2QZJA

Crystal structure of a two-component response regulator from clostridium difficile
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
121
structure length
121
Chain Sequence
QTKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNVTTCPIVYMTYINEDQSILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component response regulator
publication title Crystal structure of a two-component response regulator from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Transcription
total genus 43
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2qzjA00
4YR7A 3URMA 5FBKA 1MB0A 5JNRA 1MIHA 2E4XA 4ZYLA 4RZSA 3H5IA 5JS2A 4OTZA 1DBQA 1JYFA 4KQCA 2BGGA 3HUTA 5TQ0A 3KG2A 3SNKA 3BRQA 4Z0NA 1ZDMA 4QYMA 3EJWA 1TLFA 1E6MA 3ILYA 3N6VA 3OQNA 4O5AA 2IOYA 4G0QA 2IPAB 4G0MA 2QSJA 4ETNA 3L49A 1QO0D 3CNBA 4FB4A 3OLVA 2GX6A 1VLZA 5TPWB 4MS3B 5JNSA 1M5TA 3NNSA 2ZWMA 5PNTA 4JB2A 3LFTA 2CD7A 4LX8A 1GLGA 3H1FA 4IF4A 4EVRA 3OO0A 1U2PA 1VPWA 4TLLB 3I42A 4RK5A 2GBPA 1K66A 5TPZD 4MS4B 1USKA 5C5EA 4RXMA 2WWVD 4S05A 4YV7A 4M88A 3KLOA 3D8UA 4QPJC 1U2QA 4YCSA 4UHKA 4ZMSA 3O1IC 2TMYA 4EVSA 1ZN2A 2RDMA 2VK2A 3FFXA 2L17A 2HPHA 2FLKA 3CZCA 4MYRA 5TPWA 3Q7SA 2P4UA 4Z4IA 1NXPA 2FEWB 3Q7RA 1BDIA 1EWKA 3UKJA 1PUXA 1YK0A 3S99A 4PEVA 5IC5A 2HSGA 4Z4EA 2VUIB 3K9CA 4G86A 3RVMA 2H0AA 4MS4A 3Q7TA 5E3JA 2H3HA 5B3JA 3MQ4A 3D02A 4G97A 5GQSA 4F12A 2PUAA 2M1ZA 4WXEA 3LKVA 4MRMB 3RVNA 3A0UA 4W5NA 3JPWA 4ZMRA 4B09A 2JBAA 5DLEA 3GBPA 1BAPA 4WT7A 1ABFA 3CG0A 3O2JA 3DBIA 3JTEA 3MF4A 5FWYB 5FBHA 1Y1LA 5FWXA 2A9QA 3BREA 4F8JA 3LTEA 4RKQA 2FMFA 2A9PA 2FQXA 3C3MA 3M9XA 5IUKC 4ETMA 4ZJPA 1EFAA 2MYTA 1NXOA 3BBLA 3F7NA 3JPYA 1RPJA 1JLKA 2RGYA 4MR8B 3DZDA 3GT7A 3IPCA 2WY2D 4EVQA 1YIOA 4MR9B 5KQLA 2PUFA 3O2SB 1M2FA 4PE5B 5JNVA 3UUGA 3HZHA 3OLZA 4MRMA 4YS6A 2E4YA 3QLUC 4NQRA 1FFWA 6CHYA 3HXMA 3R0JA 3RH0A 5ED4A 2FXIA 4MQEB 2PLNA 4P98A 4O1IA 3CLKA 1L5ZA 1JWLA 2QVGA 3KSMA 1EWVA 1YS7A 4IMJB 4F11A 3Q41A 2LUOA 3OM0A 4RK0A 4G0PA 3GBVA 1GUDA 1PNTA 3L6UA 1RXIA 4ML3A 4MR9A 2ID9A 2IDMA 3NNDA 3I5AA 4MS1A 4OBBA 3B2NA 3O1JC 3RVSA 1PHRA 5TQ0B 4EUKA 5KQMA 5C5CA 1LJLA 2LBPA 2LP4Y 3DGEC 3EODA 3HUUA 3FGZA 4YGXB 1Z26A 3HEBA 3KHTA 1RXEA 4KK4A 3EDCA 5KC9A 3TX6A 1YK1A 1LBHA 2AYZA 3C97A 4YO7A 5HSGA 2PUCA 2PL1A 2MSKA 3GA5A 3MIZA 4MPTA 2PL9A 1JL3A 5EWLA 1BA2A 2JB9A 1SRRA 5I4CA 3LUHA 2FEPA 4PYRA 5D2CA 4S04A 3NHZA 4HNSA 3LKBA 2WRZA 2QXYA 1BDHA 1GUBA 4L4UA 5HKOA 2FKAA 4MQFA 4RY8A 3TMYA 3IDOA 4G0ZA 4LE0A 5GOTA 5KWSA 1KRWA 1D5WA 2W42A 4N76A 4H3HB 1RZRA 5KQPA 2FMIA 1ZH4A 3NBMA 1CHNA 1F51E 4RDCA 3O1HB 4D6YA 8ABPA 1I3CA 5T7BA 1NXXA 1JDNA 1UDRA 3VNAA 3OQMA 1DBPA 3H5WA 4WXMA 4Z4HA 3DLHA 3A0RB 1BDJA 3GYBA 4UHJA 1USIA 4LDZA 4NCAA 1JX6A 1C0EA 2WJWA 2R48A 3H75A 4D74A 4P1ZA 1OXBB 5IX8A 4TN5A 1QKKA 1ZESA 1ZY2A 1W25A 2JVKA 2MYNA 3I45A 1DBWA 1F4VA 1ZITA 2J48A 5IEJA 3VNBA 3HJFA 1BVHA 3DGFC 3C3WA 4Z99A 3CFYA 4WWHA 4MLDA 2JBAB 5EWMA 1U0SY 4LE1A 3T8YA 1K68A 3C3KA 1H9CA 1LJUA 2HQBA 3GWGA 1WETA 1DCMA 1YS6A 5FWXB 1U04A 2GWRA 3IP5A 3RVLA 1MVOA 3MMNA 1GCAA 4H60A 1W9HA 2JVIA 2PKXA 3JVDA 2FQYA 3KTOA 3MYYA 5IBQA 3KYJB 3EQZA 2MYUA 1DG9A 2I6FA 1DZ3A 1TVMA 1ISRA 5B3JC 4NV3A 1SXHA 3CKMA 4NCBA 3EGCA 4KMRA 2LIVA 1C4WA 1AB6A 3QLVC 3QLVA 4N47A 5HQJA 1XHEA 1DJMA 1JF8A 1P8AA 4ZPJA 4HYEA 5IUJC 3HDVA 1JFVA 1MB3A 2FMKA 4RY9A 4XARA 1JFSA 2CHFA 4N41A 1JBEA 2A9RA 3LOPA 3N53A 1P6QA 2DRIA 3OLWA 4RK6A 4Z4CA 5JNWA 1CEYA 3O2QB 3H6HA 4OG2A 1DC7A 4RXTA 4RSMA 1USGA 3SQNA 2VUHB 3CU5A 4IILA 3O75A 4RV5A 4MLCA 1DRJA 4RK1A 4W5OA 3HSYA 2IPMA 1DRKA 4GNRA 3F6CA 4KFCA 2PUBA 3LUDA 3NHMA 4N0PA 2FSPA 2IPNA 3N0WA 1E6LA 2AYXA 3QK7A 4TLMB 3HO1A 1U8TA 3H1EA 4KV7A 3TD9A 4DQDA 3KJXA 1TM2A 3H6GA 4MS1B 1QP0A 4H3KB 5DKFA 3IP7A 3HV2A 4YLEA 4EGSA 3QX8A 2F8TA 3KLNA 1KGSA 3KCNA 4IMIB 3Q9SA 2E4ZA 3GV0A 4JB0A 3OQOA 1Z13A 1NXTA 3GL9A 4O1HA 4XLTA 4F06A 5BRAA 2NUBA 3N0RA 5DCLA 4DN6A 4RS3A 2M98A 1PNRA 4GPAA 1J56A 2QV0A 4XFKA 3RVOA 2OENG 4CBVA 4JP1A 1QMPA 2L19A 4RXUA 3T95A 5KQGA 1TJYA 3RVQA 1FFGA 4XAQA 1NXSA 5EWLB 1CYEA 1XHFA 2FMHA 3NNNA 4KZKA 5KI6A 5IULC 4W5QA 1EAYA 3H5OA 2R47A 1JDPA 5DTEA 1QQAA 3LMKA 1RZRD 3TO5A 3FMVA 3QEMB 3N0XA 2YHBA 3K4HA 1LBIA 4MQFB 1M5UA 3FFTA 2P9HA 2JRLA 2ZAYA 3G1WA 4E7PA 4WZZA 1KRXA 4MAAA 1QPZA 1GCGA 3HDGA 1YVUA 3LUJA 1Z17A 2NZVG 5EWJA 1QNLA 4EY3A 2CHEA 2PMCA 3HCWA 4KQ9A 5IEBA 4G0YA 3QELA 1Z15A 1FSPA 3IPAA 1ZHHA 2JK1A 4Q6WA 7ABPA 1JHZA 3Q15C 1ZGGA 3JVIA 1QP7A 3C6QA 4XXHA 5CNJA 3EULA 3CTPA 3QEMA 2MSWA 4XASA 4DADA 5HM6A 1YTUA 3QLTA 2IYNA 5F64A 9ABPA 1D4ZA 1EHCA 3RVJA 2QZJA 1QQBA 5TQJA 4RK7A 2FW0A 2PAFA 4JASB 4MR7A 4WUTA 4Z9BA 5IUNC 1JYEA 3DLBA 5EWMB 2E4WA 4F3TA 2QW1A 1MAVA 3N75A 3OM1A 3CS3A 1SXGA 4N0QA 1NXVA 2F8SA 2MYPA 2VYCA 5CNMA 2LPMA 3UK0A 2NT4A 3MA0A 3ILHA 5BRJA 1ZH2A 2HQRA 1NY5A 2N9UA 2YHAA 1HEYA 1ABEA 1YMVA 3FFWA 3QX9A 2B1JA 1Z2DA 3F6PA 2FLWA 3KYIB 3SM9A 1ZAYA 1A04A 2HQOA 3LUKA 4OLAA 1PEYA 5BQ3A 4LDAA 3OMXA 2RJNA 4JAVC 4PZ0A 1KMIY 4Z4FA 2E4VA 3EQ2A 4KREA 4RKRA 3MM4A 4EYOA 2IKSA 1T34A 1M2EA 3HVRA 4QICA 4KK3A 5KC8A 3BILA 5TE9A 1ISSA 3P9YA 4NICA 2NT3A 4L85A 3LUCA 1A0OA 3M6MD 4Q6BA 2CWDA 5JS1A 1P2FA 3T6KA 3F73A 4KVFA 3SAJA 1DC8A 3SG0A 2HJ9A 3A3KA 3FDFA 2R25B 1URPA 4RK4A 5JNUA 3OLYA 2PUEA 3H1GA 3CRNA 3IP6A 3CZ5A 1XWWA 3H5VA 1Z2EA 5CNIA 4Y9TA 4EYKA 2XDYA 4MS3A 4IGAA 2E4UA 3I09A 5TQ2B 1A2OA 4TMYA 5BR1A 1SXIA 1QO0A 3LUFA 4KNYA 3H5LA 2WJAA 3E61A 4LZLA 5CNKA 1OXKB 4EYQA 5CHYA 1E2BA 2QU7A 2O20A 4IRXA 4LRQA 3OO1A 2IPLA 1LK0A 5ABPA 4G0XA 1DCFA 3M9WA 4MGEA 4RY0A 1NTRA 5TPZA 3TB6A 1Z12A 3CG4A 2GKGA 4JA2A 3QEKA 3RQIA 3W9SA 4KPYA 2ID7A 4D6XA 3BRSA 4KRFA 1AB5A 4FE4A 1DP4A 1EWTA 3JY6A 3RVPA 4W5TA 2JVJA 1VRVA 5TQ2A 3KS9A 2A9OA 3CHYA 1Z18A 3ROFA 1L5YA 3OLXA 3T38A 2FEKA 4JOQA 5EWJB 1JFTA 3O74A 3O21A 4PICA 4HNRA 3SY8A 1S8NA 2PE5A 3EAFA 2R4QA 1D1PA 4Z4GA 2GI4A 2QR3A 3QELB 1NXWA 4EYGA 3OMWA 5DGCA 1QP4A 1APBA 4E7OA 2WB4A 1ZVVA 3ROTA 3LUGA 3GRCA 1DCKA 1VKRA 2NZUG 3QLUA 3HM9A 2RJOA 4QYWA 2WMYA 2FQWA 1FFSA 3E3MA 2FN8A 4YWHA 4OLBA 5FWYA 2FTKE 1D2AA 1TMYA 2PUGA 4YRZA 2PJUA 1D1QA 2V0NA 3H5TA 3IP9A 4MR7B 4OATA 3RVRA 4HNQA 3JS5A 4RU1A 1RNLA 3KKEA 4N03A 2FVYA 3A10A 1P6UA 4W5RA 4MR8A 2OQRA 1JH9A 5JNTA 2Q5CA 3N8IA 3HS3A 4Z9AA 3RVKA 1PEAA 1Z25A 2KYRA 3HK2A 2MSLA 4RWEA 4MQEA 2B4AA 6ABPA 5T3YA 2PUDA 2JCGA 2QVCA 1FQWA 1SD5A 3G85A 2L18A 4G0OA 1ZGZA 1IIBA 1NATA 3LUAA 4FE7A 4YP9A 2L2QA 1YMUA 2FN9A 1B00A 2X7XA 1Z16A 4ETIA 1R8JA 1E6KA 4LE2A 4Q7EA
chains in the Genus database with same CATH superfamily
4G65A 3GUZA 5JH7B 4RMIA 4H31A 2IZ7A 4CR6A 2JEOA 2IYAA 2L0XA 2H65A 2OBYA 2C20A 2AW3A 1GN8A 1P9OA 2GT1A 2J1LA 3K5IA 2QLJA 5JQGB 3UCFA 4A0SA 3FKSA 4O5AA 2GZ2A 4RVUA 5A5EA 3NHAA 4ETNA 1XB2A 3U7GA 1DWOA 2WZBA 5DASA 4AS1A 2D3TA 3ETGA 3OY2A 4GPTA 1LLUA 3HWWA 2I99A 1O6FA 5BN4B 3JD2A 4NNOA 1AKVA 1PT9A 2OKCA 2WHYA 3GELA 4ROSA 2AIRA 1FRNA 5CCBA 2LDXA 1F2TB 1VSQA 1FDOA 1QH1A 1T5DX 4NE7A 4PQGA 3H1PA 4DM4A 4J3JA 4N49A 3WMWA 1UMDB 3UXMA 1AX9A 3MB8A 4BIIA 3PDCA 1Y8QB 1QHYA 1XMVA 3CIFA 1NPYA 3HCCA 2J5RA 2XDQA 4QPJC 3G2JA 2GZ3A 4X0EA 2G4VA 5L4LA 2JC3A 3Q9UA 4N65A 3IUJA 5ALUA 1RJ9A 2I65A 3TF5A 2AE1A 2C9MA 2FF5A 1XQVA 3K0CA 2HBYA 1CUIA 2PVPA 2RAVA 4QAJA 3LPCA 4AY5A 2Z2IA 4IOKA 1G0NA 2QUKA 1YR8A 3ADKA 3KNZA 2O54A 2ZJZA 5J4YA 3B3AA 3JWJA 3MS7A 1MC4A 1CY1A 4OXXA 5FBQB 1VHLA 1DJOA 4B9AA 3HM9A 3OOSA 4MVXA 1E0AA 1QR2A 2C8VA 1QG0A 2BEWA 3I1JA 1J2YA 3DMFA 3FYSA 4CI0B 3GLHA 1ADFA 1ZK0A 2H3HA 2OHOA 3H11A 2I4RA 4IHJB 3J81k 3MQ4A 2ZYHA 4X60A 3WLOA 2AG0A 5K3AA 5HPYB 5ITSA 4BC0A 2ZSKA 1B41A 4G81A 3DZIA 1YNOA 4E12A 3JPWA 1HFEL 3QIAA 4YO8A 5IDVA 1T9DA 1E2MA 4CHGA 2VTDA 3AB3A 1Q7GA 2AQKA 3MF4A 3O3OB 4ZQGA 3TR5A 1HOXA 3ZJVA 3PJRA 2ENWA 2Q3EA 3EQ9A 4RMGA 2DKFA 1N7HA 1IEQA 2A9QA 2Y1EA 1GPWB 3OH8A 3R75A 4DJDC 3QA9A 2Q9UA 4X20B 3E1KA 2AQIA 4GDFA 2V45A 1YVEI 4ETMA 2HZBA 2ZDQA 2GN2A 2EX1A 1S02A 1RPAA 4G5XA 1MO4A 2RGYA 1X70A 4W5WA 4CTMA 1EEHA 2F59A 3UJ7A 1TADA 2XUGA 4OH7A 4EVQA 1U9JA 1QVZA 1I3LA 2VYQA 1U7PA 2BJWA 5JNVA 1X8LA 3P94A 4EEXA 1UKCA 1EBBA 3IBSA 3VTFA 4R6WA 5EMKA 3LHFA 1AUXA 4C89A 4IDGA 4MGYR 1BWRA 1SHZA 5I51A 5DV9A 4DRYA 2PT7A 4MQEB 5AJWA 4MVJF 2HU5A 2XRFA 1Q91A 2C1XA 4FMCB 5TX7A 4CPDA 3IAM6 2FSHA 4KE7A 3VU1A 4CKCA 3DAYA 5GZ6A 4MVJE 3VMMA 1YR1A 3USES 1B3BA 4XSVA 5ALXA 3IOEA 3WGGA 5JPDA 1FW6A 5HK9A 3DE7X 1K5DA 4Q4AB 1TJ5A 4KVZA 3QKTA 2IYEA 4Y1RB 2FV8A 5KREA 1NDQA 1Y3AA 3AV0B 3GH3A 4WTOA 3W5IA 2BN4A 3E22A 3I39X 2IDMA 3VTAA 4KN6A 1G291 4YIHA 4CEHB 3AUKA 3G7NA 5B1HA 4X66B 1T9HA 1KFCB 3SXPA 1RD4A 1ZGHA 2YNMD 5HM8A 4RAOA 4G0WA 1YBHA 1ZLXA 3FN4A 4C6HA 4C03A 4PYMA 3AI2A 3C5HA 1YOBA 1Z2OX 1ZD5A 4B4OA 4NATA 4TSRA 3QUAA 4YGXB 2QJFA 3R9WA 4A15A 3VYWA 2O8BB 1HX7A 5C34B 2PGAA 2EL9A 5EEGA 3PE4A 3HEBA 1S5PA 4ZZ0A 3ZXSA 4JCCA 2R3SA 4ZK2A 1PR6A 3AFOA 1S1MA 3I23A 5KWEA 2ZTMA 1Q0ZA 3C6BA 1IN5A 3DEFA 3DV9A 5LU9A 2DR3A 4PG4A 1DLJA 1IHYA 1SU7A 2B8TA 3DKRA 3MIZA 1KJ8A 3CT4A 4L28A 5SY9A 2KHZA 2NUTA 3RV4A 3W9BA 4CKBA 5A5VA 4F91B 5LMUB 1DEHA 2AVNA 2AEMA 2VHTA 3UJPA 4B6GA 3MCVA 5G4LA 2WKPA 4KPUB 2B9EA 4KN5A 3VC7A 3C8DA 3KV1A 4H3VA 5CCXA 1PDVA 3DCYA 1H4SA 5JI2E 3P32A 1GUBA 3P2YA 3K96A 1HDIA 4LZNA 4NJMB 3HR8A 3IDOA 3ICPA 5BXYA 1KRWA 1SXJE 2COEA 3E2PA 4IP0A 2C82A 3ZS8A 3ETDA 3ZBPA 1NE2A 1OGYA 1GG9A 1DRWA 2HEIA 3N2EA 2FSSA 5CD9A 3ZWAA 4DJEC 1C8VB 3LWZA 3KQNA 3LC2O 2OCIA 1KYQA 1DIAA 3G2NA 4IDBA 4M89A 1V41E 1X7WB 4TVKA 1DBRA 3BXEA 3H87A 3D6UA 4EJFA 1GCOA 3DE4X 4R8LA 1V9CA 3A0RB 4DZTA 2ANCA 4KQHA 4YROA 1EBUA 1JDUA 1Z38A 1WAMA 3OE7D 2XDWA 1YACA 2FWPA 4PLHA 3KB2A 3TQCA 3VSEA 2VQ3A 3WLIA 4O2RA 1DJLA 2X7JA 1A82A 1ZMBA 5FUQA 3DD5A 3EIFA 4ZIRA 4JOSA 5G0TA 2EBUA 1YQWA 2A9FA 3FJYA 3QV1A 1TT7A 4EGJA 2WF8A 3C3WA 5DW3A 5E3HA 5IFLA 4XQEA 1W30A 1TF2A 1JSZA 1NYRA 1FOEB 3TQRA 1EDBA 3QBJA 4GXQA 3N5KA 2BEKA 4BP3A 3GLIA 5ES4B 2VOJA 1CFZA 2F62A 1CZNA 2BF4A 3ADOA 3RSQA 5CB4B 1ICIA 1BZYA 4BQRA 1R0XA 3IQEA 1P73A 2IF2A 5AP9A 3WV4A 3MMNA 1T2UA 2R1VB 3ECSA 4YRTA 4KXQA 3MWLA 5HGXA 3IAAA 4FGWA 5TRTA 2V03A 3NH9A 3TSOA 3ZDQA 3MJEA 3ZR4B 2H54A 3ESXA 2GR9A 3ZVLA 3IBYA 3KT3A 4D9IA 1TVKA 2VP3A 3D3QA 1I2MA 3EFBA 2F3QA 4W5HA 1XKTA 2ONJA 3D3EA 3ZHUA 1RP1A 2PBFA 1U8FO 2DWCA 4PC1A 3GEHA 5IRCD 1SY7A 3KM0A 3N7TA 3P2OA 1Z5OA 5EZYA 4AY4A 1PP4A 1KZ1A 1XV5A 1V95A 2A0YA 1YZQA 2W71A 4AG6A 1JBEA 4PQRA 3MB5A 1ZFNA 4TV9F 1T8SA 4ARAA 3CM0A 1P6QA 2OO5A 1R8XA 3DHNA 1Y1KE 2NYRA 3OLWA 4J1TA 2OORC 5GJVC 4Z4CA 5HW0A 4OMCA 3KYBA 5KTSA 2V54A 5AJZA 1FTWA 2J9ZB 4BNKA 3SQNA 4AN4A 3O4RA 1YFZA 1HR0B 1Y98A 3C8MA 1OAOC 1U9IC 2AN4A 5E6RA 3EPJA 1YDEA 3KU1A 1MDFA 1Q22A 2QJOA 1TM2A 3JYPA 3H6GA 4GXTA 1Z45A 4HB3A 4MS1B 4TUYB 3JYNA 4IHQA 1UP6A 5IWAB 3J7AC 3PL5A 4LV6A 2HADA 5JBQA 3W9YA 3C48A 1O94A 4G56A 4JQCA 5F1PA 1FF9A 3HB9A 3DFKA 3F2VA 4Z8XA 1K6JA 1NJGA 4OPMA 4DYDA 5F2NA 2UYHA 5EIOA 2FN3A 3DV0B 3QM1A 2ZJ5A 4PLVA 3NDRA 4YYEA 5DX0A 2GEUA 5KBYA 2W6MA 2J6HA 4LYEA 4O1HA 5AW6A 2FVXA 1CY7A 1ZEMA 3IDZA 1E9SA 2O2JA 1J56A 1RXCA 3KKPA 4L4XA 4UMVA 5K3SA 3VKWA 5HOQA 2AFIE 1JKXA 2W00A 1OT5A 4Y6OA 3T1NA 1RR6A 4XAQA 5DCYA 4CG0A 2FFQA 2D8MA 2OBXA 2CW5A 3NNNA 3O3MB 3D8TA 2GPJA 2XTMA 4AWBA 4H0CA 3CMMA 4UOQA 4TYMA 1AZWA 2X5XA 5ICSA 2C78A 3FR7A 2W2MA 1U2EA 3ISVA 4Q4LA 4QDZA 1QLWA 1I32A 2OQ2A 3PXDA 5D7NA 5CFQA 5MN4A 1IYZA 2HK6A 2XRMA 3BYZA 3I2KA 3EGWA 3EEOA 4KDFA 5BVGB 3HDGA 1FLVA 1E0DA 3LUJA 1DOAA 4Z2AA 1O6ZA 2OXFA 4PO3X 3N86A 5A6SA 1AKNA 1QS0B 3SEAA 5E9WA 3G9ZA 3RS0A 4B0OA 5IEBA 1X6VA 2IYFA 3ZK8A 2X23A 4YV2A 1Y9EA 1EHIA 3TIFA 3WAGA 3VSBA 2CNWD 1PJ3A 2JHGA 1MAHA 1ZGBA 2B1GA 4R16A 5KNDH 2FXVA 2G28A 4HGOA 4A0GA 4OQLA 4KH0A 4DLTA 5KJ1A 3PFIA 4CQMA 1BVRA 1WS6A 5EUMA 4LWQA 3DAPA 3GGPA 4HT3B 2CHGA 3RGGA 5AFSA 3FOAA 1R7RA 3UV7A 1X3SA 4DRXB 4J94A 1FSSA 1GITA 1T8WA 2N1BA 3II6X 4BO3A 3UT5A 1KJZA 2BGLA 4WUTA 1QJCA 4OHRA 4PYQA 3FMGA 4NZ9A 1QG4A 3OM1A 4RZIA 5BVHB 3U1BA 3LP5A 1WULS 4MVJP 3MW8A 5JAUA 1YGYA 3UO8B 1IY8A 3E35A 1Y6ZA 2P9GA 4M0UA 4DBVO 5LQNA 4PLTA 3IEXA 1N0HA 4JLNA 5E95A 1KVTA 3GQVA 1KI7A 2ZM6B 2VDWB 3W05A 4C6RA 4R0NA 1Z2DA 2FLWA 3NASA 5J63A 1EP9A 9LDTA 1KO4A 4I9UA 5AVQA 5JZBA 1ZINA 3DTNA 4PTZA 3REQB 5NULA 1A98A 2ZCUA 3DBVO 3DOJA 3I37X 1SUIA 3PXBA 4M0LA 1NM5C 2YIJA 3K0SA 1MB9A 2DLNA 2XCRB 3UA3A 2YCLA 1X86B 3OKPA 1NJ8A 1KEWA 3OCJA 2WU4A 2G80A 3PWKA 4JYPA 2ZK7A 1N7JA 3AJEA 3U3ZA 4QJ5A 3Q7EA 5IK2D 4TKUA 3ZHZA 1E5VA 4O2BA 4E46A 1LWOA 2QB5A 1QDUA 3CRZA 3IRUA 3QVOA 2OFWA 3GCDA 4NYMR 4Q93A 4P4GA 4Y18A 2ZSUA 5EE9A 5ENZA 5I8ZA 3C4JA 4D4KA 2YTZA 1YCGA 5JVDF 3TUZC 5IVDA 2WA2A 2Z9BA 3ZTTA 1YC5A 4JKOA 1C4KA 1ULHA 2XNDD 5CT5A 3I1IA 3T15A 3OFNA 1LZKA 3ZCQA 1Z73A 4UVDA 3GLUA 1FFCA 1C9KA 4EB3A 2J7KA 2FZCA 4EYKA 2JFQA 3EZ9A 4CN9A 3IDFA 3WRVA 1L7AA 3DBRB 1K7YA 1MOZA 1U1IA 2K7ZA 3WRYC 4F21A 2CHVA 3VKHA 1UADA 2AZDA 5TGDA 1TTPB 2EKPA 3RARA 4BFSA 4I4IA 2W6PA 3NFRA 2QD2A 2WBLC 1ND6A 1OXKB 2H0RA 2ZI6A 1I9CA 3EG5A 3HB7A 4L1KA 5JPIA 1RXWA 1VYVA 3LJKA 1WY5A 2K4MA 3S2FA 2L82A 4Y0AA 1II9A 3PA6A 1TTQB 1XP5A 3BCHA 3LUBA 3IUSA 2A1TS 1U4SA 3R41A 4HLUA 3U6BA 2JH3A 1YCDA 1OC4A 5D5HA 1PJQA 4GLBA 5JSYA 1Q1EA 2VLBA 5LA6B 3T7KA 4JLUA 1HNNA 3ONDA 4KDCA 4LJ9A 4Y6SA 4DC1A 1GUFA 5ERGB 4YUVA 3O8RA 3SGLA 3RGWS 3E0QA 1PYDA 3WISA 1N5MA 5HWSA 3D0RA 3N7UA 5FWAA 4N9WA 4V2IA 2RGUA 5K0GA 1HQYE 2JPDA 3C1OA 1H2ZA 4X92A 5CCDA 3OPYA 3WSVA 2CKDA 2I9PA 1CQIB 1J1ZA 4XPIA 4JUIA 3WA6A 3DT8A 2GI4A 2QR3A 7ADHA 3OQIA 4CLRB 1QP4A 2HSZA 3F97A 1QTQA 2JJ2D 3EVTA 3LUGA 1X92A 2BPOA 2IV2X 4DLSA 1WRBA 4BNDB 2JFFA 2IH4A 1W47A 1WZNA 3KK0A 2UUBB 3SYMA 4D0RA 3P0IA 4QPZA 1OI3A 1RM4A 2FN8A 2OBMA 2XLBA 4RGVA 1H4TA 4Z4QA 5AO9A 1XTQA 3GVPA 4NK4A 2JBHA 5K3FA 4CODB 1OLUA 3MTGA 3AVTA 3UEOA 4JI6B 2CBGA 5JCPA 1X80B 2V0NA 5CXQA 4Q4JB 3NTRA 5ALQA 3QTBA 4MQMA 5AW7A 1MOQA 1PD0A 6LDHA 3MLBA 1RNLA 4X8OA 5J5AA 1F2DA 2VG8A 1GPLA 4EJSB 5JTUA 1PN3A 2C5HA 1IXRC 1KK2A 3VU3A 3ILSA 2UVPB 4RLFA 1OX4A 1C9EA 1J8FA 1X15A 2BTQA 1E3WB 4TYQA 5DRYA 2IEZA 4MRAA 1GGFA 3F5FA 1SD1A 1OIVA 5ALTA 5DYGA 4JR1A 3PNKA 2FH5B 3QKRB 4O6VA 3RG8A 1C0PA 1KTIA 1T5HX 3G02A 1EVJA 2HV8A 5T3YA 1YBAA 3UK2A 1ENYA 2HYDA 3GA7A 5LQJA 3L4KA 2WQZA 4H16A 4NYIQ 2VNHA 2CVPA 3LL7A 2Y76A 3X1ZA 3DEAA 3OCVA 2PANA 4B4UA 1E3JA 4F1KA 3SMVA 3M5DA 2P9TA 2X7XA 4MB2A 1T15A 5JJ5A 1ODTC 3JAKB 3HBFA 2AG5A 1XU4A 1Z8FA 4LE2A 2GJAA 2I7CA 2XQVA 3FOWA 3AB8A 5DHQA 4EO9A 5JARA 4RZSA 2JLZA 3DA8A 2BWJA 4E2FA 1DBQA 1C4XA 2OECA 4KQCA 5AK3A 4AJPA 2C7OA 3ICQB 2RH9B 2XBUA 3HXOA 1IDOA 1S8AA 3DPSA 4Z0NA 2IDZA 1W5FA 3EZ7A 4HGPA 1HMYA 2V7QD 2WPDA 4D45A 3E4DA 2HJGA 2WHEA 2V3CC 2PT9A 2V9PA 4OREX 1H3FA 3ZIUA 2FE4A 1FDSA 2ZI9A 5IXYA 5JASA 5HKBA 3D8RA 5FUBA 2VSXA 1QO0D 1XTJA 3S8MA 4AK9A 3X3HA 2DERA 3GLHE 4NL4H 1VLZA 3ND7A 3DOCA 4MHSA 4Z1MD 5A1JA 3ZOZA 1PSWA 3W4KA 4Q19A 1KAOA 3FBTA 4ESVA 1FBNA 1N2IA 1XTVA 3GZJA 13PKA 4YUWA 3K0AB 4HY3A 1NE7A 1TC2A 2CL5A 3QA3E 3H7AA 5DCUA 3UOAB 3N8NA 3O7WA 2JFGA 2VDOB 3HACA 2EARA 3RS5A 5A4MS 3IP8A 1ZSYA 2C3UA 3VR4A 1A88A 1AGNA 4BJ3A 4IEIA 4DBZA 3GPBA 3NWOA 6ADHA 4A8TA 3PENA 5DBGA 4LJAA 2C2BA 4J75A 3FNGA 2I7TA 1CJMA 4RMJA 3BK1A 2CXQA 4EVSA 2RDMA 1J8QA 421PA 2G04A 2YJ5A 2Z6VA 5ITZB 2WYVA 4OP3A 1PUJA 3ELWA 3B9BA 3IOYA 2XPCA 4D8VA 4Y2VA 1N5IA 2ZBUA 3QFCA 3AJRA 4KX5A 5GY7A 3WLRA 4FFSA 2XRYA 2J45A 4W1RA 4EGAA 3P5BA 3BK7A 4DIMA 4PHTA 1B14A 1BEEA 2HSGA 4OD0A 4UREA 2JANA 4A7PA 821PA 3NBQA 1U0LA 1PJCA 1SKBA 5E3JA 1Q0SA 4DY6A 2R6FA 2I6SA 4Q34A 4E3ZA 1E6WA 4H9GA 1HQKA 3ACCA 4CF4A 4JXZA 4KN8A 4Y1FA 3UGTA 5K8UA 2JIZA 1MU0A 3QI2A 4D9CA 1DV1A 1L4KA 2PLAA 4TXNA 1YVPA 4WK6A 3VRHA 2IHVA 1QHXA 3CCBA 2GVZC 3RHZA 4XWKA 3OQVA 1W5EA 4FNGA 1CF9A 1SKMA 1R3DA 2AFHA 1Y1LA 4DA9A 3K3PA 5JSFA 1HQCA 3JYQA 1NBHA 1KVUA 3O92A 1WEHA 3W5UA 2E89A 3M9XA 5IUKC 4BCDA 3WJ2A 3BBLA 5CX1B 1D1TA 4TKLA 1EXMA 4C7JA 3RADC 1N3BA 2WM9B 3PC8A 1KGDA 2NU7B 2JKZA 3PB3A 4FHDA 4HEHA 2XDAA 4XWWA 1SKAA 3THSA 4KSBA 2R6HA 4F6RA 4MWCA 3FUWA 2ISQA 1MC5A 3L7JA 1PQPA 2QMYA 1IM2A 2IZ0A 3T7SA 2IHNA 1RVV1 3S1AB 5J1SB 1I3OA 3QXJA 1W0KA 4UDNA 1R0RE 4CUZA 1EWRA 2QN2A 2H16A 5C31A 1WD7A 4KUGA 3PCXA 3KZ1E 5KTKA 3DE2X 1H8ED 4WZBB 1MJGA 5IAJA 2WKSA 3ZXUB 1OA1A 2GOYA 2QZZA 2F4VB 4PHFA 5J5VA 5EAIA 3VR6A 4A1OA 1AT1A 2OE2A 3K70C 1N78A 2I8AA 2H9YA 2HJSA 2C96A 3D5TA 2DB3A 1FB5A 5IMBA 1GUDA 4AG3A 1IBMB 3H2YA 1R5OA 3UBMA 1T36B 3P52A 1MO6A 1SUDA 1ENZA 2SHKA 3WYBA 1OILA 3ABZA 3QH4A 4NCHA 1NT2A 4WZAA 5TQ0B 4UUMA 1A71A 5C5CA 4K6KA 1V5WA 5IXSA 2PY6A 1L5SA 4LFAB 1GPDG 1MABB 2CZGA 1ZIYA 2J9YB 3LF1A 4D4MA 2O1EA 1OKKA 3B9PA 2OVBA 4PSKA 4EI9A 1U1DA 2WWYA 2HT1A 3AH8A 1I1NA 5ADUS 3N05A 4LXIA 4NFSA 3SQXA 1CB7A 1Z0AA 2YUTA 3HDQA 4Y9DA 2GJ8A 1W88B 5C1DA 3TZQA 1L5LA 1QC5A 3TX6A 3TZBA 3ZE8A 5JRJA 3FFBA 1TF5A 3IJ5A 2D0PB 2F1HA 4IXTA 3LYAA 1H85A 1RIFA 2Q1WA 4EHAA 4JSTA 4DV6B 4DV3B 1XXLA 5M2QA 5E6SA 3O8DA 2Y27A 3L7NA 4TSKA 4MW0A 4IIJF 3ZOKA 5IJ9A 2ATVA 2O0MA 4P32A 5JD6A 4BMSA 1ZUD1 3IT1A 3OECA 4DCSA 4JX8A 2RKBA 2KE5A 3KJQA 1U8AA 3FB4A 1BN6A 4L3VA 4L6IA 5G41A 4BXOB 3LLVA 1TLLA 2ZJ2A 3OBBA 3W77A 3GLIE 1YZFA 1BS1A 1S2NA 4DJTA 3FCYA 3SOPA 2XZDA 1MAUA 2FMIA 1VYHA 1A9XB 3AJ9A 1XZHA 1TW2A 1ZJ5A 1I3CA 2DFVA 3U1TA 4UDOA 1V1RB 2FSVC 2ZR0A 2M6KA 1DBPA 1F8GA 4M1OA 2XSZD 3NC1C 2DUNA 3CPEA 4ENWA 2DUWA 2GUWA 2QM7A 4LDPA 4RIFA 4P9NA 2OAEA 2IHYA 1CIJA 2I1WA 3L02A 2WJWA 2WV9A 3K1ZA 4NX2A 4GOOD 4KGDA 3ZHRA 4F0JA 4PFQA 3ZIAA 1U80A 3EEYA 3GJ5A 4JLWA 3T7TA 5K0JA 2CL7X 1GGNA 3R6WA 4IUCS 5HNKA 3ZCRA 4X6XA 3BD9A 2GZSA 2JDID 3AESA 1WSWA 4R2MA 3VA7A 2IYLD 2J5XA 4HGRA 1XD2A 1Q1AA 2ONYA 4OYHA 5JW6A 5K20A 3GYGA 1K68A 2Y8EA 2JGDB 2C3MA 4R1OA 3JYOA 1K7FB 5FWXB 2P6RA 2BDTA 1G19A 4JI0B 1PEDA 4C76A 3IP5A 1CJUC 1HE4A 2I33A 3FNHA 1D5CA 2CE2X 1P0CA 3KE9A 1NL3A 2Q1UA 2VAMA 4H60A 2PKXA 2REBA 4CEJB 3CR7A 1NP6A 1ZD3A 2WINI 1PGOA 2ZWIA 4UNIA 2MYUA 3SEQA 4UEJA 4I81A 4LBWA 1M34B 3IKJA 2ZWOA 3JXEA 4WV3A 5ALOA 1W581 3E3OA 5HK8A 1VLHA 4AMGA 2ZRPA 1AC5A 4DPLA 2D3WA 4F4IA 3M6AA 2ZSAA 5DTRA 4F3CA 1UJMA 4LBYA 4FGZA 4RY9A 1ZU4A 2FMKA 1UPAA 3TTTA 4YMUA 5JALA 3B9RA 2YVQA 1Z4PX 3IL2A 2OOKA 3Q3GE 4HWKA 3H0EA 2JW5A 2Q99A 1PG2A 1WHSB 3CLUD 3R0IA 4JVNA 2VPXA 4EPYA 2QRGA 1CWUA 1CY4A 1K08A 4YRGA 5THQA 4MLCA 4DA6A 1NUPA 5A02A 1JEQA 1WU7A 3CBGA 1I5RA 3COWA 3QLEA 1DGQA 3HC7A 3N0WA 2AT1A 3MGGA 3UAXA 4V38A 1YHZA 4KV7A 2I4TA 3V1MA 2FW8A 2X3UA 3S2EA 1JJFA 2PPVA 5LD2C 2FSUA 3P0RA 1I2AA 3QX8A 3P1JA 3FTNA 3UGQA 3VTKA 1I3MA 1R6TA 3C3PA 4CFYA 1QJ4A 3RU9A 1P1IA 5C8YA 4IQ0A 4RIIA 2OP1A 4Y67A 4X84A 2F3TA 4QXPA 3FBWA 3LQFA 3C1AA 1IXSB 4GM0A 5F12A 4QA9A 3CPHA 4F96A 3JZDA 3C70A 4IQFA 2RK6A 2XTJA 4GLJA 2QN3A 3OC0A 4B32A 4GYJA 4C4SA 4HLDA 3ENQA 3WWZA 1PV1A 3C85A 4WBNF 3GJZA 3KZXA 5CDFA 5FO1A 3C3JA 1Z4MA 3D43A 4NH0A 1CUGA 1JDPA 1Q14A 3TLJA 3TOVA 4YR9A 2XYPA 1QQAA 3B20A 1KS2A 5DNYB 1U28A 2YHBA 4CQLB 1A4RA 2W8BA 5FNVA 3WYGA 4OQYA 2LV8A 1PT6A 3ORFA 1M5UA 3G88A 1PRYA 1U0NA 5KYYA 4UTZA 4BB0A 4E7PA 3OE4A 1XK6A 1YL7A 1L5MA 4YAFA 2DUMA 3NKVA 4N12A 4O2LA 4QJ4A 2X0DA 1WUYA 1JI3A 5T64A 2R97A 2EHJA 1KFBB 3OZIA 3X44A 4ZYWA 5LR6A 1GR0A 1P7VA 3QG5A 1KAGA 1UFOA 3LCMA 5KIAA 3I9OA 1SKQA 3TM5A 3F4KA 3WRWA 3JVIA 2G67A 3DE6X 3LS2A 1JNXX 2R6CA 4Y2RA 3LC1O 5CNJA 4BLOA 2MSWA 3P96A 1G8PA 1L8AA 1JVNA 4YV1A 5LOVA 2DP4E 1UC9A 3B1WA 3QLTA 5ARCA 4B6EA 1KI2A 2D1YA 2VYVD 3V1LA 3BMQA 2JS7A 1HE5A 1YB7A 4WH0A 3RS3A 3STVA 4IWNA 3FZNA 3DLBA 4MR7A 1ZN7A 3PXCX 3FVVA 3U26A 2OC4A 5BSGA 3RE1A 1DTSA 2VDQB 2B30A 1Z74A 3E3NA 3F3SA 4I1UA 4OQXA 5FQOA 2VYCA 2MOKA 2O52A 5KWIA 1JGTA 1ULSA 4FFPA 2QQFA 3U4AA 4XSGA 2FEAA 3VR5A 4ZT4A 4EHDA 4OK6A 2N9UA 5KKAA 4INZA 1O1YA 1E32A 1YB2A 2FPWA 5DIFA 1GN9A 2Q8NA 2A9KA 2FI1A 4MROA 4LSGA 4RAQA 4R1UA 2GRAA 3TLGB 4DOMA 4OLAA 4ZV7A 1CRZA 1HSOA 5D1NA 2VWQA 2PAAA 2WU8A 3OMXA 1CEXA 5IDYA 4BNFA 4CR8A 3U7FB 3LUPA 2PXAA 1GNSA 3MPOA 4HNAA 4JKIA 4Z3DA 4V0MA 2ZKIA 5FV4A 1GCUA 4B34A 4IM7A 1PK9A 4BFTA 2JIMA 1G18A 4AVYA 3CLVA 5E7IA 3WJ7A 4F4DA 2W8ZA 3E58A 4ZZ2A 5A3SA 1M67A 3FBGA 1D04A 3MJVA 4MYSA 5CH8A 3D0KA 3CZQA 1T43A 1XA4A 1T8UA 3L1UA 3CX3A 3R8XA 3KTAA 2P2CA 4Q6BA 3I5MA 3QPVA 4UUOA 1FMJA 5CVVA 5T6MA 2HBQA 2HF2A 3SG0A 4LPSA 3FDFA 2WOOA 4INOA 4AQDA 4LEIA 4GI1A 2BKXA 1FP4A 3ZZ1A 3DDOA 2OXTA 3H1GA 4EP1A 1XNQB 4AY6A 1XWWA 5AOCA 5LWQA 1QFXA 4RPCA 1X7XB 1BX0A 4NZYA 2WQ7A 4Y9TA 4KC0A 2RHBA 3F1LA 4KYVA 2WFLA 4EHHA 4LTNA 3MBOA 4AUMA 4YCDA 1RQGA 2FWBA 3OIDA 3QV2A 3FAZA 2DG2A 5KTRA 2KW5A 3R6LA 2QA5A 3SC2B 3T4PA 3MS4A 1XX6A 4CGZA 3PFWO 3ZBTA 1QH0A 3FDXA 4TXJA 4IKPA 1YZYA 3MCAA 1J0DA 4AECA 1ZK4A 4E2WA 3QX3A 2QPTA 3MTBA 1UQRA 4TRMA 5KNCD 2C95A 1Z7YA 1WW2A 4RGBA 5DTQA 5FEMA 1C7EA 1E7MA 2PZEA 4DW8A 3JQPA 4OQNA 4DT1A 2WD8A 2FWAA 1JMYA 3EXIA 1EZ4A 3QXHA 4H7IA 2QRQA 2OFOA 2ID7A 4GMDA 4UOEA 3HCNA 4FBGA 1FPMA 4NENA 5F2OA 4IDDA 4R9VA 3RVPA 2Q0XA 3H9CA 1REQB 1V37A 2VBGA 5H81A 4LYYA 3A8TA 3DBLB 1WMAA 3NT2A 4EJ2A 3G2QA 1D2GA 3OLXA 3T38A 3CRW1 2A86A 4D9KA 2VTKA 3OEED 1T9KA 4CCAA 2IEGA 2HXGA 2JLWA 4TKVA 2HC9A 5AQEA 4BV8A 4WXYB 4OYLA 1Z5VA 2ZBEA 4JD5A 1AUPA 2LKDA 1NXWA 5LU8A 3ZGNA 1G6HA 3AXSA 1L4EA 5DLQC 1UOQA 2GK4A 2REOA 2VJDA 3ROTA 3EIUA 5K09A 5A04A 1QKIA 5ALJA 5EYPB 1WZ2A 2PR2A 2D59A 4FDAA 3H97A 4HGQA 1OXVA 2HSJA 3TPZA 2Z1MA 5BYKA 1C7JA 4RJJA 3VR1A 2V4UA 2ZIXB 3DEZA 5P21A 3WDSA 5HJ7A 4S24A 4ZJZA 1ZP6A 3TFOA 1N1DA 3LT1A 4GQBA 4K9SA 3T3PB 3QW2A 4N48A 4JELA 3K6SB 5EJ9A 4TVOA 2WWFA 1J0CA 2COKA 2IWHA 4Q1FA 5EQDA 3E27A 3JCZA 4LPKA 1CQJA 4MDEA 1PNVA 5E2AA 4FGUA 3WGVA 3PRJA 4MR8A 3AX6A 3V4SA 2GN9A 4LDQA 4B7XA 3RS4A 1ZMRA 4C4ZA 3RVKA 3SJBA 1EK1A 4B81A 3Q0TA 2VHEA 5EQJB 2GASA 4J0HA 4ESEA 5JFTA 2VSNA 4QOHA 4Z49A 1QFMA 1LZLA 2FMUA 1MZPA 2B4AA 4GEKA 3NRCA 4DLKA 3LX8A 3MGBA 4EABA 1KYYA 4CDMA 3ELBA 2CYCA 2WC1A 2L18A 3UXEA 4J0JA 3LUAA 1ZO8A 2G88A 2AEEA 2NLOA 5CTAA 4C1BA 5JANA 4WLVA 1ZGCA 4P3XA 1A97A 1JVBA 2I4IA 5ALIA 5JD5A 2Y1CA 3BMCA 5FLXA 1OI4A 3WGQA 1VKHA 1YJXA 4F9FA 3I01A 3E9RA 1MZVA 3BTSA 4W1QA 5JAQA 2PKWA 2PYZA 3HCRA 1JE1A 3WLHA 2Q6KA 3SNKA 3K9LA 1JJBA 2OGUA 5F5NA 1ZONA 2YWEA 1SVUA 4J6FA 4EAQA 4XVUA 1JIIA 3MTEA 2PUJA 1ILWA 2LCFA 2P3OA 4HQ0A 5KX5B 2C59A 4CMHA 4G0MA 1GRRA 3ITEA 4LI3X 2VJPA 1NR5A 1R18A 2BFAA 2NV2B 4JJKA 3LK7A 2R66A 1J90A 3ESBA 4MS3B 5JNSA 3ZNOA 2HRCA 4TZKA 5CIWA 1A9TA 1ZRNA 5K4AA 3OU2A 5WRFA 5EXDA 3U7RA 5IKXA 1LCIA 3FIUA 3IKTA 1UP7A 4L5CA 1J1IA 2X8WA 3KQUA 5FDFA 2BT4A 1PNOA 2YBDA 3HPQA 4KJXA 4H59A 4WKBA 3WMGA 3Q8LA 3VHLB 2B7BA 1MJ5A 2DY0A 1OYVA 3SU8A 2Y05A 3VVCA 2HIHA 2LZ0A 2IYSA 3H9JA 4FZ5A 4NCXA 4UMDA 1R6DA 2ZXEA 1ZCBA 1DAFA 1SUSA 2BMVA 3NAQA 1GNQA 4D9EA 5DW0A 3W2FA 1FP6A 1PJ2A 3UHJA 5I7UA 1TO6A 1IPHA 4BU0A 1Z7BA 2Z8YM 1YU9A 3EZFA 3I32A 4IGFA 3ZNPA 4DCGA 2WJ3A 3KQLA 2OXEA 1I1HA 1ZXLA 6YASA 3HUDA 2HHAA 4RTPA 3S44A 3STUA 2QMZA 1OE0A 5FR2A 4ZVQA 4E5MA 1MQAA 3SZGA 2BP7B 2FQQA 3R5XA 4S35A 5IFKA 4W6QA 5D00A 1KS9A 3LYUA 3LP8A 5JCOC 4TV8A 4FFLA 4WJZA 2GCIA 2V7XA 3AQ4A 1JKJA 1X7DA 3M83A 1W4BA 1AS3A 1YQ9A 4B7CA 1KQOA 1Y6RA 1JXQA 1O54A 1M72A 3SS8A 4BCCA 1L9XA 5AHWA 3ADDA 3G9UA 4O8ZA 4TVBA 1OJ7A 4OJQA 3BL6A 4G1UC 4DSTA 1KC1A 3GNLA 3IAS1 5CFRA 4I1RA 2O7NA 3QPBA 1L5GB 3RU7A 2A8YA 2NQ2C 3NJ4A 1SVLA 3COPA 3VOTA 5GMOA 2PZAA 3CONA 4LSMA 1JXOA 4QUHA 5KJFA 2W2LD 3RODA 5JUWA 3I2YX 2C57A 4U6QA 1E2EA 5EZQA 2HRZA 2XNCA 4UBKA 1DWPA 1NBAA 2PZMA 2EJUA 2FP4B 1T6XA 3H2KA 3HCDA 2XHEA 4WZAE 1EFAA 2I7XA 1XMIA 3KQPA 2YL2A 1UDAA 4Y0VA 3F7NA 2ZYAA 1RPJA 2A7QA 2JIDA 2Y1DA 1E1YA 4L5BA 1NFQA 5CW2A 5HCIA 5ICFA 4PIVA 5T57A 2F48A 2WY2D 1O0CA 4YACA 2PUFA 2Z2YA 1AGYA 1M2FA 4YCMA 3R09A 2VP2A 4IHKA 5K0TA 2C2WA 3BB1A 1ISPA 4YS6A 5GM1A 3DNMA 3EG9A 3ZLBA 2CWWA 5JFOA 1CDOA 4FX2A 3ZD8A 5JWRA 1SULA 3U09A 1RMYA 3FNRA 1B6TA 1ADJA 5KYWB 4JU8A 4HL6A 4MA0A 4BATA 4O2AB 1L5ZA 2A67A 1EFVB 2BW0A 3IS3A 3NHYA 2P9CA 5NLLA 4PZDA 2ORWA 4TLDA 4F11A 5JZOA 1IEXA 3A9CA 4AIIA 1C0LA 3IC5A 1O4VA 5CM9C 4PV7A 2LIPA 4P5DA 3VGJA 2A3NA 1KZYC 3D6NB 3UPUA 2QVLA 2O6LA 2IYVA 4R83A 5HF6A 3W2HA 2IC5A 2CFIA 1JIVA 1Y3FE 1X8KA 2HA7A 5HDQA 3JWHA 1MEEA 5AUQA 5KTTA 5DLPA 1MHTA 2W43A 1NLFA 1IPFA 1C1XA 3IDSA 4QOGA 3RK4A 5C1PA 1NMSA 2UXBB 2VJQA 1AGRA 1IUOA 4IG4A 3DGEC 4LYFA 4D9FA 3MEQA 2B0JA 2B94A 4WCFA 3SOZA 5CVTA 4R40A 4UVHA 2ZANA 1BXRA 2ZBVA 2H9AA 4PIMA 4PZYA 1OU0A 2GESA 2Q45A 1JHMA 2C5FA 3GVIA 4L02A 4LG1A 2PMKA 5LUBA 4EGQA 1PLJA 4K6CA 4M8KA 4K46A 4Y2YA 4JP5A 2PUCA 3I6ZA 2QQEA 1PJ8A 1JL3A 1M76A 1AN9A 1E1RA 3Q6IA 3ZEIA 2CSXA 3O4IA 3G6WA 1X0XA 2IPXA 3FUXA 2A84A 1G7CA 1UBRS 1G6KA 4HAVA 4HNSA 2PCJA 1E5LA 4L4SA 2PNJA 1X74A 4U7PB 5ADVA 4R8MA 5IG2A 5JR3A 1HQDA 3H86A 1IZZA 4L72A 1OTXA 3O4FA 1R50A 5JO9A 4TPKA 3PV0A 4RF4A 3VAYA 5GOTA 1Q2UA 3TW0A 2D0OB 1Z6XA 2IYOA 2ZS8A 1W48A 3EXFA 2FU5C 2VPWA 4IJVA 4YQEA 5CVCA 4QBHA 4UARA 5CLIA 4D6YA 4FBMA 4FIDA 4ZDJA 5E4TA 1VKOA 2Y6UA 3FTEA 1YAJA 4X8HA 2O19A 3H0CA 1D3AA 3HXQA 1GQFA 3JV7A 3TQOA 1USIA 2YYAA 3U3RA 3E18A 4LXHA 4XVCA 2WVHA 4MI1A 4ZQBA 1Z2CA 2ACEA 2OLKA 3GEDA 3KQVA 5AJVB 3CSDA 5H7XA 3EVDA 1US8A 2GYWA 4TROA 1LWNA 1IJEA 4NONA 3ZTYA 1GT91 5TF4A 1VLLA 1EDDA 4X95A 1EFDN 1SZPA 1WX1A 3GQBA 2VDMB 2Y1FA 2G1UA 2YN2A 3AM5A 2JBAB 4K6MA 4HGZA 2NGRA 1KDOA 4WLFA 1TPYA 3UFXA 2YBEA 3RIHA 2EX4A 2B61A 4LECA 1Z5NA 2A5JA 3DF9A 1W46A 1E3EA 2ZZNA 2GZRA 3NW9A 1D9XA 2GETA 4NV0A 4YRMA 5ITWA 3Q72A 4KWEA 1SR8A 2ZRBA 3QVLA 4HVTA 4K9OA 4Q03A 2C03A 5C8YF 1ZA2A 5L3SB 3GZNA 3VPXA 1HG1A 2B8JA 4W4TA 3AUFA 5FLKA 3A11A 4NV3A 3VH2A 5FWNA 3KKNA 1YQGA 4QFCA 1XRPA 3S2GA 3CCFA 4R0MA 5AJTA 4IR7A 3DFMA 2A1IA 2Z08A 3ACDA 4EG5A 1BC5A 2JCBA 1WCIB 2FPPB 1WQ1R 2JJMA 1EDEA 4C2BA 4D6PA 4KWIA 3FH0A 1BWPA 2OCDA 4PGMA 1OZAA 5K0LA 1UZAA 4WLUA 3HUEA 4B44A 1P2UA 1QVAA 2XUFA 4WNIA 1IJFA 1EX9A 3E9EA 4FFDA 4J1TC 1LY1A 1V3TA 2I6GA 1QYDA 1Y1SA 2P7HA 3LCCA 5FNVF 2RGNC 4LC1A 4B85A 5KHLB 3BWMA 4OF4A 2BJVA 4LYGA 2OSBA 1LC3A 4JV5B 5C7YA 4W5OA 4MQUA 4PXYA 4E07A 4MVCA 2ZQYA 3CNHA 3C4VA 4ARSA 1R5NA 1KBQA 4N0PA 1MA3A 5K3EA 1NI5A 4E5UA 3BSYA 1JDBC 4W7SA 1Y9ZA 3KJXA 3FMIA 5K6RA 2B5WA 3TRFA 2L42A 4AKHA 2EP5A 1MQ8B 3IURA 1RJGA 2R6AA 3PFGA 8LDHA 2F8TA 2JI4A 3EBOA 2A1UA 2QD4A 1PWYE 4GX0A 3IXLA 1WUKS 2F90A 3ZHCA 3ZI7A 2YJTD 1MDBA 1NP7A 2BZGA 1HRDA 5CYFA 5LNK6 5LOVF 1JDJA 3BT7A 5IUNC 2PGNA 1E2QA 1RMQA 2N75A 2QRPA 2NTYC 4ON9A 4TMXA 1R9MA 2QV0A 1WMDA 1PJSA 2XMZA 2XA9A 3MAAC 4MNTA 5FTMA 3CLHA 3H83A 2EATA 3AV3A 4K6OA 2LDBA 4DDUA 1CYEA 1EQUA 1SBQA 3EARA 3Q1LA 1SG0A 3B52X 1V5EA 3RIGA 2VAXA 5HIMA 2BKVA 1XDUA 2EFHB 3EA4A 1IN4A 5JV5A 1V7ZA 1CY8A 3U19A 5KSOA 1LFDB 1UINA 1RT9A 1GHTA 2FZWA 4L4YA 2A4MA 2RFLA 3GPIA 2JRLA 2IXEA 4YONB 3LT5A 1OWLA 4X7BA 5ESRA 1FNMA 4MKGA 3TIXB 4BLQA 4BVFA 1AHPA 1KI4A 4TZ6A 2AZMA 3QF4A 2W2VA 4ER5A 2C58A 3BOSA 1S3GA 5I48A 2HQSA 2FUKA 1XRRA 3RYIB 2JJ1A 2W37A 3F6RA 4RTRA 4FSXA 4JP8A 5DI9A 2QL7A 3H05A 3U7QA 2FPGB 1ZLYA 4RGQA 5INTA 2JG3A 3V48A 1ZOOA 5IH7A 2RHRA 1VLJA 2R7LA 3RYHA 4GGPA 2WJGA 4JGGA 4FTWA 2Q62A 4V0ME 3CX4A 4BJ6A 1LEHA 4EF5A 2UKDA 1SEVA 1DELA 4XM1A 4DUYB 5F7ZA 3R7FA 5EIBD 1ONBA 4L8VA 1ZJWA 4A2CA 2BCEA 2DE0X 4J2HA 3PLRA 4BTLA 4F5DA 4PYOA 1QQBA 2Z2ZA 5BP7A 2QTCA 4JASB 4L5IA 3UWDA 4Q00A 2QZSA 1N2GA 4PPQA 2QW1A 1NUAA 2WP8J 1SXGA 3GRAA 4BU1A 2FRXA 2YRFA 3S3TA 3TK1A 4M55A 1YRWA 4MEAA 4RVCA 3RRNA 4XIYA 4MHTA 1U3VA 4KQWA 2IU4A 3GJTA 2OBBA 3FFWA 4BLSA 5C4GB 3W79A 3NIWA 1CJTC 2PLFA 3O8NA 2MMGA 3PT9A 3AM1A 1F8UA 4PSVA 3H5AA 5EP3A 3GEGA 3IB3A 3DAOA 1DJNA 1EFHA 2EJTA 2NTEA 4C01A 1AXEA 4K3VA 4MLPA 4JGIA 4JR0A 4Y9RA 3PFCA 5AIAA 1Z2AA 1JG3A 2R5WA 2XCOA 3UUEA 3VBCA 5IYZB 1ANKA 2X0RA 3ONNA 4QULA 1VBFA 1AF7A 3E53A 1CZKA 4RANA 3DC2A 5FB3A 5TE9A 4GP9A 1Y37A 4J3NA 5EJFA 3SDSA 2W70A 2J7PD 1WF6A 5LJIA 1ONOA 2AA3A 2AOTB 3ISJA 2WIAA 1I5OA 4MWTA 2D5LA 1A0OA 1R0LA 1LS1A 1QKJA 2ETXA 5JFGA 1EM8B 3LKZA 1VXRA 1X39A 1V45E 2XAAA 3PNSA 4HEA6 5TGTA 5B5SA 3TAXA 4DCNA 1RAFA 1MVLA 1KK3A 4GYKA 1E92A 4MP6A 1M0SA 1URPA 4PZZA 3AUYA 5LWHA 1WMFA 4G9BA 4QUDA 3FVRA 4QOEA 3COSA 4PU0A 3C24A 1WXEA 3PJEA 3MXOA 3ZJ4A 5AM1A 4AS2A 3H5VA 3MJRA 1Q20A 1KVRA 4YAJA 1AO3A 3VU9A 3AMVA 4YJ2A 3S2IA 2QG4A 2Y71A 1YE5A 2WSSD 2UXDB 4M1TA 1XRNA 1VL0A 1XLWA 3IQZA 3VJMA 3HYNA 1Y8RA 3Q2KA 3UMCA 3T1TA 4ND8B 1OZGA 1T0IA 4X64B 3P2IA 1LDYA 1XTPA 3DBHA 3JD1A 4FOSA 2HFKA 3ENWA 1L5HA 2I66A 1V48A 4PBTA 2AQHA 2HCRA 2WICA 2C4VA 3LNCA 3VHXA 2BTEA 3HMQA 1Y5NA 4L7QA 4OGGA 3IVCA 2A94A 2ZGVA 4N3CA 4G36A 3DKPA 3CG4A 4ZAYA 2QQ5A 1H94A 1RLIA 1B1CA 4CVNA 5AM3A 2QGFA 5LSAA 2CEAA 5J2TF 1BROA 2FPMA 4P8RA 2RGCA 1HDCA 4W99A 1OFUX 1T1IA 1U0TA 1M2OB 1VRVA 1ADGA 1FP2A 2NACA 4MV9A 2C98A 4ND5A 3DT6A 3ORYA 5TQVA 3EA0A 3IAEA 3SF8B 3W4IA 2MMCA 1AZLA 2CT8A 1JDSA 1EXWA 5JI3E 1I3NA 1TAGA 2H4WA 3WK4A 2DUUA 2KLHA 4MZXA 3OSZA 3WJAA 4G84A 4M6WA 4ZOAA 2R4QA 1GVHA 4XPZA 3QVVA 3T94A 1AKYA 3WHIA 4CCWA 1JS1X 2V7EA 1J00A 2XXBA 4YX9A 5AXDA 3ASUA 5BUCA 2IYUA 3G0DA 4RTLA 4MARA 2H7YA 1YRHA 1E9CA 4P36A 2BFOA 5I7WA 3VH4A 1DKRA 1ES9A 2BGKA 2QLNA 2WJ6A 4ND1A 4ZI2A 5BQXA 1Z4OA 4DVJA 4MJ3A 4WLEA 1XCMA 4HX5A 3PPYA 4FW8A 4LGMA 1HO3A 4URYR 2IZZA 4AJ1A 2HOQA 3OPVA 5IZCA 4MW9A 3H5TA 4XIGS 4RDIA 1DAIA 1KERA 2H1HA 3BUSA 3NVMB 4LJ5A 3ZDXB 5K0CA 4UC0A 5CJJA 5B53A 3TAHA 1E62A 2J9FB 4BFYA 1ZA1A 4ECAA 4DR7B 1VMIA 4TSFA 4LWZA 4F71A 3ZKWA 1U9ZA 1YVDA 1YGPA 4ZARA 5IJAA 4BLTA 3VYVA 3W6UA 3ZD7A 3NKFA 1GFSA 1XZPA 4JOCA 1E1QD 4HUQA 1QH8A 3FA2A 3IIIA 4IG9A 4V39A 3KSDO 5CRIA 3MT0A 1D0IA 3H16A 1U94A 2PKYX 5EL0A 3EQ6A 2WWGA 1JLLB 3PNYA 5AXCA 2MSLA 3USZA 4C2UA 3C7CB 3LY7A 4JC4A 2RGXA 4OHWA 1GFWA 2QVCA 3OFKA 3NOOA 4XUCA 3SBOA 2E6UX 2XGGA 1G7TA 2GRJA 5AHRA 4J3FA 3G85A 3GXOA 1YZTA 2WSLA 2GDJA 2ZE6A 4FE7A 4TWZA 1YMUA 5FOTA 4OHBA 1OX6A 2GD1O 3PNPA 3Q4GA 3PFHA 4RLHA 1YE8A 2RIPA 4LVCA 4QECA 1W5SA 2IY8A 3W3AD 1F0NA 1V7QA 2E4XA 4P81A 2NNWB 1QB8A 4LJKA 1J9GA 1U7UA 4IS3A 3ZH2A 1RLOA 1GQYA 3AKZA 1Y4AE 2G1PA 5C81A 3FTFA 2RGRA 3Q8XB 8GPBA 1C7QA 4D99A 1C3JA 1ZKMA 1SQGA 4HH0A 4PPNA 1ZN9A 4TTSA 4BQFA 3ILYA 5BPHA 4Q01A 3ZK7A 2GCPA 2Q5OA 4OSEA 1PTKA 3ZHOA 3B85A 3JAWB 3TLXA 4BV9A 4LYDA 3RB8A 3WNQA 1G8KA 2A58A 4BDTA 3EWNA 3G0OA 1SC6A 2CVZA 2CXTA 1ORRA 4A2PA 2ZWMA 4INJA 2P62A 1P2GA 1JBQA 1YUBA 1Z4IA 1LVHA 2FX3A 2FUNB 2F1RA 4BO1A 1XNHA 2ZULA 2GMWA 4FEGA 4MHOA 1NONA 3AJAA 4GVPA 1LSUA 1UXKA 2P4QA 3I42A 3NG1A 3EEIA 4FFBB 2V6MA 3S81A 1YZNA 1FUYB 3A58B 3ZV7A 1QIDA 1YQXA 3GUCA 2CLEB 3TVDA 1NWHA 3D8UA 3PGVA 3ONFA 4CW7A 3RC9A 5I7EA 1BDMA 1U8ZA 2OHXA 3DO5A 2WNIA 3MCUA 3TSAA 1C3OB 2VQDA 3ETHA 4BO9A 4DLRA 5GIPE 2J0VA 2PRYA 1BE1A 3KJHA 3FFXA 4BKPA 2VA9A 1AGPA 1EVZA 2FPLA 2HDHA 2WWWA 1HZZA 4PLPA 4X1IB 1YZ3A 5BN4A 1PUXA 4LX0A 3S6JA 5F4BA 5H0IA 1OVMA 2X7HA 3GRUA 3A36A 2JLQA 2Y0CA 2OGZA 3NYQA 1UM8A 2QUJA 4HWTA 3NUGA 4FR2A 2IE8A 3L8DA 1UMDA 3OT1A 4G86A 5FCDA 4OYYA 7AT1A 1GDHA 1D6SA 1H69A 1WMSA 4TMKA 3HHPA 1T3ZA 2ZAMA 3LAWA 3DYBA 3ZLTA 2R5FA 2JLRA 4NU5A 3WK9A 4YRFA 3WWEA 2YQ5A 4WXEA 5LP6F 3L1KA 1RXYA 3ASYA 4JA0A 1P7ZA 2GFHA 2W5UA 4ZMRA 1KO7A 4B09A 1ZNXA 1NVVQ 2QRMA 3CG0A 1CUZA 3JTEA 1Z4JA 1OTYA 3E0XA 4NYJR 4RABA 3DEJA 5FWYB 4D8UA 3U48A 4N54A 3NZEA 1BEZA 3QTTA 5BSUA 1R15A 1L7MA 2LWIA 2NZWA 1QRUA 1VG8A 3SPXA 3OZXA 5E0KB 2CXXA 1J6UA 2H1WA 1J23A 1NXOA 4O4JF 2VRNA 1QTRA 1WDMA 1H65A 3N70A 3PC8C 4M8LA 4IHJA 3IPCA 3SCZA 1XFDA 2QROA 5DN9A 3SC6A 1GTVA 5BN5B 1DUSA 4PE5B 4ARCA 2EG5A 2TMKA 1U1GA 3OLZA 4UNQA 1E60A 5TMEA 4P31A 1J42A 4KXWA 2V98A 4BQOA 2VJCA 2HA5A 3RROA 1TKBA 1KJIA 2YV2A 2F67A 3K1YA 3R0JA 3ZU3A 5I3CA 1W1WA 1JFFA 2PLNA 4ER7A 1AS0A 2A92A 3GUVA 4JJZA 4U2KA 4H7EA 4E88A 1NC3A 2XUJA 2NO0A 1JWLA 4N5LA 3MJHA 5C46F 4MP3A 2QQGA 3FM9A 2WIBA 1WPXA 4FMDB 4ZRDA 3AI7A 4LDJA 4DQUA 1GKKA 3EOZA 4PX5A 2GF9A 2H1FA 4D9MA 3GBVA 4ML3A 2C88A 2RGGA 3A1VA 1PS0A 3OOJA 2PXCA 3QXCA 3RKRA 4DQVA 2J0QA 3T99A 4CMGA 3RVSA 1PHRA 3NWBA 2OGTA 5C7OO 1DL5A 3HBLA 4ZEOA 1IVYA 2H7XA 2HX1A 3OMLA 4GLFA 4GT1A 1W1IA 1NBWB 1FFHA 1LNQA 4F2PA 1BHSA 1JAXA 2PJZA 4R8SA 2DHDA 5KCMA 4F8YA 1RXEA 3DP9A 3UPTA 3BEOA 1N5KA 3AUSA 4YMVA 5A3VA 5K9ZA 1L8LA 3C97A 4Q4AA 1HYBA 1OU4A 1UXGA 1Y89A 2YZ2A 2QRVB 3PC7A 3FVQA 3SZLA 1Z7WA 5A5DA 5AVVA 3QWHA 3U44B 5REQA 2ACVA 5T4EA 1P81A 4W9MC 1G59A 1V7CA 5DP1A 5JSZA 3EGDB 5LUAA 1MMFB 3QVTA 1HFKA 4DBLE 3E3LA 4N5NA 1Z6QA 4JJ4A 4OB7A 1BDHA 3KOUA 2O8EA 3WGZA 3BIJA 3CZAA 3OP4A 1G8GA 4J0CA 4XR4A 1PYGA 2A5LA 5EJIA 4EO7A 1TECE 4EATA 3CYFA 4PIPA 5FIUA 1M1NB 2RGBA 3OM8A 4R5HA 4GMKA 3EGXB 3ZK9A 4LHWA 4QJ3A 3NBMA 1UIRA 2IOFK 3BGSA 4NE9A 3COJA 3WL8A 2VVTA 3JZMA 5FAKA 4JLJA 5LXTB 1U2ZA 4UQPA 2RD2A 4J0KA 1FMCA 1X1SA 3MINB 3V34A 1QGUB 2RB4A 3RSCA 4HQLA 1QH9A 4NSNA 4MV1A 1GG2A 4EQ6B 1WV1A 3CB4A 4PTYA 1B8VA 4FJ1A 2IEBA 4WECA 1JMVA 1SFRA 3D8SA 5DK6A 5DM1A 3QUSA 2HA0A 4W9NC 1ZESA 5EJ8A 1H0KA 2BE7A 4OEHA 4C4TA 3S2ZA 2JASA 2UZ4A 4D25A 3CFYA 3HVHA 2ODAA 2W0SA 2H52A 3NIGB 2A7XA 1YDHA 3DFFA 3C3KA 4UE6A 3VNRA 4PYKA 1X7WA 5AW8A 1G8HA 2EYQA 1XXHA 1SWWA 1U04A 2NM0A 3LGXA 3T3OA 3LV8A 5FTKA 4ZQCB 4RQBA 2EKBA 3RVLA 2WU1A 3M5WA 1W9HA 2YH2A 4KFSA 4X97A 2EQBA 3KETA 2GK7A 3EVFA 3HN7A 2W6OA 3SX2A 4CIAA 4ES6A 1ZG3A 2HWUA 1KSJA 1CZOA 2VK8A 4MZDA 2PFGA 3FYUA 1RHQA 2E5WA 3IAM1 4JOBA 4Q48A 5H3LA 4RWZA 1AB6A 2NOAA 2ATIA 3KEFA 5FV7A 1PZFA 3OZSA 4PHHA 5CA0A 3BTUA 5A4DA 1ZRMA 2E55A 5H4HA 5FUWA 3U13A 4EHFA 5JYEA 1V43A 3OG9A 2O3JA 3C4QA 3SICE 3TR6A 1I30A 1Z4KA 1WM1A 2GCGA 4RK6A 1Q7TA 4J16A 1JSXA 3H6HA 4LHYA 1V3UA 3OJ0A 3VO8A 2VN8A 2V55B 5GVRA 4YRJA 4RSMA 4G26A 1YSCA 4KX3A 3N2YA 4I4TB 2NVUB 3RFVA 5F78A 3UK1A 5JU6A 1ZM9A 3IB6A 4L22A 4MQ5A 4JLKA 5KNDA 2PMBA 1T6BY 3GW8A 3M6FA 4DV5B 1JVSA 1LRKA 3B6EA 2W98A 3CB2A 1E6LA 3HP4A 3Q6MA 1E3MA 3KYDA 1K63A 2H1SA 3I9KA 1GRNA 2AN3A 3QU2A 4RL6A 2AOVA 5EHZA 1W36C 1KIMA 3HHEA 5DKFA 3ABIA 5EUQB 3HV2A 3VZSA 3ZGYA 4RKEA 3A37A 1E2IA 3H2GA 2PO5A 3A9RA 3R3JA 3TFWA 2Q46A 3OPQA 3BH0A 3QMPA 3P7MA 5DXAA 2X1MA 2GAIA 1TCCA 3LXUX 3Q9SA 2GHRA 5FPPA 4IDHA 3RDPA 1FSZA 1NOJA 1QG6A 2E4ZA 4M9SA 5EY5B 5BQOA 3V7NA 3P20A 1VI5A 2C7BA 1XVLA 2H07A 1W93A 3KAJA 3R5SA 4A1FA 4AUKA 4C4PA 4AZWA 4MUHA 4W1SA 1VG9B 3ESYA 4XLTA 4XJVA 5IPFA 2XZLA 1GJRA 1CP2A 2G6BA 1AHNA 3RVOA 3S70A 2IYYA 2RHMA 4FHEA 5CHEA 4D3ZA 4L0DA 4CQNA 4WINA 1FQKA 1VJRA 4JUBA 1X1CA 4UUNA 5EPOA 5EWLB 5LM3A 2FMHA 4TT3D 1XMJA 1F8FA 2WAAA 4ZO9A 1QHSA 3QPAA 3HNRA 4MOWA 2G9VA 2QE7D 1RZRD 2IHKA 3IHLA 3A3PA 5C52B 2NMVA 1K6IA 4A36A 4ENPA 3FFTA 2P9HA 3EUWA 2EX0A 1CJBA 1Y5LA 4FKMA 4IAOA 3HM2A 4IINA 4JBXA 1AV6A 5A9RA 4MAAA 4ZVKA 1AURA 1JBKA 4QSHA 1IQRA 2IU0A 1JDVA 3DTVA 1HI9A 4V1CB 4U5XA 2PU5A 4EA8A 1UDCA 1XTUA 1ZNQO 2AN1A 4BX0A 5IJZA 5K6TA 2PJRA 1LGYA 4JP3A 4LCJA 4LRTB 1TCUA 2H51A 2GXSA 5ILQA 4KTTE 2UUAB 1SH7A 1FSPA 3IPAA 2H5EA 1D0SA 1HGXA 1PK8A 2R1TA 3B2EA 5LYYA 3KSZO 1G8MA 3BCRA 3RYCA 1YTUA 2R00A 3MBKA 5EUCA 1M7HA 4IJQA 3VZPA 2F8MA 3UCXA 4JYZA 3ODPA 5A03A 1NOIA 4YUZA 3CC8A 4TM8A 3IGFA 3UTCA 4RZ3A 2JGJA 3M1IA 4FT2A 4P7BA 4QXQA 3VR3A 4N3BA 5DBOA 1ZUIA 2CCJA 1Y4UA 2R8PA 3DXZA 5ERYA 5BVGA 5C8DA 2XUDA 5KNBD 5ARDA 3OBIA 1PZGA 4JY7A 4J7UA 1I5EA 3OQJA 1N6HA 1QS0A 3FRIA 2QDXA 5BT9A 1P18A 1V26A 2CFTA 3FMPB 5D51S 3W7VA 4NULA 1FUIA 1FLDA 4GEGA 1HDGO 1XELA 2V97A 3MGAA 5E8JA 3SI7A 1TEXA 4KUEA 1OYOA 5C5IA 4YJ2F 3GFPA 1JECA 2BD0A 1KI9A 1TCAA 1YAHA 2G9QA 4QRHA 4EARA 1ABEA 4NEQA 1OMOA 4KIFA 1CNFA 2HQOA 3VDQA 4X93A 3PFKA 2CB9A 1MCZA 2ZB2A 4NEHB 3MAJA 4AL4A 4JBNA 3HFJA 5HMLA 5HRAA 4Z4FA 3MM4A 4Q7MB 1MPXA 5H82A 4EYOA 2GWHA 1JDTA 2IZOA 4YDSA 3SLGA 5BVHA 1VECA 3S27A 4G2TA 4LXTA 3EASA 2GJ9A 1PDWA 3OCWA 1FXUA 1R1DA 1FX0A 3DE5X 4ICIA 5CLLA 5D3QA 4C3VA 5JAMA 3GGCA 3L6BA 3AF5A 3NXKA 1DV2A 3Q9LA 1FFXB 2POCA 4QU5A 1ZHFA 1NPTO 1U0EA 2C04A 2J9GA 3EZLA 4J9VA 2PSEA 3NUQA 3E9CA 3EGEA 3PFBA 4J4HA 5COAA 2VDKB 5CEFA 3SXJA 3EXHC 3OLYA 2A59A 4CIXA 1Z3CA 4HZUB 4HADA 3VM6A 3ZV6A 3P71T 1OH6A 4M4SA 1XZJA 1RRFA 3AEUB 3CVJA 4BEVA 4EM6A 1YXMA 4DQXA 2V59A 3EA5A 4MDFA 1NUTA 3ABOB 2OP0A 1U3TA 2C54A 3COYA 1JKIA 1V16A 2I6QA 3G2KA 3NJ8A 3NP7A 5CFOA 1QUEA 1GO2A 2OXRA 4JQOA 2GJ4A 2VJLA 4JI3B 1KWKA 4KRXA 2D5IA 3A1UA 2QZ9A 4ZQFA 2ARKA 1EZZA 4GUDA 4RIEA 1PLLA 3OO1A 4ZVRA 3DTYA 3VSDA 2OUKA 1OV6A 1TQ4A 2C5BA 4FIZA 2JGMA 4X71A 1NTRA 1CFJA 2QR2A 2W2KA 5HKKA 3QP9A 2OEPA 3NCTA 1JAHA 4ZI3A 1J21A 2IVFA 2OHVA 5E7QA 3K2BA 2HIMA 3JY6A 3LQ1A 4EMTA 4EPTA 3ZJYA 2QXTA 2H08A 3OT5A 4C1NA 2HO5A 3CHYA 3TSYA 1FBTA 2CE7A 5IVPA 3HGMA 1BQ4A 2AR7A 3S55A 2HSEA 4H6PA 1OOEA 3DM5A 4OIMA 3F6YA 3D31A 3V1YA 3AI1A 4S2EA 4P93A 1S8NA 4IL5A 1A9OA 3R24A 1BCRB 2NV6A 5JE8A 3E05A 1KDYA 1CF2O 2WUVA 3HXKA 2XUQA 1BGXT 2VSYA 4Q47A 1P77A 4LKOA 1XPOA 5JTTA 5B1EA 1VKRA 3ZWPA 1H23A 3ELYA 3EVZA 2POQX 1HE2A 1PE0A 3KU4A 4AB1A 4AZ0A 4LZWA 1HLPA 2JJ8A 2X6QA 3T35A 3TAUA 5AHOA 2YOGA 2XWPA 5DHRA 2G5PA 4Q9DA 3KVNA 4ZRMA 1Q84A 4G9EA 5JS6A 1HTBA 3R76A 2VAPA 1O95A 1D2AA 3ME5A 1XALA 1JAZA 4RDHA 3RVRA 5AKJA 3CUEF 3JS5A 1DXYA 1ZGJA 1A9RA 3VR0A 2ZCJA 5EERA 2QIOA 4QBTA 3WV5A 2WTMA 3AFHA 1XL0A 2M1XA 4AAYA 3SE7A 2GPNA 3IESA 3R9IA 3U4QB 1XTKA 4O0MA 1AJEA 4FEAA 1C7IA 3CKKA 3DW1X 4RA6B 5CJ2A 3GZTB 1XVIA 3TCXB 3U7HB 4MWBA 2E5FA 4EHIA 4WXRA 1EM6A 1ZX1A 1DUVG 2PWAA 1P7PA 4UTNA 1I0IA 3A4IA 3BA1A 3AVXA 1LDEA 2BY4A 3SKXA 1ML3A 1T35A 4V0OA 1L8XA 3HXPA 1KI8A 3PKIA 3ZV4A 3KAQA 4DLXA 3LYLA 3MIIA 3PQDA 4IQGA 1ADCA 4QM6A 1X80A 1DIBA 1C30B 3COVA 4HPJB 4TLEA 3U49A 2CXPA 3DV2A 2YJNA 2WG1A 2N47A 2QL5A 4KIWA 1PKXA 2IXFA 2FPIA 1EINA 5D5PA 2PEZA 1U1FA 4Q9NA 4UVGA 4WIAA 1MB0A 2CLCX 4I6EA 3A7DA 5TS3A 4L4RA 1E3WA 4LTDA 4WOBA 4TTTS 4KXYA 2X5OA 1T26A 2BL4A 1RQRA 4JL6A 4MW4A 2QVZX 3Q7IA 3NALA 4RGYA 1TYBE 1VRWA 3AR2A 3GXBA 3UJBA 1THTA 1Q1ZA 3V8RA 4KN9S 1MEOA 4ZJUA 3MJTA 1SHKA 3RC7A 3JVVA 1GTL1 1MN6A 1O96B 2WJZB 2JA2A 4MW7A 1A4IA 2O8DB 4M9XA 1CT9A 1GDTA 1IATA 5TPWB 2GX6A 2Z4SA 4BKMA 3ZDCA 4ZOLB 4N0DA 3FI0A 1SPXA 4F86A 3FJOA 2CD7A 3LVQE 3X1KA 1LFAA 2P91A 4QFDA 3GMDA 2CLHB 5ICMA 4U5QA 1XLTC 1WDLA 4Y2GA 2HL6A 3P9ZA 4LUCA 3NDIA 3NEAA 2IXTA 1K8QA 3M5PA 5A4JA 1YS2X 3IHWA 4LJ4A 2V6FA 1R88A 2QTMA 3CKLA 1OWOA 4KEAA 3QVSA 4PX2A 2OHFA 4EY8A 3EX7C 1WO8A 1TYCA 2CVHA 2AK3A 2V58A 3B82A 1I24A 4WVFA 5HJ5A 5JNLA 3T0IA 2XWQA 1P7WA 5FOSA 3TE7A 2I7VA 4DCVA 1YZKA 4IHJF 4AN1A 1H2RS 2O2EA 1JU9A 2O2ZA 3O9MA 5DHFA 1FZTA 2CJWA 4PWYA 1DUIA 3ZYCA 5E7JA 1R5BA 4PY2A 5AVZA 4EG1A 2GZHA 3CF4G 5I8PA 4PEVA 1IC6A 3C1UA 5K3BA 1KMHB 2I4OA 2PV7A 5FP0A 4EFDA 4BLRA 3AR7A 4XR9A 2FDXA 1JILA 5FYDA 1TUEA 4OIFA 4Q9IA 5EXEA 4F12A 1GYRA 4KJZA 5E1DA 4MVYA 3EQ8A 1JWAB 1NF2A 1DBSA 2MHCA 4H0NA 3JR3A 1DQYA 1N8KA 2HW8A 2A0KA 5JWHA 4HRYA 4R31A 3K5WA 5K45A 1MOPA 3T5DA 2H00A 5AVWA 3AUUA 4KO3S 3NVKI 3WZ2A 3GH1A 4HDSB 2M2IA 1P3Y1 3PXAA 1P17A 4DSAA 5B7PA 4QM7A 1WNTA 2IHTA 4QU9A 2YWRA 3CINA 5BOSA 1J8MF 3BRWA 4V0LA 1NX9A 2V7PA 2BFFB 2PGXA 4D9GA 4FMCF 1KMNA 2YZKA 1N8TA 2RAUA 2ZWPA 1ZKDA 5I4BA 2B92A 1UWVA 3EWSA 3G49A 1U6KA 1VI6A 3GT7A 4M0CA 3D7LA 5DWVA 4IJMA 1JHVA 1KJJA 4H7PA 3JASA 2BZ0A 4B82A 4M0DA 3OJFA 3PGA1 4YC7A 1GP2A 4RESA 1KJQA 5AW5A 2ODTX 2HNBA 2YZMA 3UXHA 4EJ0A 5K8IA 1FU7A 3MTJA 5H4GA 5GV7A 1T9GR 2JLAA 1AQ6A 1JB1A 2XNJA 4V0RA 4YUAA 4CEIB 3IAUA 3C14C 1OREA 4OBWA 2QP4A 2YYYA 4RNDB 4C4AA 3KSMA 1UT6A 2BISA 4BKUA 3JQ6A 3NEJA 3PD0A 5D87A 4ZXFA 3QE0A 4IGIA 4ZOEA 4C05A 2OYCA 1M2WA 1CQXA 1ESDA 4G07A 1N0WA 3OTWA 4GSLA 4X8MA 5AUNB 3QOWA 3A4YA 3PUJA 5LP6C 4RHYA 5SICE 1XEXB 3LCRA 3VNQA 3AFMA 3UW3A 3KJZA 1H2YA 4II7A 1XZLA 1K7SN 3B51X 2CVFA 4M86A 3COZA 3A3NA 3TCNA 3TTSA 4LXYA 3K8ZA 1QIIA 3X1DA 5E9QA 2Q3CA 2FGKA 3G0GA 4XYEA 5JAZA 1JUDA 2ZSJA 4C0BA 1Y7HA 4D0SA 2YHSA 2QMQA 2PKQO 1EFRD 3IQFA 4WZBA 5KC9A 1U7XA 2DFPA 4II2A 4MVWA 1OLXA 2R6GA 4MCHA 2Y3IA 1R5JA 4RC9A 1YI0A 2AXPA 2GA9A 3NWPA 4F1WA 5BWCA 2ZZMA 4DA0A 2QTZA 2ON6A 4EPRA 5HSGA 2PL1A 2MSKA 2WT9A 2BFDA 3E03A 1DC6A 3IOCA 4E14A 5LQRA 2XEDA 2D06A 2Y1XA 1HL7A 2P9FA 1ZVKA 3U9LA 4DR1B 2J07A 4N8EA 4ZANA 1QHHB 1NURA 3F8TA 3GDOA 1KP9A 1WZIA 2RGDA 4XEHA 5IAEA 2TS1A 5IABA 4F45A 2CZCA 1Y82A 1XXHE 1TK2A 4MQFA 3RF6A 3TXYA 2PN1A 1U8CB 4F92B 3YASA 4BFVA 2OB1A 4G0NA 3OQ6A 1SVWA 2YNMC 3LT4A 5KQPA 5KSYA 1W88A 8ABPA 5LN1A 1TQ2A 1AU9A 3K8YA 1RC0A 2Y93A 4ND4A 3S0JA 3DKKA 3WLNA 2P41A 3SWWA 3KWMA 3RTCA 3TS1A 4CR7A 3WA7A 4E0BA 2G9UA 2IUSA 2YDXA 3MSCA 4YB8A 2RB5A 3O9ZA 1JW9B 2C9BA 5CPBA 2E87A 3OF2A 3U17A 1C9DB 4NCAA 3L92A 1YS1X 3DWGA 3EEBA 3A6FA 3PSAA 5CB4F 2BC9A 1L7RA 4DFDA 1N5LA 2ZBQA 4B7UA 2ZT6A 3FCUB 3L4BC 3NC4A 1I2DA 1ONNA 3L1IA 2ZQ5A 3P9RA 4M3NA 4KR6A 2JIOA 5HUJA 1RM3A 2Z8XA 3FHJA 4M46A 3KPUA 1H2BA 3EFEA 3WIVA 3TGPA 3GFTA 1WP9A 1TKAA 4LE1A 3AEQA 3Q2IA 2X0JA 4IH1A 5FL3A 1JLMA 1KFKB 4NPHA 2A9VA 1JZQA 1H9CA 1CRWG 3O4HA 3AKDA 2I87A 1WETA 3BF7A 3JQQA 3UM9A 1UMBB 5JYCA 3M6UA 2B3TA 2EIHA 3LZCA 1R0SA 2EAUA 3SZRA 4MV8A 3HV0A 1IAQA 5J47A 5K0FA 1N2XA 3NBKA 4RD1A 4LHSA 1DXOA 5GONA 5CW1A 4MDYA 3GUHA 4CDRA 1ISRA 2QAGC 3GB9A 3QPDA 2VUUA 1MGPA 1UMCA 4Z5XA 1YBVA 3GP5A 2ZTLA 4B71A 2GFQA 4IUBS 5DBIA 1VHJA 4CKEB 1PWXA 4NPAA 2FMTA 1FP7A 3IHTA 1TYAE 2AJ8A 3A32A 4QTXA 3TG8A 1K4KA 3NRJA 1INLA 1ARZA 4UU0A 3UJ8A 1I14A 4BHTA 5AW2A 1RE0A 1U3DA 3CUUA 3FRHA 5BYAA 3GEBA 1JFSA 4EKYA 2X6RA 3B6JA 3N53A 4ENSA 4IUDS 4ALNA 1U8YA 1JYSA 3N8GA 4LWOA 5K8TA 2CLMB 5ADWA 2PWBA 4ZZ3A 2B20A 1HETA 2FHPA 1T0PA 1SZJG 1TIBA 2BZSA 3RSGA 1DRJA 1CS0A 4YXWA 2PS1A 1UOEA 1KYIA 1ZCFA 4I9NA 3BN3A 5AJHA 3AEZA 5FHQA 3BIFA 4IOJA 1TT5B 3N6XA 4DREA 4EFNA 3B8EA 1Q11A 2FPSA 4MUAA 4UPEA 5FBLB 3FG9A 4HDNA 3MXTA 1XTBA 1R4NB 1IFXA 2QOEA 3WGKA 1XN1A 3I5YA 4Z53A 1ZUWA 1IOZA 1P8JA 2SKDA 2XJ9A 3JZIA 3M33A 4HZGA 3U3DA