5DK6A

Crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
246
structure length
242
Chain Sequence
LYFQSMKAGIIGAMEPEVAILKEKLTDAKSTEHAGYTFHQGQLDGSDVVIVQSGIGKVAAALATAILIDRFQVDYVVNTGSAGGFDASLKVGDIVVSSEVRYHDVDLTAFGYEIGQLPANPAAFMPHDDLVAAAKKGIEQLSQNIKAVTGLITTGDTFMTKEEDVAKARANFPTMAAVEMEGAAIAQACLQLKTPFVVIRSLSDIAGKESPHTFEEYLETAAVNSSQLVLNMLGQLKGKVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
publication title CRYSTAL STRUCTURE OF A 5'-METHYLTHIOADENOSINE/S-ADENOSYLHOMOCYSTEINE (MTA/SAH)NUCLEOSIDASE (MTAN) FROM COLWELLIA PSYCHRERYTHRAEA 34H (CPS_4743, TARGET PSI-029300) IN COMPLEX WITH ADENINE AT 2.27 A RESOLUTION
rcsb
source organism Colwellia psychrerythraea
molecule tags Hydrolase
total genus 73
structure length 242
sequence length 246
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dk6A00
1RFGE 1U1EA 4FFSA 2AI2A 4M7WA 4QARA 1TCVA 1RCTE 5F77A 1LVUA 1OTYA 3MMSA 4YO8A 4PNPA 1Z34A 1SQ6A 1U1CA 4L6IA 3EUFA 4G8JA 3UAWA 1V2HE 5EFOA 2H8GA 3FUCA 3T94A 5B7NA 1VFNA 4TXJA 5F7ZA 4D8YA 3OZCA 1JDSA 3IEXA 2IQ5A 5FAKA 2RJ3A 1Z5NA 2QPLA 1T8RA 2OC4A 5IU6A 4QAQA 2A0WA 1Z5OA 1JPVA 1RXSA 3KHSA 4DARA 2HWUA 4H1TA 5CYFA 1PBNA 1XE3A 4DAOA 1B8OA 5F73A 1RR6A 4P54A 2PGAA 1RYZA 1YR3A 1NW4A 3OZDA 1N3IA 4JP5A 1ZOSA 4OGKA 4F2PA 4KN5A 4LZWA 3SCZA 4M1EA 4F3KA 4IP0A 3KVRA 1RXUA 1SD1A 1PR1A 3DP9A 3GB9A 4R2XA 1A69A 2AI3A 1ODKA 2GUWA 4RJ2A 3PHCA 4TTAA 4EARA 3E0QA 5ETJA 3EMVA 2B94A 3UAVA 3NM5A 4DABA 1RXYA 1YBFA 1OUMA 3P0FA 1T8YA 4DA6A 1PW7A 1G2OA 5F76A 1TGVA 4QATA 1RSZA 4G41A 1VMKA 3ODGA 4D8XA 2ISCA 1PK7A 1Z37A 3PHBE 5CYGA 4DA7A 1PR5A 3QPBA 4L0MA 3GGSA 1PR6A 5JPCA 4OGLA 4D98A 2A0XA 5F7JA 1ULBA 1YRYE 1WTAA 5CXQA 4WKOA 4LNAA 4QEZA 3F8WA 1M73E 3DF9A 4WKNA 5F78A 1PK9A 1ECPA 1CB0A 1PKEA 4TYMA 3BGSA 3OPVA 1A9PA 4X24A 3KVYA 4GKAA 1Y6QA 1RT9A 2HSWA 4TTJA 3K8QA 5F7XA 1OV6A 1JE0A 3KU4A 3OF3A 1JDZA 1YQQA 3C74A 3IOMA 5B7PA 4GMHA 4NSNA 1PR2A 4LKRA 5B7GA 2P4SA 4F3CA 2QTTA 1A9RA 1T0UA 4YNBA 1Z36A 4L5YA 4L5CA 3BJEA 1QE5A 3E9RA 1TCUA 4BMZA 1K9SA 1V3QE 1PR0A 1TGYA 5DK6A 4D9HA 4M3NA 1U1GA 3E9ZA 4DA0A 1PWYE 2XRFA 3FAZA 4F2WA 4YJKA 1ULAA 1CG6A 3PNPA 3TL6A 4TXMA 5EUBA 5F7OA 5CXSA 1LX7A 1ODIA 4MCIA 2OC9A 2Q7OE 2QDKA 2AI1A 2HRDA 4K6OA 4R31A 1Z33A 3LBAA 2HN9A 4F1WA 1A9OA 4MARA 1Q1GA 3OOHA 1JP7A 4GLFA 5CCEA 4OJTA 2I8AA 4LNHA 4R2WA 3NM4A 1JDUA 3FOWA 4NY1A 5I3CA 1U1FA 2AC7A 3UAXA 3FB1A 3NM6B 2I4TA 1VHJA 1PR4A 1JYSA 4QASA 3O6VA 5KB3A 1Z39A 5B7QA 1A9QA 1A9TA 1SD2A 3OOEA 2A8YA 1K27A 4E1VA 4WKBA 4BMXA 4MCHA 4TXLA 3BL6A 3KVVA 4WKCA 3O4VA 4TS3A 1V48A 4TXNA 3PNSA 1VHWA 4WKPA 1V45E 3FNQA 1ZL2A 2BSXA 1B8NA 4JWTA 4G89A 1NC3A 1V4NA 3EEIA 1V41E 1T8SA 1Y6RA 4DA8A 4L5AA 2A0YA 4YMLA 3EUEA 2OXFA 1A9SA 3U40A 4TTIA 4U2KA 1T8WA 1OTXA 3FWPA 1NC1A 3DJFA 1K3FA 4DANA 3LGSA 3ENZA 3INYA 1PF7E 4I2VA 3BSFA 4EB8A 1Z38A 4OY3A 1JDTA 5CCDA 1JE1A 3LA8A 1YQUA 4TXHA 3MB8A 1I80A 3OCCA 5EPUA 4BN0A 4LDNA 1RXCA 1Y1SA 3K8OE 4DAEA 1TD1A 3ONVA 3DDOA 3OZBA 1C3XA 5C80A 4NS1A 1OVGA 4D8VA 2QSUA 1Z5PA 3KUKA 4TS9A 2OECA 3D1VA 1JDVA 1Y1QA 4GLJA 1U1DA 3DPSA 4OF4A 4QFBA 3NBQA 3OZEA 1Y1TA 1FXUA 2ON6A 1Y1RA 3P0EA 1LV8A 1SJ9A 3UAZA 4ECEA 2QTGA 1Z35A 3UAYA 4JOSA 3UT6A 1ODJA 4PR3A 1ODLA 4UC0A 1OU4A 4BMYA 4OEHA 5IFKA 5K1ZA
chains in the Genus database with same CATH superfamily
4LBZA 3RFVA 3AKCA 1JWAB 1JS1X 4Q1AA 2PN1A 1Z6YA 2V1XA 3CQ9A 1YRWA 5CMLA 1G2PA 4QA9A 5AUQA 4WH0A 3SQDA 3G5LA 1SBNE 3CN7A 4KUHA 1OTYA 2XGJA 1SAYA 4N03A 4YP0A 1I1HA 1ZK4A 3DHYA 2Q9CA 4HQOA 5AW8A 4B4UA 2C2BA 1E60A 1I6MA 4S35A 5DP1A 5DNUA 5EJ9A 5LSAA 1H42A 3WIOA 1GLVA 5G0WA 4ZVLA 4KRXA 2G63A 3TTWA 3RWBA 3EGOA 4PGHA 3T52A 1FPMA 1KBOA 1RQ7A 1G38A 1FDUA 1SHLA 2Z95A 1GZ4A 3KYDA 4ZQCB 3H42B 3GZTB 4X62B 5KMGB 1KXJA 4DLVA 3UPUA 1EXDA 1X38A 5J58A 4HAXA 2DHRA 4EGAA 1AUOA 2VF2A 5GV8A 4L08A 1SVSA 1U94A 2RJOA 4JC5A 4LXHA 4G4IA 4X1IB 5EP3A 1C9NA 3HQ4O 4IHJA 3OEEA 4RF5A 2WQ7A 1QU2A 1DO0A 2WNIA 4A8TA 3AJEA 1DTWB 1EINA 1YSCA 4B79A 2OD2A 3TLKA 1OKKA 2A2ZA 4FQ7A 4R9UC 4Q9LA 4ZVUA 1GDTA 2NNLD 2Y71A 2X0NA 2E82A 1EFPB 4YAFA 4XDHA 3CO0S 3JALA 2H08A 2QJFA 4YV2A 1KGSA 3R3ZA 5JFTA 3UJCA 3AF1A 4H60A 4WNAA 3TCNA 3URMA 5JYBA 5E3IA 3ER8A 2PZEA 1MORA 2FHPA 1CJMA 1O0BA 4BC0A 3BWYA 4UUAA 1SUAA 2OHFA 4HZGA 1GAWA 2N46A 4PYQA 3OX2A 2XCSB 3UT5B 1DMSA 1LTKA 2EWWA 4CL8A 4OM7A 1PJBA 2BH9A 3R0XA 2ZJYA 2D6FA 4V2UA 3C7TA 2OGUA 3WB9A 1U6IA 1N78A 3NH6A 2AVDA 3AFIA 3GHHA 3FPHA 4KN5A 5IAAA 1NBMD 1OBFO 4JQCA 4AF8A 2GA9A 4Q7MB 1SC6A 2VP6A 4KQMA 2PMFA 3P5BA 4Q9HA 1N0UA 3GB9A 4N41A 4MEJA 2JA1A 5CURA 1SHUX 4E51A 4YDHB 1EYZA 2PYZA 3CG0A 1A69A 3K9CA 1P3JA 3LQYA 5IYZB 3BMQA 1H3FA 1NN1A 3RC9A 1L7DA 4UDNA 5FPTA 3TL3A 4K9DA 4R8KA 1FW6A 1H1DA 1G7CA 3HO1A 5ALTA 3TGPA 3EDYA 3PRKE 5AJXA 4PFQA 2XWPA 3E0QA 3F96A 5FL7A 4KYTA 1AKEA 1PNTA 1WPGA 4KLZA 3REGA 3HN6A 4E31A 2NU8B 3G8BA 3LI2A 5LXTF 1TK3A 3LG2A 5I9SA 3RTBA 1UJNA 3RRMA 3SS8A 2Q41A 2JJ2A 3BWBA 3EAFA 4TV8F 3ZWBA 4EYSA 2ZRKA 4DB4A 4ZOLB 2CMFA 2VPPA 3QVVA 1P18A 1ENYA 2HMTA 4UNNA 5FJJA 2HIGA 1RBZA 2D4HA 4D45A 1GRCA 4J9UE 3QY9A 2HV8A 4QBIA 2C07A 1C3VA 5KCZA 1T4CB 2HT6A 3A36A 3HVUA 5AI4A 1TE2A 3AKEA 1OIVA 1HLDA 2IYXA 3UJHA 2N3ZA 5J2UB 1E77A 3R3HA 4JEIA 3SQLA 2RHMA 4OI1A 3MK31 1OWMA 4ND8A 1STOA 5ADWA 2OYSA 1CZNA 1JILA 4MYTA 4C89A 2YIJA 1XUOA 3GGOA 3NH9A 1U2EA 1CUUA 4CI0B 4CLRA 1CY2A 4WJKB 1ULUA 3IUPA 1JPJA 2CKDA 2C1ZA 3C3PA 1I36A 3FNFA 2I1WA 1MJFA 4D82A 4Q21A 5JANA 2Z5GA 5K03A 4ZV7A 2EJVA 1YMVA 3BF7A 4N65A 4EQZA 2GM5A 4AY5A 1KKMA 4OAOA 1K0FA 2R87A 1L3CA 3C3EA 3HKCB 5E2AA 3G6WA 2I4MA 3NHMA 1K63A 2X0RA 3GJ6A 3V4OA 3OIUA 3HRHA 3T5PA 1XR3A 4D9JA 2QNRA 2PTHA 1L7XA 3ANLA 2VSQA 4GZ3A 4LNAA 2HA4A 5LR6A 3C3KA 2FEAA 3FD8A 1AHNA 5DCYA 4H1WA 4RIIA 1RYMA 5KNBA 2YQ5A 3NV7A 1J5XA 3PHLA 4DSZA 2W4IA 3OZGA 4H3VA 4H59A 1ZR2A 4UBKA 4DUPA 4CQLB 4J4BA 4FYYA 5EIXA 2C4HA 4BGVA 4NDZA 1CFJA 2WBLC 3OU7A 1CB0A 3GWGA 5KNLA 2IBMA 2R86A 1UDBA 4A6EA 5KYWB 4RPGA 1YC2A 3ZTTA 1DX4A 4L6CA 2R4QA 3CLUC 4KHZA 4RLQA 3B7WA 1UEIA 2GT1A 3GBSA 4YLEA 2WKWA 2H4YA 1JHUA 2MYTA 3FFBA 2WFMA 5K3EA 5A7FA 5KOJA 1O94A 1U7PA 4DLXA 1I3OA 4QX6A 3T1OA 1ZHHA 1FLAA 5KSPA 4KYVA 1R6AA 3ZYZA 1KFEB 2QX4A 4M0UA 4U7WA 4OQDA 3RVJA 2XKJE 3BBLA 3OF3A 1E69A 2GSWA 3HNPA 4C2UA 2BUBA 1M34A 2W5UA 2JLZA 3NTVA 2V9PA 1G8FA 4I4IA 4DV0B 4MUIA 4C3OB 2NP7A 4E0BA 2P4SA 1HDXA 3D4NA 3FLAA 3PQ6A 5L4LA 2V9ZA 4O4IF 2IZ0A 3DTTA 1G59A 5K51A 2G5TA 1RE1A 3GXOA 4JEHA 4MH0R 2D1YA 4CLOB 4V0ME 1T0UA 2QM7A 4M8IA 4YNBA 3UMVA 4ZGGA 4MUKA 5JJKA 4GOJA 4RIFA 5JAUA 3NBUA 5DNVA 5G41A 2GAOA 2UVQA 3TLMA 3WTCA 5AVVA 2ALJA 2PZBA 4GRAA 2QD3A 2UZ1B 4HWOA 1MIOA 4Y0NA 2QAGB 4ZU3A 4CLEA 5E6RB 4AQ7A 4FFBA 1QXSA 1MXFA 1P2DA 1R8QA 5AJZA 1K9SA 5LU8A 4X97A 2WIBA 3BXPA 3DE0X 3ZKWA 1ADCA 2NO7A 4YAIA 1WBBA 4JASB 5CB0A 1XL0A 2ISQA 3BXHA 1WAMA 2P91A 4W5JA 3WWPA 2ZE7A 1D3AA 4D4KA 3D8TA 4ZOEA 5HTKA 5KHLB 1NWHA 4C2BA 1BE0A 1ST2A 2QZ4A 4MPDA 1C50A 3N6RA 1KO7A 1ZVQA 3QNMA 4HDOB 4C9BA 4FLMA 3JYLA 721PA 2J3QA 5IKPA 2YCBA 2W37A 1DBWA 5DASA 3LFHA 1UOEA 5AM0A 4C7BA 2HO5A 5CXSA 3ZTYA 1IHYA 1E3MA 3PKJA 4MYSA 2UVDA 2F2TA 4HPWA 4NRDA 4XEHA 3ZHZA 2BFCB 3QPDA 3DMNA 4HADA 1I1OA 3ZDDA 5HF9A 2O3UA 1Z6TA 3T4EA 4YMGA 2D8AA 2JFNA 1G5FA 2IZ6A 4KRYA 5AM5A 1KMHA 2YOFA 5G1NA 2C3UA 4B7UA 2ZWVA 3WTBA 1PEKE 3EZNA 4ETIA 1S7CA 3EZFA 4KG7A 5JYEA 4Q93A 4HDAA 4GSYA 1XZEA 3R3YA 4HB0A 1UBFA 1XA0A 1EVQA 4J16A 3CKLA 4FWTA 4DUZB 1U8UA 2A6PA 5E7MA 1R3DA 4KPGA 1OIWA 5IK2A 4C4ZA 3I92A 2PWPA 4QM6A 3UH1A 2H4JA 1N9ZA 3KSUA 1I4WA 4OBEA 5EPEA 4JLMA 3JAWB 2IXAA 2VF4X 4GLFA 4Q3DA 5TDHA 4J2OA 5KI6A 3TKAA 5HR5A 3RRJA 2XOKD 4X85A 4DLPA 4V1CB 4Y1RA 2OLJA 2ZLBA 1Z5UA 3FWKA 4HGQA 4IXTA 5FBZA 3Q9NA 5BQXA 3EVNA 4BMOB 1F6WA 2C92A 3HJRA 2QRVA 1DWUA 4V24A 4Y2VA 5HJ7A 2WHPA 4HH4A 1YRHA 4ZODA 3DPIA 2QRNA 2F8SA 1ECBA 2XDQA 4LJLA 4MW0A 1YI1A 3R0IA 1SN7A 1X7YA 2H5LA 1KP9A 2R1VA 2RG7A 4NS4A 3UJ7A 3KJNA 1FYDA 4P8RA 2AC7A 3RFCA 4CMIB 4D56A 4BQFA 1EFRA 1Y6FA 4LJRA 3MOIA 5FUWA 1V5WA 3AUJB 3GLQA 1NMEA 3DTVD 5LLTA 1WHTA 2Y4OA 5IRCD 2H57A 3IL2A 2XXAA 3GLGB 4MV0A 1YDHA 3BJMA 5KX5A 1UKVY 1GN9A 1AHIA 1U8TA 3HDQA 4Y2TA 4IIFA 1MPXA 4OBBA 1BMQA 3NOXA 1IQRA 2EGGA 1W46A 4PC1A 4POAA 2FPIB 1ENOA 2HQBA 2OO7A 4RFLA 5AW0A 2VPWA 3GA5A 3RYFB 4PZPA 1HURA 3H3XA 1XMXA 1A9TA 3QFTA 4ND2A 5K45A 2OBFA 1I5EA 2DPXA 3DFIA 3WLSA 2P35A 2OTCA 3GFGA 1NW7A 3UFXA 4BMSA 1MJHA 2WYIA 3RS2A 1ZOOA 3H5OA 5HYVA 4G67A 4CFYA 5AO9A 3PRJA 1PS9A 1UXJA 2GCEA 4B48A 1ABBA 1XEFA 3HXQA 1HQDA 1L8XA 1XRLA 2J9ZB 2VYVD 3WRXC 1PDVA 5DI3B 3G02A 3S5UA 4XDYA 1PT7A 1RLTA 2VAMA 3DNFA 3EODA 4GI1A 1K5GA 3BL6A 3E8SA 4H3HB 4B44A 2R6DA 1WA5A 4BN5A 4Q4AA 3TQOA 1KWKA 4GYYA 3T1HB 3GMDA 4FEEA 3IIIA 5IXYA 2FWBA 4IUCS 4LOKA 4PVCA 3B20A 2GK4A 1DAEA 2CSXA 1EFTA 2AXQA 3PDCA 4CGYA 4ZOQI 3L7MA 4F6LA 2YASA 4WXEA 5AMXA 1WCYA 3IP9A 1TQ2A 5M34A 4L9SA 3VR3D 1RAIA 2AUMA 4EBBA 5CG1A 1UOOA 4J1NA 4J0EA 3OP1A 5DF1A 4CM8B 1LK7A 3PUKA 1K7SN 2YZ7A 4H1VA 4N0EA 2P62A 5DXFA 3LPLA 1REQA 3ANSA 4C6TA 5HWSA 4B40A 1O0CA 2P5TB 4H0CA 4G8BA 4C6HA 2B8WA 3HWWA 3N2NA 1QK3A 4UBMA 1NI4A 3C8DA 1UQTA 2OG1A 3L6RA 4IJQA 3N3AC 1OPRA 2ERXA 2AFHB 4L5AA 3CLTD 5F3WB 3D4IA 1P9NA 4DADA 2G0AA 4AQDA 3H0EA 3I8OA 3PRYA 5HJ5A 1DC3A 1IHXA 1XDUA 2DWQA 2PKQP 2FWIA 3FGZA 4TTIA 1DQYA 3JARB 3OLQA 4ED9A 4B3SB 1FVXA 1P0FA 2H06A 4MUMA 1UK6A 3AGPA 1TLFA 1VL8A 4G1BA 4N5NA 1VA4A 3TR5A 5JTUA 4M89A 1U8ZA 2QMEA 2FEXA 4J6EA 2C82A 5CR9A 3LGSA 3AEQA 2DQKA 2DUWA 3VDNB 5DN6D 1DQRA 1V43A 1GFZA 2RK3A 2WUEA 4IV0A 4YS6A 5DWDA 2DUUA 3VFDA 2GR9A 3W6ZA 5TGTA 1TB4A 2PLRA 1CV2A 1W0JA 2M6KA 1T5TA 4CLDA 1Z2DA 2HYDA 4PSDA 2NSDA 3RYHA 4EB8A 1PVDA 2AL7A 3AP1A 5BMVA 3LT1A 1VGVA 3TDNA 2BPOA 4QXOA 3BL5A 2NQ8A 4R5MA 3GH3A 1R6UA 1GGHA 5CCDA 1KY2A 2Z2YA 3IFSA 2R7LA 4W63A 4Y18A 3JD3A 5GMOA 3UWPA 3ND8A 1G8SA 5FNVA 1ZJZA 2H3HA 2ZSDA 3CUSA 1YQUA 1ZU4A 1X8LA 2R8ZA 4KV7A 3SDZA 3TIGA 3VI4B 4JUCA 3H75A 3ZGVA 4DMGA 4DTCA 5IPFA 1I7SB 1HZZA 1SQ0A 2FPOA 4XYGA 4XOIA 3VH4A 4AKEA 2IJGX 4BFXA 2WIJA 1T5HX 2O2YA 4LDNA 5GQSA 3CZRA 4HRYA 3LSTA 1B0UA 1EXMA 2EIXA 2JGKA 4F3NA 4NJEB 4RD4A 3F98A 4UEKA 1VLVA 4KIFA 2AC4A 4ZK2A 4ZO4A 2GEDA 5B58T 3TD2A 1WXIA 3WGKA 1BD3A 1Z3IX 3C7CB 4HWKA 4FJ0A 1CUAA 4W1RA 1GTRA 1RM0A 3PCRB 1ATIA 2Z98A 2P78A 1RWMA 3MUFA 5JVDA 3AR5A 2WAAA 1MNAA 3AKDA 3CEPB 3DD5A 4I14A 2XIQA 4HZUB 1TUBA 3PE4A 5JW6A 4KE8A 2YC2C 1J33A 2ZROA 1FP4A 3MUNA 4LSZA 4OH1A 2GRJA 4XEUA 3TOCA 3U48A 1ZNWA 1SVMA 4JOBA 3DBRB 1Y1PA 3LOQA 1DG3A 4JL8A 2OECA 1ZK2A 3FTQA 1ZCAA 3ECSA 2OGTA 3WK4A 1VPTA 4CKCA 3QKTA 1C8BA 1JDNA 1UDWA 3HY4A 1HRDA 2ID8A 1KQOA 1QLHA 3MA0A 1JFFA 1JIQA 3I12A 4GOOD 2OXRA 1M0TA 2C5HA 4GR5A 5AKLA 1LD3A 2R84A 1FXUA 4LCEA 3HSSA 3O8OA 1K4YA 1MB2A 2ZYHA 4M8LA 5BO5A 2RHRA 4XM2A 4UPEA 4HDNB 3UOWA 1NLUA 2P2GA 2QRHA 2VA9A 3KKNA 3RWMB 4K3UA 4A1FA 3D3WA 5TGZA 3UAYA 4AG5A 4TRMA 4FDLA 4WADA 1WV1A 4V3BA 4IDOA 3LUJA 4UEWA 4CI9A 4WCDA 5BWLA 2EP7A 3DYBA 2XKBA 1QMPA 2MYPA 2YMQA 2ZYWX 2ZYDA 3CUWA 3ENQA 3NFYA 3QPCA 5K6TA 4DCTA 4FFMA 3BC1A 3ZLJA 3B6EA 3O38A 5A5FA 5IFKA 3EW7A 1V11B 1CUFA 2X0JA 1J0BA 2MIIA 4JSTA 4M0DA 2VXOA 1GO2A 1DG9A 4GP9A 4ECAA 1U1EA 1DAKA 2FLVA 2PSHA 4TKMA 4F46A 3AVXA 2PUVA 2BUAA 4OLJA 5JYDA 2GYUA 1BEZA 1Z68A 2VOEA 4KNVA 4OHUA 5F3DA 1UFKA 3U17A 2F17A 1OROA 1VBNA 3ZDEA 1XCGB 3AEUA 1IMJA 1FFXA 2XQGA 3QI7A 4KFRA 4KE9A 1R9NA 5F51A 3KTFA 3RDPA 3V1NA 1EIWA 2TMYA 2FUNB 3TZHA 5FOQA 1E4VA 5HHTA 2CJXA 3I04A 4A0GA 4L6IA 3BICA 3S2FA 1R18A 4DFDA 3SQXA 5CB8A 1HX7A 2YQZA 3EUFA 4LMPA 4OHRA 2DLCX 2POQX 1QZXA 2GZSA 3KSZO 4TTQA 1PVVA 1AIPA 3HY3A 3MCTA 4NONA 4UZEA 3AILA 4AO6A 2NZXA 2EIHA 3HVJA 3NBZC 4UM7A 2BFBB 1DOHA 4QWMA 2WTBA 3HA3A 3L4EA 5CDFA 4YCNA 3OE4A 4COOA 4PO1A 5EWJA 1QHHA 1F2TA 2G9NA 3WXMA 4DIEA 1KIFA 3W7AA 4RL6A 2GD1O 4DJFC 2HA3A 2BJVA 2VFAA 1BMFD 5PNTA 2HEIA 1Z83A 1TTPB 4AJ2A 3D6TB 4DV2B 4QQFA 2WWFA 3LLVA 1ZRSA 3L82B 4TWIA 4RTOA 3N2LA 1W59A 1F0KA 2GPYA 2QUJA 1CP3A 1GUYA 3K9HA 2H4XA 3KVOA 3GQBB 4LCBA 3UYLA 2CKMA 2R6HA 5DCWA 8OHMA 4BY9E 4ZV9A 5K6RA 2J6BA 3CINA 5ULLA 3FHOA 4OBXA 4MWGA 3UMYA 3QVGA 5EJ5A 3R3UA 4IZIA 3WLKX 4FB5A 4HEA6 3IP5A 1HT0A 3JU3A 3JSAA 1ZCZA 3WLQA 4E2FA 2AZDA 1C9YA 2AN5A 2LCIA 2IVFA 4TYNA 2QZZA 1K75A 3G2LA 4HDMB 5TT0A 3WX0A 3RTAA 3KX2A 3SCZA 2WVHA 2CL0X 1IEXA 2GTIA 2QYOA 4GI5A 3SBDA 4H27A 4DEVA 5J4KA 4IFBA 1EFHA 3RODA 5EYPB 1C30B 3BWXA 3NNNA 4P7KA 1Q95A 2ZU0C 1EB9A 1KTVA 1THZA 2RHDA 3OURA 5AW3A 4QBGB 1TA0A 3F3KA 4F11A 3NBAA 3V1YA 1J21A 4RACA 3VR2D 2AI3A 3CUKA 1P9WA 3CWZA 1LPAB 3L7YA 2C8JA 3LO5A 3WGJA 1HFWA 2J3MA 3AT1A 1YHZA 1Z8HA 3B1YA 1P2FA 1O5IA 4WXYB 2PJDA 3L8HA 3ZZNA 2D5BA 1Y4ZA 5I9MA 5A04A 4RHEA 1QOZA 2QYTA 1UR5A 3DOCA 1SXGA 3EIWA 4B43A 4UBLA 1AO3A 1QVAA 1OQAA 1JEYA 1MX9A 1FEZA 2JFWA 4L8LA 3ZI4A 4CL3A 3A4IA 4EK9A 3DO8A 1H4VB 2WKPA 5EMHA 4EJ6A 1U7HA 2QTVB 5ALVA 3L6EA 4HDRA 4KCGA 1QV9A 2EDCA 3LWNA 3T3HA 4E5NA 3EQ9A 3ABRB 2KB0A 3H1TA 3UMRA 4NFSA 1VCIA 3UJPA 1JIUA 2D2IA 1M2HA 1PI3A 3ZXXA 4V0LA 4MVJP 5KAMA 1G6HA 2Y1EA 3DG9A 3E3AA 5EHZA 4LC9A 3CRVA 4HNGA 2L19A 4LN1A 1JB1A 3L8FA 4KGDA 4RA6B 1F4VA 1Z82A 2G5GX 2PMBA 3HUTA 5ES4B 2ZSEA 1TVEA 3WGOA 2EQBA 3M6AA 3DLCA 2V6MA 4YJGB 4HAIA 1T4BA 3K1AA 2EYUA 3RSFA 2WAOA 3PC7A 2ZKLA 3HCRA 1TFRA 4MLCA 5DYIA 3SZMA 1E1NA 1JF8A 1MB0A 2EBUA 5ERXA 1JV2B 2IX9A 1VPDA 2CLDX 3L6BA 4NEHB 4DA7A 1UBEA 1QHGA 4I5IA 5IWCA 3PWSA 2QM0A 1GA6A 4RK1A 2BY4A 4KI7A 4XOUA 3RFFA 4MUGA 5IDVA 4ZO7A 1EUZA 1PGOA 1S5PA 4FUTA 3FPBA 2AKYA 4O2BB 3OFND 2VWPA 1UODA 3IQHX 4OGLA 1B41A 4DMHA 1R15A 4HNRA 1RLMA 1O1YA 4OOEA 3C97A 3EVFA 4V0RA 2OSBA 3NR2A 1ZKMA 1XV5A 1AD2A 1GPH1 5TF4A 2HR1A 4ROSA 4YRNA 3FYCA 1T4GA 1ZJ4A 2YXLA 5JDCA 1CEYA 3PUJA 4OYLA 1DPFA 2YRWA 5IVHA 1Z2PX 2C8VA 2IHTA 4M1QA 4URHA 1V9CA 1GSIA 2RHJA 3E9NA 4BKMA 1XCPA 2LIVA 4GP6A 4NFYA 3VU0A 1CQWA 2ZXUA 3JASA 3F7OA 1HT1E 5EIWA 3DUFA 3KJEA 1HWYA 1RXWA 4LXYA 1ECPA 5CA0A 3KSAC 5CPFA 2OV4A 1BKDR 2JI8A 4F1JA 2OO5A 4Z7NB 1PKEA 1IAQA 4FCCA 4Z7JA 2GWRA 4DLUA 2NUTA 4FN5A 4YAOA 5KOIA 4X24A 3D3NA 4KB5A 4BO7A 4A6PA 3MJEA 4U7TB 4R2MA 1PZHA 4AMGA 4LF6B 1T9BA 3ILXA 1QORA 5H83A 1YI0A 3JWGA 4M6WB 1QU3A 2GTHA 3GPDG 2VKQA 4R1SA 5FEMA 4XX1A 4KPYA 3H1PA 1E1LA 1SMKA 2CBGA 3BF8A 4EYOA 3W2TA 2QNIA 1LWNA 1NI3A 5KTYA 3ZHCA 1UT5A 1QFZA 2ADOA 3CX3A 4IWYA 3WSWA 1YDEA 4B46A 3C5WP 2NUAA 2XYGA 4LJYA 1FFHA 2OFPA 3ZVRA 5ISMA 2DECA 4KEAA 4QYWA 2CYAA 2I87A 2GN6A 4HXGA 1Q1BA 2BLLA 4X8MA 4BRWA 4A73A 3Q2IA 3V48A 3OHMA 5BR8B 5BN5B 1ZY2A 1QHNA 2WF6A 3CZ4A 1GG9A 3QHQA 1WXQA 5A4JA 4AJ9A 5JXGA 1LDEA 5FL3A 1IDN1 4JYCA 5JLAA 4AO7A 1MH9A 2AOXA 4L8VA 3WK9A 2JPDA 1HLPA 2ZQYA 3LPDA 1U8CB 2EEPA 2X3UA 2ZRLA 4II7A 5AM3A 3OWHA 3EDRA 3E9RA 4Q39A 7YASA 2VDOB 3PCTA 2HDHA 4DV3B 1K88A 2CB9A 2Q1SA 2RHHA 5AUPB 3T7RA 2YXNA 4NBUA 5DK6A 3Q3JB 1U2QA 3EGXA 3WI7A 3EVDA 1C0PA 1JALA 4WXHA 3MQ2A 2VJMB 3DHEA 4L5IA 1F9AA 3RO7A 4FR2A 2B7CA 5F1OA 1X13A 2HA7A 1X6VA 3HJTA 3I2FA 2J30A 4S1VA 3EQ6A 4YA6A 4F9GA 4JI1B 3OA2A 4FP9A 5FWYA 4KR3A 1E79D 1K6EA 1SU7A 1VECA 2WTXA 1W85B 3MINB 4NG5A 3CLUD 5FTMA 3K0CA 4UU0A 5FF9A 4QLAA 3PR2B 4IUBS 3VKFA 1XROA 1UZNA 2O8FB 2LDBA 5F7OA 4U6SA 1WMAA 3I6IA 4BV8A 2GZMA 1Y7IA 1XYYA 1ODIA 1YS1X 2Y1CA 5DXAA 1MJGA 3KJXA 4LYYA 4ZZ0A 2VQFB 1LBHA 2Q3LA 3GJXC 1SQGA 2VP3A 4GGOA 3F4BA 2VJLA 2C2ZA 3T38A 2YS7A 2J08A 1FNBA 2HC9A 2Y76A 3U4HA 2ZB7A 1XSEA 2GZ1A 3HSYA 1Z45A 1JJIA 1OJ7A 5T8KC 1TEHA 5C0OE 2GN1A 3C8HA 4KIJA 5IDXA 3A6FA 4NMLA 3AY0A 4K9RA 4ZQFA 3TR0A 3UK1A 3HCOA 3X1WA 3DXZA 4BRSA 1UKCA 1JRLA 3NTRA 3K6KA 5DX1A 5KQRA 3LHSA 3HTXA 1V8BA 1QF7A 2B78A 2NADA 3N70A 1M1YA 1CUWA 3NWPA 3KKLA 3PFWO 2HZBA 2DLNA 3QFRA 4NI5A 4OJTA 4R5HA 1TIBA 3UWDA 3V8VA 5K3SA 3ZGNA 3AI1A 1KY3A 2COKA 3R6GA 1GG8A 4IIDA 1MDBA 3AR8A 3WIBA 1XHEA 2I62A 4AW9A 3IHKA 5ER6A 4NR0A 4H6WA 1HG1A 3H5LA 1NHWA 1NW5A 1E2JA 4BMNA 3NM4A 1Y3FE 3LUCA 2G88A 3NKFA 5DSTA 3FOWA 1NIPA 1C0EA 4AI6A 4I1RA 4YYEA 1RRGA 3ZU2A 3BIJA 4U7GA 1I4LD 4EITA 2GKGA 5KQGA 3TGWA 2PMKA 3DKIA 5L3SB 3JRWA 3G0GA 1AMUA 2HJGA 4JLKA 3GEIA 2NSHA 4OJNA 2X1VA 1JLLB 5BOSB 4HVAA 3FDXA 5BT8A 1WNFA 1Z16A 2HDWA 4IVPA 2RMKA 5JHGB 2PY6A 2ET6A 1GRRA 1ZOPA 4HGYA 1ISSA 1C9MA 1HL3A 1K7FB 2XZDA 2WKQA 3BTSA 5KB3A 3PPWA 4LV6A 3H05A 5LYJA 4I81A 5A2GA 1XQYA 3KFVA 1SULA 3ZWXA 5JRZA 1G20A 3CCFA 1ATZA 1NNI1 3QKSA 2DETA 2X0EA 1QWOA 3R9KA 2W0SA 1TM2A 2UVPB 5F1YA 4F3RA 2JGFA 3QVUA 1FNNA 5EMJA 2FN3A 2ZYGA 1C0IA 4G85A 4Q12A 5I47A 3N39C 1MRSA 5A02A 2D3WA 4JEMA 4URFA 5J23A 3U56A 2AJTA 1RJ9A 1LW6E 3T0GA 2MINA 4MHOA 3RH0A 5LD2C 3W6PA 5CHYA 1C8VB 3JQCA 2P30A 3LT5A 1YB7A 1BJTA 2WIDA 1CWUA 1VPWA 2AKAB 3I9LA 1HBJA 3C45A 3HB5X 5GINE 1T2CA 1M76A 2JBHA 2TYSB 3FSEA 4MW7A 3RAGA 1T2VA 2W2LA 4CG1A 3KLPX 5J2TA 1Y9DA 2WV7A 1C3OA 4M8SA 4Y0VA 3G68A 2HADA 2JH8A 1SURA 5HG0A 4AZWA 4E88A 3C98A 4JWTA 3EPKA 3GJ0A 5AK4A 3X2FA 3VKGA 2R25B 4DILA 5FWNA 5GZ6A 3TW0A 2D0PB 4BMCA 2PX0A 3T99A 3O74A 4XVUA 3A3NA 1A7KA 1Y9ZA 2QL6A 2C5SA 4HHEA 4JKIA 4TQGA 1WUTA 1YGYA 2G8NA 1XALA 3IULA 4JN6B 4DF3A 4Q4DA 4BNUA 2FX5A 1RMQA 4BVHA 4TX1A 1GNRA 3DF7A 1W0KD 3EQ2A 1VL6A 2JAQA 4K6CA 4KI0A 3B5IA 5CW1A 3RARA 3KQHA 4XGRA 4B85A 2JJMA 4EP1A 3I6YA 1I4DD 1K3FA 1T9HA 1RPNA 3T3MB 2W6ZA 3CMCO 1YZLA 3TZCA 2FEOA 5T6MA 3CCBA 1MC4A 4TTSA 1N6RA 4US2R 2HBQA 1OXMA 3F8TA 3IAEA 4J0FA 4ZP1A 4P3YA 2EKZA 2B98A 4L8FA 3VZRA 2GXAA 1RHUA 3SVZA 2OXEA 2VYQA 2OL4A 4OY3A 5FLYA 1GPYA 3PNBA 4QGBA 1WUHS 2AXEA 2HXSA 3LXRA 3R6LA 4XYMA 1HDGO 3GEMA 4RULA 1VI6A 2D62A 2YHUA 4IOMA 2OBBA 2VBGA 1Y37A 1JL3A 4LDZA 4IIJF 5ITZB 4LHYA 2IXEA 2NO6A 5LZ2A 4M0PA 3ZJTA 1T8PA 2ZT5A 3CNBA 1AA9A 3L8DA 3CX8A 1OTHA 1YIAA 2EQ5A 4ZRNA 1P1IA 3SIRA 4PG8A 2AOUB 1WZ2A 4GPZA 2QGNA 4MVJH 4RJJA 2GKOA 2N47A 3OICA 4F97A 2PZGA 3EGDB 3LWZA 5EHNA 4OLFA 3L0PA 3CRMA 3L77A 3DGFC 3K8OE 4FKMA 5AD1A 4E09A 4WESA 3S5JA 1DUIA 1L7VC 2IEGA 2PANA 3R3XA 4S1WA 4RNDB 4TZ0A 2C9YA 2NTNA 3AB3A 4PFKA 1RRCA 1QPGA 1E99A 2W6JA 1V4VA 3VKHA 1XJQA 4HQLA 3SHFA 4Z4HA 5HPYB 1YZQA 2W0MA 4MS3B 4G3XA 1UBRS 1QE3A 1PJAA 4G4SO 1HORA 3SYKA 4K28A 5AJTA 1RC1A 4D8VA 2I66A 4PX5A 1DHRA 3RU7A 3H2IA 3PNOA 4DSOA 2O8CA 3TPCA 3UHJA 1CIPA 4ATNA 2JH3A 4QAJA 4PNZA 3DOOA 2X0DA 1U0BB 2NT3A 1CW2B 5AVQA 3AHIA 1V1JA 4Q7EA 221PA 3E7FA 3OJ0A 4NWIA 3C3JA 3GW8A 2HAEA 4GLJA 1M2NA 3JATA 3VTZA 2R4TA 3H84A 3NBQA 5L7YA 3F1KA 4PSVA 5DIFA 3BQ9A 4A27A 3D43A 5ICMA 1KQGA 1HSOA 1QGUB 3S2EA 3BK2A 4P98A 1T5IA 3CNHA 3DAGA 3IC5A 5FA8A 1Y1RA 5A7GA 2XZOA 2EZ9A 1DEKA 1TECE 1D4ZA 1JZQA 1SBTA 3GPIA 1SJ9A 3E22A 4ILKA 3OQOA 3HDJA 3HCBA 3KV3O 4IG9A 4WKGA 1JG3A 3QTBA 4JOSA 2JATA 3DWFA 3ZU5A 3M33A 3GJRA 1ODLA 5ITWA 4GXQA 3PEFA 2FUEA 4DQLA 4IFIA 3L92A 2YL2A 2PM8A 3S7TA 3I2YX 3FTPA 4PZ9A 3VYVA 3QEBZ 2C31A 2BGMA 2GPAA 2PNJA 5LMCA 4Y6GB 3U26A 3ZY5A 4UZFA 3WWYA 3OIFA 1X1DA 4Z4FA 4MTCA 3R77A 1RFGE 4MPPA 1EXNA 3W2IA 1IVSA 4Z3KA 2Q8PA 1N1EA 2MWMA 1KS2A 3HUFA 4D2IA 2QN9A 3ZWYA 1VYUA 1RAAA 1X1AA 1BVUA 5EZYA 5ICFA 2XRMA 1MABA 3LK6A 1T26A 1W4RA 3G5MA 3SR0A 4QTXA 1G3MA 1PFQA 4B7CA 2IEDA 4BGEA 1MW9X 1QFXA 2PCJA 1Y8QB 5K05A 1E9DA 1L8QA 1X74A 3EULA 2JDID 3PFBA 5IEJA 4MUXA 4RLSA 4IHJF 3KE9A 1N7JA 2IHVA 4RZXA 1XEWY 3EXFB 4TQAA 5D8DA 2GS9A 2XKAA 2XMBA 2C3MA 3AEXA 5FYDA 1JIJA 2PS9A 2EKQA 2WUFA 5CDGA 3MJDA 3OQHA 4EG3A 2VVTA 4M8NE 4NK5A 1QRUA 2ZG6A 4JXZA 3MQ4A 3DEZA 5DHUA 1FX0B 3SMQA 2BKUA 2NACA 3RANA 2IY7A 4DBLE 4LVUA 1RWKA 3EHDA 5E7QA 4FM9A 1Y5MA 2JKZA 2WINI 4QU0A 1E2HA 5D3MB 1G2IA 3ICWA 5E38A 1E9BA 4FSXA 6ADHA 4BVKA 1O54A 1DBVO 1V6SA 2ZIFA 1PR9A 3QKUA 4OB8A 5DWQA 2VSOA 3QF7A 5TEWA 3H5NA 3SDSA 4RIHA 1UWLA 4D80A 3CTMA 3L7AA 4PYKA 4DCVA 2QRMA 4YRIA 5ALOA 1P6XA 4DSTA 3CH7A 1H9AA 3V4VB 2BTOA 2CCJA 1PUXA 3C3YA 2VDRB 1J2JA 3DDSA 4HVTA 5F73A 1ZI6A 4O25A 1RR6A 1FL9A 4CCAA 5K6AA 4QRIA 3OC6A 4D1YA 2D7DA 5HCUA 3WSTA 4DJ5X 2PH7A 4NHEA 2PVCA 2Y1KA 5BP7A 4LSMA 4IICA 3ZDYB 4E33A 2AB0A 4JXKA 3CS3A 1RCFA 2GN4A 3HR8A 3T7JA 1MF7A 1IXSB 2QVBA 2WFLA 2I4OA 3ANYB 3WL4A 3BK7A 3NRJA 3TH5A 4B0PA 1DG1G 2HCJB 3AXTA 3D7LA 4L02A 1BU5A 9LDBA 1TTQB 3AJAA 4NEQA 3D4PA 5DHAA 1FQJA 3NPMA 3PXUA 3GN2A 1RXUA 1JR6A 4X71A 5ALDA 1TO6A 2AFIB 3HA5A 4LOHA 3SF8A 1G5HA 4LGCA 1PGJA 2JCXA 4X41A 4GX1A 1NA5A 1XTZA 3WRWA 1IYZA 1XB2A 4TM8A 2X8LA 4ARUA 4G5XA 3IEPA 1YZGA 5AKKA 3BIXA 5BNIA 5GZ3A 3VZBA 5IDQA 4YRRA 3WYDA 4Q66C 4AN1A 3BH6A 1N7GA 3UXYA 2JRCA 3SD7A 1M6EX 3VR5A 3NJ8A 5E6UB 4FYHA 1OXKB 4JBGA 4DIOA 1PFUA 2XMDA 1UMCB 4XA8A 4P22A 1YA4A 2O20A 2FEWB 3JQAA 4YRDA 3WE7A 4C7XA 1NQTA 2J6HA 3LQRA 1LH0A 2RK6A 4AKHA 2D1RA 5E6SB 2AJDA 3KT6A 2QYHA 3IR6A 4A91A 1YBAA 3ZZ0A 1XAIA 1WPQA 5KTPA 1G21B 3KOWA 1BD4A 1EFKA 1IIBA 2LNDA 2QPTA 4FGLA 4Y2UA 1CRPA 2FZWA 3LW7A 1RSZA 2LTAA 2HBYA 2OCAA 1C7FA 2AXNA 3ACBA 2YWFA 5LJLA 3G79A 2R9VA 1M6WA 4EGSA 1NMSA 1XTBA 2OORA 3CN9A 4FILA 4PZUA 4UAVA 3U4AA 5BVGB 1Z75A 4AUNA 3FYUA 1GTJ1 1TKAA 2OBNA 5IARA 4Z4GA 4W5TA 4F4JA 2W6PA 1B2LA 5AXAA 2H1SA 2RGYA 3S27A 4BO2A 5JH7A 1W2GA 2HMVA 1TJYA 3QUQA 4IYJA 1W47A 2QQEA 2HLDA 4O0MA 1G1AA 3QKRB 1ZONA 4ND1A 4L7QA 2HNKA 4I55A 3KKZA 4ZREA 3E9YA 3SX0A 4ZI7A 1A5SB 1J2UA 1KETA 4A9AA 2A0UA 4G9EA 3QU7A 1VB3A 3SVTA 4HPXB 1E6KA 3LC1O 3BHMA 1BCSA 5DBEX 3NJRA 4PWYA 2XECA 1U9IC 3RS8A 3LZDA 1FK8A 5JAQA 2Z30A 1XU9A 5MHTA 1Q50A 4QPDA 5HFNA 3TECE 4HSGA 1BX3A 2C9OA 2QL9A 2ZVQX 3KSRA 2PJRA 2Z08A 5DSXA 2CT8A 3V3TA 1IB0A 2EU8A 1E9SA 5DPMA 3THWA 2BR5A 3EXEA 2CXQA 3SFVA 3JS5A 4HQFA 4FZRA 4RQUA 2RCNA 4GXTA 4JT8A 4RVHA 4MKIA 4JHXA 1I3KA 1GUDA 1O4VA 3DKPA 5HJ2A 2OQ2A 4X84A 4AO8A 1OLSA 2C9DA 1Q7CA 4RKYA 2BV3A 3EZ6A 4C4OA 2OV6A 3H2ZA 4F93B 1NAIA 1WULS 1J2YA 4IIEA 4DC9A 3R8FA 3RRBA 4DT1A 2HMSA 2JASA 1JHDA 3KVYA 3SNKA 1DQPA 4KX5A 1EE9A 3EC2A 121PA 2I4LA 3OP4A 4TTJA 4R7GA 2H1FA 2Q1WA 1B0ZA 2WWTA 1ABFA 1W5AA 3EF1A 1AE1A 2PL9A 4M99A 3KU4A 5DLEA 3D8BA 5K3FB 1OREA 1DDIA 3C74A 1RHQA 2VCYA 1IM5A 4BX0A 3CYFA 3GC6A 4NYIR 4MR9B 1GNLA 1JJFA 1B73A 3EBOA 2OORC 2J0QA 3QKWA 6REQA 1WDLA 1PLKA 5DMHA 1SVNA 2NTYC 3MILA 3FJOA 2P7IA 1S89A 1OZ0A 3D2AA 5IABA 1IHUA 1PGQA 3FN4A 2VUHB 5C8DA 2YZKA 1YFJA 1Z36A 3R0JA 3WICA 1JYFA 2WWVD 5KC8A 2I7VA 4W9MC 2P9BA 4PCAA 4LIPD 2PUJA 3KYJB 3T9EA 3TBFA 5CXUA 5JATA 4BLPA 4PYRA 2I71A 3IO5A 2MSDB 3MAGA 3PGXA 4CKBA 4RF4A 5FPHA 3J7AC 4KQCA 3JYHA 1GT91 1KARA 3HUUA 4QTUB 1LBIA 3WIUA 2Q2WA 5JNVA 5K3OA 4JSYA 1GWNA 1QCDA 1QUFA 1V3QE 1V5FA 2QDXA 1MMFB 3AIIA 4ZOBA 4A0RA 2JIDA 5ESWA 4Y6OA 5E0KB 2A1TS 3TUJC 2C9ZA 4KX3A 1ZXXA 3H87A 4M3NA 3CKKA 3GH1A 3S68A 1ISJA 5FUYA 4WBSA 3ZTWA 1H05A 4BB9A 4L50A 1E0DA 1SR8A 3ZI0A 4JLNA 1RM4A 1SFRA 2WMNB 3DMPA 3FYHA 3WOHA 4DNQA 4DWVA 1Z0UA 1M1YE 5FIUA 2J9FA 1DV1A 5BW5A 1BSVA 3NHZA 4KQFA 3LP6A 4EYEA 5BUSA 5A9RA 2AA3A 1I33A 1NASA 3RCBA 4GM0A 1JWLA 3OI7A 2KPOA 1UJBA 2A9PA 4UBNA 1ZRHA 1GZHB 1IBCA 1UIMA 2WU1A 3FETA 3RS3A 1R10A 4AP6A 1ZUWA 5LFAA 4G5OA 3RJ5A 4EB0A 2DR2A 3OZ7A 4OA5A 1EBUA 4OXXA 3CLRC 4AZ3B 3P0RA 4MKZA 2YMLA 3KYBA 4WTOA 4H17A 1OBHA 4M1ZA 1Q77A 3WLAA 5I9IA 2P40A 2W6OA 3EQ8A 4E5UA 5KYNA 2JLCA 2BMWA 3VAZA 1V6CA 4ZXFA 3ZLUA 2FJ0A 3GRVA 1JFTA 2ZB8A 1JMKC 2PIAA 4OUDB 1R8JA 1SO8A 2FDXA 1GEEA 3BZWA 3FWYA 1ORWA 2WKSA 3P9RA 4JAVC 5EKTA 1P91A 3BFKA 4GG1A 1I8TA 3BH7A 4ZTBA 4II2A 1U5BB 4RCZA 5FKJA 4C4RA 3JAMA 4X1KB 2O19A 5BWOA 2Q1UA 1DWOA 1SCUB 1DINA 1G5TA 2W2KA 2X0KA 4ARVA 5IKMA 3L8ZA 1JECA 5KYKA 2H2WA 3RM3A 4Q48A 4LY9A 4R2WA 4CWAA 1VI2A 4I46A 4PAMA 4Q7LA 5FI3A 1N5MA 3IT1A 1LJLA 1SUEA 3TAHA 1IUKA 1WQ1R 4NBTA 1T34A 2GHTA 5KX5F 3COZA 4LZOA 3C6BA 3LVQE 5MGBA 1LZLA 4I36A 3I1IA 1FQOA 3F8SA 3CZ5A 1GUFA 1X3SA 1PUIA 5LQSA 1O6CA 2ILVA 2ZJ2A 4GBGA 1B74A 1EVKA 3BRWA 1T1SA 4X9XA 2X6QA 3IAAA 1EWVA 1W73A 2A33A 1EDOA 1GL9B 3KXPA 2BKAA 1H2XA 2DBVO 3O8QA 4IKPA 4JDPA 1WKVA 2VHVA 4GI2A 3UY4A 8LDHA 3ZGXA 3EXIA 5FPKA 4Q19A 4IFEA 3PG5A 4S0ZA 3RVMA 5J4HA 2GQ0A 4YXWD 1WD7A 4NARA 5CH5A 2EFGA 2WJVA 2E5LB 4RTPA 1MCZA 2YN4A 1YHYA 4IRXA 2YFKA 5LZ7A 5U4QA 5CEJA 3DE4X 4LZLA 4OX9B 3SSOA 1R00A 2WFZA 3L4BA 4P1ZA 4B4KA 4RHTA 4DCCA 3GDHA 2ZBVA 4KO2S 5KWJA 2Q21A 3SGLA 2CXNA 5KWIA 3DE1X 1MX3A 5B64A 1JT9A 1SH7A 2HGSA 4KMMA 4KPFC 1JHAA 5TPWA 2B21A 1JHZA 1DAIA 2A9JA 3K6JA 4HAOA 1IN8A 3ITKA 4MJXA 4BMXA 3AFGA 3AR2A 4PGMA 2GM4A 4L7VA 4XTRA 1AZTA 1DKPA 2DSNA 2HREA 2YXPX 2EJCA 4FYIA 5LQKA 3HJUA 1L1QA 1ODTC 1P8AA 1PWXA 2J3LA 3IQZA 3DTYA 4JQOA 4Q03A 2HA2A 1F20A 1ZICA 5C3MA 5AW7A 4R2LA 5KDOA 1JPNA 1ZL2A 4CG2A 4QGGA 4P0PB 3R5XA 3F6YA 4PW0A 4W9NA 4CM7A 4ARCA 2FUKA 3NALA 1E8DA 5HF5A 2HL6A 2XIJA 5EA2A 2IYAA 4YB8A 3WLEA 2J9GA 3ZIAD 2CWDA 1O6FA 1B6TA 3STYA 2Y05A 4IXDA 1SBCA 4F4CA 4LWOA 1KH1A 3RYIA 1PQ4A 4DA8A 1GG5A 3UGTA 1UMDB 5HUQA 4ZI2A 4M55A 2BFFA 2QEQA 3H1EA 3MYRA 2OXFA 5CP8A 4EBFA 2ETVA 2N0SA 3P45A 4HGOA 4JR0A 3RABA 1X7WB 4CMAA 2PLFA 4DM3A 4AY6A 4DYHA 2IVZA 3TTVA 4GX2A 3UN1A 4ARBA 3WJAA 3ETHA 4DXDA 2A9RA 3AH8A 5DYTA 1N0WA 1W5FA 3BHIA 3KQMA 1PNVA 3ZHVA 1II8A 5BMVF 3PGVA 4HBZA 2COEA 1ZO8A 2F4NA 3G13A 3IDAA 1YB2A 5SY4A 4D6XA 3WAJA 7REQB 1XN1A 3OZSA 4HF7A 2DUNA 3PFGA 1K0UA 1X7ZB 3TF5A 1CNMA 2O2IA 5FNVF 4LYHA 3IEVA 1Z7GA 2FZVA 2PKEA 4Q7JB 4N12A 4RL4A 4DEXA 3L4BC 5I8PA 3NTLA 1DP4A 1FP1D 2J48A 3ZPXA 3IE0A 3KPVA 4KZPA 5DTRA 5JSZB 3ICCA 2QN3A 4B3XA 4RELA 5EJ8A 4W5WA 2VUIB 2NU7B 4CCSA 1XG5A 4KE6A 4Q82A 4Z9YA 5EGSA 1M6YA 3ZD7A 4ZWNA 1DXQA 4RFVA 4YEDA 2WA2A 1X86B 1CJTC 2Q4EA 3LNTA 1FTNA 4QQ8A 3RW9A 5A4AA 1R8SA 2JI6A 2GETA 2O1SA 2O7VA 1JE1A 3IVAA 3PXBA 3SAJA 1XMPA 4WFJA 4C21A 2YHIB 4FSHA 4UCFA 5IN4A 3QVLA 5FHQA 4FKBA 4XQGA 3AR9A 4GU5A 3UV6A 4CM3A 1FUUA 3MB8A 1N2CB 2XF2A 2Z83A 1ONPA 5BNTA 3TLYA 1GAXA 3BBPA 3TINA 5JVDF 5FOTA 2FRDA 4BNFA 3JAKA 2A58A 2AGVA 1MTOA 1G9SA 1C9DB 3W5SA 3EUAA 2FEPA 2AK2A 3JD2A 4PRLA 1MRZA 1KSFX 1UPUA 2BFEA 2LKDA 3AFHA 4NCHA 5EVCA 3JYOA 1DTEA 3PD0A 3V7FA 1RAEA 3QSGA 2WYVA 3U7QA 3MTAA 4AJKA 3CKYA 4DYVA 1OLOA 2OBXA 3EEQA 4MGIR 3W8NA 5J3JA 2I67A 4HN9A 4P36A 2Y6VA 1C3XA 4HH0A 4ER0A 3PFNA 2VDWA 4EG8A 1CUYA 3RRFA 2OHOA 2PQ6A 4RVGA 1IOLA 5JJIA 3W4IA 5IULC 1MO3A 4U9HS 4H4DA 3SQNA 3LC2O 2Q3DA 4TRJA 3A7DA 3RAEC 1BH6A 3C43A 4C6TB 2A35A 2BFPA 2Y68A 1TZCA 3NWJA 4GEKA 1TQ8A 2DWOA 3KTAB 4G1UC 2PEZA 2BE9A 1U3GA 1Z13A 5GJCA 2F4VB 1A8HA 2W58A 1F8XA 1U3TA 3JD1A 2FFBA 1IPEA 2I2BA 2XZPA 4KTVE 1T8UA 2IODA 2GN2A 4W6ZA 2HPVA 3I42A 1MXHA 5CPBA 1YIDA 3BKXA 2X4DA 3N6XA 5K0JA 2GPWA 3QVOA 2WIAA 3SZOA 2G6BA 3H3FA 1WDMA 2YY7A 3MJFA 3MJCA 2YJGA 4CF7A 1KEWA 2C2XA 1L8AA 2HNAA 4ZKDA 1YC5A 1ZJ6A 3IAXA 3GVIA 3N7TA 1IXKA 5CGZA 2ACVA 2W90A 3NHWA 5IZCC 3B52X 1V47A 4IIBA 3BREA 2OILA 2ZSAA 2GM3A 4O4JA 2AUNA 1Z2EA 4CIWA 2VQDA 1WNTA 4OIMA 1WUIS 4I1UA 3HKEB 3LXMA 4NFLA 2WJZB 1YR7A 1UKBA 1XRQA 4C22A 2PXHA 4FR5A 2R47A 1DFIA 1VPEA 2QSJA 2HH9A 3ANMA 4BXOB 3W05A 4IOKA 4EATA 4EA6A 1K8QA 4OQ4A 2IIBA 2RKOA 5F77A 2O54A 1UMBA 3R0VA 1K7XB 3FZEA 4YO8A 1CF9A 3ZW9A 1J5PA 1E1RD 5DFAA 2X3YA 3T5DA 4F0JA 2JK1A 1IUPA 1J22A 2GYVA 1SKUA 2IYSA 4NYMR 3NZEA 4C6SA 1VJTA 4Z7OB 1YU6A 1O4WA 4TMVA 3UMSA 1V7PC 1W4BA 4AJEA 1T2FA 1FS6A 2VO1A 3NYIA 4IM7A 4N3BA 2NNWB 5JE8A 3WDKA 1XA3A 5GZ1A 1YZFA 2NVOA 2CLHB 3HB7A 4ZAWA 1N57A 4TYQA 2GJ9A 3IQFA 4CN9A 4EY8A 3OO0A 1KKUA 3G82C 1N5KA 3DO5A 3O4RA 3OE7A 3HI6A 3F5DA 1X77A 2O4UX 3DBLA 3UATA 5KKCA 3G2HA 4OKNA 1XNRB 3GLVA 3OZVA 3UIEA 2RONA 4GSKA 2VTVA 1TVCA 3DR3A 2OPHA 4B32A 2IL1A 1B14A 3HBLA 4NENB 1J20A 1NN0A 2GASA 3NBFA 4IGEA 4LMBA 5DH9A 1LPSA 3OPYI 3MS2A 2A4KA 3FR8A 1U99A 3M83A 2QMZA 4MRVA 4QE3A 4U5XA 4UBJA 3A6LA 2ZCJA 2EX0A 2H3EA 2P9CA 1VOTA 4L16A 3LP5A 2KQUA 1XQ1A 4BNGA 3C3MA 2YDYA 1UPCA 1T9AA 3CH6A 2BHLA 3S81A 2R65A 1JHQA 1L7OA 2ONCA 3DHNA 1M2KA 1NKTA 3EG5A 3L4SO 8ADHA 3CR3C 3EG9B 1Z17A 2QLFA 3HU5A 4FDUA 8ATCA 5CIQA 3GDGA 5GAJA 2P2NA 4ZQGA 5FWAA 3V6MA 3OFSA 1QANA 1SCJA 2FV8A 4GX5A 3DDCA 3O8BA 3PHIA 4FX2A 1HSZA 3H11B 1BW9A 3FVRA 3RC3A 3HVHA 2ZWMA 3JVUA 4F3KA 4X66B 3O26A 1B8UA 3I8SA 3KVRA 2FW7A 2BBWA 1ECJA 4RGVA 5T4HA 1HE3A 1K6JA 3A2LA 4O59O 3PE3A 2PLWA 2W6JD 4FXPA 2J4FA 4EMSA 5KIAA 5AK0A 5KINB 1MB4A 4IY1A 4KVAA 3T9DA 1Q1ZA 3WVNA 4S1OA 3QEKA 1JJBA 2MSEB 2Q07A 4YWJA 4DL9A 5JQGA 1O08A 2WJPA 2LZ0A 4R1MA 1CD5A 4RJ2A 1S2GA 3PLAE 2XMZA 1B2RA 2OAP1 4LHVA 5D01A 2EFEB 2HHAA 5CDHA 3IDSA 8ABPA 5DSZA 3R20A 4DMMA 1HQYE 3NM5A 2CNOA 4DABA 2FR0A 1WXHA 1M83A 2E4VA 1BROA 4JVMA 1RADA 2CXOA 3IT2A 3H5TA 3P4UA 3GLHB 5LD2B 5DI9A 3F67A 1GL7A 2V7UA 3CKMA 3ZY3A 4LF5B 5JWOA 1HDIA 3UTCA 1TUIA 3DVAA 2RI6A 2AZMA 3O3CA 5CLGA 3VPDA 4HRXA 2QRGA 3F47A 1W87A 2ZAOA 5BV1A 5JNSA 2NSLA 5GWXA 4FMCB 4ARZA 2QI9C 4YJ2B 5KTMA 1HG0A 4LOLA 1CUZA 1NRXA 2QT0A 3OQIA 3AKZA 1Z4NA 1VGQA 3S0JA 1N2ZA 5HGXA 4F8EA 3IUBA 2ISCA 3HNOA 3O8LA 4FNMA 4V38A 1V95A 1R6VA 4M1TA 5AKEA 1JG4A 1IY9A 3I9JA 1DRWA 5KU7A 1A77A 1EIZA 3GYBA 1CNFA 1PR5A 2C59A 4EABA 2XUHA 3P7MA 2Y0EA 1URPA 2WDZA 2P9EA 4BFVA 5FLXA 3AR6A 4UM8B 4L0MA 3G1WA 3INNA 3K1YA 5EIHA 1MR3F 4DVGA 4FGSA 1M2OA 2XUAA 4KXUA 5EZQA 1CHNA 1LX6A 1R4ZA 3D6UA 4L0DA 2H1LA 1KK1A 2XWJI 4B17A 4WZBA 2ZT6A 3USZA 2RH4A 2ZZKA 3MWGA 4I9NA 4MVJI 4F5WA 3IDQA 5I51A 2JHCA 3DB2A 4ENSA 2VRCD 5CA0F 3AVYA 1NF9A 4GMKA 1YE8A 2VPTA 4MB6A 3UZUA 1G9TA 2AE2A 3LUFA 3WGUA 4ROTA 3HB1A 3KIPA 1YF3A 5CVEA 2CVZA 1WCXA 1KC3A 5IM4A 1BMTA 4LQ4A 1QDEA 3AJ9A 5FOVA 2AHOA 2R5FA 5HGJA 4DQDA 1P81A 2FQWA 1MIHA 2BTQA 3QE0A 3R3VA 4WKNA 3VSBA 3WY9A 2P68A 3EJWA 1DXHA 2RGBA 4OP2A 2GLUA 3FPSA 2CDCA 4UMFA 4YMUA 5J40A 1WD5A 1JHXA 1CQJA 1VIMA 1YU9A 2LXNA 3KZVA 3NRBA 3GNQA 5BWCA 4YAUA 4RF2A 4DEYA 2ODTX 2OSVA 4YJFB 2WUWE 1P31A 1QG6A 4PYOA 2OM6A 4ALNA 4KR7A 1JQEA 2OM2A 1KH2A 3ZXUB 1ADFA 4LBWA 2HSWA 3JYQA 1Z6ZA 4GIBA 4RKEA 3TS1A 3EY4A 4IH1A 4D8UA 1NUPA 3EH2A 1E8NA 3KV1A 5JSHA 1FDWA 4KVFA 1J7JA 1M3SA 1T2NA 2JLQA 3UG7A 5IBCA 1U8AA 1M2FA 3VH1A 1GTSA 4XGQA 5J4YA 4RM3A 4F2HA 5B7PA 4ZXPA 2DPLA 2Z0MA 2PKQO 2NU9A 2CFTA 1PT5A 9MHTA 3GPBA 4LKRA 4MVXA 3O83A 1FU8A 3HP1A 4JUAA 1Q0SA 4RZ3A 1R4MA 1NVBA 2QJRA 2R2AA 3JQDA 4RIEA 2QUZA 2NUBA 2NXNA 2QVXX 1OLXB 4TSFD 1JWBB 2WAMA 1WMEA 1OB2A 4I50A 1BXKA 3ABOB 3I2GA 4FUQA 4KPUA 1EVIA 4O2AB 2J67A 1N2EA 3PUYA 4IHKA 1DIOB 3KT3A 3K0FB 4MQEA 1OX6A 2I65A 1GL6A 3EIHA 5FLEX 2I34A 2PD6A 2JLSA 3H6HA 3VX4A 2QRZA 1GGFA 5D3QA 5I7OA 4JJIA 3ZUGA 3GCZA 2JJYA 2WWRA 2ZI3A 3N28A 4AZVA 1UCFA 5A3RA 3MHTA 4M0LA 5EXEA 2O2DA 2YFQA 5AW2A 4JC0A 1JMYA 3DKVA 1PZXA 4HGPA 1YJXA 3A4NA 4HQ0A 3LZCA 5EP4A 1AKYA 4BWYA 5CNJA 4DCPA 2DY0A 2DM6A 1AS3A 2I7DA 4OK5A 3FKQA 1H6AA 4XVQA 5KVAA 1DLIA 3FSGA 4M88A 3Q41A 1NXTA 4FFRA 4F2WA 3UM9A 3Q5GA 4BP1A 1H4TA 2DTDA 3QTLA 4JKOA 4ZYVA 4WSOA 2E89A 3TL6A 2I9KA 5SY6A 1C4XA 2BL4A 3A1UA 5FFNA 1M7GA 1GL3A 2CF6A 3GLRA 4N0MA 5JFOA 3L06A 3CZ9A 1TMKA 3EVTA 4G1EB 2AHRA 5JWHA 4AAYA 4CKWA 4CV3A 4IO1A 1J2TA 3MFYA 3N7UA 1KAOA 2OC9A 1PVOA 1XIVA 1P3DA 3BB1A 3EVGA 3NVMB 4L72A 2IP1A 1XPRA 5L7WA 1E61A 4B9AA 3R7NA 2UXDB 2JFFA 1P4SA 2QK4A 2PZMA 2Q9AA 4GOLD 2FMTA 3AW8A 3BGDA 3IAS6 1UT8A 1Y7TA 5DYGA 3H2SA 3LH5A 4F1WA 1NFFA 2VTKA 4A10A 2DEUA 1A9OA 3CE9A 2ZWAA 4UEQA 4YT8A 4A03A 1LS1A 2C2HA 3J7TA 4UHBA 9ABPA 2VP5A 4RZUA 1UBUS 1QZ3A 4BP9A 1UXIA 1SEVA 2AJBA 2H2IA 2HLDD 4TTVA 5AKYA 1GR1A 3WO1A 1S1MA 3NEPX 3PPYA 1C9JA 4LQCA 5IP5A 3F2IA 1SA0B 5EY5B 1SXQA 5HIJA 3T54A 1Z5ZA 4KJXA 1KYXA 2VPQA 4BEJA 2QTZA 1KI1A 1FLVA 1BAPA 3K3PA 5BSUA 3WZ2A 1SCDA 3WYGA 1N7IA 3E2MA 4BNTA 2QKYA 4ZO8A 3MB5A 2WUVA 1KO4A 2WSIA 4KIWA 1RYNA 2IV3A 3VQTA 5B36A 3RSLA 1W35A 3OPYA 3W5VA 3C4QA 1MA0A 3TNLA 3CRRA 5LOVB 4DJEC 1DELA 5LYJF 3JVEA 2VHXA 4WN9A 3EFHA 1DS6A 1JPUA 2QM3A 4LJ6A 1KS9A 1IJKA 2F43B 5M04A 2Q3EA 4BOYA 2V1UA 1G64A 1NG1A 4MR8A 1T3SA 4P38A 4GHWA 1QP0A 1E0JA 1TAGA 1VIYA 1E63A 2EDAA 2FA9A 1MGOA 2P3SA 1NVVR 3IQXA 3ONFA 1T9DA 4X0EA 5AWFC 1N5OX 1RJFA 2IPMA 1A2OA 5B3KA 2RGNA 3BRSA 1E3WA 3B51X 4LSGA 4ZANA 4D0NA 4DREA 5JADA 4P0QB 2AIRA 4W1QA 2HQ1A 1SD2A 5GGXA 1ZA2A 3GOQA 3GRPA 3QBJA 1S2OA 3ACDA 1IBMB 3CLRD 4W7SA 1KP3A 5JEDA 4BEVA 2C88A 3AHDA 1VZ2A 5JD6A 2O8EA 3F4LA 1R5NA 3BCHA 4TWZA 3W04A 3RK1A 4Y3UA 4U2CA 1ORRA 3FF4A 3KCQA 5J2TF 3RTDA 2WTEA 3V8BA 4TXLA 1C7RA 5DM2A 4XD7D 1YJBA 1I13A 2WY2D 1GAEO 4GS5A 4JLOA 4Y8VA 2B8NA 2AW3A 2QY6A 3JRXA 1FUYB 1H9BA 4TXNA 3T3DA 5I5EA 2GPJA 5JISA 1TC2A 4OXNA 1ZOIA 1CETA 5F5XA 4XIJA 5T41A 3R5JA 1D1TA 1HEIA 3NB0A 5CVDA 1ECGA 1MRNA 2QORA 3KWLA 3MWEA 4PLFA 5JS2A 4F38A 2H0RA 4I5FA 3NMUF 2DWUA 5T67A 2JW5A 4GC9A 1CRLA 3K6SA 1JVNA 1U02A 1XVTA 5K4GA 3KEMA 1YVDA 1DFHA 2A5JA 2I6QA 2OCDA 2QG6A 3B13B 1G41A 4MVCA 5DGDA 3V7YA 1M75A 4KQ2A 1YZHA 2UKDA 3TW8A 1CR0A 1Z07A 4NCAA 1O7JA 2GVDC 3K16A 4QOSA 3ZHTA 4H35A 3V42A 4DNOA 4R68A 5AM2A 3Q8MA 4AIIA 1EFLA 4NBRA 4RZIA 1FP6A 4WLVA 4MO2A 5SICE 4KZKA 3GDWA 4UXIA 5KKNB 3P96A 2LE0A 2X9QA 3IRUA 3K6RA 4K7JA 3JWEA 1F3OA 3NASA 3Q1LA 4EFNA 3JQ7A 1X9GA 2XZTA 3QEOA 4X7BA 4BKUA 4HQNA 3ZE1B 4EHHA 2PUGA 1ZX1A 1XP8A 2RIRA 4YROA 3LVFO 2FMFA 3QPAA 3WKBA 4Z5XA 5KYYA 1NV9A 5DM0A 5JS8A 2NQTA 3C6ZA 4HEA1 4R8RA 4R3WA 4RMJA 4PXSA 3SYNA 1FCJA 3OMXA 1ZMTA 4MQFB 1JQAA 2J3KA 4TKUB 1FFGA 4HWRA 4W8GA 5DEOA 2F8TA 1PU2A 1CY1A 4PXYA 1KEZA 2FW9A 1FSSA 1Z38A 2Q5QA 1KOFA 3BFXA 5D5QA 3TPZA 1QYDA 3HGQA 2XA1A 3FUTA 3Q3EA 1L5OA 4BZZA 1OXUA 3BZBA 3OLWA 5AXBA 2Q0HA 4AJIA 4FW9A 5DTEA 3NDBB 4ASUD 2MMGA 3UNXA 2B34A 2NYUA 6NULA 3J80A 2I1LA 4FFOA 3IS3A 2D7JA 2Q5CA 5SYAA 1ODCA 2O2HA 1A7UA 3UCFA 3ZLBA 3D7NA 4QDXA 1DEHA 3PFIA 3QLUC 4YDRA 3RVKA 1WOMA 2XYQA 3QMWA 1H23A 3WK5A 2BC9A 1CLUA 2GEJA 2A1IA 3DHVA 5ALIA 3S2GA 4F21A 7MDHA 2F1RA 2J0VA 3FPFA 1KAQA 4ND7A 4P80A 1QRSA 3M5WA 1X7XB 1KVSA 2F90A 2J87A 2O07A 4HN4B 2FYTA 3FKSA 2NTVA 4X1YA 3T5CA 4DGQA 4UTRA 4C7OA 3ETCA 4R1NA 1FXWA 2VSXA 1CVLA 3GX1A 4JB3A 3RGGA 5F5NA 4OQYA 4RYLA 3RHTA 4BNWA 2H1OA 2YZMA 4AS3A 1LI7A 2AMLA 5K99A 2GRUA 3WJ2A 3A9CA 5AOBA 3THYA 1ZFNA 3BSSA 1CUHA 4EUSA 1AM4D 1OVGA 1U6KA 3V32A 1SCKA 3N07A 1ZYUA 4I3FA 5F1KA 1HYBA 1UXHA 3W5AA 5LOVF 4QXMA 1LLDA 2P9ZA 3PUVA 5IC5A 1J90A 4EM6A 2HRBA 2KSQA 3GGJA 5DN9A 1JSCA 3BH0A 4MI1A 5EAIA 1DT5A 2R8EA 5H3CA 1YR6A 2X0IA 3H65A 1PBTA 3HR7A 3U3XA 2WC1A 1ZS9A 4DBLC 1FBTA 1Q7TA 5KOHB 1CDZA 1E62A 2BELA 1H8ED 1XRJA 1YZVA 5IHPA 5GIOE 3F6CA 3DPSA 3VHXB 3N75A 4HY3A 1E5XA 4WE3A 3VV3A 1EX9A 3W4KA 1U2RA 3HBFA 1JU3A 4PQFA 3LAWA 5TQ2A 3WHPA 1Q3TA 2X5OA 3MJRA 3OQ6A 4EI7A 3MUOA 4CQJA 2CXRA 1RM3A 3QKIA 4YONB 2C3YA 2NWQA 4Q9DA 3OZWA 5FWXB 1N34B 4TMXA 3KHTA 1ISFA 2IXGA 3EGVA 4LDRA 2E4AA 4NVRA 5TR9A 2ZJ1A 4DSUA 4NCJA 1JEQB 1D2HA 4ZC8A 1DADA 4PCVA 1D0IA 4GECA 3T1VA 2HMYB 4PONA 3ZQ6A 5ALEA 3FLBA 2BCJQ 3NCHA 4EGFA 1SVOA 2PWZA 1C4KA 1VKZA 3JQFA 1JG2A 5EZYF 3IOBA 6AT1A 2JJQA 3PB3A 2W8BA 1LLCA 2P9JA 1W0CA 3CVYA 1C1DB 2INGX 1Y3CE 2VNKA 2BFMA 3EXEB 2QYSA 1J2EA 3Q88A 4PNEA 2ZE5A 3MOSA 2TRSB 4NDNE 2VSYA 3C8UA 4QODA 2X4IA 2C04A 4MLPA 4YI3A 4DB2A 4TYPA 1N2GA 2YYAA 3UCEA 3I28A 2AI2A 4YV1A 2C78A 1Y63A 3HYTA 3PL5A 4JYBA 3FZNA 3C3AA 2JIZD 1OASA 4JP2A 2BGJA 5ALWA 1OYVA 4IRMA 2DT5A 5JROA 3G2OA 2I6SA 3U7IA 1XTKA 2H9AA 4JB8A 3OJWA 1N3YA 3SJBA 1GG2A 1KVTA 3M4XA 3QLVC 4AMUA 1PO7A 1NVAA 2I4NA 1RCUA 3WLTA 2QTLA 1QDUA 1ULTA 4PO8A 2HQOA 1GZVA 3WYAA 4EG0A 2QLMA 3NHSA 5G02A 1KI3A 5K0SA 5KVSA 1V2HE 3T7SA 2CJPA 4JMLA 4X61A 2VZ0A 2J31A 4GBED 5IT9A 4WY5A 3OIYA 2GCOB 1VJ1A 3UK7A 4HC4A 4QOGA 3FUCA 3TIIA 3SQWA 2CV2A 4YT5A 5DTMA 2V98A 2DPHA 5HIIA 3EN0A 3E7PA 4G81A 3AMVA 2L0XA 4FE4A 3DZIA 4ABTA 2JGDB 3WSVA 4DLAA 2CNKA 5B4TA 4JJEA 1FRFS 1M66A 1H2FA 2FFRA 2OC4A 3HPRA 1N32B 3EW9A 2GEFA 3I04M 4PBTA 3R9XA 3SR3A 4MV6A 2XMGA 5TQVA 1QF6A 3RS7A 1LV7A 1MJNA 1KDZA 4OL0A 1QIGA 5E0OA 4FS3A 5BSRA 4ZKEA 4DARA 2YOHA 2GZAA 1QJ4A 4D0GA 1LUAA 3V7UA 3LJKA 1ZZGA 1DAFA 1WE2A 1BXRB 1T91A 3C6XA 3FVTA 4QL3A 5BVHB 4PSUA 1JKXA 1T3HA 1AF7A 3N2GB 4G8DA 1AV6A 1RRVA 5TV2A 1KPGA 3GEHA 1U8XX 3R7LA 3GJ8A 2ZATA 1RYZA 1S2IA 1A95A 1YR3A 3ND6A 4E5YA 5F12A 1DHTA 3H5WA 3QMVA 4OUKX 3COYA 3PVCA 1XO1A 2PQMA 3IUEA 3TOXA 1QKIA 2VHCA 1NJ8A 4CM4A 521PA 1CDEA 1ZOLA 4Y2JA 3WGYA 1O5TA 2NVUB 1DJOA 3GZJA 3RJZA 1KR2A 4FDTA 4U1RA 5BN3B 3ZI7A 5IJXA 3LO8A 4BKQA 2XWBF 2IELA 2BMDA 5AVOA 5IBPA 4E70A 4JV5B 3KQQA 1E2FA 1PD1A 1W44A 1GZDA 1U2GA 3ICPA 4D0RA 2E4ZA 3P52A 4EPYA 3G88A 3MPUA 3TXYA 1T5OA 2B92A 3H0KA 1Q22A 2P6MA 4M1YA 2QQ0A 3B5JA 3A9RA 1H0KA 2GVZC 1KYWA 1TKBA 2X42A 1E9EA 3R3SA 4GPBA 4P34A 2YMPA 2VRNA 1JLHA 3QOFA 4AYWA 2FK7A 1RWXA 1QJCA 4DWWA 4WWHA 4EPXA 4F2GA 3PD1A 3BKWA 5H8WA 4PEVA 3EXHA 2ZIWB 1KZHA 2H17A 3BXXA 2UUAB 4J2TA 3AUTA 1G5RA 3I76A 4GL2A 4DA6A 3PC4A 4UVDA 1TM4E 2V03A 3EIEA 2OHJA 1G2OA 3G7NA 5IH3A 3INGA 4DOMA 1HNXB 5B1IA 3QYJA 3VUFA 3CBGA 5JH7F 1AQJA 2P65A 3AR3A 5IAGA 2DP4E 1D7AA 2Q1YA 4L4ZA 1OZGA 3RU2A 1E6CA 3V1TC 4W1SA 5SZJA 3PL1A 4I55F 1F8GA 4D4JA 4ZI7F 3MJTA 2EZ8A 2QPOA 3ZU4A 4MLDA 2WDPA 4KN9S 3RG8A 3ZHYA 4P3OA 4R3UC 1BS2A 4Q4CA 3OZTA 5TQ0B 3S44A 4I1VA 2J7PD 2NZ8A 4FYMA 2PCLA 5FUBA 2Z3ZA 4KFTA 3TNFA 3CUVA 3DZDA 3GFBA 4UJ5A 2PFSA 5CNIA 4UTVA 4NYJR 2XNSA 3THXA 1FTGA 1QRTA 2IT1A 5BWMA 3Q0TA 5B3JA 1P1JA 1ZMRA 5LIPA 2D00A 4GSLA 4MRMB 4O4LB 1JG7A 1SXIA 1QYVA 1W52X 1O95A 4RVUA 2BM9A 2WB4A 3FPLA 4Q3AA 5IKXA 3TGLA 3GD5A 3LLUA 4OU5A 2NUPA 1I51A 4HUQB 4XB6B 3KQNA 1USWA 4A82A 3E5NA 5BUZA 2IOFK 3ZHQA 5LLDA 2RGDA 2J3DA 1U2GC 2JLAA 2ZRMA 2VWGA 1NX6A 2VS1A 2ZYTX 3SN6A 1LLQA 4N3AA 3QA3E 4RC9A 2QX6A 3HXMA 3G9TA 2BDEA 2D3TA 4BS9A 2PU7A 1BHJA 2G1KA 3NEYA 4K6KA 5F78A 5GVSA 1CYEA 1EJ2A 1U90A 2CBXA 2MJLA 1I6KA 4O08A 1VL0A 3HYNA 5KU1A 3ZCRA 5JWRA 4TYMA 5EKDA 2C00A 4C06A 5LBIA 2P11A 1UEJA 3OPVA 3K9FC 1EAYA 3NT4A 3WWZA 5L40A 3FTFA 2RI0A 4L75A 3V4RA 2GJSA 3AEYA 5TXGA 4C88A 3W7VA 4RM2A 2Q0XA 2X22A 2QNBA 4ZYZA 2YWJA 1Z5GA 1PL6A 1OZAA 2XV1A 1SBQA 1TM7E 1HYQA 3QPUA 4G36A 4IHQA 2GPTA 2ZJFA 4MGZR 3T06B 1G0NA 4JJGA 4M1MA 4TKZA 3MS4A 5F5LA 3A70A 1XCLA 4IG4A 3G8DA 3UEOA 1CQIA 1J8DA 3ZBQA 3W3AA 2BE7A 4L0QA 3LLCA 1J0DA 2ZTMA 4NLLA 2ZJ5A 4P4NA 1YQDA 1DZ3A 2XNJA 1LSOA 3F1LA 3RADC 1S01A 3BUSA 1XPUA 5A62A 2JIBA 5B53A 2NZWA 1HTBA 3HLTA 3TRHA 2Q1TA 1V8PA 1P61B 2BWJA 2ZJ0A 3L6CA 3TBKA 4TLCA 1ZISA 1QO0D 2ZRAA 3IMCA 4IKOA 4UNIA 1DI0A 2A30A 2QQGA 3ELDA 4MV3A 3WMXA 1JEJA 2CXXA 3B82A 4L5CA 4Q02A 5I7SA 1YOVA 3OPNA 1G42A 4XCXA 4JBWA 4JXXA 1OHHA 2BI8A 1IL0A 1L5ZA 1ONOA 2XB4A 3DE7X 3H5VA 3M0EA 4HRVA 4PIPA 1EXWA 4LWPA 1MHPA 2V59A 1MFZA 1YS4A 2HGZA 2GEKA 3JZDA 4JLJA 4M36A 1K86A 4E2XA 2XAUA 3ELYA 4FZ5A 4EFDA 2ZTHA 2QTRA 3T4UA 1AGPA 2RHBA 1TT5A 1JG1A 2V4ZA 2XRFA 4QNRA 4DLSA 1G19A 1VG0B 3IGFA 2C2WA 1K8ZB 5EVJA 3W1WA 4LTMA 4K03A 3BWCA 2IUTA 3N0RA 3LX6A 3NHFA 3A1FA 3QYPA 2IU6A 4GOND 3IQEA 1Y6ZA 2WU3A 1P4GA 1L4FA 3SHOA 3AIKA 1IZ8A 4C03A 2ZBGA 3BTVA 3IJ5A 1AO0A 1ZUD1 3UTDA 1CZRA 3C0KA 2PZKA 3ZBUA 1JHMA 3OJFA 3T95A 4C1NA 4EVQA 1RQLA 2C20A 1HE8B 2TECE 2V8OA 3PXDA 4O4HA 4EGJA 4CEJA 5COBA 2QLNA 3E9QA 3T0FA 1VHTA 5C7OO 1O3YA 3FYDA 3CNEA 4A6DA 1RWOA 1FFDA 2YYYA 3IQDB 5EOVA 4D4GA 4RPIA 2ETXA 4UU1A 1PIWA 1TYEB 3H5RA 1WMSA 1WY5A 4K9QA 2VJKA 4Z1MA 1KJNA 5ESDA 4WOPA 1CERA 2X8JB 1CR6A 1GQSA 1HKHA 3QFHA 4ODIA 3QPVA 5JNLA 1ZVJA 4WZBE 1RBQA 4YPOA 2PLNA 3G23A 4QU5A 3ZOKA 1T1JA 1JR3D 4RDHA 3Q15C 4UOEA 1FC0A 1EXVA 1HNWB 1ZHFA 1Y5NA 1K8XB 3DMTC 5DEIA 1MJGM 3WRVA 1Q0RA 4WQMA 1R27A 2BRUC 3INTA 3O9ZA 3FFAA 2PS3A 1R0KA 2D74A 3FCUB 3M6VA 1GD1O 1MQ8B 4Q5IA 2V96A 1ML3A 1ZK3A 2P0EA 1PFYA 3LHFA 3OCJA 3VXKA 1XQ6A 2ZIGA 4JBLA 4XAQA 2XGOA 3BB3A 3HN2A 4L27A 2RB5A 3UAXA 3PX2A 3FZQA 2Y2UA 3B85A 4MRNA 2Y27A 1U3UA 2IEAA 3KOXA 4IJ5A 3OT1A 3RSSA 4HN2A 4XASA 1TIPA 2O0MA 3AVUA 3VJLA 5LMUB 1F3LA 5AVZA 4AMVA 1KDTA 3AEKB 2ZJ6A 2JI7A 1FTQA 5C1IA 3S4YA 1M8FA 4QGFA 4YALA 4XPIA 5B2EA 2OYRA 5LP6C 3F5FA 5K0LA 4RMNA 2C5BA 5A4MS 2X4GA 5T64A 3MHPA 3JQBC 1WOYA 4LYDA 3WGIA 3WHIA 4MVJG 4DUGD 3G8AA 3WK7A 5IJ0A 5CW2A 1QOQB 1I7LA 3DT9A 1TM5E 4K9MA 1G5PA 4GW3A 1QPZA 2WIFA 4GOKA 2IKSA 4R2JA 4EKEA 2HF7A 3GIDA 2W6NA 1CULC 3HLYA 5JDIA 3L1VA 2GD2A 3PR1A 4UJ3A 3HABA 2JFUA 3AI2A 1RWNA 3NHKA 4JSRA 4JC8A 1SWVA 4N6NA 4PPGA 3AR7A 4HJXA 4KMOA 5FI1B 2B4AA 3PYLA 1XZPA 3QFFA 4MCHA 3RVRA 3HJCA 2QJWA 1DC6A 2ADMA 4F4FA 1XVVA 2PX5A 3PQEA 1PG0A 1S3SA 5IT0A 1Y8RA 1A9XA 1WTCA 5DBHX 4IXMA 4M98A 4QD3A 4D9MA 5B4UA 2IZ7A 4RK4A 4WMLA 2GRAA 3CVXA 4FI3C 4QFMA 4R3NA 2O2CA 3GLFB 4CKXA 4MVJE 1D4AA 3ZNNA 1Y98A 4C6RA 3H17A 3LXUX 1NF8A 1AXRA 2CFRA 4NQRA 4XQ0A 1N33B 4A4DA 4Z0TA 3EEIA 4FLEA 3RYCB 5B1EA 1IY0A 2P3OA 3KZKA 4ZK6A 3U3ZA 5I4BA 2P0YA 3P20A 2QVZX 4HDKB 4PN7A 5HBRA 1Y48E 1VXRA 1KMNA 5JV5A 1SVIA 4G1CA 4BQRA 4Z9XA 1VA5A 3DEAA 1H65A 3RBVA 4ZEVA 1WUKS 3HNRA 3BA6A 4X6UA 2QHXA 2FR1A 2O2ZA 2H1VA 5E9AA 4Z2AA 1TKCA 2ZUFA 1WCIA 4JYMA 3EQ7A 4XLZA 2FZ5A 5AKIA 5H80A 3RS4A 3FBWA 2FKAA 1U0JA 3K05A 1V8DA 4YIHA 1WS6A 1P73A 3HSKA 1XMOB 3I73A 1VLZA 4K9LA 1EBFA 1QP4A 2X5KO 4P5EA 1XVAA 2WSBA 2XSZA 2JGLA 4XCQA 3B1JA 2PGIA 5IVIA 4A16A 1U0FA 2ZJ3A 3D6NB 3PQ2A 1IJFA 3U4QA 1JDTA 4IDEA 3AHEA 4HK4A 4KFSA 4CM1A 4RHCA 3HCDA 5LZ5A 3HCAA 4CM9D 2N1BA 1KPHA 4IDFA 2G8LA 5FFMA 1FVOA 4EYKA 3IXMA 5KCMA 2CNWA 2PXCA 2FZCA 3OU2A 3UYKA 4FFWA 3CH4B 4V39A 4MA4A 4QZVA 2G1PA 4LISA 2KE5A 4EYQA 1I80A 5KYUA 2VTBB 3AVPA 2P75A 3PA8A 5H5JA 4H3SA 1H4SA 4PZZA 1GGMA 2MSKA 4B35A 1KR5A 3E9EA 4QECA 5IH7A 3B8HA 1VCMA 2EJUA 1W36C 1WXGA 3L7BA 5CCXA 1SKYB 1VE1A 1WU8A 2CBZA 4P82A 1HOTA 1TD1A 4ZAGA 5BURA 2ACWA 3JQ8B 5JR3A 2JFYA 3RAJA 3R9IA 1BWSA 2PH1A 4CIVA 3NBYC 3OIDA 1VPLA 4ZVNA 3OZBA 5KYXA 2QZSA 2F48A 2EFCB 2HDOA 2I2CA 4I5GA 4MVWA 3SDBA 1Q0UA 5HZKA 1WSDA 3FLEA 5EWLB 1IDOA 3CW9A 3RPEA 2GAFA 4HBGA 3F71A 2O4CA 1V16B 3OHPA 4FD3A 2O8NA 1QZZA 5HXAA 1JKFA 2RSLA 4JBHA 4EPVA 1KEVA 4DPMA 5H7XA 3H4TA 2HUNA 4MQUA 3FWNA 5LXTA 2HD4A 1IZYA 1EDDA 2FY8A 4QPJC 2O7QA 2X8BA 1U4SA 4QUAA 5D87A 5ALNA 3VR4D 3ABZA 4TV8A 3BORA 1SZPA 1QB8A 1IZ7A 2QY9A 3EFOB 4OXYA 3F5SA 3UUFA 3W2GA 1P0CA 4PAQA 3ANNA 1APBA 3AETA 3T3IA 4AN4A 2I6XA 4O4JF 4NMWA 3WKEA 1BJKA 1Q17A 3IXQA 3AWIA 1IBLB 1P1HA 2FWPA 2ZB2A 4MYHA