3GWGA

Crystal structure of chey of helicobacter pylori
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
b'MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY homolog
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gwgA00
4KRFA 1PHRA 1EAYA 3C3KA 3EULA 3LUJA 2QW1A 3EODA 3KG2A 1BDIA 1FQWA 1KGSA 2PUGA 4YGXB 1L5ZA 3IP7A 2IYNA 1GLGA 3KLNA 4IILA 4Q7EA 2M98A 1DZ3A 3C6QA 4RK4A 5JNSA 1CEYA 3LUKA 4JOQA 5KC8A 2NUBA 3O2QB 3T38A 4N41A 3L49A 3CZCA 4MS3B 1GCAA 4MRMA 4Z99A 2CD7A 5CNMA 1JYFA 1OXKB 5IEBA 3IP9A 3OM0A 3L6UA 1Z26A 2HQBA 3SAJA 2GWRA 1SRRA 1P8AA 1YTUA 3OLWA 4N0PA 5TQ0A 3O75A 3C3MA 2LP4Y 4G97A 4XAQA 4NCBA 1MB3A 3GBPA 5IC5A 2RGYA 1DCMA 2FQXA 2QVGA 4QYMA 2VUHB 2FQWA 3JTEA 4L4UA 2HJ9A 2JVIA 4NV3A 4OG2A 5FBKA 4EYGA 4RK1A 4LE1A 4G0QA 5KQPA 3DLBA 1Z15A 2QVCA 4KREA 5JNUA 1QP4A 1OXBB 1DRJA 3O1HB 3HUUA 5I4CA 4RU1A 4S04A 2N9UA 4Z4HA 1QP7A 1GUDA 2QZJA 1MB0A 2IDMA 2WY2D 3FFWA 3SY8A 3SNKA 1E6MA 3A3KA 1ZAYA 5T3YA 4N76A 5EWJB 1NXWA 3G1WA 1MVOA 3NBMA 3CS3A 2KYRA 3CRNA 2FLWA 5TQJA 2O20A 2FEPA 2A9RA 1ABFA 2PJUA 3P9YA 4FE4A 4W5QA 3OQOA 4RY8A 1M2FA 3LTEA 4MQEB 3CG0A 3H5WA 1DBWA 5EWMB 1GUBA 1YMVA 4RK6A 5CNKA 4RZSA 2DRIA 2JRLA 5BR1A 3OLXA 3BILA 2P4UA 3NHZA 4YLEA 4YO7A 3GL9A 2WMYA 3H5TA 5D2CA 3M6MD 3OMXA 2PE5A 2MYNA 3T6KA 3Q7RA 4MAAA 3HO1A 3E61A 1BDJA 5TQ2A 3OO0A 3S99A 3QX9A 4F11A 4EVSA 1Z2EA 3F6CA 3QEKA 2FN8A 2IPMA 2JVJA 3TD9A 3VNBA 1ABEA 4M88A 4HNRA 4G0ZA 5FWYB 1ZHHA 7ABPA 4O5AA 2NZUG 3QELA 4WXEA 2JB9A 1BDHA 3CKMA 2WJWA 3MF4A 4JASB 4MS4B 2TMYA 1KRXA 3JPYA 1ISSA 1PEAA 4MR8B 4G0XA 4LZLA 5EWLB 3EQ2A 3SG0A 5FWXB 4D6YA 1RXIA 5B3JC 4B09A 4YR7A 3HVRA 3KTOA 1EHCA 4G0MA 1QMPA 2MYUA 2IPAB 1FFGA 1ZN2A 4EUKA 1YK1A 3TB6A 3QLUC 1D4ZA 2CHFA 4MQFA 4O1IA 2R47A 2L17A 3OM1A 4LDZA 1USKA 5DGCA 3MIZA 5T7BA 5KQGA 4YRZA 2GX6A 3H6GA 3CFYA 1JWLA 1UDRA 3JS5A 5TPZD 3QLVC 1AB5A 3RVKA 4KK4A 2VYCA 1RXEA 1NXOA 4W5RA 2LPMA 4OLBA 4XFKA 4RXTA 1H9CA 3GA5A 2FMFA 1EFAA 3IPAA 3HUTA 1D1QA 4CBVA 3A0RB 4EY3A 4UHJA 1E2BA 3OLVA 4F12A 3QEMA 3I5AA 3BREA 1Z13A 2WB4A 3GRCA 3LUGA 1U04A 1DC7A 5TE9A 5HM6A 4KNYA 4KQ9A 3N6VA 1W9HA 5E3JA 5TQ0B 4H3KB 4RKQA 4H3HB 2LIVA 2RJOA 4IRXA 3BRSA 2JK1A 1JFTA 2PKXA 3RQIA 1U0SY 2R25B 4HYEA 4S05A 1BAPA 3HCWA 3DLHA 1YS7A 3K9CA 4G0PA 3GT7A 2Q5CA 4ML3A 3O1JC 5GQSA 4KFCA 2PUEA 1KRWA 2A9OA 5TPWB 3H1EA 1XHFA 4RDCA 2PL1A 2PLNA 3CU5A 2NT3A 1HEYA 4JP1A 5DKFA 3DGFC 3KKEA 2E4YA 3H75A 2PL9A 4TLMB 3N0WA 4PE5B 3URMA 2FMKA 4RSMA 4MR9B 2PUAA 3RVJA 2BGGA 4DQDA 2FEWB 2PUCA 4TN5A 5JNVA 2RJNA 1MIHA 3KSMA 3LKBA 4PEVA 5JNRA 3HEBA 3RVOA 2ZWMA 5F64A 2GI4A 2JBAA 3N53A 4MR7A 5PNTA 4WZZA 1DP4A 3NNNA 1TM2A 4G0YA 3EJWA 4RK5A 2FKAA 3O74A 4KVFA 4XXHA 3CHYA 4OTZA 3OLZA 3LUFA 2A9PA 2XDYA 1LK0A 5IX8A 1LBIA 2QXYA 4XASA 3NNDA 1DCFA 3LMKA 4E7PA 2ID7A 2MSKA 4YV7A 4XLTA 2IPNA 4N0QA 4WXMA 3RVNA 2FQYA 3EQZA 4RK0A 5C5CA 3LUHA 1XHEA 3EGCA 4GPAA 4WT7A 3RVSA 5IUKC 3H5LA 3M9WA 1M5UA 3Q7SA 1SXIA 3EAFA 3H5OA 3H6HA 3MYYA 1K66A 4Z9AA 5DTEA 1DC8A 1P6QA 2QSJA 3RVQA 5BRJA 1YS6A 4ZJPA 4Z4GA 2HQOA 1D5WA 1NXTA 2JVKA 1FFSA 2MSWA 3KYIB 2FMIA 2A9QA 4MS3A 5JNTA 3W9SA 5BRAA 2NT4A 1NXVA 1D2AA 3T95A 4W5NA 1ZH4A 1Z17A 4IF4A 4TMYA 1W25A 4Z4FA 2V0NA 4F3TA 3CZ5A 3FFTA 4HNSA 3F6PA 3H1FA 4RV5A 4QPJC 2R4QA 4Z4CA 4IGAA 4ETMA 1VLZA 1ISRA 1TVMA 1ZVVA 3MA0A 4MQFB 1JLKA 4RY9A 4MLDA 5JS1A 1DBQA 1YK0A 4Q6BA 3CNBA 3RVRA 5IUNC 3EDCA 3DZDA 4F06A 1E6KA 1JFVA 4LE0A 1XWWA 2PAFA 3T8YA 1LJLA 1Z18A 1K68A 3N0XA 1GCGA 2B1JA 4KV7A 4IMJB 2WWVD 3TX6A 3E3MA 3QLTA 1DCKA 4FE7A 3UKJA 2E4ZA 1JYEA 3C3WA 2NZVG 1FSPA 3ILHA 1P2FA 5EWJA 1IIBA 3KYJB 1NXSA 9ABPA 1TJYA 4RK7A 8ABPA 2FMHA 2PUBA 3IPCA 4NICA 1LJUA 1JF8A 4PICA 1M2EA 3H5IA 1EWVA 3LFTA 3HDVA 4MQEA 4RS3A 3LKVA 3IP6A 3CG4A 1A0OA 1Z2DA 4XARA 4KMRA 5EWMA 1A04A 1NATA 3NNSA 1DBPA 1Z16A 3C97A 4WWHA 1J56A 2FEKA 2YHBA 5IEJA 5IUJC 5DLEA 5C5EA 1BVHA 3H1GA 1JHZA 5IULC 4JA2A 5JS2A 1SXHA 1P6UA 2J48A 4EYOA 3HS3A 2WRZA 2FTKE 4MRMB 2JCGA 4ZYLA 2LBPA 2RDMA 4KZKA 2X7XA 4DN6A 1YVUA 5KQLA 2OENG 1JBEA 5KI6A 1QP0A 4MS4A 4RWEA 1A2OA 3D02A 3IDOA 3MM4A 1SXGA 4Z4IA 1NTRA 4MR8A 5EWLA 2GBPA 4MR7B 2B4AA 4W5OA 3ROFA 5FWXA 3FGZA 1DG9A 2PMCA 2MYTA 4HNQA 1ZDMA 1JH9A 1U8TA 3GBVA 4WUTA 3D8UA 5CNIA 3Q41A 2F8TA 4IMIB 4KPYA 4NCAA 4YCSA 2WJAA 3JVIA 4ZMRA 4YS6A 1RZRA 2FVYA 3HDGA 3JY6A 1QQBA 3Q7TA 3A0UA 1FFWA 3HSYA 1QO0A 4EVRA 2OQRA 1E6LA 3LUDA 4LDAA 1CHNA 3BRQA 3HZHA 1RZRD 4MPTA 1EWTA 4Z4EA 3SM9A 1RPJA 3Q15C 4D6XA 1QO0D 2M1ZA 3NHMA 3FFXA 4N47A 1TMYA 3OQMA 3O2SB 3A10A 4MLCA 4QICA 4N03A 1CYEA 4P1ZA 4PYRA 4H60A 3VNAA 2FW0A 4LRQA 4Q6WA 1QPZA 2E4WA 1KMIY 2HSGA 1JX6A 4MS1A 1MAVA 3H5VA 1USGA 2VUIB 1PUXA 4YWHA 4EYKA 3JVDA 4LE2A 1DRKA 2IPLA 3G85A 3MQ4A 2E4VA 2IOYA 1VKRA 2ID9A 2HPHA 3ROTA 1Y1LA 4RKRA 1WETA 5TQ2B 5JNWA 1QNLA 1RNLA 5HKOA 2P9HA 2QR3A 2E4XA 3N0RA 2H3HA 2PUDA 3FDFA 4JB2A 2GKGA 3I42A 2FSPA 1QQAA 3I45A 5TPWA 3R0JA 3QELB 6CHYA 1BA2A 5IBQA 3IP5A 3LUCA 1SD5A 3M9XA 5B3JA 2FN9A 1U2PA 2LUOA 5KC9A 2CWDA 1PEYA 5HSGA 5HQJA 1D1PA 2AYZA 5CHYA 4PZ0A 4MR9A 1ZITA 4KK3A 4OBBA 2YHAA 3OQNA 3OO1A 3HK2A 3CTPA 3F7NA 3QLUA 4E7OA 4EYQA 3FMVA 4RY0A 1DJMA 4Z0NA 3BBLA 5GOTA 4MGEA 1QKKA 1Z12A 2AYXA 3QLVA 5DCLA 4MYRA 1YMUA 2L18A 4RXMA 4JB0A 2HQRA 1R8JA 2H0AA 4GNRA 4F8JA 5CNJA 1M5TA 1NY5A 3QX8A 3MMNA 4EGSA 4W5TA 3GYBA 5KWSA 1B00A 1APBA 1YIOA 4P98A 3OLYA 2QV0A 4QYWA 3B2NA 4LX8A 3N75A 1EWKA 1LBHA 1JDPA 1T34A 3O2JA 4Y9TA 4G86A 3GWGA 3I09A 3RH0A 5KQMA 2MYPA 3QEMB 2L2QA 3KJXA 3KS9A 4G0OA 4L85A 4ZMSA 4D74A 4NQRA 3HXMA 4TLLB 2FXIA 3QK7A 3TMYA 4EVQA 1C0EA 3CLKA 3GV0A 3KLOA 3UUGA 1VRVA 4JAVC 4YP9A 2F8SA 3KHTA 2QU7A 3HJFA 5BQ3A 4ETNA 5ED4A 2PUFA 1Z25A 1ZESA 3RVMA 3RVLA 3DBIA 5ABPA 3DGEC 1JL3A 1TLFA 3KCNA 4UHKA 3F73A 1USIA 1AB6A 4Z9BA 2MSLA 5TPZA 1L5YA 1ZGZA 1S8NA 3HM9A 1PNRA 3LOPA 2FLKA 2L19A 2VK2A 5FWYA 3LUAA 4ETIA 1I3CA 1F51E 3ILYA 4OATA 2I6FA 3O21A 4RXUA 1JDNA 3O1IC 6ABPA 3HV2A 3TO5A 2IKSA 3K4HA 2ZAYA 4O1HA 2JBAB 4ZPJA 1U2QA 1C4WA 4FB4A 2E4UA 1ZH2A 1NXXA 2CHEA 3JPWA 1VPWA 3OMWA 4KQCA 3Q9SA 4MS1B 2R48A 2W42A 1PNTA 1F4VA 1JFSA 3SQNA 3UK0A 3N8IA 5FBHA 4DADA 1URPA 3RVPA 1NXPA 1ZY2A 1ZGGA 4OLAA
chains in the Genus database with same CATH superfamily
2B9EA 1GA4A 3F6RA 2PZFA 5I9TA 1SXJA 2QNRA 3B9RA 3S1SA 5DI3B 2VDMB 4QRDA 4N5IX 2OLJA 4YGXB 3U4QA 1NW4A 3N2IA 5K8IA 1M67A 1R6TA 1KYQA 2HU5A 3BB3A 5E0OA 3OQ1A 1BE0A 5ARDA 1MFPA 3RK0A 3U9LA 3SZGA 4RZUA 3NQ41 3OQJA 4LXUA 1YQUA 1ISFA 2OSBA 5TXGA 5LWHA 3LX8A 1BXKA 1BDMA 1QX3A 2Y1XA 4JGIA 2GYUA 4LRYA 4TXLA 1QONA 1VDMA 3OHMA 3P2KA 4L5YA 4GZ6A 5KO2A 2WJ6A 3IP9A 2P1DA 1D4FA 2FFQA 4RABA 2HQBA 1A8UA 3UMRA 4CETA 4M8NE 4RYDA 4OB6A 1UK7A 4JXKA 2LP4Y 2PUTA 1AA9A 1QPBA 3PT5A 4ARUA 4XAQA 1Q11A 4J3NA 4Q5IA 1Q14A 3IOMA 2MT9A 4OH1A 1BXZA 3PKIA 5IC5A 3UUEA 1N34B 3CQ9A 4H08A 3OLCX 3NHFA 3LDUA 4FWTA 2WUDA 4IDDA 4GBMA 3KJNA 3JTEA 3VC7A 2JJ1A 4EYGA 1TKAA 4RVHA 3GBSA 2RGNC 2W6QA 5H16A 5M2QA 4L02A 1UIMA 4MKXA 5BPHA 3PRYA 3QKSA 2O3SA 1X15A 4RVFA 5F5NA 4A0HA 2VPQA 4RD0A 1Y1KE 4QFCA 1O6FA 4KXNA 1CQWA 1F38A 5IN5A 3TX2A 4BJHB 3KAQA 1L7MA 3SQXA 1P9LA 4Z4HA 4C0HA 2HIHA 3LHDA 4RPHA 5C7OO 3EFBA 3V3KA 5ICMA 5BUSA 4UU0A 2K4MA 3IJ5A 3M3DA 3SNKA 5H7XA 1A9ZA 4JIGA 4YK7A 2VYQA 4LC9A 2ZB7A 1ZM9A 5EKDA 4DCCA 2JHGA 5EQFA 1T9ZA 3U4DA 1QYXA 2Z3ZA 4X9XA 3PSAA 5KVQA 1GAEO 4NJOA 3H2IA 2F17A 2RH5A 3GW8A 1BU8A 4EAAA 1XZAA 1VL1A 4FE4A 4RIIA 3FTNA 4V0ME 5EP3A 3V1LA 5LMZA 4GL2A 1FVXA 1SCDA 3PZBA 4JXXA 2C03A 1QG0A 4I5DA 3U7JA 4CN9A 5HUQA 3J81k 5F98A 4CTNA 5EWMB 1LBEA 1FRVA 5FFNA 2R60A 3W6UA 2ZZMA 1IJBA 3ZZ1A 4B2YA 5KJ6A 4PG4A 3OE7D 4XCXA 4ZZ1A 3GT0A 1A77A 2P4UA 2C04A 3KLMX 4NPAA 5CLHA 3NHUA 1LDMA 2IYSA 2WMYA 4YO7A 3TCXB 3ZD7A 1HYHA 1YQTA 5DRTA 3OMXA 1FFAA 2C9BA 4HAZA 3A3YA 2AVNA 3E61A 1MTZA 1A2KC 3AILA 3EEBA 3OH8A 3PFWO 5TQ2A 4BJ1A 1AMNA 3KNZA 1WWKA 3OKAA 2VDRB 2IOQA 1OXVA 3IQFA 4Y2YA 3KB6A 2GZDA 2FZGA 3C6KA 5TNXA 3WICA 1ZHHA 4N4AA 5C7IO 2CVFA 7ABPA 1JYSA 3AM4A 5AP9A 1B73A 1Z08A 3QNUA 3CKMA 5B1DA 3TUJC 1QHHA 1BDHA 1E64A 1T43A 1BHQ1 3MD0A 4EY7A 4XGNA 1IRXA 1TX4B 4J76A 4F1KA 1M1ZA 3R6WA 1GO2A 3BTOA 4IINA 3GDFA 2XE4A 3V7WA 3VPDA 2QP9X 2HNBA 2J3JA 3DOOA 2ZSIA 4AN0A 2GF0A 2PRSA 3JR3A 3KTOA 1JKFA 1QG2A 1YKSA 2C9ZA 2ONKA 2X86A 3AC0A 3DT8A 3LXRA 3Q5GA 2XRMA 1IOZA 4LXXA 1H0RA 4ACAA 4D9IA 2O8BB 3TLXA 1NLUA 4CZ2A 1XD2A 3DB2A 3QVOA 4X0EA 2PPLA 4YRKA 1O6BA 2R47A 2R7NA 3TI7A 4A8HA 4K5QA 2WP0A 5TS3A 5BT8A 1MO4A 3PFGA 1JILA 4DANA 1LLUA 4E33A 4FKZA 1JWLA 2ZSHA 3GOHA 1E2FA 5IJAA 5B3KA 1GLVA 2JA2A 1H6CA 4Q4AB 2H29A 3N3AC 3UKDA 3D4PA 1RHMA 1C0PA 4X1OA 2WF9A 4CE6A 2AMFA 4JMPA 1X7XB 3N76A 2LPMA 2IIPA 2BPOA 2CLKB 1QH9A 4S24A 2IV2X 1GTJ1 4D4JA 3R7AA 1RYEA 2C9MA 4HMOA 1KGDA 1SCIA 3HUEA 1E3JA 2NUTB 3LGXA 4HLNA 4B71A 5JANA 1O95C 5EKTA 1X1TA 1TB4A 1Z5GA 1NUHA 1X80B 4CMEC 1C29B 2QM8A 3LL4A 3DDZX 1KEKA 4RZQA 3V33A 3G2PA 5IK2D 5D87A 2A30A 3A1EA 4XEUA 2VTBA 4BASA 5IVKA 4L27A 2EL7A 3TTXA 1I4OA 2AF4C 3PNOA 4Q9KA 3L8HA 2WIAA 1KARA 1QV6A 1ZGCA 2X5NA 4E5DA 1ZL0A 4XWTA 2BGTA 2ZYGA 1OWMA 2ECFA 1SBHA 2ZDGA 3IUNA 2WBLC 3MJEA 3UJ6A 4AVYA 4YLYA 4DKJA 3BE8A 1H1TA 2R8OA 3CINA 3QJ5A 1TQ2A 3ZDBA 4IRUB 1J1IA 1XTZA 3TYXA 1UZLA 3K15A 3SXJA 3TXYA 1EFPB 1Q2UA 4LYDA 4S2EA 2QT1A 1NMEA 2D59A 3FZNA 3QH4A 4M76B 4PE5B 5KYWA 3L3BA 3KR2A 1GHTA 2IJGX 2I8AA 4PAOA 1F9EA 1TZCA 4DLZA 4D9NA 2HCRA 3THSA 1MIHA 1MX9A 1DWQA 1NA5A 1TOAA 1XCGB 2GMWA 2HJRA 3STTA 4EGQA 3L1IA 1K0FA 2ZWMA 1D7OA 5A03A 3N53A 3L8MA 1HDXA 1TPYA 3C3JA 1PLJA 3R9XB 3K0AA 4ZMBA 4BO5A 2C2KA 3BWMA 5EIHA 2IZZA 3DXYA 4LDQA 1KA9H 1XZBA 2Q0SA 4QUAA 3LZDA 5T41A 4CKYA 4DLAA 2X0NA 2ZSDA 1DRUA 4JI3B 3BICA 4TZ6A 4GECA 4IFTA 2ID7A 5FTMA 2CMKA 3WRYA 2N42A 1Q0RA 2W70A 2I4MA 4COOA 5CB0A 1AK9A 3VC2A 2PRJA 4E32A 5C8YA 1IN4A 5K3AA 3H5LA 1FP7A 2PXCA 2V4MA 1M5UA 2H57A 4NK5A 3LCVB 4XDHA 4DLWA 5A6VA 2MSEB 1K66A 1D0VA 1V37A 2DWQA 2QXTA 3FPJA 4EHNA 5B6IA 3HJHA 2V0GA 2A5JA 2DHRA 3L7KA 1UKVY 3AR9A 1IQPA 2O8FB 2H8KA 2YRFA 4Y0AA 4CM6A 1OWLA 4HQLA 4BO2A 4YMGA 5MF6A 3W90A 2PVCA 4XB1A 4FYHA 2X76A 5AH0A 3R5TA 3VYSB 2QNBA 3EWSA 2WAOA 5E38A 2BH2A 3MTJA 1HNWB 3KDSE 4JLUA 1O54A 2A1UA 1RLOA 4JXJA 4DWOA 5JXGA 2GEVA 2ZRLA 3R5HA 1U9JA 4M1EA 1PD1A 5HQ3A 5JAHA 3ITEA 3I0NA 2OBXA 2X1HA 3N2ZB 4RELA 5KINB 1ORWA 1ESEA 2BMWA 1TZ2A 2CXXA 2GGSA 4JJFA 4Q4LA 5I7UA 2XOKA 4I4IA 1U5CA 2AN9A 4YCBA 4TS3A 3ONFA 3QXCA 3G0HA 3BHJA 4MWEA 3EGEA 3AR2A 1BEEA 4TWIA 3TZBA 1DAHA 5CPBA 1IAVA 4TT3A 1XZJA 2OCIA 1SCNE 4UUNA 1PGNA 3R44A 5FYQA 1XWWA 2IEBA 1M74A 2DUMA 4WKCA 3JVEA 1BX3A 3U6BA 5CR9A 1DJQA 3GLGA 3KCQA 5KSPA 1M1XB 1B4DA 3BL6A 3QJYA 4ZOBA 2QJOA 4BFLA 1YV9A 1B76A 4TVSA 2A5FA 3SEZA 3LC1O 2R7MA 3NHKA 2DQYA 2V5AA 2QTBA 4JZKA 1BW9A 3URKA 4G26A 3NYIA 4FNOA 1U0RA 1TJYA 2FMHA 3IPCA 3HKEA 2M6SA 4JX8A 3IV7A 3PNMA 3QE0A 4JBHA 3HFSA 4OHXA 4TPKA 1UBEA 5AHKA 5G1OA 5BN4B 2P6OA 2BM0A 3I34X 3IIEA 4O4IA 1XTVA 5K3CA 3VUFA 4B6RA 5A9SA 2E1RA 1X1BA 4Q9LA 3ADDA 3LX4A 3V8VA 1XJQA 2WYVA 1KYZA 5IPFA 4LJ4A 4M60A 1GPH1 2HA3A 2I6GA 4INAA 1RR6A 4ZAGA 1BVHA 2UZ0A 4DMHA 2CKMA 4WVFA 3KQLA 3HJNA 1R6DA 1KJJA 3CURA 3JWGA 4BL5A 5KPJA 2W8BB 1SXHA 3HB5X 3RTBA 3TRHA 3DV9A 1CB0A 1GP2A 1IDOA 2W48A 2CVPA 3GB9A 3I72A 1KSHA 1JTFA 3FROA 2OXTA 4PX2A 4B3CA 2XMQA 3ZXUB 3VR4D 2VYFA 3O4FA 4QIHA 1Z4LA 4KOAA 2P1ZA 1AQJA 3SYKA 1NL3A 3L7LA 1E2DA 3OJFA 3C41J 1EGQA 2PZGA 5LZ4A 4I6GA 2WZCA 5CD9A 3PJGA 3ROMA 3D02A 3L79A 2FH5B 5B7NA 3IULA 5JCOC 2YCBA 1IVSA 4MV3A 3KX2A 1ZM7A 1B3BA 3L7IA 3ZLBA 2WPNA 3Q7QA 1VJ5A 4YQZA 4EQ6B 2NSYA 1XK6A 2GCEA 2X8AA 2B4KA 3K6KA 3MMSA 3DOUA 3D54D 5EG5A 3EIWA 2OHOA 4DR5B 2GTHA 5JXJA 4LJ8A 2R7KA 4QVIA 4PTZA 4CG1A 3L1HA 1K8QA 2VZLA 4YS6A 2ZUEA 4AQDA 4KXLA 3F8SA 1RJEA 5AVZA 3PGMA 2PVSA 4R9RA 4O4JB 1QHFA 2QYTA 2ZUUA 1YRBA 1E1NA 1BO6A 4LJ6A 2VJAA 1JIUA 4HDCA 1XZFA 1R5JA 4LDAA 4LQ4A 4B83A 4B4VA 2ZWVA 1NMYA 3TIGA 5JTTA 3OC0A 3GVXA 4HGRA 2FPIB 3FCXA 4F56A 3R5JA 1Y3FE 4RTKA 2O52A 4EA9A 3NAGA 2YHUA 1NN1A 1U5BB 2I4TA 3R3SA 4JKOA 1PZFA 5ALTA 4AROA 1JQBA 2R00C 3NHMA 5EPUA 3A10A 4FB5A 3MT7A 4EG5A 4F1WA 1TM4E 3QRWA 4G5GA 3C3XA 4U3JA 5AVJA 1IBSA 3KEFA 5CITA 2YOHA 2ESRA 2GZ2A 1V2GA 1SZPA 4EYKA 2JRCA 1E4VA 1J24A 4IS3A 1EP3B 4AKTA 4OSEA 1MJGA 2Q7XA 2ZTHA 4JL5A 3DKPA 4KITB 2R8ZA 3ZJTA 3SVLA 5D8DA 4RDXA 4PQFA 2FVXA 3VPGA 3JQDA 2WFAA 5HKBA 3ETNA 3UXYA 2QQGA 5HZGA 1X7YB 3DZCA 3MJTA 3ZE1B 2FLVA 3GROA 1QNLA 1GGFA 3TLGA 3ELBA 4FFOA 4TMXA 2P9HA 2ZR8A 3PCXA 3PL1A 1HBJA 3SFVA 2FWIA 4ZVVA 2P2YA 3I42A 3NEAA 2DHEA 3NG1A 3OQHA 3R7DA 3ZWMA 1OH6A 3NGMA 1DUSA 3PX7A 4IIXA 1QZTA 1J1ZA 1QYDA 1WCWA 4U6QA 2I3AA 2WYIA 1DJLA 1SD5A 2CLLB 3Q7PA 2J6CA 1C9EA 2ZE8A 2HWYA 3QUBA 1QCCA 1IQRA 2O2SA 2OG1A 5A5EA 1T2CA 1ZJJA 2YRXA 3IP8A 1DFHA 4QUHA 4OBBA 5EZYF 4M1OA 3IH5A 1NXQA 5EIBD 4LGYA 4AECA 2NOAA 4E11A 1C4KA 4F60A 3SF8A 2BF4A 4H4DA 4PAQA 3ZU3A 2UXCB 1J20A 3EISA 3EF3A 3NHPA 2MCFA 4F96A 1Q1NA 3GGSA 4FU0A 1SD1A 1T8YA 4G5RA 4WGGA 5CP8A 5FOVA 3UMSA 1V4NA 3WHIA 3PUIA 1Q3KA 3WLRA 4HVTA 3B6JA 4ZOEA 1H6DA 1T3GA 2P9TA 2R87A 3L5OA 2ZWAA 4XIGS 1B00A 1YDFA 1KI6A 2CK3D 3V42A 3OLYA 2BKAA 5C1OA 2IOHA 1VLVA 2VK4A 1D04A 4CM3A 2I65A 1KAHA 1GTSA 5L7WA 1LX7A 3H3JA 1MD9A 1QHYA 3IC5A 2I1VB 4LOHA 2MR5A 3UGKA 1XZCA 3IEVA 2ANBA 4RWZA 1GQOA 1NP7A 3O4IA 3QXXA 4KRGA 4JEHA 4BFYA 3E3OA 3SXUA 3SKYA 4N12A 4IIHA 1K06A 2Y3IA 3ZK8A 1CEQA 1XXHB 5C5IA 2HYIC 1BD3A 4NNPA 5MN5A 1IUOA 4FT2A 1ZAKA 1VRVA 3PR2B 1S8AA 1THTA 4NZMA 5EERA 2D1RA 5E6RA 1NBME 3OEHA 3UA4A 3MB8A 4MW1A 1C0LA 3BMOB 1GUAA 2JIOA 3AETA 4G5OA 3T06B 3PR1A 4LHWA 3UMCA 2CSXA 3RTEA 3DHNA 4AJOA 4HRVA 3NDJA 5GMOA 4BV2A 5JAOA 4E5YA 2WWRA 1V2HE 2YV3A 3U4MA 2IC5A 3QFSA 5JZ9A 2G1PA 1P17A 4MZDA 5DGHA 3NC0C 2GDJA 1L5YA 2PL3A 3R1IA 5TPZA 2FX3A 4LBZA 4M1YA 1KMHA 4GYKA 3ROZA 1W5FA 5IJ0B 1Y6ZA 1KDOA 1Y3IA 2NXEA 2FX5A 4QYXA 4E13A 1KU6A 1PHPA 1PRYA 4Z7OB 1NDHA 1F51E 2X14A 3WXMA 4DY6A 2EDAA 4UD6A 5JDCC 4NI5A 4XH9B 3EARA 3PTAA 2VF2A 1XZ8A 5LQUA 4IQ8A 2NIPA 1I7SB 4DG5A 2EFDB 4CIBA 1JLRA 1PV4A 3OCWA 3NIBA 4H7FA 4XOIA 3KR1A 2XGGA 4NVRA 2X9NA 3T1OA 2A5YB 1MV5A 2F9FA 1G6OA 3PVSA 5JSKA 1QFYA 1WABA 4M98A 1YR2A 1BEZA 1DAIA 1PEDA 1XYYA 1Z0SA 2GN0A 5HIAA 5JXIA 3QX3A 1JQKA 3ASUA 2I1WA 1VBMA 2W6OA 3DWIA 3OAAD 1C9MA 1AKUA 3C5WP 3HJGA 3UBMA 4CMGA 3WV4A 1OR8A 1JWAB 5B57C 1TZKA 3L8DA 3EULA 3HRHA 3HJRA 1YJQA 1NOKA 3DEJA 1QGUA 3ZVLA 3D9QX 3EIEA 4WN9B 4K6MA 2JARA 1WP9A 4NMMA 4GR5A 2P91A 4MROA 5FBWB 4JU9A 4KIGA 4ZCTA 2F8LA 4TSFD 1Y9DA 2X1MA 1R27A 4O2AB 1R4NB 1WZNA 4CQMA 5FLXA 3B48A 4L16A 3UAWA 1JKMA 3OPYA 2JDID 4LY3A 3ZEIA 3FTQA 4AWAA 1NNUA 4D0GA 1P1RA 3TKLA 5G3ZA 2ZS8A 3SAJA 3VSAA 3E27A 1JPUA 4ZHQA 2OORC 1DE0A 1Z0ZA 1ZN7A 4EB0A 5TQ0A 4DCVA 1AQ6A 5JD6A 1YTUA 1VJ0A 3CT6A 4RHXA 1U8FO 3HYSA 2OK8A 4W6ZA 5KNDA 2VAVA 3LY8A 2W0MA 1Y3HA 3EUWA 3JV7A 4Y98A 4CUJA 4FCTA 1M76A 2F9MA 1L4NA 1X0VA 3NT2A 2PX4A 4L4UA 1V43A 2D3TA 5K7SA 4U0KA 4IIUA 1C4OA 1OC4A 3QVWA 3CLSC 1Y33E 4Q01A 4RTRA 1VKNA 1OX6A 3HN7A 4MKRA 3ROEA 1N32B 3OCYA 3ZWBA 5CDYA 1N78A 1QF7A 1QFXA 1FDIA 1MIOB 1NW3A 1O9BA 4KZPA 1DG3A 4HWOA 3A3KA 4LCBA 4HDRA 1RTTA 3FRJA 4WCFB 3U7EB 5JSUA 1U3DA 2WD7A 4AJEA 2HV9A 2BM8A 2VPPA 3B6IA 2RBKA 2YICA 3LS2A 4KGVA 1DXHA 3THWB 1BGXT 2JGDA 3UENA 5TQJA 1FVHA 1ZU4A 4AYTA 2V55B 2ZTVA 3H1BA 4YJDA 5JFTA 3DL2A 1CY4A 1CNFA 1ZUNB 5CXQA 4CXMA 1M1UA 2EAUA 4NBSA 1JQLB 3FSRA 3JD2A 4LZLA 2P4SA 4Q03A 4HUJA 3IPLA 5E7MA 1SA0A 2GN8A 2VWGA 4PR0A 1OGJA 3WXBA 4CU5A 2GNPA 3ONWA 4FMDF 4LNUB 5H81A 2FRDA 1KDTA 5HM6A 3RADC 4J7AA 2BI4A 5AKYA 1ZSNA 2GYYA 3MTAA 2Q1SA 3GQBA 4C0JA 2WK1A 3EAGA 1G8PA 4PN7A 1X7DA 2CFSA 2UUPA 4I5EA 3UWSA 3PFFA 1AK2A 3PDIB 4PZLA 2PU7A 1RFGE 1P4GA 3F9RA 3USZA 4NBWA 4HCJA 1G98A 3WS7A 5FBQB 3UXEA 2VHCA 1RAAA 3GJ6A 2FPSA 1RC0A 1T6YA 4IW3B 4QQKA 5DNWA 2WJWA 5E1OA 4FJ2A 1XYGA 4G4SP 4B44A 1IY0A 2EG9A 1FTQA 3MCWA 2H08A 2VCEA 3X1XA 1B2RA 4MR8B 1K97A 4YJ2B 1F2TA 2XNSA 2D1FA 2NO5A 3KWLA 4IV8A 2IU0A 2R1TA 1CU1A 2JH9A 4ZOQI 5FWXB 5LJLA 4OQFA 4G1BA 3VHXA 1ZI6A 2QBYB 5HCNA 3FYUA 4EF4A 5IJ0A 1EHCA 3VBCA 2H1RA 3BMNA 4NCNA 4A2CA 4DYHA 4LF4B 4YONB 4D80A 1X3SA 1UBMS 1NJ2A 3O95A 3EFEA 3M33A 5J59A 4ZOAA 1I5EA 3FDIA 4FINA 3TTVA 4BCDA 5GIOE 3HL0A 1UK8A 4IDFA 4UNRA 1C3EA 1GLNA 1NY6A 3NZEA 4QJ3A 3A4YA 2PUWA 5T5QA 3ZD9A 3N6XA 4D44A 1LJ8A 2JGEA 3QLVC 4Y6LA 3KQKA 1JDBB 1TYAE 4K9MA 3IVXA 1C8BA 1CRLA 2I4IA 1XA0A 2GAJA 1Y1PA 5AI0A 4ZZ2A 3U3RA 1FEZA 4R1MA 1XK7A 2WP8J 4MQUA 5AYVA 1EH5A 1F4LA 3DHVA 3R23A 3RRNA 4IYJA 4FC6A 3BXZA 5AM5A 3HUTA 3JRWA 1KI4A 1IG3A 3ONDA 1XKQA 3QEMA 1Z13A 3CV3A 1Z37A 1MEEA 1NVWQ 2C3OA 4I4LA 4WJZA 3RW9A 3BWEA 3ZDXB 1LDYA 4IDQA 2G1AA 5EJ7A 1QS0A 2OLKA 4OB7A 4X3PA 2HK9A 3I9JA 5A71A 5L3QA 4X7PA 5AW2A 2V59A 1QB8A 1TEVA 1Q84A 4WN3A 2ARKA 3DYIA 5B6PA 5C8XA 2E9SA 2PYDA 4WINA 3NCTA 3RSZA 2NVOA 1N9GA 1N5RA 1XCBA 2RGNA 1JMKC 1M1YE 3JQAB 3D5EA 4LOAA 3TD6A 1E59A 1ZK2A 4AMGA 3N2EA 1OFVA 1IMOA 2G04A 2JI8A 4LMPA 3TEJA 1KRWA 3MWDA 2WSYB 4GSYA 4JX9A 1XHFA 2EW8A 4QKQA 4NENA 5H02A 2EFYA 4BRZA 5G40A 1V41E 4WPGA 2NYUA 1YE8A 3TBHA 3VSBA 2VSYA 3B1VA 2E18A 2XQJA 4IHAA 1P4AA 2IEAA 1Y8CA 1KDRA 3A6KA 3WAKA 1WCXA 2PUCA 4EO4A 2NYAA 3DW3X 1DJPA 1GEGA 4RAQA 4XQCA 2NV6A 3HR7A 1U8EA 4YAIA 4WOKA 2JLVA 3PC6A 1DKUA 4JT4A 1N75A 3D59A 5KNBA 1Z6ZA 3ODGA 3HA5A 2H0RA 3O7WA 4PPGA 4D5EA 2FA9A 2JGMA 1PJBA 2NM0A 4ER7A 4V39A 3W34A 3T34A 4GL4A 5FTKA 3JW8A 3BDAA 3M1IA 4PBRA 5E2IA 4DC1A 2GO7A 1C1DB 1MABA 4FEAA 1KI8A 4KI0A 4MSUA 3IMCA 3DTVB 4MRSA 4QOGA 4Y2JA 3T7EA 4B2PA 4HSGA 2JJMA 3I64A 4PIVA 5H1YA 5A3RA 4YMIA 5GGYA 3FUWA 3QEAZ 4WXPA 3O4VA 4ZALA 3LC2O 1AGNA 4IUBS 2V45A 4U39A 3LL7A 2BD0A 1X7HA 3N6RA 2IODA 3MC1A 4HZUA 4J0CA 1D0IA 3ZHSA 2ORIA 5DTEA 5HUJA 1C80A 1IULA 1Z3CA 4LQLA 3RC9A 3QF4B 2BHLA 3FZGA 1VIYA 1P6QA 2G72A 2PZJA 4RQTA 3SR3A 1CRPA 1U2DC 2XTMA 4TUYB 4F2DA 3OBIA 5IJZA 4EF5A 4GE0A 1FLAA 2EDCA 5G0SA 4DMFA 1US8B 1ESZA 3MB5A 1KAGA 4IJQA 5BRAA 2Q07A 5A0FA 5AQ1A 4L08A 2Q4EA 4B3GA 1FS6A 2R66A 2V7UA 3CUEF 1DAMA 2AW3A 2Y1GA 3E5NA 2P8SA 2FE4A 3K6RA 5FL7D 1EE9A 2C3PA 2HREA 2VZ8A 5DP2A 1TECE 4IGAA 3MTBA 3TSWA 1K7XB 1JLKA 3GEEA 4MP8A 2ZJ1A 3ED1A 3TEFA 4CKBB 1IBCA 1WOMA 2HWKA 1N0HA 4MB6A 2WV7A 1NULA 5DTIA 4H17A 1OFGA 1H2WA 1E9FA 1OWPA 3CUYA 3FIJA 3T8YA 4BC0A 3PENA 2W37A 4YRNA 2OD9A 5A4DA 3QNWA 5LU8A 2OP0A 1TVKB 1YJXA 3BCHA 2O2ZA 4L0DA 5I9MA 3TX6A 4AF8A 2Z58A 3L6RA 3QLTA 4M99A 3C7DB 4K9QA 4OK6A 3UJCA 1FFCA 2X0JA 1QP8A 1C30B 1O95A 3OOHA 3QTBA 3D64A 2RHDA 4CMEA 1E3EA 3IERA 1NXSA 4DRYA 4J0HA 4RK7A 3GPBA 4KWTA 2GM5A 2JLXA 1K8YB 4YPVA 1DO8A 3CXRA 5J2UB 6NULA 2GASA 2FOIA 2PKRA 3ESBA 5LOVA 3H5IA 3OPXA 2WZDA 3NAQA 1U2TA 4IAOA 4JA0A 1GSAA 4DAEA 2R751 1P2TA 2ODBA 4TMWA 3SDZA 3SNHA 4UOEA 5EJ4A 1DEOA 4TRMA 3LU1A 2LV8A 1M8KA 4K9DA 3QLEA 2NUPA 4GGOA 5ALIA 3H1PA 4RCYA 4ZQEA 5FA6A 3ZEAA 1J56A 3NP7A 2ZBDA 4MULA 3FZQA 5FBVB 2YJZA 4Q4HB 4AXXA 4KFSA 2AD1A 1T1SA 2HLDD 1X7GA 4LF9B 1B8PA 4KLAA 1K8ZB 1IY9A 1M7HA 2B7LA 5DX8A 1ZCAA 4CMBA 1XDZA 1HYQA 2SBTA 4QXRA 4G65A 4A16A 3CMCO 3SEQA 1Y4AE 5I3CA 2FWPA 1G66A 2QROA 1YOBA 3U1BA 1TK3A 3S81A 1EBBA 4OPMA 5AK4A 4B3BA 1A7AA 1Y4SA 3OQPA 2I87A 2PX6A 1KHTA 3A1TA 1ZX1A 4LOIA 4Y9RA 2HRCA 4NL4H 3GC6A 1QGAA 1R37A 2D4HA 1SVUA 4BQRA 5CTAA 1JDZA 4XDYA 4W5OA 2HMVA 2JHCA 4S2UA 3ONEA 1DG9A 3OESA 1GVNB 2FB9A 4GUDA 1DINA 4DA8A 2W2LA 2LTAA 2XZTA 3CR3C 4UKDA 3WWCA 3GR6A 3UWKA 5BUQA 2DU8A 3PHBE 4ODIA 3Q2OA 3PJRA 3SDBA 1VG0B 5C35A 3DZKA 3JZIA 2GFIA 5ECYA 3GMIA 4EJSA 1O94D 1RACA 1YC2A 2X5OA 2XXBA 4AJLA 5ITSA 4HB3A 2SECE 2XT0A 1XDSA 2YN2A 3OHSX 4DEYA 1FFWA 4KPEC 4PZUA 4FGSA 4YUYA 4DSOA 2XF2A 2ZBQA 2IXBA 3LUDA 4O4JF 4KKXB 5B5SA 3PF9A 5J4KA 3FFBA 4MPTA 1IPHA 4NEQA 4YQYA 2BSXA 1DRWA 4UHFA 2ZAOA 1ISMA 3KALA 1G19A 4BX8A 5J3JA 3WMFA 3RWOA 4TZTA 4DEVA 1OPXA 2RK6A 3LWZA 3EHEA 1JDUA 4D9HA 3TL6A 2IY7A 1IBRA 2B4QA 2E4AA 4HGQA 3QKUA 1XU7A 1I80A 1YDGA 4L76A 4MGKR 3M6XA 3SHFA 3AVTA 2FP4A 2JFBA 2H5IA 3H5VA 1K5GA 3I5YA 1I0LA 1C3VA 4CMAA 4LDPA 1V6CA 3TAHA 1A4RA 3BG5A 4XTRA 1GNRA 3HJCA 5LBIA 5CA1B 4L5CA 1YB6A 2Q4RA 1W46A 2X2EA 3GFFA 4NJMB 2FQ1A 1L9KA 3MNFA 1L7XA 2PGIA 3IBCA 4UFNA 2FGJA 3ROTA 4NABA 3RWBA 3HNOA 4DIDA 4ZGGA 1MAAA 1EX6A 4J0GA 1NVKA 4MRVA 5ALKA 5FAXA 5FJJA 3I6QA 5J5AA 4MDEA 3FWPA 1IZ7A 1WA5A 1T9DA 2FJPA 3Q6IA 5CDTA 2E4XA 2NU9B 3KR9A 3NIWA 4TOIA 5GVSA 4BVFA 5B7GA 4JB2A 2GPNA 1IVNA 4D0RA 4HLCA 2FSPA 2X8JB 1GZ4A 2YWFA 1KQOA 4BPRA 2O8EB 4XWKA 1HNZB 4X20B 1E98A 2HRZA 1XRPA 4R7ZA 3UCFA 4Y2VA 4DV6B 5C32A 3FNFA 1N2BA 1PI3A 4MWGA 4FSXA 2H1IA 3IO5A 3D0QA 4MKZA 1YA4A 1VKZA 1F17A 2PSFA 3C3YA 4PZ0A 1LU9A 3RSSA 5K8JB 1CY1A 3AESA 2CZGA 3VR6D 1PIWA 1DHRA 4CLOB 1J8YF 4EYEA 3SOPA 2E5WA 1EX9A 1DLIA 5AHWA 3V2IA 2A0XA 3KR0A 5DCLA 4P7JA 3JALA 1A4UA 2FPGB 2GK7A 4RXMA 3DZFA 1R8JA 1U8YA 2G83A 2YVAA 1MJGM 1NUAA 5DBFA 4L15A 1YQQA 5CNJA 5SZJA 5IWCA 5KQSA 4RULA 3RARA 3UMMA 3AL0C 3QBEA 5DCUA 4EI9A 3IO3A 3FHOA 1U2EA 3ZTWA 3UV7A 4WA8A 4WDQA 1RT9A 4WK0B 2Q6KA 3A1SA 3D4BA 4B46A 3HBLA 5CK5A 5EEGA 1ZH8A 1TA4A 3VR0A 1EEXB 3ZJUA 3CGGA 3GJ7A 1V26A 3N75A 4ZAVA 3VGPA 2WVJA 4Y9TA 5IHPA 4RAOA 1LW6E 4JZYA 3NJ4A 3VO8A 2YKGA 1EMDA 3KJXA 3GLFA 3KS9A 2K7ZA 3Q3GE 4F2HA 4MUMA 1OAOC 4XW2A 2O2EA 3AEXA 1QHEA 3CCBA 4AYWA 1YR1A 4HFNA 3BGWA 3GLIE 5JCOA 3T9BA 3MMPA 2TSYB 3DMDA 3LPCA 3UZUA 1VG1A 1LH0A 1KDZA 4ES6A 2B6NA 2BMAA 3IJPA 2PMEA 3S1AB 3WB9A 5GJVC 3V7NA 1NX9A 3IVAA 4RMIA 1E9VA 2AC4A 3BORA 1U7DA 5A1TA 3MAAC 5BQ3A 2RD2A 1R8YA 3INGA 3UFBA 3E70C 3AIKA 2XWJI 1MGOA 2CC2A 3AX6A 3OZXA 2IQIA 721PA 3F3KA 4I5GA 4F3KA 1NV9A 4L95C 1RXWA 1Q19A 2B7CA 1ATIA 2IT1A 5BPFA 1D2NA 4J91A 3SI7A 3CKLA 2B0JA 2D4AA 2QTMA 1JHMA 3GGJA 3Q3VA 4REQA 4ZK2A 3TF5A 2PH3A 2QRVB 1ZMBA 5ARBA 4AWBA 2GBFA 4BNGA 4M0LA 1WPXA 3R4CA 3N07A 5FWYA 1E89A 3LUAA 1XG5A 4ETIA 3OKCA 5C3MA 3RGWS 3C45A 5E7QA 1FP1D 3S40A 1U0TA 2CDAA 3O1IC 5AVWA 1LUAA 4KV9A 2Q2OA 3U4GA 4AC9A 4DIEA 1BRMA 4CI0B 1S5PA 1N2IA 2PIAA 4E4YA 2V6GA 1N9ZA 2Q1TA 3VR5A 1DWUA 4J0JA 4CIYA 5K3OA 2JFQA 2JGFA 3HI6A 4KQCA 3ISVA 1EIZA 4X00A 2NNLD 2W42A 2BFPA 2WHYA 4OLFA 3AR7A 2QQFA 3TE6A 3BC1A 4WSOA 4B79A 5CB4B 1ZY2A 5GINE 2PKQO 4Q0MA 4BUJA 5I3ZA 4JJ8A 5AM3A 2ZTLA 4ZTBA 421PA 4YRPA 1RIFA 3DE2X 4HZIA 4RD4A 4Y6QA 3KG2A 5MDHA 3OU2A 2YZGA 5CFLA 3COVA 2C8LA 3O3CA 2IYNA 3KLNA 1UBFA 1XTIA 5JVDA 4IP0A 4URZR 4TTJA 1I94B 4TV8A 1OXXK 2DTDA 2VNKA 4HEJA 3LLUA 2CZCA 3OQIA 4Y2SA 1YCFA 2VLBA 1Z8HA 5CT9A 1OROA 3O2QB 2AFIB 2DX7A 4QX6A 5C31A 3UQZA 4MRMA 4B6EA 5LNK1 2O0LA 4UW9A 3SJBA 4FP9A 4DLTA 1VIDA 3IVRA 1XJ0A 3L8GA 5IEBA 4OHZA 2EKDA 4ER3A 3BFKA 5KWEA 1CULC 1FDTA 1P44A 2C20A 3C2QA 3MUEA 3EVDA 2LWIA 4ZKEA 3WGTA 1J1UA 2ZIGA 3ENVA 4JOCA 3GLFE 3MWFA 3WGLA 4FPXA 5C46F 3I0ZA 4WLUA 5B3LA 2YC2C 4WERA 5CT8A 1N57A 1WZEA 4KB5A 5DBHX 3VU3A 2IIBA 4C7XA 5JQGA 2GZSA 2QX4A 2HJ9A 1ICIA 4NV3A 4HI0E 5ENVA 5LYJA 4V02A 5BWNA 2SNIE 3REGA 1IHXA 2FW1A 1S8OA 2RIPA 3LXMA 1WXGA 1QP4A 1B6RA 3I2HA 3L6EA 4I50A 4ZOCA 5EP4A 3SEAA 3ENQA 2XECA 5C1BA 4GMFA 4DVGA 2EL9A 4EW1A 3O3MB 3F4LA 3HL4A 4OXNA 1UPXA 4LOJA 3UHFA 3E7XA 4GOND 1FDSA 1HL3A 2YYSA 2H7YA 1RPNA 4L0MA 3K96A 4LK3A 3FH0A 2ZVJA 1ORRA 2HTFA 2GK3A 1GQFA 2BE7A 4WXYB 3OF3A 3TRKA 3ZGOA 3TECE 1LPMA 2HXGA 4XX0B 4W5QA 3KKPA 5LQCA 2YJTD 3OQOA 3JR7A 1AUQA 1JSRA 1XCPA 4EWLA 1T9CA 2VN8A 3L9XA 3EN0A 4D26A 2BUBA 2CNBA 3IOCA 1DBWA 4DEXA 1RWXA 3PNYA 3EXIA 3KP1A 3VZPA 4PGFA 3AKDA 2FR8C 2VF7A 2Q9CA 4XWWA 3PL5A 2OHHA 3O8NA 5DCWA 5JSQA 1G3RA 2PE5A 2HA5A 2HNAA 3RRYA 1DBIA 1V16A 2BFEA 3AVVA 2Y27A 3ZIUA 3NONA 3R6DA 4M0PA 4MVJA 3S99A 4ZAYA 3W0LB 5K6AC 2JAWA 1QH8A 3QMWA 1GU0A 2BFCA 3MBOA 1Z2EA 3JASB 2K6GA 3F6CA 1K3UB 4FQ5A 4QTZA 3TD9A 1Y8RB 2CDRA 4M88A 1Z0FA 4MQBA 3SS7X 3U4AA 4WY2A 3B12A 3KDAA 1GDHA 1L1EA 1XD8A 4I14A 4UARA 5FH9A 1EE1A 3AF2A 1VPEA 1QXSA 1Y81A 2P79A 1JQ5A 2JIPA 1X7ZA 2V7WA 2VK8A 3DW1X 3FOWA 3QX7A 4II3A 1N5DA 4LZNA 2X5JO 4QGFA 4D6YA 2Y77A 3D8BA 1QZZA 3KD2A 1JKJA 5THKA 3RK1A 4AIIA 5A6SA 5J23A 2OV2A 4TMKA 2I7TA 1MUUA 3T94A 2GILA 4E22A 3KQMA 1JFFA 4GLLA 1ICEA 3W2GA 1XL1A 2H65A 1WVGA 2PAAA 4WNIA 3TDNA 1USKA 2C2WA 4X97A 1Z22A 4CM9D 1PJ4A 2DULA 4Y6PA 3JS5A 2OE2A 4UDOA 3WGHA 1PWYE 4QD3A 4N3GA 3WJ1A 1ULSA 1GOTA 2FX2A 1D09A 3OX3A 1CR4A 4G85A 5IVHA 1XKLA 2CFIA 3X1DA 2FUKA 4OJKA 1GU7A 1BWPA 3BB1A 3L7CA 4NCXA 2VBFA 2XJ9A 2PBZA 4BV8A 4DUZB 1UZMA 1BVYF 3WRWA 4PCLA 2IYOA 5FEUA 4RPGA 3ADBA 4FJ0A 3NT4A 3WIDA 3E9NA 4NBTA 1IATA 2MHCA 3UAGA 4PYQA 1HYGA 3BXHA 2O8CA 2O3RA 4JGGA 3N2NA 4MX8A 2SHKA 4S0ZA 4F3CA 4MLPA 2F3PA 2Z5LA 2IPOA 4KQ9A 2HEGA 4HPXB 2PO7A 4LZJA 1NYTA 1GN8A 2OCKA 1YRWA 3AVOA 4BWVA 2XMGA 1M1NB 2XE7A 3R0IA 5AK5A 3B9BA 3ZWDA 4ND4A 3P32A 4O08A 4IXMA 3MRTA 4G5HA 3PX2A 2PX5A 4MW9A 2GRUA 2XVZA 1TVEA 4PZAA 1Z2OX 2VJCA 4AJ4A 4BP3A 3NM4A 5EXEA 4H1HA 1Q1EA 2CXSA 2NGRA 5GQSA 1MO5A 3TQRA 1BYIA 3W05A 1AZTA 1TTHA 2V9ZA 3DOEA 1OLSA 3AEKB 4QO8A 3OECA 1GPYA 5F73A 4YMLA 5JAIA 1DZIA 3FSGA 4F92B 2A35A 2E4YA 4FBGA 1ZD9A 3JQPA 1FX1A 3EDMA 1CLEA 3A6HA 2QMZA 3HBMA 4X93A 4Q1EA 4YVFA 3FHLA 2Z30A 5F52A 1T8PA 1EJ6A 1IEWA 2WINI 2BGGA 1WU8A 3PNQA 2FDRA 2GEDA 4MVJE 3CZ4A 4B0OA 3FB4A 2D0PB 3Q5DA 4BNJA 3PGLA 5J2TB 1SPXA 1Z4KA 3LY7A 1B23P 3JU3A 1KFKB 2KS6A 3FPCA 1G4HA 4G2TA 2I6TA 1AS0A 2JBAA 2PMFA 3VR5D 2DPYA 2CBGA 1Q6ZA 4DA4A 3F7TA 2I7VA 4MJLA 1YKGA 1E62A 4KVFA 5LVAA 2RHLA 2WJ4A 3IHKA 1KIAA 4X24A 3C98A 3LUFA 4CTMA 1RW4A 1T5IA 2WU1A 5IX8A 1LBIA 1TU0A 5EYPA 1QSGA 1T3ZA 2C4MA 3EGIA 4JKYA 4M9QA 1SC1A 1CF4A 4EFKA 1PGJA 3IJRA 5F3DA 4YV7A 5TX7A 3TLKA 3OU7A 4IEEA 4N7JA 5KSYA 3RVNA 4RK0A 1O0CA 4EI8A 4BNHA 1WMSA 3ND7A 3R3ZA 2F8MA 4J4BA 4TS1A 3L0DA 3I32A 4BNIA 2OGWA 4HNAA 4LRXA 3RCBA 3I2IA 3PXEA 3MYYA 1ISGA 2ZI9A 2IZ6A 1JAIA 3CH7A 2AK2A 1KK0A 1X8LA 4GR4A 4YH1A 1C8LA 5BRJA 1UXJA 4ALMA 2DB3A 3M9LA 2I8LA 3EFOA 3KRTA 3A1VA 3PXGA 1UXGA 4YUWA 4Z4GA 1C9NA 3AL2A 3KZVA 3ZXYA 3ECAA 3G02A 4PYOA 4TUYF 5SYMA 3Q2IA 4DW8A 5LMCA 2BOVA 3K4QA 4ADSG 1DLJA 2QVBA 5DN6D 1UZNA 4X1KA 1UWVA 5EOVA 4MUBA 1KVSA 2GNOA 3TLMA 3WVNA 4RD3A 2VP5A 4ZVRA 1I0ZA 5JXWA 1V5IA 3PPXA 4PZCA 6REQA 2R3SA 4KO3S 2FSVC 4LXIA 1BG6A 2AMJA 3ILXA 2CF6A 3F6SA 4YRJA 4CKWB 4DDUA 2VH2A 1JIXA 2C4VA 1TQ6A 1AGYA 4JLDA 4RY9A 3CNOA 4EX6A 2C98A 1SVMA 1YK0A 3P9ZA 4PTYA 2YNMA 3CSSA 3C14C 5EJAA 5D1NA 1XPOA 1O3YA 3T12A 3RUEA 3PB3A 2XHEA 5TGTA 4ITVA 4B76A 2FFJA 5AW6A 4GXNA 5KHAA 1FP4A 5H70A 1UMCA 4Z51A 3E8XA 3BXOA 5IANA 3D3NA 4KJXA 1IU9A 1M6EX 3CTMA 3SLRA 2BFOA 1TCVA 1TUIA 3ZH9B 3TMKA 1J5EB 1U6IA 2VZ9A 1PS0A 1YUNA 3KYJB 4KSCA 1JHDA 5COAA 4EW3A 3VZRA 1XIVA 1FXSA 1KE2A 4J03A 4CNQA 2AYYA 1JIKA 2J3QA 3AFIA 1YNOA 3A2LA 5LZ8A 5J2UF 1XPRA 1KQPA 1RQRA 3ABOB 3RWMB 5L8VA 1E58A 3LKVA 1DL5A 1VCOA 2V7QA 2RC6A 4PQRA 2A3RA 2QN8A 2R86A 2XUGA 5CLLA 4H35A 3WMXA 2V0CA 1OXSC 1U94A 2ZWOA 3ABRB 4WOBA 4YMTA 3OQ6A 4V0KA 4DUPA 3CX7A 3DEHA 1LTHR 2ACKA 3K5IA 3TJRA 2VDJA 3P9NA 1VGVA 1OGIA 3FWZA 3OZTA 3NEYA 4Z3DA 1AH2A 4Q9DA 2J48A 4FYIA 1CJTC 2OAP1 2OTCA 1E3WA 1QIDA 1Z8DA 2W8ZA 2FWNA 2WRZA 3VC1A 1P5FA 3DQQA 3QNMA 3AW8A 5IT4A 4WNCA 3S28A 1ZIPA 3EEQA 2GSDA 4KC0A 3GUCA 1TQDA 3IEIA 2V58A 3WI7A 2COEA 4WFKA 4X84A 4MS4A 4RWEA 3OIYA 4KN9S 4LJ9A 3PA6A 4ZO7A 1VSUA 1TM5E 1SXGA 2QX9A 3U56A 4GSKA 2X1LA 4M0UA 2FI1A 5DNYB 5DJ5A 3USES 1VA5A 3D4LA 4TXHA 1KBOA 1KIFA 4TL9A 4ZAXA 3OETA 3U3JA 3R3JA 4CHTA 1J23A 1LPSA 2E6UX 3NRBA 2HEIA 3TEMA 3U5TA 1JH9A 1T8UA 2R5NA 1H2RS 3I8SA 5ALLA 1NYLA 3HHEA 4PO9A 3QHQA 4PSCA 4QTTB 3L2OB 2J59A 5DSZA 5G4KB 2CNWA 2OYCA 4DV0B 2JAPA 3D2BA 3DKVA 3HDGA 1WRBA 4YB8A 1W1UA 3UV6A 3Q7TA 4TKVA 2ZYRA 2FP3A 4ARAA 2XBMA 1ECCA 2FK7A 3MELA 5AXDA 1XOIA 4EVRA 2OQRA 4HMQA 4OQEA 4DUYB 2JJ8A 4MPPA 1ZC3A 3GRAA 2VJOA 5JD4A 4JL6A 4QSMA 3CH5A 3C6MA 3V8NA 3ER9A 2R2AA 3IB6A 4D6XA 2VF8A 5KJEA 2NXJA 3ILVA 3VM6A 2QUBA 4NZ9A 1VMAA 4YBZA 4RCVA 1Z62A 3ANLA 3A4IA 1A27A 1EHYA 1L7AA 3I9KA 4ND6A 1CR2A 1UBJS 4R0VA 3D5TA 3JZDA 1EWRA 4IOMA 5FEMA 4HR7A 3ZXXA 1USGA 2AEJA 1Y8QB 4NEGA 3PHLA 4AKHA 2XVXA 2VDPB 3WHPA 5IZCA 5GM1A 1OCEA 3A1DA 4R40A 2NNWB 1GL9B 4LCEA 3AOGA 1T91A 3G85A 4GVPA 4UBKA 2R6JA 5CA1F 3PPIA 4JJAA 4PLVA 1OYWA 5FFFA 1ID8A 1YULA 3F0TA 4MEBA 4BMPB 2HKIA 3R41A 1NQVA 1OLUA 3H8JA 4Q7MB 4U63A 5I7HA 3VI4B 1RNLA 1A76A 1UMBA 3AKEA 2DZDA 5GZ3A 3T9DA 3QWFA 1XU9A 2WTNA 1C1XA 3TVYA 1M2VB 1Q15A 4FLEA 4R01A 3T41A 1S0UA 3NATA 3I45A 5AW1A 3WHKA 3TIVA 1YL5A 2FU5C 4N3AA 2XI4A 4BWYA 3V32A 5CYPA 1BA2A 4GRAA 4PX5A 5T8KA 4B84A 4LF7B 1U2PA 1ENPA 5FUXA 3LGAA 3AKYA 4DR6B 3NRJA 3DTTA 3PIIA 3ND8A 5DWQA 5HQJA 3F78A 3J80A 1H65A 1EFKA 1RQ2A 2HOQA 3CRRA 4I99A 3F7NA 4M9CA 2O2CA 1J39A 4Z2YA 1ZGAA 2YVKA 3MGCA 1PS9A 3E84A 3OA2A 1E3LA 4KN6A 2J0UA 2CYBA 5AFSA 5EKUA 4H7KA 3TR0A 4ZYUA 1XZEA 1RXCA 4R1TA 4D79A 4R8KA 4UBLA 5DLQC 3I01A 4JB0A 4QHSA 4X3CA 5FOSA 4E15A 4M7WA 4MUAA 4X61A 3D4OA 1CZNA 4OSPA 1AV6A 1EVZA 3SCZA 2IZ1A 1Z0JA 1TZMA 2DETA 4Q1CA 1V35A 1E1DA 1YIOA 3RIGA 3DP9A 4UM7A 3SE7A 4I8DA 3SM3A 3T5TA 2HFKA 3DF7A 1FRQA 3LVQE 4DV3B 1SHLA 3EXG1 4HDNB 4BX2A 1VIMA 2W6PA 3KVVA 1EWKA 1LBHA 5LB4A 5I8ZA 2I2AA 5AW4A 4HDQB 2YHSA 4HJRA 1CNEA 1WG8A 1Z68A 2FOLA 4CF3A 3CRW1 1YDWA 2OXCA 3NO4A 5JZVA 2P5UA 1JW9B 2AHOA 5A5GA 3A9TA 1KZHA 1TJ5A 1P0PA 2EBWA 2PHZA 2QDXA 1U99A 2VXYA 4H7DA 4BO9A 1PJRA 1GYRA 3H8VA 3G8YA 4Q66C 1NVGA 3AH8A 4GZLA 3TUZC 2X19A 1T1JA 5DNVA 5TMPA 1E8NA 2QUZA 1WMAA 3HJTA 1V7PC 2F3SA 1DEHA 4LHEA 5AJXA 2PYZA 4RTOA 5TV2A 2AD5A 3VO1A 4EPXA 5ABPA 1XMPA 2FUG1 3QVSA 1CR1A 3V9AA 4RHEA 2QK4A 5KOJA 3ZGZA 3I8XA 3ZW7A 1G41A 4PO3X 3OIUA 3MXOA 1WMEA 3H4VA 2PCLA 3OCUA 4NK4A 4YXFA 5EI5A 2B8WA 3C39A 3QI7A 3PDJA 1X1AA 4HDAA 4XDGA 4CV1A 4XD7D 2VK2A 4IJWA 2HMWA 5AW8A 1Z34A 2Q4OA 2V6FA 2YQZA 4J49A 2WU8A 3VR3D 1E5VA 3M4YA 4RXUA 2LCFA 2A9KA 2WWIA 2SCUA 3RSHA 4BNZA 1Z35A 3SX2A 2CJXA 1VB3A 3K4HA 1RM4A 2B3DA 5J4YA 1HA3A 2WMOB 4AJKA 2E4UA 5ALVA 2G9UA 2SKCA 3K9NA 4GKBA 2JLZA 4QOSA 4DMGA 5KJFA 4X44A 1NW9B 3PQ4A 1PNTA 4QGHA 1JFSA 3DMPA 3FKJA 3IRUA 3P2JA 4TRRA 1EI9A 3UK0A 1MX1A 3VU8A 4DQVA 1TRHA 5BWBA 1NU6A 3LYAA 3PYXA 4MV6A 4KXFB 4E30A 3MSCA 1F12A 1XEFA 1FMJA 1L2TA 1YGPA 3REOA 4JQCA 5D3MB 3QPVA 3RREA 1PHRA 1YOVB 3GEDA 2XVYA 1MQAA 1XZNA 3H2HA 3KZ1E 3PPVA 3AI1A 4DE5A 1L7PA 5G1PA 1BDIA 1FQWA 1EDOA 1K63A 4NS1A 7MDHA 3QU7A 3K8YA 4US1R 5T64A 4GKKB 3E03A 3IDAA 1JAXA 5SV2A 3ENWA 3UMGA 3LG2A 4CGYA 4YR9A 4FZ5A 2DP4E 4N41A 4F45A 5K4AA 1RLMA 3GVCA 4NYMR 5IF9A 4XX1A 4DPLA 3KK0A 1PTJA 4IGEA 4BMVA 1Z26A 2QG4A 1HM5A 2XTZA 2XA9A 4FHDA 1D9XA 4H1VA 1CFJA 1U11A 4OBXA 3CJTA 4D02A 2R1VB 5DU2A 5BV1A 1P8JA 4Y2XA 2QRHA 1NBEA 3BFPA 1N0VC 3C4VA 3OPYI 4ICIA 1XU4A 4DM4A 1INLA 2R8RA 2QGFA 1WHSA 1E5XA 2FQXA 1FDVA 4ESOA 2XXAA 3C6XA 3CX8A 4M6WB 2YJGA 1FYDA 2OBBA 4FFWA 3FSJX 4ZZ3A 1TYBE 2XB2A 1SBIA 2DT8A 4IDEA 5KQPA 2W2XA 1JR2A 2BIFA 4I36A 3C8HA 3N7UA 2OOKA 4KFRA 4Z7NB 4A10A 3VOBA 1DOAA 3O1HB 1SUCA 4JYPA 3W4JA 5DT9A 3ZE8A 2HW8A 1TAGA 2R8YA 4RC9A 1CJMA 2F3TA 3HRKA 3QOYA 2NO4A 4W7IA 5DGXA 3CEAA 4BNTA 3A9RA 4YCLA 4D4GA 3HHPA 2CYCA 1EXWA 1NVDA 4MDHA 2JA1A 4BJ6A 3I62A 4URUR 1IBLB 4LECA 1AF7A 1P5RA 4AKIA 4MKGA 4Q9NA 4ZK6A 3UM9A 4H0NA 4A0FA 3LTEA 4LJSA 1BKDR 1R4MA 4BKRA 1N5JA 3BSYA 3MGAA 1J8QA 4CQJA 1Y6GA 1JR3A 1Y6JA 3GJXC 4K26A 4AZ0B 1XPUA 3LVBA 4GKAA 2QAJA 3L93A 1V0JA 2INGX 4RF5A 1UBUS 3AOEA 5EWLB 3RGGA 4GKVA 4H3SA 1AKNA 1XQVA 4Q24A 1YU9A 2V74B 2RGXA 2JRLA 4X5OA 5EA2A 4PLCA 4ZU1X 1U3CA 4A03A 4C9BA 1FNBA 4DKXA 3CBQA 4ZRDA 2K2QB 2E5LB 2ZUCA 3Q2KA 3DAOA 1IHPA 1VHLA 3KE8A 2OO7A 3E7WA 2DCUA 5H9WA 5DTJA 3L7MA 1HRDA 4YJ3F 2QTGA 4OHOA 2IWHA 1FMFA 4OUKX 3WKCA 1ABEA 3NAZA 2PD4A 4G0ZA 5KYXA 1EINA 1RYMA 3H3FA 3W2EA 1V5GA 2I99A 5AIBA 3Q7EA 2Z3WA 3K6SB 3OHPA 2B78A 1FY2A 2MINB 2OY0A 2Q1WA 4G36A 3TOVA 2WAXA 4AS2A 4CM4B 1X2BA 4L8LA 2DPXA 2XBUA 1KAOA 4KDCA 1ADCA 1KK3A 2GD6A 4WKBA 3FY4A 3D1VA 1EFCA 4LVCA 1EVLA 5EIBC 4BMZA 5MGNA 3KZMA 1Q44A 3Q98A 3ROXA 3SS8A 2D1TA 2QN2A 3LC7O 1MW9X 2GF9A 3NWOA 1YRLA 4G0MA 4HQ6A 4NLLA 3W3ZB 4KN5A 1Q22A 2V7XA 4NV0A 3BT7A 4XTCS 4UVGA 1JVNA 1P77A 3COYA 3LSTA 3RBVA 2L17A 1ZWKA 1P1HA 4L7QA 4LDZA 2J3EA 4GBJA 1G8AA 3BJEA 4RD2A 5DGCA 2YZMA 3WV5A 5LZ5A 2DGDA 5EJMA 1K4KA 2Y1CA 1QCYA 3PXCX 3WBFA 1NUUA 4WQMA 1AUVA 1X3LA 1XL0A 4V0LA 1QMGA 4EZEA 4OLBA 4C05A 3GLSA 4UTPA 1NJ5A 5K8TA 4MVJM 1EFAA 2QW8A 2IVZA 2P9EA 3NPAA 2JCYA 4K8RB 3KQUA 4IQGA 1O9GA 3RYHA 3O9MA 3B1JA 3K09A 3UAOA 4CBVA 3T1VA 2YN4A 4F6RB 2Q2QA 4ETWA 5M3BA 5CAEB 2HMYB 3WBBA 4NKRA 3DO8A 3KAKA 4N48A 1W5SA 4HMPA 3ZNQA 3GLHB 1FB5A 3F2VA 3G13A 1XTSA 1KO7A 3MMXA 5DM1A 3O8DA 5E3JA 4PZ9A 5EXSA 1NF9A 3Q0IA 4NPHA 4BPBA 3OCZA 4JOBA 4KPUA 1DHTA 2R25B 4HYEA 3IL2A 1JAHA 3VKUA 1WV1A 2CEKA 2E3JA 2PO5A 3OEWA 4FR2A 3ZWPA 3QPUA 1UDAA 4US0R 3IQWA 4QE3A 3ZJ5A 4WK2B 1JR3E 1W44A 4KFCA 3GD5A 2HMUA 3ZHTA 4JEMA 2M1XA 3VRHA 2LGJA 4HQRA 3SSNA 1KBZA 3CU5A 3PNBA 3PXXA 1HEYA 1SHTX 2CLSA 3P4YA 4FLFA 2QRKA 3RTCA 4HWRA 4A1FA 4DJDC 2BHSA 3VV2A 1RBMA 1WF6A 1YIAA 2VSOA 2VRCD 2AJ8A 3PC7A 4NTZA 3RG8A 1N0WA 2D8AA 3AV3A 3E18A 3GVIA 1J0DA 2H2WA 2XQFA 4WRRA 3WQQA 1NP6A 1ZD1A 2F64A 4QUBA 1RKVA 4BBZA 5J2TF 4RESA 4YT5A 5DX0A 3U48A 3CUTA 3HEBA 4L5IA 4E09A 1JVBA 4WZZA 1H8HD 1CUZA 1UOPA 3V97A 3WNBA 1A1SA 1JIJA 5CW1A 5BSUA 1RJ9B 3A6JA 4J1NA 3TH5A 4EJ0A 4I9HA 4DC9A 3A8TA 4EA7A 5JS6A 1CJKC 2A5DA 3KQTA 2R4UA 2WV9A 4R4JA 2I54A 4P80A 3BFXA 5EUCA 3EC1A 3FKSA 1OQAA 4RTSA 3Q85A 2PBFA 4WXHA 5IMSA 4RGQA 2O59A 3IAM1 4YUXA 2FFAA 4QPDA 2ZRJA 4UDXX 1XZQA 2EX0A 2IXEA 1L0BA 2MSNA 3CMMA 4BXOB 1SXIA 3JD4A 1TUBA 3EAFA 4TM7A 2OFPA 2YY6A 3DO5A 1KQFA 2O7SA 2PA0A 2ZK7A 3ELYA 3WWEA 2I9KA 5A9TA 1CXZA 3PXBA 3H83A 3DOHA 3DZGA 2YZ2A 3K70D 4OAPA 3F67A 5EZSA 4A5SA 2QY6A 1FFSA 1Q95A 3JAWA 3AVYA 1NR1A 1WXDA 5SYAA 3T4PA 3W9SA 3PD1A 3ZXSA 1NXVA 5HG0A 5T67A 1PP4A 1UL1X 3GH1A 5LCXA 1ZH4A 4IIBA 4BE7B 4IF4A 5KNCA 4TMYA 5JS7A 3VNVA 1DKMA 3CX3A 3IAS6 1VJRA 3WL3A 5D84A 3WKDA 2NTNA 5FWDA 1VP3A 2GJ9A 2WJHA 1XAGA 2B8TA 3GZTB 3IUJA 3PU6A 3SFTA 4IV0A 2JJ2D 5BQXA 1ZVVA 2BTQB 4JI1B 2J5XA 2ZPTX 3ORQA 3HP7A 3BHNA 3ZNNA 1PJ3A 3LP5A 4C89A 4RTQA 3RVRA 4HEHA 3Q12A 2WSMA 2QOEA 5EHGA 4QM6A 2NO9A 2OL4A 3LP6A 1LPAB 10MHA 1LJLA 2AQ8A 3EXHB 1E1YA 3PVZA 1J8MF 1OD6A 3GJ0A 4KR9A 2IOFK 3I6MA 1Z5WA 1IYZA 5BQPA 3L82B 4EG4A 2M32A 3DC2A 1FNNA 3KU1A 4IVNA 4RL4A 3DEAA 1KBQA 3INYA 1FFDA 3O47A 2OV8A 2I80A 5F77A 1QORA 1NUTA 4IBOA 1C3LA 1Y7LA 4TQ9A 3V55A 5BVGB 1Z3IX 2ZPUA 3C7TA 5D6OA 1G0NA 3M6WA 5AJWA 4K6CA 5AHRA 1VTKA 3B1ZA 3VPAA 3ZY5A 4AY2A 2C2YA 2O7RA 1SXJB 1QC5A 3T61A 1E3QA 1G5HA 1NF2A 4DDWA 3EZ9A 3KOWA 3LE8A 4PSKA 4R6XA 4YMHA 4IDBA 1IONA 4ZEVA 3H1GA 4CRWB 1YQGA 2X8BA 3ELWA 3VHLB 3BA1A 1E0KA 4IDHA 4X60A 5ECGC 1N5IA 3W77A 5C4IA 4OX9B 1RE0A 3KFXA 3HS3A 3DMFA 3OOWA 4DJAA 4YYZA 1DDIA 1FMLA 16PKA 4MO2A 1BC5A 4OAQA 4RHCA 1DJNA 3G5UA 1Q3TA 3V1NA 1ZVJA 4RM3A 3NYQA 3ZV4A 5IDWA 2ZI6A 1EBUA 2B69A 4KBFA 2UU9B 2XT6A 3WFIA 1B1CA 2PMBA 2H16A 3FNEA 4EAQA 1NIJA 4ZQIA 3V2HA 4HBZA 3QHPA 2A7XA 1JXAA 1N1EA 1QVRA 4FW9A 5DNCA 4Z4IA 2JW5A 1AQIA 1AHHA 2GBLC 4CYMA 2XKJE 4F4JA 1KTIA 2JF0A 4I19A 4W4TA 2I34A 3FGZA 2QWXA 2WWHA 2GHTA 3TRIA 1LX6A 2LKDA 2DUWA 1MC4A 4XUCA 5HM8A 2OMKA 3EXG2 2VHEA 3QKSB 4TYYA 2DVMA 3OICA 2LE0A 1UBGA 1SC3A 1C2TA 2C2ZA 2R11A 3DFUA 4NZPA 4O5OA 2HMTA 4LVOA 3VU0A 4CIVA 2AKEA 1OLXA 4JUFA 3R7NA 4MUEA 2ZAGA 2J08A 4EIWA 4LJKA 2VF5X 1QRAA 2YIMA 2OAEA 2DJIA 3BF7A 1XCLA 4OMCA 4ITRC 1W36B 1FRZA 1XROA 2WG1A 4G09A 4YV2A 3N2KA 3I6IA 1U9IC 2KBFA 5TY0A 5JMOA 5L6LB 5C8ZA 3FFXA 1HX7A 1ACJA 4LRUA 4X66B 2DQ4A 2GXSA 3HABA 3IAXA 4HLQB 5LDDC 1MAVA 3H4IA 3HY4A 4K8OA 1VI6A 1WXXA 4C7BA 5LC1A 4NARA 3K9HA 1SOMA 1G4UR 2AZMA 4Q3EA 1N2HA 1CRQA 2UZ3A 2DFLA 4OHYA 1KETA 2NUAB 2V4UA 1Z4NA 3QMVA 2RH8A 4BX0A 1SU8A 2Z4RA 4OYRA 5HIKA 5TQ2B 4CDNA 2QTVA 3C3AA 4JUIA 1FTWA 3R0ZA 2P9GA 3TQFA 4KIFA 3TQHA 5HS6A 1FSFA 4TTIA 3W5AA 3WYAA 4EKIA 1A8HA 2J9XB 5DOVA 5TEVA 4B87A 3OEYA 1TYDE 3GRRA 3H9BA 1OX5A 2I4OA 3F1KA 4NHEA 3E5HA 1MW8X 3OZWA 2VO1A 1GNSA 3AMVA 1QHHB 1HMYA 3FYTA 3FYDA 5JCJA 4EOGA 2VP0A 3U5ZB 1HQDA 2Q3EA 5BSWA 2B8NA 2FN9A 4X71A 2AGVA 3DDCA 4LN1A 4TMTA 5ICCA 2G9NA 2BGLA 1H2HA 1NI4A 1NVUQ 4O29A 4KK3A 4AZVA 4Q3KA 2EP8A 1WCIA 3BL8A 3HK2A 3WDLA 5CVTA 3PGJA 3UJNA 1G9SA 4H18A 3TQTA 4ZKDA 1SKQA 3O8LA 1DJMA 4NRDA 3OM9A 5DCYA 5CYGA 3RRMA 2R8EA 4C1BA 4IIFA 4GI5A 4IR7A 1S96A 4ZANA 5DNEA 4HNTA 3F71A 4XJXA 2H1FA 3RIXA 2MIIA 5K0FA 3OE7A 1ZCBA 3V80A 3ZY3A 1EQ2A 4ARSA 4GNRA 5MFPA 4C88A 1K4MA 2GHRA 3BRWD 1FS5A 2HA7A 2YV2A 1IH8A 1Z5ZA 3DBOB 3KV1A 4I46A 4NMWA 1GRCA 2OZLA 1EJ2A 4O3FA 1Y42X 1L3BA 1NX6A 1MPXA 3OZUA 4KMSA 4RSRA 4UNPA 3M2TA 1IMJA 4B40A 5EZQA 1N0UA 1RHUA 4D5GA 1ZJ5A 3MFQA 3PXDA 4DFDA 2WWWA 1JG2A 4WLEA 3P52A 1SVLA 1AKYA 3D6UA 5EFOA 4EW2A 2Q5LA 1T4BA 4QREA 3KSRA 4XDZA 3OBBA 1CUUA 3ZDFA 4V3CA 1SU6A 1XB2A 4IV5A 2DCMA 5EVJA 4F4UA 2ZB8A 2RKBA 1EBFA 2Q46A 2HM7A 2A9JA 4IIGA 3HKBA 1V5WA 1XTUA 1X14A 3K4PA 4E4RA 3CW2A 4CMIA 3KOYA 5B1HA 2VTBB 2VQ3A 2H4XA 2Z6UA 4YV0A 4EECA 1BN6A 4QBTA 4XYLA 2JHFA 1L5KA 5I8PA 1GRNA 3GCWA 1Z25A 1GKKA 2D74A 2BONA 1QGOA 2VUUA 2C0CA 2CV1A 4IFEA 3VAAA 1ZN8A 5I9LA 3JQFC 2P3LA 5MN4A 4REMA 4DM7A 1UBOS 3LT0A 4XFJA 1CB7A 4NYJR 3VPFA 1AKVA 2W2NA 2ZUFA 3I01M 1S8NA 1G8JA 2VPYA 3L6DA 3LOPA 1RVV1 3E9YA 5FUWA 5A7HA 4PLWA 5JT1A 1P19A 1FVOA 1QG6A 2NACA 1LB1B 4MJXA 3EA4A 5CK4A 3S29A 3U1VA 3H9CA 1ZZEA 4UMFA 3ILYA 4Z9FA 4YCNA 5A7GA 2GCIA 3O2NA 3TO5A 4KR6A 1ZNXA 4ZCLA 1YZLA 1I3LA 2QA5A 4FIZA 4ABTA 2RGAA 1VFPA 2IHJA 4U7GA 2HJWA 2YFQA 3BM5A 3K0AB 3UH1A 3UV3A 1ZNZA 4U9UA 3VHRA 1E2QA 1EK0A 1W4BA 4J6FA 2GYWA 4LOKA 2VDNB 1M2KA 3Q9SA 4M8IA 2UYYA 5DWDA 4S3MA 3WGZA 1N3YA 3D3JA 3NM5A 1ORVA 4NMXB 5IK2A 5JW6A 5JG7A 3U80A 2J7PD 3WWDA 2FZKA 2G7ZA 4LSZA 3LAWA 3UGJA 2O9JA 3DJFA 5CLGA 3KXLA 4TTSA 4C87A 3LWDA 2YBDA 4M1WA 4NF2A 4QDXA 3STWA 4IHJA 2UUOA 3TOZA 4BQQA 4LK2A 4Q34A 1YCGA 1R8SA 3MEQA 2HWWA 3WLTA 1A9YA 5FNVA 2EX1A 3E8SA 4MI1A 4Q7EA 5KWIA 2JLRA 3A4TA 1ZIYA 5J5CA 1DZ3A 2OHFA 4D57A 4Y9UA 3W6NA 1PX0A 3LUKA 3QXGA 4FX2A 2DBVO 3Q4GA 3VU1A 1UKCA 3LW8A 4AG3A 1JYFA 1JE0A 3GJYA 2F00A 3OCVA 4F1JA 2PZBA 2C57A 3KFLA 1NLFA 5CRIA 3P0EA 5KTSA 2A1UB 4ROTA 1PAUA 3C3MA 2AEFA 5HQ3B 3ZJYA 1YI8A 1SKYE 4G2NA 1L5GB 5CDSA 1H0HA 1HWYA 4BIIA 4HUTA 4MW7A 3GUVA 4L50A 2HO4A 2V6IA 3MTIA 4PFKA 2A1IA 4UUBA 3L4JA 1NJGA 4LCJA 3MJ4A 3DLBA 2WAYA 1IWBB 1GQRA 1GZVA 3W6ZA 3TE7A 4PCAA 3Q8MA 1RC8A 4FGLA 4X41A 4ARZA 1P0QA 4JJGA 3ANYB 3A31A 2ILTA 1TK9A 1GADO 2EWWA 2BMFA 4EGFA 2CXPA 2HLNA 4YX9A 1PZGA 1T8SA 2WMDA 2QEQA 3B13B 3ONVA 4JU8A 2HQSA 2O2GA 3ICQB 2PV7A 4JELA 3TR6A 2P3QA 1SMKA 1UPAA 1L1RA 4QUDA 3PLAE 3H17A 3HKEB 3OPNA 1GQ2A 3EZFA 4X54A 3PQ5A 4MVWA 5H3HA 3ZWVA 2PJUA 5DBEX 5ADWA 1M2FA 4O4IB 2JPDA 5D85A 2E87A 1LRLA 1Z82A 5A9SB 1W1IA 4P86A 3LCUA 1G4AE 1W73A 2EBHX 2D7JA 4IXWA 4V0NA 3D6HA 3IR5A 3UF0A 3GEPA 5LPNA 1WM1A 3OE5A 1H9AA 2O2IA 5BR1A 3FNQA 4PBTA 2BAGA 4NBKA 4N18A 4XFDA 5FOTA 5H3LA 3QUSA 3WIVA 4DM3A 4BNMA 1YSCA 1EVKA 1S2MA 4F9EA 3L0YA 1YB1A 5KB3A 4C7KA 4HHEA 3WP1B 4W9NC 2NO1A 1IY1A 1VI5A 1XXHE 2E37A 2V7EA 1Y0BA 4RGYA 3W79A 4CFZA 4DMRA 1D5CA 2IPMA 2WWGA 5B1YA 1P18A 3DD1A 1G42A 2DF8A 4PO8A 4V2UA 3GRZA 4MVJI 1NQ5A 5HK8A 5IDQA 1JQAA 5LSAA 3TZCA 4F21A 5EHNA 3SGLA 3ZGYA 2ATXA 4LBWA 2VUTA 1J0XO 2WUGA 4UBIA 5ANRB 2ZU0C 3LXUX 2AOXA 4ZC1A 1DTEA 4YR7A 1WUYA 4MIEA 4HVAA 2QY9A 1AS3A 5ILOA 1WJGA 3IV6A 3NU1A 2GXAA 2O19A 4M1KA 1JG7A 4OHBA 1T9GS 1KEVA 4EGAA 2IEZA 3CLTC 3BIOA 4WNYA 1H9BA 1VMIA 4U2DA 2VATA 2NAPA 2VEOA 3FMGA 3V1MA 1SN7A 4QGBA 1RE1A 2Z4TA 5AO9A 5FI5A 5GIPE 2PLFA 3AQ4A 3BB4A 3D7LA 3GMSA 4PLGA 3I4FA 1GFSA 1H0SA 4H7IA 4C0WA 2PX3A 4B3HA 3KJIA 3W9BA 2H4WA 2ZPAA 5AOBA 3QGMA 3VR4A 2QRZA 1T0HB 2IUFA 2W5UA 3D5QA 3IPAA 5J40A 4UE6A 4U3JB 4C4YA 4D4IA 1FLVA 1SQSA 1U28C 2WJVA 3LKDA 3NH9A 4G6ZA 4NAVA 3CR8A 4RM2A 3SSMA 1I3KA 1T5OA 3GLVA 2EJTA 3I5AA 3BREA 3TLYA 4LTNA 4BGUA 3AY3A 5JS8A 3NTVA 2R79A 2YBEA 2NU7A 3MWEA 1RRVA 2YC4C 4LZAA 4Y2HA 1FTNA 3FPSA 4S1TA 1QQ5A 1JSXA 3OQBA 1UKEA 4IUDS 4HDSA 4G8DA 1E1CA 1Z29A 2LIVA 1T13A 1E5QA 1S3FA 1IE3A 3UA3A 1GFIA 3RF7A 4ID3A 1N7GA 1XZKA 1T4DA 1E9SA 2IY8A 3TLGB 3MT0A 3N2YA 4RETA 1NIPA 3KXDA 3ETLA 3A06A 1SBQA 2OZPA 3KSUA 2VEDA 1UC4B 2R7LA 4BQSA 4XLZA 5DKFA 1KZ9A 4JP1A 1PUJA 2RCNA 4YJGB 3PWZA 3EVZA 1NLYA 2LCIA 3KHKA 3CO5A 1BWRA 1MRSA 3O94A 4PPQA 3LLSA 4CIWA 1JRLA 4XIYA 1LC0A 3NT5A 4DQDA 1PT5A 3L4BC 1RI4A 4LTDA 1EXVA 3S8EA 1WR8A 1ZXXA 2ZJ8A 5DN9A 3LKBA 4XJVA 2VPIA 2FN4A 3LNTA 2RB4A 2Q4BA 1PK7A 2XSZD 3EE6A 4AY3A 1W30A 2Q0HA 2VNHA 3SC2A 4RZHA 1RMQA 3HU3A 3SF8B 4WX2B 1XAJA 2AVDA 4B73A 2GAIA 4LXHA 1J8FA 1F0NA 3AI7A 3ZV6A 2YFHA 3H9GA 1YRAA 2J4CA 3KIPA 3HO6A 4C3VA 1J2EA 2XMDA 3R7FA 1G60A 1TFRA 3GX1A 1L5VA 5LR6A 2KBEA 2N1BA 1F5NA 3JARA 5EHZA 1KI6B 4E7PA 3B38A 1F0KA 3EZ6A 3PQDA 1XMSA 5AJHA 3ZX5A 2RBEA 5TF4A 1WD5A 2QM3A 1SQFA 3MTDA 1J22A 3PIRA 2ZYWX 3PUZA 2XODA 2PN1A 3RJ5A 1U0OC 5CT4A 3S2IA 3EGDA 3NEPX 2QRPA 3EDRA 1SR8A 5C7YA 3E15A 1J33A 1M6HA 2GN4A 3SXUB 1PFKA 4H6PA 2IHBA 3K31A 3LPAA 2H59A 4DSTA 3T9AA 3CEHA 1UIRA 1HE5A 3N87A 4ZD6A 1SKAA 3E82A 1OLOA 4BNDA 1MHPA 1ZD5A 2RAVA 2YRWA 5LDGA 1PWZA 2LDBA 4R68A 3SZUA 5IJ9A 1CWUA 5E6RB 1W2WB 3NHWA 1MOZA 3EIQA 3HGTA 4OIFA 1JUDA 4YJFB 1W96A 3T95A 3PQ7A 4ATNA 2JJYA