3GWGA

Crystal structure of chey of helicobacter pylori
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY homolog
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gwgA00
4MR9A 3SQNA 4YO7A 2FEWB 3O1IC 4FB4A 2PUFA 5B3JC 1OXBB 1ZH4A 2QZJA 2QV0A 5JNSA 3L49A 3HDVA 2MSWA 3O21A 5EWJA 2OENG 4G0PA 4MLDA 1DJMA 2WY2D 1U8TA 3JTEA 3KHTA 4PYRA 1GLGA 5FWYA 2ID9A 3C3KA 3NBMA 5JS1A 4MS3A 1TJYA 4KQCA 2PUGA 4L4UA 1U2PA 2FKAA 3JVDA 4N0PA 3QELA 3Q41A 2IPAB 3H6HA 4MR7A 4RXUA 4LDAA 4XXHA 1ZY2A 1ABFA 4O1IA 1JH9A 2P9HA 3W9SA 2HQRA 4WT7A 3UKJA 2YHAA 1GCAA 4ML3A 5CNJA 1P6QA 1TVMA 4JOQA 2FQYA 1LJLA 2PLNA 1RXEA 3JPWA 1D1QA 2MSLA 4RK6A 2FEKA 1F4VA 3EODA 1YS7A 3MYYA 3VNAA 5GOTA 3H1EA 3C6QA 3CLKA 5KWSA 4PZ0A 1NY5A 1KMIY 6ABPA 3HSYA 4KNYA 5FWXA 3H5VA 3DLBA 2FQWA 2W42A 2GX6A 3RVNA 2FMKA 4G97A 2XDYA 5HKOA 5IUNC 4QICA 1JDNA 3SNKA 1NXVA 5JNWA 4H3HB 2A9OA 4O1HA 3I09A 1YIOA 3GRCA 4RY8A 3ROTA 4Q6BA 2FSPA 5IEJA 1JHZA 1RPJA 3O1HB 3Q7RA 3O75A 3QLTA 3SG0A 2R4QA 5BQ3A 3T6KA 2E4XA 2FLWA 3LUDA 3N0WA 1MVOA 5DKFA 4W5TA 3H5LA 3QEMB 5IX8A 3T95A 2PUAA 1TMYA 2E4VA 1QNLA 3N0RA 5TQ2B 5TQ0B 4RZSA 4W5RA 3FFWA 5EWLA 4EYGA 3FMVA 1F51E 2CHFA 3OMXA 2CD7A 3Q15C 4MR9B 4RY9A 7ABPA 1KRXA 2JBAA 4LZLA 3TMYA 1JX6A 4WZZA 2IPNA 1K66A 1VPWA 1B00A 3OLVA 3F6CA 3CZCA 3M9XA 2JK1A 1XHFA 1S8NA 3QLVA 1JYEA 3O2JA 5FWYB 1VKRA 2JVIA 4OTZA 2IOYA 4YR7A 3EQ2A 5T3YA 1YMVA 4TN5A 2MYNA 4XARA 1EHCA 3SAJA 3T38A 2PMCA 4RWEA 4F8JA 4ZMSA 1DBPA 1ZESA 2N9UA 5CHYA 3E3MA 3KG2A 4RDCA 1J56A 4ETIA 4ZJPA 5KC8A 4N41A 3KJXA 2DRIA 4MS4B 3RVLA 1YS6A 1QP7A 3HZHA 1UDRA 4YCSA 2GKGA 3H75A 4Y9TA 4EVSA 4MQFB 2LBPA 1YVUA 3HK2A 4B09A 1LBIA 3OO1A 2PUDA 4KMRA 4NV3A 1EWVA 5IC5A 2L17A 4F11A 4LDZA 1LJUA 1JFSA 1JDPA 2QR3A 2FXIA 4Z0NA 1KRWA 3IP7A 1PNRA 4EUKA 1XWWA 3NHZA 5KQPA 1MAVA 2PUBA 1WETA 1DG9A 1E6LA 1PHRA 1QPZA 4RK7A 4ZYLA 3O74A 1P6UA 4N76A 3OO0A 1M2EA 5IBQA 1W25A 1MIHA 3CS3A 2FEPA 3K4HA 4F12A 2QVCA 4KQ9A 1Z25A 4HYEA 1M2FA 3KYIB 3UUGA 2IKSA 4ZMRA 3CTPA 3NNSA 2R25B 1RNLA 4RKRA 4WUTA 1PEYA 1YK1A 1Z17A 3FDFA 3H5WA 4FE7A 2VUHB 3GBPA 3KSMA 2HPHA 4OG2A 4PICA 1USGA 5BRJA 5KQLA 5TQ0A 3MM4A 5HSGA 1ZITA 1NXWA 3HJFA 1VRVA 1I3CA 1U2QA 2IPMA 3C97A 4MS1A 1JF8A 1L5ZA 3LFTA 2HSGA 2H3HA 3LKVA 4RU1A 3H1GA 1Z2DA 4RS3A 4G0YA 4Z4HA 4RY0A 4EY3A 3TX6A 4S04A 3QLUA 2WJAA 1QMPA 4LE2A 2FN9A 4IGAA 1YK0A 3QELB 3RVRA 2VK2A 4G0OA 4RV5A 4D6YA 2AYZA 3LUHA 3HEBA 4MR7B 3FFTA 1Z12A 2GBPA 1NXXA 3BREA 1FQWA 3MIZA 3LOPA 3NNNA 1Z2EA 4P98A 2JVJA 1D2AA 4F06A 2E4WA 4PE5B 3LMKA 4G0XA 3QLUC 2A9PA 1A2OA 1DCKA 2E4UA 2L19A 3DGEC 4DQDA 2OQRA 1JYFA 4IMJB 4HNQA 4MRMA 3RVKA 4KVFA 1KGSA 3EQZA 1E6KA 4MQFA 1QQAA 4Q7EA 2L2QA 2FLKA 1E6MA 4RK4A 4MPTA 2LPMA 5TQJA 1DCFA 3KLOA 2IPLA 2QXYA 3TB6A 3OLZA 1JFTA 3C3MA 4N0QA 1A04A 1BAPA 4D74A 1ZH2A 1TLFA 2MYUA 1DRJA 1MB0A 3Q7SA 3RVQA 3F73A 3CNBA 1BDHA 4NQRA 1D1PA 1C4WA 1QO0D 2FN8A 3MQ4A 4YRZA 2RDMA 1BVHA 4KFCA 1Z26A 3HCWA 4FE4A 3EAFA 3F6PA 4MQEB 2PL9A 3IDOA 2O20A 2WB4A 3LUAA 3OQOA 2QW1A 1DBQA 4KRFA 3KCNA 4MLCA 5TPWA 4ETNA 3DBIA 3TO5A 4S05A 4GPAA 1NTRA 3H1FA 2RJOA 3C3WA 3CG0A 4YP9A 1TM2A 2RGYA 3IPCA 3JS5A 4QYMA 3IP9A 5TQ2A 4N47A 3QK7A 2B1JA 3OM0A 5EWLB 3H5IA 1OXKB 2Q5CA 5JNRA 2FMFA 3KS9A 3G1WA 4Z4IA 2JBAB 4JB2A 1NXSA 1E2BA 4G0QA 4EGSA 4MGEA 3I45A 5DCLA 3EGCA 2HQBA 3OLYA 5D2CA 2QSJA 2AYXA 1JBEA 3N8IA 4EVRA 1ZAYA 1USKA 3HS3A 1M5UA 2M98A 3MMNA 2MYPA 5I4CA 1DZ3A 3SY8A 2VYCA 5C5EA 2PJUA 3N53A 3CKMA 4KK4A 1USIA 5DLEA 9ABPA 2GI4A 4DN6A 3NNDA 2YHBA 2CHEA 4MAAA 1ZDMA 3R0JA 2BGGA 3OQMA 4GNRA 2JCGA 3H6GA 3RVOA 4RK0A 3T8YA 5ABPA 4MR8B 4IMIB 1W9HA 5B3JA 5JNUA 1URPA 2F8TA 1R8JA 1GCGA 3QLVC 1IIBA 3BRSA 2CWDA 4JAVC 1DC8A 3RVSA 3VNBA 3JY6A 4E7OA 3GBVA 2QU7A 2KYRA 5JNVA 4Z4GA 3HV2A 4D6XA 2PUEA 1FFGA 3GV0A 5E3JA 4RK1A 3GA5A 3CRNA 3Q9SA 3MF4A 3Q7TA 5KC9A 4MRMB 4Z4EA 3A3KA 5IUKC 5HQJA 3LUJA 3EDCA 5HM6A 3URMA 4EVQA 1JWLA 3N0XA 2QVGA 2M1ZA 1HEYA 1ZHHA 1D4ZA 4G86A 4YWHA 3RVJA 4W5NA 1ZGGA 3O1JC 2ZAYA 1DCMA 4W5QA 2PL1A 5EWMA 2IDMA 1JLKA 8ABPA 5FBHA 4KK3A 1ZVVA 3HM9A 3NHMA 3QEKA 4KV7A 3D8UA 3BRQA 1PUXA 3OLXA 4UHKA 1NXPA 3L6UA 5F64A 2R47A 3LKBA 4ETMA 2NZVG 3N75A 4MQEA 5TE9A 2JRLA 1Y1LA 4YLEA 3G85A 3F7NA 3N6VA 4JASB 4IILA 5TPWB 3M9WA 3OMWA 5JS2A 4JP1A 4HNSA 2H0AA 2FVYA 4O5AA 5TPZA 2FQXA 4F3TA 4OATA 1RZRD 3ILHA 6CHYA 4NICA 3LUGA 1SXIA 4Z4CA 4LE0A 4LE1A 3H5TA 3D02A 4MS1B 3KKEA 5DTEA 4LX8A 2VUIB 3K9CA 4W5OA 3HXMA 1BA2A 1D5WA 4YGXB 1XHEA 1DC7A 2V0NA 1DRKA 2B4AA 1EAYA 1QKKA 2NUBA 4M88A 3KYJB 2HJ9A 3QX9A 4MS3B 2PKXA 4MYRA 3ILYA 1SXGA 2R48A 3GL9A 3O2SB 1AB5A 3H5OA 4LRQA 3A10A 1FSPA 5TPZD 2ID7A 3HO1A 3ROFA 4MR8A 3A0UA 1BDIA 2WJWA 3OQNA 4E7PA 2TMYA 1ZGZA 4TMYA 3O2QB 2A9RA 1LBHA 4CBVA 5KQMA 3S99A 2FMHA 3RVPA 4YS6A 4L85A 4RSMA 1JFVA 1SXHA 4OBBA 3RVMA 5DGCA 2LIVA 2J48A 1U04A 4N03A 2PAFA 1ZN2A 2GWRA 1QO0A 1YTUA 4IF4A 1LK0A 3FGZA 4XFKA 1APBA 1ISRA 3IPAA 4JA2A 4EYQA 5CNIA 2MYTA 4Z99A 5EWMB 4H60A 5FWXB 4ZPJA 1RXIA 2I6FA 3KTOA 5KI6A 4OLBA 2A9QA 4QPJC 4XLTA 1Z18A 3CG4A 2NZUG 1JL3A 4YV7A 4KZKA 3HUUA 1P2FA 2WRZA 2E4YA 3A0RB 2FTKE 3LUKA 1ABEA 1EWKA 1PEAA 1RZRA 2PUCA 2F8SA 4EYOA 5IULC 3QX8A 3CHYA 4H3KB 1C0EA 2IYNA 3FFXA 3LTEA 3MA0A 4TLMB 1VLZA 5BR1A 4G0ZA 1NXOA 5IUJC 5KQGA 1PNTA 4Z4FA 3BBLA 1EWTA 1EFAA 4KREA 4P1ZA 5EWJB 1Z16A 4XAQA 1MB3A 1QP0A 4WXEA 1GUBA 4PEVA 1Z15A 4RXMA 2WWVD 2WMYA 4XASA 2L18A 3HVRA 5GQSA 1Z13A 4QYWA 1YMUA 1L5YA 2JVKA 4EYKA 5T7BA 3P9YA 4G0MA 3CFYA 5CNMA 3KLNA 2X7XA 3HUTA 4RXTA 5ED4A 1AB6A 2JB9A 1GUDA 4IRXA 3BILA 4TLLB 1CHNA 3DGFC 4WWHA 3DZDA 3EULA 1U0SY 3CU5A 2FMIA 1DP4A 3B2NA 3GT7A 4NCAA 4WXMA 5CNKA 3IP5A 1K68A 4KPYA 1M5TA 4MS4A 2ZWMA 2P4UA 1FFSA 3HDGA 3UK0A 5BRAA 2PE5A 1QQBA 2E4ZA 3M6MD 4NCBA 3TD9A 1SRRA 1QP4A 2HQOA 2LP4Y 4Q6WA 3LUFA 5JNTA 4DADA 1FFWA 4UHJA 1H9CA 1DBWA 2LUOA 1P8AA 3DLHA 5C5CA 5IEBA 3IP6A 2FW0A 1A0OA 1ISSA 1T34A 3JPYA 4RK5A 1SD5A 1CYEA 3E61A 3EJWA 3RH0A 1NATA 2MSKA 3SM9A 3OLWA 3RQIA 4HNRA 5FBKA 1BDJA 3I5AA 4OLAA 2NT3A 4Z9BA 4Z9AA 1CEYA 3JVIA 5PNTA 3GYBA 3GWGA 3QEMA 3LUCA 2NT4A 4RKQA 3CZ5A 3OM1A 2RJNA 1NXTA 4JB0A 3I42A
chains in the Genus database with same CATH superfamily
3CE6A 1GKKA 3PIRA 2X41A 2HSWA 5A7GA 5C5DA 4U9HS 4FFOA 5JSFA 4FOTA 2DYKA 4FP9A 1QC5A 4KOEC 4JEUA 5JAIA 2ZLBA 3CF4G 1AGRA 5K3OA 3KX2A 3EN0A 3RABA 4WV3A 3A26A 3HYTA 2CMDA 4ND1A 1U4OA 2AMFA 3GGSA 4G0PA 4OB6A 1V8PA 3KOWA 4ZT2A 2BYTA 2P2ZA 2II6A 3JQBC 3L9XA 1N5KA 5LFAA 3H16A 3L77A 3UPDA 3U3KA 4M99A 3I2YX 3Q2IA 4MVYA 1ECGA 4YRIA 4OK3A 1ZRHA 4QQNA 3SC3A 4QARA 4XXHA 3UN1A 3W9SA 3RUDA 3R09A 3FNHA 1PEKE 2X14A 2YHAA 1G4HA 1GCAA 3C74A 3R24A 4JJZA 4ZC8A 1OYVA 3ZI4A 1T9KA 3DV0A 2NMVA 1W581 1T3SA 3EWIA 3S28A 3GMTA 4MWOA 4QUDA 3FDXA 3EGXB 3GU3A 3JPWA 3KHUA 5AXDA 1CF2O 4QSMA 3KHKA 4BNVA 1GZDA 5JSHA 3UXMA 2JZNA 3H4TA 3MXOA 2C96A 3LWZA 3W6UA 1UBSB 2I7DA 2ZGVA 4G5OA 1Z2CA 1Q6ZA 3H4VA 1QR2A 1RP7A 2QRQA 3O4IA 4IJMA 4O4LF 4P81A 4TYPA 4ALKA 4COOA 2GJ4A 2HJGA 5DVZA 2VHJA 1YHZA 4TMZA 3OZFA 4A8JB 5HCUA 1TJ5A 1EZ1A 3AXSA 3U3MA 4BV8A 2FQWA 1VA5A 2G72A 2GX6A 3H18A 1CPYA 3C7CB 3EIFA 1ULBA 5K8VA 1DO2A 1AC5A 3BIJA 4KDRA 1OUMA 3VO1A 4ZANA 2OAQ1 2ZJ1A 4ZI3A 3U4AA 1BXKA 4HYTA 4NZ9A 4YAEA 1NQWA 2GEBA 4CMIB 5EJ9A 1C0KA 3PIIA 4B75A 3HBNA 4B3FX 5IEJA 4IJUA 1VL2A 1WO8A 4LF6B 4PXYA 5K05A 1NUHA 1CEXA 3HVUA 3IAAA 1KYVA 2V5VA 3GVIA 4ZO6A 3R3YA 3P0RA 1N2CA 4G4JA 2IKQA 5ECGC 2G70A 1AXEA 4XDHA 1G2PA 4LOKA 1N6PA 3SQOA 5IVHA 3MGKA 1BHO1 1HE4A 1LTHR 4KMOA 1TCVA 2ZYSA 1ISJA 2GNPA 1QGED 2JBAA 2PKRA 1GZSA 3PA6A 4FEGA 5ES3A 5EZ5A 2Y92A 2XVAA 1F6WA 4XCXA 3MJCA 5EKUA 4RDXA 3HY3A 2XLCA 2IS6A 2WMDA 3CLSC 1CY4A 2XYHA 2N75A 1H4TA 1MRNA 1MDBA 2HJVA 2N0SA 3P45A 2CLDX 4MVJH 2WHPB 5GV8A 1X7ZA 2VJMA 3HCRA 3HEMA 3I04M 4CHTA 4E13A 1JYEA 4HNVA 4ZT5A 5EJ8A 5KYKA 2I2XB 1OBCA 1I2BA 2X2FA 4TSFA 4YR7A 4EGJA 4LBYA 4FKZA 1E7RA 1YMVA 2VAWA 4UBJA 2NV6A 5LMZA 1EHCA 3ZGXA 1U8ZA 4KLCA 3CH6A 4MKZA 3REQB 2Q2QA 1N5JA 1JE0A 5IC4A 1JJBA 1LH0A 1Z5VA 3C3PA 1ZMBA 3DZIA 3FSGA 5CLHA 1TZMA 1P5FA 2D1QA 1U7DA 3FPSA 3ZZ1A 3M5PA 1IEWA 2HREA 4Y9TA 4Z8YA 4WNAA 1OH5A 2HSJA 4YXWA 2HSEA 1FDVA 1KEPA 3FHJA 1U0BB 4L3WA 1H0RA 1YB4A 2VPPA 3CLUD 4CLHA 3ERCA 5HYVA 4LZAA 2AI3A 4UNIA 3U61B 4FFSA 4NEQA 2ZT5A 1ECBA 3F4BA 1JU4A 3IVGA 3NBKA 4JT8A 5GM1A 1EGAA 5DHRA 1MOPA 2FXIA 1SVOA 3PPXA 4MIEA 2YC2C 5AVWA 2QZ4A 4HLUC 4ZVNA 1Q0ZA 2FMTA 5IZ4A 1G5FA 4Z86A 3H1PA 2ZUTA 3WISA 1ZN7A 3KJFA 5CBKA 3A1WA 3IVAA 4RIGA 3WS7A 1I7LA 1JIKA 1KK3A 1M2EA 2GHTA 5JG7A 4CL8A 2JAHA 3DDNA 3YASA 3THXB 1B8NA 1PJBA 3PNVA 1IN4A 1Y7IA 1PGQA 1Y1KE 1Q22A 1IM5A 3KBOA 4K9QA 4BU1A 4A26A 3SJBA 5G4KB 4OHOA 4RVUA 3SVZA 3E3OA 4V02A 4C0BA 1JN0A 1XELA 2D00A 5ILOA 3BORA 3KV1A 5D3MA 2C84A 4Q1AA 4TTSA 1X86B 2PYDA 1IUOA 1EVKA 1S9HA 1Z4MA 3CN9A 3ACBA 3P0JA 1H2FA 4LCJA 3R44A 3L82B 3ZNNA 3W5AA 1JIXA 1ZITA 4R69A 4EAQA 1DO0A 4YJGA 2B5OA 4LW8A 4B8YA 2WR8A 4JP5A 5BRNA 3L9WA 4J0QA 1HTBA 2GKSA 2Z5FA 3A37A 2BEVB 4DTIA 1WUHS 1Z2DA 3C41J 4JNKA 4Z4HA 1A3CA 2Q5IA 2V3WA 3PGA1 1V26A 4MP6A 4ZOLF 2ADOA 3LT4A 2K87A 3QLUA 4LXQA 4CKCA 2XI4A 4ZGWA 2FN9A 3O47A 3QELB 1P7WA 4YACA 5F1KA 3FHCB 3CYFA 1U0OC 3RS4A 4DMMA 3PJEA 3QYPA 4U7DA 4MR7B 1T2UA 1W36C 1DXYA 1CD5A 1G20E 2Q8QA 2WIBA 5CPFA 2QMUA 4KI7A 2PLAA 421PA 3MIZA 1L8QA 1PWYE 1XU9A 2ZJOA 4L5IA 1KY5A 4WY2A 3LMKA 5HCIA 1E1CA 2IDKA 2SICE 2XCIA 4DBLE 1AKRA 4ARZB 1JQBA 2ZR0A 2C7QA 1IHDA 2BFOA 2FDRA 3NDJA 4IAOA 3TDNA 3O3CA 1G19A 4BMYA 1FDSA 2G9UA 4B84A 4KIWA 1QANA 3KB1A 2X42A 3EQZA 3IAUA 2WAAA 3DCNA 2FZ5A 4GXQA 4I9FA 1XYYA 4TL9A 4X60A 2LPMA 3VO9A 4XIIA 4QBIA 1UT5A 2HEIA 1JEEA 4KLNA 2XVXA 1UDWA 1YZKA 3IUBA 3RT1A 3DTVB 2PH7A 2B61A 4JZYA 2ZB8A 5I6DA 3D8HA 2G4CA 3KR2A 4EARA 1YZHA 2VUUA 1XTTA 4DA4A 3QJGA 3LCJA 4KFTA 1DB3A 1FU8A 4EABA 2Y1FA 1ZEMA 1KJJA 3LT5A 1QCDA 1L4NA 1W2HA 2R751 2ZVDA 2FFRA 5IJ0A 3D4NA 2O8BA 4O8ZA 2JDIA 3EXIA 2HHLA 4D8WA 2V6BA 3HB0A 4FT4A 2W43A 4EFKA 1HSOA 3EZ2A 2CVPA 5DASA 3GOHA 4XE5A 4B6OA 1Y8RB 1UK7A 1I5OA 4J0EA 1EXNA 2ZIFA 2ZSBA 5ALIA 4Z6KA 3IQXA 4B79A 2BF4A 3CA8A 1WLYA 1XHLA 3SFTA 1MAHA 5I7SA 3D8RA 4S1VA 4AIRA 1E6CA 3H5NA 3G1WA 1ENOA 1PSZA 2VHUA 3U7FB 2C5HA 3KZVA 4Y2TA 2G82A 1UAAA 2QPOA 5EVJA 3TRHA 2WJVA 4JXXA 1PS0A 2HU8A 3SY8A 5BR7A 4Y6LA 1W2WB 1BRMA 2LIPA 2WPDA 4HQLA 4KK4A 1X7GA 4JYMA 3AF6A 5B6JA 1GD1O 1T1GA 3D2AA 2WYHA 1U3TA 3AESB 2GDJA 3EUAA 3F8WA 1Y80A 5AUOB 3MCTA 1NMEA 3I6IA 2EWWA 3QVUA 2C78A 3CSDA 5JXIA 4Q9KA 4LSWA 4Z49A 1E0AA 1U8YA 1PJZA 1PZFA 3FJYA 3JQEA 4QOGA 4MMZB 3RM3A 4B73A 2HMUA 1C50A 4MR8B 4IMIB 2DPLA 4XRRA 3RSQA 5JNUA 1WW2A 3DWIA 4ND2A 3H9UA 3DZ8A 3DOEA 4DNOA 3RT9A 4RORA 1MIOB 1OWNA 2FEOA 3GBVA 2HF8A 3BWEA 5D7NA 4ZTZB 4D6XA 2PO5A 1HBJA 4ASUA 4QBFA 1SCDA 1FEZA 4ZEMA 3PUHA 3CM0A 3E0QA 4H6WA 4ARAA 3VPFA 3J81k 3RUCA 5HP4A 1FXUA 1VG1A 1VKOA 1YZ3A 2G28A 2M1ZA 5DNDA 4KAJA 3EUFA 3C6XA 5TMDA 4C89A 2BI8A 5BN3B 5BSGA 4WA7A 2VJPA 4Q3OA 1ZIOA 5P21A 3X1YA 4CQMD 2JARA 2BHTA 3UENA 1QH8A 4N3NA 1S3GA 4Q4HB 2GFQA 1RXCA 2V59A 2IDMA 2O5VA 2WSSA 3EIEA 3LW7A 2F3TA 4JSTA 4ITVA 3T3PB 1TUGA 3QEKA 1BFUA 3D8UA 1SVSA 3OLXA 1TLLA 1TKAA 5EL0A 3PNPA 1WZEA 3LECA 3UWKA 4IFBA 2B8JA 4K05A 4RHCA 5HIIA 1FOEB 2VCEA 4FMCB 4RFSB 3CKYA 3MWYW 2JRLA 1Y4UA 3G85A 1ULSA 1CP2A 3PICA 2QQGA 3PFKA 2AI2A 1MZPA 1LJ8A 1SQFA 4Q47A 1ONSA 1NJSA 1V7PC 3Q6IA 3RSGA 4F2WA 1Y8QB 4E5PA 1KZYC 3HN6A 4OHPA 3VJKA 3TJRA 4PRZA 6CHYA 1QPGA 2I78A 4Q3BA 4LE0A 5LWHA 4GOJA 3LVBA 4J43A 3QNUA 2GXSA 2G9NA 4F2HA 1XVUA 2VUIB 2WABA 2ZIGA 5IJZA 4QDZA 3KUCA 3SHQA 1G291 3SBEA 1A98A 1NW5A 1IY1A 1F2VA 1E1YA 1QG2A 2R8BA 4XVHA 3WLOA 4ETWA 5G4LA 1YB7A 2DC1A 5J4KA 1OVGA 2BEJA 4K28A 3UA4A 1NBEA 1RKXA 5KYYB 2XT6A 5J47A 3KKQA 4WDQA 1BMTA 3GLQA 4I1UA 3ZJVA 2G5GX 2K7ZA 2YCBA 3H99A 4LRQA 4EO4A 5BV0A 2GF2A 2YUIA 3B1XA 1Z6TA 1FS5A 5LZ8A 3ROFA 4C7MA 2GAIA 2WFAA 3HCDA 3TZKA 1ZQ9A 1A2QA 2CW5A 2D0OB 2CEAA 1FCJA 5FLYA 2W2VA 4DC0A 1RC1A 4UQOA 3M9LA 1JQ3A 1OIXA 1OBOA 1QM5A 2VAXA 3ANXA 1J6UA 3BIWA 3GJZA 2O5EA 1YQWA 2BGRA 1A8UA 1UWCA 3CNEA 3GCDA 2EHJA 3I9NA 5K99A 1QWOA 4YEDA 3DM5A 3U4QB 4OPMA 1X3LA 1F17A 2ETXA 3JX9A 6NULA 2LIVA 3JW8A 3WGJA 1PL0A 5CP8A 2JFXA 3PJDA 1DC3A 1CX9B 3AHGA 4UZSA 4RVHA 5KKAA 5KTTA 4UU1A 2J87A 1XL1A 3EDMA 2GZRA 3ZHSA 1DAHA 4I55A 3PNQA 3EA0A 1ISRA 4B7ZA 5BNWA 1Z7YA 3WLHA 4NYMQ 2JFVA 1WJGA 4UDYX 1XL0A 3H7IA 1FUKA 3RJ9A 4FDVA 4PC1A 2ZYVX 2XMSA 5J59A 5E8JA 4CKEA 1XIVA 3DOUA 4DABA 1UXIA 2QLJA 1OXUA 2PXAA 5JR3A 1AKYA 4WJKB 1UBRS 4D99A 4HT3B 4ZCIA 5AJHA 3OEEA 4MRNA 3A31A 5E9JA 3QFTA 3ZHQA 2BJHA 2QGFA 4HZUA 1C7FA 1TT5B 1UBTS 2A67A 1ABEA 4QBTA 3SZRA 3WO1A 5K0JA 1A9XA 1P31A 1IBKB 5D6OA 4UXHA 5M2QA 4GM0A 4LNHA 1SVKA 1FUEA 3HV0A 4MKRA 2NXJA 3LK7A 4LY3A 1KEZA 4W82A 2HCRA 3BMQB 2CLFB 3THYA 1NY6A 2CMGA 4G0ZA 2WTEA 2JRCA 1KJIA 3IIEA 5H9WA 5ALKA 4EG4A 3WKCA 5EJEA 5DWDA 4HH4A 4OKNA 4WJLA 2QMZA 5EIOA 1T5LA 1Z16A 4GPTA 3K94A 1L7OA 2IHKA 4WXEA 3C6KA 1TZJA 1H1DA 1OV4A 3OWHA 4FLFA 1E6WA 4QPCA 4C01A 2WWVD 3BF7A 1JE1A 1GG5A 3H2SA 4Q9LA 4EENA 1B8UA 4U02A 4HNGA 5GQSA 5I9SA 1N33B 4YRFA 5CAEB 3L4KA 4AKGA 2GLUA 3DEJA 5BVGA 5IF3A 2IDZA 3FE2A 1ZSYA 2ONKA 2REQB 1ES9A 3PC2A 4G1MB 4H0FA 1IUPA 1VQ1A 4M1KA 3THSA 4LVCA 1OH6A 1TRKA 3HR7A 3L84A 3QJ5A 4IRXA 4DRXA 1CHNA 2H18A 4RD6A 1CUBA 1X7XA 3EG5A 5JVDB 1KDVA 1A8HA 1DEHA 3B2NA 3NW9A 1XD2B 3JYOA 2I7XA 2GXUA 1A5ZA 4X41A 2ALJA 3L7JA 4H1TA 3W9UA 1B8VA 3CB2A 5AXAA 1PW7A 4J1NA 5LL6P 3AJDA 1MC4A 4RADA 2HRBA 3AUUA 4MV3A 3SJZA 3UK0A 1QHXA 3FMPB 1ZMRA 3HDGA 2XEXA 3LPLA 5BRAA 4B35A 1ZGCA 3TD9A 1QP4A 2C4KA 2Q5OA 4JBWA 1KZHA 2YNMD 2RI6A 2JBWA 3COYA 4NAHA 8AT1A 5LZ2A 3NT5A 1HC7A 4IUYA 4U5QA 1FQKA 5C5CA 2EEZA 4HDMB 4H1UA 3CPHA 3VKHA 1A0OA 1R1DA 2FSUA 1T34A 1AV7A 1AHHA 1GPYA 4NDAA 1X15A 2O7NA 1T2NA 4ARVA 3A4NA 3NC0C 4KUGA 5CYOA 1C30B 4EFDA 2WWHA 3LQKA 4R3NA 4XM2A 1ND6A 3IUNA 4TKZA 1M8PA 3E5HA 3KQTA 4YWJA 2QRZA 4AZWA 4FMDF 2XWQA 1XFAA 4TRNA 3CRRA 3MHPA 4M53A 5CK5A 5EPUA 3VH3A 3R7DA 1FTNA 3QWIA 2GSDA 1HETA 3FZEA 4DYHA 3NWBA 5IJ9A 4QTYA 5DIFA 3VISA 2NPIA 3MB8A 4CR6A 3C3CA 3RF7A 3VNQA 1NXTA 2YFKA 1GQQA 3HY6A 3DZCA 1JQKA 1M7HA 2W6ZA 3PNLA 2EFYA 1O5IA 4IL5A 1DJMA 3V6MA 1GAQA 3QU2A 2Q6TA 3AOEC 4KJZA 4XI9A 1SG0A 2HHAA 1JFRA 4IP0A 4OQFA 2FG5A 4QYIA 4JXZA 1QS0B 2ZJYA 3K0FA 3OJOA 2CFCA 5K01A 2H51A 1ENZA 4HAZA 1IY8A 1E0KA 1ZWLA 2R1TA 1MJGM 5G3ZA 3EVDA 4OYLA 4JHXA 3ZU5A 1J25A 2ZAIA 4HGZA 2DMRA 4MLDA 1U8UA 4UE2A 3KWFA 4PPQA 2PBZA 4KQJA 4AQDA 5LQUA 1ML4A 1I0IA 2QDKA 4HP8A 1II8A 2Y8EA 4KUEA 1I9CA 3F5QA 5LYYA 1BWSA 3R3VA 2FKAA 1VJCA 3GLTA 4N0PA 4YJ3A 2QAGB 3UXYA 1TMGE 3RAEC 5IAOA 2IPAB 1KS2A 3CCBA 2C2MA 5A5VA 2K7FA 1NYRA 2OV4A 4BE4A 4RXUA 3TI7A 2IL1A 3ZWWA 3T1OA 2IYXA 2VATA 1MZVA 1MR3F 4X64B 2ZCVA 4ZEXA 1G8KA 2Q5QA 3LXXA 4GM4A 3TW8B 4EPYA 5BO5A 3VPBA 3P2JA 1GAWA 1QFZA 2FQYA 4E15A 3WG9A 1G1AA 2O07A 3H42B 1U5AA 1M72A 2MR6A 4MJXA 5H02A 2E21A 2FEKA 2G40A 1O77A 3H05A 3ZGOA 5CD1A 2O3TA 2OCYC 3STTA 3UAGA 4CMEA 2JK0A 3UVEA 1GGJA 5FL3A 4A0HA 2C8LA 3HCAA 2B7BA 2NWQA 1YHYA 1PFVA 2OBNA 4GMGA 1HX7A 2EW8A 2XGOA 1BS2A 5D01A 5H3LA 1KYTA 4TWBA 1TQHA 1T2CA 3EHEA 1BROA 5BYKA 1SKQA 5ELXA 1TK3A 1JSXA 1IL0A 2CDAA 2QRVB 3RVBA 1Q1ZA 2HA2A 2JEYA 3QH4A 2QENA 2V3CC 1SVMA 2F43A 2VYVA 4CPDA 4W5WA 4OJKA 3USES 1OD6A 2L82A 3FA2A 5TX7A 1A4IA 1T4BA 3VM6A 1G0NA 3NIDB 4R8LA 4TVOA 2ZBRA 3DVSX 3QPUA 5PGMA 1P7PA 3ITKA 3KV3O 1KE1A 1QHFA 3ZHVA 2RI0A 3IQZA 5FORA 4KHZA 3FJ1A 2WYWA 3OCCA 4H7DA 4PSCA 2XXJA 2LCQA 5A2QA 1QNLA 2FJ0A 3N0RA 5TGZA 3DEKA 4RZSA 1X14A 4D5EA 3RUFA 4FEEA 2ONJA 2PWZA 2EAUA 2PRJA 2TYSB 4HEA1 4MGYR 1QO9A 5BN4A 5LA6B 5AKGA 4AZ0B 4CF4A 2W2MA 1KOJA 3CRVA 3F7OA 1PJTA 2OB1A 3NBAA 4K9KA 4QOSA 4WZZA 5EMLA 5B1DA 5E38A 3ZN2A 4NY1A 4MMYB 3R7FA 1VPWA 2IYFA 2NVOA 1Y7LA 5GJWC 1JHVA 1GLNA 3TPZA 6Q21A 3COWA 4GP7A 4I6JA 2IXDA 1W4CA 3O2JA 3KETA 3VR2A 5JROA 2OLJA 4FYKA 3TQFA 4HAYA 4JROA 2QUAA 1CQJA 2GSWA 1EFHA 4PNEA 4N82A 5F35A 5KTPA 3AVUA 3HN2A 1L5OA 3KJZA 1DUSA 1DBPA 4B3XA 3ENWA 1IEVA 3L4BC 2XUDA 1FFEA 2A92A 1DIHA 4M7WA 3EVAA 3MUEA 1PJ2A 3DS8A 1PFGA 4DDUA 1KKLA 2YY6A 5HWSA 3GB9A 3GZJA 3O26A 4F8YA 3CINA 5K8LA 1IZ8A 2OE2A 3IPYA 5H5JA 3KDPA 4ZJYA 4L1KA 1CFJA 3GZ4A 2QRNA 4FI3C 2BFPA 1OTHA 1KQNA 1U98A 2CWWA 4BX2A 4F38A 2A6PA 1NI4A 2ZR7A 1A1SA 2QR3A 1W0JD 4G2NA 3QKSA 3QVGA 5C0OE 1ADFA 5KNBA 1UPUA 4G1FA 4HGNA 4RJ2A 4YNBA 5SZKB 3F9IA 4HRYA 3KVNA 2WWRA 4EQ6A 1MNAA 2ZS9A 1VFPA 3ETDA 1F2TA 1K7XB 3S1SA 4QREA 4C07A 1VL5A 4TKUA 1CY8A 2HC9A 1P6UA 1ZK1A 1GZ5A 3R9KA 2Q4DA 4K1LA 1N1MA 1MVNA 3D7KA 4NBSA 4TTAA 1O94A 4J3NA 5LQCA 1M1YB 2C7OA 1E3MA 2DHQA 1KFBB 1P0CA 4LG1A 3CMMA 4G01B 4JQOA 4FWIB 4KIFA 3L6BA 1OAAA 3R7WA 1E94E 3JVUA 3NHAA 1DEKA 3E4DA 1XLVA 4B3MB 4OOFA 4IH9A 1HLDA 1QG0A 1Y89A 4FXPA 4F4FA 1C9NA 1N7GA 2R4TA 5TV2A 3LHSA 1Z17A 4LOIA 3CTMA 3OJFA 1N6NA 1VXOA 2NSYA 1RD4A 1RXSA 3QEBZ 1ONOA 1GEGA 2NSLA 1M1UA 3U7QB 1P62B 1EGHA 4WGFA 2COUA 1V8DA 1NGSA 1E9CA 1XMJA 2A7XA 4PQEA 4QU8A 3R0VA 1GUYA 1UOEA 4G4GA 4L28A 3IBTA 4DOMA 5IHXA 1VZ2A 3KVVA 7ADHA 5B2EA 4Y1RB 1GCIA 4UHDA 3ZV7A 1DWQA 1G21A 2IC5A 2M6SA 2OO3A 3HMQA 3QHPA 4V0KA 4BLOA 4RY0A 2EV9A 3EJ6A 2V4UA 1YNOA 1Y9AA 3QYJA 4KPGA 2C5LA 2NO9A 2XNHA 3GEEA 3M5WA 1FJ2A 3QBTA 3A1DA 3D2LA 3LFHA 4XX0B 1IN5A 3MRVA 5G3YA 3ZCVA 4G0OA 2OHXA 1S2IA 3VPSA 3DHWC 3GNSA 2ODBA 2G06A 2M6RA 3GZTB 4NSNA 5EXSA 2XB8A 3OZWA 4IHAA 4UNNA 4W1SA 3T52A 3ZHRA 1PL6A 3CZRA 4IZ6A 3SEZA 3L43A 2GPNA 2YV2A 9ABPA 2ZI5A 3I0MA 3ZE7A 4ZYUA 4HNQA 2JGDA 1UAGA 5SYAA 3ZDEA 4MQFA 2PHZA 1CUUA 2WVJA 4LJLA 4Y6SA 1KF0A 1H2RS 2OORA 4LOJA 4MPTA 1DCFA 4WH0A 2QSUA 4KHPB 1ORIA 1RVV1 2W6NA 1CDEA 3DSRA 2CHVA 4FS3A 3C3MA 1BAPA 4KKXB 1XN4A 5AWFC 1ZP6A 3QXJA 2GD6A 2EQBA 1OX4B 4JBLA 2QXTA 3Q7SA 4KQMA 1GPKA 3CNBA 1N8TA 4NL4H 1LPPA 1JHAA 1Q6YA 3JQPA 3KAJA 4MV4A 3FPBA 5TSDA 3X0DA 4DM7A 1J42A 2GARA 1DDIA 4XQEA 3F6PA 5CDFA 4OBXA 3A6EA 4JVLA 4R2IA 4C6TA 2JA2A 2PM8A 3AEUB 4DG8A 2EATA 1DBQA 1PL8A 4MYTA 5G53C 2VCHA 4Q9IA 1Z7WA 4MDYA 1GA6A 2NVUB 2EDAA 5H8WA 1QHNA 5AW9A 4KQEA 4PHCA 2XZLA 2O2ZA 4URWR 1CY6A 2QM3A 2C3UA 2OD7A 3ILSA 5JT1A 2BM8A 1EP9A 2J45A 4R83A 2WUVA 1LLQA 2IXBA 3T5CA 1KTVA 4RTRA 1SA0B 3QEAZ 4V0NA 1K6XA 4LUCA 3CBGA 1GQ2A 4RF3A 1QB8A 2HQBA 3VBEA 1V2HE 2R86A 5D2CA 5JQWA 5ALJA 5A04A 3O38A 2HHHB 1NPTO 2DBYA 2G63A 2IX9A 3PVZA 4DIFA 4R0VA 4KYIB 4UPDA 2L42A 1KJNA 4HLQB 1MPTA 1UM9A 1USIA 3I04A 5EJFA 1QQTA 2QI9C 4X1YB 3NNDA 5TT0A 1NASA 4P3XA 1MJ5A 2UUAB 4TMWA 4PY2A 3U1BA 2GZSA 1DE0A 2WLTA 3EFBA 3MS2A 3DVAB 3HNRA 1DAFA 5FOSA 1T4CA 3C14C 1WHTA 1M2OB 2GGSA 3SSMA 2YW9A 3ULKA 3HKBA 1Z0AA 4AS2A 5ER6A 1EPUA 5EIWA 1C0PA 1DHTA 4G1CA 4BKRA 1QH0A 4J3FA 1N5OX 2NUTB 4JAVC 4Z54A 5ADWA 2RHLA 5IKMA 3L8MA 4GO1A 1ZNYA 5K6RA 4A0RA 3IT3A 2GEDA 5K20A 5KWVA 1P9RA 4NZPA 1FX1A 1P81A 4P4LA 4RK1A 3FAZA 2O8FA 3RV4A 5D3KA 2MTBA 1EUZA 1Z0JA 4FX5A 3LUJA 5AH0A 2OORC 5HM6A 3U7IA 3UK6A 3DP9A 3EEFA 3ZEIA 5KMGB 3AVWA 3HB4X 4WPGA 1YOVB 3BC1A 5LLSA 1ZGGA 2HK6A 2F1RA 1TUBA 2ZAYA 3DXFA 3GLHE 1JG6A 4LRYA 5FR2A 5CA0A 1GKYA 4CQLA 2C58A 4A1OA 2V6MA 3TZCA 1NQUA 2R66A 8ABPA 2VQFB 2JJYA 1S2NA 1GT91 4NV1A 3C7DB 4C0JA 621PA 4UHKA 1E63A 1H0HA 1A69A 1QYRA 2CMHA 1M6VB 4P4UA 5B36A 1UKEA 1L1RA 3AF0A 4WINA 4HLNA 4BNGA 1FXSA 5BY2A 1VHWA 4OCZA 2PNFA 1PFWA 1E1QD 1SO8A 1E32A 5D5HA 1BMFA 2AJDA 2D7DA 1QFYA 2I33A 4XM0A 3I8XA 2GMWA 3AR4A 3PZRA 3UV6A 1RBQA 1UBJS 2VXOA 4Y18A 3E03A 4BNTA 1A4XA 1WU8A 4BNXA 1N3LA 2AK3A 4RVGA 3M1AA 4Z0PA 1OQAA 2QV7A 1KPIA 3VH4A 2PVCA 2AQIA 3UJHA 2GXAA 4NFSA 2GZ2A 3C4JA 5DTQA 4F3TA 1QZ3A 3GZNB 3NH9A 3ESAA 3G5AA 1KK2A 2BKXA 2XCOA 2CBZA 1ZK2A 4IIGA 3T3GA 4OHKA 4AJOA 1B2LA 5K09A 2PKQP 1KO5A 1RADA 2FPIB 5A71A 2CLKB 5TLSA 3ORYA 3FRJA 1QLJA 4FCWA 1WL8A 4TSKA 3K9CA 2OPHA 1TK2A 2ABWA 1CJMA 2GBLC 4JS0A 3KUDA 4KXNA 4LYEA 4QIHA 2ZRGA 3WRVA 4AXBA 2VBFA 4DUGA 4G25A 3GJSA 5F3RA 1QTRA 2ON6A 3GK3A 2NUBA 5JLAA 4RNCA 4YGYA 3E5RA 5DI3B 5U4QA 1A8PA 1NRWA 3NONA 3RU2A 3E4CA 2X3FA 3QX9A 4IYJA 4BFUA 3BXPA 2ZU0C 1K4KA 4NBRA 2JATA 2XAUA 4F4HA 5CDSA 1N25A 2P79A 4CNQA 2HB6A 4BFWA 2E1RA 2I87A 1Q1GA 2P3OA 3MJDA 4CMJA 4E70A 3JQ7B 3NOXA 3SX0A 3ZYZA 2ZAGA 4DJDC 3ASZA 1PBNA 3NHKA 4EUEA 2NU6B 2HT6A 1VI5A 2NYRA 3W3AH 1GPUA 4AZTA 3G2OA 1ECLA 2PZ8A 4WAUA 1OC2A 3DDSA 3N6RA 1DBIA 3O9VA 2FMHA 1KJQA 2ZSEA 2XAAA 4L85A 4YS6A 3SQLA 1IZZA 2G76A 3QF4A 4JJ4A 5GZ6A 2J48A 5DGIA 3RFXA 3GLIA 4JDPA 1VOTA 2J41A 4UAVA 2J7PD 3DOJA 3KOXA 3WGHA 2CKMA 4L3OA 4NU0A 1R27A 4OJNA 2AW3A 5D8DA 4UMEA 1T9HA 3AJAA 4XFKA 5CPBA 3D8NA 2GLXA 4RNDB 2HCJB 2QD1A 3PPIA 3Q6MA 2R6GA 3KKNA 4E94A 1TIPA 5EWMB 3WBBA 2B6HA 3L8YA 1SCBA 3IC5A 5DYGA 4DNXA 1EX6A 3ANLA 2B0JA 5KWIA 2OFWA 4HDNB 1ECJA 4POOA 1J24A 3OZXA 5EE1A 4I55F 4ZGGA 3HO8A 5F51A 1SRQA 1JQEA 5LN1A 4D42A 5C5IA 5K9ZA 1TAUA 1HDYA 1X9HA 4HO1X 3RHFA 4P4TA 1G8PA 2DWOA 1S3FA 3EVTA 1KDYA 4ZRNA 3S1AA 1NLYA 1QIFA 3NHRA 3TPCA 1QHIA 1BNCA 4KRGA 2NSHA 1TOAA 3WFJA 2JGIA 4TTPA 1U1FA 1XQWA 4DLTA 5DM0A 1QRDA 2WV7A 2V6IA 4H4CA 1DEOA 4OL0A 5JFOA 4H7HA 2XCSB 3H19A 5KNCH 2JLVA 3V42A 1LS1A 3B51X 3D7NA 1PNTA 2EP8A 3FNIA 3AFIA 4GLBA 4PZUA 3RHTA 2VYFA 2ZJ5A 3UK1A 4L75A 1SG6A 4QJ5A 4MQLA 4QKQA 3HI6A 4JBIA 2D5LA 2VSOA 3JU3A 2CYCA 3WK9A 4JLUA 4ZHSA 3G23A 4YUAA 4QYWA 3E82A 2Y1OA 3OZGA 2JI6A 3JWJA 4NCHA 4EUSA 2H4YA 3TXAA 4AS3A 2HRCA 3HBLA 4CM9D 4YX9A 2XKKA 4YAWA 3GLGE 5JRJA 2DUUA 5A4IS 1GUDA 1L7VC 2R84A 1NDUA 4EI9A 4ISCA 3OM9A 1C7JA 1NFFA 3EFEA 4ND6A 4OMCA 4YXWD 4K88A 3FTNA 1CZNA 1GADO 4MRAA 4N8EA 3T1QA 4E6PA 4HUJA 4OY3A 1E4EB 2O14A 3K8YA 5KYXA 2W8ZA 4YRDA 1ZH0A 2PYIA 3WWDA 5F7XA 3OFVA 2FUNB 4DCUA 2ZG6A 3GN2A 4PLZA 3KYBA 4XB2A 3RR2A 1VIVA 2XKJE 1JEJA 4TM8A 1G8MA 4C2BA 4OYRA 1X7YA 3W6PA 4YH1A 3C3EA 5TB5A 3R7BA 2AOTB 4LGMA 4AROA 4TV8F 1GTZA 5FP0A 4P80A 3RANA 5LZ5A 2MSKA 5C1PA 2G9QA 3EXEA 3MJEA 1N6LA 1U8FO 3UBMA 5KNBD 3TG8A 2ZUSA 3LWDA 4HGPA 4IMPA 5B1EA 1KQGA 5CJ2A 1YR7A 1YZVA 3F0TA 2A9VA 4GKVA 1AMNA 5TF4A 4I1PA 3JVIA 1CV2A 4BLWA 3I61A 1FX0A 2A9KA 2VBGA 1X7WA 5IASA 4LY6A 2NT4A 2B1GA 4BLTA 3UZUA 1BIFA 1GQSA 3DULA 4ZYYA 1SBNE 2F59A 3BL5A 5FAXA 4BMXA 1AT1A 3NETA 3PFCA 3S2FA 3FW1A 1BDMA 3LHIA 3EGDA 3NT2A 3TSCA 3H9QA 1P0PA 3H9EO 3LAWA 4ZAVA 3INGA 3TFWA 2WQ7A 1JH9A 4JUAA 1Q74A 4FB4A 2GYWA 3GLGB 5FOVA 4G4SO 1R6BX 5B37A 1PR6A 2BV3A 1QZTA 2Q3BA 2YJGA 5FUQA 1JTEA 1TDJA 2ATIA 2PFGA 5IRCD 4HLCA 1E2FA 2XXAA 1GGFA 4QWMA 1K8QA 1H2ZA 4MV6A 4N12A 4B81A 1WP9A 2PKCA 4CMAA 4ZFNA 3P4YA 3R6WA 1F8XA 4MS3A 5HF9A 1JALA 1X80A 4II2A 1H23A 5MFZA 4TWRA 3VR5D 1P1CA 4NPCA 2MWMA 1UBFA 1S2DA 1M34E 4J2TA 1KE2A 1OWMA 3ZBQA 2A84A 3DTTA 1ID1A 3WX0A 2DU8A 5IKPA 4Q5IA 4UVHA 3WB0A 3WNZA 3I2JA 1P80A 4ZQBA 1H5UA 4EM6A 1XEWY 3BJEA 4ER5A 4FDUA 2JASA 1BCRB 5B53A 3HBMA 3JQQA 3IQIX 4DV2B 1N92A 3TZEA 5CVUA 5JYCA 2QD5A 2ZZMA 2AXQA 3A3OA 3V33A 3A6KA 4YECA 5J2UB 4XYBA 5IARA 3VNAA 2JNWA 3H1EA 1JEAA 3NEYA 2AGVA 3WLAA 1A7KA 1T6XA 3QE0A 2VJKA 4RGVA 1ULHA 1Q7BA 1IATA 4BPRA 4QVIA 2VWGA 3WK5A 5FWXA 1PTJA 4O2LA 1ZUHA 5AVSA 2FSHA 1IHYA 5AI5A 4BNLA 1I4OA 3JQGA 1Z4KA 1WMFA 1YS1X 1YQQA 1A82A 1AF7A 1VKJA 5JNWA 1NXVA 1MQ9A 4O1HA 1F0KA 3BG5A 4KWCA 4HUTA 3LTNC 2LRHA 1Z4QA 1HUQA 1JQDA 1D2HA 3M6AA 1HXHA 3HA5A 1W1IA 2JJ8A 1ILWA 1EXWA 2MR5A 2O2IA 2OCPA 4WOBA 5HTKA 3TZBA 3WGUA 1ZBDA 1W4LA 5ALGA 5ESDA 5IX8A 2QI9F 1NQ5A 4IO0A 2W2QA 4M0PA 1DRVA 3L0PA 5THKA 5K2OA 1CRZA 4GD3Q 3GQVA 1BXRA 2AKYA 1II0A 1QGZA 2ZXFA 4H4EA 4J4BA 4Z9YA 4JENA 4W5RA 4XUDA 2HXYA 4ZD6A 3GY0A 3ZHXA 2DEUA 4RY9A 2FWJA 1GAXA 1I7PA 1K4YA 1PV1A 1BE6A 3KQPA 3IKMB 3EX7C 3AUKA 1FB5A 4PO8A 1PN3A 3GAAA 1QUEA 3I12A 2C4NA 4MKXA 4GRDA 4MPDA 4Y3UA 4ZVKA 5KJEA 4BWYA 3KKKA 4KC0A 1E69A 1EJ6A 3AVOA 3BWYA 3M82A 4Q19A 3VHXA 1Z0IA 4ARCA 2F9LA 5LBTA 3SC6A 3F6CA 3PZBA 5AHXA 2W0SA 2X22A 4NZZA 1J07A 1EQUA 1N6IA 2I4OA 3DLTA 2WWXA 1TVCA 1XCMA 4LRUA 1WNTA 3A25A 3U7EB 5JAHA 4CF3A 4O6VA 5GJVC 1J23A 3FHLA 4O2BA 1E5LA 1TT7A 4OXNA 1Q7TA 3SZMA 2YBDA 5BVHB 1UZMA 1Z0ZA 4I08A 3UB2A 1YRLA 1XCPA 1MC1A 3WYDA 2J7PA 1Q50A 1QIKA 4J0DA 4MS4B 2GHRA 2OWEA 3N8HA 3Q7PA 4ARSA 4DLLA 4KITB 1UDRA 5FBZA 4QFDA 4BC1A 3AB3A 1FRVA 2JLCA 1NJFA 2P9QA 1AF4A 5AM2A 4DJFC 1F7UA 2Q5HA 2D2XA 4L51A 5DSZA 4X97A 5IAJA 5KX5A 2GHQA 3U9LA 1KY4A 2P65A 2BY4A 2ZE7A 3M4JA 5BWBA 2Z5VA 2DWQA 2HN9A 2LNDA 5EE0A 1F0NA 3F71A 2ZE8A 2POQX 3IP7A 3E22B 1PNRA 3W1VA 4TS1A 2XQVA 1EZZA 3SDZA 2P2DA 5EP4A 2PSDA 1E6LA 2CZQA 4C76A 1TI7A 5BWNA 1XNQB 4F4DA 3GXBA 1CYDA 5HIAA 3ILXA 4LQ4A 2FEPA 4YAIA 2YXLA 1EJ2A 3KAQA 4YI3A 1OE0A 3V32A 8ADHA 3EEOA 1ZM2A 2QTNA 2ZB2A 3KL4A 4TRMA 4IDNA 4AMZA 4C08A 1CZOA 1JB1A 3AETA 1QAMA 1DEXA 4DLXA 3IELA 1QJ4A 3NKFA 4I50A 4LISA 4MCHA 4EG3A 3HU5A 3EOZA 3PFHA 1NVUQ 1GPJA 1FP7A 2PZAA 1PEYA 2O05A 3U4GA 5FUWA 3AEZA 5MF6A 2A1IA 3L7NA 4J29A 4MI1A 3W3ZB 1SY7A 5HE8A 4KPFC 3RUAA 1USGA 5F23A 1SUBA 2A3RA 2HZBA 3BWBA 4D3XA 5FBVB 2O19A 1NXWA 4HF7A 1C0IA 1RPAA 1U2QA 1DL5A 2EZ4A 3C97A 4E5NA 1W36B 2DCMA 1V16B 1GO2A 2IYWA 2QTRA 3I2IA 4M55A 5DISB 5A0FA 4A2CA 1XU7A 1Y1QA 3E15A 4PN7A 5KJCA 5KWJA 3K70B 1EDBA 3BWXA 3FGPA 1JDBB 2P9BA 1D0VA 3GR6A 5HJ5A 5CD9A 4P2BA 3QG1A 4E3ZA 5ISMA 4E22A 1ZGBA 3ZEAA 2Q6LA 1OLUB 3EPRA 4ZQHA 4EITA 4H17A 5LQJA 2BGLA 2EQ5A 3P4XA 3WK4A 4KQ2A 4BPBA 1JPUA 3LZCA 1AGXA 1G7CA 1JYSA 2BJWA 3F5FA 3OPYB 1I80A 4P98A 3TWOA 2FA9A 4F3RA 1XEXA 3OX2A 2WJ6A 5LXTF 1TD9A 5TC4A 4B3IA 3QLUC 3VAAA 1EQ2A 4EB6A 5BSRA 2VZ8A 3E05A 3QF7A 1CZKA 3FLBA 3ZZNA 4EUNA 5HKKA 4C4RA 4ABTA 1EM8A 2M9MA 4J1TA 1HPLA 3VOBA 3ZX4A 2GRAA 3LYUA 1IVNA 3VR6A 2WWYA 2J59A 5JC8A 2XJ9A 3A1NA 2IA5A 4P5EA 3R7AA 5HILA 4JLMA 3KFVA 3KLOA 2WOOA 5B1IA 3V1TC 1EE2A 2X5KO 2XOEA 3PWSA 2I7VA 2XF2A 1A04A 3CKLA 4HCJA 1ZJZA 4Y7DA 4QOIA 3FOEC 5U9CA 3GFOA 1ZRNA 4AMUA 3IIKA 4EOGA 1J99A 2A0XA 1KI8A 1J2YA 3ANSA 3CIFA 1I5EA 1V3QE 3ENZA 3GRFA 3KT8A 3LUPA 4Q1EA 4ZV4A 5IDXA 3ONFA 2QLBA 3V55A 2RMKA 2XWPA 1I2MA 3REGA 5GMOA 3WLTA 1OLXA 4O2AB 3LZDA 4DBLC 1YGPA 5JO0A 2J30A 3MGAA 4JUCA 1ATZA 1P2BA 4N5MA 1C4XA 1VSTA 4IJ6A 4Q9JA 4AJ1A 2X2OA 3HJBA 1R16A 2XQGA 2GN9A 2ZDHA 5EVCA 1QDLB 1ZMOA 3N74A 2HGSA 1BKDR 4EI7A 3ZXIA 4CW7A 3H6KA 3B7GA 4UM9B 3DBIA 1GR0A 3N28A 3ON5A 3KWJA 3JZFA 1RBZA 3GP5A 5E7IA 4AT1A 1L5LA 3FB4A 3V1KA 3ZKAA 3QK7A 4BNDA 4MJ3A 1YJQA 2FWBA 3B52X 3FYTA 3OM8A 4OM8A 1LV7A 4AECA 4MUMA 5JADA 3NHLA 2ZSFA 2EJTA 4C4ZA 5AFSA 3WL7A 2QY9A 1US8B 3ZJ4A 5A9RA 2DHEA 2Q1XA 5DNCA 2PCLA 1FQJA 3MINA 1USKA 1VP9A 2J9YB 1LNQA 3GPBA 4Y2GA 3DFUA 3E2MA 1JSZA 4F3KA 2Q4RA 2R11A 3AHIA 3MT9A 2WFLA 5AK3A 3QNWA 3WFIA 4AZ3A 1H0KA 3KEGA 4FCVA 4Q0MA 4NJEB 1BHSA 1EWRA 4LNAA 1PT7A 1G8YA 3IE0A 4DJAA 4GNRA 2Y05A 2OLKA 2EKLA 2LXNA 4MP8A 1CRPA 4UCXA 1Y5IA 4ED9A 3NTRA 5I3ZA 2WWFA 3JRWA 1P1HA 3UJ8A 3V8BA 4RM2A 4JEIA 2R6CA 1VL1A 2RHOA 1MA0A 3VNBA 4EHBA 5KREA 3EYAA 2KYRA 1COWA 1B1AA 1EBUA 3MTGA 2PUEA 4CQMA 3IAS1 1NKVA 2Z2IA 3GA5A 3Q9SA 1LDNA 4KAXA 4R8VA 1H2XA 4FBLA 1ELOA 3DZGA 3K1TA 2BHNA 4JC0A 1I6MA 2DPHA 2H7CA 3URMA 4DQKA 3HPRA 1HEYA 1ZHHA 3KEFA 2ZSKA 4G86A 2Y2VA 1MX9A 3AQIA 3ZCTA 3EPJA 4IDAA 1SK9A 3MYRA 3AIKA 4NTZA 3SF8A 2JHCA 2HPAA 2BFEB 4M9XA 1JLKA 2IEGA 1Z8NA 4YJ3F 3IKJA 4I4NA 1NUAA 3TJZA 3NO4A 1NXPA 2XLBA 2YZGA 2I4RA 2I29A 5CYPA 5IAGA 3SQDA 1XF1A 3IBYA 4D4JA 2J6HA 3KKZA 4MQBA 2OV6A 4JWKA 3MWDB 1SN7A 2NU9B 1Y1LA 2H8KA 2FRXA 2R7NA 3CNHA 4REOA 5J1TB 2YXNA 4JI2B 1ZISA 1WPGA 4ZV7A 1OTXA 1OFVA 2YWFA 3DMYA 5EIBC 5EYPB 5AKHA 4QD3A 3PHIA 3LUBA 2H6EA 1R4NB 3QGMA 5H4HA 2VQ6A 4WXPA 4EEXA 3BL8A 3UJ3X 1YDHA 4DDTA 3NHUA 5CYFA 3T54A 5F9HA 3BXXA 1JT9A 3PS9A 2DQYA 2IUSA 5AM0A 1O5TA 3MS4A 5L45A 1OV6A 5CDTA 5E6UB 4MI6A 2FW7A 3H4MA 4ER0A 1BA2A 1N34B 3EMBA 5IYZF 2W8BA 2RARA 2DPGA 3FYUA 3MOGA 4IHKA 3M6IA 4P4SB 4PG7A 5FOTA 4X6LA 5K3BA 1P4GA 2XOKD 2OTCA 2Z04A 3L0CA 2EZTA 2J7KA 4OQDA 4YI5A 3RUPA 2O59A 2O3UA 2VP3A 1W59A 2Z95A 3O2SB 2WJJA 3PHJA 1AN9A 1OBFO 3I0NA 4ACBA 1E2IA 1O94C 2A9FA 1T8UA 2JLQA 2OV3A 3COSA 3GP3A 2IEZA 5DLPA 1UWLA 4GLFA 2O2XA 3JQBA 1TJPB 4EHLA 3E35A 3NDPA 4JOCA 1SUEA 3SJUA 2E82A 4K2HA 1W5AA 1OREA 1ZU5A 2XNSA 1DFIA 1ZGZA 3MWJA 3NIBA 4HN2A 4OQLA 3U26A 3A6FA 5KQMA 1S1MA 1RRGA 2A59A 3D5QA 1C81A 4UBNA 2XV1A 3R7NA 1JFVA 1PF7E 2F8LA 5DGCA 1KI7A 3NEPX 3L4SO 3EXFB 3KSDO 3F67A 3PGVA 4UUBA 4KNWA 2IHUA 2V7QD 1AUXA 1PJSA 3B6KA 3M6LA 3T0FA 4Z1MD 1T9ZA 2ZIXB 3N87A 4BN0A 1X9GA 4KSYA 2D3TA 3ISJA 2QU8A 3PXEA 4JA2A 4RGBA 3ADDA 5BNTA 3F3KA 3KQSA 3DHEA 3TLCA 3ZJTA 1QPBA 3B48A 4H7FA 3IX7A 7REQB 1TF5A 3MOIA 1MG0A 2C8JA 1GFIA 3W2GA 2I6FA 4DCGA 3FPFA 4OUDA 5C4MA 1KXJA 3ELWA 2XH8A 1E2MA 4V0OA 2BISA 4JITA 5ER9A 3BJIC 2E85A 5KI6A 4NOMA 16PKA 1MXHA 2OEPA 1Y4ZA 2H07A 3SE0A 5BUQA 1XV5A 3VPGA 1H42A 2CXXA 1PR4A 1VCMA 4RMHA 1HURA 4P5PA 1Z63A 1WWKA 1AXGA 3FYSA 1Z28A 2Q6KA 4EYOA 3CX7A 5AJWA 1D0SA 1YZTA 3ZCPA 4I4TB 2B5WA 1G8SA 3CB4A 2EGGA 4ITUA 2R5WA 1TEVA 3L8EA 4NBKA 4Q7QA 3AR8A 4WQMA 1NXOA 3OPYI 5HZGA 3Q6NA 4XYEA 2P9ZA 1JAXA 2ZSIA 3BQNB 3HEAA 5DCWA 2VUSA 4CF6A 4KJXA 4DLYA 4TKVA 5DB4A 4XAQA 1N2CE 2AFHA 1W4RA 3BB1A 1DWOA 4HK4A 5DHFA 1W6RA 5T57A 3RFTA 3QXSA 2FXVA 3DLIA 1RPTA 4ROSA 3UMYA 3P4UA 4YT8A 1KS9A 3T3OA 2IODA 4RD1A 3EVEA 4I8IA 1ZIPA 4UREA 5C8XA 5AHOA 4BQFA 1BDBA 1JSRA 2BR3A 1KYIA 1FXWA 3AU8A 3JAKB 1P77A 1DQRA 4JSRA 4K0KB 2VR1A 2C57A 1P3DA 3VJRA 2PMWB 2Q0QA 5AOAA 2QLLA 1R12A 4FHEA 2GA9A 2ICAA 3IVMA 4IJKA 4EKDA 2WAYA 4WXMA 1KKUA 4WIAA 1K68A 3TR5A 2W90A 1KAGA 2XWSA 2ZM5A 1ECPA 1YRBA 4DUZB 5CFOA 4IZIA 5K0EA 1XMIA 3RLFA 2JIDA 4D3FA 4NCBA 3MPOA 2O4UX 3IBSA 4D9NA 2WWIA 3S2EA 1XQ9A 3H0EA 4P0PB 1Q11A 3V4SA 1GL6A 1C3JA 3R9XB 2YASA 1H9CA 2IZ5A 4I46A 4JBYA 4RIIA 2J5XA 3G8DA 2A33A 3RYFA 2SCUB 4QJBA 3NASA 1LBEA 4X63A 3ELBA 4V0QA 4IJQA 2ZRLA 2ONCA 3GVCA 3E8XA 1UPTA 4UD6A 3CPJB 2V7PA 4GZMA 3RQIA 5CB8A 3D6TB 1JNYA 1GTJ1 2MSEB 2QG4A 5JJKA 2J3HA 3NX4A 5FPTA 1VI6A 2P78A 3KRTA 2OKCA 1GFZA 4RUKA 1O6GA 1MH1A 5AOCA 4CIYA 5HJ7A 5DYIA 3DF9A 3N3BC 2QTAA 5IH3A 2ZRAA 3PXBA 2GBCA 3VNVA 2FUG1 1MO5A 5IT9A 2ZE5A 4WXHA 2FSGA 3FR8A 1O8BA 2QM7A 3FROA 1UJ5A 2OO5A 2IGTA 1WD7A 2FDXA 1Z6AA 4P82A 2RONA 2W9XA 1H6CA 2BONA 1X6VA 1G1MA 2QYSA 3JYLA 4MR9A 4MUBA 1CZLA 4YO7A 2NTJA 3LDAA 3Q5DA 3WZMA 5DM4A 3SCZA 5CVCA 521PA 1PCXA 2QV0A 1L5MA 3HPQA 4PX9A 3ZR4B 3UAYA 4ERNA 1ZUNB 4F3NA 1MQAA 3NAGA 4IIDA 3DH0A 2XIQA 2WNHA 4P93A 1FDTA 4DGSA 2RBKA 4G36A 3NFRA 1AQYA 2WTMA 3BXOA 1WUIS 1BX3A 4ESVA 1XJ5A 2WIJA 4GP6A 4UATA 3WOVA 4JLVA 4CLOB 4E0BA 3QVMA 1Y34E 1UDBA 2YVUA 3IAXA 4HEQA 4HLUA 4LI3X 1YI1A 4RYLA 2WF9A 5FQNA 2QAIA 4LC1A 4ZIRA 2A1TR 2X1MA 1UBMS 3QVSA 2P4QA 3RU9A 1YFZA 1HZZA 3Q0IA 1I36A 3A6LA 1YU9A 2XY4A 2J5QA 1Q77A 4LDAA 1OAOA 4L8LA 2IS2A 4QLOA 1V95A 2FPPA 1YZYA 2X5XA 3QOFA 4WACA 1N7JA 2YYSA 3FNEA 4U5XA 4CMBA 2RHHA 3P2EA 4RO0A 1T9GS 1WDTA 2J32A 5CLGA 5CNJA 4B7CA 3T3DA 1LFAA 3L0DA 1JH8A 2CXOA 4JKYA 2DFNA 4GKBA 2XUJA 1JQAA 4B6PA 2COEA 4JUBA 3JQAB 2IK8A 1QORA 1D2GA 1CUJA 4MICA 2HLPA 2BLNA 1PD0A 2E18A 1B0AA 4KO8A 4BECA 5I8WA 1D4AA 1Z6QA 3K0EA 4PFQA 5JANA 2J9FA 1Z5ZA 4GU5A 3IV6A 2PWAA 4LGVA 1UOPA 5K0BA 5EPEA 3DNMA 3JWGA 4ZHQA 4I8XA 1I13A 1NRIA 2FMKA 4TMXA 1RI4A 2XHEA 1U9YA 1A9SA 3PNYA 3ZS8A 4Q3DA 2GD2A 1JPJA 1U28C 4YDQA 1GUAA 1YIOA 4PAOA 1NBME 1Z6ZA 2PMEA 1I0LA 1RBYA 1Y6RA 4Q6BA 1Y6QA 2YYZA 1H5NA 4FBMA 3TYXA 2CBGA 2O3RA 5KPJA 1AK2A 4MCAA 1DWPA 1WXDA 5FBRB 1RMQA 2WU8A 5JU6A 1L7NA 2AUTA 2H63A 5ARCA 3QEMB 3UWOA 4N0EA 1MHTA 1A5BB 2PUAA 1JZQA 2Y0DA 3QKTA 2GUGA 3BWCA 2IQIA 2W2LD 1IXRC 1M66A 4EB3A 4WK2B 4V0SA 5EWLA 2I71A 2EFGA 3O4HA 1U6IA 4KYUA 4BFYA 2G77B 5J4YA 4HR7A 1U9IC 3TMYA 2H52A 4WLEA 2IPNA 2YIDA 1X0VA 3P26A 4GUAA 5INTA 4LJKA 5A9SB 3Q2KA 1TC2A 1XTQA 1E1KA 1TX4B 3L4JA 2W2PA 4P38A 1SKMA 1XFDA 1E3IA 1V6CA 3ANTA 1BMQA 1KQOA 2H4XA 1DTSA 3CF2A 3EQ2A 3KYDA 5DX0A 4BO6A 4DIDA 1OB5A 1JR4A 5U1PA 3BFPA 4BKMA 1Y8CA 5KVQA 3U3DA 5FPKA 1EXMA 4MEBA 3T38A 4MV7A 1IK6A 1V47A 3GN1A 1R6DA 1NJ6A 4YUVA 2R8EA 2N9UA 3W5SA 4F6RB 1NONA 3WV5A 1S2MA 1GYQA 3RJ5A 3AM1A 1IWOA 1WPQA 1Y63A 4MGZR 3G0HA 1MTZA 1HYGA 2FUKA 3A2LA 4I0WB 3BCSA 4PHFA 5T41A 4XD7D 1FW8A 3VR6H 4MO9A 2YUTA 1L5RA 1ZK3A 4BVGA 4FW8A 1YVUA 5K7SA 1V5WA 2FX2A 1HFJA 2N1BA 2UYYA 4NV3A 1EWVA 3WIBA 2WIFA 1F3LA 4NF2A 5DWQA 4FWBA 5CVTA 2EJUA 2GVNA 4IR7A 1K06A 1ZJ4A 3GVHA 4DV4B 1M2NA 4Y6RA 4Z0NA 2CCGA 1LI7A 1PUJA 3SSOA 1G3RA 3DXXA 3WRXA 1BSVA 2WUGA 3E9EA 3FBGA 4HAWA 3WRYA 5GONA 3DE1X 2FFJA 4LJ8A 3NWJA 1FFDA 4LA4A 5I8PA 4B3GA 5HF6A 2K2WA 1XSEA 3A1SA 1CJSA 2V55B 4CIWA 13PKA 3ZLJA 3VTKA 5M5BA 3IGFA 2PLWA 3CT4A 4FDTA 4ZAYA 1C1DB 4IGIA 3AW9A 4I19A 3CNQS 3FYHA 1ZH6A 1GGNA 2NXCA 3CTPA 5FUBA 2Q5JA 1D4FA 4DLPA 2CT8A 1VRCA 1NT2A 3NWEA 3ZHBA 1UAYA 3G5TA 3NBYC 5BV1A 1E7MA 2K4MA 3ENKA 3IMGA 1VLJA 4O25A 4W63A 3LBFA 3LL7A 5KQLA 3KQWA 3THWA 1LFDB 4AP5A 3LHDA 1WZIA 2D62A 3FPGA 3WZ2A 4CDMA 3HJFA 1I3CA 3D8BA 4UXJA 2JI9A 4MS1A 1VLVA 1FSGA 2PXXA 1N8SA 2Y1GA 3I5XA 1K92A 1ZXLA 4G8BA 4RU1A 1JAHA 4Y7CA 4R1SA 2ZM6B 2IGBA 2GEUA 3MT8A 4FYPA 2XYVA 4LXIA 2BFCB 3PB3A 4I9NA 3FOZA 2AMJA 2V7GA 1G9XA 4ZYTA 1E0SA 2MINA 4RE6A 2Q4EA 2AYZA 1F0YA 3NVAA 1CQZA 3TMKA 4DLSA 1COWD 4X8MA 5TF0A 3STWA 4K8OA 1SBCA 2HIGA 3IBFA 3ZKWB 3KQOA 5K6TA 3V8EA 3EH2A 3GJRA 2XOKA 4R2LA 3HXOA 5C8YB 1JHRA 2DH5A 3OQPA 2VJQA 1F9AA 3GDFA 5FLXA 3DWEX 3IURA 1T2VA 1ZOOA 1DTWB 3AUFA 1JYFA 3ETEA 1OYOA 4HDRB 5EEHA 3BFKA 2F3QA 2GZHA 2I7TA 2X8AA 1KGSA 1NW3A 2P5SA 4YTEA 5HFJA 2XX3A 3OIUA 4HMQA 1TTQB 4IIBA 3DV9A 2RH5A 2XUOA 3TLZA 1YFLA 2C5AA 4AX4A 3PNMA 1A9OA 1U99A 3RIXA 4F9EA 1WSWA 1NBMA 1SHJA 3OCUA 4O4LA 1EUCB 5AW3A 3RVQA 4D9MA 3O8QA 5TMPA 2V7XA 3HH8A 4UVIA 3ZCRA 1WB9A 2VEOA 1QO0D 2WYIA 5JXWA 1B23P 2RDMA 3HB7A 3VPXA 4TTQA 4KFCA 4FE4A 1U5BA 4LTDA 4G5FA 4MQEB 4D97A 4RZ3A 4RTSA 3FGOA 1RZ3A 2YWCA 1RKBA 1L4UA 1RFGE 1U2RA 3QFRA 1OGJA 2C7VA 5TEWA 5TPWA 1JXOA 3C2QA 1WY7A 1R50A 2VJOA 4FI3F 3P71T 3IP9A 3U16A 1HR0B 4MVJI 2Y71A 3RRMA 3LY8A 5EIFA 3G2QA 3LT2A 3CUUA 3O4FA 4MWCA 2OAGA 3G6KA 4MGEA 2XCQA 2QSJA 5JE8A 4KKVA 3DZBA 1T5SA 2OZLA 1YUNA 1IM8A 1PK8A 3CN7A 3OTIA 3PEFA 1K98A 5ERGB 2V7TA 3A4IA 4NXNB 2AQKA 3LC0A 3LV8A 2KLHA 4LYDA 3SHFA 4C4AA 4E30A 4EECA 1PZEA 1WS6A 1KZ4A 3BK2A 3VNRA 4DGQA 3UEOA 1ZDMA 1SBTA 1FDUA 3JQFA 4DIKA 4Z53A 3OBBA 2J3JA 3ZQ6A 2BGGA 2YWHA 3GFSA 3EA5A 4WN9A 2IUTA 2YOGA 1ANKA 1P44A 3QXGA 2Q6IA 1SVLA 4TTTS 4AMYA 4QDKA 4W9NA 5JIBA 4MINA 2GZDA 3CF6R 5SY4A 3HVJA 3IKTA 1C0LA 1T5IA 2YN0A 3A58B 2BFDB 5DBHX 3QUQA 3CVVA 1ADJA 2CL7X 1QRUA 2FNAA 2R97A 3K9WA 4GL2A 1IIBA 3BRSA 1UR5A 2FQ1A 4RH0A 3FPCA 1BQ4A 5ERYA 3SLKA 3WKEA 1DBRA 4BCDA 1WVGA 2QTVA 3SYTA 3E7PA 5J2UF 3A3KA 4HC4A 3ZJ5A 1XTPA 1F0PA 1KEWA 1D4ZA 2HADA 3GT0A 3OE7D 2W6PA 3ONEA 4ENSA 3AZQA 3CISA 1N57A 3IQDB 2OA0A 3OTHA 2ZXUA 3PKZA 1E1QA 3ED5A 2D3WA 5JXHA 2B1IA 2X3YA 3I9MA 4BFZA 3ZVMA 2ZBDA 2NTEA 2C0PA 2I1QA 4PZEA 5L3QB 2HLDD 1FLDA 2ANCA 3CLUC 4WMLA 1G5PA 2PZJA 3N75A 5GADl 4F1KA 1XRLA 3VNUA 4TWJA 3RYIA 2FVXA 2PANA 5C81A 5TE9A 3HCFA 4Q1VA 1WVMA 3WLMA 2WDZA 3DOFA 3K92A 3FKSA 3DC2A 2PS1A 4R1NA 2R6DA 2BZ0A 4C88A 3A7DA 3DFMA 2X7JA 1RI2A 2GN4A 3W6OA 4DARA 2IUYA 2CLIB 2QRKA 3FF4A 3DNFA 3LC7O 4J9VA 3TE6A 1D6JA 1GRNA 2D1SA 3BHJA 3K8ZA 5EMMA 3UWMA 4EF6A 5B4UA 4DR6B 2D2FA 5DBIA 1TTTA 1R4ZA 4ZPXA 1TCUA 1Z8FA 1R5NA 3EB9A 2C2WA 1WDWB 1AKVA 2FV8A 2R60A 5AJTA 3ZQJA 1UADA 1D5WA 1XDWA 3IAEA 1JKXA 2VCYA 2BH2A 1QFXA 2JJMA 1OLSA 2B4AA 3K9BA 4MEAA 2FSVA 4J7AA 4YCDA 5FL7A 2CNKA 3ZIUA 4M7PA 4MYRA 3C3YA 3R23A 4YMSA 4YRJA 2R48A 4RYDA 5A3QA 3OZVA 3PTZA 1Q7RA 1XF9A 1BS1A 4AM8A 4EGFA 2AZMA 1WZUA 5TPZD 4WL0A 1I10A 1Y4AE 3QUCA 2C04A 4ASUD 5JTUA 4A82A 1OH7A 1UMBA 3H3XA 4GBMA 2B9EA 4I1RA 1RRFA 1TF7A 5F1OA 4CBVA 3GYGA 2OQVA 1ZOPA 3RVPA 2BSXA 4JA0A 4Y2YA 1G55A 1SXJA 1GP2A 1V1JA 4F3CA 2ASVA 4ZOBA 4I7EA 4FHGA 4X00A 3RVDA 3N76A 1TVKB 4LZPA 1A27A 4DCJA 3GLRA 4QPPA 4AY2A 1EDDA 1VE6A 1APBA 2VNIA 2HWUA 1I1OA 2J0UA 1XP5A 3MK31 1XDUA 2ZUWA 3V7UA 3DYIA 1UC5B 3MELA 4QODA 5JV5A 3K0CC 4WW0A 4GFDA 4BB6A 1NJ1A 2VYQA 2XWJI 2Z57A 2DHRA 1QIEA 4HX9A 2UYHA 3TKYA 4UTZA 4XLTA 5BQFA 3KAPA 1F2UB 4A2WA 1SOMA 4INPA 3RYHA 3GIDA 4B33A 1G7TA 1ZPDA 1M67A 1LKZA 4JUDX 3I58A 3E3NA 4TGLA 3K5HA 4JVSB 1Q2UA 5KNCA 2XUZA 2YW2A 1QRTA 1U9JA 2QQFA 3KVOA 2YZNA 1A88A 1XWFA 2V58A 3C1AA 3GDGA 3I9FA 5IULC 3JRXA 3KJGA 2JZOA 3IV9A 2GM9A 2H2IA 3QWBA 2ZZKA 3LQRA 4D98A 5BSWA 5KHLB 4XWWA 4OHBA 1L4KA 2BKLA 2P7HA 3GEGA 4DLUA 3DMRA 3ZHCA 4IFIA 4A73A 1UC9A 5B1YA 3CJRA 2C3YA 3MMPA 4C03A 1K7CA 5AUQA 4MAMA 1VCIA 2LDBA 2EZUA 4EJ2A 2BKUA 2JIZD 2PUJA 2QYOA 1RHRA 2FWPA 2NZ8A 3NM5A 1DOHA 2J3KA 1LV8A 1N2IA 3N07A 1AUVA 1HL3A 1Q12A 1RKUA 4GPIB 5KEIA 3HU1A 5IDYA 4B71A 4U8HA 4RXTA 3Q12A 1TAQA 3OF2A 1SZDA 2EXXA 2HRZA 2ZIUB 5E2BA 2V7BA 1YV9A 3TDMA 2R8OA 3D6HA 4TLCA 3WAJA 4BXOA 4NPAA 4WWHA 1M7BA 6REQB 4QDUA 1O95D 1U0SY 1A7JA 4JC8A 2EKDA 2FEXA 1DIOB 1VL8A 3AP3A 2ODAA 3GT7A 4KW7A 2PNJA 4AU1A 4MUJA 1XVVA 1M6WA 5KU1A 1NC1A 3PGXA 3W1EA 2WWWA 3UPTA 2CMFA 2F48A 1P5JA 2R8YA 4E1VA 4O3FA 4BDTA 3S0JA 4P84A 4IKPA 2RHRA 2QVLA 2AOUB 4XJXA 2HQOA 1KH2A 1BD3A 2IF0A 3DOCA 4HATA 1U2ZA 3VR4A 1Y1TA 4YQFA 2WJ3A 4TV9B 1Y98A 1DS6A 3H83A 1PSWA 1U80A 3ADOA 2FEAA 3UJ7A 2G17A 1QOZA 1M10A 3M4XA 3NFYA 4O4IA 5EJ2A 5AW7A 4XVRA 1DC6A 4V1CB 5AIAA 1CIPA 1X1QA 3THRA 3EXHA 4FNOA 1XNJA 2V97A 3UW1A 2IH4A 1BU5A 4HDKA 3DE0X 4P35A 3PLNA 2W4MA 3IS3A 3CW2A 4ZCSA 4DR5B 1E9FA 1YKGA 4R2JA 5CGZA 4EB8A 4Z9BA 3UT5B 5MHTA 4OFWA 3ZV5A 3I23A 2ZJAA 4KGDA 4RPJA 3GUZA 1KEKA 2F00A 2VDQB 3Q5EA 4PS0A 4YN3A 4YCJA 1EFVB 2XZTA 1RAEA 2H5EA 4KQHA 1JMVA 2BMJA 2GCNA 1K97A 5LMUB 4AKIA 4JB0A 3OQHA 4F5WA 1LI5A 3NGMA 4C06A 3KDSE 4JU8A 5FUYA 1LY1A 3TOZA 4EHJA 4B3TB 2O57A 4M6WB 4R6XA 1I01A 3TNFA 1MU0A 2BSQA 2QZJA 4RJJA 3W7BA 5JNSA 2XQJA 2XZPA 2YY5A 3OOJA 4D0LB 1GXSB 1ZM9A 1LEHA 3CZAA 5IM5A 4C5BA 1QHGA 5JMPA 3TLGA 1JU3A 4UE3S 4OAQA 3V4ZA 3RADC 2HA6A 3E1SA 2W6JD 1R9GA 1WF6A 3W5JA 5JEEA 3VKGA 4GOXA 3G7UA 4QNRA 3RK0A 3U81A 3KE9A 3AEQA 4XVUA 1VB3A 4MW6A 3I34X 3HB9A 1P7VA 1XQVA 4ICIA 3KM0A 4L4UA 4CEJA 1NJ8A 1ZN9A 1BJRE 3OU2A 2PD6A 4IWXA 4UZFA 3WBFA 5A5FA 2ORYA 3RWOA 1IVYA 4TUYB 5LD2C 2JLYA 2ZBGA 1PJQA 1AS3A 2XMZA 3Q3EA 5E4YA 1NW7A 4WZBB 3EC2A 4ZOCA 1DOAA 4K9RA 1XXHA 3UKJA 4YREA 4M9QA 4LY9A 4F93B 2JFYA 2QXUA 4U39A 2PLNA 3VR6D 4J0FA 4L95C 3LBYA 2VDVE 4OI0A 1K2WA 1GKIA 4FK8A 4AQYB 4WRRA 4G24A 3TEFA 5HOQA 2Q1TA 3X3HA 4PPNA 4ZO8A 1CUXA 2PSHA 1D2NA 4B3CA 2AT1A 1NF2A 4PNHA 4GVXA 5HA5A 1T36B 4ZRMA 2RGEA 3FX2A 3SBDA 4ZJZA 4PYNA 5TEVA 1QONA 5LBUA 3NVMB 2NZ2A 1MA3A 5JD4A 2QRLA 1CUHA 3PUXA 3IHKA 5ALWA 2Z4SA 3Q1KA 5EPOA 4Y2VA 3KE8A 5KCZA 1JHPA 2QQEA 4R6WA 1AQJA 3Q7QA 2ZT6A 4WVFA 2W93A 2GJKA 1JAIA 1RMYA 4LRSB 5KZMB 5LDGA 1NBMD 2VDWA 3AFMA 1U9ZA 1B6TA 1JDNA 1YE5A 3P9PA 4YJHB 5C34B 4DXAA 2CYBA 5I7RA 3WB1A 5KTMA 3JZMA 3I09A 1U9IA 3U5TA 4N7BA 1JHZA 1MNQA 3B85A 4BV2A 4XPIA 1HDIA 4ND8B 3TTTA 4ZHQF 1EK0A 1E2NA 3HU3A 4CEHA 2YV3A 1UH5A 2JHPA 3EXG1 3H0CA 4P3YA 3NAMA 1TLTA 2ZYUX 4X7MA 3ZD8A 1NM5A 5B4VA 1AZWA 3VGPA 4JT9A 1IXKA 5JQGB 1OPXA 4GYYA 4BQQA 1VBFA 3PDIA 1C8BA 3D4IA 4KGXA 4PFSA 1NWHA 5FL7D 1KOGA 3R74A 4BZPA 4LK3A 1GLVA 3A4MA 4LF4B 1Y3BE 3QV1A 3LGSA 1U7OA 5E6SA 2PGJA 3GHYA 2B37A 1EA5A 1UBNA 4OVKA 3PGMA 3JARB 1B00A 3SYMA 1P0IA 1JQLB 2CL5A 3TLAA 1DJQA 5TQVA 4J0IA 4IH1A 1S9DA 1SB8A 4KRXA 1DAEA 4P53A 4EF5A 3CNLA 4EQZA 1ADYA 1QRAA 3ORSA 2JKVA 3ESDA 3IP1A 2VQEB 2C2KA 5FFFA 4XDYA 2Q5EA 4F8JA 3LSYA 4RWEA 5EIBD 1UJ6A 1LPMA 3AZOA 2H5IA 3KG2A 4QXAA 1WE2A 2Q3MA 2JGAA 2OGZA 3TRDA 4IHJB 4K5QA 4HUQA 5JS7A 1KL7A 4F91B 4IDCA 2D1FA 2WE7A 3BEOA 4V0ME 3Q5GA 1MKYA 4O8CA 3SIWA 5DN6D 2AN4A 4HMOA 1VJGA 2RCYA 4QGFA 1GPLA 2LKCA 4JZKA 2XDWA 4LRXA 1RAGA 1WP4A 2O5RA 2FKNA 3OO1A 4MQ5A 2NUPB 3KZNA 3OPNA 5HCNA 3UFBA 1E2LA 2UYOA 3HWRA 4QU9A 3AKZA 1G64A 1R37A 4IXWA 5BOSA 4Y2QA 3TKAA 1UK8A 2OT3B 2YOHA 1KNQA 2B8WA 1OFUA 1M8KA 3LK6A 5K3FB 2D1TA 3WO0A 1YH3A 5MDHA 3WGNA 4QXQA 4PX2A 2Y68A 3NHZA 3GJ4A 1MAVA 4UTPA 5KQPA 5HGXA 5KYNA 3N1UA 1JBQA 3SZLA 2D5IA 3C8UA 4BO0A 5GAJA 4URYR 4QTZA 3E48A 2H1HA 4HYEA 3AVTA 4IGKA 1NKTA 2I8LA 4ZU3A 3DVRX 3SKYA 5H4GA 5JAOA 2DGDA 5GONF 3D3NA 2E7ZA 4CEIA 2VKQA 2N47A 5FHRA 5KYUA 4AYTA 1PX0A 1REQB 2Q4OA 2B3DA 1P19A 2PMBA 1U7HA 5FOWA 4QTTB 3PQ6A 5FTNA 2A5DA 2AS0A 2ZRBA 1L7PA 3Q3CA 3UJPA 1S8OA 3UF0A 5BV7A 1XRJA 2VUHB 4TT3D 5MFPA 3GBPA 2HA3A 3QWHA 5TQ0A 4Q37A 1DKPA 1HV8A 1XZKA 2ADMA 1DKRA 3SGLA 5BUCA 3EG9B 1B93A 2W7TA 4A6EA 5MN6A 2I6TA 1XTIA 1LGYA 4P83A 3UJDA 5KVAA 4W7SA 2Z6VA 1N1DA 1JEQA 1PX2A 4NNOA 2YN2A 4N1AA 3VTAA 1XRNA 5IXYA 2D7JA 1J8YF 2AG0A 1K5HA 2YWBA 3HCOA 3HMKA 1TIBA 4P86A 4PSVA 2JIQA 1LUAA 1CZRA 2JJ1A 2ERYA 4RZ2A 3LIIA 4E2XA 3G5LA 5F9MA 1UODA 1VGQA 2H7YA 1NHGA 1NNUA 3EA4A 4PLYA 4NBLA 2WUDA 4GLOA 3NC1C 1G6OA 3NNNA 2XUPA 1KSGA 3OICA 3R9IA 4KYVA 3P8ZA 4PE5B 3GLFE 4D41A 3BSYA 1UOOA 4D44A 2A9JA 4XJVA 2E4UA 4DQDA 3ICOA 2OQRA 2XCLA 3CZ9A 3PC8A 2N1MA 1T9DA 3PKIA 4MRMA 1KO8A 1M1NB 3HBFA 3L5KA 4L5BA 1M8JA 2IHZA 3AOGA 1T5DX 2G04A 2FFAA 3ODGA 4KVFA 3V00A 5ITWA 1E6MA 2OM6A 2E2WA 2GK7A 4IJ5A 4RK4A 3TUIC 1LSSA 1AN0A 1VP3A 5BYBA 1U28A 5HOEA 1JU9A 3I8OA 4JLWA 1PZMA 3B1JA 2JLUA 3QPDA 4HBZA 1YRHA 1E8MA 2OBFA 3EVZA 4BFVA 2MYUA 2XDAA 1P75A 4HI0E 3K0BA 5FJIA 1EK6A 1F5NA 2GBIA 4KX3A 2J4FA