5DK6A

Crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
246
structure length
242
Chain Sequence
b'LYFQSMKAGIIGAMEPEVAILKEKLTDAKSTEHAGYTFHQGQLDGSDVVIVQSGIGKVAAALATAILIDRFQVDYVVNTGSAGGFDASLKVGDIVVSSEVRYHDVDLTAFGYEIGQLPANPAAFMPHDDLVAAAKKGIEQLSQNIKAVTGLITTGDTFMTKEEDVAKARANFPTMAAVEMEGAAIAQACLQLKTPFVVIRSLSDIAGKESPHTFEEYLETAAVNSSQLVLNMLGQLKGKVLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
publication title CRYSTAL STRUCTURE OF A 5'-METHYLTHIOADENOSINE/S-ADENOSYLHOMOCYSTEINE (MTA/SAH)NUCLEOSIDASE (MTAN) FROM COLWELLIA PSYCHRERYTHRAEA 34H (CPS_4743, TARGET PSI-029300) IN COMPLEX WITH ADENINE AT 2.27 A RESOLUTION
rcsb
source organism Colwellia psychrerythraea
molecule tags Hydrolase
total genus 73
structure length 242
sequence length 246
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dk6A00
5F73A 1M73E 3LGSA 2GUWA 4MARA 4PR3A 1LVUA 2ON6A 2OXFA 3EMVA 1JDTA 4JWTA 4OY3A 4OGLA 1JPVA 3DJFA 3EUEA 5B7PA 1JYSA 2QTTA 4TXLA 4WKPA 2HWUA 1RXCA 4GMHA 3OOHA 3OPVA 4TS3A 3UAXA 4FFSA 1OTYA 1PKEA 1PWYE 1T8YA 5CCDA 1Z33A 3UAYA 1U1CA 3MMSA 2A8YA 2OC4A 3OZEA 1PW7A 1A9TA 1ODLA 4F3CA 4R31A 3UT6A 1PF7E 4F2PA 4R2WA 1JE1A 1VMKA 3OZDA 1TGYA 5EPUA 4D8VA 2A0XA 3P0EA 1U1FA 2PGAA 1Y1TA 5KB3A 1V48A 2ISCA 4OF4A 1Z5OA 1A9SA 1VFNA 4IP0A 2A0WA 2I4TA 4OGKA 1V3QE 3NM5A 3D1VA 4YNBA 1RT9A 1Z39A 3K8OE 4QFBA 3E9ZA 5FAKA 1WTAA 4DABA 5CXSA 4OJTA 1RXSA 3P0FA 5K1ZA 5B7NA 1Y6RA 3DPSA 3DF9A 1PR5A 1LX7A 1RCTE 1OV6A 4GLJA 4DAEA 1RSZA 1T8RA 1SQ6A 1RXUA 4F1WA 4D8YA 5IU6A 5F7ZA 1SD2A 4DA6A 4P54A 1K9SA 1ECPA 3NM4A 5CCEA 3IOMA 4NSNA 4YMLA 1A9QA 4TXMA 4DA0A 1CB0A 3QPBA 1JE0A 1C3XA 4F2WA 4F3KA 3KU4A 3BL6A 5ETJA 4WKCA 1Y1RA 1PR2A 1LV8A 3K8QA 1RYZA 1JDSA 1OVGA 3KVVA 1Z5PA 4NY1A 1ULBA 4GLFA 4X24A 4DARA 1G2OA 3INYA 1XE3A 1PR6A 1YR3A 3FB1A 3KVRA 4JP5A 4LKRA 1B8OA 3KUKA 2HRDA 4L6IA 3DDOA 3T94A 1JDVA 1SJ9A 3PHCA 1OTXA 3GGSA 4R2XA 2QDKA 1V2HE 4DA7A 4WKOA 4D8XA 4QARA 1Z5NA 3FOWA 3U40A 1B8NA 3KVYA 3NBQA 5EFOA 2P4SA 1A69A 1PR4A 5CXQA 4TXHA 1N3IA 5IFKA 5F76A 4LDNA 4BMYA 1I80A 1NW4A 2I8AA 1NC3A 1VHWA 1JP7A 3EUFA 2XRFA 4BMZA 3UAWA 1T0UA 5F7XA 5F77A 1ODKA 4KN5A 4BN0A 4LNAA 4LZWA 1Y1QA 1T8SA 2H8GA 3ONVA 3ENZA 1A9PA 4QASA 4EARA 3GB9A 5CYGA 5EUBA 3TL6A 3IEXA 1JDZA 4TTAA 1RR6A 4M7WA 1YQQA 1A9OA 3BJEA 4MCIA 1PK9A 2QSUA 5C80A 4L5CA 2A0YA 4ECEA 3OF3A 4EB8A 4JOSA 3FAZA 1Q1GA 2AC7A 3FUCA 3PNSA 4TTJA 1V45E 3KHSA 1A9RA 1PR0A 1K27A 4OEHA 1U1EA 5B7QA 4D98A 4QEZA 2OC9A 3BSFA 4G41A 3NM6B 4M1EA 3LA8A 4DANA 3O6VA 3PNPA 1CG6A 3F8WA 1ODJA 4H1TA 4QAQA 5JPCA 5I3CA 3UAVA 1Z34A 1ODIA 3DP9A 1PR1A 1JDUA 1V4NA 1TGVA 3MB8A 3UAZA 1TD1A 3C74A 3EEIA 3LBAA 1Z36A 3SCZA 1ULAA 4U2KA 5F7JA 5B7GA 2IQ5A 4DAOA 1OUMA 1YBFA 4D9HA 2AI3A 2RJ3A 1T8WA 2AI2A 4RJ2A 1TCVA 4GKAA 4TXNA 3OCCA 1OU4A 4QATA 2HN9A 3PHBE 4G89A 2AI1A 1QE5A 3FWPA 1K3FA 1U1DA 1Z38A 1Z35A 3E0QA 4DA8A 4NS1A 4LNHA 3O4VA 1Y6QA 3E9RA 4I2VA 2B94A 4K6OA 3BGSA 4WKNA 1YQUA 4PNPA 1SD1A 1VHJA 2QTGA 2OECA 4L0MA 4TTIA 4G8JA 3ODGA 1ZOSA 2BSXA 3FNQA 1ZL2A 1U1GA 1YRYE 1PK7A 5DK6A 3OZBA 1NC1A 1Y1SA 5F7OA 1RFGE 5CYFA 1V41E 4UC0A 4TS9A 4YO8A 3OZCA 2HSWA 1Z37A 4L5AA 4TXJA 1RXYA 5F78A 1TCUA 4WKBA 2Q7OE 4YJKA 3OOEA 1PBNA 4BMXA 4L5YA 2QPLA 1FXUA 4TYMA 4M3NA 4E1VA 4MCHA
chains in the Genus database with same CATH superfamily
3A9UA 3RC1A 1GZ4A 3DNPA 3HV0A 2OZPA 5EJ6A 2WPDA 4HHEA 3BIFA 3GPLA 1IN1A 4J16A 3SDSA 1V5EA 1WXXA 2QTFA 4INJA 4IVNA 3PXUA 3KWJA 3UFXB 1Y3FE 4C3VA 2GEUA 3EVCA 4AAYA 1GO2A 2IYRA 4WINA 1W1UA 4CM4B 4XIGS 2OHJA 2P6RA 3RVJA 1II8A 1J9GA 4TTVA 3QU7A 2OQRA 1JQLB 1KSGA 4L22A 5KNCD 5L8VA 4KI7A 3EA5A 3C48A 1TJ3A 3L1HA 2DEUA 1BO6A 3W0LB 3JYNA 4DYHA 3NUGA 1Y6FA 4UBKA 3AKDA 2D0PB 4HPJB 5CLGA 3BREA 3U4CA 1P80A 4YXWA 1Z2EA 1IN4A 2XZOA 1D07A 2A8YA 1UKVY 2C00A 3MMSA 3RTAA 4D6PA 3TUZC 1XF1A 2IH5A 3DO6A 3OTIA 3RREA 4MLZA 4BE7B 4CG2A 4ABYA 1CDOA 3ZHZA 3OF2A 2HMAA 4R31A 2ILVA 1QRAA 1Z0IA 2XQIA 3C97A 4TMWA 4AUEA 2PXAA 4WKGA 1K86A 3KDAA 4MQFA 3EFHA 1KQOA 2BKVA 1P7PA 2QLTA 2UZAA 4QYIA 5JLAA 5KQPA 2Y71A 3R3XA 2ZTVA 4MS4A 2QUKA 5F64A 4C6RA 1Y7PA 4TT8A 4MVJF 4WNAB 4CL2A 3PD0A 4FZ5A 3IV9A 1JEOA 1NWCA 3GJ8A 5E7QA 4W8OA 3H4TA 1JB9A 3ZHYA 4YRIA 5CA1A 3SS8A 1HYQA 4GE3A 3P2EA 1NG1A 1PG5A 4GEKA 1HM5A 5IAKA 3WO1A 2ISCA 2WZCA 4YWHA 2A88A 2GS9A 3CBGA 3TXAA 2YZKA 2H1VA 2QI9C 2PZJA 3C14C 3IKJA 5B57C 3BJZA 4LSWA 3PHGA 1E69A 1H0KA 2AG1A 2PS9A 3FYDA 3RJ9A 2H0AA 2VAWA 3SFVA 1ZUHA 2QIPA 3DOHA 4KTTE 5FO0A 4XASA 1E9DA 3LWBA 5SY9A 1OFGA 1T2VA 4PPYA 4AKSA 4CZ2A 2Z1NA 1P9RA 2BFEB 2GXUA 3SOZA 4Y9DA 3HJUA 2QAGC 3MYRA 4M83A 5EGNA 5JE8A 3V46A 3YASA 2VEDA 1OWLA 1LW6E 1YZTA 4MW9A 1IN5A 3VZDA 1L7NA 2NZJA 4BVKA 1QFSA 2RCNA 2OILA 5DYTA 3AI3A 3Q40A 5A9TA 1KYTA 1Z22A 3EMKA 1H2ZA 1NUHA 3RWBA 1AGRA 4EUNA 2Z8YA 2KB0A 4CKXA 4JQYA 2VAXA 4ZU1X 2X5NA 1T2UA 2DWCA 2XYQA 1H9AA 4OQNA 1MIHA 2B69A 5TQ2A 4D9GA 5JQWA 4GIBA 4OHYA 5F2NA 4KO1S 3O8LA 1E1QA 1E8MA 2ZSUA 4MW4A 4NECA 4FINA 3DXFA 4MRAA 3WKEA 5HJ5A 4FWTA 2CSXA 5FPPA 5AHOA 1DJMA 1EFPA 1WEKA 1X6VA 5EESA 3WMWA 1D1PA 4NZOA 4ZCSA 4GRDA 4D25A 1NX6A 2FZ5A 2WJGA 1DJQA 3R7LA 3ZXSA 1GUZA 4RMJA 1S2GA 1L7BA 4W9MC 2DKFA 2Q0HA 3MMPA 3BXOA 4NJEA 4MGHA 2C5AA 3MRTA 1XRJA 1B42A 1PK8A 3DAGA 4XOIA 3U39A 1R4NA 4RS3A 1FUKA 2ZG6A 2OMKA 1K7CA 5E6RA 3TJRA 3O84A 4I1OA 1OXSC 2R00C 5FQNA 3KCQA 4JWKA 1VMDA 1E2MA 3W4JA 5L3VA 2A57A 1HZZA 2WTBA 1TJPB 4M49A 1L7PA 2B20A 1SH7A 1XTZA 3G9UA 1K9SA 3JQBC 4EH1A 4FMCF 4J0GA 5F9FA 3FBGA 2XI4A 2WUEA 1G55A 2VP2A 4DR5B 1XRQA 3QNUA 2Y2VA 4YGXB 4UCXA 1KH1A 1SU6A 4IH9A 2BKUA 1U7XA 1Z6QA 3J7TA 5AJTA 1FJGB 1ETHA 5CW1A 1UCFA 3L8MA 2NZUG 4LJ4A 5KZMB 2POQX 5JSYA 1YOBA 4Q9IA 3D8RA 4S04A 1TIKA 1J5EB 1UJ4A 5REQB 2AK3A 4GU5A 2H1OA 5A4JA 2CN1A 4LGYA 1MX1A 1W96A 3DEFA 3SXJA 1ZGHA 4OHBA 1DG3A 3QYFA 3TTYA 3UKJA 1SC9A 2GN8A 3ZHCA 2G7ZA 1TNDA 2F64A 4RXMA 4BMPB 3D3WB 3WBJA 1J8VA 3ZDYB 2QB5A 1TAQA 1G41A 4XLLA 2P8JA 1VPLA 3L7LA 5IPFA 1N2CA 4WEOA 5A4FS 2FMXA 3PLNA 4QOHA 4O2RA 1UPUA 2VQSA 1VG1A 3EX7C 2AC4A 3M2PA 1A71A 5TT1A 5JZ9A 4I1PA 2AKAB 2YJ3A 1L4GA 4P38A 5JTTA 3C3XA 3UOWA 3EVNA 3DE0X 4DNQA 4YRBA 1ULBA 2BJHA 3ZHTA 3IUEA 1UPXA 2ZLBA 3B1KA 4BE4A 2JFYA 3HQ4O 2XQKA 3BIXA 4GAEA 5DLQC 1JQKA 1N6HA 4REMA 2HWKA 2Q5OA 4IHQA 2O1XA 4LOHA 1MENA 4LWPA 4RJLA 3TR6A 5B6IA 2MSDB 1P2BA 5CB0A 4M86A 3OEWA 2WW8A 2L82A 2RHOA 3HCCA 5JSZA 2ZBUA 3KVOA 3VPBA 4J1NA 2R751 2CK3A 3VPCA 1WW3A 4B2IA 3G2QA 3NTVA 3HA7A 3WZLA 2XB9A 3DWGA 4RAQA 3T7KA 3UH0A 4RELA 1RYFA 1S3IA 3C6BA 4FX5A 4C6HA 4HUTA 4CHTA 3KSBC 1JI3A 4GMDA 2IE0A 4GS5A 2TS1A 4MI6A 4U7DA 1BFKA 2GA8A 2ZJ0A 4KE6A 4U2CA 2ZB2A 3QU9A 1N92A 1IQPA 2XXBA 3DGFC 3L6BA 2I5PO 2DF8A 4AJEA 3WS7A 1L6IA 2JGFA 1LFDB 5E7JA 1ZHHA 1R0YA 2GERA 3VTZA 1VZ2A 1GTSA 2NUPB 2R79A 2I4OA 3RU7A 5J4KA 2C0CA 4Q0MA 4HDSB 4QOGA 3NBQA 1H6CA 1DC6A 1KJIA 2FUG1 1D8AA 2OGSA 4ZJYA 3HKBA 2FRXA 5HF9A 4I6JA 3QKWA 4L08A 1UBHS 1JR6A 4EMSA 5JAOA 4BVAA 3ETDA 4MK4A 5MF6A 5G3ZA 4LVOA 5EWJB 1QHIA 3EDMA 1X14A 1FFXB 3B9PA 4MV8A 1IJEA 3CEJA 3QTTA 2CNLA 2GF2A 3KPUA 4XH9B 1EEHA 3H87A 5LXTF 1I80A 4QBKA 1VJCA 3KEMA 4J0EA 5BV1A 2ISQA 4YAJA 3C5EA 1KI2A 2VUTA 3HNOA 2NXEA 2Q6VA 3KKNA 1XHFA 4CIYA 1RHQA 1TVMA 2JG3A 1K4KA 4BB6A 2IHZA 2H8KA 1XIVA 5L3SA 2JLQA 4IDAA 1YS2X 4KQWA 4HLUC 1T0BA 3DUFA 4QXQA 1XQ1A 1S1CA 3TPFA 1T0UA 1IXYA 1ZUNB 1R6BX 1C9NA 3U7QB 1UH5A 4PPGA 4GX0A 4CDMA 3AUKA 5F1OA 1KNXA 3CR7A 3AF6A 3Q0TA 1YNOA 4BX2A 2OXIA 5HKAA 3H11B 1X7DA 2Q1UA 2WIFA 2IH2A 4HQFA 3TUJC 2IZ7A 1JFVA 1COZA 2NO6A 2RSLA 3B1XA 4N76A 2H8GA 1OZAA 1H9BA 3FD8A 1GKLA 1JAIA 1EI9A 1Y9ZA 5ADHA 5GGXA 4EGCB 3IIJA 2O59A 4ODIA 1HL3A 1QV7A 3AXTA 4Q12A 4KRYA 4DVJA 2Y6UA 2V7XA 2AOWA 3KSZO 1AF4A 5ED0A 2LDXA 4YJFB 4BX0A 5FPTA 2QRHA 4IV5A 5EQDA 1SULA 1H23A 3PEWA 3HRHA 1QCZA 1U1IA 2G4CA 2MT9A 3PD7A 4JAVC 3IHWA 3JQ6A 3MHTA 1R10A 1SQ0A 2XE7A 1WVGA 4GZMA 2WWGA 4GZ3A 2ZRMA 2BMVA 4RIIA 4ZDWA 3U3XA 4RTOA 2QVYX 2X8BA 2H2AA 2HA6A 2ZBRA 3CWCA 5K3FA 5IZCA 2XJ4A 3KX2A 2E5WA 3JWPA 4D9FA 2OFXA 1V4VA 2W2MA 1T6ZA 4WH0A 2BCEA 3IP6A 3TZHA 1C7EA 4KPUB 1R4MA 1ZEJA 2G8LA 4UPEA 3DXYA 3EDOA 1PVVA 3F9CA 4LA4A 4AU1A 5JHGB 3RRZA 1LS6A 2IZOA 1YDMA 3CN7A 1KYQA 3PFBA 4CEIA 2HU7A 3BHMA 4LF4B 4UVHA 3T7JA 4IIUA 3UWSA 2BKLA 2C5HA 2ECQA 3KLOA 2VJNA 2HA4A 3JRWA 5CT6A 4DCPA 5A6SB 2JAWA 1JBQA 3S1LA 3CR3C 1W49A 4D4LA 4TKLA 3ROZA 2AZXA 4NU6A 3OQIB 1JKIA 3ZTYA 4KBYA 4LJYA 2MJLA 3AUJB 1NPDA 3NHRA 4FSHA 1ZGAA 2B2CA 1P0IA 1VL8A 4MR8B 2IYTA 1E5LA 3G0OA 1MIOA 2FDCA 2O7QA 4F5WA 3I9V1 3VUEA 4CM6A 2WWYA 3GA5A 3T38A 1TKRA 1EAYA 1VP9A 2B4AA 2J3JA 2WF5A 2ZBQA 3EC1A 2I6TA 1ZD8A 3ABOB 1ZVKA 2ATCA 1NQUA 3MC1A 3CCBA 4J07A 1U7OA 4UE3S 4D5EA 3K9FC 2R25B 3QSYA 4I6EA 1XTRA 2IHBA 1RM5A 4LPKA 4X5OA 4KDEA 5FFNA 1DU4A 1CY8A 4XQCA 1C9MA 3T7EA 3JQAD 2MR6A 1KC3A 1OI3A 2GPWA 1DBSA 1FUEA 1MP0A 4LYHA 2ENWA 5EHGA 3K6JA 5K2MA 2ZI7A 3D8BA 4YUXA 1ISRA 2I87A 4KOAA 3ZDDA 2DFKB 3V7WA 3KQWA 4C0JA 1T2DA 4Z7JA 4YN3A 3NCTA 1MO4A 3NEJA 4WZAE 4DUPA 3DHWC 1Z6GA 4F4DA 3VH3A 2E89A 2IS2A 3DZHA 3EEQA 3RLFA 3IAHA 1UM9B 2PBRA 2JFHA 4XIYA 4ENUA 2CXRA 3G2JA 3I28A 4J0HA 4NJMB 1I7SB 2PD4A 3INRA 2OBMA 5JYEA 2YYZA 1FYFA 3I8SA 5F5LA 1SKBA 3L8CA 4D9HA 5KNDH 1QYWA 3A11A 1FUYB 1EIZA 1ZISA 3VDRA 1CQJB 1DT5A 1BS9A 2QU8A 3A6FA 3TSYA 3AF5A 4BXOA 3EGVA 2LXNA 4GKAA 4K9LA 3GCZA 4ZCRA 4Y2QA 5LUAA 3K53A 4BQOA 1QQBA 1AGNA 3I32A 1TECE 2NU9B 3SX4A 3E82A 4CETA 1CDZA 1D6JA 1LB1B 4FFNA 3K09A 3VOTA 1SUEA 4QDJA 1H2WA 1Q1NA 1HFJA 1WR8A 1YQDA 2PJRA 4I3FA 4MH0R 2FPPA 3HCRA 2BHTA 2ZWOA 3NNDA 1ZJ4A 4MUFA 5BSTA 4A6EA 1IY9A 4EHFA 2PUVA 1ISIA 2Z4SA 4X41A 2VYFA 2C84A 3IAFA 3WQRA 5IASA 2WPDD 5K0SA 4URHA 3LX4A 2C7PA 1G7RA 3RVLA 2V6IA 3DZJA 4DC9A 3KNZA 5IHXA 4CWAA 4G9EA 2HMYB 1E7QA 2FQ1A 2H6EA 1WP4A 2IOYA 1ESMA 1Z38A 4AJ1A 3TMKA 4EY8A 2HR1A 2WT9A 4HLDA 1YL5A 2FPWA 2EZ4A 4DDMA 3I6QA 2DPLA 3PIDA 2CE2X 1L2TA 4XRRA 2QD2A 4RCVA 4ZOAA 5TJ9A 5DWVA 5B58T 1VRCA 3F78A 2GKOA 4QYSA 3E9YA 1RRCA 1WUYA 1WXHA 1P77A 3GZJA 5BW8A 2J3LA 3T4PA 3MGCA 2QLMA 4HLQB 3T06B 3A26A 5EY5B 5ITSA 1E9BA 1R0CA 4CQMD 4YXWD 4LPSA 3URMA 1JEQA 4KDRA 4NFHA 2H9YA 4LRUA 1GWNA 4CGYA 2TMGA 4UQPA 1R64A 1V3UA 4AM8A 3LQKA 1U8UA 3KS9A 3PX3A 5HR5A 1ZFNA 3GUVA 3RABA 1HGXA 3BKXA 1BA2A 3ZDQA 4NYMQ 5DM2A 2ZBFA 1HL7A 1HDZA 3QHAA 3GP8A 1KOGA 1T2CA 2GFQA 1U5AA 2GLXA 1J2UA 2Z9DA 4RA6A 5I7HA 1PK7A 3OJEA 3G8DA 3TNJA 3A70A 4AP6A 2YWBA 1FE8A 4KFCA 3DLCA 4B3SB 4YJDA 1YZFA 1XVTA 2VH5R 5CBPB 1U28A 2QTVA 1VGRA 2J31A 3GF4A 5JEDA 2F9LA 2CFRA 2VHJA 3KR1A 1EK5A 2IY9A 4LZNA 1YIDA 1E4YA 3LG2A 5HJEA 1SUWA 2RHWA 3PXBA 3S2IA 1E61A 1SOAA 3GD7A 4RHCA 4ALNA 5EP3A 3RC2A 3SDZA 3CZPA 121PA 1PWXA 3GLFB 2XTAA 4LMBA 5FV7A 5LA6B 3KL4A 4M7OA 5DX8A 5AW6A 3NP7A 3DKIA 3BRCA 4QHTA 1GG2A 3N2GA 1I01A 1IN8A 1IDOA 2EGHA 2A0KA 1TU3A 2Z3WA 1Z07A 3V4FA 2R47A 3NS7A 2I71A 1E9AA 1LNSA 2AQ8A 2IY8A 3LUBA 1L7EA 3O8QA 4IV8A 4KPFC 5IC4A 1IN7A 2QRNA 5IDWA 1W0JA 4H27A 5DBOA 1IVNA 5I4BA 3FOFC 2BUCA 3ZE7A 2BV3A 1G7SA 4IGFA 4MRSA 1OXBB 2H2WA 2ROQA 1VSBA 5BNTA 1D2RA 4GPBA 3TDKA 4M8LA 1JH9A 2DFTA 1ORHA 3DM5A 3IR5A 4O63O 4L5BA 2QP3A 3A6DA 4QG3A 1TYBE 1WW2A 5LR6A 2B4TO 3T3HA 2CBZA 2BGNA 4AS2A 3BZWA 1NJ5A 2G9UA 5HA5A 1E1QD 3GZTB 3K1JA 4MR7B 2YQZA 1KOJA 3DJFA 3JTEA 3H99A 5J2TF 3NO4A 1JIXA 2C9OA 1E1RA 3P9PA 4MVJM 4RDCA 4AZ3A 1XFDA 1AGYA 5HHTA 1RXCA 3ANYB 3QVSA 4GMHA 3RFTA 1HBJA 3JSXA 4FGUA 3W1WA 1O97D 5J58A 3OPVA 1W5EA 2OKCA 1TZBA 1RC1A 3AUFA 4WACA 1U99A 3THOA 1E2IA 1E5TA 5HMMA 4Z4IA 3A37A 2D74A 2NSLA 1T8YA 1XQ6A 3KE9A 3RARA 2HTEA 1P1CA 3PYMA 1E2BA 2DG2A 2RC6A 1ISHA 1J8MF 1M6VA 1Z6YA 4R8LA 1Y48E 2JRCA 1VYUA 3AEZA 1U0LA 2OZLA 5THXA 1I5RA 1XVVA 2SKDA 4IHJA 4QICA 5FTMA 1WZNA 1GOTA 4Q1FA 3AUYA 1ZVQA 2NTVA 3DBRA 3ZIDA 3NWEA 3DAHA 2H4JA 3JQDA 5FOUA 2JLZA 1ONOA 3E70C 4QUEA 3KEFA 5GV7A 3KD2A 3D6VA 4MV3A 2X5OA 4YRMA 2JA1A 4FHZA 5JUWA 3QFHA 3HMQA 4G8DA 5JDIA 4RF4A 3SVZA 3OZDA 1RAFA 4FEGA 1KFEB 4D8VA 2FRDA 4ZHSA 5KHOC 2G8NA 5IS2A 4BFTA 2H07A 3SC2B 4WX2B 4U3JB 5ED4A 1ZD9A 2REBA 3WL4A 3E18A 4Y2HA 2VK8A 1W85B 1IMOA 1A72A 4WXYB 4CEHB 2FPOA 1VPEA 2WZBA 4FOLA 4J94A 4G5QA 2RH5A 4ZC8A 4KWCA 5DGDA 4CR6A 4E5KA 1SK8A 1S8AA 2P0EA 5IHPA 1X70A 2VK4A 3NHJA 3WRXA 2H1LA 1O1YA 3EVBA 1RNLA 5I5GA 1G8YA 1SK9A 2W2OA 3LKBA 1NBMD 3SYNA 3L4JA 1JHQA 4PZLA 5IAEA 1LDBA 1FF9A 1Z83A 4JJKA 2FRVA 1QMPA 4YNBA 3TW0A 2OHVA 2AZ4A 5FR1A 1V8OA 2R9VA 1E7WA 2VHVA 3LLVA 1Q14A 2PQ6A 3SR3A 5EIBD 3IESA 3S0JA 1NDQA 2O8FB 1IWBB 5EZQA 1NPTO 1GU0A 3EYAA 3PQ3A 5LNK1 5AFSA 1IHUA 2ECFA 4NS4A 5EL0A 2CK3D 1BD4A 4G0PA 3C7KA 3L1KA 1N0HA 4QPZA 4KQJA 4MGKR 1G8JA 2YRFA 2Z08A 3PDJA 3MJCA 3BFVA 3OA0A 4BEJA 3JWHA 4QJ3A 4H60A 1PR5A 4GP9A 4YLYA 4IMJB 3AFMA 4EI7A 4LGVA 1ZA2A 2EFGA 2HLPA 4EQZA 2FLKA 2R6DA 4B4UA 5LQKA 1OV6A 1P91A 1ZNXA 4RGBA 1X8KA 3LCMA 2JH3A 4YMUA 5INTA 5CDTA 3LIIA 4OGFA 3HY4A 1DBPA 1LQTA 4FOOA 5ALPA 1BVRA 9ABPA 2ZIEA 4MINA 4N1AA 4DM7A 3TOZA 4A6XA 1MJNA 2XRYA 1YMQA 1R4AA 4PBTA 2NX2A 4NENB 1JKFA 1JS1X 1T3HA 3PIRA 2Q1WA 5ERGB 3JATA 3R7SA 3S44A 2PFKA 1EFUA 2AOTB 2QJTA 1WJGA 3BWCA 4JJ7A 1PFGA 2P4UA 3OP4A 1PJAA 2NIPA 1KZYC 2P7IA 3HCOA 4JKOA 1G9TA 4JXZA 4B2PA 2EWVA 1E6LA 3L05A 1KARA 1J0BA 5IYZA 5JYDA 5MHTA 3PQDA 2C4WA 4HWRA 5IX8A 4XTCS 3MB5A 3OQMA 3WL6A 3NX4A 2AMLA 1Q50A 1A9QA 3JD3A 4MV5A 3F4BA 4KXYA 3EOZA 1CB0A 3LKDA 4KNVA 4TV9B 3VH4A 4R69A 2VP9A 3GUHA 2FUNB 1DCTA 1XP5A 4QA9A 4MP8A 2J5XA 3PUVA 4YC7A 5DNDA 5H3HA 1J99A 2ZR9A 4WKCA 3KZNA 3OCJA 2V5AA 4AIRA 2BOVA 2XA9A 2JZOA 2EL7A 4Y9RA 4AYTA 1A8IA 3SQXA 1EJ6A 3DFZA 3D3QA 1KJWA 3JPWA 1PFYA 2OBNA 1YS1X 4H77A 4H17A 3TLZA 3OESA 3L6CA 5IF3A 4X65B 2OBLA 3V4LA 5KSYA 1VL5A 1ZM7A 1YT5A 1W36B 1LBTA 4R83A 2Q45A 3ZBTA 1Q0QA 1XRSB 1VKZA 2ODTX 1KO1A 4G9BA 4QT0A 2VK1A 4EG8A 1VE5A 3AIMA 1RMTA 3OIVA 3RE1A 1UK6A 4HRVA 1TMYA 2G4VA 2VKQA 1HETA 4TZKA 4GBMA 4GX2A 5EZYB 1SCQA 5BV7A 4RKEA 1O9HA 2X5XA 1XE3A 4U2EA 1KEKA 4LHSA 4HXGA 1E1CB 3KZKA 1Z5VA 1ISSA 4ZIRB 3UNXA 1I2ZA 4EUSA 1R5BA 1X7YB 4IEIA 2JFBA 5KSWB 3HXOA 2ZIFA 4BWYA 4EF6A 1SJ9A 1XR3A 3EVZA 2Q99A 4UD6A 4GOXA 1C3LA 1QHFA 1QHSA 2PMEA 4ZI7A 5B4VA 1T0IA 1KEUA 2Y9PB 3WXBA 4DYDA 3KZVA 1O08A 3LC7O 2L42A 3ZUPA 4R2MA 1IE3A 4ZA2A 4KOEC 2Z43A 1V2HE 4WKOA 4Q7MB 1GQFA 2Q7XA 3VZPA 4TYNA 1MJGA 1GQYA 3GOQA 1UEIA 2CMFA 2R8OA 3W9SA 4RLSA 1G8FA 1NOIA 2QQ5A 2XNJA 4DOMA 3FZEA 1ZGJA 1BJKA 1YGYA 1TEVA 5ALMA 3Q9SA 1YUBA 1IU9A 4JL8A 4Z0HO 4GFDA 1BXGA 3PXXA 4E51A 1TEHA 1Y3DE 4FM9A 1JECA 3B7WA 1UXOA 1LLCA 3FDZB 3ED1A 4ZICA 1EA5A 4XB6B 2EJWA 4DJEC 2X86A 4F60A 3VDXA 1WQ3A 3EF0A 3JX9A 4IBOA 2E9SA 3B70A 1KVRA 2ZJ8A 1A8PA 4KQXA 4X90A 5F76A 4AQYB 1B00A 2ZJFA 1VI2A 3H8WA 4HAXA 4AY3A 4I5EA 2NP6A 3TI9A 2O2DA 1BCRA 3G59A 3FCYA 4KE7A 4PLWA 4YJ3A 1WXQA 2PT9A 4Q6BA 1CRLA 2DWQA 2ZIZA 3PCTA 4TZTA 5F4ZA 2C94A 2X6TA 3ANMA 4L4ZA 2LTAA 1H1LA 3E22A 3ILHA 4GO1A 2GLTA 4RD6A 3WQBA 2VH1A 1NSTA 1Y4DE 4JELA 2A3RA 3S2EA 3L1IA 4JJAA 4UXIA 4YJHA 1JKJA 1GEGA 4ACBA 2XCLA 1N7JA 2BBOA 1WU7A 2X7HA 3NEPX 2CLDX 2INGX 4KGDA 3OTOB 1GA4A 1ORDA 2Y76A 3B12A 2NYAA 3G9QA 3Q9UA 3R44A 5C1IA 1L8QA 2A9RA 4WMLA 1RBZA 1XJ0A 4IDGA 4UM9D 5CAEA 2YHBA 4C7VA 4EB6B 4ZGWA 4AKHA 4HDMA 4F1KA 3BHJA 4IDEA 2VSFA 1X9IA 3FI9A 4XVHA 3ZQUA 4BFVA 2XDQB 3KKZA 1Q7RA 1EYZA 16PKA 1I2BA 4QASA 3R1IA 4PGAA 3TH5A 4YAGA 2X4IA 3BM5A 3Q5EA 5CYGA 4LNUB 3OFSA 1V1MB 3JQ8A 4FW8A 3LBIA 4E31A 2HA3A 1AK2A 2CJFA 1SUCA 3QVGB 1CRWG 3CTMA 4RPKA 1EKXA 4XE5A 2QRUA 2ZYDA 1M5RA 4IIJF 5GM1A 4H6VA 1WSAA 4J9UE 1DJPA 2C2HA 3W2HA 3IBYA 3BK1A 4ZALA 2EL9A 2B36A 3R0JA 4FIZA 3VU0A 1HEYA 5IKPA 1H2BA 3H2HA 4CM9A 3EARA 2HH9A 4WBNF 4Z4GA 2AZMA 5BQ5A 1NG9A 4B6PA 4TSKA 4FUTA 5JMWA 4XA8A 1G8MA 2O57A 1KVTA 1MA0A 2WWHA 3CUSA 4UXHA 4LXYA 3I0NA 5AVOA 5KYTA 4QTZA 3WFIA 3VHXB 1R0RE 3F4KA 2Q07A 5FHQA 2PYZA 1IY0A 1JAXA 2PKCA 1N9GB 5FBRB 2Q6TA 1SN7A 2WV7A 4DUGA 3KOXA 3ZCSA 1VYTA 2X8WA 3VI4B 4D41A 4URFA 2AC2A 2XB8A 2Q3LA 3LS2A 3AL2A 2CCGA 3RSOA 2BEJA 3PEYA 1SD5A 4IGAA 3GXOA 3LF2A 3HDVA 2GPJA 1U3UA 3BWXA 2ZRCA 4QNMA 3RM3A 4BTVA 1BH6A 3E6AA 4IMIB 1NXPA 5E4TA 1MD9A 4DCMA 3MJSA 5K8TA 3FNIA 4BMSA 3K32A 1HKUA 1T9CA 1AS2A 1A9YA 3AFGA 3HJRA 4BAGA 3PG5A 1RPTA 2RAFA 2UZ1B 3ZGLA 5CEEA 4FMBB 1DV2A 1KYYA 2V65A 4S1OA 4L3VA 1T36B 1UADA 1DKOA 4LQDA 4XW2A 1CC1S 5HXAA 5ICGA 3SJUA 1D2MA 1A98A 1THGA 2J46A 3SYTA 3STWA 4K0KB 4DE5A 1JHUA 1O4WA 2CDBA 2DUJA 4K87A 2BLNA 5EE0A 5AM2A 4NAVA 1WZCA 1COWD 1P1KA 3ZK8A 1LTHR 4RIHA 1YZGA 2KW5A 4OM7A 1Q3KA 2OWDA 4MA4A 2E18A 3IT2A 3DBOB 2I03A 1ULAA 2WSIA 2ZUDA 2XAAA 1MN6A 2FZLA 3X1WA 1NYLA 4PNEA 5I45A 2ZJAA 1QQ7A 5CIWA 4AZ0B 5LU9A 3JAWB 3OZAA 4MDYA 3ZE2B 1DKMA 2R5WA 1YCFA 1Y80A 2BMEA 2DCMA 4QEKA 1I10A 2VYNA 2WVJA 4KKXB 1QLHA 1O6FA 2D4AA 5SYAA 1MV8A 3WLIA 2FSGA 1YJ5A 3R3WA 4UQOA 4AZVA 3GO4A 3BB3A 3ILXA 2BGRA 1AN9A 4MJLA 2HDNB 4PC3A 3BXZA 2IDKA 1Y5RA 3A4VA 4Y9TA 3QA3E 1CNFA 4U6QA 3WK9A 3W5DA 4BWGA 1W0JD 3UCEA 1DO2A 2ETXA 1T5SA 4L02A 4TS4A 2A0UA 2Q8NA 3PHBE 4JUFA 4TMFA 5IKXA 4Q1VA 1Y33E 4V3CA 5SZIA 5TQ0A 3A1FA 3PPVA 4E94A 2XUKA 3H0EA 1SCAA 5LQNA 2EV9A 2NXCA 3L7IA 1YFKA 4GVXA 2JB9A 3E7WA 4F2HA 1O0SA 2MSWA 4KU4A 4QL3A 3QOYA 1CRPA 3QG5A 4UAJA 3CEHA 4RQTA 5IW8A 4KPGA 1UEJA 2DKNA 2F17A 3V1TC 2A4MA 2ODQA 3GFVA 3PDHA 1EWKA 2OUKA 3CE6A 4N5NA 5LD2C 3LHFA 1K9VF 2X8LA 3HA5A 3SNKA 1CLEA 2XOXA 4A0HA 1FQJA 3ZDRA 4G2TA 4JLUA 4KE8A 4MPPA 1YVRA 4R41A 4IDBA 5CM2Z 3NVDA 3I34X 4OHWA 4BFZA 1GD1O 3TOCA 4PRLA 5GOTA 2ZDGA 3KJHA 4JBLA 2OECA 4GX5A 1DKQA 3AY0A 3FYTA 1U0NA 4MKIA 5LB4A 1P62B 5AKZA 4HS4A 4FONA 1G1MA 1PZHA 4HLCA 3D8NA 1A5AB 4I9NA 1EUDB 1I2CA 2GPTA 3URKA 3L7MA 4UTNA 3EHDA 1N6LA 2NVWA 1AO0A 1E9EA 2ZRNA 1CEQA 3V4OA 1G59A 5TEVA 3X1JA 1W46A 2P9HA 3OIWA 1QZ3A 3OZBA 4PIMA 5BPFA 1N6NA 2VNJA 3CHYA 4EGJA 4MKRA 3RAFC 4D0SA 3E48A 4XM0A 5F2EA 1PNOA 4M0KA 3ETEA 2ZT7A 4F4FA 3L6OO 1GRRA 3GFTA 4LJ6A 1M1UA 2CF6A 4ZMBA 1VIYA 1RPAA 4TS9A 1G8SA 1E99A 1VXRA 3KYDB 1YZ3A 1AD2A 2VI5A 2ZP1A 3LLUA 4JQSA 2PUGA 2XX3A 5EHXA 1ENYA 3G17A 5E1OA 3E9NA 2ZTMA 4CIVA 5JANA 1RXYA 3NFYA 4CTOA 5BVGB 4A0QA 3I9LA 3A6KA 5ALNA 1FMFA 4NX2A 4JVSB 2YZGA 1HE5A 4DM3A 5K7SA 4Z4CA 5AXBA 3ZU3A 3CEMA 3OF5A 4HDAA 5HIMA 4C1BA 1LS1A 1W30A 4JLWA 1GYQA 1Z56C 1A9ZA 3L7NA 2ZXFA 3HNRA 3VNBA 4DEYA 4G0QA 2H18A 4MGZR 1N6RA 5AKHA 2KPOA 3FVVA 4X60A 2FF5A 3FLAA 1FXUA 4C0KA 4RFSA 4LY6A 4BLTA 2CW5A 4ZO7A 4AWBA 4ER0A 2FFHA 1XZCA 1LEHA 2BN4A 2JGDA 3HEMA 2OCXA 4GD3Q 4PLCA 3KSMA 5JD3A 2JLXA 4ETNA 1FU8A 3C98A 3FOEC 1RLOA 2V6BA 5D51S 3D5EA 5AM4A 1PZXA 1X0VA 3MD9A 3JZMA 4DQUA 1IG0A 1LTKA 3F3SA 2VHYA 2NVOA 3QH4A 3QVKA 1PUIA 2Z2XA 4FZRA 1MPXA 3E84A 1UP7A 2C96A 1IOWA 3GPDG 1OLXA 5BYBA 3EUEA 3FOAA 2Q4DA 4KLCA 1GPNA 4RFLA 4EVSA 4J0JA 4UFOA 4TUYB 1L5GB 1Q17A 3MWYW 2B1QA 2AMJA 1BGVA 3HBAA 1Q19A 4UU0A 2BR3A 4XX1A 1YA6A 1ZMRA 3TTUA 2PLAA 3UA4A 1A7AA 3OCVA 1QP4A 2FJPA 2FFRA 1RXVA 1QRSA 3EGDA 5KJEA 4YRGA 1YV9A 3WK5A 1Z06A 3L7DA 5K8VA 3GRCA 5D3QA 1OAKA 4H59A 4QQNA 1QDEA 1NBME 2SKEA 4BUJA 3IAEA 3X1YA 2CVOA 1EE9A 2WWWA 2FB9A 4I19A 3NC1C 3T3EA 2IYZA 2DY0A 4XDGA 5KNBH 3VVLA 3NVMB 1EFVB 3TX2A 1F5SA 4CNBA 4F04A 4H4CA 4HNAB 1F2VA 2XZTA 3LSYA 2JANA 4K8RB 4M89A 1JG7A 3EAQA 5JISA 3DMYA 4ZJPA 4D9CA 4C7MA 3W2FA 3EPKA 5K8IA 1RTTA 3C2QA 1V8FA 2XPCA 3PD1A 3I62A 5HGXA 1X1TA 4HH3C 4WCFC 3UT6A 1IRIA 2JLYA 4LCBA 4UUPA 1TZ2A 3CRRA 1RI5A 2V9CA 3C39A 3LYLA 3WWPA 4PW0A 1YE8A 4IXMA 5HX7A 3IELA 1Z9BA 5TDHA 4FGKA 2O19A 3WK7A 4BO5A 1N2GA 3D81A 4DQXA 1WXFA 3P0EA 3NEYA 4N3NA 4O3FA 3UUEA 1ABBA 1QP8A 5EUMA 3QY9A 5A3QA 1IULA 2CXXA 2GA9A 2Q1SA 3HJCA 4OA8A 3ZWNA 5BWLA 3KBOA 3OLZA 4M60A 4PQFA 4MHSA 4HQOA 1D5WA 4RTSA 1CJBA 1FRZA 1XF9A 2G9QA 4LHXA 1H8HA 4WN9A 1JF8A 4OQDA 2QMUA 1U3CA 3OLYA 5ANRB 5LB2A 1E3WB 2XOKA 4I1YA 4DF3A 1MH9A 5I9LA 3QWIA 3UOGA 5D01A 2YR0A 1VBNA 4M7PA 5LBUA 1EFRA 4WFIA 2J5KA 3ZV6A 1VLJA 3TXYA 2Q2QA 1IBRA 2NAPA 3WZ2A 3HCBA 4E2YA 4FNAA 2FE1A 3B20A 3JRXA 1XAHA 4B46A 5HK9A 2O48X 3DOEA 3S2GA 1CNEA 1X74A 3R3HA 1CZUA 5L3RA 3UN1A 3ZWXA 5LU8A 5LXTA 2O05A 5LYJB 3UMFA 3O8OB 3E9ZA 4MUJA 1CX9B 2YQ5A 2XT6A 3D1JA 3KAJA 2ZUFA 5MN4A 6GPBA 3M9XA 1WTAA 3QLVA 4HGZA 5FUVA 4KIJA 1IK4A 2WK1A 2XTZA 3FGNA 3DYIA 4KPYA 2VHZA 2A33A 4NBRA 4LDJA 4E11A 5G0SA 1X9HA 5F3RA 3UHAA 3EXAA 2SNIE 4KE9A 2UXDB 2DERA 3DL4A 2FKAA 3AVWA 4CMHA 3D8UA 5AKLA 5FADA 5DDIP 2WIGA 3O74A 4RK5A 3B48A 1ZVVA 3X2FA 2UXBB 4O5OA 1TE2A 2WPNA 2Y1GA 3BBPA 3LQ1A 4RETA 4WLFA 4DQKA 3E7XA 4TRJA 1SHUX 1OX4B 4B6OA 4E88A 1EX1A 1C80A 4BECA 3B2EA 3T1YB 3UOAB 1KGSA 3SIXA 1ZUWA 4L2IA 5A7GA 3NXKA 1KXJA 3VPXA 3W9UA 1V7PC 4GGPA 1U2SA 2QW1A 4PCVA 3AI2A 2CYAA 4Y1FA 3GNQA 3IERA 1VE1A 3QFRA 2R87A 5ECWA 3M9WA 5EINA 4ZYVA 1JAZA 4JC0A 1ILEA 4MRRA 1TT5B 2ASEA 4RTKA 1AZSC 1BU8A 2CUNA 2ICAA 2ZRKA 2C1EA 3AU9A 2Y0EA 2FYTA 4KRGA 4Z2AA 3TMYA 1TYCA 1SO8A 2F9FA 1RZRD 3GT0A 1KSFX 4ZDIA 5T7BA 4BRUA 4ENTA 3FTFA 2PAFA 2OVFA 3F71A 5FWYB 1PJSA 1N3BA 2ZRLA 1M2VA 4PFSA 4LYYA 4MS1B 5DX0A 3V2HA 2FPLA 2W6MA 3MBOA 3LDAA 2OZEA 4JOBA 4QLBA 5CCXA 1DRKA 2DY1A 1QIKA 3MOIA 4EHJA 1DC5A 4MCJA 5FA6A 1BW9B 2GO1A 3D2BA 4DSUA 2FQYA 1DKRA 4ZO4A 5BORA 1BAPA 4OLHA 4HBZA 4DRZA 4LRSB 3S40A 3UT5A 2R8RA 2X9NA 1PSWA 3NNNA 4KUHA 3KD3A 1EXMA 2YJ5A 4NPHA 4EY6A 5FYDA 3AY3A 5LP6A 4K5QA 2CUKA 1IM8A 4U5XA 2I3ZA 1UJCA 1NP6A 4C7XA 1K63A 3U13A 2J08A 4KXLA 3DPUA 4NRDA 3AERB 3OG9A 3T5DA 4TLDA 3TVDA 3BTOA 4ASUD 4W5JA 3IVGA 4Q1BA 1JPJA 2H1FA 3EWNA 221PA 4AY6A 1TK3A 4E13A 5I48A 1RYYA 1NHGA 4Z54A 3K2QA 3C3PA 2V7GA 1SRQA 2H9IA 5ICEA 4LJRA 3OZGA 2PUTA 4X24A 5JCOA 3B6KA 1ZM2A 4WFKA 1P1HA 1E2KA 4UAVA 2X41A 3G02A 4MQUA 4TL6A 5HUQA 4RK7A 1ECLA 2HWWA 4JP5A 3B2NA 3W7VA 3E8XA 5HZGA 1C50A 1VE3A 3PYLA 2FW1A 3U2QA 5JCJA 2PN1A 4PN3A 4M0EA 4KVFA 3SAJA 1CT9A 5DWQA 1EH5A 5TY0A 2JATA 1RABA 4WA8A 4OXKA 4FYVA 1STOA 3GW8A 2P6MA 1R0KA 2FN8A 3GGSA 3O03A 5G3YA 1ULZA 3BXPA 2R1VA 3MILA 2I91A 1O7JA 2IBTA 2YJ4A 4BVHA 1Z15A 2G70A 2ORVA 4PPFA 3ONDA 1KL7A 4IIHA 3OIYA 2QG4A 4IOKA 4DUGD 3CMMA 2WICA 1EUCB 1GGFA 2DECA 3IOCA 3A9VA 1G21B 2I6SA 3ZX4A 3BK2A 1ZESA 5AK4A 1C7IA 2IUUA 1DB3A 1XAJA 4TXHA 2HF8A 5J9FA 5C4GB 5A0VA 4X00A 3T7SA 4C08A 2ZAOA 4JZYA 1MQ8B 4GPZA 4HAYA 2VJMB 2ZUWA 2TSYB 4U7PB 4XJTA 4YI3A 2KWIA 1KYZA 1FFHA 2ZU6A 1I6KA 5J43A 4IZIA 1P4HA 3P94A 1E3MA 1P81A 1QGUB 3HYNA 3F5QA 4GOMD 5FPYA 4B85A 4RF2A 3G85A 4ZAGA 1E5XA 1PT6A 4KLNA 2ZDQA 3AJRA 4OQEA 1OPXA 1RHRA 3LP8A 1MAVA 3C5WP 4BU0A 3C8MA 1MTOA 1NU8A 1TTQB 5JJCA 1DKNA 3JYHA 3W7BA 1DRJA 4KQ6A 4ZOQI 2Q62A 4XUDA 3COJA 1A88A 3FMFA 1XLVA 5D1HA 4DYVA 4DA9A 2QGFA 3K6SA 5DHTA 3RIYA 2C5BA 2QF7A 1VL0A 2DBZA 5H9VA 1QQ5A 4HNHA 3TQOA 4EAAA 5M7EA 1OBFO 4HDRA 3QE9Y 4ECAA 1X42A 2C59A 1B74A 4B80A 2J0SA 2W6ZA 1DG9A 3DA8A 4UZFA 1M8PA 1PS8A 1JG4A 2I22A 4RTNA 1ESCA 1O89A 2P91A 4YP6A 3CKYA 3SEZA 3AY7A 4NHOA 1G5PA 4PIVA 2VYND 2ZE7A 1ZHFA 4YCLA 4FYYA 2ZM5A 1CUDA 4MP3A 2P0AA 2RGWA 3TQTA 2GUGA 3GELA 1NY6A 2A9PA 3MCTA 5TPZA 3RUAA 5JSKA 1A9PA 1H6BA 1M1NA 3EXIA 5DCUA 4C0AC 2VDLB 1NNLA 2DJIA 2CHQA 2D1QA 1Y7IA 1EVKA 2OO5C 3T0FA 4EHIA 3CS3A 4EMUA 4JODA 1IN6A 1FS4A 1X7HA 2PO5A 4YRDA 5EQTA 3SXPA 4YY3B 3HTXA 3GVIA 4O2LA 4DLYA 1JG6A 4RCYA 3ZNNA 4BRSA 4S1TA 3NHBA 3LFHA 1ZMTA 4DL9A 1RJ9B 1GEEA 2HJRA 4HGQA 3REQA 2HF9A 3DUWA 1ISGA 4B84A 4BS9A 2IS6A 4QAJA 4BJ5A 1PAUA 1UT6A 1MB2A 2J5RA 2I66A 4M7WA 1XZAA 1ODSA 2J9FB 2IOFK 2JCBA 3VH1A 4MCIA 1MZVA 2NQTA 1PS9A 1XDWA 1HZJA 2B61A 3QUAA 4TMTA 3DVAA 1JEYB 1VMEA 2A1TS 3CUUA 2QPTA 1L5VA 2GRJA 2J32A 2RGYA 4HQNA 3Q3IA 3AKEA 3C1AA 2QN3A 4YB8A 5F21A 2RGCA 3L4BC 2ODNA 5ALFA 2IA5A 3IEIA 1OH5A 3UB2A 5TB5A 1QHHB 2YY5A 1YDHA 2RGRA 5C8ZA 2WM3A 3M6FA 3Q7RA 1OHHD 3E3AA 3M2TA 2EHDA 1V45E 4QGGA 2HU5A 3U0BA 5HYVA 3W5AA 1FLVA 1SOWA 1CERA 3TECE 2EKBA 2J0UB 1VZ3A 1VB3A 2VK2A 1W4CA 3H84A 3QLTA 3CNNA 2DR0A 4HADA 4C0HA 4IDOA 2NPFA 3PR1A 2ZJ3A 3CLVA 3KOYA 3ROMA 1M0SA 1G3RA 1ZAKA 5JAHA 2JVJA 3SF0A 5GTDA 2ZOSA 1SCBA 4KRFA 4YCNA 2V9PA 4B32A 3IBGA 2VNAA 2KBFA 4AMVA 4LSGA 4LVUA 2FFBA 1ZK3A 4QGSA 1FA9A 5IXYA 2X40A 2VHTA 1S1MA 1R15A 3HCPA 1YU9A 1JWBB 3DP9A 1XELA 3D4OA 5AVWA 2PKXA 4RK4A 3H2GA 1LCIA 3BB1A 3Q8XB 2JCVA 3RF6A 1E9CA 1IYZA 1AX9A 2CXNA 2EX4A 2NMVA 1MOZA 2GPYA 4TTTS 3KAKA 4TWIA 1YMUA 5H70A 2CCJA 1Z4PX 4W5TA 1PJTA 3MHPA 1II8B 4UHBA 4CCAA 3AEKB 4H7PA 3PLAE 3ORHA 1XA0A 4OI2A 2WWRA 5GVRA 2AUTA 3BWMA 3AP3A 3QHQA 4YAOA 1KVUA 3V1KA 1L5OA 5KTNA 3IOYA 2Y8EA 1Z0SA 3CF4G 3U3ZA 4WY5A 1YUMA 1IHYA 2HV9A 5AKGA 1C14A 3NWPA 2IQIA 3M6AA 5J4YA 2PH7A 1THMA 4B3FX 2OPHA 1ENZA 1VE9A 1T35A 2ZSHA 3BMNA 1WF6A 3CNOA 2DBRA 3PUZA 5DI3A 2AEJA 4KW7A 2HN9A 3KKQA 4JITA 4IJVA 4DIKA 2FPIB 4FBGA 2FQXA 3UATA 3C16C 1WD7A 2V0CA 3CT4A 2RAPA 3EQZA 1LJUA 3P9QA 3PWSA 3QZUA 5LMZA 3RRJA 5HM6A 2F1HA 3PI6A 2O0MA 4AD8A 4J0CA 4E03A 3FSEA 4HF7A 1UKAA 3N2KA 3OEHA 3IDFA 3IDOA 5L45A 4GBGA 3VJMA 3LY8A 4BCBA 1FOEB 3G7SA 3ONEA 4DILA 2A67A 3PS9A 5CK5A 4F45A 4MS4B 5L51A 3RBAA 1TK9A 4OMFG 2UKDA 2J1LA 1DXOA 2B8TA 1GT91 2P4EA 1KPHA 3BXXA 1LX6A 3FLMA 3IUQA 4DIDA 5CA1B 4H1HA 5G1OA 2IYUA 4PFKA 3ZJTA 5FOSA 3T52A 3DXXA 3L0BA 2C61A 1Z4OA 2W2LD 2XB4A 3UV6A 4Y9SA 4BOYA 2PLRA 1O97C 1D7OA 2C9BA 5H16A 3IODA 4FOPA 4R5HA 5BSGA 3RC7A 1P5ZB 1UMCA 1LVGA 1SHZA 5BMOA 5LZ7A 3UJNA 1J0DA 4MYHA 5E6UB 3Q8WA 4KQMA 1BH2A 3W6OA 1GTRA 1BE1A 5SICE 2X6QA 2QT0A 1QVWA 2Y9MB 1YAHA 3JU3A 2RI6A 4GXRA 3G2MA 3ISTA 4Q1DA 1V6SA 1CUIA 1H1DA 2YHAA 4WZ6A 1P2TA 1ZOSA 2R62A 5K3DA 2P90A 4M1YA 4QULA 3DOJA 4ZOLF 2ZYAA 3QXHA 2IHKA 4XPIB 3LL7A 3LGXA 2QK4A 5AQ1A 1H93A 2Y68A 4DKJA 1DRWA 1FUUA 4MQMA 4PV7A 3T9DA 2WJ6A 3W5CA 5FX2A 3HDGA 3GLGE 4XJSA 3EXFB 3MUOA 3JASB 2GM4A 3FPEA 4EGFA 1JYFA 1NC1A 2FFAA 3AT1A 5B55A 1UQUA 1P1IA 5TQ2B 2J85A 2AE2A 2HEGA 3OZSA 1ECCA 5E9WA 1PV1A 3HPRA 4GWKA 4JQOA 2VCYA 4BB5A 3N07A 2QN1A 5A5VA 4GDFA 3PUWA 4ZKEA 4G37A 4H4DA 2Q0SA 1Z37A 2VSNA 5HUJA 4L8LA 1D4ZA 4R16A 1MTZA 1AMUA 5AI8A 4DADA 2P2CA 4FVTA 1YB2A 2K5UA 3BTVA 4NJEB 4R0MA 5EKTA 1Y6ZA 2XOKD 1IATA 3NHAA 1M2EA 3WLMA 5IM4A 2B5VA 1CVIA 2PQ0A 3ADCA 1EFRD 1USIA 2VUSA 3DOIA 4EHNA 1QV6A 3EZ2A 1ZXBA 3P45A 3FVWA 4YK7A 1YKGA 1PV2A 1D6NA 2VPYA 5KREA 4YYZA 5CFOA 4R7TA 4G5HA 3AVOA 4FILA 1E0KA 2LZ0A 3MEQA 1AY0A 1R27A 1OU0A 3C6QA 4KEAA 4KMMA 4RIGA 3SICE 1C7ZA 1KZ1A 1M73E 1Y4UA 2G09A 2VHQA 1KYVA 2IYXA 3QLJA 4R8SA 5EIBC 1QB7A 4OHUA 1CJVC 1HE4A 2G76A 1Q0UA 5EMMA 3N05A 5HJ2A 1M2NA 1PDWA 4JEMA 4DGSA 3I2KA 4LRTB 4D4MA 5DHRA 2RG1A 1R0ZA 5LQRA 1QKIA 2ZWAA 5B7PA 2LD4A 1OVMA 3WGOA 2WTNA 4WA7A 2E85A 4EGQA 4YAKA 4E14A 4YT2A 4LW8A 3NGLA 3EZNA 2ZI3A 1AHPA 3KK0A 4UBJA 2IV7A 5KYKA 5L4NA 4COOA 2Z2ZA 5A05A 4G09A 1WABA 3CIFA 5C37A 4MW6A 4HI0E 5I7VA 4DV0B 3O1LA 4RMNA 1XD2A 5DTEA 3L6UA 5F1YA 2B78A 3DMNA 1YRWA 1AC5A 5JSUA 3IAM6 1N2CB 1QHYA 4ALJA 5BW5A 1DBQA 1GGHA 1AE1A 2A5GA 4AWAA 1NMYA 4K9SA 3UAYA 5AMXA 2ZAMA 2VHEA 3WGTA 1V16B 4XZ3A 3CW2A 2HXSA 3CY6A 3OSZA 2POCA 3P9CA 1BCSA 5BQPA 2PG3A 1JT2A 1M33A 3WIOA 4UUBA 1NE7A 3A1SA 3DV2A 4II3A 4NBLA 3K9CA 5K2OA 1K75A 2YWCA 3L2OB 2QD4A 4ID9A 3DFUA 1HG1A 4ACAA 3FHJA 2CLHB 5F5XA 1QUEA 4L07A 2PSJA 1JQ3A 2GBCA 4OFBA 4PO1A 3W5UA 2P1ZA 3G0GA 1N8NA 2H1WA 3OOJA 2O2IA 3R20A 4V0SA 5JSZB 2YYSA 3DMRA 1OW3B 3FFWA 3I23A 3MNFA 1RYBA 1TGYA 4LS3A 3WV4A 4E5SA 1V3VA 5TGZA 1U9IC 2JD2A 4Q3AA 5AOAA 5LA6F 4CG3A 4D92A 4D4HA 4UM8B 2JGLA 3RYIB 3NTRA 5KB3A 3C8DA 4IDNA 2HJGA 4A0SA 2J5QA 2UV8A 4N65A 3VPSA 4K28A 4OF4A 1DMSA 1F3OA 5TJHA 4HX9A 3L40A 1Y63A 1NAHA 3HRKA 5EKSA 3AF2A 5DBIA 4LX8A 4RV5A 3KIPA 3KLPX 4FB4A 3FIUA 4MI3A 2FMFA 3B38A 4FGWA 1RQNA 4EZIA 2VF7A 1JWLA 1XXHB 3MOGA 1UFKA 5MFZA 1L3IA 1T0HB 1Y4ZA 4YUWA 4ITRC 3LK6A 1S3SA 5EHIA 3B3JA 1VSTA 4C0LA 3QXGA 1FXWF 4RANA 2ZR0A 1M6YA 3SBDA 2VTBB 1UQRA 3E7DA 2WTMA 4QFBA 2ZYIA 3B78A 2YX1A 5JAMA 4FFDA 4KHZA 3H5IA 4IGIA 2B2XA 3H42B 4A3SA 4LTNA 4PYNA 5AI0A 4OA5A 1T6YA 3MT7A 5AR1A 4Q03A 2QRJA 1NRXA 1G8HA 3GFGA 2XWQA 4IKPA 5JCJD 2ZYTX 2I62A 2VOJA 5K1ZA 5C34B 3U7JA 2C4MA 1RJFA 3T5PA 3EPHA 2J7PA 5AVUA 2C78A 2J9XB 3HEAA 1PVDA 2W6JA 2C0QA 3COYA 1ZDMA 5AESA 1WVMA 3DF9A 4AMGA 3MTGA 1R50A 1QPGA 1I9CA 1QHNA 3ISVA 1F14A 1JUDA 1K7EB 2BAGA 2WMOB 3DUFB 1JSZA 4J0KA 2BM0A 3FWKA 3HM9A 1TKCA 2GHQA 5C8YA 5L9AA 1C7FA 2J48A 2X0KA 3FTCA 4LSMA 2NTYC 3WP0A 5JLJA 4PIPA 4J29A 5AUOB 2H85A 3ICEA 5EUCA 4FKZA 1Q0LA 3L0SA 1W4AA 3EIWA 5DT2A 3PXEA 2MYPA 4RO0A 3TSWA 5BXQC 1L5HA 3WK6A 1N7IA 4EG0A 3KU1A 1KBOA 3GDGA 1DNPA 3HJAA 4GKVA 5TE9A 4E7OA 2RIPA 2CFTA 4O4LB 3LBNA 4HH1A 5IABA 2QN9A 5IU6A 2EFCB 5BN3A 5E2BA 2OGTA 2R4TA 3U31A 1LBQA 2F2TA 3VPFA 5DOZA 5CDHA 3QOXA 5EE5B 2XJ9A 3BEDA 1N5KA 2CLKB 4G6ZA 1OFUA 1GL3A 2I1LA 3DL2A 5CXUA 4N9WA 5IXJA 4ZQIA 5IEJA 4X54A 1GGVA 5ECYA 1D1SA 1LK0A 3CX7A 1XCMA 3PTZA 3UK2A 1INLA 3IMEA 5B36A 1C41A 2PGIA 1AV6A 2A7QA 1KIMA 4C7KA 2C7QA 4HPWA 5AKKA 1PLLA 4TRRA 2DFLA 2W8BA 1YZVA 1GGMA 4BLRA 2C9DA 1BROA 2GTIA 3G49A 1R4MB 2CV1A 4W63A 4ZT3A 5FI3A 5DSTA 5F35A 3DTYA 1FDVA 3IPAA 4FGZA 3I83A 2BHLA 1ESZA 4H7EA 4Z0PA 3BDIA 4CEIB 4ZOCA 3FWNA 2QL7A 1N1GA 3L92A 3NHSA 3CM0A 4FYWA 1QG4A 1UJ2A 2NSJA 2PH1A 2UUPA 3GJQA 1OX5A 3C6MA 3HB0A 3WLQA 4Z6KA 5CLQA 4E70A 3U4IA 2EC5A 4JLSA 4U0JA 1FTGA 4FEEA 4P5PA 5KIAA 2B82A 5TPZD 4GGMX 1N77A 4LG1A 4AG5A 1MX3A 3L8DA 3R0IA 1NZJA 3EQ9A 4K3VA 1RVDA 1EBFA 1U7ZA 1P5RA 2IJGX 2Q1YA 1PW5A 2QWXA 3DEJA 3PC8C 1DAFA 4K1XA 4TWZA 1RHKA 3AF1A 5IVKA 3MT0A 4FIDA 2D5LA 2JZCA 4ICIA 1EBBA 1OJ7A 3FSGA 5FPHA 3VU1A 1SEPA 3DMDA 3WLHA 3C15C 4DLZA 3MS7A 1V5WA 4URXR 3L84A 1BKSB 3OIUA 1NR5A 4YCBA 3KOMA 3WYCA 4ND6A 3OOYA 3WICA 3RSLA 2R11A 5KYYA 5JDCA 1DDOA 1MBZA 1ZH6A 3FCAA 4U39A 1JIVA 1W2WB 3B5JA 3I58A 1RWKA 3H8SA 1MVLA 3MTBA 2CBXA 3OETA 1WVIA 4UUMA 2W6QA 2CLCX 1Y34E 1RRPA 3HYRA 3CVWA 1HOXA 2XGSA 3ON5A 2ZVDA 4R2XA 4OJKA 4BNNA 3D0QA 4DA7A 1LDEA 3QKUA 4CM5A 4Z7NB 5T4FA 2IL1A 2Q2NA 1P44A 1V5IA 3VFDA 2HJHA 1K7FB 2RGBA 2PVSA 2O8BA 3IQHX 3LSTA 1EE1A 5LC1A 1D03A 2F1OA 2YFYA 1QX4A 2JLCA 2P4SA 3L8GA 3V55A 4A8JA 4CN9A 4OK3A 3DDHA 5CXQA 4DR1B 2DWOA 3DDZX 1A2QA 4XJVA 4D44A 3F5DA 4KK3A 5IKMA 5KYXB 4KV9A 3RIHA 1F2TA 2J5BA 4HDKA 2XUZA 3E61A 3HXMA 4TV9F 2EJUA 4NCAA 5KQRA 2Z6VA 4FOSA 1PX2A 2YC4C 4MGEA 1NQXA 2RAVA 1MV5A 4LDNA 3C4QA 4RZ2A 3VC3A 5CDYA 1C1DB 1B0ZA 2Q46A 5DV9A 2W7TA 2B4KA 2FPPB 3SSMA 2JBAA 1CD5A 1UP6A 3JQFA 5CIQA 5JCPA 4QHSA 6ABPA 3HYTA 1NR1A 3EUFA 2IHNA 4TTPA 5B53A 1OYWA 3UAWA 5EVCA 4MEBA 2IXTA 1GLGA 3SKVA 1UBLS 1U31A 1YE5A 2E6UX 3DTVA 5DMHA 4EA9A 4OU4A 5D5HA 4DZZA 1YHYA 3G9ZA 5FUXA 4HEQA 1YI0A 1XTSA 3Q3JB 3ADBA 3KAQA 2GBGA 4TX1A 1GU7A 3I42A 1NNI1 2FETA 2D0IA 2ODPA 3R6LA 4IG4A 4L73A 5K0NA 1YK0A 2Y1KA 4IICA 1BQ3A 2NXWA 1Z4NA 3GXBA 2JFQA 3V8MA 5JO0A 3ONVA 1I8TA 2FPMA 1SZPA 1LW7A 3EOAI 4JVMA 2P68A 4W1PA 2C3MA 4KXMA 2JCGA 4MUXA 3W2EA 4POOA 3LQFA 3FIJA 4BUCA 1C9KA 2G72A 4U5QA 3UJ3X 1T3ZA 2QRQA 3MFYA 7MDHA 2CLLB 1EWQA 1WTCA 2YWDA 2WJYA 3GH1A 1NBEA 2FHPA 1FJHA 1USKA 1UMDB 3SYRA 1IG3A 2C31A 3R3UA 3ZWPA 1H5UA 1XMSA 4L27A 4N8DA 4WHMA 3DLHA 3BWDD 1XLTA 4NU8X 1VSUA 4PTZA 4C4YA 2OORC 4YP7A 1RYEA 4LBYA 4MCAA 4HEA1 2BGJA 2O5CA 5GJWC 4NEGA 3CX6A 4EG3A 4LXGA 1V8ZA 4DVGA 4B3XA 5F98A 1ZNWA 2HBZA 4GKKB 1AKUA 3R5HA 3OEHD 2PPVA 3D9QX 3CF4A 4OTZA 1T5IA 1X7WA 4KTVE 4EVIA 5BWBA 4MDEA 5JS1A 3HJBA 4CLOB 3ESYA 3GMIA 3PQEA 1M1YB 5CW2A 4RIFA 3GVHA 5K0GA 5KJCA 1Z63A 2YBDA 3RWMB 3M7IA 1GFZA 2VF8A 3LVRE 3Q41A 1EQUA 2VZ0A 4D0RA 1E94E 4JCCA 4ZO9A 1G5QA 3DE5X 1KAQA 1KERA 1KK0A 1RBMA 2QTVB 2YICA 2GVNA 2ETVA 3M4YA 4OH1A 1JHPA 5T64A 5JRJA 3BDAA 3L06A 3DHVA 4FKMA 4OPMA 5AHRA 1R0BA 3B7PA 4ESOA 2JLSA 2IP4A 2D1SA 4HYYA 1AQUA 1EDBA 4FGSA 5CRIA 1MOSA 3HDQA 2AFRA 2XDAA 3SFZA 3DAOA 1EK6A 1MUUA 3QW4B 3O8DA 3W6PA 7REQB 3U5ZB 2OPBA 2QP4A 1NM5A 3LXXA 3PQ7A 4FHEA 5I5EA 3N2GB 5JAIA 1U7TA 1PHPA 3N2EA 2IFTA 1B8PA 4ZRNA 1BMDA 3NRJA 3GG9A 2OC9A 2JIRA 2J9YB 1IBMB 3NBMA 2J59A 3NM6B 1ECJA 4DRYA 4KQCA 1Z2DA 3O6VA 2XWPA 2OCIA 8AT1A 1R8YA 2OHGA 2XKKA 1AURA 2O1EA 3CT6A 4MVJG 4DZRA 4IQ4A 3BIOA 3O3CA 4DMLA 3NTUA 5NULA 4KVZA 3I9KA 1Z08A 2FR8A 3QW2A 1OAOA 4S0XA 1K2WA 2V7WA 3EEIA 5EP4A 1Y3AA 4L3OA 1FY2A 3AWIA 5LMNB 4BJ1A 4UDXX 1CF9A 1GPYA 2PPLA 2EF1A 3HJFA 1PKXA 4KQFA 1PL6A 3C3AA 2Q1XA 3NZEA 3P4UA 4HAOA 1ZUD1 3DLPX 3WLJA 4BQFA 3UMSA 2YRXA 2F48A 2PRJA 3DWFA 3I1YA 4BMVA 1FTWA 3HYSA 4YV1A 1D7AA 3ZYCA 1DCKA 5FL7A 1U81A 4CG0A 2PSSA 3T5GA 1VPWA 2AWOA 4KXFB 5ADVA 4FXOA 4I5IA 1G17A 1KO7A 2CXPA 4J43A 5AK6A 3WGUA 3J81k 5LWQA 3SQWA 2WIKA 3I05A 3OCCA 4R6XA 3T7IA 3WGQA 1I7NA 2EKPA 3V32A 4H6PA 3R7AA 4CLXA 2P9EA 4GP6A 2VSYA 5AD1A 3M6XA 1CEXA 2F8TA 2DPHA 2X7JA 3ZDZB 2RHMA 1BNCA 1NFRA 3WIEA 4NMXB 2Y66A 3TTXA 3DBRB 1T3GA 3V3TA 1ZW6A 2Z09A 2ZRPA 2A58A 2PWAA 1JEJA 1T1IA 2EGGA 3ASYA 3OQJA 4NCHA 4CFSA 4ZO8A 4GE0A 1WUTA 1HA3A 2JIZA 3IP5A 4WTOA 1E0SA 1XVUA 4F3NA 2WLSA 4EKGA 4OQXA 1X7ZB 4DJ5X 1N4AA 1LJLA 3I30X 2R5NA 4RH3A 4PG4A 4KPEC 2G0NA 4DNXA 1IHPA 1HDIA 2FOLA 3TRKA 4RD1A 2ZI6A 4I2VA 1SIOA 2WF6A 5BOSA 3A2KA 2RK3A 3CN9A 3GEBA 2IHUA 3P0HA 2ZPTX 3W3AH 2IS1A 4MKXA 4BKQA 4ZYUA 5EJ9A 1A9XA 5T3UA 3O1HB 3LYUA 4GM0A 2VAPA 1X7XB 3Q0EA 2KM1A 1GSHA 1AKYA 2PRIA 3MJTA 4QLOA 2JFWA 3KPWA 5I4KA 1LF5A 4MYUA 2P11A 2JJYA 4KJZA 5KKAA 3WFJA 5CFRA 2CNNA 5K5EA 5M04A 4F7WA 2VJOA 1KK2A 3ZXIA 4B9AA 1XV5A 3B1FA 3DT8A 3DD5A 1DQSA 1GIAA 1EVLA 5BN4A 4JXXA 4B3RB 2IF0A 3D1LA 4MWCA 1P18A 3O4JA 4PAQA 3V8NA 3K0SA 1O9BA 5F2OA 5I4CA 4KFTA 2V59A 1T25A 1DC7A 2J09A 2DHQA 4PONA 3LDUA 5C1BA 3NDIA 3W5VA 4O4JF 3H9JA 4FFBA 1DCMA 4MUGA 1AUPA 2IZ1A 3JVVA 2BUAA 4QELA 4K26A 3ZJ4A 3TFOA 2PSEA 4FS8A 2IDJA 1NXOA 1Y1SA 4IVRA 1PI3A 5F7OA 1Y7HA 1TQ8A 5CYFA 2PRKA 1UPTA 1NLUA 2FG6C 2QTWB 1BDIA 1XMXA 3GLVA 5HZHA 3O8RA 3C4VA 1GRNA 5IWAB 1LRLA 4KXWA 3UAOA 3DVLA 3F98A 1OLUA 4LFAB 5A1TA 1KBZA 1KBQA 5EG5A 1A96A 4TXJA 3TMAA 4YT4A 2CJPA 2ZRIA 2ZIVB 3BK7A 4CKCB 4L5IA 1LC3A 2JJ2A 1WUJS 5JJKA 3IVCA 4P31A 1H05A 2A4KA 2ZE5A 4CLEA 1K5DA 1JJIA 2IYWA 3BIWA 3MJ4A 3BTSA 5BOVA 3UH1A 4DMFA 4LF8B 3F90A 1N2BA 2R7MA 2DQKA 5J5AA 1N32B 4ESVA 1XWWA 1I7DA 4BP8A 5F4BA 3TFQA 4EY5A 4IO1A 1JPNA 1TOAA 4M1MA 3OMXA 3RFUA 4HV4A 4IRUB 1U65A 3LGSA 1TAHA 4GVLA 3WSVA 5IYZB 3DCYA 2D7JA 3DT6A 5LKAA 4P83A 1ZLXA 3DW3X 3GARA 3MA0A 2X0FA 2H5EA 3OQ1A 5LLSA 2W6JD 4NMHA 2E2WA 3TLGB 1D1TA 4KSYA 2FLWA 1JYSA 3A8TA 4KSBA 5D7NA 1YZNA 2ZJ6A 1ARZA 3RH0A 3GEMA 3OLXA 3ZCUA 4E4TA 3WAGA 4RDIA 2PEYA 1CZOA 1KAGA 3NRBA 2WKWA 1HT0A 4TS3A 3TL3A 3VAYA 4H16A 3P71T 2X9GA 3EZGA 4HXEB 1PE0A 4DLSA 3K70B 2R6HA 3ES9A 1HURA 1PWYE 3OIDA 3WC4A 2N42A 3VAZA 4A2CA 4O8CA 4O08A 5CCDA 3STUA 4M0CA 1V1JA 5SV2A 3OO1A 1PG0A 2BFAA 4BV9A 2QJOA 4NFSA 4UNSA 2COKA 1G21E 1U1CA 2EBFX 2VF4X 3WOHA 4AY4A 5DNWA 3G5UA 1GGNA 2EG9A 2WEKA 5JADA 2EF0A 3NASA 4WK2B 2WTEA 1RDFA 1PU2A 2BKAA 2IOHA 2IYPA 1M34A 2MHCA 2Q8QA 4Y30A 2IIQA 3AXSA 4ZU3A 3WJAA 5IFLA 4IO0A 4PANA 3S8EA 1IQ0A 1JVNA 1U9JA 3DCJA 1E66A 2P5UA 3P4YA 3FHCB 5LOVA 1QU2A 3NAMA 4CR8A 1KQPA 1VLVA 3R5FA 4FZVA 2BEVA 3RTDA 2OP0A 3U61B 3PFFA 1JLLB 4BP3A 4ZK2A 1YR2A 4JFAA 1XTPA 2YMLA 1M6HA 3C6ZA 5JNUA 4X97A 3Q4GA 1Z26A 5E95A 3R7WB 1NVGA 2HNBA 3GLHA 1V5GA 3MLEA 3FWYA 5T5QA 1GG9A 1T0PA 2CVZA 4EKNB 1NOJA 2ZYHA 3OLQA 1NUPA 2H29A 1ZVJA 3QPDA 1LH0A 4IP0A 3P9YA 1Q57A 1XYYA 2ATXA 3LX8A 4MRMA 1Z74A 1XOIA 4WOJA 4OFXA 3LHDA 4OHOA 4B8ZA 3KT6A 2X7XA 8ADHA 2EP7A 5JXGA 4MYDA 2HIGA 4MVJI 3SN6A 4YRKA 2AN1A 5FWAA 2QTNA 3OU6A 1SBCA 2H1CA 3ND6A 4A7PA 1KRXA 1BXGB 2QXYA 2HRBA 2G77B 2XDWA 1SBHA 3SLRA 4BP9A 3ENNA 2O52A 2JH8A 1PCXA 1DX6A 1XU9A 3ABRB 3DNFA 5BPHA 3NDPA 3WSTA 1FX1A 1POXA 1V6CA 4YEDA 5KWVA 3TSZA 1G8GA 3N75A 4REOA 3IUBA 4B6SA 1PLKA 3FSGD 2ZBDA 4RE6A 4TVSA 1EFKA 2X0NA 2ZTLA 3K0CC 4JQZA 4NZ9A 5JFTA 2DP4E 4AZWA 2XCTB 1UFRA 1SG6A 3BE5A 1I3CA 3VNQA 4YBRA 4OQZA 1IY8A 4WZBB 3TTVA 2H5LA 4EY4A 5T6MA 1E63A 4YJ3B 1BCRB 2OV8A 1UAGA 2AFIA 1JTFA 5DCLA 4ZHQF 2EBHX 1LX7A 3E03A 3O2JA 1RYNA 3A9SA 3BMQA 3C7TA 4IFBA 1S5PA 3Q7QA 3KQPA 1JEDA 3PEEA 3SDBA 3HB5X 1EVZA 4YJHB 4KXUA 1UBOS 2QAGA 2E4XA 1KFKB 1DHRA 1HTTA 1OWOA 4DUZB 4PWYA 4DLVA 4S1PA 4B44A 5IT9A 2LP4Y 1KNQA 2CLIB 4IIDA 4MULA 2B92A 1EGMB 2JFXA 4JQCA 4LYGA 3S7TA 3VR6A 4AKIA 2ADOA 2QRKA 4D7AA 4OIFA 4L85A 2ALJA 2XXAA 3CEAA 4MUHA 4JGBA 2PJUA 5F52A 5LWHA 4YRPA 2YUIA 4OGWA 2ZAIA 3KJFA 4Q15A 3N8NA 3NORA 1ECPA 1G4HA 1NIJA 1NXTA 1ACJA 1D9XA 2CXOA 2FOXA 2QL6A 2I8LA 3BQ9A 3JQ8B 2ZSFA 4GF5A 4ZCIA 5ALQA 4X71A 3TE7A 3HUTA 3TNDA 1Z0KA 2NYRA 2PZMA 2PDAA 3SM3A 3RANA 5AM1A 4MHTA 1E4VA 2OHHA 2QBYA 2E21A 2JVKA 2XCIA 4IRMA 4L0DA 4M7RA 4CKBA 1FTYA 1CZRA 1GCIA 1NNSA 1IL0A 5G1NA 1DAGA 3BL6A 3ZXUB 1NYQA 1RYDA 3V9PA 1MO6A 1VI5A 2R6FA 3DTVD 2Q9UA 3IQXA 4DLUA 4GOOD 4XARA 1J7JA 4G97A 4NZMA 2PUFA 1BHO1 1NJSA 1RKBA 1L5SA 1P2SA 2R00A 3H4VA 4Q9NA 1QVVA 2FK8A 2IUFA 2ZEJA 2ZS8A 3O9VA 4LZJA 1WMDA 3SZMA 1WEHA 1YR7A 3ZY6A 1NVFA 2OK7A 5JY1A 4NOMA 3U7FB 2GAAA 3JQBA 1QAOA 3GT3A 1YS9A 3HU3A 3T0GA 2VRNA 2HXGA 1TI7A 3DC2A 2FGJA 2JKVA 1IEVA 4BVEA 2PU7A 1WUKS 2E55A 4MWOA 4BNUA 2LUOA 5I9BA 2PIDA 5K4HA 5EIHA 1IVYA 1M1ZA 2WU8A 2D8AA 5IT4A 2QLJA 3M33A 1U3WA 4G0NA 2XTMA 3WTBA 4GLBA 4CW7A 4JLDA 1YWGO 3CH4B 3OUTA 3PDIB 4G07A 5CFMA 3H97A 1SOVA 5KKNB 1SCNE 2QVLA 1FQKA 1UT8A 1XT6A 3FB1A 3NIBA 1SQSA 3ZWCA 1VE7A 4GECA 1IBCA 3SKYA 1DEOA 1S3GA 4L51A 2QX6A 3ZIAA 4CRWB 3BXGA 4GM1A 5KO2A 1PJRA 3G2IA 1K6MA 2ZBEA 5CLHA 1M72A 3TJZA 3SEFA 5GVSA 2ZJ1A 1YFJA 3RHFA 2OCPA 3K20A 4IDHA 3FUUA 4PZDA 2FFJA 3AJEA 4ZN6A 2Z04A 4ZJZA 3SIWA 2Z9CA 1UDBA 2NO9A 4IDPA 1LC0A 2QRZA 3AR3A 3HWSA 1Z5NA 3HC7A 2YXNA 3UIEA 2GXQA 5H5JA 4MQEA 2ZVQX 4E5DA 4X92A 3AJDA 2E4WA 1A69A 1GARA 2AK2A 2N1MA 3RS9A 5KNLA 4BNDA 1DKPA 4FWIB 2DBQA 3FMIA 1Y3HA 5DSZA 4QDXA 3FPCA 4JP3A 3TLKA 2BRUC 4NPCA 1TF5A 4HN2A 5BMVB 1UBGA 2AOVA 2JFZA 1V4BA 2AW3A 1PQ4A 4TLBA 4EHLA 2H9AA 2RKOA 2CFCA 2RIRA 3GRRA 5KYNA 2BKEA 8MHTA 4NHEA 4MAAA 2VDJA 3I6MA 4QC2A 2GRUA 3B1VA 2FVXA 3BH6A 4QBHA 1DT3A 1RCUA 3EULA 4W4TA 3ZBPA 3D6MA 1ID1A 2B35A 4UU8A 3SY8A 4D6XA 5BNWA 3UMMA 2JAUA 1HUQA 4ILEA 3KDPA 5ECGC 2BVNA 4DCGA 1L5FA 4EJ2A 3E27A 2FSVC 4EPWA 4JSYA 3D3EA 3MQ2A 1Z5UA 2X9QA 4YVFA 2VG8A 2JFUA 3SZRA 1EM8B 2GRAA 3U48A 4G0UA 2V5VA 5AI5A 3GEPA 3ROQA 5ICSA 2R1ZA 1OIWA 4D43A 1F1BA 1QJ4A 3LPNA 2ZWMA 3GEIA 3SOPA 4B45A 1VMIA 1YQ9A 1L5NA 2MIIA 2DMRA 4KAJA 2BTQA 3PFGA 5FFMA 1K88A 2HGZA 4RE5A 5BW6B 5IJ0A 4ZRDA 1ZQ1A 5HE9A 3RVPA 4B48A 2F4VB 8LDHA 1U7HA 1TB4A 2PMKA 1YE3A 2PNFA 4MVJA 2O3QA 5GZ6A 3JZIA 3UMJA 1Z0DA 3D43A 3GFOA 4TLCA 1YOVA 3W6NA 1ZS9A 1HDEA 4XQ9A 3W8NA 2JLWA 4HFJA 4HSEA 5I9SA 1Y4AE 4CKEB 5ICFA 4GNRA 1CQXA 1ZWLA 3PC7A 2HRQA 3KXKA 4HCJA 3VOAA 4GW3A 3COPA 1S8OA 4TKVA 3V4SA 4TS1A 2COEA 3I9JA 4Z51A 4HLUA 3OKCA 2WDPA 2XNCA 5JCZA 1QIMA 2I67A 2RI1A 1LVHA 4RY0A 3CZQA 4Q05A 1MJGM 5A9SB 4KK4A 1L5YA 2IPOA 3RBZA 3SXUA 1FNCA 3EG9A 4YA6A 1M74A 3L0DA 1LU9A 2D1TA 3AEUA 2RHRA 1Z29A 3NHLA 4HAUA 4WN3A 4D0LB 4X6YA 1QP0A 3MINB 4PSCA 1Q22A 2AXEA 1D2GA 2PWPA 2V03A 3KOWA 4HRYA 5ILGA 4EJMA 5DULA 1ZP6A 1JDPA 5KKCA 1SC1A 4BL5A 3Q2OA 4DDWA 5AVSA 2RHHA 5BV0A 3T9FA 4YV7A 3JSAA 1HXHA 1EWYA 1SIWA 1WV0A 1C7JA 3WRWA 1O8CA 4INAA 4P98A 1ZI6A 2Y0BA 3AWDA 3I1JA 2P2SA 3OMWA 4HWTA 4R1SA 4AJPA 3HY6A 4JOSA 4YUYA 1BSVA 1H2RS 4I55B 4BKOA 2BGKA 1NFQA 5AICA 5EE9A 2EKDA 3Q88A 3QWAA 5H7XA 3WMFA 4ILKA 3W5HA 1ECFA 1MRSA 4FEYA 1WCYA 5CJJA 2WYIA 1VCMA 4NMWA 2VF2A 4RVUA 3EGWA 5CT9A 5K8CA 4XCVA 4IEFB 2VKTA 1JJBA 3P2IA 4C4OA 5IUNC 3KR2A 1Z5WA 4PX9A 4OHRA 4AQDA 3ZD7A 4GPTA 1JXMA 3HXKA 1HDYA 2IPLA 4EEXA 2ZTHA 1ZLYA 3RUEA 4LK3A 2J33A 1EU1A 2XYVA 3IO5A 1GSOA 2LDBA 4BNVA 1UOQA 1Z5GA 1CG6A 5KX5A 1C1HA 2ZUUA 3KL2A 3IB3A 1Y4SA 2YIJA 4B35A 2H1RA 4J7UA 3NWJA 1YL7A 4R6WA 4N7JA 2L2QA 1ODIA 1Z7BA 3H3JA 3BJIC 1N8SA 5GGYA 4FC7A 1TTTA 4PYIA 3NJ4A 4LWOA 3FDIA 1NFFA 1OLXB 2BI8A 4INOA 3RV3A 4YROA 3DB2A 4N3CA 5C1PA 5KVSA 1GA6A 1P9LA 4KQEA 1DXHA 1WHSA 3HUFA 3L0PA 1NW5A 4H6WA 4GR4A 5T6BA 3UXMA 2FG7C 4OLAA 4OG2A 2G9RA 2D2VA 3EVEA 4ZPXA 4DAOA 3E58A 9MHTA 3FHOA 3EGDB 2JA2A 2JJ2D 2OQIA 1OLOA 2XF2A 4QRHA 2DYKA 4KMSA 1CV2A 3E1GA 3DQZA 2NVBA 2QVCA 2JGEA 4MWEA 5D00A 3KHTA 3DBLA 3T1OA 1N25A 3GEGA 1WXWA 2VPWA 2VZ9A 1EDDA 3RSHA 4I7EA 3OX2A 4A0FA 1Q7EA 1N78A 1VJRA 5GONB 3ROXA 1JJAA 3W05A 2NP7A 1XXHE 3IUJA 2Q8PA 5C7LO 5BW4A 4WW0A 1N5LA 3OLVA 2XB6A 3WHPA 2Z3VA 3O92A 4B4WA 2H2FA 3FFBA 4JXKA 5H59A 2AEMA 1SFRA 4MAMA 2E1PA 3JQRA 2GPAA 1XWIA 1N0WA 2IDMA 4GQBA 3M5PA 3GGPA 3R3SA 1AKTA 1SXJB 2LBPA 2XDYA 2J07A 3KJIA 3ZE8A 2FX3A 2CUTA 3IGFA 1RM4A 1OA1A 2I3GA 4I3HA 3SJCA 3PNMA 1DTSA 4EHAA 2F3PA 3HN6A 1NBOA 3E0QA 3PUXA 3NAQA 4IIEA 1Q44A 1CQPA 1TO2E 2H0QA 2NACA 4G0ZA 4N0MA 4PLTA 4WQMA 1NRIA 2WAOA 3N2LA 1D1QA 1U5BA 2N75A 3EN0A 3JS5A 3O2SB 2G71A 4QDOA 3T1VA 3T5BA 2J3EA 3PRYA 1B6GA 1EFTA 4K9MA 2XNDA 5FULA 4WNIA 3BGSA 5IARA 2Z0MA 3TQHA 4W9NC 4DSZA 3TNLA 2PY6A 5CA0B 1DI0A 3N6VA 3U4QB 3FYHA 4HDNA 1F8XA 5KS2A 1JYEA 2BGTA 2SICE 2DE0X 2FOIA 1OB5A 1TJNA 4B87A 1PN3A 1MEEA 1VLZA 2P40A 4G8JA 4P35A 3QPVA 4CUZA 5C18A 5EZ5A 3KJQA 3U3DA 4OFZA 2J3KA 3E23A 4FEAA 1EUZA 1FMTA 3CLUC 3CWZA 1CCWA 2AXQA 3F2VA 4F11A 1N0VC 1IHOA 1X0XA 1DFGA 3AI7A 4E5MA 3SE0A 1SBIA 3GMSA 3VHLB 4DBVO 1RAHA 1WDLA 2DBVO 3G23A 3IVAA 4HQLA 4L8YA 1W47A 4CLRA 2BH2A 3AVVA 4BNYA 2ZRGA 4C1NA 3R23A 2VDVE 5BSHA 1PWZA 5KWEA 4R71A 5KYGA 1XEXA 3S6JA 1RKUA 1KDYA 4RFVA 3ZCQA 5C1OA 2XV1A 5F78A 4MLCA 2UDPA 3ZGNA 1BS1A 2CLEB 3EISA 2ZWVA 1VOTA 1J8DA 4M2LA 2AYXA 3SHQA 4NR0A 4YJKA 2JH9A 4L2IB 4EPYA 1CZHA 3ACCA 3LUPA 1ZA1A 3W5IA 3W8RA 5BR8B 1SEVA 3IT3A 4ZRMA 2Q5IA 4ZDKA 4ZZ3A 4QOFA 2ZETA 1GADO 3MT9A 1G20A 3TIFA 1DINA 4O4HF 4E32A 3E35A 3EIUA 3A58B 4I9GA 1I3LA 3SSAA 1LK7A 4PPQA 4Q4LA 3AR6A 2B4QA 3B8HA 3HDHA 3A6HA 4EA7A 1WZUA 4GSYA 5CVVA 1XRMA 2CEKA 1IZ7A 1JG1A 3R09A 3FNHA 5FXMA 1Z75A 3LQ2A 5K3BA 4DR6B 4RSGA 1PYGA 3KZCA 4B6QA 2XZDA 3U80A 4X6XA 2JJQA 1GZ3A 1ZRNA 1M2VB 4QSHA 1JLKA 3NLLA 4D3XA 4W6ZA 5FTWA 3ZLVA 1O0BA 1YTUA 4IHKA 3G5TA 3PGX