3BHNA

Crystal structure of a dj-1/pfpi-like protein (shew_2856) from shewanella loihica pv-4 at 1.76 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
MYKVGIVLFDDFTDVDFFLMNDLLGRTSDSWTVRILGTKPEHHSQLGMTVKTDGHVSEVKEQDVVLITSGYRGIPAALQDENFMSALKLDPSRQLIGSICAGSFVLHELGLLKGKKLTTNPDAKAVLQGMGGDVQDLPLVIEGNIATAGGCLSLLYLVGWLAERLFDSVKRKQIQNQLIPAGQMEIFETLISETIQSAESAYEYRSACESDAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DJ-1 like Protein (YP_001094981.1) from Shewanella loihica PV-4 at 1.76 A resolution
rcsb
source organism Shewanella loihica pv-4
molecule tags Unknown function
molecule keywords ThiJ/PfpI domain protein
total genus 81
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bhnA00
4UOQA 4ADSG 1GGHA 4D1YA 3ZJ4A 4GUDA 1K9VF 3PQ2A 4K2HA 4LGYA 2WJZB 1GPWB 2YWDA 3NVAA 4MGHA 4UCFA 4XLLA 3TTSA 3PQ8A 1OX4A 1GGKA 4ENQA 1IZZA 3B38A 2R1VA 4RKWA 4Y1EA 3PQ7A 4S0ZA 5JZMA 1O1YA 4P36A 2XF2A 1PV2A 2GK3A 4QYXA 5JZOA 1OX4B 4B7AA 1Q7RA 2R1VB 1VCNA 1PDWA 2W7TA 3NOQA 1T3TA 4MNTA 3TQIA 3NOVA 4P34A 4L78A 4QYTA 1P80A 2ZUVA 3RHTA 4N12A 4ENPA 4ENSA 4UNIA 1JDBC 3EJ6A 3TTVA 4AUMA 5BV2P 4B40A 2H2WA 5K4AA 1S1MA 2VDJA 4I4NA 5SY4A 5SY9A 1QVVA 1A9XB 3NORA 3PQ3A 4I2NA 4ENUA 1GPMA 1VHQA 3R76A 1OI4A 2R1UA 3P9SA 1P81A 2VKTA 1G2IA 1T0BA 2R1TB 3MIIA 1U9CA 2ZUWA 3MGKA 4E5VA 1R9GA 1ONSA 4BTEA 3CNEA 4ZGGA 4MTCA 4RKYA 1C30B 3CY6A 3CZAA 2FEXA 4E08A 4OFWA 4P2GA 3B36A 1CF9A 2D7JA 2A9VA 1C3OB 4L8WB 1KXJA 3UJNA 1QF7A 2RK6A 4ENTA 2NV2B 3UMMA 4HCJA 1OY1A 1OX5A 3L3BA 4JQSA 3KKLA 4B5KA 3EFEA 1KWGA 3TTUA 3L18A 5IP5A 1Q2UA 1GG9A 2YWCA 2NV0A 2V4UA 4BIMA 3BHNA 4L7QA 3P9PA 3TTYA 3UGJA 3BWEA 3CYFA 1GGJA 3EWNA 4Y1RB 1KA9H 1GGEA 1PDVA 3FIJA 3P9QA 2RK4A 2ZUTA 1CE8B 2R1TA 1P5FA 4ENWA 4OGGA 1IPHA 1I7SB 5SYAA 1QWSA 4OIFA 4R7GA 1GGFA 3EZGA 3NOOA 4AJ9A 2OR3A 4AUEA 4AUNA 4P5PA 1I7QB 1BXRB 3B3AA 3SF8B 4AULA 1VCMA 1FYEA 1KEEB 3PQ6A 4GE0A 3TTWA 3ZJ5A 4ZDIA 2YWJA 1WL8A 3EN0A 2VRNA 2RK3A 4GE3A 4N0MA 2ABWA 4Y1GA 3R75A 4Y1FA 4UOZA 3OT1A 1OX6A 3WFZA 4L95C 1P7ZA 2GHRA 1QVWA 3SF8A 4BFLA 2IUFA 4B31A 3N7TA 3FSEA 1P7YA 3L4EA 1N57A 1VCOA 5SY6A 3PQ5A 4I46A 4ENVA 4OJYA 1M6VB 2ZUSA 1L9XA 1UCFA 4OQ4A 1SOAA 2ISSD 3CZ9A 2VXOA 3ER6A 3OT1B 3PQ4A 2YWBA 4ZDKA 2AB0A 1QVZA 4L8YA 4Y0NA 4ZDJA 3NONA 1JVNA 1J42A 3VU3A 4ENRA 4Y1RA 3R74A 3UK7A 1SY7A 1PE0A 1QDLB 1T36B 2ZUUA 3GRAA 3P9RA 3M3PA 3F71A 4PXYA 4LRUA 5E9AA 3SOZA 4B2YA 2LXNA 3TTTA 4OGFA 4WXYB 1FY2A 4P35A 4UZSA 3D54D 3ZR4B 1IZYA 4WINA 5DFAA 5LIRA 1KWKA 2AD5A 3F5DA 2VPIA 1CS0B 3L7NA 3UOWA 3TTXA 1I1QB 4L8FA
chains in the Genus database with same CATH superfamily
1I6KA 4RVOA 2LE0A 2HREA 5A3JA 3SQMA 3RSSA 4G5SA 4C4OA 3JAKB 1C1YA 1UF9A 1EJ0A 3M5DA 2JFGA 1NUHA 1X7WB 1PYGA 3UXEA 3W5IA 4BLWA 1TRHA 3O1LA 4ZXFA 4BJHB 3DDOA 3ZW7A 1ICIA 3LBNA 4DEVA 1JR3A 2JGDB 1S2IA 3LL7A 2OBNA 1U8ZA 1C3LA 2ZJ0A 3UMBA 2RIPA 4FU0A 1U7WA 2Q0XA 2YN4A 1Q1EA 2AG0A 7YASA 4DY4A 4BX0A 4CJXA 2W2KB 4JP8A 2B4QA 1OF1A 1Y34E 4JX8A 3SIXA 2FSFA 1JG7A 4NXMB 4JODA 3PEUA 4BE4A 4MKIA 4JLNA 4IZHA 4EB0A 1EXWA 2QG4A 3U1TA 1IJEA 5HZMA 3FPEA 2EYQA 5A7GA 2GD0A 2X14A 4OTZA 4J1NA 3CE6A 3SBOA 1OU4A 3NYRA 4UEJA 1CC1S 2JDIA 1FK8A 3WJ2A 2GBFA 1E3SA 4CHTA 2CCKA 3ETHA 2JI6A 3CY6A 2WZQA 3IIEA 4Q1CA 3R0VA 3NZEA 4FDVA 2BR4A 3M3HA 4CEIB 2G8NA 2DEUA 3Q9SA 1EE2A 3GZJA 4MVJE 4NMXB 4QHYA 1CX9B 3U48A 3ZHYA 3LQ4A 2BL4A 3RIYA 1YR8A 5L53A 4JU8A 1OAOC 4LBYA 1D4OA 2AN5A 2E48A 1L7MA 3VKVA 1JE0A 2B36A 2D1YA 4UBOA 4CLHA 4ND7A 1L7EA 4CM8B 3QPDA 3MWJA 4V38A 1NUTA 4B6RA 1CDDA 1H85A 1M72A 2PTHA 3FF4A 3M81A 4MICA 4XTCS 1FBTA 3HADA 5DEOA 4MA0A 3FNRA 2YS6A 4LCJA 2G5CA 4BIMA 4TYNA 4XIYA 1PL7A 2E5LB 3VR4D 1FRNA 1JR4A 2PDAA 2WOJA 2QAGC 1UINA 4AN0A 4DANA 2DPXA 1R37A 2VAVA 4O4HF 1CRZA 4LTMA 4EWLA 2V6JA 3IGFA 5EXDA 3STUA 4JI2B 2MMCA 2YRXA 3DEZA 4QICA 3OCUA 4WZBA 1XCJA 4EW3A 1I30A 3NOOA 4O2BB 5NLLA 3MRTA 1UEJA 2EFYA 4L9AA 5JALA 2P2CA 3U3JA 2O8EB 4G5YA 1E3TA 5H4GA 1JNYA 2ZBVA 4XCVA 5EE9A 4F4IA 4UVGA 5SICE 1WSAA 5ABPA 4XD7A 3Q0IA 1Y98A 3IEUA 2JHCA 2JGRA 2V03A 1W2WB 3I1FA 4QT4A 3TLXA 3X3HA 3HN2A 4UD2A 2UZ1A 3C3PA 1KP9A 1RMYA 1W0JA 3DBHA 4LJLA 4TKLA 5EUCA 4DMKA 1FUYB 5KYKA 3K0SA 3L8EA 3FVRA 1S2MA 3P2MA 1MRSA 4DKJA 2PX8A 2GEKA 4QFBA 3CX3A 3NM4A 3BFJA 3MT7A 1EWQA 4I9UA 1HDRA 2YNMC 3RVMA 4A8JB 2QTWB 1SQ6A 1E7SA 5CJ2A 2ETXA 2VQFB 2H4YA 2PNJA 3SKYA 1FJHA 2FXIA 1Q1AA 2JHFA 4J1TA 3VO1A 5THXA 3GLFB 4OATA 3TXXA 4BFCA 3U7HB 2OPHA 2V5UA 4QTUB 1UWKA 3UT5A 2COUA 3WDMA 4WXYB 1XNHA 2CN1A 3QTTA 1MQSA 1R18A 1ULUA 2ZJFA 5CLGA 4ZZIA 5FBVB 1BO6A 1SMKA 2C3PA 5HR5A 2AG6A 3WYGA 3W6ZA 4M99A 3WQSB 3UJBA 5JZVA 2JASA 3ZV4A 3K09C 1HYHA 4P84A 4Y0VA 1I4OA 3JYHA 3PFCA 3QVUA 2XEDA 3M3DA 3P0EA 4RENA 2G07A 1D9ZA 1QGOA 1T5SA 2R97A 4E32A 1EEXB 2QTFA 4RFSB 2XVMA 5EYPB 3OWOA 3HR7A 4B6SA 4K88A 3ABZA 3BHMA 1Z8FA 4XASA 1C0PA 2UKDA 4HPXB 4L5AA 1NVDA 5E3JA 2WJ6A 5H0IA 4C4AA 4WBNA 3WBKA 2BGGA 3K2IA 4MLCA 4E3ZA 1HQKA 2LTAA 3FCXA 4AMGA 4B7AA 1MHPA 3C3DA 4H6WA 4OYLA 1QANA 4ZT3A 2WR8A 4X6XA 3TSCA 4AZ3B 5TQ0A 4Q4DA 4EIWA 2J3QA 2XMBA 4D0SA 5IFLA 5K8JB 5LQJA 1FDRA 2HHAA 5SZKB 3ULKA 1U3WA 2O5RA 2PQ6A 4TQUS 3GLGB 1BIFA 3GQBA 3KYCA 3HZZA 3IAS1 3QPCA 4MRPA 4AY4A 3ZDDA 1ZJWA 4BMOB 5IF9A 3A6KA 4YMHA 1RRMA 4MKHA 1E7YA 2D1TA 4RDXA 2D74A 4PNEA 1XPJA 3CNOA 3G5LA 4PO9A 2B2CA 1D4AA 5CFOA 5LLDA 2QUJA 1TQ6A 3PNVA 5G02A 1Y9EA 2ESRA 1YU6A 4FB4A 5DTJA 3I01A 3BKWA 1D7OA 1KQNA 5AKJA 2F00A 2KS6A 4H7DA 4BLRA 3FETA 3LNCA 4LVUA 1XL0A 4NYMR 1V4NA 1X1CA 2BI4A 2JH8A 5DNUA 1VMAA 2Q9BA 3GGPA 3LHDA 3FVTA 4U7FA 3FCCA 4E1AA 1TUGA 3LVQE 4TKVA 1VDMA 2Z6VA 1FFYA 3QJGA 3L3BA 1DXYA 2FF5A 1F2UB 1IEQA 2PXHA 3IB3A 2PLRA 4LJ8A 3VM6A 2YJGA 2O48X 3ANXA 1PLLA 4QOEA 3GLGE 1ZVQA 3CUWA 3P5SA 3K3PA 3EPPA 4O63O 4QTZA 3O4FA 1U3CA 2XI4A 1FXUA 4E5MA 3P26A 4DV0B 5KSPA 3OKAA 3QUQA 4KPUB 2HA2A 3ILVA 4L3WA 1JPNA 1C7FA 3AHCA 5LDGA 5DM60 1RE1A 4C1NA 4F2PA 1DQYA 2GBGA 3P9NA 4QU0A 1EINA 1ORDA 4A92A 1MAWA 4OFXA 4AUEA 1XJCA 2GO7A 4YAIA 1DFHA 3AU9A 4L4YA 3FSGD 1U5CA 2LD4A 5C81A 2FRDC 3I04A 4MW2A 3T0GA 4UW9A 1XNGA 3O26A 3ELWA 4PLPA 4OOEA 4PYQA 3C6KA 1WDMA 4DLXA 1IUKA 1J2UA 1QQ5A 2C4MA 2F3TA 2A7QA 1ZISA 5K0LA 3ZIAD 4PG6A 1PNRA 1EFRD 3FOCA 4IIVA 4D3SA 1QFXA 3LGSA 3QOXA 3L41A 2CZGA 4HT3B 4OMUA 4QU9A 5CNIA 1S8OA 1BYUA 3H1TA 1QQ6A 4Y0NA 4EW1A 6CHYA 1BCSA 2I6GA 5H80A 1II8B 3JQGB 3JSXA 2O7SA 4NU5A 1V9CA 2QHXA 4GPZA 4RZIA 3GLIA 3GT4A 4J0HA 4NBRA 2JBAB 2IIVA 3O21A 3JQAA 1ZL2A 1G5HA 4RJTA 3TL2A 2WJWA 3Q8KA 1H4VB 1NRIA 1UBEA 3DA8A 4HH3C 4RV9A 3UOWA 5B1DA 2LIVA 1GZDA 1DIAA 3B51X 2OMKA 4IL5A 5IC5A 1G64A 4OH1A 1D2CA 4MB0A 5CHYA 4ZAXA 5BN4A 5A2QA 5IKMA 2QL6A 1JB9A 2Q6VA 4LE0A 4YUWA 4B71A 1NN0A 4RTJA 2PUTA 2XAAA 4OJQA 1ETHA 3PEFA 4OO3A 3GJQA 2YJNA 2YFKA 4GGOA 4N8SA 4KPYA 4F1JA 1NRJB 2VNSA 1B1AA 2OP0A 2Q2QA 3F6YA 3FYUC 3TLBA 4ETWA 3A9WA 5TMEA 1K7FB 2HO4A 4U4AA 3QVGB 3QNMA 4X41A 2XMZA 4MW9A 4UE2A 4YUZA 2FKAA 2GGSA 4LHVA 3F2VA 3WL7A 3WYBA 3AM3A 3CZPA 3I12A 3INRA 3KWJA 5BV2P 1POWA 3ABQB 1ECCA 2PX4A 2W43A 2VP3A 3CX8A 3WO0A 4QPCA 1XZQA 2IU3A 1DG9A 5CA0F 3OHSX 1FSSA 2B69A 2G70A 2XBLA 3AHIA 1RNLA 1VSUA 2OYSA 1DI0A 1X1QA 4GLJA 5JD3A 2H1OA 4XPZA 4BUCA 1BU5A 4DSOA 4KR3A 3O4GA 3OM0A 5EJEA 3R20A 1P6QA 1FNCA 4JDPA 1GFWA 4HO1X 5I4IA 2GPAA 3ODPA 4JL6A 1CK4A 2RAFA 3M4JA 4DAEA 2I34A 2NQTA 3BJRA 1KVRA 3R3VA 4J1SA 1DJPA 1YOVB 4NYIR 2IJGX 3K9CA 2QBYA 2VH1A 3HR4A 4A0GA 2HSEA 1G1MA 3MAJA 4CV2A 2F48A 1OY1A 3W9UA 4IH9A 3KALA 3FB1A 4HYQA 4PLZA 2C7GA 1XDWA 2HSJA 5HKLA 2BTOA 1L8XA 2G36A 3WL4A 5TJHA 3TJRA 4JI0B 5L9AA 5K45A 3TNJA 3FBTA 2WUWE 3NX4A 1NR7A 3HVJA 3SYMA 5KNCH 2ZZNA 3BIXA 3CA8A 2QQFA 4ZPJA 4NCBA 4WI1A 5C5DA 4V1CA 4TKZA 3BJZA 5DMXA 3WY9A 1RQRA 3R7AA 1CP2A 4H7KA 3BICA 1V1RA 3CO0S 4YMGA 4AY6A 1K4YA 1NYLA 2EJBA 3MJSA 4JLSA 4MVJG 3UW1A 5C9ZA 5K2OA 4NTZA 5EQJB 1U1GA 3E82A 1UC4B 5T7BA 3BJEA 4QQ8A 3TLJA 3BOSA 4PU0A 4F9EA 1A9QA 3JPYA 4URZR 3OI7A 4YNBA 4FWTA 1IBRA 2Z58A 2ZSBA 3ZQUA 3QI2A 1KR5A 1LRKA 1QSGA 4TMVA 3G02A 4JLDA 1R6BX 4JLPA 4KUHA 9ABPA 1Q7BA 2OXCA 5EJ4A 3OZSA 4YT4A 4WD3A 2JIRA 1T0JB 3SYRA 2P3SA 3SC4A 2ZRCA 1C4XA 1NATA 1L5SA 3P96A 1GRNA 2W2XA 2XDQA 3GYGA 3MINB 3PHCA 4G56A 1X7GA 3JRNA 3EQZA 4EF5A 5EKDA 4PG4A 1B6RA 5FWYB 5F9MA 1MORA 3A1FA 1NLUA 3C8MA 1KHTA 3AEKA 3LE8A 3UFXA 4JI1B 1JSRA 2B2NA 4FMCF 1EDBA 1QQTA 1SZPA 3AUJB 4HBGA 3P9XA 1R5BA 2XTMA 3F46A 3UJCA 3WYCA 1P2TA 5BYBA 4KRXA 3BE6A 3G23A 1NUUA 2W98A 1WPQA 3B6IA 3L8ZA 1YR3A 1KSGA 4L5IA 4ZOCA 2GPYA 4GPIB 3ANLA 3ESAA 1ECPA 4MV0A 4OAPA 4Y2VA 3O1HB 3U9SA 1W9HA 1HYEA 1ZH4A 3BSSA 1GTJ1 1Z26A 3VZQA 3AVQA 5JAZA 1VPEA 1DBPA 2F62A 1CJSA 2ZE6A 3SNHA 2ZI3A 1FVFA 3KYIB 3IHWA 4D4KA 1IBMB 3OEHA 4Y6OA 3LO5A 2J3HA 2HA7A 1Z4LA 3EDMA 3O2SB 2WB2A 4U5QA 2V7GA 3STVA 4NZZA 4PYMA 3DL0A 4KXMA 2GN4A 5JVDB 4GKAA 1EHIA 4HQ6A 4QQNA 5FOQA 1JHOA 1TO2E 3DO6A 4DCGA 4ENSA 2PUFA 3G2MA 4N3CA 3GT3A 2X8JB 3OPVA 1AZLA 2BH2A 1EE9A 3D59A 1J0DA 2H85A 4Q4LA 1NWCA 2D2FA 2G1JA 1GNPA 1VLHA 3M6XA 3WRXC 2ZPTX 3OJEA 1E7RA 4IHJF 5COAA 3PFBA 5AKEA 4AJEA 4NFSA 5JSHA 2ADMA 3E3NA 1XQWA 3ZDZB 1QCZA 2ZJ1A 4ARZB 2A7XA 1NF8A 2D7JA 1PR4A 1UKZA 3Q7SA 4GOND 1SPXA 3NYIA 5DHTA 4DABA 1SVMA 1EKXA 1A9PA 1XA4A 2A67A 2JGIA 3K20A 3QQPA 1SXIA 5ALIA 4F46A 5HRAA 3PXCX 2AEEA 4KJXA 3ICPA 4LDZA 3QEMA 1JEEA 4EGCB 4F6RA 1FDUA 2D1RA 4E46A 1JJIA 3PENA 1XD2A 4JR2A 2WM3A 3FR8A 2FPIA 5EEHA 2ON6A 4MRMA 4R8SA 4C2BA 1J0EA 1XD8A 5HS6A 4M1WA 4HNUA 3DMRA 4M0KA 2NO6A 2EYUA 4EZBA 2WA2A 3KXDA 4IJWA 1FSPA 2WINI 3ESYA 5FLEX 3GJYA 2VNJA 3Q7RA 5ARDA 4OJNA 4AJ4A 3MUNA 4NSNA 4BN5A 1YR9A 2OD9A 3ITEA 3F0TA 2PUGA 3MJ4A 3VR4A 1A95A 2IF0A 2CBZA 1YHNA 2FQXA 4CLEA 4S1PA 3QE4A 5BW5A 3EUWA 5EI5A 1EU1A 1HE1C 1TZKA 4MUHA 4D92A 4DUZB 2EW2A 2GHRA 2QROA 3B82A 3WSTA 4A8JC 1C1HA 4K40A 3G17A 1F17A 1JKIA 2WTEA 4N6GA 2PYZA 3AWDA 4QBTA 1SZJG 4ZCPA 3MCTA 2BZSA 2WIFA 4ND3A 4MAFA 4OQLA 5MGNA 5FHRA 4XGQA 3PQ4A 4X71A 4P98A 3HUTA 1P1HA 4LDQA 5DDIP 3WBBA 4R2IA 1APBA 4X84A 2QW1A 2X13A 2BFFA 3AERB 2ZSJA 4M6WA 2Z2IA 3A32A 1Z5UA 3U7QA 1MC8A 2AOWA 3CEJA 4HUJA 4A23A 5A6VA 4TWAA 4F11A 3TTTA 1CUFA 2J7PA 2TRSB 4DUPA 4YACA 2DKOA 2QZ9A 2RHOA 5AK5A 4ESVA 1U3VA 1ZVMA 4CLRB 1N6IA 3IXLA 3VZPA 2JAHA 3G9QA 3MFQA 3IQIX 1RQXA 3E58A 3TM4A 2AN9A 1XZDA 1T0UA 2QP9X 3TQRA 4ZI3A 5CG2A 3T6KA 5KKNB 4C7VA 2A92A 2W6JA 1O5TA 1PSZA 4ARAA 2VK4A 2ZIUB 1TM7E 3FLBA 1GGKA 3EZNA 1J0CA 2EBWA 4YDRA 2A14A 4J4HA 1E59A 3VNVA 1KDRA 4NDAA 3KQUA 4AQYB 1J8MF 1Q22A 3ZWAA 2PGIA 5TLSA 3P52A 4MRAA 2EFEB 1Y8ZA 3KL4A 1WUJS 4H17A 3VKUA 2PLAA 1U0HC 5HFNA 4CRWB 5I4CA 1QLWA 4RIIA 1V9LA 3ZDEA 2A86A 1F4LA 4MEJA 3LUCA 4KVGA 1Z82A 2VHZA 2VP6A 3ZHOA 4AJ1A 4N01A 3T7JA 1HDZA 1Z4OA 3AHHA 4Z4FA 1Z2NX 3A4YA 4JL5A 4I3GA 1B41A 4BGIA 4ZVTA 3C98A 3Q2OA 5DLPA 1C7IA 4YRGA 1X92A 4AM8A 1U80A 5EUQB 1N2OA 1VECA 2B4AA 3QEJA 1E58A 3JQBA 1R7RA 1XU4A 3TOCA 5IBCA 2VT6A 5DXAA 1I5RA 2QP3A 4F2WA 3DR3A 2ZKLA 3HDYA 4IXWA 2HQBA 4K9SA 5BNIA 1Y1KE 2KE5A 3HGQA 2YZNA 5ETJA 3TLAA 1OH7A 1XB2A 1JHRA 2W8ZA 4Y7DA 1ODTC 3OJWA 3O6VA 2VBIA 2NVUA 4F8EA 1NX9A 4LBWA 1UFKA 1XNQB 4B32A 3X1JA 3UHAA 4G25A 2YV5A 2XKKA 4BLVA 3TUJC 1KYYA 2QMYA 3GJ0A 3CW8X 2JI7A 2PY6A 2NV0A 3Q7IA 1I80A 1NM5C 4WNAB 3TZLA 2R86A 3B2NA 1CJCA 2HLDD 2YVAA 5DU2A 5SZJA 1NDQA 3AR8A 1KPHA 4LGMA 1BHSA 3FWHA 5KAPA 3GV0A 3AEYA 3F7MA 4Z6KA 1PTKA 1IUNA 5KU7A 1NXSA 1R4ZA 4YC7A 1NLYA 3V8QA 3ISTA 3DM9B 4AU1A 1NZJA 5CK5A 2GCPA 2ORVA 3L8GA 3GGSA 3PG5A 3ZLVA 10MHA 1NXPA 3PC8C 4CKBB 2ZDQA 2HCTA 4H4EA 5KKAA 3R75A 3VZBA 2X22A 1OX6A 5IXSA 4BWYA 3QELA 4BFLA 2GS9A 3EXIA 2O8EA 5E38A 4AMUA 1VE9A 3FSGA 4WZAB 1FC0A 1THMA 5BMVB 1MEOA 4QVKA 3D3WA 1XSEA 5LQRA 4DAOA 4IICA 3H9GA 1Z16A 2KLHA 3PCRB 2UUAB 1O95D 3ETGA 3MGBA 1L3IA 1PWEA 2SKEA 5TGDA 1SC9A 3GUYA 1KPIA 4MB2A 4B4WA 1UK9A 4BXOB 1BFUA 2ODWA 3HM9A 3E48A 1ADCA 1EVLA 5FFMA 1ZH0A 1TK3A 1HK7A 5EZQA 3SSMA 1WQ1R 5LIRA 2VF5X 3JR7A 3MUEA 4R1SA 1J1UA 2FUKA 2BHTA 4U2BA 3CF2A 4IUCS 2ZTUA 3AG5A 3M0EA 1XAHA 4UNPA 5K51A 4HWRA 5U4XA 2IWHA 3T9AA 1DHRA 4YJGA 1RPTA 4OJMX 4KUGA 4LGYA 3AEQA 2FPXA 3JQAD 1UBLS 2JF0A 2ODEA 1EBBA 3NHPA 1T5TA 5BSVA 5JSZB 4M1ZA 4QO8A 4YP7A 1RHKA 4F5DA 1DSSG 3ESCA 3O0DA 1RPJA 4F0JA 3LY9A 1EX1A 4L76A 3KZVA 1T2AA 2V3WA 3A1WA 4PZYA 1YMQA 2Q9CA 2HNBA 2XUHA 3A1EA 5TVGA 3UAGA 4ZYVA 2WWFA 2XZTA 4Y6SA 3TLMA 1SXJA 3PJRA 3G9ZA 1TQ4A 1VQ1A 4ZRNA 3ZBQA 4U7DA 1KBZA 2QAIA 4U8HA 2O8BB 3PNMA 2GD6A 1QP0A 1CNFA 3UOGA 2Y1KA 4GQAA 3JAWA 4W5QA 5BO5A 4PYJA 1PHPA 4BFUA 1U98A 1YWGO 2PS3A 3GD7A 4JUDX 4ENPA 3DL4A 2WFZA 3L8DA 3QPWA 2R8XA 1KDZA 4CMEC 3LX5A 4XDYA 1KYQA 1XFAA 1U3GA 1Z5NA 2YQ4A 1E5TA 2NXNA 2NOAA 2YW2A 3QVOA 4FDLA 4I9GA 1D2GA 1DUSA 4E13A 2D4AA 4QRIA 5F1KA 4AWBA 4G0UA 2O8DA 4TWIA 1YUMA 4IDAA 4PPYA 4B6GA 3RODA 2ZI6A 1S9DA 3CZAA 1NDHA 4N0QA 2ZT6A 3T38A 2ILTA 4MS4A 3ZOZA 2N42A 3PQDA 3MYRA 2HBZA 1ZICA 3MWEB 1KETA 1H3EA 1UUFA 1K0UA 2WG0A 3ZE7A 3D2BA 3OU7A 1OCEA 1K06A 4LZAA 4A36A 4I3HA 3I37X 1U0FA 1W2GA 2ZRMA 1HBJA 1S4MA 5JDCC 1JLLB 2OCXA 3GFVA 3LKVA 2EJWA 1CXZA 1DO2A 2ADFA 2W5UA 2A3NA 4UHBA 1IATA 1VI5A 2OESA 2BP7B 3N6VA 3TPFA 1OB2A 5FRDA 4RNDB 1P4RA 1AKRA 2Z43A 2F7SA 1GGJA 1T9GR 1J0BA 2YJTD 4O33A 5BWOA 1O6ZA 2AUNA 1VHTA 2O2IA 4MVJI 4Q9KA 2OYCA 4BFWA 2H0RA 1PEAA 1XZ8A 4MRNA 3W79A 1YZTA 1YMUA 2IPOA 3EIXA 4KTTE 4AUNA 5KSYA 2VR1A 1X6VA 1WE2A 1NMSA 1XQ1A 2QV7A 4Z5XA 1NJ6A 4XIFA 1CETA 1M1NB 5EXTA 3DPSA 3ZI0A 3H1PA 1U7ZA 1T1SA 2LDXA 3RSOA 3IAFA 4L74A 4YH1A 4LDJA 1SG0A 2C07A 2WDZA 3BWMA 2OVBA 2DLCX 4F3YA 2RGNA 2UZ3A 3JQPA 3K2QA 4KW7A 4FSXA 1AO0A 4L02A 4MR7B 4UVHA 5GQSA 5I51A 1W4BA 5CVUA 1OASA 4DWJA 1NG9A 1OR8A 4BLQA 4BMPB 3HCBA 3AHFA 1MP0A 1VZ3A 1Z7WA 3DKKA 3I09A 3IR7A 3Q7PA 3WNBA 1CUVA 4FYHA 1I3KA 5DWQA 3C3EA 3N07A 1EFHA 2OPBA 4ML3A 3RM3A 3RUCA 5P8WA 2ZZMA 1B00A 1E3IA 4W1QA 4BO4A 1Z07A 2JGMA 2YZ2A 4R4JA 1GZHB 2OZEA 1DT5A 1KY3A 1R12A 2QJOA 4K6OA 5KYVA 1T5IA 5LMZA 1Z6GA 3DMDA 2JAOA 1HRDA 1MJFA 2CMHA 4K3UA 4ZKDA 3L6CA 4G81A 1SB8A 3OWXA 2YDYA 2C83A 1YE5A 3ZCUA 2ZYUX 5CR9A 3S70A 4M1QA 2H31A 3GDGA 3OTWA 3LUGA 5K0NA 1Z5WA 5NULA 2BH9A 3CRMA 4QL3A 3EMVA 4KGDA 1DMSA 1H9BA 1ZJJA 2JGKA 4X3OA 5FBLB 1OH6A 5F9HA 2Q4DA 1D2AA 2X2PA 1S89A 1YS7A 3ZUGA 1SNYA 2P69A 2WFLA 1N78A 4QUDA 4WBSA 5JW6A 4DMGA 2JHPA 4JI4B 1B1CA 1KMHB 3LVBA 3BGSA 2HIMA 4OQNA 4WOJA 3ZK7A 1L8AA 4AMZA 2RAVA 5ECGC 1AO3A 1P1CA 5CHEA 2REQB 1BHO1 4LNHA 3T54A 4B3SB 4BBPA 2PUVA 4UHFA 3TG8A 5JXIA 2JLZA 3ETJA 1TO1E 2OORA 2ZE8A 3DHVA 3OQHA 3PHGA 4IXDA 1DAFA 2AUMA 1XMIA 3H5TA 4WGFA 2PV0A 4XKJA 2NZ2A 4I4NA 4LI0A 5CNKA 3R9KA 3JQ9A 2P5SA 4EGSA 2ZSKA 2HSWA 4OMDA 3PZBA 4UHCA 4UHEA 1WDLA 2F1RA 1DKQA 4FCTA 5IYZF 3LRPA 5D84A 4F1WA 4PFQA 4QYMA 2NVUB 3KKPA 2FDCA 2DTXA 3AYXB 3OMWA 3JWIA 3KT0A 1YS6A 4KIJA 5JAQA 2CJPA 5KJEA 5F7XA 1JEQB 4MJLA 2RARA 4RMIA 3THXA 3BWCA 5BNZA 3VPCA 1R6XA 1PWXA 3V1LA 2NM0A 1UK7A 2C59A 2FSHA 2VHWA 4YRDA 4GI1A 3W7AA 1IWOA 4WNAA 1Y3HA 4BNMA 3KR0A 1M34A 4M8LA 4EG6A 1G291 2VJPA 3WNVA 1XIVA 1EGMB 3GJXC 1CUBA 1KOFA 4JEHA 3E3LA 3WSWA 5F1YA 3RBXA 5CUQA 1BS9A 5AHOA 3X0DA 4NCIA 3H8JA 1P0FA 1Z4NA 2CMKA 2DM6A 2J6CA 2YOFA 1P4AA 4GIBA 4D80A 3HXQA 1M0TA 1QC5A 1VLJA 5KWSA 3OPYA 3LDAA 1VB5A 5CXUA 4WPGA 1I9GA 2OHIA 3G5MA 1HTWA 1S3SA 2QN6A 4DMCA 5C4MA 1HYQA 1N8KA 2FX5A 3NTVA 3GUVA 2R6GA 3INNA 4ZTBA 2YJ4A 4KQEA 5BRNA 2DHEA 3IJRA 1Q7TA 2DFVA 2R8ZA 4JMLA 2VJMB 2YC2C 3W1WA 1XPOA 2KX7A 5C7LO 3EIHA 2H4ZA 1JH9A 1F51E 3W3AH 4MYDA 3SBDA 2C7QA 1E20A 3IKVA 3AHEA 4H31A 3KZNA 3BMXA 2R48A 1IRXA 1NVTA 3NM6B 4DVJA 1E9RA 4KXFB 5CM2Z 5DX1A 3C3XA 3OZFA 3WA6A 3QLTA 5C4GB 4Q4HB 2FMHA 1IK6A 5IMBA 1USUA 3RIMA 4C0BA 4DBLC 5H5JA 1OBHA 3WGTA 1X42A 1MD9A 2DUJA 2GR9A 2B98A 3MSXA 4XOIA 3L6UA 4PZDA 3M4XA 1Y4SA 3UA3A 4MJ3A 4P4LA 1TM5E 1HDIA 2IYZA 1JALA 2OXEA 4KQCA 4DOMA 2AG1A 4KYIB 4CMJA 2VFAA 4JVMA 4LTNA 5BN5B 1T6XA 4FFLA 1SKMA 4JJFA 2EHDA 1BEZA 1W5AA 2CDNA 2ZWPA 5E7IA 1Z0AA 2HAEA 1D0IA 1F4PA 2OBXA 3RU2A 4BEWA 4F3TA 2CLSA 4YECA 4YRAA 4I4LA 3RNOA 3ZD6A 1U8XX 5C5EA 3IXQA 2OCDA 3U60B 2J7PD 2FFBA 2PZEA 4IQ0A 1WG8A 3P2KA 1VP9A 1QPBA 4OJTA 4YQEA 4D3XA 2PGDA 2V0CA 4DMUB 3WWOA 4WLOA 2Y05A 3ASYA 3JYQA 2CNWA 3SDZA 4OP2A 1TT5A 3EG9A 3WQRA 1H94A 1X19A 3IULA 4WBXC 2I1LA 1BFKA 3B1VA 5EPOA 3I72A 5HCIA 5HKBA 3TF5A 1TAHA 1CLEA 2Y6VA 3Q6NA 1Z18A 5H81A 5LC1A 4EG4A 2AK3A 4MUNA 4OHCA 4AO8A 4UBNA 2VCHA 5JCXA 5TVKA 4OHKA 3LUAA 3QVKA 2I2DA 2FQQA 2R8EA 4JCCA 5KDDA 2NZWA 3LO8A 4DV5B 2AJLI 4FI3C 3HLKA 3N2YA 1V11B 4I6JA 1M8FA 1XLWA 3KTDA 4KMOA 5F2OA 5IWAB 3MQFA 4QLBA 2VKTA 2H3HA 3ZYCA 4G9GA 1AGNA 3DUFA 3HYTA 1E94E 1XZJA 2JFPA 2JIDA 2WWWA 3L4SO 1VE3A 4RFLA 1VIMA 2IA5A 3PWZA 5I5EA 5LP1A 4Y2SA 2YN2A 4LRXA 3SQLA 3A36A 3ZWXA 3KTOA 2DQ4A 3N7UA 2MYTA 4PV7A 2AR9A 3QWFA 5BPHA 1U9IC 2FWAA 3RUHA 4LGCA 2OB2A 3AUYA 1U1FA 4RIEA 3TKLA 5C1BA 1TA0A 3VV2A 4QDOA 4OG2A 5KWJA 2VXCA 3LXMA 5IARA 5F3WB 3RIEA 1G9TA 3E7WA 3PS9A 1YVPA 3PEWA 2BJHA 5G0UA 2B5OA 3E8SA 4Z9FA 3RUFA 1FMTA 2CXHA 3TQFA 1WNFA 3PXAA 1YZFA 1Z4KA 4PZLA 2D2EA 4JU9A 2UZ4A 1DBSA 2TMKA 1B2LA 5HOEA 2Z83A 4LSWA 4OIMA 5ALHA 3DEFA 1Z7EA 2YTZA 5KTMA 3QKIA 4XAQA 1R00A 3NAMA 4N5NA 1JDVA 1HZZA 2VUSA 1BU8A 5INTA 3SJ7A 1M2WA 4RHUA 3N2KB 3RFUA 1HV8A 4YCAA 1WHTA 1O96A 2XXJA 2R6CA 1LKZA 3SEAA 2N1BA 2BMVA 3JQQA 3OOWA 2EL7A 1QB8A 1HDCA 3GI1A 1ZOOA 3TMKA 5C8ZA 1PL8A 2VTVA 1KJQA 1OBOA 2YHIA 3OECA 5ALGA 4CF4A 2DY0A 1YB7A 3KUKA 3H2YA 2B8NA 4FLMA 5AJYA 4XD7D 1TTTA 4UE3S 3PRHA 5DYGA 2FWBA 1LQTA 4I1UA 1OLXB 1G20E 1W9MA 4Z8XA 4MWOA 5BXYA 5FPKA 4J6EA 4MVJH 721PA 1WTCA 3OUZA 4DM3A 1X0XA 3G59A 3TKAA 3V8PA 1QG2A 4H77A 1JHQA 3I83A 5B2EA 5CFMA 2CKDA 3GEPA 3IUNA 3N39C 3BRQA 3D3QA 3LPLA 3ZBUA 1MG5A 1GFIA 4F92B 3H04A 4Q05A 1SIWA 1QJ4A 5JANA 1WXEA 3TPZA 1GG2A 1W4CA 4HWTA 2LNDA 4P8RA 5AXDA 5DNCA 4DLNA 1GARA 4CT0A 4EVSA 4WL0A 2X0DA 1FJ2A 2ZJZA 2Q1WA 4TYPA 4YMVA 1U6KA 3LZ6A 1KH1A 2QGFA 4TYMA 4UBJA 2AFIE 4WXEA 4HDRA 1LRJA 4G1FA 1UMCA 4J29A 2REQA 4L5CA 4E5NA 1AUVA 1CW2B 2BUAA 5D7BA 5FA8A 5JADA 4JQOA 5ES3A 3TO5A 4IDBA 1GWNA 2BFEB 2QK4A 1IBSA 3I5MA 1XNRB 4C4SA 3VKWA 2NXEA 3DHEA 4BV3A 3U7GA 4TL9A 3VNUA 3ZWPA 1RXVA 1ZG3A 3NBXX 4M8KA 1RLJA 3UQYS 1XEXB 2GVZC 1NMQA 4RKFA 1B8VA 1P1BA 1GFZA 1WMAA 3L0PA 4KAJA 2GXAA 5JECA 3U13A 1AIPA 1GXSB 3TD6A 1P4JA 4URUR 1KO4A 4C3UA 3NV7A 1PG5A 3VKFA 3FWNA 1ISFA 2V7VA 5AW6A 2HA3A 4IMRA 2Y66A 2V6GA 4NNPA 5KNBH 2PE5A 2A35A 4O4HA 1W5EA 2HCJB 3AOGA 5TDHA 3CO5A 1NVXQ 2ZAOA 2MR6A 3E9NA 4PO1A 4C2UA 3HVRA 2GCOB 1DIGA 3F1LA 1RYZA 1X0VA 3PUYA 3H6KA 2FR1A 2Y0BA 1EFPA 4ALNA 2DX7A 1HL7A 4A0RA 1YTLA 1ZVJA 2HFKA 2NVBA 4KOAA 4K6FA 1J33A 4L75A 3V4LA 4O4LB 4HXGA 1P39A 4YPVA 4UNNA 4E7PA 2YCLA 3HZOA 4V2UA 4X7PA 3ED1A 1BWSA 1ZLYA 1Q7GA 2B8EA 3AR9A 3E5NA 3NASA 4B33A 5JD4A 2YV2A 4HDMA 5CLHA 1RHMA 2XUAA 3D81A 4L5YA 5HK9A 1FMJA 4HI0E 1IB0A 5JZ9A 1ZGJA 1FX0B 1G19A 1R9NA 2Y0EA 1S96A 2WIBA 1SA0A 3E9RA 1FRZA 2E5FA 2FKNA 2TSYB 3ZHCA 4ZYWA 1Z6XA 4HLUA 3A9UA 4KQXA 4YCBA 2DH5A 5BQXA 2NZ8A 3DXYA 1P0QA 4D8VA 1ESEA 3IE2A 3MLBA 3DQQA 1R9JA 4FMDB 3L04A 2GHIA 5AXCA 4CCAA 3OT1A 4CL0A 1M1ZA 4RSMA 5T57A 4L95C 3E27A 1IE3A 3EFHA 5C5IA 1G8KA 2QTZA 1WUIS 1IN1A 4BFTA 5CB6A 2VP4A 3H1GA 1N6OA 4DARA 3U16A 4OQ4A 2ZS7A 3AW9A 5D51S 4A2PA 3OA2A 2ODTX 2AMYA 2PX0A 6PFKA 1EFRA 3FI0A 3GYBA 2XSZD 2FSSA 1PR0A 1JVNA 1YB1A 1Z5PA 2ZU6A 4FSDA 3DW3X 4W99A 1AA6A 2O3UA 2H4JA 1IHDA 1FLNA 2IEAA 2OAEA 2H9IA 5BW6B 3WGUA 1QH1B 2CK3A 3EAFA 5ARBA 1LGYA 3ICCA 3OZWA 4TRMA 3L7KA 1U7DA 4FGWA 2ZRIA 4OXXA 2RJ3A 4HPJB 3B3QA 3W2GA 4D0RA 1N8NA 3NEAA 2XZDA 3GH1A 2FFQA 4YXWA 1CUIA 4OUKX 2X8JA 1DE0A 4P2BA 4B7UA 1IMOA 1FFEA 4CM3A 1XDSA 4ALKA 4E22A 2VEOA 1JIKA 3HFRA 2PANA 3II6X 3WLRA 1H4TA 5AVWA 1U0RA 4FHFA 5KTTA 2R2GA 5M5BA 4ENTA 4MUYA 1B3RA 2YUIA 4AS3A 3ETLA 4EUFA 1XMJA 2QD1A 3D3NA 5DCLA 1PL6A 1NC1A 4BVAA 2ZJBA 4WNCA 3UJPA 3RWBA 4EHHA 2NTEA 5DOZA 2FVYA 5AKKA 3I4CA 3PI7A 4TV8F 3MB5A 4I5GA 2BAGA 4JVNA 5KYYB 1Z6TA 2PNFA 2ZUVA 1A71A 3OF2A 5MN4A 3DUFB 1OHHD 1Q77A 4MVYA 2OV8A 3H5LA 4PONA 5IM4F 1ZNXA 3SHVA 4JH0A 4DLBA 1HDOA 4N8EA 3V8MA 3H42B 3O91A 3R3WA 4OUDA 1JIXA 1M1YA 4D26A 3UAYA 2J5RA 1RDFA 4NCJA 1FP6A 3BERA 3R5KA 2WJ3A 1E1KA 1X1TA 1ONSA 3DC2A 3GARA 4Q34A 1NM5A 2CXNA 3NT2A 5EFOA 4EB8A 1RRFA 3S81A 3IT2A 1FIUA 1UFVA 3BA6A 3P19A 4M37A 3QK7A 4RCZA 2JCVA 1O57A 3QMPA 2YYAA 2IYLD 2F17A 2O05A 4EUKA 4DGSA 1UJCA 4E2YA 2VKQA 2ODPA 3PC6A 5DTEA 3KEMA 4JWKA 4BQSA 5EP1A 3C5WP 5ADUS 4Q7LA 2AVNA 1JSCA 2H4XA 1NXTA 3QBTA 4MS4B 5F33A 5KMGB 1XEFA 4XVCA 4BGVA 1DDOA 2QE7A 5FOXA 2AFHA 2A1TR 3QE2A 1SN7A 4MHSA 1H05A 2X5KO 1DOAA 1GYPA 1IAVA 3LZCA 3OLQA 4JHXA 4RF2A 4YRZA 5ALFA 2J4FA 5DHPA 1FLDA 2ZKIA 1J8YF 1RYYA 2B35A 1DL5A 2FMUA 3MG9A 3P4YA 4P5DA 1SEVA 2NT4A 2XOXA 3DC7A 4WWHA 2HK9A 4C29A 4FJ1A 4CM4A 4ENWA 4DA9A 1FTYA 2HPVA 1GZUA 4ZVMA 3EZGA 3L4KA 4M8NE 1NVBA 3GCWA 3T3MB 1YA6A 3JRWA 4TWZA 2OCGA 5EWMA 4EAQA 1XO1A 4ZIRB 4WKPA 5J1TB 1PP4A 3DMFA 3T0IA 2IHKA 3O4JA 1P5RA 1JHDA 2ODAA 4DV3B 2PH3A 2NZUG 3RSHA 1G3QA 4DLVA 1ATIA 1XK6A 3FVWA 4KWTA 3D4PA 3FYUA 1WKCA 1X1BA 1PW7A 1O7JA 3EA4A 3C3CA 3P9YA 4ROSA 5CXQA 1ADFA 1H8HA 1E2IA 1XTRA 2VEDA 3KBOA 3AINA 3LPAA 2Y1CA 1U8EA 3OZVA 4KIGA 3SS8A 5A4FS 5IDQA 4P4NA 4N48A 4R9NA 3SQWA 2EATA 1G3MA 1MTZA 1KFEB 1VPVA 2DWUA 3F78A 3O2JA 2NYRA 3CB2A 4U9HS 4ANFA 4IGFA 3AY0A 3TSWA 3WAGA 1LJUA 1F8YA 5IVDA 3EAGA 3FJYA 4WE3A 1A2KC 1CP3A 2Q8NA 4X3PA 4KN8A 3TSZA 2JZCA 2QVCA 2R4UA 4FJ0A 4DDWA 4BRSA 2C2BA 4MCAA 3AI7A 2WA1A 3A1UA 4HDRB 2DBQA 4LWPA 3FPBA 4MGIR 4ALJA 1RRVA 2WSLA 2AG8A 1JG6A 3UMVA 2JKZA 2B20A 2GA9A 1CBUA 2D5BA 4G86A 1JQDA 2BFMA 3A58B 3KXKA 5E0KB 3UOAB 3O84A 1T9BA 5HM6A 4A6EA 4ZGWA 4DPLA 1P0CA 4KMRA 1U2DC 4P58A 3PKIA 2A5YB 4F7DA 3ESBA 1CFJA 5E2AA 2GWHA 4JBIA 4RJ2A 5GWXA 5IMSA 1JFTA 2DXIA 2O0JA 1ZGAA 5JARA 4QYIA 3B5EA 3AVTA 1MG0A 2WQ6A 4FN4A 4NCNA 2GD1O 3S2FA 2DQYA 1E1CB 3GGOA 5FCDA 1PO7A 2B7BA 5DGCA 3M6WA 1KRXA 1FCJA 1MX9A 1I2BA 1ZO8A 2O7RA 3K0KA 2BM0A 2CNLA 3KK0A 4HD8A 2FUG6 1E6WA 3KCNA 4TTIA 3C1AA 4QM7A 2BDTA 5SY9A 2GCOA 2BMAA 3VYWA 3M5CA 1YDGA 1OYYA 1PF7E 2Q0QA 2QTBA 3IVXA 5TS2A 3RTDA 1V3QE 1OWLA 1EFPB 1G2IA 3MIIA 3HO6A 3V9PA 2GLXA 2QNIA 4CCYA 3BL6A 1UBKS 2A5JA 4FX5A 3ZWQA 2QBYB 1KP3A 1R4NA 4FFNA 3TVTA 2FR8C 2AN1A 4YRFA 4V0LA 4MIYA 2XCRB 2R4TA 4NBWA 3RUPA 1QDEA 3SQDA 4B9EA 5K99A 1H8HD 2ZWIA 4AJLA 1I0ZA 3MUOA 4NAVA 4RXUA 4A6DA 1Z0JA 3ZHTA 3DBOB 3NEJA 2QYTA 4IW3B 4PGAA 3LT0A 5AOBA 2O2HA 3B52X 3E5HA 5E4YA 3ELBA 1QZUA 4E7OA 1YIDA 2JIOA 4MUKA 5CCXA 4IAOA 1V0JA 1YVUA 2D3WA 2IOFA 3LUDA 3RVKA 1HFWA 2Y0DA 1FX0A 2C29D 1M5TA 3ZWYA 4EI2A 5BMVA 1M6WA 2C8JA 4MKRA 3D8SA 4LF6B 1QHEA 3KQHA 1M34B 2PKEA 3HV0A 5EC8A 2CFOA 4C3ZA 3G82C 2W2QA 3FOZA 3HM2A 1SGWA 3QKWA 3R5JA 4YJ3F 3RS8A 3K1ZA 1UDWA 1EXDA 2GNPA 5HRUA 4GMDA 2H2GA 3IR5A 4GMXA 1QC5B 1C7RA 5CJJA 4DXHA 4MULA 3WZ2A 2BGNA 3R3YA 2Q5QA 5I7SA 2QZPA 3FUCA 3VPGA 3A26A 4NCKA 1GY8A 4E5YA 3OA0A 3R0QA 3VBCA 3KKNA 2G25A 1N7HA 3LT2A 4CWAA 3Q40A 5HZGA 5IKEA 4UEKA 3A9CA 2AQKA 4IMJB 3AEQB 3ZCVA 2IUFA 3EIFA 5L45A 1L7BA 2XE8A 3D7KA 4JBWA 4DIFA 3F96A 1L9XA 1UCFA 2CLIB 1T43A 5DP1A 2OCPA 3ER6A 3F6CA 3A6DA 3AC0A 3DF9A 2OBMA 4FWIB 1ZI9A 3PR1A 5EP4A 5FYQA 3KETA 2XXAB 3A1NA 5AVYA 1IHXA 4UQOA 4Q4HA 4FS8A 4J75A 5TV2A 3RJ9A 4J3NA 4QBHA 1VYTA 4DJDC 1QRSA 1BXRA 4D42A 3ZR4B 3GN2A 2EERA 4P53A 3U56A 4PR3A 1TTPB 1Z29A 2PEZA 3SVZA 3RRXA 1G18A 1JN0A 3WDKA 4BBZA 3ONNA 5BN5A 8ATCA 2RONA 1IMJA 2YNMA 4HDNA 2XVZA 4J49A 1U2QA 2W22A 4RACA 4U63A 2G9VA 4FOPA 4EQ6A 1RMTA 4S04A 2J32A 1AKNA 2IEGA 3A2MA 2JIQA 3F6PA 1ES9A 2HRQA 3RR2A 4ZI5A 3SY8A 2Z98A 3GDFA 4W8OA 5B58C 4N7MA 4RHEA 2FMXA 3NKFA 1EWTA 5EQDA 3EIWA 5JYEA 1H6DA 1K86A 5HTOA 1NNSA 1E1RA 1TD1A 3AI1A 3ZH2A 1JPUA 4WN9B 5JBQA 1T3TA 3FPLA 1PN3A 1M2GA 3L8FA 2X5XA 4L78A 3E7FA 1JKJB 1NVGA 5FTLA 1UM8A 1CYDA 1ONPA 3E03A 1THTA 1MJ5A 1WXQA 1BEUB 3EA5A 2XBUA 3WLIA 3B1JA 1GU0A 1JFFA 3OJFA 1MPXA 1Y8AA 3KDAA 3PSHA 1E3JA 1GPBA 4PPNA 2QLNA 4ARZA 2R1UA 4OFZA 3EGCA 4NZPA 4Q7MB 3L5KA 2P1DA 2J45A 1IUOA 2Q6KA 3R9XB 2J6HA 3JWEA 3P0RA 3BD9A 2ZBDA 4KU4A 1KZYC 4JLWA 3AKYA 3EIUA 1DARA 1Q0UA 1RZ3A 2JLQA 3IDAA 2W8BA 3IMFA 4ODIA 1U63A 2IEBA 5F7JA 3BMQB 3U39A 4BMDA 4QIHA 1TZ2A 2YIMA 3BX1A 2FW9A 4PFKA 1ZRNA 4QJBA 4QELA 2WZCA 1UKEA 2AYZA 2XD9A 9ATCA 3THYB 3AVYA 3H8VA 3TR6A 4NCAA 4EHDA 3CG0A 4ZCIA 2IEZA 3R5SA 2UXCB 1SBCA 1TKRA 2N1MA 3DDWA 3FTEA 2WU4A 4ZVQA 3EOZA 3JASA 4QEKA 2AFVA 4XUCA 2A5FA 2H1IA 3AP3A 1JTEA 4TLCA 1FFHA 3P9QA 2CFTA 1MO3A 2VUTA 2O1WA 5EESA 1YA4A 3F6BX 4HSGA 2V5VA 3WGLA 3A9VA 4ZKEA 4NXNB 1DKUA 2ACKA 5C5CA 3RG8A 3WQQA 2WIJA 4X0EA 4RORA 1FYEA 2XH8A 2QTAA 3R77A 1Y6JA 4RESA 4XQ9A 2BCJQ 5J5AA 5A71A 3OZCA 4C0XA 4YREA 4DT1A 3BWDD 3H5IA 4NCHA 2PLFA 4RH1A 2YJ3A 2VPWA 3ZLTA 4I1RA 3STTA 3PU6A 4PIPA 4I1IA 3S68A 2DYKA 4MQEA 4DJ5X 3KTFA 1GL3A 4K46A 1D8TA 1SQSA 3KOMA 1P7YA 2P90A 4CKEB 1AY0A 3O8LA 3UC9A 3ER8A 4YWHA 3I8SA 5E1OA 1GPJA 1ZD9A 2OQ2A 3LBFA 3GRFA 3MMXA 4W7HA 2YHIB 3ZCPA 2JGDA 3QJYA 2GCEA 2AOTA 4C0HA 4KNVA 2HWYA 2QT0A 5H83A 1KDYA 4E4YA 3A6HA 2R84A 3RSLA 4E11A 1PGNA 4H1VA 5D8DA 2AOVA 1AHHA 3VHLB 4L9WA 1UZMA 3ZNQA 1SKAA 3F71A 4BQNA 3NDJA 4IVRA 5E1MA 2W2KA 2FPKA 5TSDA 1GQQA 1RCTE 3F9RA 2D4HA 3SK0A 2X5NA 1YULA 1V3UA 5LA6A 2VPQA 5K0CA 3R6DA 4UUBA 1FDWA 2Z1DA 3GCDA 3WL6A 3KV3O 2C5AA 5EMNA 4EUNA 1GV0A 1MIOA 2HCFA 4FCCA 3OOEA 1D03A 4K9PA 1AGRA 4U3JA 2M6RA 3S2SA 2Q1SA 2HDHA 3HKDB 2Q0HA 5G0VA 5C1DA 5LQDA 2VNKA 3RFFA 1TI7A 4U2GA 2C5LA 2DY1A 4NYMQ 1QQAA 3TLZA 3W34A 4MV9A 1V37A 1P73A 2VF8A 1NBMD 1IN6A 4QXPA 2Q7OE 1O5OA 4GXQA 5IDVA 2W0SA 3LLMA 3L0YA 4J8PA 4GBJA 1Z47A 4I36A 4UHKA 4F2DA 2R00A 2C9CA 4IIUA 3H83A 1S2DA 3TLCA 2QRJA 5FWNA 4ZAWA 4EPTA 1T2CA 1E66A 4U2CA 1RS0A 1VKRA 4CM9A 4DDTA 1OAKA 5JSQA 2AX3A 5K0TA 3W05A 3R5XA 1QHYA 2HJ9A 2CBXA 3A4TA 3HB9A 5IZCC 1N32B 1QV9A 5EJGA 1OOEA 1U0JA 3H2ZA 1Z2PX 2B8JA 4U7TB 4Z0PA 3ROTA 3KQLA 3WG9A 2BF4A 1GXSA 3K15A 2VXBA 1K8YB 5FWXA 4GS5A 2NW6A 3QKRB 4CMAA 2QVZX 3CNLA 5EKXA 4YAJA 4MVJA 1BN7A 4FFBB 5AIBA 1YS9A 2FMIA 2C1EA 4NEHB 1GPAA 2I2BA 2PTGA 5CFZA 2CLLB 4B17A 1LSUA 3L6DA 3NC0C 1TYAE 3GHYA 1TQ8A 4K9LA 2P35A 4PZCA 3PK0A 4GSYA 3UV7A 2QL5A 1K2WA 3DEJA 1WZCA 4LXTA 4XXHA 4BNYA 2FZLA 3ZCSA 4N18A 4XGKA 1BGXT 2O20A 1N5MA 1P91A 2I0FA 4Z4GA 1NURA 2XZPA 1JJBA 1LC3A 3IAAA 3PRJA 4BEVA 3EEFA 1NAIA 3HB1A 3SDSA 2OCIA 1MIHA 3KNZA 3CRNA 4IQFA 2WKSA 2FEAA 5CBPA 5ICEA 3TLGA 2QE7D 3FGPA 1ANKA 1RYMA 3W06A 4L85A 3L43A 5G2OA 2QR5A 1TZBA 1ECFA 2LR0A 3F3MA 4M9RA 1PCXA 3GRZA 4XIIA 3K53A 2P5YA 5D3MA 4CV3A 1EB8A 4YAUA 5CJPA 1CR2A 1Z6PA 2OHGA 3DPUA 2XWBF 2Q28A 3LFHA 4DB2A 2XUKA 3V4RA 3FZGA 1YQQA 1IXZA 3KT6A 1RLIA 1BN6A 1HT2E 2Z6UA 1NBAA 5IAJA 2NZXA 3W2IA 5I7EA 1Q7EA 4QUJA 6NULA 1PEYA 1SXHA 5HJ2A 1O0SA 2G08A 4EOGA 3Q5EA 5TB5A 4BXOA 2ZJ4A 1Y6QA 1JFLA 3OT1B 4EH1A 3N7AA 3QSYA 1E3WB 4C1BA 1VHDA 1VJ1A 1LBEA 1RWQA 3BF7A 1QHGA 1U0TA 3DZHA 5AVJA 4EMTA 1TKBA 4ZK2A 3N2EA 4KLNA 2O2YA 4EMSA 4RS3A 5EJ9A 1N9GA 4RUKA 4V0SA 1GTZA 3AWIA 4MQLA 1KNQA 1U6JA 3Q0TA 3S29A 3SOZA 4WFKA 5DHAA 3HO1A 3IILA 1X7XB 2ZYVX 3KTAB 3QENA 3GJ5A 3S8EA 4MV6A 5EQFA 4QG7A 2QRVB 4X95A 1J99A 3CKYA 3FFWA 4Z7OB 3WLNA 4FMDF 1W30A 3KQOA 1L1QA 3TUIC 1U5BB 1Y0BA 4MVJD 2V7WA 2H5IA 5D85A 5HEKA 2PH1A 2ZR8A 4F4HA 4Q1AA 3W6UA 4NENA 2O8CB 4WKOA 1U7OA 2HU5A 2OKGA 1JZSA 2Q4EA 1N5KA 1YE8A 2HPAA 3PGVA 4QYXA 1FS6A 3AFGA 3GT0A 1JBQA 4GOXA 5ERXA 3VHQA 5JMWA 2W7TA 3ZHUA 1F4VA 4O4JA 3OQBA 1WXXA 4Q03A 2FWRA 1CF4A 3P1JA 1H22A 3HDGA 4WQMA 1Y4UA 4GGMX 3T95A 3ND6A 5EMLA 1PUXA 2QTRA 1ZBDA 4DIMA 4E70A 4HWSA 1LVUA 2E49A 3HFGA 1MZPA 5J5VA 3WV4A 1MEEA 4NU0A 3CGWA 1BAPA 1KZ1A 5GGXA 1BOOA 1JNXX 5M3BA 2V6FA 4B3DA 1B23P 3D31A 2CLMB 4TPKA 3AY6A 3ABIA 5ECWA 1DQRA 2QMHA 2ES4A 3F4BA 4RPHA 1NQXA 2HBYA 3UMJA 2HF7A 2RGCA 1RKQA 1ZMXA 4M1MA 4QZVA 3JAMA 2XCTB 4LQ4A 5GOTA 1EE1A 1M1YB 4WEQA 1UAYA 2HA0A 3GJRA 4BO1A 4CQLB 1TL7C 3W78A 1X8LA 4MLPA 2OXIA 3LTEA 4FUTA 1KBQA 1QP4A 3T34A 3ZY6A 4O1MA 2H7YA 1G6OA 3PICA 3ZXYA 3AZOA 2GEJA 2R8RA 2NG1A 2NSHA 4LRQA 3AUTA 4QQFA 2ETVA 1KFJB 2GZ3A 2IZ6A 3EGWA 4GC5A 1OZ0A 3KKLA 4V0ME 1R16A 4QWMA 2PGAA 4ZVOA 4YV1A 3IKMB 4G09A 1OLXA 3AL3A 2JHGA 4LOIA 3W8FA 1NJFA 1PLJA 2C54A 1GNSA 3IBSA 3QBDA 5EG5A 1Y4ZA 4UMVA 2JLAA 1AMUA 4FFVA 2WMDA 1B8PA 3H0CA 4LJKA 3DE2X 2C20A 5DF1A 3CNNA 1E64A 5AOAA 3KB1A 3E3OA 1DV2A 1T10A 2ZIEA 3VR5H 1KVSA 2MHCA 5BSEA 4YR7A 1LQUA 4Z3KA 3KQTA 1BWRA 2WJPA 3SR4A 1DAKA 4IRUB 4WVLA 4LAFA 3DPIA 4LF4B 1TAGA 1YDMA 2QZJA 1A04A 3EZLA 3CW2A 3TQQA 1PJBA 2ZJ7A 3NI2A 4PAWA 2FZCA 4Q19A 5KTKA 3AK4A 1CUZA 3B53X 1XLUA 3W3AD 5BR1A 1RBQA 1WTAA 3JD0A 3WHLA 2G5PA 2GETA 2NUTB 1U7TA 3QVSA 1ZK2A 3HKCB 1YZNA 4CN9A 5BVGB 4N6OA 4EGQA 2PS0A 3PQEA 3Q3IA 3FWPA 3UIEA 1C81A 4NDZA 1RAEA 2RHMA 1SKBA 4Y2YA 3AFMA 1QUEA 4MTLA 5E9AA 3RYHB 4F4DA 1A1SA 3OZXA 2YQ5A 4FZVA 4I50B 4BMSA 3TR0A 1Z15A 1YCDA 1RM5A 4WASA 1UC8A 4WZ6A 2OM2A 1K7EB 3C3AA 3SZRA 5JQWA 3GGGA 4MHOA 2C84A 4LC0A 1CUWA 1I1QB 1MXHA 2V59A 3FYTA 3MS7A 2R00C 1BVRA 1HZJA 3QU2A 3LX4A 4M87A 1H8ED 1WKBA 4C9BA 1EVZA 5C8YF 2OO5A 2XRFA 1JQBA 2AYXA 2UVPB 3IOYA 1M2HA 1II9A 3OC0A 1KY5A 1D4ZA 4RY2A 3BTSA 4B4UA 2B7CA 3IV6A 5TT1A 1G41A 4B3HA 1P3Y1 3I2HA 5CFQA 3OCYA 4POAA 1QX3A 2Q45A 2ZULA 1QCCA 3CPSA 1VJ5A 4CI0B 3U09A 4ZHSA 3QPAA 3LG2A 1N2XA 5EE0A 5A3VA 1SOUA 1PAUA 5I7WA 5DIZA 5JOQA 2PJUA 2WVGA 4JB3A 2YNMD 3G8CA 3FI9A 1VCNA 1DO0A 3PNBA 5AM1A 1N2GA 4B2IA 5AR1A 2WHQA 4CBVA 4EGJA 3U9LA 1ZM9A 5KYUA 3VH2A 1H42A 4LFCB 2XKBA 3O73A 3KR2A 1T0IA 2YL2A 3PT9A 1AMOA 1USKA 2J31A 3BHJA 2AZMA 3DVRX 4MLDA 4DADA 1S3IA 5G0SA 2JEZA 4TYWA 5B37A 1U94A 2JFBA 2OV3A 1RI3A 2PEYA 2O3RA 1WW8A 2A94A 3IUPA 4FZ3A 4CEIA 2X4LA 3S3TA 1M33A 2Q5CA 3ZWCA 3TXAA 3NHZA 1T0BA 2HCRA 4EFKA 1N92A 2QQGA 1KEKA 2XKAA 3ACDA 3I2YX 2PHZA 3TLYA 421PA 1T3ZA 4DV1B 4RTMA 4L15A 2HT6A 1YFKA 2BEVB 2WJGA 1Z0DA 2E85A 4MW6A 3VDMA 2ZSFA 4QRHA 1VCHA 1LS6A 2P4EA 1C7JA 4Y2QA 3EQ6A 4FS3A 2EZ4A 4EECA 3IP5A 3W4JA 4KPGA 3RIGA 1KJZA 2H1HA 4FOOA 4HVTA 1LC0A 3CXUA 5HE9A 4HOYA 1QIGA 3Q8MA 2G28A 4A0QA 4CIBA 1P0MA 1VL0A 3SJUA 4KV9A 1P1KA 1ZIOA 1Q2XA 4UM5A 5EIWA 5A4DA 1Z68A 2JJ1A 3HBLA 3ETDA 2PLWA 3AI3A 5HIIA 3VDQA 4FONA 4YVFA 1BVUA 1Q0SA 4W63A 3SKXA 1EUQA 1ZX1A 4H2DA 2X76A 4BGUA 3OZUA 1WR8A 3NPAA 2GPTA 4JCOA 5A04A 2RHRA 2XUQA 4L28A 3FHTA 2WWHA 4W9NC 3MT9A 5A0VA 2WZDA 4X6UA 5JJLA 1W581 1I7SB 3LCJA 4ZO7A 4MDEA 3SIPA 3NC1C 4S1TA 3H1FA 4HUQB 3WIBA 3DBHB 2VJNA 3BB3A 3WNQA 4C20A 4C21A 5KVSA 1ZMRA 3NDIA 1ODFA 3T12A 1WZ2A 3LHIA 3VVMA 1JDZA 2RC5A 3IJPA 4CYMA 2HLPA 3O0TA 2O2DA 4RMHA 3Q8LA 4HG2A 1E3WA 1U2GA 2FPRA 5AUQA 2GH1A 1V7ZA 3HS3A 3L1UA 4ARUA 4DF3A 1C7QA 2OTCA 1IM2A 2WIDA 1MCZA 3B6MA 2O5EA 3IODA 2XITA 1CEYA 2FG6C 1WUHS 1GTVA 3UH0A 2JLVA 1QWOA 2ORWA 4IG4A 5H02A 3NONA 4Z53A 4ER6A 1IVSA 4TWRA 1XQYA 3DFZA 2A1IA 3DZFA 1XP8A 1JR6A 1PK9A 2B34A 2GXUA 4TRJA 4HQNA 1PU2A 4JR1A 2W0MA 3VSDA 4QUAA 4Q9IA 1MENA 4XGIA 2PGOA 4MVJF 5DNAA 4B48A 1HLPA 3UAWA 1SVNA 2PMWB 2WPDD 4EVQA 1DCTA 1AMNA 3K9HA 1IN5A 2VBCA 4EA7A 4IHAA 1MB9A 3AVOA 4CDGA 3OQOA 1HNXB 2RH5A 2MSKA 4R1MA 3M1IA 3DCNA 1Y9ZA 1XMSA 2EAUA 2YV1A 1OAOA 4G0YA 5A3RA 3LW7A 4GSLA 5ALYA 2FWMX 4A16A 3CSSA 4GNKA 1R0SA 3H86A 3RTAA 4YT2A 2GJSA 2OCYC 1Z22A 2R3SA 2R65A 2WJAA 3A1VA 4DVGA 4HDKA 2HNKA 3ZTWA 3WICA 4EG5A 2P77A 2HXSA 2DCUA 5FO0A 3E9QA 3MD0A 2BBWA 1PJZA 3Q72A 4XR4A 3QLVC 4G23A 1USWA 4H18A 3S2UA 3WTCA 5KX5B 4RTRA 1P1IA 1QO7A 1ZIDA 2PVSA 3M5WA 4JLBA 1QIFA 4KGZA 4BFYA 4CLOA 5JT1A 2HDWA 4Z0NA 5K8TA 5JMOA 4N8DA 3RFTA 1RJWA 4Q4CA 1J2EA 2Q6LA 3JQFC 1XDGA 4FFSA 4DN6A 5EIBC 2REOA 2HTEA 3KQVA 5FQNA 2Q4BA 3C8DA 2H2WA 3RHFA 4MW4A 4MI9A 3VKGA 3NATA 4UM8B 1Y48E 4IXTA 2BJWA 1O95A 3KFLA 4M49A 4JLOA 4O59O 4DQDA 2KM1A 2PX2A 4TTRA 4MV1A 1XJ5A 5H9WA 1PV1A 2IFTA 4BKOA 4EFDA 2HMVA 3CN9A 5F2NA 2WWYA 4KFCA 3M70A 1CCWA 1GLGA 1F5SA 1WP4A 1CF9A 3DLIA 4CLRA 5FDFA 3KR9A 5FFNA 5EKTA 3AW8A 5K09A 3GN1A 4WHMA 3OQVA 1ORTA 2YWRA 2QB5A 1XBTA 4UE6A 1OIVA 3VPDA 2JFZA 4X5OA 2BMDA 3OZDA 2QS9A 4GKVA 4OBEA 1EIWA 1GSIA 2LBPA 2W8BB 5AQ1A 2MSEB 1MV5A 4NG4A 3EZ9A 3ME5A 5DYIA 5IEJA 3WKBA 4BUZA 3WIDA 3OWHA 3PD0A 3HLYA 1PR2A 4LHYA 5EINA 1AQ6A 2NO5A 3O2QB 4MHTA 3S5UA 3JQ6A 3D7LA 4G1VA 4I55B 4R01A 1GGEA 4JELA 5M34A 2WD7A 3MJDA 1WBJB 3VPBA 1A1VA 5IT5A 2V74B 4BKPA 1EK5A 3MCUA 2OORC 3SC3A 4BQRA 2SBTA 5G0WA 1E0AA 1EHCA 1SZCA 2G4CA 2IYSA 1OMOA 2XNCA 2XR1A 3EZFA 3PJEA 1H4QA 1OVGA 3L82B 2RGBA 2G9NA 4PX5A 4J2OA 1CJTC 3VFDA 2NUTA 2Z8ZA 3PHJA 1L8QA 5I3ZA 5KYNA 3W0LB 4TV8A 2CWWA 3DTNA 3HBAA 5EA2A 1K6JA 1MNAA 2AE1A 2ASVA 2GBIA 3OQ6A 4ENVA 4K03A 4NZNA 4XLTA 3GLIB 2AHRA 3CVOA 1L1FA 3EA0A 5B3JA 2YWBA 1E77A 3EJWA 5DM2A 2PL9A 1TCBA 3BE4A 4C4TA 4KG7A 4IDEA 1LX7A 2CWDA 2OBBA 3A1CA 2QI9C 5KOYA 1MDFA 2ADOA 1QORA 1U1CA 3OCZA 4FLEA 2I4RA 3TZEA 3NB0A 4UEOA 2BKEA 1SBNE 1GJRA 4Q3CA 2GVNA 5B1SA 2GRUA 2VAMA 3PTZA 1L1EA 3VTFA 3FNFA 2WM2A 1ZIXA 2CB9A 2O0KA 3OLZA 4NFYA 2QRZA 4ZCSA 3KYJB 2DUWA 2IEIA 1K7CA 1ISJA 1C3XA 2HF8A 4HN9A 4GRAA 2YXDA 4IUYA 4KDCA 4KO1S 3ON5A 4WDQA 1GCUA 4UXHA 1GHTA 1OI7A 2P6MA 3AH8A 3DDZX 2J3IA 3NRCA 3UICA 1GFSA 3WO1A 4IEFB 4WXHA 1K8RA 4OSOA 5LA6B 2Q9UA 4F5WA 3K6RA 1WCXA 1MVLA 4GXTA 3RWMB 1H3NA 3PUHA 1NF2A 4HEJA 1ZESA 2VYFA 3MJEA 4O29A 3SZLA 2Y93A 1PL0A 2PWYA 3TIVA 3VH4A 1XMQB 3DR5A 4D9BA 3GP8A 3ANSA 1YIOA 3UHFA 1FU8A 4XM1A 3O1JC 1TB4A 2C98A 4OBBA 1TIPA 1LZKA 1D07A 1FZQA 1OGJA 4O4HB 5B4VA 1M2NA 4EYKA 1JRLA 1JXQA 4DREA 5K5EA 1TQ2A 2FQ1A 2L82A 5DH9A 5HPYB 2O50A 4BZWA 4S1OA 4P5EA 5KQRA 1GUBA 1E9BA 2O3TA 4N5MA 1RRPA 4B76A 3RADC 1VMKA 2PZAA 2I8LA 1JQLB 4ZAFA 1FE8A 1PBTA 2PKXA 2R5WA 4E4TA 1YC2A 4ND4A 5F35A 5IANA 1QS0A 1UBFA 2NO0A 1Q15A 4I8DA 4PTLA 3P27A 3MRXA 4DUGD 1BGWA 4KNYA 1NC3A 5ALXA 4Z2YA 5AOVA 1I0IA 5THQA 4NQZA 1LFDB 1FPQA 4NKRA 3HI6A 2VUIB 4ZWNA 3VPXA 2XYHA 5CCDA 4Y0AA 3I9NA 3BH7A 3D2CA 2QDXA 3H4VA 4FFPA 4MWEA 1J1ZA 3CZCA 3PHBE 4I5EA 4CT5A 1FFWA 1PQPA 1ID8A 5C4IA 1EQUA 1DIHA 2CJYA 2V6MA 2W2OA 4GXNA 4V1CB 2EHJA 3NEPX 5FUXA 3QOWA 3UO8B 5LSAA 1ZC3A 3VI4B 2R5FA 3D3WB 1K27A 4FNMA 3TE6A 2WI8A 1FP7A 1IPEA 4HQ0A 4UPDA 4CETA 1SBQA 2Z1NA 3E2MA 1R9MA 5B12A 4Z4CA 1NVAA 3K30A 2PPLA 1UXOA 2ZCUA 1FNNA 2FW0A 3GEGA 4GVPA 5CLLA 4CG1A 5IHXA 1JSLA 5IT9A 3QKTA 3H2BA 4PSKA 3RFCA 3BTVA 4CKWB 2R6HA 4EKDA 1JHUA 2ZTSA 2WT9A 3GR6A 1BXRB 1ZMTA 4MIOA 3H2HA 1OH5A 3M82A 2PUWA 2AZDA 4WECA 3ASZA 5AXAA 5HTKA 4LN1A 3IA7A 4Q9LA 2OAGA 3OEEA 5IJAA 1G5FA 2ZJ5A 3BCSA 1HC7A 2AMVA 3DV0B 3T61A 1P2VA 3F8SA 3QVLA 4L7VA 2GXSA 1Q1NA 2VYVA 3EZ2A 4YJGB 5JWRA 4IZ6A 3LQKA 3MBOA 1BD3A 3NTUA 1KZ9A 2DR3A 4OQYA 4R51A 4X20A 5ALRA 4EQ6B 3C2QA 1QH1A 5CT5A 1KEWA 4ME6A 1E79A 3C1UA 2EZ8A 4WGGA 4EJ2A 4G1CA 4EPVA 3TL3A 4RF4A 4ZI2A 1W4RA 1XF1A 2IK8A 3KL2A 4FYYA 4NMLA 4HY3A 4PYRA 4TTPA 1NNLA 3NUQA 3VZSA 2AXEA 1O0CA 2PX3A 1O4WA 1MRNA 2EWWA 2II6A 2JGFA 2JGJA 3ZH9B 2LXNA 2P5TB 4INZA 1H2ZA 3GEMA 2CJWA 1L4HA 2SKCA 3QUTA 4CTOA 1TCUA 4B3FX 4YAEA 4MV3A 1F0KA 2IYUA 1ECLA 2WLTA 2J0UB 3OLYA 4AN1A 3ORYA 4AC9A 4KL8S 2YXEA 3PEVA 4AY2A 3DVAB 3JQFA 1WZIA 1X39A 2HMWA 1KQGA 3LXUX 5MFPA 3SVLA 1CJMA 1UZUA 2DFLA 1UJ5A 1K9VF 1G8MA 2ZCVA 2V7PA 2I76A 2X4IA 2I55A 1HT1E 2HSGA 2DF8A 3P9ZA 1NSTA 1UJ6A 1JEDA 1QYWA 4IIDA 1ST2A 1HDYA 5G0TA 2ZWVA 3BK2A 4M3NA 2VQ6A 5HQTA 2QD4A 1OLSA 1HM5A 1Z56C 1XZFA 4IQGA 4TUYF 5CTJA 2J6BA 4DIEA 4PBRA 1CJVC 1ZXBA 4FJ2A 4YGYA 1GVHA 3VTZA 5IN4A 1GA4A 2O5CA 3GRVA 3I3SR 3U3KA 1VPTA 3KJXA 2X58A 1AN9A 4X66B 4V24A 4MJ7A 2BFOA 1V95A 1IHOA 1ZONA 3BMOB 1MGPA 4UNIA 5DBHX 2J7KA 4CW7A 1PD1A 2DPMA 4LKOA 3EZ7A 5H4HA 4IDFA 3GA7A 4UCWA 5J2TF 1KL7A 3ZBTA 1KO7A 3OURA 5AI8A 4Q3DA 3R5HA 2J85A 3W9BA 1RQ7A 1WSWA 3PA8A 3EOBI 5AKLA 1FTNA 4PLFA 1CZKA 2DGDA 4Q9JA 4E5VA 4X93A 1TIKA 3AB8A 4M89A 2PA3A 4RANA 1REQA 5AT1A 4ZMBA 3AGQA 2X0IA 4DB4A 3AEZA 3FLMA 3BL8A 3FDFA 1XD2B 5CAEB 2AFHB 1AN0A 2O9JA 4BEJA 3GELA 3FMFA 3HEAA 5IAEA 5A1JA 4QATA 4MGEA 1NA5A 5KYWA 3NMUF 4UFPA 2JVKA 2AI2A 3CLRC 2ZBQA 3DFFA 3MTGA 4PSCA 3H13A 4RPKA 3V46A 4MA4A 4B74A 3P0JA 2WPNA 2R68A 4Z8YA 4WK2B 2F8TA 3PHLA 3SEFA 3SS7X 1IJFA 1QE3A 5GV7A 3QLVA 2DLDA 4GECA 4LJ5A 3T5DA 5BWNA 3VYTB 3I9OA 4QLOA 1XPUA 2QUHA 1Q1QA 5EZ6B 2EW1A 2JNWA 4BFZA 4DA0A 2Q3DA 2LPMA 2XYPA 1J2JA 1XA3A 3GZ4A 1L5HA 4ZIRA 1IY1A 1I5OA 3PC2A 4WZBE 5B3JC 1G98A 4L16A 4JC5A 2FA9A 1SXQA 3AUXA 1STOA 2H5EA 3FCEA 1GGFA 3H65A 3IUBA 4JKIA 3OEYA 4RE5A 4WCDA 3CLUC 4DXDA 5HKKD 1EYZA 1ZJYA 4XGNA 3H05A 5AK4A 2J3EA 1WXHA 5G3ZA 4RZ2A 3SGLA 1WSDA 1ZR4A 3RC9A 1FL9A 4QDUA 3V7UA 2ZRGA 2VRNA 4AJKA 3NHKA 2UUBB 1ZD4A 1MIOB 3BB4A 4TXHA 3LOQA 3KVNA 1SUPA 2PT6A 2XGMA 3IMEA 2FPUA 2YMPA 3QH4A 3QMWA 4U3JB 1K92A 1HE8B 2BFFB 2R7MA 3AERA 3G2KA 5EJ5A 2R1ZA 3K6JA 5AKIA 1B93A 1E3DA 4FYMA 5D6OA 1HYGA 3SZ3A 4JV5B 1HZZC 3CH7A 5F2KA 2FP3A 1NAHA 2WYIA 3HHEA 3EWIA 4X44A 4ND6A 5CT4A 3WWPA 3ZKAA 4L8GA 3TS1A 5B3LA 3AVXA 1UDBA 1QHSA 4F3NA 2KMLA 1FUKA 1AUOA 1XYVA 5BUQA 3D5TA 1XZBA 5A5EA 4LRUA 3RS4A 2J9RA 3TLGB 4XWGA 4AP5A 4URYR 5JXWA 1SH7A 5FADA 3HN7A 1ZH6A 2P40A 1EJBA 1VXRA 5ENDA 3RYHA 3U3DA 2OY0A 5E2IA 2Q2VA 1QTNA 1DO8A 1KXZA 1ZSVA 1MA3A 2M98A 3BSWA 3R6TA 4IJQA 4PQFA 4NK5A 3UGTA 5ISMA 2ATIA 4F12A 2XGGA 2IOFK 1P7WA 4ENQA 1CUJA 3S2EA 4JI3B 3QQ5A 4G01B 4UHDA 3AM1A 2GEUA 3NCHA 4M46A 3MW8A 1JHPA 2P6RA 2W9XA 3R7WB 3WIVA 1U2ZA 1JFRA 2GNOA 2JJ2A 2G04A 2W83A 4FFBA 5HJ7A 1W5FA 1IQ0A 4FW8A 3ZE1B 5DGXA 4LZLA 4BS9A 1NW5A 2MU1A 3E8MA 4E5PA 1LWOA 2QIPA 1N1MA 1ZUD1 4ZCLA 4P34A 1K8QA 4ID9A 3WK4A 4H3SA 5G4LA 4HSEA 5I9MA 1KP2A 4HDQB 4WXRA 3TW8A 4MS3B 2CUZA 4H60A 1L6RA 2CDBA 3EXAA 3GFQA 3OEED 5K0GA 4IS2A 4E5DA 1E63A 2G6BA 4AYXA 1NQWA 2PQ0A 1P81A 5EXPA 3DO8A 4YB8A 4P22A 4YAWA 4BU0A 5FV4A 2NP7A 1M7BA 3GDWA 2QYOA 1V5IA 1YB2A 4O2BA 1W96A 5MN6A 2AN4A 2ZR0A 1E2MA 3HL0A 2KQUA 3MIZA 2Q8QA 2XQFA 1KE2A 1JWAB 1XZCA 2FZEA 5I47A 4NV0A 3D6TB 4LXGA 4R5MA 2DFDA 2X4DA 4UBKA 4EEKA 4F9FA 1LQ2A 3EE6A 4IJMA 1PGQA 4INOA 3RC1A 1KMCA 5JC8A 2RGWA 3E0XA 4HQOA 1LV7A 3A1TA 3UYKA 4KQIA 3QYFA 1QOZA 1KNXA 3GJ4A 5IDYA 1GCIA 2P4UA 4IOJA 3KUXA 3I53A 4UU7A 4D8TA 2IHZA 2NAPA 3C4VA 2VYND 4K9RA 1T8WA 4PM4A 4MDHA 3U6KA 5D1HA 1YBAA 1G6KA 1AQUA 1QZ3A 3I64A 4G0XA 4XWKA 2YW9A 4IDHA 4NZYA 4TZKA 1T2UA 1XVTA 1CUAA 2OK8A 2R1TA 3KDPA 3OIUA 4Y6GB 4UTNA 3H1BA 5JTTA 1VKJA 4IWNA 5ALNA 3RTEA 5IG2A 1J22A 3AUKA 2FH5B 2HU8A 3BC1A 4GR9A 4LMBA 2VOJA 1X7XA 2IY9A 1I5EA 4BJ5A 2IYYA 1TIBA 4Z9XA 4DIUA 3F7TA 3ZY2A 1U0NA 3I2IA 4HEA1 4DYVA 5IKXA 1W4LA 4N0DA 3O8CA 3FVVA 3JARB 1YAHA 4PLVA 1A3CA 1UMDA 4M0PA 4OM8A 1VKNA 1WXIA 2FRVA 2PKWA 5IDWA 4UQPA 4DSTA 1FLVA 3CF4G 2F64A 2FSUA 4Q9DA 2OV2A 5AVSA 3KOZA 5FJIA 1KVTA 3MRVA 2QTLA 3EULA 2PGLA 3O8QA 3DDUA 4I46A 3RF6A 4I9HA 1E2GA 3VDRA 1JG1A 3ZD7A 1NHWA 1N1GA 5KQLA 2YR0A 3AIMA 4P31A 4Z4QA 3K1AB 5BWCA 5JAMA 1HH4A 3IRVA 2ZJ3A 1SY7A 5DW3A 3CUKA 1D9XA 1T36B 3EY4A 2FGKA 2ZE7A 3MJHA 4FBLA 4V3CA 2DAPA 4XRRA 2GILA 1NP7A 3WYFA 3OE1A 1L1RA 4OBXA 5AW5A 1T1JA 4X1YA 5HCNA 3SSNA 3NALA 4WIAA 1P4HA 1KI6A 1TZMA 1SXPA 1IZYA 4IEEA 4JSTA 2EJTA 1SZDA 4HDNB 4IJKA 2D5IA 2B3TA 3C6XA 3GQBB 3KYCB 4QUIA 4B79A 4N65A 5KJ6A 5LU8A 2K7ZA 1NV8A 3OIDA 1QYXA 2AN3A 2EF0A 4B35A 3O90A 4KNWA 5JQGF 5ILOA 2ZBPA 4REOA 5C34B 2HWKA 1SULA 3D43A 4LISA 5KHOC 1X1EA 4EY4A 1SC6A 3UAZA 4Q3LA 1QFSA 2XMQA 3HYNA 2H7CA 4JUCA 1WP9A 1GZVA 4G0QA 5FI0B 1V8OA 4RF3A 5JE8A 1UM9B 1W0KA 4G2NA 2P2SA 4ZVUA 4DLAA 3FZEA 5DXFA 2ZIZA 3DJYA 1KORA 4TWBA 2VQSA 2CV1A 4FGZA 1JFFB 5TQVA 2O0MA 3FJ1A 3OZRA 2J46A 1PW5A 1SU7A 3D8TA 4S2EA 4GVLA 2IYPA 2QI9F 1T8RA 1U90A 3BDAA 1SQ5A 2J30A 5H68A 5TT0A 4K6KA 1YZGA 3DS8A 4ALLA 5IVPA 4B80A 1NBMA 2VYCA 4CMGA 4MINA 3CWQA 1DCKA 1UT6A 1SCBA 3K1JA 3T5MA 1A5AB 1UOPA 2DSNA 5HUJA 5LMNB 1Z7GA 3C14C 3RVPA 4TN5A 3P9SA 2EJCA 3ZDYB 3THOA 1J06A 2FUNB 3CINA 3QX9A 1DV1A 4RZQA 4B8WA 1DBVO 3L7IA 3ODGA 1EZ1A 5C8XA 2UYGA 3BMQA 3IV9A 3MHTA 3N2KA 4QBKA 5EE3A 1P0PA 1VSQA 4WFQA 1F6DA 5GZ3A 4GOJA 3ZXIA 3EVZA 3MCZA 4W5TA 5J47A 1YQDA 2Y0CA 1FFBA 1NXVA 1F6WA 2PD3A 3CMCO 3DKIA 1X94A 4P6VF 5F5NA 5J9FA 5AK6A 4AT1A 1GLNA 2WD8A 2EIHA 3IEVA 1W19A 2P9ZA 3OO1A 1BS1A 1KJWA 1Z17A 3OTGA 3K1TA 4M7OA 1ENPA 3T7CA 1P1JA 5HRCA 3RARA 1L5HB 3GOHA 4GWLA 3ILSA 5TQ2B 1SCQA 2Y1EA 2O8VA 3RRJA 4PGGA 4MZDA 3IBGA 3KOUA 4O1HA 4ZO8A 1SXJC 3FPHA 3ZWBA 3KQMA 1EX9A 4FCVA 2QM7A 4UNSA 4ZT4A 4TLLB 2FFRA 3TMYA 1BQEA 4BDSA 4DCJA 3EOAI 3HKCA 2BC9A 1QH0A 5HDBB 1B3BA 1II8A 2CDRA 3JQGA 2UXBB 3B1YA 4H1UA 1EGVB 1L7VC 1SCUA 4KOEC 4B84A 4DT1B 5DTIA 2GEFA 2FPPB 2D6FA 3CRQA 1O8BA 2I4OA 2GARA 1I14A 2VNAA 4JEMA 2YS7A 1I1HA 3AHDA 3PQ6A 4MQEB 3ZS8A 1A4UA 1IN4A 1NIJA 5FYDA 4ALMA 1XRRA 2WV9A 1G5QA 2RFLA 3FJOA 2Z3VA 4MR7A 4C08A 4UJ3A 3JZAA 2ABWA 3U5TA 1KYXA 4KFUA 4DLRA 1W0KD 1MUUA 3BS4A 4F9TA 1R4AA 3FW1A 4M36A 3RB8A 4OB7A 4CMHA 5JAOA 4GQIA 5BN4B 5GV8A 3EDQA 3KAJA 1HT0A 4BLTA 2IZ7A 1K5HA 4II2A 4CR7A 2ZRLA 3PHHA 4NBNA 1M6NA 1OLOA 1ULAA 2D0DA 4QFMA 5F2EA 1EM6A 4MQUA 3K2BA 4ZQGA 1JG3A 8MHTA 3ZHRA 1N5DA 1Y9AA 4R6WA 1S2OA 1J42A 1FUUA 1GT91 1W73A 5HHTA 1QO0D 2WDPA 2W2VA 3MPUA 4K8RB 3SF0A 4F72A 2JIZD 4MWZA 2QTGA 2EEPA 1G21B 3A6ZA 2E55A 1CSEE 4R9VA 3RT7A 2FFHA 5GJBA 2WW8A 3NU1A 1EK1A 4XVRA 3HXLA 3VMMA 4D8UA 1OUMA 1XTIA 2E4ZA 1X80B 3G8BA 5BWBA 1Y6GA 3RD5A 4C7MA 2JGAA 4RK5A 1CVLA 2IUSA 3EUFA 3MXOA 1PEKE 2YMMA 3F9IA 2MSCB 1GO2A 1IZ7A 4BNGA 4YYEA 4K26A 1X87A 2RD2A 5L7TA 1PS9A 3L9XA 4LJ9A 1OX4A 1B7GO 2WSYB 4PANA 2C0PA 3GNSA 3RHZA 2Q5IA 3GEIA 5ALZA 4S0ZA 3NPMA 4CIWA 4FGLA 2BGTA 3I2JA 1TMKA 5E95A 4IIGA 2RBGA 1W29A 2B78A 4PYNA 3RYFB 2VPZA 1F9EA 4UUOA 4GX0A 2Y9MB 4W1SA 4O4JF 3WWYA 2QN8A 3NBZC 1E2DA 1WIWA 2PLNA 3EVDA 3NOVA 4YCDA 1U9ZA 1W87A 2P8SA 4IHJA 1GUAA 2CKMA 2F3UA 4IOLA 3D4IA 3KIPA 3PXEA 3INYA 2P4QA 1T1EA 4FBMA 3R41A 5KU1A 5JISA