5F1OA

Human cd38 in complex with nanobody mu551
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
248
structure length
241
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 84
structure length 241
sequence length 248
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f1oA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f1oA02
3H5NA 3P19A 4RQTA 1DHRA 4NJMA 1U28A 5JSFA 3DAFA 5A3VA 2P4QA 1CDOA 3MOGA 4MO2A 4F6LA 3KV3O 1VSVA 4DMMA 2JHGA 3OMLA 4W82A 3JYNA 2AG5A 4WJZA 1P1RA 1K6JA 4RQUA 5ES3A 4DREA 4PG7A 4BO9A 3OH8A 3PHLA 4YJDA 1DRWA 3P5SA 4EJ6A 1VKNA 3MTJA 2NNLD 3JQCA 4YCAA 2E48A 2FSSA 1HEUA 3MJSA 3DHYA 1I3KA 1KY4A 1TVEA 4BB5A 3V2UA 5JBIA 1UR5A 5A06A 1NXQA 4P22A 1M2WA 1Y5RA 1DIAA 4YT2A 1KVSA 4YDRA 2LDBA 4ND3A 2PGDA 4B3IA 2YV3A 3L77A 1NM5A 3QVSA 3G49A 2H1SA 4XRGA 3PQEA 1JU9A 3PIDA 2PGJA 2WYVA 2WD7B 4TVOA 2EXXA 1I5RA 2NV6A 3RBXA 4N7RA 4J1NA 2XXBA 1JLLA 1JAXA 2DBRA 3TFQA 3TSCA 1ZK0A 3OQ6A 5I8WA 2X22A 1HE5A 1HT0A 4FFMA 4XQ9A 5KKAA 4ZHSA 1HWYA 2P2SA 5G0TA 2YDXA 3FCOA 5LDGA 3LT4A 2EJWA 2ET6A 2GPTA 2QRLA 4YJFB 2A9FA 1MC5A 3NDJA 3G3EA 3GZ4A 1Y8QA 2R00C 1GFSA 2ZCUA 3KETA 2BGKA 2HJSA 1ZO8A 2WM3A 4NU5A 4XD2A 4RVDA 4CLOA 3AM5A 3E9QA 2PH5A 1QLHA 4BMVA 4BO8A 3ONEA 4OH1A 4BVAA 5C7IO 5CEJA 4W6ZA 1YB1A 4MVJA 3I6QA 2GN4A 4Q9NA 2HKIA 3MJTA 4RPHA 1BHSA 2VZ8A 4E2WA 3MJ4A 3E82A 3KYDB 5JLAA 4BNJA 6ADHA 1X7HA 2PTGA 3H5AA 1O9BA 4CM4B 2X0NA 4GX1A 3PPIA 4D79A 4YAJA 1I32A 4J7CA 4TZTA 4ONEA 4MP6A 3EW7A 1SAYA 5COBA 4U0JA 3W8FA 1B8VA 1LLCA 3PYXA 1A4IA 4Z3KA 4A0SA 4F6CA 3EVTA 1YBVA 4F45A 1ZNQO 4CM1A 1UXGA 4JK3A 3I52A 1HZZA 1V35A 2Q2QA 2IEBA 1OZAA 4FD3A 4CV3A 4YPOA 3JQAD 1EUCA 4E21A 1H93A 4NQZA 2V6FA 1NFRA 4WKGA 1O8CA 4E4YA 5DOVA 5TF4A 3JQFA 2OBYA 4NI5A 4CMGA 1JKJA 1ENOA 2WD8A 2X1HA 3EYWA 1Y7TA 3UCEA 1D1SA 3INRA 4GKVA 2NQTA 3JYLA 3ZHBA 1MXFA 1WZIA 3JQ6A 2GD1O 1X14A 3JQ8B 4MDHA 1YQGA 2X0RA 2YDYA 3KHUA 2OHXA 1QYCA 2H6EA 2NU6A 3AY7A 2TMDA 3GT0A 1E7WA 2VCYA 4FOSA 4IQ8A 3ZH2A 3ZWCA 2BI8A 1D7OA 4MKRA 1F06A 1ZCJA 4FQ8A 2O2YA 4J16A 2EIHA 4WLUA 1U1IA 5JDCC 3HN7A 3DZBA 4I9HA 2OFPA 2ZTUA 1QR6A 3QE3A 5L4LA 3MOIA 2DM6A 1XCBA 2C20A 3AUAA 3WR5A 5IXSA 2IYOA 3MJEA 4ND1A 2YQ5A 1H6AA 4EI2A 4CPDA 3PRJA 3GHHA 4GGOA 4GX0A 4J3FA 3FWZA 1B26A 2PZMA 3QA9A 1J5PA 5EQFA 1IPEA 1PZGA 1R6DA 1X15A 3GNQA 4BS9A 1CF2O 4OHUA 1UAYA 4JXKA 2W98A 3L6EA 1H6BA 3TQHA 1SMKA 2J5RA 2XAAA 2E82A 3FR7A 3JYQA 4DC1A 2HMWA 4Z6KA 4XWYA 3WGYA 2CDBA 5L3ZA 4NJOA 5DDIP 1VPDA 5DNAA 3K96A 5I7SA 5DZSA 2NSDA 2W4QA 1LLQA 2EG9A 1GQQA 1Q0LA 4HWKA 1GYQA 1RM0A 2DUWA 2HU2A 1C1XB 3ROKA 1JQBA 1K6XA 2C07A 1MB4A 1KVUA 1KEPA 1LDBA 3ABIA 4JCOA 4E32A 1VM6A 3RC1A 1GCOA 4CM8B 5JAMA 4CM3A 1GYPA 1H0KA 3PQFA 5G0UA 3NYWA 4BNMA 5I8ZA 4EUEA 1PJSA 3FI9A 4L8VA 4D43A 4XKJA 4A27A 3AFMA 4OYRA 1LRLA 2Q4BA 4GGPA 2C59A 2B37A 1EE9A 4PGFA 3W4IA 4FS3A 1YRLA 2AEMA 2HMTA 3ZNQA 4BO7A 4RPLA 4OL9A 2IXBA 2X8LA 2AQ8A 4B4VA 3I23A 3PJFA 1MUUA 1VJ0A 2CNBA 3C24A 3WQQA 2AXQA 2FWMX 4BMSA 5DOZA 3DAGA 3RBZA 4CQLB 2G17A 4B4OA 1ENYA 4PRLA 4JBHA 1Z7BA 4CJXA 3OM9A 4NFHA 3ST7A 5CDSA 1Z73A 3CKYA 1SNYA 4UVGA 2QQ5A 3PJDA 4ALJA 4BIIA 5CAEA 1MFPA 2YUTA 4IDBA 4XA8A 5BSGA 3JQAB 4E30A 3HQ4O 4BMNA 2VRCD 2BMAA 2BFOA 3UGKA 2ZQZA 1GZ4A 2O48X 1GQ2A 1XWFA 1W73A 1AXGA 1ZJYA 5A02A 1NPTO 3DBRA 2AQKA 2I66A 4WLEA 3RC7A 2NU8A 1E3EA 1ID1A 1PR3A 4XGNA 4BO1A 1DC4A 2B69A 1DC6A 4XJSA 5IZCA 2X58A 2Y1FA 3NTOA 3L6DA 5G0SA 1GV0A 2YY7A 3HDQA 4YAEA 1P1JA 4LCEA 1U3WA 2O3RA 2GASA 3IL2A 4MP8A 3OETA 4LSWA 2UYYA 4MKZA 5AXAA 2V65A 3HZZA 4R9SA 4I5FA 3RUFA 3C8MA 1SEPA 1KEUA 2BD0A 1TT7A 1GDHA 2VWHA 1TEHA 2PA3A 4PLGA 1FF9A 2WDZA 3HDHA 2BFAA 2YYYA 1TT5A 3UN1A 1EUDA 2QZZA 3D4NA 1ZEMA 5TQVA 1KVTA 1F8GA 5EERA 1HYHA 3KSZO 5L7TA 2RAFA 3GZNB 4XIYA 2I3GA 2XF8A 4BNGA 1DFHA 1K3TA 1YOVA 1YONA 3T4XA 1IZ0A 1LLUA 4RDHA 4IBOA 1NWHA 4BO5A 2BFMA 3B1KA 3ONFA 2PKRA 3W1VA 2QZ9A 1I2BA 4YAGA 2CVZA 4D0SA 4E3ZA 3IS3A 4Y6RA 4IQGA 4BNWA 4HFJA 3VTZA 1CYDA 2NVUA 4FOOA 2X4GA 5G0WA 4R01A 3GC6A 3CPSA 4WEOA 3BMQA 3L9WA 4ROSA 4EGFA 2C5AA 1ULUA 1NNUA 5I7FA 1GPJA 1XELA 2AEFA 3VZQA 1E3WB 3GGGA 2JKVA 4FSHA 2X0JA 4E2YA 4ALNA 1E3JA 2VHXA 5JO0A 2DFDA 1G1AA 2HRZA 4JNKA 5DCWA 4ZVVA 3I9MA 3VTFA 2GCGA 2VHWA 3D3EA 1BVUA 2B5WA 3OA0A 2Z1NA 4J4BA 1NAIA 4H7PA 2EV9A 1H9AA 1U9JA 4L4SA 4PN3A 3JQGB 3VH1A 1E3SA 5JYDA 1ZBQA 3AK4A 1YH3A 3PYMA 2ZB3A 3F5QA 3DOOA 1MP0A 4FFNA 4CUJA 4Q3CA 4FFRA 3MZ0A 2JFHA 1DAOA 3FWNA 3O03A 1YQDA 5ENDA 4CR6A 3QV1A 2Z95A 1DOHA 1R16A 5DF1A 1I01A 4B3HA 4KWHA 4L75A 3P2YA 5ITWA 5HBRA 1PQUA 2ZB8A 4GPD1 4ALMA 3AWDA 1AUPA 4IDGA 2P68A 5K6AA 3RAJA 2B83A 4J2OA 2NVWA 2VUTA 3ITKA 4ZQHA 4I08A 3ANMA 1ZW1A 2VUUA 4PLWA 4FDAA 2DBQA 4CL8A 1TA4A 2R2GA 4LSMA 3S8MA 3WGGA 4IDDA 2EGHA 1DRVA 3TL3A 1ZMOA 1A9YA 3WG9A 3INTA 4JGBA 4YJGB 4NPCA 1DIGA 3ZU3A 1H2BA 2FR1A 2GZ2A 3SC4A 3EZLA 4DC0A 3OJEA 4HV4A 3OF2A 1VL8A 3OHSX 1ENPA 1EVYA 3B6ZA 2QYTA 2FPPA 3RKUA 2B35A 4XRRA 1HLDA 4A5OA 1P74A 3MWDB 4JJFA 1RYDA 2X23A 1BW9A 4CQMA 1KERA 3NKLA 2EERA 4M1QA 4PLVA 2IE0A 4E33A 3DBVO 4HBGA 3EDMA 2WEKA 1V6AA 1PWZA 5KVQA 3LYLA 3DFUA 5C3MA 1GYRA 1GUFA 4RZIA 3ROQA 2HK7A 2ZJ1A 3M2PA 5COAA 3RJ9A 3BMNB 4BGEA 2JCVA 3AOEC 1WAMA 1JDJA 4EJMA 2WWRA 1NQAO 2PWZA 1SB8A 2HLPA 1LI4A 3F5SA 4D0RA 4YQZA 4YB8A 1XG5A 1CQJA 3WDSA 4YVFA 3AM3A 4GVLA 3ULKA 2UAGA 2A92A 4R3WA 4L76A 1OFGA 4X54A 4IDCA 1E5LA 3ZHZA 4B4UA 4BB6A 1HKUA 1DBVO 1RJWA 4FJ0A 4KTVE 3QRWA 5L53A 5HTOA 4J1TA 1DLIA 3P7MA 3HN2A 5H82A 3RCBA 4L74A 2X5KO 1HETA 1T4DA 2C5EA 4O63O 5IXYA 3IKVA 4WCFB 2DT5A 2QRKA 2VYNA 3ZU4A 3K5PA 3H2ZA 3Q9NA 3JQEA 4YWJA 3LT1A 3RC2A 2VRBA 4OM8A 5CDTA 1PJTA 5CG1A 3L9XA 2X7HA 2BGMA 1UDBA 4J7XA 5KCZA 1GTMA 1NQTA 3R3SA 3PHGA 4I5DA 2BFPA 4RL6A 3MEQA 4O6VA 3H65A 4O1MA 4WCFC 3GDFA 2HK8A 2Y0DA 1HDRA 2OORA 4FIZA 4RVFA 3CMCO 2FSVA 3Q6IA 1BGVA 1WNTA 1GUYA 4DPKA 5JW6A 5TLSA 4YJHA 1YB4A 4GMGA 5KVCA 1ULSA 3OEWA 5TNXA 4BGIA 1KVRA 1R4MA 2IODA 3LQFA 4XX0A 1UXHA 1IHXA 5G0VA 4CLXA 5EPOA 1ISJA 2FP4A 3ZNOA 5BT9A 1JW9B 1YQXA 4JJIA 4RGBA 1GADO 4LMPA 3D3WB 4WLNA 5COQA 2W2KB 5EESA 4CLRA 5IFLA 1PEDA 5L51A 4ID9A 1AE1A 1TI7A 3GEMA 2EW8A 1GUZA 3DL2A 1HDOA 4INAA 3ONDA 3ZWYA 2Y68A 1GEGA 4E6PA 3NAQA 3GRPA 3VVBA 2GYYA 2FOIA 5CEFA 3DBRB 3K2BA 4MKXA 3DWFA 1WMBA 4OIMA 1XQ6A 3ASUA 1DSSG 4Q3DA 1NQ5A 2EF1A 1R37A 2FPGA 2QW8A 1IPFA 4RVSA 4OOEA 3KO8A 1YBAA 1RWBA 3A06A 2C82A 2JFGA 4C4OA 1VJ1A 1P1HA 5HS6A 1NASA 3PI7A 3JD4A 3UW3A 5CPFA 4CV0A 3TZ6A 4A2CA 4BHTA 4NK4A 3KLMX 2Q49A 3LT0A 3OEYA 3W8DA 1KIFA 1ZVMA 5TT1A 4JBIA 4ZRNA 4XR9A 1K5HA 4IQ0A 3HDYA 3WGTA 3WICA 4E5NA 1LNQA 1PJ2A 3TWOA 3BHJA 1GZ3A 4LVCA 4FPXA 4CMHA 4RZHA 3LC1O 3WGQA 1LDNA 3HWRA 5BSEA 1JVSA 2VTEA 3GFGA 4AJKA 3KVOA 5TJHA 1ZK1A 4II3A 1E6WA 1WVGA 1LUAA 2Q2VA 3WYBA 2OL4A 1CEQA 3EZYA 1C1DB 4W9NC 1VL6A 2O3SA 3U4CA 3ZW9A 5A4DA 1MXHA 5T5QA 1YL7A 3PWKA 2OMEA 4ND5A 1HL3A 1I2ZA 3AUTA 3DEYX 4NNJA 4UULA 4G5HA 2NVUB 3JQ9C 1FMCA 1PGPA 4BNFA 1I3MA 4R9RA 3H7AA 2O4UX 4XB1A 3U4IA 4MVJP 2IDZA 2C2YA 4TRNA 2NUAA 2IZ1A 4OGWA 1SOWA 3TNLA 4CMAA 1NHWA 4JP3A 1AHHA 5A9TA 4UUPA 3WWYA 4IXWA 1NHGA 1ZZEA 3VKUA 3FPCA 4B4WA 2BELA 5TSDA 2O3JA 3Q3CA 3BMOB 4R54A 1LQUA 3IP3A 5BNFA 1FK8A 3DXFA 1D8AA 1TLTA 1U8XX 3N58A 1D3AA 3JQ7A 1O5IA 4U5QA 4CUZA 3V5NA 1E3LA 2BKAA 2OOSA 4ALKA 3SBOA 1E7QA 2X9GA 1CERA 3I4FA 4H3VA 4UVEA 4B8ZA 4DRYA 1LJ8A 4BNLA 3WGZA 4DLBA 1T25A 4J91A 3TJRA 4HADA 5JC1A 3DOCA 3I83A 4ZD6A 5A9SA 5JXWA 3G79A 3JD2A 3DO5A 3HFSA 3WBFA 1PJBA 1E92A 3VDQA 3IMFA 1KBZA 5CDYA 4ILKA 4XYEA 2GN6A 3PFFA 1ARZA 4H16A 3RQSA 3V8BA 2B0JA 1D4FA 3ROMA 1JKIA 4RO0A 3AY6A 1V9LA 2GGSA 1WPQA 5HM8A 4CL3A 5C5IA 3PLRA 1EDZA 4CMJA 4Q3NA 1WDMA 1MG0A 1RM5A 4HXYA 4R41A 4QUKA 1N7GA 5CDGA 5CFZA 1I3NA 4PVCA 1XLTA 5GZ6A 3SLGA 4BKRA 1PU2A 2HRBA 2H63A 1LEHA 3GFBA 3IIEA 3NTRA 4OSOA 3NV9A 4CV2A 2B4TO 1NQOA 3SVTA 1PS9A 1UDCA 3ANLA 3OJLA 4LVUA 5IDYA 4CODB 5DCUA 4B7UA 3GGPA 1T1RA 4N5MA 4KQXA 3PIIA 4YRAA 1U3TA 1KC1A 4DIFA 2JD0A 3EGOA 4YQYA 4BL5A 5JDIA 3FD8A 4MP3A 3TOXA 5HS4A 4ZN6A 4P38A 5U1PA 1KVQA 1PTJA 1MGOA 2P9EA 4Q3BA 5JMWA 1BXZA 2GLXA 3UCXA 5T64A 4OXKA 1Y8RA 1EBUA 1OOEA 3S2EA 2FR8A 4OAQA 1PS8A 3VZSA 3WB9A 3D5TA 3WFJA 4EUHA 1EVZA 2J3JA 4EYEA 4K26A 5A05A 1PJ4A 3JD3A 2D3TA 3TL2A 1UP4A 3ZCXA 3DTTA 3D7LA 3M6IA 3RUAA 4IMRA 1LDGA 1ONPA 2PLAA 5KVVA 1U2DA 3IC5A 1P3DA 5FYDA 4RPKA 2DFVA 4BNKA 2EHDA 3NT5A 4K9DA 3MJVA 1E3IA 2I99A 2B4RO 4UREA 1GR0A 3AJRA 3ZHXA 5C7LO 3CE6A 3GY0A 4C7KA 1DJNA 3VZRA 4KUGA 3JQBA 2VTDA 2D5CA 2X5OA 3CIFA 1EQUA 1QSGA 3G17A 2X86A 3NTQA 3U0BA 4YACA 3GF4A 1QG6A 1DAPA 1QYXA 3S2IA 3DMTC 2HJRA 4BUCA 5JY1A 2UUPA 1I3LA 3Q2KA 2QYSA 1Q1NA 4AICA 3PFWO 1NFQA 4WOJA 4YT8A 1KEWA 3FHLA 1Z7EA 3JCZA 2HQ1A 4LN1A 4WCDA 3ZI0A 3L0DA 4XYMA 3UFXA 2E4AA 3ZW8A 2FZEA 2JAPA 2IEDA 3RROA 5EN4A 4CMEA 1U5CA 4BNZA 4TROA 4LK3A 3GVPA 3PEFA 4GAEA 3BZUA 1WDLA 4FJ2A 2BH9A 2Q45A 3GDOA 3QJ5A 4EEZA 1EFKA 1HDGO 1A7KA 3W6ZA 5CEEA 3H8VA 1YS4A 2VRCA 2RHRA 4RF5A 4W99A 2DPGA 3VKVA 4E0BA 1G0NA 1YVEI 3C7CB 3GUYA 1DFIA 1H94A 4UVIA 4URFA 1XEAA 3VH2A 5IDQA 5IJZA 1DDOA 3GPDG 3GNSA 4D42A 1GV1A 5J23A 5A03A 1BXKA 2B36A 4MVJD 4Q3AA 4BNNA 5EQDA 3PDJA 3KEQA 5EMHA 4G81A 5JNLA 4DUPA 2IYPA 4U6SA 2QG4A 4TKMA 1DO8A 3ZNPA 4AJIA 4BNVA 1T4BA 4M89A 1LDYA 1C3VA 4OSPA 4KQWA 5KJCA 3L4BA 1X13A 4AJEA 1FDTA 4DIBA 1SPXA 4ND2A 2YHIA 3WJAA 1R4NA 2Y66A 3V1TC 1RKXA 1QYDA 3A1NA 1OC4A 2D5AA 5F5LA 3COSA 4MVJE 1I8TA 1PX0A 1D1TA 1XQ1A 4L9RA 4XZ3A 3PWZA 4FW8A 4Z3DA 2F1KA 3I5MA 1EBFA 3A9WA 5AQ1A 2A94A 2VWQA 3RASA 4YRBA 5TX7A 2O23A 4BKUA 5LDHA 3GR6A 1NWCA 2WMDA 4YBZA 3DTYA 1BDBA 5AXBA 1HYEA 2NLOA 3H9GA 3OP4A 3I3OA 1IULA 1GAEO 3WLFA 2AW5A 2Y05A 2R6JA 3GRKA 2PZLA 3IDSA 4R1TA 1F14A 3AI1A 3WGIA 1HTBA 3D64A 5KOIA 4PLZA 4M49A 3NGLA 4AL4A 2CZCA 7MDHA 1SOVA 4Y8VA 4ZRMA 1N9GA 4GLOA 1OC2A 2Y0CA 4NJMB 3K8ZA 4ZQEA 4N5NA 3WQSB 4JP2A 2I76A 4DPMA 1EE2A 1B8UA 1HRDA 4JJGA 3WTBA 4PG5A 1Q0HA 2ZB4A 4EEXA 1EQ2A 1YO6A 3D4PA 1B8PA 2Q1WA 3QSGA 3QWFA 1DEHA 3E1KA 2VHZA 2Z5LA 1EMDA 3OJFA 4DVJA 5CDUA 1IYZA 3IQDB 4OO3A 4UEOA 4XEHA 8LDHA 1HZJA 4GMFA 2X5JO 3NGXA 4O59O 3VH4A 1ZK2A 2VYVD 1U7HA 3L07A 1ADCA 1YB5A 2GDZA 3HB4X 1DIBA 3QQPA 5TIIA 4S1VA 2VZ0A 5ITVA 1VC2A 3A14A 4DMLA 1ONOA 3JQ7B 3RFVA 3JSAA 2NQ8A 4J49A 4AJJA 4R51A 3MJCA 4Q3EA 5KNLA 2AMFA 3KSUA 2IRWA 1GY8A 3X2EA 4Z9XA 2VUSA 2ZCVA 3JTMA 3DBHA 3O8QA 5BQFA 5JO9A 4EUFA 3ANNA 1UDAA 1IUKA 4XJTA 1P1FA 3TF5A 5TRTA 1DLJA 4J43A 1QLJA 2RH4A 5JAIA 4AJ1A 2I3AA 1E1LA 1NR7A 3TOZA 3E5RA 2VOEA 2ZIZA 4LCJA 4NBUA 3F4LA 5A9RA 2NM0A 4P4NA 4TZKA 3ZU2A 5MDHA 4NBWA 1E7YA 4H15A 3WSVA 2XXJA 4EDFA 2DBVO 3U4DA 1R66A 5I9NA 4J0EA 2VZ9A 4DYVA 3EVNA 3LF2A 4CUKA 3BMCA 5HRUA 1JVBA 3KM0A 4IM7A 3WIEA 4ZGWA 1E5QA 1IE3A 4KZPA 1T2FA 3ZWVA 3JV7A 3RU7A 5BSFA 5FFFA 5TS3A 4WNCA 5KJ6A 1Y8QB 1G6KA 2WE8A 5T6BA 4K6CA 4UUNA 1CJCA 3WWZA 1H6DA 3R3JA 4RCVA 4W4TA 3ICCA 5EL0A 4D41A 4CLOB 5AOVA 1FDVA 4BV8A 3O38A 2FPIA 1XKQA 3H4VA 2G5CA 1QMGA 2EKQA 4TRJA 1X1EA 3ZV5A 1XSEA 3UCFA 1ZXBA 4XYBA 1PL7A 5A5FA 1I36A 3PK0A 2DTDA 4ZU3A 4R1UA 1IOLA 3DZJA 2ZJ0A 3D0OA 3GDGA 4R4JA 1BTOA 1O6ZA 2W8ZA 1T2AA 2GO1A 2O7SA 2CF5A 3DZGA 4KDFA 2HCTA 1P0CA 1LDEA 4RPGA 3LLVA 3H5RA 1PJQA 4AJPA 4PG6A 1X1TA 1ZH8A 3GEGA 1BVRA 5JMPA 4DTIA 4JQCA 1OAAA 4FC7A 2PY6A 3T7CA 4N5LA 1SEVA 3DB2A 2O50A 3OJ0A 1U4SA 3FF4A 3K92A 2O4CA 4CM7A 3T7EA 1BG6A 3IJPA 1LBEA 2H5LA 3WYEA 4EW6A 2HO5A 5DN9A 3WBBA 2NU9A 4RLSA 4TRRA 5I9MA 4CM9D 2AHRA 1EUZA 2Y1DA 2CY0A 4J90A 2B5VA 3W6UA 4F3YA 4I1IA 2DLDA 4JLWA 5CP8A 2OUIA 5U9CA 1EK5A 3RC9A 4YRDA 1MLDA 1QYVA 3QWIA 4RF4A 2P91A 2WYWA 1N8KA 1W4ZA 2JCXA 4Z9YA 4HX5A 1E6UA 1ZKMA 2WD7A 3DR3A 3HSKA 3F4BA 5BNTA 5IDWA 1B16A 5IAAA 3H6KA 3UKOA 3RI3A 1E0DA 3JQFC 3GN1A 2R00A 3AM4A 4UVHA 4AG3A 1M75A 3KZVA 5KJ1A 2D59A 3KB6A 2DPHA 2FMUA 5FI3A 2LDXA 9LDTA 3FSRA 5KIAA 3H9QA 4NBVA 3SLKA 3C7AA 3JQBC 2WJPA 1PWXA 1OBFO 4IIUA 1FXSA 4LGVA 2Y99A 1PJLA 1SB9A 2BRUA 4OXNA 3GG9A 2RHCA 1NVMB 3DZFA 2YQ4A 1P77A 4YJFA 3GAFA 4G2NA 5A5EA 3DHEA 4GH5A 4NBTA 4KP7A 3VC7A 3H9JA 1XGKA 4R3NA 3LU1A 2DTEA 1VRWA 2O3UA 2Q1SA 4KUHA 1DRUA 1DIHA 2EKLA 1DC5A 3G1UA 2Q4EA 4M54A 5DBIA 5BSHA 1EK6A 1Z45A 1MX3A 2GZ3A 3DDNA 4J4TA 1NPDA 2P9CA 1PL8A 3T4EA 4NH4A 4B8WA 1U3VA 5B4VA 1B3BA 3PVZA 4DBZA 3KYDA 1M76A 2YW9A 5IZ4A 4RF3A 3V1YA 4E5KA 3QY9A 1U3UA 5EINA 4CM4A 4LRTB 2JL1A 3LZ6A 4PZCA 4UEKA 4KWIA 5JC8A 2AEJA 2VWPA 3WX0A 2Q1TA 3PP8A 4R69A 3ZWPA 4ZA2A 4CMIA 1G0OA 2P5YA 1XDWA 4FFLA 2Q3EA 3JD0A 1DHTA 2D8AA 4AJOA 5JYEA 2HAEA 1ZIDA 2NADA 4BO6A 4R1SA 5G4KA 4C7JA 3Q1LA 1UZLA 3S2GA 2Y93A 1LX6A 3ETDA 1A72A 4J7UA 2ILTA 5T8KA 2J3IA 3QVWA 1NFFA 1HE4A 1I0ZA 2GUGA 4TRMA 2JD1A 4ZQFA 1PS0A 1FDSA 3TRIA 2JCYA 1T2DA 2OZPA 5G2OA 3L4BC 4D7AA 3N7UA 4EZBA 2DBZA 2EJVA 2IXAA 1YL5A 3EAGA 4Y9DA 5LCXA 1N92A 2GRAA 3F47A 3O9ZA 2Y1GA 2JHFA 3DOJA 4YTEA 4CR8A 4DQVA 4ALLA 3D5QA 3F6YA 1PZHA 5EJ2A 5JDCA 5ILGA 5B37A 1I30A 3TDKA 2Y1CA 1YWGO 3JQ8A 2VNSA 3FRJA 4JN6B 1Q2XA 3QWHA 4O5OA 5JFOA 1PQPA 1LRKA 1ZJZA 4YAIA 3STHA 3ZWBA 2UUOA 3A4VA 2FRDA 3ZU5A 4E2XA 1T26A 1QORA 1F17A 1O95A 3ROPA 4NR0A 2XPCA 1WP4A 2RCYA 3R1IA 4FFPA 4OKNA 4PG8A 1T2EA 3UVEA 5JCXA 4D3SA 3NX4A 5F1OA 4ALIA 4DA9A 4KTTE 3E18A 4GLLA 1PGOA 3ZZNA 2A35A 4MVJI 1ZSVA 3HFGA 2J5KA 1S7CA 4KDEA 4CLDA 4IXTA 5K9ZA 2DU8A 1CQIA 5L4NA 3WYCA 4BQPA 4TQGA 3LSYA 5THKA 1Q7BA 3HHPA 3IOYA 1J6UA 4RPJA 2WE7A 2NACA 1Y9AA 4RVGA 1PSDA 2W2LD 2NTVA 3W4KA 1XIVA 3QVOA 5GZ3A 3E6AA 3RFXA 3VPFA 5A3JA 3AY3A 2NTNA 4N18A 4YAKA 3R6DA 4ZICA 2PR2A 3DBLA 3GH3A 1ADFA 4PIVA 3H9EO 1LSSA 1B7GO 4QECA 7ADHA 1L1FA 2V6MA 2O3TA 3CZMA 1P45A 3TZQA 4UUMA 5DCYA 1TT5B 4IIVA 4AJHA 3FNFA 3OQ1A 4A73A 1BMDA 5IZCC 3OIFA 5JE8A 1K6IA 1NTOA 1M6WA 2FN7A 1LC0A 4HKTA 4HUJA 2FZWA 2I9PA 3QHAA 4WUVA 4J1SA 1N5DA 5GMOA 3E03A 1J0XO 1YOVB 4FGSA 1UAGA 2J8ZA 4YYZA 4NFSA 1F12A 1ISGA 3PGXA 1PL6A 2Y67A 1Y81A 1EZ4A 3BYZA 1BXGA 1C14A 1E7RA 1DC3A 1Q7GA 3KYBA 1A9ZA 2ZKLA 4B7CA 4JBGA 3EC7A 1HSZA 1IHYA 1U7TA 3NDIA 4CM5A 4K28A 3L4SO 3BMQB 5DBGA 4E13A 2AA3A 2OP1A 1ZMTA 4PVDA 4RLHA 3X2FA 1ZSYA 2X9VA 4CR7A 3IKTA 3NJ8A 3ZV4A 2FR0A 4BNHA 3DZHA 5CG2A 2JAHA 1TXGA 3TFOA 3VPXA 1R0LA 1XR3A 3KRTA 4QXMA 4DYDA 3I6IA 5L7YA 1JKFA 4DBVO 4U8GA 4IZHA 1Y5MA 4OMUA 2GZ1A 1HF3A 4B7XA 3QIVA 1LLDA 3CH6A 4OQZA 1XHLA 4BKOA 2CDCA 4TKLA 1A5ZA 4CQLA 4K6FA 1SC6A 3E5MA 3K31A 3WLEA 1ISIA 3I9OA 4GWKA 4XB2A 3KEOA 3VAZA 3PQDA 4FFOA 4BO2A 1FDWA 3QVXA 3TN7A 4AJ2A 5IG2A 1IB6A 2JFFA 1A71A 3CMMA 3JQAA 1W0CA 3E48A 4AJNA 1I24A 2AE1A 4XDZA 2W90A 5H83A 4A10A 2ZTLA 2E6UX 4OOFA 1ML3A 3OSUA 4NBRA 5KWEA 2OP0A 2J5QA 2PD3A 4CM6A 2J6IA 2YV2A 3KYCA 4E31A 3GA0A 1P33A 4UEJA 4HY3A 4J9VA 4D3DA 4RVUA 5ER6A 4QO7A 4EITA 4M8SA 4BNIA 1GZ6A 2D1YA 2ZTVA 3BTUA 1AHIA 1CRWG 4UVDA 1ZEJA 2UVDA 3CINA 2AQIA 3WMWA 3GOHA 4YT4A 5K6AC 1V0JA 4M87A 4PG4A 1F8FA 2RH8A 3DMYA 3KSDO 2PZJA 3D4OA 3GQVA 1XU7A 2XOXA 3NUGA 2VHVA 4I9UA 1KYQA 4DLLA 4J6FA 5DBFA 4FB5A 1GQYA 1U4OA 2Q50A 3DC2A 1O94A 4S3MA 1KETA 3LLSA 3GZNA 2IZ0A 2AE2A 1BW9B 4L0QA 1IY8A 4CQMB 1CIVA 4XCVA 1MG5A 4GQAA 2YHUA 4M55A 2BLLA 1GL3A 3RUDA 6LDHA 1VLLA 3U62A 4I5GA 1F0YA 4U0KA 5LC1A 2OGUA 3K9QO 4MVJG 4GSLA 3EUWA 4IUYA 1LQTA 3EY4A 2GN9A 1JTVA 1OI7A 3PTZA 1WWKA 5FI5A 4PLTA 2EW2A 5MGBA 2GR9A 3FTNA 4A03A 1E7SA 3D1LA 4U6QA 1KC3A 1HDXA 2EP7A 2VHYA 1H5QA 3AI3A 5JCJD 3OIGA 2CMDA 1SBYA 2QHXA 3GVIA 3K2EA 1E3WA 3OA2A 4KUEA 4GX5A 2ZTMA 1LDMA 2BHLA 3TZHA 1JWAB 2PZKA 2VQ3A 3M2TA 3Q11A 2X9NA 5L45A 5GZ1A 5CHEA 4J4HA 2C54A 4MIEA 1U8FO 1NR1A 3I9NA 1UP6A 3IUSA 3F1LA 3WS7A 3DHNA 1HDYA 5A04A 1J49A 3ZWOA 3JQGA 3G1TA 1U2GA 5F1KA 2H9IA 2G0TA 4CMIB 1ZXLA 1E7MA 3VPGA 5ADHA 1YDEA 2UV8A 2ZQYA 4QEDA 4WOKA 4XYGA 5KKCA 4I5EA 2Z1MA 5G4KB 1B14A 3NT2A 1ISFA 4DLAA 1LC3A 4LW8A 5AXDA 4Z0HO 2PD6A 3TPCA 1C0IA 4DGSA 1GEEA 1I33A 4IS3A 3Q0EA 5T57A 3R0IA 5DP1A 3ZGYA 3OQBA 3GGOA 3VHRA 1P44A 3BXXA 5TJ9A 1RYEA 1LU9A 3ITDA 5C37A 3C1AA 1RPNA 2YZ7A 1K0UA 3WMXA 3DFZA 4UUOA 1ZK3A 1R15A 5F5NA 4NMHA 4XGIA 4QO8A 1DJQA 4YJHB 4BKPA 1NVTA 1R4MB 2UDPA 1LSOA 4N54A 4E5MA 1I2CA 1NPYA 3RWBA 5T8KC 3B20A 4MVJM 4CMCA 4D46A 3V2GA 5DULA 4YJGA 3RKRA 4GBJA 1CETA 4FBGA 1GU7A 3ORFA 1LSUA 3UF0A 3UOGA 4E5PA 2IZZA 3AOEA 3C7DB 4YT5A 4CLRB 1PJ3A 2Q99A 2WSBA 4PZEA 5JS6A 2PGLA 3U4HA 5AYVA 2VYVA 4B3JA 1NYTA 1QV7A 3M1AA 1ZUD1 3TZKA 5IN4A 1VKOA 3E8XA 3ZWWA 4MJLA 1HXHA 4QX6A 3ZWNA 4E12A 1MC4A 1Q0QA 3ZWMA 4E5YA 3U5TA 4PRKA 5THQA 3LVFO 1B15A 4BNUA 5KTKA 2C0CA 3BMNA 4IGEA 2CVOA 3WNQA 3BHMA 3OIDA 3C1TA 3U9LA 2HK9A 4BO0A 4II2A 4R5MA 4YA6A 1P1KA 3I9JA 1UJMA 1LRJA 1S6YA 3IAHA 3B1FA 4ZJUA 2PD4A 4WASA 3QWAA 2P9GA 3DBLB 1NVGA 4P8RA 1YJQA 4FCCA 1WLYA 3HB5X 4IJVA 5HWSA 1FDUA 4W7HA 1ONNA 3ZV6A 4YEDA 8ADHA 2FHSA 3DZIA 1P0FA 3PWSA 4AVYA 3ZN2A 1Y9EA 1KOLA 1W8DA 1K89A 2HUNA 5ENVA 4UAGA 5L95A 4I9NA 2G1UA 4P4GA 5ICSA 3WGHA 4WCFA 1DFGA 2E37A 4HNHA 4NFYA 4BOYA 3ZNNA 1N1GA 4NIMA 4GKBA 1B2LA 4TVBA 1CWUA 4IJUA 4NDNE 4RF2A 4J1QA 1BXGB 1Z6ZA 4L73A 4G65A 4RVHA 1M6HA 1ADBA 3DONA 2NVBA 5ER9A 4NU6A 3LK7A 3PHJA 3BA1A 3FNGA 4FC6A 3NEPX 3RVDA 1JN0A 4Z0PA 3GMDA 4MVJF 3C3XA 3ETGA 1RM3A 5I7EA 3PDUA 2CD9A 3VPSA 3W4JA 1VJTA 3K6JA 3VVCA 3ZHYA 4AJLA 1J4AA 2CDAA 4A26A 3UICA 3RU9A 4EJ0A 4CV1A 4J2HA 3S1LA 1B3RA 1Z75A 1B0AA 1GCUA 1MFZA 2ZB7A 2ZYGA 3RJ5A 1YL6A 2RIRA 1X0XA 3CTMA 5F21A 5T67A 3VZPA 1XU9A 4J9UE 2CF6A 5CPBA 3ZWXA 4QTZA 4RJTA 3FTPA 1EVJA 3EMKA 3UH1A 3PZRA 1ENZA 3BIOA 3RBVA 3LC2O 3D3WA 3WNVA 2W2KA 2DUUA 1H9BA 4BV9A 2QX7A 3HE3A 5IF3A 1VE9A 5IN5A 4R5HA 4Z9FA 4CMBA 5A9SB 3FR8A 5L7WA 4P4LA 3UUWA 2PV7A 4HP8A 4GX2A 3ADOA 1NX6A 4LMRA 5B4TA 2V7PA 3CEAA 2BGLA 2G76A 5G4LA 4CM9A 1EDOA 3QVTA 3KYCB 4L4RA 1N7HA 4ITUA 4XQGA 1NP3A 1SZJG 3HG7A 4E2ZA 3C85A 1T1SA 5JY6A 1Y6JA 3B1JA 1R0KA 3AUSA 1DIRA 3AUUA 3Q9UA 4GWGA 4HFRA 4DXHA 3B70A 2I65A 1X0VA 1O0SA 5K0ZA 1P31A 5KVSA 4QFDA 4PLFA 4DQUA 4MOWA 3U3XA 2YFHA 3OJOA 4MIYA 2C29D 3WFIA 1X7DA 3PGJA 4GSKA 3RD5A 3GG2A 1T2CA 4NHEA 4D3FA 3PYLA 4KOAA 3KXDA 4W9NA 2AG8A 2CVQA 1QYWA 2C7VA 3SC6A 1A7AA 1IZ9A 2J3HA 4F46A 3G0OA 4W7IA 4TWRA 3LT2A 1PGQA 1E1KA 3A28A 1V3VA 3JQ9A 4KMSA 3V2HA 2I6TA 4QQRA 3VH3A 1O89A 3ADPA 4O0LA 1UZNA 2AQHA 3JD1A 2D4AA 4Y98A 2G82A 2EGGA 2SCUA 2OXIA 4Q39A 1C0LA 1ADGA 1Z82A 4IPTA 4NZ9A 1VI2A 1YKFA 3NRCA 1ZSNA 4PLPA 3RUIA 1UXJA 3VOSA 3KTDA 2NWQA 2EWMA 2I67A 1C1DA 2DC1A 2FY8A 2BF7A 3U09A 5TGDA 2EEZA 1YDWA 1ISMA 2P4HX 3JYOA 1JA9A 1Y8RB 2VN8A 3U49A 3NDRA 1PJCA 1K2WA 1WDKA 4RV9A 3ZWAA 4QT0A 1I10A 1HSOA 3SJ7A 4IS2A 1A27A 2WYUA 3CSDA 4BNTA 3PJEA 4BNYA 2PH3A 3BTOA 1PQWA 3PLNA 5DP2A 5JDIC 3DAPA 3HDJA 1EFLA 2Q46A 1EVIA 1Z74A 3SX2A 1YBMA 3AU9A 3QW2A 2GF2A 3F9IA 4MIOA 1R12A 3WGOA 4XIJA 1UXIA 3IJRA 4WLVA 3GHYA 3I9LA 3BMOA 1C0KA 1HYGA 1NAHA 2VWGA 3GEDA 1YJ8A 4EBFA 3P2OA 1QKIA 5B4UA 5FWNA 1MA0A 2O2SA 4MVJH 3ZDFA 1P1IA 1VL0A 5TT0A 4CLHA 4DWVA 5HA5A 1QV6A 4WE3A 3UHAA 1HDCA 3CZRA 3M1LA 5AXCA 4WEQA 1E6EA 3LF1A 1C0PA 1UP7A 1EEHA 3RFTA 4GL4A 5BNIA 4Y6PA 2CFCA 1E1MA 1UXKA 3OICA 2GSDA 2EP5A 1P9LA 3QP9A 3H3JA 4BGVA 9LDBA 1LXCA 3S2FA 2VOJA 3FNEA 1DPGA 1DB3A 3WQRA 5JAZA 3KOUA 2JJYA 5JAQA 3AU8A 1AN9A 1UZMA 1YE3A 5FF9A 1FJHA 3AW9A 1E1NA 4AJ4A 3PHHA 2QRJA 3HADA 4ZQGA 4DIOA 2DVMA 1ISHA 2OO5A 2P5UA 1TB4A 4PFJA 2PFGA 1HDZA 1LSJA 1V3UA 2BI7A 3GUCA 3RSHA 2D2IA 5L40A 1N2SA 4XQEA 3VPHA 5KJEA 1XYGA 3ASVA 4IJKA 3RUCA 1UH5A 2EKPA 1L7DA 2ZATA 3KLPX 3FNHA 3EHEA 4PLCA 3I9KA 2C2XA 3PZBA 2V6GA 2C7GA 3I1JA 3KUXA 3RIHA 1UUFA 2PNFA 2Q1UA 1PR9A 2VT3A 3UXYA 1A4UA 2DTXA 4CMEC 2OBNA 4PLYA 5BR7A 4IINA 1AGNA 1BDMA 3MTGA 4MINA 2I5PO 4TSKA 2RBEA 1H2HA 1BSVA 3K73O 4RDIA 3H9UA 2W2LA 1KS9A 4BO3A 5DT9A 4AFNA 4U7WA 3OBBA 4PCVA 1GD1O 5L9AA 1SCUA 2HMUA 2Q2WA 5L4SA 4IJWA 4WLFA 3GMSA 5F3RA 1Q7CA 3FBGA 5KJFA 1OMOA 5I7VA 1ZFNA 3DZKA 4NG5A 3GK3A 3RUEA 1HE2A 3INGA 1T24A 2O3QA 3WOHA 1AXEA 4RORA 4ESOA 4LISA 1LA2A 5FEUA 2YHIB 3SXPA 1R4NB 4J0FA 2A4KA 3SEFA 3V1UA 4OQYA 3SJUA 1IL0A 1BWSA 1HE3A 2NTJA 3L6OO 4JROA 4PZDA 3WIDA 2HSDA 3JYPA 5B12A 4WGGA 4Y67A 4A7PA 4HNGA 4M86A 2J3KA 4PLHA 3WTCA 4BO4A 3F1KA 1E77A 1PIWA 3PJGA 3DMTA 5ICMA 1WW8A 4ZQBA 4IY1A 3EK2A 3GLQA 4JX8A 5U4QA 3AI2A 3ENNA 4IDEA 3H2SA 1JAYA 3HNPA 3W8EA 1HLPA 3HJAA 2NU7A 4XQCA 3CXRA 2YFQA 3TZCA 1RM4A 3I4CA 1QXSA 2DKNA 2DAPA 3GVHA 5GY7A 5TC4A 4I8XA 4XGKA 3AOGA 3GN2A 3OFSA 1WMAA 3NJ4A 4L4XA 3WJ7A 1N9GB 1V8BA 4OKIA 1YXMA 1DXYA 1U5AA 1GPDG 3O4RA 1MV8A 2ZK7A 4R16A 4BKQA 5JPIA 2GN8A 2D0IA 3PHIA 2POQX 4R1NA 2JD2A 1KEVA 3AFNA 1Y1PA 2E49A 4HFMA 3ON5A 2F00A 1PGNA 5F1PA 3IUPA 3GPIA 1ZK4A 4BNXA 1V3TA 5EIOA 5B1YA 3BTVA 3NT4A 4CMKA 3GVCA 4CQMD 3KBOA 2CSUA 4FJ1A 1PZFA 3QWBA 4BQRA 3MCVA 3F3SA 3FPLA 4XYLA 2YV1A 2GERA 3GAZA 2VNAA 1SO8A 1X7GA 2PKQO 3GVXA 4FR5A 4YR9A 5C7OO 4OJNA 1LTHR 4FN4A 4BGUA 3PXXA 3BTSA 3HUDA 2DQ4A 5I9LA 4MPDA 2ZYDA 3DBHB 3O8QB 4QFCA 3CUKA 3ENKA 4IMPA 2PKQP 2B4QA 3E9MA 3K30A 1R0SA 2TMGA 5AVOA 3RUHA 4GI2A 2O7QA 4LRSB 4NK5A 3BAZA 4ND4A 3S55A 2PK3A 3WXBA 4TMFA 3Q2IA 2HMVA 4B79A 2CUKA 4YXFA 1M67A 4IZIA 4WK6A 1PZEA 3QLJA 1KY5A 2Y1EA 3WSWA 5ILOA 3IP1A 1C1XA 4DQXA 4HFNA 3UAGA 2YJZA 2Y0EA 4IGFA 5IDXA 2HDHA 3VDRA 4D44A 2ZYAA 1PGJA 1WZEA 3F46A 1ORRA 1YGYA 2GNAA 3JQDA 3BMCB 5H81A 2VYND 4DPLA 4WNIA 1JWBB 3N74A 2WTBA 4R68A 2X6TA 4CM8A 1WXDA 3ICPA 1L7EA 2VT2A 4Y6SA 2V6BA 4FGWA 3FBTA 4DL9A 3E9NA 2QIOA 1M66A 4WPGA 4K1LA 1BRMA 5A1TA 2X0IA 1W6UA 4OXYA 3O26A 1VSUA 3BHIA 3H3FA 4WECA 4CLEA 4D45A 1XA0A 4WLOA 4XDYA 3GNTA 3C1OA 4GVXA 2HMSA 1N1EA 3LC7O 4IDAA 2Y1OA 3ETEA 4XR4A 3DQPA 1H6CA 4IDFA 4QSMA 3ZV3A 4Z0TA 3OECA 3FN4A 3LDHA 1NBOA 4JIGA 3MWEB 1QRRA 1QP8A 5JCJA
chains in the Genus database with same CATH superfamily
2JGDB 5BSKA 5C35A 2JDIA 1DBPA 1M1XB 2O20A 3ANTA 2X40A 3KQMA 2R65A 3DAFA 3MOGA 2I8LA 3OESA 1I51A 3KR2A 1PT6A 3NC4A 4MO2A 4MR7A 4OFWA 4OLHA 1TF5A 3AF0A 2JHGA 3BWVA 3V4OA 4AO6A 4PPGA 1O1YA 5AIBA 2LCIA 1P1RA 1YJXA 2HDOA 4NXNB 1JHQA 1OUMA 1NLYA 1OWNA 1UOPA 3IA7A 3UOAB 1E2KA 3DXYA 4EG1A 2DUJA 3KAPA 4QQNA 3O4GA 3QXGA 2C57A 2BHSA 3MTJA 4CGZA 2UZ1B 4YCAA 2ZWOA 3K05A 3ZU6A 4F12A 4YRIA 4IJ6A 4RA9A 2XYRA 3L7NA 4MGEA 4UM7A 3T8YA 3ZJUA 1I3KA 4P6VF 5L3VA 4O0MA 2VKTA 1VBKA 5A06A 3ZQKA 4P22A 3WYFA 1WB9A 1DIAA 2VH5R 4NZOA 4YP1A 2Q8QA 5DGTA 2EZ9A 4RJLA 1QU3A 3LUCA 2L42A 2PGDA 3MS2A 4UXIA 1JB9A 4CIBA 4QYMA 5FPTA 1Z29A 3A2NA 3VYSB 3ZDCA 1QVAA 3QVSA 2H1SA 4XRGA 4LEIA 4R7GA 4DSAA 5AFSA 2YOFA 3CLTC 3RF6A 4F04A 3GB9A 3QBVA 1K7SN 2AD1A 3F9CA 1MF7A 3M5WA 4TVOA 1CIJA 1I5RA 4HNRA 3PVCA 3PQ5A 2VATA 3KQUA 3KOOA 4EB6A 4BX9A 2WV7A 5GONA 4N7RA 1BDJA 5B5SA 2XXBA 3WVNA 2RAUA 3T9BA 3LUKA 1DBWA 1AMNA 4PAGA 2H65A 5HW0A 5I8WA 3EZ9A 4UHDA 4BRZA 3GJ7A 3OLCX 1QCYA 5CM2Z 3KR9A 1ZHHA 3HUFA 3IP5A 4JBXA 1L9KA 4XQ9A 4FZ3A 3JWEA 5G0TA 1PJRA 3PUWA 4C21A 5LQKA 5JWHA 3DUFB 2J4CA 2RJ3A 3F6CA 2A9FA 1EGMB 1CQPA 3DDOA 4GF5A 1E62A 4KYUA 2COKA 4AWAA 3VMMA 2R00C 4UQPA 2ZCUA 4FNGA 1MR3F 1L4NA 2ZULA 1FYVA 5FTNA 1T0UA 1ZO8A 4M1KA 4G0VA 4M1WA 4IW3B 3P4UA 3N2NA 4CLOA 1TO2E 4JB8A 1IVYA 2IBMA 1C9MA 3E9QA 2QGFA 2CV0A 4I4TF 5E0OA 2DJ5A 4W6ZA 5A5VA 1YB1A 4MVJA 2AFHE 2PXHA 2Z9DA 2RGXA 4KX5A 2JF0A 1TCCA 3O2QB 4R31A 3HXKA 1JYSA 4DUGD 3FTEA 4URHA 3MJ4A 3E82A 6ADHA 1ACJA 1K8ZB 3O3CA 3B2NA 1X7HA 4HSGA 5LYYA 4ZCMA 1VBMA 3BDAA 1SKAA 2W00A 2XGOA 3L8GA 3PE3A 4V0KA 4LYJA 5DXAA 1GVNB 2CFSA 4L2IB 1I32A 4LY3A 4WGFA 4J7CA 1LVHA 1SM4A 3JQPA 3FDZB 4TZTA 3VKHA 2JGEA 4JLOA 3EX7C 3VKFA 4ONEA 2J9ZB 4G1BA 3EW7A 3AF1A 2WBLC 1K86A 3DMRA 5COBA 2E7ZA 1IXRC 4EHKA 5B53A 2IOFA 2VDPB 1LPOA 4I6EA 2V7WA 1XZBA 3AJEA 3O4HA 4R6WA 4U0JA 1LLCA 1D9ZA 4HRYA 5T3YA 1MB9A 1CJVC 4HRVA 5JNSA 2DQSA 4UAUA 1Z0JA 2R4UA 1VCHA 3EASA 3JZFA 1PSZA 2DQYA 4N0DA 1ZIXA 4D26A 1QUFA 1V35A 2Q2QA 2Z57A 5H5JA 4DYHA 4KSYA 2IEBA 1OZAA 4FD3A 1ZVVA 1QS0B 2BFBA 1IBMB 4I8DA 4C7MA 1EUCA 3PC2A 3IO3A 1P5JA 4UFOA 5DWDA 4NQZA 4E21A 5KWIA 2XKAA 3LBYA 1YRBA 4G6ZA 4ZK6A 3KXPA 5JI3E 1NIJA 5ERYA 5DOVA 4KREA 4TL8A 3I5AA 5K0JA 3TVDA 3WDMA 3EEQA 4Z2AA 3KQWA 5D3MB 1JKJA 4OIFA 1ENOA 3RYIA 4CMGA 4HGOA 4LJ8A 1Y7TA 3O0DA 3ZIDA 2B5OA 2GJ9A 1ZJ5A 4U7FA 4C0HA 1MVOA 2GF0A 3B7WA 1Q0UA 2ZBEA 3U1VA 4B6EA 3UYKA 1WZIA 1XLWA 5EZYA 4FFWA 1NNLA 3OP1A 2YW2A 2FXIA 4MDHA 1E0JA 1UBOS 5HKKA 2X0RA 1HFEL 1RAEA 2IUYA 4W1SA 5B36A 2B21A 2JGMA 5JPCA 2YJGA 2Q2OA 1FBTA 2CMFA 3FTCA 2R6R1 2H6EA 5DX0A 2NU6A 3B1ZA 5EMLA 3UJ6A 3WO1A 4DDMA 2FQXA 3MTDA 1UWCA 5KNDH 3EGWA 2I4OA 1E7WA 4UMVA 1A9PA 2WJWA 5HILA 1E1CB 1FYEA 3ZWCA 2ZYSA 3KJHA 1RZRD 2WW8A 3L4EA 7AT1A 1F06A 3K6SB 3BFPA 3IBFA 1YA4A 2IYWA 4YJ3A 4KLAA 4ARZA 3P9SA 5TR9A 2UVPA 4MUMA 2G9RA 2CFRA 3H04A 3MOIA 2VP0A 3SY8A 1IJFA 3AUAA 1XXLA 2C20A 2Q3BA 3WR5A 1XHFA 4CETA 1U8AA 2IYOA 3BCUA 4JR2A 1X8LA 3B6IA 3HPQA 4AQYB 3RIYA 4CKWA 3F5DA 2YQ5A 2UYHA 1FXWA 1H6AA 4IXMA 4N0MA 1WS6A 5TY0A 3PRJA 2A14A 4GX0A 2Y71A 1L8XA 5KTNA 2W6JA 1R6DA 3ZE6A 2C5GA 1NVDA 1CF2O 4RETA 2ZDGA 4WK2B 1M7HA 4JXKA 4G2TA 1H6BA 4MA0A 3TQHA 4QT4A 4HQNA 1P6UA 4KH0A 3M4XA 1B4DA 5BXQC 5FOQA 3FR7A 3JYQA 1O97C 1BFKA 3NCTA 5C8YF 5SZKB 3F73A 4ZT2A 1ZRSA 3EXHA 1UFVA 4HLUC 3SPXA 3PLAE 2ZWMA 3WGYA 3KU4A 2CDBA 3FPFA 3MWKA 4ON9A 4ZAFA 721PA 1CSEE 1PCXA 1Y1TA 2BJVA 2QRHA 3A6KA 1J5XA 2NSDA 2PL3A 2EG9A 1GQQA 1N2CB 1ZM2A 1GYQA 1RM0A 2QU7A 2VDWB 1ZCBA 2VJLA 3DTVD 3E0XA 4HWKA 1U11A 1Z22A 3WFZA 4K9OA 1QK5A 3ROKA 4TTQA 3ZX4A 4ER5A 3A1EA 1K6XA 1MTZA 1Q57A 1TQHA 1WCV1 1QH1B 2C07A 1IVNA 3CYFA 4QBTA 4X6XA 4I1PA 1LDBA 1WZCA 2IUEA 1X1RA 3FPEA 4F2GA 3GQBB 4G4SP 1E1RD 2C4TA 5JARA 1U0BB 1F5SA 3M6WA 2WSYB 3EUFA 1H05A 4E32A 4ABTA 2AFIB 3HU2A 5K8IA 4XUDA 1WHSB 1GWNA 2NW6A 1PUIA 5ALFA 1PG5A 1GYPA 3IAXA 1H0KA 4CKXA 3VV3A 1U3FA 2O57A 5KNCH 3OCWA 1DDGA 4BNMA 2ZRDA 1A8PA 4WVLA 1BVHA 3FOWA 2XQVA 2POCA 4D43A 1NKTA 1RWWA 3AFMA 3I9V1 2B0CA 1BS9A 1LVGA 2P4SA 2QX4A 3UWDA 4QOJA 5HK8A 5FWXA 4YAUA 5M04A 1MO5A 2RHLA 5T4HA 5LQNA 4OL0A 4EY4A 2HMTA 2GARA 4NYJQ 4V0LA 2HFJA 3LCCA 5EQJB 3SBDA 4ENWA 4PV7A 2ZGVA 4ZT3A 3AF4A 3ELYA 4DCNA 4C2UA 4B3RB 2X8LA 4QLOA 4X8OA 5H0IA 4XVUA 2AQ8A 3O9MA 4P5DA 5JD6A 3CPHA 4B4VA 5JRJA 5MN6A 4RIFA 1TUBA 1VIDA 4R0VA 1FS4A 1FRNA 1QTIA 1II8A 2J32A 4XLZA 5EFZA 4C0AC 3PJFA 1MUUA 4NAHA 1QCCA 1VJ0A 2CNBA 3T1HB 4TZ0A 2ZBUA 2Q29A 2BL4A 1MABA 5DOZA 2G17A 2ZRPA 4R1MA 5DYIA 1L5LA 5HOEA 2YH2A 4L27A 1E58A 1O3YA 5AVXA 1Z73A 3E1SA 3KEGA 1BQ3A 2AX3A 1AQ6A 1H1TA 4LGYA 4BIIA 3C3WA 3NGMA 4C4TA 3A4LA 1QZTA 4IDBA 5A0VA 1KYXA 4URVR 5B4UA 1CUEA 1GSIA 1PT9A 1H1LB 3HQ4O 5CVEA 1UBHS 2AGVA 3H2YA 2M6LA 1U5BB 2BFOA 3OTQA 2QWXA 3SAJA 4CHGA 2FZKA 3DOHA 2NOAA 3NI2A 4X66B 1GZ4A 2O48X 5BN5A 4NSNA 3E1GA 1XWFA 1W73A 2OV2A 2YINC 2ZUCA 1K7CA 2C97A 4K6HA 4Q1BA 2M6KA 1X8KA 3UJ9A 3ZLUA 4EW1A 1GNRA 2H0AA 1T6YA 2I66A 5FTWA 4HUTA 4H60A 2V4MA 4U2DA 2QE7D 1UJ5A 2FN9A 5TVKA 1DC4A 1X80B 2ODPA 1DC6A 4MJ3A 5CCDA 2WU4A 4BO1A 5IZCA 1S4QA 3PCTA 1V8PA 3L6DA 4OKSA 4XX1A 5JCOC 5G41A 5KYYA 2HBQA 3ZCPA 4BZWA 5C4IA 4YAEA 4DCJA 1CUDA 3TLGB 1MHTA 1FRZA 2V8OA 1DCFA 1NXXA 1DBRA 2BJHA 2H0RA 1IOWA 2P3SA 4NE2A 2GPBA 5J40A 3HZZA 1PR4A 4I5FA 4R9SA 5TEVA 4DBLC 1V5FA 1TMKA 4TTPA 3ROZA 3IJEB 3C5CA 2VWHA 3TEJA 4PLGA 1FF9A 3DV0B 3HK2A 1UBCA 5FAXA 4IH1A 3PD0A 3LFHA 4FSDA 1D5WA 1B6GA 4KB5A 1TT5A 5AM2A 3K2QA 4EB6B 121PA 2NAFA 3LG2A 4XSHA 2CXQA 3Q7RA 3OPYI 5GONB 4CHTA 3D4NA 4RKRA 1F8GA 3MT8A 3JVVA 4XIYA 4MDYA 1AB6A 5IC5A 2IF2A 2HWWA 1DFHA 1K3TA 3VR6H 4A0GA 1YONA 2G9QA 2R8XA 4G63A 3H5IA 4RDHA 1XTUA 1BDHA 4BO5A 1B6TA 4A2PA 4RZ2A 4E70A 3LV8A 2BFMA 3ZIAD 4F1JA 4Z7QB 5HQ3A 4Q1VA 3NBKA 1P39A 2PKRA 1CDEA 1VBFA 2H5JA 1I2BA 3GOQA 1O7JA 3E35A 4HGQA 4M1ZA 2F1JA 5EMNA 3L7LA 4CIAA 5DNCA 2P6OA 2PLWA 3O8RA 1X3LA 4FSXA 4IDHA 3CNQS 5EXTA 1SQGA 3K70D 3GC6A 4WEOA 4EELA 4ROSA 1TVKA 5GWXA 3V7FA 3S8EA 1JHUA 1NNUA 2P75A 1GPJA 1XELA 1QC5B 4KIWA 1E3WB 2JKVA 5BV0A 2R9VA 3FH0A 3WWDA 4ALNA 2R1UA 5JO0A 3P9QA 4UE3S 1B2RA 3O75A 3FFXA 1JH9A 3DOEA 1BOFA 5AQEA 1JQJC 1AXRA 3I2FA 4JNKA 5C5DA 5K8CA 4C0KA 4X8HA 2H18A 2ZVDA 2P41A 1BVUA 2PUTA 4F72A 1JKMA 1HC7A 4J4BA 1H9AA 1JMVA 3ZUPA 4GE0A 1U9JA 4L4SA 2GILA 5CBKA 5G1PA 3HB1A 4FDLA 2FEAA 4M0LA 2B9VA 3UENA 1AIPA 1YH3A 3AK4A 2JH9A 3VDXA 2XUGA 3NHRA 3DOOA 4O2AF 2XUZA 3CEPB 1MP0A 3O2NA 4FFNA 5AKGA 5ANRB 3HZRA 1S8FA 3RC3A 2YWDA 3VO8A 4Q3CA 1VSQA 4FFRA 5BV7A 3HC7A 3VUFA 4DV4B 1YFKA 3SJCA 3O03A 4ZMRA 2CMKA 3MQFA 1R16A 5HHTA 4Y1GA 1L4EA 2ORWA 5CU7A 1IG0A 5GVRA 3PBKA 3AEXA 3ZWAA 1NU8A 1XXHA 1PQUA 2X2FA 5HBRA 5K8UA 2P1ZA 4HB4A 1GGFA 2OHVA 2P90A 4YRRA 1NW6A 3ZE1B 3P9CA 1U2GC 4J2OA 2NVWA 5KYXA 4EFMA 1U0JA 4LY0A 3AO0B 4PLWA 2W2NA 2ZSKA 4WDRA 4N8EA 1F2TA 1JKJB 1XJCA 3DULA 3Q0TA 4M9CA 2Z2ZA 3CONA 2XEXA 4EABA 4M1OA 3FCEA 5EHZA 3TL3A 5I3ZA 4R84A 4DR7B 1E61A 5EZYB 4ENRA 1A9YA 1C9EA 4C05A 3UJ7A 3WG9A 1ZOLA 1J8VA 4U3JB 3ZU3A 1GCIA 2CGEA 2XQGA 5IASA 2IYXA 1O8BA 1KKMA 2FX3A 1U9CA 2NVOA 3SC4A 1OI4A 3OPMA 4CKBB 3OJEA 1YCDA 3MJRA 4ZODA 4F9EA 4IDOA 4HV4A 1GSOA 2ZSAA 2R68A 2Y3IA 4QYWA 2NG1A 1WCYA 3R3UA 1IAQA 2B35A 1HLDA 5HCIA 1XMOB 3S3TA 3MWDB 1RYDA 3SX4A 1VYVA 3FDIA 5DPMA 3O5AA 4RTSA 3IIJA 1EWQA 1FLNA 4G0WA 1KERA 3NKLA 3PXAA 1QGZA 2EERA 4PLVA 3SN6A 3X1MA 1DUSA 3EDMA 4HBGA 1V6AA 1W88B 2I8AA 1DKPA 3U3JA 3RYCA 2BTEA 5KVQA 3YASA 3LYLA 5C3MA 2H9YA 1GYRA 4FU0A 5H02A 1DTSA 2OQVA 4GZMA 3M2PA 4CKWB 2HA4A 2O7NA 1PVOA 2JCVA 3B3FA 3AOEC 1UBEA 3I01M 2WWRA 3NJRA 4GZ6A 4EM6A 4EGJA 3HL4A 3T1TA 3UMJA 4U2CA 2YC2C 3L5KA 3T5TA 3G5TA 3DCJA 1VKZA 3F5SA 3H8WA 3KEMA 5EUCA 4YB8A 1EFVA 1XG5A 1H42A 3HEAA 3TL6A 3TNFA 2Z58A 5JCZA 3CCCA 2IZOA 3D1VA 2JGNA 4URXR 1CZKA 3JZMA 3EXHB 4LKRA 3A6GA 4NEQA 1EM6A 3Q7IA 2ZBGA 3EMBA 2I3ZA 4XVQA 3OF5A 1RJWA 4JI7B 4F11A 1KK0A 4JYMA 3UMGA 1R6BX 3I12A 3RCBA 4L74A 2WSSD 4LY9A 5IXYA 1JPUA 4NARA 4QASA 4J6EA 1SUSA 3FGNA 3THXB 2QRKA 3AP1A 3HYTA 3ZU4A 4BWYA 3AC0A 5KPJA 3Q9NA 1L7AA 3WMGA 1IVSA 2VRBA 3RRXA 1E79D 4MW5A 1DKRA 2SKEA 4GC5A 2W71A 2AWNA 2IYTA 3CW2A 3RWMB 1P2SA 2OV1A 2ZR8A 5EG5A 4MWGA 4GW3A 5CDTA 1OJ7A 2B99A 4CU5A 4UD6A 1FRQA 3GP5A 3L9XA 2OAQ1 3BZBA 3OCCA 2HA0A 4J7XA 3IOCA 4TT8A 3HKEB 3PFKA 4X97A 4DDVA 4B71A 1W44A 3II6X 3LHFA 4RL6A 1BROA 2CXTA 4GKAA 4ABYA 1ZIYA 3GDFA 4IWXA 4HH0A 4QEKA 2IIPA 3OG9A 4C01A 2RK4A 5KU7A 4DPKA 4X20A 2LIVA 5JW6A 5TLSA 5HE8A 3STXA 2CT8A 1XJQA 3OEWA 2VDUE 3DJFA 4RWEA 5KX5F 2NO4A 2IODA 2XOKA 3OZGA 5JS2A 4UU0A 2O2IA 2WJ6A 5AHWA 1UXHA 3PL1A 1IHXA 2Y1XA 2XB6A 1CQWA 3R09A 4EQZA 2AJTA 2L19A 4UNPA 1F8YA 3BG5A 2RCNA 3HI4A 1H4VB 1CS0A 3M70A 4WZBE 4B6PA 3MTIA 1OGYA 1KP3A 4BJHB 3D3WB 4G8JA 4F97A 4KK4A 1U8EA 4Q00A 4WX2B 5COQA 1RAFA 2O0JA 3MC1A 3AONB 3B6KA 2B7LA 4A1FA 5DHRA 2JFYA 3A2LA 4Q5IA 2EW8A 3SYTA 1TF2A 1LF0A 1GUZA 1T5LA 2WF8A 3UK2A 2JGFA 3OQPA 5KMGA 1H5UA 4QOGA 2ZJ5A 2O8VA 3AG5A 3DLTA 3M34A 2CLSA 3U4MA 3SC2A 2JKYA 3TXAA 1CY4A 3OIUA 3LDFA 1Z62A 2O06A 4TTTS 1QIIA 2GYYA 1CR6A 3VVBA 1C50A 4ZCRA 1YR1A 3NHJA 1NG1A 3HN6A 3ASUA 5FTMA 4YRMA 3KE9A 5BOSA 1XTKA 4PPYA 4L4YA 3WDLA 4DMUB 2ZE6A 1UDWA 2QT1A 2OBFA 4UTXA 2O19A 3DC7A 2ZVPX 1QGYA 4RVSA 1RLTA 3A06A 1WDTA 2C82A 2EL7A 3NG1A 4Z8YA 4BAGA 4DM7A 3TLZA 1AZWA 1CY6A 2C96A 1JT9A 1QHIA 1GCAA 3HO1A 2AZDA 1LNZA 3K94A 3GLHA 4CV0A 5HCNA 1F38A 2AFVA 2BHRA 1EGQA 1Z68A 5D5HA 3PKIA 4A2CA 2QD3A 3RV4A 3K0KA 1P7VA 4CDRA 4BHTA 5J2TA 1USKA 3KLMX 2Q49A 3KOMA 4YRNA 3M4NA 2BFWA 1N9ZA 1U7PA 2ODBA 4RH3A 1KIFA 3N59A 5TT1A 4ECAA 4JBIA 2IK8A 4WBNF 2PKWA 2QN7A 3WICA 4KV9A 1LNQA 1N0UA 2CVHA 4A9AA 4BFSA 2I9KA 4LZWA 4P5PA 4MYRA 4CMHA 5DLQC 3U48A 4RZHA 4NZYA 4RX1A 3VHQA 3CRVA 4M37A 3WGQA 3EBPA 4R8KA 4HGYA 1LDNA 3K5HA 3FHCB 2VTEA 1Y34E 4QYIA 1V4NA 4ZO8A 4Q7EA 4K6GA 2KMLA 4Q82A 5KSZA 5LQAA 2JAUA 1P9RA 3D6TB 3WYBA 2WPDD 1TKRA 1XAGA 1CEQA 5DNEA 3ZEAA 3ZGOA 5CA1F 2X8JB 3EZYA 5A4DA 2BKLA 5JASA 4NNJA 2IIBA 1JIKA 4AZTA 3E84A 1YRWA 4DQDA 3KBBA 2BGNA 1FMCA 4I50B 4OI4A 3Q12A 4BNFA 4R9RA 3V1NA 1QWSA 4MHOA 2AJBA 2NXJA 3QEAZ 2IDZA 2R8RA 1SKUA 4LJSA 4C6TB 5K8TA 2IZ1A 1NW4A 3KVYA 3TNLA 3CVYA 4LYFA 2JI9A 4C3ZA 2VEOA 1ZN2A 3JATB 4ZO7A 3SF8B 5EP3A 2EEPA 1I1NA 4UUPA 1X94A 3RVPA 5I9TA 1U90A 3MNFA 5F2NA 4IAOA 5T4BA 1ZZEA 3AVXA 2AT1A 3T3PB 2D0OB 2OYRA 3VKUA 4B73A 2BELA 1GPBA 3D4BA 4HAIA 4QDKA 4WINA 3I1FA 2QS9A 3LX5A 2O3JA 3HTXA 4R54A 1LQUA 1LY1A 4CEJA 2QMZA 5BNFA 2G77B 1FK8A 3P27A 1Z08A 3KCNA 1SQSA 1D8AA 1JDBC 1O97D 2QJRA 3IVXA 2B3TA 1VIMA 3EC2A 3QKTA 1XDGA 2ZUTA 1O5IA 4U5QA 4ZVLA 4CUZA 1E3LA 2OOSA 4I1UA 3UGTA 2DKFA 2HF7A 4ALKA 4FBMA 4B8ZA 2ZS7A 3D81A 5HZKA 3WGZA 2NV2B 4HAUA 4EVQA 4J91A 1W2HA 4OBXA 1KMHB 1TMGE 3BGDA 4NYIR 4KKXB 4GEGA 4D4LA 4JJKA 1EUYA 1RPJA 4B74A 1KO8A 4C2TA 2FQYA 4OY3A 3DZCA 2IYFA 4AS1A 3EAQA 1PJBA 2W2XA 4F60A 1V6SA 5AUQA 1NV8A 2IQIA 3QEMA 3EXEB 1MO2A 5CDYA 4ILKA 4XYEA 3PNYA 4MEBA 2W48A 4H16A 1D4FA 2QLMA 4PS0A 3O4FA 5IW8A 3K35A 2XGSA 5C8YA 2QD1A 3SZMA 5JHGB 1N8SA 1KI9A 3PLRA 2JIDA 4AKIA 1KNXA 4QTTB 1RM5A 3KKKA 5TEWA 3RTGA 2ZSFA 4Z3DA 4DQKA 4HEQA 3L8HA 4PRYA 4IGIA 1IHPA 4C78A 2JFBA 4S35A 3OIYA 1T4MA 3R6LA 3V3KA 2HA2A 4JU9A 1IIBA 4JLSA 3ISVA 3OLZA 3ZCUA 5BXYA 3HU5A 4Q1EA 2P7IA 4TTSA 3I5YA 4RGQA 4US2R 1XE3A 3N0XA 3TCNA 4EB8A 3ANLA 3OJLA 4LVUA 3HWWA 5BORA 3C6YA 3EBLA 3LHDA 5DCUA 4B7UA 5ALXA 2Q5EA 4MCJA 1PEYA 4N5MA 3RHTA 1SC1A 1Y4DE 4MHSA 1U9YA 3MUOA 4AY3A 1VA5A 3OPXA 2WT4A 1E89A 1USVA 2HLDA 4AN1A 2QTWB 4QLAA 2AC2A 4YQYA 1T5DX 3SNHA 4BL5A 3RYCB 4JL8A 4QNMA 4EHNA 1KYZA 1YR8A 3TOXA 4XWWA 1W0KA 4PBTA 4ZN6A 2OA0A 5FWNA 4DR3B 2O59A 1C4XA 1PTJA 3GEPA 1MGOA 4Q7QA 1AS3A 2UUBB 2HJVA 1BXZA 2O0KA 1U9ZA 3LC0A 5AM1A 1COZA 2FUKA 5ALJA 2J48A 2FKAA 4P3KA 2ZRLA 1CS4C 2FR8A 4NV1A 4OAQA 2VPQA 1PS8A 1W46A 3VZSA 1C3XA 1L7BA 4QNRA 2IHTA 3D5TA 5AHRA 3D0QA 3WKCA 4ZEMA 1EVZA 1YZGA 3GA7A 1QG2A 2MYNA 4II7A 4EYEA 4AMUA 5B3AA 3VA7A 1M1NB 5LMUB 3TL2A 3GX1A 4P7FA 2Q07A 1T3LA 4QPNA 4DWWA 1WTCA 3DTVA 1CZHA 1G16A 1UBTS 1QX3A 2HGSA 3HKBB 3QQ5A 4Y6GB 1SG9A 3RS3A 1J9GA 2X9LA 2R8PA 1U2DA 3H2KA 3I4LA 5I7WA 4H0CA 4HWGA 2FQ1A 5ALKA 2I2WA 3DT8A 1L4FA 1PNQA 1F2UA 2IUTA 2VBFA 2X7XA 1XTBA 2R7LA 2YV4A 3MUNA 3PG5A 2ASVA 2CJYA 1E1RA 3NT5A 3STUA 4BVBA 4FI3F 3KXIA 4K9DA 1JJIA 2PT5A 3I2YX 2OZLA 3IVMA 3M3PA 1JEYA 1E3IA 1ZVQA 2B4RO 2I99A 2XX3A 3H2JA 3G5UA 3C8ZA 3OO0A 1GR0A 2PFSA 3PCXA 2AW3A 3CEMA 4U2GA 1HOXA 3T0FA 5C7LO 5FT9A 3CE6A 3PUKA 1B6RA 1ZM7A 4JR0A 5JAUA 1DJNA 3VZRA 4JA2A 5K8JB 2WP0A 2X5OA 4FMBB 1KR5A 3L01A 3TW0A 1CUXA 1EQUA 3E58A 2ZREA 5A0TA 2B78A 3OC6A 1QG6A 4TWAA 1DAPA 4K81B 2PPVA 3ENZA 3R0ZA 2WUFA 1U2RA 3L79A 4KPUA 2QRPA 2QYSA 4DLXA 1Q1NA 4WT7A 5TVGA 1T3SA 4OSEA 4WOJA 3U3KA 4YT8A 2XSZA 4ZANA 3FHLA 2TSYB 3WRXA 4H35A 2O54A 2B1IA 1EA5A 3JCZA 5AHXA 1ZQ1A 3V7YA 4E22A 1QFJA 4XYMA 3OE1A 4A8JC 1OH5A 2CCGA 2W93A 5EE5B 1UINA 2W6IA 4CMEA 2V54A 3FPHA 3IQGX 4KO1S 1P80A 1U5CA 4X92A 2ODEA 2W8BA 3PEFA 4FJ2A 1G18A 4C1NA 1N25A 4YASA 3FSEA 4MRMA 1XL1A 2BH9A 4GOND 2R0QC 3QJ5A 1EFKA 2XR1A 3HU3A 3RTAA 5ELLA 1CR0A 1L6IA 1HDGO 2M2IA 5IAGA 3TQCA 2OGSA 1O9GA 4QUIA 3HJGA 1VLVA 4W99A 3TLJA 2PO7A 4OXQA 4P2BA 5E4YA 1X42A 1TYAE 2X0FA 4P98A 2BFFA 5DYYA 3C7CB 4M2LA 3STVA 2ZIFA 3D7RA 1GGKA 1PYGA 4IXNA 2QE7A 4CXMA 3GNSA 4DV5B 1JA1A 1GV1A 5J23A 2PTHA 2CNLA 2QM8A 5BOSB 3OLYA 3ZZUA 2KQUA 2HRQA 3L6BA 3QU9A 3EXFA 2XZTA 5JNLA 2PE5A 4I4TB 4NTZA 2IYPA 3HXQA 3HYNA 1LB1B 4XASA 3DB1A 1DO8A 2QVXX 3SSNA 2J9FB 3ZK7A 1F8UA 1T4BA 4M89A 3TQIA 3TSWA 1C3VA 1B76A 1ZICA 3LGAA 1O6BA 1Z0AA 2G5PA 2WJHA 3AUYA 4GYWA 4KQWA 2DGDA 4YMWA 5KJCA 1YK0A 3OQMA 3GLHB 4WKOA 5CCEA 2XA1A 2VNHA 4PC3A 1B41A 3U40A 1QZUA 2F90A 3TD6A 2IYSA 4Y2QA 3EVFA 1HV8A 2VDQB 3TLEA 1RHQA 4BN5A 3WWPA 2BE7A 4HNTA 2Y0PA 4L9RA 2ZI4A 1X1DA 1CRQA 4RJJA 4FKZA 1MNAA 2F1KA 2HPVA 1NBAA 4JIMA 4M0MA 1EP9A 3KNZA 2IWHA 2G7MC 4B1FA 1BDBA 5LOVA 3BGVA 4J3JA 4QYIB 2NLOA 4REOA 4AMZA 4FZJA 4C4ZA 4UPEA 3T6KA 3K1TA 4K9PA 4ZFNA 2Y05A 2GCIA 1O03A 1SHUX 3H1PA 1F14A 2WHPA 1M8PA 1SIBE 4I4NA 1CIPA 2C1ZA 2P6NA 3HA2A 3MQ2A 2QIPA 1DTWB 4QDOA 2C4VA 4MEJA 4ZCSA 2VF8A 3SYKA 3NGLA 1KTVA 4DXDA 3FUUA 3TMAA 2XE6A 4PFKA 1Q74A 3UA4A 4Y8VA 3OCUA 2XVZA 1KZYC 4GQIA 3U4GA 2C00A 3OOEA 2XVAA 3DMFA 1SRQA 2VC2B 4FT4A 3ICWA 3HRHA 4WJKB 1H3FA 1AMOA 3R5FA 3VOBA 4N9QA 2Q3CA 3VO1A 3VV2A 3ZE2B 3SKVA 2R7NA 4EEXA 1Q0HA 1XF1A 3K4PA 3ZG6A 3QX9A 1CRZA 1EXVA 3B5IA 3VZBA 3KTAB 2VHZA 2Z5LA 2ZBDA 5EXXA 2P1DA 3IQDB 4OO3A 4XEHA 2FV8A 5FLYA 3QPWA 4UHEA 4BC0A 1RXVA 4GMFA 4IJMA 4JJ4A 4Q93A 2CSXA 4G5SA 1SVUA 1ZK2A 4F93B 2GT1A 3IHKA 3QQPA 1NQXA 3F8TA 5TIIA 3P8ZA 2VZ0A 2P27A 1VC2A 1QF9A 1F20A 2KX7A 5H3HA 1K27A 3JVIA 4FR2A 4R1QA 4AJJA 1QB7A 5AK4A 4R2WA 3DDUA 3GCWA 1KK2A 3LY5A 1L1RA 1NXVA 3V8RA 3KSUA 1FQKA 1GY8A 1JLKA 2IRWA 1XVLA 3MOSA 3R4CA 3GFVA 4IRXA 4M0KA 4UNQA 5EIWA 5CFRA 2VUSA 3JTMA 1YE5A 2EJBA 2LIPA 3M4ZA 3NHYA 3O8QA 3ZJ4A 2I87A 1ES9A 3NQ41 4WW0A 5JO9A 5DYGA 1UDXA 5C0OE 1UDAA 2A67A 4DM3A 2BI4A 2H17A 5I8PA 1G8HA 5TRTA 1TEZA 4OGLA 1QLJA 4OQDA 4UPDA 2A5LA 2AOTB 3A9RA 5FLEX 3UG7A 3TLYA 3ZVKA 5E2AA 3QEMB 4C1BA 5IANA 3QXCA 1FP4B 4PSCA 1NR7A 3D6NB 2VOEA 2ZIZA 4NBUA 4R2JA 4CVNA 3DW1X 4P4NA 1G1MA 1F3LA 2DYKA 5E6RB 4TXJA 3PEYA 5C1BA 4QJ3A 4H15A 2R1ZA 5C8YB 2C9DA 4EDFA 1SVOA 3ADBA 2ZXFA 2Z08A 1QAQA 2ID9A 5I9NA 4C89A 3OBIA 4J0EA 4YQEA 2VZ9A 1SJ9A 4DV0B 1G8MA 1E6CA 1KH3A 1EZ1A 3QMMA 3LF2A 4FONA 4F0JA 5HRUA 4QAQA 1JVBA 2VDLB 3ZI4A 4YPFA 1IE3A 4MKHA 4KZPA 1PE0A 4XPIB 5GOZA 1ADJA 5FFFA 4WNCA 3L4JA 1HL7A 1Y8QB 4X84A 5T6BA 1WUTA 3CUSA 1NP7A 2JIZD 4NZNA 3C5HA 3ER8A 4JI3B 4K6CA 2D06A 5KOYA 1I1OA 1YKSA 2CN1A 1F2DA 2Z4SA 3LQ2A 4RH1A 4W4TA 1ETUA 1MJFA 1ZJWA 4LF7B 1V47A 3AVTA 4CKCA 3BCRA 1U0FA 4FKMA 3IFSA 3UK7A 4MXDA 5ALTA 2FPIA 1TKBA 1CUVA 3KKMA 4QA9A 5FYQA 4HRAA 4IGKA 1QRUA 1SBZA 1XALA 4JQYA 3L0SA 2REBA 1X1EA 3ZV5A 3UCFA 1GA4A 3FB4A 3T9CA 1S8OA 2B2CA 4IMJB 1PL7A 621PA 5IWCA 3EPRA 5B1DA 2EYUA 3NATA 4ZU3A 4R1UA 3DZJA 2PSFA 2ZJ0A 4R4JA 1ULAA 4KN6A 5A4MS 4EHHA 2B1RA 2FFBA 2YCBA 4DMGA 2GO1A 3JRXA 3UTDA 1V1JA 2JAXA 2O7SA 4RMGA 2HCTA 3LM8A 5EJIA 4GI3A 1Y98A 2GM3A 3DBIA 4YMIA 4F6RA 3TTVA 3WLRA 3SZOA 5H16A 1RLOA 1ZH8A 4ZQIA 1FCJA 2K7ZA 1TFUA 1SVLA 1T9DA 4TWZA 5JMPA 5BSWA 3RODA 5FNVF 2EDCA 1WXIA 4FC7A 1NNI1 1CV2A 2ZXEA 1JBEA 2ERXA 3IDAA 4JSYA 5ED0A 2O50A 2WSSA 3MTBA 5TMEA 3OJ0A 1N7IA 1F2UB 1H4SA 1DQYA 5SZIA 2G6TA 3Q9LA 1ACLA 1SBHA 1SUAA 1LBEA 4A2WA 5FPSA 4YDHB 2PUCA 3BL8A 5I9MA 5E4FA 5EJ5A 1E79A 1EI9A 5FCDA 1EUZA 2YWGA 3RS2A 1UMCA 2Y1DA 5AVYA 2X5XA 2LKCA 1N77A 5EWJA 5AW9A 2QQEA 5B7GA 1LBQA 2DLDA 3DSRA 4F4JA 1PHRA 3KTFA 4FX2A 2OUIA 3WBJA 1HO3A 4V02A 1S1MA 2P9YA 3KHSA 3O4IA 1Y42X 1HH4A 3Q8WA 3UM9A 5ITZB 5BUQA 4RF4A 1VE1A 2BN4A 4L3WA 2YYZA 2WWFA 4M7WA 4WZBA 3IE1A 1L3IA 3F96A 4FIDA 4MWBA 4XVRA 1N2OA 2H4JA 1AGPA 2JCXA 4MLPA 5FUBA 3DR3A 2HWKA 2ORVA 2WD7A 3CN7A 5DHAA 2I6GA 4ZVMA 4TYWA 4G8CA 1T9GR 5FBWB 1ZAKA 3UKOA 5IKXA 4LX0A 1E0DA 2B7BA 3JQFC 2R00A 4KPUB 4UVHA 4ZI2A 3CN9A 4AG3A 1DRKA 2XMQA 4HQRA 2D59A 4F4DA 4B5KA 4H4DA 3RREA 5CHYA 4HTFB 2LDXA 9LDTA 2QXYA 5KIAA 4NBVA 2F9LA 2WJPA 3PRKE 3WK8A 3K8OE 3ZWDA 3N6XA 4F9TA 4KXMA 3B1WA 1YNSA 2Y99A 2AH5A 2BRUA 2C5SA 1Q3TA 3OCJA 3GG9A 4K2HA 4OXXA 1DIOB 1NVMB 3U61B 5F3DA 1J0AA 1P77A 2GHIA 4MRRA 3T7RA 4JDUA 4MRMB 1FP6A 3ZIUA 3RIMA 2FX2A 2VXYA 4CL0A 3L04A 4UC0A 5EE3A 3GELA 1JE0A 2J59A 2O3UA 1W25A 2Q1SA 2YVLA 3LLMA 1JFFB 4KUHA 3GJ4A 1XL0A 2OUKA 3E2IA 1DC5A 1XKLA 2G9VA 1MJGA 1UOOA 4JLMA 4JQSA 2HH9A 4J16C 1VHJA 4U9IS 1ZJ4A 2QX6A 2FQWA 3G0IA 3HMQA 2Q4EA 2QRVB 4FNOA 5E9AA 4WNAA 2BFFB 4HS9A 5DBIA 5C1IA 4EQ6A 4YMTA 1Z45A 1R8YA 2GZ3A 3COJA 3DDNA 1D2MA 1UPTA 4FE3A 3DEZA 5AW0A 4PZPA 2P9CA 1PL8A 5IT0A 1FYDA 4K6OA 1E5TA 1GUAA 3E3NA 1SBQA 4UCFA 1BJTA 4DBZA 3E0QA 3HGTA 3SQNA 1A4RA 1M76A 4RF3A 3V8MA 4E5KA 2ZWIA 1SHJA 2IIQA 3QY9A 3TAUA 4X6LA 1CHDA 4GG1A 4CM4A 1GTSA 3VPDA 1UKAA 5JC8A 2J31A 2N1MA 3QBEA 1X70A 3LYAA 2VWPA 3ZJYA 4R69A 2KSQA 2P5YA 5BMVF 4WBXC 2YWXA 4BFYA 2VHCA 4AJOA 3ZDAA 3COZA 5JYEA 4FYIA 3D8SA 4XVHA 4U1RA 5DASA 3AR8A 4R1SA 2R79A 2GZRA 5LP6B 1SIWA 2II6A 1NVKA 1E66A 3S2GA 4DB2A 4ZAVA 2Y93A 2A9RA 3BIWA 1G8SA 1RBMA 3ETDA 1GXSA 1VFNA 4J7UA 5DJ5A 5T8KA 2VUIB 4O2AB 4GOJA 5KBYA 3F3MA 3N2EA 4KE6A 2WIFA 1YIDA 2C95A 4ZQFA 4HMPA 3TRIA 2GA9A 1T2DA 3KJEA 3ZGXA 4WXRA 2C94A 2OZPA 3E7XA 4IOMA 4XCXA 1BCSA 3L4BC 1UC8A 4Q4HB 4D7AA 2RHTA 1ZBDA 3HNOA 1VLJA 3AYXB 1YL5A 1Z35A 2WPDA 3R9IA 5LLTA 1P2DA 4N41A 4Y9DA 2C83A 3FPSA 4ENVA 1AUQA 2XTJA 5TXGA 1W93A 2Y1GA 3T34A 1R5OA 5CM8B 4YTEA 3GLIB 2A5JA 5ALOA 3RFCA 1PEAA 3PQ6A 3VGPA 3WY9A 4DQVA 4MRAA 2N9UA 2WWHA 3D5QA 1XT6A 4HH1A 4KI7A 3TDKA 3WYGA 2ZIAA 1ILEA 2IHZA 2I1LA 4CKEB 4F8EA 3JQ8A 1NR5A 1WMFA 5A4IS 1DXHA 2PZ8A 2OXEA 2YWJA 1KR2A 3CF6R 1ZJZA 3STHA 3TQQA 3V46A 3HWSA 3TRFA 3PPVA 5KYWA 2UUOA 1MB3A 3A4VA 5D84A 4B40A 1ST3A 1N8TA 2Z8YA 1T26A 4N76A 2QMOA 1TC2A 5EMKA 3ROPA 4PRZA 3UAZA 3PXGA 3RRBA 4OPMA 1M2JA 1PFUA 4Y1EA 3KQLA 1LWOA 4G07A 1RLMA 4X6YA 1HR0B 4PZLA 3SBXA 1R6UA 4LZLA 3VR4H 3WKAA 3ZWKA 2BOVA 1PF7E 3E18A 5AW3A 1JSXA 2QSUA 1XQXA 3HFGA 4MMYB 4KDEA 1S7CA 4KPFC 4HLUA 1PT7A 4QDJA 2DU8A 1CQIA 3SVLA 3VZCA 3G23A 1YNOA 2BBTA 1IN6A 3H86A 1FSSA 3RRZA 4BQPA 4NRDA 4MCAA 2NACA 1ECJA 4D8TA 3KKQA 3W4KA 3D3QA 4MB6A 3TJZA 5E6SB 3ABZA 1NMEA 2PR2A 3DBLA 4UAJA 5CK4A 5BY2A 4CIXA 1QOQB 1JI3A 1B7GO 1LSSA 1D4AA 2GBIA 2WJ4A 5AM0A 4E46A 1O4VA 3AIOA 2V6MA 3U37A 4AY6A 2O3TA 4REQA 2IUUA 1P45A 2WYOA 5DI3A 4DLTA 5A5DA 3BMXA 3OE7D 4LVNA 2JNWA