3KQMA

Crystal structure of hpnmt in complex adohcy and 4-bromo-1h-imidazole
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqmA00
3G5LA 3P2KA 2OB2A 4KVZA 3A7DA 3NDIA 1RI5A 3M70A 4LWPA 1TPYA 2GA9A 4G56A 3B3GA 4UOEA 1DUSA 1I1NA 1Z3CA 3T7RA 5K01A 5DM0A 5EZQA 4HGYA 5EEGA 2IH4A 4YUWA 1BKYA 4C05A 4YV2A 1RJFA 4A6EA 1XJ5A 2ZVJA 4E70A 2P1DA 5LQAA 5U4XA 5G02A 1JQDA 2QE6A 1VBFA 2Y1WA 2O57A 2FCAA 2VP3A 2AVNA 2CMHA 9MHTA 2IDKA 4RTMA 2NXEA 4HGZA 2OBFA 3EVGA 3OU7A 2AOVA 3G2QA 3TKYA 10MHA 3PX2A 4C04A 1JG1A 5DX8A 2PX5A 4FZVA 3BGIA 4F86A 1JSXA 5HZMA 1DCTA 5K0FA 3FPGA 1Y8CA 5E1MA 2FRXA 2PT9A 3RODA 2FYTA 3DR5A 3KQOA 4P7JA 4DKJA 2VDVE 3A25A 3HCFA 5EKXA 3EGEA 2PT6A 5ERGB 2QRVB 4OBXA 3ANXA 3QOXA 1O54A 3GDHA 5GIOE 5DTMA 4BP1A 4C08A 5EQJB 1KR5A 1XVAA 3MQ2A 1IM8A 3HCBA 3HCCA 3P9IA 1UWVA 5CVEA 2UZ4A 2IGTA 5HEKA 3GJYA 4KWCA 1KIAA 5LR6A 3R6TA 5H02A 4RTOA 3LGAA 1P91A 4IKPA 4M7RA 2IP2A 3V97A 1JG3A 4YMGA 1QAOA 3HP7A 1D2GA 3OCJA 3C6MA 1JSZA 3TPZA 5BP7A 1D2CA 4EK9A 3PTAA 3GRUA 3FTCA 5JUWA 1XTPA 3THRA 1RJGA 1SUIA 3OU6A 3DLCA 3QV2A 3SGLA 1P39A 1IY9A 4KIGA 3E05A 5LQJA 2WA2A 3THSA 3REOA 1T43A 2PX8A 3DXZA 5E9JA 4RTNA 3NVKI 1SKMA 1AF7A 1NBIA 5CCXA 3G7UA 2E5WA 3TQSA 5KQSA 1AV6A 2AOTB 1L3IA 1H1DA 4KIFA 3JWIA 4GOOD 2ZBQA 4RVFA 1G6Q1 4C03A 3UJDA 5DXAA 3BT7A 2C7PA 1YB2A 3SXJA 1Q0SA 5CUQA 5EMJA 4B17A 3E7PA 4RTKA 3BGDA 3LDFA 3C6KA 4RTQA 1ZQ9A 1I9GA 3PFGA 1UFKA 3AXSA 3NW9A 1NW3A 3LCVB 2B25A 2CKDA 4PONA 1FP1D 5DM2A 5E1OA 2ZBRA 2OPBA 1RJEA 2GS9A 4HH4A 1X1AA 2BR4A 4DF3A 2JHCA 2O0LA 3P8ZA 3D2LA 3EGVA 4YUYA 3KQYA 3G2MA 5FWDA 2OY0A 1X1BA 2ZLBA 5KYGA 3G5TA 1FP2A 3G8AA 4DA4A 3EVCA 3DMFA 1AQIA 2VS1A 2PVCA 3RW9A 3FRHA 1ORIA 4LG1A 4X41A 2OYRA 1NT2A 4H0NA 3AWIA 3I64A 4RSRA 2B3TA 2ERCA 2IDJA 3IYLW 3EGIA 3P2EA 5F2KA 3UJ7A 2Q41A 5F2NA 5E8JA 1NW5A 5MHTA 3KPYA 5EGSA 4MHTA 2JHPA 2NXJA 3KQSA 2P41A 3M6VA 5CVDA 3KQWA 4P58A 1X1CA 3I9FA 5EVJA 4ER3A 1ZKDA 2YQZA 3Q87B 5CVVA 4BLWA 1RI2A 5K05A 2H1RA 3EPPA 1SUSA 5K03A 2C7OA 3MCZA 2XVMA 2F8LA 1O9HA 3UJ6A 2XYVA 4RYLA 2XYRA 5FTWA 3TMAA 3G2PA 8MHTA 5FUBA 1VE3A 4EKGA 5K0CA 3NMUF 3TM4A 4NECA 4Z2YA 4RWZA 1VQ1A 3KPJA 1JR4A 1NV8A 4QDJA 2IFTA 4RVHA 2P3OA 3QOWA 2JH8A 3BZBA 3AY0A 3HEMA 2BH2A 3EVFA 3LL7A 2ZZKA 5E8RA 4OA8A 3JWHA 1BHJA 3G8BA 4X63A 3M4XA 4RVDA 2ONYA 5EKUA 3HTXA 1KXZA 2O07A 2HNKA 3R0QA 5HIMA 1BOOA 3SX0A 4YV0A 3EVZA 4EKIA 4E2WA 3T7TA 2Y1XA 3HA7A 4DM3A 1VLMA 1UIRA 3FRIA 2QY6A 5HIKA 1YF3A 5K0GA 1QAMA 2UYOA 4FT2A 4PNEA 2PWYA 3OZRA 5DWQA 1XDUA 2K4MA 4C07A 2I9KA 2DPMA 1YFLA 1VL5A 3A7EA 2PGXA 4YUXA 1RI3A 3LDGA 1M0EA 3CJQA 2IPXA 3BWMA 5GIPE 3M6WA 1YZ3A 1VIDA 4Y30A 3TR6A 5HILA 4ER6A 2G1PA 3TLJA 3EEYA 3VSEA 3LCCA 1SVUA 3DH0A 2HWKA 2ZIFA 3CVOA 3P9KA 5ICEA 1G8AA 5JR3A 3OU2A 1NV9A 3R24A 1KPIA 1QZZA 2CL5A 3CJRA 3KHKA 2IBSA 2N47A 4CKEA 3FUXA 3C3YA 4IWNA 3KR0A 4QPPA 3CGGA 3CCFA 3HNRA 2YTZA 2UYCA 3OE4A 4PWYA 4AZWA 5GM1A 2IH2A 4E2YA 5FULA 2AOWA 1SG9A 2HR1A 2P35A 5K0EA 2PJDA 5FA5A 4Y2HA 2ZTHA 4CWAA 1WZNA 3KR1A 3MB5A 3KQVA 4E2XA 3DOUA 2EFJA 3DTNA 1NBHA 3SMQA 4AZVA 5T64A 5K09A 4E30A 3LECA 3ELDA 1L9KA 3LKDA 3V8VA 2PY6A 2ZZNA 2YXDA 3NWBA 5CM2Z 3ER9A 1KHHA 2VZ9A 2OZVA 2PXXA 1PRYA 5FA8A 2FHPA 5T67A 2AN3A 4YUVA 2C7RA 2VDWA 5KS2A 2BM9A 1R00A 3FYCA 3I53A 2P7IA 4RTSA 3MGGA 3FTEA 5DXJA 1R74A 4XUDA 2Z6QA 2JJQA 2AOUB 3C0KA 1Q0TA 2IBTA 1JQEA 1JQ3A 3SSMA 3AXTA 2QYOA 2PXCA 2PWPA 3I58A 3PFHA 3L8DA 5E9WA 1YFJA 4PYIA 3MAGA 4BLVA 1BC5A 4RTJA 1M6YA 5DRTA 4AUKA 3KQPA 2FK8A 3HCAA 3HCDA 5E9QA 2OXTA 1KYZA 2YX1A 5GINE 1EJ0A 3TFWA 4MQ4A 3LBYA 3LDUA 1KPHA 3HVIA 5FADA 3LHDA 4JXJA 2XYQA 4FGZA 3OPNA 2AN4A 1XDZA 4DQ0A 3ER8A 1R8XA 1ZGJA 1EG2A 5DLYA 3ORHA 1FJXA 3VYWA 2AZTA 3KQQA 3SSNA 3NTVA 5FQOA 1WY7A 3EMBA 1G55A 3BWYA 2B9EA 2QM3A 2I6GA 4HTFA 2GPYA 3PS9A 4OQEA 5DSTA 5EEHA 4DZRA 3BWCA 4GF5A 2ZBPA 5EPEA 1EIZA 2P40A 3HA5A 4A6DA 2ZWVA 1D2HA 2EJTA 4QTUB 4LECA 3K6RA 4GOND 5LSAA 2LD4A 3HVHA 3ELYA 1X19A 3FPFA 1JG2A 4F85A 3ERCA 1R8YA 5C1IA 3BGVA 3PB3A 3DXYA 3P9NA 2ADMA 2OKCA 4ER7A 3GO4A 3I5UA 3UBTA 1TW3A 3IV6A 1IXKA 2VDUE 1U2ZA 2G72A 3DULA 3E8SA 4FSXA 4E32A 4M36A 3KQTA 4GOLD 3EEOA 3G89A 5K0NA 4RV9A 3UJ9A 3GGDA 2WA1A 2AOTA 1X1DA 2Z6UA 3EMDA 4C4AA 1YZHA 4KRGA 4CXMA 2ZIEA 2ZW9A 1VPTA 3KPWA 3UA3A 2BM8A 2HMYB 3ELWA 3P2IA 4QVGA 3X0DA 3KPUA 3DUWA 4ATNA 3EVAA 3P97A 4PYKA 4PYMA 5DSXA 4AX8A 2G70A 1JTEA 3HVKA 1QAQA 1P1BA 2V7EA 4WVLA 4XUEA 3UJBA 4PIMA 4XUCA 5FWAA 1EQAA 2EG5A 5K0LA 5E2BA 1XDSA 3WSTA 3HA3A 3S68A 2ORED 3G2OA 5D1NA 3GXOA 3OZSA 3LPMA 4R6WA 5DRYA 3MHTA 3P9CA 3UJ8A 1JTFA 2PX4A 1QYRA 1PJZA 2O06A 5K8VA 1MHTA 3TM5A 1QANA 3B5IA 4OBWA 3M6XA 4EVIA 3FUTA 3M6UA 4LWOA 5KVAA 2C7QA 1V39A 3BUSA 4P7GA 1P1CA 4FS8A 5LQCA 1N7IA 3DLIA 2OO3A 3KPVA 4QQKA 2HV9A 1G8SA 2NNWB 3A27A 5DTRA 4PCLA 5K0BA 3SVZA 4GBED 3HVJA 2ZIGA 3IEIA 3UWPA 4GEKA 4DCMA 4PYJA 3TOSA 5CIYA 2NXNA 2PKWA 2YXEA 5FQNA 4RTLA 3B3FA 4RTPA 2P3QA 2PV0A 3GNLA 1L3BA 2BR3A 1WG8A 4PYQA 3FPHA 3OE5A 1KP9A 2IIPA 4R8SA 2NYUA 5EOVA 4C06A 4MIKA 2EX4A 4E33A 3PVCA 3MTIA 1KYWA 5CD1A 1NW7A 4RX1A 3OFKA 3TRKA 1XCJA 3NDJA 3Q7EA 2JHAA 3T0IA 5C9ZA 1INLA 4RVGA 2PSSA 4HC4A 3KKZA 5IH3A 3BKWA 4F84A 2ONZA 1F3LA 4OA5A 4PGGA 5GWXA 5P8WA 4R6XA 4P7FA 4QDKA 3A26A 3EVDA 3ME5A 5HIIA 5C0OE 4QPNA 5ICCA 1DL5A 5EMKA 5E1DA 4V0QA 5EMLA 3LX6A 2GAFA 5LQNA 3O31A 4PGHA 3OFJA 4AZTA 2ZZMA 2YVLA 2NXCA 2WK1A 3SM3A 4EQZA 1NKVA 4M38A 3PT9A 1N2XA 5DX0A 2JH9A 3A4TA 5DPMA 3FTDA 1NW6A 3UA4A 5EIWA 1B42A 2EJUA 2PLWA 5K0JA 3VC2A 3G88A 1VP3A 2P8JA 2AS0A 2G8NA 3LKZA 5CCBA 3KR2A 1R6AA 4HSGA 3E23A 3GRRA 1XXLA 4PYOA 3O4FA 2XBMA 2ZFUA 4AZSA 3B89A 4FT4A 1OR8A 4R05A 4GQBA 4CTJA 3FZGA 4YV1A 1L3CA 2GH1A 5DM1A 5LQRA 1SQGA 1G38A 5F2OA 1AQJA 4R8RA 2ZULA 2FPOA 3LSTA 1RI1A 4MWZA 4BLUA 3JWGA 3NVMB 2G71A 5LQKA 3OZTA 4QTTB 5ICGA 2V74B 3LCUA 1G60A 3GWZA 3JWJA 3FTFA 3PLAE 1N7JA 1NE2A 3B3JA 4HTFB 3ELUA 2HTEA 3C3PA 3UJCA 4L7VA 5KQRA 2KW5A 2P3LA 2NP6A 5LQUA 2P7HA 4POOA 2QRVA 3MTEA 3KU1A 3UJAA 1KPGA 1FBNA 2FK7A 4KDCA 4PIPA 5T6BA 3SR4A 2R6ZA 4RTRA 3MCTA 3M33A 5HFJA 2DULA 4PINA 5B1SA 3UZUA 1WXXA 2CWWA 1F38A 3EVBA 2PX2A 4GOMD 1R18A 3CKKA 2AN5A 3GRZA 2YUIA 3FYDA 3PX3A 2AR0A 4U7TB 3AJDA 3TKAA 4CTKA 3FPJA 4IV8A 3LBFA 5HIJA 2AOUA 2H11A 2H00A 2YXLA 5DM4A 5EZSA 2NP7A 2PXAA 4KDRA 2B78A 5EMMA 3BKXA 2R3SA 2O05A 2OB1A 5EIFA 5GM2A 3GRYA 3U81A 4HG2A 4M37A 2ZCJA 3FPEA 2GLUA 4X61A 1MJFA 5DX1A 5DT2A 4DMGA 4YMHA 3CC8A 5EG5A 4EMSA 2XVAA 2GB4A 4GUAA 5BXYA 1NW8A 1XCLA 4WXHA 4V0RA 4PCAA 5D1HA 2AVDA 4XCXA 5HOQA 3HM2A 4GC9A 5E1BA 3UFBA 3DMGA 1ZHFA 2Z6AA 5CVJA 4QVKA 3KQMA 3DP7A 5M5BA 3SSOA 5E2AA 2UYHA 4CKCA 2ZWAA 2B2CA 3B7PA 5EHIA 3T7SA 4X1OA 3BWBA 4PYNA 1ZGAA 1HMYA 1O9GA 2ZSUA 4QQNA 1SQFA 3GCZA 5FHRA 4ER5A 4HRAA 5FHQA 3VC1A 1RJDA 1ZG3A 3R9XB 4IV0A 4ZTBA 3ID6C 4FR0A 3CBGA 3FUUA 3FUVA 4DCGA 2IH5A 3EVEA 3NWEA 1WXWA 4E31A 4BP3A 1RI4A 2YR0A 4FSDA 4ISCA 3DMHA 5BW4A 1L1EA 1WS6A 2BR5A 3BXOA 5BW5A 3HCEA 4KW7A 3F4KA 2UYQA 4U7PB 1EJ6A 2CMGA 3MERA 4GC5A 5GOZA 3O7WA 1I4WA 1YUBA 2A14A 4OQDA 4BY9E 1VP9A 2I7CA 4X60A 3GU3A 5ICFA 1M6EX 2I62A 1EAMA 1ORHA 2BZGA 3P71T 5EHGA 4P7KA 3FUWA 5IKMA 1TW2A 4K6MA 4O29A 3NJRA 4PYLA 3K0BA 4YUZA 4E2ZA 1JG4A 3KR9A 3CJTA 3GRVA 5EC8A 3GIWA 4OX9Y 5GP1A 3R3HA 2ESRA 2AOXA 3H2BA 4CKBA 2PBFA 1HNNA 1FPQA 4MTLA 3IHTA 5CVUA 5FCDA 3RIEA 4ER0A 7MHTA 5DTQA 4FP9A 3DXXA 2JG3A
chains in the Genus database with same CATH superfamily
3I5AA 1R0RE 4LJLA 4NCKA 5IAJA 5T6MA 1XGKA 1P73A 5DM60 5CDFE 4OM7A 5D5QA 4DSNA 3Q7PA 4HZIA 3WRXC 4OK3A 1RBMA 3PDIA 2BMWA 4ZO4A 1NDQA 1YS4A 3ADPA 3ZWOA 5BRJA 1QOZA 4LHYA 4LUCA 4YHBA 1E3WA 3SF0A 1G0OA 3WBKA 2B8TA 5AH0A 5CNJA 1RXWA 4JA2A 3WSVA 5ITZB 5TVKA 2E4VA 2F90A 5T4BA 1YJ8A 4ETNA 2W70A 2KWIA 1WTAA 2GKGA 3R7BA 2ZB8A 3Q72A 3VPDA 2IDKA 3SJCA 3NEJA 4B9AA 3CZCA 1OBHA 2WR8A 4C04A 1RLTA 3H9UA 3PUXA 1J06A 2RI6A 4GYYA 1TZCA 5F1KA 1NASA 3WMEA 5K0FA 1PP4A 2DCUA 2QM7A 3DL7A 4OH1A 2Q6OA 2QT9A 5EZ5A 3T4XA 1XEXB 1A9RA 3BCUA 3RKUA 1KOJA 4M0PA 5KNDD 4RD2A 1A69A 4FE7A 4WLVA 4C7OB 3CLRC 1L0BA 1ISHA 5ALOA 1AK9A 4P34A 1BGXT 4BNZA 5FPSA 4QECA 4D8VA 2ZDQA 3L04A 1QIGA 1PDVA 3L8YA 3NOQA 1K8YB 1T91A 3ANXA 4OHZA 4MVJD 3C43A 2NV0A 3DOHA 5B36A 1I1HA 2XDQA 2IP1A 4C08A 3IPAA 1HV8A 2P75A 3AIKA 5LCXA 4RK6A 3MQ2A 4UC0A 3KSRA 1GG9A 4HDKA 3FFBA 1Y8ZA 2WWGA 4EPXA 3D0KA 3HCRA 3VR2A 4B3GA 2HIAA 4BE7B 3S2SA 2IKQA 4F6RA 4R71A 4IFBA 1XQ6A 1TVKB 2VNIA 1MT0A 3MWYW 4G5YA 3MPUA 1W2GA 2GAJA 4F38A 4WEOA 5BVHB 1MG0A 3BMQA 4U9UA 1V11B 5ESWA 5EWJB 1RRCA 1SG6A 3FR7A 2O1EA 4G0QA 1K3UB 3PIIA 1V6SA 5JI2E 1IY9A 3VO1A 2K7ZA 2O1XA 3LT5A 3DXZA 4J29A 2X8JA 4BCCA 4ZDJA 3NVKI 1W8DA 5BN4B 5KVQA 5BWMA 1GFWA 3U0BA 4BFUA 3RC8A 3BEDA 2YN2A 4J8PA 4A73A 5JLJA 2R5NA 2JEZA 4GLOA 3S1LA 5IG2A 2JCXA 4GPTA 4OY3A 4PF1A 1AKMA 2W2LA 2LKDA 2PEZA 4TV9F 3TLYA 2P5TB 4F46A 2PE5A 1P2VA 1U63A 2A6PA 2P9EA 2EZ8A 2CXHA 2WPNA 5FOXA 3LDFA 3VYSB 3SQWA 1JIIA 5CR9A 4YO7A 3NDBB 1RM3A 2RMKA 1QO0D 3A4MA 2XR1A 1TC2A 2EEPA 2ICAA 1MQ8B 2VOJA 3BX1A 1XZMA 1BU8A 3LBHA 3MRVA 4X64B 4W5OA 4Y1EA 3AILA 3M0EA 4W7HA 4BMCA 4WL0A 3U56A 4C3UA 2ZIXA 1OOEA 4YJKA 3FNEA 4FB4A 1EK5A 1E79A 2I33A 5CFNA 3IAUA 2WJ6A 1L5VA 1WCYA 5H59A 2ZUEA 1V8PA 3FTNA 1L5GB 2CMDA 4KWHA 4Q9NA 3CEAA 3NAMA 4G0OA 2Q3CA 1RWOA 2H92A 2HEIA 1FNDA 1DQRA 4PC1A 1T8SA 4UUPA 3FNGA 4ZV9A 5C8YA 3RWBA 4DM7A 4QJ3A 1EFUA 1YR2A 2R00C 4MWDA 4C3OB 3F97A 1XD8A 4W9MC 4ER3A 3F9IA 1E1QA 2HUNA 4DJTA 1YFKA 3A36A 1O89A 1R4NB 4FGSA 4L6CA 4C0QC 5C1DA 2XZLA 2Q3EA 2WYHA 3E3NA 3PNLA 4PSCA 3UJ6A 3M81A 2BLNA 2DQSA 2ALJA 4RDIA 2RGNC 3NMUF 1G7TA 4QU9A 3F8TA 4FBGA 4PNZA 2R66A 1SR8A 3NHYA 1JR4A 2ZRDA 1DJMA 1A9YA 1XELA 4GYWA 4J3NA 3H04A 4LRXA 1LDMA 2J1LA 4I19A 3G0OA 3OLZA 3TIIA 1X13A 3ZW9A 4M0MA 5LZ7A 3S4YA 5BOVA 2BFNA 1KXZA 1JDZA 4I3FA 4YBRA 3SMVA 4YRAA 2XWBF 4Y2QA 4V2UA 2O0HA 4YV0A 4LC1A 4E2WA 3I0ZA 3TEFA 5K8CA 2VC2B 3DCYA 3EOBI 4XVUA 3B51X 5I7AA 4QT4A 5AW1A 3S5UA 1EP3B 1WE2A 2YNMD 4AFNA 5DHRA 2JJMA 2K4MA 1FLVA 3QG5A 4OGKA 5K7SA 4JJ4A 1NBAA 4HX2A 4YUXA 3MS4A 4W6ZA 3LZDA 4HDQB 2DPGA 4G85A 2MR5A 5IVDA 3ROGA 3AF4A 5J2UB 4KO3S 4URVR 5EWMA 4NBSA 3RYFB 4C4XA 5A6SA 4ZOLB 4QKQA 2Q9UA 1ZYUA 2QU7A 3F90A 2B36A 3FAZA 3SQOA 1EX1A 1SBYA 1CS4C 2FP4A 2YMPA 3CMMA 3I5MA 1KE1A 3CZQA 3RVKA 1TYZA 4K6FA 4YJ3B 4V0NA 1CCWA 1GO2A 1ZXXA 2CL5A 3NNDA 4B6EA 4O1MA 7ABPA 2N47A 4MI3A 3ZBTA 4EJ2A 2V9ZA 4IJUA 1R64A 4J0EA 4LQ4A 4QD3A 1JDTA 3NAGA 2YXNA 2B1IA 1YD7A 3Q98A 3P2OA 4A92A 4N3GA 2HR1A 1SG9A 1YE5A 2YN4A 1KVUA 3OOEA 2EC5A 4IDDA 4IIBA 4JUIA 3T4PA 4CWAA 5BR1A 3V33A 1ZK3A 4N1AA 3SZGA 4UUMA 3CLTD 4OU4A 3R6GA 3PGMA 4UDNA 3L02A 2OAGA 3NBYC 2GM4A 1F4PA 3Q5EA 4PY2A 2X8AA 3KV1A 4Z51A 3F5QA 5ADUS 4EKEA 4W7IA 1Z2AA 3P0FA 3K30A 4YUVA 2DUUA 2HJSA 1EDEA 2HPVA 5LQDA 1GGMA 3FYCA 3NNNA 3SDSA 4PN3A 1R27A 4O63O 2WYUA 5I7RA 4OO3A 2QGFA 2XWQA 3QE4A 4XUDA 3VPAA 2DWUA 4MQEB 4EL0A 1JQ3A 4M54A 4LC9A 2BM0A 2LIVA 1WZUA 2JIDA 2PXCA 4LYFA 4ZVQA 1D1TA 4GI2A 1OW3B 1CDOA 4MW6A 4B81A 1QGUA 1OY1A 1VE9A 1VE1A 1WL8A 1SY7A 3PDCA 4M88A 4ZVTA 4TVKA 5IW8A 3UW3A 3MRXA 4NEGA 3V7YA 2FKAA 5EN4A 3C2QA 4OXNA 1U2TA 5CYPA 1EESA 3SFVA 1KSHA 1U7TA 5IMBA 3IODA 3ST7A 4NVRA 4RD4A 5DWDA 4UM9B 5TB5A 3T7IA 3W9BA 1UFOA 3ZCTA 2ZJ5A 3X2EA 2WILA 2GPTA 3JPYA 1NU6A 3D8NA 3OT5A 4YCJA 1GZ6A 4EUEA 5LDHA 2C98A 1RP1A 4CFZA 3MXOA 5BV1A 3GN1A 5I7VA 3MGCA 4OYHA 2ILTA 3NTVA 3IVRA 2X9QA 4UBMA 4KXXA 1P4RA 4EY6A 2WAYA 4BJ1A 1EINA 4JBIA 3O0TA 3Q7RA 5KWVA 3A32A 4EECA 5JS6A 2BT4A 3LHIA 4G24A 4XJVA 4IIJA 2GLXA 1KMMA 1EHIA 4F85A 3PJRA 4ZRMA 2ZDHA 5FPKA 1QRTA 1E2IA 5IVPA 3A4NA 4EHNA 5LP6A 5TIIA 2XUZA 2Z2YA 3EXFA 5DLQC 1Q1AA 2G6TA 2CV1A 2CDNA 1XQXA 3FWYA 2YW9A 2E0IA 3IELA 1T4GA 1T6ZA 4QUGA 5HK8A 1LQ2A 4LSZA 1CJUC 4IOKA 2FY8A 1HBJA 4X54A 4ZYXA 3OURA 2G88A 1XZBA 1HMPA 1USWA 2E85A 2G1AA 3GMIA 3I05A 3WP1B 4CN8A 4GI7A 3QLTA 1FX1A 4FIDA 4OXXA 3Q5GA 1M67A 4RD3A 1K97A 4E4RA 4PYMA 2XUJA 2G70A 1QAQA 2ZU6A 4ENPA 4OI2A 4WVLA 1RHKA 3OECA 4PIMA 3CLSC 3B53X 3M6AA 4GO1A 4PR0A 3WBJA 4BNMA 1UINA 5FEUA 1SCQA 5HCIA 5BMVB 1WTCA 1HDRA 1EQ2A 1A2BA 1AKUA 1OC2A 1UPTA 4JP3A 2KHZA 2X4IA 4R6WA 5C35A 1TIBA 4IWYA 4NJEB 2MOKA 4UEWA 4DB4A 1T2EA 2G63A 2PZEA 5ALKA 3RS7A 3NM5A 2PUHA 4HZUB 4JXXA 2FDXA 4IHQA 1GU0A 3I8XA 3QI2A 2V6BA 4X20B 2WYIA 1PEYA 4YRRA 3D43A 5J43A 1DEKA 2BMVA 3KJFA 4AF7A 3I0NA 5DTRA 1QONA 2PRKA 2QZZA 3MTBA 3IEIA 3Q15C 3H3FA 4O2AA 2L69A 1KMQA 4ZHSA 2PKWA 5TE9A 4HKTA 1IBMB 4WCDA 1B43A 2WYVA 4YEDA 3GMTA 1WG8A 1BH2A 3OE5A 3KDAA 5FBKA 4W5WA 1TJNA 1XB2A 3ONFA 4XPIB 1EU1A 3COVA 3JYHA 3RTAA 2ZWPA 3TNYA 3T52A 2J0QA 4JLSA 3TB6A 2Y99A 3L9XA 1E59A 4MW5A 1W1IA 2CXTA 2E49A 2EGUA 3GA5A 3ZTTA 1KF0A 1KJWA 3C3WA 5A4JA 1SCUA 4RVGA 5JNRA 3LA8A 2IX3A 2DKNA 2NPFA 4QDXA 2F59A 3HYSA 4OA5A 4TMVA 3ZU2A 2H2IA 3U3KA 2FZ5A 1VI6A 4KRXA 3A26A 3RSQA 3WQBA 4RY2A 4NK5A 3IPYA 3F5MA 1W87A 1M3SA 4D2IA 5F7OA 2R1UA 3M2TA 1FQOA 5A5VA 4RM3A 1XYVA 1I2ZA 1X1QA 3VR6A 4DQLA 4FR2A 2QZPA 2PZLA 3QEAZ 3IEMA 2XB8A 3FETA 3ETEA 1MOQA 5BMOA 1C7RA 1B00A 1JB9A 3IXQA 5ERXA 1WB4A 3DE7X 4EQZA 3LQ1A 5DGTA 2O8BA 1UF9A 3GJ0A 1RKXA 1TUEA 1NMYA 1ZGBA 4LYAA 2ZS8A 3AF6A 4DGSA 3BSFA 1FU4A 4MRSA 2F6RA 1C4KA 3RB8A 1RZUA 3X44A 4FT4A 5L9AA 1QFZA 3OCYA 2COKA 5BN5A 1K8QA 1TDJA 1QHSA 5F5XA 2FZLA 2JNWA 2JRCA 4GXNA 4H1HA 2XQVA 3D3WB 4BLTA 5B1YA 4YT5A 1B74A 3HGMA 5HRCA 5LOVB 3SIWA 3KKMA 3L06A 2G71A 3JQ9A 5D01A 3X1MA 3BN3A 3GLGA 3M6LA 1DKPA 4BFWA 1VL1A 2XDAA 3PBKA 5EMNA 3UK1A 1FFGA 1KDPA 3UJCA 3E8MA 4KVGA 4O4IB 4OJQA 3WQQA 4GQAA 4OQLA 2NP6A 1XT6A 3UMFA 2PRSA 5EE3A 1WXFA 3KU1A 2GEDA 2QGZA 1FBNA 4FILA 4KDCA 4YAWA 4IEIA 3T5AA 2W98A 3ZQJA 3UB2A 2B4TO 2ZT7A 1QVWA 1OQAA 5AVZA 1E62A 1ZUNB 2F4NA 5HUQA 2YRFA 4LMPA 4U7TB 4IP0A 3TKAA 4PEVA 1SVNA 3V7NA 4AXXA 1E64A 2VR1A 2BBTA 1ZMOA 3AKDA 4E5DA 1GXSB 1XCOA 1UMBA 1VXRA 4H16A 5EZSA 3TLMA 4IRMA 1U2RA 4L8LA 4IUBS 1THGA 1X92A 3R0XA 3LUBA 3R74A 5A1TA 5JCXA 3NRJA 3SWWA 4YDSA 1BA2A 2AYYA 3NXSA 3TBHA 5ESXA 3CO0S 3GROA 3BG5A 2G36A 1NC3A 3DONA 3E2IA 4EMSA 5KNDH 3LLCA 3L0PA 2BZSA 3LUKA 5D1HA 5J5CA 3UFBA 1PFWA 3PWTA 2FZVA 3DMGA 4OFBA 5CJJA 3TQRA 5CVJA 4GI3A 4MVJH 3E15A 1A95A 1EFPB 2IEGA 4PO1A 4DBLC 5M5BA 4XX0B 3WKDA 2HMVA 4CKCA 5JZMA 4FC7A 1CIJA 3AVVA 2IHBA 1NDUA 2PZ8A 4TV8A 5EHIA 3Q7QA 5HF5A 1ODJA 2C7BA 2Y77A 5B37A 1P8JA 5HUHA 5TR9A 3RUIA 4DFDA 3PC7A 1GCAA 3MW8A 2IZOA 3IPLA 4IVRA 3CBGA 5D84A 4TL9A 3UK6A 2GN0A 3PU6A 1OLUA 4R98A 4RACA 4JITA 1L8OA 4N3BA 1YJ5A 2RAPA 1C50A 3HKBB 3KKLA 4CCWA 4S05A 1EXMA 1TD1A 5LMNB 4MEAA 2LXNA 3KG2A 5T5QA 3ES9A 4WOJA 5EVCA 1ZCFA 4MR7A 5GJWC 5AHWA 1XQ1A 3HEBA 2I7CA 4Q4AB 2CSXA 1IZ0A 1Z17A 2GCNA 3H5RA 4US2R 3CF4G 3OBIA 3BSYA 5HA5A 2NO9A 2H1LA 4AN4A 3QJGA 4Q1VA 3AOEA 3Q12A 3WZ2A 5IRCD 2C3PA 1OVMA 3TRDA 1ZONA 4HSEA 1GCUA 5FTLA 3ZU6A 2IU3A 5EC8A 3UY4A 3CJTA 3GRVA 3WIUA 3CIOA 1P1RA 4ND4A 4CE6A 4EM6A 1KAHA 3AESA 2I2CA 4DLBA 1PN3A 3AR7A 2EFCB 1JIUA 1QHEA 1XROA 2GETA 4ZZ0A 3LK6A 1CHDA 1EMDA 2F00A 4MRVA 5AK3A 5KTNA 3GAAA 1WUIS 4BMVA 1RWXA 1M33A 2B2NA 3U61B 1NVVR 3E9EA 4UOEA 1ZJ5A 2QYSA 3NTUA 4D3DA 1I1NA 4MZDA 1DXHA 2D4AA 2YZNA 2XHZA 4WNIA 3CQ9A 2C9OA 1CY0A 2WVGA 1BXZA 3GGCA 4CL2A 1GTRA 1B73A 1NX9A 3KEOA 2WG1A 2NZ2A 1CQJB 3OJOA 2G9VA 1N32B 2ATIA 4IFIA 1U0GA 4YFVA 3A4IA 1QU2A 1IHPA 4BBJA 5BNFA 3W7VA 1UM9A 3ZCUA 3TXYA 1DARA 3DE0X 4L4SA 4UVDA 3ZDQA 1PL0A 5IWCA 9MHTA 1O6ZA 3N0TA 2VDMB 3AUSA 3IBSA 3JQCA 5AHRA 3V4RA 2AOVA 3R0ZA 2VCHA 3HP4A 3Q0IA 3W3ZB 5HWSA 2WVHA 5DNDA 1QHXA 1U1EA 1Z5WA 2IIBA 5ALLA 1ZK1A 3VR1A 3VZBA 5KSWB 2AEJA 4AKSA 4ROTA 4FFPA 2LCQA 1NURA 1TF5A 4UM8B 3RIHA 1W49A 2SICE 3IAFA 1MVNA 5DGXA 2V54A 1E5TA 4OIFA 3BK2A 5F33A 3EZGA 2WMOB 1Z0UA 2WSYB 5DNCA 1AD2A 4LTNA 3FJ1A 5FOQA 4MKIA 1GGKA 3RRBA 2CXOA 2UVPB 5KPDA 5DTMA 2AA3A 3DAPA 4BP1A 4EPYA 4R0NA 4HMQA 1E8MA 4J6EA 2DWPA 3FCYA 4NYJQ 4JENA 4NH4A 1CFJA 3GJYA 1RYYA 1U4OA 1QUEA 1JGTA 2ZT8A 5HDBB 4EY8A 1XZEA 4K8RB 1ZMXA 4M7RA 4QJ5A 1NPTO 3HY3A 1SXGA 4E09A 3TPZA 4PTZA 3CEPB 1QQ6A 3EBLA 4ITRC 1VECA 1JZSA 1E3IA 4I50A 1C3JA 3SGLA 1RXYA 2AD1A 1LSOA 4TMWA 2C4MA 2V5AA 4EYGA 1FE8A 2A2ZA 3THSA 3ENKA 2FR0A 5AOVA 4LISA 2DQKA 2WSIA 5HGXA 4MUHA 4C0HA 3F7MA 2C78A 4F97A 4PX3A 1DRVA 1XKQA 2DTXA 2ZBQA 2QE7D 3KYDA 2ZWIA 3N2LA 1HORA 821PA 2ZJBA 1V9CA 3OAAD 4G5OA 4MV7A 3MUFA 4UM9D 4ZOEA 2QVLA 5BW6B 1M2EA 1Q7BA 3ROFA 2VJMB 5H7XA 1HT3A 4M7OA 4B17A 3E7PA 5HM8A 3TJZA 3ACBA 4NZPA 3TTTA 3ZCSA 3T3GA 2DUWA 1Z8NA 4FKZA 3C14C 1SB9A 1UFKA 4KZKA 1NUQA 2HLDD 4KH1A 2OPBA 2PFGA 4PLYA 1JHVA 3GK3A 1QU3A 2XXAA 1UZMA 1OGYA 1F2UB 1OFVA 5TARA 2IU6A 1A4XA 1HFKA 1X1BA 2D00A 2OHOA 1FRQA 2R60A 1S8OA 2ZI9A 4I0WB 5DEOA 4FONA 3DHEA 4HH1A 2OXRA 2JGDA 3IGFA 4L5BA 1MB2A 1C9DB 1CZKA 2JI4A 3A1WA 1XKXA 1ZL0A 3RW9A 1G1AA 4ZI2A 4JSRA 4DG8A 5LB2A 1IRXA 5GADl 4IOMA 1U2SA 3E3LA 4RCZA 3MCUA 5EJIA 2AEEA 4IXMA 3IYLW 4NFYA 4HUJA 4BFTA 4CR6A 1GT91 2JVIA 3RF7A 4DLXA 2A35A 4HQ0A 3KZNA 2YJ3A 3RTBA 1CC1S 5AYVA 4WCVA 4C0XA 1JKFA 1CUJA 1U94A 3F5SA 1CEXA 4GWKA 4ZARA 4K1XA 3G13A 2C7OA 4IG4A 4JGBA 4JXKA 2BEKA 1PK8A 3QXGA 2E18A 5DZSA 5KNCD 4M1ZA 2H51A 3RDPA 3OA2A 1CIPA 1AU9A 3UMVA 1J7JA 1G3QA 1QH9A 1KK1A 3WO0A 2BSQA 2JLWA 4A7PA 4RWZA 3HN2A 5DBFA 3FDJA 5HM6A 1NV8A 3CHYA 3IUPA 4LV6A 5CT8A 4GYKA 4OHUA 2HXSA 3MF4A 3QBJA 5A9TA 2FFRA 3ZY5A 5I8WA 4ZCIA 1E94E 1NC1A 1NIPA 1ZCBA 2ZZKA 1RLJA 3EVFA 4GMFA 4AO7A 4TV9B 4MQFB 1MORA 5HIMA 2HREA 3CRMA 4UUAA 1KAOA 5LDGA 3K3PA 3RBXA 4CVNA 1AUVA 3ZKWA 2IUUA 2ZOSA 3TI9A 2I2FA 3W05A 1DBRA 2AQ8A 2XLBA 1QXSA 5SZKB 2ZYRA 3EAGA 1SOMA 2MIIA 3I5XA 1XV5A 2PWYA 5DWQA 2N46A 1XDUA 1ZKMA 3T5BA 4C07A 4S1PA 2WAOA 2WSSD 2QSYA 2O7RA 2FZCA 2REOA 2CD7A 1K89A 2X40A 3FBWA 3LT0A 4C7BA 2Q5FA 3GCXA 3G79A 2OECA 2M1ZA 1N3YA 2JA1A 3HL4A 2D62A 4HEA1 1ABFA 1XVTA 5E6SB 4X5OA 1NF2A 4WSOA 2K5UA 3VSEA 1ZW6A 2X0JA 4ZYLA 3RASA 1DIAA 5C8VA 3BSSA 1QQAA 3UV3A 1A9PA 2QU8A 3OVMA 2NVUB 2CFSA 4Z9FA 2CVZA 1RWPA 1G5RA 1KPIA 3AP1A 4URXR 4ARZB 5HYVA 4D0RA 1TJPB 1XR3A 3KAKA 3S1AA 2Z43A 1A1VA 3E9RA 2YTZA 1QOPB 2IXDA 4TUYA 3W2TA 5ER9A 4ZOBA 3RC3A 3TL2A 4Y1RB 3HYRA 1YE8A 3K9LA 5ALVA 2BEWA 1TADA 4Y2HA 1THZA 2ZG6A 3HU3A 3L8FA 1L1QA 1UJ2A 3AUUA 3N0WA 2Z0MA 5K3EA 3T35A 4CM1A 3IQFA 3IR5A 4L57A 2HA6A 4HAIA 2ZETA 3OUZA 4H4EA 5F4ZA 2C2XA 4FFVA 3VHXB 3TW8B 2J7PA 4FHEA 2AN3A 1SKAA 3U4MA 4D99A 4ZI5A 4JQZA 3VUEA 4QPZA 4P0PB 3KO8A 1A76A 4BTEA 3UWSA 3KQHA 3I9OA 5CG2A 3DS8A 4P4LA 2A78A 1Z6PA 3VAZA 5AVXA 1JDNA 3HY4A 2R0QC 3TL6A 1C30A 1Z25A 3FNBA 1BVRA 4HAYA 4D43A 4DWOA 3S81A 2VEOA 3KYCA 1GDTA 4DR6B 3O8BA 4PC2A 1VCNA 2EJCA 3BRCA 1JXQA 2D0OB 2F8MA 4OL0A 4BO4A 1TF2A 2ARKA 4OATA 2X3FA 3GYGA 3UOGA 2POQX 3EISA 3GARA 3IURA 4HS9A 3D5EA 4Q3KA 3AHHA 4LVCA 3LDUA 4QC2A 3LHDA 2V7QD 1SC9A 3KE9A 4LE1A 3ZH2A 3FAKA 3F71A 3RRFA 4U7JA 5L3VA 4PHFA 3R5JA 4EENA 2J3KA 3L6CA 2OV8A 3MEQA 3Q3VA 4DPLA 2QLLA 1UBFA 3IUJA 2VQFB 3O2JA 3CZ5A 1CY4A 2A4KA 4OJYA 1IOVA 2B9EA 4QOFA 4BLPA 2ZRPA 4DV3B 2P9BA 3HUFA 3MLEA 1YMUA 1UDBA 2RHBA 4U6SA 1NXWA 3V5NA 1V5FA 2BBSA 3NONA 5JD6A 1Z2PX 5FAKA 4LECA 1HNZB 2AXEA 3ERCA 1VHQA 4CCYA 3W2IA 1DCMA 5IAOA 4I8DA 3JZIA 3N5CA 2IHUA 4JR0A 3ONEA 1UDRA 2JFZA 4LXGA 2WTUA 3TI7A 5ENDA 2ZAOA 2WA1A 1YNOA 2GARA 3JTMA 5BR8B 3RGGA 1YZHA 1MB0A 2JGMA 4B7ZA 3CY6A 2IXBA 5EJEA 4IQ8A 2QPAA 4Z3KA 2B0JA 4XD7D 2GK6A 5JAIA 4QLBA 4MWSA 4KR7A 3BMOA 3DUWA 1PV1A 2RJNA 2F1RA 3PGVA 4PQGA 2FV8A 1ZGCA 5K0LA 2F7SA 1MMFB 1GRVA 1A2OA 1W5TA 2IHVA 2YVUA 1Z6ZA 3WK5A 4ZZ2A 5IHPA 1WBDA 2RHJA 5FOWA 4EB6A 3HO1A 1BW9A 1CUYA 1COWD 5PNTA 5A06A 3S8YA 2VI5A 2CB9A 3UJ8A 3P5SA 2R68A 1PHRA 2RG7A 1JVSA 4FS3A 1YMQA 3P9SA 4A15A 2CL0X 4MA5A 1MC8A 2RIRA 1SWVA 5IUKC 3STTA 3I32A 2FSVA 2R8ZA 1OXVA 3QVWA 4RA6B 1NMXA 4GLBA 1JLSA 1JWLA 1RE0A 1FP4B 1R6VA 1VGVA 4QHTA 5EJ6A 4GRAA 4MJLA 1G9XA 4DWWA 3STYA 3KQUA 3KJZA 2ZJ0A 4WECA 3VNAA 1Z26A 3H2ZA 2HSGA 4QA9A 1SM4A 4X6XA 1I3MA 1J97A 1SHLA 1ISIA 2BR3A 2J0UA 1NP7A 2Q46A 3EE6A 3HO6A 4JXZA 4UAJA 1EYZA 1ARZA 1Q84A 1TK2A 4UE3S 4C06A 4E33A 3UMBA 2I3GA 2HPAA 4RX1A 2DF8A 2YFKA 2VBCA 4M22A 4CKXA 2PRZA 4CQJA 1B26A 5E0KB 2A33A 3BCRA 3D9QX 4Y7DA 2JHAA 1UWCA 1DG3A 2FSGA 3DHYA 4GS5A 3UMRA 4R2WA 4B6RA 2BZ0A 3TNLA 1DFGA 4NESA 3GG2A 3HG7A 4F84A 2XOKD 5P8WA 4DCPA 4QDKA 4W9NC 2Q2OA 3QTBA 3ZDXB 5HIIA 2O8VA 1H8HD 2GILA 5KU1A 2SBTA 4E2FA 5HS4A 2A9JA 3PE3A 4FZRA 2J8ZA 3QWAA 2Y1KA 1A88A 3IEXA 3N74A 4F4CA 3MWDA 1ESDA 2OE2A 3S99A 4D44A 2WZBA 5A4MS 3IUMA 1K9VF 2X5KO 2YVLA 1R1DA 4RHEA 3LPCA 5JZBA 4MGIR 5LYJF 2EBFX 3PT9A 3QMPA 4TMZA 2EZUA 4K9RA 1XNQB 1SKBA 3FTDA 2AG6A 1YUNA 5DHFA 5DXFA 2NYRA 2PLWA 1KY5A 1SVWA 5K0JA 3B7GA 1AQUA 4M1TA 5FI1B 1N6RA 1RWVA 1Z88A 2PLFA 4KR9A 5HHTA 3TLZA 3M4JA 1Y3FE 3HLYA 4U2FA 1E69A 1OU0A 2X6TA 1YJQA 3RHTA 3SZOA 1MQSA 4R1NA 4TM7A 5B57C 4GPBA 3V48A 3FMFA 4G0YA 1QP0A 3NHSA 2IYAA 1TQ2A 2WE8A 3KAQA 3EXG1 3L4EA 4C2TA 2O5CA 2QAGB 1IJEA 3T1VA 3ETGA 1K7FB 1KEPA 1VHLA 1T36B 1Z07A 4OHOA 4CU2A 1YRWA 5BSUA 3GPIA 2FP3A 3ETHA 1BE6A 1FUYB 3OKFA 4B2PA 4L4RA 3H11A 2A84A 1E8DA 3FDFA 1H69A 3C3PA 2HFJA 1KZ7B 4X7PA 5HTKA 5CGZA 2DT5A 2P3LA 1HYEA 1XKTA 3OIUA 3WLLA 4TMXA 2IOFK 2JATA 2BD0A 4BGDA 4RAQA 3L0CA 3R8XA 3CN7A 4A0RA 3N8IA 4MO2A 4FX2A 4PINA 5ES4B 1IZZA 5I4KA 1R88A 4XEHA 1TA9A 2CWWA 2RKOA 3ILYA 1GOTA 2C59A 2WKSA 1XTUA 4GOMD 1BVYF 5DBEX 1N2SA 5IABA 3EZ2A 4Y2RA 2CJFA 4A8JC 1O4WA 1VG0B 2WF6A 1VMEA 3H7AA 3NVDA 4NAUA 4EWLA 3U9TA 4AD8A 1Z5PA 1YTUA 1A9OA 5TQ2A 4L3VA 1QIKA 5H16A 3BKXA 2IZ6A 2O05A 3HKEB 1B8OA 4JC0A 4FFWA 2ZCJA 4UM7A 1TM7E 3ZVNA 4D82A 4ZAFA 3PUWA 3ILXA 3FSGD 5IKEA 1APBA 2O6LA 3SYRA 5DBHX 1QZUA 3RD5A 4KUGA 1ODCA 3PJFA 1JTVA 1G8PA 1P61B 2NUPB 1SC6A 3W1EA 3ZIDA 4REQB 4AJ4A 1ONOA 3GLFA 1P2TA 2WM9B 3CNEA 3EN0A 1CRPA 2IJGX 1D0IA 2FW1A 3HDYA 1VIAA 2CYBA 3EW7A 5CDSA 3A1UA 2QQ0A 5LBIA 2JIMA 2BTEA 2JIOA 2QLBA 1KS9A 4BQFA 1W2WB 2QSJA 3KUUA 2AHOA 1Z8DA 1LFDB 4ZVMA 1PG0A 3ZPXA 4EA6A 4JJIA 5FHQA 3HXLA 3IAM6 2X0IA 5JO9A 1MENA 2APJA 1DB3A 3QJ5A 5EHNA 4FM9A 3GLKA 4LDPA 4YROA 3ZW8A 2W0MA 1X7YA 1MC4A 4D9KA 3FCUB 4E31A 3NGMA 3ZHCA 1UXJA 3QUSA 3DMHA 3WA6A 3L79A 5JATA 2W00A 3HNPA 4B85A 2A8YA 3AERA 2QRMA 5KOYA 4AY2A 2D5LA 1HOTA 3L0OA 3PV0A 1RLOA 3U19A 3UCXA 3O90A 2QZ4A 1KVTA 1YJCA 1XRJA 2W48A 2Q4EA 1J49A 1NXOA 2RHGB 3SM9A 4ARUA 2PRJA 1UK9A 4PYLA 3AEYA 3BILA 4BMNA 2V1UA 3ZD6A 2A9QA 3S2UA 1YQGA 1CS0A 1TA0A 4GX2A 5BOSA 5A3RA 5CP8A 2AN9A 4CKEB 4CTNA 1T1GA 4EZIA 2FH5B 2NVBA 3AHCA 3EGXB 4FHCA 1U0HC 5HCNA 3A4VA 3PZBA 3U26A 3VC3A 1JDVA 4RW0A 1Y63A 2UUOA 3MS7A 2XRZA 4JA0A 3DDUA 2IEYA 3IR6A 1TLTA 4WADA 1T0HB 1UC9A 4AROA 3KEFA 4P3PA 4U2EA 2QN3A 5FUMA 4FEAA 1F7UA 1AKRA 1K8ZB 4EHBA 1A9QA 2VSQA 2VZ0A 4JJ6A 1HT2E 3U7QA 3WR5A 2EJVA 2J6IA 4TT3D 3RLFA 2HXGA 1KO1A 2V7BA 4PS0A 2IH4A 2ZJ4A 4E11A 2P9FA 4KBGA 5AJTA 4AJLA 4DPKA 2WJJA 3GY0A 1SZJG 1TTQB 5K8IA 4I08A 1HLPA 2C92A 2JBAA 2NNLD 4E0BA 2VP6A 5EE1A 2ZSJA 3EQ8A 3ASVA 2PYDA 3GZNA 2HK9A 4RY9A 1PU2A 1TU4A 4C0JA 2A67A 4JX9A 3JYPA 4N9QA 4J94A 5FIUA 1GPMA 2JLRA 2OBFA 3FKSD 3GXBA 3M9LA 5FBVB 5KNCH 4RGBA 1HG1A 5DX8A 5KJFA 2YRWA 4A10A 5BSMA 4DJFC 1XZKA 1R0XA 4AX4A 4V1CI 2JGKA 4OQNA 5E1MA 5CBPA 4UASA 4IZ6A 4GKJB 3E70C 4WWHA 2ZUUA 4KOAA 4PSVA 1LDBA 4HXEB 3A25A 4P0TA 1L5HA 3ENNA 3R5FA 4OUDB 4Z9XA 4KO1S 3TBKA 3IKJA 2BFBA 5HS6A 4G01B 3W9UA 4D96A 1RYFA 1YGPA 1V8ZA 1V9LA 4O4JF 5THQA 3TBFA 3PWKA 3VC7A 1IM8A 1DOAA 3P9IA 4RETA 1G8YA 2WHPA 1UZAA 1UBCA 2PS0A 2EYQA 1OMOA 2PWBA 5LMCA 1N9ZA 3MAAC 2VUUA 4OHWA 2EQ5A 1S2GA 4TVBA 3HHEA 4ZO9A 1NJ2A 1C3LA 3I9LA 3PTAA 1JBQA 4R68A 3T7EA 4CT4B 3THRA 4LWZA 5CK5A 3I4CA 2XNSA 1LX6A 4MJ3A 5NLLA 3WLEA 3RAJA 3CCCA 3GV0A 4F4DA 1UT5A 4IKEA 3UJHA 3I4LA 1L4NA 1H3EA 1SD5A 3OQVA 3ZJVA 1OASA 4JY7A 1JR3D 4K6KA 1VJDA 1CUHA 5FBWB 3K9BA 3TDKA 3D3EA 4RFVA 1GAXA 4RF3A 2NTYC 5CT4A 4EW6A 5D00A 5DXAA 1JHXA 2ZTVA 4M0CA 5AXDA 3GFGA 4L3WA 4ON9A 3ZIUA 2ZE8A 2ONKA 3UAGA 2DMRA 2X8WA 3OHMA 2P4QA 4TYPA 4C4SA 1OFGA 3OCVA 2PRIA 2P9YA 1Z5NA 1ULTA 3HLKA 4HH4A 1KQGA 1E2UA 2B4RO 1PUJA 2XH8A 1U3UA 2D2FA 4FDTA 1QBKC 2Y0BA 4FHDA 4DNOA 3D54D 2X77A 3GL9A 3G8YA 3H5WA 3ZNQA 2PS1A 4JLUA 4PQYA 4ZV7A 3HC7A 2R1VA 3DYBA 2X2PA 1CQZA 1XJWA 3AYZB 4QGSA 4HNUA 1C9EA 3O8CA 2YOFA 3DAGA 1ORIA 3T3OA 3AC0A 4S0ZA 2YZ7A 3HR4A 3WB1A 4MW4A 3I9KA 4QBGB 5A5EA 3WRXA 4BE4A 2OQIA 1QDLB 2ZU0C 3EGIA 3D1JA 1N5OX 1R4ZA 4N9WA 4RCVA 1JEYB 2PGIA 1SD2A 1KVSA 3B1KA 5EZYF 4Z3OA 1PYDA 4C4RA 5C8XA 4PSAA 3K0FA 4BNUA 2HCBA 3LYUA 3PT5A 3CH5A 4CV2A 2B83A 2FETA 3TQQA 2HU2A 4RA9A 4N0QA 4P4SA 4BV8A 2OUIA 4EW2A 5AVRA 2V7TA 1I5EA 2R8OA 2JJ2A 1QE5A 5D6NA 1C1XB 4IJVA 4PBSA 2WUWE 2FOIA 3QNMA 2QAJA 3A3NA 3QTLA 4D4KA 5DNWA 4ARCA 3AQ4A 3Q3EA 4N47A 1GDDA 3GLHB 3UT6A 2YRXA 2XCUA 2ZAGA 4JLDA 3ZWAA 4KN9S 3IVCA 1V26A 1Q1QA 2NGRA 2ZUBA 4LOKA 4EYEA 4KYIB 3EVZA 4YS6A 1D1QA 2IPMA 4BRZA 1QLJA 4D8TA 5B3KA 1XXHE 2FFBA 5IAGA 3I3SR 3K9CA 4UAGA 3PFNA 5I7OA 5KNBD 4F8EA 1N6HA 2P2LA 1ZICA 4QATA 4RO0A 5AW8A 5JHHB 1NTOA 5IC5A 3P2MA 3QLEA 1QLHA 3AUKA 4FE4A 4GUDA 3PQ8A 4PHHA 3RJ5A 1GAJA 4Q15A 4U7DA 1M0EA 3COPA 2DECA 4KFTA 1VLZA 1VL6A 2GD6A 4Y1GA 4CQMB 4CFYA 1FQJA 2CCJA 2G1PA 1QC5A 2JDID 2BFEB 3DH0A 3F4LA 2VYFA 4IG9A 5ARCA 5ICEA 2G06A 5JNSA 4WMLA 4DMHA 2OWEA 5LL6P 1RPZA 1R4MB 3K5WA 4TWAA 4BE9A 3DEFA 1I7NA 1KMHB 3H8SA 3N8HA 3WG9A 1IH8A 1XCPA 5HJ5A 4IWNA 5ALGA 3KR0A 4F5ZA 2G1UA 4CLEA 4KN6A 3COZA 3BXXA 2E5FA 1JJVA 2IVZA 4OV6B 1ZX1A 1S2MA 2HHHB 1T8WA 5A0VA 3ISVA 1KEKA 1JI0A 1ZN2A 3LBIA 4TQGA 3JAKB 1W2HA 3KLMX 4CMKA 3CUTA 3IAHA 1A72A 3OE7A 4O4LF 1QYDA 4BGUA 4J03A 2ES4A 2QLMA 2RDMA 2BGNA 1DC7A 1SGWA 4EI9A 4MSUA 3TMYA 2PNFA 3ET4A 4FE3A 4EO4A 3ZTWA 4CCAA 3JQBC 3NG1A 5ITZA 2FWNA 5CAEB 4I4LA 2XNCA 2X5XA 4J07A 4KP7A 3UMCA 4BMPB 6GPBA 4BN5A 1V3VA 3JV7A 4JQCA 2QJRA 3WISA 1P2SA 1TKBA 3NIDB 4OK5A 5EKSA 4WRRA 2OEPA 3KEQA 4YT2A 3PFHA 3DJFA 2BGKA 4WBNF 2WWYA 4DYVA 4F12A 2BGGA 3GC6A 4B3SB 2I66A 3LDHA 4S2UA 4TL7A 3A11A 1BXRB 3GZ4A 3SQLA 4EG4A 1IVYA 1RWMA 1RWWA 2HPHA 1Z0DA 4V0MA 3QIVA 1V1MB 4HYTA 3VBCA 3JQAB 3EPKA 2VQDA 5ADVA 3DGEC 2R00A 2WJYA 1XHEA 4PPQA 1SMKA 1E1DA 5JSUA 4KO8A 1Z39A 3WGTA 1II9A 1M7GA 1PS0A 2V7WA 3HKCA 1USIA 4MDHA 3GDWA 1DAKA 2DZDA 1XDZA 4F8JA 4B6SA 2AMFA 3CVWA 5HQ3B 1XLUA 2WTAA 4E12A 4ESOA 5IYZF 4WEQA 1RADA 3UPDA 4HLDA 1XEAA 1ESMA 2RGNA 5BSEA 5HQ3A 2Z8YA 1X9IA 2GMWA 2O7VA 3BVPA 3K5HA 3PNPA 3OMWA 4JCCA 1B8PA 3WNQA 4BU1A 2R7LA 4NENB 1Z0SA 3PKJA 4UE6A 2BUCA 4YASA 2R96A 4ZVLA 3EJWA 4HH0A 1GNQA 3OZUA 3QMWA 1U81A 2GR9A 4R8LA 4HFNA 5GONF 1TVKA 4N6OA 2DEUA 2DXIA 1JFRA 2HL6A 1JPJA 1Z9BA 3KTAA 4TLCA 2ECPA 1M2GA 5DNEA 3KOXA 1EFKA 5EWJA 4EBBA 1IN5A 5AQ1A 5BWLA 3GO4A 3K8YA 4WJKB 2Q7XA 3IV6A 1DMSA 2VDUE 2G72A 5G4KA 1CP3A 4B74A 5AXCA 4CIXA 3VSAA 3CH6A 4Y0NA 2PZJA 3FOCA 3L1VA 5DYYA 1K4YA 1MTZA 3WHKA 1JHQA 1JKXA 1SCKA 1Y9JA 3JQ8A 2I1LA 1NUPA 3IJEB 5TPWA 3ELWA 4L9RA 2X6RA 2WVJA 3VM6A 3D59A 3ESBA 1RKBA 3OEYA 1Z35A 2XKKA 2CLSA 3MWGA 1N9KA 4IH9A 2O7QA 4RV5A 5IDQA 4JKOA 3VKHA 2FMTA 5EWLA 4AI6A 3MCVA 3PUHA 3W79A 2RBEA 4EF6A 1Q1NA 2Q9AA 1I3LA 3EUFA 1MG5A 1PLKA 4RKWA 3KVVA 5CEFA 1ID1A 1E6MA 2OM6A 1YJBA 1T5DX 2M6RA 1CRLA 3FB1A 4MB6A 4G5GA 3J81k 3SEFA 3L1HA 1WV1A 4JGGA 9LDBA 1EUDB 1W94A 2GEFA 4Z1MD 1X7WA 3SZMA 3DLIA 5HPYB 1KYQA 3HVUA 4QQKA 1E4YA 2HV9A 5IT5A 2VF7A 3GCWA 1ITZA 3WIOA 4KE7A 4OFZA 2I4LA 3I72A 4K9NA 5FTJA 3F9RA 2QN7A 1JIJA 3CW2A 2ZI5A 4GLFA 3OJEA 5JOQA 3OPXA 1B16A 3WLOA 3TOXA 1GILA 3A70A 3DP9A 1R4NA 3DZBA 1KFEB 3PQDA 3R8FA 2MR6A 4UEKA 4BMYA 4UEOA 3PVCA 3KOZA 1TZBA 3MTIA 1BX1A 4QDTA 1XCJA 3FJYA 4KUHA 3TGLA 1CUWA 1A5SB 3W04A 1OZ0A 3I9MA 4HC4A 4K9SA 2FW6A 1RLUA 1G19A 1TCAA 2YZMA 4FYMA 4WJLA 2AQIA 2VRCD 4P22A 4R6XA 4XYLA 3ABRB 4II7A 1ILWA 3ETJA 1OAAA 1FTGA 3C5WP 4L4YA 1RT9A 2XF8A 4JIGA 4W1RA 3A6PC 3CT6A 3WL8A 4CM9D 4ZAZA 3RARA 1FJ2A 3BMXA 4GLJA 5DW0A 4MRMB 1T8UA 4YT4A 4QPJC 4DAEA 2Q50A 4CDMA 2ZTLA 1A96A 1AA9A 1T6XA 1IUNA 1SK8A 3VUFA 5J1TB 3OOHA 2HCTA 4HLCA 3QLUC 5CDFA 3X1XA 3LKZA 1YIDA 1D7AA 1L7RA 1IHXA 4BB0A 3RYFA 1ORVA 2FXIA 2XPCA 1ADBA 3I4FA 5JAMA 1RWNA 1DCKA 1IE3A 3IAEA 3ZDDA 1UBKS 3DTVA 3D5QA 4ANFA 5AM2A 4LTDA 1GITA 1X1TA 4NU6A 1QGZA 2JAHA 4QEDA 5D5HA 221PA 1PLJA 3EC1A 4WBSA 1EM8A 3FMVA 4HRYA 2Q1TA 1L4MA 1NR7A 2FMHA 2HA4A 3BJZA 3D6NB 3H1AA 5LYYA 3OLQA 2JS7A 4DEYA 1HQYE 5CITA 2OGTA 3K2BA 2QTZA 3B3JA 3OETA 1JHPA 4G97A 4HTFB 4N6NA 1RZRD 2CEAA 3WV4A 3BTOA 2D3WA 5CT5A 4MR8B 4HGOA 3CZAA 5TGZA 3MM4A 4J0HA 3RHZA 2CHUA 1AQLA 2Z57A 3OE1A 3BBPA 1A5ZA 2OFWA 1QH8A 3FA2A 3GUCA 3DZCA 2DHQA 4L4ZA 5DTJA 2IYZA 1NYRA 2VQ6A 3A0UA 3KL2A 3ZWDA 2D1YA 4IJ6A 1DOZA 1UBTS 4R1LA 3E9YA 3PHBE 4JGIA 1T6YA 2WFLB 4OQQA 3JPWA 3FPJA 1OC4A 1M54A 2XW6A 1G5FA 1U8FO 2P68A 1S3FA 3LBFA 4IV8A 4MQEA 2H3EA 2XUPA 2WNSA 2QG4A 1K5GA 1TAHA 3F3MA 3KUKA 4L85A 4ZU6X 5K3DA 1A9SA 2R3SA 5GM2A 2L2QA 3MMPA 3K53A 3R3VA 3W5AA 1KFJB 1TI7A 3BK1A 4ARIA 5LYJB 2MYUA 2FSIA 2OHXA 3ER6A 3IB6A 4PZUA 4ZZ1A 4YMHA 4HLQB 5EG5A 2VAWA 4UNNA 2Z2IA 1Q3TA 2IGBA 4Q34A 4XCVA 1DRUA 4FC6A 4JI1B 1DAMA 1V95A 1Z0KA 1VL0A 5EY5B 1NSTA 5B6IA 3GRCA 2GBGA 4QXOA 1U0BB 3HM2A 3RBVA 3BIWA 2E4UA 1ZHFA 2ECQA 4FYKA 4L0DA 4FBMA 4OPMA 4YVFA 4UTVA 1R8SA 1Q91A 5E2AA 1M8JA 3T3IA 5G4LA 1II8B 1GEGA 1Q14A 3GA7A 4ZD6A 4M3NA 1HMYA 5ADHA 5C4IA 1KSJA 4ZN6A 3QEKA 4TMKA 2KB0A 3L1UA 3L84A 4EHHA 5E4JA 2RFLA 1RC0A 4P2BA 4Z99A 3CR3C 4O3FA 3D7LA 2DJ5A 3AI3A 2ZT5A 4DCGA 1AZWA 5K2MA 5AOCA 1OPXA 1RI4A 1TQ4A 2YR0A 1PFKA 4IIHA 4LNUA 5CH3A 4KE9A 1E2HA 1RBYA 3IP1A 3KD2A 2IA5A 3BL8A 3P32A 4QLAA 4KW7A 2ODTX 3F4KA 3IBTA 3KM0A 2H1IA 4U3JB 1H4SA 4PLVA 1IN8A 3B3QA 1GPYA 2ZXEA 1DKNA 3B6MA 3R3YA 4AJPA 3BERA 1QVRA 2WIAA 4IDFA 5DO9A 1AMNA 3Q40A 3LKVA 3DV9A 5JTUA 3SN6A 1PQPA 4E07A 1EAMA 1DWOA 3MTGA 1Y5NA 1HZZC 2R2GA 4C0SA 3GVIA 2XRFA 2XTNA 1DO2A 3DBOB 4WE3A 4BZPA 3ECCA 3TUJC 4XQ0A 3KDPA 1EP1B 4P4UA 4L4XA 4YUZA 1RRMA 2I80A 3I3OA 5E6RA 1N2GA 3TLGB 2PUWA 2WZQA 3C6YA 3MELA 4LF4B 1MX3A 1AE1A 4DCVA 3ZK8A 1Z6AA 1Y9ZA 1UFRA 4TSFD 4Y67A 4BQPA 1J2RA 1X39A 3WWOA 3KC2A 3E0XA 3NC1C 1YL5A 4F92B 4N5DA 3I04M 1C3EA 2BEVB 2OV4A 4BNIA 1T5OA 3IUEA 4EY4A 4JUBA 2D0DA 2XZTA 1H2EA 2AFIA 2V7UA 4RLQA 5EP3A 3SEQA 1C41A 4QG3A 4XWYA 1E66A 2XBUA 3T1NA 5CJPA 5ALZA 4LY0A 2WTXA 4ND6A 4TTVA 1XA0A 2JKVA 1E0SA 1XDWA 1OXSC 2FR8C 4DBZA 3QWFA 1WVMA 4PANA 4YAGA 1W85B 4X20A 2AMVA 2A1TS 2QRJA 4WASA 4D0NA 1GLVA 2ORVA 1Y8RB 4H3VA 2QE6A 1F9AA 3O2SB 3HXKA 2VHQA 4HN2A 3AB7A 3OM1A 4K3VA 3IP3A 3UUWA 5CX1B 4CQMD 4DCTA 2GZRA 4FYYA 3SK0A 2EFYA 5EXEA 5KSOA 1F6DA 3WC4A 2IS1A 3JRWA 1LDYA 2QROA 3G2QA 2OCDA 4NLLA 4TLBA 1ZVQA 1A71A 3UAOA 4BJ5A 10MHA 1J24A 1MKYA 2A9OA 1OGJA 3TRHA 3AZPA 3VNQA 4DV7B 1Y8CA 4XPIA 4QNMA 5FNZA 1ORRA 3PUKA 1JMVA 3QVVA 2P9HA 1U7OA 1PJBA 3IHLA 4MMYB 3I6ZA 1JH9A 4KPUB 2OLKA 3G2NA 4MVWA 3X2FA 2BCEA 3H5AA 4FGUA 4EPTA 3TGWA 3HCFA 2RD2A 3D3QA 4DQXA 2PT6A 2G07A 1UOQA 4JT9A 3OEWA 5ERGB 4XD2A 1GUBA 4BNDA 1FJGB 1RXUA 2QQFA 4KXVA 4RD1A 3A37A 2JFBA 2B0CA 3PNOA 1XAGA 1HURA 5YASA 5IXJA 1X1SA 3U7HB 4HAXA 3EULA 2FLVA 1IHDA 5KNBH 5LR6A 4LZZA 4F2GA 1FTNA 2FWMX 4E7PA 3ZIAD 1A27A 3IBFA 3N2EA 4JOCA 3U1TA 1S2IA 3AL2A 1D0VA 3K6JA 4CN9A 1QYVA 1RCUA 4E1VA 4JOQA 3GLGE 1KYTA 1DS6A 4YMSA 4JNCA 4EMBA 1GYRA 1OLXB 4EG6A 2JIBA 3M5DA 3NDRA 4JNKA 3NU1A 2R11A 3CLVA 4TLDA 1V2HE 2D0PB 1SIBE 3HJAA 4WKBA 4RXMA 3EG9B 4WVFA 1O77A 3O4VA 4I1RA 2VUIB 4M8IA 1NVVQ 2XTAA 4YRFA 2HLNA 4ZCMA 2FEOA 2OZEA 3LG2A 1KQOA 3T4UA 2CNKA 4YECA 4HLUA 3VI3B 4F4IA 4NJMA 1UXKA 2KQUA 2WF8A 1J8MF 3E4DA 4M1OA 1F17A 3D6FA 3PGJA 2NSJA 2A1TR 2Y1EA 4ZOCA 1JEAA 1UJ6A 5L3ZA 4DCUA 1R0BA 1ZM2A 3OT4A 4QOGA 1ZI6A 4Q00A 2FJ0A 2WWRA 4D4JA 4CV0A 3FOWA 1E58A 1U0NA 1ZZGA 5DE3A 4O4IA 3FSJX 4A23A 4UMFA 1MU0A 4EF5A 2OP0A 3VGPA 3VJKA 5DK4A 2OY0A 1R9GA 2HNBA 3K09C 3NHFA 2DHEA 4NCHA 3DOEA 3I92A 4FYHA 4UFOA 3WDSA 1M2OB 1E98A 1DKQA 3DD1A 4AMYA 3LC2O 1QTQA 4NBTA 1AVTA 4O4JB 3BFVA 3H5TA 3PD7A 2RIPA 3ABZA 5FYDA 4IMPA 3GN2A 2OYRA 2YFQA 2VHYA 1LZKA 1TUGA 5C1PA 3UH0A 1GUYA 1U5BB 2CUNA 4HXFB 5HMLA 4B2YA 5HIAA 2C8KA 1PJSA 1SCNE 1QIIA 3N76A 4CYMA 4MHTA 1W59A 2PUDA 2G40A 1Y3AA 1X15A 1XMPA 2IUYA 3AVYA 3UIEA 2VK2A 2LV8A 5K03A 4CU5A 5K20A 3ONNA 4DRYA 3MCZA 2XVMA 1I8TA 3SVLA 3QHQA 2X1HA 1YZQA 3G9QA 4I1YA 1CNEA 2XWJI 1NJ1A 1GPNA 1UBNA 4LJ6A 4CI0B 4U8HA 1T2NA 4IVNA 1N6OA 5HKLA 4YLGA 1PZGA 2IEZA 3GJ3A 4HWSA 1EFPA 4DXHA 3IIMA 3WTBA 4XX0A 2REQB 3AW9A 5I7EA 2OP1A 1FNCA 2P2GA 3BZBA 2PSFA 2QVCA 3LL7A 4XM0A 1QX4A 4OKNA 1CULC 3P9PA 4YA6A 3JZFA 2W4IA 1FOEB 4JU8A 4GKAA 5IPFA 4OHRA 6Q21A 4EKIA 2X9VA 1PWHA 4HDCA 4MGKR 5CB4F 1A1SA 4INAA 4Q7QA 1CU1A 3HKBA 5D85A 4XRGA 2B6NA 5K0GA 2UYOA 3ADOA 3DDWA 4QUAA 4E6EA 5K6AC 1B1AA 4NYMQ 1ZM4A 2BJWA 4Q16A 1X94A 5EJFA 4U7HA 2B21A 1A9ZA 4DIMA 4AS1A 3ANSA 1HDXA 3QELB 2KPOA 2FMIA 4OG2A 4Y18A 4D92A 4L6AA 1JXMA 2GTPA 1ULBA 3L6OO 1GSHA 1NQAO 4Q4AA 2WUGA 2J5QA 3BA1A 3L40A 4OXIA 4CL8A 3BHMA 2I3DA 4QDOA 2HWKA 1C3XA 3W2FA 4A8PA 3W6OA 3S1SA 5LQSA 4TKUB 3MTJA 3VNVA 3H0KA 4LDNA 3NKFA 1RJ9B 4OQFA 1FFWA 2L42A 4RHTA 4J0FA 4UPVA 4B2IA 5EZYB 1L8AA 2CVOA 3CGGA 3GD7A 4G8BA 3W6PA 3RV4A 3KIPA 5AVYA 2WHEA 3A3OA 2R79A 3MWKA 3FR8A 3H1FA 3N0VA 3V34A 1UZNA 3ITDA 4FFBB 5FWYA 4V03A 3QBEA 1UQUA 2EFDB 4HNRA 4EA8A 1UKVY 1VCMA 2QWXA 3NWOA 3PD0A 5LZ9A 3QOYA 1IQUA 5J4VA 3L0BA 3K9NA 4IMIB 2G0AA 3W9SA 1WPGA 3NHZA 5KYGA 2F64A 1BE1A 4HR7A 4W1SA 4BKRA 3WMRA 2V59A 1L9XA 3SYTA 1YI1A 1BQ4A 2BHTA 5FRDA 5HTOA 3EGDB 1J9GA 2PL5A 3BMNB 3I53A 1CQJA 1G2QA 1YFZA 1OUMA 1QE0A 1HH4A 3DG9A 1XAJA 3K1TA 4YGYA 4C0KA 4TRNA 4ZI7A 3P1JA 4IZOA 1CUXA 1FDVA 4S1TA 2QZJA 2WQZA 4KQIA 4B4OA 1LI7A 2GCEA 3DT8A 1U0FA 3C8MA 3WK9A 1O5IA 1CQXA 4KXYA 4AUKA 3TSYA 2EWVA 4KQ1A 3HCAA 1GZHB 5E9QA 1K6JA 4DHEA 1KRXA 2G08A 3QXSA 3LI2A 1DAHA 3PPXA 3G0HA 2XRMA 1WUYA 4L51A 2QRPA 3U9LA 4P3OA 6ABPA 2RKBA 3B9RA 1KPHA 4RHUA 1SVIA 1QKKA 3BMCB 2F43A 4WY5A 3UMGA 5CDTA 2ODPA 4MX8A 3EARA 5LXTF 1HWYA 4WNAB 3OPNA 3ZKAA 1U7DA 4IHJA 2QEQA 4RZ2A 5FBLB 5H5JA 4UJ3A 3CLKA 4TRMA 4CKYA 4AQDA 5KZMB 3R5SA 3A2LA 2PGJA 2C0QA 2YY6A 3HLTA 3NHLA 4NV1A 2R8EA 3OY2A 3MNFA 4RZIA 3U3XA 1EWVA 2B1JA 4NH0A 1LH0A 3ZZ0A 1S7CA 4QJ4A 4Y9DA 2I34A 5EPEA 2PCLA 4FQ8A 2F3PA 5E3HA 1A9XB 1CG6A 3TNJA 1JAYA 2GRAA 4QTUB 1R9MA 5JHGB 4KREA 3TIGA 4LJ7A 3FPFA 2AC7A 4AIIA 3DF7A 4IR7A 3DVLA 4DANA 4AJHA 5B12A 3ZJYA 4LCBA 4O4LB 5DBGA 1AO3A 2C7GA 2FPUA 1DHTA 2NW6A 4ZRNA 3RBAA 3I2IA 4M36A 2DBRA 2BZ1A 3DZHA 1Y6QA 3R4CA 2WKWA 1F0PA 2HK8A 1U90A 1Y33E 3T34A 4RZXA 4XA8A 5ALTA 4LOHA 4TKVA 3EVAA 4NNJA 5IANA 3BRSA 2VJMA 3E9ZA 3R8CA 1H5NA 4F1JA 5C8DA 4WBNB 4MQMA 3U7GA 2QUAA 1I6KA 3BL6A 1IN4A 3BZWA 5DIFA 4DR3B 2H1OA 1O0SA 1CVIA 3DAOA 2VRBA 4LDQA 3ZI0A 4EHLA 4BWGA 3BE4A 2XNDD 4Q48A 4E46A 2W8BB 4GZLA 2IYUA 5FNVF 3I76A 5C5CA 1GNTA 5DRYA 1RTTA 4JJEA 4IDNA 4XASA 3K70D 5AIBA 4BXOA 3M34A 2NVOA 1HNXB 5DNAA 2H7VA 3D8BA 3B5IA 3HA2A 4OQMA 4FNGA 3RS5A 3L7BA 2AHRA 1Q92A 5IYZB 3B3AA 2I8LA 4KX3A 2QMYA 2QL9A 1ZC3A 5GPBA 4LOJA 1J0EA 2DWCA 3DD5A 1SQ5A 1YJAA 3BWDD 2HO4A 3UKDA 5JYEA 3JSXA 1CF2O 3IP9A 3OPYB 4B48A 5L4LA 1PCXA 4FOOA 4BZQA 2A5JA 1UM8A 5GONB 4A03A 2NXNA 1NI3A 5J63A 1FMCA 4BUZA 2P1RA 2P3QA 4RTPA 3KFVA 3LQQA 4DNPA 1FL9A 3F2VA 1W5SA 3T1QA 3UWOA 3SP1A 4UPEA 2R1TA 4TVSA 5EOVA 4R1OA 4MIKA 2DR2A 2X4LA 1W0JD 3RADC 3OFKA 3KEGA 2YDYA 2G6BA 1RPAA 4V38A 4MI6A 3RAGA 1TK9A 5LP6F 4P54A 5HG0A 5F64A 3FKJA 3BKWA 3NHWA 2E9SA 1O87A 4Q3BA 5FPYA 4AT1A 1PR9A 4RESA 5E9AA 2XQKA 4TV9A 4NTZA 3UPUA 4LGMA 5L7TA 4MQFA 4DW8A 4G37A 4ZCRA 1RNLA 4WBXC 1EWQA 1NXPA 5FKJA 3O31A 4MLPA 4AMUA 4IW3B 1YNSA 3SFZA 2CCKA 2C57A 3NNSA 3DR3A 5LFAA 1MP0A 5CEJA 4ZIRA 3WYBA 4NCAA 1KFBB 4LHZA 1U0RA 1OKKA 1R9NA 3I52A 2P78A 2WINI 3TTVA 3VVBA 5JD3A 3ZBQA 2QLTA 1U9ZA 1VP3A 2HRDA 4INZA 5C3UA 3R7FA 1XCBA 4AJKA 2SHKA 2VG8A 5E6SA 4BHTA 2R8XA 1HF3A 1YQUA 3KWMA 3B89A 4G4SO 5HQJA 4JDUA 5F5NA 3U3ZA 4DLPA 5KKCA 2XT6A 5J2TA 4HCJA 1NBWB 4MLCA 2VDKB 3UMSA 4FCCA 1JKJB 2QYTA 1XBTA 1DG1G 2C2OA 3GYBA 3VYRB 4G0MA 3ZWCA 4DNQA 1HL3A 5LQKA 2VKQA 2NACA 1U3VA 1U4SA 3L7YA 2VSFA 2B82A 1P81A 1H6BA 1JBKA 1E8NA 1U1GA 2IHYA 2W6JD 3AEQA 3BDAA 3Q3GE 5IBCA 3OO1A 2NYAA 3VV3A 3JQ7B 1N3LA 1PGQA 2CNDA 3UWDA 2OO5C 2OG2A 4UULA 1BRTA 3GT4A 5FPHA 3MWFA 3I6IA 1F4VA 4QIHA 1MO4A 3NEYA 4O2AF 5D3MA 4EHFA 1H05A 3L7DA 4HQKA 1P5RA 1BNCA 1YV9A 5GTDA 1N36B 3RRNA 3LP8A 1F12A 2J4DA 3VHXA 4KXUA 3DWIA 3OTIA 4RD6A 4PICA 4GQIA 1FDSA 2Z58A 3EVBA 4Q3AA 1I4LD 1V8OA 2GBLA 1Z0IA 3FCCA 4BFZA 2AN5A 2HYDA 1I2AA 5JEDA 3B5EA 1PJQA 3G68A 4KAJA 5HBRA 2NP7A 1YQTA 4A6PA 2WSLA 4CM7A 4B0PA 1BKDR 2GNOA 4HTAA 4O08A 1VDZA 2HGSA 1DSSG 3PGA1 1BCSB 1MGPA 1Y1TA 2HA5A 3D02A 3WNZA 4LJSA 5DX1A 5ILOA 3HJRA 2SECE 5I8PA 4ZQHA 5FWXB 1SJ9A 2VNAA 3KXPA 3DDNA 9LDTA 2UXBB 3DZGA 1XZJA 1ZINA 1W48A 1IM5A 3ECSA 3NJ8A 5EJAA 4KQFA 3B60A 2XADA 1FFYA 3MT8A 5LLSA 2J87A 3V55A 5IKXA 1MO5A 3H0CA 4HAVA 4CTMA 1G66A 3G0DA 3KQMA 3NCTA 4KQXA 4QVKA 3A6KA 2WUEA 4F6CA 1I4DD 1P0PA 3D81A 3P2JA 5K3FA 3TB4A 5BURA 3T7SA 4X1OA 4PYNA 3FYUB 2RK6A 2CK3D 2XA2A 3P94A 4QL3A 5FOTA 4A1FA 4XYMA 5IK2A 4AJEA 1AG9A 3I0MA 4FIZA 3R9XB 1M8FA 2F2TA 5EI5A 4YCMA 4BVGA 3R6WA 2VJDA 3EXHC 2DQZA 4YCNA 1T5LA 3OX1A 3QOFA 4BP3A 5JQGF 2ZR9A 4EEKA 4W9NA 1P5ZB 4D9FA 2GPSA 3NH9A 2NG1A 4UU0A 4OAQA 3U4CA 3HCEA 1RPNA 1RP7A 2PMDA 4U7PB 2EDAA 4YC7A 1PT7A 1THMA 4DA4A 3GJ5A 2J0SA 1I1OA 4GPD1 3O8QB 1UP6A 4WKCA 2FEMA 1I4WA 2NQ2C 4AVYA 2HHAA 3DKIA 4M0DA 4H18A 3O4JA 1L7EA 3L5OA 2I62A 1N1DA 1GQYA 2ID9A 3OZGA 4G8JA 4Q3DA 1Q1GA 3UB3A 1NI5A 4P7KA 5T4EA 1BFUA 2ZBFA 3S8MA 3S2GA 1HE5A 1RIFA 2C2MA 2C9MA 1YDEA 3RWOA 4FFSA 1TKAA 1Z62A 2C95A 1NLUA 3GRKA 2HMTA 4PS1A 4EUHA 4I2NA 2PT7A 1E9SA 4LRQA 1XX6A 3S0JA 5ED0A 4GMDA 4HS4A 5E38A 1X0VA 5JD4A 2QI9C 2C94A 3G5LA 3P2KA 3VAAA 4UUOA 1BU5A 4O2BA 3L7JA 1TPYA 1TM4E 3KHUA 4YCBA 1A2QA 4G56A 1T1IA 5I45A 1JZQA 3O47A 4CF5A 1AGNA 4FDUA 1Z3CA 4XYEA 1JP7A 2BFOA 1YB1A 1YZKA 2Q0SA 3E27A 1LPMA 1W47A 2COEA 4ID9A 3Q6NA 1XA3A 4BMSA 3BPSA 4YRIA 5LIRA 3B85A 4LW8A 2CJWB 2JFQA 4E70A 2BMFA 3LDAA 3QE9Y 4P1ZA 5DM70 1JECA 2ZM6B 4RA6A 2Y1WA 2FCAA 5B64A 4XYBA 4F72A 1UCFA 2FAXA 1YASA 4YQEA 1RC1A 5LA6F 2JIPA 1F2TB 3GJ4A 4FDLA 1DEAA 3R3ZA 4HGZA 1ACMA 1LBTA 2LKCA 2FRDC 4MUBA 5JWHA 3O91A 5KHAA 1P0QA 3CRVA 4R3WA 2RAVA 3F0TA 5AK5A 2C1EA 2W42A 3GFFA 4A8JA 1JSXA 1DCTA 2MINB 3BWVA 2IK8A 4OSEA 2G0NA 4LBWA 4BIIA 4Q12A 1F48A 1KJIA 1L7QA 3UN1A 5I9MA 3OSUA 4A8HA 5AW7A 1ZIYA 4AYTA 1KK0A 1HDYA 5GAJA 1SOUA 1V71A 1YQQA 3PLNA 4QO8A 2WD7B 1QCYA 3A05A 2PKXA 5DBIA 3UGKA 1Y0BA 5I7HA 3CB4A 1UFQA 1DX6A 1IQ0A 3NRCA 5AW6A 1ICIA 1ZITA 2UZ1A 5ICMA 4UE2A 2QIPA 5H80A 1ZWKA 1SQSA 4PLCA 2EATA 3S28A 3L49A 1P91A 2IP2A 4ENUA 3QP9A 3IAS6 3QENA 4IFTA 4WGGA 1D2GA 2C4WA 3NLLA 4E7OA 1NMSA 1I36A 2X1LA 1WOMA 3GRUA 4F2HA 5KTOA 2QL5A 2V4MA 2IZ5A 2NTJA 2Y76A 4JMPA 3RSHA 1ZVKA 2JEOA 2YH2A 3C39A 4BRSA 1RXVA 1N78A 1AMOA 1FDWA 3CRW1 1CQPA 2WA2A 4N18A 3B52X 3N2NA 2ZAIA 1XQYA 2PX8A 2O8EB 3R3SA 2MSNA 1SKMA 3BWEA 4JR1A 2R7MA 4Z0NA 1AV6A 1Y7PA 5EIBD 3C70A 4HGRA 3WWEA 1BX3A 1D1PA 4P5DA 4DT1B 2ONJA 1W76A 1Q0HA 4K9PA 3RBZA 2GCGA 1JT9A 4E13A 1EFRA 1G6Q1 4FD3A 2OOKA 2QAGA 1M0SA 1PD0A 4R1PA 3WLIA 2C7PA 2VF8A 1T36A 4C4OA 1NF8A 2GZHA 7ADHA 2O8CB 4ZYUA 1FYVA 4PONA 4MWOA 4MO9A 4KSCA 2QLJA 3GPBA 3PFFA 1UK8A 2Q5EA 2ACWA 4EHJA 2GS9A 3USCS 2ETXA 4E1BA 1WUTA 3D6JA 4PZYA 3TQCA 1R6BX 4AMBA 2CW5A 3ONDA 3O3MB 3ORFA 5LWQA 3IJPA 1R0LA 4JBLA 2PKYX 5K51A 1FP2A 5HRAA 1WXEA 2I8CA 4IDBA 3VU0A 1H0KA 2HAEA 4OAOA 2VH1A 2FN8A 4HVLA 3T99A 3BGWA 1U1IA 5A3SA 5DK6A 1NT2A 5TQ0B 2BSAA 5DB4A 2B3TA 3S44A 5DI9A 3HJCA 2HSDA 2GRJA 3PTLA 2H5LA 4P9NA 3VDQA 1EFVB 4URYR 2X9GA 4RPKA 3HKEA 3DL2A 3ZJTA 3WLRA 1N33B 3KQWA 3QITA 3M89A 3EFHA 5EQTA 1XXHB 2X22A 3NFRA 3Q8WA 2BP7B 2GBCA 3VHRA 2ZRFA 1C7QA 1KC3A 1H0HA 4Q4JB 1E9DA 4P83A 3U3JA 3HQ4O 2XYVA 1NQ5A 4M9SA 5E2IA 3NPMA 1VZ2A 4FGKA 5COAA 4KX5A 4REQA 2Y0EA 3WYGA 5AJXA 4TWIA 3HU2A 1C7EA 2R9VA 3K72B 3I39X 4R0MA 5TF4A 4I50F 4UU7A 3W5HA 3PDIB 4H15A 1H3NA 3L6UA 2YDXA 1U7HA 4EX7A 3AEZA 3QKIA 4AJ2A 1E3WB 3FOEC 3MBIA 2NX2A 1YC5A 2JVKA 2WC1A 4N40A 3IPXA 2HDWA 3EGOA 3VR3A 2QZ9A 1G7CA 3HS3A 3AK4A 3HA7A 2JKZA 3BM5A 3N28A 2NXWA 1X3LA 1E2KA 3NO4A 5JS2A 2BRUA 1JE1A 3V1MA 3FNQA 4HNAA 1ILEA 3QI7A 1Y3DE 2Z3VA 3DW1X 3RS2A 5I4CA 4NS1A 2YIVX 3LDGA 3IQGX 5DP1A 2V7XA 4TLAA 1UKCA 2F67A 5ERYA 1U8CB 4DDVA 1YHYA 1VIDA 3FMGA 5ALEA 4BO2A 2I4IA 3RFCA 1EX6A 6NULA 1EVEA 2ZIFA 1N0WA 4RH1A 1G8AA 1P2DA 2H52A 2B7BA 2PCJA 5KWJA 5DLDA 2HSJA 3VV2A 3OIDA 5P21A 3M3DA 2NV2B 4R9UC 4TMYA 4CKEA 2B92A 4F06A 1MQAA 1R16A 4FXPA 5J3JA 3CCFA 2QTRA 3NWPA 3LP5A 1B14A 2I6SA 4HGPA 1JT2A 2GPAA 1KBQA 1WMDA 4HDKB 3WL4A 2P35A 1KMCA 1TQDA 3GRPA 1Z5VA 1L4FA 2VJQA 3X43A 1NSFA 1L4EA 3LL4A 1NNUA 2AT1A 1T8RA 2PJZA 2VPWA 1ZCZA 3DOUA 2VPXA 2PBLA 3GJRA 3H4TA 2ECFA 3D3JA 3PR2B 4L15A 4LC0A 4XUGB 3V32A 5ICSA 4XQCA 4ZAVA 1AB5A 3RJZA 3UWKA 4RDHA 1ZXBA 1R5BA 1DTEA 1WP4A 3BMQB 1WQ3A 1NUAA 1FX0A 1KHHA 1M8GA 1GHTA 3P27A 4YMTA 2MDTA 2NQ8A 1VLQA 3EBOA 3EZ9A 3TAUA 4F96A 1I0IA 4ALKA 1QFSA 3HFRA 2FE4A 4JMLA 2XUDA 4B76A 3LPDA 4CG3A 2VTBA 4J16C 2ERXA