3FGZA

Crystal structure of chey triple mutant f14e, n59m, e89r complexed with bef3- and mn2+
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDESTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWMMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
molecule tags Signaling protein
source organism Escherichia coli
publication title Matching Biochemical Reaction Kinetics to the Timescales of Life: Structural Determinants That Influence the Autodephosphorylation Rate of Response Regulator Proteins.
pubmed doi rcsb
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fgzA00
3N75A 4W5NA 3DGEC 3H5IA 3A3KA 5IBQA 1K68A 2E4XA 4H3HB 1ZN2A 3C3KA 4QICA 5DGCA 3C97A 3TB6A 1PEYA 2P9HA 2M1ZA 3R0JA 1JF8A 3C3MA 3NNNA 3I5AA 4OG2A 4N41A 3OO0A 3KLNA 3VNBA 4G0QA 4EYGA 4RZSA 4UHJA 4JA2A 4YR7A 4HNQA 1C4WA 3SY8A 3RVOA 2HQRA 3TD9A 5E3JA 4F8JA 3OLXA 1NXVA 1KGSA 4RDCA 1EHCA 1JYFA 4EUKA 1PUXA 4G0XA 1FSPA 1NTRA 2CWDA 3Q9SA 3QEKA 1Z16A 2ID7A 5BQ3A 3LKVA 4G0YA 4LRQA 1XHFA 5B3JA 1WETA 5ABPA 2PE5A 3JS5A 1GCGA 1Z15A 4W5TA 3HO1A 4NCBA 5DKFA 5DCLA 5TQ2A 1DCKA 5IUNC 1SXHA 3LOPA 3KLOA 1L5ZA 3JPWA 5TQ2B 3BILA 4YWHA 1ABFA 2Q5CA 5JNWA 3MIZA 4MPTA 3T6KA 3MYYA 6ABPA 5CNMA 4DADA 2MSLA 2WWVD 1DC7A 5JNVA 1TMYA 4E7OA 1D5WA 3P9YA 3K4HA 3JTEA 2CHEA 4B09A 5C5EA 1VRVA 4M88A 3H1GA 3H5WA 3LMKA 2DRIA 3H6HA 1BAPA 1EWKA 1RPJA 5JNRA 3ILHA 1DCMA 3QLTA 2JVKA 2NUBA 1M2FA 4KNYA 3GBPA 5C5CA 1JX6A 1QP7A 1GUDA 2A9RA 3L49A 4PYRA 2FVYA 8ABPA 4LE0A 2R4QA 3FFWA 1JHZA 1M5TA 2LIVA 4ZYLA 2FQXA 2H0AA 3BRQA 3E3MA 4HNRA 4WWHA 1YK1A 4RV5A 3BBLA 4HYEA 4Z9AA 3GL9A 4N47A 5KC8A 2VK2A 1QO0A 4G97A 2FEKA 3S99A 4XASA 4RK7A 4RXTA 4O5AA 5KQMA 2B4AA 4MR7B 5EWJA 3JY6A 4MQFA 2QU7A 4KVFA 4WXMA 3DZDA 2FMHA 1QKKA 4RKRA 1PNTA 1VLZA 4JOQA 2I6FA 1JDNA 3M6MD 1U0SY 4KMRA 2LBPA 3HSYA 2WY2D 1ABEA 1EFAA 1Z25A 1C0EA 4RXUA 3O2SB 3N8IA 1DCFA 1TLFA 5ED4A 2A9OA 2IOYA 3M9WA 4LDAA 4IILA 3H5TA 3A0UA 4DQDA 3SQNA 2JRLA 1D1PA 1ZDMA 4D6XA 2PAFA 3QLUC 4KK4A 5TPWA 5F64A 4RK5A 3SG0A 1ZVVA 2V0NA 2MYTA 4EYQA 3SNKA 4JAVC 4EVRA 5IEJA 3LKBA 1BDHA 1SXGA 4Z9BA 1NXOA 5B3JC 5JNSA 3W9SA 5FWYA 4E7PA 2AYZA 2HJ9A 2JK1A 5FWYB 1LK0A 4OATA 1A2OA 3ROTA 1QNLA 3Q15C 1SRRA 3OLZA 4L85A 2HPHA 5EWLA 2FMKA 3N0WA 1JFTA 4TLLB 3LTEA 2QVCA 5TQJA 3CRNA 4MLDA 4XAQA 4KREA 1VPWA 3JVIA 2KYRA 1YS6A 2HSGA 3OLVA 3DGFC 3I09A 2HQOA 3LUCA 4G0OA 4YRZA 1RZRD 5JNUA 3CKMA 5IULC 1QP0A 5FBHA 3O2JA 2PKXA 3QLUA 4QPJC 5KWSA 1UDRA 3TX6A 4Y9TA 2A9QA 1JH9A 5KC9A 4MQFB 3CS3A 3EJWA 2QV0A 3H6GA 1ZH4A 4MQEB 2PUAA 1D1QA 3UUGA 1RXIA 4H60A 3OLWA 1ZGZA 1U2PA 3OMWA 3HUUA 4MR9A 4F11A 3GRCA 4YGXB 1QQAA 2E4UA 3I45A 1P6UA 4GNRA 4TLMB 5TPZD 1P8AA 3Q41A 4EVSA 1E6MA 2GBPA 1LBIA 3JPYA 2RDMA 3MM4A 5IUKC 5KI6A 1Z26A 2LP4Y 1YMUA 5KQLA 2VYCA 3CU5A 1LJLA 1BA2A 3MF4A 3QK7A 4P98A 3KYJB 3LUGA 1QQBA 1D2AA 1P6QA 4JB2A 4W5QA 2LPMA 4Q6BA 3RVSA 3KS9A 4OBBA 4QYMA 3D8UA 3URMA 4Q6WA 1RZRA 1YS7A 4ZPJA 4Z4IA 4ETIA 1ZGGA 2WMYA 3JVDA 2JVJA 4IF4A 2A9PA 4RKQA 5T7BA 4Q7EA 1DJMA 1NXXA 3SM9A 2FLWA 2P4UA 4KFCA 4MLCA 5TE9A 4MR8A 2FN9A 3B2NA 1NY5A 3F6CA 2W42A 4QYWA 3RVQA 5IUJC 2GI4A 3CLKA 2FQYA 3EQZA 3GV0A 3LUFA 4RK1A 2RGYA 3BRSA 3F6PA 1BDJA 1JLKA 2FMIA 4MR7A 1K66A 2L19A 4IMIB 4XXHA 2MYNA 1DG9A 2ID9A 4MQEA 5PNTA 2IPLA 1DRKA 1RNLA 4Z4CA 3HXMA 1BVHA 4MS3A 1HEYA 2E4YA 2WB4A 4RY9A 3FGZA 1L5YA 3NNSA 2BGGA 3OO1A 1LJUA 1QPZA 1BDIA 2RJNA 1SD5A 1JFVA 3KTOA 1CYEA 3F7NA 4F3TA 1R8JA 1TJYA 2NZVG 3RVPA 5JS2A 1NXTA 4N0PA 1YK0A 1Y1LA 5EWMA 2PMCA 4LZLA 1CHNA 3HM9A 3Q7TA 3QLVA 4RK4A 4KPYA 4G0PA 4LDZA 3CNBA 1FQWA 1JL3A 5CNJA 2QSJA 4JB0A 4TMYA 4NV3A 3FFTA 3HDGA 2IPNA 1EWTA 3RVKA 3TO5A 1ZITA 4MR8B 1M2EA 2IDMA 4RWEA 4OLAA 4XLTA 1E6LA 5T3YA 2QR3A 4LE1A 2PUFA 2WRZA 1APBA 4JASB 2AYXA 2PUGA 4D6YA 3CHYA 2IKSA 3QX8A 3HDVA 4KV7A 4NQRA 3NHZA 4PE5B 4W5OA 3L6UA 1Z18A 2B1JA 2N9UA 2F8SA 5BR1A 2FTKE 2OQRA 1GCAA 4W5RA 3O21A 2GX6A 1P2FA 1Z13A 1I3CA 5JS1A 4PZ0A 2NT3A 3VNAA 1S8NA 1YTUA 2PLNA 3H1FA 3UK0A 3IPAA 3MQ4A 1MIHA 1U04A 1FFWA 3H1EA 2TMYA 5GQSA 1Z2EA 1JDPA 4UHKA 1EWVA 5GOTA 4NICA 5HKOA 4P1ZA 1DBWA 3CG0A 1URPA 4MGEA 4OTZA 4XARA 1GLGA 5JNTA 2QW1A 4RK6A 2QXYA 3O2QB 4EYOA 1MB0A 3I42A 3RQIA 1LBHA 4GPAA 4ML3A 3F73A 3KG2A 2L2QA 2PL9A 5FWXA 3LUKA 3SAJA 1B00A 1QP4A 3N0RA 3QEMB 3EULA 3LFTA 5BRJA 3O74A 1VKRA 3FMVA 3O1JC 4H3KB 4MS4A 1YMVA 4TN5A 1USGA 2JBAA 2WJWA 2NZUG 4MYRA 4WUTA 1M5UA 5D2CA 1IIBA 3KKEA 2PUCA 3RVLA 1JWLA 3GWGA 1FFGA 4IGAA 1F51E 3CG4A 3BREA 4O1HA 4N0QA 2XDYA 5CNIA 4RY8A 1W25A 2VUHB 1PEAA 4G86A 4Z4HA 2ZAYA 3EODA 3GYBA 4ETMA 3RVMA 2E4VA 3HK2A 4S05A 3UKJA 3QLVC 2QZJA 3HZHA 4Z4FA 3IPCA 3GA5A 3EAFA 4L4UA 4ZMRA 3IP6A 2YHAA 1D4ZA 3A0RB 4KZKA 2RJOA 4YCSA 1YIOA 4RSMA 2FEPA 3KCNA 4YO7A 4HNSA 3Q7SA 2JVIA 3IDOA 5KQPA 4OLBA 2IPAB 5IEBA 3QELA 3HV2A 4YV7A 3RVNA 5TPWB 5DTEA 2IPMA 2GKGA 1ZAYA 2CD7A 2X7XA 4NCAA 1DZ3A 4IMJB 1Z17A 3CFYA 7ABPA 1Z2DA 4G0MA 2L17A 2MSWA 4YS6A 1CEYA 5KQGA 5HQJA 3T95A 4ZJPA 1KRXA 4RXMA 3KJXA 1AB6A 2R48A 3IP7A 3N0XA 2E4WA 4WT7A 3DLHA 3ROFA 3GT7A 1A04A 3DLBA 5HSGA 5CNKA 5FWXB 3RVRA 1J56A 3HCWA 3TMYA 4Z4EA 3OQMA 3EGCA 3QX9A 2OENG 2PL1A 3HUTA 2IYNA 3EDCA 2GWRA 5EWJB 1A0OA 1DBQA 4ZMSA 4YLEA 1XWWA 1ZESA 2FQWA 1ZY2A 4KRFA 4LX8A 1E2BA 3D02A 5TQ0B 3C6QA 1ZHHA 3T8YA 4MS3B 2FW0A 3OQNA 3OM1A 3H75A 1DBPA 4WZZA 5IC5A 2FLKA 4KQCA 1KRWA 4FB4A 2H3HA 3A10A 4Z4GA 2FEWB 9ABPA 2PUEA 2VUIB 1ZH2A 3OM0A 2MYPA 1NXPA 2HQBA 5FBKA 1T34A 3NHMA 1SXIA 4JP1A 4EGSA 4KQ9A 4MR9B 2NT4A 1JYEA 3N53A 4MS1A 1JBEA 3K9CA 3HJFA 1NXSA 1EAYA 4O1IA 5TPZA 2FMFA 3KHTA 1AB5A 1DP4A 1F4VA 1PHRA 2E4ZA 3FDFA 4YP9A 1ISSA 5HM6A 4EVQA 3E61A 3LUJA 1H9CA 1DRJA 3C3WA 3G1WA 2FXIA 5CHYA 1MAVA 1USKA 2R25B 2MYUA 5IX8A 3QEMA 2CHFA 4EY3A 1KMIY 5EWMB 2O20A 1U2QA 3IP5A 1YVUA 3MA0A 1MB3A 3MMNA 3N6VA 4FE4A 4FE7A 3EQ2A 4MRMB 1NATA 2JBAB 2M98A 4ETNA 1W9HA 5BRAA 6CHYA 4MRMA 1TVMA 4LE2A 4PICA 2FSPA 5I4CA 3H5LA 4N76A 2J48A 2WJAA 5DLEA 2FKAA 3CZCA 3OMXA 1OXBB 3IP9A 4RS3A 1DC8A 2PJUA 3OQOA 3T38A 1JFSA 5EWLB 2ZWMA 4RU1A 3H5VA 3RVJA 4D74A 4RY0A 3Q7RA 1Z12A 3LUHA 3NNDA 2PUDA 4S04A 3H5OA 5TQ0A 3DBIA 4RK0A 4WXEA 3LUDA 1QMPA 3FFXA 2MSKA 1PNRA 4IRXA 1ISRA 2FN8A 3OLYA 2JCGA 4G0ZA 2PUBA 1XHEA 1E6KA 3O75A 1TM2A 3HS3A 4XFKA 3LUAA 3CZ5A 4N03A 1NXWA 1RXEA 1USIA 3HEBA 3KSMA 4KK3A 3RH0A 1U8TA 4F12A 4PEVA 1GUBA 4Z0NA 3O1IC 3CTPA 3M9XA 4CBVA 3G85A 2R47A 2QVGA 4MS1B 3O1HB 4MAAA 4Z99A 3QELB 1MVOA 3GBVA 2YHBA 3HVRA 4F06A 4EYKA 1QO0D 2L18A 3NBMA 4DN6A 1OXKB 1FFSA 4MS4B 2JB9A 2F8TA 2LUOA 3KYIB 3ILYA
chains in the Genus database with same CATH superfamily
4E15A 4JOBA 1Z0AA 4I9GA 2AG6A 2XKJE 3MWKA 4F2HA 3B1KA 1D2HA 2CNNA 2P1RA 5IBQA 5A71A 4F1KA 5LXTA 5HW0A 4N49A 4HXGA 4IDPA 1KAQA 4RPIA 4U3JB 1O95A 4FT4A 1LEHA 4QGHA 1ECGA 4XD2A 3VAZA 4YQFA 4MQLA 2BZGA 4X90A 4ECEA 2ZRNA 3HBMA 3DHEA 3V8VA 1L6IA 4G0QA 2CVOA 3G0BA 5BO5A 2YY5A 4ZCRA 3FKSA 3Q88A 2IHTA 4ZQEA 4CUZA 3RVOA 4RF3A 3TD9A 2ZQZA 2WWTA 3OLXA 2LWIA 1WV0A 2JGRA 1F8UA 3RC7A 4BEWA 1JYFA 4G1UC 1X9GA 2BISA 5JYBA 3BOSA 2FN3A 2YQZA 1WQ3A 1JG3A 1KPGA 4IIXA 4FDAA 4LRQA 2WPNA 3A1TA 4IJWA 1Z5UA 1R4MB 3AUUA 2DERA 4ZT6A 3BGOS 4BEVA 4ZOAA 4HH0A 4FNMA 2QJOA 2NSHA 1CUBA 5K8JB 4AMZA 4EUEA 3U09A 1RR6A 2QTCA 1X1QA 5TQ2B 5BN1A 3RRJA 2JGDA 4XWOA 1EP3B 3ROKA 4ZDJA 3HWX1 4HNUA 3BM5A 4YQEA 1QGAA 3GMSA 1H6CA 2P6PA 1OKKD 3WGNA 4O4LB 4DILA 5BPHA 4EGJA 5C5EA 2P9GA 3IUNA 3HTXA 1XZCA 3GT3A 1XELA 4TMXA 4I99A 1EBBA 4ZZIA 4NBLA 4FYPA 4A8HA 5A6SA 2RD2A 1TTPB 3SNHA 3HR4A 1NJ6A 3I23A 4IM7A 3ZVLA 5JAIA 2VXYA 4QQNA 3NOXA 3M89A 3OUZA 1WDWB 3MT7A 3UG6A 4YECA 3MINB 4N1AA 3W4IA 8ABPA 1PR0A 1AA9A 4KYVA 4MWCA 5H81A 2FQXA 3I04A 1PFKA 3BK1A 1CB0A 3C5VA 4ZARA 5AK6A 1XTJA 1JWBB 1BWRA 1B43A 4D8WA 3RTBA 2B3TA 2G9ZA 1E2GA 4BNLA 3THYB 2V6FA 2HI0A 3N8DA 1Q16A 4P81A 2OHVA 4MR7B 4KWTA 4M89A 3LVQE 2JGIA 4JI6B 4Q16A 2P0YA 1CUZA 3I0ZA 3DWFA 4BFZA 1JDNA 1J39A 1BX3A 3W9BA 1N9KA 2AEMA 4X7BA 4A9AA 1M54A 3VR6D 2OWDA 1U6KA 5FHQA 3RTDA 1EFAA 1U0FA 2HSWA 3VTZA 2B7LA 3JQAD 1Z25A 2EC5A 2JGJA 2ZRBA 1CJMA 2ZRKA 4I8DA 4UTOA 4BRWA 4JBYA 1YHZA 5J63A 1ZIYA 3AEXA 1PT5A 1FE8A 1M75A 4MV8A 1NMZA 2IZZA 1ZD2P 3A0UA 4GYYA 2JRLA 1YUMA 1N9GB 1Z0FA 4GI5A 5EZ6B 3VOTA 5CCEA 5LOVA 1RLOA 1VHDA 5TPWA 1F9AA 3FAZA 5KYVA 2MYTA 1WDKA 4JX9A 1YF3A 2AG8A 2BEJA 4BFUA 1N7GA 4EJ2A 3LY8A 3E9NA 4IGEA 2XCLA 4JBWA 1NP3A 3PFFA 4M9SA 5EKUA 1ISGA 2G5CA 3AFHA 4LZOA 1MAUA 1ECCA 5LCXA 3AO0B 4XB1A 4TQ9A 2Y27A 3ZWVA 4WHMA 4MX8A 3ZWNA 1JSCA 1VLQA 4KODA 1M0SA 3IAUA 3SZGA 4LF4B 1XKQA 5KOYA 2GA8A 3LTEA 1ECLA 1F6DA 1IMOA 3A6GA 4N9WA 3V4LA 3ZD6A 2CHVA 1DIHA 1I36A 2J9FB 4L5CA 4AB1A 2WFMA 4CN9A 2HRBA 5ALQA 5IT9A 1EI9A 1MXHA 2NTEA 4X94A 4C0AC 1HTBA 4WXHA 4W4TA 3EQ7A 3GJ4A 3HSKA 2VK4A 2WYIA 5IULC 4TM8A 5CX1B 1X1EA 5F7JA 1M2NA 3PC7A 3W6UA 1N3BA 5DM60 4PYKA 1ES9A 4GS5A 3REGA 2FMTA 5C7IO 3HP1A 3LO5A 3HN6A 2JLWA 3MT0A 4FC6A 5E38A 5EJ4A 4BZXA 2IDKA 1SN7A 2G1PA 2JZCA 3QFSA 2DC1A 3EJWA 5E8JA 2CN1A 3R40A 4JGBA 1D1QA 3Q2KA 1A2QA 4F11A 2AOUB 4R2IA 2IXBA 2IODA 2VO1A 2VT6A 4IHJA 1L3CA 4XYGA 5DNDA 3AM4A 4O08A 1UPCA 3T4UA 1U3VA 2QGNA 4EVSA 4RD4A 4WLVA 2C58A 2J5QA 2EZTA 3B8HA 3LW7A 2X4DA 2ZPUA 2BFNA 3BULA 3OETA 2ONZA 2Q6VA 4G3XA 3H99A 3DT8A 3SI7A 1W8DA 3SK0A 3VO2A 3AY7A 3MJSA 5KREA 1E6WA 1RQRA 2VNIA 1ADJA 4ZGGA 3D6VA 3BZWA 4OJNA 4IO1A 2LPMA 1EGAA 2O4CA 4L95C 2NACA 1HMYA 3MIIA 5IH7A 2HMSA 4CMHA 3UJPA 2DQYA 3KXPA 1C0IA 5CT4A 3AEZA 4XWGA 3M4NA 2FPUA 3QNWA 4QWWA 3PWTA 3P5SA 2GZ2A 2HM7A 3L8EA 3VHXB 5B7QA 4RQTA 3TXXA 5CFQA 2QMEA 3V4RA 1XRQA 2PZAA 3ACCA 1N77A 3LZDA 2R84A 1EQUA 3AHEA 4H77A 2YJ4A 3WBBA 4JU9A 2RGYA 4NCXA 3RB8A 2B4QA 2AV6A 3J81k 1VRWA 4IMIB 3DOHA 2JBHA 5ARCA 2GCOB 4PPGA 1A9XA 1EWYA 3U4MA 1BVHA 2ZIXB 3BSYA 4MS3A 5TSDA 1US8A 3BMCB 2F9FA 1EVLA 5F2KA 4MEBA 3QYPA 3FNEA 1I4OA 1ISFA 1LJUA 3BWDD 4MKHA 4GOLD 2XADA 3HO6A 2ZP1A 5EIHA 2O8CB 5LZ4A 1O0SA 3F7NA 1VKNA 5EP2A 1PJ3A 2AKYA 3N3AC 4YFYA 5ALJA 5L3QA 3V2HA 1JDBC 5GVRA 1BGWA 4RYLA 2HYIC 2R5WA 4BAGA 3DZIA 2ZYGA 3JQ7B 4CI9A 4LDRA 3O8OB 2Q5IA 3CRRA 4B3DA 4M99A 3VHLB 2VSOA 1PAUA 4WESA 1EFHA 4JEMA 4MA0A 3FRIA 4IXNA 5IKEA 4B2YA 5JWOA 2Q8NA 1ZXLA 2WMDA 3DFMA 1WUIS 5BT8A 4EGFA 2J31A 3PBKA 3C6MA 4DM4A 4FSHA 3GEMA 3QU9A 1I7LA 4CHTA 3HG7A 3T9FA 1RPAA 3CTMA 3WSWA 2FZKA 4HHEA 2HBZA 2IPNA 1D2GA 1EPUA 2Y6UA 4KB5A 2I29A 1SHUX 1XDBA 1XJQA 2ZDHA 3DFZA 3FTDA 4UPVA 2LNDA 2P77A 5TMDA 1TVKB 5E4TA 3F3SA 2SCUA 4PHGA 4AYXA 4B7AA 3BYZA 3TSAA 1MO5A 4D6YA 3SCZA 1T2VA 4AX4A 3N9IA 4OFWA 5AM4A 5HWSA 3K9WA 4FJ1A 3GNLA 1R12A 1T5HX 2A0FA 1SNYA 4QOGA 4X91A 4KIFA 2DPGA 3FNFA 2VH1A 1JLRA 4GC5A 4RZXA 3O21A 4OF4A 5COQA 4QC2A 4MH0R 1L8OA 4TL7A 3N86A 5DIZA 5JS1A 1JXOA 1TA4A 2I2BA 5BNTA 2JEZA 1ZRMA 2X22A 4V0OA 4TT3D 3DYVA 1NX6A 4O3FA 4BBJA 1WHTB 3E9MA 3CEPB 2BDTA 1RLJA 2V7VA 1CF2O 2WOJA 4NZMA 5BVHA 2A5DA 3KLPX 2RGRA 1FDWA 4UHKA 3KJNA 1OJLA 5KKNB 3OZVA 1G9TA 1UKEA 3U7QA 4P1ZA 1XNRB 4F3CA 3PEUA 2PSEA 4JQOA 3L8ZA 2QW1A 4U6QA 2HZBA 2NQTA 3O2QB 1Z7WA 3CEMA 4RLQA 5AKZA 1ZW1A 5TGDA 1O3YA 3DCJA 2UZ4A 1C7FA 5IDWA 1CNEA 4JWTA 2EZUA 5DM0A 1V3QE 2CJWB 3TZCA 5C51B 1M83A 4DCVA 4AMBA 5K0BA 4KXNA 1JHDA 3LFHA 3DKIA 1G3UA 5FR1A 1UPFA 3GFFA 1KYZA 3N0RA 4WUVA 4ZANA 5A7GA 5IX8A 4YAOA 4ZQHA 3VOAA 3OTOB 2IZ1A 3LL7A 4JT2A 1KO1A 5D2CA 2C92A 5EL0A 2WM2A 1IXZA 4KFRA 4KXYA 3K7EA 1T24A 1C3EA 4LNUA 1L5HB 4NCHA 4CF6A 4WVLA 4YV0A 1BHQ1 1M34E 1YZHA 3NOVA 5D1NA 1DIGA 5M5BA 1KNQA 4D9MA 2DX7A 1OYYA 1UBLS 1ND6A 4CF7A 5J23A 3OE1A 2KLHA 1ZISA 1HKUA 4UXIA 2AWNA 4BB9A 4TZ6A 3AF1A 1NNI1 5CVUA 2HUPA 2HBYA 2D7JA 4EP1A 4EW1A 4C29A 1XRPA 5AVSA 5L7WA 1I13A 2RAFA 3K8YA 2NQ8A 4BQEA 3KQYA 2YHAA 4E2YA 3DV2A 1RJFA 3W6NA 1W0JA 1BOFA 2OBXA 2FPMA 3IIKA 1B76A 1SU7A 2RJOA 2W7TA 2ZPTX 4GZ6A 2AB0A 3Q8MA 1KIAA 2JFWA 1RC8A 4GDMA 4YJ3F 3HBNA 4OSEA 2Q45A 3FR7A 1ZR2A 3QELA 4F1JA 4ZKDA 2I7XA 3RVNA 5JZBA 1LC0A 1TQDA 5SY6A 1P1FA 2JC3A 1RPNA 1Z4OA 2B4KA 3K0KA 3RG2A 3ZGOA 1ISMA 2NXCA 3DW3X 3SBEA 3SZOA 4D5EA 3FCAA 4GHWA 4OGLA 4YS6A 4D92A 4LDPA 4KIJA 3KJXA 1KJYA 3MGAA 3N0XA 4LHYA 3UMCA 2IP4A 4EB0A 2IYFA 3JRXA 2GZ1A 4Z9FA 1XXHB 4RKYA 4TSFD 5CNKA 5B58C 1QIGA 1D5CA 5HZMA 3IIIA 2G0AA 2VAVA 2E5LB 2OM6A 4GT1A 2H1RA 4QO7A 2IXGA 5BQXA 2OENG 2QDXA 3IO3A 4NBWA 4DCNA 6YASA 4B73A 3EDCA 4GMHA 3OZFA 5E7JA 1ORVA 1GG9A 2ZBVA 3SIPA 2ZAIA 3MBKA 5LMZA 4GVXA 2V74B 4PGFA 5TQ0B 4WERA 2AT1A 1FDVA 1I33A 2QLFA 3E5HA 3OOEA 3F6YA 4DA9A 4H31A 2DMRA 3R5HA 1QHXA 1YR6A 4PU0A 5DW0A 4ZV7A 3SSAA 1FYFA 5H82A 5JQGF 5JU6A 4EKDA 3ETGA 1ARZA 4MWBA 3E2MA 1CJTC 4F2PA 2D1FA 5ESWA 3PPWA 2OQVA 1HZZA 2R1UA 3PZRA 3PDUA 3WLPA 4HNGA 3VDRA 4LXTA 1XMVA 3N74A 3QHAA 4RHFA 3VSAA 1NI3A 5BYAA 1TC1A 1SBCA 3IODA 4MS1A 1JBEA 1WLYA 2W5UA 4D5GA 1CZUA 3J7AC 3P52A 4KQWA 4TV9F 3BXEA 4YH1A 4DAEA 4IKEA 3P71T 2WD8A 1X7GA 1RAEA 2JCYA 1VQ1A 2JFBA 4YJ3A 2NSJA 2ZWAA 2IX3A 2MINB 4JNCA 4LS3A 3NXSA 2PRKA 3ESAA 3O3CA 3VPDA 3MCTA 3UH1A 2GEKA 3MC1A 4CU5A 3R23A 4NNJA 4B74A 1ADGA 1P74A 1KMHB 3LVBA 3L7DA 1N5LA 2HSDA 5EWMB 4PC2A 1E7MA 4ZU3A 4L9AA 4HS9A 2ZUEA 1B2RA 4N4AA 2KW5A 3KTDA 4MRMB 2X0FA 1RP1A 1MBZA 1V5IA 4DA4A 4UASA 1X1BA 1BVYF 1SC3A 1ZVMA 5LYJB 1XMIA 3QQ5A 1CB7A 4DSUA 4PQGA 2VRWA 4OMCA 4RQAA 2NUPA 1KSGA 3FLAA 1NHGA 3OIFA 4S12A 3PX7A 4EZIA 4I1IA 4R5HA 5IW8A 5BOSB 4X9XA 4JCCA 3SC6A 2D7DA 3K2BA 3OQIB 2O8DB 2FW7A 4QECA 1AGYA 5MGBA 4QVIA 3SZRA 3S2FA 2VH2A 3DFUA 3U0BA 3TQQA 3QBVA 2RHOA 1XZJA 5FA6A 3MWFA 3G68A 4D74A 2O1EA 3ZGYA 5TDHA 4A2PA 1TECE 3LHIA 4RPJA 4TUYB 3TL2A 2UYCA 1YFKA 2QAGC 4MXDA 3A04A 2GD1O 1UQTA 3EGXA 1VTKA 4TXHA 2MOKA 4NBVA 1OXSC 3DDHA 1VYHA 4UNNA 2FN8A 1SBZA 2H63A 3K0FA 2FDCA 3PA8A 1Y89A 2CXSA 3HEBA 2P78A 3NT5A 4YAJA 3JZFA 1PWEA 4XQ0A 3M1LA 2BFEB 4K8OA 1SR8A 1GUBA 1WF3A 4NPCA 1BCSB 2AOTB 5EXDA 3A70A 1Y33E 4BNMA 4CTKA 1RBZA 2ZB7A 3ZQ6A 1NW5A 1KAOA 2QYSA 4QDJA 3FPJA 1GD1O 2NSYA 1ORIA 1DS6A 3PUHA 3SF8A 4GOKA 1PSZA 4UCFA 1XAIA 4ZOLF 2G8NA 1I3OA 3LUPA 3B48A 3D8RA 4BLSA 4FPXA 3N75A 2CZCA 3DGEC 3L1UA 5IN5A 2GD6A 2J85A 1PF7E 1M33A 2W71A 4WOBA 3PXAA 4X84A 2XVMA 4HNAB 2RGWA 4TZTA 2PANA 2V4UA 4PZCA 3T9BA 4OJYA 3TG8A 1NI4B 1PEYA 1WBJB 3UN1A 2YJ6A 3DZHA 2P9HA 1NE2A 3R24A 1M34A 2G5TA 1VOTA 2IYUA 3GXOA 4OHPA 4XUGB 1XRNA 3QPWA 4ER5A 4DDUA 2PO7A 4Q4JA 2FY8A 2NZ8A 3PCTA 4R84A 5ES3A 1N8SA 1C2TA 3NYRA 2Y6VA 1DEHA 3FVRA 3MJHA 1X1RA 3GRVA 4UHJA 3WV5A 2AFRA 2BR4A 2RB5A 4RZ2A 3PTAA 1RYZA 2QOEA 1IBCA 2Y1DA 1U2RA 2VJOA 2IEAA 3ESZA 4ZI3A 4Z4QA 2Q1YA 2HFKA 3OZSA 4IXWA 5BR8B 3OQHA 3UQZA 3O31A 3QTBA 1FSPA 5JD5A 2GJ9A 2VJQA 5AR1A 1LW6E 5BQ3A 3F8WA 1EQ2A 5BR7A 5KNDH 1WW8A 1X1TA 1U28C 2VHQA 3D7SA 4C7VA 4ER3A 5BURA 3F90A 1LQTA 1AS3A 2C4WA 1FU7A 1NZJA 4GNKA 3KXIA 4D4JA 2DGDA 1VA5A 4PCUA 4YJFA 4EO7A 4LHSA 1EDBA 2CL5A 2HCBA 3IQHX 1T3SA 2WSLA 4KWIA 2FZWA 5JNWA 3ER6A 1WB5A 2H2GA 3DEHA 2A33A 1W85B 3PDJA 2QTHA 3PE4A 4MVWA 2G70A 2BMWA 2H11A 3PHLA 4ZJYA 4DV7B 3ZW9A 4A8JB 2Q1WA 3K4HA 2IDZA 1YQXA 1R0XA 1SCQA 3AQIA 1UZNA 3AHFA 3H1PA 4GVPA 4IDEA 1E3SA 3HB7A 4JVNA 5FADA 3ZWDA 3ZY4A 4FIZA 5KQSA 1EGVB 1DFHA 1RKUA 1JXQA 5AXCA 5KMGB 2EX0A 4ECAA 5ALPA 1YRLA 3LW8A 1HDOA 3GH3A 1JIXA 4U02A 4MW9A 2WSYB 1M2VA 3KKQA 3MHTA 1N5JA 4ZYLA 1VZ2A 1PL7A 3K09C 4QGAA 4WWHA 4YT2A 3G82C 1OXUA 4V1CB 3NX4A 1M0WA 4WEQA 2AMYA 3D54D 1Q11A 4MVJG 4OPMA 2BKUA 2WEKA 2XUOA 4XWWA 5CB8A 1VXOA 3AETA 1H5UA 1TK2A 2HWYA 2Y8EA 3HKCB 2VT7A 5F78A 1NBMD 2ZRQA 5F2NA 4ILEA 4B3CA 1IK4A 2XF8A 3N70A 3RSHA 3BMOA 3EVNA 1C4KA 5IBCA 4KAAA 1EXDA 2Y2VA 1A9RA 3LF1A 3V80A 1T8PA 4DS3A 3W5JA 2VDNB 4TV9B 2EU8A 2WABA 2WD7B 3FB1A 4F97A 1OFVA 3BL5A 3BGDA 2H08A 4OI4A 4FEGA 1SKUA 1P73A 2PAAA 3FHJA 3M6MD 4F4IA 3ESXA 1SOAA 5F9FA 1QGDA 5KYNA 5JDIA 4V0KA 3ROMA 3QVUA 4LOHA 2QN1A 2JIOA 1R0WA 3AFIA 3SS7X 3WJ2A 3O2SB 3ZJYA 4PRYA 3WB0A 2MINA 1TD9A 3N8IA 4DYDA 4MCIA 2G71A 1QORA 3LVFO 1USUA 1ZQ1A 1C7IA 5IK2A 1GNQA 4DQDA 3LTNC 3OA2A 4HDAA 2KI5A 2ALJA 1AXEA 1POXA 2YASA 3VTFA 5EIOA 5CJPA 4C0HA 1JEEA 2V7TA 1IN6A 4GKKB 3MCUA 2EKDA 5BP7A 4ZVRA 3S7TA 4LHEA 3JQBC 1QWSA 5FTNA 4WW0A 4K6FA 2HLDA 4B45A 4KYTA 2DP4E 1SRRA 3FJOA 2LCQA 2IHUA 4BV2A 1T0JB 4U7PB 1S4MA 2GPJA 4LGVA 5CDYA 2P6MA 1LDNA 4NZPA 3PUXA 3TDNA 4LQLA 4BYGA 2XLCA 4MHTA 2QX4A 2RHGB 3GUVA 1IOVA 1ZWKA 3QNMA 4M0FA 4NFSA 4B83A 4EX7A 4LXQA 1OBVA 2QEQA 2I7CA 1W5AA 4PHHA 2JDID 2KYRA 3DE0X 3HEAA 3AVYA 1H8HA 1I6MA 3LUCA 3QA3E 2G6TA 3MTIA 2OAEA 1A8UA 1KZ6A 1Z28A 2PQ0A 2VHTA 2VF7A 3HJTA 2HDWA 1I3MA 1Q0HA 3V2IA 4QPDA 3OJXA 2WPDD 3MBIA 1JG6A 1OFIA 5FYDA 3G0DA 5ULLA 3SOPA 1IAQA 1JTVA 3AIKA 4MR9A 1Z4MA 2ZBGA 2WUEA 1K97A 3WGIA 4IGIA 4M1KA 1T35A 2IL1A 2JGFA 4JY7A 5T67A 4HCJA 3A1FA 1IJFA 4J0GA 3S8EA 4P36A 1T1RA 3DD5A 1A8PA 1PK9A 3JWHA 1Z5OA 1JNXX 3CCCA 4J9VA 3V8EA 3KZCA 2P90A 3UUEA 3VPCA 4F92B 2BGTA 2CNBA 2X1VA 2BRUA 2QR2A 2J7PA 1XX6A 3CRW1 4ZO9A 3WYAA 1G63A 5IJ9A 2HX1A 4BMOB 4CNQA 1JPJA 2AN5A 4RA6A 2WVJA 3M4XA 4JL5A 1IPHA 5CM8B 4Q6WA 4P3OA 1GG2A 3F9RA 1H8ED 1T0UA 3DUFB 3GLQA 3HB1A 3PTZA 4RKEA 5FNVA 1MIOB 1Q7RA 1VGRA 3IDFA 3C8ZA 5T7BA 1H2YA 4BVAA 3H8WA 1F9EA 4D42A 3SM3A 4R69A 3TLJA 1AU9A 1SUCA 4JC0A 4KWHA 4RTSA 2JH3A 3IAAA 4LN1A 1LDGA 2PX5A 5TE9A 4BY9E 2BTEA 4K1LA 2PIDA 2OM2A 3VSBA 2F3RA 1H85A 4E46A 2YRWA 1PE0A 1YBVA 5K4AA 3UO8B 2QZ9A 1SPBS 3M2TA 2HLNA 3GCZA 1K8RA 1VPTA 3LNCA 4BAUA 2WLTA 2QLLA 4F9TA 4WJZA 5P8WA 4BFSA 1G9XA 2ID9A 1J8VA 2VHCA 3A25A 5IM4A 5FX2A 1WXEA 2ODQA 1IONA 3B52X 4X41A 4ZYUA 3LYLA 1SVOA 2RGEA 2D0DA 1UR5A 1DAMA 4FEAA 3OFKA 4C87A 4CKEB 4KVZA 3OO1A 3IQXA 4F4UA 5DISB 1GSHA 1QH1A 2P5YA 3D8TA 1YXMA 1IC6A 3K16A 4B2PA 1R0KA 5AOBA 5CVTA 3C1UA 2YJGA 3RVPA 1SU4A 2H0RA 2YOHA 4QYIB 1HV8A 1Y1LA 1W8IA 3VR5H 1WXGA 4HX2A 3WBJA 4ARSA 5ECGC 1NVDA 2A5FA 3GT4A 5K3FB 4OXYA 4MKZA 1R6AA 2CFIA 1BXZA 1VJCA 3DLPX 2ZDGA 3RLIA 1GTRA 3VOSA 1JA0A 4QKQA 4RNCA 5HDBB 1N0WA 1AVTA 3HRHA 1OH7A 3GAZA 3WIBA 1YR9A 1MJNA 1BYUA 1NSFA 4U0JA 7REQB 4R2MA 4PLPA 2AGVA 2ETXA 2JIBA 1K4KA 3ZVNA 121PA 2GBLC 1T4CA 2JFYA 3QBEA 1E6LA 4UTPA 1V9SA 2ZZMA 2PUFA 1Q0RA 2AYXA 2IJGX 3AR2A 1UXJA 2OWEA 4XUCA 3LE8A 5DYIA 1KFBB 1TVEA 5CIYA 1FFYA 3NWJA 5LMCA 2JKYA 4DG8A 3U6BA 5AOVA 1KDPA 4KO3S 1GCIA 1KRHA 4ZVSA 4BGEA 2YWHA 4MEAA 4RL4A 4CMIB 4KQ6A 5EMJA 4WFJA 3KHUA 4LVUA 4JKIA 1VCMA 4QUIA 4G1MB 3W2GA 3WKDA 1I3CA 5JASA 4MI3A 1R6VA 4M0UA 3UJCA 2V3VA 1WO8A 4GYJA 4DQLA 2IHJA 3L1IA 1XEFA 5FTLA 2D1SA 3AYXB 3JD4A 1RYFA 3AJ9A 1ZCJA 2WSBA 2O2GA 4FMDB 3MQ4A 4G1FA 2Y71A 1INLA 5DI3B 4D97A 2KPOA 2ZCJA 5FBLB 3F1KA 1T2FA 2IY7A 2Z8ZA 3KZNA 1YS9A 3OF5A 5HRUA 2EQ5A 3X1ZA 3ANSA 1TIKA 2I4NA 2GEVA 3EFHA 1BIFA 1W76A 2QA5A 4KBGA 1ELOA 1XP5A 2RARA 4AG5A 4ZK6A 5HJ5A 6ADHA 2F8MA 4GXRA 3FUWA 4KPEC 1NDQA 2VBCA 5HF8A 3SQMA 1QKIA 4PYNA 4A16A 4MINA 1XVTA 2XNCA 4UU7A 1GOTA 2Q3FA 3AEQB 4P0QB 2R6JA 4OL0A 1CUAA 5JHGB 4CPDA 1QE0A 3I28A 5CAEA 5KVVA 1Q0UA 2AFHB 2VF2A 3RT9A 4MS4A 1P4HA 3GB9A 2JIZD 3BQMB 1EGQA 3FIJA 1GGMA 1IIBA 2X0DA 4BNJA 4RIHA 4RUKA 1JWLA 1HFKA 4Q47A 4CT0A 1B6RA 1PFYA 4IGAA 3RYIA 3ZV4A 2AQHA 3A1WA 2IZ0A 4J8PA 2JAPA 2BFFA 4QAQA 3UOGA 1Z8DA 4LTMA 4FM9A 1ODCA 3HYSA 5MN6A 5EVCA 4RL6A 1PEDA 4C6HA 1G5IA 1KORA 2DY0A 3H8SA 3FSGD 3IOBA 4L4YA 4DLNA 1V7ZA 1K1EA 3KEMA 5E1OA 1C9KA 4JI3B 4D3DA 1Y9ZA 3MCZA 4PHCA 3IPCA 1IBKB 5T5QA 5AHKA 2QN3A 1M6HA 1H94A 1LU9A 1P5FA 4GLFA 4LY3A 3UEOA 3FI0A 1NJGA 3KQQA 4FGLA 3KQPA 4MUXA 2O19A 4KQKA 3DXFA 3UMRA 1B8OA 3EXAA 1DRUA 2GFHA 2O48X 4KFUA 5FR2A 5CCXA 3EVDA 2MSNA 4EEXA 5IAJA 3LWDA 2NUTB 4KRXA 2JFXA 4Y2UA 5KQPA 2O8CA 1Q1QA 2RC5A 1RE1A 1D0VA 1PBNA 3ZLUA 4WK0B 4EGAA 1J8DA 1FY2A 1QZZA 2VSNA 4JP5A 1PQUA 1VBFA 3A8TA 4JI5B 1Z5PA 5A7HA 4QT0A 4NCAA 3QF4A 1DZ3A 2Y0CA 4HGNA 4GWGA 3CFYA 4WXRA 1Q50A 2C77A 3NDPA 3G7SA 1PS9A 4RXMA 4JV5B 1AKNA 2OK7A 2QD5A 3G1UA 4XPIB 3TD2A 4HNAA 2BM0A 4ANFA 1EBFA 4WNAB 4PHFA 4WLNA 1LH0A 1BO6A 3VKHA 4EQZA 4IH4A 1I32A 5BPFA 3HWRA 2B83A 4R6WA 1KKLA 2X0EA 1VG0B 3QX9A 3E7DA 2YN0A 4JJKA 3RAGA 1VDMA 1RHKA 4PVCA 2ZYIA 1E58A 1JJAA 4QO8A 1J0CA 2B69A 4P4SA 1NSYA 1HURA 2IRWA 2J9FA 1Y6GA 3VI4B 1CETA 4EY5A 4RACA 1EMDA 4UVDA 5EKXA 4UM8B 4FYHA 1IWBB 1F3OA 5C7LO 2PWZA 2FPWA 2VRBA 1Y3IA 2R6HA 4WZZA 1R4NA 4ZGWA 3OLCX 4L51A 5AVXA 1UDBA 3O4FA 4S1NA 4XR9A 2WNSA 3PQ2A 2J9YB 3ZGVA 4LFBB 3OM0A 5LUAA 3NHMA 1SXIA 2BH9A 2H9AA 3CRMA 1F48A 5HIMA 8MHTA 3AKDA 5BN3A 1TEVA 4GW3A 2ZQ5A 4BXOA 1E2UA 1ODTC 3PQCA 2RHCA 1U8XX 4AT1A 4CE6A 3HI4A 3LGAA 5TPZA 2JGKA 1IULA 1UOQA 3DC2A 4OYLA 3U7FB 2JFUA 4HRYA 2R8XA 4V1CI 1ZU4A 4RHEA 2CXUA 5FT9A 1JTEA 5ARBA 3VH1A 2V9CA 2XDWA 2XAUA 1Q7EA 1YS4A 1KVRA 3E3OA 3LUJA 3O5AA 3QPUA 4INAA 4PLHA 3RWMB 1QB8A 2NU6A 1M1ZA 1MAVA 3HJNA 4PNPA 3JAMA 4CIVA 2IYPA 3E18A 4XQCA 1IVNA 2GASA 5JCOA 2I71A 2BM8A 1N2IA 1FIUA 3GOQA 1G3MA 1U2QA 1NRWA 2GN4A 1G66A 1XF9A 2WHQA 3L41A 3W78A 1DIRA 5J1TB 4C6SA 4DV6B 1RCUA 2WTXA 5BRAA 4MRMA 1LBQA 4P58A 1UXKA 4NMLA 1ZD5A 2Y1OA 1M67A 1GGJA 4KTVE 4Q3LA 4Y0VA 5JMOA 1T9HA 1UANA 1Q3HA 3LX8A 2CNWA 3E9DA 2C5AA 3AMVA 4IUYA 4L8LA 5EUBA 4BB5A 1I30A 1UBOS 2W6ZA 3ER9A 3AFNA 4DLWA 2CXPA 4US0R 4DIFA 5IVIA 4UBKA 2AFIE 1TB4A 1QFYA 1XZFA 4HNHA 5KCMA 3UBMA 4DC1A 2E4AA 3QMVA 4QUJA 4ZVUA 2H9YA 3WGYA 4ILKA 4R9SA 4IWXA 3V9PA 4NDNE 1DINA 1TZKA 1SVSA 2VYFA 4GBMA 3ZDZB 1KI1A 2JFVA 5FB3A 4M0EA 1PR1A 4KO4S 4G1EB 3Q6NA 5A3SA 1TUBB 4ND3A 3U56A 4DR7B 3GJ3A 3OIWA 5CDSA 1XZPA 1KBOA 3PFWO 1K88A 5K0TA 3F97A 3N0TA 3LUAA 1CR4A 1NQAO 3A32A 2RHWA 3JYQA 4QAJA 1E2IA 2XITA 4OLHA 1L5KA 1U8TA 3AUKA 4YAEA 3ZHCA 5GZ3A 2OYSA 3JCZA 5J4VA 5IAKA 5C8VA 4BNTA 2LIPA 2FWMX 3QWHA 3PHIA 4XX1A 5JXIA 4YMGA 1PK7A 2QTMA 4MDEA 2QMHA 4OAOA 3K5HA 1HDRA 4N0DA 2YHBA 2H1OA 4UUBA 2NZ2A 5KNCH 1I01A 1U2GA 3S68A 4ALNA 4AN0A 1QO0D 2M2IA 2OHFA 4ID3A 2HMVA 1NNUA 2VF8A 3L2OB 4HQOA 1QAOA 4LGMA 4M7WA 4XUDA 3KYIB 3RRBA 3VSCA 4CZ2A 4OY3A 4ZOEA 3WZLA 1XOIA 4A2QA 1ZGCA 2BFDB 4X54A 1T1EA 3S8MA 1V8BA 3SYLA 1X7YA 4U3JA 5HK8A 4N3BA 3EDQA 3VKWA 1U98A 4HYTA 2D1TA 5DGCA 1CJKC 4NSNA 3AOGA 3QEJA 2JIRA 1JDVA 2VQEB 3T3HA 3TQRA 3V6LA 6REQB 2VJYA 1JG4A 2CLLB 3LY7A 5FFNA 2YNMC 2R87A 4BC1A 3MJEA 5F1YA 1W1WA 2YVUA 1Q1ZA 3T06B 4GPTA 5LP6A 3KKMA 3F9IA 1BQ4A 1KY4A 2YIJA 3KO8A 1XLTA 1Z0JA 4Z7OB 3N3BC 1J0BA 5LP1A 4U7TB 1JSZA 1Y82A 4OUDA 2HCTA 2IVZA 4JUCA 2VZEA 1T43A 3OF3A 1XHFA 4Q3KA 4WXPA 4R2JA 3GT0A 4LSWA 3W2TA 4QTYA 5JT1A 1J2UA 1KIMA 1AH2A 5DYTA 1PQYA 4CQMA 4L7QA 2EP7A 3NLLA 5TQ2A 5HPYB 1WOMA 3H3FA 3S1SA 2MT9A 4OXKA 4UTRA 1GITA 2OY0A 1RYHA 1SOWA 2VTBB 4PO8A 1Z4QA 3T6KA 2XRFA 3VKVA 3EGDB 3WI7A 2YBEA 3G0GA 5AKYA 5DM4A 1WUHS 1XN4A 1ML4A 2XB6A 1V95A 2BEWB 2IPOA 4DMKA 1GARA 1UBHS 2IIQA 2J3HA 1CY6A 3JQ8A 1E5XA 1R5NA 2GM5A 1ESNA 3JRNA 3P94A 3D4NA 5GY7A 3JQCA 1JDSA 3MZ0A 5AVKA 4C4OA 1Y8CA 1PFGA 1YR8A 3KPVA 2JVKA 3GZNA 2VK8A 2LW7A 2Q6TA 3VPXA 1JPUA 2DZDA 3VVCA 5C8DA 4KNYA 5FYQA 3BSWA 2A9RA 3HXLA 4XSGA 4F8YA 3UPDA 3ZD9A 1NMXA 1TK9A 3RUCA 4BMXA 2HSJA 2H0AA 1RQLA 3N2ZB 1NYQA 2Z6VA 3RIMA 1JEDA 3TZEA 3UH0A 1W5EA 5E4JA 1K7EB 3DBRB 2QGFA 5EZYA 5CA1F 5AW1A 4G5XA 1N1MA 3WL7A 4RXTA 5HKKA 1QTNA 4B3SB 2B4AA 4P6VF 3WWCA 5C32A 4AYTA 4YP1A 4LV8B 4JXKA 3K6SA 1H2ZA 1A9XB 1I6LA 4R2KA 1OBOA 1ESDA 4CLHA 1W87A 3B6ZA 4M7RA 4GWKA 5HTKA 1CVRA 2VRCD 5BR4A 2RBGA 4PNZA 5DIFA 3V34A 3ORSA 3HSYA 3LBHA 1UCFA 4PPFA 5CXQA 4WASA 1UC8A 3V7YA 2C59A 2C7RA 4FMCB 2WAYA 4WZAB 2DTEA 3KYCA 3CNNA 4R8SA 4N6NA 1FFXB 2R97A 4F3KA 5CDTA 1P1RA 3KQMA 1LNZA 4Q1BA 1FLVA 1C0LA 1U6JA 2Y99A 4IYRA 2HJVA 1BS2A 4QBKA 3FYSA 1O6FA 4RK5A 2JAOA 3TBHA 1WSWA 2V7QA 3FUTA 2FFJA 1PFQA 2XGOA 3KXLA 1ZK2A 3HVKA 1IY0A 5CMLA 3HMKA 2I2XB 4N65A 4BJ3A 4CDRA 5KOJA 3NVKI 2CW5A 3P2MA 4WIAA 2KX7A 4LWQA 1TZBA 2UZAA 3PNQA 2IIVA 3KDSE 1W30A 1A5BB 2JEYA 4M0LA 2ENWA 3KOUA 3ROTA 4JL6A 3MJRA 2A5GA 2FFHA 3TTTA 4NEHB 4BMSA 2VEDA 3FUCA 5KZMB 5BNIA 2V9PA 5T41A 4RVCA 2NZJA 1OPXA 4KFSA 3PSHA 4LWZA 1K98A 4F5EA 5I7RA 2Z5FA 3C87A 3LGXA 4UREA 3PF9A 4BQSA 2OOSA 2B34A 3M7IA 2XEDA 2B99A 2HSGA 2YY7A 4BFYA 4MUFA 3AHGA 1DAOA 2PQ2A 2YZMA 3OQIA 1EXNA 1B93A 1JB9A 3O4VA 5AM1A 2CT8A 1MKYA 2A5YB 3UKOA 1V16B 4QJBA 5I8PA 4FI3C 1V5WA 2P9ZA 4QPJC 3C74A 3GARA 1D2CA 3BD8A 4ZVLA 1CX9B 1UK7A 4BN0A 5IANA 2YXEA 1H66A 2EBHX 3CLRD 3KSRA 3LPLA 4QRHA 3SQOA 4MQFB 3V3TA 4ITVA 5JRJA 3NM4A 4X1IA 1NW9B 2DVMA 4BO3A 4NU0A 4EJMA 1MO2A 2UYQA 2HW8A 3OMWA 1Y7PA 1XR3A 5DXJA 4UEQA 2RSLA 3I9KA 3I45A 3LC7O 4DW8A 1YA4A 2K7ZA 1ZLYA 5K3BA 4L4RA 4DMLA 3ETHA 1MH9A 3A1DA 1QC5B 4UAVA 2XZLA 3HDHA 4HAVA 3N8KA 1Z26A 2ATCA 2VOJA 2IOFA 2LP4Y 2ZR7A 5F5NA 3RV4A 3PGXA 3EPLA 1QR6A 5I4IA 3MF4A 3FI9A 3U1VA 3MTAA 2PHZA 1QQBA 5FL7A 3AQ4A 1Z2NX 3EG9A 3RVSA 3T35A 5A2QA 2EJCA 2M9MA 4MB0A 4QYMA 4TXLA 1JQEA 5EFZA 1U4NA 1ZN8A 4CJXA 4L16A 4WN9A 2BHSA 1QTQA 2FSSA 1VCIA 2V7BA 3QVSA 3S5UA 2AEEA 3HR7A 4YRGA 4K6CA 2VPTA 4C7MA 5IT5A 4Y2TA 1MIOA 1JJVA 5K0SA 2XTJA 4KQ2A 5T3UA 1VJDA 3VU3A 5EHIA 4DWJA 4E6EA 5AOAA 1K7CA 4K03A 4MW1A 4S1PA 2O5EA 3BQ9A 5MF6A 1R7RA 3O4RA 2WUVA 2C9CA 1I9GA 3QU5A 1AKYA 1Z0UA 1CNFA 4LZWA 4O2LA 5HCIA 3IA2A 2Z09A 3ITNA 4J43A 5BNWA 4XVCA 1I4DD 1H65A 1Q7TA 2PCLA 4R1OA 1SBQA 1QLJA 2VTEA 5A62A 3S27A 2QU8A 3H3JA 5EP4A 4JVOA 5B36A 1O6GA 2GM4A 5CVVA 4ZPXA 4PG5A 4IIEA 4OJMX 3SFVA 1N8KA 2IU0A 1Q21A 4WK4B 4DDWA 4LSZA 4URHA 1YS1X 2VP4A 3GLFB 4AI6A 4ZTZB 1PZNA 3GGDA 3HGTA 1ZNWA 3LYHA 3W8FA 1T9KA 3B3AA 5JPCA 3CB2A 3AUAA 2R8EA 3MSXA 1TF7A 2ID8A 4YXWA 2GF0A 2JZOA 2NZVG 2WF6A 3JVEA 4IIVA 1NXTA 1S9DA 1XGKA 5EWMA 7ADHA 5K6TA 3SC2A 4BWVA 3BWCA 2W6IA 4O2BA 4BE9A 1CR1A 2BGNA 4DEVA 2RAPA 2UV8A 4QUBA 4OV6B 4KPYA 2D06A 2E5WA 1OROA 3HE3A 1W88A 3ONNA 4CNBA 4N12A 4PSAA 1GNTA 3PUYA 4IIUA 5A0FA 1VGVA 3FUXA 4NIMA 4X7RA 1UZUA 1ZA2A 3CUKA 2B21A 3ITKA 4P83A 1PZGA 4BKQA 1N0HA 5JVDF 1C8KA 4MVJH 2AHRA 4ZRMA 3RVKA 1U1CA 3F5QA 4O33A 4IAOA 1N2GA 1E2JA 4RO0A 2H4FA 3WB9A 4IHQA 4BFLA 3DAGA 1TU0A 4XCQA 2GAFA 3FYUC 3WYDA 1J20A 4GOXA 5ITZA 5LC1A 3IUQA 4O4HF 3NYQA 4KXMA 2C0PA 2PLAA 1SCJA 1XA4A 4ZZ1A 4JIGA 4LC9A 5CLJA 2XYRA 1WXHA 2PEZA 4A2CA 2P75A 5AJZA 2JLCA 2X58A 1DADA 3NHZA 3WNDA 1C3VA 4W5OA 4B47A 1M7GA 3KR0A 4JYBA 4NNOA 1N1DA 3UJDA 1F8GA 4BEJA 3RRZA 4JELA 2XMRA 1SIUA 2DFNA 1EFVA 4BEBA 4N5NA 1PGNA 3R77A 4MW7A 3PEFA 4CLRB 4LF7B 2FEAA 4FHFA 1K2VN 3TKLA 2XXAB 2QYOA 1RU3A 2BF4A 3GVIA 4F86A 2X5OA 5KWIA 2C7PA 2W6MA 1GL9B 2O50A 2AL7A 3AJDA 4TWAA 3T9CA 4IIHA 1OI4A 1WL8A 3W1WA 2C8JA 1NRJB 2CFCA 4OMFG 1X3LA 5M7EA 4R1QA 3CF6R 4K9PA 3BRWA 4D79A 3CG0A 1URPA 1CY0A 3HP4A 4DB4A 1U4OA 4MVJP 3SKVA 4MMYB 4P34A 5B1HA 4YMLA 3M6AA 1W75A 3RADC 4KSCA 5AM3A 4Q12A 4OHCA 4UNIA 1N78A 1NRXA 4FDLA 2YQ5A 4M9QA 5FNVF 1BNCA 3OFNA 3N2YA 4GI3A 3QEOA 3W2IA 3NB0A 4EG3A 4L2IB 3DB2A 4B7CA 4QQ8A 3GQBB 1CS4C 2R00A 3FWYA 3OAAD 3IXMA 4MZDA 4YVFA 5B2EA 3GK3A 4YRSA 5JDCA 3S2IA 2NZUG 1LI4A 3T1OA 1T5TA 3QHQA 3ZXSA 2H18A 1E61A 1FXUA 1NQUA 4YRFA 2CBGA 3MGKA 4RJIA 4WY8A 3ZK9A 4OD0A 4B6QA 4K6HA 2Z2XA 1EDOA 5D7BA 4RY8A 1YBMA 4UFOA 2H3EA 4DV3B 2AFHE 2DH6A 4DXAA 5CA0F 3FVVA 3G2QA 1JR3A 1DAKA 3AEKA 3FF1A 5IC6A 4YRQA 1XYVA 4GPD1 1XFDA 3HK2A 4S05A 2C7QA 1XQXA 4PIPA 1GLVA 3FVWA 1RXYA 3IT2A 1CDEA 2B30A 1THTA 2IDJA 2GA9A 4LXYA 2GZSA 1TPZA 1QNFA 3CLRC 3IP6A 1KYTA 3LQ4A 3PUVA 5ALMA 1BSVA 1QXSA 3CINA 3R0ZA 3I30X 1QE3A 4KZKA 1YB2A 5DX1A 4B76A 1T13A 3O7WA 5JQWA 3W9SA 1QOZA 2BOVA 4HGZA 4J29A 1C9DB 4LKOA 1XZHA 4CG3A 2B0JA 3KQUA 2JVIA 2IV7A 4BBZA 3M81A 4HK4A 3R3XA 4PLFA 1EUDB 2LKCA 3EIFA 3OIUA 4MUKA 2NZYA 5TLSA 1W36B 1L5VA 3OM8A 4Q39A 4Y2RA 5FUXA 1LTKA 3CZPA 4YRPA 3RRYA 3WOVA 1Z17A 3R0IA 1XZIA 4N5HX 1QV6A 3EDRA 1XRSB 1WW3A 5DOVA 5LBTA 3SC2B 2CY0A 2P5UA 3VC2A 1MG0A 1E2LA 4LF5B 2HHJA 3TVDA 5B1SA 3W2FA 4L73A 4F6RA 4EUFA 1SC1A 1F38A 1WXQA 3HPQA 3PFHA 4LKRA 5IDVA 4ZU6X 4WE3A 2HF9A 5DFAA 4GL2A 1EFCA 1U9ZA 2QRUA 5F35A 2MIIA 4IRUB 3ER8A 3OJOA 2N1BA 1Q5PA 1QVWA 5E9WA 3V4OA 3B3GA 1Y3AA 1OZFA 2NZXA 4NENA 3BDIA 5DF1A 4F91B 3P4XA 3QXHA 2A9KA 1WDLA 1WBBA 2H5JA 4L6CA 2PKRA 2JCVA 4I1YA 5BUQA 2YWJA 4ZEWA 1L4GA 2B8EA 3S2YA 2FX5A 1XSEA 3DOFA 5HS4A 2F3UA 4X6UA 2X76A 1EM8B 1MJFA 3OZIA 2Y0PA 1NBHA 3NW9A 3M0EA 4YR9A 2B3DA 4PONA 3USZA 3LHDA 4NTZA 4TRJA 5TMBA 4DTIA 3H9EO 3OQNA 3OM1A 5HFAA 4G26A 1CRLA 4AECA 1F14A 1RBQA 3DBOB 3P9XA 4IBOA 1J07A 3GLFE 5E1DA 2QUIA 2R8OA 1I7QB 2N75A 5CW2A 4XQEA 1P3JA 2MYPA 3T41A 3WGKA 1S8AA 1WY5A 5IT0A 2AOTA 1BCSA 1GKKA 1PDWA 4B17A 4EUNA 1T8UA 2QK4A 2QVXX 1BQ3A 4KXVA 2GLUA 3PGA1 2A84A 4TTVA 2W4MA 1OIXA 2A1UA 3MLAA 3P27A 3QP9A 2WTMA 2QJRA 3WRYC 3HJFA 1A2KC 1N92A 3CH4B 2Q1SA 3QVKA 2VRNA 3L6OO 4LSGA 1J6UA 1ODJA 1XCPA 5I6DA 2NYUA 4Q4AA 1NFRA 1V9CA 1WCIA 4O4JA 3ZDRA 1ZVQA 2FOLA 1YL6A 5MGNA 3AZOA 3KYCB 1ANKA 1PDVA 1JFFA 4PRLA 1OREA 4FKZA 2QAIA 4FX2A 1VBMA 1V5GA 3G9QA 5ALHA 1ZZGA 3TL6A 2O20A 2OFPA 3PR1A 2QMQA 3QBJA 3T5CA 3ZCSA 4BVKA 4FE7A 3SX4A 5FUYA 1WCV1 2UYOA 3A28A 5LOVF 4ZZ2A 5EXSA 2DQZA 3CCBA 1NBOA 3NHRA 4CTOA 3HB0A 3DPIA 4EARA 1C9JA 4KDFA 3ZE0B 2HV8A 4DREA 2X42A 4LPKA 2BW0A 1MT3A 1I51A 1RP7A 4JR0A 1D7OA 2VUUA 1V16A 2SKDA 5EUQB 3OQOA 3LBNA 3DBRA 1QYXA 5EAIA 5EZYB 5FA8A 3RSLA 4IJ6A 4BL5A 2WILA 4GLJA 1ZEMA 3W8NA 1VLLA 2IT1A 5KOIA 2BKXA 3DKKA 4UEOA 1D2RA 1QQTA 3BXXA 5DPMA 3WP1B 4EI7A 3DBIA 4HYYA 4RM3A 4JT9A 2BEUB 3B8EA 1E32A 1JQLB 4R16A 2RAVA 2G1KA 3P1JA 5IXJA 1QK4A 2DFPA 2J6BA 5ALSA 4E5YA 1W36C 3O75A 1E2HA 3FDZB 1IZ7A 2AXEA 2QIOA 3KSUA 1HZZC 3RUPA 3SVTA 4W7SA 4UFNA 3WKEA 3FWHA 1JIQA 2R3SA 1SHLA 3GJZA 4RJLA 4MQMA 4RVDA 3U3ZA 1J25A 3ML1A 2TMDA 3TUJC 1V1RB 2WJJA 1SOUA 4DDKA 3M9XA 5C35A 1M1YB 3UK7A 3OQVA 3VKGA 2QVGA 1EEXB 3CF2A 1G5TA 3AR8A 1TT5B 1TM7E 2AMFA 4U9IS 4V38A 1CR2A 4XYBA 3WLMA 4NLLA 1E1CA 5G1PA 4AURA 1NQOA 3KSAC 1WOYA 5C8YB 1EK5A 1JVNA 3G2OA 3CXRA 1TLTA 5DHRA 4MS4B 3QXSA 1N32B 3PVZA 4QIHA 2AE1A 3IOYA 2AG1A 2PQMA 1U7OA 3B3QA 3H5IA 3MMSA 4OM7A 2Y1KA 3AR6A 4UARA 3A3KA 1EFPB 3SYMA 1VLMA 5G3YA 5CM2Z 3SEZA 3IRUA 2IBSA 2ZJAA 4YCCA 3IP8A 3QU2A 3OX3A 3M6WA 2XF2A 4HKTA 2Z5LA 4DJEC 5E4FA 3BA6A 3SEQA 3T5DA 3GD7A 4O4HB 2PPLA 4RPCA 3LHKA 3JWGA 4Y2XA 5H1YA 1LBSA 4AYWA 4RZSA 3QVLA 5U4QA 3L18A 3LSYA 4IVQA 4LMPA 2JATA 3DWIA 4P86A 5LZ8A 1T8WA 5GGXA 4MWEA 3WMWA 5KX5F 2B9VA 3MWYW 3D1LA 3HKDB 5IFLA 3PICA 5FBVB 2ZCUA 3IE2A 3B3JA 4JD5A 2QL5A 3KJQA 5JFTA 2IY8A 5KHLB 3D8HA 5M3BA 5I8WA 1KVUA 2FRXA 2OZLA 4M38A 2GPAA 3LYAA 4C4AA 1BH6A 2V6BA 3HQ4O 2QRJA 3IUJA 4I8IA 3TIGA 1K9VF 4YB8A 2YWCA 1RWKA 1WU7A 3G2HA 4RM2A 2FH5B 1WWKA 4NCBA 3TTYA 3X1DA 1H4QA 5FIUA 1ORRA 3LOPA 1HDYA 4F2WA 3KU1A 1KI7A 2I54A 3L3BA 3RSCA 3V4VB 1OLUA 4FKMA 3IAM6 3MTEA 1LJ8A 4MGYR 1L4FA 1ZH8A 2FFAA 2I4TA 3IKVA 3QXXA 1JU4A 4KE7A 4C4RA 4AS1A 5CNMA 4P5EA 3PUIA 3FN4A 1TYZA 2JGDB 3HO8A 3FGNA 2JKZA 3EZ9A 2Z83A 3P9NA 4MGZR 5HCUA 3ZWBA 1CUIA 5FPKA 1JVBA 4GR9A 1ZHFA 3CX7A 2DRIA 3H6HA 2J6HA 2UUBB 2P68A 5IMSA 1K27A 2PXXA 4DJJA 2BR5A 2X8JB 4IO0A 3AK4A 3JALB 2GSWA 2C4HA 1NRIA 1SD1A 3QJ5A 5FNVB 4YJ2A 1JX6A 3FNQA 2TS1A 1GRRA 4LAFA 2Y3IA 4PYRA 2HF7A 2HPZA 3BC1A 2EF0A 4F7DA 2D1QA 1FDSA 1KI6A 4PSKA 3HM2A 3HFSA 3HU3A 1GZSA 1N5KA 2QD1A 3TPCA 2QE7D 4C2UA 3ZQKA 1RMQA 1RQ7A 1SM4A 1JRLA 1X15A 2OGUA 4A2WA 4L8FA 4UE2A 1LSJA 1XTVA 4F93B 1AQUA 1NU8A 1UT5A 1DUVG 4RFSA 4JEIA 3NBQA 2IVFA 2PGJA 4M21A 2FK7A 4BU1A 3FWNA 4Y2JA 2B7CA 5KTRA 3WZ2A 4BO1A 1F06A 1MLDA 1YB1A 5J58A 5F98A 4IHAA 2WIBA 2YX1A 4K9MA 4UDXX 1K4YA 4PIMA 4D99A 3QYJA 2O5RA 3SICE 3NHJA 1ULSA 2O3RA 2FOIA 2WY2D 1CJSA 3AFGA 3K9FC 1U7UA 1WXFA 3NOQA 4E70A 5CFPA 2FYTA 1NM5A 1H2EA 2V6GA 1YKGA 3E5NA 3VXKA 5C18A 2NO4A 4H7IA 2OBLA 1BW9B 2WTAA 3ES9A 4FBGA 5L53A 4Q1VA 4HUTA 3GPDG 4WMLA 3ECCA 2R7MA 3GLHB 3U4QA 2BBSA 2NPIA 3SZMA 3SG0A 1CQIB 2ORED 2VK1A 1NL3A 1BDHA 4XYEA 4CXMA 3UCEA 3LKBA 3L79A 2DEUA 1FYXA 1RAGA 2BC9A 2D0PB 2OYCA 5ELLA 1NWHA 5CK4A 3O03A 2XBMA 4RD3A 3MJTA 1QHFA 2VPZA 2DYKA 1O03A 1NVFA 3HWSA 3MWGA 4FOOA 2J0UA 4ZT5A 5FH9A 4F6CA 4UKDA 1MX5A 1ZGAA 1QNLA 1S2NA 4ZI7F 2YN2A 1MU0A 2WKSA 1YE3A 3KVVA 4CHGA 1SC4A 4KJXA 4DF3A 3DEKA 1YNSA 1H0RA 1PQ4A 1TM3E 4UE3S 3K70D 2QVCA 3JARB 2WW8A 4FW8A 4ZJZA 4LMRA 3AUSA 2G9UA 4UEWA 5ITZB 2ZZKA 4L28A 1XLUA 3C14C 1IB0A 3I6IA 2W6PA 3Q3CA 5K03A 4X92A 5DLPA 4DZRA 4QGBA 1CUYA 1MX1A 2OCYC 3FDXA 4DUGD 3W5CA 4E4RA 3R9KA 4N0MA 3N39C 4NJMA 4R3NA 2QVLA 4TL8A 4G25A 1FMCA 2X2OA 5FBHA 5SZHB 2ZRFA 1PWZA 5AM0A 3ORHA 3QLUA 1OZHA 3DDNA 3PHBE 1DHTA 1Y6FA 5E3IA 1IJEA 3LK7A 3EH2A 3ND8A 4ZDWA 4ABYA 1FS4A 1Z82A 3B5IA 2QV0A 1Z74A 4MQEB 1RWXA 2VXBA 3TNJA 1TTTA 1RXIA 1DJQA 1SIOA 3LIIA 4OXXA 3SX2A 3GRCA 1JHVA 4H08A 4CG0A 1P6UA 2GAIA 1VKHA 2IWRA 4EBFA 2FPRA 4GYKA 1H6AA 3DMNA 1RXCA 2XUGA 3TJMA 1NYTA 1FW6A 2ZYAA 3HJUA 2XV1A 4ZEOA 4I7EA 1KPIA 4S35A 3RODA 3UT5B 2QMOA 1L4KA 3ELDA 2XNKA 1HEIA 3LUGA 3C4QA 2OBBA 2X8JA 1UOOA 4W5QA 2HNKA 4OBBA 5TEVA 2AUTA 4ZIRB 3CZRA 1J70A 1EA5A 4B46A 3MVEA 5FV7A 3WICA 5EJ6A 2QG4A 2W2KB 1XXLA 1H4SA 1JHPA 2H1SA 4FNGA 1RZRA 4URZR 4X1KA 2XD4A 2GN1A 1ZGGA 1BFUA 2B35A 2HMTA 2CB9A 2JVJA 3R7FA 4Q7EA 2OQIA 2OSBA 3EYAA 4FMCF 3TTXA 4CKWA 5AVJA 1ST3A 5LZ9A 3U60B 1FDTA 4DBLE 2HJHA 1ZOLA 3EZNA 1P18A 3ON5A 2CWWA 1KS9A 3HNOA 1BVRA 1N2CA 3F6CA 3LG2A 1CY7A 4O5OA 2BPOA 4TVBA 2IHNA 4PSCA 1E9RA 3EDOA 4DJFC 3MFYA 5LL6P 1LV7A 5EPOA 1BDJA 4B87A 3IESA 4OHFA 3I53A 1CIVA 3ZEIA 3OUUA 2R79A 1E7YA 2HA7A 3WK4A 1DRKA 1RNLA 4Z4CA 2RBEA 1FS6A 1TM5E 4DRZA 2G07A 4QXRA 1H2WA 3F1LA 4G4GA 4PC6A 3UWSA 1PSDA 4CQLA 2WD7A 2BEUA 2ZR9A 4K6KA 4G5RA 1MHPA 3NNSA 4RCVA 1DLJA 2EX1A 2XOKD 4PQRA 2X41A 1LVHA 2CEKA 3IQGX 4R9NA 1UJBA 4JP2A 1PLJA 2FRDC 1G5RA 4CYMA 4IMPA 2QD3A 2UUOA 1KSHA 1R8JA 1NT2A 4MRAA 4ZTUB 3RJMA 4FR2A 1MHTA 4ZQFA 1EVEA 3DEIA 3WYCA 4D9BA 1QHHA 3KZOA 4KYUA 5C4GB 1G1AA 1QRAA 1DAEA 4LZLA 6AT1A 3VNAA 1UADA 2Y9MB 2ZBPA 3OCJA 4R8MA 3WMXA 2JFNA 4IDQA 2I3GA 5CFLA 1LPNA 2KE5A 2QRPA 2CYCA 1FTSA 2H1VA 2JHAA 3I2FA 1Y5IA 1V1MB 5C3UA 3TRJA 2QSJA 2QSUA 2ZCVA 3ZN2A 2QBYA 2JNWA 1RFGE 3CGWA 1L2TA 3PQDA 1QWOA 2FZ5A 2YFYA 3Q98A 3VU1A 1DHRA 1AIPA 1UZMA 1ZITA 2IDMA 3BIFA 3FF4A 3KV1A 3M2PA 4INOA 3S2EA 2ZSEA 3VH3A 1II0A 2MR5A 1KJIA 3DNMA 3DVQX 4W6QA 1OX6A 1P9LA 3EEYA 1OCEA 3DQZA 3I34X 3L05A 1SO8A 3P45A 3R3YA 3VO9A 5IF9A 3RGGA 3I39X 1ZXBA 3OBIA 3PC8A 5EN4A 5EMMA 4CCWA 1GNVA 3EVEA 5CP8A 3VAYA 4XWAA 4GVLA 1J2RA 3CKKA 3P2JA 1C7ZA 3FJYA 1L7DA 3L4SO 3VV2A 1Z18A 4YAGA 3NHFA 2VNHA 2XUDA 3A6DA 3AR7A 1W0KD 2POQX 1B41A 1E3WB 4JFRA 4CM3A 4ZI5A 4MI6A 5EE3A 5HA5A 2BFFB 3LQQA 1KO5A 3BB3A 1LW7A 4OI0A 2ZDQA 1L1EA 5LR6A 4TVKA 4M53A 5AKKA 3C3YA 3PZBA 2OO3A 3FZNA 1DQRA 3BXZA 1ETUA 2IYOA 3OF2A 4TM7A 5EXTA 1OZAA 4CQMB 3FOBA 3GLVA 4RDIA 5IBPA 3ZJTA 3IPAA 1U04A 5IYZB 1BXGB 1K6EA 2J6CA 4L75A 3KV3O 5EIFA 2CB0A 3B1JA 1DBWA 4ZICA 4OTZA 5F3RA 4R7ZA 5BWNA 3N7TA 4EYOA 1YONA 5K7SA 5FPHA 1N6HA 4Z7JA 1BE1A 1G6OA 3HKBB 2G9NA 4BFXA 1ORHA 3NPMA 1ZONA 4IY1A 5LWHA 2Q3MA 2WT9A 4HBZA 5IBRA 2XSZA 1JAIA 1UXIA 3ZTTA 5MN4A 1SIBE 4N3NA 3FIUA 3TBKA 4RTRA 2IYTA 3R5KA 1PDOA 2IYXA 3W8EA 5JAOA 1QP4A 5JZ9A 1BEUB 1YQQA 4HEJA 4GYWA 4KJZA 4OQ4A 2ON6A 3JX9A 3UMGA 5BRJA 3MILA 3AF5A 4IV0A 1OV6A 1CUCA 1VGQA 1JQ3A 5IDXA 1YUBA 1USGA 5THQA 3H1AA 3AEUA 4FUQA 2IYVA 2IU6A 3JVVA 4NDZA 2CNLA 2ZIEA 3ZY3A 1RM5A 2XGGA 3IEKA 4XEHA 5G1NA 5P21A 2B1IA 2NTJA 1KBZA 1MTZA 4LYGA 1M66A 1A98A 3ZCQA 4JB3A 3TH5A 3T0FA 3E8SA 2GFIA 4BP1A 3GJ7A 1HT0A 3BHMA 1VP9A 3DWEX 4ZO4A 5B12A 2QTLA 3FG9A 3SJZA 2E5FA 3D2LA 2XKAA 3E6AA 2G63A 4OEHA 1OY1A 4KN5A 2GZDA 1NFQA 2KQUA 3NETA 5KSYA 3CZMA 3GA5A 3N6XA 2P2YA 3RS9A 2IBTA 2EP5A 3FUVA 3K6RA 1O2DA 1U94A 5JG7A 3Q40A 4KKXB 1JJFA 1JDBB 4CCAA 2XNHA 3KWMA 4G0NA 1G55A 4IZ6A 1P9WA 1HE2A 4GPBA 2RGAA 5EJIA 2Q46A 4YCSA 3MJVA 2I7TA 1OUMA 2G40A 2UVQA 2WKPA 3CMCO 3PE6A 4FZ3A 1L0BA 3QE2A 5A3RA 2BAGA 2JL1A 4OQYA 4PPQA 1UJNA 4PINA 4B84A 3ENNA 2CL0X 1TZMA 1H9AA 2IEBA 4ZHSA 4L7VA 4LZJA 5GONF 2VDOB 3A1VA 2NYVA 1ODKA 4FDMA 5LKAA 3DLHA 4P3KA 4FDTA 4BJ6A 4RVGA 2PNJA 1A8QA 1R50A 3WGMA 1SCDA 1I3LA 5HSGA 3AERA 2CJWA 3BWMA 4KN8A 1WSAA 5C7OO 5HRAA 4X93A 7YASA 1BE6A 1N2JA 3T1TA 2UZ1B 3IR5A 1Z07A 4G07A 4YUAA 6REQA 4YUXA 3H2BA 2I34A 4JP8A 3ELYA 1FVOA 3WGLA 1DBQA 4ZYYA 1T8RA 1XWWA 1KI4A 2AS0A 3SQDA 5I5EA 1JN0A 3PUKA 4M7OA 5I7VA 1JQAA 3OCYA 3ZDEA 2EJBA 4PXSA 5CLGA 5EE9A 3M4YA 1X86B 4KH1A 1NUHA 5HHTA 1FJXA 2GAJA 1YQWA 3A7DA 1FNCA 1LX7A 3I76A 3TCKA 4FB4A 3N6RA 2YWEA 2LZ0A 3QUSA 2CCGA 2QUAA 4QD3A 4RE5A 3TR5A 1T5LA 2X8LA 2DY1A 3DPSA 4QU0A 3R5FA 1S8FA 4HGRA 1V25A 2D3WA 3W79A 4EQ6A 5KTTA 4EGSA 2O2SA 3F8SA 4HADA 3R7LA 1DT5A 2PLRA 3PXUA 2HCRA 4WBNA 3UHPA 2Z2ZA 3MUEA 1TLLA 3VR6H 2V0GA 1U80A 3B38A 4NS4A 2ZFUA 2PBZA 3A1EA 3A3NA 4R1NA 4TL6A 3I4LA 1NE7A 1IRIA 3I6QA 3MRXA 3FDFA 4XDZA 4CLRA 1PHRA 4DB2A 2YHUA 1KZGB 1PS8A 3ZHXA 3VR4A 1Z5NA 4INJA 4EKNB 3ASUA 1OWOA 4Q66C 3BUSA 1G2QA 5DBEX 3O3NB 5F1OA 3OJLA 2R6AA 4CFSA 1U63A 1XVVA 1LV8A 3UJNA 4PYJA 3NBFA 3NGLA 2AWOA 1B1CA 1U9JA 3D7LA 4Q7MB 1V37A 1YVUA 3DL7A 3EXEA 1MOZA 3QMMA 4ND8A 5M29A 1GVNB 1SQFA 3ETDA 1TVMA 4OX9Y 1CRWG 1NIPA 1OB5A 3A4IA 3HFGA 5AW2A 2C1XA 1A97A 1FSSA 2P2DA 3D6NB 4BJ1A 2CF5A 1LC3A 3NFRA 3RK0A 5KIAA 4Z1OA 1SOMA 1XZMA 3RKUA 2Y68A 3LCRA 2B8TA 2M6LA 3GVHA 2V7EA 4I3FA 4TWBA 2OESA 5DGXA 3T38A 3RKRA 1VFPA 4TZKA 3SJAA 3BJIC 4ENRA 4PN3A 4A92A 2OLKA 1Z6ZA 4NMMA 4IFEA 3I9MA 5TS3A 1B4DA 1L4MA 1UH5A 1B7GO 1J8YF 1MAHA 1JAHA 3VHQA 5KNDA 1G8GA 4NQZA 5E3HA 1V3TA 4WBNF 5TEWA 1WV1A 4PRZA 2Y1CA 1ZMBA 1KFEB 2CSUA 1X74A 1G5QA 3ENQA 3FMIA 4M55A 2I7DA 4TPKA 3VR3A 5HP4A 2ZJ2A 1AZSC 1ISRA 4YRJA 1UWVA 2JCGA 2BHLA 4M1TA 3EEBA 5AI0A 2X8AA 4URVR 1NOJA 3OY7A 4D9JA 5F9HA 4CEHA 5AM5A 4Z1MA 4FIDA 3FNBA 3RH0A 3ZDDA 1UJCA 3IT0A 3PC4A 1KC3A 2WAOA 4Q7JB 4DSZA 3F67A 4COOA 4CBVA 1VPDA 3ZVMA 5C4MA 3H42B 4QOIA 4B44A 1A3CA 1XVUA 1YH3A 1LS6A 2BZ1A 4J9UE 5D84A 4YEDA 4GZ3A 2H1WA 1B8NA 3P2KA 4RVNA 4G9EA 4K9DA 4MVCA 4QUAA 3JQBA 4LJ6A 4Y2VA 4DDHA 4YX9A 3HVRA 2L18A 2WQZA 4UOQA 4WADA 1W34A 1WDMA 3ENWA 3TRIA 5JXJA 4ZAGA 4ZI7A 3A58B 4BQPA 4W5NA 1MA3A 4D3SA 5C4IA 1TM1E 1RMYA 1RRMA 1PJ8A 2O2XA 3AJAA 1C5KA 1I2ZA 2G5PA 1TW3A 3F6BX 1V4VA 5KJCA 1ZUNA 1ADCA 3COWA 3D5EA 3PIRA 3EG9B 3GROA 4JLMA 4KRGA 4ACBA 1VSQA 3L01A 4UU1A 1FDOA 3ORQA 5A2GA 3PQ3A 1QZXA 4H7KA 3HYTA 5CAEB 2FP4A 4RTNA 2D5IA 2ZRAA 3OJEA 1JF8A 2GPWA 2JA2A 1MO6A 4NAHA 3RRFA 3B3FA 5BQ5A 4EL5A 4GLOA 4JZKA 4WD3A 5K9ZA 3U44B 4N3CA 5EHNA 2YJ3A 5DP1A 4TKZA 1NDUA 4DZZA 3NMUF 3FCSB 1LZKA 4HN2A 2RH4A 2HPVA 1YQTA 4U7GA 5AJWA 3U17A 1ODLA 2I2DA 4QRIA 4HAZA 1G8KA 1KGSA 1OC4A 4RDCA 1NBEA 4ZA2A 4EUKA 4JKOA 2XMBA 3R7WB 5BSGA 3G5TA 4EHAA 3PLRA 3DEJA 5IZ4A 1PJQA 2GN8A 4G41A 2OT3B 3WLSA 4U7JA 1EK0A 2YVQA 1FU4A 2FK8A 3MNFA 4NJOA 4OL9A 4C01A 5ABPA 3MJCA 5JEDA 2WF7A 2PV7A 4KE6A 5DCLA 4ISCA 4BIMA 4YBZA 3SF8B 2OZEA 4NZNA 5IMBA 2VAWA 2G1AA 2E87A 1LS1A 5DGTA 2R6CA 4J6FA 2J8ZA 5FD8A 1HFEL 5EZYF 4F85A 3TCXB 2XODA 1Z63A 3RTCA 3UWDA 4DV1B 3NVAA 3CSSA 1WE2A 4PR3A 5DNEA 2W2PA 3D1VA 4KO1S 4HRVA 2FETA 2ZT7A 5JNRA 3CNOA 1T0PA 1JJIA 1NLFA 3T7EA 1R74A 1P4GA 2W2QA 5J3JA 1CV2A 1ND5A 1M2FA 3CEJA 3F98A 1MNAA 4J3FA 5C5CA 3BH6A 1Z3CA 2PS0A 4PYQA 1SHZA 2UDPA 1YZYA 2R4QA 5KYYB 3TDMA 3NV7A 1CUJA 3RYIB 4YJGA 1YK1A 3PGJA 1UIMA 2QD4A 4KGZA 1UKBA 4CGZA 1PYGA 2MR6A 3MWLA 1HEUA 3OFJA 4U1RA 4EPYA 2EJUA 4QFCA 2I8LA 3ZNNA 4R1TA 3FOFC 3MN1A 4DIKA 2LTAA 3FDIA 4MVJF 3ZS8A 1TGYA 2JFPA 3LI2A 4LY0A 3JTMA 4GH5A 4MPJA 2HHCA 2M32A 5FPQA 3TW8A 1X3SA 5JAHA 4DR5B 1YQUA 3DTVD 2F43B 2H2DA 3ZY6A 3GAAA 1XT6A 4MQFA 1NU6A 4BP8A 3CN9A 1BH2A 2PZFA 3BK7A 4JDPA 1OBFO 1NM5C 2P9YA 3O8BA 4AZWA 4UUMA 5JW6A 1H0HA 3QUQA 1VL1A 1LRLA 3DSRA 2JGEA 1S2GA 5ECWA 1M7HA 1YU6A 2BJHA 2PFKA 4XUEA 2F64A 3ZEAA 2XMPA 1V9LA 2AW5A 1DRVA 1I5RA 3HFJA 2I3AA 3S8YA 1X7XB 2VUTA 4QUGA 5JWHA 5E0KB 4GG1A 3RLFA 1QDLB 1G59A 1VM6A 2C54A 4PANA 4IILA 4URYR 3H5TA 3TEFA 2PBLA 3N2KB 2JJ8A 3WWDA 5I7EA 3PWKA 4G0UA 2HMYB 3DTTA 3FKJA 2CC2A 1GSIA 3PA6A 3D7KA 1XZQA 3L4EA 3V8BA 3AU9A 4EVRA 1J0XO 2BUAA 3C2QA 3T15A 3V1TC 2R1TB 1GDDA 3KXKA 1RIFA 1E3DA 2P0EA 4O2RA 5I3ZA 3J81A 1TA9A 2IYEA 3AU8A 2O0HA 1WHSA 3KE9A 4Q3NA 3OWXA 3RC3A 1TC2A 5AH0A 3V5NA 5FHRA 5IM5A 1KK3A 4NCNA 2HPHA 1XF1A 4DSAA 3TK1A 5C1BA 2V3WA 2R66A 2DHCA 2OB1A 4AZ0A 3SC3A 1N2CE 1K7XB 1XC7A 2XE6A 3I6ZA 3MERA 3N8NA 1AHNA 3EGXB 4C0JA 4D57A 2WTNA 3AM3A 2FFQA 5A4IS 1PX0A 3OLVA 4BECA 2HQOA 3WAGA 2EW1A 3RRMA 2X0RA 2YR0A 5E6UB 5LNK1 5EFOA 3RAFC 1YO6A 3T9AA 4FR5A 3WSVA 3R5JA 4EATA 4FZVA 1O9HA 3A6FA 4XLZA 3TUZC 2PS1A 3V2GA 3HUDA 1VI2A 3E4DA 1V6AA 1AGRA 3GUYA 5KC9A 3ZHOA 1A9TA 1QAQA 1A9YA 1NUPA 3FJ1A 1WEKA 4RTQA 2OV1A 3VISA 1Y4ZA 3STXA 3V1KA 2EL9A 4P80A 5DZSA 3ZLTA 2OORA 4QEKA 4TYWA 2NO0A 2AXPA 2CLSA 4ALJA 5C8ZA 3WS7A 5CB6A 3DE2X 2NO7A 4C30A 2J4DA 2Y1XA 4EG6A 4J0DA 1N7JA 1HETA 1YOVA 4YRAA 1ESEA 1XVAA 1FMTA 3QK7A 2EWWA 2VJMB 3HNPA 1IB6A 1T0IA 3I6BA 5FO0A 3SYKA 2QZPA 5G2OA 2ZWIA 1CUXA 2ZREA 3MRVA 3R3JA 2ZROA 1TPYA 4GR4A 4Q6BA 3T5BA 4QDXA 4FFSA 2Z2IA 2GB4A 2XA2A 4G24A 3E15A 3B6JA 2REXB 4TKUA 2B82A 5GGYA 3WDMA 2R68A 2R7KA 4YJ2B 3COJA 4ETIA 5A5GA 2I55A 1JYSA 1XQ1A 3JYHA 3VR5A 4ZYWA 5ALNA 1OPRA 4NARA 4CF5A 1AOXA 1GAQA 2FLWA 2JFFA 3PDHA 1I10A 2BGLA 3VVBA 4C76A 5DYWA 2GJ8A 1V43A 4MR8A 2R1VA 3V4PB 4HN4B 4UTNA 2FPKA 5DGDA 5AJVB 3JYLA 3K5PA 2XRZA 1MEOA 5I9MA 1GTG1 5KS2A 2HO5A 2GI4A 1CE8B 3VPGA 2YYZA 2WJ4A 3LDHA 3ZWKA 3TLBA 4DBVO 3I9V6 3RYFB 1GL6A 5K4HA 2L19A 2JGAA 1DG9A 1BWPA 3CWQA 1TAQA 3H16A 2VHUA 4G67A 5ALZA 5E8RA 3E1KA 4KTTE 3O8CA 2YFQA 4K3VA 2G88A 4B35A 3EHEA 5C37A 1TRHA 2C5GA 4UBOA 5YASA 2BGGA 1KL7A 3RS3A 4YCNA 3TCNA 1Z33A 5JQGB 3TI9A 2I7VA 5JD4A 2VHYA 4S1VA 5EMHA 1A8IA 2AEFA 3U9LA 3PEVA 4MWDA 3LX5A 4W1RA 5CLLA 4ARUA 1VI5A 1FRVA 2V0CA 3C4VA 4YDSA 5JCJA 1XN1A 1XQWA 4LJSA 2WU4A 1W48A 1CF9A 2J3EA