2QZJA

Crystal structure of a two-component response regulator from clostridium difficile
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
121
structure length
121
Chain Sequence
QTKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNVTTCPIVYMTYINEDQSILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a two-component response regulator from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Transcription
molecule keywords Two-component response regulator
total genus 43
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qzjA00
1C4WA 4P98A 4YRZA 3OQNA 4EVSA 3SM9A 3RVPA 4MR8B 3O1HB 1KGSA 2H0AA 3CTPA 2IPAB 3QX8A 1SXGA 4JP1A 2PKXA 3RVOA 3EULA 4S05A 5DGCA 1OXBB 2FN8A 2RJNA 4XARA 3ILYA 3CLKA 5BR1A 1Z13A 4KZKA 4WUTA 3DGEC 2CWDA 4GNRA 3IP9A 2V0NA 3LUHA 5T7BA 4RK5A 3GWGA 3CU5A 1RZRA 2E4YA 3OLXA 3RVNA 2QR3A 2RDMA 7ABPA 3C97A 4N47A 1NXXA 2NUBA 4Q6BA 4D6YA 2IKSA 4DN6A 2Q5CA 4NCAA 4UHJA 3TB6A 4JA2A 4N76A 4PICA 2RGYA 4LZLA 3OO1A 4XAQA 4EYOA 4RY0A 5EWLB 4DADA 3H5IA 3FMVA 2R48A 1DBQA 3DLHA 3N0XA 4NICA 1GUDA 2MYUA 4KNYA 1TM2A 1YVUA 2LP4Y 1Z17A 3HS3A 4MGEA 1ZGGA 3CFYA 4D6XA 5KQMA 3ROFA 2QSJA 3OLVA 1U8TA 1Y1LA 3HZHA 4G0ZA 4MS1B 4PYRA 4ZJPA 2GKGA 4CBVA 3RVJA 1A0OA 2FLWA 4NV3A 4O1IA 1FFGA 5TQ2B 4ZYLA 3F73A 3NBMA 4NQRA 2R25B 2PUAA 2MSLA 1ABFA 3DBIA 3N53A 4RWEA 1QP7A 1KRWA 4YWHA 4EUKA 3LKVA 4KQCA 4ZPJA 3TD9A 1E2BA 1JDPA 2NZVG 4W5QA 2JVJA 4LE0A 4YO7A 4TN5A 4OATA 2FEWB 3M9XA 4ETIA 3O21A 5FWXA 3BRSA 2GX6A 3LUKA 1GCGA 2FTKE 4HYEA 4LX8A 5JNRA 3H5LA 3HCWA 1MIHA 3KYIB 1PEYA 1RNLA 3QX9A 4YP9A 1AB6A 5IEBA 1JWLA 1W9HA 1PEAA 1EWVA 4MRMB 1ZHHA 1ZH2A 4F11A 5KI6A 3NNDA 3NNNA 4RK6A 1B00A 2MSWA 1LK0A 3LOPA 1NXVA 1DG9A 3BBLA 4OBBA 3HM9A 3C3WA 3HSYA 2ID9A 5HSGA 3RVLA 3O74A 1PNTA 2X7XA 3CZ5A 3GBVA 4RXUA 3NHMA 2JCGA 5BQ3A 1QKKA 4WXEA 3F6CA 1DJMA 3CS3A 2PLNA 2E4UA 4MS4B 2NT3A 3CNBA 5GOTA 1CEYA 1JBEA 3I42A 1DBPA 2PE5A 4RK7A 2QU7A 4E7OA 3LUAA 2JB9A 1MVOA 2MYPA 3QK7A 1BA2A 3RVKA 4OG2A 1W25A 2A9OA 1XHFA 1NXPA 3GBPA 2M98A 2QV0A 1U2PA 3JY6A 2ZAYA 4RU1A 4Z99A 5DTEA 5GQSA 3O2QB 3BREA 1ZITA 4IMJB 1RXIA 5B3JA 2HQBA 1WETA 2F8SA 4M88A 1JL3A 4MRMA 3LFTA 3Q7RA 4YV7A 4XLTA 3OO0A 2FMHA 3MYYA 3H5OA 1U0SY 1TLFA 1I3CA 3L49A 4KMRA 3Q7SA 3H5VA 5HKOA 3P9YA 3GA5A 3FFWA 5CHYA 2QXYA 3ROTA 4OLBA 4UHKA 4HNSA 4JB2A 5HM6A 1YS7A 2IPMA 5TPWA 1RZRD 4KK4A 1ZAYA 2FMKA 4MQFB 2HSGA 3RH0A 4KRFA 5ABPA 4RS3A 1Z15A 4NCBA 3URMA 1LBIA 3N75A 2WRZA 2QVGA 1K68A 1RPJA 5C5CA 2QVCA 1JLKA 4Z4CA 4G0YA 5DKFA 4KPYA 2E4VA 4EYGA 5C5EA 2TMYA 5JNTA 3QLTA 4RZSA 4L85A 2PL1A 1XHEA 4KV7A 5FWYA 4N0QA 2L19A 3H75A 3IPCA 3LUFA 2AYZA 2P9HA 4EYQA 1QO0A 2E4XA 1A2OA 1S8NA 5PNTA 4OLAA 1OXKB 1FQWA 4WWHA 1P2FA 1USIA 3RVSA 3C3KA 4D74A 1JH9A 5TPZA 2QZJA 5IUJC 3OQMA 4MS1A 5D2CA 3LTEA 5TQ0A 2PUDA 1VPWA 3Q41A 3SG0A 2PUGA 4PE5B 3JTEA 5FWYB 3IPAA 5TE9A 1RXEA 3N6VA 3QLUC 1E6LA 4EGSA 3H1EA 2HQRA 4LDAA 3HEBA 1NXWA 4MR9B 4MQEB 2LBPA 1ZGZA 3TMYA 4WT7A 1P6UA 3B2NA 1R8JA 2PL9A 3A3KA 3CRNA 5EWMB 2L18A 1MAVA 4W5RA 4RY9A 3KYJB 4WZZA 2A9QA 1ZDMA 4TLMB 5JNVA 1M2EA 4WXMA 5FBKA 1M5TA 3EDCA 2IDMA 3TO5A 1JDNA 1ZN2A 4EVRA 5JS1A 2E4ZA 2CHEA 5IBQA 5DLEA 3I5AA 2WY2D 5IUNC 2FEKA 1MB0A 4OTZA 5IEJA 2MYNA 5KC8A 5KQPA 3O75A 1CHNA 2PJUA 5TPZD 2A9RA 5DCLA 2IPNA 4YS6A 5EWMA 1QPZA 1F51E 5KQLA 3QELB 3KHTA 2IYNA 3H5TA 1KMIY 1Z26A 4G0XA 3ILHA 3MQ4A 4ML3A 4Q7EA 4EYKA 3LUCA 4RKRA 3OQOA 2WMYA 1USKA 1EWKA 1NXSA 2OQRA 3L6UA 2JRLA 4RV5A 3LUDA 4JOQA 1DRJA 3EGCA 4G0PA 2HQOA 3KLOA 2YHBA 3CG4A 4FB4A 1AB5A 3RQIA 2PMCA 5CNIA 1E6KA 2FQWA 3KSMA 2H3HA 3QLVC 4HNRA 4MAAA 4XXHA 5JS2A 1DCKA 4YCSA 4QPJC 3NHZA 1Z18A 2WB4A 3IP6A 2NZUG 1XWWA 3QEKA 1TVMA 1DP4A 3H1GA 3N8IA 3MMNA 5KQGA 3D02A 4H60A 1ZH4A 3GRCA 5IX8A 4ZMRA 3EQZA 3JVDA 4LE2A 2AYXA 3UKJA 2FKAA 4W5NA 1JFTA 4RK4A 2FMFA 1D1QA 3BRQA 1YS6A 2FQXA 4MPTA 4Z4IA 2JK1A 2MSKA 3I09A 1LBHA 2JVIA 3MM4A 4DQDA 3C3MA 3IDOA 2FLKA 3GV0A 4MQEA 4MR9A 1EHCA 3RVMA 3IP7A 2FMIA 5JNWA 3H1FA 2E4WA 2WJAA 3MIZA 5TPWB 2OENG 3EJWA 5JNSA 2BGGA 3T38A 1VLZA 2FSPA 2FW0A 4RK0A 4S04A 3F6PA 2PUFA 4Y9TA 1Z16A 1Z2DA 1P8AA 5JNUA 3D8UA 4KREA 3KTOA 3KKEA 3HDGA 3DZDA 4KK3A 4N03A 4XFKA 2JVKA 3KS9A 4N0PA 4ETMA 1BVHA 4G86A 1HEYA 4F8JA 4LDZA 4PEVA 4IGAA 3S99A 2PUEA 2I6FA 3BILA 1SD5A 4YGXB 2HJ9A 3W9SA 1U2QA 2B1JA 3K4HA 2VK2A 4JASB 3QELA 4YR7A 3UK0A 1JX6A 2MYTA 4JB0A 1FFSA 3LUGA 4P1ZA 4KVFA 1BAPA 4RDCA 5T3YA 1APBA 4H3HB 1D4ZA 1GLGA 1NXOA 4QICA 4ETNA 3CHYA 1D2AA 3GT7A 2FN9A 3KG2A 1DBWA 2ID7A 3CZCA 1D1PA 3QLVA 2FEPA 3RVQA 2PUBA 3O1JC 1DC8A 9ABPA 5I4CA 4IF4A 3LUJA 1BDHA 3CG0A 4Z4GA 1EFAA 2JBAB 3QEMA 3G1WA 2VYCA 3CKMA 4RXMA 3OMWA 1KRXA 4EY3A 1NY5A 1DZ3A 3N0WA 3FFTA 1FFWA 1QO0D 3QLUA 3JS5A 5FWXB 2CD7A 4Z9AA 5IUKC 5TQ2A 2HPHA 1ISSA 2IOYA 1YTUA 3OLYA 3JPWA 4F06A 3SQNA 3HJFA 3OM1A 3IP5A 3VNAA 4W5TA 2LUOA 1M2FA 1GCAA 3LMKA 4Q6WA 5IULC 3H6HA 3HV2A 5FBHA 2JBAA 3QEMB 4RKQA 3A0RB 3HUUA 1QNLA 4G0OA 4Z4FA 2FXIA 3T95A 1YMVA 3EODA 4XASA 3UUGA 2B4AA 2DRIA 4IRXA 5TQJA 1Z12A 3T8YA 5IC5A 1QP0A 3DGFC 1L5YA 3KCNA 2R47A 1ZY2A 6ABPA 2PUCA 1CYEA 4G0QA 4JAVC 5F64A 5BRJA 1ABEA 8ABPA 2YHAA 1DRKA 4Z9BA 3Q15C 2M1ZA 3R0JA 4H3KB 4QYWA 4B09A 1VKRA 3O1IC 1F4VA 1YIOA 3KLNA 1C0EA 2VUHB 4KQ9A 3SNKA 1EWTA 1ZESA 3M9WA 3EAFA 4E7PA 3FDFA 4TMYA 4MYRA 4Z4HA 1JF8A 1JHZA 3HDVA 3TX6A 3O2SB 4W5OA 1TJYA 2CHFA 3EQ2A 2GWRA 3LKBA 4FE7A 4PZ0A 4QYMA 5EWLA 3O2JA 1YMUA 2WWVD 1A04A 1QQAA 1BDIA 2NT4A 2WJWA 3JPYA 3OMXA 4RK1A 5CNKA 1T34A 4MS4A 2L2QA 4IILA 1IIBA 1QP4A 4RSMA 2J48A 2R4QA 3E61A 1URPA 4HNQA 4RXTA 1M5UA 3K9CA 4LRQA 3N0RA 1SXHA 3C6QA 4KFCA 3OLZA 3GL9A 2O20A 3M6MD 4F12A 3KJXA 1P6QA 4Z0NA 2N9UA 4LE1A 4F3TA 5HQJA 2GBPA 3HVRA 1PUXA 1NATA 3F7NA 2F8TA 1D5WA 1DC7A 1BDJA 1SRRA 3E3MA 3VNBA 2FQYA 4G97A 2RJOA 1QMPA 4MS3B 1LJUA 4MR7A 3NNSA 3H5WA 1J56A 1Z2EA 1JYFA 1JFVA 1UDRA 3MA0A 2PAFA 3SAJA 4ZMSA 5B3JC 3A10A 1NTRA 4G0MA 4Z4EA 3HXMA 5EWJB 4N41A 1USGA 1ISRA 1FSPA 2FVYA 3HO1A 1PNRA 1DCFA 4O5AA 1EAYA 2ZWMA 4MQFA 1PHRA 3MF4A 4O1HA 3GYBA 1VRVA 3OLWA 4MR7B 3A0UA 4MLDA 1YK1A 1TMYA 2KYRA 4IMIB 4L4UA 2IPLA 3FFXA 1H9CA 5KC9A 6CHYA 5CNJA 5EWJA 2A9PA 1GUBA 1Z25A 3JVIA 2P4UA 4GPAA 3G85A 3T6KA 1QQBA 3DLBA 4FE4A 5BRAA 4RY8A 3Q9SA 1K66A 1JFSA 2L17A 4MS3A 4MLCA 4MR8A 3SY8A 1SXIA 4YLEA 1ZVVA 1U04A 5ED4A 1MB3A 3Q7TA 2LPMA 3HUTA 5E3JA 1LJLA 1L5ZA 5KWSA 1JYEA 2QW1A 3HK2A 4EVQA 5CNMA 1NXTA 1YK0A 2LIVA 5TQ0B 3I45A 2GI4A 1E6MA 2XDYA 1DCMA 3FGZA 4TLLB 3RVRA 2VUIB 3OM0A 3H6GA 2W42A
chains in the Genus database with same CATH superfamily
4A6XA 4AN1A 3KYBA 4HTFA 1GUAA 1L5WA 4E14A 1HETA 3JQBA 4H7FA 2Q45A 4BQRA 3LC0A 1VECA 1MABA 2P0EA 3SM9A 2LDXA 4BO0A 1UOPA 4YXWD 1JIXA 3CUWA 3IAM6 2XCIA 2XE8A 1ADJA 3TB4A 1QC5A 2PY6A 5EERA 4CV2A 2FFAA 2RB4A 1KH3A 4CR6A 5K0NA 1R0YA 2WPNA 3OQPA 3IB3A 3A4IA 3P32A 3O8OA 4GH5A 1G59A 4G0UA 4Q9AA 5M7EA 1QWOA 1QRUA 2A9KA 3Q8LA 1NMYA 3ILYA 3BXEA 3NETA 3SQWA 2FETA 3CZQA 4NVRA 1NQTA 5FWAA 5LLTA 3I9KA 2GCOA 4GNRA 3MOSA 4XM2A 3UCEA 1WPQA 1FMCA 1KO5A 3EYWA 3DE3X 4NS4A 1O97C 2UYYA 2DG2A 4BZQA 4NP6A 2JJ8A 1Z75A 2QR3A 2RDMA 4NBVA 1NXXA 1U1DA 3ZCPA 4ZVTA 2EAUA 2V55B 2AC2A 1SULA 3L6DA 3E9MA 4N76A 2OAGA 1FFDA 2R6R1 5AVWA 4MV1A 1LVHA 1PQ4A 4Q9NA 2GN1A 3Q3GE 3H5IA 4LF4B 2R48A 3FRIA 5T41A 2QNIA 4FKBA 3RV3A 3FF1A 4XWGA 3K0KA 4D42A 2LKCA 1I7QB 3KQKA 3NVAA 1XZHA 2OEPA 3HA2A 3QU4A 2QQ0A 4OOFA 4S12A 2MCFA 1NBAA 3WE7A 4QU8A 3W1EA 4YACA 1R6BX 2CNKA 1ODSA 3NALA 4FMPA 1W59A 4Q24A 4CBVA 4E2WA 2PV7A 1K1EA 4TWZA 3KR9A 2OFPA 1FFGA 4LCEA 4QO7A 5CHEA 5K8UA 3PEWA 3F73A 2Q46A 1NRXA 2RGGA 4D97A 2FUNB 5CTJA 4C0SA 4JX9A 4TTQA 3CQ9A 2A94A 1TUEA 2BFBA 3A70A 3I3OA 4R84A 5HBRA 3ZNQA 3ECAA 2AG8A 3P2IA 3FX2A 1E1QD 2Z30A 3IOMA 3ND9A 4QYXA 2FSVC 1C3OA 1A2KC 4YAIA 1FIUA 4PBRA 3DTYA 1CF2O 1E1RA 4DBVO 1YOVA 3MGCA 3WLKX 4C7MA 2JF0A 1YR1A 3B1KA 1U2TA 5DN6D 1C2TA 3AUFA 1KZYC 4IH1A 3B3JA 3FUVA 3WYFA 4WKOA 1MIHA 2BELA 1BXRA 3PWTA 2ZM5A 1M34E 3JRNA 1MNQA 4LJSA 4EA8A 2WAMA 2CKDA 4PIMA 4DV5B 5FEUA 5KI6A 4I9GA 1Y3CE 2P9ZA 4RK6A 4PZPA 1ZZGA 4NZMA 4KLAA 3V46A 2F4VB 5AYVA 3MOIA 1YQEA 4WACA 3RVLA 1KJIA 3GJ6A 3PIRA 1NJGA 2FW6A 2ORIA 2ZIFA 3LTNC 3RS0A 4TKVB 5CYFA 4YJ3B 2VQ3A 1KIMA 1P7VA 3NBFA 3PA8A 3PQ5A 4OFXA 4KIGA 1LRLA 2E4UA 1E2HA 1OFTA 1RQGA 2Y67A 5CXXA 1S2NA 1YKFA 2AMLA 1EUCA 1B0PA 2W2NA 3JZAA 3EZLA 5LCXA 3RIGA 3ZGLA 4DG5A 4Z49A 2JK0A 3NTVA 4ZT7A 1VI6A 2ZJ7A 3LD9A 1G4HA 1PG5A 4WCFC 4AZ3B 5B30A 1WKBA 4R7ZA 4Z99A 3BSSA 5JAMA 3BE6A 2ZAYA 4P7BA 4LNUB 2R6DA 2A33A 3VR6H 3K4PA 1ZUIA 4U2BA 2GSDA 3B36A 5B2EA 3PGLA 4A15A 4OLFA 4KR7A 2JFHA 1FTNA 3HPQA 1DARA 1G9SA 1K8RA 1I4TD 3KXLA 1QFXA 1V0JA 1NVAA 4Z3DA 4J6EA 3AM5A 2G9VA 3CNOA 2XODA 4KDCA 3OPVA 4WNIA 4QT4A 3TKLA 1E5DA 2GBFA 2W6JD 3EG5A 4ZQBA 3WRYA 1SN7A 3KCQA 4DMHA 3C7DB 1EUYA 3K6RA 4P83A 3OQVA 4JVSB 4EG1A 1UC9A 2WIFA 5BSVA 1HYBA 5ICGA 4GVLA 1GARA 1U0FA 1FA9A 1YFZA 3GEHA 4I1UA 5ELXA 1I80A 1GDTA 4KSCA 3L1KA 4RQUA 4UDOA 3OFND 1HYQA 3FPKA 5K0JA 1KHTA 3SIPA 2ECPA 3TX2A 4R3NA 5CB6A 4UQPA 1TPZA 1SUPA 1UPXA 2P90A 4OQYA 5F1KA 1MB2A 1LDEA 2BL4A 5BSTA 4BS9A 4Z4QA 1Z4JA 1M6WA 3H2IA 1XKTA 4OBEA 1LNZA 1UJ4A 5C5EA 4HDSB 3PXXA 2QT0A 4RZSA 5A4DA 1ISFA 3T54A 5CIQA 1SIUA 2QRGA 1FDIA 3GN1A 3VOSA 3P2YA 4BN0A 3T1OA 4DLKA 2A1IA 3ASVA 4IAOA 4MYSA 3RAJA 2DHDA 1ZD2P 2WT9A 1NQWA 3R9IA 4KRYA 2OTCA 2WKSA 4M9ZA 3WLRA 2P9HA 4BNKA 2BFOA 1P9LA 2E4XA 2YZ2A 3GA7A 2XW6A 2QUZA 2YZNA 3ILVA 3PGJA 1SH7A 1FQWA 3HLYA 3KB1A 4WWHA 1UAGA 3OX4A 4RLSA 5DWDA 5HPYB 1JLLA 2DPGA 4UAJA 1YB6A 2RBGA 2XCOA 3MTBA 4D5EA 5IUJC 5J3JA 1JH9A 2IZ7A 3NIDB 4M89A 1BGXT 2B8TA 3N70A 4WD3A 5DRTA 2BRUC 1ZJYA 3H2KA 4OQXA 5B4UA 2GAFA 2O7NA 2P3SA 1N6PA 4O2AA 1T29A 2XCQA 3OD5A 4PE5B 3HA5A 4X8MA 3GFRA 4EJ2A 2YWRA 3IA2A 3RYHB 3OJLA 1V2GA 3H1EA 3MINA 4AMYA 3DAHA 1FDSA 4RA9B 1E1MA 4JZYA 5CLJA 4G6ZA 4UBLA 5CDSA 2DY0A 3HLTA 1DEHA 4Z53A 1YC2A 3MTAA 4QTZA 3I1YA 4X7RA 3A3KA 4H31A 3OMLA 4F86A 1IAQA 4H7DA 2P9CA 2YHIB 4N39A 2HXYA 1WO8A 1SBZA 1UDWA 2Y6UA 1KZ9A 2R3SA 4QOJA 1E4EA 2NSLA 3DL7A 4LBVA 3OJCA 1BWQA 5DWVA 2ATIA 3HFRA 3LQYA 4MMXB 4RD3A 1GZVA 5FR1A 5CEEA 1OH5A 2PMBA 1JDNA 4YT4A 5KSOA 1EHYA 5IBQA 2XIJA 3S8EA 1F2UA 3B1WA 2I29A 2AE1A 3EWNA 4OQNA 1NX9A 4Z7OB 3TSAA 1X0VA 2K7ZA 3WIUA 1Z0KA 4K7JA 2HF2A 1QE5A 1VE5A 3E8SA 5AVZA 1NTOA 1P1FA 1UXGA 1OGJA 2OZEA 2QY6A 3CNHA 1BWPA 4TSFD 4DXDA 5B2FA 4Q7LA 3EVEA 1EVLA 5EWMA 1Y8AA 1IU9A 4Q0MA 4FMDF 1XD2A 2DTEA 1YS2X 2OLJA 4LOAA 5L53A 2HBYA 2QW8A 2EKZA 3TNJA 4BVGA 4F3KA 4TQUS 3QP9A 3CLTC 4EYKA 3LF2A 5TRTA 3ZDQA 2OSBA 1Y3IA 3D81A 4L4SA 4QU5A 4RHXA 4X3CA 3F7TA 3GG9A 1XEAA 4V03A 1RKQA 5ECGC 1UWLA 3LVBA 1IMJA 4UMVA 1KS2A 1Q3HA 3G1TA 1WSDA 4KXMA 3FSJX 1U94A 1JR6A 3CLSC 4MCHA 3A31A 2FW9A 1DCKA 3W34A 4TROA 1DBRA 4NU6A 3NHZA 4J3NA 1T13A 3VISA 4PLPA 5TC4A 4D41A 1IVSA 2A59A 3TIXB 3IBCA 5CVJA 3H9EO 3K3PA 3N8IA 3DA8A 1Z0FA 2HPAA 3G2IA 3PRKE 2GJAA 2Y1GA 2JIBA 4UUNA 5DASA 4JX8A 4YCMA 2AT1A 2NGRA 1HT1E 3FHLA 3QUBA 2AYXA 3G49A 3VDRA 2EX0A 1IULA 621PA 4OGFA 3AVUA 3N58A 1GG5A 3DONA 4HB3A 3GAFA 1I30A 4JNKA 1JFRA 2ETXA 4ARAA 1QF9A 1Y34E 3NYQA 4BGIA 4B3XA 5CFLA 1NP6A 1ZK1A 4FEGA 3TMAA 5JD5A 3WBFA 4UMDA 5BMVA 3D4OA 4MKZA 4OQQA 4EQ6B 5BNFA 1XF1A 4CMEC 1FEZA 1SWVA 1KY4A 5GAJA 2PZGA 1H4SA 5JRJA 1JVNA 1NLFA 2XEDA 5HILA 3CT4A 2H17A 1E5TA 1FE8A 4FWBA 2XOXA 1U4NA 4L5YA 1ID8A 2QSYA 3QU7A 2RBEA 4R54A 1DUSA 5HCIA 1DIOB 1ZCBA 2VDQB 2OBYA 3JWEA 2JAUA 3EZXA 3QTBA 3NIFB 3OJWA 4GEKA 1G1MA 1QHNA 2HA3A 3K16A 1XLUA 1WV0A 3IRVA 2O50A 4WA7A 5AM1A 5FFNA 3ZOKA 3Q8KA 3PHLA 2NU6A 3C16C 2ZCUA 1ETHA 2A0UA 4F45A 3BHIA 4WJZA 5EPUA 1CQWA 3A1FA 3JQDA 2CYBA 5HCUA 4C88A 3HMKA 2QVLA 1YRBA 3BILA 1SD5A 4YGXB 3GFGA 4BPRA 3OM8A 1ZC4A 1XPUA 7MDHA 1O6ZA 1E3EA 2RONA 4P92A 3WWEA 3UK0A 3PGXA 4BFWA 1EXVA 2BKUA 3I34X 2GZMA 2YUIA 4X0EA 3GAAA 1C30B 5JV5A 5GM2A 3BSWA 1J90A 5T3YA 2GTHA 3EY4A 1KFJB 2OM6A 3CHYA 4MUHA 4MUGA 3FYHA 1ENYA 4OXRA 2PVPA 5KYVA 4MO2A 4ZA2A 5LU8A 3L4BA 3HDQA 4Z4GA 5AW6A 3QEMA 4W9NC 4NI5A 5FBWB 4Q39A 2FW8A 5JXGA 4JVOA 1QFJA 2XKKA 3MGAA 3C70A 5KVQA 1P2GA 2WKWA 4BO4A 3AVTA 2V7XA 3DOOA 1WLYA 4G5XA 5BSMA 2VF2A 1IEWA 4WXHA 1YZHA 1KAGA 3C74A 3K8QA 2QD2A 2FX3A 2PWAA 2ZYIA 4NEHB 3WJ2A 1W36C 4KDFA 2VDPB 3D2LA 2HMSA 1IB0A 3PEFA 4GP7A 3NX4A 4BTEA 1TQHA 3WLPA 2F90A 2C97A 4J3FA 2J07A 1BMQA 3TLCA 3GRAA 4DG8A 1JG3A 1QHHB 4W5TA 3GYGA 2CXHA 1GCAA 2LV8A 5IULC 3ZS9A 1GQYA 3HU5A 3GLIB 2F48A 2ZJ0A 2HY7A 3OCXA 2WIBA 3HDJA 4G9EA 4Y2PA 2FXIA 3GEEA 1Q92A 1TAUA 5CYGA 2XRFA 5JSZA 2Y1KA 2ZTHA 1GPH1 3GT4A 4KDRA 3NWPA 2G06A 4QA9A 4D0GA 1Z12A 4GR9A 5CB4B 3LC2O 3IAS1 1A82A 4QUEA 4YUZA 1SHLA 1IYZA 3HCRA 1DOZA 1PUJA 3A1TA 5J2TB 1CPYA 4R4JA 3T3MB 3JD4A 3CX7A 4V0SA 4C0BA 3P9CA 3K9FC 1WKVA 3TLBA 1EWTA 3A9UA 4M8IA 1Z83A 4E7PA 3TFOA 3N0VA 2PKQP 4ZQEA 4G8DA 4HATA 1DWUA 4O2RA 1NJ6A 2VSNA 3DMTA 3HJNA 4JLKA 3HPRA 3LZ6A 3TX6A 5J40A 3VUFA 2I7XA 3T1HB 3R8XA 1G98A 4W7IA 3R0XA 4M1TA 4ZOQI 1P74A 1PR5A 2ZM6B 3EFEA 4MS4A 1KDYA 4JXXA 4OL0A 1GAEO 4ZWNA 4URWR 3EPRA 1KBZA 2BKEA 3FAZA 4LI3X 1IL0A 3U4GA 2YXEA 5FLEX 2WK1A 2VHJA 2YNMA 3PWSA 4Y6PA 4ZQGA 1P5ZB 1I3OA 3FPJA 3HXPA 5FL3A 2EZ8A 3SSAA 3RUAA 4ZCIA 1H2YA 2G3YA 2OVBA 4LXYA 4F3TA 1QZTA 2PSFA 2B8NA 1WHTA 2IW1A 2XQFA 2X14A 2ATEA 1IVYA 3JX9A 3KT0A 5H3LA 3VHRA 4BNYA 4N3AA 4DWOA 2CN1A 1SR8A 4YI3A 4OGKA 1NLUA 3LZCA 3OOJA 4KKVA 3OPYB 3LX5A 1REQB 5CJPA 1IN8A 1TZMA 1F8XA 3QPUA 5EVCA 4GU5A 1CR0A 3P4XA 3R5TA 4JLBA 1TJ5A 4G0MA 2D7DA 4X1KA 3EPKA 5F3DA 2QAJA 4RH3A 2RHOA 2C2HA 2NUAA 4R0MA 1DCFA 1BXRB 1PNRA 1U63A 3T5AA 3QYAA 2V6GA 2Y76A 3ELUA 3CBGA 3FVWA 4G1VA 2Q4BA 3MF4A 3IEUA 5DYTA 4ZVLA 2VH2A 3HBNA 1DEOA 2QQFA 3OLWA 4ZRMA 1NVXQ 3FDZB 2XB9A 1R64A 4RMIA 2V6FA 1VG9B 1XD2B 4ZQIA 5CM8B 521PA 5JY6A 1M2OA 1C50A 5H4GA 4IMIB 1R4NB 2QD1A 3OQBA 4BX2A 4JLVA 4YJ3A 3VQTA 5HUJA 5LQJA 2ZYTX 1GUBA 4RMGA 5FULA 1NI3A 2PRZA 5JSUA 3T6KA 3W8DA 3ZXXA 4TTPA 4M0PA 4GOOD 4KX3A 3K6SB 1CP3A 1XIVA 5TT0A 4EHNA 4UMEA 5JJCA 5TQVA 4LYJA 1GNTA 3U5ZB 3HQ4O 1TU3A 1VLQA 3JQGA 5AP9A 4BO3A 1OASA 3RFXA 1TK3A 5ALHA 2JC3A 4GLJA 4MLCA 4WCFB 3CZRA 3WLHA 2ZWOA 1O03A 3HGTA 4I6GA 2X23A 1IVNA 1I2MA 2IY9A 4OREX 5ECWA 1VYTA 2XZLA 2PX8A 4KAJA 5FOXA 2N75A 3H5RA 3TLYA 3SC2A 3VZQA 4WKGA 4B82A 4EHHA 4LC9A 3HK2A 3E03A 3CRVA 2HKIA 2YNMC 3TSZA 1X6VA 4DQXA 2V7QA 5GPBA 1RWMA 3EC7A 2VHZA 2FK8A 1TCAA 4JJZA 1DCMA 3DZHA 2OP1A 4HH4A 3ZXIA 2I1VB 3GLSA 3LY7A 4RSGA 3JSAA 3RRXA 1QZUA 2FSUA 4CEHB 3MWJA 3U0BA 1PZFA 2FDXA 5A1JA 2N1MA 4DSTA 2X9QA 3D2BA 1MAUA 1TYBE 1U81A 3IEXA 1RJWA 1BO6A 1IQ0A 4GOND 2Z2ZA 2LCIA 2OLKA 4JA0A 4EFMA 4D45A 5EMMA 5CA0B 3IBFA 2QN9A 4C03A 1L3IA 5KKAA 1TJ3A 5E38A 5U1PA 1WRBA 1SBCA 4YRKA 5C5IA 1VIDA 1E1LA 1FTSA 3IAAA 3JV7A 3A6EA 2PVCA 3RHZA 1NNEA 3DPSA 1Z2PX 2P27A 2I8CA 4R40A 2C59A 2K2WA 1U2GC 3DLPX 2D8AA 1WSWA 2B5WA 2OFOA 3ZCQA 3HGMA 3IUEA 3WYAA 3LCJA 4M0FA 3GWGA 5JCZA 3G9QA 1JJIA 4DE5A 4FN4A 4EFLA 5BSWA 1PZEA 2QTCA 1V7ZA 4RPGA 1PZGA 2CL0X 4IIDA 2FWNA 1H3FA 4IJ6A 4DN6A 4Q93A 4TSRA 4X62B 4N6GA 3LS2A 1Z6XA 1B8OA 2K4MA 2RGYA 4R98A 5B1DA 2QUAA 2C4KA 2WKRA 3OO1A 5TXGA 3ZG6A 4AX4A 1Q91A 4URXR 4Q4AA 3U61B 4HQNA 2LD4A 2FWPA 2C99A 4QEDA 3ZGNA 2W37A 3FUUA 3GFOA 5J5AA 2PGDA 3QVMA 4UAGA 5B3LA 2HFKA 3F78A 1XNJA 1Y1LA 3ANNA 2QJRA 5E1BA 3ZDRA 4PYRA 4D9IA 1NRWA 5B55A 3IQHX 2H9YA 5CAEA 3RLIA 1LC0A 2EFHB 4NMWA 1OI7A 4NV3A 4Q9DA 4EB6B 1PFYA 3NBMA 4DMRA 2FJUA 3O91A 2H4JA 3KXKA 3CRZA 1NI5A 2ZBDA 3GP3A 4IJKA 1GP2A 1KA9H 3WQRA 4M6WB 4Z3KA 1PJ2A 3NAGA 3AB7A 1BHSA 4YJFA 4IOJA 3R3YA 1I0IA 4BMYA 1MOPA 2JVJA 2E18A 4ER5A 1WA5A 3C5CA 1E7YA 2XB4A 4NDNE 1Y5RA 3DPUA 4OHMA 3SYTA 5ARCA 1N1EA 5EHZA 3TAUA 4F2DA 1WY7A 1OFUA 3F1KA 1VJ0A 3OI7A 1S2LA 5D84A 1U7PA 2IHYA 1SUIA 3O82A 4ISBA 4AKEA 3LQRA 3TSOA 3HCWA 4MIKA 3WGVA 2HZ7A 4RCYA 1I6MA 3QX9A 4CLXA 4F4UA 4DPLA 2Z58A 5IEBA 5JVDB 3AGPA 4OB6A 3UAXA 3E4CA 1OPRA 2D1TA 2J0VA 4BFZA 2C04A 4JEHA 4R1TA 2FRDA 2Q1YA 5JTTA 1AA9A 3KEQA 2BVNA 2YV4A 5JS6A 3BE5A 4MV3A 4YO8A 4GOMD 3DDSA 5D86A 3VO8A 1KERA 1XI2A 1DAIA 2X7XA 2VP4A 3WVNA 3BH0A 3OOEA 2IDZA 3ZZ0A 4E12A 4D3DA 4BNVA 4QKQA 5LZ2A 1GN8A 1Q2XA 2FH5B 2INGX 3ITEA 5BQ3A 1HMYA 2VJKA 3NOXA 4L4RA 2HA2A 4JC4A 4GT1A 3DO5A 2CZGA 1SIOA 3VKWA 5HTOA 1U8CB 4L5JA 4OQZA 1K5HA 1O57A 1QGUB 3CH5A 1E2DA 4F04A 3F6BX 2AJ8A 2JB9A 3T9EA 1ZD5A 3KYDB 4QDJA 2JJ2A 3QK7A 5FUXA 1Z2AA 3ODGA 3MRVA 4LSWA 2JDID 3O73A 1MBZA 4F38A 4R6WA 1MQ9A 1MTZA 1Q7CA 3PF8A 3P9PA 1E7MA 3E9EA 2QMQA 4FZ3A 4QBTA 1ZK3A 1ZIYA 4HX2A 4QOHA 1ZITA 2HLHA 3DV0B 3NC0C 3GIDA 4PRZA 3INRA 5B3JA 3RS9A 4V1CA 4DIDA 3LQFA 3C1AA 4FTWA 2W98A 4FDTA 5HJ2A 4B3DA 4BNXA 1QOPB 2FUG6 5SICE 5I7HA 4DB4A 1GZSA 1GNQA 4WW0A 2HWKA 2O5VA 2KMLA 4HGPA 1VM6A 4RUKA 4TWRA 5J63A 1MT3A 3LBIA 1W5SA 3LDHA 1NMEA 2ZRJA 5CHYA 2AJLI 2Z1DA 4RFLA 2WV9A 3WXMA 2IPMA 5EMLA 5B36A 4G41A 2C5AA 5CGZA 4E5KA 4I1VA 3F4LA 1ZOSA 4OYYA 4C4AA 4CHTA 1TLTA 2W6MA 3RW9A 3EPHA 3H05A 1UDCA 2A5DA 3A4VA 3NP9A 4L27A 4XTCS 4MPJA 4DR6B 4D4GA 4X97A 5EJEA 4ZAVA 4M8KA 3M6FA 3UICA 1E6CA 3C1TA 5L3SB 3BXGA 4HYYA 1IY8A 1U7ZA 2Z2KA 3SOZA 1IZ8A 3W78A 5JNTA 1E3WB 3MJ4A 3H75A 1UADA 3AU8A 3KUCA 1PZNA 1G19A 4Q02A 2AIRA 2FPIB 4YFYA 1FTWA 3BJZA 2CNWA 3N6RA 3VYRB 3WB0A 4CM3A 2O57A 2C0PA 3GDGA 3GMDA 4QJ3A 5IT5A 3MSCA 1PL7A 4YAOA 5TB5A 1AK1A 1LBSA 1DIAA 1RRFA 1W5AA 1OWNA 4IO0A 3GFQA 4AZ0A 3TDNA 1GTL1 1NNSA 5E4JA 4TGLA 1QRDA 3HB4X 5ELMA 1RAHA 3OQMA 1N4AA 1MFZA 3B13B 4B3IA 3KBOA 5EJ9A 2UAGA 5TQ0A 1GL6A 4CGYA 1CERA 4A91A 1VPWA 4GC5A 3RS8A 2POCA 3JTEA 4HFJA 1MORA 3I64A 4GVXA 4S1WA 5H7XA 1EP1B 2Q7XA 4B5KA 4MIEA 1NXWA 1QLHA 1VLHA 3EZYA 3PPVA 4BAGA 1KSFX 4HB2A 3K15A 4J16C 3BFPA 1XQXA 1XTPA 5DHQA 1G8MA 4JP2A 2PL9A 2NYVA 3BTOA 3BA6A 4Z54A 1K98A 4V0NA 3CLUC 4ND5A 2CE7A 3ZBUA 4BZPA 1ZR4A 5HZMA 3SC2B 1R00A 3HE3A 5H16A 2OO3A 3IDZA 1B8NA 2I34A 2PO7A 3KC2A 1EGMB 3E22A 1SWWA 3NYRA 3R5FA 3H11B 1RFLA 3ZR4B 1CXZA 3JQ9A 3P9XA 3QTTA 5K20A 3ZQKA 2D7JA 1YA8A 2PXXA 1XLTC 1MB0A 3H7IA 4K6FA 3LDUA 2VYFA 3NS7A 2JGIA 3U3DA 3M4XA 4N9WA 2ZZMA 4IIXA 3T06B 2YJTD 4KE6A 2A9RA 2LDBA 4UU7A 4N6OA 1WZNA 1ADFA 2IPNA 2OKGA 2XMQA 1Q0HA 3B51X 5BV8A 2R7LA 2XUZA 3C7KA 2BTOA 1SKAA 2HWYA 1X7WB 2AJDA 1MH1A 3ABOB 5H02A 3ILHA 3MQ4A 3SHTA 4YVFA 4I1PA 1S0UA 1TJ4A 1W6RA 3HJAA 4Y3UA 1M34B 2OQRA 4LDPA 4QASA 1AO3A 1G41A 2RI1A 2QNBA 4G8JA 4RD4A 3EGCA 3TPCA 4RIEA 4JR2A 4HQKA 4L6AA 3ACBA 1V1RB 2W2PA 1VJDA 1OX4A 3FIJA 5E6RB 5AJHA 3GGGA 2CDNA 3FMIA 5JS2A 3HYTA 3MJTA 1ILWA 1E1YA 2A14A 2IZOA 3HUDA 4D9BA 2Z98A 3QVWA 1EXDA 2ORVA 2FW7A 4RQTA 1QAOA 3OY7A 3QBVA 1ZM3A 3HO8A 3L18A 1C7RA 3AUJB 5GONB 4GI3A 1UL1X 1DKLA 1X1DA 2WF6A 3IIJA 1JA0A 3JVDA 1JKFA 4YC7A 4ENPA 1GZ5A 1NSTA 8ADHA 5EKSA 1NE2A 3JQ6A 1P62B 1FQJA 3K70C 2XMRA 1UBJS 2J3MA 3B6KA 3UW3A 1RRKA 1E2JA 4B7ZA 1GR0A 4QGGA 4MUBA 1Y9JA 1BOFA 4RX1A 2WTNA 3DO8A 5KOHA 2Q6TA 3OE1A 4DQDA 2G77B 3VNUA 2XKJE 3I2IA 4H0FA 3GV0A 1AXRA 1J5PA 1P7WA 2Y1DA 4NTZA 1CZHA 5ESWA 3KD2A 4OAOA 3ZY4A 1GPLA 1ONNA 1F0NA 3S1LA 2O59A 1Y1PA 5JD4A 3EHEA 5ALUA 4EPWA 4B7AA 2G63A 3QY0A 4PTYA 3F6PA 3UCFA 4EIWA 1II0A 4TTVA 2X6QA 1FFXB 4UNQA 3FUCA 1E6WA 4P38A 3WO1A 1EGAA 4J94A 4O2BA 4RM3A 3R6TA 5D5QA 3MQFA 4FWIB 1DAMA 2B98A 3GRZA 1VG8A 4FR5A 4W8GA 3NR2A 1Y1KE 4XFKA 4PLYA 5ALYA 3QVJA 3WLOA 4BFLA 4G01B 1XD9A 5IHXA 3UYKA 3ETHA 4E5SA 2VA8A 2EBWA 1NSFA 4XYBA 2RHMA 4F4IA 4WGFA 1GILA 4CI9A 3T3OA 4BVJA 5JZ9A 3RG2A 4ZHQB 1C29B 1DT3A 5KO2A 2QD3A 2FG5A 3EAGA 2VL7A 1O95D 1ISMA 1F0PA 3L4SO 2VJAA 1RRVA 3E9DA 3Q1KA 4YR7A 2OC9A 3GXOA 3MSXA 5AUNB 1SCQA 1LW6E 4I99A 2WM3A 3DDZX 4P7GA 1J8YF 3JWGA 2C92A 3EXEB 4MICA 3KPYA 1NXOA 4NJMA 1OLSB 1RYBA 1X77A 3A11A 3D4IA 4KWHA 5IK2D 2FN9A 2FV8A 1TYDE 3K6SA 3V4VB 1PV4A 4NOJA 1JIUA 4UM9D 1OW3B 3AF1A 5EMJA 4ID3A 3I9OA 1KR2A 4GGPA 4A0SA 4OFBA 2C5HA 4X94A 1K92A 2R4TA 2R11A 4WZBE 1CK4A 4BKPA 1OSNA 4MULA 2VTVA 1Z7EA 1FLAA 2YV5A 4RTQA 2SHKA 4NZZA 3GA0A 3GFFA 4TWIA 4FGWA 4JGBA 4FSHA 3QKWA 3HBMA 5B12A 1B2LA 1Q2UA 2XMBA 4DNXA 1KNQA 1ZJJA 4FYYA 4IIHA 2IYQA 3QVGB 1VA4A 3OLYA 3UXMA 3AESA 1HI9A 3HYNA 3PG5A 2HU5A 2JNWA 4UCWA 4TXNA 2IOHA 1O96A 1BQ3A 1NP7A 1P4JA 3T7DA 3CRW1 2G67A 4LQCA 4U7FA 1PR4A 5K45A 1CVRA 5THQA 2C7PA 3TVDA 1VCIA 2UZIR 2Q2OA 2R1TA 3KEGA 4BRUA 3G9UA 4BMPB 3HLKA 5DOZA 1C80A 1PDOA 3PC8C 4BVHA 1ZUHA 2JJ1D 4C3VA 5BQ5A 2Z43A 3TIVA 4ER3A 1A8IA 1VRCA 1XK7A 1LPMA 3IVCA 1XLTA 1DO2A 2PKQO 3KCNA 3KJQA 3KTFA 1RM5A 1NZFA 1E8DA 2QL6A 4B45A 3FJ1A 1BCSA 4JUAA 4JAVC 3TGWA 2ALJA 2QX7A 4OHBA 2RHRA 4QOSA 5AHRA 1IZ0A 3FAKA 1MRNA 4H7KA 4KN8A 3SJAA 3VPHA 3WKEA 3DKVA 2IUEA 4IOKA 3L1JA 3T3PB 4AK9A 3PXUA 5BOSA 2C7QA 1SQ5A 4PYJA 3FSRA 1XMJA 4RVFA 3SXPA 3CINA 3BJRA 2QM0A 3D3KA 5KTKA 1EGVB 4TSKA 4D82A 1N5DA 1M8PA 1ZWKA 3KT3A 3R20A 1YHNA 4BQPA 1A4XA 1HTTA 1CVLA 2CLFB 3CZAA 2ZB2A 4FOOA 4XI9A 1QYWA 3KZXA 4GZMA 4IDPA 5FIUA 3LNCA 4IO1A 5LQDA 1U0OC 3O8DA 1X7GA 1V5GA 1UWKA 2JKYA 1H6AA 2ACKA 2G4LA 2VF8A 3JPYA 3PKZA 4UUPA 2CFOA 2V4ZA 4NPAA 4WBNB 5HKKD 3V2HA 2PFSA 3U81A 2H00A 4RSMA 1NKSA 1N5RA 1W94A 3CIFA 3N2IA 1KEZA 3ZY2A 5LDGA 4HX5A 3TJMA 4CW7A 1D09A 2ZSKA 5AESA 2DB3A 4DJEC 1BWRA 1X94A 2Y1FA 5JALA 3BCUA 2OL4A 3N3AC 3KOYA 4NZOA 4TMWA 4UZSA 4YRDA 2VH5R 1E2FA 1A5ZA 4ZVSA 1S1CA 1LUAA 1DC7A 3LT1A 1KDOA 1UP6A 3O84A 1IEXA 2P9EA 3CGGA 4BLTA 2ZFUA 4GUAA 2QUKA 5CVEA 4LG1A 4F72A 1UXKA 1G8AA 4XUGB 1ZJ6A 3QPDA 2ZIEA 3K30A 3QXCA 5EWJB 3THYA 4GQIA 2AFHE 1IDOA 1FQKA 3KLBA 4DMUB 4HKTA 3ZHYA 2O8DB 3T61A 1JFFA 3WTBA 4IHJA 5DEIA 2PZKA 3PNVA 1EAYA 1O89A 1N7IA 4KFTA 4LJ7A 3U49A 4BTVA 1HFWA 2H8GA 3QY9A 5AW1A 2JLAA 1AT1A 1KGDA 4GYYA 5EHIA 1BE1A 3ZGYA 5FWNA 4XGRA 4AZ3A 2DUWA 4N0EA 2Z3ZA 5AW2A 4IIFA 3GQVA 3VHLB 2IPLA 1YCGA 4MIOA 4RMJA 1M33A 3EUWA 3T1YB 1T9GR 1K6MA 3NHKA 4CKBA 5JXIA 2G9NA 2W5UA 1D7OA 3EIHA 4U7DA 5KPDA 3VTKA 3VX4A 2B35A 3VNVA 4XYLA 3NDPA 4TV9A 4B4WA 1QAMA 4Q1CA 5JAZA 3VSCA 3B7WA 4MHTA 1AKWA 1U5CA 1U04A 3BWMA 2CNDA 3EN0A 4CQNA 4MQ4A 2GN6A 1IG3A 2Q1XA 4OI4A 4CUZA 1RWOA 2YJGA 4DC0A 4PLTA 4MQ5A 1KBQA 5CNMA 2VHQA 4L4XA 3MWKA 3I45A 1J7KA 3G2HA 4LRUA 3AF2A 3SZUA 2E6KA 4URUR 2EP7A 3OAAA 1C8BA 3WI7A 3J7TA 3U6KA 1P72A 1LA2A 1ACMA 3FIUA 3TQSA 4M7RA 1USUA 2PNFA 4CLEA 1AHPA 4RTKA 1DAOA 2Z9DA 1UDAA 2G82A 4LMPA 1BC5A 1UFQA 1C7QA 3R0ZA 4KQHA 1KVUA 1GGMA 3AYZB 3CTMA 1Y5NA 1DAGA 1WMSA 1WDTA 3G59A 3K0CA 1KGSA 3RVPA 3RYCB 4B3MB 2H0AA 3CUVA 1AGPA 2I6QA 4TRNA 3RSCA 2ZSEA 3ND5A 3MS2A 4YMUA 1NMQA 3RVOA 4ARBA 3ZCVA 5EE5B 4PX3A 1LZKA 1EXWA 3G2MA 3L7AA 3O9ZA 4IZIA 2P9GA 5A6SB 3V80A 3OQ6A 4DA6A 1XA4A 2B3DA 3OWOA 1AKVA 2NXCA 5LBTA 2Q8QA 5AD1A 4L8WB 5LD2B 5IARA 2CBXA 3U2QA 2VS1A 2XUFA 4KQJA 4D25A 2ZKIA 1MX9A 2WTBA 1TDJA 2O0HA 5GZ3A 4PTLA 2HGSA 4BP1A 2TMGA 3D3NA 4NMXB 2HT6A 3EVGA 1IY1A 4DZTA 2IT1A 4UHJA 2F3RA 2OO5C 1A72A 4PICA 5DLQC 1LV8A 2CUKA 2Y1EA 5BYKA 3UYLA 3I4CA 2KPOA 3TLMA 3KOXA 1D8AA 1FMLA 1MG0A 1O97D 2PGIA 1ZWLA 3KDPA 3PPWA 4NBSA 4Z0HO 1TM2A 2CVPA 3C3EA 1Z17A 3JU3A 2IXTA 5ALTA 1UC5B 4D6XA 1ZM9A 2B4YA 2W6CX 4OX9Y 3NDRA 1U99A 2AYYA 5C52B 3UJNA 1NUAA 1K3TA 4HEA6 5KJ6A 3VM6A 2IE0A 3DXFA 4G81A 4AI6A 1A0OA 1HDYA 4HWGA 3VO1A 1OWOA 5JPCA 4MV0A 3GVPA 3K9GA 3SZ3A 2XUPA 1L7VC 3F9CA 1RHKA 4P4LA 1L4NA 5I7RA 5CD1A 5GP1A 3R76A 4C04A 4E1VA 4YXFA 1L4GA 4RE5A 3NMUF 4GLOA 4OGWA 5L3ZA 2A5FA 2RK4A 2OZKA 1E2BA 5L40A 1QZZA 1BQ4A 4UTOA 5AJWA 3DNFA 2ODBA 2ZJ3A 2NXNA 1S2DA 3QF7A 4QSMA 2VAPA 1KZHA 2ZYDA 4YMTA 4UBKA 1X2EA 3I58A 1JXAA 2ZIGA 1N33B 5HXAA 3K71B 1T2NA 3H5LA 1TAQA 1IUKA 2C4VA 5HIKA 5L9AA 4O5OA 2BGJA 1EWVA 2FR8A 3MCTA 2ZJ5A 3C3XA 4R2KA 1ZXLA 4H6WA 3S44A 9LDBA 1VMIA 4U6NA 3LRPA 2JFGA 2WPDA 3SYNA 1AKYA 4HUQB 1PFWA 2FF5A 2A5LA 1EGHA 2I8AA 2OGWA 4OBBA 4DLAA 3H8VA 3JQAB 2ID9A 4G4SO 4RW0A 3O74A 2CE2X 3LW8A 3NHYA 1YMQA 4P54A 4TTJA 4EKGA 2JFBA 3M1AA 3DAOA 3FOCA 4NBRA 4IM7A 4WVLA 1F9EA 5A7GA 1E8NA 3IE1A 1T9HA 1HORA 5HDQA 4NQZA 3MRXA 2IOFA 3DT9A 1R18A 4OI1A 2CB9A 3KJIA 4H7JA 4BVAA 4GVPA 2A58A 1M8KA 1J8QA 1OX4B 4IP0A 4IDEA 2BAGA 1BX1A 2PWYA 4R0VA 4RK7A 4A6EA 3QEJA 5JE8A 4Q47A 4IJMA 1R88A 1XOIA 2DBVO 1EK2A 2C4MA 2XDQB 5IXSA 1ABBA 1E2LA 3QSYA 1NW8A 1F4PA 1R0RE 4YBRA 2J46A 1QFMA 4C20A 2B2CA 2IBMA 1QRAA 1JECA 3C41J 3O03A 3VC7A 4EPTA 2QYTA 5CM2Z 1L5QA 5DTEA 5TX7A 3V42A 1H5NA 1QO7A 2QRZA 4R3WA 5ILGA 1RYHA 4J7UA 3LKZA 5AJXA 2O2GA 4JKYA 3HRHA 3FMFA 4MA5A 5KVSA 5GV7A 1WLSA 5DNUA 1J0AA 3W3AH 2OC4A 4RV9A 4C4OA 4EH1A 3LFTA 3UJ6A 1IXKA 1ELOA 1RW4A 1G7TA 4W1QA 1Z2NX 1CDOA 1O58A 3LVFO 3FVTA 1C3EA 3QKRA 2I2DA 1PJRA 1PZXA 4KQGA 4M3NA 4Y9RA 5K0FA 1TUGA 1ZCAA 2QRHA 3KKOA 2EGUA 4YIHA 1M6EX 4GECA 4PAWA 3AHGA 4I4TA 3G88A 4UHKA 3UPTA 4JB2A 2ET6A 2HSDA 2VQFB 2FMKA 1G38A 4ZHSA 3MRSA 3NDIA 1NVVR 5H4HA 3OAAD 5MF6A 5G1PA 4AUKA 1NW3A 2C0CA 3IQFA 3OFVA 1FJXA 1N2CE 2IYVA 3RK0A 3AFNA 4XW2A 3AM1A 1Z47A 1HDCA 3ZY3A 3IUBA 4PAQA 5EOVA 4RJJA 1HZZA 2HMTA 3CUYA 3PC2A 4PG7A 1P80A 1CE8A 1SUFA 2DPLA 1XMPA 2BEUB 3LRXA 16PKA 1HDXA 2BZ0A 2QVZX 3M2TA 4TT3D 3ZZMA 1A27A 2L19A 3OSZA 1TTTA 2C2MA 5DYNA 3PHHA 3V7FA 3RT1A 2P0AA 4NATA 3WIBA 1XZNA 2OHOA 3E2MA 1KEEA 3BJIC 1VJCA 3B1JA 3R7WB 2RHGB 2O2SA 4RZ2A 5PNTA 3I2KA 3F7MA 1GHTA 2H06A 5K8CA 3U3MA 1QK5A 3EH1A 3RREA 4C4SA 4HEA1 2GF2A 1Z08A 3C3KA 1CULC 3L0PA 4N5NA 5EP4A 4YAGA 1BIFA 1XC7A 2CFSA 2Y9PB 2ZUDA 1B15A 5ALPA 2WMDA 2VQEB 4DUYB 4MS1A 1SU7A 4LWPA 1QBKC 3ZWDA 5JZMA 2V98A 2IOFK 2IXFA 4FI3C 4EF5A 2Z83A 4TL9A 5FWYB 5BT9A 3ZTTA 1J7JA 4OQFA 1KORA 1RXEA 4MDHA 5ALEA 1XCPA 2G76A 3I2JA 3JZFA 4Q3CA 3RR2A 1JILA 1IZ7A 2A0YA 2Q6LA 3FB1A 4R8SA 3FJYA 1OX6A 1QHHA 5DOVA 4R0NA 4LJ8A 2QN3A 1NG1A 4G2TA 3HDHA 4DJJA 1AN9A 2L18A 1J23A 3JXEA 1AKQA 2H5EA 2P2LA 3BD8A 2P67A 1UMBB 2OFFA 3UT6A 1UAAA 1RXCA 2OESA 3GEBA 2Z04A 4G1BA 4FYVA 4PLVA 2VZ8A 3LVQE 4JI7B 5BWLA 1I7LA 4MQBA 5REQA 4DMFA 4RCVA 4NCXA 4KAFA 4EMBA 1OB5A 3KJEA 4UPVA 3SCZA 1EBUA 2H1SA 2HX1A 2QV7A 3PNLA 3R40A 5IEJA 4PWYA 3IVMA 1ECLA 4OV6B 5AVJA 4RZHA 4GMKA 1I8TA 1HLGA 3G82C 3OJEA 2Q7OE 4JB8A 1EAMA 4CZ2A 2H2WA 2QPLA 2QRNA 3RYCA 4BP9A 3DBOB 5A4KA 2DJ5A 4MVJP 1NIJA 2IYNA 4UE2A 1GXSB 1Z0SA 5ILQA 4UHEA 1GA6A 5FTNA 1LS1A 4LTNA 5EP2A 4ZGBA 3GLQA 2IQIA 4QDOA 4G1UC 3LP6A 1L7BA 5H70A 4N7BA 4WASA 3K9BA 4PGGA 1AMUA 4RV5A 4JIMA 5I45A 1H05A 2HRZA 1O6CA 1B26A 3VFDA 1K9VF 5BOSB 4MZXA 2YXLA 1N3YA 1RWPA 4ZEVA 2H3HA 4HNRA 4ECAA 3L4KA 4CUJA 1X15A 2YXPX 1B6SA 1TF2A 3T7CA 1E3DA 5DN9A 4AWBA 1RDFA 2HLDA 2J9ZB 3AC0A 2DETA 2HJVA 1R9NA 4KN5A 3WIOA 3BQMB 4WDQA 5FORA 1BS1A 3ZKWB 1DUVG 3WL7A 1ESNA 1XZGA 4HLUA 1VE6A 2AOTA 4C4TA 1V16B 3ET5A 3P7MA 3QNUA 1GPNA 4KR3A 1BXGA 1RQ7A 1BMTA 5EIHA 2OV6A 4X7PA 3JASB 1QLWA 1TKAA 4ERXA 3FYTA 3QI7A 1N5MA 1J2EA 1JAXA 1ONPA 2WFAA 3KOWA 3MJRA 3PQ3A 3WHIA 1JAIA 3ZDFA 3O90A 4DEXA 3B1XA 1A77A 3PUVA 4GSYA 3E0QA 3EVZA 1FQOA 5DLDA 4QATA 1LBHA 5EC8A 3N8GA 5C1DA 2GNPA 3RVMA 4YJHA 2R96A 4NENB 4TV8B 3H1FA 4ALJA 5DYGA 4CM8B 1KDRA 2XQVA 4IIJF 4PG4A 4PZYA 2B1RA 3KSBC 5K51A 4Y9UA 3L5KA 1M2JA 1LBTA 3BBPA 3AKCA 3R7BA 1E1QA 1DJNA 3QA3E 1UBCA 2E37A 2GA8A 2ATCA 2OMKA 4LJYA 4MCIA 3SEFA 2H31A 4XIJA 2AQ8A 1MOQA 1UM9B 2IH5A 5AM0A 2HK8A 4KREA 3ZE6A 4CFSA 4WESA 1TA4A 4NESA 1JTVA 2O48X 4OHKA 2Y92A 4IHJB 1X7YB 5J58A 1R12A 1XA3A 1T9GS 2HMWA 1I3LA 3CEJA 3I5MA 1K3UB 1S8FA 1NVKA 3RODA 3AU9A 4DVJA 3W9UA 2GZ3A 4U2FA 2VXYA 2X76A 3IA7A 3ZDAA 3GJ8A 5CH5A 5JI2E 2XLCA 3FYDA 4Q18A 5EKUA 4EKYA 4U0KA 2BFCB 4YGYA 3WFJA 3I37X 2W6NA 2DWUA 2QA5A 4RPIA 3THWB 1VLLA 4GLBA 3DNPA 4JI4B 3RS7A 3HNOA 4CKBB 5T3UA 1RE1A 5CLFA 3FPAA 3I30X 3TSYA 3ES9A 2P3LA 1T0HB 2VEOA 4GI7A 2X15A 4NNJA 4Q16A 1CU1A 4TQGA 5C3UA 3SJBA 5I4CA 4G2NA 5KKNB 4RKYA 2IWRA 3A1EA 4HAIA 1K63A 5FPYA 3G1WA 1CF9A 1T5SA 2PTHA 3EIOA 3JARB 4RXMA 1F5SA 3BRWD 1CZUA 1B42A 2ZRKA 4UNPA 1GTG1 1TJPB 3DOFA 1V11B 3C3AA 3ETCA 2WDPA 3HMQA 4HL6A 5DNWA 4O4JF 5J5CA 4AW9A 1P7PA 2NNLD 4DXAA 1XAGA 2YW2A 3WJAA 1UBEA 2VJYA 2H4FA 1ULAA 4AD8A 5BUSA 5C32A 1YUNA 2FG6C 3PJDA 4MGIR 4BE9A 5AJTA 2PU7A 3TUIC 4LBWA 3WTCA 1DXOA 3FOFC 1UWVA 5DHSA 2NVUA 2PBZA 1VPLA 2C61A 1BTOA 1HV8A 2XWBF 1GRVA 1W4ZA 1NYTA 4KXFB 4TXMA 5D5PA 5AKJA 3HV2A 2ENWA 1OXVA 3PR1A 4JDPA 2NG1A 3A0RB 3T5GA 3F74A 4ZGGA 1Y6FA 2FUCA 4BCCA 5HWSA 3IMEA 1P29A 3CNLA 4PQEA 4E5MA 5P8WA 3GFTA 3OIFA 4GBED 4QJ4A 4BGEA 1U2SA 3L9XA 4OYRA 5FPQA 2R47A 5JAUA 2JZNA 1EU1A 2YKGA 2JFOA 2ZRDA 2YHAA 4XLZA 2M1ZA 4R2HA 5DE3A 1I51A 3GD5A 3CSSA 3VXKA 1TEHA 4I50B 2J1LA 3UXYA 1LC3A 4LOHA 4ZTBA 2IUTA 4LXTA 1RC1A 4KXWA 3ZCTA 4CVNA 1NY6A 4L08A 4PYMA 2OCLA 3D7NA 1NF9A 2WB2A 4AJ4A 4CN8A 4TWJA 4X9XA 4XFDA 5CDTA 4HXYA 2ZWPA 3D0KA 4B4UA 4B2IA 4AQ7A 3M34A 1CZLA 1RRGA 3PFIA 4PU0A 3UENA 1Q1AA 2YZGA 1K2WA 2AE2A 2D1RA 2NX2A 4E21A 3WQHA 3A3YA 2XUIA 4IDCA 1TQ6A 1TT5B 4FM9A 1KMHB 3KR0A 2A6PA 3M3PA 5TS3A 4EZBA 1N7JA 2ZXUA 2VP6A 1UBMS 4M0DA 1CIPA 1WD5A 2FUEA 3HHPA 3KVVA 3KZKA 3C6QA 3T4EA 2D59A 3AETA 2R2AA 1MUUA 3C7AA 4RAOA 2IA5A 1QHEA 1KMCA 1VJTA 2RHJA 3OVMA 4PS0A 1IXRC 2N9UA 5ALQA 4WBXC 4DQUA 3L77A 5A9SB 5K5EA 2WLTA 1QVVA 1DUIA 1LDBA 2G09A 3W9YA 3KL2A 3GG2A 4I2NA 4OSPA 4L9WA 2HPZA 4LJ9A 1FCJA 4N7RA 4OHZA 2I4MA 1J56A 1Z2EA 1ZM7A 3WZMA 3OQIB 2XA2A 3OZBA 4YPFA 2ZRIA 5AHXA 5C1IA 3JRXA 4DSZA 1NVMB 2A86A 2WHPA 3T12A 2WWRA 4KXNA 1VG1A 1EB8A 4AF8A 2O2DA 4RF5A 1E1RD 1V9CA 3P9KA 3E27A 1G6KA 1PHRA 4IKEA 3V8RA 1QPGA 4W6ZA 2NO5A 1B4DA 4RTPA 4UXHA 3PB3A 4OHCA 1MOZA 1Z82A 3DUFA 1IBKB 1P7YA 1FVOA 3VPBA 3PFWO 1E7SA 3NGMA 1GXSA 1PJZA 4BV3A 5B7PA 3RUHA 3SJUA 4ZZIA 4HD8A 3TZBA 3ASZA 3AIKA 1VPVA 3ZVLA 4LPSA 1C9NA 1W48A 3RTEA 2AG1A 1NU6A 4I9HA 2GYWA 4LZAA 4NE9A 5JO9A 3ZHBA 1IHUA 4ND7A 2G72A 2M1XA 5F77A 4BNLA 4POAA 5BRAA 1TADA 2A7QA 1YDMA 4ZMBA 4F1KA 3SY8A 2EFDB 3R5KA 3L0CA 4YLEA 5IJZA 1UIMA 5K0EA 3HCFA 3NQ41 4M0UA 3FWZA 1Y8CA 2FPPA 4WN9A 3ZGVA 1WDMA 2QW1A 3OOSA 5GV8A 1T2VA 5LOVA 3I9V1 3GRRA 3P4UA 2YOFA 3WK9A 4OBXA 1G63A 1NONA 2EWWA 1XGKA 1RKXA 1G1AA 3ABQB 4F0JA 1JHQA 1Z39A 4NDZA 4TXJA 4I55A 2JJ1A 1WJGA 2PGLA 4JI3B 2MINB 2WU4A 1JW9B 4R3UC 5B2ZA 1D9ZA 4MR8B 1IB6A 4Y1RA 5B1HA 2HCFA 1JQAA 4NPHA 1EFTA 1YF3A 2IPAB 2UYOA 3V1LA 1WVIA 4MB0A 5KAMA 1EDOA 1UKAA 3OZFA 3ACCA 4FBLA 5LM3A 3G8DA 2Z5LA 3O95A 1HTWA 5CR9A 2GS9A 4ZOAA 4BZXA 1ZL0A 2OAEA 3CLKA 3V8EA 1OAOC 2R9VA 1F20A 1LBEA 2ZAIA 1EFRA 1UBUS 3KEMA 1N8NA 3Q7PA 4NBWA 4XOIA 3QV2A 2WAOA 4WUTA 3VSBA 2VYQA 1UJNA 3T9AA 3CWCA 1HOTA 3LPMA 4RK5A 4XTRA 3W5IA 4DUPA 3OT1B 2QORA 4XVQA 2P3QA 3ENZA 2JGLA 3PXEA 1KOLA 4E6EA 4UHDA 5HJEA 1XZ8A 2GN0A 3NLLA 5DZSA 3V2GA 2AEEA 4Y2SA 3VR2D 4AYTA 4WLFA 5IXYA 1S4QA 4QEKA 5KTPA 5DNYB 3PEEA 5KX5B 2PBRA 3N0XA 3TINA 2R84A 1QGZA 2LVBA 3PL5A 2LP4Y 3U13A 4ZIRB 5MFZA 3EVCA 3S7ZA 1QZ3A 3KQYA 2FKNA 2HI0A 5I7AA 3WFIA 3EFOA 5K99A 1JR3D 4AUEA 3UMCA 1WXDA 5IT9A 1DOHA 3SS9X 3GY0A 4F2GA 5J2UF 2IK8A 5FTMA 3RVJA 3K0AA 4YTEA 3AVOA 1GZUA 2Q6OA 4BNJA 2WJZB 3DYVA 1LLFA 1B6TA 3D7SA 3TCKA 3W7VA 1T9KA 4MOWA 4YV1A 1E9SA 1FRQA 1TVEA 2HM7A 7AT1A 2PX5A 2H2DA 1GAJA 3U16A 2X4DA 3C5VA 1RWXA 2QX6A 3IC5A 4JC8A 5AR1A 3TLKA 5IYZF 1SCKA 5JPDA 1B8VA 4U8GA 3NTOA 2QDXA 2PGNA 2WF9A 4CU2A 3H9CA 5IM5A 5T8KA 5AOVA 2KS6A 3D6MA 4G65A 4QO8A 2SICE 3DAPA 1WPGA 1QH8B 3LCVB 2O8BB 5IKOA 3UJHA 3K1AB 2O2ZA 3P19A 4LHZA 3DNMA 3CV3A 4ENVA 4DJ5X 1HX7A 2G5CA 1ML3A 2OLEA 3GRUA 3M70A 4NBKA 1JXMA 4TUYB 5AM2A 5ADVA 1NP3A 1C1XB 1SUBA 2CCGA 2HJRA 4BKOA 1CRQA 4FJ0A 2RH4A 5CCDA 1VFPA 4WE3A 3U5TA 1HPLA 3EJ6A 3PD1A 2MSWA 4GAEA 5EZYF 2CNLA 1QYXA 3IJPA 1PL0A 4EF4A 3ADDA 5EJGA 1KQFA 3FCEA 4ZO6A 4H77A 4Z86A 5FFFA 5KWEA 2AEFA 5HSGA 1J0XO 1NDQA 2IWHA 4IJVA 1Q50A 3I5XA 4D57A 4EENA 2AVDA 4YMHA 1KDZA 3BXHA 1I4LD 3Q40A 2HU8A 4U9IS 3UTDA 2AKAB 5C7OO 1H2RS 3PDUA 1E8MA 1ONSA 4TMZA 3DC7A 2OHIA 2EBUA 4JJ6A 2GCOB 3KUXA 3CNBA 4I1YA 2ZWAA 3COZA 2POQX 2C9YA 1QR2A 3MNFA 5IJ9B 1RJ9A 5JJLA 1PD0A 1EFRD 5F3RA 1FMFA 2R8YA 3OF3A 1D0SA 2V6JA 3HU2A 4B84A 1OC2A 4H2DA 5DW0A 1ITZA 1SEVA 2W2XA 4DBZA 1A8QA 1R4AA 2AFIA 2XWPA 2BZSA 1AF7A 1TTPB 2O3TA 1EIWA 3IP8A 3IBGA 5HUQA 2I78A 5BN3B 2QG6A 2DQYA 4HCJA 3SC6A 4YRSA 1O4WA 3G8BA 2X4LA 3B6JA 1UXIA 3BERA 4OJMX 4BUCA 2VNJA 3DEJA 1WETA 1YCHA 5L8VA 2W2MA 2C5LA 4GMXA 1FFEA 4TQ9A 1JL3A 4HPWA 2N46A 4MRMA 1OKKA 4P4UA 5AIAA 1DKMA 1YB7A 4G63A 4PQGA 1FRNA 3R6WA 1TLFA 4KMRA 1ACJA 2YWCA 4ZAYA 3TLXA 4ZTUB 4QOFA 3MCAA 1SQ0A 4L0DA 2DBQA 2JGRA 4JKOA 1HH4A 1EDBA 1LK7A 221PA 3RT9A 4B75A 1BVUA 1UH5A 4NENA 4A2CA 4AULA 4F1JA 1OKKD 4YB8A 4LGYA 2XMZA 4PO1A 1PR2A 4XQGA 5AICA 3WL8A 1IPEA 1AQIA 4WGGA 3IXMA 1R8XA 4GKJB 1PO7A 4RIHA 1YXMA 1KZ4A 2CLKB 2WJHA 1G20B 2DLNA 3GK3A 3HL0A 3K0CC 3O6VA 4OHFA 3S5JA 4MV6A 4MKIA 4MKHA 3PEUA 1A7KA 1EM8A 2WJPA 4L50A 4GKVA 4PM4A 5DM2A 3DVAA 1HZZC 3RO7A 1QHXA 4EUSA 5B5SA 2W6ZA 4JP5A 4HT3B 5A5GA 2ZTMA 5JARA 5ESRA 4BO2A 4CDRA 1YRAA 4YCBA 5KYUB 3IVAA 4R5HA 2QUJA 4PHHA 1H9BA 4X90A 3L2OB 5J2UB 1U9JA 4IUCS 3D6JA 2BKLA 4XIYA 1VL1A 2FPKA 1OXKB 2O07A 2GBGA 2R8ZA 5EJAA 4X8HA 3PNSA 4NZNA 4D2IA 5BSKA 3ADBA 3HR4A 4MP6A 5IHPA 2E5WA 1ORIA 4W63A 1C14A 4LSZA 2ZUUA 4N0MA 3Q7EA 2WG2A 3BEOA 3M1IA 1KJZA 3EGDA 4G1CA 1N8SA 2F4NA 3I72A 1RBZA 3KPWA 3MJDA 4NS1A 1XZJA 5HM8A 2DHRA 3TXYA 1JALA 3C4VA 2JFQA 5I7VA 4QNRA 1XRQA 5CP8A 2BR5A 4ZT4A 3RKSA 4MR9B 5KQRA 1K7CA 3ZK9A 5JECA 3OZIA 1CJKC 1NW7A 4XPZA 4KPEC 1TU0A 1ZR2A 3F46A 1VE9A 3LOQA 10MHA 1BYUA 3Q72A 4PNEA 1PT5A 1GM5A 2NNWB 4BNIA 2J32A 3AF3A 3RAEC 1JGTA 2X5JO 2XOKA 2C9OA 2IYXA 3L8EA 3PT5A 4AJKA 4KODA 1ZNXA 1XRMA 4LXXA 1B43A 3SSMA 4HGOA 4PPFA 1JHMA 3D4LA 4ED9A 2W83A 5LN1A 5DM70 4H1UA 4IS3A 1YTLA 2FPWA 2QJTA 4IYRA 1W88B 1JI0A 1Q1GA 4IGEA 5IUNC 1R10A 1YVRA 3VDMA 2XB2A 2NVUB 4DR2B 1RM4A 4RMNA 2R7KA 1RFGE 2WU3A 4RABA 1KETA 1C9EA 1FFCA 1B0ZA 1PWXA 4CL8A 5KNCA 3HB1A 1S9HA 5ER6A 4HEQA 1YHZA 3AF5A 4L0MA 2C2OA 2AQHA 1UZUA 2B2NA 5YASA 1BXZA 3P96A 1QTNA 2DQ4A 4PSAA 3DDOA 1WCYA 1C8VB 4TRJA 5BN5B 1CRPA 2QR2A 3T3IA 4DA9A 2H92A 1U7WA 5JQGB 1EWKA 1NBIA 1WHSB 2JRLA 4JOQA 2W2OA 4G0PA 4Q3OA 1QIEA 4C7OB 1QLJA 3AXTA 1T24A 1UPUA 3TG8A 2AZXA 1UT8A 2QRKA 5GADl 1LI4A 4JXZA 2H57A 1KDPA 1YZNA 2QR5A 3TTVA 1E2EA 1ZGCA 3VC1A 3QWAA 3EZ7A 4YXWA 1Z18A 1F06A 1OWPA 2ERXA 1R6DA 1AU9A 4LI0A 4S1NA 3SF0A 3U9SA 4CG3A 3V1NA 1SQGA 3QW2A 4KITB 3QEKA 4RLFA 1XXLA 4JHXA 5MHTA 4Q4JB 4YN3A 4A82A 5E6UB 4RLHA 2Z8YA 3L8ZA 4HUJA 4DJFC 5B7NA 1H5UA 1MHPA 2ZG6A 1HA3A 1YT5A 4CDNA 4JD5A 4CMIA 2ZIXB 4RNDB 5J2TF 3S8MA 4QFMA 3VRHA 1Z74A 3B53X 4LNHA 4I5EA 4TUYF 2ADMA 1E9BA 3WV4A 4DC9A 2QAGB 2CLIB 4UEWA 1E6EA 3G9TA 3BVPA 1FYXA 2JJYA 1QGED 2XTMA 3LO5A 1EJBA 1LRKA 5EXTA 3E8XA 1N2CA 5HHTA 2Y2VA 2UYQA 2X1MA 3LLCA 4FUTA 5L3VA 2ZPTX 1FYDA 3JALA 4U7HA 4RA9A 5CYPA 1S2OA 3G9XA 1ISHA 4IFBA 4PXSA 4QYIB 4DZZA 4CTMA 3L46A 3WWZA 1YQQA 3K31A 3IOCA 1T0PA 4YRQA 2CZQA 1BKYA 2GZSA 4KWIA 5B1SA 1E1KA 5KOHB 1YS4A 1TW2A 1VMDA 3OQIA 4DYHA 5KTMA 4Y9TA 4ZQHA 1EDEA 7YASA 1M8FA 2X4IA 2ZYHA 2C2YA 3K0HA 4A10A 3KXDA 2XNCA 5JFGA 3HDGA 3PI7A 5C8YB 2OXTA 4PCAA 1BDBA 1SG0A 1Y3FE 3D6VA 1O7JA 3U3KA 3WQSB 4M76B 1EZ1A 5DBHX 5K6RA 4IIEA 5G0UA 3MAAC 2VOEA 4QUBA 4A0GA 3FMGA 1FLDA 4RD0A 4NWIA 2AZ4A 2F2TA 1ZNYA 4ZT2A 4HRVA 4P4GA 4QWWA 1Z88A 2Q5QA 4OMUA 3B6MA 2KBFA 2EG5A 3ED5A 4NIMA 1SU4A 1OGIA 3K32A 2PZEA 4TTAA 1MIOA 2I22A 4MVYA 5FAKA 3H2GA 4U2CA 1E9AA 4KVFA 3QQ5A 4ZREA 4D8UA 1K88A 4Z1MD 3IV6A 4F2HA 4AY3A 3SBEA 4DLLA 5F12A 1XV5A 1TYZA 3UJ7A 1P0IA 2BM9A 1QBGA 1GTRA 1DC8A 4X3OA 1E4YA 1FRFS 2DFKB 2QP3A 3N87A 4JSTA 3WLTA 4AVYA 1RJ9B 1PNQA 3DTVA 5KX5F 4B32A 2VPIA 3UWSA 3WS7A 1EFAA 1N6RA 4JJ4A 4ZVUA 4M1SA 3BT7A 1Z0JA 3KQLA 1IN7A 5HE8A 1QSGA 3CJRA 5ALZA 1MO5A 2ID8A 2VBIA 2P68A 1N2HA 3FFTA 1P31A 3B6EA 1IWBB 4DR4B 1DMSA 4J2HA 4D8XA 1GCOA 4TM7A 5IUKC 4JODA 3GELA 2IOYA 3ICCA 4PZAA 3VMMA 1Y8RA 2EXXA 4PXYA 4AXBA 5BW6B 4RKWA 5BR4A 5JAIA 2IOQA 2FE4A 2WBLC 1I7SB 3ZUGA 4ZALA 4EPXA 3WSTA 4OLAA 1TIPA 1ZNQO 1E3TA 4K2AA 4NJEA 2NZ8A 4E70A 3WWDA 2XRYA 1RP1A 3UK1A 5FBHA 4AN4A 4PO8A 2R1UA 3VR5D 2JAWA 1DG1G 2IV2X 3LKDA 1RLJA 1O87A 1V8OA 3S55A 4JI6B 1PZHA 3HRIA 3WDSA 4CL2A 2VCEA 1YUMA 2V7GA 4AY4A 2GK6A 5C34B 2X6TA 3FLAA 3IDAA 4TVOA 3R7SA 4D8YA 4IIYA 4UUQA 4F2PA 3E84A 1NQVA 1XCOA 3N59A 1YWGO 4MHSA 4PLGA 2V8OA 2DMRA 3VU3A 4KPUA 1T4CA 2MR5A 3WBBA 4C5CA 2FCAA 2EZ4A 2FMXA 3CXUA 3GZ4A 3RANA 2HLDD 3KLNA 4B44A 5EGNA 4M53A 4JVMA 8ATCA 2HF7A 2V1XA 4UUOA 2H52A 3FDFA 4FYHA 1IXZA 1WZEA 4Z4HA 1FS5A 2OBLA 2GZ1A 1KZ1A 3UEOA 4BNTA 2C3UA 2DR3A 2OHFA 3TM5A 5IWAB 4W5OA 1TJYA 5JRDS 2FWIA 1QWSA 4AKTA 4JC5A 2VDKB 4M7WA 4DR3B 3QKIA 3W6PA 2GCGA 1LB1B 1T26A 1IOLA 3DOIA 4YA6A 4RK1A 2OE2A 4US1R 1TZBA 4HR7A 2Y8EA 3GOHA 4KP7A 5D7NA 4ZVNA 3WB2A 4D43A 2VF4X 2AWOA 3RUEA 2PH7A 3A2NA 1D9XA 3GT3A 3ZHXA 4AROA 1GUFA 3VAZA 3AEXA 1FLVA 5DXFA 4LUCA 4P80A 4L73A 5FUWA 5BVGB 3CX8A 3UAOA 3M6MD 1XYVA 4C76A 2JH8A 3SIXA 4J0QA 4LVNA 2BH9A 2OHHA 5AJVB 2ZTSA 2ZUVA 3W6UA 1HYGA 4PGMA 4IQ0A 4COOA 2P7IA 1W46A 2DPXA 3CH7A 3ROMA 3MB5A 1IQRA 4UOEA 1C9JA 2W11A 4GXNA 5JJ5A 5LZ9A 4IR7A 3BZWA 1KAEA 1O95A 2BHRA 3WGTA 5LIRA 3FHTA 1B16A 3QNMA 4MR7A 4QU9A 2QZ9A 1IJKA 3H5WA 4ZEOA 1JFVA 2I4NA 2IJGX 2VK8A 2BFEA 4V0QA 3SAJA 4NLLA 1NTRA 5ICSA 3ZC3A 3ESCA 2ZS9A 2JCYA 4MZDA 2VKTA 5KTTA 1ZA1A 1C1XA 4LIPD 4ES6A 4MUKA 4QJ5A 3K9QO 4HWKA 4MKGA 4DLVA 4ECEA 1N25A 4Y9SA 2ECQA 1UFOA 1DQRA 3MCUA 4JBIA 3QHPA 2YNMD 2FEXA 4AJJA 3ZU6A 4YK7A 1SB9A 1UCFA 1FUEA 3CIOA 4MV4A 5CPBA 4F4CA 1YRHA 2IF2A 3HKDA 3OKPA 2REOA 2X4GA 4BFYA 5C51B 2JCXA 4DYDA 3JVIA 1VIMA 3G3EA 4FP9A 4WHMA 2NYAA 3R7LA 3IESA 4PR0A 4NOMA 2D1QA 4KKXB 3TXXA 2AFIE 3MWGA 4FFSA 3NKLA 5TVGA 3SZGA 4BFSA 1V3TA 5KNBA 4CFYA 3L07A 3W6NA 1DV1A 3PVCA 4LF9B 2J3LA 3LSTA 4H7PA 5DEOA 2Y1LA 3PRJA 2FUKA 2NTYC 3WHKA 1G64A 2TS1A 5FOUA 2ZRBA 4N6NA 4Q3BA 4IQ4A 1GFSA 3P4YA 4M1YA 5FXMA 3SBXA 2OXIA 1L5HB 1ZONA 4IFIA 1GZHB 1ZKDA 1YS1X 2PUWA 5H0IA 1MC5A 2G7ZA 5DNEA 2ZE8A 4LKOA 4UVDA 4XSGA 4IHJF 1OF1A 2VBCA 4HP8A 2CL6X 1P3Y1 2Q5OA 4ILKA 4P98A 2JA1A 4A7PA 2WWWA 2C2WA 1VHJA 2MMGA 4R1MA 5CVDA 1YE5A 3GQBB 1N2CB 2BJHA 2KBEA 3EIEA 4P0PB 4KO1S 2X2PA 1JVBA 5E9QA 5C37A 3DBRA 2EJTA 1E9VA 1KMNA 4IDAA 4RIGA 5JSFA 3L0SA 3PFFA 1VJGA 1WW2A 3H4MA 1UQRA 4FR2A 3MFYA 5COQA 3T3GA 4QYIA 4ZI7F 2I9KA 2PQMA 1VG0B 1G9TA 2DQZA 5E7MA 4X60A 1OIVA 2HQ1A 4DR7B 2D0OB 1Y4SA 1YULA 4PC1A 4UARA 1MJGA 4E22A 3HP1A 2V0NA 3NBAA 3OPNA 3VH1A 4O0LA 1UFKA 1ESCA 2E4YA 1S3SA 2YN0A 3PIIA 3GB9A 2BGTA 4CKYA 1QZXA 3OA2A 3NB0A 1KO7A 3TB6A 4MSUA 3ADOA 5KSWB 2JD2A 2G1PA 2GZAA 3GP5A 4XAQA 4EM6A 2X5NA 4X1YB 1TAGA 3B7PA 3ZWOA 4DADA 1Z8NA 3UIEA 5IVIA 3AVXA 3AOEC 1B73A 1TZ2A 3A4YA 1JSZA 4GPIB 2I3ZA 3ML1A 1PEKE 2QUBA 3GPIA 4FYXA 4PZZA 4JN6B 1GSHA 1LTQA 1N4DA 3W3AA 4UPEA 1QYVA 4L4YA 4B76A 1T9DA 2FFQA 4EDFA 1KY5A 1OLOA 3TRJA 5B4VA 5KYYA 1K4MA 2O5CA 1N8KA 4TL8A 1SUSA 1TTHA 4HH0A 3ERCA 4PBSA 4UFOA 3A1NA 4IV5A 2JKZA 1ZIDA 2MSLA 5F1PA 5LL6P 4RWEA 1KSGA 2J87A 3GROA 2XOEA 1QGUA 1KRWA 2ZE5A 4D3FA 3G23A 4EHKA 1DX6A 2PAAA 3LKVA 4EHDA 1JDPA 4KQ6A 1FSFA 1V5EA 1VHDA 3MTQA 3G2JA 5A1TA 4ETIA 3TZKA 2IH2A 3U62A 1X74A 2WHRA 3ANSA 5KTRA 4CF3A 1MRZA 1IY9A 2Z56A 3DFZA 4X41A 5ALGA 4C0LA 1J2JA 3IUSA 1Q44A 1VE3A 1JDBC 2BI7A 1E3LA 1WY5A 1X1AA 3I2HA 2NPOA 3HUEA 2IDJA 2QN8A 4PN3A 1KC3A 2FZ4A 2QGFA 3W8FA 5CDGA 3H8SA 2WILA 5KREA 4YONB 2XUKA 5D85A 5SZKB 4OUKX 2HW8A 4YR9A 5I7OA 4D9FA 2C82A 1WXHA 1Y4AE 1ZD3A 3GDWA 1E0KA 1TFRA 4B6PA 2F3PA 3T0GA 3VOBA 4MW5A 1DQZA 1GLNA 3MXTA 4H4CA 1YE8A 5LMUB 5FP0A 3C8DA 3U56A 2HK7A 3UWPA 5JEEA 4D98A 5A7FA 4B6QA 3OY2A 3CS3A 3QPCA 3E1SA 2PLNA 2NOAA 4NHOA 4LW8A 2YCLA 3Q9NA 4Q3LA 1X7XA 1XRSB 2A9JA 2GAOA 5K09A 1I7NA 2BGUA 2F8MA 5DU2A 2HQSA 4BAUA 1WAMA 5F2KA 1BA2A 1OYWA 1NPDA 5LQNA 1NXPA 1INLA 3DDHA 1ZMXA 2RHLA 1U2PA 2ZRNA 4LOKA 5IMSA 1WB9A 5AVYA 3DLAA 1LQUA 3FPCA 4MRSA 1PJBA 3SWWA 3W2IA 5CLGA 1FY2A 3STUA 2DE0X 2HQBA 3WK8A 5EJ5A 5HM6A 4AZ0B 2QRPA 5CW1A 1Z0IA 3TD6A 1QFZA 3PD0A 3T15A 4E2ZA 2PCLA 1CUHA 1A8SA 3DHVA 4N8DA 2V4MA 3ZPXA 3U9LA 3ZKAA 1GPMA 1NNI1 1KFKB 1E3QA 1OIXA 4RJ2A 1WU8A 3SBOA 1JLRA 1JKMA 2REBA 2CC2A 2BGWA 3P9YA 1XUOA 1LFAA 3KUDA 3ROTA 5BYBA 4JS0A 3VHQA 4BWGA 3FZNA 4CU5A 4C7XA 1GUZA 3VNRA 5IT4A 1HXHA 5AQ1A 5BSEA 1CUXA 2N1BA 1R66A 4LV8B 2OUIA 1W93A 4FFMA 3FWPA 1KMMA 4HXFB 1DL5A 4KIFA 4MWEA 4D9CA 3OZAA 4WZAA 3FKQA 2F1JA 1P5HA 1C41A 3FSEA 4Z4CA 4TMKA 5EPOA 721PA 2H1HA 2P9YA 2YJ4A 3R41A 2HMAA 4HLQB 4DCOA 2R6JA 1JB1A 3G7NA 5K3OA 2FE1A 2CMFA 1TF5A 2PR7A 1Y9DA 3CE6A 4WIAA 1I5RA 1ZLXA 5BVHB 5FNVA 4QQ8A 1ZH8A 2WV7A 3L6CA 4B6JA 5CB4A 1KEPA 3QG5A 4O4IB 3R3SA 4B3JA 5F98A 3AJRA 1EXNA 2WM2A 4YRFA 4RGBA 3SJ7A 2AS0A 5K3SA 4EA6A 4NCKA 3WYBA 4D74A 1BMDA 2RHHA 2FPGB 3K53A 4W8OA 3AEKB 3D54D 4RL6A 4BFCA 3BH6A 1KK1A 4HVCA 4L74A 5D2CA 5K0CA 4WEQA 1O5OA 3ESRA 3SZRA 1I2DA 3L5OA 4EUEA 2ESRA 1V4VA 1E5QA 2YVLA 3IPAA 2QMZA 4K8OA 1JU4A 3N6VA 2XWSA 1DBVO 1E6LA 2I3BA 1OV4A 2FFJA 2G6TA 4LDAA 2BHLA 1TE2A 1KO1A 4L8YA 4WNCA 1NPTO 3Q11A 4HOYA 3I0MA 3L05A 2AW3A 1NULA 2ERCA 2GRAA 1R8JA 2WNIA 2QTGA 3FUTA 1MABB 2ZQ5A 4K9NA 1HL7A 5L7YA 1FW6A 4X84A 2A2ZA 3AW9A 3OFJA 1Y89A 3QVOA 1XVUA 1YB2A 2H54A 3ILSA 4H9GA 1X8KA 1T5LA 1UPCA 2FP3A 5EG5A 2X3FA 1C7IA 2GAIA 3GZJA 2GPYA 3EA5A 3M6VA 4LF8B 3CZPA 5JUWA 4P31A 5FUBA 1M5TA 4AMZA 2OK7A 4KTTE 4U0JA 4YMLA 1ZN2A 2JFVA 3BJEA 4DRXA 2M2IA 4KYUA 4BX9A 1L7XA 3ZV5A 3QLJA 2WY2D 1TF7A 5AW4A 2XLBA 3E82A 3I5UA 5IAGA 4UNRA 2NLOA 1OE0A 3EUEA 4R7TA 1Q15A 1QK3A 2NSHA 4PYQA 4NV1A 1I1NA 2G8LA 3RFVA 1WCV1 1POWA 4P5PA 1T3SA 3TQRA 2O23A 3GMTA 1RI4A 3VPSA 1WQ4A 4Q4HB 3WX0A 3EGEA 2H08A 2ZWVA 2ODQA 4B46A 2JAXA 1Z4LA 3OZSA 3OEYA 2YYAA 4W1PA 2PIAA 1KMIY 3WMXA 1CSEE 3EXG2 3VVLA 3ZKWA 1ZMBA 3GLFB 4Z3OA 5DHRA 3HH8A 5AK3A 1SK9A 2AOTB