUJS 1ECPA 1NDQA 3OJFA 1YAHA 1RQXA 2OV3A 1YBMA 1KORA 3N5KA 3GJ4A 1UZUA 3V4PB 2WKQA 5EWLA 4PZ9A 1FP4A 2Z1NA 1KXJA 3E2IA 4EHNA 1M67A 1G7TA 3LYUA 1YULA 3MGKA 2JBAA 2NPIA 4O2RA 2Y6UA 2CHUA 1WAMA 4LC9A 4PLFA 3TD2A 5KSZA 1RKUA 2IDJA 2IBTA 1SC6A 1ZC4A 4U8HA 1LI5A 2WM3A 3HGTA 4NL4H 4JFRA 5J9FA 1VE7A 1XLTC 1XQ9A 2WIDA 3DE4X 3E9MA 2ZRGA 4XPIA 1Z2PX 2WVAA 3HU3A 4ZVQA 4D43A 3B1WA 3TMAA 3FXAA 3FWZA 1A9XA 3M8KA 2A1TS 3CSUA 2XCSB 3D6UA 4YNBA 3ILXA 4KAJA 4Q4CA 4R2IA 3EB9A 2Q99A 4Y6LA 4OREX 1JEEA 1SA0B 2OCAA 2ZAIA 3D3KA 3WYAA 5AW9A 5KDDA 4IDCA 4RE6A 2RG1A 4YP9A 2O3QA 2VNAA 2ZIUB 2OSVA 3C6YA 1V9SA 3B1ZA 4R2WA 1GGKA 3W8DA 3FMPB 1WBBA 5FBRB 4FC7A 1SOVA 3SKVA 1K5GA 4KXUA 5JD6A 4B6RA 4Q3KA 3BTVA 2B8JA 1TGVA 2XYVA 4ZI7A 1J49A 1VRCA 3AI7A 3B70A 5LB4A 1DBPA 1KBZA 1HZJA 1T6NA 1J9EA 4GX1A 5ESXA 1JIKA 3D4BA 4HX5A 1FYDA 3KZNA 4PZ0A 2ROQA 2R4UA 1K4MA 4JL8A 1CUUA 1JT9A 3MUFA 4C4SA 1W5AA 2V7UA 1NVEA 1DO2A 1KQNA 5CVEA 2PH5A 1XX6A 2A9VA 1PN3A 3GL9A 1YTUA 2DETA 4GMGA 1KMHB 1WD7A 1WUHS 1XD2B 4FS8A 3TVTA 1TYAE 3F47A 1A9RA 3T1OA 4EYQA 4DUPA 3JAMA 3EZGA 4C43A 3HBAA 4UUPA 4NCBA 2RMKA 4QUDA 1PSWA 3PA6A 1YZFA 4L22A 1FU7A 1LFAA 2P2NA 3KQTA 1I3OA 3U40A 1W25A 4XX0A 4XZ3A 5GAJA 3ZWQA 1N5MA 3EFEA 3GP5A 3L6DA 5HYVA 3PFCA 1GZ5A 4CFSA 1XLTA 621PA 1GDTA 4URWR 1SIUA 3WRWA 1II8B 2XF2A 5ELMA 4E4RA 4IH4A 1F3OA 1IRIA 1NSFA 1T3SA 3KPYA 1G4HA 3BE8A 1C9JA 2HF7A 2VUIB 4IRUB 1RLOA 2QSUA 4ZANA 3BJEA 1VLVA 1L0BA 3N07A 3QU4A 2IYEA 4J0JA 3UTDA 3QVMA 1PVDA 2WOJA 3QF4A 3V4SA 3ZLTA 2PPVA 3RGWS 1SEVA 3HTXA 2H6EA 1L5RA 1K2VN 3E35A 3Q11A 5AO9A 2R1ZA 3CJTA 4E6PA 1LTKA 3KZKA 4M1YA 2ZZMA 1XRRA 3TQHA 1QR6A 1CY1A 1OBHA 4JLDA 2OK7A 1UMBB 3VYWA 4MRNA 2MHCA 1THZA 4RMNA 1AHIA 2EZ9A 1Q16A 3WDSA 3B6KA 4BYMA 3PNPA 4GWGA 5K8TA 1AZWA 3GD5A 3E0QA 2RGRA 2V6IA 4NARA 4D9GA 1D04A 4R69A 1BXRB 1L4MA 3BWBA 2E3JA 1N1MA 3FGPA 4LRTB 3PLAE 3OKCA 5CA0A 4P4SB 2PBFA 3FPGA 2O54A 4Z4IA 5CT6A 5CM2Z 5BSVA 4BQRA 1W1WA 3QLUC 3EVEA 1T43A 1C9NA 2HIGA 4HLQB 1ACLA 4O29A 2IZ7A 5ALSA 4BGIA 1DOAA 1F8FA 4YCMA 5KU1A 1TEZA 4HTFB 3O3NB 1PGOA 2CXSA 3U3DA 4AS3A 4ZA2A 1OI4A 4Y30A 3AG5A 1LS1A 2QTCA 1K0FA 4O8CA 5AHOA 1T26A 2FKAA 2PL9A 2ZXUA 2AOXA 5H82A 1NT2A 4EYSA 3K4HA 3R1IA 3VR3D 3I01M 4KL8S 1W5BA 2PT5A 2VJKA 3CUEF 4P0QB 1XVTA 2ZQYA 3HCCA 3EGXA 4DQXA 1ISIA 1CUVA 3I6MA 4NFHA 3ETGA 3W9UA 3AKZA 3D59A 4DIDA 1DEAA 2VPXA 2FZWA 4R3WA 5K09A 5CCXA 2NV2B 3WAGA 4PAGA 4TRMA 5FBVB 2WF5A 4HUTA 4U9HS 5KMGB 4GPIB 1N3LA 3MTBA 4B6EA 2BP7B 2OO5C 4J3FA 1P6UA 4NPCA 4YJGA 5ALUA 2YRFA 4YMTA 1YUBA 3ZWMA 1UDWA 2RGUA 5E2AA 2GTHA 3DE2X 3R3ZA 3C3EA 3EYWA 4KDRA 3OKFA 2Z2YA 3EOBI 4C7JA 4BAGA 1RHRA 3ECCA 3LCVB 1PT8A 2HPVA 4GZ6A 1AA9A 4X41A 4PPYA 4AXXA 2VOEA 5ALZA 4Q1AA 4UTPA 1I36A 3AVVA 3BOSA 4D4LA 1VBMA 1XFAA 1PEAA 4JJ6A 1Y98A 1ISFA 4FOOA 3RRMA 2GXUA 3MTGA 3AEUB 3PF8A 4BO4A 3QLUA 3PC3A 4X65B 2YNMD 4KPYA 5KQSA 3FM9A 3MAGA 4YRMA 3NH9A 1XKQA 4Q9KA 2JIOA 3I62A 3V48A 1O0BA 2ZK7A 3MK31 2AMVA 1X9IA 4RK4A 1ZJ4A 2EP7A 1E2DA 3GIDA 4TWJA 4B1FA 7REQB 3G9TA 4AF6A 3CKMA 3DLPX 1JR2A 2X4GA 3S2SA 5LL6P 3AHDA 1TVKB 1S3IA 4W7IA 3B13B 5TE9A 4HDCA 4XUDA 3VO9A 2XMPA 2ZAMA 4XWWA 5CFRA 1BMTA 3H8SA 4E5SA 5JZVA 1XXLA 2JDID 4JBGA 5BMVF 2GM4A 3VZDA 3OCJA 2DFDA 4YRFA 4A26A 1O6GA 5H5JA 2JF0A 3LZCA 1NW6A 1ZISA 3QX7A 2Y4NA 3QNMA 3FGNA 4DC9A 3R6LA 4BIIA 2C7PA 1VPTA 4OHCA 3TUIC 3IL2A 2QX6A 3Q8KA 2ECKA 2OO5A 4KLNA 4X91A 1R3UA 2XADA 3TL3A 2O5VA 1Q22A 1Z2AA 1JG1A 4OL9A 5FYDA 4MARA 2AQ8A 3NP7A 2RHTA 4OGFA 5AVJA 5H0IA 3SBEA 3U7QB 2YOHA 1UPCA 2ODWA 1Y1TA 4RM3A 3SF0A 2QORA 2E5LB 3PVCA 3TZBA 3VR4H 4RZIA 4XLZA 4EA6A 1G60A 5AQEA 1L7BA 4F8YA 5ALXA 4K8RB 5JH7B 5G4KB 2NV0A 1OLSA 1T34A 3F97A 3ETNA 1P62B 5EHGA 1F14A 1W0JD 4A2CA 1Y8AA 4JZKA 4G37A 4NV3A 2IEGA 4Q4HB 3U0BA 3ZDRA 4ZJUA 3I2IA 3RADC 3DZDA 5K6AA 1BAPA 1HG1A 2H59A 3DTYA 2B35A 1JHVA 3LPLA 3DDSA 1T9DA 2P0AA 3EVBA 2A0UA 4O1HA 4CQJA 1L9XA 4NBUA 4DILA 4B43A 1RAHA 3FDIA 3PIIA 3HKDB 5ELLA 2Y1LA 2G8LA 1AKTA 1WQ1R 1WU8A 1ZNZA 2CL5A 3BRWD 3AKYA 4HMQA 4RV4A 2ACVA 1QK5A 4JLMA 3ACBA 1J0AA 3SU8A 4Q37A 1Y5RA 5DTQA 1FSSA 1KMNA 3G6WA 2QLLA 1Y1PA 3P2MA 4M4SA 2J4FA 1TF2A 2Q50A 1KAMA 3OEHA 1Z5PA 4H60A 5COBA 3RS8A 3DCJA 3VX4A 5BWLA 1WIWA 3ITEA 3KO8A 3TCXB 3OLWA 4RHEA 5CNMA 5CXXA 1JDJA 4PLCA 3T8YA 1K9SA 4JR2A 4XYGA 3GJ7A 5KKCA 1TC2A 3AHHA 3PFHA 5MF6A 4CQMA 4GW3A 1VJTA 3V8QA 4UOEA 3Q2KA 2A67A 1NW7A 1OV4A 3KBOA 3TD6A 4CIVA 3P32A 1C2YA 3TSOA 4NDZA 1UPXA 4XAQA 3TNJA 2GD2A 1JLMA 2ASEA 1QOQB 1QIMA 4YRIA 4Q16A 2MTBA 3PBKA 3FPAA 4GOKA 3BIXA 1Y3DE 5REQA 1Q91A 1TKAA 5I9LA 2G1JA 4H7HA 2REQA 5K4GA 5KNLA 3CGWA 4MYTA 2HM7A 4BE7B 1M1YA 2F1IA 2GHIA 2ZRKA 4KE8A 5JATA 3EZ6A 4INZA 1L7XA 3SJUA 1IRXA 3OKPA 5DX8A 2OCPA 4O2BA 4U7DA 4O4LF 4WXMA 3L7MA 2YXPX 4CMJA 3Q3EA 3VNQA 3L7OA 1U7XA 5FWXB 1T8SA 1VIYA 3I32A 2N75A 4RC9A 1IE3A 4UOQA 4FMBB 4QGFA 2ZE8A 3AL3A 2H5LA 4G5GA 3WLHA 2QD1A 1LNZA 2O8BB 3PRJA 3CLSC 2DC1A 4H0CA 1CLUA 1JT2A 1ZUIA 2FLWA 4JASB 1CUBA 1WMFA 2JFFA 3GNLA 4GPZA 3I9JA 2ZS7A 2MYUA 4GLLA 4DMCA 5BSFA 1IQ0A 4PFSA 4GBED 5K8LA 3G2HA 3I1IA 3TPFA 3JQFA 2XXJA 4QPJC 3VNBA 5JANA 5CH8A 1T2NA 4DRYA 2J0UB 3JTEA 1FP7A 4XDYA 1PX0A 4XVUA 5CDYA 2H48A 3DTVB 1JYSA 3GBSA 4KXVA 4N3CA 5DV9A 4F3NA 3EF0A 3OUZA 5BW4A 2HGZA 2X5XA 1XHFA 2B83A 1JR3A 2ZT5A 3LP6A 4YRRA 3DE1X 3G0BA 3OJ0A 4YO7A 1X7WA 5DSTA 5I8ZA 3U4AA 1PJ2A 3ZV4A 1NYTA 2YOGA 1GDDA 3WJAA 3ADCA 3LSTA 2HI0A 3A2MA 5E6SB 4DQLA 1KMMA 1VLQA 3LPNA 4WSOA 5JLAA 3Q12A 5THXA 3T9CA 4BLPA 1AMNA 1R0XA 4UFNA 2X2FA 3HP1A 4YYEA 5IT5A 2PR2A 3JWGA 1VMKA 1G19A 1BDBA 2GAOA 2GNOA 3OLQA 4G0YA 2ZRPA 1RC8A 1E7QA 2Z83A 2QXUA 3EQ6A 3WHPA 4KVZA 1QJCA 4YAFA 3HJUA 4LQLA 3THYB 2P1RA 4RUKA 1S2LA 1UIRA 2PGXA 3PFGA 1D2HA 1XHEA 1JG4A 4BMDA 2DKNA 3TSZA 3U4HA 2XF8A 1EFVB 1FRZA 5A4JA 2BONA 1KI4A 4HNAB 3O8OA 2NPOA 3RRZA 3T7TA 4ME6A 3P9IA 5D2CA 1E3TA 5FOQA 3FMOB 3LOPA 2VK8A 4AO7A 3G1UA 3PFFA 1ILEA 4JSYA 5K05A 4I4LA 1VECA 5M29A 2FNAA 4YUAA 1XWFA 3QKRA 2X0DA 2GJ8A 5B53A 4Q00A 4EWLA 2XUZA 2PKWA 1MQAA 3CH4B 2PDAA 1UJNA 1ODLA 4QA9A 2WM2A 4WXRA 3TOCA 2OHGA 4ZRDA 1N9KA 4DY6A 5JO0A 3GGJA 2RHJA 1OWMA 2DP4E 2GI4A 4UDOA 5AKGA 4N3AA 5JZOA 5HKAA 5FOUA 2C97A 4ITVA 2D7DA 4MVJI 2TYSB 1FLNA 5C9ZA 1C7EA 4GECA 4L2IB 1MR3F 4BLOA 1M7BA 1G16A 2VP6A 5JMTA 2DWUA 2ZWMA 3GCGA 3HHPA 2YJZA 1V71A 1UPUA 4MCJA 5ALFA 1W4CA 4OO3A 4BE9A 2ZETA 3A14A 3IKTA 1W2GA 2VHJA 2VEOA 4GT1A 4W7HA 5BYAA 1OASA 2CXHA 1S3GA 3SC6A 1IHXA 2VPYA 2NZXA 5AVZA 3BXOA 3DYIA 2N47A 2QYSA 3L7DA 4IV0A 2OYCA 2YYAA 4YDHB 5M7EA 2R25B 1W49A 5AJWA 2J3JA 1V6AA 4LZJA 4QG3A 1YBFA 3ZK8A 4XB2A 4ZYUA 4JROA 4N5HX 2VDRB 3A26A 4RPGA 3IE1A 1VHJA 3A0RB 2PKCA 4FFWA 2HJWA 2XKAA 3DKRA 1NBOA 1XNGA 4FEYA 4R1UA 4DLUA 2BGLA 4FKZA 4TV8F 4ALKA 4AU1A 4G2NA 4WCFB 5K0ZA 1NKSA 3AX6A 2H1WA 1VYHA 4XDHA 3MGBA 5BY2A 2ETVA 2GK7A 3CE9A 2IHYA 4L15A 1WRBA 1UDAA 1CUWA 1YRBA 4LZWA 1AHPA 1JPVA 1U5BA 4QXOA 4UNNA 3T3HA 4FGUA 4LDJA 4I1SA 5DGTA 4LF4B 3WHKA 3REOA 2PUFA 4RD1A 4BGDA 2XVAA 1C3JA 4RFVA 3VI4B 1Y5MA 2W2LD 5CMLA 1U6JA 1OGJA 3O91A 4B73A 4EFDA 1H4SA 1JXAA 4MIEA 1FDIA 1PVVA 5KVQA 5CB0A 1ZL0A 2GNPA 4E2WA 2DLNA 1CXZA 3RYIA 1R3DA 3RG2A 2PJZA 2UYYA 3WGJA 2O2SA 5C0OE 5JSUA 3PUWA 3VNAA 5F23A 5EN4A 1PWEA 1BWPA 5JNWA 3AR4A 5THKA 3QEBZ 1P73A 1W6RA 4B6QA 4WACA 5T57A 5T5QA 1Y9AA 4IDGA 2B1GA 2ZTHA 4MDHA 4Z6KA 1CUYA 3GFFA 1YB5A 1RHKA 3EEBA 3AM1A 4BYGA 2FRXA 1XN4A 1IM5A 5B7PA 5JSQA 3T34A 2A5FA 2G71A 2PRIA 3JU3A 4F12A 2EW2A 1XRPA 3HDHA 1ABEA 4HDKB 1N5KA 4I1OA 4C0SA 4DL9A 2P3OA 4LE0A 1OH7A 3N0VA 2GYUA 2G0NA 4ZARA 1NW9B 2JIQA 2ZBQA 4FEGA 2RGEA 4I9GA 1ZJWA 4G67A 2JJ1A 2A33A 4FR0A 1W73A 4MVJD 1PZMA 1I4DD 3KQMA 4CW7A 3AJAA 3ASYA 3HA7A 3FBTA 1E94E 3IBSA 2WJ3A 3IAEA 5EINA 2A88A 2Z2KA 3HKBA 1FFSA 1RYBA 1Y7IA 3L8GA 3NW9A 1NVBA 3Q87B 4YACA 4AMVA 3E7XA 2YV5A 1D2GA 1SG9A 1W5SA 3A9SA 3FPBA 1RQLA 1JG7A 3LUDA 4MRMA 1E3IA 5IBCA 1UKZA 1S1CA 3B9BA 3O93A 1XKLA 1DV1A 1TYEB 2QLMA 2B0CA 3ET5A 3WNDA 2F8TA 3W5SA 2JLCA 2B2NA 3GJZA 1ZQ9A 3RHSA 2HU8A 2IIBA 3O1HB 1R4MA 1FQJA 4B83A 3F5MA 4JLVA 2PSFA 4WESB 3R7WB 1THMA 4MUNA 1RJWA 4X6LA 1JEAA 4LYGA 4LNHA 2ABWA 4DMGA 2XSZD 4MQ4A 3QJ5A 1XHLA 3IRUA 2OHIA 2XVXA 4X8LA 4JI6B 3OESA 3Q9SA 2C5LA 4AKHA 2C4HA 1B8PA 3NCHA 4KFSA 5J2TA 2F3TA 5ITVA 1MJ5A 4F46A 1JHZA 4I9UA 4H18A 2OVBA 1SWVA 1K75A 4G0ZA 2IUUA 2SKCA 3GUVA 2CHGA 2X8LA 3TN7A 1ODFA 3O8CA 3JQ8B 4NHOA 2X4IA 2YUIA 4I50A 3X1DA 5B1EA 2Y92A 4ZOLA 3REFA 3UK2A 4MIKA 1QAOA 3BUSA 1E3WB 2ZYSA 1IXSB 2WVGA 1Y3CE 3AB8A 2AF3C 1AY0A 1R2QA 5AXBA 4XD7A 2F9FA 1G7SA 2EZUA 1AXEA 4BVHA 2Z2JA 4OLJA 5C80A 1AK9A 1EXNA 1NR7A 1XC7A 1NUPA 1MAVA 3OE5A 4NMWA 3E03A 4CIXA 3EGDA 2ENWA 3JQRA 1XU7A 1P9NA 2HA6A 3U6KA 3ER6A 1FVHA 2PKYX 7YASA 2UDPA 2DHDA 3ABSB 3MZ0A 2B7BA 3EQ2A 2UU9B 3BWEA 4I08A 1H69A 3ZJYA 4A27A 4ZPXA 3CNEA 1G21A 2AG6A 3NDRA 3Q98A 1NZDA 5F9MA 1YCDA 4X93A 5FOWA 4EMUA 4YQFA 2DFLA 4IKEA 2QMUA 5BPFA 3TUJC 5AM5A 1PJ3A 3WDKA 1ZL2A 4G25A 3N70A 4HNQA 3T3DA 5IVKA 4OMDA 3BCUA 2CUNA 1CNMA 1UBCA 2YYSA 4QLBA 2H57A 1R0BA 3O4GA 4YAEA 4EKYA 2D54A 2NN3C 3NIWA 5F78A 1JZSA 2C9MA 1XTTA 3FZQA 2FMXA 2VHYA 1GCGA 5DIFA 3HCOA 4MZXA 3TTXA 2O3JA 3FOBA 4RKFA 4BOYA 3EDQA 1U1DA 3OEWA 2EEPA 2IEYA 4H6XA 4YUXA 3G6KA 3E22B 2PX8A 3CEPB 1JPJA 3IAM1 1WHTA 1JBEA 3AERB 4UUOA 3CUTA 3QMVA 3C5WP 4ZGWA 1S02A 4M98A 1J23A 4URXR 4WINA 1KDOA 4REMA 3EMDA 3REQA 1Z6ZA 3RTEA 3X43A 5JDIC 4F0JA 4CIYA 1G3RA 1QYVA 3COVA 3N59A 3OJCA 4BMYA 1M2NA 3I1FA 3IULA 4Y98A 5DASA 1UK7A 2HMSA 4JA2A 5E6UB 2QTNA 4EF4A 4MI1A 3JS5A 5IMSA 3IAS6 3UMFA 1U2DC 1NG9A 1P2DA 3HV0A 1BW9A 4AN1A 4R1NA 1NQAO 4QYTA 3LQ2A 1QAMA 4BBJA 4NI5A 1Q7TA 4J07A 2AN5A 1J8DA 2XQIA 4FHEA 2VBIA 4Q4DA 1JSRA 5B37A 1HTTA 1C50A 3LBIA 1DMRA 3PGJA 4GR4A 4C30A 3MS4A 1S1MA 4R81A 2CXUA 4UHHA 4BO5A 4BN0A 3FHTA 2HIHA 1BWRA 2VVTA 1VKOA 1A9TA 1GEGA 3LT0A 4W9NC 3TX2A 5HDQA 4F1JA 3KQOA 1MU0A 3PDCA 4PAWA 3TIIA 2GQ0A 3U3OA 1PFYA 3ROEA 1WA5A 4LJ8A 1BXGA 3QE3A 1WTCA 1K3UB 1W46A 1WW3A 3C8MA 3N2GA 4IUBS 4WLOA 4ZDIA 4CF3A 1M6WA 3J7TA 1K3TA 2Z58A 2GJ9A 4NYMR 2VDWB 3LDAA 1O9GA 2VCYA 1GQQA 1QOZA 2XGJA 4EF5A 3FYTA 4EHFA 4N0DA 3VR1A 1KVRA 4WXYB 2O3UA 1P6QA 4JVOA 3AVTA 2QM0A 1KTVA 3Q85A 1YQUA 3AIIA 5AXCA 3I4CA 3RSLA 3FTCA 3ZKAA 2JFVA 4MO2A 3OCCA 2Q6TA 4L4YA 1G3IA 2IELA 2XYRA 3ETEA 4G3XA 4OHOA 5KJFA 2XWQA 2XUQA 4JCOA 1YRWA 3IFSA 1Y1KE 2ZYAA 2PUHA 2C31A 3DZGA 2G4VA 4N82A 5AI0A 4A4DA 1AN0A 5JT1A 3SKYA 2FW6A 1H4QA 2HU5A 4ED9A 3HDJA 2J87A 4J29A 2WHQA 2OYSA 5IVIA 1CQIB 3AF5A 2K7FA 3ZHRA 4LZPA 4YBZA 3RC1A 4B84A 5HUJA 1VFNA 3R7BA 3BT7A 1KFBB 4Z8XA 3TTTA 4QOJA 2YUTA 4TTVA 1MG5A 4OB7A 4OGGA 3LKVA 5KUTA 3NHFA 4U5QA 2PZFA 5T41A 5LMUB 5AJZA 3HVJA 1AURA 3OF2A 2IYVA 2EIXA 3BE5A 5DBOA 2C8LA 4LJAA 4U39A 3FJOA 4W9NA 2I9PA 3LT4A 1EE9A 1VCMA 4L8WB 5AKKA 1QYRA 4R8SA 1B6RA 4JJEA 2UYQA 4G0MA 5CDTA 3R44A 1E1CA 4EOGA 1GGFA 5LNK6 1G3QA 4W5OA 3SQXA 3YASA 2GCIA 4IJQA 3M1YA 1WMAA 2Q1UA 3IP5A 5BV2P 5EZYB 3UATA 13PKA 1DP4A 1ZSVA 2BBSA 4QXAA 3UJDA 4DJFC 1Y8RA 2GKSA 1S96A 1O87A 1OW3B 2G5TA 3SNHA 1E0JA 2AJTA 4LOKA 2IRWA 1D1QA 1SHJA 3M1LA 2XMDA 2ATEA 4US2R 1EFPA 5JG7A 1B0AA 4RGVA 1MQ8B 1K8ZB 4BMNA 4ZC8A 1RZVA 4UM7A 3SBDA 4EG1A 1NQXA 2I4OA 4L95C 4WNAA 1BE1A 3EIUA 4LI0A 5IT4A 3I6QA 2R8YA 5K51A 1CKEA 4RLQA 2ZRIA 5TGZA 2HRDA 2XAAA 3HY6A 3LVFO 5A4FS 1OFVA 4AJNA 2N1MA 1E7YA 4B7AA 1NVTA 2C0PA 1QLWA 1U9YA 4WQMA 4Z1OA 2VJMB 4XGKA 3LZ6A 1QZZA 4EB3A 4MV0A 4ZXFA 3U7GA 3CLUD 2NO7A 1I3LA 4D57A 3NJ4A 3LO8A 4QNNA 5DF1A 5HK8A 3TL6A 3UG6A 1P4AA 2HWWA 1SZJG 3MCUA 4HBZA 3PVZA 3DMNA 3K15A 5JO9A 3ZHXA 3WBFA 1LPSA 1E3QA 3A31A 4CL2A 4N0EA 4KR6A 1CJSA 5BRNA 2E4XA 2HDNB 5K9ZA 1V43A 2P67A 4HPXB 4A8JB 2AG5A 2DUJA 4ZZ2A 4AJ9A 4KR7A 3T41A 3TM4A 4AZVA 3DZKA 1Q50A 2JVIA 2WJAA 1LW7A 4ROSA 1KR5A 4IOKA 4WJKB 1FLAA 2PRZA 1BX0A 2WWWA 2F3UA 1TD9A 3B1JA 2PCLA 5FWAA 3RUHA 1H3FA 1LUAA 1T24A 2JFOA 3JZAA 4QHYA 1PK9A 5ISMA 1VLJA 3ORHA 1XJWA 4ZCQA 3A06A 3ZVKA 1OX4B 4YMLA 2YFQA 3DXYA 4JOCA 3X44A 3R9XA 3WFJA 3H2HA 2VAMA 2WFMA 4LSMA 3QV2A 4FN5A 3H2BA 1LF5A 1J21A 5FUQA 1ZBQA 2F1RA 1H6CA 5KYUA 4Z7JA 1N6LA 3CG0A 1LBHA 2WU1A 4QVKA 1O8BA 1DJNA 1FBTA 3C5CA 1F06A 3DBHB 3IP6A 2I4IA 3LK6A 4LYEA 2PZEA 4FYMA 4G1MB 4OXNA 3VOAA 1OXMA 5A02A 1KBOA 3OJXA 3HB4X 2EW1A 3E9YA 4GMFA 3WLMA 1QC5B 4IXDA 1KY2A 5A6SB 1EPUA 1A8HA 5EXEA 1RLJA 1SXJD 2OCKA 1Z4MA 4D4MA 2P9CA 1V3QE 2I3AA 3QJYA 3ZU3A 4CEIB 1HNWB 4QDUA 5DLPA 2JFPA 1BGVA 1D9XA 3I9NA 3KU1A 2VTBB 1NUHA 4D02A 1REQB 3GMDA 2EJWA 2XKKA 1I0ZA 5IEJA 2GAAA 1UFKA 3GFTA 5A9SA 2GRUA 1X8KA 1L7NA 2BM9A 3WICA 3AU9A 3EPPA 4D9EA 1ADFA 3QIVA 1RIFA 4QWWA 4Y2QA 2H1LA 4OI4A 5D3MB 3LFTA 2VF2A 1P8JA 1ONNA 3I2HA 3ER9A 3OQMA 1I3MA 3GWZA 1ISHA 4LNUB 4JIGA 4A10A 1G8AA 2C92A 4BLSA 3I9V1 2YMMA 2YMPA 5D5HA 1TZ2A 3A32A 3LAWA 3V42A 5A62A 1ZM2A 2Q8QA 3M89A 2QM8A 3I04A 1VGQA 3OE7D 2IFTA 3FMFA 5FHRA 1P9LA 3GMTA 2AEMA 2Q29A 2I3BA 1J8MF 3L0OA 4HDAA 4KVGA 4RE5A 4P58A 3NS7A 1AG9A 1IULA 1HFEL 5BN5B 1IZ7A 1VDZA 3I42A 4JA0A 4NZPA 5FKJA 5CDFA 3LGAA 4JI1B 4RZQA 1E2PA 1RAFA 4UM9B 1YOVB 4ESHA 3U44B 4B7ZA 5JXHA 1EGVB 3CO5A 3CLVA 2DLCX 1K63A 1Z08A 1TM1E 3B5EA 4WOJA 4DG8A 3NHJA 4KSYA 4BJ5A 1XPJA 4BQFA 2CLEB 2XRMA 3HYRA 2CUTA 5CU7A 1LRKA 2Y93A 2GN8A 5JIBA 4BVGA 5L45A 1P0QA 3DSRA 3OQPA 5C5DA 4UUQA 1RPZA 3QG5A 4CCYA 4E5PA 3GLGA 4RZ2A 4EY5A 1HT1E 1GRQA 4KTVE 3RG8A 5CXUA 4ZAXA 2OO3A 5L40A 2VJYA 2XE6A 3QP9A 3GD7A 1PFWA 2PH3A 3RQSA 3AINA 4JN6B 1V3VA 4HO1X 4N8SA 2Z5FA 2V7VA 5HF8A 1OLOA 2H00A 2NU7B 3TBFA 3H9UA 4F2DA 4MR8A 4PZZA 1PQUA 2QX4A 1KJ9A 1ZONA 4Q24A 3H2JA 2HCFA 3JQ6A 4OHUA 4RANA 1NLMA 1WL8A 5IU6A 4HN9A 1KH2A 4PAMA 3S2EA 1COZA 2PUBA 2V1XA 4GXNA 3O4HA 3HADA 4IZIA 4MS1A 4X6XA 3OTWA 5IFKA 4NFYA 2IYQA 2PBRA 2ZPAA 1ENZA 1W4LA 2D2XA 2NZ2A 5TT1A 5IWAB 4RADA 2P6PA 4JUIA 5FB3A 2ET6A 4EEKA 2OXCA 1FRQA 5CT8A 4MS4B 5J2UB 2X8AA 2G5GX 2NU8A 4KKXB 4U0JA 2OXRA 1JDBC 3AWIA 2J0EA 3VDNB 2II6A 3Q5GA 1P75A 4KE9A 1KI8A 3DOJA 2CNNA 4Y2SA 2B0JA 3UGJA 1IHYA 2XMSA 3VC7A 1P1RA 2XT0A 4JT8A 2PX6A 1UBLS 3N7TA 2W6OA 4CDGA 5TARA 3T94A 4JKIA 4JJ7A 4P0TA 1YQDA 2BYTA 1Q12A 2CVQA 1BE8A 3F6EX 2CMDA 4JZYA 4GRIA 3K70D 1RW4A 4ZVVA 3C3CA 3P19A 5HJ2A 2IWHA 2YVKA 2W83A 2ZTUA 2YWGA 3FYCA 3KEMA 2BMVA 3QEMB 4G81A 4YH1A 3CXRA 5DNWA 4EK9A 1LBTA 1M2JA 5FUVA 4ARUA 4NH4A 4HDNB 2QJFA 3EXG1 4YVFA 1YS9A 3GFQA 4MRSA 3O82A 4ID3A 1A4UA 3F90A 4DC0A 2FUG6 2H29A 1TFUA 2P27A 2HDHA 1UFQA 3C8ZA 4DBVO 5T6MA 3GN2A 1MVOA 1N8NA 1F2UA 1EGHA 2XX3A 3O9MA 2HLHA 3N53A 1SUPA 3EVZA 1NV9A 2JGAA 5SZJA 1AGNA 3WZMA 5IKMA 3OIVA 2QU8A 3BL8A 2EJVA 4FJ1A 5LDDC 2MSDB 1UC4B 4MPPA 2NTNA 3W6ZA 3MRVA 3WLTA 3ZY2A 4M21A 1QMPA 4LY3A 4V2UA 1RZUA 2CD9A 4IH1A 1H6BA 4PR3A 3AW8A 3L04A 4W8GA 2FN3A 5C18A 2IX3A 2CT8A 4R01A 1ZGJA 2ZRMA 5TMEA 3W1WA 3IPRA 1O97D 4B33A 4FILA 2DMRA 3S7TA 4YT8A 3F4KA 4GMDA 3AILA 2R85A 4AJJA 4DQUA 4QAQA 3RC9A 4D8TA 4IMRA 2KQUA 3MSXA 2Q5OA 1B23P 1I5RA 1S7CA 5GONA 4GS5A 4MWCA 5L3SA 1UT5A 3UWSA 3N75A 4NZOA 3WLKX 2GLTA 1M2FA 2PLWA 3ODPA 2C4UA 3KR9A 3NBXX 3LTEA 3D4PA 4L9SA 4Q9DA 3A1CA 1BCRB 2WRZA 2WWTA 1L5HA 3PEYA 3D8UA 4IEFB 4JJIA 1NVVR 1PLLA 4TSRA 4FFBB 3S0JA 5KWIA 3VU1A 1SN7A 1QG6A 5L9AA 2R4QA 1M1UA 1SHUX 4V0RA 3PYXA 3R3HA 4DLNA 1WDTA 4N5DA 1I14A 4PLVA 3BGVA 5E9AA 5TS3A 1SUAA 2DUMA 4EW2A 1CPYA 1P1HA 4F3KA 2UUAB 3X2EA 3NDIA 1NVUQ 5ALHA 1XWIA 1BZYA 5DSZA 5KBYA 4OXXA 4TZ6A 2H65A 2H5JA 4U7FA 5L7TA 1OH5A 3OQOA 2XVMA 2BZGA 3PD0A 4GI7A 4IIDA 5IJWA 3EIQA 1ID1A 1V95A 3ZGNA 2FWJA 3H42B 4ZVUA 2RGGA 3PFIA 2RJ3A 4LZNA 4OMCA 1FU8A 5I7OA 1M0WA 1TM5E 4YP6A 1AK1A 1LC3A 4AZSA 2JAOA 4GOLD 4JYCA 5BSHA 2JJ2D 3TDNA 2VDJA 1MF7A 3DMTC 4R1QA 1ZPDA 3DPSA 5FUXA 5F7ZA 3HBJA 2ZITA 1IVYA 3TQRA 2O1WA 1W48A 2UKDA 3LX5A 1GG9A 2Q2QA 3IS3A 4O4HB 1IM2A 4F3TA 2QJWA 4E5NA 1ZN2A 1UQUA 3MWLA 4HDQB 2VDMB 4QGSA 4ABTA 1N9ZA 4MPDA 1KU0A 3IQIX 3MTDA 4IIEA 4P53A 3CPEA 4QDXA 1JG2A 4IGEA 4EY3A 2OHHA 4PYNA 3VR3A 1WP4A 2H1FA 1K8XB 2XZPA 4HDOB 5EUQB 1KZ7B 4JELA 3W9BA 3BBPA 5G1OA 4HB3A 4D9MA 2R79A 5P21A 2B4YA 1X80B 3AG6A 1PZFA 1T1IA 4KLCA 1CJMA 2VPWA 5DHFA 5JECA 4I5FA 4YQYA 1HT3A 2HT1A 3TLAA 1GO2A 5EXTA 3R5JA 4RIFA 2EFGA 5FA5A 2VKTA 4DCNA 5LVAA 5BN3B 3C3PA 4DREA 1LNSA 1NLFA 2C2GA 3RT7A 2F8SA 3LBFA 3LNTA 2E55A 3UAYA 3BMNA 1MC5A 1GSHA 1HURA 3NO4A 1QFXA 4HI0E 4NONA 4UBIA 5DISB 4M22A 3RFXA 3WNCA 4TMKA 2EKLA 2VK4A 3CW8X 1K5DA 4QYIA 5K2MA 5T4FA 1D4OA 2VHEA 4R51A 4D4IA 2ZUVA 1WCIA 3ILYA 1PYOA 1BMFD 4CKXA 3IC5A 1V5WA 2FP3A 2X8WA 4U02A 3TKLA 1F2DA 2FEXA 3JD4A 5FEMA 1N0IA 2OKCA 1IJKA 3NNDA 4PBTA 4R6WA 2C2OA 4IHKA 4CG2A 1XZEA 3HU1A 4FNGA 4MYSA 3ZWOA 4OLAA 3ZLVA 2WUVA 1E2JA 5ALWA 4C7KA 2QP4A 4YRTA 4Q9JA 4QPPA 1N0WA 2A9FA 2AJLI 1E2NA 3D4OA 1L1RA 4L16A 4EI8A 4DR3B 1I4OA 4DG9A 3D4IA 4LEIA 3WR5A 2VSQA 5JPDA 2BKUA 1M34E 1FUUA 5CRIA 4UUBA 3M3HA 5KNDH 5AKHA 5A2QA 4QYSA 2OCIA 4DV4B 3A36A 4L76A 1XZDA 3HVKA 4I5DA 5J47A 4HGNA 1TLTA 2JRCA 4LPKA 4K6CA 3OMLA 4E2YA 3T1YB 5ALYA 3U3MA 1RWWA 1T0HB 4WECA 4HLUC 3L18A 3K0KA 4WWHA 2XB8A 3E70C 2AI2A 1UJ4A 4IIJF 5GWXA 1GQOA 2F9MA 3U1TA 2ECFA 4BXOA 1WB4A 1JVBA 1K86A 2OAP1 3FOWA 2QRQA 2YQ5A 1OUMA 2DULA 3QA9A 5F21A 2IIVA 4QGHA 1IEXA 3OICA 3Q0TA 4UM5A 4MW2A 3DPUA 5I9NA 5JDCC 4EW1A 4IRXA 3O8BA 5K3OA 1SHTX 1JJVA 2AX4A 3OZWA 4TYWA 4DV5B 1EE1A 2WTMA 1B2LA 4AC9A 4EX7A 5AH0A 2GN2A 3HJTA 1VSUA 4YRAA 1B14A 4UTOA 3S55A 4HDSB 2IDKA 4HQNA 3HNRA 1NIJA 3L41A 1MQ9A 5KNCH 2AR7A 4ODIA 5B12A 2C99A 1W0JA 1M33A 1ND6A 2B34A 2BFFA 4R16A 4RAOA 3K5WA 1FP4B 4I4NA 2QDKA 5EWLB 3JQCA 4BX0A 1MGPA 1YSCA 2JRLA 2FGKA 1QHHA 2BH2A 5DSXA 2EQAA 2V03A 5CYPA 4YV2A 1PRYA 2O8VA 2RBGA 2WZBA 3DKPA 3ITDA 3CPJB 2QUHA 4RHYA 4YXWD 2RCYA 3WWOA 2R7NA 2VDPB 1NBME 2A9PA 2IUFA 3BRWA 3HO8A 3MCWA 2PD3A 3MWEB 2DRIA 4JNCA 3C8UA 1A9XB 3I1YA 2ZZNA 3TGPA 4MQFA 1GAXA 1PE0A 3N58A 1CP3A 3PNBA 4Q9AA 4Y9RA 3KXKA 3SYRA 6NULA 3U60B 1OHHD 4D81A 3O2QB 2NSYA 4KZPA 1JIJA 3GLTA 1RKQA 1U0EA 2ZIFA 3CZ5A 2ODAA 3FVWA 3I76A 4BO3A 1WXGA 4XTRA 4DV7B 1RQNA 3LUJA 4KN9S 3WK4A 4EDFA 3JXEA 1XRMA 1TCAA 2P9QA 3ZJ5A 1QO0A 1DG9A 4LCBA 4QJIA 3NVAA 2XCQA 2PANA 2BMFA 2HHCA 2QD3A 4G0OA 4JQSA 2JLAA 3VZCA 1YJBA 4PYOA 5JXGA 5JDCA 2NO5A 1XAIA 3UGQA 3D7SA 2WMOB 3UENA 5EUBA 3HSYA 3BWYA 4QEZA 4KGDA 1P7VA 3H87A 1JH8A 2XH8A 4D8WA 2BMDA 2BTQA 2CN1A 3VU0A 2FPIA 1YJCA 1ZQ1A 1TA4A 3SVZA 3WWCA 1SK8A 3LQYA 2PS9A 4LJ9A 1X39A 4Q3DA 4FYIA 3BVPA 4CKCA 2NTYC 4F91B 4TLEA 4C6RA 2O5RA 1FJ2A 2XNSA 3JD1A 3HYTA 3V1YA 1O5TA 3VPHA 1NMYA 4L0CA 2AUNA 2V6FA 3PCTA 1S01A 2WDZA 2O57A 2WILA 4K05A 4MVXA 3WS7A 4C7MA 3H2IA 1E7SA 1VIAA 2HOQA 4N76A 3GNSA 3FH0A 4FD2A 4PLTA 2O2IA 1VJGA 2OQ2A 2QVXX 1M72A 1GLVA 2D3WA 3M82A 1Z4OA 3KVRA 4PQRA 4KKVA 4R2XA 4TSKA 2R8RA 4JMLA 5AI5A 1RI5A 1W96A 2VRCD 4QEDA 3RASA 2J0QA 3PIDA 4S2UA 1QAQA 1P4GA 3CU5A 1RAAA 4D1YA 3UXHA 1E59A 1Z18A 3D6AA 3QYJA 2FV8A 3D1JA 4F71A 3QF4B 5FA6A 3KG2A 5EY5B 4GH5A 2H5EA 5BWNA 4MR7A 3SC4A 5TC4A 1P0MA 2HMTA 5F2KA 2GXAA 2FEAA 3UHOA 4ZMRA 5FXMA 1RWNA 4IX1A 1NYLA 1AKNA 3WIVA 4BNLA 2BEWA 3PJEA 4D41A 4TZTA 4YBRA 1OIVA 1N6RA 1T9CA 3EIEA 3TXAA 5DWQA 1A4RA 1HDZA 1Z4LA 2WR8A 3H2YA 5AKIA 4NXMB 2CB0A 4F8JA 1QHEA 2FK8A 4PZLA 1E9CA 5FULA 3UBTA 1GV1A 1IY0A 4KK4A 1DJMA 4B3HA 2XDYA 1XAGA 3U0VA 1ZGHA 4F85A 2C4KA 3DBOB 2PGDA 3A9RA 3M4ZA 2O20A 5CA0B 3IE2A 3L7NA 3QYFA 2GCGA 2P2CA 5BNFA 1QIEA 1EDOA 3ZHUA 5LUAA 2PS3A 5BYKA 3ZJTA 4IPTA 2HDOA 1QUEA 2G3YA 3IXLA 3MT7A 2AJDA 3RRXA 5KWVA 3P9KA 2V7QD 1HYGA 1P9WA 3T3NA 1Z7GA 4M0LA 3BRSA 5LP1A 4IWYA 5HTKA 1OKKD 2W58A 4WA7A 3TLKA 5BW8A 1PSZA 1B15A 1W88B 3OM9A 2XB6A 4BRWA 3VOTA 3R3YA 4JYMA 3K92A 1CYEA 1AZSC 3OECA 1BROA 1MRNA 5B1IA 3AZQA 3T5DA 5CR9A 3EGXB 4DYDA 1DS6A 2JVKA 3LPAA 3AF3A 3PFWO 1K4KA 1PT9A 1PYGA 3CRQA 4K26A 1NONA 4E21A 1C29B 4NCIA 4DPLA 3RH0A 4MLDA 3SM3A 3UJ7A 3P20A 3GYBA 4BCBA 3GGPA 1KEPA 2QL5A 3M6MD 2NSJA 4K1XA 4WK2B 4YHBA 1Q1QA 5EP1A 3UBMA 3ZZUA 3B9PA 2JIBA 3W3AH 4XR4A 1QYCA 2YICA 2PN1A 4CKBA 1VLHA 4OKIA 1PIWA 2AH5A 5DW3A 1Y7PA 1S2GA 2AFVA 2XUAA 4E46A 4OI0A 1UBHS 1A2QA 3HU5A 4Q1CA 1AQYA 1MO6A 5FNVA 5TMBA 3F7OA 4MTLA 1KPGA 3V9AA 2CNOA 1DL5A 1XIVA 2GLUA 2WWHA 3B2NA 4WY2A 2NGRA 2O4UX 3I3OA 1WXQA 2AZ4A 2PK3A 3QXCA 3EVDA 4IIBA 4Z7OB 2A5JA 1KYTA 1QGZA 2QVLA 1I33A 1GZDA 4C4ZA 3N28A 4U6NA 1Z4JA 5A0VA 3ELDA 4AKEA 3NFYA 1JAHA 1U3TA 1YCGA 3V1KA 3T3MB 4LRUA 3W77A 3UJAA 2AJCA 2C9BA 4LDQA 5G0UA 4DLKA 5AVOA 3EAGA 2Z6UA 4F3YA 1YS2X 2AYYA 2XQKA 5K03A 2I2FA 2PMWB 2J33A 3TCNA 3HH8A 2PWPA 2WTNA 3VZPA 3VKVA 3T4UA 4Y2JA 2JI6A 1PP4A 1II0A 3HM2A 3WZ2A 5JCZA 5JYDA 5KYYA 2O8FA 1PDOA 1UZLA 2I5PO 3CW2A 2QWXA 1NXWA 2X7JA 3I9LA 2WG1A 3KM0A 2C8JA 5COAA 2JB9A 3BFKA 2W2LA 4JQOA 4RCYA 4ALLA 2GBIA 3ESZA 4D56A 3OG9A 4LVOA 5CDUA 3FLAA 3K2QA 3NLLA 1QNLA 3ZYCA 4Q21A 1WDWB 1Y4UA 1E2GA 3HNOA 3HWWA 3IA7A 5CYFA 4F5YA 4YRZA 2P2YA 3NH6A 2W70A 5L53A 3EXIA 1E6LA 1MKYA 4MVYA 3TZCA 4TWIA 3P4XA 2XXAB 4LF7B 3DVSX 4OEHA 4DARA 2CBXA 4YJKA 1K6JA 1OMOA 4ZI3A 1HOXA 1MRSA 3GQVA 2A0FA 1RKXA 4TSFA 3ORRA 1SKBA 4AY5A 5L3VA 3UAGA 2AKAB 2PT7A 5LQKA 1OLSB 2CVPA 1YMUA 4ZJYA 5EE3A 1N6NA 2QRUA 1GL9B 3OFVA 1TVCA 4IJUA 4US0R 4ARZA 4MHSA 3ZLBA 2GDZA 4Q3BA 4RKYA 3CF0A 1F48A 1QS0A 2QDXA 2WDPA 2UZ0A 3BPSA 1E8MA 3R23A 4PLGA 3EH1A 4PICA 4V03A 3VTAA 3IUQA 1YR8A 1EVZA 1QFYA 1VIVA 4KB5A 4MVJA 5FLYA 4Q5IA 3K1AA 1T35A 4H4EA 1HYEA 1TJ3A 3ZWDA 4ZZ0A 5BWMA 1EESA 1IOLA 3S68A 4HAIA 2VYCA 2VXYA 3SE0A 3IO5A 3P2JA 3DD1A 5DYYA 5KHAA 5FBHA 3FIUA 2O7RA 3D3JA 4MV1A 2QBYB 1U8YA 4PC7A 5ALLA 1C81A 4L07A 1RTKA 2O0MA 5F9FA 1GL7A 1GTL1 3O03A 1I24A 1PNVA 1RAEA 1EDZA 1A0OA 4UCXA 4X0EA 5F5LA 4DRXB 1DAIA 5HOQA 4ZODA 3IH5A 4DOMA 4MULA 5KTSA 2OD9A 3DOCA 2IH2A 2BT4A 2WSSD 4TVSA 1V5FA 1EVJA 1C1DA 1P7YA 2VWHA 3UAXA 3RVRA 1E1MA 2W2TA 3T9DA 4X61A 3OMXA 1P5ZB 1G2OA 2VRBA 5BXQC 2Y8EA 4EJMA 1P1KA 1MABA 1Z7YA 4F6CA 4OQNA 2BSQA 3K1TA 2F1HA 3PE4A 4L08A 1NPTO 1ZS9A 3MT9A 4Y2RA 1ESZA 2BBOA 3GZJA 3OZDA 4FGLA 4AWAA 1V35A 4B47A 5A6VA 2REQB 1L5OA 5LZ8A 3M3PA 1B43A 1D7OA 1Z62A 1EVIA 3FNEA 3RSCA 5IK2A 3JQ7A 4G0VA 2IEBA 3H5RA 3JARB 2CXNA 4HVAA 4FNOA 4I9FA 3THOA 3WBBA 1VPLA 4O2BB 4JC5A 3CGGA 4NK4A 2C2KA 2W4IA 3AIMA 1QH1A 3TFWA 1DXHA 3JV7A 3WB9A 1ST2A 4F97A 4ZJPA 1NP3A 3RS7A 1YIDA 2H9AA 2OPBA 1RSZA 1T2EA 2Z3VA 3IEMA 2PUAA 3FHJA 3F5SA 1GR0A 3IHLA 4KFRA 4FE4A 3U3KA 5EZ6B 3AUFA 4G1UC 1LV8A 3N8GA 5FQOA 4EB6B 1KI7A 5E38A 3PSAA 1PKEA 2XTMA 3NC4A 2GZ1A 3KVOA 1R0WA 2I54A 1Z63A 1KAHA 3OOSA 4LDAA 3OJWA 2F3PA 3NJRA 1Z6TA 1FFAA 3GPDG 4ZOQI 3C6XA 1KFEB 5MGBA 1J22A 2I33A 1P1BA 1U3FA 4LXUA 1JA9A 2ZIXA 4HP8A 4YPFA 1LA2A 1TCVA 3PTLA 1E1LA 1Q5PA 1TCCA 3ZHYA 1ZH6A 4JBWA 1X7WB 4L1KA 3RK4A 1CUJA 3T7RA 8ATCA 2AVNA 2O2GA 2VZ0A 2Q5FA 1PU2A 4NFSA 4WZ6A 3BBLA 4GRDA 4MRAA 3DEJA 3PDWA 4MQEA 7ADHA 4Y0NA 1JHUA 3DT8A 3CRZA 1UPFA 3MF4A 2AR0A 1ZJ5A 3MBIA 1TFRA 2FUNB 1YQXA 3L4BC 3VU3A 5FIUA 2X7HA 1NP7A 2FJUA 1TIBA 2KW5A 3F5DA 1P9OA 4L5YA 5CVDA 5FR2A 4LY6A 3Q7PA 1S9DA 4J0FA 3UANA 1T5SA 1U4SA 2ANCA 1MAWA 2VXBA 1KK1A 5FOXA 1UBRS 2Q0XA 1IVNA 1T6ZA 2JS7A 3AEKA 3BXZA 4NBTA 5AI6A 1XMIA 5LZ9A 5FDFA 1XJ0A 1X1CA 3MQFA 1DCKA 1DKNA 2IXDA 4Z0TA 5BSWA 1MO4A 4Q0MA 2HRCA 3N76A 4W63A 4XPIB 5ICGA 3DMFA 3O8OB 1XLVA 2B4QA 2FG5A 3FHCB 4OU5A 3PK0A 4X3OA 4BQEA 4ML3A 4QBGB 3CE6A 2ANBA 4S24A 4DNFA 3VGPA 1BN6A 1YQQA 3GVPA 3L8MA 3UB4A 3W05A 1UAAA 3HCBA 3KB6A 4CXMA 1H1TA 1ZXXA 3GRUA 1VL5A 4QOGA 1KRXA 4KE6A 4JS0A 1MRZA 3CCFA 4V0MA 4IXTA 5EJEA 1I9GA 4ZDJA 1OWLA 3EPHA 4HRYA 4TYYA 4B3JA 1D6NA 1OPXA 2PLAA 5DWVA 2XUDA 3IERA 1T6BY 2NVUA 4KQ6A 3T12A 2GFHA 3OZCA 3WQSB 5MGNA 2FTKE 1HR0B 5E95A 1NI5A 1IH8A 2HCTA 3HP4A 5JFGA 3GMSA 1NBHA 2FX3A 2L18A 3ZXUB 3W0LB 2DQSA 2Z30A 3L6BA 4WLUA 2DX7A 5E8RA 4NKRA 3QLJA 3SS7X 3IT2A 4PAQA 3SPXA 1YIOA 4OP2A 3TW6A 3BWMA 4XYEA 2ZBDA 3GNQA 5HF9A 3R8XA 1ZH8A 3C1AA 1TRHA 1XTJA 2IOFK 5EZQA 3UWMA 1EX9A 1OD6A 3KAQA 3L7KA 3E5RA 2ZPUA 3NTOA 3ZHQA 1ODSA 1SKMA 2ACKA 3ZTWA 3L6UA 2GCNA 4PIMA 1M1YE 4W8OA 3WRVA 1CUDA 2WVHA 2O48X 2QQ5A 1MW9X 5KINB 1Z5NA 2V96A 3E6AA 3LPMA 4FBLA 1M9NA 3OLCX 4H1VA 2W93A 5G1NA 2YYYA 4QOEA 3NIDB 4NJEA 3ZHSA 4TVBA 4J2TA 4PHTA 4R84A 5I7AA 4EYEA 4LE1A 4O3FA 1F6DA 4F11A 1ZIXA 2BHNA 1CZHA 3MJEA 2VF4X 2R6AA 3LPCA 2YYZA 3DHEA 5TQ0A 5ITSA 5KX5F 2R7KA 5L6LB 1Q21A 3FRIA 4MMXB 4NTZA 2ZBEA 9GPBA 3KQSA 4MB6A 3W8FA 4F9EA 2LV8A 4ETIA 1U5BB 1WCWA 2CXXA 2GCEA 3CKLA 1Z4PX 1ZH0A 4H4DA 3CLUC 5L3RA 4A2PA 1PL7A 4DLZA 1POXA 1EUZA 3BSWA 4M8LA 4EI7A 3ZS8A 2BV3A 4FB4A 5CDHA 5LP6F 4ZTUB 4MGYR 1PKXA 3WLJA 4BUJA 4ACAA 1XBTA 1R6TA 1MC1A 3TQSA 2B5OA 3DHWC 2A84A 2YY6A 4QJ4A 1M1NB 4YONB 2J7PD 3OC6A 5DCYA 4JHXA 1JR3E 4YJ2A 4W4TA 2IVFA 3EFOA 1E92A 3CLTD 3RYIB 6YASA 1WSBA 5DX1A 3MRSA 5B1SA 3BH7A 5LA6F 1M5TA 5K3BA 3WHLA 1Z8HA 2LXNA 5EHNA 3IQHX 5JC8A 2RC5A 3M4JA 4E12A 1K6MA 2GZAA 2UVDA 2BGTA 5LR6A 2DTEA 4K86A 5TNXA 3SHFA 2JLZA 3LF1A 4MVCA 4UD2A 3NZEA 5F76A 1PS8A 2PX2A 3A4VA 3DDNA 1VE1A 4WLVA 2V1UA 1YV9A 4H7EA 2PHZA 2WAOA 2O9JA 1E9EA 4FFRA 2OVFA 4A1OA 1JKXA 2QVZX 2WTAA 3LUFA 4M0KA 5DE3A 2BKXA 3DEHA 3LLVA 3UZUA 2WA2A 3L0IB 1KAEA 4YUZA 3IAAA 3ONWA 3TQFA 4EMSA 4XVRA 4KQJA 1U63A 3PNVA 3B1YA 3B52X 3V3TA 1Z3IX 4F4IA 2XCTB 1UPTA 2FSGA 3M70A 2PZGA 2I6FA 2QV7A 1GKLA 4A36A 4S1WA 4IMIB 5FI5A 1L7PA 3BXXA 3HKBB 3RB8A 1DJQA 4K9RA 1AX9A 4TMWA 3SQOA 2FVYA 4YCCA 6PFKA 4MRMB 1KXZA 3KJHA 2E7ZA 5I9BA 4EPWA 3P2OA 1OPRA 3Q10A 4LDZA 1J07A 3EIWA 1L4EA 1TEXA 2OQIA 2Q3FA 3B48A 1PJBA 2D5AA 3DTVD 3DUFA 2CXRA 3GEIA 1FNMA 3NNNA 3NV9A 1R4MB 4FYXA 1KU6A 1K4YA 2GAIA 5EIBD 4CVNA 1GPLA 4AJPA 1GYQA 3R74A 4DCCA 3G9XA 4WJLA 8GPBA 3F4BA 2XZLA 1RRVA 2P9YA 3T7KA 1L8AA 1IUKA 1YB2A 1B8NA 1MDBA 1R4NB 1TKCA 2GN4A 4YJFA 4ZV9A 3ZGYA 5JFOA 3KZ1E 1BMDA 4DV6B 5J2TB 2Q9CA 2CDNA 2PAFA 3BMXA 1EFHA 4D4GA 1LCIA 1NMQA 1Z36A 1G1AA 3LLCA 4OQDA 4EJ2A 5IP5A 2BBTA 2A1UA 4OGKA 1KS2A 2A7XA 1Z0SA 4GIBA 4YP1A 2F8LA 3CINA 1IN4A 2A9QA 1ZK1A 2BR4A 3B9QA 3NHPA 1GT91 4I50B 3KOZA 3QW2A 1WTAA 4ON9A 3ZDXB 3WE7A 1GPNA 2PBZA 4ZOLB 1QX4A 4MMZB 4IKOA 2QJRA 1PGNA 4LE2A 4R8RA 4AI6A 2JAPA 3L4JA 3LGSA 3B9RA 4QHSA 5HIIA 4BNVA 4LQDA 2ZCJA 3IURA 1AT1A 5EYPA 5CLJA 4C4XA 2PLRA 1ZOOA 1JH9A 4GOXA 4DEXA 3D3QA 5KYVA 3QUCA 4WJZA 4UTRA 4A0RA 3K7EA 2B8EA 3AUKA 4TXLA 2OCXA 2BSAA 3Q72A 3C43A 4C0QC 5AUOB 3F6CA 1SXHA 4E14A 2NYVA 3IT3A 1ILWA 3KJXA 4ZTBA 1K97A 3PQ8A 4GP9A 2HHAA 3LT5A 2FGJA 3PNOA 1V37A 5F5XA 1DE0A 1PHRA 1HLPA 3KKZA 4OLHA 4DA0A 3FRHA 3VR5H 1FTSA 1G21B 1Z88A 2Z8ZA 2C07A 2XD9A 3HWX1 3MJRA 1RM3A 1V11A 4JUCA 4LSWA 4PYLA 2ZSFA 1Y1SA 5YASA 1R0CA 4LC0A 3ST7A 3ZXSA 4NDAA 1RHJA 3MINA 5G0WA 2OXEA 4FW8A 4TXHA 1KK0A 2DCUA 1CFZA 4ZHQA 3UK0A 2P4QA 3WLLA 1Y8ZA 1FS6A 3KOYA 4FDVA 3VZSA 1RRKA 1LXCA 2Q1XA 5LN1A 2CHFA 2WHRA 3QH4A 1HF3A 2BOVA 2GX6A 3F3MA 1ZJ6A 4ENVA 5K0CA 1QVZA 3WK8A 2IYWA 1LJLA 1YDFA 1DEOA 5LU9A 1EMDA 3UEOA 1DAHA 1HT2E 3OE7A 3MCVA 1VJDA 3CB2A 5CUQA 4Q9LA 1TCBA 4XSGA 3RJMA 3WTCA 5AM3A 4G0NA 2VWGA 4O4JF 1HNNA 1WHTB 1BXZA 2SICE 4I1UA 1C7QA 1NPYA 2OBYA 4A6EA 2WTUA 1USKA 4NAUA 4LV8B 4EFLA 5BQXA 1WCV1 1CWUA 3REQB 1TK9A 2I22A 3I6YA 4GE0A 5BWBA 2O14A 3ANLA 3HMKA 4GYKA 2C7QA 1YL6A 4I5EA 4CGYA 4NYIR 3P2IA 2GPWA 1GZUA 1L4FA 3EIFA 4WY5A 2CW5A 1M83A 2R0QC 1VI6A 3E5HA 4QDKA 3LWBA 2C5AA 2YHUA 1J6UA 1QWSA 2ZQ5A 1BW9B 1Z2OX 1VJ5A 4DG5A 3G0CA 1QE3A 1Z12A 1IN1A 2QZJA 1JECA 3MJFA 4HAXA 2C1ZA 3AMVA 1KY3A 3NBMA 3HR4A 3LUHA 5I9SA 5BUCA 1X7ZB 2H0RA 1FPMA 1LF0A 4QARA 4DSZA 3F3YA 5E1MA 2PV0A 5HQTA 4RMHA 2R1VA 1W47A 1A7UA 4RETA 3MBKA 5FFFA 3D4NA 4UHBA 5F7OA 3T52A 2VFAA 4NBVA 1ATZA 3CNNA 3ENKA 1E6EA 2NV6A 3CONA 5G53C 2OC4A 3S1AA 1TDJA 1U7OA 1J0BA 2YTZA 3AR7A 1T6YA 3I3SR 4CMCA 1GU1A 2UZ3A 1S8OA 3KTAA 2AC4A 2DQKA 3C98A 3N2GB 3INGA 2FKNA 1VMEA 3OFSA 4WZBE 3W5DA 3NT4A 1S3FA 3CT6A 3P7MA 1YZKA 3PG5A 4K6HA 3NETA 1HFWA 4RKWA 1MA3A 1TU4A 2HO5A 4CUZA 4N9QA 2ISSD 1ZBDA 2EX1A 2BKLA 4PX3A 1EVLA 2XDQA 5C7OO 1KR2A 2Y1OA 4ZOCA 2XTJA 3HK2A 3PXXA 4OFZA 4BWFB 4BTLA 3OHMA 4CTKA 5B36A 4FONA 1EVEA 4WL0A 2HA5A 3GK3A 2PY6A 3FKQA 2MT9A 3TTWA 4FFMA 4GRAA 1OFTA 4ZO7A 1N8TA 4I0WB 2OYRA 4D9CA 2ZSAA 4LCJA 3KJQA 4GLFA 2VYVA 3GRVA 2DH5A 3BFVA 4POAA 5LUBA 2WAMA 3T5TA 4NULA 3VNRA 2HK9A 2Z3WA 5DI9A 4F5DA 1YZGA 3IKVA 1VB3A 1JS1X 3EDCA 1FUYB 5EMLA 4AFNA 2YDYA 3PPWA 3RSFA 4KQKA 2AI3A 4DCGA 5A9RA 4CM8A 4EYOA 8AT1A 4P80A 1W0KD 4JSRA 4LAFA 4OAOA 2XHEA 3HUDA 1NF2A 2BEKA 3EFBA 1SKAA 4U0KA 2B99A 1QH9A 3QKSA 4QUHA 3UXEA 1JDTA 4KDCA 4OHVA 4JT9A 3BJRA 4NBRA 4ZKEA 1E1CB 3GGSA 4ZK2A 3PEEA 4LY0A 3PLNA 1SXGA 3VPSA 4AKIA 3AV0B 4B5LA 1CZLA 4BAUA 1Q11A 4CMAA 4HR7A 2RHOA 4TS9A 2VZLA 1N7JA 3T54A 2G9RA 1YRYE 3QXSA 2EVWX 1X1SA 2W9XA 3DBIA 1N5RA 1I30A 3NB0A 3Q3HA 2RG7A 3BB1A 2QLFA 2XB9A 1Y8RB 4RQTA 4WKCA 3WB0A 2FMKA 5THQA 5K8CA 4ZWNA 3EISA 3PQFA 2BMAA 3UMVA 3E8MA 3VYSB 3FE2A 1EZZA 5IABA 2WUEA 4G9GA 5FPSA 3RYTC 2J31A 1KOJA 4QM7A 4R3UC 5FFNA 1EFPB 1U81A 3DL2A 5TR9A 3U48A 4BB5A 1JTEA 3VGJA 3A7DA 5TSDA 3UA3A 1DAEA 3ZOKA 4ASUD 3I61A 3SP1A 2OBMA 1QH0A 4FMPA 4WNAB 1JTFA 3D7RA 3KR1A 4AVYA 2IUYA 2YVLA 3CZCA 4UAGA 4DZZA 5A03A 1UXHA 5B3KA 4C1BA 5JJ5A 3MUOA 1ND5A 2OAGA 4P7FA 3RQIA 4BHTA 5J3JA 4N48A 1HKUA 2IT1A 2Y05A 3S5JA 5H9WA 1O6CA 1RYEA 1X1AA 1XMPA 3KDSE 1YKFA 4J4HA 5GIOE 4BVAA 4Z4GA 1ZMOA 2OL4A 2WQ6A 3DFUA 3NDPA 1ZVVA 3GLQA 1WWKA 3EJWA 1NVKA 3NC1C 2XXBA 3X1JA 1FNDA 3L77A 1A95A 2ZYHA 4EUKA 4OIMA 3CS3A 2P8SA 5BNTA 3ZTTA 4EYKA 5BRJA 2ODBA 1AS3A 5CYOA 2NTEA 1TM3E 4A0QA 4B3BA 1CVLA 3FDZA 4KPFC 3I4LA 4LYDA 3C7TA 3G7UA 2GJSA 5ICMA 2HUPA 4IGIA 3M4YA 3PQ6A 2WC1A 4P3KA 1GRCA 4PZAA 4TT3A 4IFEA 1H2HA 2WSLA 2P6NA 4U4AA 2K7ZA 3C45A 3IESA 5CT4A 4ZT5A 4NC9A 5DBHX 3RV3A 3R9XB 2IPLA 1D0VA 3LRPA 3P2KA 4BNGA 2QTVA 2IV7A 3ZIAA 1IM8A 4S04A 3SG0A 3ISVA 3TAUA 5F2NA 1ULZA 2EYQA 2C54A 3FUXA 3QTTA 3T35A 4IOJA 1OU4A 4NOLA 3KDPA 1P18A 5CH5A 1AM4D 3N6XA 4R54A 3QFCA 1LK7A 4GSLA 5DOVA 2IYLD 5K0JA 1HYHA 2GM3A 1GA1A 3ROFA 3VHXB 3L3BA 4TL6A 4NE9A 1Q44A 2JHPA 1IG3A 4A9AA 2Y1CA 1W36B 4ESOA 2WOOA 3GXBA 4XUEA 3ME5A 1FNSA 4DIUA 4EHJA 2HTEA 4H7DA 3ELYA 2XWSA 3W5CA 3NP9A 5HIMA 2ZBVA 2JLBA 4BTEA 2G9NA 3WNBA 3CCCA 2IOHA 3O5AA 4LDPA 4YAKA 4TM7A 1Y6ZA 2RI0A 1P5JA