2QZJA

Crystal structure of a two-component response regulator from clostridium difficile
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
121
structure length
121
Chain Sequence
QTKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNVTTCPIVYMTYINEDQSILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Two-component response regulator
publication title Crystal structure of a two-component response regulator from Clostridium difficile.
rcsb
source organism Clostridium difficile
total genus 43
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qzjA00
2WMYA 2QVCA 4RK6A 3SAJA 3CU5A 3L6UA 1U0SY 1P2FA 4YV7A 1IIBA 3OLWA 2DRIA 1DRJA 1GCGA 2FMIA 3C3MA 3OMXA 4LX8A 3UUGA 4DQDA 4N47A 1ZAYA 4Z4FA 1DCFA 2M1ZA 4P1ZA 3F6CA 4MYRA 5JS2A 1QO0D 1Z12A 1USKA 2P4UA 1YMUA 3JPWA 2RGYA 3LOPA 4GPAA 2MYNA 2WY2D 2B1JA 2QZJA 2R25B 2R47A 3OO1A 1YVUA 1PHRA 3KTOA 3GBPA 3HCWA 4O1IA 3JVIA 2CHEA 4RKQA 1D1QA 4E7PA 4KRFA 2JVJA 1E6MA 4RK0A 2ZAYA 3RVOA 1ZGZA 1D1PA 4YR7A 3OQOA 5HM6A 4G0ZA 4D6XA 1YIOA 2FEWB 5EWLB 1F4VA 5FWYB 1E2BA 2PLNA 1JYEA 1XWWA 4P98A 5B3JC 4CBVA 2FEKA 1D2AA 4LRQA 1QP0A 1H9CA 5JNWA 1EWTA 5T3YA 3DGFC 1USGA 3KYJB 4PICA 5FBHA 1LBIA 4G86A 1XHEA 4EYOA 2HJ9A 2H3HA 1DG9A 1KMIY 2JVKA 3Q41A 1NXPA 4YCSA 4Y9TA 4NQRA 3RVJA 1U2PA 2IPMA 2M98A 3HV2A 1MIHA 1SRRA 2QU7A 1GCAA 3JS5A 2IOYA 2L2QA 2WB4A 2IYNA 2J48A 2P9HA 5ABPA 2E4XA 4MR7B 6ABPA 4N41A 3QEKA 1DBPA 4ZJPA 4ZMSA 4EVRA 2N9UA 3QELA 1QP4A 3QELB 3F7NA 4IILA 3Q9SA 4RKRA 1Z17A 1NXSA 3LUJA 1OXBB 4YO7A 1JF8A 3LUFA 4KQCA 1QNLA 3RVSA 4WXMA 3H5WA 1GUBA 3OM0A 5TPWB 3RVQA 4F06A 4MS1A 4FB4A 2VYCA 2GBPA 3LUGA 3A0UA 5IX8A 1M5TA 2JK1A 3TMYA 3VNBA 3N0WA 1JDPA 3G1WA 5EWMA 4YWHA 3H5IA 2FMHA 5EWMB 4S04A 5JNRA 1SD5A 5DGCA 1DP4A 3KSMA 3O2QB 2FQXA 2JB9A 2QV0A 5TQ0B 1QQBA 3A0RB 3O21A 2CD7A 1K66A 4G0PA 4MR9A 3RVKA 2LIVA 2A9RA 3LUKA 3CTPA 3KHTA 4KK4A 6CHYA 4Z4CA 5BR1A 3GWGA 3LUCA 3S99A 3KJXA 3JPYA 2YHBA 4ZPJA 3KG2A 4NV3A 3N0XA 3E3MA 4B09A 1YK1A 3MYYA 4NCBA 1CYEA 5FBKA 2FN9A 4YRZA 1RXEA 2IKSA 4KVFA 4WXEA 4E7OA 1YS6A 3LFTA 4EVQA 4Z99A 3QLUC 3HXMA 1ZESA 1Z18A 3H6GA 3QEMA 4L4UA 3M9WA 4LE1A 2W42A 3N6VA 1TMYA 3EJWA 3I09A 2PUEA 3EDCA 3HUUA 3H6HA 3C6QA 3A10A 3DZDA 3IP6A 4KK3A 3MQ4A 3DLHA 1JLKA 4TMYA 1T34A 1JDNA 3O1JC 4LE2A 2Q5CA 1SXHA 2QXYA 5DLEA 3IPCA 5KQGA 3VNAA 2RJOA 3T95A 5T7BA 3LUHA 4MS4A 3BRSA 3TD9A 4F8JA 1U04A 1EFAA 2OQRA 3H1GA 4F3TA 1CEYA 3Q7TA 2VK2A 4ETIA 1A2OA 1EWKA 3OM1A 3EGCA 2HSGA 5HKOA 2XDYA 4N0PA 1DZ3A 2IPNA 3P9YA 4MR8B 1P6QA 4KREA 2LUOA 5IBQA 1QKKA 3O1HB 4WWHA 1YS7A 4MPTA 3T6KA 2FQYA 2HQRA 2PL1A 2FTKE 4F12A 5D2CA 1JX6A 3EAFA 4RDCA 3FMVA 4N03A 4FE7A 3ILHA 4FE4A 1ISRA 2BGGA 2HPHA 2MYPA 3NHMA 1P8AA 2A9OA 2MSWA 1Z2DA 4Z9BA 5HQJA 4N0QA 2PUCA 2MSKA 4W5TA 2X7XA 3KLOA 3Q15C 5BQ3A 2NZVG 2R4QA 2FMKA 1HEYA 3OLXA 1JYFA 3H75A 3HUTA 2PUBA 1NXVA 5CNIA 1M2EA 2ID9A 4W5NA 3FDFA 3QX8A 5EWLA 5FWYA 3CFYA 3M6MD 2JVIA 3MF4A 4JOQA 4QICA 4ZYLA 2LBPA 4LDZA 1JWLA 3IPAA 3T38A 1RZRA 3RVPA 2A9QA 3QX9A 4RK1A 5JS1A 3BREA 1RXIA 2NUBA 2FEPA 1JFSA 2PUGA 1DCKA 4RK7A 4XLTA 4HNSA 1Z26A 3C3WA 2AYXA 4JP1A 2FMFA 2FQWA 3UKJA 2PKXA 4W5QA 3SY8A 3D8UA 4KV7A 2FXIA 3TX6A 4MLCA 1ABFA 3OLVA 3RVRA 2MSLA 4KQ9A 1C4WA 1C0EA 2PAFA 4DN6A 3DLBA 4TLLB 5EWJA 1PNTA 3F73A 5EWJB 3I42A 2VUHB 1JBEA 4D6YA 1M5UA 4OATA 3T8YA 4JA2A 3CG0A 4MR7A 1DJMA 4MRMB 1Z15A 2E4UA 1NXTA 4TLMB 5TQJA 3CKMA 4MS3A 4RK5A 4MS3B 1PEAA 2CWDA 2NZUG 3MMNA 1Z25A 2IPLA 5FWXB 4MQFB 1W9HA 1FFSA 1QMPA 3OQMA 1L5YA 4H3KB 5TPWA 1J56A 4RS3A 4EUKA 4PE5B 2E4ZA 4QYMA 5IUNC 5I4CA 4O1HA 1OXKB 3H1FA 1SXGA 4Z9AA 1K68A 3DBIA 5JNSA 3DGEC 1KRWA 4ETNA 2QVGA 3IP9A 1ZY2A 3C97A 5TQ0A 4RWEA 4Q7EA 3SQNA 1TM2A 4TN5A 1TLFA 2YHAA 4EYQA 5DTEA 5PNTA 2L17A 3CS3A 1ZITA 5KI6A 1JFTA 3CG4A 1ZH2A 1Z13A 1M2FA 3UK0A 1FFGA 1MVOA 5B3JA 3SM9A 1CHNA 3N0RA 4IRXA 3HJFA 5TQ2B 2IDMA 1Z2EA 3HM9A 5TE9A 3HK2A 1FSPA 3E61A 3GRCA 1JL3A 5CHYA 2F8SA 1BAPA 3OLYA 1L5ZA 3OLZA 3URMA 2NT3A 3OQNA 3A3KA 1RNLA 3RQIA 1VLZA 2GWRA 5TPZA 2LPMA 4KFCA 4HNQA 3KLNA 4GNRA 4RU1A 4H3HB 2QSJA 4PYRA 5KWSA 1A04A 4RV5A 2PE5A 3CRNA 2ZWMA 3I5AA 4EGSA 3H5TA 3BRQA 4XASA 4W5RA 3TO5A 5C5EA 2E4YA 2FKAA 2FN8A 3NNDA 3EULA 2WJAA 2WRZA 1D5WA 3R0JA 2FW0A 3QK7A 1B00A 4JB2A 4IF4A 3SG0A 4XXHA 1YTUA 2QW1A 3CHYA 3H5OA 1S8NA 4RXUA 2JBAB 3EODA 1AB5A 1ZGGA 1GUDA 1VRVA 2PMCA 4KZKA 5KQPA 3RVMA 4EYGA 5KC9A 5BRJA 1GLGA 3EQ2A 4MR8A 1JFVA 2RJNA 1ZHHA 3QLTA 2PUFA 4KNYA 4F11A 1QO0A 3H5LA 4RK4A 1TVMA 4M88A 4L85A 1P6UA 4OLBA 3GBVA 3Q7RA 1YK0A 1MB3A 1YMVA 4WZZA 1VKRA 4YS6A 5BRAA 4EVSA 3KYIB 1W25A 3RVLA 3SNKA 2QR3A 1MB0A 2GI4A 4RY9A 4NICA 3MA0A 3HO1A 1SXIA 1LK0A 2E4VA 3GV0A 4RY0A 3IP7A 4YGXB 1FFWA 5KC8A 2FLWA 4XAQA 4LZLA 1D4ZA 2MYTA 5IULC 3BBLA 4G0OA 4Q6WA 3GA5A 2ID7A 1PEYA 3MM4A 1AB6A 3QLUA 3JVDA 3N53A 4WT7A 3ROFA 2L18A 3K4HA 3L49A 4OTZA 1MAVA 4D74A 1ZVVA 2PJUA 5DKFA 1USIA 2HQBA 3HSYA 1UDRA 4JAVC 2H0AA 5E3JA 2GKGA 1PNRA 1RPJA 3IP5A 4KMRA 1DBQA 2V0NA 4MAAA 1WETA 1E6LA 3BILA 4MGEA 3QLVA 2PUAA 3HZHA 7ABPA 1EHCA 1I3CA 3LKBA 4H60A 1Z16A 1KRXA 1BDIA 2PUDA 3HEBA 5GOTA 3H5VA 1LJLA 4XARA 3C3KA 4Z4EA 5IUKC 5JNTA 5JNUA 2JCGA 5ED4A 1XHFA 1NATA 8ABPA 3NHZA 4EY3A 5KQMA 1Y1LA 3O75A 2WJWA 4MRMA 4UHKA 1QP7A 1ZH4A 3IDOA 2KYRA 1R8JA 3LUDA 2HQOA 3D02A 4G0QA 4ETMA 3FFWA 4O5AA 5FWXA 4MQFA 3M9XA 1BDJA 1NXOA 1NY5A 1NXXA 1RZRD 4OLAA 3JTEA 3LTEA 2F8TA 1BVHA 3O74A 5JNVA 4IMIB 2PL9A 3EQZA 2IPAB 4KPYA 1EAYA 3LMKA 4UHJA 2MYUA 3KKEA 5KQLA 3O2JA 3W9SA 1ABEA 4G0YA 4PZ0A 5IUJC 4DADA 1URPA 1APBA 3HVRA 1DRKA 2B4AA 4PEVA 3CZ5A 3GT7A 4OBBA 3ILYA 4N76A 4OG2A 9ABPA 4JB0A 3HS3A 4ZMRA 2WWVD 3OMWA 3G85A 1NTRA 3B2NA 2FSPA 2NT4A 1ZDMA 2E4WA 3O2SB 5IC5A 5TQ2A 3KCNA 1VPWA 4MS1B 3K9CA 3LUAA 4EYKA 4IMJB 3RH0A 4XFKA 3N8IA 2L19A 1TJYA 2OENG 3I45A 4G0XA 5DCLA 4Z4IA 1DBWA 3ROTA 5CNKA 1ISSA 4MR9B 4JASB 3GYBA 4QYWA 5IEJA 3FFXA 2FLKA 3CNBA 4LDAA 1KGSA 3FGZA 4MLDA 1E6KA 1A0OA 4YP9A 1BDHA 3CZCA 4MQEA 4WUTA 5HSGA 4MQEB 4QPJC 2I6FA 1LJUA 4RSMA 5C5CA 3N75A 1QQAA 1QPZA 4Z0NA 4S05A 4RY8A 2LP4Y 1DCMA 3NNSA 4RXTA 2CHFA 5IEBA 1DC8A 2A9PA 4NCAA 1NXWA 1BA2A 3QEMB 2JBAA 2GX6A 3HDVA 4LE0A 4Z4HA 2JRLA 3NNNA 4G0MA 3H1EA 5CNMA 1U2QA 1PUXA 5F64A 5CNJA 3JY6A 1ZN2A 1EWVA 3MIZA 4Q6BA 2O20A 1FQWA 5TPZD 3F6PA 4G97A 4HYEA 1U8TA 4W5OA 3O1IC 2R48A 3HDGA 5GQSA 3CLKA 3NBMA 3QLVC 4RXMA 3KS9A 3TB6A 2AYZA 2FVYA 1LBHA 1JH9A 2VUIB 2TMYA 1DC7A 3FFTA 4HNRA 3LKVA 4YLEA 4MS4B 3RVNA 3Q7SA 1JHZA 1F51E 4IGAA 4ML3A 4Z4GA 3GL9A 3OO0A 4RZSA 2RDMA
chains in the Genus database with same CATH superfamily
5JYBA 1U3VA 2ZYDA 3AONB 3ONWA 2IHYA 5C1IA 2ZPTX 4UZEA 1OASA 3BGDA 1CY6A 3OFJA 4K7JA 1WU8A 4YROA 4D82A 4FGKA 1K0UA 3ZHOA 4MGYR 4FGSA 3ZOKA 1ST3A 2NXWA 3UUGA 3UXEA 5JDCA 1RU3A 1FBTA 2FWAA 3KSAC 4LHEA 1CY8A 3IT2A 1HKUA 4NJOA 2HXSA 4JVSB 3WGZA 5C32A 1DCFA 2CLFB 1G8KA 3QG5A 1BQEA 2WJGA 3JPWA 4XUDA 2JHFA 3S1SA 2EW2A 3PNPA 1KMHB 2P9CA 1FXWF 2LWIA 3RJTA 4DCOA 3FLAA 3QUCA 1S2IA 2ID4A 3KEMA 4YRFA 3ZLTA 4BIMA 3KJNA 1FUYB 3WK6A 1Y7PA 4ZGWA 3BOSA 4CN9A 3BIXA 4FQ7A 1E7MA 4X5OA 3H2KA 1RAHA 1E6MA 1TTHA 2AR9A 2XAUA 2OVBA 3L1IA 3NOQA 2Y0BA 3GVXA 5KSPA 1M1YA 1C0PA 3VNBA 1HA3A 1PYGA 5AHKA 3KHSA 3KEQA 3I64A 4FDLA 4FI3C 1OJ7A 1L5NA 3UGJA 1K8XB 3MB8A 4LRQA 1MX9A 4IOLA 1RYDA 5CIWA 1DL5A 5HG0A 3T5CA 4AJKA 4UAVA 1BFUA 3GB9A 1SXQA 3WBFA 2TMKA 3Q8WA 2JLRA 3SSOA 2NP6A 2K4MA 2YV1A 3SYRA 2Z1NA 3KWLA 1AE1A 5AM5A 3BJRA 5ELMA 2W00A 1EFPA 1DUVG 4O3MA 2HO4A 3G2LA 2WSBA 2OQVA 2J48A 3P26A 4TYPA 4MHTA 2YCBA 4ZMSA 4EJ2A 3PNBA 2J9RA 4Q3AA 2N9UA 5CFMA 5JYEA 5KNDD 2WIAA 1UKEA 4S1VA 3GDHA 1OZ0A 1ZU4A 2EWMA 4JBGA 1J6UA 4DTIA 3V4ZA 1QH1A 4AB1A 4MQLA 2ZGVA 5HIIA 5FJJA 1VIDA 1YDHA 2OSVA 4UBLA 1GYRA 2JLAA 3ICQB 1S3IA 1J09A 5F2EA 1ZJ5A 2HU2A 3WBBA 1RC0A 3H05A 5KJ6A 4RHUA 1UZLA 4PHHA 4Y0NA 1D4FA 3G79A 5EWMA 4U8GA 5KWEA 1YHYA 4S04A 4M8KA 1VL8A 1XEFA 3CE9A 3B1WA 1F17A 3MD9A 3BIFA 3PQ5A 4FHEA 3UK1A 4RADA 1SKBA 1CUJA 1TZMA 2FQXA 2ECPA 1ZK1A 3L7OA 2PH7A 4U2GA 3MT0A 3NEPX 1F2DA 1SEVA 3W4IA 3KZNA 4C01A 1B6RA 4GD3Q 4AYWA 4P3KA 4IXMA 4Z6KA 4URVR 5FEMA 3DLTA 3OY2A 1W88A 2FYTA 2AUTA 2XVMA 4LN1A 5FPQA 5EFZA 5BPFA 5JO0A 4MJXA 5L95A 4YRLA 3V1MA 1TK2A 1C30B 1XJWA 2B82A 2DWQA 2NTEA 4LY9A 2FG6C 1Z82A 3G68A 4OU5A 4NCBA 3RAGA 2ZSBA 2Y05A 4KRXA 4EY7A 3JQ8A 3PF8A 4GR5A 3KOMA 2VJYA 4R5MA 2P2ZA 5GZ3A 1QHGA 4G1BA 1YE3A 2P9JA 3TVTA 4ZVUA 2WUGA 1EDEA 4A4DA 4LF5B 1ISGA 4F85A 4Y6PA 3U37A 4LWZA 2RD2A 4YAJA 3MGGA 3CEAA 3W2FA 3AK4A 4FX2A 3PE4A 4LC1A 1TGVA 2G1JA 2CY0A 3U0BA 3DZDA 4WL0A 3DLHA 4YECA 3IQGX 5U9CA 1IJKA 3TIVA 1EQUA 2PVSA 1V9CA 2XDWA 3PE3A 3DQPA 3ZWBA 3A7DA 2ZVQX 4QQNA 2YWRA 4H6VA 2CVFA 3OD5A 3M5CA 3BHMA 4E5PA 1WIWA 5IN4A 2VP2A 3M4ZA 4UQOA 3C43A 3LUHA 3OIUA 3WNBA 4LNUA 3RSFA 4CQNA 3EGDA 3T1VA 4CGYA 3S3TA 4DR3B 1ZICA 1J5PA 3PL5A 5SY4A 2WR8A 1E3WB 1NY6A 3FVQA 1PX2A 2B99A 2O3UA 3DTTA 3I9JA 4P4LA 4JJGA 4PNHA 5H80A 2UKDA 1DJPA 1UXHA 3QV1A 5I47A 1EX1A 1KY2A 4F6CA 1G3RA 1SURA 2DUUA 2VAPA 2DPYA 4O2LA 5CM9C 3RD5A 3FG9A 1M8KA 1QKKA 1U3UA 1XZKA 5IW8A 4LWPA 4XIGS 5JSHA 2F3UA 1G5RA 2P90A 3U26A 4RZ3A 4DQXA 1RW4A 4MWZA 1JHDA 3INGA 1KH2A 4DUGD 1WSAA 1DTSA 3RU9A 3IMFA 2WICA 1ZN7A 1ULZA 4F2HA 1HDOA 1PZFA 3MBKA 5KX5B 2A9OA 1JSXA 2H63A 1GQYA 1B43A 2N75A 4JOSA 3JQQA 1XYGA 2CBZA 3QVGA 3R5TA 4F84A 3THYA 1QF7A 1IOVA 5K2MA 3U5TA 3ZV3A 4MB2A 2QMZA 4O4IB 2NV6A 4OMUA 1I1NA 4XDHA 4OQYA 5HCUA 3SEAA 3ZVMA 1UQTA 3FDFA 3LVFO 1E62A 1EWRA 3MF4A 3H4TA 4QICA 4AX4A 5E1OA 5CDTA 1XL0A 3N2GB 3JCZA 4ZV4A 3PBKA 4NPAA 4V38A 3FOEC 4GKJB 1M1YE 1VL2A 2HRBA 2J5XA 1XAHA 1X7DA 2H1RA 1PSZA 3FYUC 3IPLA 1P91A 2WSIA 4IBOA 4ALNA 1QO7A 3QPVA 3LHDA 3GAMA 1W1IA 3O5AA 2I2FA 4H2DA 3LA6A 4J3NA 3VTFA 4BMNA 1Z26A 3EA0A 1RLIA 4R0NA 4KR0A 2PEYA 4XX0B 1QG4A 3K6RA 5H3CA 221PA 4NHEA 3U3RA 3KT8A 3HB0A 4BP8A 1UK6A 3OIGA 3U80A 1U3DA 1L4HA 4DQUA 2JDIA 2WTUA 2EAUA 3LPMA 5M29A 1JRLA 4L51A 1KQNA 2CJWB 3UAOA 1XLTA 2AHOA 1X2BA 3DBHB 3JYNA 3FDXA 3IO3A 2OY0A 4JA2A 4LXIA 3MWYW 1ZD4A 5DRTA 1QNFA 1T3ZA 5H1YA 3A11A 1AO0A 1LV8A 2VDJA 4FHDA 5F2NA 2GASA 3LL7A 1W85A 1Z0AA 3O38A 4O2AA 4GBMA 4QJ4A 4W99A 4OQMA 4DV3B 5ECWA 3KVNA 1VZ2A 3BFVA 4XE5A 2JFOA 3DMGA 1XZEA 1Y7LA 4WINA 1A2BA 2O57A 2OQ2A 3H8WA 1HEIA 3TLGB 3ZDZB 1I6LA 5DCWA 5JY1A 4URXR 4BV3A 1DKPA 3GPDG 1W36C 1FLAA 4IVQA 4YX9A 1KS2A 5AKJA 3AKYA 1G8JA 3BWDD 2EV9A 4YJ3A 2GR9A 4HSEA 4UEKA 5ALLA 2CJYA 5TQ0A 2ZRQA 1FP1D 3HB7A 4HQLA 1JEYA 1PS0A 3P9KA 2HHCA 1TLFA 2P62A 4OLHA 4ZQCB 4B4VA 1JQBA 3LCVB 2BMJA 1EM6A 5LYJA 2VPXA 3M5WA 4FBMA 4LFCB 2O3TA 3R7WA 3ASUA 1C3OA 2OXCA 4IEIA 2AG0A 5E2IA 3S68A 1G66A 3JWJA 3WK5A 4QHSA 4TUYB 3OFNA 1VG8A 4Y1RB 2JAXA 3LBYA 4GSLA 1JDBC 1QOZA 4Q47A 4PNPA 2IDMA 4U2FA 4X65B 3FPHA 1NT4A 2GXSA 1I2CA 2R8YA 5K4GA 2Q8QA 3NHLA 3OPYB 4QJIA 3C4QA 3HJBA 2QZSA 3I2FA 2IS1A 2R0QC 5DASA 1GJRA 3SPXA 1F7VA 4OJMX 3OLYA 5J5CA 2K5UA 3HWSA 3A3KA 2ZDHA 3IR5A 1VLZA 2I9PA 5DGXA 4ENPA 3NDBB 2OG2A 3I32A 3S40A 5LQRA 4IIYA 5DK6A 3W7BA 2QD1A 2PQ6A 4ZO7A 1H42A 5AESA 4CR7A 3D4BA 1YNOA 3JX9A 1PGPA 1Q3TA 2AF3C 4KXXA 3Q88A 2W2XA 5H68A 3HUFA 2LW7A 4DA6A 1NKSA 3PI6A 5FBVB 1Q7GA 1V7ZA 2FKAA 3HDJA 1WWKA 3PPYA 1S7CA 1NVAA 2VR1A 1L4LA 4RETA 1PQYA 4C43A 3UFXA 1CJBA 4P8RA 5LP6B 1GU7A 1NNEA 3LG2A 4JDUA 4FKZA 5I7SA 5BWMA 2O5CA 2BFEA 4KRGA 4D9NA 1RJFA 3S5UA 2PMCA 3IV6A 3S28A 3OQVA 2RHOA 3WQQA 1HT0A 2OBYA 3RJZA 1QFZA 4B35A 4E12A 3ICCA 5DE3A 1E3IA 1UJCA 1V3VA 4D8VA 1V4BA 2X8AA 1BWRA 4GC9A 4AJOA 3B1JA 5HUJA 1VIAA 1I51A 1IB0A 4DLBA 3EG9B 1I0IA 3FGOA 5IYZB 1YIAA 2EX0A 4RACA 3EGXB 3LPLA 1U5CA 1QIGA 1YR7A 3DTVB 1FPQA 3FJOA 3GXOA 3NWJA 4TTJA 1A4RA 2OGUA 1A27A 2GBGA 2DSNA 4DKXA 5CGQB 1O95D 3ZQ6A 2PHZA 4U7TB 4RGYA 4L6CA 1EESA 1Z33A 2HMTA 4QBKA 1FFWA 1NRWA 3E0XA 2NU6A 5DP2A 1D4ZA 5IRCD 10MHA 1R5OA 4KU4A 2OB2A 1EP3B 3VOSA 2I4IA 1W5EA 2PQ2A 1RPAA 3G5LA 1KAMA 2BMVA 4H1WA 2L18A 3FM9A 4TWAA 4U1RA 4QG3A 5ICGA 5K4HA 4OA5A 3EC7A 4G8JA 3ZEAA 3PGXA 1B93A 2PJUA 2EG9A 1PR3A 2C96A 3B85A 2QTLA 3NATA 5DN6A 4PO3X 4A0GA 5CG2A 3EVGA 2H0AA 5IHXA 2DPMA 3TAXA 1RQNA 2GAFA 1XVVA 1Z9BA 2HIGA 2IYZA 1NQ5A 5DBIA 3W3AD 5D1NA 4AW9A 5EG5A 4L2IA 4I5FA 1HDCA 1IK4A 1V5GA 3FJYA 3BAFA 3ZHRA 1H8HA 3M83A 1Q92A 2XYVA 4XDYA 4C78A 4XARA 4YV2A 1NVXQ 2J3MA 1YBFA 5JPIA 1HZZA 2ATEA 3IHLA 3QPDA 3D3WA 3QUBA 4HDNB 1M1YB 3Q3VA 1SGWA 2PSHA 4I9GA 2OT3B 4RZUA 2IJGX 5CT4A 3RVBA 2DB3A 4YT4A 2KYRA 4GOND 1IMOA 1X70A 1KZ4A 1Y8CA 3B7GA 1H22A 3B9BA 3LUDA 5EMNA 4D4GA 4O5AA 3WGGA 1PZNA 2VSOA 1K8QA 5KYVA 1JWBB 2FPOA 2DFKB 4FUTA 1LFDB 2KJQA 1AN9A 3MJFA 4RIGA 1YKGA 4YAOA 5GAJA 2O8VA 5FA6A 4DZZA 3B89A 2VHYA 3LNCA 2LV8A 4JLKA 2C2XA 4ZAXA 1EFPB 4H4CA 2XT9A 3ET4A 2JL1A 3OAAD 4MRPA 1CY7A 4XI9A 4TLDA 1CR1A 5KDLA 4BNGA 5SICE 3DL0A 4TZ0A 3IP8A 3AKZA 2M6SA 3KSRA 1P2GA 2HA0A 3H83A 5KBYA 5C3MA 2D7DA 5JFOA 2J5KA 2Q4TA 3RT7A 4C3UA 5FORA 2ONZA 4HXGA 3RT1A 1S2GA 4EI8A 1YL5A 1RAIA 4IUBS 4EUEA 4PZZA 1X39A 1QYXA 2FDXA 3R7FA 1QH1B 3OCVA 4ZGBA 4YPVA 1N2XA 3FDZA 3PJDA 2FWIA 3BFPA 4LV6A 2QLBA 1MJ5A 3DMDA 1QZTA 3EIXA 4TRMA 4Z7OB 1WVIA 2AN4A 3OQBA 2OPBA 3BTUA 4ZOEA 4IINA 1NF3A 3L7MA 1ZC3A 4HPJB 1RJEA 1AKTA 3E35A 3GFSA 1U8AA 3NHRA 1Z6YA 5EKSA 3I1YA 1TJYA 2WUWE 2WJYA 2EZ9A 1NKTA 2ERCA 2QA5A 2O4UX 2Q62A 5JJBA 5KO2A 3ZD6A 1G16A 2HD4A 3C8UA 1XDBA 3PD1A 2ONCA 4FMCB 1NQTA 3L05A 4WY2A 4KXQA 1MO4A 4R2HA 4MI3A 3TR5A 1QTIA 4PHTA 2NVWA 4Q18A 1YR8A 5ALWA 2A8YA 4OFXA 4A0HA 1AHNA 3DMPA 1A71A 3IV9A 2V7EA 1W88B 3LUPA 3Q11A 3CBQA 4HMPA 4HDMA 5K0LA 1R3DA 4FFBA 3DAHA 3DKRA 3H2GA 4ZRNA 3SYMA 2Q1XA 2I91A 4OHVA 1I3MA 1E3JA 3AU8A 3T3GA 1T3HA 4DBVO 3ZI4A 2QTZA 4KGXA 2DUNA 3JQ8B 4CVNA 1PF7E 4B4WA 1U80A 2P5UA 3AVXA 3F4KA 3HABA 3HA5A 4P4TA 3G8YA 1G2OA 2RI0A 1IY9A 4URHA 1K5DA 1G5FA 4ZAVA 3ITDA 5ALUA 3WOVA 4OUDA 5G2OA 2ENWA 3NNNA 2UZ1A 4QBHA 4PPFA 4GPBA 1SUWA 4X71A 3KL4A 3ECSA 1EWVA 2ODBA 3NPMA 4Y3UA 5ALVA 3WQHA 2QAJA 4HSGA 3F5MA 1RADA 3GNTA 3OWOA 3UV6A 4DDUA 1B2LA 1QVAA 5JI3E 3K5IA 1M2JA 3U3MA 4B32A 3GJ3A 3JQEA 3V80A 5A4IS 1RKBA 3E2IA 4P34A 1DG1G 1G3UA 5DM2A 1RTTA 2GESA 3WLSA 1E5LA 2ZE8A 2A0WA 2OPHA 2EFDB 4ZCTA 3FTPA 1GTMA 4IRMA 4AG3A 4XWKA 3T0GA 4LNUB 3HMQA 4Z2YA 3EGDB 3KT0A 4J90A 2UYHA 1GNPA 4IICA 4OK5A 1LUAA 3SK0A 1HE1C 4HGOA 2XSZA 1QFJA 2BI8A 3K9QO 2QXTA 3H4MA 4W63A 4QBFA 3V1LA 3WLTA 3IBGA 3A9SA 5CEEA 1EVKA 2JFPA 4YTEA 4KX5A 4TXLA 4Y2QA 5ALNA 3PJGA 2Z6AA 1T4GA 4FZ3A 4I50A 2P9EA 3RUEA 5K3AA 1WD7A 3GMIA 4JUCA 1YMUA 4OCZA 4ZK6A 2FB9A 5ALIA 4BMCA 5C1PA 4J6FA 1CUEA 2NVBA 3VPGA 2P0EA 1KVSA 1MJNA 3A1EA 3AIOA 1RM3A 1JR2A 2GM5A 3QVGB 4FOOA 1CZKA 5CK4A 1GT91 1P0MA 3DZGA 3VVBA 4BBPA 3THYB 3AF0A 3I0ZA 2QZZA 4G26A 4N49A 4G85A 3A8TA 4E5UA 2ZAYA 4F6RA 5M2QA 4KRFA 3DCIA 2O8BA 4IIHA 1Y33E 5DGIA 1U90A 3LLSA 4MW1A 1S5PA 1V45E 2LE0A 5LQJA 4N3GA 2QLMA 3VAYA 1BXGB 2GZ3A 3FDIA 3LRTA 1SOUA 2H5EA 1V8OA 3I5XA 5HOEA 3IKTA 2P1DA 2ZS9A 2FEKA 1Y0BA 3GH1A 4J0FA 1D2AA 4PU0A 4D46A 3BRWA 4PG5A 2HWYA 3LVBA 1OWPA 4GLFA 5KZMB 2BF7A 2Q6IA 2Q9BA 4BNKA 4IJVA 4IO1A 3VMMA 1C80A 4DLTA 3KKKA 3A36A 5A6SA 1HO3A 5K0FA 1VCIA 3E58A 2PKYX 1WXGA 4B46A 3OPXA 1UP7A 3UMVA 1W73A 3ZVNA 1RRMA 4JYPA 3HYSA 2ZSDA 2UZ4A 2OGSA 4J1TC 4PFJA 5HQTA 2IOYA 3UY4A 1SC4A 1XDZA 2HADA 4HLUC 5KNDH 1JJAA 1T3GA 5ABPA 4CEHA 1TM4E 5AOAA 4DSOA 3IIEA 1T35A 4IDGA 4E4TA 1EFRD 3W5UA 2WA1A 1TC2A 1L7QA 4WKPA 2BC9A 1RQ7A 2BGKA 4K6FA 4O2AB 1JHMA 4RJLA 5FR2A 5KAPA 2L42A 1FP7A 3NHYA 2GK6A 1OXSC 2CXTA 3PZRA 2HIMA 2P35A 2CUNA 2OGTA 2YASA 5FA8A 1JPUA 2Y1WA 1L8AA 3MSCA 3LY8A 4HZUA 4AROA 3C6BA 5K0SA 5AKGA 1C9YA 2ZREA 2BUBA 5EA2A 1ESNA 2GZMA 1QANA 1RSZA 2OD7A 4URUR 5IKXA 3FAKA 4YJ3B 3TDKA 2X1VA 1RWWA 5TQ0B 2DHCA 1UBMS 4FONA 4GF5A 2ENUA 2B61A 5LYJB 2I34A 4LDPA 3TPZA 1IJFA 2B78A 2J3DA 3NBYC 4N0EA 3CH5A 3K8OE 1C3OB 1T5OA 2F1IA 5EHZA 5DULA 5G3ZA 5AP9A 4XD7A 4R2WA 3L43A 4KQMA 1QVWA 1K3UB 4BWFB 4RHCA 3HU2A 2RGNC 4YRZA 4BFTA 1K27A 3HA2A 1UOPA 4DLAA 2DG2A 2V5UA 1UF9A 3B6MA 4RW0A 1T43A 5JALA 2FR8A 3I6IA 4JLJA 3GEEA 5FXMA 3OIFA 1QTNA 3LCMA 1PCXA 5G40A 2F1RA 3PX2A 1ULSA 1Q0PA 1ZESA 1DT3A 3B38A 4Z9FA 3T4PA 4BTEA 4C4TA 3H1BA 3VO8A 5EJ8A 3QXJA 2VTEA 4QSHA 3T3DA 3N6VA 3EGWA 5BSEA 5L4NA 3KNZA 2AGVA 4HEQA 4MWDA 2YZ2A 4FYXA 3WOHA 5E3IA 4BAGA 2WW8A 2JH9A 3TTWA 3ZTYA 4F72A 4WACA 1KSHA 3C6QA 3OTWA 3PIDA 4Q4JA 1U31A 2JIMA 4I1IA 3GVHA 4TWIA 4UHHA 2JEOA 3KSBC 4ZI7A 2GF2A 4RZIA 4CN8A 5JHHB 3ON5A 3PENA 4ISCA 4KO4S 1NVVQ 4IIGA 3IPXA 4QDZA 2IF2A 3R7BA 3UFXB 3SHQA 4TLAA 5BV8A 2DBQA 4MS4A 2O2IA 4H7PA 1IHDA 4F9FA 2P4SA 3CVXA 3RS5A 4B3IA 2BFEB 1I36A 1ZBDA 4J7UA 4E5KA 5HF8A 5HW0A 1LFAA 3R40A 5T5QA 1R6DA 3OQ6A 1K97A 5HS4A 4N6GA 1HDXA 2EZTA 3DOCA 3ML1A 4S2UA 1NUHA 2I2DA 2X7JA 2VK4A 2XDYA 4IDQA 4QPCA 3PX7A 5C9ZA 4J49A 1H2XA 4B6EA 1FS4A 1NRXA 2LUOA 2MCFA 3EE6A 1SN7A 3GDOA 3MHPA 2GS9A 1XR3A 4KAXA 1PKXA 4D45A 1LVUA 3PPVA 5FDFA 5AW8A 3CVVA 2FX2A 2ORVA 1UKBA 1M66A 2FTKE 1YJ8A 2GSWA 2ZKLA 1V1RA 2F2TA 2I7DA 4O08A 4P58A 3PNMA 3CR3C 3MWFA 3N76A 4I9HA 4NE9A 4UBJA 4YDHB 3JSAA 5HF5A 1NOJA 3IHWA 4QNRA 3UYLA 4B3BA 2DEUA 2QUJA 2GT1A 2QWXA 3C8ZA 3PR1A 3NUQA 1P8AA 4ND5A 1DC5A 5HQJA 2VCYA 5EHQA 1CRQA 2NU6B 2NZVG 4FQ5A 5CVTA 1VFNA 2R4QA 3QOFA 3HUTA 1IRIA 4FFSA 2BLNA 2XODA 1EYZA 2CXRA 1CUBA 1YWGO 3EMDA 4I6GA 1R18A 1NVGA 3AHFA 5EC8A 3IMGA 2ZYSA 3LQ2A 3NHJA 2P8JA 3QH4A 1A3CA 2EJWA 3SN6A 4E5VA 1P9OA 1YC2A 2QUZA 1NR5A 1VJDA 2H1CA 3MVEA 3RIMA 3VH2A 3HVUA 4CNBA 3GC6A 1XMQB 1CR6A 1OAAA 3CRRA 2QRHA 1KI6A 2GSDA 2ZROA 3SXJA 1NXQA 1J00A 1M7BA 3EFOA 4RK7A 4UZSA 3D1LA 5ERXA 4K0KB 3ZEIA 1T5SA 1QMGA 1OX5A 4JLPA 3L7NA 1Q0RA 1VYVA 3DB2A 4I9FA 4BLOA 3VSAA 3F3YA 2PU5A 4L2IB 3CVOA 5J2TA 1PT5A 3QTTA 5DRYA 4WASA 5AW5A 1PFUA 4GYYA 4J0HA 4HX2A 1OKKD 1MQSA 1Y4ZA 5K51A 2O8EA 2YFHA 4RHXA 2BRUA 2C9CA 4L3OA 4XYMA 3EUFA 3D3WB 1P9LA 1JS1X 1NZDA 1Q7RA 1ZG3A 3FSGA 5DWQA 3UAWA 2N3ZA 4MR7A 4ALMA 5C7YA 3MPUA 5KVAA 1Z15A 1VPDA 3OF2A 3JZFA 4IIUA 3II6X 1R6VA 3CKMA 1H3EA 1SB8A 1AXGA 5DM4A 1E6CA 4KTTE 5IJXA 4BFUA 1KWKA 1KBQA 5G41A 4M1WA 4NCXA 4LGCA 1B6GA 4H3KB 2QX8A 2JFYA 3D54D 3OPVA 2QRVA 5TIIA 1P2VA 1KEPA 1Z0ZA 2VL7A 4LYHA 3V9AA 4EUKA 3G5TA 1NDHA 3KKZA 2WMDA 3WVNA 2OESA 4JJ8A 1LQUA 4C0SA 4ZZ0A 1MXHA 5CBPA 2HCJB 3IDQA 2WUVA 4J4HA 1AZWA 4MYDA 4YYZA 4RWEA 2O5RA 3NAQA 4JFRA 1N4AA 1B3BA 1PS9A 1U8XX 2P1RA 2ERXA 2R751 4QOJA 3R24A 3HJUA 3HBMA 4ARVA 2J3QA 3AHEA 3RYIA 2Z9CA 2ZFUA 1N5KA 1X80A 4Y7CA 2FE1A 4B34A 5JSUA 3W8RA 1SVSA 1W44A 3FDZB 1W49A 2BUCA 2POCA 3E3LA 4HWPA 4U0JA 1UT5A 3PFWO 8ADHA 1QKIA 2OHVA 2OYRA 4C07A 4LK2A 2ZI3A 3MLEA 1X1CA 4LS3A 1KFEB 3IJ5A 4PCAA 1X7HA 3OEHA 5E0OA 3BWCA 5D7BA 2QD5A 2NT3A 3HE3A 4WZAA 3RCBA 5ALKA 5KX5F 1L4NA 1U7WA 4MGHA 3R8CA 4KFCA 2CL6X 1XAIA 4PF1A 1H05A 2XVYA 3W5CA 2AJ8A 2G5GX 2IZZA 3TFOA 2C2GA 2PO5A 2F1KA 4L8FA 4PFQA 5E95A 3VKUA 4B43A 4D9MA 4DZRA 3RT9A 5I9TA 3VDRA 5JSZB 1KIMA 1RABA 2B2CA 3PHIA 1PUJA 2Z98A 4JC5A 2Q9UA 3DG9A 1Y89A 4HDMB 1R0ZA 4FFBB 1KO7A 4X6UA 1EE9A 2Q3FA 4P5DA 3G5UA 4BTLA 3TE7A 1E6UA 1CERA 3NM5A 1O03A 3D7SA 4PYKA 1KERA 2G04A 3FFBA 3VR3D 4A5SA 3ROQA 4KI0A 4PGAA 2WZCA 1B00A 1JLSA 3L1KA 4ZZ2A 4LXTA 1EG2A 2J41A 1I1HA 4LYYA 4CMAA 4LJ7A 2OZLA 5M04A 1YTUA 3SOPA 4IOJA 3U6BA 1D7AA 2IKQA 4OUDB 5AW3A 3COZA 1NYTA 1N3LA 2UZ1B 1WABA 3H2YA 3TXXA 1J99A 1GLGA 3CF2A 2PIAA 2GN6A 1L4KA 5EXSA 4F1JA 4UM7A 3FVWA 4KUHA 2Y6UA 3WNZA 2V54A 2QVBA 4JIGA 4F5ZA 5JS7A 5BSHA 3K92A 3PXEA 4IW3B 4MGKR 4TX1A 3O8QA 5K01A 2R68A 2QQEA 4NDZA 1A8SA 3OX2A 5G3YA 3ROPA 2O2YA 1PK9A 2Z56A 2ZUVA 3ZH2A 4C0BA 4RABA 2BHLA 1MB0A 1YQTA 3DYBA 3LYUA 3D6MA 5EE1A 1N0HA 2QE7A 3QFTA 3ZHCA 4DAEA 4B8ZA 3LDFA 2Y3IA 4YGXB 1E2GA 2JHCA 1PU2A 1ZIYA 3N70A 1OLSA 4U9UA 1SUCA 3O4GA 5HQ3B 2AW3A 3LT5A 2NO0A 4V0MA 4AECA 4QU5A 1TEHA 4NXMB 1Y3FE 2D2VA 3AW9A 2AH5A 4R1NA 3W90A 5JSQA 2OCBA 3TL6A 3BZBA 3FLEA 2V5AA 1V48A 4HG2A 4NZYA 5EP1A 1NRIA 1ZVVA 5H9WA 5LZ4A 1USIA 1RAEA 4DIEA 3WLOA 4L75A 2GEBA 4M21A 4UTXA 3RFVA 4LXXA 3W3AH 2GKGA 5K8TA 4JT9A 1RPJA 1W4LA 4BNJA 5LWQA 1RFGE 3WB9A 4TUYF 3WLKX 5I4IA 3NIBA 1NVMB 4DJFC 3EXHC 3UJCA 1Q7TA 4MKIA 3ZV5A 3MRSA 2O8BB 2Q3DA 1Z2NX 2VSFA 4F6RB 5A9TA 3RO7A 5D8DA 1G5HA 2GILA 2EKQA 2Q5QA 3DVSX 3ENNA 4OQ4A 5IUKC 2NUTA 1O4VA 4CM3A 3JVUA 4KXYA 3KJEA 1UBSB 3IV7A 3TM5A 5KQMA 1E69A 2WWGA 1PJRA 2X13A 2WJWA 5JTTA 5ESWA 3GJRA 1BXRA 1F8FA 1JQ3A 2DY0A 3BCUA 4IV0A 3RHZA 4EF4A 1OH8A 2ZUUA 4LCEA 3LQ4A 3GA7A 1DT5A 1CUCA 3CWCA 4DCVA 3S1AB 5E6UA 4Q93A 4CMBA 4YCBA 3ZDXB 1QGUA 2H4ZA 3EZ6A 1X94A 3KEFA 3KOZA 2CHUA 2QW0X 4N39A 2GD1O 1RIIA 4PG6A 4RNCA 4IUYA 4KOAA 5ARBA 2DP4E 3RW9A 2HLPA 4M8IA 4C4SA 5DWDA 3INNA 2XQGA 4AMZA 1T6BY 1N2HA 1VBFA 3MWGA 4JT8A 4Q9AA 5KYYA 3PU6A 1UFKA 1XNRB 2P3OA 3NHAA 3KDSE 3DMHA 5HRAA 1IB6A 4CEHB 2PKQP 3GA0A 2PGIA 5H83A 4NSNA 3ILYA 3MGCA 1LTHR 3WP0A 1O95C 4FDVA 1NASA 1XKLA 3OMWA 4XIJA 5DM60 2OCDA 1P45A 5CYOA 2ODTX 4PZUA 4J3JA 1OZAA 2EKLA 3FYHA 3M4XA 4XLZA 4AX8A 1CDZA 4B6FA 2CNOA 1DBIA 2NT4A 3WWOA 1ZHOA 5AI9A 4TV9A 3TQQA 3WY9A 1E4OA 3HB4X 3QMVA 2KW5A 2X1LA 5TF4A 4YHHB 1XDSA 4EMUA 4HZUB 1S2DA 2QTRA 1HC7A 4HYQA 5F33A 1Y6GA 1Q44A 1HG1A 2GCNA 4F21A 5CA1A 3A4IA 5DCLA 1FP4A 1DBWA 1G8FA 3DV0A 3FUVA 3UT0A 1E3SA 1ATZA 3QBEA 3FTEA 2HMSA 4WZAE 3T3HA 2CLSA 2WYOA 2Y68A 4KACA 2I7VA 2R65A 1ZLXA 1E2UA 4FPXA 4QJ3A 4D0GA 3WGIA 3ENWA 4LUCA 2HU5A 1UWLA 1PJZA 1P2BA 1KOFA 3V7FA 4LOKA 4E6PA 2A30A 2NV2B 3PVCA 1VCNA 4X64B 5LZ8A 1A4XA 3AI2A 4MQMA 1Z7GA 4NH4A 1EUZA 4MQEA 3SVZA 1J2JA 3IUJA 4ZGGA 1LJUA 5J5AA 3THSA 3N75A 4D3SA 4S05A 2IYXA 5CITA 3PYLA 4YUWA 4MDYA 1MCZA 4P3NA 4EGAA 1ZM7A 3AM4A 3IHTA 5TMEA 5ED0A 4Q48A 1JZSA 1AQ6A 1G21A 2RONA 1E3TA 2ADMA 2GX6A 3VA7A 4HYTA 3LS2A 1RBQA 4ZVKA 3GFBA 3H1EA 4Y30A 5JD3A 4C4ZA 2X0FA 4M9CA 5DNUA 4D0LB 1SKQA 4WY8A 4P36A 2I4OA 1KFJB 3TNYA 3ZUPA 1SCNE 4Q4JB 7AT1A 3HTXA 2QLNA 2XZDA 3CCBA 1NUSA 3KEGA 3L7KA 2YN0A 3HDGA 4J0CA 3QA3E 1QQ6A 2Y1KA 4ZEMA 4WBXC 4QUBA 2BHSA 2VF5X 3IDFA 2I66A 3LP8A 1KGDA 5LZ2A 1KH3A 3OQPA 4MS4B 2B8EA 3IIKA 1HETA 3TH5A 1YO6A 3B51X 2HTEA 2Y76A 4FWIB 4L08A 3THRA 4MEJA 1KEUA 2CMHA 2X6RA 1Y5MA 2VI5A 4UZFA 5DCUA 4UDYX 1PI3A 2GMWA 3HGTA 3L8DA 1J24A 2QN3A 2VVTA 3VPCA 1XP5A 3L4KA 2ATXA 2UYQA 3GIDA 3L93A 3I6ZA 1NV8A 3C5WP 2NP7A 3QP9A 5GP1A 4V0ME 4P9NA 4NECA 1EXNA 1FVXA 1VPLA 1KI4A 4YMSA 3K16A 1V1RB 1OD6A 2KS6A 4JJAA 3NWBA 5CCBA 1W30A 3BD6A 3DW3X 1G38A 3D0KA 1PGNA 2Z3WA 1GG2A 2QYHA 1R64A 2ZRMA 4HY3A 1SVLA 1K6JA 3QBDA 3JWIA 5KU7A 1SOWA 4RVDA 3KKOA 5CLIA 3E4CA 1E2DA 2F8LA 2JJMA 4J03A 4IWNA 4AMUA 2HF2A 4D0RA 3RBAA 4CKEA 3U19A 3A6LA 1GAQA 1YVRA 3BDIA 2QORA 3KU1A 3GUZA 3SR3A 3TVYA 4ZCQA 5F76A 1C2YA 2I33A 5DOVA 5ITWA 3CF4A 5FBLB 4Q7KA 3CCCA 4KV9A 4P2GA 4Q16A 1OH7A 3KQLA 1FTGA 3MBIA 4NJEA 1G0OA 2FI1A 4UKDA 3ZY5A 1IBMB 2EQAA 3WLMA 5AK5A 1R0LA 3IX7A 4FMCF 4YEDA 1BHSA 2XH8A 1S3SA 4MGZR 2QN9A 1PGQA 4TMFA 5ILOA 1KI6B 3VDXA 3L4BA 5JRZA 3EFOB 3K5WA 3LXXA 1J2UA 3PP8A 1RXWA 2HJ9A 1SBTA 4B47A 3RAFC 3H1PA 1DG9A 4UVDA 2YYZA 3A06A 3E9NA 3GIWA 3Q41A 4PLPA 5J2TB 1ZCAA 1ZCJA 2IH5A 4C0QC 1HQCA 4G1CA 3RIEA 2GNPA 3KPYA 3NI2A 3H2HA 3V42A 2NOAA 2OTCA 4A8TA 4D4HA 2O8EB 4X45A 4FT2A 1UJBA 3DM9B 4YFVA 5I9BA 1U1DA 1UZAA 4G37A 5AXDA 3UYKA 1ZCBA 1IYZA 4CM4A 3KZOA 4PZDA 4MR7B 4O2BF 2I78A 5CXXA 1V4VA 3DCYA 4EUHA 2NO9A 3DZFA 4RF2A 4C21A 5FPPA 1BGWA 3QVXA 4IILA 4IYRA 3Q9SA 2VSNA 3L5OA 2AXEA 4FFOA 4R31A 1MOQA 1UWVA 3DA8A 2AOTA 5AM1A 5K3FA 4RJTA 2PGDA 3C45A 1IDN1 3W04A 1ML4A 3NQ41 1P4JA 1QZUA 1L2TA 4XFJA 4FQ8A 1RR6A 2D5BA 4B81A 1CULC 2QRVB 4NCJA 2WUEA 3D43A 2ZIUB 1LNQA 1HWYA 1UANA 1XMOB 4HEA1 4NYMR 3N0WA 1VKNA 2IEDA 2G36A 3GARA 4LJ8A 1FSGA 2VCHA 1MH9A 3LT4A 1L5KA 3WXMA 5EN4A 1DP4A 1P29A 3QIVA 4OLJA 5MN6A 2QV0A 2FFHA 3N58A 1UKCA 2AFHA 2R1TA 8ATCA 3LUKA 1ZEMA 3UQYS 4BCDA 1YBHA 1R0SA 5JXHA 4Z4CA 3EIEA 2XZLA 1HOTA 3F1LA 3RYIB 2CJPA 2P0YA 4Z1MA 3ZE2B 1O8CA 1X80B 3B8HA 3KJXA 5ER6A 4JY7A 1PJQA 4LHYA 1TX4B 4MCAA 3V97A 3VQTA 2GZRA 3F7MA 4RV4A 4YRCA 3HM2A 2ODPA 3OQIA 3VR5D 3VV2A 2PXAA 5LVAA 1RVDA 2I5PO 4X8LA 1BA3A 5L3SA 2QL6A 2RHWA 1F5NA 3V4RA 3FWYA 3L0IB 1ZO8A 3NV7A 1YS6A 2AG5A 3E9ZA 3FSEA 5B58C 2IYTA 4P80A 1KJ8A 1HE4A 4CHGA 4Q9IA 4LJ4A 4WZAB 3C87A 3H6GA 1WOYA 1NBEA 2D5CA 3A1TA 5EPEA 5H16A 3QM1A 5FFFA 3AZOA 3KQTA 4GMFA 1ILWA 1G21E 4YN3A 2AG1A 2C07A 4QGHA 5I7HA 3E2MA 5I8ZA 5LQNA 3NT4A 1RD4A 3OCYA 2VO1A 4YRAA 5L3VA 2G6BA 4FNAA 1Z28A 4BVFA 4YBRA 2IY7A 2JZOA 2FPIA 4FGUA 1EFHA 4Y2TA 4M4SA 3V6LA 5L4LA 3R3HA 2ZT5A 1M1ZA 2RJOA 4RENA 1E2IA 1YDWA 2H51A 2ZTUA 3HHEA 3GLFB 2PSFA 2GNAA 4L3VA 1YCFA 2A88A 1PAUA 2AJTA 2OZLB 2W6JD 3IE2A 2OQRA 3KZMA 1QGAA 4NESA 4RGVA 5ALOA 3ZX4A 5LIPA 2VPIA 2D1YA 2XUJA 1UBGA 3BUSA 3I6YA 4YRBA 1EWKA 3OM1A 3MHTA 4QOFA 1K7EB 2HSGA 3T4EA 1Q77A 2QVYX 4G9BA 2EZ8A 2Q5JA 1FTNA 1KQPA 3IKLA 5AVWA 2WNHA 2X42A 2P6MA 3FAZA 4FYIA 2WD8A 4PCUA 1W4ZA 1E0JA 1T5TA 4MPTA 5JCJD 5AIBA 2DUMA 1TUEA 2W98A 1I24A 2BHRA 1U6JA 2NXNA 3Q12A 3PC4A 3O8QB 2NACA 2DLNA 2QGNA 3B3GA 4DLLA 4O2AF 1K98A 3DDUA 2BEKA 2ZUSA 1BRTA 5HFJA 5F4ZA 1XN1A 4WUVA 3VX4A 5LU9A 2PUCA 1TW2A 2MSKA 5CX1B 4W5TA 3H7IA 3GAFA 3K94A 1YF3A 4HBZA 1PWXA 1NSTA 3EQ7A 4DUYB 4O5OA 1BJKA 3O03A 1VGVA 2RAVA 2I6GA 1OA0A 1GN8A 1W0CA 3L1UA 5KJ1A 4LOIA 4PR3A 1J9GA 2OXEA 4XIYA 1JHVA 2B8NA 1U0TA 1N6PA 3RWBA 2Z08A 2AD1A 1Y1SA 2OMEA 1T2FA 2A9QA 4RK1A 2OILA 3WZMA 5AKXA 3NZEA 3FGPA 5A4JA 5JARA 4J16C 1ZAKA 1SUBA 1YOVA 5B1YA 3UH1A 4FKBA 3OT1A 2QJWA 1R0WA 1U0GA 4HJRA 1L7EA 2O8DA 3JV7A 2FQWA 1N2BA 3F47A 4HD8A 2V03A 2PJZA 1OQAA 2WF9A 1YRBA 3D2LA 1R74A 2UU9B 3H3JA 4MLCA 1T8TA 3W2GA 2NUTB 3HR4A 4JEHA 1XELA 1XZFA 5ALQA 2ZU0C 5L45A 2G1PA 1NVEA 3DLBA 3K2QA 1D3AA 3PA6A 1SD1A 4V2IA 3WAKA 1PYDA 4K3VA 1HQDA 4PO8A 4FFVA 1T1EA 4UVIA 1AX9A 3SOZA 1J0AA 4FWTA 2FJ0A 1DTWA 4GXRA 5AJZA 3CNNA 2WWYA 1BXRB 3DLIA 1PLKA 3FETA 2X4LA 1XUOA 3EVEA 3HV0A 2C42A 4CKBA 5FFMA 3MMNA 2QX6A 2GD6A 2QD3A 3HXLA 1MEJA 4CKXA 5E6UB 1QGUB 2CB0A 1LPMA 4MZXA 1LX6A 4G1MB 1L5YA 4H7FA 1KEKA 5CR9A 5DHPA 2QLTA 2AFIA 4EDFA 4MKZA 1CR2A 2FR1A 1L5WA 2J5RA 5G0UA 5DYWA 1Z5NA 4EEKA 5KYWB 2ZTVA 4ZHQF 5KYYB 2EX4A 2R87A 3HY4A 3VDQA 1RZUA 4LA4A 5ITVA 1N75A 3DLPX 3ROXA 1B74A 2JLSA 3UK7A 4CF6A 3AGPA 3JZIA 3TSYA 1MRSA 1ULTA 1ZY2A 2GFIA 3C97A 2EBHX 4LKRA 3F5DA 1IE3A 1Z7BA 3BMNA 3R8FA 1KZ6A 2DE0X 2BOVA 1SU7A 1WKCA 3NR2A 3O83A 5T3UA 1KMCA 1FTSA 2D1TA 1BJRE 4TV9B 4OAOA 4RWZA 5AUNB 3UAVA 3WGUA 3HJFA 1M6WA 1G5IA 2XMQA 5JZSA 5TE9A 4DB4A 3OSUA 4HLQB 1FVOA 5TMBA 5CHYA 3KD3A 3PT9A 5KPDA 3O3MB 1UEJA 1CUZA 1P1BA 5IJ9B 2P3SA 4WGGA 5CA1B 1E77A 4FSXA 2OUIA 2Y1CA 4QTYA 4POOA 1FP4B 2YZKA 3DV0B 4PYNA 3A05A 1NW6A 3MINB 2FKNA 3G5AA 3GRKA 4GX1A 1QCYA 5ESDA 3RANA 4YJ2B 1P3Y1 7REQA 1ZA1A 2CXHA 3U48A 3CISA 4J1TA 1ORTA 1FFDA 4FCWA 1I4WA 2PE5A 4KWHA 4HLUA 3S1LA 4FR5A 4BC1A 5C1DA 2YN4A 1RHMA 3KWJA 3QVTA 2NVOA 3VR0A 4DXAA 1G4AE 3FCSB 3FX2A 3QGMA 3AJDA 5FKJA 4NCNA 3ZZUA 4JBHA 3M6UA 1QQ7A 1UJNA 3OZEA 3PEUA 5CVCA 1I6MA 1ZBQA 5EP3A 1G0NA 3BK2A 4EO9A 1SKUA 5FHQA 1M2HA 2B2XA 2WJJA 5TLSA 2G06A 2RK4A 2MWMA 2F55A 2JIZD 4TL6A 2PZBA 3R5SA 3KDAA 1PG0A 2VHVA 1G21B 2ZRKA 4WEOA 5E7QA 1E79D 3ZBPA 1S9HA 3L2OB 1Q1EA 1GN9A 1DRUA 4YRNA 1Q14A 1CZHA 5DXFA 4ALIA 5KC9A 5BRJA 1PDWA 4D9FA 3TRFA 2NU8B 2B0JA 2ZT6A 4WFIA 3ZY2A 1NAIA 1H9BA 2WM8A 1CJVC 1KO8A 3NP7A 4MHOA 1YK0A 4N3NA 4HWTA 4ANFA 1JSCA 3OEED 3IP3A 1C8BA 2WVJA 1V6AA 3LBAA 3UHJA 3USES 4WQMA 2FEXA 3IVCA 3I04A 2O2XA 3KX2A 1E7WA 4QLAA 3KV3O 4G5GA 2O3JA 1W25A 3MOGA 2GI4A 3IQZA 4NICA 1DDIA 4LMBA 2GO1A 2ZRNA 3NORA 4JSTA 2RGNA 1NSYA 2ZIEA 1TEXA 1NN3A 1L4YA 1E98A 2D5LA 3BBLA 1UJMA 4CEIA 3OVMA 4Q6WA 4AJJA 1A5ZA 2FJUA 5E4TA 4B80A 4BJ1A 5F9FA 3EXG2 2JAUA 1PL8A 2PL5A 2Q1TA 4GHWA 2YWXA 5MHTA 1Y8AA 4G5RA 5LZ5A 3KPVA 5K3BA 4ETWA 1QU2A 2VWQA 1Z7WA 4ZYZA 3M1YA 3QOWA 1NP7A 3WYGA 4RTPA 4KR2A 3VPFA 2HQBA 1SIWA 4GVPA 1LVGA 3R4VA 3VGPA 3FWNA 3T9EA 3EZLA 5CD9A 1QPGA 2RKOA 1OV6A 2GDJA 1MV5A 2JGAA 2XCOA 5EZYA 1KE1A 2ZU6A 2IWRA 4L02A 4Y2PA 3EZXA 4BU0A 1B14A 2WU8A 4LY6A 3CRZA 2RE8A 2Q0SA 4CKEB 1ZD5A 2FZGA 3SWWA 5CLGA 4ZI3A 3GBSA 1SULA 3TZBA 1H2WA 4RY2A 1EM8B 2X4GA 4P81A 2FSUA 4U7PB 4X24A 5KNDA 4Z4EA 3BMQA 4PWYA 1YZUA 3KZKA 5ED4A 1AZLA 5AKLA 1IRXA 4FD2A 5I7EA 4FIZA 3QLJA 4DY4A 4R8RA 1DJLA 4V24A 4NJEB 1UOQA 2JAPA 3MGKA 4X1IA 4H7EA 5F9MA 5ELXA 5EI5A 4KRYA 2CHGA 3FPKA 4YB8A 2P0AA 4GM1A 2VA9A 5AI0A 2WF7A 2GHTA 2I62A 2C3UA 3F5SA 3C8MA 1U8UA 2OL4A 3H9QA 2KBEA 3VX3A 3LTEA 2GEFA 1E3MA 1BVUA 1SQ5A 2QMHA 2NZ2A 2IPAB 2WM3A 3QEJA 1Y6RA 1U4SA 2RGAA 2AFIE 1E2FA 4B5LA 2FPGA 3DQZA 3L5KA 1P7CA 1P1CA 1EHIA 4DJDC 2G5PA 3WJAA 3G2MA 3ADCA 3ZW7A 4IL5A 1TQ8A 4K81B 1DRKA 2B4AA 3F4BA 1LDEA 1DKRA 1Y5IA 2I6XA 3T5PA 2C5BA 1K08A 1SXJD 2C61A 3O4IA 4D9KA 1EX9A 1KA9H 1PNQA 2J3LA 5K3FB 1RXVA 2O3RA 2AOTB 4PTLA 3SEFA 3UKDA 4EVIA 2BE9A 5A7GA 3ZZ1A 4HQFA 5TXGA 2PXXA 2UYYA 1KS9A 2JGNA 4ICIA 2HHJA 2GYUA 4CDMA 2GF0A 2JHAA 3SQDA 3KCNA 5HA5A 3T1QA 3WIEA 1VPWA 5GVSA 4QT0A 4EW2A 1D03A 2VZLA 4HLDA 1DKNA 2C1EA 4II2A 4YMHA 5LJIA 1L5OA 1V37A 1ETUA 3N8IA 5D6OA 2DHQA 1GKIA 4RD2A 4C2BA 1ZJYA 4TKZA 4CODB 3ZIUA 3CLHA 4AJ4A 3OQJA 3TJZA 4V0QA 2FP4A 3LT1A 1ZMRA 2AFHB 2R1TB 4BQQA 2EJVA 2H5JA 2XWSA 4ILEA 3IQDB 3OIVA 1U11A 1QZ3A 2OK8A 4C89A 2FLKA 2DERA 3F2IA 4KE6A 1F9EA 1XRNA 2NUAA 1YQ9A 1CQZA 1U1GA 3TRHA 5KVVA 3OQIB 3OZTA 1BE0A 3CZCA 3H18A 1RKQA 4BO0A 1L5VA 3BXGA 5JATA 5JAOA 5L3SB 4N54A 2EF1A 1QS0A 3ZIDA 9ATCA 2PZKA 2EDAA 3HXTA 4IGFA 2CHFA 1CR4A 1SCIA 3KJQA 3KTAA 3SBEA 1E5DA 4E13A 4HT3B 2I7TA 1BA2A 3ZLBA 3LKZA 2DY1A 3CPJB 4G1UC 4G4IA 4ZCSA 3VFDA 3BE5A 4R2MA 2BR5A 2GTPA 3G0CA 5CTJA 1RC1A 4DUGA 3AR5A 3U3KA 4C4RA 4NEQA 1IUKA 4CIXA 3PD0A 4LHVA 2K7ZA 2H1FA 4NY1A 1U7DA 2YWJA 4CUKA 2QUBA 4XKJA 2XGSA 1ZZGA 2O48X 3KUUA 3FD8A 5GQSA 3FRJA 2FPIB 2V3VA 3NBMA 4LHSA 3WLNA 2HKIA 1FRNA 2AYZA 4KLAA 2P7HA 4ZCRA 1LDNA 4TWJA 5BW5A 4FX5A 4YLEA 1H5QA 2NTJA 3FHLA 5LBUA 4C3ZA 3AOEC 1XT6A 3BWYA 1JUDA 3HYNA 1JKXA 1IJBA 2BCGY 3RB8A 4A8JC 4RK6A 1F60A 1TT5A 3TFWA 5FBZA 4I6JA 3M4YA 4GX0A 2C2WA 3L6UA 1DLIA 4LHXA 4WTOA 5ECDA 3WYAA 1TYEB 3Q3EA 5CJJA 3ZZNA 4HNTA 3EX7C 2AQKA 2W0MA 2EP7A 5BN4A 3OMXA 3C70A 3NHSA 4JC8A 4BGIA 2G80A 1V3UA 2Q07A 4AY3A 1T3SA 4TTIA 4JI0B 3I23A 1Z8FA 3ZCQA 2DPXA 4E88A 3F6CA 4MYRA 1ZH6A 2W42A 1T25A 1T1IA 4GPAA 4C5AA 4OOEA 3RLIA 1IN7A 2QRQA 3RABA 3M6LA 1HQYE 1RM0A 4MWCA 5LDDC 2VP0A 1PZGA 2JGEA 3ZJUA 3EEOA 2EARA 3UJ9A 2H65A 3I9FA 3ZY6A 5D01A 1OFUX 4C1BA 2PM8A 5A4MS 3FNIA 1DKQA 1JT2A 1NW7A 5FAKA 1AGXA 5EERA 2D8AA 1N0IA 3GPCA 4BNDA 3C0KA 1AGPA 5A9RA 5HGXA 3SMVA 2BMAA 4Y1FA 3H42B 3GK3A 1DVRA 4MEBA 1H9CA 1S6YA 3GT4A 2V3CC 4MITA 1RKUA 1K75A 1YOVB 2Z6UA 1C0KA 1GSAA 1OCEA 4JUBA 4G86A 4CQMB 4D5GA 4B3CA 1IZZA 2O8DB 1WLYA 1BN7A 1S1CA 3R1IA 1YS4A 3ABRB 3TGWA 1G59A 1W2WB 1QZXA 4RO0A 3CZPA 3O47A 3GELA 2J0UA 3FTQA 3PT5A 4II3A 5EJIA 1D6SA 1MGPA 4ZCLA 1XALA 2DECA 1ENYA 4ENQA 1A9SA 1R27A 3AR8A 3ORHA 4PSKA 1A4IA 3E9QA 3WHPA 5BYKA 1LCIA 4QZVA 5JMWA 4AZ3B 3X1WA 4LWQA 4RD0A 4U00A 5EIOA 5BNWA 3NVDA 1ZOSA 1DTWB 3TM4A 4DQLA 3QELB 4Z7QB 1ECCA 3TRKA 2I2WA 1DU4A 2Z57A 4WD3A 3GO4A 4CKBB 2KPOA 3HNOA 2XDAA 3PNOA 3SP1A 5DHFA 2OHHA 3RADC 2BYTA 4MV1A 3BE8A 1EP2B 2WZQA 3RBXA 4JOBA 4CM1A 5HZHA 1GUBA 1YS2X 3PG5A 5F7ZA 5BUSA 2AFIB 4MS1A 3ENQA 3TZKA 3TMYA 2JK1A 1I2DA 1A9ZA 1E1LA 4I4IA 5EP4A 4CF3A 3EAGA 1LV7A 5JYCA 1WZUA 2FMHA 2JS7A 2X8WA 1Q11A 3Q40A 3ZWYA 2WMOB 5KPJA 1RYHA 1US8A 4R8KA 3EXHA 3PR3A 4JLMA 4QXRA 4FOLA 4EHHA 1WG8A 2PPLA 1QQBA 4E0BA 1TYCA 3FN4A 5E7JA 3L4JA 5KREA 3OMLA 2DQYA 5BR1A 3ABOB 3BMNB 3LUCA 1TYDE 2Q8NA 3DLAA 1M8JA 1WO8A 3O84A 2WEKA 4NAVA 4R6WA 2JGKA 3VR5H 4EKYA 3GFPA 1QFYA 2IY9A 1GKYA 1V43A 3E3MA 4M38A 5IANA 1VLJA 4M1MA 4X61A 5CVJA 5IHPA 3MYYA 2A67A 1N2EA 2O7NA 3ZE8A 3ZKAA 1RXEA 4ZO8A 1OY1A 1T1GA 3DCNA 2QT9A 3Q3GE 2XXBA 3IQEA 1E0KA 4Z99A 1SHLA 5CHEA 3QWAA 4NNJA 5BWCA 4BV2A 2H2WA 2YVKA 3P20A 4JZYA 1WMEA 5I9MA 2E1RA 1V9LA 4ZJZA 7REQB 1M6HA 1WUIS 1EQ2A 1ZXBA 2HBQA 1TMYA 5A3JA 2HYDA 1QP8A 3KXKA 2EATA 3FOBA 1J25A 3RSGA 1N78A 3PXBA 2H31A 2ZKIA 5DBGA 3SMQA 1W1WA 1BKSB 3B8EA 3AB3A 1N5RA 4BBJA 1HFWA 3AH8A 3C5HA 1ZCZA 2V0GA 3A1WA 4DILA 3GCGA 3K0SA 3PHBE 1O95A 1BEZA 2YNMD 1O94D 1BX0A 2C95A 1H4TA 421PA 1PJTA 5AFSA 1VLHA 4FVTA 4UE2A 4MWGA 1HH4A 5JCZA 3K09C 3DOJA 2M6LA 4G0UA 2O1XA 3OSZA 1K63A 1ZU5A 3DE4X 4KQGA 2AC7A 1ZD1A 1VXOA 2WWHA 2PNJA 5BURA 2ODWA 1A2OA 2D00A 1G7TA 3MCUA 4KAAA 4HUJA 5CCXA 2OZPA 3OZFA 2COUA 4G07A 4D0NA 2H17A 3BXFA 5AW2A 3WFZA 4KWIA 3H86A 1JJIA 3O1HB 3EA4A 1V96A 4W9NC 1Y6ZA 3LYAA 1BC5A 1D8TA 3NYQA 4WW0A 3STHA 4RTMA 1NR1A 3W3AA 3OQ1A 1CETA 1IBRA 2Q9AA 1P7WA 1FNMA 4POAA 3CNQS 2HH9A 4MIKA 4ESOA 3EXFB 2VHCA 2X5JO 4M76B 4IKPA 3ODPA 1X7YA 2F48A 3A32A 1UEIA 4H7IA 1W6UA 1GSHA 4CT0A 4WFQA 1VJCA 2NADA 2WAYA 3OKPA 5M3BA 2GN4A 3OLXA 4CEIB 4O0MA 1MX1A 5L4SA 1HT1E 2G67A 2ID9A 2OAGA 5AI6A 1VJTA 1EBUA 1HYBA 2PSDA 4M6WA 2Y9PB 4M60A 1ZJZA 3GGDA 4BNWA 4J0QA 2WF5A 1P0IA 2ZI6A 1JWLA 1WE2A 4KDFA 2PWYA 2WT4A 2WTNA 2QPTA 1E99A 2KLBA 1FNCA 3T38A 2WB2A 1J8FA 4RVFA 1QAQA 3QY0A 1C3JA 5EZYB 3CJRA 4XLTA 3ZHUA 4QWWA 3KOYA 1YJAA 2O2HA 3C3WA 5FTJA 5IASA 3OAAA 5IKMA 1KFBB 2D0OB 4UARA 4PYIA 5ALXA 1VZ3A 2EJCA 2I7XA 5HWSA 1LI4A 4EY8A 3ZUGA 4BN4A 1L3BA 1S01A 1PZHA 3T9BA 1C4WA 3HRIA 2PAFA 3BMQB 3MTJA 5FNVB 3NJRA 3I9LA 5ILQA 3LCRA 1T9BA 4EPWA 3A1VA 3IBSA 4RELA 3H7AA 2POQX 3V2IA 4JSYA 1A97A 3FZYA 4E15A 5AVRA 3GFVA 3DUFA 2V6MA 4X1IB 3NP9A 2QUKA 1ETHA 3HRHA 2J5QA 4L8WB 3VMFA 4DMGA 1CLUA 1O6CA 2AFRA 3D4IA 3STYA 1UJ5A 4G89A 1J2EA 3DQQA 1GPKA 4YI3A 5K45A 5L53A 4EAQA 4AT1A 5BOSA 2OHJA 4ER7A 4PPGA 2JJ8A 2AXPA 1R6BX 4PSDA 3DE3X 3F96A 5C7IO 2FPGB 1QM5A 3AF1A 3TEMA 3GLUA 4AF6A 4P4GA 4K6OA 4R1QA 5AJVB 3OCUA 3ZZTA 4HNUA 1ADJA 5DMXA 4XSVA 3WFJA 2W48A 3IT0A 3WLAA 4RKFA 3M3HA 1VPVA 5LQMA 4MTCA 1GPDG 2ZUBA 3FUWA 4MUKA 4E5DA 1TM2A 5CD1A 5K8CA 3AFHA 3G0HA 4WCVA 3RRMA 3UXHA 2EZ4A 3B78A 3CG4A 3SIWA 1GGMA 3SLKA 1GQ2A 1S02A 3D7KA 4QNNA 4YRQA 1UIRA 2TMDA 3SM9A 3N0RA 3GJSA 3K0HA 4K9LA 3PHHA 4RPKA 3RG2A 4NZZA 4GKBA 3HM9A 2VTBA 4YRDA 2QT1A 3U4QB 3JARA 2IPXA 4ZQHA 1T26A 2VPYA 4HAIA 2Y2VA 4YXWD 2NGRA 2OCAA 1UQRA 2GRUA 5EKDA 4PZLA 3WLHA 3IBFA 3ZW9A 1ZR2A 1L5ZA 1XIVA 2GN1A 1C8VB 2X0EA 4MV7A 1Z22A 3BVPA 4F4FA 3UPTA 2FP4B 1Z4IA 2A9FA 3GCDA 5KJFA 3UWKA 4DJAA 4GKKB 4A27A 2ZG6A 4LOLA 1BHQ1 3CNHA 4LBWA 2B94A 4R8VA 1XQWA 1T9GS 1IZ0A 1CPYA 2O05A 3AY6A 4I9NA 4CIDA 5A4AA 3GFQA 4W5RA 2E4YA 1M3SA 1PWHA 3LYHA 3W8DA 2NSYA 3IBYA 3AXTA 1MIOA 2BLLA 3C5VA 4A6EA 4AUMA 3PFHA 1ONNA 4Y0VA 5CLLA 2V4MA 1K6MA 1QS0B 1RXYA 2HT1A 3Q6MA 4JB2A 1F0YA 3SQMA 2P27A 1Y9AA 1ZRMA 2A4MA 3CH6A 3G0IA 3KTAB 3N8GA 2QD4A 1X13A 2ZITA 3TNDA 3PNLA 5F77A 4FFLA 3VYWA 4M8LA 3EDYA 1PT6A 5GONA 1CQXA 2RCYA 3WWCA 2JLYA 2H8KA 1JB1A 2XYRA 3RNLA 4F96A 4XVHA 2D4AA 1OR8A 2OHIA 4AK9A 1OHHD 3BHIA 2Y4NA 3E81A 3Q2IA 5CA0A 4C4AA 3FVRA 3ND6A 4J3FA 1UDBA 2BWJA 4KGDA 4KFTA 4MP3A 2JCXA 3HSKA 5IZCC 2IGTA 3M70A 3R8XA 1BMQA 1U02A 3LDHA 3KOXA 5K1ZA 4YIHA 1T0JB 1ICIA 2HI0A 2XE7A 3BWXA 1JTFA 2FMXA 4W6ZA 3SNKA 1YZLA 4P3YA 4RY9A 3MA0A 1OFTA 5KC8A 4D79A 4QELA 5FUBA 2QSUA 2WUDA 3STUA 3ANNA 1WMBA 3MZ0A 3RIXA 3TOZA 5A62A 1U9IC 1PJ8A 4UW9A 1SU6A 2WG2A 4R1PA 5EUMA 1DIBA 1GEEA 1ABBA 2UXBB 4LOJA 2VJBA 5LA6F 3ANYB 5BN4B 4IR7A 3NOOA 1YONA 4M8SA 3DPUA 4DLKA 1U28C 1DIAA 3WIUA 3G6KA 4OQXA 2E7ZA 5CEFA 2A7XA 4EUNA 3SZUA 3DP9A 3T7AA 2VHUA 3RRNA 3W1WA 1DHRA 3WICA 4IJ5A 4AMBA 4N9WA 5CX4A 2Q6VA 2Q27A 3RKRA 5C4GB 4PYJA 2ZS7A 2JIQA 2BV3A 4TTTS 5CJ2A 4C87A 4JJKA 2PA3A 4GR4A 2MOKA 3CWQA 2X2EA 2X86A 3KOWA 2J7PD 2ZP1A 3AUFA 4RQBA 1EFRA 1IG0A 3I83A 1LWOA 4BQEA 1X1SA 4PX3A 4ZDIA 5HUQA 4O6VA 1GUAA 3TKLA 3TW6A 4PS0A 2XKBA 1Y8RA 2V4UA 4G8CA 4WZBB 4EKDA 3EGVA 1CVIA 1Z3IX 2XB8A 4YJ2F 3HUEA 4JI3B 4U6QA 2RHBA 2JCBA 4ZQBA 1WJGA 5FOQA 2I6QA 1SUIA 1H2BA 2VDOB 3Q5GA 4GZ6A 3WP1B 4WKCA 1SUDA 1KI3A 1NVTA 1MX3A 2GEUA 4IS2A 4DJJA 1JGTA 2OCLA 4EG8A 2N47A 3DYVA 4A1FA 2H00A 1VHDA 1F0PA 3E1SA 1E9EA 2BMDA 4QU8A 5FO1A 2J1LA 4BECA 2J0UB 1KZYC 2IZ6A 3MFYA 3E7DA 4PYMA 3I5UA 5G0SA 2DBVO 3O2JA 4FNMA 2QN2A 5IVDA 1B0PA 3PQFA 5EGNA 4WVLA 1Z5WA 5FP0A 2C7QA 4B7XA 3G8AA 3R3JA 2W93A 5KUTA 2FFQA 2YCLA 1UWKA 1XRLA 1QYIA 3PUKA 1JJ7A 2DQKA 4Y98A 2PX4A 5FUMA 4XWWA 2O5VA 1D09A 1LLQA 1RHKA 1X6VA 1YHZA 3WA7A 2A5DA 2UZAA 2VN8A 4UHBA 2FGKA 1XKQA 5ALGA 4IDCA 5SY9A 3EZFA 2E4WA 4IH4A 3SKXA 2IXDA 5B58T 1J8VA 5DX0A 1O6GA 3NO4A 4MS1B 4J16A 3COVA 2AEJA 3ABZA 4PONA 1WBBA 2ORED 4ZARA 2XRYA 3BJIC 3WYDA 5IT5A 2HIAA 5TARA 3OX3A 1PL7A 4NBUA 4Q3OA 5LDHA 3PTAA 3EXHB 1RXCA 4O4HF 1X0VA 3E4DA 2FUG1 4YNBA 1ISSA 5BWOA 3ZXIA 4RL6A 1N1DA 5J63A 4Z49A 4Q3EA 2AD5A 2BFNA 2DTXA 4DSUA 1ZI9A 3HJCA 4PTYA 2BI7A 2VT3A 3MELA 2Q3HA 2HLDD 4Z3KA 1A0OA 1KRHA 8GPBA 2WSYB 3QSGA 4NMMA 4X90A 1G5TA 1IJEA 1JFFA 3QI2A 1O57A 3U0VA 1Z8DA 3U4DA 1EEXB 3MUOA 4RSMA 5DHAA 3RTBA 4I8DA 2XDQA 2ONKA 3NNSA 4MGIR 2JEZA 2PBFA 3V00A 5B4VA 4NMHA 2ZK7A 2XMGA 1OC2A 3T7SA 1AJEA 3TD2A 2JBAA 1IOLA 5KTMA 1Z38A 3FSJX 1CZUA 4IV5A 1SKAA 1WR8A 3ACDA 4HPXB 4P35A 1HYGA 1JZTA 3BL8A 4JQYA 1V16A 3C3EA 2PD3A 5I4BA 4LVUA 3UCXA 4COOA 4L9RA 3BSFA 1U8TA 2QTWB 2VXCA 4OXYA 3VNSA 3HJNA 4NPHA 1OWNA 3D2BA 3Q87B 4B85A 3DVAA 3QLVC 4LGYA 5CH3A 2HMYB 4C7OB 3QU9A 2OXRA 5HR5A 1JSZA 1QIJA 4DIKA 3C3JA 3OQHA 5L7WA 1DO8A 2EFGA 3QVLA 2HT6A 3LKVA 4MKGA 4RA6A 5DYGA 5FPHA 4AXBA 2PG3A 1SXJC 3FB4A 3ED1A 1HBJA 5AW4A 2C7RA 4Z4GA 3BGOS 4R98A 1GA4A 1QRTA 1I7NA 1LS1A 5DDIP 1X1BA 4E2XA 2FUNB 1LW7A 2BBSA 4HEHA 3KJHA 4UQPA 4Y1GA 2F4VB 1VJ0A 1GPYA 2RHDA 3ZWWA 1K2VN 2BSXA 3HO8A 1QPBA 4D43A 3OG9A 3THXA 2IX3A 3X1ZA 3Q5DA 4ZAWA 3ZC3A 4XVCA 3V6MA 4N47A 2HR1A 3K31A 3KCQA 5U4QA 5JFGA 5AW0A 4BQOA 4OKIA 4S1PA 1V71A 1XE3A 2ZRDA 3MNFA 5HIKA 3L8CA 3R6GA 4J0KA 2WMNB 1PJSA 5C8YF 4DV2B 1OKKA 1IONA 2G1KA 4QBTA 1XCGB 1GRRA 2NVUA 3JQ6A 1EB9A 1XQ9A 1T4DA 2GXQA 1VE7A 2PMFA 1X7YB 5J2UA 4YA6A 4O1IA 3FBGA 4RFVA 2JVJA 3MJDA 1OXMA 1YRYE 2JIBA 3H3FA 2O7RA 2OORC 4RC9A 4G0ZA 1YIOA 3HLKA 4M6WB 1GWNA 2BKUA 2PLNA 5DLYA 4RJJA 3SZLA 5IAOA 1EFLA 1TVCA 2MR6A 2QLLA 2E48A 1UODA 1Y3CE 1CUYA 4WDRA 2Z58A 1LF5A 4BO5A 3D6FA 4LFBB 4V02A 2C31A 3EMBA 4DWOA 1E0AA 2Z9BA 3GQBA 2NAFA 4R8MA 4TN1A 3RJ5A 4FYPA 2BMWA 1OROA 4LC9A 4AL4A 4R0MA 5ITZA 5G1NA 1SPXA 4RIIA 2SKEA 4Q15A 1H5UA 5J4HA 1U2PA 1NWCA 2AQHA 2WI8A 3JYOA 2IUEA 3SXPA 4PQRA 2VJAA 4QHTA 3OJEA 4C7KA 2HHLA 3LF1A 3G1TA 3NBFA 2MIIA 4OA8A 3C98A 2JGJA 4WECA 4KR9A 2P9HA 4DR7B 4JYAB 1Z6ZA 1G2PA 3KETA 4DMUB 1DBPA 4MI6A 4ZREA 3H2BA 3TCKA 1QFMA 4ACBA 3CO5A 3ZHTA 1UBLS 3MTGA 3DULA 3YASA 2NQ2C 2E89A 3IAAA 1Z63A 1ZNQO 3UA4A 1IPHA 4YO7A 2GARA 1Z29A 3NWPA 4CQJA 4DM3A 1H6AA 1B0AA 1Q2UA 4MVJM 1KMMA 3PEEA 1QNLA 4BV8A 4CT4B 4ZV9A 1RYZA 1Y1RA 3CRMA 3BSYA 3KRTA 5BOSB 2J3KA 3NYRA 5DBFA 4S24A 2Q3BA 4AIRA 1JDPA 2WV9A 1X74A 1ZLYA 4CM5A 1T1SA 5JH7A 4IVRA 3TG2A 4MO2A 1JAHA 1XTVA 1JTVA 2R7NA 3O3NB 3OTQA 5JS8A 4AKIA 3A0RB 2VBGA 2HL6A 1GVHA 1N6IA 1YDEA 3O21A 4MUNA 1MG5A 3HWWA 3CTPA 3DZ8A 4FSHA 5C3UA 2C3PA 2XECA 1HDGO 4HB3A 1HLDA 1WZEA 5J4YA 1CLEA 1T8WA 2XE8A 1UAYA 2D0DA 1AGRA 3PKJA 4ZPJA 4NV3A 3VR3A 4F9EA 3P5SA 3WYNA 1S3FA 1LK5A 1SPBS 3L0CA 2QL5A 4Y2YA 2HJSA 2WLTA 2ZQYA 3L8FA 2D2XA 4H1TA 2OQIA 3JARB 2QD2A 2PYZA 4U63A 1SBHA 2VRBA 3GLHA 4DZTA 4F60A 4R84A 3FMIA 4TMKA 4CG3A 1KMNA 3DT9A 5IJ0A 4C22A 3H6KA 3TG8A 2JLUA 2MSEB 4OXRA 1KJZA 4DA8A 4LYGA 2V9ZA 2BBTA 2YOHA 2QF7A 1Q6ZA 2IBMA 2DM6A 1H8ED 3F97A 1JE1A 2A2ZA 4NJMA 1S8AA 2GVDC 2Y0EA 3L8HA 3QFSA 5CVUA 5D00A 2X1MA 3IUEA 3RTAA 1QX3A 1RCFA 4KUGA 4DDMA 1R3UA 4S1WA 3JYLA 1TU3A 1Z0IA 3EVTA 5ALZA 4FZJA 1AUPA 4DEXA 4ADSG 2V74B 3R6DA 1TIPA 3SE0A 3SSMA 1T34A 4YRMA 3NUZA 4JOCA 1MIOB 4LE2A 7GPBA 2WG1A 1J5XA 3ETCA 4BV9A 3LVRE 3GUHA 3IKJA 3DWEX 1Z73A 1GTZA 2OLJA 3EISA 3BRSA 1WHSA 3GCXA 4JVNA 1QHYA 4BTVA 5KWVA 1T5BA 3DV2A 3H1GA 5FOXA 2CFCA 4Y6QA 4F8EA 3ORQA 5GONB 3MWDA 3T54A 3CYFA 1XI2A 3D5TA 1KNXA 3G0BA 3DL2A 1Y7IA 4PLWA 1CQJA 5INTA 4N0PA 4EX6A 4FIDA 4J7CA 3ZHBA 1UBEA 2EBFX 2IPNA 4KREA 3JQRA 1Z74A 3VYRB 5CA0B 4PSCA 3EGIA 1XV5A 3F9IA 4RUKA 4XLLA 4X9XA 1RM5A 5T6BA 2VAWA 3R20A 4MK4A 3UB3A 1EA7A 1R9JA 3CW9A 2J31A 3R6TA 1IBKB 4IM7A 5BWBA 2PYIA 5LMUB 4JUIA 1TZ2A 3CVUA 2RARA 3GJ7A 1V25A 2GQ0A 3Q4GA 3LXRA 4I14A 2Q3CA 4OI1A 3I2GA 3DF9A 1G60A 2VQ3A 3Q0EA 1PLJA 5COQA 3LFHA 5FQNA 4DN6A 3OZBA 1R37A 5J3JA 3G2OA 3AHIA 1HYHA 3GUYA 5F5LA 4RH3A 2BELA 3R6LA 2O06A 2VJDA 1DSSG 2JFNA 3TZCA 4D2IA 2IYLD 1NGSA 1VMAA 3CX6A 4YDRA 3A1CA 2YWHA 5JY6A 4PNEA 2JLBA 3V2GA 2AKAB 6REQA 4N0MA 3HY6A 4RVNA 2WHPA 3AR3A 3AR6A 2YINC 2Y2UA 3QUQA 4UAJA 3MTAA 1RZRA 4D3YA 2PZLA 1O54A 1G6KA 4PHFA 2QRKA 2FEPA 1Z6QA 4D8YA 1PLLA 1DCKA 3HR7A 1M33A 3MUEA 2ATCA 3TNJA 2PANA 4YRKA 2YWDA 4PQYA 2O0MA 2IYFA 1ZR4A 4Q03A 4M86A 4C88A 3O93A 2UAGA 4QA9A 4RTSA 2C03A 3RSQA 3TEJA 4NONA 4QODA 4UBMA 1FDWA 3OOSA 4EHDA 2ZBQA 4TSKA 4Q9KA 5K99A 5JAIA 1TM1E 2DOKA 1NW3A 5AHWA 3W2TA 3R3SA 5EJ9A 3CIOA 4OKSA 2FN4A 2YNMC 1ELOA 1O94C 3AOEA 2ZAGA 3QZUA 2ECQA 3OPMA 3SYNA 4MZDA 1SKYB 1EVYA 1RQXA 5EWJB 4A8JA 4D1YA 3U9LA 1M5UA 4HBGA 1Y8RB 4XQGA 1M1XB 3H8VA 2AJCA 3FTDA 4AY5A 4F04A 2OAQ1 4IFIA 3RTEA 4DA7A 3GLIA 4MS3A 1AS2A 1JILA 3VNQA 1R6AA 2JFXA 1GKUB 2DXIA 2IZ7A 1CC1S 4XTCS 1ZN8A 2B4YA 4Q9JA 1I0ZA 1W2HA 4XWGA 1S9DA 3LLMA 3JQPA 1N9GA 1R5BA 4MUBA 1NC1A 4OL0A 5B1HA 3ZBUA 1CE8A 3N8KA 3K6SA 2QTGA 1RLTA 4H27A 5I4CA 4LJYA 3H11A 3QWBA 2JH8A 4G1FA 2VP5A 3R3UA 4FZRA 4BKRA 1PVVA 1XJQA 1FFHA 4QGGA 1Z56C 1P4RA 4U6SA 4RH0A 4UBIA 1V2HE 2GGSA 4C4XA 4Q7EA 3VC2A 3FUUA 3SQNA 4KHPB 3AWDA 3EPPA 4C3VA 2O5EA 4L1KA 2L82A 5AKEA 2P41A 1SZJG 1CTQA 1DE0A