3GWGA

Crystal structure of chey of helicobacter pylori
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY homolog
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gwgA00
3QX9A 2JK1A 1H9CA 1VLZA 1GCGA 3A0RB 2W42A 1Z2DA 1D1QA 5JNWA 1K68A 2KYRA 2PL9A 4O1IA 2WJWA 3Q41A 5CNIA 4PE5B 2PUBA 3L49A 3DLBA 3CHYA 2NT4A 1B00A 2PL1A 2IKSA 3H6GA 3QLUC 4Y9TA 2MYUA 4XFKA 1RXIA 1E6MA 4MGEA 4EVRA 4KRFA 4YRZA 1AB6A 3CKMA 1OXBB 4Z4GA 3EULA 3C97A 1P8AA 1ZDMA 3DBIA 4WWHA 5TQ0A 5IX8A 2B1JA 5TPWB 1DRJA 1JHZA 4JOQA 4RU1A 5E3JA 1ZH4A 2HQOA 3JPYA 4JB0A 1QNLA 2CWDA 4G0QA 5KQLA 4MR8A 5IUJC 5JNVA 1CYEA 4HNSA 4YO7A 2WMYA 4FE7A 4MR9B 5TE9A 2PUEA 2E4WA 4RK5A 2RJNA 1QO0D 3N0RA 2FMIA 5EWLA 4TN5A 5C5EA 1Z13A 3H6HA 1ABEA 3FFXA 4W5OA 1D1PA 5KQMA 4YP9A 1YMUA 3LUCA 1NXWA 3HDVA 4RY0A 3M6MD 3SQNA 1JLKA 3GBVA 5IEJA 1Z17A 2FVYA 2WY2D 1YS6A 3SNKA 1D4ZA 1JX6A 1NXOA 3JS5A 5TQ2A 4S05A 1A0OA 3C3KA 4NICA 4MS4A 1U04A 2WRZA 1E2BA 3R0JA 5HQJA 3RH0A 3LUAA 3RVOA 3OQMA 1SRRA 2FTKE 4KK3A 2JBAB 3HUTA 5FBHA 4RS3A 9ABPA 5TQ0B 4B09A 4ZJPA 3F6CA 3IP7A 1OXKB 5KQGA 4Z4IA 3RVSA 4MQEA 3HZHA 4MS1A 1FFSA 1Z18A 3RVKA 1YMVA 3NNNA 4ETNA 3EDCA 4ETMA 1W25A 4KNYA 1DZ3A 3LMKA 4MR8B 3DLHA 1DBPA 3SAJA 1U2PA 4D74A 4MAAA 1BDIA 2FSPA 1PHRA 3GBPA 3JTEA 2CHFA 3N6VA 4ETIA 1Z2EA 1I3CA 3LOPA 3I5AA 3JVIA 5DCLA 5ED4A 4IGAA 2MYNA 1XHFA 3MF4A 3RVMA 1TLFA 2PAFA 4F06A 2QVCA 1DJMA 2PMCA 3CG4A 1SD5A 4JA2A 4W5TA 1SXIA 3DZDA 2E4VA 4Z4FA 3OO1A 5CNJA 3EQZA 5TPZA 4RV5A 1LK0A 5CHYA 1MVOA 3F7NA 5TQ2B 1JFSA 3CFYA 4MS4B 2WJAA 1FFGA 2QVGA 4G0ZA 1KMIY 3O1HB 5CNKA 1F51E 2FMHA 4RY9A 4YWHA 3DGEC 2FLWA 4MS3A 5D2CA 5BRAA 4NCAA 2JB9A 2L18A 2MYPA 4F3TA 3RVNA 4MS1B 3JY6A 3CZ5A 2FMKA 3GV0A 3SY8A 1C0EA 2AYXA 2IOYA 5IEBA 1KRXA 3GWGA 3TMYA 4LX8A 2IPLA 1GCAA 2FEPA 4WXEA 1C4WA 3KJXA 4EGSA 4RDCA 3QELA 5TPWA 4E7OA 1ZESA 1UDRA 1SXGA 1LBHA 1USGA 3E61A 5EWJB 3DGFC 4DQDA 2PUAA 2PUCA 2B4AA 1VPWA 3H1GA 4RKQA 6ABPA 3EGCA 1BA2A 3O1JC 2GBPA 2ZWMA 5JNSA 2PJUA 3EQ2A 1QP4A 2FKAA 4RK1A 2WWVD 2PKXA 2YHAA 3H5WA 2CD7A 3HXMA 4D6YA 4MR9A 2LBPA 4RK0A 2FN9A 4TMYA 3QLVA 2GWRA 4HYEA 5HSGA 2HQRA 1QO0A 1TMYA 1EWVA 1ISRA 1ZITA 1S8NA 2FMFA 1NXPA 5PNTA 4YR7A 5ABPA 4RZSA 3A10A 5B3JC 3Q7TA 3O74A 2L19A 4MR7B 2PUDA 4ML3A 1LJUA 4MS3B 3LUDA 1ZH2A 3H1EA 5I4CA 1EWKA 3IPCA 5IUKC 2I6FA 4YGXB 4YS6A 1NTRA 1NXSA 4QYWA 3I09A 2FQXA 4IMJB 3MIZA 3RVRA 1DCFA 4F8JA 2R48A 4FE4A 4RKRA 4RXMA 3GYBA 4QPJC 2H0AA 2JBAA 4N47A 3O2QB 5KC9A 3H5VA 2R47A 3QELB 5DGCA 1Z15A 5DKFA 3JVDA 2HPHA 3KHTA 3NNSA 4EUKA 3QX8A 1YIOA 3CZCA 3RVPA 3QK7A 3EJWA 3N75A 3M9WA 4KQCA 3OQOA 3ILYA 3IP9A 3IDOA 1QKKA 1YK0A 3K4HA 3C3WA 3C6QA 4KZKA 5FWXA 1PNRA 3EAFA 3HSYA 1L5YA 2QZJA 1JBEA 3LUJA 3TB6A 1EAYA 2MSKA 3CTPA 3SM9A 1YTUA 1F4VA 3OM0A 4XXHA 1P2FA 2OENG 4KMRA 2JCGA 4XARA 3LUHA 2V0NA 2HSGA 1YS7A 1JDNA 1U0SY 4GPAA 1VRVA 2ID9A 3RVQA 2MYTA 5CNMA 4Q6BA 3RVJA 4JP1A 4O1HA 1Z25A 2OQRA 3OO0A 3MM4A 1PEYA 1XWWA 1FSPA 1TM2A 1ZY2A 3HS3A 5T7BA 2NZVG 1HEYA 3QLUA 1M5TA 1BAPA 2FLKA 4KV7A 4N41A 1JYFA 3KYIB 4IF4A 2IPNA 2PE5A 1AB5A 1ISSA 2IPAB 3H1FA 3W9SA 2F8TA 3G1WA 2JVJA 3P9YA 5FWXB 1GUDA 2GKGA 4UHJA 4EY3A 1JFVA 2TMYA 4H3KB 4LRQA 3KCNA 5EWJA 3O2SB 3URMA 3MA0A 2IYNA 2VUHB 2VYCA 1DRKA 4S04A 1ZHHA 2MSLA 2JVIA 3K9CA 4G0YA 3EODA 2LUOA 2NT3A 2AYZA 4D6XA 2QR3A 4YLEA 3HO1A 5F64A 4G0OA 3O75A 4MQFB 2QXYA 4RK7A 3JPWA 2PUFA 3CLKA 3NNDA 3HJFA 3IPAA 1QQAA 3KKEA 4LE2A 2R25B 2HJ9A 4L4UA 3OMXA 3CU5A 4MR7A 3IP5A 2YHBA 3T95A 1CHNA 1MIHA 4JB2A 1DC8A 1IIBA 3OLWA 3HCWA 4WUTA 2GX6A 4RK4A 1YVUA 4G86A 3Q7SA 1ZVVA 2FXIA 1RZRD 1L5ZA 1Z26A 3FGZA 4G0XA 5IBQA 4Z9BA 3NHZA 3N8IA 3LTEA 3OLZA 3OLVA 5IUNC 5FBKA 2QV0A 4KVFA 5BR1A 2P4UA 1JWLA 5FWYB 4E7PA 2JVKA 1T34A 3OLYA 4P1ZA 3ROFA 2FEWB 2FW0A 3OLXA 4OTZA 5DTEA 2M1ZA 2QU7A 4O5AA 4TLLB 2E4XA 1URPA 3CRNA 3KLNA 1DCMA 3UUGA 1KGSA 4Z4CA 1MB3A 4P98A 3T38A 5KQPA 3BILA 4LE1A 5HM6A 2DRIA 1KRWA 4W5RA 2ID7A 4JASB 3TD9A 4Q6WA 4L85A 3LFTA 1JYEA 1QMPA 1TJYA 4HNRA 4LZLA 2NUBA 5T3YA 3UKJA 1BDHA 4NCBA 1RNLA 1ZGGA 4N76A 1K66A 4RXTA 3LUFA 2FN8A 4PYRA 4F11A 1Z12A 2NZUG 1QPZA 4DADA 3HVRA 3ROTA 4Q7EA 1GUBA 1VKRA 3HDGA 1QP0A 1NXXA 3RVLA 3GA5A 3N53A 2M98A 2E4UA 1YK1A 1APBA 1E6LA 2MSWA 3GL9A 1NY5A 4FB4A 3N0XA 3T6KA 1D5WA 3HUUA 4KQ9A 2P9HA 2PLNA 1BVHA 3L6UA 8ABPA 3HM9A 3SG0A 4CBVA 5EWMB 4PZ0A 4EVSA 5BRJA 2XDYA 3Q7RA 4G0MA 4OG2A 2RDMA 2FQYA 5GQSA 4EVQA 4MRMA 5JS1A 3LUGA 4F12A 2X7XA 1JF8A 4YCSA 1QQBA 1PEAA 3UK0A 1EFAA 2FQWA 5IULC 1QP7A 2VUIB 4W5NA 2H3HA 3BRQA 1R8JA 3CG0A 3A0UA 5BQ3A 5KI6A 2O20A 1Y1LA 4WZZA 6CHYA 1DBQA 3BBLA 4RXUA 4EYQA 2LPMA 3OMWA 3NHMA 4MQFA 3O1IC 4UHKA 3TX6A 3HEBA 4RSMA 4EYOA 1WETA 4ZMRA 3I45A 3KSMA 2PUGA 4XAQA 5GOTA 1XHEA 3F6PA 5B3JA 1ABFA 3O21A 1NXVA 4ZYLA 2A9QA 3B2NA 2LP4Y 3KG2A 4ZMSA 1ZN2A 1M2FA 4GNRA 4LDZA 5C5CA 4RWEA 4Z99A 1FFWA 4NV3A 1E6KA 5JNUA 4KREA 3H75A 1A2OA 3GRCA 5HKOA 1P6QA 1MAVA 4IRXA 3QEKA 5JNTA 4RK6A 1PUXA 2GI4A 3A3KA 4MPTA 1RZRA 1RPJA 1SXHA 1LJLA 4MRMB 1DC7A 4PEVA 1M2EA 1DBWA 4OLAA 3MYYA 4Z9AA 1LBIA 3BRSA 1ZAYA 1J56A 1EWTA 3M9XA 3ILHA 2N9UA 4N0PA 5JS2A 1M5UA 2A9PA 3QEMA 5FWYA 4KPYA 4Z4EA 4WXMA 5JNRA 3H5TA 1NXTA 1JDPA 3LUKA 2A9RA 3LKBA 1DG9A 2R4QA 2WB4A 3FFWA 4RY8A 1P6UA 3OM1A 3QLVC 2Q5CA 2A9OA 4NQRA 2RJOA 5EWLB 2L17A 3BREA 3NBMA 4TLMB 2BGGA 4M88A 4OLBA 4EYKA 3IP6A 3N0WA 1W9HA 1USIA 5KC8A 3KYJB 3MMNA 4H60A 1NATA 4JAVC 4QYMA 3T8YA 3F73A 2JRLA 3D8UA 4MLCA 3G85A 1TVMA 3D02A 3I42A 3HV2A 3TO5A 3H5IA 4W5QA 4LDAA 1PNTA 4G0PA 3RQIA 1Z16A 1GLGA 3FFTA 2E4YA 2CHEA 3MQ4A 4N03A 2HQBA 2QW1A 3GT7A 3S99A 4Z0NA 7ABPA 3FDFA 4YV7A 3FMVA 3VNAA 1ZGZA 1MB0A 4DN6A 2IDMA 3QLTA 4IILA 1BDJA 2E4ZA 1A04A 1U8TA 2IPMA 4QICA 3C3MA 3QEMB 4Z4HA 1U2QA 5KWSA 1USKA 4EYGA 4PICA 1RXEA 3CNBA 4HNQA 2ZAYA 4MQEB 4OATA 2J48A 5EWMA 2QSJA 2L2QA 3KS9A 4XLTA 2FEKA 1FQWA 2LIVA 3Q9SA 4LE0A 1EHCA 3CS3A 5DLEA 4MYRA 4N0QA 4WT7A 5IC5A 3KTOA 1JL3A 3H5OA 4IMIB 1JH9A 3H5LA 4KK4A 3HK2A 4KFCA 3O2JA 4G97A 1DCKA 4H3HB 2RGYA 1CEYA 4XASA 3VNBA 2VK2A 3KLOA 3E3MA 2F8SA 3Q15C 4ZPJA 3OQNA 1JFTA 1D2AA 1DP4A 4MLDA 5TQJA 4OBBA 5TPZD 3LKVA
chains in the Genus database with same CATH superfamily
1LH0A 4I2VA 3PNVA 3TF5A 2GXAA 4HGYA 1Z2DA 4U63A 2VK4A 3MRTA 1EFPB 5AW8A 2OHVA 2PUBA 1Z9BA 4KBFA 1TYCA 2OBBA 3ZJYA 5C3MA 4QASA 5JCJD 4M4SA 1E58A 2DUMA 1JQLB 3O31A 4XD7D 4A36A 4L57A 1DV1A 3BIXA 2BHRA 1A82A 2FW7A 4UKDA 4YAGA 4XOUA 3K9LA 2XE6A 2LNDA 3KB1A 4IJWA 5JADA 5JI3E 1N78A 4L07A 3L3BA 1JHZA 4GECA 5E3JA 3RM3A 3WAJA 1NW4A 2QOEA 2HQOA 4MI3A 4RPKA 5K45A 2JJYA 5BSKA 1RLOA 4G1VA 3C4VA 1LBEA 1WF6A 1U4SA 5TARA 5IUJC 3TSOA 1FPMA 3HKDB 1XCLA 1OY1A 1AKUA 1U98A 4GMFA 4UD6A 1CDEA 5JOQA 1L3CA 2BBTA 4J03A 4KR7A 5EQFA 1K92A 1DAOA 5FTWA 1QZZA 4MICA 2ONYA 4GQBA 4EARA 5JVDA 1FUEA 5HFNA 4AY4A 5EZYA 4WH0A 3IB3A 4ZO6A 5JXGA 2IHVA 4YP9A 2JFHA 2Z2YA 4EKYA 3CLUD 3DW3X 3FR8A 2HK6A 3K7EA 5KPJA 1PTJC 1PQUA 2Y1XA 3Q7EA 1TA9A 2O3RA 1EDBA 1QK3A 1J2EA 3DOHA 3GUHA 2PCLA 2RARA 3P5SA 4GX5A 3NHUA 1QV6A 4I3FA 4M8IA 4Q03A 1WCWA 4ZOLF 2PZBA 3RH0A 1SU6A 2XUIA 4ND7A 1SVNA 1PU2A 3CLRC 1AKQA 5IF3A 1HDYA 2F3UA 1AX9A 2BISA 3ZZ1A 4D5GA 5AVTA 3D0OA 4Y2RA 1VXOA 2YKGA 3G8DA 4K9OA 3AOEC 4RZ2A 3GI1A 3ZYZA 3UOWA 2AG0A 4P0QB 1CUDA 4BC0A 1A4RA 3QBDA 1Z2NX 3L18A 4MR8B 5EE0A 1J70A 1P2TA 1U2PA 2ZT5A 4LYDA 4NU6A 4BMNA 2E87A 4PLCA 1JRLA 4NBUA 1WP4A 3C5HA 4INZA 2ZJ4A 4UM5A 5A5VA 2CVFA 3C3JA 4MB6A 1HM5A 3HCNA 4P4SA 2EFGA 2AQKA 4OYRA 1NOIA 2DWQA 2IXGA 3ICWA 1H8ED 4NR0A 4O4HF 4Z0TA 2O8CB 2WFZA 3JVEA 3OJ0A 4MXDA 2V4ZA 1A7AA 2CFCA 3FTFA 5KO2A 1P0MA 3KUXA 4TWRA 5J2UF 1N2BA 3OI7A 1E9RA 5FOQA 2ZWIA 1KIMA 1H65A 3IKJA 1SU8A 1VJDA 4R98A 1MIOB 1GA1A 5CNJA 5CHYA 5INTA 5LR6A 1GYRA 3K16A 3UJ3X 2N1BA 3FSGA 2ORYA 1QUEA 4MWSA 4CLRB 5MF6A 2XZLA 2ZVQX 2QVGA 4Y2JA 3GJ0A 4DR5B 2V6IA 4JXZA 2X42A 1P5FA 2DCMA 1HMYA 4PSVA 4WCVA 4ON9A 5AM3A 3NVKI 4OHCA 5AKLA 1XD9A 1NI4B 2FPPA 1CQWA 1H3FA 2JCVA 3EZGA 4FJ2A 4MS3A 5D2CA 3X1KA 3DMNA 2JB9A 4BO9A 4MMYB 2O0KA 4M0FA 3EPJA 2MYPA 1JMYA 3QXCA 4OGKA 1JKFA 3R0QA 3ZCQA 821PA 3K1YA 2OFWA 3CPSA 1FXWF 1MO5A 1N2HA 3NBXX 3VSDA 4BOYA 3HLTA 3GWGA 4O4IB 1QF6A 2F1IA 3KBOA 2P6MA 5P21A 1S3GA 2RH4A 3OEYA 1TK9A 1YCGA 1UWVA 2QVXX 2VHJA 3B3QA 3STYA 1QCCA 3ER6A 5DX0A 2FDRA 3KWFA 4M54A 3WGOA 4LBWA 2YWGA 3CN7A 2HB6A 2PUCA 1R6UA 3DMTC 4K28A 5FH9A 3EGCA 5IYZB 2FXVA 2GBPA 1Y8RA 1Z36A 2PX6A 4X91A 1XZ8A 5GM1A 4QQ8A 2LE0A 3A9SA 4HXEB 3RRYA 3H5WA 1GPAA 1R27A 2CD7A 2G28A 2PS3A 2P90A 3PYXA 4MK4A 1NPDA 4PPFA 5LFAA 3QXXA 1XP5A 4K0KB 1JHPA 3ZV5A 3QVUA 3SF8B 2JL1A 4LY9A 2RB4A 4KH1A 1F1JA 2M6KA 1E5XA 2GLXA 4BQFA 4X1OA 1I7DA 3LP6A 3SYRA 1ESDA 3DE3X 2GD6A 3FNQA 2YVQA 1SEVA 2P5TB 3WQBA 4YV7A 5H7XA 5I4CA 1NJSA 4KPEC 1L1QA 3MB5A 3ONEA 1QO7A 4RF3A 1SURA 2J5QA 2OM6A 1NTRA 4RELA 2Q3MA 1XLUA 3RWOA 1LTKA 5AUNB 5JISA 2VSOA 1W96A 1QRAA 3MIZA 3OJEA 2BJWA 4LDJA 1T5LA 5F5LA 1TM7E 5JWRA 3CLRD 5LP6A 1OYWA 3A6HA 1U0EA 1XTZA 3ECSA 1XFDA 4QPJC 4YY3B 3I01M 2P4SA 5ECYA 2ZSKA 1YQDA 1F6BA 5KYVA 3NNSA 1I24A 4HXGA 1G16A 1U28A 1T9GS 2HX1A 1LTHR 4P22A 4D45A 1BGXT 4QVGA 2VK1A 3GGPA 5IBPA 3HWSA 4AK9A 5GZ1A 3OE5A 1XNRB 5J4LA 2B1QA 2CVZA 1JAYA 1LV8A 1V1RB 3CYFA 3AM4A 3DP9A 4FGLA 1VL0A 3LQ1A 3E7DA 2QROA 1OU0A 4QEZA 3CCCA 3KJGA 3ND6A 4N3NA 2C2OA 1CG6A 1F4VA 2QLTA 2ZWPA 2C2BA 2AHRA 2OENG 3VOSA 4BN0A 1I6WA 3S3TA 2L0XA 4F92B 3URKA 4A7PA 1U9YA 3QBEA 1AQJA 1R1DA 3RPEA 3FTEA 2DAPA 1OREA 3G1UA 2NTNA 3RYCA 2H92A 1Z25A 3OUZA 5LQAA 5DOVA 5GTDA 4C01A 4XDGA 5KYUB 4LC1A 4N5NA 1RP7A 4CG1A 2VCYA 3EF0A 1ITZA 3LC7O 3KNZA 3EUFA 3F74A 4V24A 3WFJA 4YPOA 1U0LA 3ZXSA 4DMHA 4Z51A 5MFZA 2HPZA 2P78A 1XQ1A 4BAUA 2ILTA 3C3AA 1BGVA 1L8OA 3D8RA 2IEBA 3GFTA 3AEKA 1IEVA 2G9QA 2QRPA 2VCHA 3M49A 4TTJA 4AMBA 3SKVA 4AJ4A 4EEXA 4B3GA 3KIPA 4AUMA 3BPSA 3GJ4A 3E1KA 2WIGA 4REQB 5JZ9A 2O7RA 4GI5A 1NBIA 1TYDE 1Y3BE 3HL4A 2R9VA 4O08A 4RESA 5K3AA 2YS6A 4X1IA 3MUOA 4B83A 3WDSA 4IXTA 3KO8A 3RK0A 4YR9A 1O6GA 5MN6A 2BR5A 3T9AA 13PKA 5E0OA 2VT7A 4DHEA 3ZZTA 4EPTA 3G9UA 2XD9A 1V4VA 4WI1A 4S04A 1ZJ5A 4TV9B 4FEEA 4D0SA 2CCJA 1AQUA 2AYZA 2SKDA 1WVIA 2HNBA 4LXHA 4XCVA 1KE1A 3BJMA 5TJHA 3KT3A 2PZAA 3VPFA 4W8OA 5AKHA 1T2AA 3U13A 4LEIA 3T7CA 3SQOA 1QQ7A 1A5BB 1W5EA 3OMXA 1KK3A 3VDRA 2RC6A 3WKAA 1JR3D 2D62A 3UHPA 1OHHD 1RQNA 2X8AA 3EBPA 1UIRA 1CRQA 3UOAB 3IQFA 4L4RA 1COZA 1K4MA 2HQSA 4IICA 1C3JA 1RHMA 3SZRA 3FUTA 1D1SA 5D1HA 1CJBA 2CLHB 2PSJA 3FHLA 3GLTA 2FFAA 3GRUA 3HCWA 3SIXA 3EVDA 4AX8A 1ZVVA 3CNHA 4R3NA 1UOEA 3GFFA 1GNLA 3GN2A 3H13A 4Q01A 4TQUS 1Y5MA 1NHWA 2WBLC 1FU8A 1L5ZA 3VZCA 1PR0A 1UM9A 1WDWB 3I1FA 5SZHB 1KBZA 2DT5A 4N7RA 5CCDA 2UZ3A 3J81k 1TOAA 2FSGA 3CX6A 3N3AC 4LYYA 5JO0A 1YUMA 4GM0A 3THXA 2BR3A 4Q12A 2YVLA 4LPKA 5AW4A 1IVYA 5LXTB 5CTJA 1U7PA 4EG6A 2PH1A 5HJ7A 4BO5A 3H99A 1B8OA 2WWFA 4COOA 3IJPA 3K6RA 3BWXA 3QP9A 4XYLA 1W73A 3KLNA 4DWWA 3WV5A 1RWQA 4P98A 4OJTA 4AY6A 4TKVB 4F3RA 1QAOA 1EI9A 2C1EA 2UU9B 1US8B 4AUNA 1TAGA 4E7OA 3U16A 3JZDA 3R4VA 1QNFA 3NHJA 2VAWA 1HRDA 4JGBA 4IIJF 1SWVA 4L3OA 4RX1A 1YQTA 1OI3A 4XJTA 3FY4A 1L5HB 4HB2A 5HCIA 3ROEA 3WRXA 2V45A 3FE2A 4R1LA 1B6RA 5DSZA 4DAEA 3UENA 2HLHA 1JYSA 2VSFA 3UJHA 1SD1A 5JYDA 1E2JA 1Z29A 2VDMB 2AC7A 2OBNA 2OHHA 2ZUCA 3JZFA 1G7CA 1NP3A 4MLZA 1S96A 3ZK7A 4DADA 2UUBB 1WMDA 2ZTSA 2B8EA 4Q7EA 1Z4PX 5DTRA 1QP0A 3HCPA 2ZRHA 4UU1A 3V7YA 3O9MA 4DIFA 1ZJWA 4IXDA 3KB6A 1M2OB 3B6EA 1JG1A 1ZA2A 3HUUA 5IHPA 3R5XA 1ZW6A 3OZEA 5CFLA 3G7SA 1T2EA 2ZJFA 2QR5A 1QORA 3FWKA 8ATCA 3X1MA 5EJ5A 2EEPA 1MDBA 3W2FA 1KJ9A 1J5PA 4I5IA 3KU4A 5HKLA 5HNKA 4EIWA 1GRVA 1HT2E 4FNMA 4RGQA 2HUPA 2W2VA 5EMMA 2O2IA 1Q0QA 4YUYA 3RABA 4EH1A 1YR6A 4E32A 4IXMA 2ZJBA 1W34A 2ZJ1A 1VCOA 2WSSD 3NOXA 2BUCA 5KI6A 2HTEA 5KAMA 5T4HA 2EW1A 5H5JA 1CJKC 4G24A 4UHKA 3I9KA 5BW6B 1JR6A 3U7FB 2I9KA 1O54A 4EENA 1C4KA 5EI5A 2CF6A 3EY9A 1DX6A 3UAOA 4LPSA 4C06A 4D4KA 4HDAA 2QRVB 4EOGA 4CM4A 5K8UA 4X8OA 2AFIA 3LQQA 3DV0B 2OXRA 2UUCB 4O4LB 4ISBA 2XCUA 2AWNA 2FGKA 5A3SA 4CMKA 1BJTA 1ACLA 3PEWA 1MAWA 3GEDA 1UBTS 3GRYA 1ZGHA 4NL4H 2Q6IA 4TVBA 1KEEA 3LBAA 1R8YA 1DFGA 5AVVA 1G19A 1XMOB 4DM4A 2MINB 3W90A 1N8SA 3K1TA 2AW3A 2LDBA 1OQAA 1Y7TA 3A3KA 3N5CA 1RPJA 2VNSA 1D0SA 2CJYA 1J7JA 1P0CA 4DDKA 4R2IA 3IPLA 5COQA 2MR5A 1AV7A 1M2EA 3BTSA 3E8XA 5DO9A 3RSGA 3MYYA 4DSTA 1N92A 1P1CA 3LPLA 1G7SA 5KTPA 1ZAYA 3MBOA 1XVLA 4MA0A 1UWKA 2ZB3A 4NAUA 4NV1A 4F4HA 1Z88A 1PBNA 4JROA 1FIUA 1IN1A 2OZPA 1GUAA 3NTOA 1PO7A 3QRWA 4FGSA 1SJ9A 1TF2A 3G5LA 1OBFO 3PDCA 4PAWA 3TOXA 4C4AA 3WHLA 3EH2A 2WB4A 3BCHA 3HWWA 3L41A 3UG6A 2AKAB 3D8HA 1ZM7A 4ZMBA 1M7HA 3EFHA 1EFDN 2OHOA 5JVDF 3JV7A 4F97A 4NV0A 4ZI7A 1OLSB 2GNOA 5L3QA 2F1RA 3OX2A 2HWKA 4NQRA 2WK1A 3BREA 4E08A 2WYOA 2CXTA 3FRJA 3Q8MA 3CNQS 4YWJA 4C0SA 1REQA 3MCTA 1S1MA 1LKZA 3N0WA 4I6GA 3RIYA 3T54A 4PYMA 1KYVA 1GZ3A 1V7ZA 4W6ZA 2GPSA 5E4JA 4PV7A 1N36B 4I5EA 5AJUA 2H1OA 5CP8A 1G4AE 4CCWA 3RQIA 4UNSA 3BKXA 2QX9A 1KBOA 1FP2A 4GBED 3BN3A 3RB8A 3TG2A 1P1BA 2QU8A 2C3YA 2WJGA 3MJFA 3EG9B 4NBLA 4LMPA 4P34A 5LP6C 2QRKA 3DVSX 1Y82A 1U2RA 4WXYB 4B17A 3L05A 1WRBA 4S24A 4CQNA 4QICA 4LXTA 1Z68A 3C5VA 3DEKA 4JIMA 2C4MA 5D87A 1U28C 4ESOA 1W2GA 3JQGA 4GPD1 1HV8A 4WFKA 1Z5PA 5TMDA 4EYGA 1SZDA 4LN1A 3EGXA 1ML4A 1JE0A 1P75A 1YJAA 1I51A 2LIVA 2EBUA 2Z04A 3VU8A 2GJSA 5H3HA 3WGHA 4AZVA 4KE9A 3ADBA 2XRYA 3EEOA 1CUUA 4B76A 3KOZA 5HIJA 4HTAA 3V4PB 1G63A 1C3LA 1ID1A 4RVHA 2TYSB 4AURA 3MWKA 1XYYA 1DIHA 2R6ZA 4JUFA 5IJ0B 5IJWA 4J8PA 1JH9A 4JMPA 5IF9A 1CRLA 4MHSA 4V0QA 2W2XA 3CE6A 3HP7A 1N0WA 1NBOA 2I4TA 2Y4NA 2XMBA 3MERA 1DAEA 4YQZA 2ID4A 4WCFA 5K5EA 3VUEA 4CMGA 2IDKA 4NDZA 2GF0A 2JAHA 1F8XA 1Y6QA 2V3VA 5EINA 1L5MA 1QFXA 1E2NA 3LTNC 1DKMA 2VA8A 1QANA 3U7QA 1NKVA 1RLUA 2YL2A 4Q16A 4ZEVA 3I73A 1BFDA 3FSGD 2HSZA 3A0RB 2DUJA 3C74A 3BMCB 4JYCA 5JAPA 1IQRA 2FU5C 5C53B 2PXCA 2ZSDA 1K97A 3DLBA 3MLAA 4B6OA 4WNYA 3MSCA 1CBUA 4R9UC 1FUUA 3LVQE 1R4NB 4BFCA 1JLSA 3NIDB 3TZQA 1NUQA 4UM7A 2J0EA 2VP9A 3S81A 1VE5A 3VYRB 4X00A 1N1MA 5FFNA 1C29B 3ZGVA 1RXIA 2JFXA 4JJ4A 4JS0A 5CIQA 4CIWA 3ASVA 1KMMA 4NOJA 3ZDZB 1X1DA 4WWHA 4NBKA 1LDYA 5ALDA 4P80A 1NQOA 3U40A 3SIRA 3IAM1 2PBFA 1E2KA 4YT4A 2ZUDA 4JJGA 2CWDA 4KUGA 4M38A 4NNPA 2WJ6A 4QDZA 4G8BA 5FAKA 5KQLA 1AK2A 1EPUA 2XZPA 1ODSA 2QN3A 4DDVA 4P3KA 1JTEA 4TL8A 5JC1A 3ZQ4A 3SSOA 4PBTA 2FPGA 2OCKA 1XEWY 4EBBA 2NZJA 3DBHA 1Z06A 4LDPA 1IWBB 4WEQA 4N48A 2KI5A 1CR2A 3FNEA 4U0KA 4ECAA 4W5OA 5CPFA 1YMUA 4OQQA 1ZC4A 2VN8A 4BMDA 1BJRE 3GDOA 4AKEA 5LP6F 4HZIA 3G89A 5TEWA 1QM5A 3BAFA 1R74A 2O1XA 1F1BA 3T41A 9LDTA 5JSZB 3VKFA 4O02B 1M6NA 1D6MA 2HF9A 3E58A 5CEEA 4N01A 1ESCA 1TAQA 2XXBA 2ATCA 2DJIA 5FBHA 3L82B 3IA2A 1SK8A 4GHWA 1QVAA 4RMGA 2GPYA 1P0FA 5F73A 4BTLA 3ZLVA 5KU1A 1VM6A 1WF3A 2QUHA 3E0XA 3IP7A 2A35A 2WUVA 1J39A 1R9MA 2R6R1 4WZAB 1W5SA 4JDPA 4TMZA 3ENKA 4FIZA 3C43A 2HCJB 4KNYA 2EVWX 4P81A 5EGSA 3NUQA 3ZGLA 3BYZA 4NU8X 3FBWA 1PEDA 1Z37A 4ZYUA 5ALYA 3RC1A 1DJOA 5T8KA 4F85A 3GRVA 5K8LA 3KYDA 3JTEA 4W7SA 1XZQA 2CHFA 5ALJA 3OOWA 4FNOA 4C30A 1K7SN 4MI6A 2I6SA 4CMHA 1GCOA 2H85A 5FDFA 1QLJA 2A2ZA 1JIJA 3BCUA 1IG0A 3Q85A 4YQEA 5E6SB 2I8AA 1J6UA 4FMDB 4C29A 3WYFA 4JGGA 1W0KA 4JLOA 3T4UA 3ZWDA 1FS6A 2FEAA 2V0GA 4KYIB 4FFNA 3CG4A 4OHPA 3LY8A 1KFKB 5A06A 2XGGA 3V8PA 3WRXC 2E4VA 2NSYA 2W2LD 2Z9DA 3F5DA 2ZAOA 3I4FA 4WPGA 1TRKA 4HDKA 1CQJB 2Z6VA 4QUBA 3BL5A 3ZU4A 2YVAA 2ODQA 3CFYA 3W1EA 3G68A 4Y6GB 1FFGA 2NU8A 4G0ZA 6YASA 4WY2A 5ADUS 5JMWA 4RY9A 4I19A 4S35A 3TQIA 3PQ4A 2SKEA 3KOYA 1IB0A 2VNIA 2WNSA 2YOFA 6LDHA 2W4MA 2JLYA 3LCMA 4IO0A 5HKKD 2EJBA 2A5LA 3DHYA 2BZSA 2VBFA 3GPLA 1W35A 5K6TA 3A32A 1XNQB 3T3DA 1T4GA 3HFRA 4LV8B 1GKUB 1NZFA 3QWHA 3TXAA 4X90A 4UHBA 1E2UA 3W2EA 2QL6A 1JDBB 3RJ5A 2JI9A 3RKUA 1I4TD 2GBCA 2Y1LA 5E9JA 4BLVA 2R2GA 5AOAA 4PNPA 3O8QB 4V0OA 4O25A 2WD8A 3DQPA 3H04A 3NT2A 4G5GA 4HAYA 2R8EA 4IEIA 1G21A 2IHTA 1JDVA 2WLSA 4J0HA 2PUJA 3SXJA 3ABRB 4WZAE 3ZHOA 4DRXA 1PQ4A 2W0MA 4L2IA 4MJLA 5B30A 5AM5A 4W1RA 1RRKA 3VHQA 1AC5A 2GCNA 4MV5A 1KJ8A 3B8HA 3LYUA 3M4XA 5CM9C 3TYXA 4DKXA 2GWRA 1BMFA 1OH5A 1ZJ6A 4HH0A 1SB9A 5H9WA 5JS7A 4G1UC 1PLKA 4Q3OA 3FR7A 3A9RA 4KNVA 3GD7A 4C7OB 2Z1MA 1O77A 1AIPA 3WRYA 3ORQA 3ZD9A 5JD5A 3HJBA 3LO8A 2R7AA 3H1EA 3R0XA 4TTPA 1S3IA 4KQEA 1QYRA 4KXMA 3KKNA 1F0PA 3D6MA 1FVFA 4MH0R 4QYWA 2BVNA 3S2ZA 2OPHA 1IBLB 2PEYA 4UUMA 3T7RA 1Q17A 4BO8A 1E9EA 4L4XA 2IWHA 3WQQA 1O3YA 1X1AA 2JBAA 5L7WA 1OC2A 1AM4D 2QAGA 3F9RA 1SKUA 3GOHA 3D7KA 1KAGA 1BMQA 1V7PC 3B9QA 3WKDA 4MWCA 3RVPA 2EW2A 1SCAA 2I4NA 3W2IA 1CIJA 4YAJA 3FMOB 3QYAA 3HJUA 5GZ3A 5LMZA 5LN1A 1ZD9A 1G9XA 1KYZA 2QIPA 3AM5A 2PGDA 2NYRA 2LXNA 4MRSA 4RDIA 4AU1A 1ECBA 3VGJA 1NAHA 2AYYA 1SH7A 2YXPX 1ZEJA 1XKXA 1RJEA 2RAUA 3IUPA 3CTPA 2UYHA 5GJVC 2ICAA 1L4HA 2A5YB 4II7A 3A11A 4DC0A 4GZLA 1E2MA 1VGVA 3UPUA 5KSWB 3I30X 3KSRA 5E95A 1KO1A 4HZUB 4NE9A 1K6EA 2ZI6A 3RHZA 4FFVA 4GBJA 2KQUA 2D2XA 1EWYA 2J7PA 3GLVA 5ALOA 2ZULA 1GEGA 2WJJA 2YW2A 2H2AA 2OBFA 3EA5A 2D0OB 2IY7A 3WDKA 2YWEA 2PZLA 1I6MA 2ET6A 5L40A 1JEQA 3O3MB 2JA2A 1V5IA 5ALNA 2YHSA 1IM5A 2ZRDA 4KFTA 2WPDA 1PEYA 3V2IA 3NDJA 3OU7A 4DJEC 2CUKA 4ZN6A 2YH2A 3FXAA 1P81A 2HBRA 1PZGA 1NVKA 2O4CA 2IIPA 4J0JA 1FMLA 1SVIA 3UG7A 4IF4A 3TEMA 1U0OC 2WV7A 3JALA 1SOUA 2GPNA 2IPAB 2HJSA 3VC1A 2UZIR 3ZQJA 1WUHS 4TQ9A 1Q2UA 5A02A 4N82A 5FLKA 3K9QO 1J07A 1GDDA 1CR1A 1SHJA 2B5WA 4ZVLA 5M7EA 1YQEA 2XYGA 3CW2A 2IS4A 1Z08A 3BB4A 5I7VA 4E2XA 4Q3BA 2FR8A 1ML3A 2CW5A 2B35A 4M9QA 1R88A 4DC9A 1OLOA 2I4MA 1HL3A 1M6WA 4AF6A 4ZGBA 4U7FA 3B6MA 3IOCA 3IT3A 4X20B 2LUOA 3NBYC 2Q3LA 2O06A 3EFEA 4WCFC 1LDGA 5DEIA 3TD6A 4AJIA 5FTLA 4G0OA 2C61A 5HZHA 1CD5A 4FYIA 4C0JA 4DR7B 4LAFA 4MB0A 4C2UA 4X66B 1SIOA 2I5PO 4HDSB 4EUFA 1FYWA 2ZWAA 2YV2A 3QKSB 3KOMA 4EP1A 4RJIA 2A0KA 4U6NA 2V7UA 1E0DA 1ZRSA 5IAOA 4PU0A 1WXEA 3NT5A 2HBQA 4MSUA 1OBVA 2O2XA 3W2GA 2P75A 3L84A 4QA9A 3UC9A 1H0HA 1Z3IX 5HVNA 4X9XA 1SQFA 4B3HA 1P3JA 1FU4A 1DC8A 2C9DA 2FZCA 3RQSA 1FFHA 4BQEA 1R8SA 8LDHA 3UAYA 2XGOA 2ZDGA 4RK4A 5ICSA 1KO8A 3P0JA 1N2CA 1AA6A 3E9CA 4QEDA 4EHAA 5FPTA 2NYAA 4JP2A 4BNDB 4YRMA 3AF6A 4UEWA 2P5UA 4DQLA 3WQRA 3LWNA 2GAFA 3LTEA 1XZLA 2FRVA 1KDVA 2AVDA 2FW1A 3IIJA 5IUNC 2NQTA 1O6BA 4CIVA 5IABA 2WYHA 4JBNA 2GO1A 1M33A 1PT6A 4IIUA 3VBEA 1K3UB 2VDPB 3D3NA 1W36B 1QG6A 3BD9A 1NT4A 2D2FA 3DE0X 4Q18A 2DUUA 2EL7A 2BHSA 2ATEA 1A5AB 4M1ZA 2GZSA 1ECPA 1GTG1 1NLUA 3WK7A 4ZZ3A 3CRNA 3OZIA 4JR1A 5COBA 4C4TA 3CF2A 1WPGA 1V8ZA 4IM7A 4QJIA 4FT4A 4RSGA 2NZYA 2DFPA 2EGGA 1JVSA 2Q0XA 3NBZC 5GV7A 3WYNA 4EY6A 2N3ZA 5HWSA 3GPBA 2RK3A 2ZI3A 4CKBB 1Q1NA 3LPMA 5JWHA 1ZPDA 4DOMA 3GLQA 4FE3A 3H4MA 2D74A 5FHQA 2MSCB 3A4LA 2MOKA 4BEWA 3KKKA 4POAA 2LW7A 1OFVA 4HNRA 1EXVA 2AKEA 4BXOA 1AKTA 3L06A 4QPPA 1THMA 1OFUX 4RHTA 1YVRA 4UOQA 1PX2A 1Y9ZA 3VAAA 1UFVA 4QU9A 2Q7DA 4DRYA 4NULA 1EX7A 4DM7A 3FWPA 3DB2A 2ZSAA 4C3VA 1BJKA 3R9XA 2FG6C 2V0CA 1QGYA 5IN5A 3A1NA 2PYIA 4ZHSA 3TTUA 2DFKB 3D4OA 1NXXA 4GZMA 4DCSA 4AUKA 1HE3A 1X8XA 5FOVA 2JH9A 3TFQA 4P2BA 4EG5A 1X1EA 5ALQA 3Q6MA 3TE6A 5KJ6A 2QRMA 4Q1BA 3ZZNA 4ZT2A 3RAEC 4CT4B 1RWVA 3LXMA 4N8EA 4B2YA 3GQVA 4LOJA 4R1OA 4RD0A 4TS1A 1DAMA 3AINA 3GG9A 3HYRA 4EVQA 4HNTA 1L1FA 4CCAA 4RHYA 2C8JA 5T8KC 1L4MA 3GG2A 3ZE9A 1ETHA 5KDOA 3ZVMA 2ALJA 2WAOA 1N0IA 1OX5A 2B69A 5I01A 3G8YA 1V95A 2Y2VA 3W6ZA 4ZC1A 1Z2AA 2NVBA 4PVCA 3TGPA 1PJAA 4B2LA 3NHMA 1SXQA 1K0FA 2XBLA 2CLIB 4IH4A 3D1JA 4V0ME 4LF4B 1GFIA 4EYOA 3WGUA 1U8ZA 1UMBB 1D4FA 2X5JO 3GFBA 4MJXA 5I9BA 3HYCA 2QTCA 2Z3WA 2M9MA 4C89A 3HHEA 2H1VA 4HWGA 4DLSA 1C9NA 1M6YA 2J9YB 1T1EA 5KJ1A 1SHKA 4WNAA 1VL6A 3B6KA 4PLZA 3T7SA 2BLLA 2Q6TA 5LZ5A 1F8GA 2X9NA 4OHOA 5CT5A 5EG5A 3U3ZA 5A4DA 2OVBA 3GVIA 3G0BA 3PITA 4LVOA 5H80A 2JZOA 4HB3A 4UXJA 4EYEA 2LCQA 4FT2A 5JNUA 2QY9A 2Y1CA 4XWKA 4AWXA 4BP8A 4KREA 2O19A 4G5HA 3QEKA 1V0JA 1OYYA 3AY7A 4EF6A 2JFVA 2CUTA 1M73E 3DFIA 4JLVA 4QOEA 4AZWA 1II8B 5FUXA 5FADA 2XLCA 2P2CA 3A6ZA 3L4SO 4PX9A 1LGYA 3BD7A 4EKDA 3SXUA 1GA4A 2ETXA 3L6RA 2V1XA 1PL8A 1ZONA 3OD1A 4HWSA 1SC9A 4NZYA 3VHRA 5IT0A 4JSTA 2XEDA 3TKLA 1YZNA 4LCJA 3QNMA 5AIAA 3TL3A 2FP4B 2QLLA 4D9KA 3HWRA 2CFRA 1E7YA 2Z95A 1A95A 1PJBA 3AWDA 1MX3A 4YBZA 1JMKC 3TLCA 3T3EA 2TECE 3BGVA 2IZ5A 3UJPA 4PLTA 1CVLA 1WIWA 4Q4HA 3FYHA 5FNVA 3B48A 4MKXA 3WLIA 1LPAB 3WMWA 1NVFA 3I5UA 4Z7QB 3ICOA 4WDRA 4QZVA 3LYHA 1TYBE 1X19A 4ZYXA 1Z7BA 2HLDA 2GPAA 2QZ9A 4FYWA 3I5XA 4ZWNA 3TZCA 4NCKA 4C0AC 1RJ9B 3Q9UA 4L7QA 3W7AA 3ENQA 2HEGA 3LFHA 3WRYC 1CULC 1Z47A 4HPWA 1OV6A 2XQIA 2XUFA 3G85A 4NBNA 1KVRA 3I2FA 3IOYA 3M4NA 3P8ZA 4K8RB 1PNTA 4MVJP 5HEKA 3VOTA 3TLAA 1N5RA 3LGXA 2CHEA 5A3RA 3K92A 5J2TB 4MW0A 5K8JB 4ZO7A 2B1GA 1EIWA 1I2DA 1DINA 1EK6A 4FFDA 3OWOA 1GL9B 1TM5E 1YUBA 5DX1A 3DZCA 2P27A 3VV3A 3THWA 4GG1A 1C3EA 4O2AA 5F1OA 2V5UA 2QAGC 2IPMA 4ND8A 2C4WA 5CGQB 4ENTA 2RBGA 2XDWA 4QQNA 5G0SA 2H4XA 4KQHA 1W4BA 5KWSA 4QTTB 5A9SA 1Y9JA 3E23A 2IEZA 3OJXA 1IY1A 1XZIA 4GP6A 1BKYA 3U9LA 4BGIA 1EA5A 1M1NA 3BHJA 3CXUA 4UM9D 1UBUS 2F8LA 5LNK6 2OP1A 1SOWA 3LDUA 3DOEA 1N1EA 5A4AA 1SVMA 1DS6A 4RV9A 2OFFA 2CFOA 3LPNA 1E61A 3P19A 2IC5A 5K0JA 2J9XB 5E8JA 2ZB2A 3AIIA 1WXWA 4KXXA 1PFGA 2NVOA 2L42A 2X23A 4DJFC 1W0KD 4IFIA 2C29D 2GN8A 4YK7A 3IQWA 3Q3HA 4ZOCA 2C07A 4BDSA 3DHVA 4UHHA 2FPXA 4H15A 2HCFA 3CF4G 2C83A 1K8XB 2XHEA 4N54A 1GGMA 3QBVA 3V1NA 1D2EA 4FFBB 1AQNA 4ARCA 1R4ZA 1CWUA 4RWZA 4XGIA 3IH5A 2JFGA 3TN7A 4WRRA 1RRGA 3WLFA 3WVNA 3SWWA 3DEZA 3H8SA 4JI2B 1DQRA 2GFHA 3IAUA 2ENWA 2KYRA 1L8AA 1Y0BA 2WJWA 1NMQA 3JD2A 4E5DA 5CLGA 4ZCPA 4BS9A 2PL1A 1B00A 4CWAA 4YMTA 4GO1A 3LHSA 5C7LO 2OBXA 3SGLA 2VAVA 2YJ5A 3I61A 4KWEA 4D4MA 4JYMA 2QMHA 4Y9TA 3OZFA 3UMGA 4JUCA 2YMQA 1FTYA 5K0LA 3LLCA 4IGEA 1R16A 3IKLA 3HA2A 3AONB 2EW8A 2WD7B 4GOLD 3ISTA 3QKUA 1R15A 1ULHA 4NJEB 1WWKA 3WL8A 3W2HA 4JC5A 4W63A 1TQ8A 1ZCJA 1TXGA 2D2EA 4KR9A 2UXCB 5HTKA 1CQIB 2KM1A 3CUKA 4PGFA 3GRAA 1KJIA 1NR7A 1RQ2A 1UDXA 2HY7A 1T2NA 3C7CB 3JPYA 3N2KA 2FR8C 2X76A 1MAAA 3BFJA 3RUFA 1FX0B 4FKBA 5G3ZA 1UQUA 4Q3KA 2WTAA 3GJ7A 2RG7A 1HYQA 3IDQA 4HGNA 4HNSA 4JWTA 1XEXB 1SULA 4FBMA 5IKOA 4DCTA 5HJ5A 3GLIA 4AY2A 1LCIA 3TRFA 4AZ3B 2IYTA 2OCBA 3SN6A 3HKCB 1N57A 2JI4A 3CGGA 4J1NA 4KQWA 4O33A 4ZJYA 3UWOA 2VTKA 1S2OA 1CPYA 2AQ8A 5DN9A 1OAAA 1ADYA 1PZFA 3FPLA 4NYIR 5JO9A 9GPBA 4B6GA 3OKAA 4CN9A 3GFQA 3ZKWA 5AOVA 3FCEA 1M7GA 5CK5A 1ZCBA 5I9IA 1HOTA 4DSOA 2EZTA 2ZYAA 2I3AA 1IY0A 3TOCA 1NXOA 2OYCA 3WYGA 1A0OA 3DAPA 3TNDA 3UYLA 3WIVA 4ERXA 1LDMA 4OLJA 3CZQA 1KR2A 1SEPA 2GCGA 5G0WA 2I80A 1G42A 4RS3A 1WZ2A 3KQQA 5FOWA 4M1OA 2DHEA 3GJSA 1YCHA 4P33A 1QYWA 3PUJA 3RUHA 3HADA 4MS1A 4E09A 1TMGE 2PKQP 1YMVA 2JNWA 1GGKA 1VMDA 2WWWA 3Q7QA 3WMGA 2ECKA 1DZ3A 4RMHA 2DGDA 4YC7A 5BSTA 3G9XA 5IZCA 3EQ6A 4JI4B 4Z2AA 3UXMA 3X1XA 4DEXA 1XTJA 3CLTC 2RGCA 4YRTA 5FTNA 4GSKA 1KYYA 3KUKA 4HTFA 4GDMA 1J0EA 1QCYA 2BE7A 2YMMA 3G7NA 4EY3A 4KWHA 4TYMA 4KGZA 3AW9A 4MW2A 1K2VN 1P17A 4NECA 4R2WA 3T5DA 4BVEA 3WLAA 1SPXA 1UKCA 3K6KA 4PZDA 1GKLA 1ZGCA 3K9WA 2EV9A 2H4HA 4W5TA 3TMKA 1Y1TA 2KPOA 2PT6A 2ZJ0A 3GZNB 3DZDA 4HEJA 4P92A 3QG1A 2PA3A 4MTCA 2J7PD 4I6JA 2NUTB 1XNJA 1GADO 2NPOA 2R1TB 4L27A 4QDKA 4D26A 2AG6A 4XUCA 5TQ2B 4B85A 1JFSA 3QWBA 5I7AA 3G23A 5HS6A 3SSMA 3E9DA 2G1AA 1W4CA 2WPDD 3B1YA 4GR4A 4DY6A 4NXNB 1KDZA 3OIGA 5JR3A 3KV3O 1JECA 4WBSA 1YU6A 2A59A 1TCAA 1FK8A 5AJTA 1AN0A 1JEOA 4NCAA 1MEJA 5EJGA 3U1TA 3E7WA 1U1GA 4GUAA 4B82A 2FPLA 2KW5A 1Q1EA 3PSHA 1IM2A 2V7QA 4PYOA 4AW9A 3BZUA 2YIVX 4LX8A 1CEEA 2ZYIA 1GTMA 2EL9A 4EGSA 1Z22A 3C14C 5DBOA 3W79A 1BE0A 4ZRMA 1IN5A 1T0JB 1LBHA 3E61A 3LIPA 1LK7A 1RTTA 1YAJA 3GUYA 2B4AA 3JYOA 1QYXA 1LRKA 3KEFA 3UJDA 4NQZA 4BJ3A 1JV2B 2FWNA 2PZMA 4CQLB 5DXAA 1ZM9A 2IEAA 1HLDA 3LECA 4FOSA 2ZETA 3I9OA 3FKJA 2XDAA 4UCQA 2B0CA 4RK0A 4CLEA 4D5EA 4EGCB 3UXYA 5C46F 2OMKA 3E22A 1F8UA 2J3DA 4RO0A 1Q7TA 4DAOA 3QKTA 5DGXA 3KOUA 3W8DA 3MCVA 1LZLA 5EZSA 1YI8A 2BGRA 1S2NA 5EIBC 2A1IA 4BFXA 2ZR7A 3O74A 4RLSA 1RKVA 1N2GA 1Z63A 3HMQA 3LUDA 1OT3A 4NCHA 2C94A 4NC9A 1K3FA 4KIUA 3ZIAD 1LPBB 4UBMA 2H59A 1J20A 3NCHA 2P1DA 1GN9A 2C2GA 1RE1A 3GOQA 3OJLA 3QUTA 4IMJB 1DCFA 4GX1A 4ODIA 1PJRA 2AG8A 4D82A 1G8HA 1YQUA 4M1QA 1TRHA 1KO5A 4MCJA 4MNTA 1JA0A 4IIEA 3I8XA 3SKXA 2VJAA 4HMPA 4B33A 2AK3A 1RLJA 4D46A 4E4RA 3A4NA 1BYIA 1IY9A 1TU0A 3C1AA 3JVDA 3KHTA 3OQIB 5CU7A 3DWGA 4RPGA 3CZCA 1Q6YA 3FNRA 3SYMA 5JHGB 4FN4A 4QOSA 4QYTA 3GLFB 2GKOA 8GPBA 1G0NA 4AG6A 5FI1B 2WT9A 1IN8A 2F64A 3IDOA 3X1JA 1WEKA 4D0LB 1WZUA 1EAMA 4R54A 3QY0A 4FD2A 1PS9A 2W6ZA 2WSBA 3FZYA 3C6BA 1GNVA 2DSTA 3SFVA 4G5SA 4OHFA 1F48A 4GLFA 3CC8A 4KQXA 5ER6A 3BCSA 2QQ5A 2AVNA 3S27A 5LC1A 5IAAA 2CMKA 4GLBA 5EXPA 1I0LA 2VDRB 5I5GA 3TH5A 3RRZA 1D0IA 3QKRA 1J97A 4JZKA 3X1WA 1B3BA 2HSGA 1Z4QA 2ZJ5A 3HCBA 3JD3A 4IHJF 4JWKA 3ETEA 1IHYA 1NMYA 3DVAA 3S1LA 5B36A 4RHFA 4C4ZA 5KMGB 5L8VA 3FNHA 1NI3A 1O03A 1ZA1A 4TWAA 4UMDA 1DG3A 3IUYA 2BJHA 4XKJA 3RRJA 1M8PA 4TQGA 2G09A 2XOKA 3ZU5A 4FDTA 3L8MA 3L1JA 1S2GA 3F90A 1Z0UA 3VTFA 3TVYA 1TM2A 1DZIA 2GZHA 2YJZA 2D5BA 1BAPA 2WSIA 5CXUA 4E21A 2QTBA 4GSYA 4B6EA 2AI3A 3IDAA 2ANBA 1TM4E 4DT1A 4HNAB 4X62B 4AQDA 2I8CA 3KZVA 3QSYA 4M0DA 2I2AA 3H1FA 4F4JA 5BWMA 1XQXA 2QI9C 4UTOA 2QTWB 1A7KA 3S44A 2H2IA 5K99A 4Z0HO 2EG9A 3RT9A 2QSUA 4EA8A 4Z7NB 5BN1A 2WEKA 3BF8A 4EUNA 4NPHA 1IJBA 4OAQA 3E9RA 1OIVA 2XB9A 2J3QA 2GPJA 1GD1O 4ADSG 2XXAA 2DP4E 1WJGA 3PLAE 4MIKA 3HXKA 5KHOC 2QN6A 1ZZGA 1PZHA 1OH7A 1P7ZA 4XUDA 3GLFE 1Z75A 3OHSX 4Q9KA 3SC3A 5IC6A 5J23A 1J5EB 2XKBA 4UVHA 4LGYA 2ZRCA 3D1LA 2I9PA 1XWIA 4XLZA 5FB3A 1LNZA 1U5BB 4KZPA 4B2IA 3RK4A 5LJIA 1Z5NA 1ORIA 3R74A 5HKBA 5EIBD 2QTNA 5FP0A 2FV8A 4RCZA 3T4EA 3CXRA 3NHWA 1NX6A 5B7NA 1NSTA 4PFQA 3GAAA 3U81A 2QUZA 3JWGA 3LDAA 3QMVA 1DUVG 1B0AA 2X5OA 4XI9A 1A1VA 2DH5A 3D3EA 3SYTA 4D9NA 1T3ZA 1MNQA 4HAOA 3EGEA 5AK4A 3C6ZA 2VJDA 4KITB 1DWPA 4ZAXA 3UJAA 3G2PA 2DPMA 2FK8A 3N7TA 4NYIQ 4GLLA 3KLMX 1VB3A 3BUSA 2X6TA 4UDNA 3HVIA 4MUHA 2HHLA 4HKTA 4LXXA 1IHPA 3AY0A 2BZ0A 1E77A 3TIXB 3NANA 5CM8B 3QH4A 4JLAA 2UVQA 4AN4A 1HKUA 1PFQA 2H17A 2HU8A 2VHTA 2YZNA 1E9VA 4N5IX 4A6EA 2GXSA 1X87A 2H1HA 3CRQA 5AIBA 2Z09A 1EFVA 1MC5A 4MWOA 2EZUA 2NZ2A 3NHRA 4P1ZA 1RKBA 1W85B 1JXOA 5B3AA 4UAVA 3ROFA 2Y0EA 1E5DA 2QU7A 2WAMA 3IS3A 3TZLA 1B1CA 1WCYA 3IESA 3PPWA 5FNVF 4RQAA 5I48A 2GYVA 3UUGA 3DT8A 4KRYA 3K6SA 2I71A 3QSGA 3VO1A 3U4CA 4B80A 4PTLA 5ALEA 3CEMA 1E2PA 2FWBA 4DA0A 2ID7A 3U4QB 1HA3A 4CM5A 2OV6A 2CC2A 2C5HA 3CONA 4TMVA 4KMSA 5DHAA 4BJ5A 2RSLA 3VTAA 1WA5A 4N49A 4WK2B 5JJKA 3IKMB 1N2XA 1P2UA 4K9SA 2BFCA 4HVLA 4IZIA 4AO7A 4A1FA 3EXIA 1BXGA 3E9QA 2I3GA 2RIPA 1CW2B 2IUYA 3TLJA 1Z0DA 4O2AF 3BWYA 1DBSA 4DLVA 1F2TA 5HGXA 2DR3A 4UPVA 4AJNA 4RDHA 1TUBB 3C8UA 1O2DA 4KQ9A 1P1FA 1Q1QA 4YT8A 5KOJA 3IO5A 4W8HA 1TQ4A 5C5IA 3HM9A 3B20A 1AV6A 5GJBA 2CYCA 1E4EA 3OFJA 3C8HA 5EWMB 3WIUA 1PL6A 2JAPA 1KJZA 3KHUA 1DKNA 1WUKS 3I6ZA 5KWEA 1T5IA 3PI6A 5IZCC 4C2BA 3DZFA 4B4VA 1CTQA 3SNHA 4QGFA 5TF4A 1GSHA 3TVDA 4FYPA 4XX0B 4YIKA 1JJ7A 4KXNA 5FCDA 1FRFS 1NT2A 2E7ZA 2GHRA 2XVXA 3MBKA 4YP0A 1EHIA 3LD9A 4R3WA 4HT3B 1U0FA 4UDOA 4KO2S 1WUJS 5BSWA 2Y6VA 1YGYA 1EJ2A 4TV8F 3A25A 3A37A 3E3NA 4Y1RA 4EYSA 3I34X 3RU2A 4QGSA 4DZZA 3I6MA 3AUYA 2D1RA 3MGGA 1CP3A 1J42A 4BLSA 1EP3B 4GUDA 3UJ8A 4H6XA 4BNHA 2RHCA 2O5EA 4UJ3A 1RM3A 2UVPB 3CUTA 3QVXA 3D3JA 3HPRA 2BFBB 3KHKA 1QIKA 3QFTA 4O2BF 4C5CA 1G5PA 2HCRA 1D4AA 1KYXA 1L5QA 1K06A 4YJGB 5K3CA 3UNXA 2YJGA 4U2DA 5C5CA 4OHUA 3CVXA 3B2EA 1KK0A 1YJBA 1G5TA 221PA 3G9TA 4ZV9A 2C4KA 5JNTA 3P97A 2ID8A 5GVSA 3GFRA 3H3JA 3OM9A 3MGAA 5IDVA 4KG7A 4TUYB 3DNMA 4C6TA 1O0SA 1JSCA 3OF2A 2BGLA 3OA0A 4JVOA 1AT1A 5TVKA 4NOLA 3IAAA 5AICA 5KIAA 3A31A 4BTVA 1Y5RA 2AMFA 2B0JA 1ARZA 3QEMA 3ESYA 3R0IA 1HE4A 5GJCA 4E2FA 3OIYA 4WXMA 3P9ZA 3K30A 1JT2A 3DZIA 2NUAA 3AW8A 3LT0A 5A4KA 5LQJA 2PRYA 3WL6A 1Y33E 3QPDA 3VC2A 2V4UA 4LSWA 3OPYA 3ZWXA 3P9PA 3OCVA 3K05A 3ZWMA 1CV2A 4JT9A 2Q5CA 3OZUA 4WOPA 5JPIA 2FPWA 4KLZA 2O3SA 4RKEA 2TMDA 4UCXA 3ZV6A 4DIEA 3B7WA 3W06A 1RD4A 3DAFA 2HYDA 3VR4A 3AXSA 5KOIA 3KYJB 1Q11A 1NN5A 2ZDQA 3T8YA 3UAVA 4Y2GA 4BWYA 1V16A 1K5HA 3I2GA 3ZD6A 4RTOA 5ADVA 3VI4B 3OTOB 1GLGA 1HE2A 4EFMA 2BMWA 2JDID 2GH1A 4KVAA 1N2OA 4LF6B 3MT7A 2H5LA 3SJCA 621PA 5D5HA 4P3PA 1LLFA 2BGTA 3BA6A 3VNAA 4CUKA 2O2SA 2WFLA 4FHEA 4IIBA 5MHTA 3GUVA 2XEXA 1A04A 1A96A 1H0RA 3AILA 5EKTA 5SV2A 3ZE0B 4G8JA 4M9XA 5ADWA 1USKA 4BBPA 4HQKA 1Y8QB 4FGJA 1J9EA 4PICA 1Q74A 5DTJA 4URHA 1ZH8A 4K6HA 2Q9UA 1VMKA 5DRTA 3ESQA 3B6JA 4BV8A 2CSXA 1ZUNB 3P9XA 1IBKB 4GZ3A 1QQ5A 4PLVA 4WT7A 2ST1A 3HSKA 3RHFA 3VHXA 4QHSA 3OA2A 1NUSA 4XIYA 3BB1A 1YZQA 1Q0LA 4FB5A 1EQAA 2UZ1A 3RTEA 4M6WB 2CMDA 2I2XB 3DJFA 2J4DA 4Q1EA 3T7DA 1S4QA 2JFZA 1R6TA 4DBZA 1PKEA 2QDKA 2XB6A 2E82A 4M0EA 4P83A 3VZQA 4YB8A 3JR3A 4F6RA 1UXJA 4FW9A 4LWQA 2QK4A 2P40A 3GWZA 5EMHA 4X45A 1J22A 5DM1A 1C1YA 2JK1A 1CYEA 4U7JA 1J23A 1UOQA 3L0IB 5CT8A 3VO2A 4DPMA 5BSVA 4NZOA 5KAPA 4G07A 5F9MA 1M6EX 1WUIS 4AJOA 1XTKA 1ZH6A 3IV6A 3T4XA 4CIAA 4HV4A 3L49A 3AF1A 2EARA 2QV7A 4QPCA 5DHTA 2B2CA 2OSVA 3F3MA 2WUEA 1T5SA 2HN9A 2RGGA 2QZSA 5IBRA 1JW9B 3MW8A 4MUEA 4LJRA 2OV8A 3TQCA 3RGGA 1UIMA 1O9GA 2J7KA 2H2HA 2IY8A 2WWYA 2BHNA 4JMLA 1EVKA 3MN1A 1XCMA 1Y1QA 1JIUA 2SNIE 3FZEA 2KJQA 3EDOA 3WWEA 1XN1A 1W5TA 3IT1A 3QVWA 4ZAYA 1W5BA 3IFSA 2WABA 3PZRA 5TPWB 1RBYA 4AFNA 3KRTA 1BD4A 3DNFA 2B82A 4K0RA 5CBPB 3T7IA 4JB0A 3RC9A 2JAUA 3DEHA 4FI3C 4ALIA 2A9VA 3G5AA 1RCTE 3KSUA 2IQIA 4G0QA 4B8ZA 4BNXA 1OFHA 4BX8A 4B1FA 1LSUA 3THOA 1AUPA 1DAGA 3JQFA 3TAHA 3TBKA 3C1UA 4TQAA 4PCVA 3VPAA 1RWOA 1KU0A 1J90A 2CLKB 1O5TA 2REOA 3HCDA 3OESA 5DU2A 5TE9A 5CA1B 3U2QA 5BN4A 1R7RA 4EG1A 2XQVA 4FR2A 4H08A 5H16A 5ALPA 4BAGA 3F6BX 5YASA 4DV2B 3U44A 3V34A 1P4AA 2HPAA 4HLQB 1X92A 2AG5A 1GCIA 3HJAA 3KT8A 4NU5A 3RRXA 4MW1A 5IEJA 5KSOA 1JHOA 3BXGA 5MDHA 3UJNA 4TMKA 3UN1A 2FUEA 3JS5A 1GG2A 5HDQA 3HGTA 5HHTA 3AEXA 2I6GA 1M76A 1PR5A 5A7HA 2IXTA 4P53A 1RZ3A 4PQRA 1JI3A 1NVAA 3NHAA 3UT0A 3ZWQA 5I9LA 1GPKA 2CDCA 2QSYA 4M37A 2X0IA 2VP0A 3O38A 5LIRA 2YWRA 2QRQA 5A1JA 3RSCA 5DB4A 2W90A 4ZARA 2A1UA 1UMDB 3L5KA 3FD8A 4DR4B 1KH1A 3BHMA 3NNNA 4NZMA 5DHQA 2ILVA 3HBFA 2WIDA 2DF8A 3JAKB 3EPHA 2ZR8A 1ZUD1 4R31A 4RVSA 3TOZA 4JU9A 2FSPA 4K9NA 4K6FA 4QNRA 3FOBA 1FNMA 1Z2EA 3I5AA 4QT0A 2HGZA 3BXOA 3ZUPA 4MGIR 4QLAA 1NG1A 1TJNA 4IGAA 4WDQA 4L1KA 3W5DA 2VTBA 4O4JB 4MUFA 4TLAA 2GRJA 2IZZA 2C1ZA 3GHHA 2FWPA 4X54A 3IMGA 3VX4A 4H1WA 1YDFA 3SDZA 2VPIA 1SUWA 3DB1A 3DBRB 2FP3A 4M99A 1Y63A 3O4GA 3DL2A 4WMLA 2UXDB 4DJDC 3QVGB 1CNMA 2GZ3A 5F2OA 3OO1A 4JNCA 4D7AA 1CRWG 2OWDA 3N2GA 2A0UA 2HA0A 2IT1A 4YBRA 1FMTA 1W8IA 2HR1A 2YW9A 4HDQB 1OTXA 1F3OA 4LJ5A 4G09A 1WZIA 2WJAA 4MV4A 2HCBA 3GLHA 3DZGA 4HVAA 4I14A 3TNFA 3UK7A 3MCAA 1CUXA 5A05A 1QGZA 4QTYA 4XQGA 5BMVA 2XOKD 5G53C 3BHIA 4W1SA 4Q3NA 1E2LA 2BTEA 3DGEC 4RA6B 4O8ZA 5DCWA 3WQHA 1M6VA 1KVTA 5DYGA 4D9JA 3DAOA 2YOGA 4ZYYA 5JASA 2YZ2A 1DCTA 3TOSA 4PO1A 4GPZA 1OAKA 4FCCA 4OUKX 3R75A 4DR2B 1IATA 2IOYA 3LW7A 4C3UA 3K0FB 3GROA 4IV0A 2IL1A 5LJLA 1Y3FE 3QV1A 1L7AA 3Q1KA 3TDNA 3U5TA 1N32B 1WXHA 1EHYA 2GCIA 2Q5QA 2NSDA 3EIFA 4FI3F 2PS1A 4LSMA 2AUTA 1UDRA 1QE3A 3EUEA 3QLEA 3ZY4A 3HXTA 1LPOA 4J4BA 3VNQA 3H1GA 4CR6A 3NETA 4MCHA 5LNK1 1IEXA 2A94A 3UJBA 4L8VA 4RVNA 2O8VA 2ZWMA 2WT8A 3ETLA 5BR8B 5AI9A 3DBVO 1K9VF 2OAQ1 3VSBA 2IBSA 2VUTA 3N58A 2LBPA 4P5PA 1NP7A 1W1UA 4D56A 1MOZA 1XTRA 4KE8A 4A0GA 1KEUA 2Z98A 4J0CA 5BPHA 1R0YA 1TMYA 4FONA 3WOVA 2EX0A 5K20A 1SXJB 3L4JA 1YIAA 5PNTA 3SJ7A 2BGIA 3D0KA 4LI3X 4GYWA 3WY9A 3Q7TA 4IUDS 3T3HA 2HI0A 4X71A 3SS9X 3UH1A 4XM1A 2F9MA 2UDPA 1AKYA 3PEYA 1GNRA 2I54A 3OCCA 2I3ZA 4K1XA 3AR2A 2XECA 4RKRA 2J0QA 4YUZA 2QLJA 1SKMA 5KVSA 1IL0A 5AK6A 3VZRA 4ZALA 1G8MA 3X2SA 1Z15A 4G5XA 3W6NA 4ILKA 5AUQA 2NLOA 4YDQA 4R7GA 4MRRA 2ZRBA 1JG2A 1QZUA 2FOLA 4UMFA 1YNOA 4V0KA 3TZBA 2JKVA 1M1ZA 1MABA 2DG2A 5HIMA 3HJGA 1B76A 3TLGA 2BFWA 3F8TA 1QKKA 2HJVA 5LYJA 2P9GA 1EUDB 3UFBA 2NAPA 4YRPA 1XZMA 3RE1A 1CEQA 1PNRA 4LI0A 1FFYA 2POCA 4GR5A 4PC6A 3GJ3A 1H42A 1C80A 4I6EA 4WK4B 1JZQA 4Z0PA 1E9AA 3WGLA 1QQBA 1YTUA 2PRKA 2EX1A 2J3MA 2P6OA 2Z56A 3DMDA 4D79A 4IDAA 3OT4A 2H51A 3DS8A 1TNDA 3AEQA 1VRVA 2XUGA 3MOGA 4G4JA 1ISMA 3RVQA 1AZSC 2SCUA 1Z6AA 4I1VA 4L5CA 4XM2A 1BMTA 2I2CA 4GXTA 1RHRA 1V9SA 1B8PA 3TZHA 3HBLA 5KYYB 2C77A 2RHTA 1BMDA 1JVBA 1N0VC 2R00C 4QYIA 1DJMA 3MJTA 3UEOA 2WD9A 4K6GA 3KXDA 4X61A 4YCCA 2OV3A 1VL8A 2NXJA 2BF7A 2FPMA 3L7OA 4RA9A 3QVSA 2BN4A 1XRRA 1L7BA 4YH1A 4ICIA 1JYFA 4EKEA 1GN8A 4LQ4A 1QC5B 5BWBA 2VPQA 1T3HA 1OASA 1Z6TA 2VDUE 4ZU1X 1UPFA 2REQA 3O90A 4RENA 1RVV1 1N3BA 1NMSA 3D2AA 1IN4A 1YRYE 2WZBA 1WCIA 2O3JA 3G1WA 1GUDA 2YX1A 3PQCA 4KYVA 1PJ4A 2TMYA 1HRKA 3KQOA 1NQAO 2RHMA 2E6KA 3O2SB 1JKMA 3J81A 1P18A 2P2YA 1AKEA 2CVPA 5FTJA 3C1OA 1KETA 3C3DA 3UOGA 5IHXA 4S1WA 1V4NA 4WESA 3DVQX 4DLPA 3V1KA 3K32A 4GWGA 1E3WA 2O2GA 2C5FA 3EODA 4R5MA 2AG1A 3CRRA 4C21A 3ZCRA 1A8IA 1RAHA 1VLJA 2PX8A 2EGHA 3OY2A 4UARA 5IVDA 2Z4RA 2WWHA 4CKEB 2JGDB 5HQ3A 3NNDA 4HR7A 3IPAA 3GEMA 3E05A 1LVGA 3ECCA 4BIIA 1N5OX 4ZHQB 3ZDQA 4N5LA 5HR5A 5CAEB 1X7ZA 3NRBA 5FLYA 3TTTA 2DFNA 4G01B 3UB3A 2VJQA 3TZ6A 1Y3AA 3II6X 3RS5A 4GL2A 2RHJA 5CW1A 1N77A 4P84A 4PTZA 4U9UA 3EN0A 5CDSA 5K8VA 1DKRA 1YZFA 2JJ2A 4PAMA 1C3OA 1RPZA 1AKNA 1GO2A 4ZVSA 1LSSA 4MVJF 2GAIA 2NTVA 1K8YB 3CKYA 3GY0A 3AVXA 4H1HA 3GEPA 4BFSA 4Q4AB 3GUCA 3V33A 4G0XA 4DA4A 3ED1A 3N8IA 3OKCA 4FQ7A 2GR9A 3BG5A 1UM8A 5WRFA 4DCCA 1GFZA 2E4AA 2QJTA 2Z43A 4RF5A 2R65A 1A1SA 2JAOA 1DIAA 1U4NA 3FDZB 1OD6A 2P4UA 3I72A 5TEVA 4OL0A 5BR1A 4E7PA 1P80A 5EUMA 1B6SA 2VRCA 4J0DA 5HZGA 4DBLC 2BM0A 2M1ZA 3I23A 3VPSA 2O0MA 2REBA 4TLLB 3WGZA 1DWUA 4A0QA 5KWJA 3T61A 2WQ6A 3TLMA 1JG6A 1PFUA 1PGPA 2NSJA 2XHZA 3FWHA 4IW3B 1U1FA 4XYBA 5LA6A 4EHIA 4CQJA 3JQFC 3K0KA 4QGBA 2J9GA 1BCRB 4UAGA 3HR8A 3OT1B 4F3CA 4G0UA 4LZAA 4JLJA 3REQB 4MVJM 5BV7A 2KB0A 1SBQA 1CYDA 5JTUA 5JQGB 3HDTA 1QTQA 4JT8A 3RC2A 1JKJA 2BW0A 1E4OA 3I1IA 4BU1A 3FB4A 4ZXPA 4Y1GA 2NU9B 2EFCB 4KN6A 1A8UA 3PR3A 1BA3A 3LBYA 4EAQA 3OX1A 2VYNA 2NVUB 2G83A 2XZOA 1BX3A 5K0NA 1RRFA 1VOTA 1THZA 1RAAA 3B38A 1S9DA 1WD5A 4KI7A 1N6HA 4RTNA 2GERA 3IQEA 2VPXA 2BL4A 2EFYA 4OIMA 3RRNA 1IBRA 1YK1A 2GK4A 4UD2A 3G5UA 2JI7A 1EZZA 3AJDA 3TI9A 1A9XA 3DV2A 1HQCA 2AHOA 5ENDA 1Z6GA 3LBFA 1XXHB 3G2OA 3L7YA 2PDAA 3EY4A 2AOUB 2V8OA 2RAPA 2OD2A 3EIEA 1ULTA 4E51A 1JQBA 5LZ9A 3ZJUA 3LPCA 3HV0A 1D07A 1KSJA 2RHWA 9MHTA 2B34A 2FWRA 3LUGA 4FOTA 4JJIA 4K9MA 2H8GA 4M22A 4F12A 4RY2A 3QVKA 1PNOA 3V8EA 5IANA 3JZIA 3FPAA 2WF5A 3PHCA 2BFDB 4Y8VA 3BRQA 4DF3A 4DCMA 5KYWB 2BMAA 5IJ9A 1HF3A 2PM8A 3CG0A 3J80A 2JG3A 3S0JA 1QHYA 1A9TA 5HK8A 3AUUA 3UMBA 4TWBA 3GDHA 3KV1A 4QUEA 1WTAA 4FBGA 3VTKA 1YFZA 3VPXA 5EN4A 1HC7A 3ZCUA 5D3MB 3SXPA 3O5AA 1F2UA 1X70A 5AW0A 4GNKA 3VKWA 2MCFA 4CEJA 1DSSG 1ZK3A 1I3LA 2I62A 2F62A 2QKYA 3O4RA 4LVNA 3VAZA 4EI2A 4YRBA 5JRDS 5DNEA 4H7IA 3PTAA 2EBFX 1B43A 1CUAA 2ISQA 1GWNA 2R84A 2QRGA 3AB7A 3B2NA 4BVKA 4E88A 3RUEA 2W98A 1DDOA 2ZM5A 4YREA 2XBMA 2XUKA 1ZXLA 1ZNYA 1DMRA 1PR1A 4JEHA 4KSCA 2HEIA 2IITA 4MQBA 4QOHA 3IUJA 1Z6YA 4K03A 5EIOA 1XJ0A 2Q4TA 2VATA 3DOIA 1KZHA 1XO1A 3THRA 5DXFA 2GK7A 4GKVA 5FPHA 4URUR 4NI5A 1C5KA 1IULA 5B1DA 1M1YB 3UICA 4S1NA 3OPXA 4FSDA 2J0SA 1F06A 4C08A 2ZUVA 3FIUA 3KL4A 3G2IA 5ECDA 4BQOA 4DQKA 1DBWA 2ZS7A 2JIOA 4AJLA 3T3MB 3T9CA 4RMNA 3AV3A 1F2DA 4C20A 1KY2A 5JS2A 2ZK7A 2ECPA 4R01A 4XOIA 4XUEA 1TIKA 4DUGA 2NW6A 4E03A 4HD8A 4G1CA 1RAIA 1SKYB 1XXHE 4OIFA 3UGQA 4Z8XA 3R7NA 4E4TA 4HDNA 3UVEA 3U3JA 1DG9A 2R4QA 4EWLA 4J90A 1X9HA 1YZLA 3KR2A 3LOUA 4I4TA 4RE5A 4KFUA 4A6PA 4ZO8A 1O5OA 2X22A 3PRHA 4OMUA 1QCDA 3KQPA 4C6RA 3JSXA 1WEHA 2D13A 4D97A 1KTIA 4XGKA 1TCUA 3I0ZA 5C8VA 5JYCA 1ZXBA 2L17A 1T3SA 4M83A 2EJCA 4OLBA 1WVMA 4JUAA 1ZK4A 2X86A 3IP8A 3DZKA 2VJPA 1V96A 3NC4A 3CLHA 4GOND 3GZ4A 4N6NA 4QUJA 4RFSA 5FI0B 4FZVA 4TN1A 2AA3A 3KTAA 1YOBA 4MLCA 5BW4A 3AUFA 3HMKA 2CL0X 1CIVA 3ONWA 2XUZA 1I1HA 1BG6A 1MJFA 1EQ2A 2QMQA 3Q8WA 1AGPA 4HQ6A 3ZCTA 5MGBA 1KYWA 1F7VA 4XVRA 2I99A 3ZDBA 2X6QA 3P7MA 2QTAA 2BEVA 3CUVA 4XVHA 2HC9A 3GLKA 3W8FA 4Q3DA 2CNOA 5DNAA 1BXRA 1X7XA 3WJ2A 4B35A 4NAVA 1U2QA 4PXSA 3IKVA 4JCCA 5AXAA 5BY2A 4HNQA 1PIWA 4RIFA 2ZT6A 2W6OA 4OVKA 2ZSFA 3Q9SA 2FJUA 2AE2A 4TYQA 1EHCA 1WY7A 2OD9A 2W8BB 1X2BA 3RIMA 2YWJA 1M1YE 4K9LA 2ZIXB 2QS9A 4N0QA 3RJ9A 3I6BA 3RSLA 5HF9A 4DGQA 2DWCA 2YWXA 4GKAA 3EJ6A 2QG4A 2FKNA 5LB4A 1B1AA 1M1XB 2FK7A 1VE3A 3JYLA 4JVLA 2NWQA 4AG5A 3JD0A 4KK4A 4F93B 1ZS9A 5ITZA 1I7QB 4E5MA 1C9MA 3IHLA 4DSAA 4YALA 4NBWA 3WHIA 4F7DA 2DUNA 4BQIA 4XASA 1TEHA 2VK2A 3ZXYA 3NKVA 5FQOA 1SKYE 3C7DB 4WNIA 1DKLA 1K63A 2J33A 5CXQA 5GWXA 4GI3A 2QE7A 4OBBA 1FW6A 1VJRA 2H9AA 2VFAA 4Y2UA 5IKMA 4OHYA 3VDXA 5BMVF 2G82A 1WSDA 1HPLA 2QQFA 4X8HA 2X40A 2N46A 3K2QA 4MGHA 1XRLA 2V7PA 4NHEA 3R8FA 1B26A 3DDOA 5AVSA 2XGJA 4CV1A 4IXNA 1RQLA 4HVTA 4L51A 1I2AA 3IIKA 4PLHA 4FIDA 4PE5B 3RU9A 4DANA 3SU8A 2ZJ7A 2NT4A 2VHWA 5G1PA 1PS8A 2H63A 2IKSA 4JJAA 2JZCA 2I34A 4LC9A 4AS3A 2D3WA 1FRQA 4MVXA 2VOEA 7MDHA 4QOIA 1QX3A 1Y7PA 4ZXFA 2VHZA 2IIBA 3EMVA 3I52A 3SF0A 4D3SA 2VYFA 3OZBA 1J8MF 1AS2A 2DLCX 3DD1A 3OEWA 4CT5A 1K7FB 4MUGA 2VPWA 4PFJA 4WINA 4ZYVA 4GMHA 1ANKA 2KX7A 2VLIA 2HJRA 3LI2A 4QBHA 1TF5A 3GP5A 1Q84A 4MYHA 1HZJA 2XIJA 4B6JA 5SZJA 1AHHA 1OJ7A 2H1SA 3IVCA 3KUDA 2X0FA 3ROXA 3EC1A 3CRVA 1OVGA 2GHQA 1MO3A 2NO4A 3PXAA 4A0HA 2WJ4A 4YUWA 4JT4A 5E7JA 3HR4A 3WMRA 4RD6A 1E0KA 1HO3A 1T1SA 1WV0A 2DPHA 1WMAA 3OAAA 3Q0TA 3TE7A 4WLFA 2BHLA 2PUEA 2E4WA 3QTBA 4RK5A 5GONB 2VAPA 1XA4A 5AP9A 1PFKA 2JBHA 1Z2CA 4L22A 4OYYA 2Z2XA 2VWPA 1DMSA 3H9BA 4RJLA 4YXWD 3A4YA 1CRZA 3C98A 4KX5A 4JC0A 2W11A 1Q12A 4OJKA 4DA7A 1ST2A 3A2MA 1E89A 2R87A 4LJ8A 1HK7A 1KS2A 4X1YB 3ZVLA 2JIDA 1FA9A 3MEQA 1PGOA 1RWNA 4FP9A 5FLEX 4AKIA 4X97A 1Y1KE 3PDIB 2RH5A 1F9EA 4IRUB 2MWMA 2B25A 3DUWA 3B1XA 3IV7A 1YZKA 3VH1A 4UBNA 2O1WA 4Y2QA 2ZIVB 2VDVE 5CDFE 3DPSA 2PH5A 1HL7A 3GCGA 2ATVA 3O3CA 4LYEA 5TQ0B 1SIUA 4MPJA 1S3FA 4R2XA 2QM3A 3RVSA 3MWYW 5LYJF 3EXAA 3FUCA 3ESAA 3TRKA 3RVKA 3CKLA 3EDCA 4C0LA 5EA2A 2OL4A 5CRIA 1HKHA 4QBFA 1F14A 2FMXA 3UXEA 1T24A 4TM7A 4D74A 3O6VA 3G5TA 4E30A 5LBIA 3D2BA 3U37A 4PS1A 4X1KB 3WA6A 4UEKA 4LC0A 5EJ2A 1ZD2P 2ERCA 2YFQA 1ECGA 3I6QA 1EEHA 1VIMA 2J6BA 3U4IA 1BQEA 4CM9A 1P1HA 4J3NA 1XRJA 3G13A 2MSDB 1XEFA 5CHEA 2P4EA 4BWGA 1SIBE 2YFHA 4Y0NA 5IVPA 2H52A 1U3WA 3IE0A 4E5KA 3IAS6 3DC7A 1YS2X 3IBYA 3CSUA 4O2RA 5B6PA 1A5SB 4D8UA 3BX1A 2Z1NA 4Y6PA 3QHQA 5K0EA 3ULKA 3RNOA 1EFPA 2TRSB 3E35A 2VT6A 3OX3A 4YMIA 3H87A 4B3JA 2CK3A 2F9LA 5HOQA 3F5SA 2NNWB 4DYDA 3A1FA 4GI1A 2QMYA 3IQGX 5IJXA 2DWPA 3IEUA 3VMMA 3HBAA 1K27A 2ZTVA 5EIWA 1M2VA 5AWFC 3BE5A 3NPMA 2GUGA 2FMKA 4LDQA 2GMWA 3WYBA 2HMVA 3G8AA 4HNGA 4W9MC 2EJUA 3ITDA 4BPBA 1QIFA 4WXEA 2YN4A 5A6SA 2XAUA 5JYBA 1IY2A 4Q66C 3DXYA 1L9XA 2CVHA 2WIAA 3CY6A 4CTJA 5TGDA 1MOSA 1XIVA 3AYZB 4DWOA 6ABPA 2V7XA 4D81A 3R76A 3MGCA 3R7WA 5FIUA 5A04A 1T4CB 1Z6ZA 3HKDA 1QR2A 2YHAA 5T4FA 1P6XA 4NMWA 4KDRA 2KHZA 4WJLA 4XW2A 2GDJA 3G7UA 1E9FA 3NU1A 1NP6A 4Y2SA 1NNSA 1XROA 1GGNA 1OXSC 2R4UA 1MNAA 2VP5A 3MD0A 1ZITA 3I8SA 4GPIB 4J16A 1V5FA 3QF4A 1PWYE 3SHOA 1U81A 1Z6QA 2IDJA 2WMDA 4LOAA 5CPBA 3QUCA 3LXXA 2OC4A 5CXXA 2PRSA 3NDPA 4IFTA 3WLMA 1FTQA 1OZFA 1U2DA 2RKOA 1GPDG 1QHHB 3JQBA 5BN3B 2VEOA 2VQ3A 1AUQA 3QY9A 2E55A 3C3BA 1QGUB 1WCV1 2DFTA 3K73O 3AVPA 3IR7A 4IOKA 5A6VA 1U65A 1UEJA 3QG5A 4NZNA 5L95A 1K6XA 3B9RA 2HWWA 2IYLD 4FOPA 1UJMA 4C1NA 3KBBA 4L8FA 3M34A 4BGVA 3IVGA 4E31A 4DDWA 1M2WA 3M3DA 1GPH1 2D7CA 3P9QA 5DGCA 4PX2A 4LF5B 4W99A 4ZPXA 3ADKA 5CJPA 6PFKA 2CFIA 1UXKA 1YNSA 2PK3A 1YE5A 4FQ8A 3COZA 4JJKA 1BFKA 1OWPA 3R6LA 3N75A 3L7DA 4NENB 4PX5A 4TRMA 1CZHA 2JKYA 2VRCD 4LXQA 2JD1A 4KSYA 5JMOA 5LA6F 1NNEA 3ZXXA 2BM1A 3KJFA 4JR0A 4ZVVA 3R7FA 4HJRA 4BN5A 4V1CA 1Z7WA 4KZKA 3NONA 3W5IA 4AI6A 1EFUA 1KI6B 1VRWA 2FSSA 1YIDA 2QZJA 4MQLA 3B9BA 1P1JA 2CLLB 2D0DA 3TQFA 2QJOA 4GBMA 3OM0A 3CUEF 5DF1A 4KMRA 2OQIA 2YC4C 1T29A 5AW7A 3TJRA 1H2FA 1YQQA 3WO1A 1MIOA 4XWYA 2VYND 3MUFA 1ULUA 1ZC3A 4B3DA 2H08A 2WF7A 3OY7A 5DK4A 3QNUA 3ON5A 1DARA 2ZZKA 3OCJA 4V02A 5G0VA 2RFLA 3FSJX 3PDUA 2OV4A 4KE7A 4ZOLB 4QDUA 3CWCA 5F1KA 3OPQA 1FSPA 1SHZA 4Z53A 2CFTA 4XJXA 3WYEA 1HEYA 2AXPA 2ZRKA 4KAXA 4UPDA 4ZK6A 4UTRA 1NJ8A 3K5WA 3KKQA 5IKXA 1G5HA 4X3OA 3GU3A 4ZT6A 4YCNA 2C0CA 3K2BA 1YB7A 2YRXA 1CX9B 1CRPA 1UMCA 4M49A 1RM5A 3HN2A 4HRAA 4UZFA 3OM8A 4X7PA 4YRQA 2D8AA 5EXXA 2XT0A 3FG9A 4JNKA 4BQQA 3P9YA 5DN6A 4YIHA 4FR0A 1HE8B 1E7WA 1FY2A 1FX1A 1X86B 2O57A 1G8GA 3LAWA 1GRQA 4KUHA 3PQ7A 4CM1A 3HO8A 2ODNA 4N40A 1XRSB 3LY5A 3MA0A 2ZJAA 5EE9A 1JLMA 1UKEA 3PXEA 2AFHB 5TIIA 3PG5A 4TKUB 4LJ4A 2FQ1A 1CERA 3ANMA 4LHEA 4O4HB 3EIQA 1FB5A 3W2TA 4TTIA 1AF7A 2BUBA 3RUCA 1PR4A 3ZD8A 1U7HA 3W6PA 2QXYA 4TYNA 4G84A 5J2UB 4BPRA 1STOA 5I7HA 1VDZA 2LVBA 2W48A 5DYYA 1LVUA 1R8XA 3NXKA 5CDYA 1CS0A 2JCBA 2O7NA 3GUUA 2QYTA 3NAZA 1J0DA 3SF8A 4EX6A 4ZQIA 5LQNA 2C3OA 1PDWA 3IUSA 4BGDA 3ABQB 2J5XA 2VKTA 2C2YA 3GELA 3IP5A 4KYUA 3P0HA 1GZDA 4ANFA