3GWGA

Crystal structure of chey of helicobacter pylori
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY homolog
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gwgA00
5CNJA 3OLXA 1TMYA 4KFCA 3KLNA 1VRVA 4YWHA 3LMKA 1ZGZA 1J56A 1YS6A 1SXGA 1UDRA 3G85A 3I5AA 1NXSA 4HNRA 2GBPA 4QYWA 1SD5A 2HQRA 3D8UA 3FMVA 4MR9B 4LE2A 5TQ0B 5C5CA 1W9HA 3CU5A 4OG2A 1JH9A 3H6GA 1DCFA 2FMIA 1TLFA 5DGCA 5EWJA 1L5YA 4KRFA 3O74A 2MYTA 4GNRA 2B4AA 2MSKA 1T34A 1BAPA 3FFXA 4MR8A 1ZHHA 3H5TA 4WWHA 3FDFA 3SY8A 4Z4CA 3BREA 3HDGA 1P2FA 4LX8A 4IF4A 4MYRA 4MPTA 1E6MA 4KV7A 1K68A 1LBIA 3NBMA 3O1IC 4RY0A 4B09A 5IUNC 1F4VA 1BDHA 1JHZA 3SG0A 1BVHA 3IDOA 3QX8A 4F06A 3C3WA 3OO1A 3KSMA 1JL3A 4PYRA 4Q7EA 4Q6BA 4E7OA 2H0AA 3DZDA 4LDZA 1U0SY 3UKJA 1CEYA 4S05A 3H5WA 4WXEA 1Z15A 4Z9AA 2JRLA 4XAQA 1Y1LA 1KGSA 3RVOA 1KRXA 4EYOA 3ROTA 2E4UA 4YV7A 1DCMA 5FWXA 2FLKA 1NTRA 1ISRA 3QK7A 1A04A 4QYMA 1DC7A 5EWLB 2WY2D 3LUGA 2FTKE 1PEYA 3DLBA 3VNAA 1ZGGA 3HXMA 3JPYA 5FWYA 3T8YA 3O2QB 1Z16A 5TPWB 5IC5A 1GUBA 1E2BA 3CG4A 5I4CA 3OM0A 4N0PA 4RKQA 4MS1A 1E6LA 1QO0A 4Z4HA 1CHNA 3IP7A 3GL9A 2QSJA 2PAFA 4OBBA 3CG0A 2JVIA 3OMWA 3MMNA 2FW0A 4Z9BA 3OLWA 2NUBA 2AYZA 2PLNA 4MRMB 1DJMA 1RPJA 3KJXA 1NXTA 3CKMA 3N0WA 4F3TA 3JY6A 2FKAA 4MR7A 5BRJA 3O1HB 4GPAA 3Q7SA 4EY3A 2WMYA 2PJUA 2ZAYA 4RV5A 1RXIA 2FLWA 4JP1A 3N8IA 3LUCA 5T3YA 1D1PA 4FE4A 4F12A 2QW1A 3UK0A 5HQJA 1USIA 4WXMA 5DLEA 1GUDA 1IIBA 2E4YA 4LRQA 4N41A 3F6CA 4NCBA 8ABPA 5CHYA 2MSWA 3GRCA 2W42A 3C6QA 1DRJA 1B00A 3CNBA 4G0OA 2X7XA 2BGGA 4G86A 1TJYA 2IOYA 2NT3A 1XHEA 3LKBA 1GCAA 3MM4A 3QELB 2NZVG 3QLVC 4YCSA 5B3JC 4KNYA 2QV0A 4FE7A 1QO0D 1TM2A 3N6VA 1ZESA 1EHCA 3RVPA 3QLUC 5JNSA 4IMJB 1JX6A 2PKXA 3I42A 5TQ0A 4IRXA 2V0NA 4MR9A 1Z18A 4EGSA 4LZLA 4N47A 3QEKA 2F8TA 4N03A 1PNRA 1QMPA 3JTEA 2R25B 1P8AA 4FB4A 2RDMA 3LFTA 4W5RA 2CD7A 4EUKA 1D4ZA 5TQJA 3M9WA 1JFTA 3OLZA 2N9UA 1BA2A 3H6HA 3MA0A 3T38A 1VLZA 4P98A 1Z25A 2R47A 2I6FA 3GBPA 1DCKA 3HZHA 1D2AA 1NXVA 2L2QA 1DRKA 2ZWMA 4P1ZA 5JS1A 3N0XA 4MGEA 3OO0A 4ETNA 1L5ZA 4YR7A 3N53A 3JVIA 2P9HA 4WUTA 3RVRA 3EAFA 1A2OA 3JS5A 3LUFA 2F8SA 3KHTA 5EWMB 4ZMRA 4G0XA 2TMYA 4Z99A 2LBPA 5IEJA 5KQLA 5T7BA 1ZAYA 3JVDA 3TB6A 1U2QA 4OLAA 3HO1A 5TQ2B 2VK2A 1XWWA 2YHAA 2A9QA 1EWKA 2Q5CA 3MF4A 1ZITA 3IP9A 1SXIA 1DC8A 2PL1A 3NNNA 5EWLA 3SM9A 1M2EA 3NNSA 4ZPJA 5IBQA 3DGEC 1ABFA 1USKA 4RXTA 1USGA 2DRIA 1MB3A 3Q9SA 5ED4A 3QEMB 5DCLA 5TPWA 3TX6A 4W5TA 2M98A 3H1GA 3DBIA 1JWLA 3LUJA 1DBWA 3TO5A 1NXWA 3HCWA 3OM1A 3KS9A 2JK1A 3RQIA 4CBVA 1ZH4A 4MLDA 1NXOA 5GQSA 5TE9A 4NCAA 4H3KB 1NY5A 1GCGA 1Z17A 3K9CA 4YGXB 4IMIB 2OQRA 3HUTA 3SAJA 3FGZA 2A9PA 3Q7RA 2J48A 4MRMA 3O2JA 1FFSA 1W25A 2PMCA 4OATA 1ISSA 2JCGA 4ETMA 3H1FA 4EVSA 2P4UA 4RK4A 3F73A 3KYIB 5CNMA 4EVQA 1BDJA 4TLMB 3EQZA 3O21A 5FBHA 4KK3A 2WJWA 4O1IA 3LUKA 1SXHA 3EJWA 4O5AA 4D6XA 1PHRA 3HVRA 4KPYA 3DGFC 4PZ0A 1YK1A 3E3MA 2XDYA 3R0JA 3BRQA 3NHMA 4RK0A 3HM9A 4QPJC 2ID9A 4NICA 5JNUA 3OQMA 2FSPA 2WWVD 3CS3A 4Z4IA 4S04A 1ZY2A 1U2PA 4KK4A 2JBAB 3OQOA 4N76A 3T95A 3QELA 4L85A 5F64A 1JDPA 2CHEA 4OLBA 3UUGA 1H9CA 4JB2A 4MLCA 1JLKA 2JB9A 2GI4A 3IP5A 3GV0A 1Z12A 3ILHA 3LUDA 1DBQA 4W5NA 1ZDMA 4Z4GA 3URMA 4G0PA 3IPCA 4Z4FA 4Y9TA 1NXXA 4F11A 5BR1A 2FQXA 4MQEB 2IPAB 3I09A 3H1EA 1P6QA 1XHFA 1KMIY 1QNLA 1YIOA 3C3KA 3C97A 4H3HB 4EYGA 5BQ3A 3F6PA 4RK6A 3BILA 4HNQA 1PEAA 2IPNA 5E3JA 1ZN2A 3DLHA 4YP9A 3RVSA 1YVUA 2QXYA 3IPAA 5ABPA 2PUFA 3HS3A 3W9SA 1M5UA 3IP6A 5C5EA 2M1ZA 4OTZA 2FXIA 1C4WA 5CNIA 2R4QA 3KG2A 3MYYA 3GT7A 5HM6A 2RJNA 4YO7A 2CHFA 3EULA 2HPHA 4M88A 4DADA 2PUEA 1NXPA 3KKEA 1YMUA 6ABPA 1LJUA 5EWMA 2FN9A 5KQGA 1JBEA 4W5OA 3LUAA 5HSGA 2LIVA 4IGAA 4PEVA 5TQ2A 3QX9A 1HEYA 4RS3A 3I45A 7ABPA 4Z4EA 2FMKA 1RZRA 2FVYA 4PICA 5KI6A 4KREA 2ID7A 5KC8A 3HUUA 3CHYA 3N75A 2PE5A 3KTOA 1RXEA 2LUOA 1MVOA 3H5VA 3OQNA 4JOQA 3HK2A 3QEMA 4HYEA 2E4VA 3VNBA 3KCNA 1JFVA 3A0RB 3TMYA 1OXBB 1R8JA 4PE5B 1A0OA 1JDNA 4ZYLA 2QR3A 3OLYA 4YLEA 4RZSA 3SQNA 4RK5A 1FFGA 4RSMA 3MIZA 3LOPA 1NATA 1F51E 3EGCA 2HQOA 1YTUA 2KYRA 2QU7A 1D1QA 4G0MA 1D5WA 2IPMA 2RJOA 2JVKA 5JS2A 4YRZA 4XFKA 5JNTA 4TMYA 2LPMA 4JASB 1YS7A 1EWVA 3O1JC 3HSYA 3OMXA 2NT4A 3O75A 4MAAA 1MIHA 2B1JA 4RU1A 3HDVA 3Q7TA 3CZ5A 5IUJC 4JA2A 1Z26A 3O2SB 3QLVA 4JAVC 1LK0A 3G1WA 3OLVA 3KLOA 3GBVA 3CRNA 3K4HA 3H5LA 3N0RA 2PL9A 3QLUA 3LKVA 4LDAA 3M6MD 4MQFB 4RY9A 3RVNA 3E61A 1VKRA 1C0EA 2L17A 1APBA 1JFSA 2FEWB 1FFWA 4W5QA 2JBAA 5IX8A 1Z2DA 4XLTA 3B2NA 4MS4B 1EFAA 1FSPA 1LJLA 4RXMA 2FMHA 1PUXA 2MYPA 2WJAA 4RK7A 4RXUA 3KYJB 1ABEA 2FEKA 3CFYA 1I3CA 2PUAA 3TD9A 3QLTA 4NV3A 4MQEA 4MS3B 2GKGA 4N0QA 1SRRA 4RDCA 4Z0NA 5TPZA 2IPLA 1BDIA 2R48A 4L4UA 4RY8A 3LTEA 2PUBA 2A9OA 2MYUA 3HJFA 4XASA 3L6UA 3CLKA 5GOTA 2HSGA 3C3MA 3LUHA 1JF8A 3ROFA 1Z13A 4HNSA 1VPWA 1YMVA 3EDCA 3M9XA 4O1HA 4XXHA 4TN5A 4EVRA 1AB6A 2WB4A 3NHZA 3ILYA 2MYNA 2A9RA 5KC9A 1DBPA 1P6UA 1EWTA 1QP7A 5IEBA 1AB5A 4WT7A 3GYBA 1RNLA 3RVJA 1ZVVA 3JPWA 3BBLA 5D2CA 3A0UA 2FQWA 5EWJB 2IDMA 4UHKA 1Z2EA 1EAYA 5JNVA 2PUCA 1E6KA 1DZ3A 4NQRA 2GWRA 2QVCA 3FFTA 1JYEA 2RGYA 3P9YA 4EYKA 4MR8B 5KWSA 2L18A 2L19A 4XARA 3H75A 2HJ9A 5TPZD 3T6KA 5IUKC 2PUGA 5DKFA 4QICA 3EODA 2E4XA 5KQMA 4IILA 4LE0A 1TVMA 2QVGA 1YK0A 4G0YA 1QP0A 4YS6A 9ABPA 5BRAA 4KZKA 2FQYA 4F8JA 3GA5A 2IKSA 5JNWA 3A3KA 1URPA 2NZUG 4RK1A 2YHBA 1PNTA 4RKRA 3EQ2A 3RVMA 4D74A 4ML3A 4WZZA 2VUIB 5FWXB 3Q41A 3BRSA 4UHJA 3Q15C 1FQWA 3H5IA 3D02A 4G97A 5FWYB 3S99A 3L49A 2E4WA 3CZCA 4D6YA 4DN6A 2PUDA 5FBKA 5PNTA 1KRWA 4MS1B 2LP4Y 4G0ZA 1QKKA 4MQFA 1QQAA 3MQ4A 6CHYA 2AYXA 3F7NA 3CTPA 5DTEA 1ZH2A 5JNRA 5IULC 5HKOA 4G0QA 4KQ9A 4TLLB 4MS4A 2CWDA 5CNKA 1QPZA 2HQBA 3NNDA 4MR7B 3HEBA 4DQDA 2H3HA 1QQBA 2IYNA 2VYCA 4KQCA 3SNKA 4H60A 1MB0A 4E7PA 1DG9A 1MAVA 2FMFA 4Q6WA 1QP4A 4MS3A 1M2FA 3A10A 4LE1A 3H5OA 4ZJPA 1CYEA 3FFWA 1JYFA 2JVJA 4KVFA 1GLGA 1DP4A 2WRZA 2O20A 4EYQA 3RVKA 2OENG 1K66A 3GWGA 4RWEA 1U04A 1OXKB 3HV2A 5B3JA 3RVLA 4KMRA 4ZMSA 1M5TA 2GX6A 1RZRD 1WETA 4JB0A 3RH0A 5KQPA 2E4ZA 2VUHB 3RVQA 4ETIA 1LBHA 1S8NA 2FN8A 1U8TA 2MSLA 2FEPA 2QZJA
chains in the Genus database with same CATH superfamily
4XYLA 4ZTZB 1YONA 4BQIA 4HDNA 4B76A 4Y1FA 5K0CA 1D2EA 5CMLA 3UFXA 5FTLA 3AL3A 1S96A 3RT9A 4ZI7F 4LHZA 1GTVA 1TQ2A 3QY9A 3A2LA 1NXSA 4L15A 5H9VA 1JPJA 1S4MA 2VPZA 4MR9B 3T5MA 3A05A 4KKXB 6REQA 3A4NA 2EKBA 1AQLA 1VGRA 2NTJA 2OCIA 2ZU6A 2JLBA 4LCJA 3S55A 2XRZA 1V39A 4OXYA 4AWAA 3TRFA 2H2HA 4HTFA 3LHSA 3BCHA 4V0NA 2QM8A 4MTLA 1Z74A 2Q3MA 2YHIA 3D59A 3LWZA 5HFJA 3SY8A 5IG2A 3RC8A 3OFVA 3N2NA 2B8EA 1EVJA 2RGEA 3RRZA 4PG8A 2IOQA 1D04A 2JRCA 2J0EA 2WAMA 2WF8A 3Q5GA 4BV8A 5HKBA 5JE8A 1SAYA 3TEMA 5K9ZA 1YA8A 4I50A 5IKMA 3RRMA 3KQMA 3RTGA 5J47A 1CY0A 3KSMA 1S4QA 1MX5A 1UBFA 3V1MA 4C07A 3AIMA 3EXFA 3DTNA 2G80A 4CF4A 3S5JA 4DXDA 4GKKB 3Q8LA 1TPYA 1M54A 5AI4A 2F59A 3BB1A 3D5EA 3H5WA 1PG5A 4MYHA 4ERNA 4ZT3A 3AM4A 1W47A 5AVYA 3JYPA 1O03A 2OK8A 1YI8A 3C3DA 1OFTA 1GGFA 1KERA 3KYBA 1GOTA 3LUGA 1W88A 1BFUA 2O2EA 1RXWA 4C3OB 1WP9A 3VISA 2IZ5A 1E0AA 2UVQA 4NJEA 5LQKA 1NDUA 3FGPA 2D00A 4XW2A 4HPXB 5IC5A 3WL3A 4BAZA 4EELA 2BSQA 3M1IA 2R6CA 3HZZA 3E9NA 2JFFA 1AGNA 4UPVA 3V1TC 1JAHA 2FUG6 3FA2A 2NPIA 4FCTA 4G5SA 3KKOA 4DANA 1RRVA 1GA4A 3NEPX 2EJUA 4KQHA 1KJYA 2COUA 1G7RA 4N6OA 4AICA 3BTOA 1CNMA 3GJ4A 1WZ2A 4TTPA 3FH0A 1F0PA 3V4LA 2YWGA 2HRBA 3CKMA 5TC4A 1TEHA 4F3TA 1YZQA 1JR3E 2A4KA 2QMQA 1FU4A 3MILA 1RJ9B 2EG5A 1BHSA 1NBMD 3PUVA 4JBIA 4KXMA 4L9RA 2H4FA 3AFHA 3D6AA 3EAQA 3AF1A 4INZA 3I04M 2HT1A 2HO5A 5IDXA 3O4GA 4L3VA 4J03A 2IHJA 3HH8A 5JCPA 2WQ7A 1V2GA 3OCYA 1TC2A 2BE9A 1JLMA 3BE5A 5FPYA 5A4MS 4N1AA 1SRQA 4IHJF 1J07A 3WWOA 1B23P 5TVGA 1GU7A 1W6RA 1WSAA 1ZA2A 3O91A 4IZIA 4FMDB 4GLLA 5C3UA 4EKDA 3QXJA 4UKDA 5AK4A 4MTCA 3EE6A 2LCIA 5K3SA 3BIJA 5CYFA 1NOJA 3WP0A 2Z09A 2GHIA 4CWAA 3E70C 4DQVA 2IOYA 2AN3A 2JI9A 4CQNA 2B98A 3LAWA 1MCZA 3K2BA 1QIHA 1XLWA 2ZKIA 4KO3S 5GGXA 5F9FA 3IE1A 4KMMA 1U8CB 3O83A 3KTFA 1IEQA 3RS3A 3VI3B 1XD9A 2OUIA 2ZTHA 4QTYA 5B2ZA 1ZJ6A 3VOAA 2UYOA 1P44A 4IRXA 3DO6A 2RHJA 4K9LA 4EGSA 5CRIA 3C8MA 3NT2A 1T4MA 1Y9AA 1Z5PA 3DV0A 3QJ5A 3JTEA 1CFJA 2JLUA 2DUUA 1X7ZB 3GRFA 1YA4A 3UC5A 4Y2TA 5ED0A 1AHNA 1CUZA 2C1EA 2D62A 2IITA 3E8SA 1D4ZA 5J1TB 5LD2C 4W9NA 4XUCA 1BA2A 2PSEA 3K5WA 1K1EA 1QE0A 4GR5A 1RBYA 5EYPB 4P98A 5ESRA 1DL5A 1OOEA 2R47A 2YWHA 4Z4FA 5EJ7A 5IT4A 1BWRA 2X15A 3DVRX 3COZA 3ZHOA 3U40A 4E5KA 2NZWA 4ENVA 4O2AB 1XVVA 3ES9A 5BYKA 1ACMA 4IEIA 2AI3A 2XKJE 3MTQA 4JDUA 4IQFA 4US0R 2R65A 4FT2A 4WUTA 3RVRA 4YAKA 3NFRA 5B4TA 1G20B 4NYIR 4EA9A 2Q4TA 4D9GA 2ZBEA 4WNAA 2G5CA 1T2CA 3RWOA 1D5CA 1BX3A 3J81A 2WNIA 4HNVA 4ENQA 3GCDA 3PQ3A 2GN8A 3QLEA 1LKZA 1PK7A 2QR5A 1CQJB 3O82A 5EUBA 5TQVA 1P2TA 1CTQA 3VO1A 1BX0A 3NU1A 4NWIA 2ZJYA 4E21A 2VPQA 1XTVA 1N1DA 4NP6A 3FPFA 5EQTA 1CIVA 4PZLA 5T8KA 1PV1A 4K9PA 1QCCA 4TUYF 4WDQA 1BDMA 3MT7A 1N0WA 4JUFA 4FGKA 4KUEA 1JHUA 4IHKA 4KQGA 1JWLA 1EYZA 3KV1A 4LKRA 5ALZA 1V8DA 3R5XA 4YROA 4CUKA 1Y5IA 3QLJA 3TDKA 5JISA 4GI2A 4LRWA 3B51X 5GQSA 1LLFA 2P11A 3KQTA 1OGIA 3HBAA 4ZU6X 3K9CA 2HSEA 3NTRA 2YZKA 4H18A 1RRCA 4G63A 2XB9A 4WFJA 3UAWA 3N76A 4GU5A 2XIJA 1QGED 2P9TA 4WOKA 4W6ZA 4P0TA 2Q0XA 3QIVA 2IVFA 3M82A 1NBME 1ZKMA 3SIWA 1OGJA 1A2QA 1NMXA 3GFPA 1XJQA 2XUZA 1NKSA 1COZA 4DUPA 5LU9A 3DKPA 3CLUD 4AMUA 1V5FA 2BRUC 4EMBA 1PZMA 3X0DA 3OZGA 3M6UA 4Q4DA 5EVJA 3PQ7A 5HXAA 5JROA 2VJMA 1XRNA 1G1AA 4DCSA 3QHQA 2PZBA 2Q5EA 5CA0A 1XNGA 3THRA 2ZUSA 3C5VA 3L43A 4DNXA 4FHFA 3DM9B 3KTDA 5KDLA 2I4IA 3DULA 4L8FA 4TL9A 2F62A 2EX0A 4XJTA 4KK4A 3UMJA 1KDZA 4BE9A 5LU8A 1ODCA 2BJVA 1V7CA 2H4WA 3IMFA 3KT6A 4GECA 4OQZA 1JDPA 4ROTA 4N01A 5F64A 2HRRA 4NU8X 1FMTA 1CT9A 1A8UA 4X20A 1DG3A 2IXEA 1W4BA 4KLZA 4H7FA 3T12A 2IYQA 1CYDA 1DBQA 2CXQA 4G0PA 4B3BA 3FOFC 4E22A 2SBTA 3LDHA 2GAAA 1TAQA 1GZ3A 1U3WA 2HWUA 1UAYA 1L1EA 2HK9A 2IPAB 4Y2JA 4HWRA 3CSDA 4IWXA 3TEFA 2Y67A 3OPMA 2A67A 3GR6A 5FTNA 4AJHA 3CH4B 3Q5DA 5B3KA 6AT1A 3PTZA 1SUIA 4IJQA 4XWOA 3BZWA 3U7IA 2IXTA 3MWEB 2NSDA 4CDMA 2RC6A 2INGX 3EGEA 1FL9A 1ENZA 1OTXA 5BPFA 4FYMA 1P3Y1 1P80A 3K32A 4A8HA 5C8DA 1SWWA 4QE3A 2FXIA 1RJEA 2GZ1A 3MWJA 4HSGA 1TCCA 1YWGO 2RJNA 4PPFA 2VP0A 4OMUA 1KI2A 4DADA 2ZW9A 4I66A 1XAJA 4YRQA 2FPUA 2W37A 3JARB 4JROA 4QDKA 1BKDR 1DJNA 1YZGA 5HF9A 5TMBA 4CQMA 1ZU4A 1BXGB 1MGPA 1R27A 2YY5A 4AO7A 4CKBB 3BWMA 1FTSA 5JBIA 1X39A 2X9LA 4UEKA 5A04A 3UENA 4B7CA 1FRVA 1OXSC 5JI3E 3VKGA 2BFBA 2MJLA 1M8JA 3CLTC 1O95D 4IH4A 5DNVA 3GVXA 1KPGA 4BVHA 4DMFA 1GRCA 2Z2XA 3C15C 1Z0IA 3CHYA 4KXVA 5DYGA 6PFKA 4HDAA 2XZDA 2ZJOA 3QUTA 4FKZA 3ZXYA 5IM4F 2QSZA 1DTWB 2J5BA 2IQ5A 3DDWA 3QUQA 4TLCA 1L8XA 2FPIA 3A9UA 4EJMA 1TAGA 1Z5NA 4Z7OB 3Q8MA 1QHFA 1G8JA 3DV9A 4EYEA 1JDNA 3DE2X 4HAUA 2O0HA 3EIEA 3HFJA 4K1LA 3WGMA 1CRPA 2JD0A 3EXAA 1E2QA 1JEYB 1MAHA 1U90A 4TV8B 5BN1A 3E8XA 1E0SA 5I9IA 5AKGA 1TQ6A 2IIPA 3AETB 4H7HA 2VQSA 2XVYA 4L2IA 2CXOA 2Q27A 1NATA 3AYXB 1ZQ9A 4FOTA 1EX9A 4KQFA 3RU2A 5FTKA 1IJBA 2HRZA 3P45A 4CR6A 1WQ4A 1ND5A 4EF6A 5BOSA 3CF0A 1EHIA 1B0UA 3WFJA 4Q18A 1G4UR 5DASA 4KI7A 5FI1B 4ESVA 3WNQA 4Q93A 4H4EA 1E7MA 1XEFA 4RH0A 5HIJA 2BKAA 3LP5A 1NN5A 3RKSA 1UWCA 3ND6A 4P8RA 2P9QA 2QTBA 4LOAA 3I9FA 5EZQA 5C8ZA 2C57A 4URHA 5IF3A 2UXDB 2NP6A 1O7JA 1PJQA 1UAGA 3D6MA 3IUNA 3QNUA 5E6RB 3IKVA 4EDFA 2NMVA 3GT4A 4J3NA 5DW3A 1S3GA 3PZRA 4C0QC 1WMEA 3S70A 4KWIA 2Z5GA 5IWAB 3M6MD 5L95A 2OO3A 2NZ2A 1FLNA 1RYYA 3ZNOA 3ZKAA 2IGTA 2Y1DA 1BGVA 4J1NA 1X3SA 4K9SA 3R7NA 4D9CA 1REQA 1EFAA 4OXKA 1VA5A 1FXUA 1P4JA 4CM9D 5L3VA 3C6BA 4R8MA 5J1SB 4GNKA 5L45A 3KT3A 1KY2A 3L8ZA 4QC2A 2CMFA 5I9TA 3OFND 2PUAA 4BGEA 1TL7C 3QXHA 4X90A 3IH5A 3NP7A 2X5KO 3W7VA 1T1EA 3L77A 4D4GA 3QV2A 4XPIB 8AT1A 4ME6A 1YB5A 4CHGA 2QSUA 1BS9A 4P3KA 5D1NA 1AMNA 3K1TA 4BXOB 1EA7A 5JS7A 2WE7A 1ID1A 5EI5A 2VYQA 2FPPA 1SQ0A 1CW2B 5AXAA 2HSGA 1TIPA 3WWZA 3T1TA 3ZHZA 2ILVA 3C3MA 3MK31 1FX1A 2R6ZA 4C6TB 4E32A 1CQWA 4RIIA 4ZAXA 1JS1X 4BNTA 4QGGA 4E14A 1OREA 4BVBA 3W06A 4ZI3A 1VGQA 3U0BA 3ADBA 2EQAA 4P38A 3H3JA 3T3GA 5JADA 2YINC 2OM6A 5F1YA 2IEAA 3PPIA 5FBVB 2AC7A 2ZSAA 4HGZA 1EZZA 4FGLA 4OA5A 5FT9A 4PXAA 1U7TA 1FE8A 3IKMB 3C3YA 3AM1A 2QL7A 3DQQA 1H3EA 1GLVA 1NKTA 4GOKA 3TW8B 1LFDB 3RVJA 1V5GA 2GEBA 1R4NA 3UMBA 1ISHA 1NM5A 4BB6A 1W5SA 1LDGA 2IDMA 2WSMA 2HRDA 4JJIA 4JVSB 2CKMA 2ZTMA 4M1YA 4TTAA 4NQRA 3LCRA 3TSZA 1B76A 1GJRA 2C9MA 3DCIA 2H3EA 3P9YA 4UZSA 5F5LA 4RF4A 2XCOA 2M9MA 4QQFA 4XARA 2X5JO 3NTOA 4Y98A 4BLUA 3SDBA 3ZS8A 4B3SB 1J2RA 1UXGA 3OOHA 3U5TA 5AIAA 3VPDA 1FPQA 4GL2A 3WMRA 2E4XA 1NNEA 1VMKA 4ALNA 3M2PA 4LE0A 3AGPA 3HY6A 4Z49A 2RHHA 2OESA 2XDQA 1V11B 1JR3A 4R8SA 3VOBA 2C59A 5CGQB 4B32A 4Z2AA 4XQ9A 3G6KA 2G04A 3OURA 5FLEX 1U99A 4RK1A 2O14A 5AHOA 4ISCA 4B6PA 2QL9A 1PSDA 4M4SA 4AJ2A 5FBQB 2JD2A 4E5SA 4AIRA 2UDPA 2QGFA 4JHLA 3UKOA 5I8WA 5DNUA 2ZGVA 1A82A 1T24A 3DVLA 1QZ3A 4IDGA 2IY8A 2HA2A 1RXCA 1XTZA 2A7QA 2NV2B 2OLKA 3S99A 3QYAA 1E1DA 2H48A 4R1LA 1IXSB 2ZROA 2D6FA 4M9SA 3PGMA 1UBCA 1YKFA 1LSSA 5AOVA 1ZK4A 2QBYA 1AHIA 4JN6B 4PX3A 1SJ9A 1Q2UA 4NLLA 3NB0A 4Q3OA 4RD1A 1IJEA 5AVKA 4BFWA 2VOJA 1H2BA 3KPWA 4R16A 1PNQA 5E4YA 5CLLA 1Q7EA 2B1GA 1EE9A 3YASA 5C1OA 5BVHA 3IXQA 1A8SA 1TUIA 1S2GA 2O23A 1SBZA 4JBNA 1NVUQ 4WLFA 3ORSA 4ZQFA 1W0CA 4PG5A 2Z5VA 3I62A 4W7HA 4RGVA 3A6EA 4ZA2A 4DJTA 3L01A 4F2GA 1JRLA 4Q3KA 2OXCA 5SZHB 1VYVA 1VE1A 2Q6KA 2YZNA 2Z58A 3L04A 2F3SA 1OFHA 2HWWA 3WL6A 4LA4A 4O4JF 4G4JA 1DJQA 3I6ZA 3JZMA 4MQBA 4X7PA 2PQMA 2GB4A 2J0UB 3C7KA 3FVRA 1XRMA 3KIPA 4JWKA 4LDJA 4AMYA 2GZHA 4WUVA 4YJKA 3SYLA 1WZUA 4G1BA 4KVFA 4ZCRA 2O5EA 3G5TA 3K8YA 2BHSA 2WKSA 1J7JA 1LW6E 3R75A 3CC8A 1GQOA 5FD8A 2R7LA 3OZRA 3WYAA 2JGRA 1SC9A 4IXTA 3ZE2B 4JJEA 4FXOA 2XSZD 4OUDA 4JEUA 2K7FA 3PC6A 3W6UA 4FYHA 4DJEC 5EJMA 5EIFA 4A03A 2XUJA 4CETA 1QYWA 2CFTA 4I5IA 2HEIA 1I1HA 4AUKA 1KQFA 4BX8A 1FDVA 1SUCA 3KM0A 5A62A 4P34A 1EJ6A 1KA9H 4RKQA 1CP2A 1XKTA 2C20A 3NVKI 1YVRA 5D5HA 1YHYA 1HXHA 2A5JA 5G4LA 3H8JA 3S2ZA 2HMVA 1U0GA 3GUCA 1UANA 3OU7A 1N5DA 2Y2UA 3CF4G 4IKPA 3UPDA 4N48A 4FLMA 2OHOA 1JXOA 1AQYA 2KSQA 2XUGA 3ACCA 3EVBA 4OL0A 4FMCF 1VCNA 3MSXA 5C8YA 1ZWLA 4PCVA 1I14A 3D7LA 1KFCB 4RQBA 4UPEA 1JZSA 5C5DA 4P83A 4J9UE 4Q3EA 4XOUA 5AKXA 4K8RB 3SVTA 5JH7A 1KMCA 4RMHA 1GILA 1F4VA 1NBIA 4PPGA 5JG7A 1UBRS 3N2KB 5AI9A 1EE2A 2GAIA 3ESRA 1KO8A 1Y8AA 1JL3A 4ZIRA 1O4WA 2FLVA 3GRZA 4LJYA 3WBFA 2XV1A 4LDZA 5ALTA 2I54A 3PFKA 1U0SY 3GXOA 1AZWA 2F1KA 4LOHA 1NBMA 4EW2A 2JLVA 1UMBA 4Q00A 1Z15A 4ZK6A 1BEZA 2WU0A 3REFA 4RFSB 1SK8A 1V16A 1ADYA 2OHJA 5DIZA 3RODA 1EWQA 1XRRA 1X38A 1Z33A 4Y6GB 1E2LA 1OIXA 3ROTA 2R8BA 2VNKA 2AFHE 5AW5A 5F3RA 2WJGA 4YV7A 5KYWA 4DDHA 5JJBA 1A04A 1RHQA 1JAYA 1TYBE 2GSDA 4Y7DA 2YXBA 5EWLB 3NC1C 4FFVA 3LLVA 1XZBA 2V4UA 2C9YA 5E2BA 1H6AA 2XMBA 1L7EA 3M5DA 1E5TA 5MN6A 4LY9A 3DR5A 4JA0A 4L4ZA 3A1CA 2A94A 3TE7A 4RACA 1QFYA 4BB5A 3CV3A 2PFKA 2HF2A 1GPNA 3TUIC 4UEJA 4HVTA 1MJNA 5F2KA 5DHSA 4QXPA 4YCBA 3Q7PA 1WS6A 2WYWA 4Z4HA 5FUYA 1NVBA 2JFUA 5LC1A 1UXJA 1Z0DA 1I9GA 3L7DA 1SQ5A 4UVIA 2FYTA 4KX5A 1Q44A 3IS3A 1IPEA 1YRBA 2I6GA 1H85A 3G2JA 4G1UC 4WK6A 4ZRMA 3LVRE 2DUMA 3F47A 5ALFA 2BDTA 1PK8A 1GPDG 4NMHA 1NWCA 4Y2PA 1U5BB 4V1CB 1OWOA 5B37A 1W73A 2AR9A 2ST1A 5CIYA 2FE1A 1EFUA 4BMOB 1NQXA 4JP1A 1AKRA 4WKPA 3VSEA 5E8JA 3U7QA 3GLQA 1JNYA 1Z47A 4NHEA 1D2MA 1T25A 2G17A 4HQNA 5HNKA 4F12A 1A7UA 3FVTA 4ZHSA 3AHFA 3GYGA 3QMVA 3ZLTA 1MDFA 4BLSA 3TIIA 1YIDA 1UKCA 1JGTA 4NCBA 2BFDB 1EGHA 2HDOA 4IDDA 4UXIA 3H4IA 2JFXA 5LBTA 8ABPA 2AW5A 3EFOB 2J6HA 4JBLA 3UT5B 3A4MA 1KXZA 1NBWB 1YJAA 2JC3A 3HSSA 4V0OA 4HUTA 2YFQA 5BSFA 1TJYA 4ER5A 1P39A 3WGQA 3R3UA 1EJ2A 5EIOA 1T8PA 3ETEA 4JJ6A 4HMQA 1JFRA 3ZK7A 3GEMA 3PWSA 5HZHA 2MMGA 3GMTA 2FR0A 3SK0A 4FDAA 5DU2A 2D74A 2HK6A 4X60A 5JNSA 2NSLA 2DUWA 3AJAA 4PHCA 1SM4A 4DV1B 3PFHA 2I4TA 1GCIA 1GLNA 3AUKA 3ZJUA 4LRSB 1D2CA 1UOQA 2BR4A 3WTBA 4UDNA 1N75A 4KE6A 4JITA 4ALJA 1BMQA 4CEJA 3L7BA 1P8AA 2G06A 2CCGA 4DCMA 2DVMA 4PWZA 1QGUA 2JHFA 1RCFA 4QT0A 4CM8A 2WZCA 1VSUA 2ZRJA 1LFAA 2E5WA 4EHFA 1M1NB 2CLSA 3OQPA 3C8ZA 3QGMA 5T4FA 3U17A 2D1SA 3AY0A 1FPMA 2LDXA 3BMOA 3AT1A 2JA2A 1J33A 1D03A 3ZG6A 5ICEA 3AP1A 4NV1A 5AW2A 1L5ZA 5EZYB 3VSDA 5J4VA 2YUTA 2EFGA 1RKQA 2P9HA 4GE3A 4JGGA 4BMSA 1TVCA 4INAA 3KXLA 3MWYW 4NFLA 5L7YA 1K0FA 3G3EA 4YJHB 4G0XA 5G40A 3S3TA 4MW0A 5KYNA 4NONA 2YKGA 1N4DA 2HFJA 3MUEA 2VXBA 4QOFA 3ZDXB 4J0JA 3F67A 4G89A 4K6KA 1ZK1A 2V3VA 3FZGA 4NJMB 2NGRA 1LI4A 2PL1A 4Q12A 3V2HA 1NAIA 2NV0A 1FUEA 2QTLA 1K8XB 1BW9A 1LI7A 1CXZA 3OCUA 4RXTA 1E99A 3IUMA 4BNDA 1E1MA 1P72A 1QK4A 2CDRA 3D4NA 4AIIA 1EGAA 2ZB8A 4C30A 3IOCA 4JYMA 4AWBA 1FMJA 1X7WB 1RLTA 1V8OA 3FSRA 4EB8A 2PS0A 3CW8X 1KO4A 2KBEA 4I3FA 2V9ZA 4O4HF 2W2NA 1H0KA 3AQIA 2ZIXA 3GLUA 2M2IA 1US8B 1ESDA 2XXAB 1G64A 3FRIA 4B80A 1B41A 3A11A 1G60A 1QPBA 5F78A 3SS9X 5JV5A 4PN3A 5CH8A 4MRMA 3W6OA 1XEXA 4HDKA 5A3QA 1YJXA 2GBGA 2QWXA 5ECYA 4PYLA 3UMFA 1LPPA 4BKRA 2I67A 2GZMA 1HG1A 1WCXA 3GOHA 3KKNA 3O8OA 4URUR 4IWNA 3MHTA 5IF9A 3GUZA 1CNEA 5LKRA 2NQ8A 1C41A 3CLTD 1Q1NA 4G5QA 2CNNA 4JB8A 2QNRA 2H7VA 1BDJA 3WOHA 2GM5A 2PV7A 1ES9A 3L41A 3AZOA 2O3TA 1A4UA 4MULA 5CM8B 3NYRA 3GA7A 1Q0ZA 1SXHA 1EM8A 3CBQA 5ITZB 1PEDA 4KPYA 5I7OA 5KDOA 4ZAZA 4EI2A 1ONOA 4DB2A 4RK0A 1R6BX 1SHZA 3KYCA 3V33A 4BZWA 2YOFA 3ZWOA 2CC2A 2QMYA 3U2QA 3CCCA 3L6RA 5E1MA 4ENSA 2WSYB 3P9RA 3T7TA 4M87A 4UDOA 2ZIWB 2RGGA 3WGNA 1PWXA 2Q0HA 3PQ8A 3FTNA 4HXFB 3BK2A 1ZY2A 3U48A 4UUPA 5AW8A 2C99A 2YN2A 1FYEA 1F4PA 3UUGA 4EI7A 1AUOA 3A1WA 4I2NA 3NRJA 1NZFA 3NYWA 3NP9A 1HDGO 3WYDA 1C1DB 4JMPA 1H2EA 4XUGB 4J4BA 1G0OA 5B2FA 1L8QA 5GONA 2A5DA 4L22A 5BR1A 2GJ4A 2P69A 2ID8A 5EESA 5P21A 5IXJA 1DAMA 2F90A 1GPH1 2YZ7A 4LSZA 4FVTA 1HTBA 2C5AA 3O31A 3AIOA 3F6PA 4RV9A 3I5UA 4BHTA 1KBZA 5LMNB 3DKRA 3ANNA 4DBVO 1IPFA 3EIXA 3UT0A 5LQAA 3BOSA 3IUYA 3K1JA 4PIVA 3HP1A 3X1KA 3D3EA 3E3AA 4Z8YA 3J7AC 3O3MB 1HDZA 3IJ5A 3IP6A 2QJTA 5AM0A 4OTZA 4EPWA 3TK1A 1M72A 3OQJA 1RWWA 5T41A 3GT7A 4S0XA 4QGFA 4LOLA 4YO7A 4H77A 3UMCA 4ZCSA 4EFLA 3AEKB 2JIZD 2QRHA 1ZLXA 2HF9A 3A26A 4IG4A 2PH5A 4JODA 2G76A 4NI5A 4QSMA 4RPGA 3SJAA 3THXA 1PR2A 3L5KA 1M1XB 2VWQA 4P7BA 4MI6A 5KWJA 4TQAA 1Q74A 1GYQA 3K72B 3AF4A 4DEVA 4V0ME 5SYMA 1L1QA 1FFEA 1XXHE 3W8EA 3ERCA 2B82A 5DB4A 4P86A 1UPTA 3RYHB 4ZRNA 4PHGA 1MVOA 1KQPA 1SZPA 2UZ0A 3D5QA 3H04A 3PHBE 1E5XA 4HB2A 4PXSA 4WE3A 5C4GB 3VNBA 4DV4B 1L7DA 4AECA 3E18A 3KCNA 1MJGA 4DIEA 1EXVA 3E53A 2R8YA 3VHQA 1L0BA 4CN8A 5JXWA 1I1OA 1L8OA 2PPLA 1OTYA 3BWXA 4F3NA 3OLYA 1V43A 3FUUA 4C7OA 5EKDA 2HX1A 2ZRDA 1E3WA 3KQPA 4C01A 4UOEA 3TF5A 2EHDA 3SQNA 4LYDA 3W04A 4RJTA 4TKUB 4BLRA 3OFNA 4ER7A 4DCCA 3CSSA 3T3OA 1ISFA 1N8NA 3EC7A 3GJ5A 3S2UA 2RHLA 2IOFA 3KKQA 4G1CA 1CJMA 2ZYTX 3V4RA 3C4JA 1HY3A 4QGHA 4OH7A 2ZPUA 4Q15A 2IPMA 3L0IB 3QM1A 4OVKA 3ABZA 4ZT5A 5LKAA 2QG4A 5K3BA 2JVKA 4HQLA 1X2BA 4DDTA 3KPVA 1ESNA 1EWVA 1ULBA 4OUKX 4U9IS 1ETUA 1P1CA 1MIHA 1IY2A 2WDPA 3AKEA 1Z26A 3IBFA 3VR4D 3DEHA 3OTQA 1GYRA 1TQDA 2C9CA 3F5DA 4K9DA 5F5NA 5KAPA 1YCFA 3CEHA 1CHDA 4JOCA 3HL0A 4DZRA 621PA 5LBUA 3FOWA 1CRZA 1FFDA 1X86B 4RHXA 3KLPX 4R1TA 2R6AA 1CJVC 1F48A 2DT8A 4N18A 3HJCA 3HYTA 4A0SA 4C6RA 4OLHA 3VVBA 1FVXA 1QPGA 2X6TA 2HIAA 1M34B 2J3MA 1FNNA 1UAAA 2WD8A 1VYHA 3I53A 1EUCB 1GPAA 3I9LA 4QOHA 4Z1OA 5JECA 1G16A 3MRXA 2N3ZA 1OLUB 1TU0A 1T5HX 1SPBS 2G6BA 1LPMA 1P17A 3F2VA 4MQEA 2MOKA 3FROA 5CM9C 1D6NA 4Q4JA 5LJIA 2BEKA 4TTVA 1JHRA 1RI5A 3V5NA 4D9BA 2LIPA 4CF7A 4E31A 3WYEA 5E4JA 1ZNXA 2PH3A 1UKAA 2QRZA 5AICA 2PUBA 5CB0A 1PZNA 2GPSA 3DZJA 1OXMA 4X3PA 3TBFA 1U7HA 4KWEA 3CZ4A 4O2LA 4UUMA 1Q1ZA 4RZ2A 3QMWA 3SJ7A 3WGGA 4BNIA 3C3CA 4GX2A 5BN4B 4OHBA 5BT9A 5KNLA 3PPYA 2F64A 4P22A 3WDMA 1PT6A 4FTWA 4B7UA 4RKFA 1B8UA 1KDYA 5AHWA 2I8LA 5J23A 2AFHA 3CRZA 4BVLA 3ILYA 2DHRA 3SN6A 4F9EA 2A9RA 1K6MA 4QEKA 4RM2A 4Z54A 4ZHQF 5B36A 1EWTA 3L18A 4F96A 2F4NA 1H3FA 2ATEA 4TLAA 3ZGOA 2OBFA 4PTYA 1EVLA 1XJ0A 4R1NA 2GNOA 5CA1B 4URFA 3AG6A 4L8YA 3GY0A 2CZGA 1HKHA 1Z2EA 4KIWA 3RM3A 3RVNA 1PZHA 1OWPA 2YHUA 3WGTA 1J0AA 4DM4A 5K5EA 3ND5A 4EYKA 1J6UA 3AY6A 3FSEA 5M04A 2UZIR 3MIIA 5LP6F 5JASA 1QH1B 3FRJA 4NNOA 2BFAA 3JQFA 4B71A 1LNZA 4CLOB 2HJ9A 1V8FA 2O3RA 1H6BA 1PGJA 4O4IA 4AF6A 4CKEA 5BW5A 1BVUA 2BAGA 2OZLA 3JZDA 4B34A 4HQ0A 1CFZA 2QM3A 4MB0A 3UXHA 3VHXB 1B16A 3RUAA 5EJ9A 2X0DA 4V39A 2I2XB 1KJ9A 4QRHA 4ZDKA 1U81A 5TB5A 1NW4A 4CNBA 4AKGA 2HGSA 2XUFA 1R6DA 2R5FA 2WSIA 3FZEA 2VSFA 3H2IA 3M7IA 4KN9S 1O58A 2GYUA 3QJGA 4MJXA 1QV7A 2J9FA 4KRXA 3LJKA 1NUTA 3MTAA 3SHTA 3OCVA 2OP1A 3EQ2A 4GQBA 4L73A 1M2OA 4CDGA 1NDHA 4YJ3F 3JZFA 3QWBA 5JEEA 3UYLA 2NYVA 2ET6A 1AKVA 2BN4A 2PMFA 3EDMA 2GM3A 3G1TA 2IBMA 5FJIA 4EEXA 4EI8A 4LF5B 1TX4B 1FMFA 1Z0UA 3BL6A 4BNNA 3EVGA 1KF0A 3UZUA 5AM4A 4NOKA 3SXUA 5CG2A 2H2WA 1B2RA 2QUJA 5DIFA 2VQEB 3HCPA 2ZRLA 4M7WA 4MS1B 3RSHA 5KJ1A 2B36A 2LZ0A 4I9FA 5GVRA 3ZTWA 3PWTA 2F67A 4LWQA 1P60A 3IXMA 5LXTF 3TIVA 4I14A 1IRXA 3GMSA 5G0TA 2XUDA 3VNQA 3G7SA 4YV2A 1S2NA 3FDZB 3K05A 1GRNA 1SBYA 3QIAA 4RELA 3NBAA 1CUFA 4U8HA 3F4BA 2IUTA 4KQ9A 4L3OA 5I47A 2X58A 1KNXA 3BBPA 4X84A 1WOYA 3OLCX 4PAGA 1XZFA 4PLCA 5C7LO 4ARVA 3R3YA 1G21E 4IYRA 2A57A 4W5HA 5CAEB 4DJDC 5JCZA 5AFSA 3ZLVA 1WXWA 3LWBA 1RDFA 2G7MC 1XROA 1NMSA 3OQHA 4OB6A 1L7PA 2I2WA 3FDIA 4X61A 1RADA 4ZOAA 5AVUA 4WBNA 4PV7A 2NTYC 2QAGC 2ZSFA 4QFDA 4YJGB 2QPOA 3F8WA 1QQTA 1RQGA 1Q50A 4ZV9A 1TCBA 3TTUA 1ZVMA 1HE4A 1XD2A 1WY7A 3AEQB 3RUPA 1G5FA 3SHVA 2FSUA 2NAFA 3DOJA 2ZSDA 5KQPA 5LZ4A 3D2BA 4KDEA 1S8NA 1BD4A 4KEAA 1H65A 1LXCA 1R5JA 3RJTA 2AZTA 4EUFA 1CWUA 1NJGA 3C43A 1K27A 3LT5A 3W34A 5CB4F 2C5FA 2WHPB 1EK5A 4HAOA 2CWWA 4D96A 3S28A 2JARA 3GJRA 1ZGZA 1DO2A 3CZMA 2HO4A 4J0EA 3V8EA 3KAJA 1JHXA 4NU6A 1MH9A 2ZWVA 4ZWNA 4CL8A 3R9WA 3FYDA 1JR2A 5AVOA 2FMIA 4KXNA 3PRKE 2P3SA 1MV5A 1YSCA 2F00A 3WLQA 1F8UA 3TOVA 1QVZA 2MSKA 1CQXA 1KU6A 4LV5B 3EXHC 4XGKA 3SXJA 2B7BA 3FDFA 5ALRA 1AA6A 4LFBB 4XWTA 4BYGA 2OFWA 1IWOA 3KKZA 1EFVB 1LBIA 3H4VA 1N9KA 2ZJFA 3O0TA 3E9RA 3H0CA 4A0RA 3QEJA 5DHTA 1LPSA 1POXA 2B2NA 2EFCB 3EWIA 3EBLA 5KYKA 1EBFA 2O06A 3GPDG 4BTVA 2VXOA 3OQ1A 1BJTA 4Y2XA 4D4KA 4XYMA 3MMXA 1ZIYA 4PYOA 4WXEA 4MUXA 2VNAA 4Z9AA 1U28C 1XLVA 3CJQA 3MZ0A 5ILOA 1KGSA 3GDGA 2G40A 3B60A 3IGFA 2MINB 1R5BA 5H1YA 2GJSA 2J0VA 5H59A 4DLRA 5A5DA 1ZL0A 1S0UA 5HZKA 2VZEA 5IPFA 1FTNA 4LDNA 4G4SP 4CU5A 4JGIA 3WKAA 1PL0A 5C52B 1GQFA 3CWZA 3I3OA 4EUHA 2XTJA 1RWKA 3AL0C 3HXMA 4OGWA 3S44A 5SZKB 1A9ZA 4QKQA 2HMYB 5FUMA 2BMFA 3JYLA 2C7BA 4MUFA 3MAJA 1KP2A 2REBA 3BD6A 3HLYA 1G8PA 2D2IA 1HETA 5T6BA 1MZPA 5ARCA 5SY4A 4M0FA 5DTMA 3A6FA 3COVA 1FXWA 1IG0A 2BFEA 2ZB7A 3W2TA 1IUOA 2PFGA 3IUJA 4BGVA 3OJWA 2CYBA 2FEAA 2QVBA 2IHUA 4Z0HO 5JOQA 3IP1A 1B14A 2NUBA 3T1OA 1NNUA 3FPAA 1ULSA 2J08A 1J24A 3IEMA 2YC2C 5KNBH 4QUBA 3W7AA 3SFVA 4H3SA 2X1HA 3WB1A 4OQPA 2FKAA 4QPCA 3RYCB 2W4IA 2WVGA 4Q37A 3GLIB 3GGJA 3RG2A 4EB0A 5LNK1 3OZUA 2V55B 5JXJA 1P5RA 3BA1A 1YF3A 3A8TA 2VT6A 4RV5A 3EEBA 1PAUA 1OAOA 4N5NA 2P1ZA 4IEEA 4JXKA 1Z38A 3PKIA 2JLAA 3NEJA 2I7XA 1K8QA 1WW2A 3AZPA 4O02B 2BONA 4W7IA 3W5BA 1ZR2A 1R4ZA 1TC1A 3ZHSA 4O08A 5IYZF 3BVPA 3AW9A 2C2ZA 1NVDA 1IIBA 2G3YA 4B4VA 1PU2A 2O57A 3FDXA 4ZDJA 1ZD1A 3BEDA 2QLMA 1GSAA 1KDTA 3I1FA 4P84A 3WV5A 2WOJA 1BA3A 3BERA 4FS3A 1NLUA 1HO3A 1T3SA 4G86A 1VZ2A 4L4YA 1DDIA 4XGIA 1YCGA 5BW6B 3QLVC 1MHPA 2ZR9A 1UP7A 2Y1WA 3S1AA 1GV1A 2RHRA 3T7JA 3WJAA 4V0MA 5LMCA 1RABA 1SHLA 1XXHA 2ZATA 3G59A 3N86A 4JQSA 1SOAA 1DEAA 2XYVA 4R81A 1K8YB 5CXQA 5JWRA 1HF3A 1B73A 1XALA 5TQ0A 1J9ZA 4YV0A 1D8TA 1GA6A 2PZFA 1E1QD 2BV3A 4YMTA 3A3OA 3BXZA 5I7HA 2VZ8A 3GN1A 2D0DA 1IBCA 3I2GA 3EY4A 1VHDA 2R25B 3OPYI 3RIXA 4FQ8A 3ANSA 4UC0A 6YASA 4RTNA 1HNNA 1B7GO 3GG9A 3OLZA 3SLGA 4UTPA 3ENQA 4JJ8A 3FYUA 1CUEA 1VECA 3HCRA 2AF3C 3GPBA 4GI3A 3ZV7A 1RC8A 2ON6A 1U4NA 1VL5A 1JPVA 4HDSB 1KSFX 2AI2A 3ILXA 4J0IA 4FUTA 4DLZA 2OA0A 2H4XA 5C53B 4IGKA 4RH1A 4Q7KA 2HCJB 1NNI1 2G07A 2JJ2D 2RGCA 5AJXA 2FSVA 5AXDA 4D45A 4Z7JA 2ZE6A 2EKDA 2PANA 3L8GA 3IR5A 4WY8A 3ZH9B 2F8LA 3E1SA 5FPKA 1TZBA 2R1ZA 3AF2A 5EWMB 1AGYA 4KGZA 5J2TF 2H59A 4JOBA 1D4OA 1RWXA 3DVAB 4PHFA 3MB5A 1ILEA 1XWWA 3GCWA 4LK3A 4PINA 5B7QA 3DZIA 3HA7A 3RRXA 4NYJR 2ERYA 1WAMA 4HG2A 3LP6A 1XZQA 3SYRA 2IP4A 3SOPA 1U2DA 4BWGA 2DRIA 3TFOA 1MB3A 2P91A 3L8HA 3RRYA 5ED4A 3U31A 2Y0PA 4LHWA 1RWNA 4BO4A 2BGRA 3NKLA 3OZXA 1KTIA 1Q77A 1J7KA 2Z0MA 3PDWA 4Y2GA 3IURA 2ZDHA 1GADO 4DCVA 2BIFA 4D3DA 3OWHA 1ZH4A 2AA3A 2C4UA 2I6XA 3OIDA 4F85A 3DBOB 4JI7B 2VPWA 4H3KB 5BNFA 1H0SA 3DLCA 3F7TA 1UODA 3NX4A 3SAJA 3V7UA 1QXSA 3QFCA 4ARBA 5CDFE 1VHTA 3FGZA 4XVHA 3L93A 1RPZA 2Z8XA 4J1TC 3D4BA 1RU3A 4TSFD 2PMCA 1L4GA 4LZNA 4V2IA 4E6EA 2JCGA 1MO3A 1EK2A 5FA5A 2V0CA 2WR8A 3HKBB 3E0XA 4GDFA 1P7CA 1IY0A 1KZHA 3UWSA 4WINA 2WJWA 4IP0A 2QLTA 1PS9A 2C84A 3H1AA 4XGQA 5B1EA 1PR3A 4GWLA 2O54A 3BF8A 2NLOA 3GJXC 3D7SA 3TRHA 4ZCQA 3ZTTA 2ID9A 1ADFA 1ZYUA 3I1YA 3V6LA 4NICA 4M1EA 3DE3X 4QXQA 4YWJA 3OIYA 3DFFA 4CCYA 3PEWA 1MRNA 3I6QA 2CNDA 2JIOA 2QVYX 2R1VB 4W9RA 4CTNA 4ZDIA 4YMLA 3G6WA 1FP6A 1QFXA 2XWJI 1II0A 4XQGA 1GGKA 3M8KA 4L85A 4Y6PA 3N3AC 2DKNA 2X13A 1CR1A 4MLCA 2WAOA 5CX4A 3SHOA 1CE8A 2AUTA 2O8DB 3IP5A 3O8LA 3OT4A 2Y71A 2R7AA 1ZC4A 3EQ8A 1BJRE 1JEJA 4BLOA 1UXOA 2ZBPA 2GCOB 3X1MA 3MGGA 4MWOA 3ELYA 5IDVA 2OHVA 1MAAA 4WQMA 2VDKB 3WIUA 4ZCMA 5KO2A 3ECAA 3VR6A 3R3VA 2OSBA 4GPBA 1M66A 1RE0A 3C97A 4RHTA 4YYZA 1S6YA 4J1SA 1BMTA 3KPYA 1KJIA 1SXPA 3TXYA 3W77A 2V5AA 1YO6A 5THXA 2KM1A 1ZSNA 3SZMA 5KUTA 3MWDB 1ZRSA 3HVUA 1W93A 4D1YA 5AW3A 5KOHB 2QXYA 1IWBB 2EQBA 2OV3A 1TUBB 5DJ5A 3UK1A 4IDNA 4P3PA 1Q1BA 4PYIA 2Q1XA 5BN5B 1ODSA 3LCCA 2H1VA 4G9BA 2HADA 2IXDA 3QVUA 3TOXA 1HMYA 1X8XA 1ZXLA 4R51A 4QNNA 1CY4A 1T29A 1GZVA 3BL5A 4EP1A 4G8DA 3KKEA 4DYHA 2XZLA 3W1VA 1DQSA 1FFXA 2PU5A 4FNAA 2GCEA 2IW3A 5G0VA 2Z9BA 5HGJA 4FPXA 1FDSA 4HXYA 1NJSA 1BJKA 4DMCA 4CVNA 2QLFA 3EGXB 3WS7A 4J3JA 1SKBA 3VR4A 1HEUA 3I45A 1ZIPA 7GPBA 2O1WA 3V8MA 3FHJA 4PRKA 3VPFA 2Q4EA 2VYNA 2W0MA 3LPNA 3QWIA 4FNGA 1RAAA 4RC9A 3URKA 1K5HA 4C4XA 3IXLA 1B8PA 2OFXA 4V3BA 1ENPA 5A9SB 5CCXA 2JJ8A 3IQGX 3LH5A 4RVCA 5I8ZA 3LC2O 4HUQB 1PV4A 2DH5A 2IYEA 1JLLA 1V7QA 2HNBA 4E4RA 4AK9A 3QKSA 4GBGA 5ESDA 1C3LA 2IWHA 3UJ9A 3EPHA 1VIVA 2VP3A 4JSYA 3D2CA 3WQQA 3FI0A 1AHPA 4C7KA 4DBLE 5JYCA 1ZU5A 1RBMA 1BWQA 3WYNA 4RSMA 1HT1E 5ICFA 4DIKA 1G21A 2UVPB 2ZIEA 4F6LA 5BUZA 2WTEA 3Q6NA 4LI3X 5CK5A 5FOWA 3TI7A 5B3LA 1OFVA 3UGJA 4KR6A 2HQOA 2V3CC 2VNIA 3R0IA 2W2TA 1GO2A 3ECSA 3DBVO 3HA3A 3HCAA 1JTEA 4BIMA 2VTDA 3MMPA 2AR7A 2RJOA 3OH8A 1MT3A 4HNAA 4TVBA 4ZO6A 5CYOA 1RXUA 2IY7A 4XTCS 2AZ4A 2P2LA 3VC3A 1DARA 1TK9A 1YS7A 4OGKA 4ZU3A 1SXQA 3EEIA 5FOUA 3HBFA 2GAOA 3I83A 4ZEXA 3Q7TA 1RMYA 2F2TA 3JSXA 3P5SA 4OMCA 1NW7A 2J07A 2HA6A 2UYYA 1K6JA 1TQHA 1H0RA 2EZ4A 2P9EA 3CRNA 3HUFA 3OY2A 2V7WA 2X8WA 4XEUA 4QA9A 3FCAA 1RCTE 4XWYA 5KYVA 4GHWA 4AG5A 1C2YA 1IN4A 1VKRA 2OCPA 3WWEA 4TMFA 5K1ZA 3AXTA 3I6YA 4NY1A 4AS1A 1K97A 1FFWA 1CF4A 2BMDA 1GAJA 2JBAA 2PZGA 3JAWB 2G77B 2H9AA 2VWHA 4I5EA 5EUQB 2JGFA 5JVDB 2QTVA 4GUDA 1BOOA 3NT4A 3ISVA 2C61A 2V6JA 1I2DA 4PAOA 3SQMA 4MWGA 2AJBA 2GXSA 3SX2A 3EUAA 1AO0A 4F04A 3EN0A 4P58A 1WCIB 4PGMA 4GC5A 2P3QA 3MS2A 4OBXA 1GPKA 4KYVA 2VT2A 4G41A 1MC4A 3AVWA 3OIFA 1TYEB 5K7SA 3HLKA 3KKKA 4CMEA 2YIVX 1JB9A 5AW4A 1MJFA 2OT3B 4D5EA 3RGWS 3VU3A 3T94A 1XR3A 3GAZA 3LTEA 4L8WB 2YS6A 5G4KA 2EF1A 1U7PA 3PNMA 2ZS9A 3B9BA 1U1FA 3L6UA 1OFUX 1I4OA 1ZVJA 2X5OA 1PFGA 3OG9A 3PGKA 4IUYA 4O2RA 4AC9A 4YRDA 1DIBA 2C4NA 4H7KA 1G8MA 2CXXA 1FUYB 3PGA1 5KX5F 1N0HA 4S2EA 1YMVA 4R0NA 3AFGA 2EKZA 4M98A 4C0XA 2X23A 4RA6A 3GEGA 3M9XA 4R71A 1PEKE 1R4AA 3NIBA 4H1VA 1ZMOA 4WNIA 2D8MA 2Q9AA 2HC9A 1G291 3B48A 3FTQA 4EVRA 2GM4A 3W2FA 1L7NA 1K4YA 4B3XA 4MKGA 3AKYA 1Y98A 4DJJA 1DIHA 3NBQA 1WMSA 4U2CA 2JFNA 3A2KA 3DBRA 2A4MA 2Q62A 3QENA 3DL2A 4PRLA 2GD6A 3TNDA 3WGHA 5HEKA 4BUZA 3CTMA 1HFJA 4LECA 2XQKA 4RESA 4C2TA 4ZZ3A 5DNDA 1Z37A 3PT5A 4XX0B 4BY9E 4V2UA 1L5NA 4G8CA 5IH3A 4FB5A 2BMWA 3GLGB 2TMKA 3I2JA 5EERA 4C78A 1D4FA 1B2LA 1H9BA 1HK7A 3ADDA 5K51A 1SXJD 1GZSA 3MC1A 1E18A 1KK2A 1W5AA 3GU3A 3AUUA 5EG5A 5KQMA 2AC2A 1X8LA 3W5IA 3K31A 3T1YB 7YASA 4EJ0A 1KZ9A 2P40A 3EEFA 4WECA 2GK3A 3D43A 4KSCA 5BRAA 5K6AC 2DPHA 2I87A 2MHCA 4LJ6A 4CLRA 3UH1A 2A1TS 3AF6A 2G4CA 2JH3A 1DIRA 2NZ8A 4A26A 2VJPA 2PWZA 1CQZA 1Y1TA 2PKRA 2WJVA 2YHBA 1KK3A 3GA0A 3NH9A 2WPDD 4RKRA 4X8HA 1OH7A 9ATCA 2DOKA 3X1ZA 3MJ4A 4OCZA 1YZFA 5KCZA 1QONA 2I3BA 1P2VA 2WWIA 4B8ZA 1Z4KA 3RARA 4M55A 3MCTA 2A86A 2XOKD 1PI3A 2A59A 4G97A 4I8IA 4P92A 1HE8B 4ENPA 4DN6A 2CVFA 2ZVJA 2YJTD 1Q20A 2C42A 3TW4A 2FDXA 3KR0A 1QG2A 1KDOA 5FBKA 3VYUB 4M1QA 3F3KA 4I1YA 4G0ZA 4IDPA 5A9TA 2CXHA 5C46F 3IL2A 4I50F 4YAWA 2HD4A 4R31A 5ALOA 1NJ1A 3UGQA 6CHYA 2AG0A 4HKTA 4FR5A 1T2AA 3VR2A 1P7VA 3JAMA 3IIJA 5UKDA 1ZH2A 4FBLA 5CCEA 4DV3B 4IFBA 4F21A 4MS4A 2Z6QA 2G83A 2VJOA 3EBPA 5GZ6A 2WKWA 4IH9A 3PQDA 4X41A 5HOEA 5SY9A 1ORRA 1RJWA 3NCTA 2W6JD 3FUWA 1Z3IX 4KQCA 4NENA 5C1BA 4RNCA 4NE2A 1WQ3A 3PGJA 4RJLA 4E7PA 1SUDA 3Q0TA 1QP4A 4HOYA 3EK2A 3JWEA 1ZUD1 4YMWA 2VHEA 3STHA 3UIEA 4BLQA 1LTHR 5BNWA 2IS2A 1SCBA 4YP6A 1HL7A 1FFBA 3A1EA 3MSCA 3UMYA 3U6BA 1PR4A 1YDGA 2VDMB 4Q3BA 1N2HA 3F3YA 2WSLA 1WQ1R 3DYVA 3JQGA 4GIBA 4W4TA 3UW1A 1BD3A 2J5QA 4IVQA 3RH0A 3M3PA 2H85A 1G9XA 4MWTA 1NV9A 3VVMA 3E6AA 1X7HA 2VDUE 3A9CA 3PC8C 1EDOA 1SBHA 2Q1TA 5CH3A 4W82A 3TR5A 1TMYA 3UHAA 3TLXA 3IEKA 3G68A 3BGOS 2H1FA 1J1IA 1I5OA 2J7KA 1ZAKA 2FUNB 3LY5A 4ZHQB 4GOOD 4P7KA 4J91A 4HI0E 5DDIP 4EB6A 1EFHA 2P6UA 3CKLA 3E5MA 3IDFA 3JVEA 3CF6R 3HEAA 4R68A 1EIZA 1EVZA 1BYIA 1W48A 2A9JA 3DEKA 4IINA 2PH7A 5DGIA 4GNRA 4IOLA 2VHUA 2B4AA 1RM4A 3DV2A 3NC4A 3DFMA 2MWMA 5DWDA 5CW2A 4ZJYA 3VUFA 3ITDA 2R0QC 4R41A 2DFLA 3EVAA 4WWHA 3ZHCA 5LP6B 4Z4CA 4YUXA 4BO7A 2WTNA 5A2QA 1T3GA 4PWYA 2A0KA 4FBMA 4H4CA 4RY0A 3ON5A 4AW9A 1DV2A 4BKUA 5AKLA 1C3JA 1SXJE 3JALB 1BQ4A 1KZYC 5CDFA 4EUEA 1GXSA 4X3CA 2C7QA 2O0LA 4JXZA 4J90A 4OJNA 4HZUB 4PYRA 1UEJA 3LRXA 3DZDA 1T3LA 2BP7A 4DW8A 1AMOA 5CVTA 3UKJA 1C8KA 1RTTA 4JDPA 1EB8A 1PVOA 3ZHTA 3T1QA 4BDTA 2G72A 2Z3WA 1NFRA 3AVOA 5JQGA 1CR0A 1TF7A 1BHJA 2HXGA 3B3JA 4EKGA 2QXTA 2DQ4A 1N92A 2FA9A 1H6CA 3JD2A 4B31A 4CV0A 2IS6A 1DCMA 1X9HA 1HH4A 2HU8A 1U6JA 4FLFA 2NW6A 2VRBA 3TDMA 5JPDA 1EMDA 3AW8A 3FY4A 2F9FA 1UK6A 5ICMA 5JLAA 4A8TA 4JB3A 3L84A 5D85A 2IUYA 1NQAO 3ZWAA 4NYMR 2ZT8A 5KWVA 4Y9SA 3IO3A 3S7ZA 2P8SA 3AU9A 2P67A 4BFVA 1V9CA 4AN1A 2NU8B 1GTJ1 3T0FA 2P2CA 2UZAA 2YV1A 3ASUA 4NBTA 2C2BA 1JSCA 3NPMA 2G67A 2QX8A 3H1PA 4HFRA 4PONA 4DLVA 3STVA 3ELBA 2C4KA 3I6MA 1BN7A 1E9DA 2JK0A 4H59A 4N3BA 3D3NA 1SIOA 2QSJA 3PJGA 5I4KA 3CG0A 3OWOA 3TVTA 4LQCA 1ZSVA 4Z9BA 5JCOA 3KYDB 2I71A 1ZD5A 3FR7A 2Y92A 4GI7A 4OBEA 1CX9B 5BNIA 1E1QA 3R5TA 4B2YA 3N0WA 1F9AA 1YVDA 1U63A 4OK3A 2PJDA 3B8EA 3DWGA 2G70A 4UBKA 3KZOA 5ALXA 4MYCA 3ZCTA 4MI9A 4ZT6A 5KMGB 4PC1A 1FTYA 3W79A 1M75A 1L5WA 3ANLA 4IFTA 4WESA 4B8YA 5HKKA 5MN4A 3TNJA 3HXQA 1FJXA 1D1PA 1QE3A 4EITA 1IONA 2J3EA 4EGQA 3LBFA 2F1JA 4ZO7A 1R3UA 2QTFA 1XMPA 3H8WA 4JJGA 2XZPA 2E4YA 4N41A 4YUYA 4R1UA 4CMHA 2HIHA 3HR7A 4MUYA 3SE7A 3WGZA 4QLAA 4M21A 1GNRA 4ZCTA 1JEDA 2KWIA 2W42A 3W5DA 2NTVA 2Y0DA 3QI7A 1T5OA 3IT3A 2QENA 3TNLA 5KNDD 3NBUA 3GGSA 3S40A 5B3JC 2Q3DA 1KMQA 3I61A 3DOIA 2JD1A 3O9ZA 4DSTA 1QO0D 5EPEA 2IVZA 3R5KA 3C70A 3I2HA 4AULA 1ZESA 1VPTA 3UV6A 5CFMA 4CKCB 1GD1O 2P9CA 2R1TB 3IMGA 3SIXA 5L53A 5H70A 2C8LA 4G1FA 4KI0A 1Z18A 3D7RA 5K4AA 1JIUA 4C08A 1P9RA 2NU9A 3AY3A 4BZQA 5HJEA 2F8TA 4KR9A 2PRJA 3E7PA 3UAGA 1T13A 4NABA 3K70C 4W5RA 2P3LA 4A2QA 3DFKA 4B73A 4E33A 5HK9A 2KW5A 3EIFA 3PWKA 2YYYA 2XD9A 4BB0A 1GCOA 5DLYA 5FH9A 4G8JA 1WBJB 3CW9A 3WVNA 1EQUA 1XAIA 2ZSIA 3PFFA 5CA0F 4EKIA 3VPCA 1JKJA 2P7IA 2VVTA 3E1GA 3QXCA 2QYOA 3DB1A 4TSFA 2EGUA 3DW1X 4MGEA 1ZUNA 2PSFA 4DSAA 2CVPA 1XQYA 2IYUA 4Y3UA 3IHKA 5J4YA 3MUOA 1OBCA 1PBTA 3V4VB 4HB3A 1QRDA 4M0CA 1JV2B 3KHTA 1CJTC 5BW4A 3BWEA 3IJPA 1XEAA 3G9TA 3QKRB 3V4OA 5KVVA 2GPTA 2XB8A 3TB6A 2O2XA 1NASA 2WTAA 3CEPB 2YXLA 4OXIA 3WAGA 1LF5A 1RSZA 2ETVA 2HU5A 4LNUB 3RSZA 1KYTA 4RKWA 1CCWA 4YK7A 1AG9A 2PA3A 4ZPJA 3A1DA 2X8JB 4DLLA 3F0TA 3DGEC 3NGXA 4L6IA 1OUMA 4FXPA 3SWWA 5JYDA 1TMOA 2QZZA 5HFAA 3O38A 4C2AA 4D2IA 1D7AA 4A10A 2DWOA 3KV3O 2ESRA 4C4YA 3QQ5A 3H2JA 1WZIA 2BELA 2HL6A 4EGJA 5I9NA 4F2WA 2O8EB 1QH8A 5F4BA 1TM3E 4L3WA 1TJNA 1SHUX 4PX9A 2A7XA 4EJFA 2BFNA 2XT0A 2EFDB 3PXXA 4MCHA 2GGSA 1V25A 1TK2A 2P9FA 2N75A 3V8NA 5K4GA 5FNVA 2YASA 3M70A 5KOJA 3IQWA 1V1JA 3QYPA 4R3NA 5BQPA 5HUHA 2SHKA 2RFLA 3NXSA 3OPVA 2Z4RA 2GYVA 4M0UA 4M1KA 4NMWA 4RIFA 1BXRA 1IRIA 2CDCA 1N57A 5A7GA 3PTAA 2P4UA 1QF6A 3HPQA 2HF8A 2OG1A 2VDNB 1MLDA 4QO7A 5H02A 3R3JA 1B6RA 4LJ8A 5FTWA 2OFPA 4UDYX 2C5LA 3NOQA 4D0RA 4URXR 2XH8A 4G65A 4PHTA 1XU9A 4UASA 1S8OA 1N78A 4KXXA 1N9GA 4D6XA 1A9XA 3WG9A 1Y63A 2NYAA 4LWPA 4UZEA 5FCDA 3O4RA 3ZV5A 1T8UA 4F1WA 3E3MA 4F7WA 4RSRA 1U0TA 2Q07A 2NP7A 3AESA 1OHHA 1CDOA 2FHSA 2CJXA 1JJ7A 5FI3A 3Q85A 5E2IA 4S04A 1E1RD 2IDZA 3OJOA 4NX2A 3ZS9A 5K09A 1H0HA 1Z0KA 2P9YA 3OE1A 4A92A 4KDCA 4B3HA 8LDHA 4AKHA 1C30B 1JLKA 2EWVA 5CITA 1T43A 3WRYC 3S7TA 4BN0A 3EFEA 5G3ZA 5LD2B 2IP2A 3X44A 1WXGA 4M0EA 2C7PA 2B21A 3HKEA 1MD9A 2PKWA 1I5RA 1J5XA 1O0SA 2IGBA 5JDCC 2BKXA 1IXZA 4NCNA 4RFLA 2WYVA 1DWQA 5H83A 1RZUA 3FIJA 2GBFA 1SOMA 2BUAA 2J67A 1VG8A 2QE7D 4O4LA 5D6OA 3SHWA 1JFFA 1U9JA 4H3HB 2OBXA 1SBQA 2ZYUX 4YT2A 1ZHOA 1Y1PA 4MVJD 2PYDA 4B87A 3VV2A 4ID3A 2JW5A 1E9VA 5CFQA 4FFBB 4WKCA 1CKEA 3EUFA 5J40A 3FOCA 1HQCA 4IX1A 5E6SB 2P4QA 2B2CA 4NZZA 3P0EA 3P9KA 4GUAA 1JA9A 4W8GA 2Z8YM 1L5SA 1CG6A 4I4TB 2C2XA 2I7TA 2PTHA 2RHDA 2R62A 2NZYA 5AYVA 4AROA 3ZK9A 4UNRA 3LQFA 2V6FA 2FEXA 2HZ7A 1F14A 2BL4A 5KCMA 1G8AA 4RH3A 4HAIA 5BVGA 3N7AA 3EXEA 3PFNA 2H54A 2W2KB 4Y0AA 2O2GA 2FB9A 4K6GA 3EA0A 3F6RA 2DY1A 5KI6A 1PUIA 1P2GA 4X1KB 2IP1A 1YI1A 2Q41A 5LFAA 5SZJA 3PK0A 1DC6A 3AR4A 1O5TA 1ZA1A 3D6VA 2DKOA 3CB2A 4ZOCA 3PL5A 1CJCA 3MGAA 2CSUA 5IANA 4BXOA 2CLFB 4JBHA 4Y9RA 2YBEA 3C48A 2FZVA 4IO0A 3GLTA 5ILGA 4DGQA 2QDKA 3WRXC 2XNHA 4LNAA 2XBMA 4LXXA 3K0AB 4ZO4A 2FK7A 3PUKA 4TGLA 4PE5B 3H13A 1P0IA 1M10A 4N9WA 1LPAB 3PQEA 3WLHA 1IIRA 5D5PA 2CDNA 3NHSA 1YUMA 1EGQA 1AS0A 5BWOA 5TMPA 1FFGA 3N2IA 3LOPA 1IQRA 3N8NA 4TZ6A 1YNSA 3CIOA 3JZAA 4RSHA 4QJ3A 2O2HA 5A7HA 3Q6MA 1C14A 1DOAA 1OWMA 2J4FA 1LLQA 4YRBA 1D1QA 1DUIA 1HV8A 1N5JA 1QC5B 2GILA 1M6HA 1A8QA 1X7GA 3KNZA 5EFZA 5FUVA 3RKUA 4M0KA 4E5VA 4ZZIA 4XQEA 4Y6SA 4GPD1 3IDAA 4KMOA 4KGDA 2I33A 5CX1A 3Q1KA 1QHSA 4D0NA 4BGDA 5GADl 4AP6A 2A92A 2XDWA 4KAAA 3P97A 1EUQA 4H6XA 4L57A 1GAQA 4KQMA 4U02A 3ZHXA 1AKUA 1M1YB 3F5MA 2CLIB 1E7RA 4QXRA 2WPNA 1L5HB 3GBVA 3F9RA 5GOZA 2NU7B 1S3FA 3CZPA 3WK6A 1XQXA 4YTEA 4B45A 1P0PA 3ZWDA 4BVJA 2NUAB 4YUZA 2I3GA 4LF9B 2V54A 2J31A 4HZGA 3PUXA 5CJJA 3EWAA 4YECA 2HI0A 5G0WA 5ADWA 3I23A 3GVIA 1XDDA 2EZTA 1LJLA 2IU3A 2IUFA 4LJ9A 1XKLA 3E2IA 1Z0AA 1RQRA 3T3HA 3RJMA 1BQ3A 3AYZB 2G71A 4DDMA 1I4DD 3L1VA 4QFMA 5G1OA 3DTVB 4NU5A 4OLJA 5IC6A 4DWJA 4TMWA 4IWYA 4N0QA 2IPLA 4MYSA 2CHVA 5BWNA 2CDBA 1L7VC 1SXJA 2D4HA 3G82C 1KY3A 3HACA 3DHYA 1QE5A 1WUJS 3DQPA 2D2XA 4JUBA 4KOAA 4QYSA 4XGNA 1ZXXA 2YJZA 4HNTA 4YVFA 4OHUA 2CXRA 2B78A 5FLKA 2P75A 1SPXA 4DUYB 2QT1A 1S9DA 3AWIA 3A7DA 1Z13A 3A6GA 4NDNE 3TE6A 4BLTA 1U0NA 1VPWA 1M6EX 1XVTA 1TVKA 4X92A 2WAYA 4O1HA 5D5QA 2HW8A 4MOWA 5AJWA 2WPDA 2MR6A 2Z5LA 4DPMA 1UIMA 2B4RO 5M29A 2X19A 4E15A 3THYA 2MYNA 3UXYA 3MTBA 4GMGA 4UEQA 5DM1A 2XOKA 5EQFA 1MB2A 2PQ6A 2C3MA 2QMUA 1E20A 3OCXA 1JXMA 1KAOA 3BE6A 2CXSA 5DXFA 1ENYA 5ENVA 3W5UA 3UJCA 5I4BA 2X6QA 3KVRA 2VUTA 1K63A 2FRDC 5I9SA 3UOGA 5MN5A 2WF6A 1CF9A 2F7SA 2QVCA 2JA1A 4TKLA 1U7ZA 2UUCB 3OZEA 2PDAA 3ER8A 2CJWA 3K1AA 2HMSA 3G0BA 2F9MA 2DTEA 4N40A 5IUKC 2HNKA 1MIOB 4IVRA 4R8LA 4EQ6A 3IDQA 2CKDA 2VT3A 4KXYA 2EGGA 5CFRA 1XYVA 4XRGA 2VPTA 4Q9LA 4U7DA 1JQJC 2XGMA 3FBGA 4QU8A 3JQ9A 3TLCA 5BV0A 2W6JA 4FEYA 2IV3A 3ROEA 2P27A 1A9QA 1PIWA 2XVZA 3NTVA 1R9MA 2AL7A 4PVCA 3RG8A 2W22A 2GYWA 4PZZA 1E6CA 1NJ2A 2IIBA 5J5CA 1NHWA 2W6MA 3PDIA 2EL7A 4N8DA 1OZFA 4WNYA 3VH3A 4ML3A 4LDQA 4DR1B 3G5AA 3M34A 1D6MA 3UGTA 4K46A 4C87A 1FS6A 1IOLA 4I55A 4DT1B 4UHJA 4JYAB 3WTCA 1QJCA 3MJFA 4A5OA 2ZB4A 1NE2A 1VYUA 4MP3A 1YVPA 3KJEA 3B5JA 2VZ9A 4MUEA 1A5SB 4N3GA 1GGJA 2O6HA 3BSYA 5F7JA 5FHQA 5C8YF 3RGGA 1T6XA 4OSPA 1E2JA 4F1JA 1FNCA 2PRKA 4D8VA 1TIKA 1V4VA 3M6XA 5JH7F 2C7OA 1KIFA 2QJWA 3VHRA 4D4JA 3ZWQA 3PPVA 1TCVA 2VEOA 3MQ4A 3P9QA 4QUJA 2PKQP 5TVKA 4DM7A 5JUWA 5JU6A 1F8GA 1X9GA 2JHCA 5EKUA 4RKEA 2FE4A 5IULC 3MEQA 3RFUA 3C1TA 2WIGA 3RV4A 3H8SA 1TCUA 4X1YB 4DCJA 2AZMA 1ZR4A 2YY6A 2HQBA 4EHKA 4LJRA 3BJEA 5BQFA 4ZYVA 4OY3A 4RYDA 1V5EA 3B6KA 4KW7A 2DPMA 3LOUA 1ZOPA 2V7EA 3M6IA 4FYWA 4O8CA 2YFYA 4H1WA 4U39A 2NXNA 1Y7PA 2QE6A 2GF0A 5GM2A 1JYFA 4TMVA 5EXXA 1GLGA 5KWEA 5L3SB 2CGEA 4GYYA 1FRQA 2OV8A 4U2GA 1V4BA 3ESZA 1R8XA 2XT6A 4J0KA 1VCHA 1Z2PX 5A02A 3J80A 4JUIA 3ZVKA 1WV0A 1YRLA 4ITVA 3TTWA 1RXSA 2B3TA 2UYHA 2ZE7A 1AHHA 1RAFA 3SJZA 1G18A 1CR4A 5KQRA 3LRPA 3CNQS 2FEPA 4DUGA 3CRQA 2CLCX 1G1MA 4M0PA 1T2NA 2A6PA 5K3EA 2CL0X 3GEDA 2CBXA 4MV9A 3KKMA 1L5LA 3TSWA 1IH8A 3UKDA 4MPDA 1J56A 1N8TA 3PRYA 4UXJA 2LCQA 3KOYA 3O03A 2OAP1 1BDIA 3FMVA 3D8UA 3QVGB 3OJCA 3VX3A 4R84A 3CX7A 4YO8A 1JJBA 1G4HA 2ILTA 2AUMA 2IHTA 3AIIA 3D0QA 4AZTA 3K5HA 4N82A 1A1VA 3CKKA 2RGNA 1UPCA 3BIXA 1X42A 4GP9A 4N39A 8OHMA 1T15A 4WCVA 5J3JA 2CSXA 4BECA 3AM5A 5HA5A 2QUHA 2X7JA 3CVJA 1VFNA 2KJQA 1XE3A 4TV9B 2BM8A 1Q14A 4M46A 3F1LA 4UPDA 3L7MA 1CY7A 4WPGA 1E5QA 1NFFA 1U9ZA 1OA0A 1YZUA 2K2WA 4HLUC 4OU4A 4R3WA 3SD7A 3U7EB 4EECA 2GLUA 1P1HA 3PDUA 1GRQA 3C3WA 3OO1A 5ALIA 1S89A 1IK6A 1OX4A 1T4CA 4K8OA 4MVYA 4QEDA 4B48A 3T61A 5A5VA 5KYYB 4Q05A 3ISJA 2QGZA 4RGYA 4QXOA 3T7RA 4CKYA 1D2HA 3ZY6A 2JLXA 3FTFA 2BHRA 3HVHA 1G19A 4JQOA 4XIFA 4LISA 2DWUA 4F3YA 1YNOA 2XMPA 3D4OA 4MP6A 2GBCA 3PB3A 3P2OA 1CD5A 3DMNA 3I9V6 3PC2A 2OXTA 4MRNA 3U3OA 4WFIA 3RRJA 2E18A 3SR4A 3V1KA 1NGSA 2Q0QA 4UNQA 3VZSA 2R87A 3U39A 3UJ6A 3DBHB 2PY6A 2ENUA 2PXAA 3I4LA 4PAWA 5BWBA 1CBUA 2LE0A 5H4GA 2E6UX 2OBBA 2Q3BA 1WEHA 2ZSKA 1TEVA 2Y0EA 2C77A 3IQHX 4NAVA 5CR9A 5EIBD 2FX3A 2HH9A 4UBMA 3VO8A 4F56A 5LOVF 4Z4QA 3IEPA 4WZAB 2ZAMA 4I4IA 5KNDA 3HRKA 2VK4A 5I4CA 3I2YX 2FR8C 4R1SA 2IE0A 2O2SA 1XHLA 2X9QA 2VEDA 3BMXA 2DXIA 2H1HA 4FD2A 1C9EA 1EEHA 1QO0A 4HTAA 1Q0RA 5EXDA 4CIXA 3FBTA 5CBPB 4A4DA 5HR5A 4LNHA 1RHRA 1K6XA 3HR8A 3OICA 3ZDYB 1MRZA 3HN2A 2Z6AA 3RBAA 2OD7A 3U3XA 2RKOA 1CZNA 3UMGA 2WWRA 4OXNA 1QGOA 1DV1A 5KTKA 1G41A 1DEXA 1SA0B 2QRKA 4PZUA 1Q11A 4RD2A 4FSHA 4TTSA 1EVQA 1PNVA 5C5IA 5U1PA 3ABQB 3MD9A 1NMYA 4FKBA 3NALA 1KC1A 1PQPA 2RI6A 4EY3A 1FUIA 1UJBA 1N2XA 2VJLA 1W5TA 4CKXA 4M1WA 1UBKS 1F6DA 1RXIA 2BKVA 2XNDA 2H8KA 3FNFA 2HMAA 1YQTA 3HLTA 4QL3A 2JJQA 5B58T 4YCNA 5EUCA 4LZAA 1UJ2A 3UK0A 3IAFA 3CLVA 4UE6A 4LRQA 4XLZA 4TM8A 1EVIA 2QYHA 3FLAA 3QE0A 2V03A 2ZJBA 5ALSA 5JRZA 4PS1A 2HK8A 2MSWA 5AKZA 1J9GA 3C6QA 3EX7C 2IPXA 1IM8A 1PJSA 1WOMA 2EX1A 2X7XA 3B1JA 3G7NA 4GKBA 4HD8A 4NCXA 4XUEA 4Y0VA 3LKBA 4O33A 4YONB 5TEVA 4AO6A 1BXKA 4BE7B 4EF5A 1TUGA 3M49A 1DE0A 2G28A 2JCSA 2RKWA 1U11A 2Y9MB 4HWTA 2IU0A 7MHTA 2QY6A 1C3EA 2QP3A 4OQMA 1MR3F 3C6KA 4G5GA 4LYAA 1U9IC 2A1UB 3NHLA 2CVQA 3WK9A 1ESMA 2FK8A 5E2AA 5KYXB 4GG1A 1O96A 1W49A 2P4SA 4GPIB 3PJRA 1JG2A 2VAWA 1F4LA 3TZQA 1CB7A 5IJWA 4GPEA 4RQUA 1CY8A 2FW6A 2GT1A 7MDHA 1PKXA 2IZ6A 3GP8A 3IIIA 1BCSA 5FI5A 3LO5A 1YUNA 1S02A 1QYDA 1SBCA 5TQJA 2APJA 4TS1A 4XDHA 3U37A 4HGYA 2KLHA 1PQUA 2C07A 2R66A 2YN4A 4GSLA 3KAPA 2ZS8A 1DCKA 1AM4D 5CIWA 4GLOA 1I94B 4BMXA 2R7MA 1E9EA 2AW3A 2LW7A 3CT4A 4GVXA 1U0HC 3HCEA 4D25A 1K7SN 1P73A 1XRSB 2IZ1A 3HU1A 1I51A 4WZ6A 4RULA 2O8FA 3P4YA 4E4TA 4LC0A 4WEQA 1NOKA 3U9SA 3JS5A 4A8JA 3AJRA 4BVAA 4UUQA 4L72A 4C2UA 4Z99A 3I5XA 5IEJA 3GK3A 1Q7RA 4KDRA 1C80A 4BAGA 1UBJS 4X62B 2HQ1A 2JEOA 1T2UA 3GN2A 5EXTA 5ENDA 2RONA 5A4IS 2YV4A 5GONF 1H5NA 4TLDA 1Q7CA 2Y1EA 3IP9A 1RZVA 1P4RA 2FPRA 1MZVA 3NIGB 4HC4A 1AUQA 3SM9A 5TIIA 1V3QE 3LYAA 2R6DA 3CPSA 1C1XB 5CYGA 1E4EB 3WL5A 5IJ9B 2ZDGA 4GGMX 4MVXA 5DWVA 1ZNZA 3OOWA 4TKVA 1G55A 1E1RA 1NUUA 1IUNA 2YWXA 3HB1A 3UA3A 1G7SA 4BEVA 3BH6A 2W4QA 1NXWA 1DNPA 1XC7A 2ZXEA 5ERGB 1XQ9A 3RS8A 1E3MA 2ZIZA 1XVUA 2UKDA 8ATCA 1T4BA 1YMQA 3W0LB 1GHTA 3AVPA 3G9ZA 4NATA 2C78A 3MD0A 3V80A 4NCAA 3AR7A 1BRTA 4LY3A 3CO5A 1GFWA 1J8QA 1ISSA 2AFIE 2GF2A 3ENNA 2QE7A 4UEOA 2WJHA 5AJZA 2YQ5A 4PR3A 3ZWXA 4GRAA 5A6SB 4ESEA 4RK4A 2I80A 2QW0X 4QDTA 1HFWA 2C3PA 2HRQA 1DTSA 3CN7A 3P32A 3L40A 3FR8A 2QRVA 4FQ5A 4JEMA 3ZWYA 1E7SA 4HEA1 1NVXQ 3Q3JB 2AD1A 2D1FA 4B44A 2GCGA 2FUG1 3AP2A 4G25A 3PDJA 4K86A 5CEEA 1VLLA 1NLZA 4C3VA 4KXLA 1ESZA 4XOIA 3HI6A 3NBKA 2GN2A 4TMKA 5FTJA 3HM9A 3DPUA 1LBSA 4MUGA 4N7RA 2ZJZA 1G5TA 1H5QA 3G8AA 3HADA 5E7MA 4NMMA 3U3MA 3EAGA 1LQTA 1NBEA 4FCWA 4PG6A 5CVEA 3OBIA 5KTPA 4LXQA 2BOVA 3KO8A 3HKDA 3RTEA 3F6SA 1NI4B 2FFHA 3U5ZB 3P9NA 4WXRA 3OQOA 4EX7A