3KQMA

Crystal structure of hpnmt in complex adohcy and 4-bromo-1h-imidazole
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
total genus 95
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqmA00
3OPNA 5LQAA 3U81A 5CVVA 4DCMA 4Z2YA 4RTJA 2P1DA 2VDVE 1WS6A 2XYQA 3A7DA 4ER7A 3KR0A 3TLJA 4QTTB 2VDWA 2R6ZA 3LPMA 4QVGA 4RTKA 2PT6A 2LD4A 1RI2A 4OBWA 5D1HA 1X1CA 3KKZA 3T7SA 4RTQA 3DLIA 5EMMA 5DPMA 3IEIA 3SSNA 3E05A 3THRA 3GO4A 3DH0A 3FTEA 3A7EA 2CWWA 3OCJA 4GC9A 5EEGA 3TOSA 2O57A 3P8ZA 5FWAA 4GF5A 3C0KA 2ONYA 3DMFA 3NTVA 1XDSA 1JG1A 1QAMA 4YMHA 3I58A 1VLMA 4P7JA 5B1SA 5GP1A 3KPVA 4YUYA 5E1MA 3FTCA 5EC8A 3RODA 2P40A 3C6KA 3KQVA 3FTDA 4X41A 5EMLA 1YFJA 1Q0TA 2DULA 3HCBA 3MB5A 2P41A 4PYOA 4HTFA 1P39A 1R18A 4RWZA 2Z6AA 2FK8A 3P9NA 3KQMA 5EMJA 5GINE 5F2NA 5ICCA 4BY9E 1ZHFA 4DQ0A 2P7HA 1ZKDA 5KQRA 2QM3A 1NW7A 1VP9A 2ZBQA 3AWIA 3CVOA 3BZBA 5DT2A 5CIYA 3MHTA 2ZULA 4E2XA 4KVZA 4XCXA 2B25A 3ELDA 3MTEA 5HIKA 5DXAA 2I9KA 5DM1A 2HNKA 2UYHA 3PS9A 3AY0A 1UWVA 4P58A 1G8SA 1U2ZA 3JWGA 2PXCA 3C3YA 3P2EA 3HP7A 3DXXA 1SUSA 1DL5A 1VP3A 5EEHA 4E2ZA 2AVDA 2VZ9A 4RVGA 4YUVA 2AOUB 1G38A 2PKWA 3GU3A 4QTUB 5G02A 2H00A 2Z6QA 4IV8A 1XVAA 1RJDA 2GLUA 2Y1WA 3TRKA 2ZVJA 1NV8A 3JWIA 5T64A 3SX0A 3EVFA 3TPZA 4GC5A 4F85A 3ER9A 1WZNA 4PONA 2FRXA 3A27A 3KR9A 1H1DA 1RI4A 3EMDA 3P2IA 2XYVA 1JQ3A 5CCXA 1VPTA 2CL5A 2OPBA 3BGVA 2HR1A 3HNRA 2ZCJA 2G72A 4ER5A 1YUBA 4EVIA 3LDUA 3QOXA 3LGAA 3R24A 2ZLBA 1D2HA 4ER6A 2NXEA 3ANXA 1EAMA 1JG3A 2FYTA 3SSOA 3JWHA 3CGGA 2FPOA 5KS2A 5GWXA 4AZWA 3HCEA 2PLWA 4ISCA 1NW5A 5DX1A 1NE2A 1FBNA 3M6WA 5DRTA 3DP7A 1HNNA 3QOWA 2O06A 3I64A 1ZGAA 1QYRA 3EEYA 2Z6UA 5CCBA 2WA1A 3OU6A 3PB3A 2V74B 5K0BA 2CKDA 5BW4A 5EMKA 3VC1A 2ZIFA 4RYLA 3GDHA 4DZRA 2IIPA 4V0RA 2GAFA 3ID6C 3NVKI 3FUTA 5C1IA 5BP7A 1JR4A 1VQ1A 3F4KA 3TM4A 4EQZA 1AV6A 4KDRA 3G2MA 5K09A 1L1EA 5EIWA 2OXTA 3G8AA 4E70A 3PFHA 5EG5A 3UJDA 5HFJA 1JG4A 4RTMA 2QY6A 1BKYA 3UJBA 2PY6A 4C07A 2BZGA 1IY9A 1KYZA 3GRUA 3EVDA 5K0FA 5MHTA 1EJ0A 1X1DA 5DXJA 5FWDA 5JR3A 3CKKA 4P7GA 3T7TA 5LQKA 5IH3A 3EMBA 2P7IA 5K01A 3GJYA 5HIMA 3FUWA 2HV9A 1L3CA 3T7RA 4KWCA 1YZ3A 4X60A 4ATNA 4PGGA 4HGYA 4U7PB 2ONZA 3BGDA 3UJAA 1KPIA 2FCAA 3M6VA 2VP3A 2OYRA 3V97A 4C03A 3HA5A 2XVMA 1Z3CA 3E8SA 4HTFB 4Y30A 2PXAA 2ZIGA 5E2BA 4OX9Y 4LWPA 1AQIA 5DSXA 3UZUA 1XDZA 1D2CA 2AR0A 2GA9A 3LCCA 1XDUA 4R6WA 3B5IA 2PX5A 2ADMA 3NMUF 4RTLA 2IDKA 4F84A 4CTJA 4OA8A 3G88A 1EG2A 2AZTA 4ER0A 1PRYA 3DOUA 1L3BA 2AN5A 4CKCA 3EGIA 3VC2A 2I62A 4PYJA 3M6UA 1ZG3A 3B7PA 1HMYA 2G70A 2P35A 4M36A 5FQNA 1Y8CA 3I53A 4PCLA 3I9FA 3UBTA 2JH9A 1NW3A 3BWBA 1O9HA 3SGLA 4C04A 4LECA 4OQEA 2PWPA 3D2LA 4BLWA 1JSXA 2JHAA 4X63A 3M70A 3DLCA 3M4XA 2VS1A 3LL7A 2IH4A 5T6BA 2O0LA 2ZTHA 3LDFA 4BLUA 3FPEA 2WA2A 1YF3A 3FTFA 3GWZA 3K0BA 5EIFA 1RI3A 5E1OA 4RTPA 2NNWB 2NP7A 2EG5A 4QDJA 1V39A 3FUVA 3FYDA 4WXHA 3UA4A 5K0GA 2ZBRA 1R74A 3FRIA 3KQPA 3M33A 4X61A 5DSTA 2ZZMA 2OO3A 2K4MA 3KR1A 4AZSA 1DCTA 4FT4A 1VL5A 5EKUA 2YXEA 2PJDA 3G2OA 3PLAE 4A6EA 5E9QA 2HTEA 3FZGA 3JWJA 2YQZA 4CXMA 1M0EA 3GRYA 1ZGJA 3EVBA 5CUQA 2O07A 3GRZA 3KPUA 3L8DA 4MTLA 4C06A 2IPXA 1QAOA 3DULA 3GGDA 4Y2HA 2PT9A 2ZWVA 5GIOE 3E23A 5H02A 3LDGA 3DXYA 1G55A 3IHTA 4BP1A 5HIIA 3WSTA 3ER8A 5DX0A 1KXZA 3ORHA 4QPPA 2NXJA 5EHIA 1RJFA 2BR4A 2R3SA 3CBGA 4POOA 4HG2A 1QAQA 3EVCA 4R6XA 5LR6A 3LBFA 3EGVA 3BGIA 4DCGA 1RI5A 3EGEA 3NW9A 1NBIA 3KQYA 5FA8A 5IKMA 3EVAA 4CKBA 3R9XB 5JUWA 5BXYA 2AOWA 5ICEA 4RTNA 3KPJA 3CCFA 5CD1A 5K03A 4EMSA 3IYLW 2ZSUA 3P9CA 3P9KA 1FP1D 4IV0A 4R8RA 3EVEA 5FCDA 1NW6A 2I7CA 5DM0A 3V8VA 4DA4A 3BXOA 1I9GA 2NP6A 3ERCA 3KQOA 2PWYA 2BH2A 2G8NA 3MCTA 4GEKA 1AQJA 2BM8A 2JJQA 2YXLA 1XCJA 2B2CA 2NYUA 2P8JA 4X1OA 2OKCA 2QRVB 2PX2A 4PYIA 1BHJA 5FHQA 3PX3A 2V7EA 3TKYA 1O54A 1VIDA 2FK7A 3GXOA 3R0QA 3CJRA 2DPMA 3LKDA 4DMGA 5FA5A 3DMHA 5FUBA 3OU7A 5GM2A 4PNEA 1L9KA 4E30A 2P3QA 4G56A 3O7WA 2P3OA 3HTXA 3HA3A 2AVNA 5C9ZA 4GBED 3NVMB 3A26A 4AZVA 5EZQA 4OBXA 4HRAA 2PBFA 5DTQA 3P2KA 4HC4A 2ZBPA 1UFKA 1XCLA 2ORED 2AN3A 3G2QA 2OZVA 4C05A 3KQWA 2H1RA 3BUSA 4MHTA 1I4WA 2HMYB 3Q7EA 4YV2A 4FSDA 3PT9A 5K0EA 2IDJA 2PSSA 2AN4A 3BWCA 4U7TB 1IXKA 3UA3A 4IKPA 2PVCA 3R6TA 5DM4A 2ZWAA 5LQJA 2IGTA 3KQSA 1MJFA 2AOTB 1FP2A 3I5UA 3GRRA 4KRGA 3UJ9A 3CJQA 1R8YA 4KIGA 1R00A 4PYMA 4PGHA 2OB1A 5CM2Z 3M6XA 5CVEA 5E9WA 3VSEA 4RTRA 3HVJA 4BP3A 2YVLA 4GUAA 4QPNA 3EPPA 5EQJB 3UJ8A 3SM3A 2AOVA 3EVZA 4CKEA 4P7FA 4RVDA 5EGSA 3TKAA 1XJ5A 4KW7A 4EK9A 3G8BA 2UYOA 5M5BA 3ELWA 1X1AA 4XUCA 3OZSA 2OBFA 3BKXA 3SXJA 4YUZA 2JG3A 3OU2A 3AXSA 3FUXA 3NWEA 4PIPA 3BWYA 3HCDA 5EKXA 4C4AA 5LSAA 5LQCA 3ELUA 3VYWA 1D2GA 3O31A 4OQDA 4PCAA 1NBHA 3OZRA 3BWMA 3KHKA 2ZW9A 1SQFA 4ER3A 4GOMD 4YMGA 5GIPE 1JSZA 3UJCA 1YFLA 5FADA 1T43A 1YZHA 4E32A 3MTIA 5E1BA 3AXTA 2C7OA 4M7RA 5DLYA 4RV9A 2YTZA 1QZZA 1ZQ9A 3E7PA 3MAGA 4FS8A 2PV0A 1JTFA 5E1DA 3G7UA 2VDUE 2IP2A 1FJXA 4RX1A 3SSMA 3DXZA 5FULA 1P1BA 2P3LA 5K05A 3OZTA 2BM9A 2FHPA 3KQTA 1KIAA 2YUIA 3HA7A 3KPWA 4IWNA 3NWBA 3FPHA 5EOVA 3IV6A 5LQUA 2EFJA 1KPGA 3LX6A 1UIRA 2HWKA 3ELYA 5K0JA 2C7QA 4M38A 4RSRA 5E9JA 1SKMA 1N7IA 2AOTA 3CC8A 3THSA 4E33A 4FR0A 3H2BA 2CMHA 3GIWA 3G5LA 3OE4A 8MHTA 4BLVA 2KW5A 4PWYA 3TMAA 4XUEA 5ICGA 4QVKA 3MGGA 1SQGA 3LCVB 1WXWA 1EQAA 5HZMA 4QQNA 2G71A 2C7RA 5E8JA 4NECA 3B3JA 1F38A 2PX8A 1NT2A 5DRYA 1BOOA 1SUIA 4AZTA 3LBYA 3REOA 2O05A 2C7PA 3MERA 1B42A 3KPYA 1KPHA 3GRVA 4UOEA 3SMQA 1G6Q1 1XTPA 2H11A 1F3LA 2OB2A 3B3GA 4LWOA 4YV0A 10MHA 1M6EX 3PFGA 1IM8A 3SVZA 2JHCA 2Y1XA 2YR0A 4DM3A 1INLA 3BKWA 4MWZA 1RI1A 4E31A 2IBSA 5KYGA 1FPQA 2GPYA 3G2PA 2QRVA 4HH4A 3Q87B 4RVFA 1R6AA 1P1CA 1RJGA 1X1BA 3FPJA 3LKZA 3R3HA 5KVAA 4YUWA 3DMGA 3LCUA 2Q41A 2E5WA 1L3IA 1M6YA 2QYOA 2YX1A 3AJDA 4HGZA 5EHGA 4YUXA 3MQ2A 5ERGB 3P97A 4PINA 5D1NA 1WG8A 2XYRA 1BC5A 5HIJA 5U4XA 3RIEA 3UFBA 3OFJA 2UYCA 5GM1A 3LSTA 4AUKA 4E2YA 4M37A 2PXXA 4A6DA 1ORHA 3MCZA 3HCCA 4GOND 4PYLA 4CWAA 5K8VA 4RTSA 2B3TA 4L7VA 3X0DA 3FRHA 4EKIA 2AS0A 2XVAA 2PGXA 2AOXA 1AF7A 2ZFUA 3NDIA 5LQRA 2EJTA 2ZZKA 4R8SA 4ZTBA 2ERCA 2F8LA 5T67A 3TM5A 3PX2A 1NV9A 7MHTA 2UYQA 3HVHA 4PYQA 3C6MA 4KIFA 4WVLA 2JHPA 1G8AA 5CVUA 3UJ6A 5EZSA 1EJ6A 4HSGA 3GNLA 4DKJA 1JTEA 2WK1A 4R05A 5EVJA 4DF3A 4V0QA 1VBFA 2B78A 4XUDA 4E2WA 1P91A 2I6GA 1NW8A 3DTNA 3HVKA 2QE6A 1KYWA 3NDJA 4RVHA 4F86A 2BR3A 3HEMA 4FP9A 4GQBA 4JXJA 3KQQA 3TR6A 4RTOA 1KHHA 5FTWA 4KDCA 2OY0A 5EPEA 3HVIA 2EJUA 2NXNA 2IH2A 1X19A 4GOLD 1OR8A 2XBMA 1NKVA 1DUSA 3CJTA 4OA5A 3TFWA 1N2XA 1ORIA 1TW2A 4B17A 3OE5A 2ZZNA 2YXDA 2IBTA 2EX4A 3B3FA 1JQEA 3G89A 1PJZA 4FSXA 5DWQA 4FZVA 3LECA 1N7JA 5BW5A 5K0CA 3DUWA 5K0LA 1O9GA 4GOOD 2IFTA 3LHDA 3SR4A 3HCFA 1JG2A 1WXXA 2ESRA 2PX4A 4K6MA 2BR5A 5DTMA 5HEKA 3A25A 3TQSA 5HOQA 1I1NA 5ICFA 1TW3A 5CVJA 3NJRA 3UWPA 2JH8A 5CVDA 2GH1A 3OFKA 3KU1A 3ME5A 5HILA 2A14A 3G5TA 3PTAA 3FPGA 3QV2A 1MHTA 2UZ4A 5E8RA 5FQOA 3K6RA 4O29A 5F2OA 1VE3A 4EKGA 4YV1A 1SG9A 1XXLA 3PVCA 3RW9A 3DR5A 1RJEA 3FUUA 4QDKA 1Q0SA 5C0OE 9MHTA 2CMGA 3HCAA 3P71T 3P9IA 3EVGA 4PYKA 5K0NA 1WY7A 4FT2A 5E2AA 5DX8A 5KQSA 5LQNA 1TPYA 2NXCA 2GB4A 1JQDA 3FYCA 3EEOA 1KP9A 3GCZA 1R8XA 5DTRA 5FHRA 5P8WA 4CTKA 3A4TA 4P7KA 3O4FA 1EIZA 3KR2A 1QANA 3UJ7A 3B89A 3C3PA 2N47A 4C08A 1KR5A 4FGZA 4PYNA 4LG1A 2GS9A 2ZIEA 1SVUA 3S68A 4AX8A 1G60A 2IH5A 3BT7A 4H0NA 5F2KA 2B9EA 3HM2A 4QQKA 4PIMA 5DM2A 3T0IA 2G1PA 5GOZA 2AOUA 1YB2A 4MQ4A 3FPFA 4MIKA
chains in the Genus database with same CATH superfamily
1J0CA 4R9SA 1SC3A 1JB9A 1XHLA 1AS3A 4RZIA 5JJKA 4IDGA 4YO8A 3BXGA 4L85A 4DCMA 4UQLA 4TL8A 1L8QA 1XD2B 4KNWA 4LTNA 1XAHA 1SUWA 3TBKA 4F21A 1E32A 3O73A 4YRSA 5B1YA 4FE7A 5I8ZA 1KK3A 1RI2A 3LF2A 3M8KA 3OHSX 4FZJA 5FOWA 1X87A 3ZZ1A 4JJZA 2XOKD 1ZOOA 2GM9A 1LTHR 5MGBA 1Z56C 2QGFA 3LWNA 1B74A 4P83A 2C4HA 5IUNC 3ZJUA 4R98A 2INGX 3QV1A 5FTMA 4FQ8A 4JJEA 1Z6AA 1ZXXA 2X86A 1CB0A 4B6RA 1ZZEA 1UADA 5GP1A 3FTCA 3AK4A 1GUZA 2QD2A 1DIGA 2VNAA 3DMNA 3QHAA 5B3KA 3IODA 3STHA 4R68A 1L4EA 2JCBA 3QX9A 5KQRA 2ZBGA 4YFVA 3JARA 4ZAGA 2WJPA 5DYGA 5F7ZA 5CURA 2YFYA 2HIMA 2X9NA 3PS9A 5AJZA 4LX8A 3DKVA 4MW0A 2NWQA 4MJ7A 4MR9B 4EB6A 3CVVA 4ZQFA 1QP4A 2FDCA 2VNSA 1O57A 2AVDA 2FFRA 3H9EO 3Q7PA 4YUVA 3Q5DA 1HGXA 4QTUB 4B71A 2JANA 1GEEA 3IAFA 4UDOA 1Z4QA 2J6HA 2UVDA 4L22A 1WTAA 3TB6A 1C0PA 4OPMA 1EE2A 1KKUA 2HL6A 1A04A 3EIWA 4NXNB 3DEHA 1U2TA 5BN3B 2OZPA 3F6YA 3PFFA 3FLBA 3OF2A 1Z2PX 3RR2A 3LDUA 5BVHB 4IINA 1ORVA 2PRYA 4B3XA 4DJ5X 6CHYA 1ZBQA 4FJ1A 2X58A 1VHQA 1N4AA 3WTCA 4MVYA 3T1OA 5H8WA 1YZNA 5ALWA 3T94A 4L28A 1G2PA 1TT7A 2XGOA 3QG1A 3CGGA 2AG6A 4FIZA 5JAIA 3NWJA 1BH2A 1HR0B 3RRJA 1R5BA 1XXHA 2QRLA 5HIAA 4W4TA 2HK9A 1N33B 1QYRA 1F3OA 4P84A 1U5AA 1F2TA 1LI4A 4Y1FA 4ZT6A 1W88B 2WE7A 3PB3A 3CZPA 5DGCA 5L3SA 3IQDB 1GN8A 4BFWA 2PGNA 2CHGA 2ZETA 1V45E 4I50F 1TYDE 5L7TA 3L6RA 3ETCA 2OHIA 4MW1A 3V1UA 3QA9A 3FUCA 1DZ3A 4WLUA 5A1TA 1U81A 4KDRA 3G2MA 1ODIA 2YVQA 3C3CA 2QQFA 3KUDA 3G8AA 4N47A 2V3WA 3UXYA 5H59A 5IT9A 2QTCA 1D4ZA 2H29A 2JCSA 3COPA 4EPYA 1T1RA 1KE2A 3DA8A 5AXCA 3DMDA 2C31A 3VPHA 1ZQ1A 3B53X 1EHIA 4G1EB 4MHSA 1GFZA 1M54A 1TGYA 3H11B 4QICA 1I6KA 2YJZA 4EJSC 1YIDA 5AI5A 3PUXA 4PGAA 4QA9A 2VQDA 4UNSA 5FWDA 5A3QA 5KCZA 1NMZA 4M89A 4YT5A 3T34A 5K01A 4RIFA 4JR0A 5IVKA 3AESB 4KCGA 4ENPA 4HS4A 4JYCA 2ZK7A 4TWBA 2CDNA 5ALVA 4HGYA 2XT0A 4DWVA 5D5QA 3QHQA 2WSSA 4E6EA 3LFUA 1XFAA 2V0CA 3HXPA 2C4MA 1Y9AA 4NJOA 3RU9A 3HJUA 1JWAB 1SUBA 1Z6GA 5B4VA 5CIWA 5J43A 4B84A 5JMTA 1E2BA 1C3XA 4OX9Y 3ICQB 1LX6A 1AQIA 1XRNA 2O7NA 2RI6A 3I9JA 3CNOA 2HHJA 3O84A 4RA9A 5I9SA 2AR0A 3D4IA 3WMXA 5CLQA 3LQ1A 3X2SA 1LD3A 1N8SA 3LKVA 4HZGA 3RIXA 4C88A 4EF6A 4W5RA 1Z08A 1MX1A 3K8YA 2QTWB 3MEQA 1L5OA 3GA0A 1L3BA 3I2KA 4V03A 1TKCA 2ZKLA 1SKUA 4NQRA 1KEEA 4PYJA 1FJGB 4X6UA 2W6NA 3SS8A 2G70A 4Q4AB 1NFFA 2FR8A 3WP1B 4M60A 2JH9A 4PZAA 3E2MA 1NW3A 3BWBA 5DHQA 1AXEA 2MWMA 1E61A 4OOEA 3T3HA 4GS5A 3DO5A 2HWUA 3F98A 1FQOA 3VVLA 5I3CA 4Y2YA 4EI9A 1F0PA 5F76A 4LX0A 1C3EA 3WL4A 2ZYIA 3F74A 2M9MA 2CDRA 4PC3A 4EZIA 1EU1A 3OBBA 1W48A 5CT8A 4D9GA 2WJAA 2D74A 5TF0A 4WFJA 4EHHA 4TT3A 2XLCA 1J1ZA 5K0SA 4NEGA 4ZU6X 2QBYA 1VLZA 3T1HB 3D3WB 2REBA 1GG2A 4JXKA 1SEVA 2BDEA 2XSZD 2JGRA 2J59A 2H3HA 2NZ2A 4G26A 3LBAA 2ISSD 3GCGA 4OXNA 1HKUA 1YVRA 1KQOA 1RKQA 1ZJ5A 2XNSA 3QE4A 1TFRA 2PUVA 1L5MA 4IQ8A 5AJHA 5DGXA 1CY4A 3WV4A 4C6SA 3RU2A 1CDDA 1JXQA 3PQ6A 1AK2A 1J99A 3VPGA 5IJ9B 1JECA 3FHTA 3KYIB 1KOGA 1XKQA 1UJBA 2O0JA 4I1UA 3GDGA 1XIVA 4EMBA 4J7UA 3WAJA 1OH8A 4LHSA 1S7CA 4M7OA 4D4IA 3JXEA 2YJNA 1N75A 1DJNA 4N0DA 1T26A 1B15A 5ECWA 2WQZA 3W5AA 4GG1A 4I4LA 3COSA 3I0MA 1GAEO 4UPEA 4XFDA 2NYAA 3LPLA 2J08A 1JI3A 3FF4A 1RYEA 3PGVA 2CK3A 3W77A 1ECJA 1G98A 1CZHA 1B43A 1G64A 1LRLA 1OFUA 2CE7A 2G17A 2OQRA 2RKWA 2SCUA 1CDEA 3P0FA 4R31A 4J0IA 4YJFB 4EHBA 3M3HA 5ED4A 3R9XB 2HHCA 1EP9A 2JZCA 2Q4RA 1UK7A 2DH5A 2RHTA 3JRWA 3K8QA 4G1CA 4JT4A 3AHDA 4PLGA 3VI4B 5BN4A 1F7VA 1CNEA 1BVHA 3I04A 5IJ0A 4CI9A 4YPVA 2OSVA 4GZMA 2HJWA 4UMVA 4JI4B 4ZO7A 2Q99A 3JALB 4TS4A 5AO9A 5EJMA 3PLRA 1AJEA 1L4FA 1U02A 3CINA 5BQ3A 4HDNA 4KXYA 4BUCA 2VT7A 3KD3A 4HH1A 1E9VA 5LM3A 2B2CA 3AV0B 3VU9B 3BE8A 1QCYA 1Q0HA 2GCNA 3R5SA 1F9AA 1PN3A 1ZO8A 2V7EA 2H17A 2R6R1 1NZDA 1O54A 3QYJA 5GJCA 5H4HA 2XQFA 5CCDA 2DPMA 4L3WA 4BUZA 2C0QA 3F47A 2VFAA 1EZZA 1LF0A 3FWNA 1U94A 4PZDA 4BJHB 4EG3A 4KPEC 3KETA 4BGDA 4LFBB 2G83A 1IBMB 1R5JA 1RWWA 3PPYA 3PZBA 1JA9A 3HKEB 1U9CA 1AIPA 2O23A 1Z6PA 2XB4A 4BHTA 2JGNA 4TX1A 5SYAA 3GG9A 4ZDWA 4ND5A 4JLNA 1NJSA 4K1LA 3MJTA 3BD9A 4RESA 4HAWA 1KI3A 4HHEA 3H5LA 3GF4A 4X24A 5F9HA 5E6UA 3KQWA 1YTUA 2PO5A 2ZM6B 2QTGA 3UICA 3QVSA 5J2TA 1ZN8A 2ZCVA 1RCFA 2JFQA 2IOFA 3CURA 4CT4B 1P9LA 1O6BA 3BL5A 1NI5A 1Z12A 1XMJA 3BXXA 4DC0A 3C6ZA 1HYGA 3M5PA 3OQIB 3BA1A 4REOA 3H6KA 5FUMA 4AY6A 2FEXA 1B8VA 3OFNA 5DLQC 3I9V1 2P6UA 3U49A 2RARA 1HE2A 3DAFA 1E6WA 1QGAA 4OB8A 3VSEA 1SCUA 1GTL1 1JALA 1HG1A 2JIMA 521PA 3WHPA 4HNAA 4S1TA 3USZA 4N7MA 2HMVA 4RVDA 5JFOA 2FMHA 1XA3A 3BRCA 2H4YA 2WTAA 4QXOA 2ZE7A 4HJXA 4IICA 1SBQA 1I24A 2JHGA 4KWHA 2B1QA 4LXQA 3ZV4A 3AOEA 3B6JA 4UZSA 5IW8A 3WP0A 1QHFA 4IVRA 1ARZA 2W43A 1QIHA 1DLIA 1Y3HA 2HSWA 3O31A 3TXAA 4KR6A 1UF9A 3QOYA 3OZRA 4OGKA 3VV3A 4YAWA 5KJ1A 3W5BA 2XE8A 2C2KA 2CSUA 2O1WA 3IXQA 4GOXA 1QZZA 3E7WA 3MAGA 3Q8XB 4QDXA 3FFTA 5AOCA 1W1IA 5FO1A 4EA7A 2RAPA 4R8MA 4CKBB 2IHUA 3B8EA 4OBEA 4MS4A 3W5SA 1U8CB 3UJNA 1THMA 2SCUB 421PA 3C3XA 2VPPA 3KPWA 2TMGA 5JYCA 3CRMA 3DG9A 5LQUA 2XDWA 5D3QA 4GX5A 4JWTA 4RSHA 3TQCA 1OYVA 5K0JA 3D81A 4LV8B 4RSRA 1A0OA 2CXUA 2FPWA 3KK0A 4PXYA 3CC8A 2ZWMA 3NANA 1QS0A 3VR3A 3ZV6A 3MBOA 5HQJA 4K0KB 2WWTA 4EPXA 4NY1A 3OI7A 4ZCMA 5JJIA 3OO1A 1W6RA 1JLLA 1KZYC 3JQBA 3VMFA 4BLVA 4YR9A 5A4IS 5KQMA 4GVPA 1TTQB 2D59A 4Q7LA 3RSSA 1WLSA 3LCVB 5L9AA 1Y0BA 1O5IA 3K2EA 1EX9A 1SB9A 1X8JA 3RT9A 5E8JA 1BHQ1 1XYGA 4BWFB 4R2KA 1SC9A 5DWVA 1KVUA 3DSRA 3I6IA 2IYVA 1SUIA 1UC4B 1WB5A 3CEHA 3TCXB 2P6MA 1FNSA 1QFMA 1K7YA 3WNVA 3CWCA 4UOEA 4TVBA 3E9ZA 1BE8A 3VOSA 2IEYA 1IM8A 1AE1A 1INLA 1X80B 4IIUA 2EP5A 2FV8A 4Q16A 3R3HA 1T36A 4WK0B 4EF4A 5IEJA 2XAAA 2ZSKA 3MTDA 2QPLA 3U26A 1P1RA 3JQDA 2HEGA 1GRCA 4ROTA 3EUFA 4YUWA 1NIJA 3HP1A 4QU8A 2HLDA 3RU7A 4FFPA 2YX1A 3GEEA 4DZTA 1TFUA 1W52X 2WFLB 1AMOA 4F4CA 1JDSA 3QPWA 3KWLA 5AW4A 4YRKA 1G3IA 3GLKA 3ZX4A 3BEDA 3WGQA 1F5NA 2CF5A 1ZGCA 1T8YA 3DZCA 3RASA 1A1VA 2BI8A 4U2FA 5CM8B 2VJYA 2GPJA 2Y4OA 1I13A 1G3MA 5IDVA 3ZHYA 3I1YA 1EYZA 3RJZA 4CKCB 3OIUA 4KQHA 5FI0B 2XCUA 2G08A 3D59A 3IP9A 4QUBA 4R83A 2DFDA 4AY5A 3LXMA 5BSEA 4P4UA 1TLFA 2CUNA 3AOGA 3CYFA 1UKZA 4KIFA 4KB5A 4L51A 4MCHA 3ZBQA 3GHHA 4YTEA 3RCBA 1YAHA 2ZB2A 4IPTA 2BRUA 2X1HA 2YFHA 5HG0A 2C9OA 1SZDA 4E5MA 1BXKA 2VK4A 3D7NA 3THOA 2VH5R 1CUFA 2VZ0A 3DMTC 5ADVA 1KFCB 3G9ZA 3GK3A 4L95C 4TTAA 4L78A 5FLEX 3VDRA 3TR6A 3TTWA 2CJWB 2ZS9A 3A1FA 2VF4X 3AF3A 1KZHA 1KQ3A 2WOOA 3D0RA 1ORIA 3PP8A 3IP6A 1H94A 4EOGA 2NUPB 1EK6A 1Y1KE 4U6QA 5LWQA 1YBHA 2WJHA 1PX0A 3HY3A 5B1DA 4JJKA 4BQOA 3CPJB 3PHLA 1HOTA 1V16A 5FWYA 1IC6A 4B44A 3DB1A 1H1LB 5DHRA 5L3SB 2ESRA 5C34B 2E21A 2HA5A 4UEWA 4BECA 3I30X 3NP7A 5AW3A 1JSRA 2FUG1 1LC0A 3ACDA 3PUVA 1DS6A 2PA3A 1NSFA 3QEMB 1EP1B 4ZOBA 3SDBA 4MX8A 2X23A 2WWVD 1JEDA 4UUQA 2H2DA 3ZJ5A 4K0RA 2A14A 2RAVA 3EAFA 4AECA 3MGCA 4BB0A 1YB4A 2VQ6A 3G13A 1EE1A 2WRZA 3QVGB 4LZAA 4YCJA 3PXUA 3OIDA 4IDAA 3T38A 4B7AA 1YULA 3QK7A 3FYUA 1YU9A 4A0QA 4YNBA 5TGTA 3W3AH 3ZWDA 3RRNA 3V32A 1RAGA 2OD2A 3TLGB 8OHMA 3GV0A 2F9FA 1V9CA 3TLCA 1CS0A 5KWSA 1NP7A 3EVGA 5ALUA 5EIBD 2O2CA 3ZW7A 4IYRA 3EUAA 5AK3A 3QNWA 3DZIA 1YJXA 4LZNA 4Q7EA 2L69A 3PE6A 4KTVE 4OLHA 4YGXB 3HCNA 5P8WA 1GZ3A 3GJ4A 4BO7A 2RGCA 4K28A 5JQGA 4DIEA 4JT8A 4YT4A 4BFZA 2PX3A 2WSIA 4XQGA 1PWYE 3BXHA 4FDTA 4NJEB 1MABA 2GBCA 4GRAA 5EHZA 3H5NA 1H0KA 4AF8A 3TQHA 3LY7A 1CR0A 2NVBA 4K46A 5TEWA 5GOZA 1DT5A 1T9CA 1P5ZB 1U0JA 1DO0A 1QR6A 1YC5A 1Z5GA 1XMPA 2P4HX 1T5IA 4DCUA 1G20E 1O8CA 1XPJA 1VMIA 2GJSA 1DIBA 2VUTA 4PLPA 1BS9A 2JGMA 4WZAA 3SQNA 4LTDA 3SLRA 3V1NA 1AO3A 1YNOA 3OLQA 1J7KA 1KAQA 4HEA1 5KTKA 1JXMA 5FWXB 1XKXA 1Z2CA 3DBOB 3FMOB 3PHGA 2WIDA 4ER7A 2OHXA 2R6ZA 1AK9A 3DPIA 1R9NA 3EZ9A 3M4YA 4MB6A 4ZREA 5C3UA 1E2PA 3AVYA 3E61A 1N2IA 1ZD9A 1X1CA 3CR3C 2FN8A 3K2BA 3E53A 4MV8A 1M3SA 1T4GA 2V9PA 2VBFA 3E05A 3KZOA 1Z6ZA 4GPZA 3WWEA 3TJRA 1KY4A 4GC9A 2RC6A 5KSZA 1X1TA 1GQQA 2B98A 2B9VA 3FFAA 2Y9MB 1MC8A 4GUDA 2YBEA 3QVLA 4KLCA 3N53A 4TQGA 4BB6A 1BSVA 4BEVA 1FEZA 2OILA 3RRBA 3KQVA 2F3SA 3FTDA 2VXYA 4Q1EA 3KDAA 3ZIUA 5JAUA 1EFRD 1CHNA 4RD0A 4UTXA 1DIAA 3DL4A 4XYEA 3FMIA 4BWVA 3ZBUA 2YWDA 4CMEA 1BCRB 4Q21A 5CA1B 3H1GA 1Q22A 4Q47A 1L7AA 1XL1A 1IFXA 5LC1A 3WWZA 4Y6LA 1MT0A 4NARA 4DAEA 3ISJA 3HNOA 3FFBA 1JJ7A 1XZHA 3QNMA 4CM8A 2CJFA 5F7XA 2F4VB 3CZAA 2PL3A 3PNOA 4EWLA 5JSZA 2JL1A 4FPXA 1Y3DE 4KKVA 1F5SA 1BKDR 1Z25A 3SX2A 3TLBA 1G0OA 3OCWA 3TSAA 4I3HA 1TM1E 5JNLA 3MTAA 4O4IA 1NW4A 2XA1A 3HQ4O 1Q21A 1UK8A 2LIPA 4C14A 4HXGA 1G8KA 4XGNA 2QBYB 2I3BA 4J2HA 5JAHA 3TPZA 1USWA 1XCPA 3EVFA 1QP0A 4LJ9A 3KAQA 3OEHA 3QE9Y 1B26A 3DJYA 4ITRC 3V3TA 4DRZA 2OPBA 1ODCA 4P0QB 3JSXA 3N86A 4AJOA 3BDVA 1IXYA 1JT2A 3E35A 2ZUWA 3ZDYB 3ZK8A 1Z7YA 1BCRA 4KQCA 3U3KA 4ECAA 2MSCB 4X1YA 3S7ZA 3T7KA 1EAMA 1JG3A 3CXUA 3Q7QA 3MT7A 1KWGA 2A94A 1B4DA 4WT7A 1Q50A 4ZVKA 2X40A 1CY2A 4WK6A 1EFAA 3RYFB 4C0BA 4I7EA 4X95A 4HNSA 2X2EA 1BDJA 1BO6A 1LX7A 4WOJA 4FWTA 2HYDA 4X1IB 1E96A 1R0XA 1I94B 3VYVA 2OV3A 1C9EA 5K0BA 1FX1A 1DVRA 1PSZA 4KO1S 3VC1A 4JI8B 3KAKA 3NNNA 3WTBA 1XP5A 4AVYA 4CDRA 5C1IA 2OYSA 3AIKA 1CUEA 3M5DA 4G1UC 1K6EA 1BCSA 1KETA 1MIOB 2HUNA 1ZH6A 2NZYA 3CIFA 1A9PA 3CKYA 3DYIA 2PRZA 3DDSA 4ER0A 4BOYA 2NQ8A 4LBWA 3RRYA 2ZSAA 5E7MA 2H07A 3URMA 3F3SA 4U00A 4ZOLA 5JYBA 1JEEA 3A0RB 4BYMA 1RLOA 3T3NA 2BZGA 5A9TA 3PD7A 3EJ6A 3N0RA 1NJGA 1UWLA 3AESA 2OO5A 3CEMA 1M67A 3BL6A 5TMPA 3SFTA 1JHXA 5FOTA 4MKZA 4KLZA 4B82A 4EY8A 2QTVB 2H1OA 1J9ZA 4Q5IA 3T7RA 1SBCA 4B34A 1DRJA 1P0FA 2E4VA 3D6FA 4ZDIA 3N70A 1XJCA 3S3TA 3V97A 3LC1O 1KOJA 4I4NA 3QX8A 4Y30A 2I1WA 4RCYA 5B6IA 1QM5A 3BIJA 1EMDA 3FE2A 3GAMA 1R4AA 4LXTA 1IU9A 1HSZA 1G7TA 3DJFA 1II8B 3LPNA 4NS1A 3ZEIA 3DLHA 5TDHA 5M2QA 3AR6A 1VC2A 4NMLA 4RHEA 2H51A 1K7XB 3PRKE 3TW8B 4RTLA 3IIKA 3D7KA 4MVXA 1NJ5A 5KYWA 1Z9BA 1VPEA 4DLKA 2A67A 3QA3E 2C42A 4MRMB 1QHGA 1IXSB 4PAQA 2O8BB 4B0OA 4JVMA 2AXNA 2R00A 4JGBA 1PDWA 3B7PA 3FNGA 1O0SA 3LC2O 4MARA 2J3EA 4LJKA 4A3SA 1Q11A 4U5QA 3OH8A 1P0QA 4QYIB 2WT4A 4PPGA 2VH1A 4N5MA 1J24A 3L92A 2FZVA 2A6PA 2C07A 2X19A 4RZ2A 4YFYA 1JSLA 3D7LA 3FH0A 1EJBA 2ZYAA 2J0QA 1EXMA 4IHJB 1FFHA 4BLUA 1D07A 3D0KA 1TC1A 3ETDA 4MUIA 3PGLA 4HMOA 5HKBA 1FU4A 3PGJA 1Z45A 2ZUBA 5L4LA 2D2XA 1N1DA 2WG1A 4IYJA 2FW8A 1Y8QA 3OPMA 3QI2A 2D1YA 1CJTC 1WB4A 2RK3A 5DHPA 5JD4A 5KWJA 3AKZA 1T5OA 4C6TA 3LY9A 1V39A 1L8LA 2ZSDA 1Q7BA 4DS3A 1VL8A 1M6WA 2H4FA 3KSZO 1HE8B 3KZXA 3TW4A 2ZZMA 1D1PA 4I1RA 4S1VA 1PWEA 3I92A 4OF4A 1IN7A 5C31A 4RKYA 4XSHA 3RUEA 2ZAOA 4MPRA 5AJYA 1EUQA 4CR7A 3O92A 4UU0A 4D26A 4TOIA 1LLCA 3MYYA 3NEJA 4L8GA 3UAZA 4AY3A 4UTOA 1GA4A 4ZQCB 5IVIA 4NESA 4F9GA 3ES9A 2CD7A 4JJFA 1UFOA 1JFFA 3T0GA 4UHCA 3GGDA 3QYPA 4Y2HA 2GBGA 4C29A 3WLJA 1OBCA 2WIJA 2PIDA 3DXYA 3OT5A 4BP1A 1CLEA 1R9MA 2CNDA 4ZI3A 1JAZA 1EGHA 1YRWA 2YYYA 4TQUS 3ZV3A 2Q1SA 4RF5A 4QPPA 3F1LA 1E2IA 3B3AA 3BL8A 3GLIB 2ACWA 2B6NA 3R0IA 3RB8A 3ROGA 2AQHA 4BRZA 4DVGA 4R6XA 5B36A 2ZXUA 1MENA 4N76A 1EDZA 4OKNA 2EQBA 2B4RO 2KBFA 1XTTA 4C0XA 3TIVA 1R6UA 2V9ZA 2X1LA 3CZRA 4UXJA 3RKSA 1HNZB 4DYDA 3NHSA 1N1GA 1RXIA 2WPNA 3RTBA 4AP6A 3MJRA 4DLBA 2VTDA 3MJ4A 3JCZA 3KJIA 3BJEA 4PZLA 1AKMA 5BPHA 1NVEA 1ETUA 1X86B 1RBZA 4RJLA 1YAJA 5HF5A 1L5HA 3WRYA 1CVRA 4E7PA 4ENTA 5M34A 5HXAA 121PA 1O08A 2QU7A 3DEZA 4PSCA 2PWYA 4MRVA 3I61A 5IAOA 1CZRA 3H5IA 2BM8A 1XKLA 1WABA 2A30A 2QD3A 2QN1A 3TW6A 4EUKA 1SK9A 5CLIA 3TX6A 2IBMA 2G0NA 1TIPA 1X1RA 1XQXA 3HJHA 1VIDA 4RZ3A 2QJRA 4DA9A 3QLTA 4J4HA 5KB3A 2PUEA 1KI2A 4OQ4A 5CDHA 3HI6A 4RKEA 3ANSA 4OQLA 4WUVA 1G291 5EJ4A 4L5AA 3A8TA 1D8AA 5CGQB 1R6TA 4W5QA 1U28C 3N3AC 4G85A 4RZXA 3DWIA 2ZBPA 3AO0B 3N2KB 3DVAA 3PDIA 1AKEA 4G65A 2NUTA 3H5VA 3KTAB 5TE9A 4EW6A 2VBCA 3E6AA 4WWHA 3S1AB 2D7DA 1U8TA 1KFJB 1RXCA 2E9SA 1UFQA 2OMEA 2J4CA 2XMQA 3CRNA 1FFCA 1NDQA 1WVMA 1VHWA 1Z15A 3AY3A 3C1UA 4I4TB 5F73A 1AK1A 2REQB 3CV3A 2YHAA 1BFDA 1T9KA 3G0CA 1WXEA 3R3UA 1C1DB 1RXUA 2Y77A 3UJ9A 2JAQA 4R2MA 4EX7A 1ZDMA 4YHBA 2GFQA 3TLKA 4QJ3A 3ZWYA 1YL5A 1E77A 1KMHA 4ZOLF 1JMVA 2QN7A 2VJNA 5HPYB 2C59A 1QH1B 1V1MA 4D3DA 1F8FA 4XH9B 3LO5A 4YAKA 3KUXA 1L4HA 2CDCA 2QLNA 1GYPA 3QMPA 4GX1A 3LD9A 3AX6A 1NU8A 3FF1A 3O4HA 4UZEA 3G8BA 4NR0A 5TX7A 3OCZA 2R4TA 1FJ2A 2X0NA 2BFEA 3A4VA 2WHPA 3OU2A 1IUOA 1DV1A 2JJYA 4KMMA 1PT7A 1GSIA 2C77A 2C5FA 3I9LA 4ZGWA 2VQ3A 1JA1A 3PVSA 3Q9SA 4INPA 4AXBA 4CEJA 5I6DA 3VZDA 1WDWB 3ONFA 5LYYA 3PQDA 3BJIC 4LKOA 5BXQC 3H6HA 5CNJA 1KK0A 2DVMA 4YMGA 1EVZA 3RU3A 2A0YA 5BYKA 5JYDA 4Z9AA 1Y3BE 5COAA 2JEYA 3B1ZA 2CSXA 3E03A 1MZVA 1BRMA 3I39X 4NBSA 5DLYA 3K15A 2WIGA 2PV0A 4H7PA 4QPJC 5DBHX 1BVUA 2LV8A 4F60A 3JAWA 3MLAA 2O48X 2XD4A 4FW9A 2H18A 5DYIA 3FZYA 4EHFA 1WNTA 3RBVA 4RLSA 1NI4A 2FHPA 1FS5A 3WRWA 4M1ZA 2JASA 1NULA 3DBLA 4G81A 2Q5HA 3EF1A 3DFZA 3IV6A 3LX6A 4NF2A 4MWGA 1X0VA 1RDFA 5I7SA 4M9XA 4PSAA 4FEEA 1PJLA 1F20A 1GDTA 2CHVA 3T7CA 1PJ2A 1R4NB 2H92A 2VJCA 2AOTA 3HLKA 1KI9A 2BKEA 3TDMA 3WZMA 3KS9A 2AN9A 1WPRA 3EGOA 3G5AA 3D6MA 3SE0A 3O03A 1H69A 1XRLA 1PUXA 3L7LA 4BO1A 4EUSA 1U1EA 2DQZA 3C4QA 1X7ZB 2YHIA 1K66A 4Y6QA 1CE8A 4D9CA 1E3MA 4NV0A 4XUEA 1FVHA 1N5RA 1BNCA 1Q20A 4QVKA 2Z5VA 4P6VF 3QPVA 3KKQA 3RKUA 5TPZA 4QQNA 1W5AA 4QE3A 1W96A 2KLBA 2XDQB 5LZ8A 2GO7A 4AMGA 2Z5GA 1KQPA 2O5VA 4K3VA 4Y0NA 5T5QA 1BOOA 4W7IA 3LBYA 1POWA 4HDRA 3D3EA 1EFVB 1JIKA 1PNTA 1M1YA 4NV3A 5CK4A 2WV9A 1Z7BA 3B3GA 4WKCA 2B4AA 1QKKA 1XRSB 1SU6A 4J6FA 1M8PA 1PL7A 2W9XA 2DF8A 2ZI4A 4XUGB 1MJGA 5JO0A 1RD4A 3FPJA 3VR6H 3IX7A 2YASA 3NUZA 1KJ9A 1XR3A 3WA6A 1RWVA 3NWOA 4BX9A 1NQVA 3T1YB 4IDDA 2VTBB 3IVGA 2JLZA 2A1UA 5F3WB 3AHCA 3V4ZA 1NMYA 3AU9A 1R50A 3CX6A 3MLBA 1FFSA 1Z4MA 3VHLB 5CXQA 2GX6A 2OZLB 1JPNA 1I6LA 1KZ7B 2JGKA 3K0FB 3OZVA 4LJ7A 3W9SA 3FWPA 4FFDA 1U5BB 3H2GA 3SJBA 2AS0A 5BYJA 1P2VA 4R8KA 3F49S 5K3EA 2ORYA 1XYYA 1U7PA 4HP8A 2PKYX 4HSEA 3KJNA 4OCZA 3QFHA 2PX0A 7MHTA 4F9TA 1OXKB 1GPWB 3TE6A 1WHTB 4CQJA 1MH9A 1DFIA 2OHJA 2FG7C 1TM3E 4C7VA 5EZSA 4XRGA 4GBMA 5BV2P 4UMFA 3L8GA 1EGVB 1YL7A 4OUDB 4O5AA 5EVJA 1YA8A 3PEFA 4D57A 2ZJAA 1FTQA 2Y1OA 3D4OA 2QTBA 2AEJA 3LT1A 1NW8A 2MR6A 1Z0KA 3M2PA 4DN6A 3ABZA 2N46A 4URXR 2NX2A 1MBZA 1SXIA 3W5HA 4B5LA 3G2KA 3MELA 3VHXA 1YVPA 1C14A 4OAQA 3H5WA 4EQ6A 1GPBA 1TRHA 5CX4A 4OA5A 3W9UA 3E7FA 1KXJA 2PTGA 2YY6A 3HUDA 4IVPA 3WQSB 7GPBA 1T6XA 3VU8A 1TVCA 1RYNA 2EEZA 2IU3A 2VOEA 4U7DA 4FGKA 3S8MA 3LECA 3RRMA 2OV2A 4PHFA 4BYGA 1FLDA 4RQAA 5DIFA 4FM9A 4CV0A 4IKEA 1NE7A 3CLUC 2FPSA 2WF9A 4JC8A 5DTMA 4AYXA 1I1NA 1HTBA 2QVXX 3EGDB 4R3UC 4WNAB 3DCIA 3TVTA 3ZNQA 4AFNA 3OEED 3KKLA 3ME5A 1OV6A 2CUZA 2V54A 3OQPA 4KX5A 4B3TB 4LF5B 3K73O 3WYGA 3DOCA 4HDOB 1U7UA 3ZU3A 2HW8A 3K6RA 1GZHB 2GDZA 4GKAA 4YV1A 4BE7B 1KKMA 1Z8NA 2JCVA 3VR0A 4OYHA 3W8DA 4LY6A 3FUUA 1UOOA 3DTYA 4CIXA 2CNKA 4HDSA 2A84A 4L4XA 4UHJA 2Z0MA 4B3IA 5IT4A 4I19A 1X6VA 3DE0X 3ILXA 3P71T 3HXMA 1WY7A 1TNDA 4QSHA 3UCEA 2IZ1A 1ESEA 1BN6A 1E62A 1TU4A 3DYVA 4TVOA 1R3UA 1BDBA 4GR4A 5ALLA 1J2RA 1N2OA 3GPCA 4O2LA 3KR2A 5F78A 5I5EA 3LT5A 4DARA 1FP7A 3B1VA 3Q41A 3L7IA 4OOFA 2QVYX 3QEJA 1Q91A 1C1YA 4Z1MA 1A97A 2BY4A 2OLJA 3W5DA 1ZJZA 2W37A 1EHCA 3R40A 3WHLA 2QR2A 4E3ZA 3HZHA 2R79A 5EJGA 5TLSA 1SXPA 4RH1A 1QTRA 2DUJA 3M2TA 3PNBA 3HCWA 3SIRA 1QQBA 4MQFA 5AVVA 2NPFA 5ES4B 2WSMA 1I01A 1ZI6A 4UEOA 2IV7A 1A8IA 4FFNA 4HAZA 2VZLA 3T9BA 2W0SA 1JJFA 3A1CA 2YOFA 3HMQA 1A8QA 2PMWB 2Z2XA 3OICA 4N6GA 4RHCA 2VAVA 5EZ5A 4DRYA 2CBZA 7REQB 4IMPA 1KAEA 3MAJA 3L82B 2NVWA 4NDZA 5JECA 4RTKA 1LZKA 4ZPXA 5D1HA 2VRBA 1AKUA 1G66A 4OBWA 5BN5B 3SQLA 3E18A 3T7SA 2RGNA 3BREA 5IDQA 1DG9A 4BIMA 1NN0A 1WHTA 1LTKA 3QMVA 2BHNA 2CEAA 1WW2A 4G23A 4OQNA 4O3MA 3A6DA 1WMDA 2J0UB 1KWKA 1N5KA 1SG6A 1I3OA 1E3JA 4DHWA 5CX1B 2HMSA 3AFOA 2HUPA 4MGYR 2NVUA 1NX9A 2WG2A 1NVXQ 1YB1A 3AYXB 2XDYA 1DOAA 2V6JA 3F5FA 4JNCA 1LB1B 5HFNA 1WMBA 1ZFNA 2QAJA 4RF2A 1OWNA 2I80A 1JR3D 2P7HA 1XI2A 3LZ6A 4QBGB 1S96A 1WCWA 2I6QA 1NW7A 2ZBVA 3K30A 1R6BX 3LAWA 3LHIA 4OXQA 1Y7LA 1S89A 2Q1YA 3KJEA 3K9HA 4N8EA 4YJDA 4MMXB 3VQTA 4ICIA 3LYLA 4IMJB 4O59O 2DY0A 1ZR4A 2BGWA 2NTJA 1M8JA 4ARBA 4Z4QA 5DB4A 1L8OA 1PR4A 3I09A 1F06A 2E6KA 4YQYA 1LWOA 1KYVA 2EGGA 1XVTA 2J9RA 1WPXA 2HWWA 4YX9A 1KZGB 4LJ5A 3SHOA 4ZU3A 1LBTA 3STTA 4G4IA 1OMOA 3MJDA 2QROA 3O7MA 2V7QD 3PGA1 1XZEA 1CR1A 5HRAA 2QUIA 1XEXB 2C7VA 3QTLA 2Z30A 4DR3B 5CYPA 5JVDA 1NV8A 5FAXA 2YXBA 4RL6A 2F9LA 3T1VA 2VDQB 3L7YA 5EQTA 2B4TO 1ISRA 1C8KA 1RI4A 3O8RA 4OYYA 2IOHA 1H4QA 3EBLA 4Y3UA 3EWSA 2AX4A 4O4HF 4EKYA 3Q9NA 1XRRA 3BMNA 1JBEA 1Q0LA 1Y5NA 1Z7GA 1R0ZA 1UODA 3L1IA 3U9TA 1SVNA 4DMUB 2BSQA 3K05A 3I5YA 3OEEA 4L2IA 1CQJA 2AFRA 1NG1A 3DOFA 2QE7A 2B8NA 4X3OA 3UAOA 2UUBB 1FBNA 3M6WA 3VKUA 3B9QA 3Q3EA 2FTKE 2PKQO 3HKCA 4U6NA 3MGKA 2HI0A 3UWKA 1EQ2A 1M8GA 2Q3JA 4IEEA 1TUBB 1N0WA 1L1FA 4ZHSA 4TTIA 3K31A 1B16A 2J9GA 2UZ1B 4G67A 3VTZA 1A9OA 3GD7A 4XX0A 2B0JA 4HR7A 1N0IA 1QNLA 4MUJA 4X8MA 5CFOA 5DP2A 1W5BA 1JR4A 1BQEA 3EGXB 4G9BA 2IV2X 2P9BA 3E81A 5A3SA 1QKIA 5K8CA 4XCQA 4F5ZA 5T4HA 2DFVA 4MA4A 1FLVA 1JG4A 4E5YA 1D5WA 1XMSA 1ACJA 4OHUA 1QHHB 4LHYA 2RJ3A 4MEAA 1FFBA 6PFKA 2BFBB 3QM1A 1MW8X 1EFKA 1LK0A 5CLLA 1UBKS 4LJYA 4MAFA 4FGWA 5T3YA 1S02A 4HX5A 5LQKA 1R9GA 1TJ4A 1URPA 2XUFA 5IH3A 3W7VA 1UL1X 3EPKA 1OROA 3BD7A 4I81A 5L3RA 3SHTA 4JV5B 3CZ4A 1KZ4A 2GXUA 1ZL2A 3ET4A 3P7MA 3WL6A 4MJXA 4OL0A 3EFOA 3HA5A 3CLUD 3UUEA 2OHFA 1X7WB 1ZIPA 1XU7A 4XDHA 4YAFA 4Y2GA 4K6FA 2Z3WA 1SHUX 2Y1FA 3QGMA 1L9XA 5EIAA 4KR9A 3I5MA 3ZNPA 2WWYA 3PHIA 3SJCA 2GA9A 3LCCA 4BX2A 1RQRA 3B5IA 2CV0A 5K4GA 1BMFA 2WTUA 3R5JA 4DIMA 1PWXA 1LLUA 1V0JA 2AZTA 1FXUA 2HKIA 2I4NA 1H4TA 4OU5A 3WLLA 3ZCRA 3HVRA 1G3QA 1UKEA 2VA9A 1LI5A 3IR7A 4UAUA 5HE8A 4E5VA 5BV1A 4B3HA 4KQKA 5JSKA 4WW0A 4JODA 2JLUA 1S2LA 3UHFA 2PKCA 3WMWA 4G9GA 4I4TA 1TPZA 3CG4A 3MT0A 1R8QA 4KODA 1I2ZA 5FUVA 1KYIA 5L4NA 4QXRA 5F1KA 3HVUA 3QBTA 4I1YA 3VJRA 3U3RA 3ZG6A 1H2ZA 4ZI7A 1LVUA 2HU8A 3SYNA 3GJZA 3H8WA 3U7IA 2JLVA 3E4CA 2RCNA 4FD2A 2WKWA 3CX3A 4N7JA 1GCGA 1C5KA 1NRWA 3G0IA 5TVGA 3RAGA 1PJQA 1QFYA 4ECEA 4KQFA 2HH9A 1NL3A 2NT4A 3RUDA 3GN1A 3TI7A 2XQGA 4F5EA 1C2YA 4OKIA 5K0GA 3ESXA 2M32A 2CB9A 1VYHA 3REQA 3HE3A 4HH3C 3PJGA 5LA6A 3UMRA 2FI1A 3INRA 4HAYA 3C48A 1M5RA 3N2LA 4OXKA 3CN7A 1RAEA 3GJ3A 1LBSA 2PJDA 5EXTA 2WLTA 5IT5A 3IILA 3JWJA 4LMPA 5C8YF 1M0EA 3HDTA 4KYUA 4JI7B 1O1YA 4WKOA 2C96A 3D5TA 3L8DA 2HFJA 2ZAMA 2OG2A 1WHSA 2PZLA 1H4SA 2EFCB 3LUHA 2Y71A 2ZWVA 1PD0A 5LDDC 3IHTA 2VXBA 3T3MB 4KJZA 2XA9A 4LDNA 1KFKB 5IZCA 3PQ3A 3BIOA 4EDFA 2ZIXA 5EHIA 5D85A 3CBGA 2JD0A 2HJSA 2ALJA 2WSLA 3E4DA 1QAQA 2GBPA 1G8GA 4PTLA 3I8XA 4FFOA 4W1PA 2VK8A 2BEVB 4PG4A 4DCGA 4D0SA 4P4LA 5CT5A 3IOMA 1FRNA 3TBHA 3HJCA 5IKMA 4O2AF 4OHZA 2XHEA 4RTNA 3A6JA 3GH3A 1VA4A 4R81A 1J5XA 2RSLA 3W90A 1Y42X 2WU3A 4AG3A 3IOEA 5JNSA 2ZSUA 1TM7E 5HGXA 3IBGA 3BB1A 3LUFA 4WVFA 3C41J 2ZSEA 3IIMA 4QHYA 2FFAA 5ALRA 2C99A 4JA2A 2C3YA 2DKNA 3NHAA 4NK5A 2PMEA 2BGTA 4BVHA 5KWIA 2JBWA 3UT6A 4G86A 5HUQA 2WUVA 1HZZA 2OHGA 1N3YA 1ULAA 1IN6A 1BA2A 4G36A 5DT9A 2CD9A 4L5BA 4PTZA 2QNBA 3V4VB 5KJEA 3C7DB 1HK7A 2JFXA 3TUZC 5JC1A 5A7GA 3K1TA 3N0TA 4WA8A 3LKDA 4QUJA 2QTLA 2IX3A 2B34A 4I6GA 4PNEA 1ZITA 1HQKA 1TO1E 1HLFA 1Z6TA 2R7MA 4G56A 4LMBA 3ZHRA 4E30A 4OHFA 1S2NA 5JNVA 4ZP1A 2O8NA 3EE6A 3ZW8A 5HDBB 1Y33E 2ORWA 3MILA 1NF8A 4ZVMA 2HHLA 3M1AA 1JAYA 2QSJA 2JGJA 3CUSA 2ORIA 4J4TA 4LXIA 3T5PA 1AUVA 5TQJA 4E1VA 4MV5A 4EH1A 1NQXA 5FOQA 3IDSA 2OZVA 3MJVA 4XGRA 4BN0A 4NHOA 4MHTA 1B6GA 1PHPA 1XDDA 3EXEA 3X1DA 4TL7A 1IONA 4YBZA 2E3JA 4LDQA 4DDHA 4KZKA 3FDXA 4X6XA 2B5OA 2B5WA 9LDBA 2EW1A 4DBLE 1H2AS 2I55A 3Q9LA 2HBYA 4HWSA 1V1RA 3BCUA 2XDQA 5DTJA 1JG7A 5J5AA 3TCKA 1RC8A 3OZCA 4MQ6A 1K8XB 3PTZA 3SC4A 3G8DA 4YI5A 3F5SA 4FHGA 1SVMA 4QX6A 1XLVA 1G20A 2ZCUA 2ZRGA 1PV4A 4H7EA 3T5CA 3VZPA 3LUDA 1N9ZA 3D6NB 4KFUA 5LOVB 2BMEA 1PR9A 3GAAA 2QENA 1EUDB 1UXHA 3KVVA 5DHTA 4PS0A 1FFWA 2DECA 3EXHA 4CVNA 1WIWA 2I03A 3RVRA 4B35A 3HKEA 4B83A 4NICA 3FUXA 2GSWA 3QKSA 5AM0A 1Z63A 2HYIC 5KTYA 1EFVA 1NMQA 1RQXA 5ECDA 2JVIA 3KKEA 4GKVA 1E3IA 1YKSA 1NBME 1TA0A 2A33A 3F7TA 4PR0A 3UWSA 1LDBA 1QZUA 2VDLB 3P5BA 3PA6A 3S2ZA 2P9YA 4KI0A 1XROA 2OCXA 2O5EA 3T3OA 3KHKA 4XEHA 5LU9A 1NA5A 4GI1A 5FXMA 4C1NA 4JAVC 3WDLA 4C4OA 2ZJ7A 1CS4C 2V6GA 4U0JA 4WAUA 4RK1A 3R0ZA 4DG8A 1U1GA 3TR5A 4E32A 5HZKA 3QUAA 3ZVNA 3UAXA 3T35A 3TI9A 3B1JA 2TSYB 1Q57A 1A2KC 4KXWA 2XODA 5LA6F 4BVGA 4EG1A 1EA5A 1JWLA 1E5LA 1FU7A 1FJXA 1HUQA 3AIMA 4FFMA 2P6RA 1WE2A 3WO0A 4H6PA 4J3JA 4IOMA 5J3JA 1UZAA 1XCGB 2C61A 1IRXA 5YASA 3DCJA 5I7HA 3A31A 3IQZA 3ITKA 2PHZA 2I34A 4TKUB 3OOEA 4LDAA 3SXUA 4PC7A 4DG5A 1VJ1A 4HLNA 3HFJA 1BMFD 3SBEA 3SYTA 1JEYB 4A4DA 5K8IA 2ZPUA 1GU0A 1FFDA 4U2DA 1NRIA 1V48A 2F62A 4QBKA 2NTEA 1P45A 4FR0A 4JOQA 3U3ZA 4TZ6A 4Z4EA 2CMHA 3Q1LA 1ADBA 3HN6A 4DJJA 1Y3CE 2F00A 1NVBA 1OBFO 3DOEA 3OE4A 2WPDA 3UH1A 3OIGA 2A86A 1Q0UA 3KSMA 4HL6A 3DEJA 3HS3A 1TI7A 4FSHA 5BURA 4KN9S 2AT1A 3D8NA 1K0FA 3GFBA 1E7MA 3DO6A 4GI3A 2ZVDA 1JR2A 2OV8A 1F38A 5D5HA 1SCAA 1N3LA 1XAJA 2Z9CA 3PENA 4NKRA 4B4VA 1VG8A 4D3SA 4IJWA 1E2JA 2O52A 2O05A 4XD7A 1KP2A 4B4UA 4BFTA 3DTVA 3TZCA 4A2WA 3K5HA 3KTAA 1SCBA 10MHA 1X1EA 3EC2A 5GONA 3WLOA 3OC6A 1J00A 4HWGA 5TQVA 3MXTA 2NG1A 4YDQA 3P4XA 4REQA 4Y1GA 2YBDA 1ZNWA 4IOJA 3TSCA 2EZUA 3W5JA 4Z4FA 2F4NA 4WBNB 2ZYWX 2D4HA 4P2BA 4ZEMA 4DCNA 4ZO9A 1HZJA 4KPUA 1F7UA 3LOPA 2KB0A 3S2EA 4W5OA 2R8RA 5FJIA 1M6YA 5JSFA 3LL4A 1OLOA 1TCCA 2MTBA 1H66A 1WTCA 2OPHA 3STXA 3GRKA 1L4LA 1EX1A 1LEHA 1A7AA 3MXOA 3NIDB 2VBIA 3CNBA 5K9ZA 3OPQA 1TQ4A 4NL4H 2IOFK 3MWJA 4WIAA 4KFRA 3VH3A 1VL1A 2IYTA 3WK8A 3X0DA 3FRHA 3RVNA 3VNBA 1IVNA 2QZZA 5C5DA 2OD7A 4RIGA 1AF7A 1I7NA 2EWMA 2OWDA 3R1IA 2VQFB 3L0BA 3H2YA 3DVAB 3PDIB 2JLXA 1E1DA 4XAQA 3TR0A 4BJ3A 1M1XB 2F43A 5C3MA 2A9PA 5JDIC 5GVRA 2Q5OA 2O8FA 3NOOA 2VDRB 2VCYA 1CJVC 1K4KA 1ZVQA 2G9RA 3H4IA 1EJ6A 2ZIUB 4QFMA 3W04A 4FGJA 2O8DA 3AIOA 2YV4A 4IJKA 5JD5A 3KKPA 3OT1A 5C46F 2CHEA 2LVBA 2MSWA 2CLFB 4Y9UA 2QSYA 3OM8A 3PRYA 4Z4IA 3CB2A 4I14A 3DTNA 1F4VA 1OE0A 2QE6A 3R7WA 4E51A 5B55A 2DLNA 1KK1A 3FR8A 3K9GA 4GR5A 4ILEA 4JYMA 5KSWB 3KQQA 2W2VA 1IUPA 1YVUA 5D5PA 3VKVA 2IH2A 5JCXA 4QGFA 1VCIA 2QUKA 1GDHA 3MG9A 1OAOC 3KBBA 4QARA 4Q03A 3WL3A 4AUMA 1XZDA 1GZSA 4YXWA 1SD1A 4GPTA 1T0PA 1V5FA 4J1SA 3U13A 2ILVA 1IK4A 1B2LA 1KYXA 1XELA 4YDSA 1UDCA 3TOCA 4AM8A 3L06A 1EDOA 3ZCXA 3WYFA 1AUQA 3OQBA 2BI7A 1IHYA 5K0LA 1DX6A 3LJKA 3OTWA 1SHJA 2EIXA 5JCOA 2RHJA 3OP4A 2J9YB 3RS3A 3K0KA 4DQVA 2XVZA 1AXGA 1WU8A 3PUHA 2H2GA 2MSLA 1CUSA 2OQIA 3DAYA 1UJ2A 4JROA 4L0CA 5HILA 3RRXA 4D9NA 4ZK6A 5C4MA 3P52A 3FW1A 4O29A 2LW7A 2HY7A 1SG9A 5CHEA 1PSWA 4F2HA 1FRQA 1Y89A 2W0MA 1EVEA 4J6EA 4TMKA 3TIFA 3ONWA 3NV9A 4KHZA 1I1OA 2HDHA 2PGDA 1LRKA 4YROA 4JH0A 3RSGA 1I2BA 2KYRA 3B6EA 3UK6A 3HCAA 3IH5A 3SC6A 3ZDEA 4YRJA 4LQ4A 3OCXA 4JB8A 5LKRA 4I4CA 3ZXUB 3WK9A 2JI4A 4C5AA 1FW8A 4DLYA 3SX4A 4A15A 3ZDCA 1JEAA 1HRDA 2J3DA 3U7FB 3VH2A 1R8XA 1M33A 1V11A 2P90A 4LZOA 3A4TA 4P5DA 3VOAA 4EELA 4RLQA 1QANA 5AVOA 3DC7A 3C3PA 3H75A 3FJ1A 3F1KA 4J91A 4LJLA 1R10A 4OHRA 1T3LA 2Y3IA 1P31A 1KH2A 3NTUA 1ATZA 4JBIA 3TW8A 1L7BA 4PFJA 4ZCRA 3AVVA 5F2KA 3L4JA 1Z22A 4ANFA 3CU5A 4HNHA 4FLEA 4QQKA 4E21A 5CFZA 5E4JA 1XPUA 3LPAA 1UMKA 1SQ5A 4I0WB 1C9DB 4TLBA 4N3AA 4E3WA 5I7VA 1CPYA 4BFXA 2VP5A 4CTOA 1WA5A 3FSGD 1C7JA 2GLXA 1YQDA 3D31A 4G4SP 4YP7A 3U81A 4CPDA 1E0JA 3KYDB 5JS8A 1O95C 1H3FA 2QPAA 3DOJA 2EHJA 3TLJA 1JYEA 1BVRA 4L6CA 3R5HA 4LSMA 3K9CA 2CMDA 3GGGA 4J8PA 2YWEA 4TQ9A 2VZEA 2I8CA 4LHWA 1VCMA 4WLOA 4E88A 1YS1X 3N5KA 3E27A 1Q7GA 1Z5NA 1T5SA 2VLIA 2XECA 4MDEA 3H1AA 1HEYA 4LA4A 5DM70 3QBVA 5J58A 4ESOA 4YP9A 1AGRA 1E9EA 1SM4A 1VKRA 2XA2A 2EYQA 4KX3A 4MKRA 3ZWOA 3ZHTA 4DR2B 3CGWA 4P7JA 4RKRA 1H2EA 3UK1A 2PSEA 3R75A 4LJAA 2O8EB 4PQFA 3VR4D 3WSWA 1A9SA 1HFWA 2V7BA 1H2HA 3MB5A 3PHCA 1KEVA 4G5GA 3J81A 1W2GA 4M4SA 5AW5A 5ICCA 4I55B 4QNMA 3CLTC 1E1RD 2PGAA 1SXJB 3S44A 1WUKS 4NDNE 5T8KC 4QJ4A 3BK2A 4JDUA 1PK8A 1PLKA 1SGWA 3ANLA 2XW6A 4GI5A 1VSVA 4N0QA 4URZR 3WDKA 2HNKA 2G9ZA 4EB8A 3UMVA 1L4UA 1U2ZA 3QLJA 1T36B 4KSYA 1IN8A 4OFBA 4YAOA 2QD4A 3EGDA 3LRPA 1JJBA 5EEHA 4B4KA 1BKSB 2Q45A 1U2EA 2ZB8A 3L43A 5AVSA 3S81A 1YC2A 3IO5A 3QVKA 1I3KA 2ZATA 1MNQA 3CSUA 4JP3A 1T0UA 3PWTA 4HQLA 4PEVA 2HBQA 2QZPA 4AU1A 1G41A 4A36A 3JWIA 4M0LA 4M9ZA 3BRWA 3HI4A 3P2IA 4K6CA 4O4IB 3PIIA 4U2EA 1R12A 2WINI 4G5XA 3UGTA 1DKQA 4CF4A 4EG0A 4RHFA 4HDKA 1B2RA 2W2NA 2Q4TA 3R3VA 1IZ8A 1V9LA 2DUWA 4IIBA 3TF5A 4E6PA 1CXZA 4JLBA 1EKXA 3RVDA 3V2GA 2Z5FA 4BV2A 2AUNA 3D8HA 3UATA 2C2HA 5KS2A 1TA9A 2O7RA 4YY3B 4K26A 5AHKA 4JIMA 2TMKA 2RGBA 1DOHA 4A23A 2UV8A 5C5IA 1KAHA 2J5KA 1QLHA 4RD2A 4DMMA 3OKPA 5K3CA 4XRRA 4KUHA 5EI5A 3QUBA 4X00A 1P2BA 1UFVA 3NPMA 4KV7A 2OFXA 4CTMA 3AEKB 3F4KA 3MLEA 2QG9A 5K09A 4F4HA 1W76A 1RFGE 3L4KA 2R2GA 4IFEA 2ON6A 4PIVA 1EFUA 1DARA 1ZD8A 5AHRA 4CCWA 4K3UA 5CDFA 4WINA 2XWJI 4BCBA 1V71A 1UINA 1XHFA 3TOVA 4QGHA 4NYJQ 1DBIA 2VTBA 5DXJA 3KELA 4Y2VA 3CEJA 3A6HA 4WFQA 4P35A 4ALMA 2HSEA 2WNHA 3FDZA 2P9HA 4RJJA 5CHYA 3NHLA 3VNQA 1Z83A 3T3EA 4RQUA 1LVHA 1SCJA 3HUTA 4UXHA 5CXXA 3WR5A 1DBVO 1KO7A 2JJ1A 3M6VA 4OMUA 3FSRA 4FDAA 1CY7A 5I7AA 3T3DA 5CA0B 5H3HA 3EEFA 4MYCA 2YQ4A 3BQ9A 3ZK9A 2Y9PB 3OJEA 3LCMA 4BRUA 5LQMA 2W6IA 1XEAA 4ZOQI 3H87A 3QE2A 4WZZA 3B1FA 1JAXA 3IB6A 2PU5A 2VJMB 3QFCA 5TQ2A 4NZOA 1KSJA 2OZLA 3ENKA 4R2LA 1EG2A 1VZ2A 3AEUB 4P3OA 4B8WA 4RBNA 3DOUA 4O4HB 4U7JA 1IJBA 4A1FA 3VC2A 4KRFA 4B8ZA 1N0UA 3NC0C 1NXSA 2YJ5A 3ZJ4A 1KC1A 4U2KA 4BMNA 5L3VA 4BNGA 4TKVB 4K8RB 1MO4A 1QHXA 2I5PO 3F4LA 2R6JA 3G9XA 3I9FA 4BFCA 3BB4A 2BFNA 4BNLA 1CS0B 1V7PC 4KE6A 1DHRA 4MB0A 2PJRA 1ABEA 3H0EA 3D2LA 1S2IA 4IH4A 4NI5A 2C2GA 1L7QA 3NATA 1B14A 1XZGA 4GBGA 3G3EA 3LL7A 3LQFA 2VC2B 1Y6JA 1UK9A 1FNMA 5EIFA 1PNOA 3DR3A 4NHEA 1NASA 3CR8A 4DTCA 4KAXA 5TQ0A 1SPXA 3SXPA 4F8YA 1VPDA 1FDVA 2GHIA 5H3LA 5GZ1A 5BUSA 3E3OA 1LDMA 1WVGA 3EWAA 1ZVVA 2PANA 1IQ0A 2XUJA 1ADYA 2QI9C 3K53A 2FUG6 5KAPA 3ESBA 3H19A 2G1JA 2QGNA 2X3FA 1A4IA 5KYYB 3VU9A 1DZIA 3SHVA 1V47A 4KL8S 4A0FA 4MLPA 1JR6A 2YXEA 3G2OA 1XN1A 4LJ8A 4EYGA 4A6EA 3HA2A 4CLRA 2IZ6A 3ET5A 3GLGE 4D4KA 1Y4DE 4I9UA 2QMQA 2RBGA 3U7JA 1NPDA 4DREA 5JAPA 1EHYA 4BNNA 1PFKA 2C04A 1RIIA 2BMWA 1GZVA 3GVCA 4CM4B 4HUQB 1ONOA 3JQ7A 4NOLA 5LB2A 4A7PA 1J70A 4P3NA 1EGAA 2FSFA 1N2CB 2GF9A 2AEEA 1R5NA 1SVSA 1TEXA 3L1VA 1HT2E 1TJYA 4JCOA 4Y7CA 3S0JA 4N82A 3IUEA 1CFZA 1X74A 1YB7A 4RQBA 3EZLA 2E4YA 3WIUA 1P4GA 2XNDD 5G0TA 3K09C 4X6YA 3DUFB 3T41A 3ZY2A 4Y98A 1NPTO 2IHJA 2QUZA 5KI6A 5G53C 3M5CA 2JIZA 4HQOA 5U9CA 1GPKA 2O2JA 3JAWB 1J25A 4H7HA 4MIYA 2AOWA 4AN4A 3HO8A 1IB0A 1FB5A 1NUSA 8AT1A 2W2OA 4EPRA 1ADCA 5AVUA 2Q2OA 3BJZA 1ABFA 2JKYA 3A14A 2B1RA 3AQ4A 3IELA 3QE3A 3BXEA 4U8GA 4JIGA 1H4VB 3O8LA 4P22A 4R2IA 1I9GA 5AVRA 2Q29A 3GJRA 2DWCA 2QPOA 4MW7A 3I45A 3U40A 1M6HA 1OFGA 1O94A 3B13B 4YAGA 1TT5A 2F1HA 1BA3A 1KEWA 1BHJA 2XE7A 3KVOA 1L5VA 4XPIB 1HWYA 1OIVA 2PL1A 2Z4TA 1O87A 3PF8A 4HQ0A 5D86A 5SICE 4UPVA 1ZK0A 1KA9H 4KQEA 4QUIA 5GM2A 1DT3A 3TQRA 5HKKA 5GONB 1XSEA 1T9ZA 1Y80A 2P3QA 5C1BA 2QUHA 5KNDH 5FBKA 3HTXA 1RBYA 2H4ZA 4RZSA 4MGZR 1QH1A 1V1MB 2QQEA 3D3KA 2IZ5A 3NVMB 3UN1A 1V8DA 2PH5A 1ZM4A 2Q07A 3HPRA 4YJ2F 3CT6A 1C4XA 3G2QA 5J4HA 3UMYA 1ZJYA 3I52A 4BQFA 3R6WA 4DLZA 1WW8A 1RRVA 2W90A 1AMUA 1NJ2A 1J23A 1H2YA 2DUNA 3OJOA 4FFWA 2FOLA 1T3SA 3UPDA 2AN4A 5FTLA 1CY6A 2V1XA 1JYSA 3JQ6A 1Z36A 3QLVC 4HDSB 1SKAA 3NKVA 5EP1A 5EZ6B 1CUYA 4UVDA 5G41A 5K1ZA 3UPTA 2VNJA 4ZVNA 1ILWA 1FP2A 3F3MA 3JWPA 2UYYA 3OKFA 4R1SA 2C9DA 1V9SA 2NW6A 3L04A 4KIGA 4PYMA 4R1TA 4AJ4A 4RTRA 4V24A 5LQDA 4MIEA 1KR2A 3ZCVA 1JFLA 3SIWA 1NXOA 3T9CA 1TZ2A 2YHSA 1Y6ZA 2ZTMA 3DZFA 1GPAA 3L3BA 4JL5A 4RA9B 1I80A 4EO7A 5EGSA 4AF6A 1G2QA 4CCSA 2C1EA 2LDXA 4QFDA 3HB4X 3SWWA 4FD3A 3KCNA 3GX1A 3OLYA 5SYNA 1EWQA 4DFDA 1OWLA 1OT3A 4JY7A 4YRPA 2Q4DA 4TMWA 3KLOA 3X1MA 5IBCA 2VJPA 2I2WA 1GDDA 3OJXA 2I2CA 4I36A 4YS6A 1CVIA 2QG4A 1KO1A 3IMEA 4WTOA 4LDZA 5LSAA 3TLZA 2HMUA 2GEFA 3Q12A 1MOPA 3VYWA 5DCLA 4RDIA 3ETLA 1YBAA 2IXAA 1KARA 3EZXA 4TL6A 5HJEA 1TUEA 3IEMA 4INZA 4AMBA 1RXEA 2BD0A 2AJLI 2XITA 3UIEA 3SY8A 1MDFA 5F1PA 4BO9A 3NR2A 1LNSA 4R16A 4N5NA 4LSGA 2FMXA 2QNIA 1YACA 4RENA 3I9KA 3EPJA 3VKHA 4B75A 2BN4A 4C0WA 1QF9A 2Q5IA 3LUJA 2G63A 2CZGA 1D1SA 2GXQA 3HV0A 3Q7RA 3B60A 2W48A 1RNLA 2RIRA 1Y8RA 4Y2UA 2JFGA 2OAEA 3HBFA 1MX5A 3KZMA 5BSGA 1QMGA 3LGXA 2V3CC 2PRKA 2Y1EA 3KOZA 4OHKA 3RNOA 3OETA 3KXDA 1RRPA 4MS4B 5B2ZA 3H2BA 1V1RB 1POXA 2NU6B 4Q9HA 4AROA 2ZI9A 4N39A 4X20B 4N7RA 2I2BA 2HF2A 3CWZA 1AX9A 3NM5A 1SQGA 3AILA 4R7TA 5JJBA 4Z1OA 1E4OA 3VBEA 4DQKA 4R0VA 2FRVA 1RJ9B 3KB2A 2A1UB 4POAA 1AKYA 4Z8XA 2H2WA 1V3TA 2QM7A 3UENA 4CR8A 1TKAA 1Y6RA 1NBAA 3O75A 5JRZA 3WI7A 1YSCA 2EW8A 1CLUA 1TM4E 4GMFA 1WO8A 4HN9A 4U2BA 1B42A 2XRYA 5LJIA 3MMSA 3Q0TA 1USUA 1FRFS 1U2DC 1Y34E 3D2BA 4FYVA 3SMQA 4AQ7A 5KYYA 2P27A 1COZA 1DMSA 1LWNA 4DLXA 1PYOA 1XMIA 3WICA 1YJ5A 2ZYSA 4X3PA 5JSUA 3NBZC 3IGFA 1GNRA 2QZJA 4LZJA 3KQNA 2IBSA 2Y6UA 5KKAA 4RVFA 4BKRA 4HH4A 3Q87B 4Q9LA 1R6AA 5IAKA 1L5ZA 1G1AA 3FXAA 3MNFA 2ADOA 4HNAB 4TS3A 3ESCA 1BXGA 1C7IA 2BUCA 5EUQB 5F12A 3LCUA 3O3MB 4ZCQA 3PEWA 2AX3A 3OFVA 4YUXA 5EHGA 1P19A 4I9HA 4D3XA 1XN4A 3E5MA 3TFQA 2UYCA 3LM8A 1U0TA 2H9AA 2QZSA 3L8CA 4AUKA 4J1NA 1EFRA 4EL5A 5CFPA 2FOIA 1K4YA 2IDZA 1X42A 3PRJA 3WLTA 4NE9A 1YKFA 3MSXA 3ZHSA 1C4WA 2VEOA 2J3LA 4DIKA 1KO5A 3FNIA 3KEGA 4ZOCA 4CQMD 4OX9B 4INAA 1BHSA 2R85A 5ALXA 2LCIA 4MUEA 2BEKA 2WWGA 4RK0A 1MAHA 1VI6A 5ES3A 4C2AA 4D8XA 1H9CA 3FRJA 4L8WB 4PYQA 3C6MA 3GMSA 4CIDA 1Z47A 2DKFA 4KYVA 5E6SB 2D7CA 4DHEA 2IOYA 2AFHE 5AMXA 2F48A 1JTEA 5IN4A 1P2DA 3BCRA 3U44B 4LYAA 3B1XA 5CH8A 1GL9B 2B78A 3HUEA 2O59A 2CFSA 3N75A 4MVJG 3IDFA 2I4TA 2ZRQA 1FNNA 5JAZA 2GZAA 3AB7A 1OT5A 3OUTA 3FCSB 1PAUA 5IU6A 4ZYTA 2DFLA 4C4SA 5H5JA 4YMVA 5I7WA 1FDOA 1ISGA 4AL4A 2B2XA 4IWXA 1A50B 2FY8A 3FD8A 4WZ6A 5IMBA 4GOLD 3CSSA 4B7ZA 3OEWA 1Y5RA 4P08A 5FLKA 2NTVA 3C6XA 2Q49A 1IM2A 1N5IA 2P6NA 1JJVA 3MD9A 4OB7A 4U6SA 3DL2A 3P2OA 3P9SA 3SQOA 1FSSA 2OE2A 1VA5A 2BFCA 5TMDA 5J4VA 3FDJA 2ZOSA 4NCHA 1W8DA 1QH8A 3E3LA 1UT6A 2LP4Y 3AMVA 2JJMA 4Q4CA 2Z4RA 1MDBA 1RYZA 3PF9A 1LLQA 5HM8A 1F1BA 2BHLA 1O9GA 3D6AA 8ATCA 3Q3HA 1G5HA 1UPXA 1GUYA 2BR5A 3IKVA 3OLWA 2JA1A 2YYSA 4O4JA 4P3KA 4B2LA 5I47A 3WIVA 1TU0A 5K0TA 1WL8A 4ESHA 1VIMA 2JH8A 2WLSA 4CKWB 3PC3A 4QXPA 2FXVA 4PICA 4RCZA 2UAGA 2Z2IA 2WVGA 1MPXA 1X2BA 4BDSA 3KOYA 2NO5A 3ZEAA 1GFIA 2BKAA 2RI1A 3N8IA 3B48A 4RPKA 5SZHB 2GBFA 5MN6A 2XGMA 5DNDA 3IRVA 3O8OB 2YKGA 1ZLXA 2JIDA 2C5AA 4GVLA 3GLFA 3AVWA 4GL2A 2PUBA 4FFLA 3TE7A 3ZTWA 1ZW6A 2NT3A 2IZ7A 1CD5A 4PZPA 4K9MA 1S4MA 1TPYA 4IOLA 1GT91 4OATA 5EKTA 4FMDF 1RACA 3ORFA 1WNFA 1L4KA 3SYLA 5AK6A 4NCJA 5AVXA 4HMPA 1IVSA 1ZRSA 3UJ7A 3ZD7A 4HNUA 1JDUA 1J8MF 4NCIA 1I3LA 2IQ5A 4MRNA 4QUHA 1GZ6A 3AL3A 3PDJA 1EVQA 1UDWA 2OOKA 2W6ZA 4PYNA 5KIAA 2BI4A 2NIPA 2NO9A 4JLWA 3ITNA 3BT7A 3HFGA 1A5TA 4IW3B 3SBOA 2VSFA 2B9EA 1ITZA 3HYCA 2AF3C 5J5CA 4ZARA 4HEJA 3PFBA 1QF6A 4JD5A 4MVJM 1N34B 1T2VA 2Y4NA 1FUKA 1VLLA 3GCDA 4F9EA 1RKUA 2QLBA 2PFSA 1Z33A 5KWEA 2XJ4A 4D4LA 1IHXA 3T4UA 3GPDG 3TZ6A 3ZGOA 4FMCF 1L4YA 2Q9CA 3NU1A 1V8PA 2C4VA 5G1OA 1IOVA 1CC1S 1BGVA 2HU5A 2Z2KA 2DMRA 4QVGA 1O8BA 3I4FA 5CNMA 1QU3A 2JVJA 3MMZA 4ZAVA 3UAGA 3Q72A 4UFOA 1U2GA 3W2EA 2C94A 3RFTA 3JQBC 4WGGA 2R0QC 4OQYA 2JK1A 4YP0A 5E6SA 1LPNA 3A7EA 4NMMA 3FTEA 1HX7A 1ZHHA 2FW9A 3GUUA 3NT2A 2O57A 2GTIA 3P8ZA 1W0KD 1DTWA 4GMHA 4KVFA 4V02A 1JX6A 2BKLA 1WF6A 1JG1A 1NDUA 2R4UA 1MH1A 3QU2A 4WY5A 4YUYA 4HKTA 2I29A 2GKOA 4Z99A 5CDFE 3A3KA 4EMUA 2GPSA 1YRHA 3MWEB 5EMLA 2JAUA 3VYTB 3VZQA 1YQTA 2ZR7A 3F6EX 3IPAA 1NVVR 2JLRA 3H7AA 4CLOA 2IF2A 3B2NA 3K20A 2I6XA 5EMJA 4CM9D 1GNSA 4P4TA 5B7PA 3ND7A 4BY9E 2VF8A 2D6FA 3VR4A 2FQWA 3ZCPA 1JGTA 2ISCA 5ADHA 1MV8A 3BZBA 3KRTA 3E7DA 3ZQUA 4MPJA 1JJAA 4RFVA 4AKIA 3P94A 1ODSA 2R6GA 1NJ1A 4NPHA 3EFEA 3JQRA 3S1LA 3AY0A 1UP6A 5BT8A 1G8SA 2Y0CA 1YL6A 3HJTA 3BTVA 3EA4A 5GONF 5IYZF 4C87A 1KJIA 4HUTA 1SELA 2WUEA 3FWKA 1T15A 4AI6A 1OZHA 1Z0SA 5TPWA 1MTOA 2L2QA 5TT1A 2VT6A 2QD5A 5IFKA 2YWBA 4P4GA 1KDVA 4MVJH 5SZJA 1Z2DA 4AJJA 4L74A 5EIEA 5H3CA 4B40A 5ERXA 2R8OA 3BD6A 1R88A 1SXJE 1ZLYA 1S9DA 2H1VA 2QAGC 4NK4A 2I1VB 2ZYUX 4AP5A 1DTSA 2Q2VA 2RGEA 4KAFA 2WSYB 4JLUA 2OYCA 1V8FA 2C7OA 1HPLA 1OFHA 2A1TR 2AXQA 4LAFA 1TF5A 3OBIA 2Q9BA 4W8HA 3W2IA 2ZCJA 2LUOA 1USVA 4P82A 3G68A 4AG5A 4HVLA 4EUNA 1B6RA 4INOA 1MFPA 4MGIR 3ZWWA 5CJJA 3MWKA 5ESRA 3JWHA 3HXOA 4YJHB 4TMFA 4RABA 5GWXA 4DXAA 2PLWA 1Q3KA 3D7MA 4ZXPA 4EVRA 2G9QA 2Z5LA 1J8FA 1I4EB 4FVTA 1O5TA 4P81A 4NZPA 5BWLA 3IQIX 1OXMA 2HB6A 2DPHA 3GT3A 4ODIA 1N2JA 3ZIAA 4JJIA 4ND2A 1EESA 3QLEA 1Y4SA 2X14A 5F33A 3PDUA 3MTJA 4AMZA 3PE3A 3KB6A 2HJGA 3B78A 2QQ0A 4DLRA 5EJ5A 4TTVA 1AM4D 3ZUGA 4ZJYA 1R7RA 3FCYA 2XNHA 1PVVA 3CE9A 3GC6A 3JD1A 3MWDA 3A9CA 4ZVQA 3ZHZA 4E70A 4A92A 3HM9A 2R1TA 4HDCA 2B83A 5HFJA 2J6IA 2W11A 5EJFA 4BO3A 3QELB 1WD5A 3IC5A 4MQLA 4S12A 3HSKA 5JCPA 2ZUCA 3TLYA 1EI9A 1UBTS 3EVDA 3CW8X 5HYVA 1DWUA 2FPIB 2J9FA 1T5BA 2O2HA 3SF8B 1LH0A 1FYDA 4CG3A 2QPTA 4QDOA 5BNFA 2Z8YA 2FA9A 3SNKA 2JPDA 4QPZA 3G9TA 1W5FA 3NJ4A 4IXTA 4XR9A 3ISTA 4DNOA 2ZTUA 1J5EB 1S6YA 1KPIA 1VMKA 4GWKA 3KX2A 3W3ZB 5L3QB 2EP7A 2OFWA 2QA5A 1WXGA 1Z3CA 3EG9B 4K81B 4JWKA 3KZCA 5AVTA 3FKQA 4NCKA 1FC0A 2O3TA 5HCIA 2XKJE 5KSPA 3ZZUA 1OYOA 1RWOA 4AKTA 4FU0A 4JR2A 3G2HA 2HLHA 2GO1A 3BORA 1ATIA 1NYQA 1WMSA 2D7JA 1N77A 4BKOA 2IP4A 1M5UA 5U4QA 4F84A 3EXG1 4PLWA 1L6IA