3GWGA

Crystal structure of chey of helicobacter pylori
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY homolog
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gwgA00
3O1JC 4PE5B 2E4VA 1D2AA 2KYRA 3KTOA 3LKBA 1KRWA 4YO7A 1ZGGA 3CG0A 4EUKA 2WJAA 1Z13A 3QLVA 4EVSA 3TMYA 3C97A 2P9HA 4HYEA 2GWRA 1P2FA 2FLWA 1QO0D 3F6CA 3URMA 3OLZA 2PUGA 2NZUG 3RH0A 2DRIA 4MS4A 1DBQA 4WT7A 1QQAA 1RZRD 5FWXA 1JH9A 4ZPJA 3TB6A 4G0PA 1U0SY 3FDFA 3QX9A 1ZITA 3C3MA 3O74A 1DZ3A 1DC7A 1NXSA 2PJUA 3W9SA 1JFTA 1A2OA 4WZZA 1Z15A 4E7PA 3IPAA 2PAFA 2WRZA 2WJWA 5JNVA 1IIBA 3Q7TA 4XFKA 4JOQA 1E6LA 3CNBA 4MR7A 3HZHA 4TLLB 2WMYA 3HS3A 4KVFA 3O21A 3SQNA 4G0MA 3O2SB 3N0WA 2GKGA 3CG4A 4W5OA 4OG2A 4HNRA 1LK0A 2FEPA 4RK7A 1SD5A 1SRRA 4Z99A 1JWLA 3KS9A 2FMIA 3DBIA 1QPZA 3GT7A 3HEBA 4ZJPA 2FQYA 3IP5A 1USKA 4EYQA 4YV7A 3HXMA 5IUNC 2PL9A 5ABPA 1K68A 2FLKA 3O1HB 1JFVA 4NV3A 2MYUA 2IOYA 1DCMA 3A10A 1EHCA 1XHEA 5EWMB 1L5YA 1Z18A 2FMFA 2GBPA 1F4VA 3LUJA 4QYWA 3KLNA 2IYNA 4Z9AA 5TPZA 3OQMA 2QXYA 3HV2A 1QP7A 4N76A 1YK0A 4Q7EA 3JPWA 5TPZD 4NCBA 4N0QA 2I6FA 2JBAA 3OO0A 2FEWB 1JDPA 1EWKA 1D1PA 3JVDA 1ZDMA 3HUTA 1QQBA 1OXKB 3HO1A 2PL1A 2J48A 3QLTA 4ETMA 1RXIA 3IDOA 3QK7A 3L49A 1TMYA 4W5QA 3DLHA 2OQRA 1GUDA 4QYMA 1EWVA 3NNSA 4MGEA 1A04A 1MB0A 4OBBA 3MM4A 4KK3A 4PYRA 5TQ2A 5KQGA 3OLWA 1BDJA 3H5TA 3GBVA 4YLEA 3T38A 4LDZA 5GQSA 2HPHA 4W5RA 2PE5A 1WETA 2LUOA 1NY5A 1JFSA 3UUGA 3SG0A 1BAPA 5DCLA 3EAFA 4MAAA 4XASA 3OQNA 4PZ0A 5JNRA 3CRNA 3UKJA 4TMYA 2QVCA 3H5VA 3JTEA 3T6KA 5IEJA 2P4UA 2JVIA 4RK5A 5TQ2B 1T34A 3RVNA 3N8IA 2E4UA 2QV0A 5EWLA 1NATA 1ZAYA 2PUBA 2JVJA 1CEYA 3N53A 2CHEA 5BRJA 1JYEA 4KRFA 4L4UA 5FWYB 1KMIY 3LUDA 3NNNA 1CHNA 3E3MA 2IPAB 3HDGA 3I45A 3NBMA 1W25A 3LUKA 4P1ZA 2OENG 1USGA 1P6QA 2JK1A 3O75A 3SY8A 4DADA 4F8JA 3ROFA 1FFWA 2W42A 4MR8A 2LPMA 5CNKA 3ILHA 3N0RA 4RY0A 2R4QA 4RKRA 3HVRA 3CS3A 5DGCA 2PKXA 3Q15C 2R25B 3GYBA 2FQXA 1ABEA 4YS6A 1YIOA 2IPLA 1DCFA 3TD9A 1BVHA 5IC5A 3QEMB 2CHFA 4YR7A 5KI6A 3OLXA 3IP7A 3FFWA 1S8NA 1Y1LA 2FVYA 2ID9A 3RVPA 5JNSA 4FE7A 4W5TA 3CZCA 4MR9A 1NXTA 1F51E 4EYKA 3KYIB 2ZWMA 3KHTA 1DG9A 3JY6A 2WB4A 4ZYLA 2WY2D 1EAYA 1Z12A 1BDIA 3EJWA 3LOPA 1NTRA 1NXWA 1SXHA 3A0RB 2FMKA 4PICA 1QNLA 4B09A 2H3HA 4GPAA 4MRMB 4Z4FA 5IX8A 5KWSA 2PUAA 3CU5A 3GBPA 3OLVA 5DKFA 5KC8A 3LUGA 9ABPA 1RPJA 1M2EA 4LDAA 4EY3A 2L2QA 1Z2EA 5FBKA 1SXGA 1FSPA 1J56A 3DZDA 4O1HA 5IUJC 3RVRA 1P8AA 5HSGA 1YK1A 4Q6WA 1TJYA 2A9OA 4G0YA 4L85A 3M9XA 1PNTA 1PNRA 2NUBA 3M9WA 1M5UA 1MAVA 3LUFA 1LJLA 2R47A 5ED4A 2YHBA 1ZN2A 3P9YA 4RY8A 5HQJA 3RVJA 4GNRA 1M2FA 2A9PA 4F12A 1I3CA 3H5OA 3LUAA 2M98A 2V0NA 1D1QA 2JB9A 1ABFA 2F8SA 3BREA 4IGAA 2HQOA 3KYJB 5JNWA 2RGYA 3VNAA 1ZY2A 2LIVA 3R0JA 3K4HA 4WXMA 4MS3B 4XXHA 3JPYA 3Q9SA 4LZLA 4F06A 5T3YA 3QEMA 1BA2A 3QLUA 4OLAA 1K66A 1EFAA 1DBWA 5JNUA 5CHYA 5DLEA 2PUEA 3L6UA 3FFXA 4RK6A 2RJNA 5C5CA 5BQ3A 5IEBA 4N41A 3JS5A 4MQEA 4Z4IA 3GRCA 4WXEA 4RV5A 2FEKA 5EWMA 4KPYA 2MYPA 4M88A 4S04A 1JBEA 1W9HA 3IP9A 1DP4A 2B4AA 2Q5CA 4EGSA 4E7OA 5EWJB 4TLMB 3HSYA 5CNIA 4FB4A 4MRMA 4WUTA 4S05A 5BR1A 4D74A 1ZGZA 2QSJA 1RZRA 4WWHA 3GWGA 1NXOA 5TQJA 4MQFB 1QP4A 3IP6A 1YTUA 1YS7A 3LTEA 4OATA 2FN9A 4RZSA 4ETIA 3DLBA 3T8YA 2FXIA 4OTZA 3A3KA 1C0EA 1E6KA 2MSKA 3JVIA 2RJOA 3OM0A 4G0OA 4YCSA 4RY9A 3LUHA 5EWJA 5JS1A 2X7XA 1U04A 4LRQA 2B1JA 3FGZA 3H5WA 4G97A 5BRAA 3RVOA 4HNSA 3OO1A 4UHJA 5KQLA 3KG2A 4PEVA 4ETNA 2R48A 4LX8A 2FW0A 1PUXA 4RU1A 3F73A 3MYYA 3H6HA 5CNMA 4Z4EA 1D5WA 3H1GA 3HDVA 3CFYA 1AB5A 3IPCA 4IMJB 3K9CA 1YMVA 4TN5A 3I09A 3HUUA 4W5NA 2JVKA 5TQ0A 1LBHA 1ZH4A 1Z25A 1Z17A 4Q6BA 2MSWA 4FE4A 3CLKA 5E3JA 2M1ZA 3FFTA 1R8JA 5F64A 3I42A 2AYZA 1FFSA 3I5AA 4Z0NA 4EVRA 2E4YA 1GCAA 3EQZA 3N0XA 3CHYA 2FKAA 1JYFA 4MLCA 4QPJC 4RSMA 3H1FA 3BILA 4CBVA 5FWYA 4Y9TA 2QW1A 4MPTA 4F11A 3Q41A 3SM9A 1JF8A 3RVQA 4KQCA 2JBAB 1LJUA 4H60A 4MQEB 2HSGA 1DC8A 1P6UA 2YHAA 3QEKA 3KJXA 4N03A 2VYCA 5KC9A 3OQOA 2MYNA 1Z2DA 4P98A 5JS2A 3E61A 4IF4A 1EWTA 5TPWA 3NHZA 3SAJA 2L18A 2FTKE 2IPNA 1APBA 1M5TA 3HM9A 2AYXA 5B3JA 2FMHA 3MA0A 1A0OA 3C3WA 1URPA 1DCKA 2NT4A 2A9RA 1FFGA 4MQFA 1CYEA 2MYTA 4RK1A 2GX6A 1ZH2A 2IDMA 4ZMRA 2VK2A 4O5AA 1GLGA 3EULA 3KCNA 4HNQA 4XARA 3G85A 4LE0A 4MS1A 3MF4A 3Q7RA 3RVMA 4DQDA 3MQ4A 4G0ZA 3N75A 4MS4B 5PNTA 8ABPA 3OMWA 5GOTA 2QZJA 1YVUA 1TLFA 2GI4A 3KLOA 5EWLB 1JX6A 3KSMA 1HEYA 6CHYA 5FWXB 3OM1A 3RQIA 3BRQA 2VUHB 1SXIA 5B3JC 1KRXA 1PEYA 3DGEC 3QLVC 3O2JA 4YP9A 5IUKC 3RVKA 2O20A 2FSPA 3CKMA 5CNJA 4MS1B 2TMYA 2FQWA 1ZESA 3EQ2A 1TVMA 1USIA 1ZVVA 4N0PA 4OLBA 4RWEA 1DRKA 4IILA 1QKKA 1QMPA 4MR8B 1GCGA 1QO0A 2LP4Y 3H1EA 3OMXA 4MYRA 1NXVA 2E4ZA 3GL9A 3CTPA 3C6QA 3EDCA 3MMNA 3KKEA 1JLKA 4NICA 1VKRA 4JB2A 1OXBB 3NNDA 1AB6A 1FQWA 1L5ZA 4D6YA 3OLYA 4QICA 4G86A 4MR9B 1B00A 3EGCA 3LFTA 2HJ9A 4D6XA 1U8TA 2L19A 2E4XA 3S99A 5KQPA 2QVGA 4G0QA 1JL3A 1KGSA 4RK0A 2E4WA 4KQ9A 1NXXA 3GA5A 3F6PA 3T95A 1U2QA 4N47A 3BRSA 2HQBA 1ZHHA 5HKOA 3ILYA 4O1IA 3H5LA 3N6VA 4LE1A 4EYGA 1QP0A 1H9CA 4KZKA 5HM6A 1VPWA 3BBLA 4JAVC 4YWHA 3ROTA 1LBIA 3FMVA 1DJMA 1Z16A 4UHKA 4YGXB 3CZ5A 1PHRA 1E6MA 7ABPA 1JHZA 4JB0A 3RVSA 2PUFA 4DN6A 5I4CA 4KREA 1E2BA 4EYOA 2FN8A 1VLZA 3B2NA 3VNBA 3DGFC 2JRLA 3SNKA 1XHFA 2H0AA 4ZMSA 3MIZA 4KNYA 3GV0A 4RDCA 2RDMA 5C5EA 1DBPA 3H6GA 4XLTA 2PMCA 4XAQA 1MB3A 4KK4A 5T7BA 1YS6A 3QELA 2A9QA 1ISRA 2JCGA 6ABPA 3H75A 3HJFA 3HK2A 3G1WA 4JASB 1U2PA 2ZAYA 1JDNA 3O1IC 4NCAA 2NT3A 1BDHA 3A0UA 2IPMA 2N9UA 4RXMA 2HQRA 4KMRA 4Z4GA 5KQMA 4MS3A 4IMIB 1DRJA 3Q7SA 4RKQA 5FBHA 4YRZA 2PUCA 4Z4HA 1C4WA 4Z4CA 1YMUA 3QELB 3H5IA 1TM2A 5TQ0B 1MVOA 3TO5A 4H3HB 1XWWA 1MIHA 4IRXA 3TX6A 4RXUA 2QU7A 2XDYA 4MR7B 2QR3A 2L17A 3EODA 4G0XA 1NXPA 2CWDA 4H3KB 3LMKA 2MSLA 3NHMA 4ML3A 5IBQA 2LBPA 1ISSA 3HCWA 4KV7A 4RS3A 5D2CA 2F8TA 3QLUC 3LUCA 1PEAA 1RXEA 3UK0A 4JA2A 5DTEA 2IKSA 4F3TA 2NZVG 2VUIB 4MLDA 3RVLA 3D02A 4LE2A 1RNLA 3QX8A 1VRVA 3F7NA 2WWVD 3M6MD 1Z26A 1GUBA 3O2QB 5IULC 4EVQA 3D8UA 2ID7A 1D4ZA 3LKVA 4RXTA 2BGGA 2CD7A 4Z9BA 4NQRA 2PUDA 5TE9A 5TPWB 3C3KA 4JP1A 2PLNA 5JNTA 1UDRA 4KFCA 4RK4A
chains in the Genus database with same CATH superfamily
1LBEA 3OZIA 3EARA 1YKSA 3O26A 3VM6A 5KAMA 2RE8A 1XLWA 2EWMA 4BC1A 1DHRA 4IR7A 1LTKA 2BC9A 1CE8A 2RGAA 4H1HA 5B53A 1ZEMA 2FXVA 2HEIA 5I8ZA 4R2MA 1Q7RA 2CGEA 2VPZA 3A14A 5EJ2A 4HGPA 1AVTA 3TB6A 1B8OA 2XGMA 1N2GA 3I4CA 1RTTA 3DFKA 4AJIA 2QLNA 1RACA 4HEQA 3UJ8A 4BFTA 2G9RA 1BE0A 1OZAA 2QG9A 4MKRA 2PLRA 1TZJA 2PG3A 4YALA 2GJ8A 3BULA 3GP5A 1V47A 1G6Q1 2PJUA 1YS4A 1NUUA 1SC1A 2AC7A 4AULA 1W30A 5AMXA 4F04A 1MJ5A 2QMZA 3DMDA 3KOXA 1IFXA 4TX1A 2BCGY 4F8EA 5HGJA 4R83A 4B8YA 1QIDA 2QBYA 4XFKA 4O1MA 1AXEA 1KZHA 5ALNA 1GCOA 2FE4A 4IDFA 2WMYA 2KLHA 4F97A 2G08A 2Z8YM 3OHPA 2WU0A 4HMPA 1U2GA 4LC0A 4WOBA 4BLQA 4FYJA 4EHBA 4EVIA 3K9FC 1LK0A 3H5RA 1JWLA 2NNWB 1NW6A 1L7NA 3HMQA 3UGTA 2J4CA 1P6XA 1U8YA 3DV9A 1ZM2A 5E4FA 1C7IA 2BD0A 4J7CA 3ZBPA 4ZJPA 4WL0A 3JYNA 4EYQA 1B4DA 1A8QA 4I4TF 5TR9A 5IUNC 1X1CA 4Z7OB 2ARKA 2CVPA 2I7VA 3ZI4A 1R8YA 5BN3A 4OHKA 4G9EA 3QKIA 1DCMA 1OZGA 3DOUA 5KTTA 4P2GA 3V9AA 2GBPA 2YZMA 1Y63A 2H4FA 5GTDA 1EAMA 2RHDA 3AR4A 3PDIA 2ZS7A 4QYWA 3BGWA 3K4PA 4JT2A 3N8NA 2DCUA 1DTSA 1OIWA 2ZYWX 1KYZA 2A4KA 1EH5A 5C8VA 3QX3A 1SUFA 1JEAA 1AY0A 1ZLYA 3KR1A 4WKBA 5IKOA 3EZ2A 1H3NA 4BV8A 5CB4B 2DWOA 2CLMB 2NNLD 1NUSA 1W5FA 1X7GA 3VDXA 1U3UA 4N49A 2AI3A 3A1WA 4AZ0A 4GR5A 4UOEA 1OH7A 4G1BA 5JAIA 2A92A 2NZ8A 3K72B 2RGRA 1GUDA 1G8KA 1Q74A 4QYMA 3ZJYA 4OBBA 4W8GA 1V7QA 3VU0A 4MI3A 4BBJA 3AHEA 1HA3A 1SQ5A 1V3QE 4G8JA 5LB2A 5J43A 5KOHB 1GGKA 1M2KA 4W5RA 3JAKA 1XMOB 2YOGA 3RUFA 4TMVA 3LV8A 1OU4A 1MX3A 2D62A 4ZZ1A 4N7BA 3R6LA 1X39A 4XASA 4HD8A 1NT4A 4QL3A 3K32A 3S44A 1DWUA 2P4EA 3KU4A 5DBGA 3FRIA 3TW0A 4MOWA 1EFKA 3CLSC 1FP6A 3IR6A 1KK1A 3D64A 3Q6IA 1VFNA 4N0EA 2ZIFA 4AI6A 3CUTA 4N0MA 4MVJF 1DGQA 3V7NA 4J0DA 1SURA 4ZI7F 2JEOA 4WCFC 5IDQA 1Z45A 5AW2A 1FRZA 1IHYA 2DCMA 2W8BA 3CLTC 4FNGA 3T3GA 4YLYA 1WPXA 3QU2A 5SZKB 1JSRA 3PHLA 4AECA 4XGKA 1FUIA 5B6JA 2Y0DA 3U7HB 2QZ4A 2O2XA 1G98A 1YJXA 3ER6A 4ASUD 3EDMA 2PKEA 1KQ3A 3NJ4A 2JIDA 4IOKA 3LUKA 4BX8A 1WY5A 5KMGB 4NEGA 1UBCA 3KUXA 5LQAA 4ZOLF 3EIQA 3D2BA 2GB4A 3OCYA 4G4SP 2IIBA 4OLFA 4A6EA 4IJUA 3HVRA 4BNUA 3CS3A 1Y3HA 2WTNA 4TQUS 3FNEA 2F1IA 2PZ8A 4WNYA 3UK6A 3WLEA 3GYBA 3K70B 2FQXA 3EIOA 1UJ6A 5CX1B 1YIOA 1T4CB 4KSCA 3C7TA 3W5VA 3R4CA 1Y42X 1KY2A 1QGZA 2C8VA 3DDHA 3WYBA 5A4DA 5KJCA 4IAOA 1OMOA 1UZNA 3E9RA 2OKCA 1S8NA 1XBTA 2ZZKA 3BOSA 4PQRA 1GKIA 1IQUA 3BEDA 3CCCA 1XFDA 4AZSA 1NXTA 4ZTBA 3KYIB 4RZIA 1SVSA 2A0FA 3H0CA 2DFDA 3JY6A 4Y2TA 4Z9YA 1N6RA 4UVGA 1NJGA 3AEYA 4D9CA 1PO7A 1QVAA 4LYYA 3QUQA 4B4KA 1NXWA 1NVVR 3JSXA 3LSYA 3TTUA 3A0RB 3VOTA 5IZCA 3S8MA 2GEVA 3O3OB 1QNLA 2B1RA 3FHLA 4U39A 4B09A 3VR3D 5JSHA 1HORA 4MGKR 1J0EA 3SJZA 4V39A 4OUDA 5J47A 3PNLA 2H29A 1O9GA 2X0KA 3LD9A 1M2VB 9ABPA 1IJEA 3JAWB 1DBIA 2P9ZA 2D74A 3FB1A 4NBVA 5F76A 4EGCB 3L46A 3R5SA 4ZJYA 2CBZA 1FYXA 1QTRA 4ZKDA 3E9DA 4KPUA 4NE9A 3LWBA 1MORA 1OLSA 3B1ZA 4AZ3A 4AKHA 1O3YA 1YB4A 4MRPA 1YIDA 1O2DA 1QAQA 1S4QA 2MOKA 3GFTA 3DDUA 2NUBA 2N42A 3EVDA 3PDCA 1SGWA 3X1JA 3HYTA 4C04A 2RGWA 1F8FA 2I03A 4GU5A 2EOAA 2H06A 2WHXA 2Z43A 4F12A 4ZIRA 2MTBA 4B4WA 1R15A 4PX2A 3BTUA 3GFOA 2G5PA 3AV0B 2P2LA 1MU0A 3IUNA 2C2XA 1JZQA 3Q3GE 3BREA 4KXXA 1NWCA 3ZGZA 1K9SA 5K9ZA 3A1VA 1J7KA 3DR3A 1VJGA 4G07A 3WGVA 1E0SA 5ENZA 4Z8XA 1SU7A 1E5XA 2LIVA 2XGGA 5LD2B 3HCOA 1HC7A 4MEJA 4MI1A 2ZBUA 1Q77A 4FC7A 2IW3A 3D7NA 4LZLA 4NZPA 4XXHA 4ARSA 1EUYA 2YTZA 1C0IA 1ST2A 1KO4A 1XNJA 3ZHTA 1SUAA 5A4JA 1VC2A 2ASEA 4MHOA 1ZJJA 1WXXA 3HB1A 4EFDA 3K20A 2CB9A 4Z1MD 1LS6A 3SC2B 3RSZA 1CUSA 2HGSA 3GQBB 4MWOA 2XQKA 2WVJA 1RMYA 2IYYA 2VP4A 3PVZA 2BHSA 3CEPB 5BWNA 4KPYA 3ZK8A 1YJQA 1C30B 5B12A 2AN1A 2AWNA 2D7JA 3VISA 1JKXA 3TPFA 4EY8A 3FOAA 4X45A 5FUQA 1A5ZA 4EO9A 4B3CA 1PZXA 3BE5A 3EIFA 2B8WA 2VSFA 3W05A 4D57A 3HWRA 5A5VA 2QNBA 1GFWA 2TMGA 5FUBA 4NAUA 2F17A 1CP3A 3KJQA 4UCWA 5EE9A 1A8IA 3QQ5A 2AZXA 2JLYA 3JWPA 3HHEA 4OBEA 4QGAA 5H59A 4AO6A 2ECKA 3D7RA 4TTJA 3PYLA 3KPWA 4MNTA 4Y2PA 4CKWB 5EWJA 3H9BA 3ZHYA 5FV4A 1ZHFA 5DM4A 2ZIWB 1NLFA 5FOVA 3QNMA 4O4JA 5LQKA 2B1JA 1B3BA 3KOUA 3DL2A 3PK0A 4PR0A 3MCZA 2GPTA 3HDHA 1Y8ZA 4PLWA 4PEVA 1IZ9A 5HRUA 3K70D 3F73A 1C3OA 3DDCA 4W1PA 4CMAA 1DKRA 4R2JA 3I61A 2C8LA 4L8GA 4B3BA 4CDGA 3C2QA 1X87A 3I5MA 2VHJA 2BBSA 5DSXA 4DCVA 4P82A 1ILWA 5K7SA 1K27A 4BLSA 4F6CA 4CODB 1WY7A 2NTEA 2QORA 3I2JA 2GSWA 4HQKA 4KRGA 3V80A 2W2XA 1Y7IA 4CIYA 1ZH4A 5JO0A 2XNJA 3GHHA 5CU7A 3G3EA 4FDMA 1TQDA 2G09A 1HDGO 1L9KA 5CLFA 3V97A 1RAIA 4XPIA 3O82A 2C7VA 3WYEA 3E4CA 4F4IA 4RA6B 1WUJS 3OESA 4OD0A 4XM0A 5IC4A 3U3XA 2O0HA 1EJ0A 3LZCA 1ECFA 4RSMA 1JNYA 3BILA 5D7NA 3QF7A 5BSMA 3UCXA 3ZBTA 4V0ME 1LDBA 1XTTA 4JS0A 1YOVA 3EGDB 3TOSA 4LBYA 4Z3KA 3JZIA 2NIPA 1IAVA 1YUNA 4PGGA 1SKYE 2QDKA 3B9PA 3D4IA 4UASA 4ZI5A 4G36A 4UVDA 1MOQA 4A16A 3KJXA 2VYCA 3SMQA 1XRLA 1Z0UA 2R4UA 5JSZA 1VDMA 2C0PA 2K87A 1P0MA 1E7QA 2B3TA 3PXDA 3QFRA 4O2BA 16PKA 1IN5A 1ANKA 3MVEA 4H17A 5JS2A 4DG8A 5DNUA 1JB9A 1B8UA 5ISMA 3A6EA 3ZEIA 3F1LA 1T1SA 5FPQA 4RQBA 4X8LA 2O54A 2OPBA 1URPA 4ZC8A 4BB9A 4LMPA 3KVRA 1H6BA 5JQGB 3PC8C 4FFNA 4CLXA 3ADPA 3FPHA 1ZCAA 3M1LA 3N58A 3PFFA 4Q47A 2FPMA 1XEXA 1SQ0A 4NJEB 1CYEA 2ZJZA 1P29A 3UFBA 3FPLA 2GX6A 2P78A 5L40A 2WYHA 4HBZA 1YMQA 3WLAA 2Q21A 2QTCA 1E4YA 3HVIA 4US1R 2BZSA 2J3JA 4HADA 3N75A 1QS0B 2D1FA 2I2BA 1EQAA 4DXAA 1BOOA 3WMEA 4MDHA 4EWLA 1XLVA 4QRHA 5DGTA 4FZ3A 3KEFA 1T3LA 2FSVA 3P27A 3U16A 1EG7A 3INGA 3BXZA 1SR8A 1I2MA 3GZNB 3TR0A 2N3ZA 2RHJA 4QQNA 4ZCRA 2NQ2C 2WFZA 4AUNA 2ES4A 1O57A 4WV3A 3TNJA 2DSTA 2YQZA 1USIA 2EFDB 3L7AA 1N1MA 3WWOA 3UXMA 2DFVA 4C0QC 4DKJA 2EDAA 2REQB 3EYWA 3V33A 4F9FA 5ARDA 3WNQA 4DUGA 1RXCA 4QM6A 1CJMA 1IOVA 4AYWA 2GPSA 2HDNB 4JR0A 2WWFA 3H1EA 3G9XA 4S1NA 2BF7A 5TC4A 5HJ5A 2AVNA 2QGZA 3U56A 2ZM6B 2IHZA 4WZBA 4BVJA 1T9HA 2A33A 1UMDA 2Z98A 3QGMA 4UAUA 1OKKD 1MP0A 3LC2O 3IUBA 4KAXA 5CVVA 1BJRE 4D8VA 4RGYA 1SKUA 4JMLA 2VH5R 4MVCA 3MTQA 3B7WA 1FFYA 3QVUA 4EKGA 4DCPA 4U2GA 3AO0B 5EJEA 5G1NA 5I6DA 5IM4A 3DTNA 3ZE0B 1OI4A 2H59A 2P41A 2QRZA 4YAIA 3BWXA 5JU6A 1QO7A 4YQYA 2P4SA 2L19A 3NVDA 1OA0A 1ULBA 4Y6LA 4HXYA 4DUZB 3EEFA 3D7MA 3V7YA 1XZCA 1UMCB 2X7HA 3R44A 4L9AA 3GA5A 3SBXA 1CQIA 4GZMA 1ORHA 1QO9A 4LYGA 3DMHA 2XT9A 2AN4A 1KJYA 1XWFA 5H81A 1EI9A 1M6NA 1VYUA 1V8PA 3EF0A 3JD3A 3N6VA 3CF6R 4KZKA 5SZHB 4JAVC 1R0KA 2EERA 4TMFA 2VDJA 2Z2XA 3PHJA 3TN7A 4AJOA 5L4SA 1RAGA 3KPYA 3Q3CA 4L27A 1WBBA 1Z5WA 2XSZD 4OXRA 1JHOA 2PH3A 1T8PA 1XTUA 3CPEA 1AS3A 4RHUA 4ZHQA 4JB0A 4FFSA 3LAWA 3QPVA 1NNI1 3GK3A 1OI7A 2J0UB 4F7WA 5IHXA 4CLRB 2VDMB 4RULA 4GL2A 3ILSA 1NFQA 1XKLA 1L8LA 3D4BA 1P7PA 3JCZA 3NLLA 4WFQA 1T13A 1EDOA 4JOCA 4Z2YA 5BT8A 3V4ZA 5I9LA 1HZZC 1QWOA 2BTQB 1PR9A 1SCUB 2PMCA 2OB2A 2YWJA 2D6FA 1L0BA 2WJ4A 3JQ7B 1E69A 4EFKA 5JADA 1LDYA 1Z4KA 3FFAA 5H8WA 3WMGA 3HB4X 1TUIA 1TPZA 5IRCD 2HT6A 2YYSA 3FPBA 4PX3A 3ADBA 3HJFA 1ATIA 3EVNA 3FVTA 4E31A 2C9OA 1JFFA 2BMAA 3TL3A 4KR6A 1J2RA 4NCAA 5AI0A 4F56A 4KXUA 2P3OA 2JH3A 4KQ1A 4D9FA 3TG8A 1UKVY 1C2TA 4NPHA 4QDOA 3E22A 2CT8A 3MAGA 4E2XA 3AR8A 1E4OA 1ONOA 3OQNA 3LBHA 1AMNA 4KDCA 2H08A 2PUCA 2P3QA 1Z4PX 3DE4X 4U9HS 5I9BA 2Y27A 4Z4CA 3GLGB 3RR2A 4GVLA 1NBIA 3I9NA 5IAOA 1W2HA 5DWVA 1ZRSA 1T3GA 1OY1A 3NR2A 1O87A 4MMXB 4UTZA 2Q1YA 4HDMB 1K08A 4H3KB 5CP8A 2J5QA 1T2NA 5B1IA 2ATCA 2O0JA 1TOAA 3SQWA 2J0SA 3W8NA 821PA 1YSCA 1SHTX 3K70C 1W59A 1NAHA 3NWBA 4RS3A 5EPOA 4MWTA 3KSAC 5ALGA 1FMLA 3KLMX 3LUCA 1T6BY 1P31A 1XU7A 4PYJA 1ZFNA 3UK0A 4DAEA 4U7WA 4A8JA 4IKOA 4BKRA 4BQSA 1HRDA 4GQBA 4CL3A 4DPMA 2PSFA 5JJIA 4FZJA 4ZQCB 4LF7B 2BV3A 1G5IA 4U6QA 2H4HA 1H8ED 3OZEA 1M67A 1LLUA 2CVQA 5EUQB 1JQ5A 3THRA 1FVOA 2FUCA 2GCIA 3DE1X 1D4ZA 4UKDA 4R1MA 2HZBA 2OWEA 4GMXA 1N7JA 3WK4A 3HU3A 5K3BA 1N33B 1EGVB 4C21A 1XZFA 2ATVA 2OCXA 3N8KA 3BK1A 4MUBA 3K6SB 2SHKA 4A73A 5LC1A 1RLMA 1WUIS 4KFCA 3NYIA 4LZWA 2PU7A 3K0BA 4LY9A 1JU3A 1QYCA 2WF7A 3FIJA 2WTMA 3P9IA 5JSFA 1I51A 1TAUA 2AN3A 2WUGA 3VSAA 2ZI4A 1KL7A 3OY7A 5BSEA 2WJAA 5JOQA 4L16A 5AJHA 1RR6A 2W90A 1E3WA 3FDJA 1YDMA 3URMA 4YYZA 4CIDA 2VOEA 2WG0A 2CV1A 3B3GA 4B3FX 1DBRA 3NOQA 4IZIA 5E6UA 5J2TA 3SDZA 4GRDA 1DAOA 1LQUA 1VIDA 3E7DA 4B4VA 3I9KA 2JLUA 3ROGA 2QPTA 1LPSA 1Z6TA 4RA9A 2I2CA 2Q3JA 4JQOA 4WH0A 4EOGA 1EWQA 3FYDA 1ZWKA 5B7PA 5DP2A 3LLCA 1T1IA 3ENZA 6GPBA 2WSYB 3C3MA 1DZ3A 3WV4A 1GGJA 3UK2A 1BWSA 3WHKA 5ITWA 3C3YA 2JJ1D 3ETCA 5LXTF 1G8HA 3NAZA 3R0XA 1P4JA 2I6SA 2WHPA 5JXHA 4NXMB 3WXBA 5L3VA 3W77A 2PUWA 3O0DA 3PJFA 5DMXA 1NR1A 3A6LA 3LF2A 4JOQA 1BCRB 2AXPA 4CMKA 5DLPA 1CSEE 4BQPA 3VAYA 5JHHB 5BOSB 5BYBA 1VIAA 4XJVA 2GKGA 5JPDA 3LCJA 3E8MA 1L7XA 1V6CA 2O3QA 3U3DA 4OJYA 3UHPA 2V0CA 3UWMA 5F23A 4NYJR 2QXUA 1FSGA 4HWRA 2GAIA 4H77A 4ARCA 4INAA 1QB8A 3CVWA 1COWA 2A59A 4XJXA 3DCIA 2NM0A 4LN1A 4WSOA 5AW5A 1TI7A 5BV8A 1PEKE 3EIXA 2LE0A 2REXB 3I0MA 4ENSA 2IOYA 1BS9A 1UDAA 4CKCB 3G2QA 2VJMA 1I7SB 3I2KA 3NDPA 3QVJA 4FINA 4M89A 2A35A 4IQGA 4Z9AA 4CKZA 2VBGA 3O94A 3JQBA 1OGIA 2NVUB 1M6EX 4CG0A 3BMOA 1OZ0A 3ESAA 2I6FA 3O8BA 5JECA 4FJ0A 1JDPA 2ZAGA 1EWKA 2GFHA 3VMFA 3EVBA 3MWJA 1YC5A 4PV7A 1C4XA 1Q1EA 4C43A 3NEJA 5GZ1A 3U81A 1SHJA 3G0BA 1CK4A 1O6ZA 4WLFA 1GLNA 4I55F 3VR2A 5HCIA 2D2FA 3GZNA 4Y0AA 2DR2A 2YVQA 2FWMX 3EC2A 5B1SA 3W0LB 1KR5A 1X38A 3QMVA 2G6BA 1GPH1 2W71A 3DLAA 3KIPA 1TT5A 4KIWA 2ZUSA 1V2HE 4X92A 5BQXA 2GCPA 1WE2A 2FQ1A 1PGNA 1ULSA 2PX4A 4Q4JA 5GQSA 3VC7A 3ZV3A 4B75A 4YUXA 5B36A 2OCPA 1TB4A 3T3IA 4YXWD 5FPYA 5CDHA 5EJ5A 3M1YA 3OEEA 4JLVA 2C9MA 1T3TA 4KPGA 1AGNA 3V2GA 1M8PA 3K0HA 4PZ0A 3P19A 3GT4A 2UXDB 4L4SA 3TIGA 3JTEA 1NF9A 1W0KD 1ZGJA 1V4NA 1JWAB 5FTMA 4ZI7B 1UOEA 721PA 2XDAA 2VXCA 3MUEA 4KQ2A 5TQ2B 2VSQA 1YVEI 3QG1A 4YRPA 3MBKA 4IM7A 5CEEA 1NW9B 3FJYA 5K8JB 4LC1A 3VGJA 3GLTA 3JV7A 5KNCD 1BC5A 3MCTA 1LLCA 5KYXB 4C7OB 1EHYA 4IW3B 4C0LA 1T43A 3HN7A 1Z6AA 1PTKA 3A1TA 2D5BA 1RE1A 4Q1FA 3ANSA 3V7UA 3ASUA 3DC2A 1PZFA 3PPYA 4JIGA 4LFCB 3FTEA 1V8DA 4HS4A 4NPAA 3OLCX 3K15A 5EA2A 2O14A 5KOIA 3S2SA 2PSHA 3NBMA 3S70A 1USGA 2PMKA 3O75A 4XSGA 3G0OA 2BIFA 5H3HA 3A31A 5CNKA 3NDBB 1Y5LA 4RY0A 1KFCB 1Q1GA 3UAGA 1GU0A 2O2IA 1QRRA 4TQ9A 2ATIA 3DCNA 4DMRA 4JZYA 3NIBA 2R25B 4A0FA 5KIAA 1TRKA 3REOA 4YCCA 1DFGA 3ME5A 2CUZA 3VYRB 1EM8A 1OE0A 1SN7A 2HNAA 2ZT8A 4QUAA 4I9UA 4W5JA 2P67A 1XAIA 1I5EA 2B61A 2WJPA 4PC3A 2ZRQA 3DEZA 3K09C 1J21A 3PZBA 5FOTA 5IVDA 5KI6A 4DEXA 3RYCB 5BR8B 3TEJA 4L28A 1Y4DE 5KYUB 3VZSA 1B14A 3UEOA 3DBHB 2YWGA 3FF1A 1T2AA 4DSAA 4H6VA 1FNSA 5HF5A 2ZSUA 4NCKA 4NOKA 3WJ2A 1U5BB 1YB5A 3HKBB 2SBTA 1TYBE 4WKCA 3RT1A 2CN1A 1NTRA 5TRTA 4MW1A 1UZLA 5IKPA 3U7IA 1DT3A 1JPNA 3PNMA 4GOMD 4BXOB 4KYIB 4GLOA 1KYTA 2JIOA 4U2EA 1N5DA 2AQKA 3H11A 5AXCA 3W4JA 3HXOA 3KKNA 1CC1S 4GPIB 2G40A 2FMXA 5EGNA 3NOOA 3D1LA 1DBVO 5E2AA 4MCJA 5TMBA 4EG6A 1KAGA 1UWKA 2PGAA 4N5LA 4K3UA 4E4YA 2VEOA 5F1YA 1IUPA 3KQTA 3RVRA 3JD2A 4L2IB 3OMLA 4YEDA 5E4TA 2F1RA 4I8XA 4PGHA 5E4JA 3LVRE 5IFLA 2SKDA 1Z47A 2O8DB 5TEVA 3CKLA 4MV3A 3SPXA 5BSWA 4QIHA 1ZN2A 3K30A 1JDJA 3PDJA 1W75A 1XE3A 1DFIA 1C1DB 1O9BA 4UPEA 1R10A 2JKYA 2PSEA 1NX6A 4QODA 3USCS 2JB9A 2XYPA 3P0FA 3FRJA 4G0VA 4IGAA 3PDWA 3PHHA 3WL7A 4Q1CA 2OR3A 4RFSB 2IIVA 1M1NA 2Z4RA 3FYHA 1M54A 3SFZA 3WG9A 4PX5A 3WZ2A 2H1FA 3IAXA 4HLCA 3SCZA 4ETIA 4BHTA 1GXSA 2C2ZA 1EDDA 1RXUA 2QTAA 5LA6B 2O2YA 5JAZA 3DKIA 2VJPA 3QLUA 1QQ5A 3R0IA 2PHZA 5DLEA 3AETA 1KR2A 3OT5A 2O07A 3FWHA 1II9A 3GQVA 4QLAA 1C4OA 3N7TA 3DNFA 3RUHA 3CGGA 3JS5A 4MQEA 4RM2A 4LHSA 3ROZA 2NQTA 2IYVA 2BE7A 3MJCA 4MYCA 3JVVA 1K8QA 4EUEA 2IYZA 4EGJA 2UUCB 2VDLB 1G4HA 4UE3S 4EDFA 5LN1A 2ZCJA 3EQ7A 3LW8A 1CP2A 1XNHA 4QXQA 3JQDA 1JIVA 3U7QB 2AJBA 1C8KA 5E6UB 5AUPB 1G59A 2BFDA 3RV3A 3EOBI 1KJWA 3B9BA 1SUCA 2BUCA 2ST1A 2VOJA 3GRYA 1RQLA 3GWGA 1JXOA 3K73O 2DFLA 4HGQA 4MJ3A 4MVJM 4AG5A 4DZTA 2AEEA 4YIKA 1BGXT 5JI2E 3IAS6 3LTEA 3PUHA 2IYQA 1DJQA 1VBFA 2GCEA 3BHMA 3GLIE 4DA9A 3S7ZA 2PD3A 3GLSA 1Y9JA 1E6KA 2GNPA 1WF3A 4BS9A 4RY9A 4ZCMA 2VPIA 3W78A 3TF5A 1AQIA 3RKRA 1M8JA 1O8BA 3RJ5A 1SELA 4LHXA 1GU1A 5LDDC 5B1DA 3SYRA 3U48A 5JI3E 1CZOA 2DULA 1UODA 1RYNA 3TTXA 1L4KA 4Z4EA 1NG1A 4RTNA 3QEAZ 1RP1A 2QN7A 5A5DA 2B98A 1C3XA 1TIKA 4N1AA 4YMWA 5E0KB 3K9CA 2EL9A 4U9IS 1QHGA 4BQOA 4RJIA 2J5BA 4DTIA 1KZ7B 4EYEA 5TQ0A 3WAJA 1YGYA 1Z25A 2V5UA 3RFVA 5JSQA 4JEHA 5EMNA 1SVUA 2WTUA 3I42A 1UDBA 4TV9B 5IMSA 2AYZA 4M0DA 3RKSA 2OGUA 4HDSA 1AMOA 4F60A 1KDTA 4C0XA 5C51B 4RH3A 1Q15A 1F17A 3JVUA 1MG0A 2QD5A 1OLUB 4LX0A 5BXYA 3KYDB 4I7EA 2ZRLA 3JR3A 1L8AA 2H17A 2Q6IA 3JALB 2QW1A 1AHNA 2D00A 1IPHA 3WGMA 1JHUA 1T9DA 2B9EA 3H97A 1NQWA 1K98A 1AZTA 4QFDA 4NCIA 5IBPA 3IEIA 2VYNA 4ZDIA 3TCXB 4H60A 1M6VA 1RAAA 5BYJA 1UPCA 3NFYA 3GJTA 5DYWA 4M0MA 1ODIA 3AF1A 4TWZA 3CR3C 3M9LA 1MR3F 4Q7LA 2A0YA 3MCUA 1HEUA 2G70A 3AIOA 4FHDA 5DCYA 2H57A 1O6FA 2PT7A 1P33A 3QW2A 5LYJA 3NIFB 3UAOA 1GTL1 3FHJA 3VHLB 2B92A 2PA0A 4D6PA 1NI4B 1M0TA 4M0FA 5K0EA 5KTRA 1E5DA 4PX9A 2ZW9A 5JCOA 5GPBA 3T3HA 2BMJA 3WNCA 1IBLB 5B4VA 1SBIA 1YIAA 1HLPA 3IURA 2OV3A 3UMMA 2GK6A 2VG8A 3EZXA 3LOQA 1VA4A 3MGGA 1OF1A 5DHSA 4HZUA 1X7YB 2BJHA 3I9LA 1IVSA 4KBGA 1PD1A 1I4LD 1E1RD 1VTKA 2PBLA 1JQAA 3RTDA 3GCZA 4X95A 2NQ8A 4H16A 8ABPA 5GONB 1IK4A 1YBHA 3DZHA 1XQXA 1Y8RB 2GI4A 4FQ5A 4K9SA 2W37A 3MMXA 4P92A 2Y4OA 4QGHA 3BRQA 1XMSA 3LO8A 2D4AA 3RQIA 3ZWOA 3ZD6A 5INTA 2HM7A 2VSOA 4HXFB 1T5OA 2Q4BA 5U1PA 2NO7A 5CNJA 1G8PA 1ZGAA 5FUVA 2UZ1A 5SV2A 1CIJA 1JJVA 1DJLA 5FJIA 1DKPA 1ZESA 2FWJA 1E1NA 3BB1A 2C9CA 5FXMA 1E8MA 4B5LA 5LU8A 2O7NA 4NYJQ 1F1JA 4BEWA 2EIHA 4EZIA 5FRDA 1GTSA 2I9KA 5JXIA 2OC4A 1Y8QA 1MQ9A 3T5DA 4UNSA 5E7QA 2QX6A 3DM5A 4M37A 2JNWA 5DTIA 1A69A 1TUEA 1VJ5A 4NVRA 1EGMB 1XGKA 4TSFD 3H2ZA 4R0VA 3ZXSA 3AIIA 2OCGA 4DLXA 1OXBB 4AJ2A 1J9GA 2XTNA 3BD7A 3HLYA 4HH4A 1QCYA 5BV0A 2QVBA 2EFGA 4ND1A 8GPBA 3U4QA 5EY5B 1XWIA 5GMOA 2UDPA 5SYNA 4G86A 4IG9A 4F4DA 3ND6A 4DJ5X 1RRMA 3ZGOA 1AN0A 1W0JA 1OH5A 1Z6XA 1A9XB 1H4VB 2QVGA 2BTEA 4YFVA 2XUPA 3IUQA 4WK6A 4ZO8A 1DT5A 1XRRA 5DNEA 5ICFA 1T5DX 4OXKA 5KQRA 1B6TA 1EZZA 1QU2A 3OOJA 3QE9Y 4WK2B 4AKGA 4D9KA 1XTJA 4FSXA 3DOIA 4X3CA 1PI3A 4MV0A 3LGAA 3HL0A 4DLVA 2ECPA 3L07A 4EEKA 3ROTA 4LJYA 2RH4A 2GM4A 3PQFA 2NG1A 1PT6A 4V1CI 2G9QA 5IJ0A 1K06A 3P2MA 3ZTYA 1QCCA 3OUTA 1JHZA 4Z7QB 3PTAA 3CUUA 3FBTA 1JAXA 1CF2O 1EU1A 3ACCA 3FNFA 4CWAA 4DDHA 4D99A 2A7XA 4PNZA 4NNPA 4OGGA 1U2DA 1AKMA 3AEUB 4MIKA 5J23A 3IP8A 1E7SA 3OOYA 5BNWA 5JC8A 3WHPA 4BKOA 1C7ZA 5BUCA 1Z2OX 2RDMA 1K6IA 1ULUA 3LYUA 1FLNA 3RUEA 2D13A 1VHWA 2QJWA 5KTOA 2PUVA 3RT7A 2BGMA 1MB3A 1F1BA 3QUTA 2PNJA 4ZVRA 1DAMA 1YVRA 3HJBA 4GLJA 2JF0A 3SF8A 4DSNA 1RWVA 3JSAA 4QBFA 2CC2A 3H75A 2HDOA 3AUJB 4PTZA 1U1CA 1GGNA 2HIGA 1Z0FA 3EXEB 3TBFA 4BVKA 1RQPA 1Z75A 2XUZA 3DHVA 4J29A 2HQSA 5LB4A 5U4XA 3U40A 1LGYA 1NW7A 1U6KA 4URZR 4IIFA 3UHFA 2BMDA 3M6LA 5E9AA 2K7ZA 1VZ3A 2P35A 3Q7SA 5F9FA 3NTXA 1NC1A 3LQFA 5E2IA 1DUVG 1WUKS 4FDUA 2QTVA 4ZZ3A 3ULKA 3VR6H 3L0IB 2G1UA 2VXBA 2A0KA 3NHRA 3F78A 2G9UA 3S81A 3P9KA 5CITA 1LUAA 2DFPA 4FFOA 1YQEA 4AY3A 2FSUA 2HMYB 4YRNA 2P1ZA 2MSLA 2ZUBA 3OIUA 4Z5XA 1IN7A 1JVBA 1HT3A 1VXOA 3PXAA 1EUDB 2B8NA 3GEEA 2KJQA 4TUYF 5FYDA 1IB6A 4Z3DA 4GW3A 4K6MA 1Q22A 1FRQA 4H6XA 4KN5A 5C3MA 4LXGA 3I1JA 1CQPA 4TTVA 1F3LA 2V55B 1HTBA 1XFAA 2IKSA 3ILXA 5EKUA 3NEYA 3E3LA 3G7NA 5F9HA 1HDZA 4TXJA 4V0LA 1DXHA 1HTWA 2CXSA 1VBNA 3LSTA 4WASA 1C29B 1QIIA 3ZDZB 4BLPA 4AX8A 1S9HA 1GZ3A 3EZGA 1NPDA 4AUEA 5A0VA 3GAAA 2Y93A 4HFJA 1CE8B 3DTVD 2HHJA 3E2IA 4EEXA 2XE6A 1JEOA 3RNLA 3PC3A 4P38A 1OOEA 1O0SA 1JALA 3DHEA 2OFOA 4UDYX 2VJYA 3A4LA 4RTPA 1E3MA 4TVSA 3SYMA 3MGKA 2WJYA 1QG4A 4JSRA 3A4TA 2N46A 4LV5B 4X6LA 4ZI2A 4RTQA 5BWMA 4RSGA 3TLZA 2XHEA 3UJ9A 3U1VA 3L0PA 3C5HA 3GAZA 1W9MA 2WD7B 3FDZB 5B58T 3T9FA 5MGNA 4YJDA 3DMTA 1SXQA 1EESA 4DWJA 5AOVA 4V2IA 3WKDA 4W1SA 3UICA 1EP9A 3WDKA 2YWBA 3CH7A 3DVAA 4RTKA 2VDWB 5B7QA 3SF0A 4NENA 2VFAA 1U2DC 3L4EA 3HXQA 5IG2A 4CQMD 3IAHA 3REGA 3OPMA 3QX9A 3SSMA 1RBYA 3EFBA 3GEIA 1JJAA 2HCBA 2FP3A 3A06A 3H2GA 2FX2A 4IO0A 3R74A 4F2HA 3I3SR 4N01A 1X3SA 4CV0A 2FRVA 4G81A 4HCJA 4QBIA 4BVGA 3TAHA 3L7IA 4G4GA 4DRYA 4B35A 2ZJ6A 1K8ZB 2W6JD 1LVGA 4XB1A 1QCZA 3GLRA 3QV2A 3RU7A 2HSEA 4JLSA 3O21A 2BR3A 3CCBA 1HDEA 2V7WA 2EX0A 2BPOA 5MN5A 1BKSB 1FL9A 1AK2A 1NJ5A 2J67A 2O6LA 3DLPX 5FNVF 421PA 1W4RA 3L4JA 1I33A 1DELA 4NATA 4PZPA 3ZQ4A 1PDWA 1TLTA 2LKCA 1J00A 4YV7A 2PL9A 2O2SA 2Q0QA 3G5TA 1VRCA 4WK0B 2G1AA 1OXMA 4KUGA 1QH8A 5JRDS 3IPXA 3C8ZA 2YXDA 2VKTA 3GFPA 3Q3VA 3FYUA 5AVQA 1R4AA 1EHCA 2WT8A 4FCVA 5BPHA 4HWSA 4MQLA 1C8LA 3TSWA 1FBNA 2EZ8A 2PGJA 4QA9A 4WKOA 1P3DA 2XQVA 1WNFA 4WNAA 3WL3A 3DQZA 4N76A 3BRWD 4NYIR 3U4DA 5C9ZA 1NOJA 1QH1B 3OA2A 3DJYA 4I46A 5B1HA 1YU6A 4FFDA 4UUOA 2A0XA 5ELLA 5JANA 2Z2ZA 4RNCA 4FE3A 2D1YA 3HUTA 3E35A 3P9CA 5KNLA 1OXKB 4MRVA 2WM3A 3M1AA 1XCGB 3HJHA 4EPRA 3T7CA 3MJSA 2MSNA 3FSJX 5JMPA 3KETA 1TCCA 2P77A 1PZHA 2YJ3A 1SXJA 3EMVA 3L6OO 4FD3A 3HFGA 1HO3A 3BE8A 2OLJA 3AGQA 2IX9A 2Z3VA 2F3QA 4BTEA 4D02A 5IABA 3TG2A 2HPHA 1XYYA 4QG7A 4AROA 1W4BA 3Q10A 1OX6A 4DMCA 1R50A 3L8FA 5BWBA 2F43B 1F7VA 3P0JA 3G0CA 3GMTA 2IEYA 4EHHA 2CDAA 1KY4A 4W99A 1ZNWA 1VE1A 4TV9F 3OFNA 1UBEA 4KTTE 1BCSB 2D8MA 2R1VA 4DV2B 3MTDA 2YN2A 1Z0ZA 3WTCA 4GZLA 2LVBA 4WE3A 3D3KA 2PWAA 1OAAA 1LDGA 4MEBA 1K7XB 4YJ3B 3KJNA 4EW6A 2O8VA 1ZAYA 4NX2A 2QENA 1OPRA 4WA8A 2OQ2A 1G2OA 1SCKA 4K6KA 1ZD9A 5D01A 2I71A 3FPGA 4LRTB 4L8WB 4AX4A 1YR3A 3ND8A 2LZ0A 3KKKA 4JYMA 4L4UA 4IZHA 1Z3IX 3DM9B 4HDOB 4BNTA 1MFZA 4DWOA 3AXTA 4HWOA 1ISHA 4MYUA 3E48A 1QHEA 3DT9A 3SY8A 4DADA 3H1BA 1N2OA 5TNXA 4L4ZA 3T4XA 3N0RA 3P4XA 1S4MA 2V4ZA 2X86A 2ZAMA 4OF4A 2VBCA 3W1VA 3DMYA 1N36B 2B4KA 1XJ0A 2QOEA 1MOSA 4YRCA 4EPVA 3JWIA 1HQDA 4B81A 2O3TA 1CRPA 1EB9A 4AXXA 2OA0A 4B3GA 5FO0A 2H1VA 4RPLA 2H63A 4HNAB 4P58A 4U63A 5E8RA 3O90A 5KMGA 4AN4A 1JHXA 1QQ6A 4DGQA 2J32A 4KH1A 2P2ZA 4ND5A 4PVCA 3RG8A 4FE7A 3MS2A 1D6MA 2Q3DA 3PGVA 4W5TA 1YVDA 2XVMA 4H7KA 1SD2A 2P2NA 2G80A 4CTMA 2P9TA 5K1ZA 2XJ9A 3AI7A 3KT6A 1GEEA 1TVKA 2PD4A 2OCLA 3DBRB 3M33A 4MO9A 4PPNA 1X9HA 5AW3A 1L4MA 1M2VA 2QAGC 2Q5OA 5IARA 1MEEA 3JAWA 3OIGA 4HZGA 4JLBA 4M54A 4PRLA 4R9SA 2R5FA 3MSCA 1ZP6A 4YP5A 3F3YA 4I19A 1TVEA 4QULA 1UP4A 2H48A 1A5SB 4JKYA 4GPAA 1RIIA 5F1KA 1XROA 4YI3A 1QBGA 2ICAA 2R2AA 4D4KA 5JY1A 4KI7A 1OB5A 3KEQA 1EFLA 2PR2A 3MC1A 2ECFA 4ZYYA 4YREA 1QV7A 2MR6A 2AH5A 3OOSA 4HZIA 5ADHA 1NBWB 2QE7D 4Y6RA 3O03A 1J99A 1SG6A 5ER6A 5M7EA 4DV0B 5DIZA 1EEXB 2IH5A 4WCFA 1VA5A 5GV7A 3FUXA 1BU5A 5KPDA 4NZMA 4EFNA 4L85A 4WFJA 2JGLA 1KEEB 3M9WA 2BBTA 1M5UA 2W48A 2HMWA 2R6CA 2SCUB 1IBKB 3NQ41 1V35A 2I33A 4HLUA 4IV5A 4E5SA 1T8YA 2D1SA 3P9YA 2A5JA 1RC8A 1ODLA 3G17A 3QPDA 4D81A 1OH6A 3H5OA 4MDYA 1M75A 3V4FA 1MO5A 1SUIA 3E9QA 2R5NA 4QU0A 2F8SA 1Y9AA 5AWFC 4ZCSA 4LGYA 1X1BA 2OHVA 4IDOA 3VNAA 3PPWA 2R6ZA 1R0BA 4W1RA 4Q3AA 5FR1A 4Z9XA 4UHHA 2YV2A 4XOIA 2PO7A 5T6BA 2B5WA 3EEOA 5BN5A 3QEMA 3DPUA 2FG7C 2AMYA 1BA2A 2ZRDA 1ISGA 3LHSA 3K35A 3QENA 1SZDA 3EGXA 3AR5A 1G3MA 4KOAA 2A9FA 2UYOA 2XMDA 3C1TA 3DMNA 4X54A 1JLHA 2QRQA 5FA8A 4N41A 4HK4A 2VATA 4Z4IA 4YRRA 1L8XA 1M73E 1QRUA 1HNXB 2NV2B 4G5QA 1M66A 1Y3AA 2FFJA 4FILA 3GH1A 2YIJA 3E8SA 2DERA 4WY8A 4ZCLA 4R7ZA 1MT0A 3PIDA 1SVMA 4H7PA 5KSWB 4IZ6A 4GHWA 2V6MA 9MHTA 4I1YA 4UOQA 2NV0A 4KNVA 3HVHA 5KJEA 3RS7A 3W1EA 4F5ZA 1UC9A 4UNQA 4NEQA 4RVCA 5HS6A 1N78A 4JENA 1NBEA 3K0SA 1PK8A 4K5QA 3C6BA 3KZNA 5JHGB 3L7CA 4N3BA 4R8LA 3HMKA 3K9QO 5ERYA 2WMNB 4CM4B 1G64A 5JH7F 5TQJA 2HHHB 1JG2A 3L6RA 2XVAA 3IPYA 2QSYA 3D7SA 3H1PA 4OJMX 3UUEA 1IXYA 3AR9A 4LW8A 4N54A 2W22A 8LDHA 2ZXEA 3QI7A 4U6NA 1EK5A 1X7WA 3BRWA 3JVIA 2RJOA 4G5YA 4G37A 3BS4A 3W2FA 3U60B 1PUJA 2ZE5A 3OLQA 1NDHA 2WOOA 4HNUA 2YUIA 4ZAZA 4EUKA 1P62B 1PJ3A 1K6EA 3FN4A 5B30A 4LOJA 4CIWA 3FGZA 3A2KA 3BMXA 2VZ0A 1EG2A 4B9EA 5JASA 1E5VA 1WIWA 4ROTA 1ENPA 1UBLS 4YBZA 1UK8A 2C5LA 3A1SA 3F5MA 3C5WP 2D4HA 2Q62A 5CNMA 4LG1A 1GOTA 4JODA 1X2BA 3INTA 3G13A 4BFXA 1E94E 3DVRX 4ZK6A 5EMJA 4DBLC 1IWOA 2IX3A 3M6XA 1KHTA 4Y1EA 2IY7A 1YZLA 3FFTA 2E5FA 3NUQA 1GNRA 5E3JA 3GJRA 2HZ7A 2UV8A 2ZIZA 3ENVA 5EIAA 2WJ3A 3B6JA 3GFGA 3N0XA 1U0HC 3AWIA 4I9HA 3IUEA 3O95A 2QT0A 5CD9A 3IIMA 2IE8A 2P11A 1J8MF 4I5GA 1NXQA 3UF0A 3NDJA 1WUHS 4YMVA 4D46A 3DT8A 3O8QB 2OO3A 4F11A 2P79A 3T99A 2UUOA 4JB3A 1TCUA 4KQCA 2HNBA 3CZRA 1H2ZA 2IY8A 1WMDA 4MUXA 2HSGA 2FSHA 1RAFA 2FX5A 4M3NA 2R6DA 3CUYA 3WGOA 4NYMR 4WI1A 4ARIA 2QN3A 3C7KA 3QBJA 3B6EA 1KF0A 4MLPA 1M83A 3S4YA 1DEKA 1FQKA 5KZMB 1QK4A 3IIEA 1C81A 4IF4A 4A3SA 1MDFA 4LTMA 4BJ1A 1W73A 3NHZA 4CMBA 5ADWA 4F2GA 1Q0ZA 1P18A 4RIFA 4KWEA 3OECA 4MPDA 3ZD8A 2RK4A 3IQWA 2JLBA 1WPQA 2IYAA 3QJ5A 4NHOA 4FW8A 2K2QB 1OWOA 2FMTA 1ZOIA 2DYKA 3RSOA 2JI6A 2NXJA 3C4JA 2W43A 1Q0RA 5CVEA 4F3RA 2QTZA 4I81A 3KYBA 1TE2A 1RPNA 4OI0A 1LV8A 1L6IA 4DQDA 3I32A 3MQ4A 4G0ZA 1RBZA 1KJJA 3V8VA 1TCBA 3AQ4A 4R7GA 1RM0A 3IHWA 3P2IA 4IWXA 2P2DA 4JFAA 4LWQA 2EBUA 1G291 1F12A 2IF2A 4MCAA 1J2UA 2WTBA 1SXIA 5JNVA 1U3WA 1BQ4A 6YASA 1JG3A 4MA5A 4URUR 3HUEA 3HB0A 3WMXA 2IGTA 4R2XA 2FEMA 4BV9A 3OCVA 3OJOA 2IHTA 2DVMA 2C59A 3I8OA 1DQZA 1DIBA 1UMDB 5JS8A 2XIQA 1CVLA 2WT9A 3D6NB 4IJKA 2P9GA 3DLCA 4DMGA 1TVMA 2QAIA 3BWCA 2JD2A 2Q3BA 3IBYA 2CFCA 2PKCA 1OA1A 1QKKA 2FZEA 3FI0A 4DR4B 1RM3A 4N3GA 1JA1A 5A06A 3IA2A 2FF7A 5I9SA 2DTEA 3P9NA 1YKFA 2Q7DA 3ZI0A 4UHCA 3EG9A 5BMVB 1NFRA 2ODEA 1JLKA 4Y98A 4OX9Y 4DLLA 2NO0A 3T5PA 2Z5VA 1VKRA 2VHVA 1RZ3A 2XMGA 2AG0A 2NTNA 2YR0A 3ZX4A 621PA 2DUUA 4KO4S 4FLEA 3DOOA 4IYJA 1QIKA 4YJ2F 1GQ2A 4YAWA 5K3EA 1SCAA 4HWGA 4RVHA 4D2IA 1SO8A 2I4OA 1HT0A 1M0EA 2ORWA 8AT1A 4D6XA 3NOXA 2ZFUA 1U8TA 3RFCA 3PRHA 2QPOA 1Z83A 2MINA 3M6FA 3ELYA 4JITA 3RUDA 4DZZA 5BR4A 5CCBA 4BPBA 2C2MA 5EN4A 1MO4A 1VXRA 2OYRA 5C3UA 3VC3A 3EJ6A 1BE8A 2E4WA 1J0CA 1Y1TA 1YHZA 1XDGA 4N5IX 4NZ9A 1KKMA 3TVYA 3AZPA 4EAAA 5ARBA 1KK3A 2WSBA 2WKWA 3ZXUB 1KXZA 2HQBA 2HF8A 3QJYA 3BE6A 5TF4A 1PR3A 1FZTA 2UZ0A 1HLGA 5L7YA 4C78A 1KGDA 1JEYA 1HYQA 1WXEA 5FEMA 4UHKA 3I53A 2YOHA 2C58A 4XVCA 1IHXA 7ABPA 4YP7A 1V1RB 1Q2UA 1TEHA 2IYTA 1EK0A 3CW9A 1ZNXA 1K7FB 2CUTA 3I0NA 3ICWA 1RP7A 1AV7A 1V11B 4JKIA 3SZ3A 4BIMA 3VNBA 2BFCA 3JQ8A 5LSAA 1TEXA 2XBLA 2W4IA 3BG5A 3CEMA 3GDOA 3FWPA 1ZK1A 3RD5A 3VI3B 1KEEA 1C9DB 4I99A 4BO1A 3GV0A 5K6TA 1VHQA 5C5EA 2AE2A 1G21E 4EG1A 1WWKA 4DAOA 2HU5A 2VDQB 1NRJB 4KXFB 1XMXA 5COAA 3TOXA 5CT9A 4G85A 3NHFA 3C3EA 4JI8B 2JCGA 1JKJA 5AVOA 3ROPA 4WTOA 5BSRA 1NVDA 4MV6A 1X8XA 4L0QA 3FKSD 5A0FA 1QXSA 3V8NA 4ZDJA 5F1OA 1A4RA 1JMKC 1Q50A 3OQHA 5HBRA 4EB6A 2N9UA 2P40A 1B1AA 3HBMA 4RXMA 1T5IA 2CBXA 3GAMA 1AGRA 2RC5A 4X8MA 2EG5A 2R8OA 4RKQA 4J75A 2XY4A 2ZK7A 2A1IA 4CEJA 2NGRA 3RGWS 1RYFA 2JCXA 1FTQA 3SX0A 3ZVNA 1TM2A 4ZVPA 4EY7A 1WZ2A 4H3HB 4F85A 1JFFB 2QLFA 4L1KA 5JDCA 4GKKB 1NUPA 3NHMA 1HBJA 3KJFA 4MQ6A 2XRZA 2FWNA 5CX1A 2IVZA 2YWEA 1Y6JA 3G89A 3K1AA 4NG5A 5J59A 2Q6VA 2QT1A 5B4TA 2GD1O 4YAKA 1IH8A 1QK5A 3MWEB 1Q0UA 1RWNA 4A8HA 3GLGA 3OM9A 2C5GA 3AUYA 4KSBA 3UA3A 4MLDA 2GQ0A 3EVCA 3UANA 3I1FA 2RB4A 1PYDA 3DEKA 3PF9A 1VRVA 2O2ZA 3SZLA 4GQAA 4R9RA 4UMVA 3ZKAA 3TX2A 3DTVA 4J0KA 5BRNA 5AXBA 4IVNA 1K8RA 1KJZA 4INZA 1OI3A 1H6DA 2CD7A 2A88A 2O5VA 1EX7A 2PSDA 3FAZA 3OM8A 4I9FA 3CVOA 1KZ4A 4BMCA 2WICA 2VF4X 4NBRA 4A8JB 3ZWBA 3TNYA 1JDBC 4BUCA 1KI7A 3PITA 3F3MA 1XN4A 4B6OA 4IXWA 4O0LA 1N6IA 1XVUA 5GONF 4DMMA 2IXFA 4ND6A 3RWOA 2BI8A 1Z13A 2AF3C 3K2BA 3OE1A 3N2YA 2X23A 1GTRA 1LPAB 4U02A 1ZJ5A 3ZTWA 2W98A 4OHRA 2O4UX 2XE4A 3SFVA 3ORSA 1O6CA 2PRZA 2X14A 1LRLA 1G9XA 1SJ9A 1DBQA 4O02B 4WAUA 4YDHB 3IQIX 3PNYA 2WSMA 1A4IA 2FEAA 4G0PA 4RDIA 4L6IA 3VO2A 4BYGA 1V16A 1Z4NA 2PBRA 3IVCA 2HWXA 4K6HA 4O4LB 3VPGA 1FTSA 3IGFA 3KZOA 4ZIRB 1TF7A 1BOFA 2E2WA 1HQCA 4RJKA 1BWPA 2Q0SA 2P0AA 5C32A 2WOJA 2UUBB 2VYQA 2W2PA 3PFIA 1O4WA 3RGGA 4XUGB 1NBAA 3CNBA 3SD7A 3PT9A 5FNVB 3ZY6A 1PN3A 3P5SA 2VT7A 3OIVA 4YPVA 2HV9A 1DDOA 4JU9A 3CC8A 4AKEA 1Y7LA 1QPGA 2TSYB 3IHLA 3SXJA 4I6JA 1LSUA 4C76A 5CRIA 3OZRA 4PAGA 4HDAA 3L0OA 4MJ7A 4TTPA 2GXQA 1IK6A 3N5CA 1K7CA 3Q72A 1N1DA 1RRCA 4ZO6A 2W6IA 1C9JA 1LXCA 1P5ZB 3PEFA 4HO1X 2YC4C 4Y1FA 5F2KA 2A67A 3D8SA 2XVZA 2ZP1A 4NABA 3LQYA 2GRJA 2BOVA 1WKVA 2FMFA 3N7UA 2Q1TA 2D5IA 1X0VA 1F0PA 2VP0A 2HT1A 2IYNA 2RI1A 3HGTA 2FZLA 2LIPA 3LPMA 4MQ4A 3EW9A 1E0DA 2CUNA 3F3SA 3H2BA 3RFTA 4OAQA 5LZ9A 4XWOA 4FXPA 3HA7A 4J94A 4DREA 2HO5A 2QR2A 3PIIA 4LOKA 1ORIA 3UIEA 4WPGA 2ZUUA 5AJVB 4MYHA 5E7MA 3OP4A 4KE6A 3UMVA 1D2CA 4HHEA 4BWGA 4DRXB 1E9BA 1HFKA 4QFBA 4U2FA 4BMSA 1CD5A 4EQZA 1M1YB 2C96A 4PLPA 3VV3A 4B3HA 1VKNA 5ELMA 2O4CA 2B0CA 3ETGA 3T15A 2HYIC 3NNSA 1A04A 3N74A 4PYRA 5TQ2A 3OLWA 3C7DB 3RF6A 1ICIA 3L8ZA 3EZLA 2NACA 3AU9A 3ZDYB 4YQZA 3CMMA 5CVCA 4CRWB 1T0HB 1E1LA 4DIUA 2UVPB 1UAYA 4UCFA 2VO1A 4P93A 1M2HA 2ZBFA 3EG9B 2I3BA 3H5VA 5EYPB 1TT5B 2JFGA 3VKUA 1OYOA 3HNPA 3L4BA 5AI6A 4IJWA 5E9QA 4D3SA 3J81k 4HQ6A 5EIWA 2ZIUB 6AT1A 2PUBA 4DIOA 5CA1F 1PJ2A 1GCUA 2JANA 4NFSA 2DC1A 5A03A 1SIWA 4JL5A 3AVVA 1GNLA 3WYDA 3TRKA 1EM8B 4INPA 2SNIE 1UEXC 4PGMA 4TXNA 2VCYA 1XB2A 3T9BA 4J4TA 1Q3HA 2GN6A 2H85A 5A4KA 1P9LA 2DH5A 1HURA 4MR8A 4BNLA 1AZWA 3OJCA 2O5RA 4DJDC 3KPVA 4L0DA 1MAUA 1STOA 2CHUA 3M2PA 3RBXA 2WE7A 2K5UA 2PR7A 2D54A 4ALLA 4C4AA 1J20A 3P4YA 3QA3E 3SJCA 2J9YB 3I73A 1Y33E 4M8SA 1LDNA 1U5BA 3BXOA 1IM5A 3NXKA 4HUJA 4HX9A 3AJEA 1M34E 5AKGA 5IC5A 3FOWA 3SKVA 4KE7A 1FDWA 5JMOA 1RYDA 4KR2A 1DWQA 3AI2A 2V65A 2UZAA 4MJLA 1ZO8A 4U2BA 1II8A 3TDNA 4GKBA 4OB6A 4PG6A 3DMPA 4C4RA 2GVDC 2VHTA 3GLVA 4COKA 5JXJA 3DMTC 1N2JA 2EKDA 3EMBA 3GRFA 3WISA 4OI1A 2PX0A 4NCHA 1FXWA 1NNLA 1FFXB 3LXUX 2ZULA 2VP9A 2YXNA 1QS0A 3WSTA 1BROA 2ZYTX 1SKYB 4P35A 1IL0A 2F3TA 4S12A 3ZZ1A 3QVGB 5JE8A 1E2MA 4PCVA 4ZAFA 4EI9A 1KYQA 4CG1A 1JKJB 1SBNE 3LBYA 2Q7XA 2PUTA 1Q7CA 5B2FA 4TKLA 2PTGA 3L7BA 3MJ4A 3BXEA 3O4HA 3ICEA 2COEA 1J90A 3IIIA 4N6NA 3EEBA 3OJXA 3CZ9A 4LVNA 4G8CA 1NQ5A 3A11A 5I9MA 5JYCA 1SHUX 3HKBA 3R3HA 1N77A 5EESA 4REQB 4K26A 1GEGA 3AZQA 3JYOA 4JB8A 1FSPA 2XKAA 4C2AA 4BZZA 4UNNA 3KR2A 2J6CA 2PUJA 5HM8A 3R5FA 4FYPA 1U2SA 5EJFA 4ARBA 2FW6A 4Q6WA 1TJYA 2XUFA 5AR1A 5F2NA 1VE7A 4GMKA 5K09A 1SVKA 1YR2A 1Q1BA 1W2GA 4LGVA 3DONA 1Y4UA 4Y2RA 1ZKMA 1CR6A 1LPOA 1FPQA 3OKAA 5FBLB 5JAMA 2HMTA 1I3CA 4KXWA 2DQSA 1T2VA 1THZA 2MJLA 1GSHA 1Y37A 4PXYA 4KWHA 4DR6B 2F1JA 2FI1A 3CA8A 2XTZA 4M7PA 4XTCS 3REQB 5A3JA 2JIMA 4L5CA 4Q4AB 1NI5A 3AHCA 3VR5H 4B74A 2PBZA 1TYEB 2IEDA 5B6IA 5JNWA 1ZY2A 2IFTA 4GS5A 4ZQGA 3PBKA 2FCAA 2Y1KA 4OSEA 4WXMA 4A1OA 4ARZB 3HRIA 5A3QA 4Q3LA 4YJKA 2O8CB 4Z3OA 1I6MA 1F14A 3L6CA 2PBFA 4I5EA 4TRMA 3EX7C 2OXCA 5GM1A 4HTFB 3NEAA 2FSFA 2IHNA 1ZUWA 3ROMA 1U1GA 2J9ZB 3PSHA 5CIQA 4OFXA 4Y2JA 3NV7A 3LPAA 4MPPA 2C3YA 3SXUB 3IMGA 1KSJA 4INJA 2XTJA 3K8YA 2QL7A 1DQRA 2Z30A 5FBZA 3I0ZA 2X5OA 1UXJA 4P3XA 3ZCPA 2MYPA 5BO5A 1SHKA 3H83A 3PUVA 3DYVA 4AAYA 1E2FA 1T25A 2P0EA 4NNOA 4ROSA 2I9PA 4S05A 1TZBA 3NKVA 1QTNA 1DPFA 2E48A 4WADA 4D74A 2EWVA 2FK8A 1HSOA 1MVNA 2V7EA 1BS1A 4OMFG 1TRHA 1D07A 1QG6A 5K3OA 4FT4A 4EA8A 2Q1SA 4MMZB 1FLVA 1U81A 1TJ4A 2XH8A 3WLQA 1ADCA 1IWPB 3G2PA 4J6FA 4RFVA 5IH3A 4P3KA 4K6CA 4LKRA 3U7QA 1A1VA 3KQPA 5IW8A 3L40A 4M36A 2UXCB 2ZWAA 1G20B 1K63A 4EECA 2NVWA 3C43A 4MWGA 1IXRC 2Z57A 4O0MA 1K6JA 3WOVA 1L5SA 2HXGA 4TL6A 2B1QA 2TMDA 2HAEA 4KHZA 3I9FA 3H6HA 4JQYA 2FFQA 4LZOA 4OJQA 4YWJA 5EIEA 2QGNA 1HL7A 3VXKA 3IPCA 2HD4A 1E4VA 3K94A 3O0TA 2ZLBA 3WNDA 1YCGA 2CLHB 3AFMA 3C74A 4E13A 3WQRA 1JYSA 2Q4RA 4ZV7A 3HBFA 4DEVA 2XCUA 3AJ8A 3HFRA 4R1OA 1DZIA 1N2EA 1CBUA 2GZDA 2NTYC 1P4HA 4E88A 4UTOA 1N2SA 2C7RA 1EX9A 1T2DA 3ABSB 3I39X 5FB3A 2AJTA 2AQHA 4PG5A 2B94A 4RKWA 4EUSA 4G1MB 2CV2A 1X9IA 4KIFA 1OASA 2YJTD 4Y9TA 1PDOA 2HHAA 3K31A 5BSKA 5JISA 2YNMC 1QPBA 1GRQA 4J7AA 4POAA 4PC6A 4BRUA 5JR3A 1C9MA 1GZSA 3GLFE 1UQTA 2NSJA 3H3FA 2YHAA 4ID9A 3TFOA 3RSQA 1SOUA 1XV5A 1RABA 3A9TA 2CL7X 3F49S 4HEJA 4G63A 3JZAA 1CF4A 1H2FA 1M1YA 4YRMA 5IJAA 1UXIA 3DE7X 4PVDA 5K01A 5DSZA 1SUDA 2GKOA 3LRXA 2FMHA 2GAAA 4E2WA 3UC9A 3QVLA 1M6VB 4U2CA 1U0FA 3EXAA 2DBRA 1PJCA 4FMDB 3V1NA 2Y1FA 2GSDA 4MUHA 5ALPA 3AP1A 5KVVA 1ZH2A 1IB0A 2UVPA 2VK2A 1YRWA 3D0RA 2NUAB 3HBJA 3VVBA 1I1QB 2VNAA 1DJPA 3D7LA 4Y0NA 2UZ1B 3AM3A 4HG2A 2HBQA 3KQWA 4MS1A 3A8TA 3RSFA 2P68A 3AF2A 4QATA 4L15A 2WP8J 4BGDA 4KB5A 5DGIA 1AIPA 6CHYA 3IOBA 1HH4A 1UBTS 2I78A 1A3CA 1TIPA 2VF8A 3ASVA 3I30X 4XWTA 4DR2B 5TVGA 4AZ0B 2R3SA 1P9OA 1OBVA 3AB7A 1QONA 3ZGXA 4KDFA 4FFPA 1XZDA 4H9GA 3T1YB 1NP6A 1XU9A 1N2CB 2H4YA 3ND9A 4JH0A 8MHTA 2A3NA 3SR3A 4PPQA 4E1BA 4ZYTA 5T4EA 4NV0A 1IEWA 3CPHA 4F2DA 4MR8B 1V5IA 4I2NA 3LECA 1GPNA 2PZEA 4LZZA 4RWZA 1RI1A 3AJAA 4L5JA 5ALZA 4DC1A 1E4EB 1LWNA 3EDCA 1EFVB 1Z6QA 1T9CA 2GS9A 4RZ3A 1XPOA 3B3JA 4IL5A 1AD2A 4RX1A 5FEUA 3VH1A 4IHJF 3CBQA 4TT3D 3U0VA 3OJ0A 1VYHA 4D5GA 5CR9A 1II8B 2EW2A 2L0XA 4D6YA 5M2QA 5F5NA 3ZDEA 2OLEA 2W8BB 1ZQ1A 3CUKA 4HAUA 1CXZA 4IHKA 4PONA 4TWAA 5E7JA 5WRFA 4JYZA 4ANFA 3TH5A 3TJRA 3TLEA 5F7JA 1DCTA 4MVWA 4UU1A 5KOYA 3GNLA 4L5BA 5IDXA 2RGCA 4TTIA 4BJ5A 1RWKA 3VPBA 3B5JA 4MUIA 3FSGA 1E7RA 3UBTA 1W34A 1JLRA 2RH5A 2WYVA 2VT2A 1XQWA 1ZUD1 3USZA 4DCCA 3EXIB 1XZIA 1R12A 2VHCA 4K8RB 3ACBA 1Z16A 1JIIA 4X90A 1IG0A 3HSKA 3QFTA 2X0DA 3FCOA 1QE5A 1BRMA 1IUKA 2I8CA 2V8OA 2VP6A 1SIUA 3FTCA 3KO8A 5DYIA 1FS6A 3FUWA 5K0LA 4R84A 3GMIA 1B1CA 3R5XA 1JJFA 1L7OA 2OO5A 4EJMA 3VI4B 2BZGA 1GUZA 1MNAA 4GUDA 4PLTA 4C03A 3ROXA 3DGFC 3RVDA 3WWEA 3QTLA 3QVXA 1UK7A 4HH1A 3RI3A 2LGJA 1T3ZA 4NS4A 3JWHA 5FPKA 2FCRA 2NP6A 3M4JA 5JV5A 4ESVA 4GSYA 4MQMA 3LLSA 4TLAA 3QWIA 4YV0A 5CFPA 4CIBA 4G0UA 3IDSA 3HK2A 1R6DA 5KYXA 3D6MA 2AOUA 4QDZA 4URHA 1H1TA 2ZS8A 2ID8A 4KP7A 3BAFA 3UQYS 4B6GA 3R0QA 1UJCA 5JMTA 5I3CA 1LFDB 2EAUA 4MWEA 2XZPA 1Z37A 2AOVA 4ZOLB 5KHLB 5AM5A 1SKMA 3EVTA 2GNAA 4B4OA 3IEVA 2NLOA 3MQ2A 4QD3A 4A15A 3NGLA 3DFFA 3EVZA 4UFNA 4JYPA 3BTVA 3PQ2A 2X19A 2PPLA 4N7MA 1NRXA 3KEOA 2VJQA 1SM4A 1WEHA 1VSBA 1SPBS 4G0XA 5ES3A 4MYTA 1Z35A 2JLRA 1P1KA 2PS3A 3I05A 3KUCA 3BMCA 5G3YA 3RDPA 4XDZA 3SHWA 1ZN9A 2OB1A 3O3NB 1GPDG 1Q20A 3L0SA 5TLSA 2UU9B 2F8TA 1KYYA 3VSEA 3RAGA 4FWIB 4HAIA 1J24A 4P32A 3Q6NA 4QVGA 3ILVA 2TYSB 5LLTA 5F9MA 2IPXA 3D8RA 2H4WA 5AOCA 3FCAA 1FMFA 2D8AA 4F5EA 2VSNA 2W6NA 3BH0A 5LQSA 3FSGD 3I9JA 3HYSA 1GUBA 1CRWG 2VEDA 1EK1A 3QOWA 2IRWA 4R68A 1Z9BA 2AOXA 2RGNA 3SX4A 1HUQA 5E1DA 4X65B 3G1UA 2G5TA 4XSVA 5FOQA 4OXNA 1ONPA 5L3SA 4F91B 4TXHA 1NMYA 1ZEJA 2CJFA 1TYDE 3LHIA 1GDDA 3QIVA 4NU5A 5JEDA 5G0UA 1XA3A 2D59A 3VNVA 3CN7A 2VDWA 3GB9A 1ZL0A 3GQBA 3J81A 3ZCXA 2VTVA 1SWVA 3LWZA 4EPTA 5FLKA 1PAUA 2AR9A 4M0LA 1S89A 3AHGA 1YA6A 1E89A 2GJAA 2VPXA 3OLZA 5FDFA 4GLLA 4QQKA 4E15A 3FUVA 2ZATA 2NV6A 2NU7A 4MS4A 4EJSC 1NZDA 1ZA1A 3LT2A 3PA8A 4WFIA 3VKWA 3TLCA 3CLSD 1QQAA 1ZH8A 1J5PA 4JV5B 3F6EX 1E3EA 4F3CA 2QD3A 1YQTA 1N6OA 3OF2A 4JBGA 4MB2A 4PCUA 3X1DA 5KDDA 3BE4A 3ONEA 3TQQA 1Z29A 1DKLA 4RF2A 5EKXA 3K0FA 1GR1A 3TLGA 2HWKA 3IJEB 2FZ5A 4WZZA 1JZTA 3EMKA 4KQXA 3UW1A 4MWDA 5CJPA 1NJFA 3AKEA 2VDRB 2FR8C 5G3ZA 3D1JA 2EWWA 4MR7A 4A8TA 3AMVA 2P8JA 1J2EA 3O2SB 1K97A 1TCAA 3FCCA 2JLQA 1BMFA 3A9UA 3HI4A 4RK7A 2E49A 3NV9A 3HTXA 4ZARA 2ZJAA 2WUDA 2J3MA 5SZIA 5FBVB 3RRNA 2R2GA 2JBWA 3E9CA 3IP5A 4UE2A 1ZI8A 3UWDA 2PA3A 2PUHA 4W6QA 1OGYA 3EW7A 3RBAA 1E18A 3IKJA 3WR5A 1N6PA 2IUEA 1U7UA 3X0DA 2JJQA 4YR9A 1QB7A 1T9KA 2MYUA 2FPXA 2OECA 1XA4A 1FYEA 5FJJA 1IM8A 4C2TA 1FBTA 4G8DA 4OHVA 5HUJA 2JEYA 2Z8XA 4O63O 5K3FA 4IEIA 1Z18A 5EWMB 3HP1A 3MJEA 4Q05A 4RETA 3B3AA 2NVOA 3DAYA 3QBDA 4OYRA 4OUKX 3SIPA 4BP8A 3OQMA 4RVDA 4BLOA 1TC1A 2QTBA 4H6WA 4CDMA 5A02A 4CFYA 2PZGA 4XQ0A 3DZFA 4YAUA 2Y1DA 1NQVA 3GOQA 1N8SA 4FFRA 5KKAA 3VOSA 3WP0A 3OO0A 1SWWA 2G0NA 2QTWB 3LOUA 4A10A 4HYQA 1XQYA 4ZV4A 2WYOA 3RIHA 1KK2A 4REMA 4OAOA 4XB2A 1J0DA 4RQAA 1WMFA 4XR4A 4QQRA 4BWFB 1MZVA 3D7KA 1KBOA 1TUBB 1EYZA 1Q0TA 3Q1LA 4FR2A 4PC2A 4PFKA 4F2WA 4C5BA 1MB0A 1T2EA 2R1VB 1QH1A 2OD9A 2JG3A 4JROA 3EIHA 1JS1X 3GAFA 4OIMA 3UY4A 1MMFB 2BUBA 3FCUB 3V6LA 4CGZA 3RYIB 1CUHA 3SYLA 3PX3A 3I04M 1EQ2A 2HY7A 4HL6A 3SR0A 3FPAA 1AGXA 1HFJA 1LY1A 1PFYA 1UBSB 2GPAA 3KFXA 3M0EA 1FP4A 1N5KA 4RZ2A 3AR3A 3TIXB 1UR5A 1ZI9A 4QKQA 5CTAA 3B9QA 1D6SA 5JNRA 4LK3A 1AT1A 5KEIA 4ZAXA 2QVCA 2O3RA 4F38A 3NBYC 1R16A 5I9IA 4XWAA 2A4MA 1L1RA 2RK3A 3GX1A 5F33A 5K0NA 1ZOSA 3V3TA 4FOPA 2NP7A 4TV9A 1DV1A 3TMKA 2BGTA 1FLAA 3FW1A 3N53A 3QNUA 1VQ1A 3A28A 4GSKA 3RHZA 4L3WA 2ZOSA 5C8YF 1HF3A 3KSDO 1HFWA 1I5RA 1SH7A 1X2EA 2WI8A 2W70A 4P0QB 1OGJA 1GL9B 1PL6A 1UC8A 1W0KA 4MYSA 1L6RA 4V1CB 2I5PO 1E9AA 1U5AA 1DTWA 3AY0A 2G83A 3PQCA 3Q12A 4HB4A 3ETNA 3WQBA 5K45A 3VJRA 1VJ1A 1CUUA 2VPTA 1M10A 3GDHA 1I4WA 5CXUA 4AG6A 3ROFA 3RS8A 2JFWA 2XLBA 1J5XA 3GZTB 4DA8A 4RE6A 1GA1A 4UCXA 4KXQA 4JI4B 3R3UA 2KMLA 4D42A 1L5WA 5LUAA 1UBJS 3GEHA 1JDZA 2ZTSA 4R1UA 4WLNA 2QU8A 2X77A 4U2DA 1ABEA 3U4IA 4OCZA 4F4UA 1OZHA 2QJOA 2I1VB 3ANLA 2HLNA 4B87A 4Q3DA 3N2ZB 4OHPA 2DT8A 2HI0A 1QC5A 2JGRA 5TF0A 3GCWA 4EARA 3KOOA 4E5DA 1S8FA 5L4NA 1D1TA 1U28A 4LQLA 2JLZA 1ZIOA 3R77A 3OJFA 4BVHA 5JMWA 3M82A 2GYWA 4IOLA 2ZWMA 2IEGA 1A8UA 4EELA 4MLZA 1EAYA 5I01A 1ZVKA 1TXGA 1B6GA 1C3JA 1KP9A 1V8BA 3OZBA 2NUPA 5DGHA 4EMSA 3A1NA 3I2FA 3K9HA 3CSDA 1GAWA 2IYFA 2B69A 5E1BA 3AHFA 3DO5A 3GBPA 4X1YA 1EIZA 1FYVA 4IS2A 4WLOA 2ZXFA 4F21A 2CZQA 1ZXXA 4HAOA 4S3MA 2F1HA 1WR8A 2HCFA 1H65A 2CL5A 2HBYA 4FS8A 4Y2HA 4LBWA 3V32A 3WLPA 2Q8NA 4HLQB 2O06A 1Q7TA 4DYHA 2FLVA 4IVRA 3WK8A 1AC5A 1O54A 1J22A 5ALVA 2W2NA 1RYHA 1W1WA 4RD4A 4QJ5A 3SI7A 4UXJA 4DEYA 1JA0A 4TTTS 1BKDR 2QLLA 2KM1A 4UNRA 1GD1O 2QRJA 2ZTLA 2GBLA 4B6JA 3CRZA 3HYRA 3BMCB 4NLLA 5K3AA 3HFSA 3THSA 1IY0A 4MVJA 4UE6A 4YT5A 4EI8A 3EE6A 1E7YA 3ZNOA 2AZMA 2CB0A 3GGGA 2JFUA 4RY2A 1DQYA 1QP8A 1FTYA 3H1AA 3PNKA 2YY7A 4PZ9A 5DE3A 5C8YA 1WZNA 4QXOA 3RJ9A 4H2DA 4E08A 3PZRA 3WLHA 2Q0HA 3AL0C 3IULA 1MB4A 2G0AA 1KJNA 1E99A 4KQEA 1JPJA 3NHWA 4ZU3A 1PUIA 3C6YA 3LLVA 4BB5A 2NXWA 3K4HA 3KHSA 1G7RA 2C3PA 5GGYA 2JASA 5ANRB 2I22A 1LVHA 3COVA 2EYQA 1XCOA 1DXQA 4NU8X 4EKEA 2AL7A 2B35A 1KMHA 2JAOA 3LZ6A 4F4CA 3P4UA 3R1IA 3VVCA 5SY4A 4DV5B 1KMCA 1X15A 2EX1A 3AVYA 5DJ5A 1CCWA 1N0UA 2GEUA 2ZSDA 3TSAA 3HUDA 2WFAA 1XZEA 1PL0A 3EYAA 5LYJF 3AB8A 2ONYA 4WXEA 4TWRA 2YYYA 4HSEA 4OAPA 1VL0A 1MA0A 4TT3A 5LDGA 1ENOA 3WNVA 2IYEA 3KVOA 1SVWA 1XLTC 2J5XA 4JZKA 4X7MA 1AQLA 3KFLA 3K9BA 5LP6F 4BX3A 1ZIPA 4F9TA 2RGDA 3S2YA 3EGXB 2B4YA 4BDTA 4DDWA 3A70A 4Q15A 1PFUA 1FS5A 1U0RA 4CR7A 1M6WA 4AN1A 1CJVC 1GWNA 4OGLA 1KS2A 2EHJA 1RZRA 3DUFB 3B6IA 1E9SA 5IYZF 3V1KA 1U9ZA 3PL1A 1YU9A 2W6QA 3TIIA 3TW4A 5JAHA 1HG1A 3UB4A 3OURA 2H3EA 4CN9A 5KU7A 1YB1A 1QHNA 4OTZA 4B43A 5CIWA 4EIWA 4YCSA 1QG0A 1XZQA 3HKDB 4KKVA 1NNUA 1JHAA 1NTOA 3CMCO 3GJ8A 4G9GA 3SF8B 3OA0A 4O8ZA 4RABA 4S1VA 2DPXA 3GARA 4P36A 4I2VA 3P96A 2HCTA 3NVKI 2V6FA 3F1KA 3IJRA 2BEUB 4V0SA 4ISCA 3DEHA 3H16A 3OO1A 1NMSA 3HCEA 2JLXA 1OT5A 1NIPA 3NAQA 4NESA 1UPFA 3H1GA 2YN4A