3BHNA

Crystal structure of a dj-1/pfpi-like protein (shew_2856) from shewanella loihica pv-4 at 1.76 a resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
214
structure length
214
Chain Sequence
MYKVGIVLFDDFTDVDFFLMNDLLGRTSDSWTVRILGTKPEHHSQLGMTVKTDGHVSEVKEQDVVLITSGYRGIPAALQDENFMSALKLDPSRQLIGSICAGSFVLHELGLLKGKKLTTNPDAKAVLQGMGGDVQDLPLVIEGNIATAGGCLSLLYLVGWLAERLFDSVKRKQIQNQLIPAGQMEIFETLISETIQSAESAYEYRSACESDAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/PfpI domain protein
publication title Crystal structure of DJ-1 like Protein (YP_001094981.1) from Shewanella loihica PV-4 at 1.76 A resolution
rcsb
source organism Shewanella loihica pv-4
molecule tags Unknown function
total genus 81
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bhnA00
1PDVA 4L78A 3NONA 1GGEA 4LRUA 4OFWA 3EFEA 4WINA 3VU3A 1T0BA 1P7YA 2XF2A 1OY1A 3TTTA 3NOOA 1J42A 1R9GA 4UOQA 3TTUA 2GHRA 5SY4A 1PV2A 2IUFA 1P80A 3FIJA 4B31A 1G2IA 1Q2UA 2ISSD 3CZ9A 3BHNA 2VRNA 4K2HA 2R1UA 2R1VB 5SY9A 2V4UA 4D1YA 2YWDA 1KXJA 1IPHA 3R75A 3MIIA 3NOQA 4XLLA 2NV2B 3CY6A 3TQIA 3ZJ4A 1I1QB 4BTEA 1M6VB 5JZOA 3ER6A 4UCFA 1OX4B 3N7TA 3SF8A 1KA9H 1JVNA 3CZAA 4ZDKA 4JQSA 4P36A 4B5KA 1VCMA 2ZUTA 3MGKA 4Y0NA 1N57A 2GK3A 4AUEA 3ZJ5A 1JDBC 4R7GA 4AUNA 3WFZA 5SYAA 4N12A 1GPMA 1P5FA 2H2WA 3NOVA 4Y1GA 1KWGA 3L3BA 4PXYA 4P5PA 5JZMA 5E9AA 1CS0B 2AB0A 4ADSG 3EZGA 1WL8A 1K9VF 3BWEA 1QDLB 1S1MA 3KKLA 3TTXA 4ENRA 3P9SA 4BFLA 1GGHA 3ZR4B 4P35A 2ZUWA 4L8FA 3OT1A 1VCNA 1QVVA 3L7NA 2LXNA 1GG9A 1PE0A 1FY2A 4GE3A 3TTWA 5BV2P 2R1VA 3EJ6A 3NVAA 4HCJA 1CF9A 1KEEB 2OR3A 3P9QA 3SOZA 3PQ6A 3UMMA 4WXYB 3PQ3A 1Q7RA 3CYFA 2NV0A 4LGYA 4RKWA 3R76A 3L4EA 4L8YA 1OX4A 2R1TB 2FEXA 3EWNA 3FSEA 1SOAA 3CNEA 3F5DA 1CE8B 2WJZB 4Y1RB 1T36B 2ZUUA 1IZYA 1P7ZA 4OIFA 4S0ZA 3UOWA 4B2YA 4E08A 3NORA 1OX6A 4GE0A 4QYXA 1O1YA 2VXOA 4ENWA 1OI4A 4ZDJA 4ENUA 1I7QB 4B7AA 4OGGA 1KWKA 1OX5A 1ONSA 4E5VA 4P2GA 3D54D 2RK6A 3SF8B 3B38A 3TTYA 4OGFA 4L95C 4Y1FA 2RK4A 4ZGGA 4QYTA 1GGJA 1U9CA 4RKYA 4L8WB 1GGFA 4OJYA 1UCFA 1GPWB 2VKTA 3TTVA 1BXRB 2A9VA 2VDJA 4I2NA 1QWSA 2W7TA 1FYEA 3EN0A 3F71A 3PQ7A 4GUDA 1QVZA 5DFAA 3RHTA 3UK7A 4AUMA 5LIRA 5K4AA 1T3TA 2YWJA 2YWCA 1SY7A 4I4NA 4Y1EA 4L7QA 4MGHA 2AD5A 4ENVA 4UOZA 3UJNA 1PDWA 3M3PA 1GGKA 1L9XA 3OT1B 2R1TA 3B36A 4AJ9A 3R74A 3PQ5A 4N0MA 3TTSA 2VPIA 3PQ4A 3GRAA 4AULA 4Y1RA 4ZDIA 1P81A 1VHQA 4ENQA 3L18A 3PQ2A 1A9XB 2ZUVA 1QVWA 1I7SB 3PQ8A 2ZUSA 2RK3A 4UZSA 4MTCA 2ABWA 4ENSA 4BIMA 1IZZA 1C30B 4I46A 4MNTA 1VCOA 4B40A 3P9PA 1C3OB 1QF7A 4P34A 3B3AA 3UGJA 4ENTA 4OQ4A 4ENPA 5IP5A 3P9RA 2D7JA 4UNIA 5SY6A 2YWBA
chains in the Genus database with same CATH superfamily
3QBVA 4TTVA 4MVWA 4K9KA 5DNAA 4E1BA 1WP4A 3IBSA 4HNRA 2IVZA 1E2NA 3EXG1 3QHPA 2E5FA 5FTJA 3GNLA 1KK0A 2I66A 4J94A 4L5JA 3ZKWB 1DU4A 2WZCA 3DAFA 3EVAA 4X3PA 3UOAB 1W85B 3WTCA 3EPLA 3SCZA 3PNMA 1EWRA 3EWAA 3G9XA 1P45A 4HDRA 2QM7A 3AF0A 2QRKA 4C89A 4DLLA 1IPHA 3H1AA 3UA3A 5AVWA 4XUGB 1I6LA 3ZQ4A 4ZFNA 3M9XA 2A0WA 2HT6A 5HCUA 3C3XA 1KY5A 4F7WA 2NZWA 1MRZA 3K6SA 4ONEA 1JAXA 3GOHA 1P0MA 1PS9A 4QD3A 4ZJPA 2A0XA 2UUPA 5ESXA 3CCBA 3K0KA 3Q7PA 2QROA 1V6SA 4Q48A 4U9UA 4JI0B 2I2XB 4XFKA 4HP8A 4IO0A 1MB4A 2H2WA 4OQXA 5BQPA 3W5IA 4E1AA 2JFGA 5JBIA 4TKMA 1HORA 2OQ2A 3OIYA 3WGMA 1XNRB 1H1DA 2Z2YA 4IDCA 1JJ7A 5AM2A 5ALFA 3E61A 3C1TA 2V9CA 3AR6A 2H54A 3N5KA 3EZ7A 4IJKA 3SYLA 4CQJA 2PZLA 1G6OA 2E6UX 2PIAA 4BLQA 5L3QA 2VP3A 3CXUA 3GT3A 3KSUA 4R2IA 1BMTA 1JI0A 3RIMA 4EBFA 4WBNA 1SOUA 3ANNA 3BMOA 5LXTF 3WL6A 3C1AA 3EJ6A 3TIXB 2MJLA 4QT4A 3V4LA 4TTTS 3UFBA 1F14A 3RBAA 2WAMA 4GLBA 3KJZA 3ESXA 4ZT5A 7MDHA 5K5EA 1ZH0A 4DA4A 5I5GA 1AGNA 1IQRA 4UBKA 3W8FA 4DSNA 3LFTA 4DDUA 1R0XA 1U0OC 2IPOA 2EX1A 1KH1A 2D4AA 1SUCA 2ZI9A 3F5DA 3FLBA 2IEAA 3QA3E 4TPKA 5TGDA 4YRJA 2ZBRA 4YGXB 3MINA 4YT8A 1NNI1 2IGTA 4GZMA 2RARA 2KB0A 3BS4A 4X45A 1MQ9A 4DLBA 5LBTA 2Y0PA 1HNXB 1NBME 3O3OB 3ZK9A 4C3ZA 1SH7A 1U2EA 2KQUA 3ROKA 4CLHA 1J8FA 3SF8B 4IXDA 2HW8A 4I6GA 4D74A 1DIBA 4R31A 1GGNA 2Z4RA 3CLVA 3EW9A 4JC5A 3BFVA 3WHLA 1PNRA 4M0KA 2VRCD 5FUYA 4ZCPA 1U98A 4QDOA 1LFAA 1Q57A 3QLVA 4YRTA 1O89A 2CNWA 4ZXPA 1R6VA 2AG1A 2XD9A 2WK1A 1DJMA 4L8GA 5ALIA 4ALIA 3BFKA 2AG5A 4YXFA 1HTBA 2BGRA 1TPYA 1ZXXA 4HN2A 3QQPA 4X20B 2FU5C 1EE1A 2R8XA 4Y1EA 2W90A 5FI3A 4GMHA 3PUXA 4LRYA 2YH2A 2DWPA 4N3BA 3QTLA 2GX6A 3ZY6A 2JAUA 4NE9A 3OWHA 3HJUA 3L7LA 4UAUA 3U1BA 2C4MA 2WHRA 3NU1A 1VYTA 4L5BA 1AG9A 1S3IA 3R5FA 4M1EA 4WEQA 5C80A 4Y2VA 1OW3B 2TS1A 3DEYX 3BCHA 3IYLW 3MLBA 4KLCA 4LOIA 4ENQA 3O84A 5A04A 3TLCA 1LBTA 4GBED 1Y5NA 4H1VA 3PQ8A 5BSUA 3UJAA 4D9JA 2QTCA 5A1TA 1QAQA 5HRAA 5KDOA 1T8WA 3GRRA 1T5DX 3ABIA 1EBUA 3B5IA 3L1UA 1PL0A 3LZDA 3NOXA 4C0QC 5BT8A 3WB9A 4GRDA 4IX1A 4BNGA 5BSRA 3HCOA 3OQOA 2P4EA 3AO0B 2YY5A 3QJGA 4OQ4A 1EWQA 3OSUA 5FO1A 4Z7QB 4YP6A 1XFDA 3FWNA 4JJIA 3ICCA 2WJHA 4IGFA 4R8LA 4BQQA 4DSTA 4PBRA 3OM0A 1B42A 2PG3A 1HO3A 2GF0A 2VYFA 2WWGA 3MFYA 1Z0UA 2RCYA 2DLDA 1IG3A 1W88A 2JIPA 1U9ZA 2I91A 3AVYA 2QTFA 1TW3A 3ULKA 2B1JA 3Q11A 3H04A 3NBKA 3W5AA 4RFSA 5SY9A 5FI1B 5E3HA 4MQ5A 5KOJB 4CXMA 3B5JA 1SEPA 1XBTA 1QO0D 3N86A 4GBMA 3L84A 4XLLA 4ASUD 3ZS8A 4XIGS 4MKHA 3ELBA 2G9QA 2X9GA 2O9JA 2Y6UA 4BAGA 1HZJA 4DN6A 1Z5NA 1KO4A 1J1UA 1UINA 3I6YA 4W5WA 3ZJ5A 3KKNA 4FHDA 3K8QA 1P5FA 2RFLA 4FFWA 4JY7A 1K6JA 1SQGA 1SO8A 2K87A 5C3UA 4AZVA 4KQGA 3K94A 3TL2A 5LP6C 3I5MA 4MA4A 1FZTA 3TQCA 1WR8A 4PBSA 2QL5A 2FF7A 3H9QA 1YSCA 3M70A 3HN7A 1T3HA 3NWBA 4Y2UA 4BRUA 4EG3A 3S2FA 3LLCA 1P1KA 4D8TA 2Z83A 4GR5A 1ZUWA 3MHPA 1KQ3A 5I7AA 3L8HA 4Q3BA 3AEQB 2VJAA 3VSBA 1DHRA 1XLTA 3QVGB 4XDZA 5AH0A 3KYJB 3CSUA 1CETA 1V1RB 3E9NA 4EI8A 4LSMA 3QNUA 4O63O 4ZHQB 1PGOA 2PN1A 3OE7D 4KODA 1BCSA 1ZONA 4FGLA 1SBCA 3MMZA 3NIBA 2RDMA 4GKBA 5AIBA 1E1RA 1D4OA 1ZL0A 2XA9A 4OHZA 1O0CA 3BJIC 1RAHA 2OBNA 4ND2A 3DT8A 1RFGE 1GRCA 3GEEA 4PAMA 3WIBA 1BDHA 3HP4A 4X7RA 1GPAA 4WCDA 3VHRA 4D7AA 1JR3D 1WTCA 4PAQA 2UYCA 2C96A 1W4AA 2PUEA 3M9WA 5TF4A 2BN4A 5KNDD 2EDAA 2J7PD 2PLRA 4PIVA 2BM0A 2C2BA 3KB2A 2QTAA 2E1RA 3R0IA 4M9UA 2Q8NA 2NACA 2V6GA 1Z5OA 2CXOA 3V9AA 4RSGA 4YQYA 1L5OA 2IT1A 3F6CA 5F2OA 3SN6A 2C9MA 5K6AC 2Y1FA 4TL6A 4ZCQA 4D0LB 4E7PA 3FMVA 4HLNA 3TNDA 3O21A 4EPXA 1YO6A 1AOXA 4FFVA 1EGAA 5IKOA 4RZ2A 4A8PA 2OSVA 2QN2A 1DE0A 3PXXA 1OZFA 4KX5A 4P2BA 5AHXA 3ESAA 1JQEA 2B9VA 4I3HA 4WJLA 5F12A 4BQRA 4YR9A 1DMRA 2OC4A 2C00A 1A95A 2Q9BA 1NXXA 2CXTA 2VPIA 3R5XA 4OHOA 4RCVA 2WWIA 4GI7A 1USVA 1YL6A 3EG5A 2QRPA 4CQLB 5JD5A 3NCTA 4F72A 1M73E 4CT0A 5D87A 1WD7A 4QARA 4X44A 2ZRIA 3EYWA 3RSQA 3KXDA 4V3CA 4C1BA 4DJAA 3GLFB 4Y6QA 1JXMA 4D25A 2E49A 3I64A 4D82A 4DDVA 2Z98A 1AKWA 4WLFA 4RTSA 2UXCB 2O06A 2GCPA 2XI4A 1UMBB 3I2YX 1Z4KA 5DXAA 4KBFA 4MUMA 3RRFA 4NKRA 4UE3S 2OMKA 1N6OA 2RBGA 4ZCRA 4OA8A 4BFWA 5HF6A 4G4IA 3BIWA 3M7IA 3EC1A 4CLRB 2E5LB 5FA8A 3PUWA 4UOQA 3CZMA 1JFFA 2I34A 4OAOA 4WWHA 3N2LA 4MGEA 2OXRA 4TWAA 5DHRA 2NUTB 4OHVA 4QIHA 5EI5A 4GMGA 3EGVA 4JJAA 4NFLA 4KREA 3JVDA 3KQLA 4LMPA 1QU3A 3VTKA 1JQ5A 4TYNA 3F7MA 1E99A 1T5OA 3TLJA 4KAAA 3CH7A 4OLBA 1MH9A 4MTLA 4BVKA 1R3DA 4PGGA 5G0TA 3W5BA 4JENA 3TVDA 1OJ7A 4GM1A 1K06A 4FEEA 2VWQA 3EK2A 1J2UA 2HADA 3O8NA 3X43A 3DFFA 3GHYA 5I45A 1MO4A 2BFDB 2PS0A 3G7SA 3M6MD 2OCKA 2XUZA 3SJZA 2B0JA 1T4CB 4UATA 4DLWA 3ZIUA 4CEIA 3QG5A 3W9BA 2ZB2A 1GITA 3IUYA 4PGAA 4CKWB 1GTSA 1JALA 1W2GA 1D0IA 1I7NA 2OCIA 1YA6A 3ZWWA 1LDGA 2ONCA 1KYIA 5IM4A 2WA1A 3OLYA 4G1CA 3W5UA 3GLGB 3A6GA 1HG0A 2QUJA 5EGSA 4W5JA 2FPRA 3DC2A 3L8CA 4NMHA 1CUZA 3BL5A 3IEKA 1Z0DA 4RD4A 3ANSA 4XA8A 1NN3A 4RESA 2XQIA 5JTUA 1CWUA 3D0QA 2H2HA 2KLBA 1FTNA 1ZG3A 2FQYA 3PQ6A 3WJ1A 1ZZEA 3RS8A 4KQ9A 1HFWA 3V7WA 2A4MA 2BSQA 1QORA 3FDFA 1JJFA 3I72A 2R751 3NBMA 4QYIB 5ILQA 5JMOA 2C0CA 1RLMA 4KN8A 1IWOA 4BKOA 2D0PB 1E9CA 3I39X 5E7MA 4G1EB 3F6YA 1T13A 1P2GA 3QH4A 2CCKA 1BDIA 4EJMA 1QRUA 3SHWA 1O1YA 2R5NA 3QEJA 1NBIA 2I4NA 2GZ2A 3H2ZA 5IM4F 3JD2A 3ORYA 2OGWA 1GO2A 4A27A 4E5VA 1AN9A 2A58A 1Z26A 1U8FO 2OXFA 4KKXB 4CCYB 4RZXA 3CUSA 1QFJA 3QGMA 4JJ8A 2WWYA 2LNDA 3WDSA 1AQLA 4MVJP 1ZH8A 1TLLA 5EJIA 4P82A 2YRFA 2PD3A 4HX2A 1SUBA 2JIBA 1OTXA 3JVVA 3NBXX 2E4VA 3P94A 3U37A 4P53A 2SKCA 3VDRA 3GVIA 2XPCA 4XD7D 3DOUA 3ESBA 1I3LA 1WNTA 4YUXA 1U8CB 4Z4EA 4ILEA 1E2GA 1PFUA 2AG8A 121PA 1VSBA 4OQFA 5KNCA 4MRRA 1Z2NX 1J0EA 1L5WA 1ZOIA 3BIFA 3UWMA 5KJ6A 5JG7A 2YHIB 4PZCA 3GJTA 5E6SB 2ZIUB 1O5IA 3PQ2A 1ORIA 4KQHA 4ME6A 4UXJA 5DNVA 1RBMA 5ECYA 5CLLA 2AQIA 1JMYA 2C0PA 1KP3A 3TH5A 5JQGA 5KX5B 3RVPA 3BWBA 3SJ7A 3G2OA 1N2GA 3LU1A 4G2NA 4G5YA 3UHAA 1CF4A 1S7CA 2ODWA 3IRUA 4ENPA 1Y8ZA 3PXCX 5CM8B 2F43B 1OMOA 2NW6A 2ODBA 2QT1A 2CGEA 3O2SB 5JHGB 4MP8A 3ZI7A 3WK6A 1OXXK 1OAOC 1Y8RB 4H9GA 4WNCA 3NTOA 1VHJA 1CJKC 4B4OA 4XARA 2CHVA 2QYHA 4QEKA 1CC1S 2GPWA 2KS6A 3IA2A 5ECWA 4KQKA 3TIIA 1MZVA 3WWEA 1X38A 1FYFA 3RC3A 4AO6A 5C7IO 1TJPB 3MS7A 3P1JA 1CP3A 4JR1A 2QRVA 4NMXB 5JFOA 2XMCA 3NUZA 5KTMA 3FYSA 3TLBA 1PKEA 2GEUA 1GY8A 3ENQA 2O6LA 1P0FA 4FDTA 3LIPA 4MJ7A 5DHTA 5JNTA 1ZRHA 3RKUA 2O3RA 3LRXA 1KO5A 4QJBA 1MX3A 2WVHA 4HDNB 2ZYDA 1RC8A 1XTTA 1UZMA 3JARB 1IZ9A 3OFKA 1F4LA 3ZCQA 3EXEB 4EUFA 5KU7A 4FP9A 3A27A 1VE3A 3JQPA 5A4JA 3I1FA 5ALYA 3TCNA 1JHAA 1SCBA 4EO9A 1E1QA 1DAEA 3G7NA 4GIBA 3SKVA 1JJBA 4IDAA 3MPOA 3Q5DA 3V1TC 5IFKA 3VA7A 1PJ2A 4OX9B 1VCNA 5M29A 2GRUA 3AVPA 1V26A 4MV0A 4O02B 4E11A 4URXR 2F00A 4XXHA 3HBMA 3R7BA 1L4GA 3UT0A 3HLKA 3GEGA 5ESWA 2GN9A 2R65A 4U2FA 1QCZA 1D4ZA 3O8BA 2ZGVA 5TJHA 4XWOA 1M3SA 1XLUA 5FPYA 3DEJA 3BSWA 1DO0A 1V47A 4I1PA 3EXAA 4JXXA 3GVXA 3EXIA 2IU0A 3PGXA 3SJCA 2ZTUA 1UFQA 4MW4A 4S1PA 1JIIA 1WAMA 3D3WB 4WAUA 1DQRA 2CK3D 3CKKA 2Q49A 5C8XA 5ITSA 5KYNA 2V58A 3WL4A 4DJEC 1BNCA 3VDXA 2VP4A 1BTOA 3GAFA 4GPBA 4ER0A 3D6AA 1F0YA 3C3YA 2QI9F 4WE3A 4BLWA 4DV3B 4JN6B 5HDBB 1TU3A 1KI9A 2W2NA 2E55A 2HWWA 3D2AA 5JPCA 3S8MA 2PZFA 1ONOA 3ZVRA 1KP9A 5DK6A 3ZZNA 3DZBA 2YHSA 4NJEB 3RUAA 3L8EA 2IVFA 1DXYA 1Q22A 1AKYA 2BUBA 4IXMA 4LZZA 2A86A 3V4ZA 4PLZA 2VHJA 2VG8A 4X64B 3OP4A 3FHCB 4LYHA 3I9NA 4N5HX 2XT6A 1E6LA 3EUWA 3VPGA 4D56A 1KL7A 4WD3A 4ECEA 2A67A 2UYOA 2L0XA 2XYQA 1DTSA 3J80A 4ZPJA 5DI3A 2RGWA 5EYPA 4BBZA 5HIKA 2AGVA 4KN6A 3R4CA 1MC5A 5M2QA 4G0YA 1NWHA 4GSLA 1BQEA 1J8DA 1NVVQ 2HIAA 2IP4A 3CU5A 2W8BA 2V74B 3QVTA 3S2UA 3QE2A 1I6KA 3FIUA 3AB7A 2HWXA 3CURA 5TPWA 2R62A 5EAIA 2H7XA 4EHIA 4QX6A 4YRAA 2GZRA 3E4DA 5KNDH 2OFPA 3RNOA 2RGCA 2OXIA 1N6LA 4BX3A 2ZUVA 4IGAA 1BG6A 2G71A 1W76A 3Q4GA 3HDHA 4NOMA 4ZRNA 3ZW8A 1G9TA 3K6KA 4HMQA 2PRKA 2ZIGA 1EK2A 1SA0A 1QC5B 2P9FA 3N87A 4PC3A 3IEIA 3RKRA 2BFAA 3GO4A 1NP6A 2I1LA 1UMKA 2AC2A 3AKDA 3GJ4A 3MW8A 1ORTA 5AK0A 1G6Q1 4YDQA 4JT8A 3THXA 5IC4A 3BULA 2NVUA 5EHNA 4GNRA 1HLPA 2Q2QA 4PF1A 2EQAA 4A73A 3PDIB 1GQQA 2NM0A 2ZU6A 4LBYA 3CKYA 4QDKA 4CM9D 1JHVA 2ZTMA 3D6FA 4C4PA 3ZWKA 2BFCA 1I7LA 1I4DD 5LZ5A 1M5RA 2BI7A 3QV2A 1AZLA 2VP6A 4X1YB 2KWIA 2YQ5A 4NK5A 5BRJA 4WKNA 2A3RA 4QXPA 4XIIA 3T41A 1PEAA 4Z7OB 4B3HA 1TAHA 4NRDA 5M7EA 1P73A 2XA2A 4C21A 4G9EA 1TECE 2BGKA 3C87A 3LUPA 5JW6A 1NURA 1E3JA 3KJFA 1UC4B 3P2MA 4PC6A 4U7WA 4F1KA 4N4AA 1W2HA 3ROGA 5LZ2A 4X8LA 4GOXA 1JDJA 4MWSA 3STYA 1ZK4A 2BMJA 2I1QA 1NOKA 4WOPA 3L7MA 1JDBC 3GAZA 3ICWA 3Q0EA 4MIYA 4PLTA 1AKTA 5EIAA 2GUWA 4K9NA 5KQLA 1PK7A 3L7KA 3LTEA 3KUDA 4I4TB 1WWKA 4MROA 5A0TA 2LPMA 2JH3A 1MQ8B 1X9IA 1ZSNA 2VHZA 3PNQA 4WGFA 3TX6A 2R2GA 4G01B 2G9ZA 1QHIA 5C0OE 3L0BA 3DHWC 1KAQA 4WOBA 4G8JA 3MLEA 3HLYA 4WZBA 4NARA 1U4NA 1PD0A 1ULHA 2H08A 3IV6A 3OURA 4OUKX 4UTRA 2PGLA 4EL5A 5H4GA 2PXAA 1CF9A 1O08A 1CD5A 3NHLA 3HG7A 3TSWA 2GN1A 1D1PA 2A94A 3KV1A 4ML3A 3K0AB 3VSDA 5AVQA 1BQ3A 4RPKA 3Q6IA 3LC2O 1NYQA 3MSXA 3H2HA 3MAGA 4MEJA 1EX6A 1A96A 1RHKA 4N41A 4MV5A 5KTYA 1LC0A 3KKPA 4BASA 4ALJA 1P7ZA 3WLJA 3ZCTA 3DOIA 5BR4A 1YI8A 3HCWA 3KIPA 1YKSA 3VO9A 2D5IA 3GRPA 3WMGA 3B9RA 5CM9C 1HDIA 2XJ9A 2NO6A 3SPXA 3OZUA 5F3WB 1DAMA 1EFCA 4QUDA 4AI6A 2XQKA 4RNDB 4I8DA 3D59A 1G4UR 3FI0A 3IBGA 4A16A 3FYUC 1IYZA 1QGUB 2C7BA 5CLGA 1Y7HA 3RS3A 2RC5A 4MI3A 4CF3A 5KOIA 4F9TA 1VI6A 2XQGA 1SKAA 4IYRA 4CEHA 2A7QA 3WYGA 1GLGA 1P9OA 4PBTA 4BC1A 4CI9A 4AQ7A 1AMOA 1S6YA 1XD2A 3DXYA 1E2DA 3M8KA 1WHSB 2FZKA 1ENZA 2PLWA 4G4SP 3OPXA 3T9CA 1LQTA 5B2FA 2G4LA 2SKEA 2DHQA 3MBKA 3ZZMA 3AESA 2JCBA 1CVRA 4F8JA 4F1WA 2YXPX 4MWDA 3F2VA 4F06A 1SC1A 2RGXA 4IICA 1F60A 2FEWB 3WB0A 5JZVA 3ASUA 2R25B 1ILWA 1LI7A 5CW1A 2V4MA 4Y0AA 2VQFB 3KLMX 1H9CA 1DXOA 3T3HA 5BQOA 4ZJUA 4RIGA 4ES6A 1BRTA 1SHKA 3CLSC 5FFFA 2VJCA 2WJYA 4TV9A 4EG0A 3OAAD 2FMUA 5L40A 3TMKA 2VF5X 1EJBA 1KMHB 1SU4A 5CP8A 3RTAA 1O9GA 1QV6A 2EIXA 3KKEA 5CA0B 4N5IX 3DBRA 3HLTA 1OFUX 1QKKA 4KN5A 2X1HA 5IC6A 3AUYA 3TNYA 4UCQA 1YTLA 1AGXA 1KHTA 5TARA 1M0TA 2D7CA 2I55A 2C9DA 3HADA 3SHQA 3TIFA 4E6PA 1UBJS 3HRIA 1ND5A 3AJ9A 3CINA 4NU0A 5CFQA 1SXHA 5CDUA 1CEQA 4IS2A 1WXIA 3NWJA 3DCNA 1KDTA 1DCMA 2ACWA 1L1QA 2FPSA 2Y1GA 4KIUA 4CI0B 3IVXA 5CD9A 4A6PA 4G4GA 1RZRA 3F9IA 4K6OA 3UJHA 3H65A 4M98A 1SC4A 1JQAA 2TMYA 3LT5A 3OMXA 3BWCA 4D97A 1W25A 2Q7DA 1Z8NA 2IIVA 4HGRA 4WXMA 4MGIR 4OK3A 2QAGB 3TNLA 2N46A 2FSUA 2WM2A 4GPZA 4OXIA 1FFEA 1S02A 1J09A 4H7EA 2I80A 3RUFA 3HCDA 2FWMX 1L7PA 1CUCA 2IYUA 1EFTA 1XKQA 4N54A 4P38A 1Z2AA 5JRZA 4MH0R 4DBZA 2NTJA 5A9SA 3UCEA 3DQPA 3CX6A 1OHHA 2IYZA 1AK1A 2IBMA 3CN9A 3JALA 2ZWIA 3P0FA 4M1YA 5JJCA 1E6EA 1NW5A 1QYIA 2QVZX 2PL5A 3NDRA 4NZNA 5H59A 3SBEA 1EK0A 1XAIA 4YQEA 3CRW1 4PYIA 2QENA 4LJRA 4YBZA 1G6HA 4RYDA 1RI5A 3OE1A 4DJDC 3CVJA 2RGEA 5ABPA 1CUSA 1KTIA 3O8RA 2YDXA 1I30A 1UBNA 4RTMA 3HUEA 4P80A 4RK4A 3NHJA 3VV2A 3E5RA 3ET4A 1UODA 1NATA 1HT1E 2D1QA 4TN5A 4C14A 3QVWA 1KFEB 3GDOA 3RS2A 3T3DA 3JWPA 5CVUA 4DC1A 1G5HA 3HVJA 1JDUA 1VJRA 2VPTA 2YHUA 3GD7A 4FZJA 2QMEA 1Y3FE 1NW4A 1XZMA 2X76A 5TX7A 4CIBA 2C7PA 1C9YA 2BY4A 3C7AA 1XD8A 3R7LA 2BFWA 1BXRB 4GD3Q 2P90A 2O8DB 1F6BA 1XZBA 5E6RB 1A9ZA 5BMVA 3U4MA 5F23A 3WK8A 5C1DA 2GCGA 3RASA 3E9YA 5E1BA 5LA6A 1M6HA 2RGNC 5IUJC 4DYHA 2QXTA 2W43A 4R0NA 4U9IS 2LCQA 2EJCA 5FXMA 5BNZA 2ZJOA 1GVHA 2XNSA 2JB9A 2I76A 4UFOA 2O23A 1JEJA 1L7QA 3CIFA 2LBPA 3N5CA 3PBKA 4LY3A 1M67A 3AFNA 5ALJA 1YF3A 1DEOA 1U3WA 3PIRA 2WC1A 4FZ3A 4AYWA 1IC6A 4UW9A 5DNCA 3G82C 2BELA 4Z7JA 4E4RA 2FEMA 3OE7A 1VLJA 3FOZA 2JAQA 3WLNA 3R8FA 4V1CA 1B43A 5IJWA 1L7MA 4ZO7A 4F12A 2YJ3A 3TSAA 2I7TA 1TIKA 5F5LA 2I1WA 1QZXA 2X3FA 4YR7A 5TEWA 1NF3A 1M1XB 4REQA 1RCTE 2CNLA 2QPOA 2PUDA 5F7JA 1Z07A 3U60B 4HPWA 5LOVF 1T91A 2IDMA 5HSGA 4YA6A 4PSVA 3G0IA 2A9RA 1NQVA 2BGLA 2IU3A 2YWEA 2XMZA 4B47A 5LZ4A 4WX2B 1GTVA 2VQSA 3HSKA 4LZAA 4QJ5A 2IH2A 1UK8A 2IEIA 1VDMA 2XVXA 4F7DA 1EDOA 2FZ5A 4FPXA 5JZOA 1L9KA 2P8JA 1YGPA 2QVXX 2ZS8A 3NHRA 4ZARA 3U26A 3AVUA 4TXJA 4JLWA 5HMLA 4B2LA 3ZDBA 5JPDA 2AKEA 5IT4A 3HZOA 1BMFD 3RG2A 4M0MA 4V3BA 2BWJA 1T6ZA 2CWWA 2E4WA 2PSFA 3VKVA 4AUNA 1K63A 1AB6A 2RI1A 3STXA 5IHPA 4JP2A 3X2FA 5FPKA 2Y2UA 4QGBA 3UCXA 3I42A 4FYYA 4G0ZA 4Q5IA 4RGBA 1XZIA 3JATB 4RMIA 2VTEA 1C7EA 3GZTB 4PTZA 4R01A 5ALKA 4EYGA 1U3UA 1PEDA 3FPGA 2XE4A 2GZAA 3G13A 3HJTA 1YBMA 4L8FA 1BVYF 2F1KA 3T7TA 3ZKWA 1X0VA 2J5QA 2YXDA 4UZEA 1ZSYA 1W85A 3FZNA 5ALVA 4HQRA 4CUKA 2OHFA 2VDWB 3F9CA 3N59A 2XKJE 3ORQA 4RY2A 2XVZA 4CODB 1BS2A 1EQ2A 3Q5GA 1ECCA 2O1XA 4WGGA 3CG4A 2EFGA 4RV5A 1EFPB 3KLOA 5D51S 3T3MB 4RTNA 3O9ZA 3S5JA 1Y9ZA 4JMLA 4R1MA 4EKYA 4C4YA 4EJFA 4S2EA 1X7DA 3G0OA 4YN3A 3AX6A 3GAMA 3VKWA 2O8BB 2XIQA 5A4IS 4KXNA 2WF7A 1G55A 1SBIA 2BBOA 4PCAA 3T5MA 3E9ZA 2DQSA 3B6ZA 2Z8XA 1HSOA 1O6BA 2GFIA 3IERA 3NHUA 4R1UA 1YBVA 2RIRA 6GPBA 5FAXA 3O73A 1P3DA 3B7GA 2RK6A 3SOPA 3RC9A 2P4UA 2QX6A 2VHYA 2W6MA 1MJGM 3HKDB 4N3AA 5K7SA 1KQGA 2X0FA 1R0CA 4FXPA 4DE5A 4RKYA 5F3RA 2GYWA 2HDOA 5F7XA 4BCCA 1WDLA 1VIDA 2VK1A 1EE9A 1NJSA 1UQUA 1RRGA 2BHSA 2ET6A 2QTHA 4L73A 3GJ3A 2GA8A 4UUQA 1AHIA 4MRPA 3EN0A 4NONA 3UK1A 4HFJA 5JSQA 2W22A 3CVYA 3R6WA 1QTNA 3RDPA 1ETHA 1HZZA 2WIJA 3LA6A 1GUAA 2JFXA 5IT0A 1QIMA 2MIIA 4BCBA 1Q0RA 3SXUB 1GL3A 4E2ZA 2VJLA 4X6LA 4EA8A 1MDFA 2D1FA 4AJJA 3OLVA 1FRZA 2UZ1B 3GMIA 1DAHA 2ZB3A 3ZTYA 1FJXA 5EJ9A 4L3VA 3HJAA 2Z9DA 3WP1B 2GM9A 2E3JA 4UD6A 4UNPA 2X42A 3TGPA 3UMVA 2HSWA 3HMKA 2G80A 4FOLA 3U9LA 5LQCA 4WLVA 4J0KA 4EB6B 3BMQB 5H7XA 2QIPA 1V95A 4HWRA 4WK6A 4CMEA 5ARBA 4GXRA 3BTVA 4GZ6A 4LZJA 1PR1A 3SSAA 1H93A 1U99A 1XZLA 1SAYA 5MGBA 1AVTA 1MNAA 1OLOA 2P6OA 3UHPA 3T38A 3ZWMA 3N74A 3CQ9A 5L7TA 1SK9A 3C98A 5EJGA 1Z08A 3KKOA 3VPBA 1Q1NA 2BAGA 3STVA 4GPD1 3L6OO 1E7YA 2DCUA 3VYUB 4S0XA 3RRXA 4X20A 4GYJA 3FSGD 1RKQA 4RAOA 3LNTA 5EN4A 1Y3AA 4KE6A 4JC8A 1PFKA 3L01A 3MD0A 2GYYA 4TTPA 4GWGA 3VZSA 1V1JA 4M8IA 5AKHA 1LI5A 4LUCA 3EAFA 3RFTA 3DL4A 2YW9A 3DXXA 2IHNA 2BI4A 5E8JA 4KQFA 3IOBA 1VE5A 2XTNA 4C29A 3JQRA 1JHMA 1Q0LA 1Q7CA 2R8BA 2AZTA 4H59A 3SBDA 2F17A 4U7JA 1ZMOA 1G59A 3FDZA 3FNRA 3KQMA 3LGXA 1FTGA 4IDQA 2RAPA 3I83A 4I81A 4JP1A 4O4LB 4D5GA 2Q0XA 2GF2A 4XD7A 5AKYA 5CDYA 3MWGA 3SGLA 2GKOA 3MJEA 5FLYA 4KXXA 4W1QA 4LF6B 1TQ6A 2I8AA 2ZVPX 2GEVA 2C2HA 4XYBA 3NKFA 5GY7A 4ZCMA 1PZNA 3QFSA 2YVUA 5EE3A 2H2DA 1RHRA 1JDNA 3MMXA 5J43A 3OUUA 5FA6A 3N0WA 1P0IA 4JYCA 4Q3AA 3MS2A 3RJTA 1QCYA 4R2KA 4C7VA 3E53A 2Q1TA 1Q0SA 3T0IA 5CJ2A 2HN9A 2GDJA 1JEDA 3T06B 3UMCA 1NUQA 3F6BX 4CM6A 4EG8A 5KQRA 1JLSA 5DTMA 2EP8A 2Z57A 2UUOA 3B5EA 4KWIA 4X90A 5KOJA 4EY7A 5P21A 1E3LA 3CLUD 3GMSA 4FI3C 4DLPA 2V98A 1H8ED 2P8SA 4S3MA 3D6TB 3ZDAA 3FKSA 1ZGJA 5A2GA 3H5LA 3X1WA 1ZISA 2RKOA 3IQXA 3FA2A 1QNFA 3Q88A 4Y2PA 2P5YA 5DVZA 1A77A 3STWA 4YASA 1FUKA 1UPXA 3HK2A 4Q4JB 1OX5A 3LLSA 2OD2A 2CVFA 4E12A 1YDHA 1NKVA 2AZMA 4HPJB 4AN4A 4KMRA 5GINE 3RM3A 2OP0A 2Y0CA 4GR4A 1G3IA 1QM5A 3HGMA 3UA4A 1A7UA 3AUTA 3HV2A 1CZNA 3GFTA 4PX3A 5GM2A 3DE3X 4DW8A 5T8KA 4CG3A 2GT1A 2NO0A 3B53X 5JVDA 4F71A 3QVGA 1SQFA 1V1RA 2EP7A 4RY9A 4ZHQA 1FU8A 4NQZA 1PNQA 3SHVA 3VFDA 4KZPA 1SZJG 4QSMA 5AKIA 4CIWA 1MB9A 4DC9A 5AD1A 1N25A 1HC7A 3AZQA 3D2CA 3DTVB 3I32A 3U7HB 1B2RA 2FHSA 5H8WA 1GTL1 1WPRA 1ZL2A 1T0JB 1HKHA 2I33A 1VG9B 3HCFA 1ZVQA 3EDCA 4LE2A 3UH0A 5AW0A 1NUSA 1KBOA 2AN9A 1KAHA 2HK7A 2XE6A 3LWBA 3OD5A 4FYHA 1JLLB 1DG1G 4PW0A 1Z28A 5C31A 3I0ZA 4B40A 1JT2A 3DL2A 1U2ZA 5T41A 9MHTA 2PZMA 3CUVA 3EVTA 3W8RA 1ULBA 4KV9A 2YY7A 5C8YB 4J0DA 5JVDF 1UAGA 4V0MA 5C46F 3DZIA 3SKXA 4I5GA 2IF2A 3PPVA 1JWBB 1BE0A 4F5DA 2PSDA 4ZHQF 1UMCB 4YAUA 2BFBB 5FI0B 4MIOA 4H35A 3BF7A 5JNVA 4C4XA 1XMOB 3Q7IA 4CCSA 2P11A 5CXXA 1JEOA 2XXAB 3HVUA 2AMJA 1DKUA 4YAKA 3H4MA 3OKAA 3PYLA 4MQUA 3ECAA 5LBUA 1Y81A 2R5WA 3SE0A 3AP1A 4LY6A 4XDHA 5K0JA 4OQEA 4TVKA 1FB5A 5EOVA 3H2YA 4WH0A 1YD7A 2B82A 1L7DA 4TMTA 5FPQA 2J59A 4FGZA 1PVVA 2G3YA 2Z3ZA 2XMGA 1QJCA 3KOMA 3PDJA 1KQOA 2C3PA 4R9VA 2D5AA 1E0JA 3CF4G 3OCJA 4U39A 4LMBA 3L92A 1NQAO 2IYEA 3LXMA 4JWTA 5JY1A 2EZ9A 1IBKB 1XPJA 1UMBA 5B2ZA 3K1AB 4OM7A 4AECA 1LPNA 4BLTA 4OL0A 3DZKA 3VVCA 5IMBA 2AJBA 1V71A 3I01M 2ZBQA 3RRJA 5KWIA 1VE7A 5IAEA 4E7OA 1IXSB 4Q03A 2X7JA 3SYRA 1K98A 2KHZA 2DF8A 1WA5A 1ZJZA 5BYAA 3TIVA 2SICE 2YQ4A 3CEAA 2A3NA 2GNOA 1T1SA 4QBHA 3AL0C 2AJLI 4PN7A 1C3EA 1SVWA 3NS7A 5KSYA 1FY2A 2AUMA 2GFHA 4RJJA 2CT8A 1V41E 3G9ZA 3BFJA 2YV5A 4LYGA 3MRXA 4X00A 4K8OA 4YJ2B 1SCUB 3SSNA 3SOZA 4TLAA 2VWGA 4RVHA 4EBBA 5E3IA 4YGYA 3WISA 4QO8A 1QZUA 3F3YA 2FR1A 5JQWA 1Z88A 4JLDA 4WKGA 4IRUB 1X87A 3BK2A 3R5SA 4ID3A 4MYHA 3VNQA 2AOUB 3BYZA 4S1OA 5B2EA 4ZOBA 2HYDA 4AKGA 2NSJA 5JAIA 4MW5A 2BFDA 1ADCA 3JWEA 4NG5A 4CU5A 2EFCB 4YUAA 1Y9DA 1T4CA 1EX7A 3TJRA 3HY4A 3IVGA 2AJCA 5KVVA 3BJEA 3Q7QA 4AMUA 1EESA 4ZRMA 4MYSA 5AWFC 4CKWA 3KK0A 1F48A 2Q3EA 1SVUA 4MP6A 4H77A 3TUZC 3RKSA 1N5LA 3P52A 4OMDA 1FPMA 4ID9A 3WTBA 3GLGA 2QLTA 1RWPA 4L8WB 1U3TA 2XUHA 3TRKA 5JJIA 1NE7A 1ZNYA 3C45A 3F90A 3LG2A 3KTDA 3OZRA 5WRFA 5BNTA 5HX7A 2JLXA 3B6JA 2Y92A 3L8GA 4GQAA 1FNDA 1KFCB 2P91A 3AVTA 2C4UA 3WYFA 3IPAA 4I14A 4YRQA 5T67A 4MPTA 1MPTA 2JFPA 3F3SA 1UBEA 4OYHA 3WGJA 4QYIA 1T8PA 1K7YA 2IPAB 4J43A 3X0DA 2PXCA 2DLCX 4FWTA 1P1IA 3NHKA 4P7KA 3PVZA 1X74A 1AT1A 3VR5H 5KC8A 1EZ4A 3GLUA 3GRFA 1U3DA 3MOSA 2JIMA 2WYWA 1CR6A 3EEOA 2FZVA 1G8JA 2FFAA 3BGWA 3L05A 4MMZB 4UZFA 3TSYA 2H07A 1X19A 3D8HA 1ZVJA 3KFXA 2RKBA 2GHIA 3HB4X 1EXWA 1UF9A 4P86A 4CCYA 2BR3A 1H2AS 3Q9NA 2AVDA 5AYVA 4GKVA 2VQDA 4X8MA 2ONKA 1K2VN 2FPGB 4AX4A 2YWBA 4LKOA 4CIAA 1CVLA 3RJZA 4LOHA 4BU1A 1I4WA 1VJGA 3RVKA 3VH1A 2OPHA 2OV6A 3FUWA 4F5EA 5KSOA 4CN9A 2XUGA 4ARVA 3AHJA 3JRNA 5ALMA 5I7VA 1E61A 4FN4A 1T2AA 5HKKA 1UPUA 3DE5X 4NOKA 3KL2A 2CNNA 3HACA 4O1HA 3UUFA 5LDDC 4DZZA 2ZM6B 4OHMA 4LZPA 1U9YA 4JB3A 1XQ9A 2OAEA 3HDYA 2QN1A 4BEVA 1JH8A 1FX1A 5JBQA 2AXNA 1QU2A 1OBOA 2D1TA 3R75A 1KRWA 1SBNE 2EBUA 2YHIA 2PL9A 4WVLA 2O7VA 3VR6D 2PL1A 1VMDA 3KNZA 5AW3A 1Z7GA 2NUAA 1ZI8A 2CEAA 1IZ7A 2VJDA 1R6XA 1ZOOA 3UAVA 3U7RA 1QS0B 3LYHA 2X58A 3KQPA 4BNWA 4OLJA 1KIAA 1SKQA 3COWA 2VKQA 4PS1A 1OZ0A 2J8ZA 5AKXA 5ANRB 5BN4B 1E1MA 1LW6E 2AX4A 4MAAA 4M7WA 4CKCB 2DWQA 2F43A 4M21A 1U80A 3VKUA 1JF8A 3CH5A 4NDAA 4PLCA 1HYQA 4G37A 1KJJA 5I7WA 1I2CA 1E89A 3BN3A 2PJRA 4W5NA 2OVBA 2J30A 4EGQA 3Q10A 3ETLA 5B6IA 1V5FA 1OXSC 2YICA 1P6UA 3CBQA 5ALDA 3QFFA 2VWHA 4DF3A 4YJDA 3EH2A 4KK4A 2R60A 4RJIA 2YJZA 1J06A 1ZA1A 2OL4A 4TKUB 3K71B 4HEJA 4XJXA 4QE3A 3RSCA 3O93A 4ETWA 4TSKA 1YZUA 1HETA 4U7GA 5DHFA 3KQSA 5E9JA 2H7VA 3H3FA 4G0OA 2Y1CA 3JWHA 4HDNA 1G20B 4PLWA 4UJ3A 5ICGA 3JARA 3EAQA 3EXEA 1TGYA 5DLEA 2W98A 3UW3A 2YJNA 2VDVE 3RTGA 3WK7A 3PLAE 1U2SA 3KUCA 4MLZA 4WZBE 4Y1FA 4ARIA 1QG4A 4LMRA 5IYZB 3DTVD 1OI7A 4CM5A 1NOIA 1CRQA 2BGIA 1R0BA 2CFRA 3WWYA 3JV7A 3EF0A 3Q9UA 3A4VA 4HH3C 4B6RA 4D8XA 2OCBA 3NHBA 2A88A 2GO1A 5ESRA 3BEOA 5DMXA 1M6VA 1KRXA 2ORYA 3T7IA 4O0MA 4DMCA 5IT9A 1H2BA 3ILYA 3WS7A 2HKIA 3NWEA 1Z82A 4FYWA 1XAHA 3LO8A 3PEUA 4XLTA 1U0HC 4DCCA 3UBTA 1ORVA 1IB6A 1VM6A 1ZYUA 2NTEA 3CRZA 5E4FA 3E9MA 2VL7A 4XLZA 1U0SY 5LP6F 4B0PA 3AEZA 1PN3A 1W0JD 5BN1A 4PGMA 5AJTA 4AYTA 4QVIA 3BH0A 1EMDA 3ADBA 4FYPA 2AEFA 1HQYE 2IHVA 1QYDA 2A9OA 3HFRA 1I6MA 2H1VA 4GLOA 3ADOA 3OZWA 4M0DA 4XJVA 4K9RA 4FEAA 2GEDA 3ASVA 5CLHA 3IQIX 5D5QA 4EDHA 2O5RA 4NJEA 1HK7A 4KGXA 4JJ4A 3HXMA 2BLNA 2DPGA 1ICIA 1NRWA 1XUOA 2R7MA 4AN1A 5TEVA 3NOOA 4MR7B 5AFSA 5BV8A 2J9ZB 4A0GA 3E8SA 8ATCA 4JI5B 3EQ6A 3KE9A 3TIGA 3KQOA 4HGYA 3HBJA 5K4GA 2QYSA 2HA3A 5D3QA 3VDMA 3AY0A 4QNMA 2P27A 1W4RA 2ZBFA 1MHTA 2JAPA 4RH1A 3WYDA 1Z75A 4YAGA 1D04A 2H2FA 1RYNA 3OEHD 4XQGA 4PIPA 4X1OA 3ZJ4A 3PFNA 3IAUA 4I55F 3OESA 1T1RA 1ZK2A 1SHLA 4YACA 1F17A 1V45E 1D2EA 3D4BA 1QIHA 1Y42X 3C3PA 3C4QA 3MUFA 4HZUB 2COKA 1ZM2A 5AW4A 3C7CB 1CQIB 1QC5A 1Z9BA 4A8JA 1XP8A 2PKYX 3WHKA 1QHNA 2XJ4A 1RWKA 4PG8A 3F0TA 5EERA 1LRLA 4MUYA 1VCIA 2Q3HA 1X1SA 4MUAA 1TT5B 4PLFA 3M6WA 4AY6A 2J3EA 4LC0A 1XVTA 1GCGA 1Y1QA 4BECA 5A5GA 2F55A 2R9VA 4R9UC 3IEUA 4LHXA 5FP0A 4D81A 1EUZA 5JNRA 2BMEA 5KTPA 4ZTUB 4X1YA 2QE6A 3TEFA 1AQIA 3VOSA 3S8YA 3DWFA 2OCLA 1SG9A 4U5XA 1E9SA 3JQ6A 3I61A 3KAJA 3RABA 5DTEA 1MO3A 2ID7A 5KVCA 2AMVA 2P9TA 2IYRA 5K8UA 1NDUA 1NTRA 1X80B 2LDXA 2H2GA 4JBYA 5IF3A 4GQIA 2AN1A 3IMEA 1N2JA 1XEWX 4FZ5A 2PRZA 2CLMB 4M1SA 3GFPA 3G2JA 2IYXA 2XF8A 1ESDA 1TCVA 1A9QA 4FFSA 3RK1A 4RULA 3V8PA 4KG7A 3NQ41 2F3UA 2GWHA 4RPGA 1JL3A 1WULS 2NXWA 1EFRA 4AQDA 4E08A 5BWCA 1OD6A 2IQIA 3LHDA 3LDUA 3WSTA 2FZEA 2I7DA 4MKIA 5HEKA 3ZLBA 2W2LA 2JIZD 4LXXA 3JRXA 1N5KA 2W2XA 3P27A 3IPCA 4BO5A 4CYMA 2VUTA 4YAWA 2J07A 4DNOA 1QIDA 4KPUA 5ALEA 5E3JA 1RMYA 2CC2A 4BV3A 1NMZA 2QN7A 5DHUA 5IXSA 4I3GA 1M7HA 4RX1A 1QWSA 3UQZA 4GOKA 2MT9A 3RNLA 3FJOA 5DFAA 3NHYA 3V2GA 1Z18A 1NMEA 1DUIA 2YBEA 4EX7A 3G68A 2YZGA 3JWIA 4J9VA 1CULC 2X1VA 3BXFA 3EEIA 1RI4A 3K0AA 3RAJA 3ZYCA 3LECA 1GQOA 621PA 2O2YA 2CFSA 2EX4A 4O5OA 3CV3A 3FUVA 4HBZA 3ZHYA 4G5QA 2V5UA 1DEXA 4D96A 3LBYA 5JALA 4HFMA 3A6DA 4K6FA 1D07A 1UM8A 3GPLA 3PE6A 4LHYA 4L9WA 4I46A 4KYTA 3TW6A 1NRJB 1RRPA 1VG1A 4JMPA 2ZUEA 1HV8A 5B1IA 2WILA 3BHMA 2DR2A 5ITVA 3DFUA 1E4EB 1ZRMA 3IMCA 4RWEA 1YMUA 1A9YA 1V43A 4LNUB 1QGUA 3NHPA 4HFNA 4RVDA 2Z9BA 1MAUA 1XB2A 4FGSA 4LJKA 3RYCB 1THTA 3U48A 1GG5A 4D4KA 4R05A 4BL5A 2J33A 1QP8A 5A2QA 3NP9A 2R6AA 1DBSA 3U3RA 3GV0A 2FXIA 5CJJA 4FSXA 5IS2A 2R85A 1UQTA 3FIJA 1UXOA 1JHXA 2PKCA 1U2GC 3NGLA 3LQ1A 3O1LA 1WHSA 3TE7A 4M1MA 4OHBA 1AS0A 1RAGA 3WLPA 4F3NA 5DNWA 4AB1A 3EIOA 3MN1A 2VTKA 4NYIR 3MCAA 4HPXB 4F04A 3UW1A 5I5EA 2OO7A 1TC2A 3QE4A 5FKJA 3ROPA 4UM9B 1RQXA 3USZA 2J31A 4E2YA 1WUHS 3STHA 4FC7A 2NAPA 3SVLA 4ZAYA 3JASB 3PHGA 1QO9A 3V8RA 1PWEA 3GX1A 7ABPA 1IB0A 1Z8FA 3NOVA 1GFZA 3BWDD 2B61A 4HWPA 1PLKA 5LQSA 5DNDA 5ALUA 2FLWA 1SJ9A 4KWTA 4YCAA 5F5NA 2GCEA 3S99A 3JAKB 1BC5A 1D6NA 2A35A 2B5WA 1KMHA 1BH2A 3CB4A 4RU1A 3IBCA 1QKIA 4JSTA 3HNOA 2D74A 4FT4A 5CA0A 1YL7A 5F2NA 1KS9A 2ZCJA 3OCVA 3PGA1 3CPJB 3NV7A 2ZYTX 1L5KA 1Z5WA 4HRXA 3HB0A 3CLRD 4L3WA 4MSUA 5D86A 2D4HA 3N76A 3R0VA 5DHSA 2I22A 2NU9B 3SE7A 1FSSA 3OOYA 4OXYA 5KYYB 1P75A 3RAGA 1ODFA 3RTBA 1MG5A 1QBKC 3UWKA 1A9XA 4HK4A 2ZVJA 4HN4B 4DWWA 4M0UA 3B3FA 2P5TB 2II6A 3WGQA 5LQAA 5EFZA 5J4HA 4LQ4A 1NT4A 3O82A 2B83A 2RHHA 1CE8B 3PC8C 3DDWA 1EX1A 4HB0A 3PPWA 3VZQA 3K4QA 4H15A 1CQXA 3BXOA 1PBTA 3FSGA 3PDCA 2J3JA 4E13A 3ZGXA 4H31A 1SB8A 2PX5A 3S2IA 3HVRA 2QAGA 1WXWA 4MO9A 5ELMA 1EGMB 3VYRB 1E0AA 4NDNE 1K7EB 1JDSA 3AY3A 1DBWA 2N9UA 5FL3A 3FJYA 2FUEA 3GFFA 3GGCA 1LW7A 1NHGA 4IXTA 1IEXA 4QXRA 4HVTA 5C8ZA 3RYHB 5JYCA 5I6DA 4IEIA 3H1TA 3NEAA 4RE5A 2XNDD 4DR5B 3LO5A 1FP4B 1ECPA 2IOYA 2IHYA 3PR2B 4I1RA 1B6GA 3A06A 4V39A 2D5LA 4UBMA 3VR2A 1AHPA 2EKLA 3JQ9A 4L0QA 4RUKA 1N8KA 4W7SA 4BLPA 4H1UA 3QFTA 2W6IA 4D9HA 4D9MA 2FR8A 5ADUS 1K3FA 3VQTA 1MRSA 3HKCA 3ER9A 3BILA 2JKVA 1XJ0A 2QNBA 2XHZA 1U0BB 3L0CA 2VK4A 2CVZA 3BFPA 3M6IA 2I7XA 4BE7B 4OAQA 1UXIA 1ID1A 1Q3TA 4FUQA 1GSOA 1T15A 2I5PO 1JZTA 1QE5A 1Z0FA 2Q1YA 2V9PA 2QF7A 3EIHA 4UC0A 4EMBA 2C0QA 1RC1A 4HMOA 4R16A 5I9LA 2K5UA 2VSQA 4KQMA 1P4RA 3GROA 3RF7A 1URPA 2VFAA 1CJTC 4IOMA 2NZJA 1H8EA 4PRZA 4BIIA 3OFND 4S05A 3NJ8A 5IXJA 3K30A 2XZTA 1BXRA 2I4IA 2VQ3A 4DZRA 4JHXA 2IZ7A 4ZO4A 1I3OA 1QE0A 3EASA 3F7NA 5E6RA 2O8DA 2IY9A 1E2JA 1FS5A 2CLOB 2HX1A 2ZXEA 4IRXA 1P72A 4LKRA 1KPGA 2NXCA 2ZWPA 3D4NA 1GWNA 5FNZA 3DAPA 2JIRA 2FPUA 5EIBC 2DFNA 2XUAA 3AEKB 5G1OA 1G5QA 2GJ4A 4W1RA 1FRVA 4D6XA 4DCTA 1KOGA 2JI8A 1W0KD 3KB1A 4MS1B 5CYOA 3QPAA 3ER6A 4KPGA 1RWOA 4CDRA 1TO2E 3Q7TA 1CR1A 4GFDA 4CIVA 3OUZA 3UB3A 1XZDA 5J63A 3S6JA 2OFFA 1VHWA 2HJSA 5BNIA 3GJXC 2H0RA 3OQNA 1N1DA 1COWA 1SUIA 3DD1A 3CGGA 4JNKA 3TN7A 4G1VA 1EK6A 1L7RA 4RHUA 5J2UF 1XXHE 3C8MA 3GIWA 2JZNA 1CYDA 1WZEA 1AK9A 2XNCA 1LUAA 1T5SA 2YC4C 4NEQA 3RIXA 4YV7A 4XVUA 4QHSA 4A6XA 3KOXA 1C29B 3G8YA 3HBAA 2IX3A 4FB5A 3O7MA 1DEKA 3AWIA 1ECFA 1XQWA 3NATA 4KO1S 3MMSA 2IHJA 2YCLA 3T3EA 4PC7A 2XMBA 3PDHA 1US8A 2AXPA 1EQUA 4JR0A 2OBMA 1MW9X 4YUYA 3PLNA 3SZUA 3TLXA 1LX7A 4M22A 2X22A 3LGSA 4G5SA 1UMDB 3R76A 3H2IA 1SCDA 3I52A 4IOJA 5HE8A 4A6EA 2F2TA 3C4VA 1JKFA 2ZYUX 5CR9A 3UZUA 5BPFA 3FW1A 1VP9A 1F6WA 1IOZA 2O5VA 1LNSA 2ZIWB 4LDPA 1O96B 2BKEA 4RGVA 3R7FA 3WMEA 1V3VA 3WDMA 3A6LA 1ZJWA 4WCFB 1N6KA 2BDUA 3OMLA 4I9FA 5IARA 2IW1A 1F4VA 4I50F 2Q7OE 1U9IC 3W2TA 1THGA 4NF2A 5JDCA 3ZNPA 2IYVA 4YMHA 2DQKA 4QYTA 1TYCA 2WJ4A 5CVDA 2DFVA 5C81A 1TRHA 1NX9A 2HRBA 3FOAA 1XU9A 4PRKA 2J9XB 4D9EA 2JBAB 3PCTA 4LDRA 4F86A 3G0HA 2WJGA 2WUFA 1H1LB 2VDWA 2WIGA 1LWOA 2XBUA 1VHDA 2IJGX 3I73A 4G23A 1NPYA 4KQJA 2P9CA 4RF3A 3I5UA 4PPNA 5GP1A 3KP1A 4D4MA 4RQUA 3U4QB 4MICA 2OBBA 3FDIA 5ALHA 3N9IA 1VBKA 1EFPA 1FP2A 4JS0A 3STUA 4BVFA 4BOYA 2EC5A 4BJHB 4C01A 3ZXXA 4GVPA 1L9XA 3BGOS 5JS1A 3CB2A 1EZZA 2AV6A 2PVSA 3N2ZB 3QVXA 1C81A 4IG9A 1S2MA 2XMPA 5KPJA 1V7ZA 1ZJYA 3ENWA 4BNVA 4C0JA 4DXHA 4XCVA 3V1LA 5BP7A 4ZDIA 2O8BA 1TYDE 3BK1A 2H0AA 4LX0A 1H2YA 4EWLA 2FQQA 3QUTA 2IOFA 4A10A 4C2UA 2W2KA 2QPLA 2UKDA 3L1JA 3UGTA 1U3FA 1EP2B 4TQAA 3VZPA 3PA8A 2JGDB 1D2HA 1UKBA 4P83A 2B21A 4UPVA 4DNPA 4AS1A 4M9CA 1T6XA 3IJPA 4CJXA 3HKDA 5BV7A 4UHDA 5KJFA 1L8QA 1PL7A 2JLCA 1FNNA 2Q6LA 1I5RA 3OZXA 4GI5A 4R51A 3FGZA 5EHQA 4BZZA 5J23A 2P69A 4M1QA 4RZUA 4FE4A 2JGFA 4TQUS 3M6AA 2QP3A 3M4NA 1VZ3A 4DIDA 4FVTA 4IWXA 3I37X 5HJ7A 1XMVA 2PLNA 3NJ4A 5DN6A 4D57A 3T3GA 3FKJA 1A8PA 3G2LA 3TQFA 2H17A 3DH0A 1PHRA 4KI0A 3Q87B 4BDSA 5MDHA 3SXUA 4RCYA 4FS3A 1U2TA 1DDOA 4FMDF 4AXXA 1FP6A 5KU1A 1MV5A 2NOAA 4UD2A 1E7QA 2C2KA 2HIGA 3HY6A 3GJSA 3IR7A 2VDPB 4M36A 3PX3A 3DEHA 4BMCA 1VIMA 2C99A 1W8IA 4DREA 4EW2A 3VVLA 3PNVA 3OQJA 4EB6A 1ZHOA 3BMQA 2GK3A 4V0ME 1WO8A 2RHTA 1CFJA 1NF8A 1QGDA 2X2FA 2X8BA 3I4CA 1KYYA 1E2FA 3L6DA 5E6UB 4K87A 2O14A 2FWAA 5JPIA 2BSXA 2PWPA 1EVJA 1V1MB 2CBGA 2P9HA 4H4EA 4QJ4A 4Z9FA 3TAXA 2Y1WA 4ISBA 3NYRA 1DJNA 1HLFA 3C97A 3T4PA 4AUKA 3W79A 1H6CA 1FFAA 3IR6A 4P98A 5DBOA 5M04A 4DIKA 3OZEA 2Y0EA 2PD4A 4N9WA 3EGXA 1W4BA 4IFEA 5CD1A 1KMNA 3CX4A 3KYIB 2QSJA 4G5OA 2OUIA 2QTGA 1DQPA 1HLGA 1NG9A 1DQNA 2PO7A 3AHEA 1A71A 2D0IA 3IRVA 2CLHB 2H06A 4J7XA 4NYMR 1BKYA 1N5JA 3CH4B 2UYGA 1KMMA 3C8HA 4M0CA 1MZPA 3CEJA 3DXZA 2DXIA 4UAVA 1WU7A 4B8WA 3OE5A 2C5SA 3DKPA 1DC7A 4FUTA 4O4LA 1YB7A 4FYKA 3TLKA 3PR3A 4RDIA 1OWOA 5IJXA 3NEPX 3TE6A 1TRKA 4JBXA 2P65A 4DIOA 4F4UA 1OA0A 2VYNA 3C6BA 1YC5A 2AWOA 3EVBA 2R44A 1EHIA 1AHNA 1LNZA 3F8TA 1XVIA 5LYYA 4YRKA 4QZVA 3JQFC 4UBJA 1X1CA 1ND6A 1YMQA 1WP9A 4MPRA 3VR6A 1XR3A 3D4PA 4IHQA 3F4LA 3JD0A 4IIHA 1QOPB 1KKUA 1GAJA 1SZCA 1GSAA 1WG8A 4V0QA 4GMKA 3T54A 4AZ0B 3WGUA 3THYB 4R81A 2WQ6A 2IZ1A 1ECBA 1EFLA 1TKBA 4AG3A 3T61A 2HCRA 3WL5A 4II2A 2A5YB 1TQHA 4G1BA 3T1YB 1DLJA 3OVMA 5F9FA 2AD5A 4JXKA 1X1QA 3LCJA 2HO4A 2X9VA 3H75A 3IP6A 3CNLA 3DAGA 1OVGA 3FMIA 4MS4B 3X1DA 4AVYA 5F51A 2ZR9A 1YMVA 3IJEB 4I7EA 4WY5A 4YT5A 4OP1A 4AO7A 1WPXA 3TBFA 4BB6A 5L45A 1GTRA 4NCBA 3AF3A 4N47A 2GESA 5HBGA 3O4GA 1GR1A 4P3NA 4KQ1A 4UNQA 2FUG1 1GPJA 4TRRA 3F5MA 4X24A 1LF0A 4J3NA 2PT9A 3E1KA 1Z13A 1HY3A 5ED0A 3LP8A 4AP9A 3GLGE 1FDTA 3INNA 4FJ1A 5IYZF 2BKAA 2A8YA 3LS2A 2D8MA 3OM9A 1KDPA 2NWQA 4MLPA 2HRQA 4N0EA 2IP1A 2Q6IA 2PH3A 2YNMA 4EVIA 4KACA 521PA 3KYBA 1X1TA 1JHOA 3D8NA 4Q3LA 4KQIA 5CHEA 3QTBA 5CXSA 3DD5A 4G0NA 4TM8A 2I3DA 2OE2A 1ID8A 1P74A 2PS9A 2R86A 1GPDG 4KVZA 3KC2A 1L7VC 4JC0A 5CBPB 4FHGA 4XGNA 3OZCA 4IF4A 4MJXA 2Y1LA 4AJ4A 5GVSA 3E7PA 1XQYA 2G63A 3I62A 1ZR2A 1PIWA 3DOJA 1Q0HA 4ZK6A 2E85A 3AIOA 1CERA 3M0EA 4Q47A 4OGKA 3RQIA 1P6QA 2Z95A 5FH9A 3TFOA 3CLUC 1U1DA 5LJLA 1MN6A 1R8JA 1JMVA 3P2IA 1C0LA 4JQSA 2HJ9A 4KI7A 1E1CB 1WKVA 4CV1A 1AUVA 3U13A 1JLLA 1V3TA 2V6IA 4MKGA 3WFZA 1EFVB 2YN2A 2UVPB 1ZCJA 5C8YA 2BGWA 1Y1SA 4B33A 4JQCA 1HEUA 1TO6A 2BTQB 2OAGA 2ZIVB 2W6JA 3C3WA 3W1VA 5JATA 4ZAWA 3MJSA 2MR5A 1DBPA 1UMCA 3A25A 2BFBA 1HT0A 2QQ0A 4OHRA 4V38A 5CXUA 2ODTX 1CS4C 1IEWA 3CZPA 1W0JA 4OQDA 2HLPA 4B4VA 4UFPA 2NYRA 2XXAA 3CUKA 3WAGA 4MS3B 2WF9A 4DCGA 3IQFA 5D7BA 3U4IA 5HS4A 3OF2A 1E7RA 4BO3A 3C5EA 2OR3A 3RJ5A 3NBZC 3I28A 3OHMA 4BLOA 4BE4A 1TD9A 4DTIA 1KH3A 5JBNA 1FW6A 2FW7A 3MJDA 4EW3A 1X6VA 3VX4A 4KLRA 4Q1AA 4RS3A 1C0KA 1RBQA 4MV6A 4FMCF 2FVXA 3QPUA 2P3SA 1HL3A 1NW8A 1FZQA 5AI5A 1FFXB 1FNCA 3DV2A 4R2HA 4D9NA 2XCSB 3HM2A 4OU4A 3UWSA 1T25A 3WIVA 4UDXX 3M4XA 3FGNA 2I9PA 5BYBA 4BO4A 3JQ8A 4P3KA 3K1AA 4JUCA 4TWIA 1FC0A 1PD1A 4UE2A 3VPDA 4BP9A 1K1EA 3PNPA 1IY2A 4PCLA 2PJDA 5BNFA 3BM5A 3PFHA 5EZQA 3I6IA 4B3DA 5JXWA 1NNSA 1CB7A 1SURA 3K8YA 4WESB 5IDQA 3T1NA 3YASA 4AAYA 1W8DA 2O0JA 3OQPA 2Q4OA 2QEQA 4IFTA 1FW8A 1AM4D 5GV7A 1OWNA 3STTA 3LD9A 8LDHA 1OF1A 2ICAA 1SGWA 4DUPA 1OBHA 2X8AA 3AFMA 1QV7A 1AXRA 2GASA 3UMGA 1P4JA 3HC7A 1P6XA 4RJ2A 4YJ2A 3D8RA 1OPRA 2I8LA 3OIWA 3QXCA 4RF2A 5FLEX 4L08A 3UXEA 3Q8XB 2CL0X 1KYTA 2ZR7A 1V6CA 2C4NA 3OY7A 5IEJA 1NC1A 4HGOA 5DV9A 1SUEA 2AOUA 1XZAA 3HUTA 3JYLA 5CM2Z 3ZK8A 1GZ4A 4E6EA 2R5FA 1CNMA 3KQKA 1JKJB 3U80A 4AXBA 721PA 4JAVC 3R3WA 4AQYB 3AOEA 1O4VA 2ABWA 2YDYA 1KKLA 1YS9A 2R84A 1PJ3A 4LXTA 3SLRA 2QZJA 3GJ7A 4Q4LA 1G8MA 4C4RA 4HXGA 3OU7A 4TQ9A 3IC5A 1TJ4A 1QSGA 2HU8A 4YUVA 3WL8A 4P7JA 4EATA 4G9GA 3JQBC 4K88A 5JAPA 1FA9A 1Q83A 4YJ2F 2VAWA 5TS3A 4HQOA 3MNFA 5CK5A 1PZMA 2Q5LA 1WU8A 5JECA 1EHYA 4JK3A 4QTXA 3BIJA 3GFQA 1XMPA 2QR2A 3MD9A 1SVIA 1K6MA 1OZHA 4LTNA 4MINA 5H80A 3DE1X 5EGNA 4G09A 5LU8A 1A04A 4MUKA 3WJ7A 4RLQA 4NFYA 1ENYA 2BGMA 1F7VA 1ORWA 4MWZA 1F8GA 2D3WA 3T5TA 4H17A 5DM4A 5G02A 3UUWA 3OOEA 4CM4B 2GBFA 3D2BA 3E58A 3C24A 1X1AA 5KTNA 4X97A 1FDVA 2PWYA 3PUYA 1FFSA 3OQ1A 4IIGA 1R6AA 5EPOA 1C3JA 5B53A 4YMTA 5IULC 1LPBB 1QYWA 3LP6A 3H8SA 2FW6A 3HI4A 2B1QA 2HU5A 2NVBA 3P32A 1CEEA 3E8XA 5HKAA 4LJLA 1P7VA 2WFLB 4MK4A 3CLTD 3ASZA 1WABA 5IAGA 4TL8A 3H1PA 1KPIA 4LCEA 4P4SA 3OPVA 1OYWA 5DISB 2D0DA 3LPNA 4E5KA 2HH9A 3PV0A 2WMDA 4BDTA 1L5NA 2PTHA 4OF4A 5AW8A 3ZJUA 4GC9A 4RO0A 2JFNA 2YS6A 5TPZD 4ZJYA 3GP3A 3QLUA 1L4FA 4CEHB 1EB8A 1IXRC 3ZWPA 3D0KA 4YYEA 5PGMA 5BN5A 3KE8A 3EOAI 1Z5VA 2EJVA 1UOQA 2FPMA 4ZVVA 1TEVA 4EKIA 3NAMA 4PX9A 1L7AA 2CJPA 4JJKA 3NIWA 2J0EA 5FHQA 3HXKA 4Q1DA 4CM8B 4DR6B 1IAVA 5A5EA 3ZK7A 1QS0A 3DAYA 3R3UA 4MUEA 1UK7A 2ODAA 2QUIA 1PQ4A 4OJNA 4K6GA 1FQKA 2OWDA 3JQAB 1IHUA 1XCGB 2AXQA 2AQKA 3EFHA 4KUGA 4JUBA 3TZCA 1PW7A 3ZZUA 1L2TA 3IOEA 3LV8A 3KO8A 4MHTA 3L7AA 4HO1X 1AIPA 3WRXC 4A82A 2G76A 1WQ3A 2F62A 2OG2A 2MINB 2POCA 3JY6A 3MB8A 5DYWA 3SZLA 3IKTA 2MOKA 2IPNA 1OGYA 1XMIA 2PYDA 3KSRA 3KDPA 1U7ZA 5TQ2B 1J8YF 3SFZA 4RDHA 4D3YA 4B6PA 2C2XA 3UUEA 1IONA 1MJHA 5KDDA 3WNVA 5T7BA 4CMJA 3UPUA 2W2VA 3R3SA 1JSRA 1EBFA 3FR7A 3LUBA 4N3GA 3TOZA 2JLAA 3ANMA 5BUCA 2P4QA 3IBTA 4TKUA 5BURA 1Y98A 2O20A 5CB8A 1NL3A 4JXJA 2LIPA 4NENB 2BSAA 1K8YB 1SIUA 1ZM3A 3IIEA 4IRMA 4C4OA 3PF9A 3R9WA 2AIRA 2J87A 4ABTA 1B76A 2H4HA 3CGWA 2H0QA 2PNFA 1G20A 2DX7A 3EFOB 1JIJA 1U0GA 1Z0AA 2V9ZA 3TPCA 5E6SA 2QORA 1EUQA 3DT6A 4CLDA 2VDQB 3PD0A 4K6KA 1LS1A 4MV1A 2QSUA 1U11A 2FUCA 2W37A 2JH8A 2ON6A 4D80A 4WUTA 1YJBA 4JEIA 2CLKB 5GADl 4FI3F 4NECA 5DYIA 4D43A 4Q3DA 1HQDA 1GR0A 5L4LA 3DO5A 3MXOA 4H6XA 3HYTA 3J7TA 2PU7A 3KKZA 3KS9A 3SQWA 5E9QA 3RIEA 2E4YA 5GGYA 4ZTZB 3PRKE 3GPBA 4HJRA 1L7XA 1PJ4A 1DRVA 5AUOB 5DOVA 1C50A 1D3AA 4HVCA 1QXSA 2ZYWX 3KTOA 3WXBA 5TQ0B 3A4LA 4OG2A 1IJFA 2CE2X 3PFGA 2P2YA 5IF9A 2OM6A 4GLJA 3NBAA 4G84A 3PUHA 5M5BA 1JFTA 1R7RA 2GM3A 1AQ6A 4HQ6A 1C4OA 1XMJA 4PX2A 4UHCA 1QDUA 2QVYX 1A4XA 2YFKA 3CR3C 3DZ8A 3FF4A 1IN6A 2RSLA 4QQNA 1E9VA 3RJMA 2ZTLA 5KS2A 1KVUA 1WXQA 3AP2A 1DC3A 1QZTA 1USIA 4JASB 4JZKA 2XCRB 1JILA 4AUEA 4BFUA 5ARDA 3DKIA 1YVPA 4XGRA 4D02A 1YQ9A 1DNPA 3PC6A 1TVKB 3MOIA 2G1KA 1U28C 2DPLA 1POWA 3LDAA 3R6TA 1Y63A 4M2LA 2JLBA 1UZAA 3D3KA 3EVFA 4Q9HA 3ZWCA 4BVAA 2IEDA 3OOWA 3QKTA 4O2AF 1BO6A 2OP1A 5GVRA 2FGKA 3D31A 8ABPA 4MR7A 1DXQA 3BZBA 1FDRA 5BWOA 4X66B 3ZDEA 4NBUA 4G0WA 1CBUA 4IAOA 1ECGA 5JNLA 3DLHA 3OIFA 3V8QA 4TUYB 3FPEA 3NALA 3W4KA 5KVAA 1KSGA 2O48X 1VXOA 4H7HA 2ZCVA 4ITVA 4EPWA 1D03A 2G36A 2X0EA 4H1HA 1H3FA 4ARZA 4WKBA 3PJDA 1HDCA 3BHIA 1VDZA 4BXOA 2JJ2A 3GEMA 1UEJA 2DQ4A 4LOLA 1J8MF 3PGMA 1NJGA 2B78A 2C8JA 4HZUA 2JHGA 3TKAA 4DQKA 5IJZA 2K4MA 2RB5A 1VPLA 5FHRA 1ZGCA 2PMEA 2X0DA 4IZOA 1CQIA 2P6NA 3S1AA 4GYYA 5ALZA 2RB4A 3HXLA 3EARA 2X5OA 3OOHA 3N8NA 4BAUA 5KVQA 3PR1A 2X7HA 4YRDA 1U2DC 3ZDQA 2Z09A 1NUHA 4F92B 1TT5A 1S7GA 1XFAA 2WSLA 4M99A 1CR2A 3ZH9B 1MCZA 1O94D 4UTZA 3L49A 1QR6A 2A9FA 3OCXA 3KKQA 5B4UA 3HGQA 1Z4QA 1THZA 3RPEA 5FTNA 3EYAA 1OT3A 4ER7A 2PUFA 3QW4B 5E7JA 1NN1A 4WKCA 2P6UA 4M8NE 4Q82A 3EQ7A 3JPYA 4ZO9A 1TZKA 3K1TA 4IZIA 4IJUA 3QOWA 2EZ4A 3QPDA 4K0RA 1GPLA 3R40A 1V11A 4AKEA 3M3PA 3LQ4A 3D8TA 4K6CA 1RQGA 1NVUQ 2NSYA 2XTMA 4KP7A 3LT0A 1JU9A 3RC8A 4CPDA 1AS3A 2EL9A 1Z8DA 1LLUA 4L50A 2JGJA 2VZ0A 4O4JF 3SYTA 2HA5A 3V7NA 4BU0A 5KYKA 4MVJM 5FAKA 3GR6A 4ZI7B 4NSNA 2B37A 1TA9A 1HMYA 1K8RA 3HVKA 3SR3A 4AJ2A 5GZ6A 2NG1A 4D42A 2XGJA 2XITA 2QE7D 5COBA 1SD1A 4Z9AA 2J67A 1NY6A 1NLYA 3G0DA 5CH8A 5CW2A 3ESCA 4RFVA 4LE0A 2WUDA 3AR8A 2NU8A 3P9RA 1H2XA 3AF6A 4H7JA 1V9LA 3GRCA 1APBA 5BW4A 4G4SO 1SELA 4JB2A 1YZYA 4R7TA 4G67A 5CYFA 1L8OA 1OFTA 2VJYA 4HAZA 1R27A 1NA5A 1ZSVA 1RXUA 2OYSA 2P9YA 3K73O 3S40A 2FETA 3WL7A 1XZQA 1VPEA 2H29A 4A4DA 4HVLA 1PAUA 2H52A 2V7EA 1C4XA 1PX2A 1TYAE 3UMBA 4YMWA 5EZYB 4KXLA 4RF4A 5G53C 3WBFA 2IXTA 2TYSB 3KPWA 3OEED 5FFNA 1Z7BA 5TIIA 1G7CA 3E7FA 3LT1A 3ADDA 3MCTA 4B4KA 3QW2A 1IHPA 5JSKA 2BHNA 2G1JA 5A4KA 3V1MA 3COSA 4F6CA 1RVDA 4PO1A 1P5HA 1NSTA 1VL2A 3B2QA 5FBRB 4F46A 1ICEA 4D99A 1Z29A 5CA1F 3WNDA 4L6AA 2RGGA 3EZ6A 5G0UA 4OAPA 2ZUTA 3SZ3A 4XWKA 3NPAA 3VC2A 5FTKA 1QFSA 4YREA 4X65B 1M2FA 3SQLA 2QLBA 4DB4A 1TTTA 1JQLB 3KQWA 2CUKA 1E4EA 1U0LA 4KQ6A 4NBWA 1FJHA 3UXHA 3O8OB 1N6NA 4PLVA 3BB3A 1R9NA 2G72A 2E87A 3L3BA 4LNUA 5CVVA 1Z3IX 4TLDA 4URUR 3SS7X 3RYCA 3MTJA 4BX2A 1QOZA 5J4KA 1JI3A 1U31A 4BFLA 4NBRA 1JVSA 2IA5A 2CJXA 1KSJA 2HCTA 1KAMA 4U2CA 1DELA 3JQAD 1G64A 2ZRPA 3HDVA 4E88A 1TKRA 4GMDA 2B8NA 1YZKA 3ER8A 1M8JA 2YYZA 3JZIA 2XV1A 4HAXA 5EPEA 3C6QA 2XDAA 3FMFA 4FYJA 3LWZA 1FSGA 1NQXA 4C6TB 1Y6ZA 3BWXA 3CX7A 3OSZA 4DADA 3NVDA 4LQCA 4EYEA 1KFJB 4AF8A 2XKBA 1JHZA 2G04A 5C34B 1RQLA 4Z0PA 1XEXB 3NTQA 4Z1OA 2QUKA 3JASA 1JHUA 3MBOA 3AGQA 3MRSA 3QMPA 3LX5A 1HE8B 2FRDA 2BCGY 4C7MA 1X8JA 5EL0A 1ZGZA 3CCFA 3K53A 4V0OA 1DKNA 1NBMD 3IXMA 1XF9A 5JUWA 3Q8LA 2PA0A 3JAKA 1L6IA 4RPCA 5JEEA 4IPTA 1IE3A 2CHUA 2R00A 2ZSKA 1Z36A 4Y9UA 3E27A 5KWVA 5F5XA 1E6UA 1ULZA 3C1OA 3JSXA 4D0GA 1GZDA 4GDFA 4HEA1 3DPUA 1NAHA 5IKMA 2O3SA 4OHKA 1CZOA 1HDXA 1I32A 1UBMS 1UWVA 5KYYA 2NU9A 3U19A 4WBNB 4FYXA 3ZWDA 3MWDB 3B13B 4YQFA 3AHHA 4RPHA 4MW6A 5DU2A 4G0QA 5DTRA 1KAOA 4UOZA 4LYDA 2R7LA 1CDEA 3THOA 4DWVA 2Q3JA 5LL6P 2HI0A 3NX4A 1CE8A 5IAJA 3JTMA 3TOVA 4YHBA 1YB2A 1GKLA 1T10A 2JAHA 4Q6WA 4YRLA 5GZ1A 2FGJA 4KDEA 2P6RA 4IIJF 4PVDA 1J4AA 4MWTA 3AIIA 3WDKA 3M6VA 3JZDA 2RK3A 1UBTS 3I34X 2NUPB 3HSSA 1FRFS 2VJMB 1RYBA 2YV3A 1IJKA 3PZBA 4ZZ1A 2I9KA 2A84A 2J08A 3V3KA 1WBDA 1KDOA 1UBLS 1WSDA 3K5IA 4M1ZA 4J0IA 1Q3HA 2PKQP 3VU0A 1NYTA 3GELA 1GKKA 3RYHA 2QDKA 2NT4A 4ZYXA 2AFHA 1XT6A 2ZSIA 3LL4A 4ETIA 3WLLA 2Z08A 2NXNA 2GPSA 2VEOA 3FYCA 4ZT2A 4M1KA 1Y9JA 3SSMA 4K9MA 2F3SA 1UKVY 1YXMA 3RFVA 3FZQA 2MHCA 2PGXA 1ADGA 4J0JA 1Z4LA 1W36B 2QSZA 5COAA 2AK3A 1EP9A 2X23A 4K03A 3OZGA 4QT0A 4DLTA 3PTLA 1MFPA 1ULAA 3CLRC 3K09C 2EKQA 5JTTA 4HR7A 4POOA 4DDTA 3UAYA 1R16A 2ENUA 2KJQA 1NXPA 4O2BB 1XMQB 2G0AA 3KG2A 5DCUA 3GBPA 1NQUA 3O2QB 4O4HB 1PKXA 5JRDS 5KTTA 5HF8A 2AD1A 4A91A 4PN3A 2IODA 1BQ4A 1N9KA 4OSPA 4UHHA 1K6XA 2FPIB 2WPNA 3SIXA 4BNXA 1M2VB 5L7WA 3NJRA 4L75A 1TVEA 1VFPA 2RGAA 2WU0A 2B7CA 1CNEA 1U5BB 2FFRA 1MXHA 1MW8X 3IAS1 1U0NA 4K5QA 3RSFA 4BRWA 2HMTA 1K3UB 2PX2A 1ZK3A 2WI8A 2C98A 2D00A 3G5LA 3R2JA 4I6EA 4K40A 1J21A 3U4GA 5CT9A 5DBFA 1C1XB 1CY6A 3PWSA 3U2QA 4BO2A 1T29A 3GLSA 5ADVA 2ZRDA 4XFDA 3EA0A 1A9OA 3IIKA 4RPJA 3T9FA 2ZJAA 1NV8A 1ZMRA 3NTLA 3ZE2B 3K72B 1NW9B 1YNSA 2G83A 3AEKA 4NAHA 4I6JA 1NXOA 2Q2VA 3A1SA 3LVBA 2WM9B 1TYEB 4BMPB 3P9IA 3U1VA 5DRTA 4HRYA 2A0YA 2O2DA 1Z16A 2B7LA 3K96A 4MS1A 2NPIA 3KR0A 1W1WA 4EUHA 2WTUA 4WNIA 5LDGA 1J56A 3HUFA 1H2HA 1EGVB 2PVPA 4HLUC 5C4MA 2JD0A 3D7RA 2NNLD 1YRWA 3NANA 4IJ5A 3IIIA 4MKXA 2Y9MB 2ZK7A 1U8TA 3AC0A 3ZKAA 2HMAA 421PA 4EARA 4ENUA 4OGGA 2XGGA 4MW2A 2DHCA 4OJTA 5BSFA 1WZUA 1N3BA 4NE7A 2DFLA 1QGOA 4HNUA 4LNHA 3C0KA 4MVJI 1VLVA 5B3AA 4W5RA 1KZYC 5FOTA 3USES 2CB9A 4L57A 3GGSA 3I9KA 3BRCA 3ZIAA 5UKDA 3R7SA 4GL2A 4RTLA 1W4CA 4GT1A 5AJVB 3P2KA 1YVEI 4FSDA 3F71A 1YRQA 1S4MA 1OGJA 2NIPA 4OI4A 5DX1A 2WIBA 3KEMA 1BWQA 1GQ2A 2Z1DA 1S2OA 3SQOA 1UMDA 1N7GA 3IOMA 4FNMA 1E58A 1JPUA 5DRYA 4E22A 3BWVA 3QY0A 2ZJ6A 4IM7A 3LQRA 2QYOA 1O96A 4C43A 1RKXA 2O50A 2XUJA 3O0TA 4ZAZA 4HNQA 3HFJA 5KWSA 5DWQA 4WCFA 1M2JA 3UOGA 3QUBA 1WW8A 2V1XA 4WN3A 1Y4DE 5K0EA 4YMLA 3KZMA 2XLBA 1GEGA 1KR2A 4NP6A 4RVFA 1IPEA 4UNSA 5C4GB 3OPYB 3ICPA 4RHFA 1C3OB 1G18A 3U4HA 3E5MA 3QBTA 3KYCB 4D3XA 4EQZA 3U6KA 4JYZA 2O2GA 3ZLTA 2MYNA 1LBEA 3UUGA 2OO5C 2JBAA 1YVRA 2BEVB 3GAAA 4FK8A 3DDSA 2GA9A 1TA0A 3U40A 3QNWA 3RT7A 1KYQA 1K97A 1H1LA 4IDFA 3HV0A 1T8YA 2TRSB 5K8LA 2C1ZA 1RLJA 2ID8A 9GPBA 3U4QA 1RHMA 4BNNA 9ABPA 1UIMA 2FEPA 4NFHA 4TT3D 1C8KA 3VU9B 1A2KC 2FEOA 3AR9A 2HNBA 2VHUA 5KJEA 1Q1QA 1AK2A 2HF8A 4BWFB 5A4AA 2ZZMA 2JEZA 2QQEA 1FDIA 3M1YA 3AB8A 3AEUA 4NZOA 3AV3A 4UXIA 5C32A 5EESA 3MJRA 4TXHA 4EVSA 4KIWA 4E94A 4B32A 2I3ZA 5LZ8A 1QF9A 2JGDA 5CFZA 4GKJB 2Q07A 1CUJA 1JEEA 2G08A 4KE8A 3RFFA 3ZJYA 3UICA 4X5OA 1C9EA 1V5GA 4N39A 3V4PB 1TAGA 1XKLA 2IFTA 3FPCA 4J76A 3Q3JB 4YCCA 3QFCA 1MOQA 1CY0A 4DLAA 3R3HA 4JB8A 4FGWA 1SQ0A 4MPDA 4XH9B 4Y30A 3IP1A 5AI6A 3TPFA 3U09A 3G85A 4KXQA 4ZJZA 1YZ3A 2PCJA 3H1EA 1WDKA 3R5HA 4UVHA 3HUUA 5EVJA 1ZVVA 1YQEA 4X1IB 3OT1A 4P6VF 5BYKA 4U0JA 2F90A 4ZMBA 2BMFA 5AVOA 3KKKA 5JR3A 1DDGA 1JIUA 4DRZA 4O4IF 1KIFA 3PP8A 3P9QA 3DMFA 3I9V1 3RSHA 5H82A 1CZRA 3AR2A 1OXKB 2C9ZA 3UMSA 1EB9A 4MRVA 3FB4A 3ZD8A 4GSYA 2ZRJA 4ACAA 3ZW9A 3PUKA 1G8FA 1O6ZA 1QJ4A 2Q9CA 3IPLA 2PGOA 3KJIA 4O25A 4R9SA 3E7WA 4YJ3B 4Z2YA 4EGFA 1EKXA 1T36B 4BKUA 3LCCA 2DFKB 4KQCA 4RK7A 4MCJA 1NRIA 1CUAA 2XMSA 1LK0A 3CR8A 1SUWA 3I76A 4GE0A 4IINA 4MVCA 5E6UA 3AI7A 3DWIA 1GL7A 3EPPA 5FIUA 3GDFA 4HGZA 4I9GA 5JWRA 4B7AA 5IVHA 5IZCA 2X77A 1E3WA 4LBZA 4DOMA 5ICMA 4OK5A 5ICSA 5AQEA 1PYGA 1IULA 1V1MA 2JC3A 3C7TA 2HR1A 2Y3IA 3FLEA 3L6BA 2ZT8A 3DM5A 3U3DA 1VA5A 1XNGA 4YMSA 3EQ8A 4F3KA 4YV1A 3G1TA 2YZ2A 1G3RA 3PNKA 3BKWA 1MT3A 4KH1A 1XJ5A 3WGGA 4MVXA 2I0FA 3ND9A 5ELLA 4AT1A 1IDOA 3H1FA 1K2WA 3VZRA 1SVNA 4BEJA 4EZEA 2PT6A 1QUEA 4B85A 1R0ZA 1U1FA 1QQ7A 4QLOA 4JLSA 4J4TA 3K4HA 1ZXLA 2QAJA 4KYUA 4RMNA 3S27A 2ZETA 4EHHA 5HCIA 4OKNA 4UBIA 1U0JA 3GLKA 3SF0A 1E9DA 4LXYA 2ZRHA 1P19A 3HDGA 4FGUA 1WDTA 3NGMA 4HAYA 2H7YA 1J0CA 3OIDA 4JP3A 4L51A 2IXEA 4KVFA 5TPZA 3EBOA 4OI1A 2R00C 4OB8A 1UDXA 2QX7A 1W36D 5HPYB 5CB4F 2AEMA 1FF9A 5F73A 3OA2A 2H18A