3FGZA

Crystal structure of chey triple mutant f14e, n59m, e89r complexed with bef3- and mn2+
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDESTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Matching Biochemical Reaction Kinetics to the Timescales of Life: Structural Determinants That Influence the Autodephosphorylation Rate of Response Regulator Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fgzA00
3JS5A 2WRZA 3HV2A 3OM0A 4RK4A 3O2SB 5B3JA 1C0EA 2PJUA 4RK1A 4KMRA 4TLMB 2QXYA 2Q5CA 1NATA 2R47A 1EWVA 2IPAB 2RJOA 1MIHA 4S05A 3OQNA 3JVDA 1QQAA 1YIOA 3LKBA 2BGGA 3HS3A 3N53A 4KPYA 3ROTA 2JK1A 4RKQA 3CKMA 1LK0A 4MS1A 5JS2A 5BRJA 4NCBA 2ZAYA 1ZY2A 2QSJA 3KLOA 3VNBA 1CYEA 1Z12A 3R0JA 4YP9A 1PEYA 2PL1A 3URMA 1DBWA 2FXIA 3LUDA 4JAVC 1DRKA 1DBPA 2L17A 1D5WA 4RS3A 4KNYA 3GT7A 3OLXA 5EWMA 1KRXA 3KKEA 5TQ0A 4Q6WA 2IPLA 5HQJA 4P98A 1RZRD 3I42A 4MQEB 1P2FA 1E6KA 2FEKA 3D02A 4LE1A 3KCNA 3NHMA 1OXKB 2J48A 1KMIY 1RNLA 4IGAA 3TMYA 2IPNA 1K66A 4DADA 4ETNA 2WY2D 1AB5A 2YHAA 3A0UA 3C6QA 2FMHA 3IP7A 3Q9SA 3QK7A 4MS4A 2E4WA 3EQ2A 4YR7A 2WB4A 1D1QA 3LOPA 2M1ZA 3Q7RA 5FBHA 3H5TA 3QELB 5PNTA 3HUUA 4JASB 5D2CA 3O75A 1SD5A 2PUEA 4G0OA 5KC9A 2MYUA 3MA0A 1EWTA 4LDZA 2FEWB 4MR7B 1ZDMA 4WZZA 2HQOA 3OLWA 4RKRA 2IPMA 2M98A 4EYGA 3O21A 4ZJPA 4NV3A 2CHFA 5CNMA 1VPWA 1XWWA 5KQGA 3EODA 4F3TA 2AYZA 4LE2A 2GI4A 4QICA 1S8NA 1NXPA 3H5IA 3HDVA 2MYTA 5I4CA 3DZDA 1TVMA 4HNSA 3S99A 2OENG 4RY9A 4Z9AA 5EWLB 2DRIA 4OLAA 1MB0A 3K9CA 3MMNA 5JNWA 1J56A 2JBAA 2QVGA 3F6PA 2A9PA 3CLKA 4G0MA 4EYQA 4F11A 4LDAA 2CWDA 1JF8A 2WJAA 3NHZA 3QELA 2H0AA 1DC8A 4Z0NA 4NQRA 3CNBA 1K68A 5IC5A 6CHYA 2W42A 3H1GA 1QQBA 4OLBA 1MAVA 2LIVA 3BREA 3LUGA 2A9RA 1NXTA 3EGCA 3HJFA 5IBQA 4HNRA 1Z2EA 3N8IA 2PE5A 1M2FA 1P6UA 3Q41A 4MR9A 3EULA 1U2PA 3G85A 1RXIA 4LZLA 1FSPA 1FQWA 2HPHA 5F64A 1TMYA 2FQYA 4RY0A 4OBBA 3QEKA 4XLTA 1D4ZA 1P6QA 2FQWA 3H5OA 3H75A 1Z15A 4Y9TA 5T3YA 5BR1A 3RVQA 4QYMA 3N0RA 1JWLA 4N03A 2FMIA 4XASA 3RVSA 1ZH4A 2NUBA 2WMYA 3F7NA 4JOQA 1ZESA 3GYBA 3FMVA 1ZVVA 1CHNA 2VYCA 5CNJA 3UKJA 2HQRA 3HEBA 1URPA 5TE9A 4PICA 1BAPA 2HJ9A 2FQXA 2FSPA 4FB4A 4Z4GA 4WXMA 5DCLA 3RVRA 4YV7A 2PUCA 3TX6A 5CNKA 2LPMA 5FWXA 3IPCA 4ZMRA 5JNUA 4KK4A 2FLWA 1PNRA 1ISRA 2RDMA 3HXMA 4G0ZA 1JBEA 3O1JC 4HYEA 3CZ5A 2ID9A 1E6MA 2N9UA 3HVRA 3KG2A 3RVMA 3RVKA 1Z26A 3OLVA 3SM9A 1JL3A 1Z18A 1U0SY 3H6HA 3FDFA 1W25A 4G97A 4EYOA 3RQIA 1BA2A 4RWEA 1CEYA 5BQ3A 3FFWA 1C4WA 4MS1B 1EFAA 2L18A 2FEPA 5IEBA 2MYPA 2E4XA 1JFSA 2NT3A 5HKOA 3LUFA 1YTUA 5HSGA 4EY3A 2WWVD 4WT7A 4YS6A 1YMVA 1F4VA 2E4ZA 5ABPA 3SNKA 1GLGA 1WETA 5EWMB 2PUDA 4N76A 3O2JA 4KVFA 1Z25A 2NT4A 3C3KA 4L4UA 3GV0A 4IILA 2NZUG 2MSWA 2PL9A 2XDYA 3CRNA 3OM1A 4RU1A 2R25B 3I5AA 3QX8A 4EVSA 5ED4A 3GWGA 5FBKA 2X7XA 3NBMA 3DBIA 4EVRA 2PAFA 5EWJA 4WUTA 4W5OA 3QEMA 2PMCA 4RZSA 1ZH2A 3LFTA 3OLYA 2E4VA 2VK2A 3FFXA 3KYJB 4IMJB 4UHKA 3ROFA 1DZ3A 4WXEA 3GRCA 5JNRA 4QYWA 3DGEC 1E2BA 9ABPA 1UDRA 3Q15C 3HSYA 4W5RA 3QLUA 4F12A 3L49A 3F73A 3BBLA 4LRQA 2FTKE 3SG0A 3IP5A 3P9YA 3Q7TA 4MR7A 3T8YA 3GL9A 1XHEA 1MVOA 3OO1A 1DCFA 3H5WA 3K4HA 4XAQA 4ZMSA 4RK6A 1YMUA 3UK0A 8ABPA 1IIBA 1EHCA 1D2AA 4Z4IA 3DLHA 5IUKC 1ISSA 3A0RB 6ABPA 1ZHHA 5TQ2B 1R8JA 4O5AA 1H9CA 1USIA 1JDPA 2FLKA 4M88A 3QEMB 1L5ZA 4Z4HA 5B3JC 1ZGZA 2ZWMA 4L85A 3TB6A 1QO0D 1QP4A 3GBPA 3EAFA 4W5NA 1ZN2A 3JVIA 5JS1A 1QPZA 3OMXA 3HM9A 3SQNA 1ABFA 4ETIA 1EWKA 2PKXA 3CZCA 3O1IC 1ZAYA 2WJWA 3HO1A 2FVYA 1TJYA 3OO0A 5KQLA 3MIZA 5KQPA 3HDGA 1BDIA 1NY5A 1GCAA 1YVUA 1Z17A 4MS3A 2PUAA 1JYEA 1M5TA 2LUOA 3T38A 4IMIB 1NXVA 2AYXA 3H5LA 4H3HB 1SXGA 4PEVA 4N47A 1GCGA 4YLEA 1GUDA 1MB3A 3IPAA 3QLTA 1RZRA 5TQ2A 4JA2A 4RDCA 4NCAA 2RGYA 3ILHA 3UUGA 4MRMB 1VLZA 2FW0A 2E4UA 5TPZA 1PUXA 1JDNA 1L5YA 3I45A 4WWHA 4YGXB 2GKGA 1ZITA 2GWRA 2P4UA 3QLUC 5E3JA 5FWYA 1U8TA 1FFSA 2FMKA 3H1FA 3KLNA 3MYYA 2QVCA 3HCWA 3C3WA 4O1IA 5C5EA 2FMFA 1M5UA 1QO0A 2I6FA 1EAYA 2RJNA 5JNSA 4KREA 4MGEA 1LBIA 2B4AA 2GX6A 4RK5A 5DTEA 3FFTA 5IUNC 2E4YA 3HUTA 3W9SA 3BRQA 3QLVC 1U04A 2R4QA 1TLFA 3MF4A 4IRXA 4Z4FA 4KQCA 2A9OA 5KQMA 3O74A 1F51E 1P8AA 3L6UA 4GPAA 3JPYA 1NXWA 4IF4A 2JVJA 3O2QB 4MRMA 4ETMA 4KZKA 4PE5B 1QP0A 1OXBB 7ABPA 3OQMA 3CG4A 3GA5A 4DQDA 1USGA 4F8JA 5JNTA 4D6XA 4MQFA 4JB0A 3LMKA 4P1ZA 2R48A 2LP4Y 1JFVA 3D8UA 1LBHA 2V0NA 2PUGA 3LUAA 1HEYA 3C3MA 3VNAA 3BILA 1AB6A 3CS3A 3FGZA 4D74A 3TD9A 1BVHA 3RVNA 5IEJA 2L19A 3LTEA 1DCMA 4EUKA 1YK1A 2TMYA 1I3CA 5GOTA 2QZJA 4KRFA 3CU5A 4ML3A 5CHYA 3RVOA 4PYRA 2PUFA 2HSGA 1GUBA 1Z16A 3DGFC 3H5VA 2ID7A 5CNIA 5TPZD 4F06A 3KYIB 5DGCA 5EWJB 3RVLA 4G0YA 1KGSA 1A0OA 3Q7SA 1QKKA 4N41A 5IUJC 1PNTA 2CHEA 2O20A 4N0QA 4FE7A 4MLDA 1E6LA 1VRVA 1NXXA 1YS6A 2A9QA 2FKAA 2QU7A 4H3KB 4Q6BA 3KJXA 3N0XA 4G0QA 3IDOA 3ILYA 1DBQA 4RSMA 4TN5A 4S04A 3G1WA 4MQFB 2B1JA 4XFKA 3F6CA 4TLLB 1W9HA 4E7OA 2JVIA 1JYFA 1ZGGA 3B2NA 3KHTA 1A04A 4OATA 1USKA 4PZ0A 1RXEA 2MSKA 3RH0A 1FFWA 3MQ4A 5TPWA 5DKFA 1DG9A 1VKRA 1KRWA 3N0WA 2NZVG 5TQ0B 4YRZA 3OMWA 2JVKA 3NNSA 1BDHA 3C97A 4JB2A 4KFCA 3LUHA 1T34A 3SY8A 4YCSA 5C5CA 5DLEA 1YS7A 1BDJA 2JRLA 3T95A 3H6GA 4D6YA 3TO5A 2VUIB 3HZHA 2MSLA 4MR8A 2CD7A 4KQ9A 2QR3A 4RK0A 1DC7A 3T6KA 1YK0A 4RXTA 4MS4B 4B09A 2F8SA 1PHRA 3N6VA 4RK7A 4MPTA 3QX9A 4N0PA 4XARA 2F8TA 3IP9A 4RXUA 4Z9BA 4EYKA 2HQBA 3M6MD 4MAAA 2JB9A 4NICA 4QPJC 2IKSA 2PLNA 4KK3A 1XHFA 4MS3B 1LJUA 1U2QA 3QLVA 2FN8A 5TPWB 3N75A 3OLZA 2H3HA 1SXHA 3JTEA 3KS9A 4W5TA 2QV0A 1QNLA 1SXIA 4YWHA 1QMPA 4RXMA 1FFGA 4EVQA 1JX6A 4KV7A 4E7PA 1SRRA 3CHYA 3LUJA 3H1EA 1NXSA 4MR8B 3CTPA 3MM4A 5EWLA 5IULC 1JH9A 4RV5A 2P9HA 2IYNA 5GQSA 3E3MA 4G0PA 1Z13A 4FE4A 1DRJA 3DLBA 4OTZA 2JBAB 1NTRA 3NNDA 3E61A 3JY6A 5FWYB 3I09A 4CBVA 1JFTA 2YHBA 4YO7A 3RVPA 4ZPJA 1DCKA 4Z99A 4Z4CA 5IX8A 4O1HA 5KC8A 2KYRA 3M9XA 4G0XA 4JP1A 4TMYA 5T7BA 4UHJA 1Y1LA 1TM2A 4Z4EA 3A10A 1DP4A 1JLKA 4XXHA 4EGSA 4MR9B 3IP6A 2L2QA 1PEAA 4OG2A 1APBA 1B00A 3GBVA 1M2EA 2OQRA 3BRSA 1ABEA 2FN9A 1QP7A 2IOYA 2IDMA 3EJWA 4MLCA 4G86A 1JHZA 3A3KA 4H60A 4LX8A 5HM6A 4W5QA 2PUBA 3LUKA 3O1HB 1D1PA 2MYNA 4HNQA 3LKVA 3SAJA 5KI6A 5JNVA 2QW1A 4MYRA 3KTOA 3NNNA 3OQOA 2GBPA 1Z2DA 4DN6A 3HK2A 3RVJA 1DJMA 4LE0A 4Q7EA 3M9WA 1A2OA 3KSMA 1NXOA 3EDCA 3CFYA 1LJLA 4GNRA 5TQJA 4RY8A 2JCGA 3EQZA 3JPWA 4ZYLA 5FWXB 5KWSA 5BRAA 4MQEA 3CG0A 3LUCA 2LBPA 2VUHB 1RPJA
chains in the Genus database with same CATH superfamily
5CH3A 1WCIA 1K3TA 2ZVPX 3IDZA 4C4XA 5JCJA 4JBIA 3AI3A 4JLPA 2OGUA 1I1QB 1ZVQA 4QOGA 3HB1A 3K0CC 1TUEA 4B4KA 1EQUA 1PR1A 2IT1A 3JVDA 3HNOA 1LF5A 1MV8A 3ICOA 4ODIA 5LZ7A 5DX8A 1P5JA 1GRVA 4DLSA 4JS0A 2Q1WA 4KPYA 2JJQA 2AUMA 2QTFA 3D6HA 3DZHA 2R8ZA 3GXOA 3G2QA 4XJVA 3QSYA 3VNBA 3R40A 3GMTA 3EA0A 1OTYA 5THKA 2H2HA 4JNCA 1T9BA 4X60A 3P45A 4FUTA 2OGSA 2PUHA 2QAIA 4LZPA 2X6TA 3R7WA 1ZRNA 4IOLA 3GLFB 2A9FA 2R5WA 2A0WA 3ENZA 3KQPA 3LZ6A 3MCAA 3N8KA 1NJ5A 4FZJA 4IJUA 4MGYR 2OHFA 4OA8A 4PFJA 5AJXA 4N7JA 1O97D 5EMLA 2I34A 4DXHA 1BKSB 1I3KA 1EQAA 3R5TA 3UWSA 4MW5A 1CFJA 4DV4B 2CDBA 1L7NA 2Y05A 1ZYUA 3C8MA 1BEEA 1ETUA 3TVTA 1T26A 3RC8A 4UFPA 1P39A 5D5PA 1CY2A 1EGHA 1FDRA 1T9DA 3E53A 4HBGA 4L0MA 4LYEA 4Q3KA 2W2MA 3B1XA 4DGQA 2E87A 2X8BA 2PZFA 1ZMBA 3SKXA 3GJTA 1LS6A 3E4CA 2NLOA 4X00A 2R8OA 1K7XB 2GASA 5CB0A 2BIFA 2XSZA 4MZXA 2JLZA 3WAJA 4B8YA 2Y68A 4JEMA 4TTVA 4URXR 2CLOB 2YQ5A 1LD3A 1JR3A 3MTDA 1F12A 2CZCA 3LOPA 1UPCA 3Q7RA 1RDFA 3RSCA 2D59A 2CE7A 3IEPA 1NI5A 2K7FA 3ZGOA 4M87A 3N2EA 5E7QA 2C8KA 3AUYA 4KRGA 1YZYA 1VKNA 4MW0A 5LSAA 1A82A 1ADBA 3BH0A 2HF7A 2VC2B 4ZANA 4ZCTA 1JHVA 3PLAE 1HQDA 4TRRA 5FCDA 2M98A 1YVPA 1GN8A 1ZA1A 2BWJA 2R5FA 2Q7OE 1KH1A 2B1IA 2C59A 3C5VA 3G79A 2GYUA 4FNOA 5EFZA 5A1JA 2VF4X 2PXHA 4GVPA 4QA9A 2WYOA 5GVSA 3DMGA 3BSWA 4PPFA 3DDOA 4I99A 1H94A 2ZRNA 3LNCA 4BL5A 5DLDA 5I4CA 2PG3A 2O4UX 2WHRA 1QO9A 4UASA 1XP5A 5K03A 2UYCA 4ZCSA 3KELA 3O7WA 4BO8A 1ICEA 2ECQA 2ONJA 1MB0A 5E6SB 1U0BB 1D7AA 5IAJA 2QVGA 1BGWA 4G0MA 5EJAA 3DVQX 3HQ4O 3N8DA 4IXTA 4RV9A 3SOPA 5LQCA 4NU8X 2H0AA 5J1SB 2XMZA 5JH7A 1PQPA 3GUUA 3SBDA 3DV0B 2OZVA 4BRZA 3E2PA 1RIIA 3BMQB 5JR3A 2O2XA 3RSQA 2FWJA 1AM4D 3BFVA 3W4IA 4G5GA 1FXSA 2FPSA 4DDMA 2A9RA 4CKEB 1OJ7A 4AO6A 5L53A 3S44A 2JLQA 1TUBB 5JD3A 3QHAA 3BJEA 5A03A 5EL0A 4A2CA 3IALA 2P3OA 1R2QA 4X92A 3VAAA 3CPHA 2WA1A 1NQWA 4MI1A 4HJRA 4DVJA 5JBNA 3DT8A 3L0OA 3AVTA 1BFKA 4B3IA 1KPHA 2QRMA 4UU1A 1FLNA 4KVZA 4PGMA 1ZR4A 1H2HA 1PX0A 5JOQA 1UZMA 1VJDA 5IYZF 4ER6A 2GTPA 2R8PA 3S5UA 1Q2UA 4KI0A 1IAVA 1C8VB 3HKCA 3O4JA 2OG2A 2WMYA 1KAHA 2JFGA 3O8OB 4N4AA 3TG2A 3AL3A 2KS6A 2CXUA 2GAFA 5EY5B 5MGBA 5EXEA 3QE0A 3R4VA 5KVQA 1L5KA 2ZZKA 2V8BA 1TAUA 2XUJA 3DFIA 3TQTA 2ICAA 3V7UA 4FB4A 4TKUB 4TV9A 2AN4A 2DR2A 1GAWA 1MOSA 4K9MA 1A9XB 5EHNA 4OHKA 1A8UA 3ZE9A 2QL6A 2QTVA 1GDHA 1Z29A 2CVHA 4S2UA 3CX8A 3U26A 3OU6A 4ZMRA 2DOKA 3BJZA 1X2BA 4JGGA 1CUXA 1NC1A 4H6VA 4LTMA 3SCZA 2PGIA 1E6MA 3AILA 2UVPB 2W6CX 3KG2A 3RVKA 1M6HA 2BSAA 3DVSX 5IKEA 3LWNA 4ZU3A 1LWNA 2PYZA 3MT9A 4L5IA 1MGOA 2P9YA 1NI3A 1N7JA 2BFBA 4EEXA 3GIWA 1FMCA 2BTEA 4M46A 2CJPA 3BBPA 5AICA 4RORA 1OY1A 3IQWA 4ZVTA 3NOOA 1H3FA 3OOJA 1XGKA 2P0AA 3ECSA 1EX7A 1EFAA 3A37A 3FJYA 2OORA 4KAXA 1LRLA 4LRSB 1EUCB 1WOMA 3S2UA 3VDRA 1E62A 2MYPA 1XX6A 2FI1A 2JATA 2R1VA 4FFDA 1U63A 4NEGA 2X0FA 1XXHE 1GEGA 2R7NA 2XKJE 3UO8B 2W4MA 5JATA 2V45A 3K09C 4CM9A 4BZXA 1GLGA 1R18A 1A4IA 5JSQA 1EUZA 1TQHA 1VPDA 3QNWA 1L8LA 2MSWA 2YQZA 2AG8A 4RIHA 3W06A 3HXLA 4DMFA 3T4PA 4KDRA 3ZHBA 1E1QD 1XNGA 4EMBA 4V1CA 2YMMA 1YRBA 1A95A 2C2KA 2P4EA 3KEQA 1DLJA 4H15A 1ZCAA 4TLBA 1E20A 2B7CA 3ZUGA 1R00A 4Q37A 4YRMA 3DMYA 3VOTA 2G04A 5T57A 4OBWA 1XZLA 2HBRA 4F12A 3F73A 1L4UA 3U56A 2B9VA 3KKLA 3C39A 3OWHA 5AW6A 1XNJA 2XE8A 4X95A 4FJ1A 2GCOB 1ZUNB 1MB9A 3AEUB 4DDWA 4IHKA 1ULSA 3NHFA 2ZPAA 1DWOA 1MAWA 1PF7E 5T3UA 4UCWA 4GL2A 3GCGA 3ZD8A 1FS6A 3LYUA 2LKCA 5F5NA 1Q0UA 5GY7A 3VR1A 5CB8A 4B3SB 2C96A 1LU9A 1CVRA 4YK7A 6REQA 3M0EA 2XCUA 4OXIA 3CVVA 1W7AA 1WY5A 4RIIA 2ZSEA 5L51A 1F2TA 3ZGLA 1RYDA 2RBKA 2YJ4A 3FYHA 4CETA 4UBJA 2J7KA 4ROTA 4LZWA 3ND5A 3IE2A 4OHUA 3V1MA 1SOWA 1ONSA 2VOJA 1UC4B 5ILQA 5BNFA 1ZGZA 1GTSA 5EJ9A 2RKOA 1M1NB 4MGKR 1ZSNA 3EAFA 4JR1A 4A0QA 3WR5A 1WAMA 1FF9A 5B12A 1DRUA 3CZCA 5F76A 1TFRA 1NVVQ 4WNCA 5C8DA 4B6PA 4GP6A 1WUHS 2XB8A 4JJFA 3U4DA 1TM5E 1ENYA 3MIZA 4EW2A 2B20A 1GFSA 1NY5A 1SURA 1FX0B 3GX1A 1EGAA 4N5HX 1R9MA 1D03A 4RF2A 3SK0A 1EBBA 4IMIB 3DPUA 1FDOA 5E3IA 1W8IA 3TQSA 2Y1EA 3AF0A 1MC4A 4UVHA 4CLXA 4EDHA 3CLTC 1RT9A 3GEHA 1KSJA 4YLEA 3CZPA 1B2LA 1Y8ZA 1MB3A 1NC3A 1WSWA 5K8JB 3EIEA 4B3RB 3PCXA 2NVBA 1ORWA 3FHTA 4M1MA 3DVLA 1KP2A 4QATA 1AQJA 2CXPA 2JFXA 1H0SA 1KI6A 2OCYC 5I4IA 4FM9A 1LH0A 3ETHA 4KQXA 2J9ZB 2VVTA 1NFRA 2GKGA 2JKYA 5JZOA 4FYJA 3CEJA 4XQCA 3D6JA 1U3GA 3NH6A 1TF2A 3BMCA 5HCIA 3AVYA 4YLYA 2NU9B 3MXTA 2HO5A 2YHIA 1AZTA 2ZYUX 1ZD8A 5ETJA 3SXJA 4EY6A 2NXWA 2PX2A 3W4JA 4DR4B 1NFFA 2G80A 2W98A 3DXFA 3JSXA 2GF9A 2Y1FA 3JWIA 3V3TA 1O6ZA 3CLVA 4PSVA 4Z2YA 3TOCA 1XQ9A 2FGKA 2WIKA 3ZU6A 2OO3A 5EGSA 1U1EA 4JU9A 4QEKA 2GX6A 1MDBA 2QOEA 3MUEA 3FUTA 3HXPA 3GLGB 1XVIA 5F2NA 1WD7A 3S70A 1TLFA 1N34B 2LR0A 2JIPA 4HXEB 3E8MA 5CLJA 1H2BA 1L4KA 4XVCA 4HDSB 1B26A 2RHCA 5I7HA 2PSSA 3PSHA 3JPYA 5LFAA 3F9IA 2WM9B 2WIBA 5BWLA 1KY3A 1Q21A 1HT0A 3MZ0A 1OI7A 1WHSA 5J2TA 2J0SA 4N5LA 1IM8A 1F1BA 1GAEO 2RIRA 3IELA 4DQDA 1GYPA 1USGA 2ZRIA 4MIKA 5KYNA 5ALKA 2DPHA 2IF2A 4HDNB 1YUMA 4I9UA 1JEOA 2IOFA 4ZOLA 4RGQA 3ZK7A 1Y4AE 3PWZA 5LU9A 2ZSBA 1XXLA 3EFOB 3L6EA 4N3GA 3UG7A 4KI7A 4RD3A 1EQ2A 3PU6A 1RYHA 4P4LA 1I3NA 3HLKA 4GPD1 1LK7A 1OGIA 1RYEA 2WZBA 2V7QD 3W3AH 2ZJOA 1NJFA 1GUZA 4B85A 2RFLA 2O1EA 3HI4A 1J0CA 1JIKA 2ALJA 4LJAA 3DDHA 4EUKA 5JBQA 3FBGA 3UOWA 5JMOA 3LW7A 4MVJF 1QF7A 5L3VA 3FFBA 2VQEB 1NQTA 4PYRA 5AKLA 1Z16A 1HZZA 1YS4A 2SCUA 3H5VA 1PK9A 1QHIA 4TLEA 4BMXA 3ER8A 5TPZD 3EXFB 3TMKA 1K98A 2REBA 3IERA 5EWJB 5DGCA 2ZRMA 2OQIA 1M0WA 3GGDA 4JVOA 2HGZA 1FQKA 3RFUA 2J4FA 4IZIA 2ID8A 1U5BB 1OWOA 1JBQA 5F3RA 2GEUA 2MIIA 3HCAA 2IYTA 4JYBA 2J4CA 5AFSA 3UAYA 1J22A 1W52X 1FYXA 2WWGA 3HR4A 3KJEA 3P27A 4L7QA 2EQ5A 4WCFC 5EXTA 5M04A 3GHHA 2QGZA 4FN4A 2PGJA 3G1WA 3OIGA 4BFVA 2EKLA 3UJHA 4E2XA 3MEQA 1Y6QA 3B2NA 3BL5A 3AETA 3LDGA 3N2GB 3TW0A 4MVJG 1CU1A 2QAGB 4DSTA 4ZCQA 4AY4A 4UBMA 2IYLD 1U2SA 1K7SN 1TPZA 2IXGA 3C16C 5ADUS 4K86A 4YRAA 1YV9A 5AW9A 2OVFA 3W5AA 5AJZA 2P90A 5B4UA 2J0QA 3OHMA 2XITA 1VSVA 1C81A 1RIFA 1X6VA 4ND8A 4UU0A 5DM1A 1E0KA 2IBTA 3KQUA 3L8HA 4JB2A 2V9PA 3ZWYA 1Z0ZA 5JZBA 1MEEA 2DKNA 3DVAB 2G36A 3EDRA 4AQ7A 1NVTA 2ZG6A 3GCZA 4X61A 4BFSA 5AM2A 2VUIB 3JQAB 1G21B 1UOEA 2J85A 4GGMX 4MR8A 3AIMA 4M1TA 1LRJA 2B3DA 4N3CA 4Y6GB 5FRDA 4EQ6B 3RNOA 5CFLA 5EZYA 4YQZA 3SZOA 3ELDA 4MWGA 2C5FA 4KE9A 4YAJA 5BQ5A 4MPTA 4NU6A 3PD1A 4TT8A 2RGNA 3CRQA 3D3EA 2DHEA 1ADGA 2C0CA 1OJLA 2FMXA 2VBCA 4RXUA 2Y6VA 2AHOA 2YXPX 1ZUIA 3E0XA 3P9ZA 2JLCA 4X93A 4G1CA 4F38A 1ZJWA 3FRHA 2ZR8A 3GZJA 1H4QA 2IU6A 1KZHA 5J2UF 5EYPA 1VYVA 1HNZB 2Y92A 5IM4F 3R9XB 5JI2E 3BAFA 4BVGA 4O33A 2PWZA 3TTTA 3JQQA 2R7MA 5JSZB 2BRUC 2C0PA 1RWKA 4H17A 4WNAA 3OPXA 5D1NA 5FUXA 5IDYA 5A6SB 4AKHA 1RRMA 4BJ5A 3ZV7A 1SAYA 4F96A 4Y1GA 3E2MA 1FDTA 5JJLA 2J33A 3QU9A 2C61A 1FNNA 1ZLYA 1FQJA 1CZLA 3FE2A 2DY1A 4L0QA 3ZWNA 5MN6A 5BSUA 1BJRE 1R6XA 3CNOA 3NBUA 3BIFA 3CMCO 4RXMA 4EMSA 2C8JA 2FWBA 1XZKA 1XTKA 1ZD2P 2MSDB 3BULA 1YC5A 2BTQA 1D9ZA 1Z8NA 1JFFA 1KZ9A 2I2AA 2Q49A 1HE1C 2RIPA 3HBLA 3KLBA 5F7ZA 4BFLA 4EJ6A 2Y1XA 2YHUA 1P7VA 1NR1A 3I8SA 1E1RD 3LPCA 3LC1O 4HATA 4R84A 3RK0A 1PD0A 1PR4A 2IQIA 3QKUA 4C2AA 4JWTA 2W00A 1X1SA 1B8OA 1MVNA 2PN1A 2CWWA 2VTDA 3I09A 1JTEA 2QI9F 4IL5A 4KL8S 3RPEA 4F4IA 2PX5A 2VF8A 2YFKA 2YHBA 3B7WA 3UJNA 4F0JA 1F17A 5CT8A 2QRKA 2Q1SA 1OQAA 3GG2A 4EPTA 3M9XA 3MQ2A 2PGOA 4DA9A 3GN2A 1DT5A 1UPUA 3I8OA 1VSUA 3OQJA 4Z5XA 3K32A 3QY0A 2C1ZA 3S68A 3WS7A 4D80A 4JJGA 1HFKA 1JLKA 1M8JA 1PQWA 1X8LA 3BGWA 3GJ6A 3NJRA 1TZKA 3TL2A 2MT9A 1TMGE 3FYUC 2R66A 3R3VA 2RHLA 2VWPA 4OQXA 5D3ZA 4BWVA 5I6DA 1PEAA 4ARBA 3L7BA 4PRLA 1LF0A 2GFHA 1SBTA 1TEXA 2CUTA 3BRSA 4RD4A 2VWHA 3BQ9A 5C53B 4JJAA 3ELYA 4ER5A 4MLCA 1Y3HA 4LYDA 4FGUA 1SHZA 2VZ0A 3RREA 1AKMA 1XP8A 3NUGA 3V97A 1N78A 5CFMA 4IQ4A 1Z6QA 1FP1D 4AB1A 3VR2D 2A0KA 1VSBA 4WHMA 1A9RA 3IO3A 1HNNA 4ON9A 5BUZA 3PQ7A 1H1TA 3UWPA 3QEJA 3NKVA 3RT9A 1I94B 4DN6A 3L6RA 1QTRA 1MTZA 2FHSA 2I6SA 1NN0A 3M9WA 3DAPA 3WGHA 1EFDN 4H08A 3E1GA 4KPUB 1WMEA 4X84A 3KAQA 5FWXB 2NU8A 1KYTA 4D1YA 3CG0A 5JAZA 4QTXA 2ZIVB 3PGLA 2ZI9A 3C4JA 4FYYA 3WB0A 2CK3D 4ACBA 4FBLA 4JVLA 4KMRA 4YALA 3F5MA 4EHJA 3GDGA 5IXYA 5E1OA 2OBFA 4DDKA 4BWGA 2ZITA 1YIOA 4BASA 1FY2A 1KFCB 4G4SP 2P5TB 5CDGA 4V0ME 1JIIA 2RC6A 2QT0A 3F3KA 4HEQA 4OX9B 1H5UA 5FNZA 3LT5A 2IH5A 5MHTA 2M6KA 4MYCA 2G17A 3P0EA 3RU3A 5DOVA 3U49A 5AJVB 4AJNA 3D7SA 2IYZA 1QGZA 2AZ4A 1FNMA 3SE0A 1QFYA 1V9SA 4GGPA 1Z2AA 2VPIA 4K6CA 4DV5B 3I62A 3H2SA 3GUCA 4H2DA 4PZDA 1XEWX 3WGZA 4RVUA 2JH3A 4QQKA 3TLGA 1RHJA 4URWR 2H59A 4PGFA 1XMXA 5EWMA 4JEUA 4BUZA 1XC7A 1NJ2A 1M1XB 2IE8A 1TADA 1M8FA 2XMCA 1UEJA 2LCQA 3VSDA 4XJSA 1YJ5A 5BSTA 3WB2A 4ZN6A 1I4OA 4KYVA 4YMHA 2BKLA 2VJNA 1MC8A 3WAGA 4MCJA 1XROA 1G17A 1JHYA 4IGAA 3WXMA 5DT2A 2O23A 4IVPA 4DCJA 1JSRA 1M74A 2LXNA 1EH5A 4YHHB 2V3CC 3QK7A 4R9VA 3UWKA 4DB4A 4X7PA 1LSJA 1XLTA 1QQ6A 1N9ZA 4RHYA 1O94A 5C7LO 5HJEA 1O4VA 5CPBA 2Q2NA 4GLJA 5F33A 2YJ5A 5IHPA 3QELB 4OHCA 1JQDA 5EINA 1AGYA 4EFKA 3GFOA 4G0OA 5CU7A 1QIIA 4P3PA 2X3FA 2HSZA 2Q1YA 2IUSA 2W8BA 2XMPA 2NYRA 2QE7D 1I1OA 2XVYA 2YZNA 3CIOA 3HABA 2QV7A 2H29A 2WZQA 3LT1A 3HCPA 4FMCF 2VK1A 3UAXA 3WBKA 3UENA 3BPSA 3GA7A 4PXAA 821PA 3PGXA 3A4NA 3RU9A 2IUYA 1NBOA 5A7GA 2IHUA 3D4OA 2I62A 5DI3A 3GD7A 1L6RA 4PLFA 2PTHA 4Y6PA 2B99A 3QMPA 5DTRA 1RM5A 3JYHA 4RW0A 3THYA 1X1CA 2FRVA 2WJJA 4KWCA 4WINA 1CUWA 4ZODA 3N5CA 1C4XA 2YWEA 3A4MA 3K9CA 3PFHA 2XGGA 4HNAB 4C43A 2AB0A 3E1KA 1JSZA 1XZMA 2G4VA 3S2SA 4O2BA 4P7FA 3TLKA 3D3NA 2N46A 4LDAA 1PD1A 4YUYA 1NSYA 3O8CA 1P0QA 3NV9A 4J4BA 4CG0A 1QUEA 4TMKA 1WDTA 3FYSA 4BNIA 4DCVA 4ZDIA 5HHTA 1CFZA 3FPHA 5IC5A 2D3WA 3TZEA 2NGRA 3W2GA 4K81B 1R27A 5EUBA 3TBKA 2UYHA 2J09A 4PS1A 3BXXA 1YL6A 3EY9A 3TW8B 4F3KA 5FLKA 4DLXA 3PXEA 3ENWA 1NXTA 3TZBA 4FFLA 3HJAA 3HJFA 4P4NA 3SR0A 1G60A 2YTZA 1ECLA 4Q39A 1P6UA 1EG7A 1GGFA 1ONOA 1OXUA 3EULA 1UKZA 5AVJA 3UCFA 1NNUA 1U31A 4QXAA 4CKXA 5JAMA 5K6RA 2H4YA 1FSPA 5TJ9A 3IV7A 3LE8A 3M4NA 4F4HA 3KQKA 4IHAA 3H13A 1HL3A 4RY0A 4EB8A 4CU2A 3D8BA 3OCUA 4IJVA 3ZCSA 3KQQA 1JHPA 1SBQA 3U1VA 4URVR 3I83A 4NK5A 2WTNA 5F1PA 4P36A 2NNLD 2EV9A 3DMDA 2CMFA 3LY8A 3OJCA 1XOIA 1U0GA 2UZAA 1ZH4A 4Q4AB 4P7BA 3V80A 4BO2A 5L8VA 1IBCA 1ISHA 1ID8A 3RUAA 3VNQA 2J9XB 4FJ0A 4F84A 4CIWA 4CLOB 3U39A 3YASA 1BXRB 4KPGA 5JU6A 2DQSA 2OP1A 3ZU4A 1A2BA 2HIAA 2X0DA 2FPWA 2DWUA 4DQLA 1GPJA 2BBSA 4U7HA 3R76A 3A6FA 4EG1A 5FTLA 1PNQA 3QYFA 1MC5A 2GETA 2CF5A 4GP7A 5LPNA 2EEPA 4MI6A 3JD1A 1N9GB 1SU8A 1X77A 3PNOA 5DH9A 2A1TS 4R1TA 4GYWA 5FAXA 3WLRA 3D0KA 4PSDA 3S8EA 2ZWPA 5B3KA 5K0JA 1I9GA 1MO5A 4II7A 2H0QA 5CX4A 3WJ7A 4DSUA 5JMWA 1U0SY 1KP9A 1LW6E 2YN2A 2DHRA 2J5RA 3FF4A 3PQ4A 4G97A 2EC5A 3W77A 4R0MA 2JARA 1EP1B 5D85A 2LD4A 2W2KA 3MMSA 1J0DA 3REQA 2D74A 3FVTA 3GJ3A 1FFXB 2FEPA 4P32A 1VIYA 2HLDA 4UZSA 3EVEA 2H0RA 5K0GA 3PEYA 4JI0B 1TEZA 3LUFA 2XXAB 2BDUA 3FMFA 4ZEWA 3R0XA 2GFIA 1YTUA 2ECOA 3GP5A 3GRRA 3F1KA 3L8ZA 4NMMA 4N76A 3SNKA 1FCJA 4EO4A 4FQ8A 4M8IA 2MINB 2OXCA 3A6DA 4RMJA 2AG0A 3SZUA 1AC5A 2NZUG 3FFAA 1KYQA 4BWYA 3D2LA 5CM9C 1RAIA 3LQKA 1RVDA 3M5PA 4PZZA 2D5CA 1C9YA 4RC9A 4AX4A 3V3KA 5IJ0B 4JDPA 3Q8XB 1OSNA 3CLUC 3HI6A 3KKMA 3CR8A 3VPGA 2JD0A 1SPXA 1I51A 1YRYE 3H3XA 3IHKA 1QHHB 1KWGA 1KNXA 1EBFA 4UDYX 1VLVA 3OCYA 1VDZA 2WJGA 3FMGA 3FCEA 2O2ZA 2XNCA 2AIRA 1D0IA 2XEDA 1SUAA 3P32A 3QLUA 4H4CA 4W5RA 5B2ZA 5JYEA 3CXRA 1VHDA 3LCVB 3JR3A 4O63O 5T5QA 2IH4A 3IPYA 2XGSA 2RI6A 3C4QA 1RW4A 4CEJA 3CC8A 1F7VA 4EHDA 3P9YA 5LP1A 2BJHA 2FOIA 3GL9A 3UK7A 1QP8A 2QUZA 4NBRA 3UXYA 1YQQA 3EG5A 2FW6A 3QBJA 4US1R 1VE7A 1RYFA 4BEVA 4M55A 3MG9A 4OQ4A 1D4FA 4DQVA 3K15A 3L7KA 3RVDA 4MKXA 1E64A 3WZ2A 2GM9A 1NJ6A 1NV9A 4Q9KA 3EVNA 1R12A 2XDQB 1N5MA 2BMEA 3OX3A 1MX5A 1KJ8A 4IDFA 4YMIA 2DEUA 1RADA 2B34A 3A0RB 4MPPA 3VDMA 4C7MA 2I2DA 2I6XA 4GQIA 2QSZA 4YCNA 3QG5A 4CGYA 5DHSA 4NBWA 5KKAA 4J0CA 1L5ZA 4DQ0A 5JD5A 1RQPA 3NWEA 4KVGA 3SJAA 2XBLA 3M3HA 3VX4A 4C3OB 3GEIA 2IVZA 2ZUVA 3EFHA 5HF6A 1ORIA 3L07A 5BPFA 5MN4A 1XHLA 6Q21A 3CEHA 3K35A 5LNK6 1UBRS 4XEHA 4OJNA 1GSAA 4QTZA 2P6PA 4D96A 1OIVA 3JVUA 1GGNA 1W4CA 2YYAA 4LHWA 5KNCH 3KQNA 1O97C 3K70B 2G77B 3OFND 4HLDA 4UE2A 3RYIB 3PC2A 4LZOA 1BDIA 5KWVA 1GCAA 1DIHA 3ENVA 3OPYB 5IK2A 1KBZA 3BG5A 4MULA 2IXBA 3RNLA 1XR3A 1JYEA 3V55A 4C0LA 1Z6GA 2WP0A 2Y1WA 4BFWA 1XTIA 2EKDA 1DIGA 3LY9A 2EQAA 3CT4A 2KLBA 3K0HA 4JJ7A 4MHOA 2ZS7A 4QT4A 5LWQA 1JV2B 2WTAA 1OWMA 1XDWA 3KR1A 1G5TA 2VBGA 5HUQA 4CF5A 2OMKA 4UBIA 1LZLA 3ILHA 4ZK6A 4TS4A 3FSEA 1YGPA 3BRWA 3OTQA 1JXQA 1KXZA 4E1AA 3S2ZA 2CXXA 4V2IA 1LXCA 4OV6B 4BFYA 4EL5A 3R3JA 2VKQA 4Q4JB 2IPOA 2JK0A 4NAHA 5LZ5A 4AQYB 2CNDA 3NEPX 1D7OA 2PZ8A 3QOXA 4FR2A 4UW9A 4Y2UA 3RS5A 3RTDA 3U3KA 4L0CA 3DFMA 2C3MA 4X3OA 1YRHA 3EIXA 1SELA 1Z6XA 2GVNA 2H11A 4WY2A 1OU4A 2QX9A 3LL7A 1ZR2A 4MGEA 3RHFA 2PUJA 3FVQA 2AC2A 1KR2A 3NM6B 4BTLA 2WHEA 3IPLA 3OU7A 4LXHA 3TJMA 1XTUA 2Q3HA 2OHHA 3KYCA 3G8BA 4M22A 4R01A 5DBFA 2ACEA 4RMGA 2FLVA 2QRJA 1E8NA 4D99A 2O1WA 1OX6A 5EMKA 1UAAA 1Y3DE 2VTBB 3NX4A 4IWXA 1SR8A 2BI7A 2DWOA 2VSXA 3GK3A 1QIDA 3HCBA 1IY2A 3FIJA 4INJA 1SUSA 2IUTA 3O2QB 4FGJA 2PFKA 1O5OA 2YW2A 3HUDA 4YV2A 1P18A 1QP0A 1JR3E 2TSYB 3TOZA 4D4JA 2V7WA 4O02B 1P0IA 1V71A 2XUIA 1MKYA 4MV3A 4CNQA 1DFGA 3I1JA 4D26A 4C2TA 4FFMA 5K0CA 4AZ3A 1DQPA 2DFPA 3CF4A 4EWLA 3W8RA 5FQNA 1CS0B 3IILA 1SCKA 1XD2A 4L8FA 3MYRA 3T5AA 4Y8VA 2FGJA 3SHQA 4UU8A 3NVAA 3LL4A 1ISJA 2FDXA 4WJKB 5BSWA 4E5SA 2ES4A 5FWDA 4X44A 2XUQA 3GELA 1OZGA 3FOCA 4TVKA 4KRFA 2QN1A 2HF2A 2W6QA 2F8LA 2A6PA 4G8BA 4I6EA 4KODA 2V55B 4DWWA 1A7UA 3ORQA 3KYIB 5LQDA 4YECA 4PC2A 2GRUA 3QXCA 3AR7A 1XAHA 3WWCA 1CY1A 2DWCA 3KBBA 1E4EB 5C3MA 4J90A 3N70A 2XVMA 4MLDA 5ICMA 2AOWA 4DC9A 1D2MA 1E8DA 1TJ3A 1UP6A 4HVAA 5C8YA 4E33A 1YS6A 3FOAA 3ZNPA 2J3QA 1NP7A 4I8IA 2A8YA 3ILYA 4HLCA 1G18A 5K4AA 3A6EA 5BN5A 1O4WA 4TLLB 3KZKA 2GAJA 5AK5A 4BQRA 4NBLA 2O2HA 5F1YA 1QGDA 1VRWA 3KQVA 5GJBA 1MRZA 5DN6A 4KR7A 1HDGO 5CYOA 3VTAA 3DTNA 4YRZA 2QX6A 3L7MA 2Q4OA 5AW1A 4EMTA 2WU8A 2YL2A 1TIPA 2OFWA 3QE4A 1JQAA 5JY1A 1NBME 2RG1A 3B38A 1AK9A 1PKEA 1FYDA 1UC9A 4PAWA 1UXOA 2HU2A 2ZYAA 3EZNA 3KB8A 3O0DA 7MDHA 2AGVA 3Q3GE 1KAOA 2JJ1D 3OJLA 1UKVY 4ZHSA 1SKAA 3VNRA 1XU7A 1N1MA 3MJFA 2J5QA 3L1UA 3NXKA 2HFJA 3EBPA 3O8QB 4MS4B 3NTVA 5J9FA 4J4HA 4RYDA 3QX9A 1I0LA 3L4SO 1IFXA 3EA5A 4XX1A 4LGVA 1VG0B 3S29A 4UHHA 2HQBA 4I3HA 1G21E 2OZLA 3RIMA 4EG5A 3FJOA 3ORHA 1B42A 5DLPA 4LQCA 4QVGA 5FOTA 3ZQ6A 1S2DA 4RHCA 3VUFA 1TEVA 1BX1A 1U7HA 3EBOA 2IKSA 4R54A 4E14A 4ZU1X 1AMNA 3AY3A 1E9CA 2XA9A 3O47A 3QTTA 1RRFA 4UMDA 4A27A 2HA2A 1JIXA 4G89A 2O7QA 3UAVA 4F91B 2XNKA 3LTNC 1TTPB 1KR5A 3S5JA 2JIDA 2WD7B 1VE3A 3C5HA 5DTQA 1T6BY 3QXHA 4K05A 4NOLA 3ILXA 3SBXA 1CT9A 4JZYA 2YWFA 2I0FA 5A3RA 1Z83A 3GQBA 5TGTA 2ZDQA 3PNKA 4HGRA 4LV5B 4CKCB 3S7ZA 5A3VA 5ITZA 3FOFC 5BN3B 2QD4A 1H8ED 4ND4A 2Q5EA 2YVUA 3ASYA 1FU7A 3SIXA 1D09A 4LJSA 2NNWB 3N76A 4WV3A 4C7JA 5KSOA 4NCXA 3HXTA 1IQPA 3QW4B 2CXQA 2R2GA 5BOVA 1LLUA 1O5IA 3LZCA 3P0HA 4RNDB 1Z4MA 3PJFA 5FWYB 5F78A 3WK5A 3TM4A 4E11A 3EZFA 4S2EA 2Y27A 3PQCA 1N2XA 1ZCBA 1L4GA 1KAEA 1X42A 2X0IA 1WXWA 4HTAA 1N2SA 3DMRA 2RGWA 4MDHA 3AY6A 1IM5A 3FOWA 2KYRA 1W93A 4G0XA 2AFIA 2H8GA 1Y1LA 3A9RA 4G65A 1N6OA 4S12A 5F73A 1V1MA 5HM8A 3DOUA 1C3XA 3KSDO 4FOTA 2I7XA 3DHWC 5TMBA 1Z5ZA 1YE3A 2AR7A 3CLSD 5EMJA 3OE7A 1LSSA 3U7QA 3ZU2A 3TEFA 3JQ7A 3KVNA 4G07A 2B4YA 3C6YA 2JI4A 1N8NA 3HYSA 3NS7A 4WERA 1ABEA 2R6R1 3LVQE 2O50A 2DX7A 5CFQA 2QPOA 1XVAA 5EIEA 3U4GA 1IONA 1Y7LA 4H60A 3CWCA 4IXWA 4TL8A 3CZMA 3S2IA 2IYWA 2MYNA 1IBLB 1UP4A 1T4CB 1WBJB 3LLCA 3V8PA 1HRDA 4RCZA 5HQ3A 3KTOA 1HE4A 2G67A 4RVHA 5JNVA 4O59O 5LQAA 3WYGA 4OH1A 2MDTA 1UM9A 5AKZA 2CV0A 1CE8B 1DG1G 3G0IA 3B53X 3RVJA 1NVAA 3IT3A 2EFCB 3GPCA 2BEUA 4CIXA 3K70D 5A9SA 4OHOA 4LUCA 4LOJA 1CZOA 3IUJA 4TT3A 2JCGA 2IIVA 4P86A 1E3SA 3PSAA 3WK4A 1RPJA 5HCNA 1GP2A 2NO1A 5KU1A 5B1IA 1G5IA 1E2KA 1M34E 4KRXA 5BN1A 1WPQA 1B0AA 3I5XA 1HEIA 4WESA 3NVKI 1N7GA 3W6UA 1S2IA 2D1YA 3VZDA 1JQJC 2OM2A 4QO8A 4NJMA 1QH9A 3LKBA 5FH9A 3TKLA 3VRHA 2DVMA 2ZKLA 2BP7B 2F2TA 1T2UA 3SICE 3QKWA 2XNSA 4F92B 1ZY2A 2V7UA 2ZAYA 3IXMA 3UJ9A 4Z4QA 2P62A 1RWBA 3R0JA 3HHEA 3KUKA 3LX8A 3K70C 3RROA 2UVDA 5K6AC 1HY3A 3H1TA 4RO0A 4ENRA 3A2KA 4KNYA 5KKCA 1EGVB 3H1PA 1Q1GA 1FXUA 1ZWLA 3P4YA 4J9VA 1QGAA 4RVNA 1ZIPA 4NLLA 4WCDA 5AJTA 2YDYA 4IIBA 3AHHA 2BEVA 2VP6A 5A2GA 2YY6A 2VAPA 1NL3A 4HDRA 5JWOA 5K0BA 4NEHB 4C88A 3I9JA 3TGLA 1THGA 2A33A 4Q15A 3TOVA 3VFDA 4S0ZA 1G66A 5A0FA 5I8ZA 4F6LA 3LUPA 4UVDA 4J0FA 4OXYA 1KMMA 3TMYA 4IGFA 3KALA 3OUZA 3QVLA 1V9CA 4XIGS 1LB1B 1RHRA 1L5WA 4UTXA 1VB3A 4ES6A 1AHNA 1NLUA 3IP7A 3NWBA 1IBKB 2F1IA 3SC4A 4BVJA 4EFMA 1QFSA 2Q07A 3LO8A 1W96A 2M1ZA 5FBHA 1V1JA 3UAZA 1KK0A 2C2OA 1Y5LA 1PL7A 3NCTA 4HMPA 1CY4A 5F2OA 2G9NA 3V1TC 3PPXA 1RI1A 3FPGA 4XQ9A 1Y3CE 5B1HA 1GZDA 3T3OA 3DE2X 3CZQA 4LFBB 4KYIB 2VBIA 5G3ZA 3P97A 3E81A 2IPMA 1E0JA 5LP6A 1U9ZA 4L72A 4UDOA 4CMGA 5DEOA 5DBOA 3HVIA 2XRYA 4Q1FA 3NWPA 2W2LA 2V4MA 4EKYA 3NP7A 1XVTA 4P81A 4YQYA 5K3OA 1DDIA 1JG1A 3BE5A 3LYAA 4DV3B 3D5QA 3OJOA 4O4IF 1VLMA 3MN1A 1BO6A 4BLOA 1QCCA 4RY9A 1OFUX 2GLUA 2EJCA 3PEFA 1XT6A 4G5QA 3QU7A 1G3QA 3B2EA 5T6MA 4B48A 4D42A 4E2WA 3DWFA 5HKLA 3NAQA 3NBAA 3SSNA 4YO8A 3THSA 1SU6A 4HVLA 4JX8A 2C8VA 3SWWA 1U9CA 2BYTA 3MRTA 1LPPA 3DS8A 3RF7A 1MUUA 2J3EA 2QJTA 3BCSA 4KU4A 2EWWA 4BO7A 3DYBA 4MOWA 4XUDA 6CHYA 2BHNA 3BN3A 4ESHA 3U44A 3PFWO 3RS2A 3H1GA 4CF7A 3L05A 4G5YA 2BELA 2AQHA 2KE5A 4IVQA 3RJMA 5BMVB 2D62A 1RABA 1NU8A 3BREA 5K7SA 2IYRA 1UP7A 1EB8A 4QUEA 2JJ2A 4IOKA 5B57C 3VI4B 1LPBB 3P9RA 4IOJA 5K2OA 4A2PA 4C0XA 1R0YA 1M2FA 1KFBB 1P4GA 2V4ZA 4CUJA 4YRNA 2NQ8A 1J0AA 4LJYA 1P5ZB 1UMCA 4FD3A 1K97A 1KY2A 1UADA 5FOXA 1UUFA 4D57A 2GN2A 1XK7A 3GU3A 1H0HA 3LC2O 1K6JA 4JVNA 3BUSA 1YR7A 1EX9A 4RJTA 4HAYA 4Y18A 5I01A 4BNNA 3FZGA 2QNBA 3HCDA 4YCLA 4AMUA 2P2YA 1W35A 1GARA 2VSOA 4XGRA 3S40A 1GPNA 4N03A 4G85A 1ZVVA 2HLDD 5BVHB 5IPFA 2WE8A 2C9ZA 1CHNA 5KSYA 7REQA 3HEBA 1G4AE 2DBRA 2HRBA 1VSQA 2ZFUA 2NXCA 4PICA 1XTRA 2HK7A 2XOEA 4YV7A 4AIIA 2CV2A 1CQZA 4HAZA 5GP1A 2I03A 3SIPA 2H1CA 1QTNA 1XA4A 4JMLA 1P73A 3QFTA 1LDBA 4KK4A 2ZIXA 4JBLA 2ATEA 1GPBA 4ZHQB 4BO4A 5JTTA 4D3YA 1JBEA 1VCIA 1U7XA 1ACMA 4G25A 4X71A 3CV3A 3CZ5A 4PVCA 1OBFO 2A9JA 3HVRA 3FTFA 4QYSA 3NH9A 4OJKA 2ZIZA 3SYLA 3ROMA 4P08A 4LJ8A 5FJJA 3J7AC 2B5OA 4P82A 2WJYA 2XOKD 1M6EX 3EA4A 4R7TA 1CEYA 2BFWA 4LJ4A 1NNI1 2P8SA 3IO5A 4KN9S 3ZK8A 2C9YA 4IG4A 4KITB 3PIRA 4DB2A 3HXQA 4KB5A 3LXMA 3AGPA 5IEBA 5F4ZA 3BVPA 4PU0A 4WSOA 2I6GA 1GNSA 2NU7A 2PVCA 3R7WB 3D81A 4HY3A 2BGUA 3OX2A 3BH7A 3SMQA 2XCSB 2C4NA 1YMVA 3RKUA 1JR3D 1P1CA 1V5GA 1FJHA 4BAZA 4O4IB 2OXTA 5AW5A 2WVJA 1JJVA 4O4LF 4HD8A 3SZRA 1TZ2A 2ZIGA 3WLHA 4LVNA 1N2EA 4IHQA 4N3AA 3RUIA 1PS8A 1SC6A 2V3VA 1JXMA 2ZU0C 3GWGA 1BVUA 2WWTA 4BMPB 1P1FA 4RD0A 4EUSA 1Y9JA 3MWGA 1PX2A 1ULAA 4QGFA 1G6KA 1F14A 1XMQB 1IXKA 2I3DA 1H1DA 2HY7A 4JIGA 4JKOA 4YAKA 3N7TA 2VK2A 2WIFA 5BRNA 4QUKA 3EXHC 4MUAA 1JT2A 2UUOA 4FXOA 1U28C 1Z74A 3L1JA 2XTNA 2C4UA 3A1FA 3MOGA 4ZQBA 4C7OA 2VJBA 1GADO 3AVPA 4R5MA 4U2BA 2DH6A 4E5MA 1N5IA 1ZEMA 2FTKE 1Z4PX 1D2HA 1VBFA 2QQGA 4MIEA 5FYDA 3RR2A 2EVWX 4XCQA 3T8YA 4PGAA 3MNFA 2Q0XA 3I4CA 1KZ7B 3KU4A 4W5HA 5H7XA 4S1NA 3WLQA 3Q8LA 4FWTA 2G4LA 1S2OA 2YN4A 1GLNA 1T5OA 3DKVA 1X3SA 1GZVA 2ZATA 1MA3A 2QW8A 2CLSA 3W4KA 3GLKA 3B1FA 3WDLA 2GKSA 3E18A 1OXSC 3C87A 1MX9A 2Z8ZA 4RKFA 4DV2B 2V65A 1KMQA 4REQB 5DRTA 2FP4B 3SN6A 4JP2A 3WJ1A 4MVJI 4F71A 5T4FA 3OT4A 1CS4C 1ZHHA 5JCJD 2XJ9A 5L95A 4W1SA 1GGKA 2GD2A 1P2TA 3WY9A 3ZOZA 4DXAA 2WM3A 2F3TA 1TNDA 3QEMB 4Z4HA 1YOBA 1NOIA 1WXGA 2IOFK 4BAGA 3G7SA 3VU9A 1UPAA 3I05A 1RKUA 3VPAA 5EJEA 1XRMA 1EVJA 3PRYA 1A7JA 4J1TA 5BWCA 5FB3A 2X8WA 4RPIA 2GPSA 3HO1A 2F1KA 4C0QC 2VP9A 4FNAA 1HE5A 1SHTX 5JQGF 3ANTA 4B4UA 1J70A 2FPMA 1GL6A 1TMKA 1JSLA 5CITA 4DV0B 5E7MA 5DSTA 5BQXA 5DBGA 3T15A 4CKEA 1M2VB 3RHZA 1LFDB 4EJ2A 1QVRA 4D4GA 3T7KA 2WVHA 1J39A 5DIZA 3GJXC 4N1AA 4UTNA 4YVFA 1CR0A 2C7PA 3RC2A 5KX5B 3LY7A 3ZLJA 4GBMA 1HTBA 4RDCA 3T94A 2FSUA 1EVZA 3PT5A 3I2FA 2MTBA 1P44A 1S02A 3FN4A 1DFIA 3K9BA 4NZOA 2XKKA 1K7FB 3K1AB 3AK4A 3ENQA 4N3NA 3WNCA 2X9VA 1YBVA 2GVZC 3O26A 1YZ3A 4J1TC 4V0MA 3P4UA 2H5IA 5IJXA 4YRGA 4DNQA 2UUAB 5IKXA 5DNYB 5IDQA 4CKBA 1BJTA 1NYLA 1K0UA 1FFSA 3I32A 1XUOA 1CUIA 2D1RA 3G1TA 5LDDC 1CULC 1NMYA 3DH0A 2BGNA 3IDFA 3ZBTA 1BXZA 2ROQA 2CL6X 3NJ4A 1GQOA 1VXRA 1I4WA 2VDWB 5U1PA 1X7GA 5G1PA 4O4HF 4EGFA 4Q4HA 2Z5VA 1A9XA 1E5XA 4M7RA 2CB0A 1ZU4A 4I08A 2QTVB 2F3QA 2Q2WA 4JXJA 4RD6A 4R1UA 4UXJA 3R7DA 3UW3A 3UAWA 1Z4OA 5G0WA 3DE7X 2JZOA 4KQCA 1LI7A 4IZ6A 4TQ9A 4GLBA 5K3AA 2UXBB 1U6IA 5ALEA 3DR3A 3O74A 2E21A 2UVPA 2BM1A 1P2VA 2XYPA 1JDUA 3G7UA 3E7DA 1RMYA 2B5WA 2OKGA 1C0KA 1X9GA 5HA5A 3TQHA 3ITKA 1PZHA 2BFBB 1JPUA 4I19A 4XQ0A 2JW5A 4LMAA 3RC1A 1N32B 3FROA 4RDIA 5IBCA 3PPWA 1DUVG 1EUCA 3R5HA 2APJA 2QLFA 1SBNE 2R1VB 5DGTA 5F77A 5KDLA 3ZY6A 4ESEA 1KKLA 4ZZ3A 1JIVA 4MINA 3L9XA 3CS3A 2GJAA 4MUJA 2JHPA 3OT1B 3QF7A 5P8WA 1OLSA 3LTEA 1YB1A 1YK1A 4C1NA 1ZZGA 2CT8A 3LQQA 3N8GA 2WWXA 3C6BA 4L4SA 2QIPA 2P9EA 2R4UA 3G89A 1YZVA 3C14C 3GFSA 2IYEA 3D3WB 3EFBA 4JFRA 4JLVA 3JD0A 4O3MA 3FLAA 1LI5A 1ZI9A 1PT8A 2XVXA 3GXBA 1S4QA 4D0SA 4MYUA 4FD2A 3IL2A 1IN1A 3MWLA 3TRJA 5K1ZA 2HZBA 2C5AA 2QP4A 2O20A 1N2CA 1J09A 1Q1QA 2G8NA 3S1LA 1SQ6A 3BC1A 2Q6IA 2GK6A 3A1VA 3CINA 3MTAA 3HSKA 1WSBA 2F7SA 5DP1A 4NH0A 5GGYA 3HLYA 4D45A 3O31A 3ITEA 4WL0A 3ONEA 3SKVA 1W9HA 5BYBA 1YASA 2ATVA 2D8AA 1L7VC 2D5BA 1C7ZA 1I36A 2XQKA 1Z4IA 3BFPA 4DJTA 3SQLA 3Q87B 2IV3A 3WQSB 4W6QA 5EC8A 3TLZA 3AUSA 3I01A 3F78A 3HGMA 4DDUA 3HKBB 4QGBA 3ACBA 2MSCB 5M2QA 1VIMA 1E2FA 1GPMA 1QYCA 1YCHA 4GAEA 4MUFA 1OD6A 5IM5A 4D9HA 4ZQEA 3V32A 1K2VN 3E8XA 1T1JA 4D0LB 5LD2C 1O0SA 2OCDA 1IC6A 4MWSA 3ODGA 1QOZA 2GN1A 1Z0JA 2XUDA 4IO1A 4ALKA 4B09A 4B87A 4WK2B 3N6VA 4OJYA 4QPPA 1K5DA 4N0PA 4XARA 3RRFA 4DCMA 3SHWA 1KAGA 2J31A 3ZHYA 1FW6A 4ND6A 2PL3A 2ZYHA 3D6MA 2E82A 1LGYA 2JDID 4PCVA 3AI2A 4LOHA 4R6XA 3VR2A 1BWSA 5J4KA 1FP4B 3KSZO 3DTVB 3DE4X 3REOA 4DRZA 4Z3OA 2POQX 4TS3A 2DHCA 4O29A 1YJAA 3B20A 3SDZA 4CLRA 3DUFA 2PMEA 1BJKA 3TPFA 1TO1E 3LP6A 4LNUA 3BD9A 5FKJA 4QHTA 1QNLA 4ERXA 1P4JA 4P7JA 2YMQA 4DBLE 4IGEA 3B6EA 2HR1A 1F1JA 4BKPA 2PSEA 1JX6A 2GAIA 3IUSA 4Y3UA 5A4KA 3NHRA 4LX0A 3A7DA 4AKIA 5LZ8A 4KYUA 2H7XA 5DP2A 5EWLA 5IP5A 2P3SA 5B2EA 1JHQA 1J0EA 3O4IA 4LIPD 3U13A 1C9JA 4G0PA 5J4HA 1UK6A 4FE4A 3QE2A 4KFRA 2HNAA 5A5FA 1IZ7A 3AYXB 1ZISA 4NVRA 3FNBA 1Z6PA 2NTNA 1SCQA 1Y4DE 4QQFA 1US8B 3RW9A 1YB5A 4G4GA 3STHA 3Q2OA 4ARVA 4GPTA 1XTVA 4Z4CA 1KYXA 5K0SA 4QG7A 3WRXC 2GR9A 1LSUA 2KJQA 2XRFA 3HDQA 3BHNA 4G1UC 2RGGA 3ER6A 4IMRA 4X45A 2H4HA 2QGFA 3V4RA 3RE1A 4MV6A 3W8NA 1VG1A 3GLGA 1E7SA 3IHTA 4MK4A 2F64A 1FTQA 4HYQA 3I6YA 1X86B 4MKGA 5ULLA 1H5QA 3MB5A 3SQMA 4OG2A 3GBVA 4LYYA 1CRPA 1IMJA 2JFWA 2GJ4A 4MYDA 1P3JA 3L79A 4UBOA 5D7NA 4C4SA 2F9FA 4NULA 3NRJA 4ZYTA 3O90A 1JHZA 3SJ7A 3A3KA 1C9EA 2GEDA 3AL2A 3GG9A 4WA7A 3WLSA 3LUKA 1CV2A 1CZKA 4PLYA 3R5XA 3EXHB 3HO8A 1T8RA 3CLTD 3IP1A 2X8LA 3B1KA 1BMDA 2VWQA 2WD9A 4I8DA 4OH7A 4AMYA 2H51A 2DT5A 1QH1A 1XWFA 3EFOA 3KKKA 4RZXA 1C41A 4UCFA 5DT9A 3T5CA 1NF9A 1VJ5A 5IZCC 4GYYA 3EGXB 1SK8A 3JXEA 3FBTA 1RD4A 2AEEA 2EOAA 2R97A 4YWJA 3A6PC 2FETA 3IMFA 1K6XA 3MSXA 3JWPA 2VNSA 1VDMA 4G01B 2VFAA 3S55A 2V6GA 1CVLA 1V5IA 3VR4H 3FTPA 1ZVKA 2SCUB 3U7FB 2WU1A 3LGXA 3ONDA 4CM5A 2JGLA 4QRDA 4EVIA 4QG3A 4YEDA 3GT0A 1WWKA 1HE2A 1I80A 1WOYA 4E6PA 1Q92A 3H8SA 1YJBA 4CL8A 3C0KA 3ERCA 4Q47A 3QPVA 2CUKA 3U5TA 3CY6A 2XPCA 3JWEA 4HLQB 4E0BA 3SQXA 1R16A 3PFIA 4OBEA 4JC0A 4M1WA 5J43A 1OASA 1EE1A 3OOEA 1KOLA 1S8OA 3ONVA 2C2YA 4WXPA 5F4BA 3Q7EA 3KJGA 4QJIA 2HJSA 2DCMA 3EMKA 4TS9A 1DCTA 1WPXA 2CCGA 3Q0TA 1DRKA 4N18A 2A4KA 3NRCA 4WI1A 2A5FA 3AUUA 3GT7A 2OCXA 3GFPA 3ZNOA 3W5HA 4W8OA 3ZXUB 5AKHA 4B7CA 3SAJA 1Q19A 2W6ID 4X54A 2I1WA 4BQSA 1A1SA 2EKBA 3G9UA 2C78A 2OC9A 4ND8B 4C0WA 4CQMD 3W6PA 4TYNA 1GG5A 2XMSA 4GX0A 2ZYRA 5FTNA 3R77A 1ZXLA 1PJ3A 4MDEA 1HMPA 3R0VA 4M60A 3AF6A 4UQLA 4ABYA 2BTOA 3EK2A 2EW8A 2K2WA 1G21A 3P5BA 5C0OE 5LUBA 3WL4A 4DADA 3OJFA 4FFPA 4WZAA 1A4RA 1C3JA 4EL0A 3R5KA 2FMHA 4HTFA 3AHGA 3MJSA 4IJWA 5JECA 2HHLA 1PR0A 1ZMRA 4JUFA 1W4RA 3MCZA 3K09A 3UGKA 3QNMA 5LZ9A 1KIMA 4B32A 2YFQA 4NZ9A 4DUPA 4L4RA 3U5ZB 1SQFA 3R9XA 5TT1A 1GA6A 1G5QA 1Y8RB 4D8TA 2IE0A 4YPOA 5BUSA 2DKFA 2RHRA 1D2RA 3QKIA 3WV5A 5A6SA 3COSA 1D4AA 2GT1A 1YHZA 3M1YA 4ZJPA 1C0IA 2CHFA 2XUAA 3N2KB 1NPDA 2OB2A 2P68A 3HA3A 3ORFA 3QVXA 4INAA 5BW6B 4F9GA 5C1OA 3JAKB 4IDPA 3EW9A 3W79A 5HDBB 1ZPDA 3UK1A 3WYFA 3JYNA 3QENA 2C77A 4RETA 3RJZA 4EF6A 3VV2A 1IOVA 2ZYSA 2MYTA 1K63A 1K8QA 2X7HA 3M49A 4H4EA 1YL7A 1JFFB 3ENNA 4OQMA 2D0PB 1RC8A 4JEIA 1H2RS 3FWKA 3H16A 4F2WA 1JH8A 4ZVVA 4BP3A 3OZFA 4P84A 4CV1A 3UT5A 5KSZA 4MKRA 4R71A 2C4KA 3TDMA 3C1OA 5JDIC 5HNKA 3COYA 4XVHA 4Z0NA 3T9DA 3V46A 3HPQA 3CNBA 2I7VA 2A4MA 1P1KA 2VYVD 3Q40A 3QP9A 1WL8A 3AUTA 1A71A 4YASA 4QL3A 5EIOA 3NYRA 1PFWA 1SHLA 2ZJ1A 2C20A 3CCBA 3VBCA 4FYPA 1W9MA 3T54A 1SVKA 4NG4A 1PTJA 4URYR 1GN9A 4N39A 2J3LA 2W37A 2JHFA 1WD5A 2CFTA 3G85A 3F7TA 1L5QA 2DZDA 4PZEA 4LF9B 2WKPA 3I6MA 3IXQA 3IUBA 1H6CA 3QBEA 4X1KB 4JCOA 5LA6F 4EW1A 2WZCA 2I2BA 2QEQA 1Q7TA 3BGOS 2CB9A 4XYMA 1FNSA 1CLUA 1Q5PA 3IBCA 4I5FA 2ZRAA 2PLWA 5DN9A 1L9XA 3M83A 3V2HA 2FMIA 1I7SB 1FUEA 1WEHA 3TRFA 4XIIA 3KZNA 3N6RA 4BLUA 2O2JA 1A9OA 2XQGA 4D3ZA 2CVZA 2HQRA 3AW9A 4QSHA 1OA0A 3VKHA 2BSXA 3NEJA 1N0UA 1B43A 4PG5A 1ZN7A 1OW3B 2PSJA 1ZCZA 2WU0A 4PLPA 3RVRA 4KPUA 3UC9A 2PPLA 2HU5A 3BWYA 5FWXA 2A3RA 2GCIA 2Y0CA 3WADA 2XNDD 5JAOA 3GGOA 3IMGA 5KTNA 1UIMA 1I6MA 3AI7A 3RABA 1JECA 2R8YA 3PC8C 1OFTA 4Y7CA 2JKVA 3SBEA 3JQ8A 3DSRA 2RAFA 1SG9A 1SEVA 2HPZA 3E0QA 3KVVA 3MMPA 3OLVA 1ICIA 1KEVA 4IXNA 4OY3A 4KMSA 1Z18A 4AVYA 5I4KA 4E94A 2EYUA 5G0SA 2BI4A 4NPHA 1VKJA 1NY6A 3DO5A 2BV3A 4W63A 4AKTA 3CVYA 3SYMA 2L18A 4MV9A 2HWYA 3IAFA 5EHXA 1N77A 1OTHA 2NSYA 2VRBA 3EIFA 1ZGAA 3QXJA 5HK9A 3VC1A 1CJCA 4KE8A 4IDGA 3F2VA 4U02A 3IAM6 2J30A 1V8OA 1XZIA 4WT7A 4W1QA 4EJFA 3NAZA 5FJIA 1CNMA 1GXSA 3LCCA 5EWMB 5LXTB 3LC7O 3JARA 4KVFA 1FC0A 4MIOA 1TT5A 1L4NA 5GMOA 2EZUA 4KR6A 5CT9A 3VO9A 3OH8A 3CRNA 3EG9A 3QF4A 2GLTA 4UE6A 5SYMA 1JQEA 3I5AA 4UREA 3VVCA 4A8JC 2OV4A 4DNFA 2VT3A 1E0AA 4LVOA 1Z2OX 2FA9A 2Y71A 4GX1A 4QBFA 2C83A 2QX7A 5D84A 4JVSB 5H4HA 2YVLA 4IZOA 2BSQA 5U4QA 1JU4A 3IURA 1ZI8A 1TAHA 2UYGA 3KYJB 3WL6A 2QM8A 1N1GA 2ZI4A 4KFUA 1L4HA 3DGEC 1W2WB 3UT6A 2E85A 2PM8A 4MRAA 5EZ5A 5AYVA 1WU8A 3L4EA 2ZYWX 2Q27A 4N9WA 1K9SA 1X39A 4V1CI 1WP9A 2CLIB 2LDXA 2WAOA 2CLDX 4LNHA 1ZOOA 3HB7A 1NURA 3FUWA 3PVZA 3DAFA 4OM7A 4ZFNA 2WWWA 1UOQA 4IKOA 4PR0A 4PNHA 2IITA 4O2BF 2VDJA 4E70A 2GF2A 4F9EA 3AV3A 4GC9A 1KEPA 4CCYA 3C5EA 1Y0BA 2V6IA 1EFLA 1BFUA 4GW3A 4WJZA 4CT4B 4G0UA 3AR2A 2R8BA 1F5SA 1YZFA 4JD5A 3SLRA 3TLXA 1X1RA 4L02A 2OCIA 4QU9A 4Q9IA 4RPCA 2VP2A 3G0OA 3WGKA 3ADCA 1RP1A 4PLHA 5ALIA 1SVUA 4OFXA 6ABPA 5F9FA 3PYMA 3D6NB 3TIXB 5LQJA 5K3FA 3NONA 1H4VB 1BW9A 5AM1A 4WBNF 3CUTA 3MOSA 4ZV7A 4L85A 5E6UA 3TB6A 3U7RA 1AK1A 4V03A 2Q9CA 4JYAB 4PPNA 3GJ7A 1J06A 3A4YA 2F3PA 4J0IA 2AD1A 3UUFA 5IH3A 2BR4A 2OYCA 5L3SA 2OD9A 1PL6A 3H9QA 3FOBA 1U8EA 2QIOA 3EXG1 2NVWA 4LHZA 4PCAA 1W75A 3T9FA 4IR7A 2DYKA 4G2NA 5DMHA 1YVUA 3HL4A 4DANA 3EFEA 4M6WA 1OREA 2H1IA 3TW8A 1KZYC 3ZHXA 4JHLA 3VU0A 3OLCX 2VBFA 2XQVA 1FEZA 3F4LA 3H5LA 4MGIR 1BGVA 4M7PA 1TTQB 3KZMA 3QVJA 1XNQB 3ESAA 3W2EA 4YAUA 3DFKA 3GAFA 3O83A 4I4IA 3A9WA 4F72A 4D92A 3GFQA 3GLIE 3TECE 5H83A 2ZPUA 3U31A 3ORSA 1II9A 3HR7A 4D3FA 4YUZA 4B80A 2GK4A 2WTXA 4OGKA 3V1YA 2D2EA 4FSHA 4UM5A 5A71A 4A6XA 3JAWB 3CRVA 1Y33E 3MRSA 4JXXA 3L7CA 1T25A 4Q9DA 2O48X 5DHTA 2QYTA 3OWXA 1PWZA 3AEXA 3TG8A 3KU1A 1U8TA 4XLLA 3KLNA 2BGLA 3MYYA 1W4AA 3IEVA 2P4QA 3AR8A 2P2CA 2II6A 2G5TA 2DM6A 2NZ8A 1DI0A 2NUAA 1T2EA 3C3WA 3I2JA 2Q6KA 4X97A 4PG7A 5TY0A 2DPMA 2HMVA 1FFAA 2DERA 2O0KA 4DE5A 3ZH9B 1BXRA 3U19A 5AM5A 5M29A 2OL4A 4Q19A 3LSYA 1BKYA 5ALNA 1QU3A 2Q46A 5AHOA 3QMVA 1JKIA 4U0JA 3FKJA 3RV4A 3JWGA 3WLFA 2YC4C 3D7RA 3G9TA 3W9SA 1QUFA 4LQ4A 2J3HA 1N9GA 3MF4A 3R7AA 1R9GA 5BWNA 4KR9A 3WLKX 2VK8A 2UV8A 3TGPA 3AR6A 5ESWA 2CMHA 4P4GA 1K92A 3EC1A 2F3SA 5I9SA 4CUZA 1ANKA 2J9GA 1YFLA 2IRWA 2OBNA 2HBYA 4BJ6A 2OO5C 4YAIA 4MUKA 5AVQA 2J3DA 4OXNA 2N1MA 4PX3A 3BM5A 4C29A 3CG4A 1QQ7A 1Z8FA 8AT1A 1EMDA 1WNTA 3OHPA 3QPUA 1KS9A 1CJTC 5ARBA 2ONZA 2PEZA 4QNMA 4LGYA 4LF6B 3M5WA 4DMRA 4FT2A 3VNVA 2XXAA 4G5RA 5LLSA 4AF8A 1KZ1A 1PQYA 1AB6A 2VYFA 5DISB 1UF9A 3BIWA 1W5SA 3IOCA 5ICGA 4EKDA 3G1UA 4YFYA 3EUAA 5A9RA 3TZHA 1VLLA 5KBYA 4GE3A 2G08A 3AIIA 1BCSB 2R7AA 2EW1A 3ZVMA 4HMQA 3IQHX 3NTRA 4JYPA 4U9IS 1NVKA 1W0KD 3JD3A 4UNPA 3CX6A 1SXJA 2E18A 2PO7A 2BFDA 5K3DA 1E2MA 2IWRA 4F06A 1UFQA 4IHJF 3T1OA 5A6VA 3O38A 1G64A 3TKYA 3OA0A 2X40A 1R74A 3PTZA 3ROGA 1AJEA 5BQPA 1I6KA 1TGYA 5DWQA 1NXXA 3KV3O 4EJMA 4JOBA 1YZNA 4YQFA 3CKLA 4MUBA 2BLNA 4RSMA 5EEHA 3ZCUA 1FMFA 1EINA 2QN2A 3ZQUA 3UMGA 1NP6A 1H1LB 1MQ9A 2DSNA 3L8DA 3R0ZA 4I50F 4QXPA 1OXTA 1YB4A 1RXEA 5AW7A 3AOEC 1K88A 1LV8A 4UPDA 2X5KO 2CLMB 4CEHB 2HAEA 1MJNA 1A5BB 2J7PD 4P0QB 2XUZA 4RYLA 4R9SA 2TMDA 5JXJA 2VP5A 1IHUA 1G20E 4L8YA 4EA6A 4BGDA 1CZNA 4R2XA 4ZO7A 3FLBA 4W7SA 1YCGA 1WW8A 4X62B 2ZR9A 4PHHA 3T95A 1FYVA 2IEIA 1Z3IX 4TM8A 1V95A 4XX0A 4QYTA 1L5HB 2RGEA 5C52B 2Q62A 3ESZA 5C4GB 4LSMA 2V5VA 3NDBB 4WFIA 1RR6A 1RQ2A 4FI3C 5DNWA 3ZJ4A 3C1TA 1Y34E 1SN7A 4FR5A 3VZCA 1U0RA 4I1VA 2QL7A 5IM4A 1J00A 3AF2A 2NM0A 1THZA 3M6MD 3P0FA 3OOWA 1WG8A 4MAAA 2DETA 2ZU6A 4FMCB 2AE2A 4K3UA 4HUQA 4QPJC 1WZCA 3L0DA 2ONYA 1QH8B 5AO9A 4KWHA 2VPQA 3WLAA 1R8QA 1W5EA 2A92A 1U2QA 2BCGY 3M4JA 3QLVA 4U00A 5HF8A 3QPBA 1K4YA 4JT9A 4AK9A 2CFCA 3OLZA 4HQNA 5D51S 5JDCC 1S7CA 3NB0A 4PLWA 3WKCA 4EH1A 2IIPA 2JJMA 4FX5A 3KS9A 3FCSB 5K4GA 2YW9A 3ID6C 1QMPA 4FLEA 2FK8A 4K7JA 2C2HA 1NX6A 3PGVA 4QOEA 1U0OC 3EGEA 4RL6A 4IFTA 4N49A 1EZ4A 5D8DA 5C2JB 5KVCA 4F45A 1OV4A 1SRRA 1XDGA 4FNGA 1QHXA 5EMHA 2D00A 1QKJA 2WG0A 3BXHA 4KR0A 3B7GA 5LC1A 4OD0A 2B0CA 3FI9A 2G06A 4JUDX 4ZEXA 4Y9UA 1ZCJA 1IN8A 2IW3A 1BS9A 2X77A 3NNDA 4OLHA 4ZO9A 3FVVA 3S27A 1GTVA 3GR6A 3G2NA 3FH0A 3SXUA 1SZJG 1UJ5A 5PGMA 1FFHA 3B85A 3IQFA 3OM9A 5GONF 1YVEI 1VKHA 4HB0A 3WYNA 2Q5IA 1PR6A 1PFVA 4LV6A 5G0UA 4E1BA 5I7VA 3GLTA 2QN7A 4YAFA 1J23A 4HCJA 4UD2A 2CVQA 1VMDA 1Y1SA 1B8PA 2X76A 3I01M 5AHWA 1SBYA 1M2GA 4TV8F 1E1LA 2DKOA 3W05A 4Z4EA 3A10A 3B3JA 5HF9A 3TUZC 2PQ0A 1N5KA 1V2HE 3KKQA 4DLAA 1I7PA 4O5OA 1VG8A 6NULA 5KNDD 1JZQA 3KPJA 4NBNA 3ICWA 2B69A 2HQSA 2IX3A 5EKTA 4H7HA 1JAIA 3RI3A 2IOYA 1RI3A 4K9NA 5CH8A 2A58A 4CTMA 3BD8A 5CFZA 1E5VA 4O8CA 3SR3A 3EZXA 3LQYA 2Q3JA 1OAOA 2JLXA 2RAVA 5LKAA 1WMDA 3H2YA 2FQ1A 1QIFA 2BCJQ 3DZKA 3ESRA 4JH0A 1DXHA 4A0FA 4A0RA 5H9WA 3IBTA 5HKKA 5JJKA 3BZUA 3CRZA 4QDZA 2R0QC 3HK2A 5CK4A 1LBSA 3TIIA 4F9FA 4YV0A 3CVWA 1DJMA 2PKCA 2ZSUA 3IPXA 1O87A 1M34A 5BMOA 3GLGE 1XD2B 4ZAZA 1VZ2A 2HCJB 5EMMA 4QDOA 4QYXA 1SQSA 4S0XA 5FFNA 2R60A 3ZE8A 2LWIA 3VZRA 3JQPA 4OHMA 4WVFA 3ZPXA 1Q6YA 2LBPA 2ZSKA 2XXBA 1WVIA 1U2EA 2QJRA 5HZKA 1E0SA 2ACWA 1U1CA 1MH9A 4M76B 1DO8A 1T2NA 1RRCA 1W1IA 2Z6UA 1BYUA 4L6IA 3AVOA 4BEJA 4CXMA 3A05A 2HDOA 5C81A 4Y2YA 3BTOA 1ODSA 4P33A 1ZU5A 1E4EA 5I48A 4V24A 3U6KA 3SFTA 2P1ZA 3BCUA 4NFLA 4XDZA 1PYGA 2D0IA 3HS3A 2G9RA 1ZM3A 3SEQA 1EVYA 1H93A 4UAUA 3CKMA 3NHBA 1LK0A 4Z7QB 5JS2A 5BRJA 3KE9A 5BN5B 3NATA 4DUGD 1CLEA 2JHGA 4X5OA 3Q2KA 2XH8A 1KKUA 1G3IA 1CUJA 3B6IA 4L8LA 3SC3A 1X3LA 3HBJA 1K6IA 1E7QA 4L5AA 3RJ5A 1DKUA 4FFNA 3QV2A 5ICEA 1IVSA 1KRXA 4P3OA 2JIZA 2PYDA 3KKEA 3OCJA 2RC5A 3G9QA 2V96A 4M1QA 4DWVA 3RBAA 1NZJA 4YRRA 2IGBA 4D98A 3S3TA 2XKAA 4OI2A 3CPJB 1Y7IA 3ORYA 3LA8A 4CMAA 4UEWA 1A8HA 3FPCA 1GD1O 3WYBA 4TT3D 1FUYB 3F8SA 3Q3CA 2C03A 5A4MS 3FRIA 2FU5C 4M0DA 4M8LA 3MWDA 1SKYE 3OM8A 4MS4A 5EUQB 2KI5A 1Z0DA 2O5RA 1NLFA 3KOWA 4MPJA 2XUKA 3DJYA 3LWBA 4HDMA 4ZV4A 1YR6A 4JASB 2OZLB 4CI0B 5HKBA 1AN0A 2GKOA 1XCLA 4JUCA 3T9CA 2VDLB 1GKLA 1QB7A 3OA2A 4MRNA 3WLLA 4E09A 5CT5A 1ZC3A 2DMRA 3G0GA 4X8OA 1KP3A 4I4LA 3DHVA 2JAOA 1KJWA 5LBTA 3RS3A 4DYHA 1L1EA 3H8WA 1W36C 2P6UA 1CSEE 2GO7A 2BGIA 1SKQA 5DCYA 1ZM9A 4NARA 4RADA 1QYVA 3WGOA 4NV3A 3JW8A 4HDOB 5ELXA 1KHHA 4KP7A 5CNMA 3UF0A 1NBIA 1T0IA 4ENPA 2G0TA 5ITZB 3FX2A 3BXZA 3K6RA 2ZR0A 4LRTB 3K0KA 4QICA 3AGQA 4C04A 5BN3A 3EUEA 3FSGD 3EMBA 4PAOA 4WCFA 4Z6KA 2VYQA 3GP3A 4JEHA 4PG4A 5ALUA 3KD2A 3OF2A 4C0SA 2OENG 3DFUA 1SKYB 1C9MA 3O82A 5CR9A 3IKLA 1XTTA 2ZI3A 4C89A 3V33A 4ACAA 3IKJA 1J56A 3CH4B 4OU4A 5CCDA 3ZDDA 3DUWA 1XMIA 2H4ZA 1V43A 5EIAA 5DHAA 1IEXA 2AI1A 3ZE7A 1RWPA 2Q50A 5BVGB 1Y5NA 4MUXA 3QOWA 3STVA 4TSRA 4YP5A 1XDUA 1W36D 5IMSA 4FE3A 2XKBA 4LRWA 4NCJA 4C0BA 3KD3A 1GUFA 5CEFA 1R6DA 4MKIA 4MH0R 3ELBA 5LWHA 2ZGVA 3U37A 3PDUA 3R6TA 1I2AA 3N8IA 4D4IA 1IHOA 1E4YA 3TLCA 1Z36A 3BWBA 3Q41A 4JI3B 1ZOIA 1QHYA 1XJCA 3JQ7B 2Z3WA 4GKVA 2NP6A 3GJ5A 1YJCA 1OAKA 3H19A 2HPHA 2VDNB 3HJHA 4J2TA 3U3OA 4PZAA 2VIIA 2OQ2A 1MFPA 2IS4A 2XMDA 2FQYA 4OUDA 1WLSA 2R1TB 3ML1A 5GOZA 3FPKA 1SY7A 2HIGA 1DUSA 4GOND 4A8JA 3QBVA 1WCV1 5CJ2A 4CFYA 1UDWA 1VJTA 4ASUA 1P6QA 5T3YA 3H75A 3VDXA 1J99A 3DBLB 3RVQA 5BSGA 3C7CB 4BIIA 5ALOA 1UM9B 2O2SA 3GLIB 3ADOA 3EGIA 4HX2A 5TMDA 2B1RA 2VXBA 1NKSA 1ZJ5A 4DT1A 1M8KA 2BEUB 3SMVA 1HI9A 1NG9A 2H1FA 3LI2A 3LXRA 2VQ6A 2VJKA 3WO1A 3D5TA 1U7TA 5A62A 1UKAA 3UMJA 1XJ0A 2ZDHA 3AOEA 1BVYF 3L46A 1X1QA 4HEA6 4ZA2A 4DKJA 5DTMA 1TCAA 1XEXA 2ATIA 1JAYA 3Q1LA 5TT0A 1B14A 4OL0A 4KGVA 1RU3A 2ZVDA 1E2EA 2BJWA 3LVRE 4L78A 5EGNA 4EPXA 3DMHA 1FFEA 1TB4A 2QNIA 3VYUB 5LJLA 1IH8A 4Y6QA 2F48A 4ZMBA 3W9YA 3R7BA 2DQ4A 4XWAA 3Q3EA 4TTJA 2BP7A 4CUKA 1BA2A 1MRNA 2E2WA 4C14A 2BGTA 3OQPA 5BQ3A 1V8BA 1QH0A 3K6SB 4ZYWA 8OHMA 3W7VA 1DVRA 3FTDA 3N59A 2JFNA 2HU8A 2V98A 1QRSA 4LMRA 4EA7A 2JLRA 4ALLA 4DLBA 1ZJJA 1D1TA 4JOCA 4E2FA 2JHCA 1V4VA 1SC1A 1T6NA 1YMQA 3HKDA 4NL4H 1E1NA 2JGIA 1QAQA 3ZS9A 2RGAA 4H4DA 4BFTA 1X94A 3CX4A 3HJUA 1P33A 2PL9A 1SIOA 1DC5A 4CRWB 5H02A 3BTVA 3DAYA 3GUVA 3AKCA 1YZUA 3VPXA 2VJOA 1GITA 4LVUA 3DBIA 4E07A 1MABB 2NPFA 2Q6VA 2WHPB 1YA4A 3IESA 1XQYA 2IF0A 1V7QA 3VH1A 3X0DA 4B3BA 3RYHB 2ONKA 3WLEA 5L7TA 3PUKA 4AJHA 4FK8A 3O5AA 5LDGA 2V0GA 3N8HA 1MT0A 2G63A 3KT6A 3IAM1 1G42A 4NNPA 4UEJA 2HO4A 1MEOA 1G8FA 4DLYA 3I04A 4JUAA 1VKZA 4QTTB 4FYXA 5FTMA 2BONA 2Q7DA 1QRRA 4WFQA 2JRCA 4PTYA 3HM2A 2DUNA 3ZUPA 2J0UA 1LLFA 1XL1A 1UH5A 1IN5A 3OD1A 2Z5LA 4C9BA 1ESNA 3K4HA 3O6VA 4ZYYA 3TCNA 2YJGA 1MAHA 3V2IA 1HG1A 2M1XA 2C5GA 2PWYA 3GGGA 4G4JA 5DNDA 1G20B 1W4ZA 2ZSDA 4YCBA 5FXMA 4B47A 4B79A 1LRKA 2JLAA 5KNLA 1ILEA 5IUKC 4L4ZA 2WZDA 1K89A 3NWJA 3TDKA 1G1MA 2OB1A 3D6FA 4PNEA 4QVIA 1TL7C 2VUSA 2QTRA 2WJZB 3QVSA 4KXQA 2J3IA