5F1OA

Human cd38 in complex with nanobody mu551
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
248
structure length
241
Chain Sequence
TWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIHGSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
publication title Immuno-targeting the multifunctional CD38 using nanobody
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 241
sequence length 248
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 5f1oA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5f1oA02
3JQDA 4J2OA 5IDWA 1Q1NA 4RVDA 3KLMX 3TOXA 3B1JA 1SB9A 4DGSA 4IY1A 3JQ9A 1MUUA 1R0LA 1GUFA 1NFQA 1H5QA 1VRWA 4XYBA 1C14A 3RBZA 1NPTO 5DF1A 1I01A 5AVOA 3M1AA 3B6ZA 4JNKA 5KJ1A 1NVTA 3TWOA 3BMNB 1X7GA 4FOSA 4B7UA 4E2WA 4K6CA 1PJQA 1Y1PA 2H1SA 3A06A 4XB1A 3DZKA 1C1DA 2FMUA 5MGBA 2LDXA 1E7RA 3W8EA 4R1UA 3HG7A 3H9QA 5I9MA 3UAGA 5EMHA 1DHTA 3CZRA 4O0LA 3KV3O 3F1KA 1ZEJA 4BGUA 3KYDB 4XCVA 4ZQBA 1HZJA 1GCUA 4BUCA 4AJ1A 4ND3A 3KHUA 3GQVA 3BAZA 3NGLA 4IXTA 1N7HA 1U2GA 1TVEA 3UW3A 5G2OA 1M67A 1E3WB 1WWKA 2PK3A 3D0OA 4J90A 2POQX 5DULA 2O3TA 3WWZA 3EK2A 4J91A 3A4VA 5DBIA 1Y5MA 4GBJA 3WQQA 5BQFA 2C2YA 1GQQA 1I5RA 4OOFA 1A71A 4D44A 4G2NA 4ALIA 1TT5B 4WECA 1KY5A 1YDWA 2HRBA 4ID9A 3T4EA 3WMXA 1ZNQO 2R00A 2P9EA 2UVDA 2HO5A 4I08A 3K73O 5AXDA 5L4NA 1MFZA 1XHLA 3KLPX 1BHSA 2BMAA 3PHJA 1J4AA 5DZSA 4WNCA 3GAZA 5KJEA 1CJCA 1IPEA 1L7DA 1V3TA 2PTGA 2UUOA 3L4SO 1ADCA 3ZH2A 3D3EA 3FNEA 4LK3A 2W2LD 1LTHR 2A92A 1Y5RA 2V7PA 1P9LA 3AU8A 2PD4A 3FR7A 1ZK0A 2P4HX 2HRZA 3AWDA 1GFSA 4BO2A 1HDZA 1LC3A 5A05A 2Q3EA 1NVGA 1T2CA 2GPTA 2GR9A 1JDJA 2J3JA 4W7IA 4M54A 2PFGA 3NGXA 3EGOA 1E6UA 3UN1A 1MV8A 2EW8A 1GUZA 1ZK3A 3I23A 3NTQA 4NBUA 3RU9A 2J6IA 1M75A 4GLLA 1PJCA 3IQDB 3EMKA 5TNXA 3TOZA 4Q3AA 3E1KA 3JQBA 1NHGA 1ISJA 3UOGA 5LC1A 3MWEB 2RAFA 4Y6RA 5HS4A 3ETEA 1QYCA 3M1LA 1NQOA 3SC6A 4CPDA 3PHLA 3NDIA 4JGBA 4XWYA 3TF5A 4R69A 4UUMA 1MP0A 3RJ9A 5DOVA 1ML3A 3E18A 3LC2O 3K8ZA 3S55A 1NBOA 5CDTA 2A35A 3D3WA 1HXHA 1EZ4A 3AOGA 3LYLA 5B12A 1AN9A 2AMFA 2Q50A 1Q7BA 3KYBA 4HP8A 4E21A 1W0CA 2B0JA 2AXQA 2OXIA 2QQ5A 3PJDA 2RH4A 2ZB7A 4OM8A 5T57A 1UP7A 1PJBA 1JWAB 1X7DA 2X8LA 4E5PA 1PL6A 4AJJA 1PZHA 4P22A 4BGEA 2ILTA 5L9AA 2NSDA 1W8DA 1GV0A 1VSVA 3DC2A 3WYCA 5T64A 2W8ZA 2OMEA 4RVFA 3GVXA 4TQGA 2QZZA 4GGPA 1EE2A 1Q7CA 2E48A 4J6FA 3ZU4A 3KETA 4PIVA 1SAYA 2VTEA 3D4OA 4CM4B 5JAMA 1E7MA 1ULSA 3RKUA 1Z45A 2D2IA 1A27A 4ZQEA 4PLTA 4Q3BA 4NJMB 5B4TA 3CSDA 2CF5A 5I7FA 2JFFA 3UCEA 2GN4A 2OORA 3B70A 5ES3A 2ZKLA 3ONEA 1L1FA 4IS3A 4Y9DA 3NEPX 4R54A 3OMLA 1B8PA 1O8CA 4CQLB 5B1YA 4NU6A 2ZTMA 2JD0A 1QSGA 4GWKA 1AUPA 1KY4A 3E9QA 3GNTA 5THQA 4BO7A 5ITWA 5L3ZA 5CAEA 3JQAD 1B8UA 5ENVA 5F1OA 3LDHA 2C5EA 4JBGA 4ZRMA 2PKQO 3O8QB 2YFQA 3DMTA 3ITDA 4NH4A 4KOAA 4OXKA 2GUGA 2HMSA 1GYQA 5JBIA 3PYLA 4Z9FA 3R0IA 3WGHA 2IDZA 2HJSA 1E0DA 2IZ0A 2B83A 5JY6A 3LC1O 4B4WA 3U3XA 4NU5A 1HKUA 5A04A 3RUIA 3W8DA 1DFHA 4P38A 4ZQFA 1XG5A 5L51A 2WD7A 2GO1A 3VTFA 2C54A 4W82A 4M89A 4W99A 3ZHZA 3FBGA 3VAZA 3WQRA 3GGPA 4MVJA 2OZPA 5EQFA 3IUSA 1N7GA 4O6VA 3HDHA 4ILKA 4QFDA 5K6AA 3QHAA 4JQCA 4EUEA 3JV7A 3BMCB 3P2OA 2J3KA 3CEAA 3ZNNA 3OETA 4B7CA 1B16A 2GYYA 1V3VA 2HJRA 3HFGA 4BNXA 3BTUA 1R4NB 8LDHA 1JVBA 4LVUA 4I5EA 1TXGA 5EQDA 5G0WA 3W4KA 2AQHA 4A73A 4CV1A 2HMUA 1KERA 4RVUA 4XB2A 2FSVA 2PGLA 3GVPA 3DL2A 4YAJA 4UREA 5G4KA 1I30A 5U1PA 3OJEA 5T8KA 1D1SA 2PY6A 3FI9A 3RD5A 1G0OA 2Y1EA 1R66A 3TZQA 4W9NA 1P1JA 5AQ1A 1T4DA 1WDKA 1I0ZA 5DCWA 3IKVA 4PCVA 1JAXA 1Y9EA 3R3SA 4CLOA 2PWZA 5BNIA 3MWDB 4XGKA 3GN1A 1ZXLA 4J7CA 1M66A 1LRLA 1HYHA 3NDJA 2V6FA 4WEOA 1MLDA 4WLUA 5ADHA 2X0NA 3C85A 3K2EA 4KDEA 4BMSA 1RM4A 3JD1A 4CLRA 5EINA 4URFA 4PLCA 3QW2A 1EVIA 2TMDA 3O4RA 3NRCA 2AE2A 5T67A 3PK0A 3DFZA 4EYEA 5C7IO 5TS3A 3FHLA 1OMOA 5COBA 4H3VA 2VNAA 3Q2IA 4RO0A 4BKRA 1R4MB 1VM6A 2DVMA 3H9GA 4YRDA 1HTBA 2JHFA 1XEAA 3I9OA 1B15A 5BSEA 1UUFA 4B3JA 3A1NA 4ONEA 5DOZA 3BXXA 2EKQA 4GVXA 5CDGA 1ZIDA 5DT9A 1ADFA 4R9RA 3U9LA 4IDBA 2C07A 1K89A 4KUEA 5CP8A 1WMBA 2YV3A 4G5HA 2FPGA 2AE1A 5BSHA 4B7XA 1HF3A 3WWYA 3ZWBA 1GPJA 1PZEA 3QLJA 2CF6A 3ZWCA 2D0IA 3A14A 4E30A 2B5VA 3CH6A 5K0ZA 2DAPA 1KVSA 1PGOA 1UR5A 3H5RA 1DFIA 3PWKA 3SC4A 5CEFA 2Z5LA 4BKUA 2NM0A 3H4VA 2OHXA 4HV4A 4I5DA 2VQ3A 2XF8A 5LCXA 4E33A 1F0YA 5IZCA 1HEUA 2YUTA 1I2ZA 1NYTA 1QXSA 1NHWA 2OL4A 2G82A 3TZHA 3NJ4A 2HUNA 3JQ8B 1XSEA 3G1TA 1GDHA 1BXKA 1MFPA 1LRKA 4A26A 2NVUA 1UDBA 4ZHSA 4FFRA 3JSAA 2I3AA 2X0RA 2GNAA 2VWQA 1T24A 3WFIA 3VH3A 3KSUA 2XOXA 3PLRA 3I9NA 1R15A 1D1TA 1DJQA 4EITA 4J4TA 4PZDA 3E8XA 3QVSA 4XYGA 5KIAA 2GGSA 3GVCA 3H7AA 3WYBA 5ILOA 1UJMA 1D8AA 1BDMA 4CM9D 1SMKA 3HADA 3TFQA 5C37A 1YRLA 4JROA 4LISA 5KJCA 4O63O 3ADPA 4IZIA 3NTOA 2YDYA 3QWHA 2DTDA 2EG9A 1ENYA 1DC5A 1F06A 3ZWWA 1QRRA 4YAKA 1E6EA 4GSKA 4C7KA 2DUWA 2F1KA 3VZQA 4XGNA 1PEDA 4YB8A 3RROA 3ST7A 3MJ4A 4WCFA 3DBHA 3GDOA 3GVHA 4JXKA 4A0SA 3KSZO 1BVRA 2V65A 4RPJA 5LDGA 1N5DA 1ZKMA 4NBRA 4J16A 1P1KA 4I1IA 4WOKA 3CTMA 2VHYA 4IIVA 2W4QA 3JQGB 4WE3A 3DHYA 2VZ8A 3I1JA 5DBFA 2Y99A 4FW8A 1CERA 2VT2A 3JD3A 4TZTA 2DBRA 2I6TA 3LT4A 2O7QA 4IGEA 4N5MA 4CM7A 3MOGA 3L9XA 3CKYA 2WJPA 4BQRA 1U3WA 1WXDA 1OAAA 3DZHA 3WTCA 3F4LA 3GA0A 1X15A 5L53A 4UULA 4LCEA 1UAGA 4KQXA 3AY7A 4WEQA 1S7CA 1HL3A 4E5MA 4QO8A 3KZVA 4PZCA 1BG6A 3D7LA 3RUFA 3PI7A 2Q45A 3D4NA 3DWFA 4A10A 3DMYA 4NNJA 4FFMA 2PH5A 1KBZA 4LMPA 4LRTB 3IOYA 3EY4A 2Q4BA 1YWGO 1IZ9A 2FP4A 1ZSNA 1LDBA 2FZWA 3IC5A 4L76A 4N7RA 4BO0A 3W6UA 2Q1UA 4B3HA 2Q46A 5T6BA 1YE3A 2VZ0A 4TVOA 2CNBA 2G1UA 2PD6A 3DBVO 2HQ1A 4FQ8A 4W4TA 1BSVA 2HK9A 2PZJA 1ZO8A 2FN7A 3AUTA 1NAIA 2VYNA 3Q1LA 1ZFNA 4TRRA 4YEDA 3PP8A 2CFCA 3ASUA 4GQAA 3ANMA 4CL8A 3QWIA 2BFMA 4FJ0A 5ICMA 2ZTVA 2E4AA 3KEOA 4PRKA 2C7VA 4MIEA 2FSSA 3FPCA 3H5AA 1XYGA 1DB3A 2IZ1A 3Q0EA 3QRWA 4CLDA 1MG0A 3HDJA 3RFVA 4CQMA 3PQFA 4RGBA 3PDUA 3KOUA 4WLNA 4DQXA 5JCJD 4YJHB 1C0LA 3HN2A 4JP2A 2I65A 4R16A 1UZLA 3GEDA 3AM3A 4OYRA 1PU2A 2VRCA 5IXYA 3ZW8A 5DDIP 2Y93A 5B37A 1EVYA 4NFSA 1F8FA 1DIGA 4MVJI 1SC6A 1PJ3A 3PZBA 2EHDA 3KRTA 1HZZA 4U7WA 4BNHA 1XELA 3L4BC 4HWKA 5T5QA 3S1LA 1MG5A 3TZCA 2CMDA 3OEWA 1ISMA 4P4NA 5A4DA 5F1KA 3F1LA 4C4OA 2JAHA 2VHVA 2O2YA 4UEKA 2QIOA 3EVNA 2D8AA 3RC9A 3WOHA 4PG5A 3AUUA 1Y6JA 2VHWA 2Y05A 4QSMA 2QX7A 3N74A 5BNFA 4TVBA 3UH1A 4OH1A 1YB5A 3KO8A 4GAEA 3WGQA 2PNFA 9LDBA 4K6FA 3NT2A 5CPFA 4CMIB 1EK6A 3G1UA 3O38A 4R68A 2PA3A 3PXXA 5IAAA 4UUPA 4D3SA 3JYPA 4QXMA 3GT0A 4TRMA 1PZFA 3VPSA 5TX7A 2Z95A 1ENZA 2TMGA 8ADHA 4BMVA 3DZFA 4UVEA 4YTEA 1PSDA 4YVFA 1V0JA 2RH8A 3E03A 1ID1A 2BHLA 4CMGA 1QG6A 4ZA2A 4XZ3A 2DC1A 4PZEA 5HM8A 3ZHXA 2ZYAA 2VHXA 4MVJG 1YGYA 3Q11A 1PJ4A 3E9NA 1VL6A 1T26A 3TJRA 3PYXA 3KVOA 1U5AA 1XR3A 3FWZA 4J1SA 4AICA 3ULKA 3WGYA 1MA0A 4MP3A 2BI7A 3FPLA 4CMEC 4FGWA 3VDQA 1CETA 1NM5A 3LU1A 4WJZA 3U4HA 2AW5A 2I66A 3DOOA 4YAGA 3RJ5A 4BNGA 3SXPA 4YPOA 3DZGA 4IDFA 2NVWA 2GD1O 3CMMA 4J49A 4HKTA 2O3JA 4UEJA 3BHIA 2X7HA 5DP2A 1B8VA 3VH1A 1X14A 4J43A 3GAFA 1LDMA 2X9NA 2X1HA 4WLFA 3UCXA 3OQ6A 2H5LA 4MVJD 4DLLA 3PJGA 3E6AA 3R1IA 4PGFA 1GCOA 5KJFA 1ISIA 5ILGA 1VJ0A 4MVJH 3JQEA 4AG3A 4KWHA 3PFWO 4IDAA 2RIRA 4BNIA 2XAAA 4FFLA 3E5MA 3PWZA 5A06A 4CUKA 4IMPA 1NFFA 3PJEA 4OSOA 3RQSA 1YL5A 3BMOA 3RVDA 4NJOA 3ZDFA 1ZEMA 2BGKA 1X1TA 3C1TA 2GZ3A 1HWYA 2OP0A 1V9LA 1P44A 1T4BA 1LSJA 4INAA 4RORA 2W2KA 1HSZA 3AI3A 4WASA 4Y6SA 5TT0A 1KEWA 2ZB3A 4Q3EA 2DPHA 2D1YA 2I99A 3PHIA 2IYOA 2CUKA 3DOCA 3OJFA 1P0FA 2V6GA 3WSWA 5CEJA 3E9MA 2Y0DA 3TFOA 2YJZA 1SOWA 3DQPA 4IJVA 4Q3NA 2PR2A 3SLGA 3OECA 5JDIC 1EBUA 5DP1A 1X0XA 4BGVA 5A9TA 2IEBA 5JE8A 4KQWA 4N5NA 3I3OA 2Q99A 3I83A 3ICCA 1EQ2A 5JO9A 4U5QA 4PG6A 4K9DA 3SVTA 5IDXA 5COAA 5JYEA 1XWFA 1YO6A 4D7AA 3ENNA 4YRBA 5JLAA 3PFFA 4IMRA 2YDXA 4O1MA 1JWBB 5KVVA 2DM6A 3OP4A 4BNNA 2B5WA 2B4RO 4CMBA 3U4IA 4KP7A 4DWVA 1DO8A 3DBRA 3KTDA 3UHAA 1EMDA 3WLFA 4QFCA 1XIVA 2PLAA 2XPCA 1GL3A 2XXJA 1YBAA 4DQUA 3NTRA 4CL3A 3UXYA 2FY8A 2IRWA 2IZZA 2B35A 2YHUA 3SJUA 4YWJA 1IB6A 3TZKA 3TDKA 5DN9A 1EEHA 4L74A 2OUIA 2X86A 4XYLA 4Z9XA 1Z75A 4B8WA 4CMJA 1LLCA 2VUTA 4H16A 4OKNA 1O6ZA 5JFOA 3ROMA 4RJTA 4Q3DA 3S8MA 3AJRA 1IYZA 3M6IA 1KVRA 4IJKA 4B4VA 5TGDA 4DPKA 3D5QA 2R6JA 4PLHA 3SJ7A 3V2UA 4BV9A 2UAGA 4DVJA 3C7DB 2BFAA 5A3VA 9LDTA 1N9GA 4YJFA 1YL6A 1E1KA 1NX6A 1FXSA 2FZEA 1GQYA 4D46A 2IEDA 3H3FA 4J0FA 2WD7B 3G3EA 5HTOA 1XKQA 3QV1A 3LF1A 2JL1A 1T2FA 2JCYA 3DBLB 2E82A 1PJLA 3JQFA 3ANNA 2VOJA 4J4HA 4Q39A 2W90A 3W6ZA 4NQZA 5IJZA 5IDYA 4EEXA 4YT2A 1G1AA 4II3A 5H82A 2HKIA 3KYCA 5BR7A 4J9UE 1KVTA 4J2HA 5A9SA 4MVJF 3HB4X 3PJFA 1HDRA 4JJFA 1VPDA 3DTYA 2PZKA 4M55A 3NDRA 4RZIA 2Y68A 1ARZA 4UVGA 4OXNA 3NKLA 3UKOA 3BIOA 2Y0CA 2EKPA 1PR9A 3JCZA 4BKOA 1RM3A 1Y8RA 4DIBA 3AOEC 4PG4A 2WTBA 5JCJA 1XLTA 1C3VA 3TRIA 5A3JA 3BMQA 1IZ0A 5G0UA 1KOLA 2J5QA 4AJIA 2YHIA 4KDFA 3GH3A 1KETA 3JD4A 4CLRB 5IG2A 3H9UA 5H81A 1O89A 4O59O 3DHEA 2CDBA 5DCUA 3QY9A 3ZWAA 4JP3A 3KSDO 5ICSA 2IE0A 1YBMA 4AJHA 1PGJA 1PTJA 1AHHA 1JAYA 3GZNA 3ZZNA 3UCFA 4EW6A 1ZK1A 3WICA 3WYEA 5KCZA 1HETA 2J3HA 2Q49A 1GAEO 3PIDA 1ZVMA 4ALLA 4R3NA 2QYSA 3PQEA 3NJ8A 2YQ5A 2VYND 1UP4A 4DC0A 1HDXA 4RZHA 1H93A 4DBVO 3F5QA 2EJVA 3W8FA 5JC1A 4GLOA 4NHEA 1C1XA 3RC2A 3NX4A 4IQ8A 3FNHA 3QVOA 1Z6ZA 5TIIA 4NZ9A 4KUGA 1YXMA 1CYDA 3NT5A 2NWQA 2QHXA 2C20A 4Y98A 4QT0A 4AFNA 4CQMD 2O50A 1LDEA 1LU9A 2H63A 4PLVA 4PLPA 3C24A 4RF4A 2EP5A 1F17A 3K30A 3WB9A 3KUXA 4GKVA 5IN4A 4LVCA 1JU9A 2A94A 4A2CA 2ZATA 2VRCD 3A28A 5ER6A 2IXBA 3TPCA 2DPGA 1P1IA 4FSHA 1O95A 3IAHA 2FR8A 4IDCA 4W6ZA 1VC2A 4I9UA 1IHYA 3DONA 4MP8A 5KNLA 3GNSA 2BKAA 4RL6A 3RFTA 2X5JO 2ET6A 2Y0EA 1LLQA 5AOVA 4YT5A 1RM0A 2NTVA 5TC4A 1A5ZA 4IGFA 3BMNA 3WMWA 3ZHYA 4R1NA 3T7EA 2P4QA 4B79A 3RIHA 3LZ6A 1PS9A 3OFSA 5IXSA 3VOSA 3C7CB 3ANLA 1Y9AA 1A4UA 1U3UA 4Y67A 2I5PO 3OA0A 3TQHA 3DAGA 3ITKA 4KTTE 1HE5A 3KYDA 4MINA 1D7OA 2UUPA 1A7AA 2CD9A 2DQ4A 4J9VA 3GRKA 2ZYGA 2WMDA 1DC4A 1EE9A 1HSOA 2O7SA 1GADO 1SB8A 2H9IA 2PKQP 3L77A 4TKMA 4DL9A 4DA9A 3F5SA 1E7QA 1IPFA 2D5CA 3PQDA 3RAJA 3UICA 1H9BA 2VTDA 2YQ4A 3VPXA 4I8XA 5IF3A 1DAPA 4Q3CA 2CVOA 2VWPA 4BIIA 1B7GO 2GN8A 2O3SA 2EGHA 3OJOA 1FDSA 1NQTA 1SNYA 2ZYDA 3X2FA 5COQA 3G79A 3ONDA 1NXQA 1LJ8A 3BHMA 4WLOA 3GHYA 4LSMA 1KC3A 4K28A 3JQ9C 4XA8A 4EI2A 2O2SA 4HNHA 4J1QA 3I4FA 1WW8A 2DBZA 4IIUA 1OFGA 4YBZA 2GERA 1ZJZA 1GZ6A 4CR7A 1EDZA 2NVBA 4E13A 4UVHA 5G0VA 1YB1A 4HY3A 3BHJA 4BV8A 5JDCA 4ITUA 1EUZA 1RKXA 3PGXA 2YV2A 3QVTA 1ONNA 3JQ6A 4LN1A 1DAOA 1I2CA 3GN2A 1E3LA 1YOVB 3KM0A 4XR9A 4J7XA 4E4YA 3MJEA 4X54A 2EIHA 3FD8A 1N1EA 5J23A 4RPGA 3M2PA 3HWRA 4XRRA 4G65A 5FEUA 3TL2A 3VKVA 3EW7A 1PQPA 3Q9UA 4F46A 3D64A 4J4BA 2X5OA 3ROQA 1DIBA 1Y8QB 4BNYA 4OXYA 2B37A 1WNTA 1OOEA 2EWMA 4XDYA 2Z1MA 3HFSA 3WGZA 2JJYA 4CLHA 1BW9A 1J0XO 3H6KA 1XQ1A 2CVZA 2JKVA 3H9JA 1UZNA 5ENDA 3BTVA 3IJRA 1A4IA 1E5LA 1PWXA 1Y7TA 4GX0A 3OSUA 4M49A 1LDYA 4CJXA 4BNLA 1H2HA 3CMCO 2GN6A 1HE4A 1ISGA 1FK8A 1R37A 5EERA 3ENKA 2R00C 4F6CA 2OBYA 5F21A 1RM5A 4RVGA 1GYPA 4A5OA 1PX0A 3I9JA 3DR3A 3HQ4O 2CZCA 3ABIA 3KB6A 1DIHA 1FF9A 1LQUA 4J7UA 5JO0A 1C0IA 3RUHA 3QE3A 5KKCA 3AM5A 4MKXA 2HCTA 1E5QA 3OF2A 3JQAB 3STHA 4FGSA 5JAZA 1IY8A 3PVZA 2JFHA 1GR0A 3E82A 4IM7A 1AE1A 2E37A 2UDPA 4BVAA 4CM4A 2UV8A 3DZJA 3S2FA 3WG9A 4YCAA 5EL0A 2ZQZA 3MZ0A 3C1AA 5TJ9A 1BMDA 3VDRA 4Q9NA 5AXAA 3WGOA 1XDWA 1TA4A 5JAQA 1H6AA 2DKNA 2Q1TA 4B8ZA 4DUPA 3OICA 4CQLA 3JQBC 3PHHA 2EGGA 5HWSA 1Q0QA 3CXRA 3HN7A 4PVCA 1HDGO 1LUAA 1N8KA 3GG9A 3JQ7A 2EV9A 4BO4A 3EC7A 5A9RA 4IQ0A 2BELA 3O8QA 4I9NA 3RBXA 2EW2A 2AG5A 5G0SA 3L6OO 4L73A 5C7LO 1I32A 3VHRA 2O4UX 3DFUA 3WXBA 1DBVO 3H2ZA 4FBGA 4IZHA 3EZYA 4PG7A 1NQ5A 2Y1GA 1FDWA 5JMPA 3DAFA 4I9HA 5JSFA 2WE8A 5ER9A 3L07A 1KS9A 4AL4A 1SPXA 1BWSA 4UVIA 2J3IA 2FPIA 1Z7BA 2NLOA 4OGWA 1EK5A 1LRJA 1C0KA 2XXBA 3FRJA 5L7YA 1K3TA 1E77A 1ZK2A 3BMCA 3JQCA 2V6BA 1QYXA 3WJAA 3ETGA 4YJGB 3WBBA 4BB5A 3GDFA 1LX6A 5CPBA 2PZMA 1KEUA 1CDOA 1R4NA 2CDAA 1DIAA 1EFKA 3WR5A 5FI3A 1M6HA 2CDCA 4NK5A 4CM8B 4OJNA 3WFJA 3ON5A 1P0CA 2JD2A 4OIMA 4Z3KA 1Z74A 4FR5A 1LSSA 2NUAA 3IKTA 2P91A 1XU7A 3AW9A 5JCXA 4OOEA 2PD3A 2QZ9A 4OMUA 4ZQGA 1U4OA 4CM5A 1I3MA 2FHSA 1DC3A 4ND4A 1PIWA 4JX8A 2EF1A 1NWCA 3DMTC 3ORFA 3WTBA 3K2BA 1BXGA 3T4XA 1U8FO 5ITVA 2G76A 3WGGA 5CG2A 4CMCA 3AFMA 1NR7A 2I9PA 3H2SA 4PVDA 3DO5A 2W2KB 4ROSA 1HYGA 2V6MA 4CM3A 2GZ1A 3HHPA 2GLXA 1DOHA 3LQFA 3LC7O 1R16A 1MX3A 4MP6A 2P68A 4L4RA 1ZZEA 1I24A 1E7YA 2OBNA 1R4MA 1QP8A 3MOIA 5BSFA 4HNGA 3OHSX 5K6AC 5HRUA 3ZWMA 1T1RA 3G49A 4LRSB 3TZ6A 1K6JA 3HE3A 2I3GA 4ALJA 4BO3A 3WGIA 3AUSA 6LDHA 1B0AA 1QR6A 3GC6A 4BKQA 5HA5A 1S6YA 1M76A 1GEGA 3ZNOA 1WAMA 2X9VA 3VH4A 4NIMA 3LT1A 1JN0A 2O3RA 4R1TA 1NP3A 4RCVA 2VN8A 3A9WA 3QP9A 4BO1A 2PGJA 4HFMA 5T8KC 4CODB 4XIJA 4QECA 2GASA 3IP3A 4BNKA 1VL8A 2WM3A 4W9NC 2VUSA 1FJHA 3NAQA 3WSVA 3FR8A 1U9JA 3ZWXA 3C8MA 2YV1A 3GG2A 4WCDA 5CEEA 3GY0A 1PWZA 1OBFO 3JQ8A 5I9NA 4FJ1A 4MKZA 1E7WA 3G0OA 3MJVA 4Z3DA 1ZSVA 1GUYA 1NASA 3PIIA 1HYEA 2LDBA 4JBIA 1BVUA 3D5TA 2WYWA 5H83A 4RQUA 1YS4A 4WUVA 3V5NA 3COSA 3I6IA 3FCOA 2VRBA 3B1FA 3GUYA 1I36A 4IDGA 1TT7A 1C1DB 4JLWA 3VH2A 5I7EA 1PGPA 4JK3A 4CV3A 3ZI0A 3JD2A 4BB6A 1U5CA 4E5KA 1H0KA 4ALMA 4IJWA 1HE2A 1V8BA 4DTIA 1G6KA 3RC1A 4M87A 1MC4A 2CSUA 1LXCA 5FF9A 1I3LA 3GDGA 3ZNQA 4U0JA 4RVSA 5JNLA 4PLZA 4YQYA 1XCBA 4BO8A 1YL7A 2QG4A 4S3MA 3PEFA 1EUCA 4MVJE 4YJDA 5K9ZA 2HMWA 3EVTA 3B20A 1PS0A 1ZXBA 3GPDG 2X58A 3GVIA 4DPLA 4TSKA 4LCJA 4N54A 4P8RA 4TZKA 1R0SA 4D0RA 3BZUA 2BGMA 3W1VA 4ESOA 4NBTA 3ZU2A 4ZRNA 1E3JA 1VE9A 4BQPA 1T25A 3GMDA 1BTOA 5IZCC 1LLUA 1DDOA 3U4CA 1P31A 4Z0PA 3INTA 2RCYA 3EHEA 3QWAA 1QMGA 2HMTA 1EDOA 4Y6PA 5BSGA 2ZQYA 1MXFA 1WP4A 2D3TA 3I9LA 1CQJA 2A9FA 2VT3A 3IDSA 4YACA 2AHRA 4NR0A 5JAIA 2QYTA 2O3UA 1TEHA 4RF5A 4PRLA 4R01A 3RU7A 4Z9YA 1R12A 1Z7EA 2OGUA 1D3AA 4UUOA 1ORRA 5F1PA 3LT0A 2WD8A 3P19A 1SCUA 2AQKA 1GEEA 1HRDA 2GN9A 2VNSA 3MCVA 2G5CA 3UF0A 1LEHA 1HE3A 1N92A 4JCOA 2O3QA 4U8GA 3FN4A 1VKOA 1NR1A 5JC8A 2BLLA 1VJTA 1ADBA 4BNJA 1LQTA 4BOYA 1T2DA 1HT0A 3CINA 1XQ6A 2PV7A 3LSYA 4WCFC 4DIFA 4JJIA 1I3NA 4P4GA 2I67A 2HAEA 1E3EA 1EVJA 3H65A 3UVEA 3D3WB 2Q2VA 4K1LA 4NMHA 2Q4EA 1RYEA 1LA2A 3VPFA 3ZWVA 2DFVA 3KBOA 1V6AA 4NDNE 3KXDA 2JCXA 3CE6A 3IS3A 4JN6B 3AI2A 3ZWOA 1DRWA 4R3WA 2YYYA 3U5TA 2IXAA 4OHUA 4D0SA 3F6YA 1PJSA 5G0TA 1BRMA 5I8ZA 1W73A 1QYWA 4FFOA 1PGNA 4YJHA 2VCYA 3D1LA 1NQAO 3U09A 4KZPA 2H6EA 5KWEA 1P1FA 1UXGA 1PL7A 1X7HA 2O23A 5EJ2A 1U3VA 4YA6A 1N1GA 4LSWA 3ZGYA 4OQYA 5IFLA 1M6WA 1J5PA 3AY6A 4A03A 3MTGA 4DQVA 3GOHA 3HDQA 5KVSA 4LW8A 4LGVA 1NVMB 1VJ1A 1WDMA 3PDJA 4EZBA 2X0JA 4S1VA 1GD1O 2DBVO 2JD1A 4CMHA 1U2DA 2X23A 1T2AA 4XX0A 2DT5A 4NG5A 4ZD6A 4E5NA 5L95A 4RDIA 1ZMOA 4F45A 1O9BA 3AUAA 4MJLA 5A02A 4EGFA 5I7SA 4ZICA 2Y67A 2B4TO 5C7OO 1AHIA 3VZRA 1PL8A 1I10A 5MDHA 2PGDA 2VZ9A 4GPD1 2C0CA 1SBYA 3DDNA 3WS7A 5L7WA 4F3YA 4IDDA 1K0UA 1SEVA 3F3SA 1CQIA 1E6WA 1P45A 1KEPA 3ICPA 1Z82A 2NQ8A 4IBOA 1QORA 2DBQA 4JIGA 3Q3CA 4KWIA 2WYUA 4HXYA 3WDSA 2O4CA 4CMIA 4P4LA 3X2EA 2NU6A 3N7UA 1YQDA 5F5NA 1WVGA 4WKGA 4XQEA 1VL0A 2ZTLA 3R6DA 3ZWYA 4HBGA 4IINA 4N18A 2QRLA 1JVSA 4GGOA 3RUCA 3ASVA 3GFBA 3WNQA 4Z0TA 1DRUA 4EJ0A 4E5YA 1HLDA 2BH9A 3BYZA 4PLWA 4PLFA 4H15A 1E1MA 2AEMA 3DAPA 1K6IA 4XEHA 3VZPA 2BF7A 1PQUA 3EYWA 2C82A 3RUEA 1BDBA 1PS8A 4W7HA 2NADA 1OI7A 1YKFA 2HSDA 1MC5A 1XU9A 1YBVA 3H3JA 4WNIA 1JW9B 1IE3A 1T2EA 2P9CA 3OEYA 4U6QA 2FR0A 3WQSB 3ZWNA 3JTMA 4WPGA 4CR6A 1ZH8A 4EBFA 1W6UA 1P3DA 4O5OA 5GMOA 4RLHA 3ZV4A 1H6CA 5G4KB 3ZNPA 2Y1CA 3BTSA 3RC7A 1B3RA 3Q6IA 4GWGA 4KMSA 4UUNA 3C7AA 2GSDA 3OIFA 1NNUA 3Q2KA 4GL4A 4B3IA 4NK4A 1ZK4A 1U7HA 4DPMA 4IQGA 5JW6A 3K5PA 3AY3A 3GLQA 1A9ZA 1AGNA 4CLOB 2EERA 3TL3A 2P2SA 1QV6A 3AI1A 4MKRA 1GU7A 2J5KA 3OJ0A 2PKRA 1FDUA 4XRGA 3M2TA 1OC2A 3OA2A 1A9YA 4FJ2A 5TRTA 1U3TA 1PZGA 1WZEA 4E6PA 4YXFA 3AK4A 1WLYA 3S2EA 2BFPA 4RF2A 3B1KA 2VYVA 4J1NA 1PJ2A 4RDHA 4TWRA 5IZ4A 1LI4A 1ONPA 3TSCA 1K5HA 1JQBA 3CUKA 2NV6A 4R41A 4XKJA 1ZSYA 3SLKA 3OBBA 3F46A 3O9ZA 1BW9B 2AA3A 1R0KA 3JYOA 4GMGA 4A7PA 1ZBQA 4M1QA 3QSGA 5L7TA 3I9KA 4YR9A 1HDCA 1LDNA 4GMFA 4BGIA 5JXWA 3INRA 4EDFA 3AM4A 1U7TA 3RI3A 3IIEA 5C3MA 1YJQA 3NYWA 3LT2A 1BGVA 5AXCA 4TMFA 2CY0A 3RSHA 1U8XX 4FDAA 3GUCA 3AU9A 5AYVA 3ZN2A 1K6XA 1W4ZA 1DLJA 1RJWA 1HLPA 2X22A 1XA0A 3MJSA 1H6BA 1DRVA 1B2LA 5C5IA 1NTOA 3P2YA 2J8ZA 3QVWA 2NVUB 4BHTA 2IYPA 4ZJUA 2JAPA 2W98A 1XGKA 4UVDA 1DPGA 1AXEA 2Y66A 4IDEA 2ZTUA 3L6DA 2NQTA 4UEOA 5L45A 1GQ2A 3FWNA 2HU2A 4ND2A 1E1NA 1TLTA 3HUDA 1E92A 4N5LA 3MJCA 1UAYA 3LLSA 2X6TA 4AJKA 4IJUA 3BTOA 4FIZA 1F14A 3GEGA 2QRJA 1EBFA 4OKIA 1X1EA 2DU8A 4M8SA 4RQTA 4D43A 5I8WA 3CZMA 1FDTA 2C29D 5JPIA 4E12A 2WWRA 3K96A 3FTPA 1E3IA 3ZV6A 3JQ7B 4PLGA 1NAHA 1JTVA 5BT9A 2EKLA 4BNUA 2P5YA 4FOOA 5A5EA 4TRJA 1L7EA 4WCFB 3DBHB 2JCVA 2NACA 2DFDA 1UXIA 4E0BA 1B14A 2J5RA 1E3WA 3WLEA 3H9EO 4YRAA 4IS2A 4R1SA 3PRJA 3GFGA 4QO7A 4GX5A 2NNLD 4BNTA 4GKBA 3WIDA 1GYRA 1E3SA 3JYQA 4RPKA 4GH5A 3FBTA 1J49A 1E7SA 1ENPA 3PYMA 1YQXA 3VVBA 3FF4A 4QUKA 3DBLA 4U6SA 2FR1A 4YT8A 3RBVA 2FOIA 1MXHA 1TT5A 1PGQA 1UDCA 4OSPA 5A1TA 2DTEA 4ND5A 4D79A 2AG8A 5FFFA 1CF2O 4BNZA 4BO6A 4D41A 2AQ8A 4PLYA 4DMMA 3IP1A 1YVEI 1UH5A 2JHGA 1JKFA 2X0IA 4HUJA 4QX6A 5CDUA 2D4AA 2QW8A 4ZQHA 2X9GA 3RCBA 3L9WA 2ZB8A 3GR6A 3PHGA 2NTJA 3V1YA 4XYEA 1YONA 5EN4A 4MO2A 1EUDA 3DZBA 3L4BA 4WLEA 3NUGA 1JA9A 3LVFO 4YT4A 1I8TA 1EVZA 3GGGA 4MVJM 3RKRA 1Z73A 3QVXA 1ZW1A 4J3FA 4AJOA 4NBWA 1ZCJA 4TRNA 1ADGA 4CLEA 1BXGB 1LSOA 4L0QA 2OO5A 2D5AA 1UZMA 1X13A 3H5NA 1P1RA 4R51A 1KC1A 4RVHA 2DTXA 2NU8A 2VOEA 2NTNA 2PH3A 3GZ4A 1G0NA 1VKNA 3GPIA 1CEQA 2NU7A 3WJ7A 1OZAA 3F47A 4CR8A 2ZIZA 3LK7A 1BXZA 2Q2QA 3JQFC 3LF2A 3V1TC 4E32A 1D4FA 3OQBA 5LDHA 4D3FA 3AFNA 4TKLA 1QKIA 3UUWA 1SEPA 1WZIA 4RLSA 4CQMB 4EJ6A 2PZLA 4K26A 1ISFA 1VI2A 3ZHBA 3UFXA 3CIFA 2F00A 5HS6A 3T7CA 2ZB4A 4Z0HO 2X4GA 4RF3A 1P74A 4XR4A 3TN7A 3NV9A 4YAEA 1QV7A 2C2XA 4MOWA 3F9IA 4GI2A 3I9MA 4CMEA 2WDZA 4HX5A 3GHHA 5AXBA 1NFRA 3P5SA 3NT4A 1ZJYA 4CMKA 1UP6A 3WBFA 4DBZA 3S2IA 3IL2A 1GV1A 2WEKA 2VUUA 2QRKA 3OIDA 4HFJA 4NFYA 1IUKA 4AJ2A 2HDHA 3ADOA 1R6DA 1CWUA 2P5UA 4NJMA 4CUJA 4D45A 3VKUA 1VSUA 3TNLA 1H94A 4MDHA 2GRAA 3W4IA 3RASA 3GEMA 1UXJA 3QWBA 1LLDA 2RHRA 3RFXA 2FPPA 1ONOA 2E49A 4B4UA 2NU9A 4EEZA 2HLPA 2OFPA 5TJHA 2BGLA 4L4SA 3R3JA 5F3RA 5U4QA 3OQ1A 4ZGWA 1TB4A 1ENOA 4BNFA 4MIYA 6ADHA 4FS3A 1GTMA 4MVJP 4M86A 3ZW9A 4WGGA 1QLJA 3GGOA 3PGJA 5BNTA 5IDQA 5EPOA 1KEVA 4A27A 4U0KA 3V1UA 4BNWA 3IJPA 3L0DA 4RPLA 3SEFA 3PWSA 7ADHA 4XYMA 2D59A 3EUWA 4NPCA 3C3XA 4PG8A 4DXHA 4TROA 5I7VA 4BKPA 4DMLA 1V3UA 4RV9A 3V2GA 3O03A 5HBRA 4DC1A 5GZ3A 4GSLA 4QQRA 1UDAA 5L4LA 2W2LA 2JFGA 1IHXA 3VPGA 4II2A 5THKA 1VLLA 4I5GA 5JDIA 1TI7A 2GCGA 1DJNA 4DIOA 2EJWA 4GX1A 1DFGA 3DZIA 5KKAA 3OIGA 2Q1SA 1WMAA 2C5AA 3E48A 3DTTA 4ZVVA 2G17A 5G4LA 1GY8A 4D3DA 1O0SA 2E6UX 1K2WA 3RWBA 3DOJA 3KEQA 2X5KO 4IUYA 3ZCXA 3ZV3A 3DHNA 3ROPA 2WE7A 1O94A 4NI5A 4XQ9A 3WGTA 5CFZA 4EUHA 5DNAA 1J6UA 1DXYA 2IODA 5TT1A 2P9GA 1N2SA 3JD0A 1WDLA 1Q2XA 3QWFA 4FFPA 3ZU3A 1E1LA 3U49A 3K92A 1IULA 1MGOA 2GF2A 4CM6A 4WLVA 1U1IA 3GNQA 3DEYX 3BMOB 1H2BA 3ZV5A 1YJ8A 4UAGA 3GF4A 4HFRA 1O5IA 4MPDA 3QQPA 3PPIA 4DREA 1YOVA 4J0EA 3WNVA 2WYVA 5L40A 3UGKA 3U0BA 4HFNA 4DYDA 4CMAA 4QEDA 4F6LA 2OP1A 3N58A 4DLAA 5EIOA 3U62A 1KVQA 5A5FA 3MTJA 1HDOA 2VHZA 2AEFA 5JY1A 1UXKA 3RUDA 2VWHA 4BNMA 5KJ6A 1Y8QA 3FNFA 4IXWA 2C7GA 4CV2A 3V8BA 1CRWG 3VVCA 2EXXA 3QJ5A 1DLIA 1EQUA 4XJTA 2DLDA 5A03A 4CUZA 1JKIA 4BL5A 3JYLA 2CVQA 4QTZA 3W4JA 3I5MA 4AJEA 1LDGA 3FTNA 1CIVA 4ZU3A 2VYVD 3F4BA 3P7MA 1I3KA 2BI8A 3I52A 1I33A 5I9LA 1T1SA 4FPXA 4E2YA 1NWHA 1U28A 4E31A 4FB5A 1QYVA 1Q0HA 3DB2A 1FDVA 4R9SA 5CG1A 5KVCA 2VWGA 3HB5X 1SOVA 4L4XA 4G81A 3LLVA 1FMCA 3DBRB 5B4VA 3I6QA 1ULUA 4XIYA 4ALKA 3ZU5A 3U4DA 4AVYA 4BO9A 2HMVA 2EEZA 4MIOA 4XDZA 1LNQA 3JQAA 4GX2A 5JDCC 1Q0LA 5FWNA 4FD3A 4NBVA 4AJ4A 4Z6KA 4XQCA 5DBGA 3MEQA 5KOIA 1GPDG 2I76A 4OL9A 4WK6A 3HZZA 2HK8A 3H8VA 5FI5A 4C7JA 3CPSA 3IMFA 3PTZA 4AJNA 4XD2A 1YB4A 1IOLA 3HDYA 4ALNA 2FRDA 3AOEA 1IL0A 3RUAA 4BO5A 3HJAA 4FC7A 2RBEA 4BS9A 3VPHA 3V2HA 3EAGA 1RWBA 7MDHA 5EESA 5B4UA 1DSSG 1B3BA 1NPYA 1RPNA 3EZLA 1PJTA 3PZRA 1N9GB 4YJFB 3IUPA 1M2WA 1NPDA 1UXHA 1PR3A 5L4SA 2SCUA 3HSKA 1U4SA 4KUHA 1GZ4A 4JJGA 1C0PA 4HADA 3GK3A 1ZUD1 2HK7A 5KVQA 3SBOA 5TQVA 1AXGA 2GDZA 5GZ1A 5JYDA 4EUFA 4H7PA 1EFLA 5F5LA 4PN3A 4AJPA 4LMRA 4KTVE 3WX0A 3JQGA 1ISHA 3KYCB 5CHEA 4ND1A 4YQZA 1P77A 1PQWA 5A9SB 2WSBA 4L75A 4J1TA 1F12A 5GY7A 3D4PA 2B36A 4EJMA 1SO8A 4L8VA 3VZSA 1KYQA 1I2BA 4WOJA 1A72A 4FN4A 4E2ZA 3BA1A 3HNPA 4XQGA 1Q7GA 4BMNA 3VC7A 5CDSA 4YJGA 4YYZA 4AJLA 4E3ZA 3MJTA 3Q9NA 2Z1NA 1V35A 4OAQA 3GMSA 2C59A 4OQZA 1LBEA 2BRUA 1YQGA 1Y8RB 5JMWA 2ZJ0A 2B4QA 3DXFA 4CM8A 2O48X 4GVLA 1B26A 1H6DA 5CDYA 2Y1OA 2ZJ1A 2YY7A 3OJLA 4FC6A 2AEJA 4DLBA 3S2GA 1KVUA 3L6EA 2R2GA 4PFJA 3FNGA 2BFOA 2YFHA 3BMQB 1HDYA 1KIFA 4CM1A 2ZK7A 2YHIB 2G0TA 3INGA 4I5FA 2UYYA 5DCYA 1P33A 4E2XA 1YDEA 5TLSA 1H9AA 3OH8A 1DHRA 3ROKA 3OM9A 4OO3A 4RPHA 1QYDA 1WPQA 4R5HA 3ETDA 5TF4A 2OOSA 2YZ7A 1F8GA 1ZMTA 2ZCUA 1X0VA 3JYNA 4R5MA 5FYDA 4ZN6A 2GZ2A 5KTKA 2YW9A 2Y1DA 3GZNB 1JKJA 2DUUA 3SX2A 4DRYA 2Q1WA 1A7KA 4XJSA 4FCCA 4D42A 3C1OA 3ZWPA 1Y81A 3K9QO 4CV0A 4XGIA 4R4JA 5IN5A 3O26A 3QIVA 2FWMX 3E5RA 3PLNA 2RHCA 1JLLA 1GZ3A 1QLHA 4DYVA 2B69A 1OC4A 1RYDA 4CLXA 1DC6A 2AQIA 2ZCVA 1SZJG 1DIRA 1MB4A 1YH3A 4YAIA 1C1XB 3ONFA 3QA9A 3GRPA 3WIEA 2BD0A 3EDMA 1LSUA 1LC0A 2A4KA 2EP7A 3FSRA 3K31A 4L9RA 5JS6A 5GZ6A 4YDRA 3K6JA 4B4OA 3VTZA 4JBHA 4NFHA 5TSDA 4IPTA 1DEHA 3G17A 4Y8VA 5U9CA 1P1HA 2Y1FA 4FFNA 4BNVA 2Q2WA 4CM9A 3I4CA
chains in the Genus database with same CATH superfamily
2WZDA 3JQDA 5IDWA 1NUQA 2XSZA 4GXNA 3AMVA 1MB2A 3B1JA 4DGSA 1AN0A 3JQ9A 1R0LA 1GUFA 1VECA 3QXGA 3SVLA 2XVXA 2DHEA 4XYBA 5DO9A 4PO8A 4TTTS 3RLIA 3ZOKA 4NESA 3EBPA 4AK9A 5ABPA 5AO9A 5CH5A 4NSNA 5DF1A 4DV1B 3H86A 4EAQA 3H1TA 4B7UA 4ZC8A 3B36A 3VPCA 1RKQA 5AK6A 4B35A 1Y1PA 2H1SA 3BL8A 3TIFA 3VVBA 1TM7E 4FR2A 4QVGA 5LLDA 3OKAA 4BWYA 3W8EA 3MPUA 2GPAA 1J2UA 1L5RA 1Q1EA 3H9QA 3HG7A 4FNGA 5BO5A 3BJMA 1DHTA 3CZRA 1BO6A 2W93A 3BGDA 3PA6A 2WHXA 4O0LA 5FTLA 1G9XA 3ZHRA 2PL3A 4BGUA 5AVXA 3KYDB 3UNXA 1SELA 5B7GA 4IV0A 2C03A 4BUCA 5I45A 3K1ZA 4BQSA 4B33A 3PC8A 1DTSA 5JVDF 2YASA 1N2OA 1AQNA 1N7HA 3ZV7A 4P1ZA 3UW3A 4M60A 4A8PA 1H1LA 3L4EA 4J90A 2PK3A 1EGQA 3PPWA 2AFVA 4FKZA 3CWZA 3WWZA 4ASUD 4UE3S 3EK2A 5T4BA 5ALSA 1EA5A 4D6XA 5LYJA 2V7UA 2GN2A 2W6OA 5LDDC 4ZMBA 4BLUA 2RAPA 2OECA 1PAUA 2REXB 2QLBA 1QE5A 4LDPA 4PAGA 1KE2A 2QQGA 1ZHHA 4ERNA 1A71A 4F97A 4OGLA 3QVKA 2Q41A 2WR8A 4G2NA 5BN5B 4HTFB 4BGDA 3K1TA 1YDWA 4ID9A 4Q4AA 5EGNA 3WAJA 5HRAA 3D8HA 2HQRA 4MI1A 5DWDA 4NEQA 2OVFA 4A0RA 4DT1B 4EHKA 1B0PA 2WIDA 3TMKA 3LBFA 3GU3A 2H06A 1M72A 2QQFA 3H83A 4O4JF 5AXDA 4BVHA 5L4NA 1HRKA 1MFZA 4C7OA 2BMAA 1KSHA 3ZBUA 1Y8AA 5DZSA 4RTKA 4R2LA 1QAOA 1IPEA 4IG4A 1L7DA 2FVYA 2PTGA 3HBMA 4K81B 1ADCA 3VBEA 3ADBA 4EWLA 2DECA 4V0KA 1QDUA 4LK3A 4OFWA 4KQ1A 3SF8B 4LFAB 2V55B 3GCZA 3I12A 2A92A 1L3BA 1M8PA 4FMCF 4KU4A 4ZEWA 4ABYA 4P33A 2J4CA 1ZK0A 4AYTA 3NBZC 2QV7A 3HRIA 4WZAE 5DNDA 5ETJA 1RWQA 5J40A 1RYBA 5E7JA 3RT1A 2GAOA 3W8RA 3M81A 2P9JA 1HDZA 2FZ4A 3H7IA 4BV2A 5AM2A 4DIKA 3E84A 4BLTA 1T2CA 4Q34A 2GR9A 1ZM7A 2PFGA 2YICA 3NGXA 3IDOA 3E2PA 1MV8A 4U2FA 5JSZB 4NBUA 5E6UA 3GL9A 4M1YA 2ADMA 2H57A 1PJCA 3EMKA 1BH2A 3OE7D 3A1SA 4N76A 4WOBA 3LQYA 2FJUA 1MX1A 4RIEA 1GVHA 4MI9A 1C9JA 3NCHA 2O1WA 5ALOA 5FBKA 1D6NA 3IE1A 5AK5A 2DXIA 3EIWA 2DJIA 3AG6A 1GTZA 3M1LA 3BULA 3RYHB 4JGBA 3H9BA 3BSWA 4R69A 4U3JA 5F4BA 1COWD 2DH6A 1MP0A 1RXEA 1XF1A 1ZNWA 2ZLBA 1HT2E 3E18A 1Z62A 3LC2O 3K9NA 3O8NA 4K8OA 1O6GA 1U5BB 2A35A 2YHBA 4M53A 3L1KA 4N1AA 4Q9LA 5DXJA 4BAZA 3G0DA 1XDBA 1AN9A 5KVAA 2ZBRA 3A9TA 3LKZA 1BD3A 1XVLA 3AJEA 3KYBA 4HP8A 3RTAA 3T3OA 2Z04A 1E32A 3PJDA 5T57A 3TI7A 1CF9A 1MC8A 1JB1A 1BX3A 1FUKA 1PJBA 1UP7A 3IXQA 3R0XA 2I4LA 2X8LA 4JZKA 5EUCA 1PL6A 4C88A 4E5PA 2R5WA 2QUAA 1P5RA 1UKYA 3HACA 4CXMA 3EULA 3TW0A 2VPPA 1PUIA 4RY9A 5T64A 3KCNA 4A2WA 5T7BA 1R4AA 4REOA 1Y34E 2ETVA 2LPMA 3OC6A 2RK4A 4GGPA 5J43A 1GSOA 1XMVA 2N75A 3STUA 4YUWA 4DUZB 1SAYA 3ME5A 5EAIA 5I51A 3T4UA 4DLKA 3CVUA 3D4OA 3ZXXA 1E7MA 4MKFA 3W5IA 5IXJA 3RKUA 4DJTA 4RTOA 1A27A 3CKLA 2HJGA 3S27A 1PP4A 2O8FA 2WFAA 1QVRA 4MUAA 2HCJB 4Y2TA 3TTWA 5LJIA 1E2QA 2JLXA 1S4MA 1PV2A 2QROA 1X8KA 2CF5A 3ELYA 3WGIA 4E07A 3ZQ4A 2BGWA 4HD8A 1U2EA 3FGZA 3G6WA 1M34B 3TAHA 3UCEA 2OORA 2V0NA 2ZWPA 4B6RA 3QEAZ 2D7CA 3WL8A 1DXOA 1L1FA 4Y9DA 1TJ4A 5JVDA 4R54A 4PBTA 1QO0A 2ZTMA 2JD0A 2SECE 2C2ZA 1WDWB 4HH3C 4L78A 5AHWA 5AJYA 1PG0A 4AQ7A 3DZ8A 2AUNA 5IWCA 2O1EA 2XA2A 2Z98A 3GNTA 1RHMA 5CAEA 3PHBE 3FDJA 2J46A 5ENVA 3LDHA 2C5EA 3VR6D 1IBMB 3ZBQA 4B46A 1ZCAA 1O87A 3ITDA 4FCWA 2XUDA 4OXKA 1U8ZA 4YALA 2HMSA 3KXLA 1E5TA 5JBIA 1I9GA 4L7QA 4PN7A 1TYCA 3T54A 3U81A 3TYXA 3N75A 1I0IA 3QVVA 3TRJA 3LC1O 4B4WA 2GWRA 1GL9B 4PYOA 1M54A 1K4YA 2EZ4A 2F3SA 3IVCA 2WD7A 3A6FA 4MJXA 3AIOA 3GLSA 3IP6A 2WC1A 3MMZA 3ZHZA 3FBGA 3VAZA 3ICEA 4MVJA 5FPKA 2OZPA 5AJTA 4PCLA 1EFRA 4NP6A 1Q16A 4P53A 3TGLA 5K0JA 3VNAA 1L7MA 2AFIE 4L5BA 3HDHA 1YR6A 4JQCA 3VFDA 2WI8A 4EPWA 4F38A 1FRQA 4MV7A 4FMBB 2IJGX 2J3KA 3PFBA 4EQ6B 2WNHA 3ZNNA 1W4CA 4OBWA 5CB4F 3W5BA 1B16A 2GYYA 2UZIR 3ESXA 1SD5A 3HFGA 4QREA 1AKTA 5DXAA 1KRWA 3OZFA 3SQOA 1R4NB 1EJ2A 2F9MA 3O1JC 4B2LA 3LTNC 3CNLA 3R3UA 4YCBA 4MW9A 1BWQA 1GTG1 1U2DC 4XUCA 5G0WA 4A73A 1AS2A 3G2IA 4XB2A 2PGLA 3GVPA 4KSCA 1JBKA 2WSLA 2YNMD 4LKRA 5H0IA 1Z36A 4LYDA 2QX6A 1D1SA 4JB8A 4F6RA 1H3EA 2JDIA 1JALA 3K15A 1KQOA 4KIFA 2I2XB 4RFLA 4W9NA 1EAMA 1Z4JA 2X13A 1F0PA 5FI1B 2H92A 3AF4A 1DKNA 2SKDA 3G1WA 4WADA 2IOFK 3THYA 3LG2A 1ZJWA 4MGEA 2DLCX 1I0ZA 3LWZA 1TW3A 3KKZA 3WWDA 1Z12A 4CLOA 4H4DA 4ES6A 1PYOA 2PWZA 4WZAB 4CYMA 1IDOA 1HYHA 2ZRAA 4L4ZA 2JCGA 3ETJA 3GA5A 2V6FA 3L0OA 4WEOA 1ODLA 1MLDA 4A0QA 2XH8A 4TV9F 2C92A 4WLUA 4X7PA 3GLIA 3JPYA 3AKEA 5AVJA 2HIAA 2OCXA 5EP4A 4BCDA 3JD1A 2HWKA 1VG9B 5D1NA 4ED9A 2X15A 3TGWA 1DAMA 2BCJQ 3K5IA 3STWA 3CF4G 1T1JA 3NRCA 2AG1A 4G23A 4PBRA 3F6CA 5C7IO 1Z8HA 2B34A 1FRNA 3BSSA 4H3VA 2VNAA 1F4LA 3F3MA 4MKIA 5AKIA 1I3CA 4BKRA 1A8IA 1PFQA 2PL5A 3EG9B 4YRDA 4UQPA 4HEJA 1UUFA 4B3JA 1E2NA 3A1NA 3AO0B 4LOIA 4ONEA 1F5NA 5FBQB 5CDGA 1NXOA 2BBTA 3HJRA 3KAJA 4BN5A 4BFWA 3IUJA 1DDIA 3R6WA 3QOFA 1ADFA 4C06A 2AZXA 3U9LA 1PKXA 4IL5A 4R40A 5DTQA 4KUEA 3R76A 1JAIA 2YV3A 2FPGA 3QEMB 4G5HA 4P0QB 1HF3A 3OOEA 5JZMA 2Z30A 1GPJA 4RANA 4D9KA 2JCBA 4YO8A 3S7TA 1K7CA 4K5QA 4AZTA 1PFYA 4J0JA 4FILA 3ZZMA 2D0IA 4EHLA 3M49A 5CA0A 3A14A 2DP4E 3UG6A 2QRMA 3LECA 1KAMA 1PGOA 3H5RA 1N4DA 1OA0A 2FUCA 5A5GA 1EXNA 2JAUA 4Q7QA 5CEFA 1AJEA 2JIOA 2OHXA 3R5FA 5AJWA 3H2JA 1TW2A 3H1AA 4I5DA 5LCXA 2OSBA 2BWJA 1C3XA 1H1TA 2C7QA 5IMBA 1N2CE 2CXHA 5H5JA 2OESA 4F4FA 1I2ZA 2I1WA 1N6KA 4HB0A 4IOMA 1NHWA 3Q85A 4HVAA 2G82A 4JJ6A 3TZHA 3NJ4A 4QTXA 2NZ8A 4IIYA 1BXKA 1MFPA 1A1VA 4QYWA 4D82A 2DWCA 2NVUA 2A9OA 1UDBA 2PEYA 3LYAA 1JG1A 5HMMA 5A5VA 3OTWA 2AOTB 3ZDCA 1MJFA 3ZIUA 1NNEA 2ZRQA 3PEWA 3QNWA 1FUUA 2ZM5A 1GDTA 2O8CA 2XOXA 3V8QA 3LQQA 4J29A 1DJQA 3T7KA 4EITA 4W9MC 2X14A 3E8XA 3C0KA 2YMQA 1E1DA 5DM70 1SCKA 2VP5A 4X1YA 1J5EB 3GVCA 3G2QA 3H7AA 2GXUA 1QGYA 2PKCA 3KQOA 3VR2D 4WDRA 1D8AA 4KG7A 1ONSA 3VMMA 3LZCA 5IABA 1YRLA 4OP2A 1EI9A 4LHEA 1M7GA 4FN5A 5A6SA 4LISA 5KJCA 3HLKA 4O63O 3RAEC 3WLAA 1JLSA 2NYVA 3ADPA 1JQDA 1EIWA 4HGZA 2OWEA 2XDYA 5LZ7A 3DEZA 3TS1A 1E5XA 2BGUA 1DC5A 3ZWWA 1PFUA 2B5OA 1QRRA 5TEVA 4YAKA 4XOUA 3BBPA 3T61A 3UMGA 4Z1OA 2TYSB 2AJDA 4KWEA 4EUKA 3ST7A 1W44A 2CE2X 2VHTA 4G9GA 1FX1A 3GDOA 1KYTA 1R00A 1KL7A 1I1QB 2PT5A 3GVHA 4JT9A 1EDBA 1P2UA 3KSZO 4JLMA 4W63A 4CT0A 2JKYA 3KLOA 3V4VB 1KJNA 4GEKA 4NBRA 3C15C 2R47A 3ZY2A 5EKUA 3CTMA 3M1YA 4X7MA 2V8OA 2AFIB 2W4QA 2OCIA 4WE3A 2VZ8A 1SY7A 3I1JA 1B2RA 1XNGA 3VNBA 4FW8A 1AOXA 1NNSA 1GNRA 5CK5A 3ZZTA 3V4SA 6NULA 2F8LA 2DBRA 3DDCA 2O7QA 2JFZA 1VXRA 5AJHA 1PZXA 1UMDA 3A6ZA 1QQ7A 3NH6A 4GQBA 4L07A 1YZVA 1WXDA 2JFUA 1KMHA 4W9RA 3DZHA 3F7NA 4P3NA 2ZSUA 3F4LA 1NDHA 3NUQA 4LYGA 4NEHB 4US2R 2I9KA 2ZBGA 3FSGD 2Q28A 4TV9A 1T4CB 1G21E 2NOAA 4YX9A 4BZZA 2IHTA 2IYUA 3NBAA 5L53A 5H3CA 2QNBA 5E7MA 1OU0A 3QKSB 1ZZGA 3D7LA 1MENA 1GGNA 4QVIA 3D4NA 2KWIA 4LJYA 3DMYA 1R0XA 4NNJA 4CVNA 1DWPA 3CF2A 3E3LA 1KBZA 4LMPA 2ES4A 3IR7A 4BCCA 1I7DA 2OORC 3K1JA 3I2FA 4O08A 3FOCA 3THSA 4DLVA 1IHPA 2GN1A 3O4GA 3QFSA 1IZ9A 1ULTA 1POXA 4M36A 4RIGA 1O6CA 2FJPA 4N65A 4R1OA 4BWVA 3B53X 5LQUA 5JZVA 1FCJA 1W1IA 3K4HA 2BUBA 4DQKA 5KREA 1Z13A 2A3RA 3QX7A 2V5UA 3TEMA 1U9IA 3VV3A 2CNBA 2G1UA 2PD6A 4L27A 4CCYA 3O4JA 5ALWA 3R3YA 2JIRA 2PZJA 1ZO8A 4KPGA 4LNUA 1W4AA 2QD3A 3Q1LA 2EQAA 4PAOA 5C8VA 4MQ6A 3GLFA 3WMEA 4ZCTA 4L4UA 1QPGA 2I03A 2V5VA 3AVXA 4AKGA 3T9DA 4EGJA 1KJJA 5E3JA 4DLXA 4UZEA 4AKEA 3DNFA 5ICMA 1Q3TA 2YKGA 1J5XA 2P2GA 4C5CA 5B1EA 4PRKA 4L3WA 4MIEA 1B6RA 1JR3E 3QKSA 1H0SA 2QTRA 1DB3A 2IZ1A 2XYHA 3PIRA 1PR2A 4OF4A 3ZJ5A 5MFPA 4LMBA 1SXJD 1Z6GA 4F9EA 4LFBB 4JKOA 3PQFA 3U40A 2W2PA 3SQMA 4BQFA 2FMTA 2ZP1A 1J21A 4YJHB 1IJBA 4BXOB 2JI9A 4R16A 1KORA 4DNOA 1DTWA 3GEDA 3HCCA 4ZIRB 1N4AA 2DX7A 2VRCA 2QL9A 3AVPA 4F8YA 1P72A 3AJ8A 3C16C 1Z5OA 1F8FA 2RI0A 3F6RA 4NRDA 4GI1A 3IKJA 2YRFA 1PJ3A 2C2MA 1FSPA 2C94A 1QTIA 4EY8A 4ZCQA 3O2NA 4BNHA 3L4BC 1BEZA 1KH2A 4TUYA 1XI2A 2WTXA 2O8DA 1U8TA 3BAFA 1M0SA 2F2TA 3B3AA 1HURA 2X42A 3CN7A 3EDQA 4C4OA 4BEBA 1F38A 2YJGA 5E3HA 2FUEA 2O2YA 1CUEA 2JA2A 4FYJA 3IIKA 2QIOA 3EVNA 4PX9A 4UEKA 2ZAYA 3WOHA 1ZGZA 3LY7A 3N8GA 3EGDB 4J0QA 1DBIA 3U1TA 1JRLA 2CMFA 3EWAA 5ALMA 2QX7A 2OO5C 2PH7A 5BNFA 4RXMA 4D8VA 4OH1A 1YB5A 3A1DA 3WGQA 2C1XA 1L5OA 2WICA 3NOOA 3SK0A 3JVIA 4IIXA 4LF5B 9LDBA 1WHSB 4UTPA 1VXOA 2H1IA 4OXXA 1EK6A 3I8OA 3O38A 3CLRD 3QYJA 2P2LA 5AVSA 4HB3A 4JJ7A 4OBBA 5DNVA 3W5UA 4D3SA 2PS0A 4QXMA 4UC0A 3U7IA 1PZFA 1ZNZA 1PVDA 2PJZA 2Z95A 5TX7A 2TMGA 3EZ9A 5I7HA 3HJBA 4B6OA 4BTVA 3WK8A 2BGRA 1P7PA 3PUZA 4P4SA 8MHTA 1AKRA 4P2BA 1IXSB 3E03A 3EA5A 2Q0QA 2ZU6A 3R6TA 3QF7A 3I28A 4OK6A 1N0WA 4ZA2A 3W2FA 3ZR4B 4F2HA 3K70B 2DC1A 1DAFA 2HHJA 3L1UA 3PNPA 3TOSA 2ZYAA 3ZHXA 4MVJG 1TYZA 3AFHA 3Q11A 1KARA 1NDQA 2HMAA 2P7IA 1PJ4A 3R77A 1II8A 1T26A 1Y6QA 2WWFA 1DQSA 1GTL1 2C8VA 3K7EA 1U5AA 2ZSAA 3PYXA 4J75A 5ALLA 1KK3A 5KMGB 5GJBA 5B1IA 3TIGA 3WGYA 5AI0A 4ZAYA 1E6MA 4BMPB 2GHTA 3N8HA 3QPWA 1ZN2A 4F93B 1L4HA 1CETA 3SPXA 3LU1A 1PN3A 3DOOA 2I66A 1HQCA 2WVGA 3EPRA 3PFNA 3SXPA 4AJ9A 1CQPA 3DXXA 2YY5A 4EG6A 4PX2A 1IJFA 1WM1A 3OTGA 4IDFA 2WIBA 3AV0B 5AI9A 1DUSA 4UEJA 5DP2A 1AX9A 2PMDA 3G5MA 1CP3A 1SHJA 5EXEA 1FVXA 2HLDA 2A1TR 4FEEA 1FJXA 3T12A 2QB5A 1G21B 2VH5R 3PJGA 3IILA 2WHPA 3NHMA 4MYSA 3L41A 4MW6A 4PGFA 1ISIA 3DW1X 3I6ZA 4H9GA 1LFDB 2EFHB 1YR1A 2I1VB 3QPCA 1KP2A 3JQEA 3RABA 1NW5A 4AG3A 4KWHA 4Z4HA 2RIRA 2X8JA 3M4YA 3IVMA 1WCIA 3LTEA 4HLQB 5CX1A 5L6MB 4MI3A 5DHUA 1PTKA 5LD2C 1DAEA 4ARZB 4CUKA 3FJ1A 4G26A 4IMPA 1G9TA 3VO8A 2CUTA 4FMDF 5AUOB 3RQSA 1YL5A 2GILA 3BMOA 3PC3A 2E85A 4UNSA 4F84A 1DBQA 2VK8A 1X1TA 1MRZA 2A9RA 2RGNC 1P44A 1LSJA 1PZMA 3KKNA 2X0DA 3AI3A 10MHA 1OWLA 3TJZA 2HD4A 1KEWA 1RADA 4PR3A 4Q3EA 1B42A 1U9ZA 3B60A 2D1YA 3CRNA 3T34A 3PHIA 4GOND 3A27A 2FRXA 2IYOA 4KK3A 4M6WA 3QOYA 1W1UA 2I6FA 4I55F 4XE5A 1P39A 4V0MA 3UATA 4NOKA 3SC2A 3UJDA 5CEJA 1M83A 4I3FA 1IZYA 3E9MA 2Y0DA 2X8WA 3WADA 1IXRC 3TFOA 3E35A 5BWBA 3UWSA 1BMQA 4Q93A 4G6ZA 5I5EA 4OH7A 1TU3A 4MV9A 3TW8A 5JDIC 2POCA 5DP1A 1X0XA 3F74A 3KVYA 4WI1A 4BGVA 5IU6A 8ABPA 2PS1A 1JG7A 4ZXFA 3U6BA 3WA6A 4DV7B 1V48A 4PAMA 4X85A 3VR5A 4F3TA 2V7XA 3ABZA 3I3OA 4JT8A 3F73A 3I83A 2ST1A 3MWYW 2P4UA 5AICA 2MSCB 2VDQB 2ZBFA 2FZLA 4K9DA 2VDMB 1YO6A 3COZA 4ZVPA 2X2OA 1O94C 2IWHA 4D7AA 2DT8A 1N2ZA 2FVXA 1U8CB 2P5TB 3CJTA 2TRSB 2PKWA 3HB9A 3PFFA 1TX4B 3DGEC 4FHCA 4IMRA 5JLAA 3ZLUA 5KO2A 3OP4A 5DHAA 4FWTA 3T3GA 3QVGA 1WW3A 3UB2A 3PR1A 2B4RO 4BWFB 1GNLA 1Y9ZA 5DW0A 4W5NA 3ORSA 2W58A 4LYAA 3KQVA 3KTDA 1Z6YA 4QQFA 4YRQA 4RFSB 5AK4A 4LY9A 3WLFA 3MS4A 2XAUA 1FB5A 4EHNA 4H1HA 4JQYA 4B1FA 1UWKA 4LYJA 1XIVA 5LPNA 3X1WA 3QVUA 2JC3A 7REQB 1U3DA 5DX1A 1F2UB 2XB6A 4A6PA 5IX8A 4KQKA 2CWDA 2IZZA 1LJLA 2K5UA 5DB4A 5E2BA 2ODNA 2VEOA 2YHUA 3GT7A 4V38A 1IB6A 3KSMA 5E2AA 2VQEB 3VJRA 1PF7E 4OFXA 4YRZA 1RI3A 1XEXB 1UJ5A 1UJ2A 5KKNB 2ZB2A 4B5LA 1KYXA 2XNDD 4O0MA 2IV2X 2Y27A 3PSHA 1Z75A 5I9BA 4B8WA 2R1ZA 2AVNA 1C80A 5JFOA 1K98A 2WJ4A 2Y4OA 4RJTA 5MN5A 3V8VA 2HBRA 2C3MA 3CYFA 2G72A 1IYZA 2WWTA 4N6NA 4DM4A 3EQ6A 3TLGB 3GXOA 4DPKA 2J9FA 3QBTA 4TVSA 1VE6A 2XX3A 1GCAA 3M9XA 3V2UA 3SMQA 2UAGA 2ZPUA 3HY3A 1L5HB 2BFAA 9LDTA 2PUHA 1YL6A 5DYYA 1E1KA 1KOGA 2FU5C 4L57A 4S12A 4MZXA 1DU4A 1U81A 1P2DA 3QLTA 4D92A 3CX8A 3AR7A 2XQJA 3LF1A 4I8IA 5A0FA 3HKEB 1C3EA 1L7BA 1U6KA 3JQFA 4G24A 4EY7A 1DUVG 5I4CA 4R2XA 4LAFA 4DSNA 3K2IA 1P18A 5KYYA 4NQZA 2QTBA 3BIXA 4YJ2B 5DM4A 5HILA 5IJZA 5JS1A 5IDYA 3Q88A 1DUIA 2Z6QA 1P4GA 1DKMA 4II3A 4ZOQI 1IN4A 4F5DA 1QVWA 3K0AA 4EZEA 5LMNB 1YIDA 2ZVQX 1RRCA 4D5EA 4P82A 2OHOA 4ZALA 4R7TA 2AOUA 4X3PA 2XUPA 5CYOA 5A9SA 2PUGA 2VDNB 1Y3DE 2WP8J 3C8UA 4DDTA 3BXHA 3SHWA 4CN9A 4X66B 2ECKA 1G3MA 3DTYA 2DULA 3D6HA 4R6XA 4G0ZA 4UZFA 4RZIA 4BZQA 3ZDEA 4YLYA 1WF6A 3ILVA 1P9RA 3K0CC 1XP5A 2X8AA 4DFDA 2JHPA 3CG4A 1BVYF 2EKPA 3ED5A 5B2ZA 2RI6A 2VXYA 2VP3A 4RZSA 3ZCPA 2QTWB 3E9ZA 4X9XA 5FWXA 2OXRA 2OQVA 5CA1A 3N0XA 1VHDA 1ZG3A 2WUWE 1Y8RA 2DHCA 3KYJB 3ITEA 3N86A 3A04A 4LY3A 1VIMA 3SZGA 1AF7A 4I55A 5AVQA 1Z0SA 4PG4A 4BRUA 1FUEA 1HQKA 1Y7HA 4ER6A 1V1JA 4B09A 4W5TA 3ABQB 3GDWA 3G2HA 2A9JA 3F4KA 4AROA 5EP3A 1E9RA 2HOQA 3OZGA 2PZFA 4JR1A 4M3NA 4W99A 5A3JA 1MO5A 1Z8NA 1KOLA 2EOAA 5CLFA 1RPAA 2JNWA 1PK9A 2YHIA 3B1WA 3IMKA 3S29A 4IZOA 1YMQA 3RADC 2JF0A 3GH3A 3OHPA 2C3PA 5FUYA 3HVUA 3JD4A 4CLRB 1RXCA 2I6QA 1H23A 3H9UA 3FPEA 3TXAA 1O89A 4O59O 4B44A 2CDBA 1ZOSA 4H1VA 4J7AA 3OF5A 5MN4A 2IYWA 3QY9A 3PC7A 5ICSA 2IE0A 2WUVA 4E5SA 4AJHA 1PTJA 3G59A 5JSHA 1CJSA 1GLVA 3G8DA 2L2QA 3N59A 4JLDA 2O52A 4IVNA 4LDZA 1NP6A 4FCTA 4U2GA 3UV6A 4UHJA 4HV4A 1XMPA 5FUMA 2VXOA 3KOZA 4JUDX 1AQJA 4Q6WA 4CBVA 2HFKA 1CS4C 4M7OA 5HMLA 3SZRA 1DX4A 1E6LA 1XNHA 4AAYA 3PQEA 3LFTA 1LWNA 4BKMA 4OL0A 4FR0A 1HDXA 4ZCSA 4QGBA 1D8TA 2D13A 2ZT8A 1SKMA 4ZANA 4NWIA 3WLIA 3MHTA 1SWWA 1C1XA 1GA4A 5KWSA 4PC2A 1Z6ZA 3IBSA 1P6XA 1O0BA 2H51A 4NZ9A 2B7BA 3QOXA 4KUGA 3TLBA 4A0FA 4CZ2A 4D9CA 3D1VA 3NP7A 2XIQA 3SNHA 4U1RA 1T3LA 2NWQA 1PDVA 4GIBA 1IN7A 2C20A 2HPVA 4LWZA 2WRZA 3CO0S 4Y98A 4DJAA 4HJXA 2IF0A 2JZCA 4WGFA 1FRZA 4PLPA 1RQ7A 1BHJA 2H7CA 3UC5A 1BZYA 3KQTA 4ECAA 5HR5A 5C4GB 2FEMA 2YY6A 2YJ5A 3GQBA 3VSDA 2D0DA 3E23A 5BOVA 1MX9A 5ER6A 3X1MA 3AG5A 2IBSA 1N8SA 1P1IA 4W6ZA 1SVKA 4D26A 2ODWA 1QBGA 4MP8A 4LJLA 5KNLA 2ET6A 1NUSA 4L0DA 1RM0A 2XYPA 4YT5A 2UUAB 4K6HA 4IGFA 3GAAA 4UARA 3NLLA 3WMWA 1A82A 2ORVA 3BS4A 3RU2A 3OFSA 1WMSA 1KDOA 3VOSA 5HZHA 1T0HB 3D4LA 3QQ5A 1ZI8A 2DH5A 2GZMA 1A4UA 2GHRA 3HKDA 4GFDA 4NEGA 2P2CA 3CV3A 5IT0A 1GRQA 4RWZA 1U1DA 2ZYTX 3RIYA 1OAKA 1QGUA 4Z1MA 4P58A 5IVDA 3TQHA 5FKJA 4C08A 3DVAB 3ITKA 4ZP1A 4UQLA 2ABWA 3AUKA 4D56A 3SS8A 2P1DA 4OHRA 3HI4A 5LWHA 4H08A 1D7OA 2UUPA 4MW2A 2XTNA 1VFPA 2ZYGA 2ATIA 1S5PA 2DFTA 4BX8A 1NRIA 4PQFA 1XX6A 3T7AA 4MUEA 1JXQA 1SB8A 1L4UA 1UIRA 4TLBA 5JT1A 3JWIA 2PKQP 4G8DA 4DL9A 3HXOA 4DA9A 5HRCA 3I05A 3AKDA 5K3DA 2D5CA 2B3TA 1WUJS 2FPLA 1WV0A 2WFLA 2VTDA 3MMPA 4L3OA 4D9HA 3G0BA 5MGNA 3UW1A 2O3SA 1IQUA 1C7FA 2Y77A 1FFCA 4LRXA 3S1AB 1RRGA 4F91B 2NUBA 5BVGA 1MJHA 2PS3A 4MV3A 4PQRA 4ZRDA 4XGRA 1TZJA 2EKZA 2O5RA 3GHYA 4IIFA 3K5WA 4PONA 5CM9C 2QR5A 3ZK9A 4B74A 4QYTA 4N8EA 2ADOA 4R84A 1PV1A 5DX0A 1JFFB 3IVRA 1WW8A 1JBEA 4H31A 1OFGA 3LY9A 3AUFA 2R6ZA 4IIUA 4JYBA 5JEEA 1QH8B 5FUXA 1JJFA 1QWOA 2VJPA 3A9RA 5G0VA 5JV5A 1CR6A 3CY6A 3E22B 3L02A 5KSPA 3EQ8A 3FPFA 4HN9A 4E4TA 1E2BA 4F86A 4HWTA 3F8WA 3A9CA 2YV2A 2H5JA 2WNIA 1ONNA 4JJAA 3ZI7A 1KFKB 1DAOA 3B9PA 4OHKA 1ZW6A 3ZGOA 5CCXA 1YOVB 3OCYA 4IXMA 4AG5A 3C48A 5JARA 3ONNA 4Q1FA 3ADKA 2ZBEA 2C7RA 5J23A 4KIJA 2EQ5A 3HWRA 1ZOIA 4PPGA 5A4FS 3ASZA 1DRJA 4HGQA 3NTVA 4PPYA 1KU0A 1P2SA 3EW7A 2XB9A 2ORED 1PQPA 3KV1A 3NUZA 4GEGA 3DHWC 1GSHA 4FTWA 3WMFA 3KX2A 2R4QA 3ROQA 1JLRA 2YZMA 4MICA 5IM4F 1GCGA 1DIBA 3FNBA 1L1EA 1Y8QB 4OXYA 1E2IA 4BNYA 1WNTA 3FMPB 3IO5A 1O8BA 4XDYA 2EL7A 1E6CA 3GP8A 3DHVA 3H5OA 1W2HA 1XQ1A 2CVZA 5J63A 2C4MA 1X7XB 2XCIA 5EIBC 4Y0AA 2C9BA 2X7JA 4C6HA 2HF7A 5TDHA 5A4DA 3PFKA 2V9PA 4TPKA 3P32A 3T1HB 4G0WA 3KTOA 2X41A 1IZ7A 1PWXA 1YS6A 3CEJA 3ABRB 4D74A 2P3LA 1YCDA 3E3AA 3OO0A 2ENUA 4PO3X 4D3YA 4P32A 1HE4A 1V39A 4O4LB 1R37A 2I29A 2DUJA 2R00C 3LWDA 2WHQA 5ERGB 4F6CA 2BYTA 1WUYA 4QODA 2QUZA 1Z0ZA 2CV0A 1UL1X 4HDNA 3W5HA 3SDBA 2VZEA 5KHLB 4M7PA 3T0FA 4EJSB 3KB6A 1FF9A 1I4DD 1LQUA 5JO0A 3VTKA 1BAPA 2FPMA 2ZE8A 1CF4A 3QE3A 4OQQA 2R7LA 3PUIA 1UMCB 2CXRA 4MKXA 3PXAA 4CKEB 3JQAB 1TECE 4PSDA 3S99A 3STHA 3RC3A 5AI4A 5FPYA 4LJ8A 5JAZA 1JU4A 3V1KA 1MVLA 4RPCA 3B5EA 3AB7A 4WVFA 1CUDA 2HSZA 2R7KA 3AHFA 2DETA 3FLAA 1A9QA 2WTEA 4IM7A 4WINA 1AE1A 3P0JA 3PRHA 3ZOZA 4TTVA 1FUIA 4BVAA 4CM4A 2H1VA 5M29A 1YRWA 5K0BA 3FAZA 4D9MA 4EVQA 1KO8A 2B7LA 4FIDA 4HQRA 5DIZA 1JG4A 1QH1B 4YCLA 3O1IC 3QBEA 3UJ6A 4P7FA 3QEBZ 3O4FA 4KSBA 1OYOA 1BMDA 4G4SO 4YI3A 3UV7A 4Q9NA 2HRCA 1SU7A 3Q1KA 3PQ7A 4IR7A 4LI3X 4UASA 4PSAA 4Z7OB 3CRW1 1XO1A 3DA8A 3O8RA 4B8ZA 5I8PA 1I0LA 3L93A 3JQBC 1QRTA 2BEVB 2XEXA 1KH3A 4LF4B 1A8PA 3PVCA 1YZTA 4OHFA 4YRIA 1A5TA 3IALA 4C1BA 1DP4A 3I4LA 4TSFA 4BO4A 4TQUS 1W5TA 3BB3A 4N9QA 2G71A 1N5MA 4QJBA 3O8QA 4HAOA 3TNDA 3UJCA 2GM3A 1A2BA 2A0WA 2AG5A 1ULBA 5G0SA 1HNXB 4ON9A 5C2JB 1SCAA 3D4IA 1OKKA 5JCZA 1CB0A 3DFUA 1DBVO 2RONA 3CUVA 4FYKA 4P2GA 4KQJA 1F2TB 1THTA 2EZ9A 5HFJA 1BA3A 1NQ5A 4PG7A 3R8FA 5JMPA 1V43A 2YRXA 3U9TA 1QQBA 2PUTA 1P5JA 5FB3A 4R6WA 5E1MA 2WE8A 4YI5A 4KXQA 4BX3A 4AL4A 1T8UA 3MVEA 1U0OC 1N3BA 1NLZA 1SPXA 1BWSA 4JVSB 3LP8A 4LXUA 2FPIA 1QE3A 5IH3A 1Z7BA 4N03A 3WQHA 1V1MB 2FMKA 4QYIB 1FS6A 3FRJA 1LV8A 1R6BX 1VG0B 3WA7A 3KK0A 1VRVA 4U7DA 5CR9A 3H75A 5FNZA 3BMCA 2IT1A 2ISQA 2V6BA 3JQCA 5LQMA 3D6FA 4BBPA 1KXJA 2Y4NA 3TKLA 2QPOA 3KXKA 1J2RA 4GI5A 3R0VA 3WRYA 4BB5A 5DGDA 3H2HA 3QF4B 1JYEA 4NE7A 5CPBA 3IYLW 5ALNA 3U4AA 2CDAA 4Q3OA 4GOOD 4ESEA 2VCHA 5FI3A 3GD5A 1KZ6A 2R4UA 1W75A 4GGMX 6YASA 2WM2A 3ON5A 4LBYA 1P1BA 1Z74A 3ES9A 2OB1A 2EJCA 4MRNA 4WXYB 1VP9A 4Z3KA 1WNFA 3EXFB 4UOQA 2M6KA 2P91A 3AW9A 3U19A 4OOEA 2PD3A 1S8NA 2QZ9A 2XZLA 5K8CA 2ASVA 3DE7X 4I1YA 4CM5A 2Q3HA 3GFRA 1S1MA 2XWQA 2XBLA 5B58C 4ND4A 4Q9KA 1PIWA 3DMTC 2IYVA 2XITA 4PGHA 3WTBA 4Q1AA 4BX2A 4DOMA 5KYUB 3EW9A 2HR1A 4QOJA 2ZI5A 3AW8A 4KE8A 4IF6A 1VCNA 2DG2A 4CMCA 3JPWA 1NR7A 2I9PA 3H2SA 2FEAA 2W2KB 3OM1A 2JEOA 5L8VA 1HYGA 2FK8A 3HHPA 1ZGAA 1WXGA 4PO1A 4UNPA 5AKKA 1U0BB 3WL7A 1EWRA 3N9IA 2C9DA 4DY6A 3VU9B 4L4RA 1DVRA 4Z86A 2OBNA 1R4MA 3EZ6A 1AZTA 3KVVA 2XQKA 3MOIA 5FR2A 5FUBA 2H00A 4NBNA 4UTRA 2Q4RA 4DVGA 2RB4A 3OHSX 2C1ZA 4DCMA 3NHAA 4DJ5X 1A8UA 1K5DA 3TZ6A 2AXPA 3S40A 4KGVA 4MA4A 4EJ2A 1G5IA 4KW7A 4KDCA 2P78A 3RFUA 5M34A 2HCBA 3GBPA 3CUEF 4XSGA 6LDHA 1UBKS 2AG0A 3NIFB 2TMYA 1G2QA 1PW5A 3EVGA 4B3RB 3ZNOA 1WAMA 2X9VA 5M7EA 1Y6FA 3ZS8A 4F1WA 4R1TA 4PNPA 1RZVA 2FSVC 4MWTA 3WY9A 2CUZA 4HFMA 3VTAA 4Q05A 1PJZA 2J3LA 1L5MA 1HG0A 2RHBA 4PTLA 7GPBA 3HA5A 5HKBA 3B78A 4FX5A 4Q0MA 1NATA 1O57A 3EF0A 2RKWA 1EP1B 5HF5A 3NAQA 1KBOA 3FR8A 2ZUFA 2I2AA 1XKLA 1TEZA 1MMFB 3KKEA 3AVTA 3A6DA 2CXUA 4PR0A 4WCDA 1MOPA 1WR8A 4BEJA 4BIMA 5CEEA 1PWZA 2NO0A 1OBFO 3D0QA 3PF8A 4JLPA 4K3VA 3TL3A 2PH1A 4WH0A 3GOQA 1FNCA 4WFKA 4CDNA 1NASA 2BN4A 3PIIA 4HDKA 1RWMA 5GGYA 4G36A 2PAFA 1YS4A 2HM7A 2PQMA 4WUVA 3S5UA 3V5NA 1XZBA 4N6OA 3GUYA 3B1FA 1YZKA 1RYNA 4IDGA 4JLWA 2V7WA 4PPNA 4QUDA 2VJMA 1H2AS 1Q14A 4WL0A 1KZHA 2R60A 5SV2A 3B7PA 1QIIA 1V8BA 1QYIA 2PEZA 3OLWA 2PRJA 3ZVMA 3NWJA 3RS7A 3GDGA 5K8UA 2FA9A 1U0FA 3FNIA 3ROZA 4PLZA 1W4BA 4RA9B 4YQYA 4EG4A 1UFRA 3J81k 3KWJA 3SLRA 2DWOA 4PC1A 5M04A 1R6VA 2ID7A 2ZJ3A 3LI2A 1FU7A 4I6GA 3G5AA 4ZPXA 3LGXA 3RG8A 1H1LB 1M1XB 1SM4A 2W6NA 3PEFA 4MVJE 5K9ZA 2HMWA 3B20A 3OZAA 4KYTA 3KT3A 4DABA 3CM0A 1BYIA 4NXNB 1PNOA 2GKSA 3A4TA 3C5HA 1OLSA 1RI2A 3CKMA 3GPDG 1SH7A 2PQ2A 3IUYA 4V0QA 4ZMRA 5LYJB 1U8EA 3RRMA 1T0BA 4YJ3F 4C3VA 4UHFA 5HDQA 1M2EA 4TZKA 3VI4B 4EHFA 3RSQA 3VGPA 4OHZA 4FEAA 4ESOA 2XI4A 5EE3A 4DMHA 2VA8A 3ED1A 2LRHA 4JOBA 4Q4AB 4V0RA 3GMDA 4PZ0A 3RRYA 3C2QA 5A5DA 2VH2A 3INTA 2C95A 1G5TA 3PR2B 2O07A 3CLUD 4FWBA 1SBHA 3QWAA 3NM6B 1VPEA 4TTPA 1QMGA 2P9HA 3OCCA 4WNAA 4C7OB 2Z4RA 3ID6C 3PCRB 3IPLA 4Y6PA 1KIAA 3EFOA 2Z2IA 3ZI4A 2PIDA 4LGYA 2RGUA 3K35A 3VR1A 4A16A 5IJ9A 4GF5A 2A9FA 2N3ZA 4BBJA 4BEVA 3LW8A 3HI6A 3IDSA 5LN1A 4N12A 4TKVA 2Q6OA 4TVKA 1X19A 1ZUHA 2P40A 3ND8A 3F2IA 1MD9A 1N7JA 3A1EA 4R01A 2OAEA 4MV0A 1WL8A 3AXSA 3QU4A 4RJIA 4WXEA 2Y6VA 3DKPA 3TO5A 1M5RA 1Z7EA 2IZ7A 2G83A 4KR7A 3GLIE 2GCIA 3OPMA 3W5AA 2KX7A 1ORRA 3WXMA 4NAUA 3P19A 4HNUA 1OX4A 1NN5A 1DRKA 1EINA 2AEEA 2HPHA 3S4YA 3TSWA 3EXAA 3IQWA 3VHXA 3MCVA 4E88A 3AEUA 3VX4A 1N92A 2EG5A 2WYIA 1VKOA 3ZYZA 2PSJA 3H18A 4BZPA 3BIJA 1Z5ZA 3UEOA 1LQTA 1VBNA 4BOYA 4B31A 4U3JB 4A0GA 4QBTA 4KCGA 4BQQA 1XQ6A 4MJ3A 3LSYA 4DIDA 3KCQA 2RGCA 1QHYA 3HCEA 1EVJA 4MUFA 1N0UA