3GWGA

Crystal structure of chey of helicobacter pylori
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
123
structure length
123
Chain Sequence
MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY homolog
publication title Crystal structure of activated CheY1 from Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Signaling protein
total genus 45
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2009-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gwgA00
5I4CA 1M5TA 2PUAA 3HV2A 5IUKC 5ED4A 3N0RA 3IDOA 4ZJPA 4E7OA 4MRMA 4EYKA 3F73A 1Z15A 1DG9A 2WJAA 4YLEA 5EWLB 4O1HA 4S04A 3L49A 2BGGA 4NICA 4JASB 4XASA 1LBHA 3R0JA 2IPNA 3DGFC 3GYBA 3MA0A 4IMIB 1A04A 5PNTA 4W5OA 3C3WA 3N8IA 4QICA 3O21A 5IC5A 2E4VA 2FMFA 2E4YA 3UUGA 5CNKA 4RXUA 1E2BA 4IGAA 3RVOA 4JAVC 4LE1A 1PNRA 2A9PA 3GRCA 3B2NA 3H5IA 2MSKA 4B09A 3E3MA 3FFWA 4KMRA 1S8NA 4N0PA 2FMIA 4OBBA 2FMKA 3OM1A 1E6KA 4W5TA 3MYYA 2HSGA 3IP7A 1LJLA 2L18A 2NUBA 2JVJA 4YV7A 2M1ZA 2I6FA 4IRXA 5HM6A 4Z4EA 1ZESA 2R25B 1AB5A 1F4VA 3NBMA 5BQ3A 3GT7A 3OMXA 4W5NA 3JY6A 4LE0A 5B3JA 4EYGA 1TJYA 1BAPA 3QLVC 3RH0A 4KRFA 1PUXA 1F51E 2FSPA 3GA5A 3VNBA 4TLMB 3LUGA 4RU1A 2J48A 2FEPA 3K9CA 3CU5A 4G86A 4ZPJA 4ZMSA 3SAJA 2QU7A 3BREA 3D02A 3GV0A 1ABFA 1NTRA 1W25A 4KPYA 3RQIA 3RVKA 3NHMA 4YWHA 4YR7A 2PL9A 2QXYA 4LE2A 4RDCA 1HEYA 3GWGA 2H3HA 4MQFA 1FFSA 1MB3A 1WETA 5FWXA 1EWKA 1NXWA 1L5ZA 2MYNA 4MR8A 3RVNA 3KLNA 3M9XA 4MS3B 2PUCA 3HDGA 3QELA 4HNQA 3EAFA 1NXSA 2A9RA 2AYXA 1P6UA 5T3YA 4WXEA 2XDYA 1TM2A 3JS5A 3UK0A 1LBIA 3HUTA 4M88A 2VUIB 2YHBA 1SD5A 3QX9A 2B4AA 2Q5CA 4O1IA 1T34A 3H1GA 3ILYA 3IPCA 4Z9AA 2R47A 5JNVA 3NNDA 3NNNA 1DBQA 2LBPA 4MR7B 1GCGA 4OTZA 1Z2EA 3BRQA 3A0UA 5EWLA 2CHFA 2FN8A 1D4ZA 3H5LA 6ABPA 3T8YA 1KMIY 1NXOA 1PHRA 4PZ0A 3UKJA 1FFGA 3OMWA 1BDHA 4YGXB 3CHYA 2RJOA 1JF8A 1W9HA 1JWLA 1VLZA 4HNSA 3H6GA 9ABPA 3OLXA 4WXMA 5KQPA 3CKMA 3KYIB 3TD9A 1QQBA 4KQ9A 4LDZA 4WUTA 1DZ3A 5KQGA 1U8TA 4RKRA 2VK2A 2GBPA 1DBPA 5TPWB 1EWVA 1QMPA 3QEMA 5BR1A 2NZUG 5JNTA 1JBEA 1KGSA 2R4QA 3CG4A 3HUUA 4N47A 1IIBA 4Z4GA 4KREA 1DBWA 4MGEA 3M6MD 3Q7SA 4Q7EA 4RZSA 1GCAA 1EAYA 3H5OA 1ZGZA 4JP1A 2ZAYA 5JNWA 1UDRA 1E6MA 3A3KA 4JB2A 1KRWA 3OQOA 1FSPA 2HQBA 4TLLB 1QP0A 1H9CA 1RZRA 4MS4B 3M9WA 5C5CA 3Q7RA 5IBQA 5JNRA 3KJXA 2CHEA 3C3KA 4H60A 1MIHA 4EYOA 2FN9A 2IDMA 3OO1A 1QP7A 3OLYA 4FE4A 2DRIA 2M98A 1LJUA 3CZ5A 4PE5B 2JBAB 4NCBA 3EQZA 3TO5A 2QVCA 1U04A 1SRRA 3A0RB 4OG2A 4N76A 3FFTA 3CZCA 1ZITA 3I42A 4Z4FA 2CD7A 2FQXA 1GLGA 2GWRA 2P9HA 3TB6A 3IPAA 4KV7A 1QPZA 2WJWA 4HYEA 4RK0A 5IEBA 3O74A 3QLUA 1Z12A 3QX8A 4KVFA 1Z17A 4PICA 3RVSA 1A0OA 2W42A 4MS3A 1MVOA 3SG0A 3OM0A 4O5AA 3BBLA 1ZHHA 3A10A 4IILA 2PUDA 1CHNA 1JLKA 2GKGA 1RZRD 4KK4A 4OLAA 2GX6A 3KSMA 3MF4A 4P98A 2PUBA 4LX8A 2O20A 3H75A 4QYMA 5TQ2B 4S05A 1YVUA 2AYZA 2WRZA 1K68A 4RY8A 1Z25A 3KHTA 1DRKA 5DCLA 1JFVA 1A2OA 4MR7A 4MS1B 4N0QA 5GQSA 4ETIA 2IPAB 1C0EA 4PEVA 1JHZA 3LTEA 3Q15C 2OENG 2P4UA 3O75A 1ISSA 3FGZA 3OQMA 5E3JA 4YRZA 5IULC 2GI4A 2E4ZA 1RNLA 2WY2D 1U2QA 3H5VA 4ZMRA 1JL3A 3QEKA 3ROTA 4EY3A 3O1JC 4G0OA 1D2AA 1Z18A 5IUJC 1GUBA 1JFTA 3F6CA 4Z0NA 3URMA 2PL1A 4P1ZA 5TPZA 3H5TA 4RK5A 1NATA 3LUKA 3I09A 1NXVA 2FEWB 3TX6A 4CBVA 5DKFA 1XHEA 2PMCA 3MIZA 3D8UA 4G0XA 2HJ9A 3CNBA 3RVPA 3SY8A 1M2EA 1Z2DA 2WWVD 4XLTA 5EWMB 1XHFA 2JB9A 1RXEA 3KLOA 2FQYA 3LMKA 1Z26A 3T38A 2F8SA 3DBIA 1RPJA 3EGCA 3QK7A 4G0PA 1VRVA 3C97A 4ETMA 1M5UA 3LUHA 3SQNA 3OLWA 1EHCA 2HQRA 4GPAA 4UHKA 1D1PA 3LUDA 3IP6A 4RK1A 4KNYA 3EODA 1EWTA 1U2PA 2TMYA 3QLTA 5CNJA 4YO7A 5FBKA 4N41A 4Z4HA 1YTUA 4FE7A 5IEJA 4G0YA 3KCNA 3E61A 5TPZD 3ROFA 2JVIA 4GNRA 1ABEA 3RVLA 1APBA 5F64A 3H1EA 4Z99A 1JFSA 1ZN2A 5KQMA 1CEYA 1ZDMA 3KTOA 5KWSA 3JPWA 4RXTA 2QVGA 4ETNA 5KI6A 5BRAA 2ZWMA 1OXBB 5FBHA 3RVJA 2VUHB 3DZDA 3MMNA 2FVYA 3QLUC 3IP5A 3MQ4A 2JVKA 4WZZA 4Z4CA 5JS1A 3H1FA 3CG0A 4MLCA 4YS6A 2PKXA 2PAFA 2NZVG 4EVSA 5HSGA 3G1WA 5IX8A 3HZHA 1BDIA 3I45A 3FFXA 1C4WA 3H6HA 1D1QA 4HNRA 3KG2A 4Q6BA 4MS1A 3S99A 1P8AA 1DP4A 5ABPA 3IP9A 4MR9B 1YK0A 2ID7A 2MYUA 4EVRA 4L4UA 2QZJA 5CHYA 5EWJB 3RVRA 2PJUA 2IOYA 3OLVA 4W5RA 2VYCA 1ZVVA 1Z16A 3TMYA 3EJWA 2ID9A 1ZAYA 1YS7A 2E4UA 5B3JC 2PE5A 4IMJB 2N9UA 1DCFA 3DLBA 1ZY2A 3FDFA 4F3TA 1K66A 4XAQA 2A9QA 3L6UA 3CFYA 3ILHA 1DC7A 2V0NA 1RXIA 1QKKA 3HDVA 1JYEA 4TMYA 1J56A 2NT3A 3KS9A 1DCKA 1SXHA 3LFTA 2PUEA 3LUJA 1B00A 2A9OA 3NHZA 4RY9A 1Z13A 2E4XA 3RVQA 1TVMA 3HSYA 1I3CA 1NXPA 4Z9BA 4RK6A 4DQDA 1QO0A 1E6LA 5FWXB 1KRXA 3EDCA 3F6PA 2E4WA 4G0MA 1USKA 3HXMA 4NQRA 1JH9A 2PUGA 5DTEA 4F12A 2FEKA 5EWMA 4EVQA 3HS3A 4L85A 3QELB 2MSLA 1P2FA 2CWDA 1XWWA 2RGYA 5IUNC 5TQ0B 2L17A 4RXMA 4MLDA 4RWEA 5JS2A 1QP4A 2FXIA 4JB0A 1BDJA 5DLEA 3HK2A 4W5QA 4MQEB 6CHYA 3LKVA 4WT7A 1USGA 2H0AA 2HPHA 4OLBA 1VKRA 3KYJB 2LPMA 1Y1LA 5D2CA 1QQAA 3VNAA 4Z4IA 1TLFA 3N53A 2FLWA 2MYTA 4OATA 4H3KB 4YCSA 4F06A 3HJFA 1YMVA 2IPLA 4QYWA 1CYEA 2RDMA 3BILA 8ABPA 2FQWA 4XARA 1QO0D 3HM9A 1M2FA 1NY5A 2WMYA 1ISRA 1JYFA 1AB6A 3K4HA 3Q41A 4EUKA 4XXHA 5FWYB 1PEAA 3F7NA 5BRJA 2L2QA 3QEMB 2IKSA 3HEBA 3GBVA 5TPWA 2IPMA 4LRQA 5DGCA 3I5AA 4RK7A 2WB4A 3Q7TA 2LUOA 4FB4A 4QPJC 4RK4A 4MR9A 3O1HB 1PEYA 5EWJA 2HQOA 3O2JA 3G85A 3W9SA 4NCAA 3C3MA 4MYRA 4Q6WA 3LUAA 3O1IC 4RKQA 5HQJA 4RS3A 1ZH2A 3CTPA 4MS4A 4MAAA 4Y9TA 1DC8A 1NXXA 1OXKB 3N6VA 3JPYA 4ZYLA 2QV0A 2FLKA 3GL9A 4MRMB 1JDPA 1MB0A 1L5YA 2JBAA 3T95A 1FQWA 2LIVA 3DGEC 5KC8A 1PNTA 3OQNA 2YHAA 5TQJA 4DN6A 2FMHA 5T7BA 4UHJA 3P9YA 1P6QA 4G97A 1USIA 4EGSA 2NT4A 1U0SY 4E7PA 4TN5A 3RVMA 3EQ2A 3FMVA 4RSMA 1R8JA 5CNIA 5KQLA 3JVDA 1LK0A 4XFKA 3HO1A 4RV5A 1NXTA 4LDAA 1SXGA 1MAVA 4KZKA 2FTKE 5TQ0A 2FKAA 1VPWA 4IF4A 3N0XA 2R48A 2MSWA 3GBPA 4EYQA 7ABPA 1ZH4A 4PYRA 4MQEA 4G0QA 1JX6A 2JRLA 3O2SB 2PUFA 1SXIA 5TQ2A 4WWHA 2FW0A 4H3HB 3T6KA 1TMYA 3H5WA 2X7XA 2KYRA 5C5EA 2MYPA 4JA2A 2JK1A 4KQCA 1DCMA 4F11A 2F8TA 1BVHA 3QLVA 5HKOA 2B1JA 3HCWA 1URPA 3JVIA 3LKBA 1YIOA 2JCGA 5KC9A 4NV3A 4F8JA 3LUFA 4G0ZA 4D74A 2L19A 1D5WA 3BRSA 1YMUA 2RJNA 3LOPA 2LP4Y 3N75A 5GOTA 5FWYA 5JNUA 2QW1A 3KKEA 3OLZA 2QSJA 3CS3A 2QR3A 3CRNA 3JTEA 3NNSA 4MPTA 1DJMA 4DADA 3EULA 4KK3A 3O2QB 4MQFB 1EFAA 4LZLA 3LUCA 3OO0A 3SNKA 1FFWA 4JOQA 4KFCA 1BA2A 4D6YA 1YK1A 4ML3A 5JNSA 3Q9SA 4MR8B 4RY0A 4YP9A 5TE9A 4D6XA 3CLKA 2PLNA 5CNMA 1ZGGA 1YS6A 2OQRA 4N03A 3HVRA 1JDNA 2IYNA 3DLHA 1GUDA 3C6QA 3MM4A 1QNLA 1DRJA 3SM9A 3N0WA
chains in the Genus database with same CATH superfamily
5I4CA 1VCOA 2Q4EA 3K8OE 3LC0A 4FR2A 1GTG1 4TV9B 1JDBC 3IDOA 1I3NA 4LK2A 2Y92A 2OBFA 3ITDA 5F9FA 4O5OA 1REQB 5GV7A 4FSXA 1QR6A 1N0HA 1CUYA 3M3HA 1J7KA 221PA 4JBXA 3VU8A 1ZG3A 3BFPA 2O8VA 3HYRA 4LPSA 5AK6A 2O5CA 1KNXA 1SNYA 2O14A 2O6LA 1OBCA 3ACCA 3C6ZA 3MFYA 4XRGA 3GW8A 3SVLA 1S9DA 2OL4A 3PPYA 5I4BA 3CT6A 1MGOA 4N7BA 3C3WA 2J9FA 3GJSA 3MQFA 3FVWA 3N2NA 4QUGA 2WJIA 4N82A 5FOVA 3W5VA 5JALA 2E4YA 4HYQA 4QEDA 3OX2A 4LWZA 2VXOA 3MB5A 1ODSA 3VHXB 4B6EA 4NPHA 1WXEA 4LFAB 3VZBA 1QE3A 3P71T 4N0DA 3P94A 2ASVA 3I6ZA 1JN0A 3LY8A 5B7QA 5FOQA 1QFYA 3F90A 4I46A 5JOQA 1JSRA 5ANRB 4K6OA 3IJ5A 1C3JA 3JQGA 1VL1A 3F3MA 4HGQA 3SIRA 2A88A 3QUTA 3PYXA 2XXAB 3N2ZB 3UUFA 4KAFA 3DAPA 3QYAA 1E2GA 2XKAA 1KZGB 2NUBA 4WL0A 3D8BA 3WR5A 2DHDA 4FP9A 4IDQA 2BZ1A 4M7OA 1NVVQ 4OYRA 4RELA 3IA7A 1II9A 4EYGA 1T3LA 1DG1G 3HJAA 2JAPA 1VL0A 2XH8A 1T4CB 2P9CA 1QE5A 2QDXA 4TLMB 1LSOA 1RBZA 2D5LA 1CZOA 1T1GA 2FEPA 2XVAA 3IMGA 4ZV7A 1A5SB 1KVTA 3BL6A 3HJUA 4ZPJA 5DBHX 3SAJA 4Q48A 1W2GA 4FDAA 2BUCA 3TXAA 3AEKB 3ZHRA 4LF7B 2PGNA 4BO5A 3K0CA 4D92A 3PX2A 2AFIB 4DXAA 4YALA 5BN3B 2HSZA 2W0SA 1JAZA 4V0NA 4M1SA 4I6JA 2HGSA 2QSUA 3V48A 3WQRA 4GP6A 3IIEA 3T1HB 1M7BA 1BGXT 4W7IA 2IXAA 1NDHA 2JEOA 1PV1A 3DDHA 4EKGA 4N5DA 4E31A 5K0GA 2HA6A 3I9JA 1L5ZA 3ZCTA 1KWKA 1U6KA 4MR8A 4EMBA 2AEEA 1SBHA 4R2IA 4B48A 3ETEA 3K96A 3KALA 4GZLA 3BFXA 3FGNA 3GGOA 4LDNA 5EOVA 4WXEA 2FGKA 3VHQA 3FM9A 2QE7A 2JH3A 1LBIA 2ZJ0A 4FQ5A 4M9XA 4MLZA 5CLLA 1EXVA 1K3UB 1S2MA 2C0CA 3H1GA 4FGZA 4L0MA 2GFQA 2R47A 3O3NB 4OXNA 4EL5A 1Z6GA 2HBRA 2LBPA 3H3XA 3DKIA 1A9XA 3PTAA 1DO8A 4UM8B 2YMQA 2IYLD 3PPVA 2FN8A 1X7HA 2OV6A 1CJSA 4MW2A 3LGXA 4BGUA 2A9KA 5FEUA 1N3LA 4IQ0A 2BH2A 2JJ1D 3CHYA 3HMQA 4N40A 4LA4A 1O03A 2C4TA 4NBRA 1Q91A 4GPBA 2W8ZA 1D2CA 3SYMA 1NNI1 4G5FA 2EW2A 1BRMA 4AMGA 2HXGA 4K9SA 2HHLA 2AUMA 1B76A 2DG2A 2Q1WA 4MA5A 3TOCA 4B8YA 5C9ZA 4Y2SA 5ECDA 1W30A 1Z5UA 3S27A 1PT6A 1N2CB 2LR0A 1QGYA 2V7XA 1O0SA 2XT0A 3GLVA 4L57A 3WK4A 2C54A 1A7KA 1U98A 5J59A 3HP4A 5IM4A 2R4QA 4KREA 3G82C 4YJKA 4N0MA 2OLKA 2YIVX 3LDAA 5FRDA 3M6MD 3VDXA 3GEEA 3VNSA 1LA2A 4CV3A 1NQTA 2P2CA 3ZE2B 4N9QA 2NQ8A 4FZVA 3ZHTA 1B16A 5IF9A 3A3KA 2PUVA 4FOLA 4PRZA 1WBBA 2Z30A 1SVNA 3EIQA 2A35A 2NSHA 3GRRA 3TL6A 4F7DA 4PZAA 4MS4B 2OOSA 1IAVA 1XVAA 5CK5A 5K1ZA 4B3XA 4BP8A 1PTKA 5AMXA 4C88A 3VU0A 1BXRB 1PDWA 3ANSA 2P40A 2FN9A 4KIFA 4L74A 5IDYA 1O77A 1NNSA 3WV4A 5LMZA 5TRTA 3BJMA 2D2FA 2NTEA 3FOCA 1UBUS 4PWZA 3TG2A 1SCDA 5EIFA 1EFHA 3IXQA 4KRYA 3ZIAA 3TSCA 4YV2A 2QJRA 4ZDIA 1AK2A 4Q3CA 3RRYA 5KS2A 2VQSA 4TTIA 3L7CA 4N48A 1L7AA 3KEGA 4GDMA 2WSYB 4GE3A 5B7GA 4FMCF 3WBKA 1KVUA 3SZOA 1JTEA 3Q10A 4BGVA 3EVFA 2VIIA 1B4DA 1GLGA 1I2MA 2NSJA 5CDUA 5JAZA 3Q5GA 3AUAA 1PGJA 3O74A 4UQOA 2R6R1 2GEUA 3MJ4A 5I6DA 3IALA 4K3VA 1A82A 1MVOA 4EFNA 1H2XA 3D4BA 3DV0B 4FEYA 1RJ9A 3A10A 4TKMA 5AHWA 1L3BA 1J8VA 1JV2B 2XOKA 2GKGA 4CTNA 2C57A 1ESNA 5DTEA 5LMCA 2PUBA 3DL4A 1EUZA 4ND8A 4TKVB 4BDSA 4BZQA 3ENNA 3E7FA 3ZDBA 2YWXA 1NHWA 3VTZA 3PUHA 2EJBA 3HN2A 5DCLA 4WCDA 1WDMA 2CEAA 1Q7GA 3ICPA 4Z86A 2JIZD 4OHUA 4FHGA 2QRUA 5F9HA 3NTOA 2DXIA 5EEHA 5KIAA 3MUEA 3ZGNA 4PGHA 3PXAA 1IRIA 2Y4NA 1ISSA 2OESA 2YFYA 2AMVA 3K1AA 1YJCA 2J9RA 2X58A 2XMDA 3NLLA 1FP4B 1HG1A 2PQMA 3A1VA 3DL7A 2A0UA 5ECYA 3P7MA 4BNLA 3ZQ4A 1W4RA 1FB5A 4E2XA 1Y34E 1L3IA 1SM4A 2LE0A 1TC1A 1GUBA 1PR4A 3TNJA 3NP9A 1I9GA 2SKEA 1PFGA 4R8MA 3DWEX 4PYMA 3URMA 2F55A 5I9MA 5A0TA 1PSDA 5L7WA 4DR1B 3AC0A 5CT8A 1T5IA 3D7LA 7AT1A 2VYQA 5IVPA 3HCNA 5CX1B 2Y9MB 4UEJA 3ZZUA 3KV1A 4LISA 1JWBB 3LPMA 3P9SA 3R3HA 4QNMA 2P9TA 1P74A 2I2WA 4CQLB 1I2ZA 2J0UA 3BMCB 4JJ4A 5CCXA 4L27A 3ZJVA 4YT8A 2H7YA 4C4RA 2J3EA 3M5DA 1Q0HA 1CDEA 3ZQJA 4N5IX 2J3KA 4TWRA 3WB2A 1E3EA 1KHTA 2HT1A 5E0KB 4Q3OA 3LZCA 2FQYA 2FRDC 4Y2GA 1AO3A 5LC1A 1SEPA 4IO0A 3FZQA 1J25A 3DBIA 4N3GA 2BH9A 3GP5A 1JEYB 2HJSA 1DQSA 3LPDA 1GJRA 3I8SA 3DLAA 5T5QA 1P4SA 3UFXA 3LUHA 2R4UA 2PH3A 3IQHX 1KJJA 4IFBA 1U8CB 2ZI5A 3NASA 4RJLA 2IEYA 3N2YA 2TMYA 3GLQA 4W1QA 4CF3A 2AOUA 2WD8A 4Z4HA 1CW2B 3CF4A 3HPQA 1C5KA 4O02B 3JVVA 1DV1A 3KXIA 1ENOA 1FFCA 2BMEA 3ESDA 2XWBF 4INPA 4U00A 4UNIA 5TPZD 3R9XA 4BKOA 3RANA 1JG7A 3P0RA 4KFUA 4UNRA 1CEYA 1JVBA 2G83A 1SWVA 2AJDA 3LDUA 4TWZA 2Q8QA 3AXSA 4S12A 4CF6A 1XNHA 3W5HA 3ZYZA 1KKUA 1XT6A 2P0AA 1OJ7A 2RH4A 4OHWA 3DZDA 2FF5A 3D6AA 3QLUC 3ESQA 3PGVA 3IP5A 3LXRA 4PXAA 1AXGA 1QDUA 4POAA 4HWRA 4KPUB 3RSGA 2QJTA 1I13A 2MSDB 4L7VA 4UFPA 4EVSA 4RJIA 3KYCB 5BW6B 3G1WA 4ZEXA 1O54A 3CV3A 1X13A 2FWRA 1DL5A 1Z2NX 4I6EA 4WY5A 1F2UA 4II3A 5ALOA 4CDRA 4AS1A 2BFDB 4ZN6A 3KXLA 1OFVA 3MNFA 4UXJA 3WMFA 1UAAA 2H07A 3FCAA 3TNYA 4F1KA 1PLLA 1KWGA 1Z4LA 1P8AA 2B9EA 3BB1A 1SQGA 4BB5A 1NI3A 1XVLA 5LQSA 1N6LA 3UJ6A 2HTEA 4F96A 4L4UA 4PSDA 4P82A 3GMTA 5EWJB 1CNFA 4RZ3A 2RGDA 3N2KA 2O0LA 1L5FA 3RODA 1U8YA 3CNEA 3LDFA 1HX7A 3IRVA 2A14A 2ORED 4Q1FA 4PYLA 3SSOA 1RQNA 2H65A 4O2BA 4MVWA 5AUNB 3QKRA 2VJQA 1ZY2A 3S28A 1KSFX 3FDFA 1K66A 2MU1A 3LT2A 1D4FA 4EZIA 1P0MA 2O7SA 4R3UC 5IAJA 4MUJA 4LY9A 1TTHA 5TEWA 3FY4A 3AY6A 3KS9A 4JS0A 1H8HA 1KI4A 3AR9A 3MIIA 3VQTA 3MWEA 1CR6A 2A9OA 2CVHA 121PA 1LDGA 4CR8A 3LNTA 3E58A 3LX4A 3FIUA 4OQQA 5IN5A 2RG1A 4DNPA 4Q7KA 4OB7A 3SZMA 1RM5A 2UZ3A 3DXYA 3L06A 2WF8A 4GOJA 4NKRA 4Y0VA 4G0MA 4LNHA 3RHTA 1CZNA 4DLZA 5J4YA 3H17A 4R1OA 3ELWA 4M21A 4AF6A 2X7JA 2YYZA 4QXOA 4M0CA 3ZGOA 2WG0A 5AUOB 3F7TA 4CCWA 5EY5B 2HO5A 2WIGA 3VNRA 2OK7A 4F3NA 2FSVA 2ZPTX 1SOAA 5A4MS 4MLDA 4TTRA 1E79D 2VHUA 4YT4A 3FGPA 5DLEA 4W5QA 1N0UA 3R6WA 4GL4A 4FQ7A 4JR2A 2BL4A 1DEHA 1RWWA 3O0DA 4E07A 3D31A 3LM8A 1JR4A 2DPHA 4BWGA 1KZ7B 4D4HA 3VO1A 4F5ZA 4LJRA 1UDWA 2I6GA 1S2GA 1KL7A 2GZRA 1H0HA 4TMKA 1I8TA 1YS2X 3ZLVA 4YAKA 5J2UA 4KMSA 3HJFA 2PYIA 1ZS9A 4WKCA 4AKGA 3C39A 1C4KA 4EG3A 1C50A 5CYPA 3U49A 1FFXA 4R1TA 2DTDA 5JXIA 2QKYA 3ZE0B 3UHPA 5LP6F 3CIFA 1YFJA 3UAXA 1ST2A 4J8PA 3R5HA 4NZZA 1I1OA 2XIQA 1ISRA 1JYFA 1P45A 2GAAA 2GAOA 3A2NA 4WK0B 4X1KB 3CLRC 3G0OA 3O82A 5TGTA 2Q7DA 1EK1A 3EXIA 2QRVB 1HNWB 4C4OA 1VJ1A 2ZBFA 4RCVA 3UC5A 3KR9A 4B4KA 5ADUS 1M1NB 2JFUA 2IPMA 3EZYA 3KYDB 1EXMA 3NUZA 5FR2A 1EXDA 1EVLA 1M6HA 5JSZA 2Q3EA 1YOVA 5KHLB 3UGQA 4NMLA 2JHFA 3T3GA 4B3SB 3FIJA 3O4IA 3AVQA 5ECWA 1BG6A 2AXEA 2GZ1A 1AIPA 1QBKC 4OH7A 5A0FA 5A3QA 1GAEO 1RE0A 1X0XA 4OQZA 3E4CA 3L0BA 3G85A 5F4ZA 1DPFA 3U9LA 4UTNA 4NCAA 1CETA 5DW0A 4TWAA 3IT1A 1FXUA 3D3NA 3MBOA 1TCUA 1XF9A 3Q6MA 4HLDA 4Q00A 4RKQA 5CA1B 1IY8A 5JZVA 1BFDA 3IILA 3WRYA 1N5DA 4KSYA 4K2AA 4BS9A 4A6XA 5HE8A 1OXKB 4O4IB 4U9HS 2DTXA 2C8LA 3IDZA 3UMCA 1X7WA 1VE5A 2C7VA 4RKYA 3GLTA 3PYLA 3C7DB 2YY6A 2DPXA 1PS9A 3OOJA 5MGNA 3I4LA 5DTIA 2FP4A 2Q3DA 5CM9C 3ZVRA 2FPMA 1L4YA 1KI1A 2FCAA 3UJHA 1Y48E 2OCBA 3ZDZB 1OFUA 5CNIA 3R7AA 1O4VA 4BJ5A 4D9CA 5K2OA 5C8YF 2XZTA 4ZI2A 3EFBA 4OQFA 3WZMA 4JC8A 3ZCVA 3C85A 2IZZA 3T3NA 4HG2A 3AU8A 3CNNA 1H0KA 1KEVA 3NT5A 4ZHQA 2FR8A 2F3QA 2HPAA 4ZOQI 5M2QA 2OGSA 2APJA 4XR4A 4B3HA 3PPXA 2X41A 1Q57A 1BRTA 1EQUA 2A0WA 2OC4A 3QMVA 4N9WA 4UBOA 4FCVA 4BZXA 1J0BA 3A26A 1MXHA 2RAVA 2WA1A 2QUKA 4PTYA 1KAGA 3IDFA 3KXPA 4RZQA 2YC4C 4N5LA 4X20B 3HL0A 3JSAA 4HN2A 1RYBA 4WJKB 2PIAA 1RYEA 2QEQA 1HM5A 1P73A 3D8RA 3N8DA 4A8JA 1FRFS 1QOQB 2C2HA 2P2SA 4NJEA 4F8JA 1UWVA 4C89A 2R65A 4PAMA 1GZHB 3G1UA 4DLKA 4YT2A 3EPRA 1YB1A 1DBIA 2EFYA 3SZLA 2JAUA 2IYYA 1SXJA 2D0OB 3FYUA 3ZWQA 5AW0A 2FYTA 4G2NA 1QGUB 1SKYE 1XDUA 2DJ5A 4C7XA 3C3BA 4M46A 5AKIA 1DQZA 2IL1A 3PA6A 4AJNA 5JFOA 2C9BA 1Z39A 2I2CA 3CLVA 4QKQA 3U4AA 4PN7A 3P9PA 3V34A 3L1KA 5BT9A 1FYEA 5CT9A 2PXXA 3GPLA 1O8CA 1QTIA 1UINA 2C82A 2HRBA 4G56A 4IHJF 4DCOA 1BA2A 1ICIA 5AVSA 4LNUA 5JNSA 4PO8A 2OEPA 4AX4A 3KSBC 2B2NA 1NUQA 3RD5A 2FGJA 4D6PA 3QJYA 2FPOA 4IDBA 7REQB 3BWDD 2ZK7A 3S1LA 4TOIA 3U39A 2QUIA 3MGGA 2BFNA 3ILSA 1S2NA 3VMMA 1OE0A 2EV9A 2WKSA 3OIDA 3RSSA 1A5ZA 4K3UA 3V1NA 4S1OA 1GZ6A 2QLNA 3BTUA 1J7JA 2AHRA 3FI9A 4HX5A 4KQMA 4Q3DA 4DB2A 4K9MA 4L9SA 3IEUA 4F2DA 3HDJA 2XOXA 3LX8A 2GA8A 3VDNB 1EDEA 4E70A 1DO2A 1JSXA 3H0KA 4QLBA 4MYHA 4RHTA 4DFDA 2NAFA 3GRVA 2XB6A 4FIZA 4LWQA 1WXXA 4A0GA 1RLIA 2G77B 4D26A 4B34A 3QLJA 1O58A 4W5JA 5CLFA 1PT9A 5KTYA 2B99A 1IVSA 3QMWA 5HVNA 1OC4A 3I30X 4MRVA 3O9MA 2JFFA 1SOUA 3AETB 1W5EA 5AVRA 1SUBA 3QI2A 4Z3OA 4QAJA 3T5AA 3GRCA 4GMKA 3K16A 4DLLA 1W7AA 2AN3A 4UE6A 1XTSA 4F4HA 4ZGBA 3GX1A 4JBHA 1Z45A 4C30A 1THZA 3IP7A 3H05A 1FU4A 1CERA 4BJ3A 5IBCA 1STOA 1SH7A 3K0FB 5EKTA 3RTGA 3UW1A 1IAQA 1C3VA 2HX1A 4W63A 3GT7A 1N2OA 4GRAA 4LE0A 3MAGA 5CFOA 3V4PB 4QFMA 1HWYA 1CQPA 2CLFB 2PMEA 2C4UA 1UXJA 3GA5A 1NBOA 3EC2A 1AUVA 3IV6A 4GI5A 3AVWA 1M9NA 1KEWA 5D3MA 4ECAA 3W79A 4EAQA 3K6JA 5C32A 4X85A 1PX2A 1NTOA 1CS0A 4UHFA 4RTJA 2XMGA 5EQDA 1HE8B 4F5WA 3PI7A 3IHKA 2HCRA 2ZI6A 3H0EA 3EFOB 4N6NA 2UUPA 2GEDA 1J20A 2C83A 2MR5A 2QXYA 4M83A 2OYSA 1ZGBA 4W7HA 5BVHB 4CEJA 3U3JA 1Z4NA 1GWNA 1E1KA 1PO7A 3K8ZA 1TX4B 4OK3A 4LSGA 2IU0A 3LT1A 2LVBA 3SOZA 3ORQA 3U4QB 1PJ3A 2CXRA 4CT0A 2WT9A 6NULA 1P2GA 3BEDA 2XRMA 3BIFA 1E98A 3V7UA 4BN0A 2GILA 1PWXA 1NGSA 4NU6A 3TIVA 4B3TB 1KH3A 2AYXA 1KEEA 3TVDA 3ZX4A 4BP1A 2VDNB 5MDHA 2RD2A 3QX3A 1KQ3A 1Z0JA 3HA7A 3P27A 4V3BA 1QHSA 2Q5CA 5EE1A 2X0FA 1QS0A 2Z6VA 4ARBA 2CFIA 2FEXA 4XUCA 5HGXA 1DBQA 3R6DA 2J8ZA 1Z2EA 2SKDA 3F8SA 4XCVA 3RLFA 2C4NA 2V3VA 4G5SA 4N7MA 1KMIY 5C3UA 4P7KA 2BI7A 4PZ0A 3W2EA 1BTOA 1DU4A 3DVQX 1QCDA 2N42A 4O4LA 4JBYA 3FVQA 4MRNA 5BV7A 1KGDA 3LQQA 3USES 3H9QA 4HNSA 1O1YA 2YNMC 1K08A 2AQHA 2H6EA 3H6GA 4IIFA 3WLNA 1P75A 1CR2A 1M8GA 2RCNA 4PNPA 1Z0IA 3WJ2A 3ZYCA 4Y2PA 2DF8A 3AQ4A 5SV2A 1YWGO 4ZO7A 2NZXA 4ECEA 4UBMA 3KWLA 3IXMA 2Q3HA 5BURA 2VJDA 3BWMA 1YB2A 3T5CA 2O59A 2KSQA 1BHO1 1GAWA 2KQUA 2QE7D 2PRZA 3H1BA 4J1QA 4WN9A 4RVFA 1P2UA 3T99A 5DLYA 2J3QA 3T0IA 3ET4A 1ATZA 3GNQA 1KGSA 3ETNA 4IMRA 5JNTA 4BVAA 1J8MF 2WJHA 1OBVA 1VGRA 3WKBA 3THXB 1L5NA 3D5EA 4J3FA 4RZSA 4NBVA 3ZN2A 4J0DA 2AR0A 2VYFA 4WXYB 4W82A 4NCIA 4M0EA 1G59A 1VDZA 1MAWA 4NHEA 1QG2A 3WFJA 3LC7O 1KU0A 2CNWA 3HCPA 4TKUB 4ZVSA 3AEUB 3EVEA 1CY0A 5KBYA 3CO5A 3S1SA 5FWAA 3M83A 4H6PA 1NLZA 2QM3A 4LZPA 2CD9A 4P84A 5FLYA 1PVOA 1MIHA 2C4WA 3OEWA 2IQIA 4CLRB 1JQBA 4BUCA 5JCXA 3ICVA 1EB8A 1ODCA 1UT8A 1FLDA 1I94B 1M0WA 1EMDA 2DRIA 3U19A 4YJ3B 2PO7A 1O94A 4CEHA 3CUTA 3MUOA 3NXSA 4UE2A 4Z9XA 3RSCA 5IJ0B 2NVBA 3OOWA 3GLFA 4IUCS 1IBLB 3TQFA 2CVPA 3E7DA 3LJKA 4ARZA 2O1WA 4DE5A 2IYFA 3PDWA 4RMHA 4QQRA 1SOVA 3ML1A 2OBXA 2ZUUA 2QIPA 3GCGA 4JL8A 2DQSA 2H08A 2JATA 4EEXA 3BBLA 4IEEA 1FDWA 5IC6A 4DS3A 3EZ9A 4GWGA 4KK4A 2XMPA 5FI3A 5IFKA 1XQ9A 2JLVA 3HXKA 1QH9A 3H75A 2XE6A 4MI6A 2AYZA 1G3RA 4HNTA 3KHTA 4ZQCB 3BXFA 2I6XA 5BMVA 4BUJA 3FFBA 1N9KA 2FPWA 3HVUA 2V1UA 4L50A 1WSWA 3KPVA 4RHEA 3ZIAD 3C3JA 1GT6A 1WB6A 2WM9B 4OKIA 1IOZA 3DAFA 3STWA 1ZH8A 3UBTA 1U0GA 2AKYA 4KNVA 5DNCA 3GT0A 1FF9A 1W88B 1MAUA 3H5VA 3NP7A 3MMXA 4LMBA 5DI3A 1OZAA 2JGNA 2OSBA 4G9BA 4HDNA 3QBTA 3ZCPA 3AIMA 1XMVA 5BSHA 3JD1A 5DNWA 5P8WA 1LPOA 1G3IA 2EERA 1G2IA 3E7WA 1X87A 3WWCA 4PYIA 5IARA 4D8VA 3FDZA 5FB3A 2OZEA 1RP1A 2RIRA 2V6FA 1AKRA 2BGNA 2OVBA 3VYVA 2Z6UA 2IUFA 1OREA 1ZO8A 3E22A 3F5DA 2QTMA 3O8QA 1UOQA 2XOKD 2FEWB 2EFCB 3FNGA 4LMRA 3ZDEA 1WCXA 1BS1A 4IIEA 4ER7A 3FNEA 3KAQA 8LDHA 1GSIA 4HY3A 5IC4A 4GBJA 2GERA 4V0KA 5FBZA 3MIZA 1MMFB 2DUJA 1YRQA 5EJAA 5FAKA 2FG5A 1IXZA 4XYMA 4BE9A 1TF5A 4R9NA 4O2AB 5LA6A 1CRWG 1RKXA 4OFBA 3H1TA 2X1VA 3R75A 2JI6A 4P2GA 1DG3A 4TTTS 3L8CA 5KKNB 1SEVA 1WQ4A 2AKAB 2FUNB 1Z26A 1K5GA 2BONA 1OYOA 5CM2Z 3M1IA 3VYUB 4P0QB 1B2RA 3TKYA 4WKBA 3LUBA 2AOXA 4JBIA 1U9ZA 2J85A 2Z8YA 1NUHA 1XCBA 3P9RA 4R4JA 4ETMA 4MDFA 1MO2A 1WE2A 3F71A 1D1PA 3EASA 4F3RA 3LUDA 3OJCA 2WJ6A 1KMHB 3ANLA 5DU2A 3P45A 3EGEA 2JFQA 5EHZA 4Q9KA 4BRUA 5IJXA 3ELBA 1RC0A 3ONDA 4MZDA 4RTSA 1UBEA 3AKDA 1QZTA 2HNAA 1NF2A 5EUQB 3VH4A 3UJ7A 2BAGA 1AKWA 4DNOA 2B21A 2PUWA 2WFZA 5LDHA 2JAOA 2ETVA 1VE6A 4N54A 1CEEA 3IHLA 3AGQA 1PN3A 3EPPA 3KJHA 5FBHA 3I04A 4XGNA 5CVVA 5LOVF 1FBTA 4Z9YA 5CDSA 2DKOA 1C2TA 1PJSA 3IS3A 3PWTA 1XQWA 2JVKA 4HC4A 4AZ3B 3DKPA 4P80A 4BLTA 4HI0E 1WL8A 1J8FA 1AN9A 1EQ2A 2EJUA 2ILVA 3LSYA 4I50A 4Y9DA 4N1AA 1NN0A 5IN4A 3KWFA 2JFOA 4M55A 5IX8A 3FPEA 1ZBDA 2RFLA 3HB1A 2WM8A 1D1QA 1A8IA 5CT6A 1E2NA 1PBNA 3EFEA 2OV4A 1A72A 1MVLA 4KJXA 4WK6A 5FO1A 3ZDDA 5I9BA 1VCIA 1LWNA 3BD9A 2V7QA 2NV0A 2XQGA 3NM5A 3ULKA 2ZJ7A 2XUPA 1B26A 2AQKA 2HRCA 4M0LA 4A91A 1CUIA 2HF9A 2ZRQA 1DVRA 3LLCA 4HRAA 4ZPXA 3RS4A 3IOCA 5CB8A 1DOZA 3QE2A 3G79A 4DYDA 2AEFA 1DX4A 3PK0A 1DCFA 1XEAA 1RPAA 1J5XA 3OBIA 1KR2A 4BB9A 1U1DA 3H84A 1T0IA 2BWJA 3LX5A 5KYYB 3ILHA 3RU2A 1DC7A 1HKUA 4YK7A 1AC5A 5AM0A 4EEKA 4GUAA 3C6XA 1E1MA 1FXWF 1T29A 1PZHA 3JQ9C 3RC1A 2FH5B 3ZD6A 3P0EA 1W34A 2ETXA 1JU3A 5EYPA 3KAKA 2D7JA 1KY3A 1Y5LA 3KL4A 5DN9A 1T8YA 4WLEA 5TXGA 2Z43A 3WG9A 1W59A 1QH0A 4Z9BA 5L45A 1YJBA 2P6MA 1ZUD1 2VRNA 3LA6A 1NAHA 4B6OA 4CM8A 4L4RA 4OGLA 4X7PA 4CWAA 1ILWA 3FZEA 1UBNA 4OOFA 2YYYA 2F9LA 1BE8A 2EARA 4H4CA 3DB2A 2YDYA 4PLPA 4IRUB 4IDOA 3X1KA 3ZGXA 2REBA 4QBKA 1A9SA 1ECPA 3DE3X 3K09A 3L0OA 1TD9A 1ODLA 3I9LA 2AW5A 3WRVA 5TQ0B 3UXYA 3VR2A 5EQFA 3CRZA 3CN9A 4RH0A 4M89A 4ZAYA 4C22A 4JQYA 4A1FA 6LDHA 4LXYA 1B6GA 1BD4A 2YJ6A 4RULA 4B46A 3KM0A 1GN9A 2XMCA 2XCTB 3ZD8A 1N0IA 1MFZA 1N6PA 4OYLA 3NBXX 3QKUA 3VR4H 2JH8A 3ZV3A 3CR8A 3F8TA 4ZXPA 4JUIA 1SVMA 2VOJA 1H8HD 2VPWA 2YZMA 3ICCA 2ZJ1A 2ZTHA 3P32A 4OXRA 4F06A 4DDVA 1J22A 2YHIB 1ZI6A 1PYOA 4QUDA 1U1EA 4BO6A 1LDBA 4QYWA 4PAQA 1Z5NA 3QBEA 1YZFA 1E2KA 3DCIA 1FMTA 3ADCA 2ZKLA 4MB0A 4Q9HA 1XRLA 2E6KA 5D5HA 1N2EA 5FOXA 3DEIA 3AY7A 3OLQA 4M1QA 3A6FA 2X0RA 4OJQA 3BTSA 1FDVA 4KDRA 3PL1A 1CQXA 1TXGA 1RCTE 3IAUA 1D2GA 2FN3A 3GBVA 5TPWA 1PWHA 2GRAA 4URHA 2VSFA 5KYUA 2IHNA 5T41A 2Y9PB 4L16A 4RDIA 2BD0A 2XUKA 4COKA 4MAFA 5IYZF 3HL4A 5C2JB 1N6IA 4P08A 1SK8A 3K6SA 1LRJA 1N7GA 5M34A 2VPYA 1GGJA 3TIGA 5B7PA 3LECA 4R54A 1GPBA 3IAM6 1M0SA 1AQYA 4PGAA 4JLNA 2WF6A 3K5WA 3NZEA 1FTNA 1VSTA 2ICAA 3C3MA 4Q7QA 3A8TA 1T4BA 1R9JA 3SR0A 3O4FA 2XT9A 3DBLA 3GJ6A 1E4OA 1JILA 3ESCA 2IYRA 4MRRA 3ABIA 3SXUA 1NXXA 2QTGA 3EC7A 1NLMA 1WWKA 4IYRA 5DT9A 1EP3B 2V4UA 1CY7A 4RA6A 4UXIA 5KQSA 1GKYA 4JNCA 1Y7TA 4R01A 4CI0B 4XYLA 2VTKA 1NVUQ 3RARA 5MFPA 2R62A 4WZAE 2DSNA 3P2JA 4C14A 1XQ1A 3BWCA 2HUPA 1O89A 3BCSA 4LDJA 4OMFG 2B61A 5AJZA 3WQQA 2D0IA 2FFRA 2CCGA 3L84A 4NK4A 5I8WA 2YVQA 4FNGA 4QOHA 1FRQA 4U2KA 3INTA 4G97A 1MU0A 4RBNA 3ABQB 2FN7A 3PA8A 4RJ2A 2J33A 4YCJA 3FUUA 1FNSA 5JDCC 1XTBA 3T5GA 2P9BA 1KTIA 4G4SP 1YI0A 5JRZA 4ZV4A 1SO8A 1LK0A 3AG6A 5IT9A 4MMZB 4U5QA 3AHFA 1C8VB 3HKBB 4Y7DA 2XEDA 1N2ZA 4L9WA 1GR1A 2C4VA 1NUSA 2ZUSA 2ECQA 2IWRA 1XCPA 3BMOB 2ZJ8A 3UJDA 5IK2A 3U81A 3ZEAA 1XDWA 5AHRA 2IYEA 4HL6A 2FVXA 4G8DA 4JKIA 1DJPA 3NTQA 2L42A 4RFSA 4MEAA 1SOMA 1PYDA 3EXEB 2O19A 1BWRA 1AV6A 3JQQA 3T6KA 3HN7A 5HM8A 2FEMA 3IB3A 4NZNA 4IIDA 2CK3A 4D4IA 4K9KA 2QSYA 3V4OA 4R1LA 3S70A 3P2OA 5FTWA 4GZMA 4DABA 1WUTA 4GHWA 2Q3BA 4P0PB 4YAFA 2JI9A 3T3IA 4NV3A 2X15A 2HZBA 3CINA 1BGWA 1P1KA 2YYSA 1NM5A 2R1VB 3OFSA 5ALNA 5K01A 1S3FA 4NZMA 1YT5A 3BRSA 5CJ2A 3SMVA 2W48A 4ZCTA 1PS8A 3CX6A 1F2TB 2XTAA 2LP4Y 3N75A 4Q03A 1UFQA 4RPKA 4WBXC 4N7RA 5E95A 4V38A 2IE8A 3OT1B 4Q3BA 2YWDA 2AGVA 4P35A 4NWIA 3T4PA 4A6DA 1NF3A 2EKZA 5AIAA 1KOLA 2NSYA 2CMDA 2P41A 1UXGA 3W1WA 2IEZA 1NURA 3AWDA 5T6BA 4L9AA 4WA7A 4N8DA 2IVZA 2CXUA 1IFXA 2VZ0A 3L6EA 4LZLA 2WIKA 2RKWA 2Y0EA 1A88A 4MQFB 3W6NA 4BJ6A 1X94A 3CNHA 3VKVA 1PSZA 2VATA 5CB4A 1RW4A 4QUIA 4R9VA 3GUZA 2G67A 1JHAA 1HT3A 4E09A 5IT4A 1HDOA 4MQUA 1UWLA 4RADA 3HJTA 1H6BA 1JU9A 4D44A 3MUFA 5FA8A 3ZHBA 1RYFA 1GYQA 2IS4A 2YW9A 2HMYB 3COPA 4I4TB 3BERA 1RQGA 5JAOA 1DFIA 4FGLA 3NALA 4IAOA 3SX0A 2NADA 3W7BA 2ZT6A 1GXSA 1JG2A 1CIPA 2QZ9A 4ND6A 4L08A 1AQUA 16PKA 1SXJD 4JHLA 4YP5A 4CNQA 3TUIC 5AW4A 2BR5A 3VISA 5GADl 1K98A 1GCUA 2AWNA 2O07A 5GY7A 1TAUA 3OIYA 2PTHA 1PKXA 3SVTA 1GU1A 1VL8A 2H63A 1X1CA 5DPMA 4AY6A 4XOUA 1XFAA 2ZP1A 3E9EA 3H87A 2IGTA 3SZGA 3HNRA 3QUSA 3B3FA 3HCBA 2FXVA 2I66A 3LP8A 4WCVA 3H0CA 4DMCA 4H4DA 1HDZA 1D6JA 2XMBA 3OJEA 4RW0A 2AYYA 3A7EA 5E8RA 2E5FA 2R6JA 4RXUA 5FCDA 1JMKC 2XF2A 4Q1CA 1SZPA 4C7MA 4CMEC 1EVEA 4V39A 3LY5A 5SZIA 1IY2A 4AMZA 4YXWA 4F8YA 3AO0B 1PJ8A 3GZJA 1V7PC 1NVFA 1T43A 4EJSA 4DIKA 1RBMA 1EM6A 1XMXA 3OCZA 4J4BA 2HSGA 2D6FA 5HNKA 2TSYB 5TB5A 3NWOA 3QIAA 1T8UA 3OQPA 2GKSA 1KQNA 1P39A 4X1YB 2YICA 4I3HA 2ZDQA 1SG6A 4EKEA 4BLWA 4JLAA 4OFWA 2WZBA 4ZQGA 3U0VA 1DCTA 2C7RA 3CCBA 1TA4A 3EDMA 4WEOA 3TE6A 3ZHXA 3HR8A 5L4NA 1NW3A 1L8AA 3L93A 3LUGA 1Z5GA 1UAGA 3QU7A 4QO7A 4ZYXA 1INLA 4B2LA 1IEQA 4PLWA 4ZMSA 3BREA 1Z08A 1YI1A 2P4HX 1NTRA 1TTTA 3AKZA 5EPUA 3RQIA 1HUQA 4QO8A 4C0XA 4EA7A 4PG6A 3D3WA 4QD3A 1GGHA 3PKIA 2BGWA 2C84A 1P17A 3M8KA 5CD9A 4AZVA 2AZDA 1NMXA 1C8BA 1KXZA 3AFMA 3M4ZA 2DULA 3N2IA 1RYHA 4PO3X 4FX5A 4UMVA 2CFRA 4GX5A 4P22A 4P31A 3WK6A 2QT0A 3PWZA 2JLUA 2ZJ3A 4LKOA 1J0XO 3RVNA 5EVCA 1NVTA 3WI7A 5J58A 2RGEA 1E32A 4ITRC 2QLLA 4HXGA 1WABA 3IE0A 1FNDA 2PKCA 2PN1A 5L6MB 2A9RA 3JRWA 2Z57A 3I23A 4LF9B 2OORA 1SG0A 1EB9A 4WAUA 3EDOA 4H1WA 2MSNA 4QBTA 3BE4A 3LS2A 1DJOA 2CEKA 2RGNC 1KI3A 4O1IA 1YB6A 4RF2A 3IPCA 4DYHA 4TV8F 1YC5A 2BDUA 1YU6A 4MIYA 5E8JA 3RYCB 3OX3A 3M5WA 2HDOA 4ZA2A 2GO7A 2YMLA 4BE7B 2VJCA 3F8WA 4X54A 1KI6A 4AXXA 1ZCZA 1XD8A 3NDIA 1FS4A 2XVXA 4OU4A 1ZNZA 1ZD2P 2GZ2A 4M22A 2VVTA 4KXMA 3M6FA 3V9AA 2ZTSA 4RF5A 4E3WA 3X43A 2F9MA 1UDAA 3PUKA 2YCBA 4UATA 3BSSA 1JWLA 2WQ6A 3IEVA 2A5FA 2MDTA 3H9BA 1FNBA 1V16B 4MUHA 3KKNA 5EFZA 3WDMA 4EUEA 5KQPA 3ZWCA 3P9XA 1UT5A 5F3WB 3RS7A 5JARA 1QHYA 4E30A 2CFSA 2H1VA 5GJWC 1G9TA 3AJEA 2Q0QA 2OV3A 1NP3A 5FULA 5KUTA 3WNQA 3PRKE 1AF4A 1ILEA 3OHMA 2WKRA 3KCQA 4PNHA 3HUUA 3V55A 3E48A 3QE4A 3PI6A 4G0WA 2BM8A 3WLRA 1NW7A 3H5OA 3CRRA 1J90A 3RIYA 4LXXA 4YBRA 2HU7A 1NMQA 5I9NA 3BL5A 5KTPA 4RF3A 1UZMA 3KQMA 4BNMA 1J99A 4EUSA 2P30A 4GKBA 3C1AA 4ZARA 3KJXA 1L8OA 1IRXA 4G0NA 3A70A 3G8BA 3THYB 4EY6A 3G1TA 1FZQA 5BXYA 1MC5A 1E3MA 5EJ7A 4NZPA 4ARIA 4PG8A 2C7BA 1B0AA 4HAYA 4HSGA 1C0IA 3AR6A 4IVQA 4P32A 1JEAA 2BMDA 4OBEA 4G85A 4Z7QB 2A7QA 4FGUA 2I2BA 4DV2B 1SMKA 1ZITA 3KEMA 2BBTA 3C5WP 5FTLA 4I8DA 5KTSA 4BJHB 3TB6A 4S1WA 1HOXA 4HYEA 2D2IA 4CEIA 2XJ9A 1LPPA 1VMEA 1OHHA 2VYVA 1U0OC 2J41A 4EKNB 2YN0A 3GBSA 1UM8A 1IUNA 2CNWD 3ORSA 2HK9A 3QXHA 4LGCA 5IAGA 3AJAA 4HDKA 3R3VA 1JLKA 3ZY5A 4U9UA 1G20B 1Q14A 2FCRA 1JFFA 5CXQA 2QN2A 2V7TA 2X2FA 1EFCA 2O20A 4HZIA 4LX8A 2Z3ZA 4BMDA 1P4RA 1V8ZA 1KPIA 1SRQA 5F5NA 1GPKA 4DZTA 1GDHA 2A4MA 1W96A 3UB2A 4ZT3A 1JAXA 2QP4A 3LTEA 1O94D 3P9KA 4CIXA 3ADBA 1NOIA 2D8AA 3RAEC 2F4NA 4FEEA 2WF5A 3OQMA 4YMVA 1VGQA 3V2GA 1G18A 1G8AA 2WUVA 4CUKA 2E4ZA 1C1XA 1RNLA 5KKAA 1JA0A 3H2HA 2Q2OA 2IS6A 3V2UA 3K9QO 1ZN8A 1ZSYA 2WUDA 3DWGA 3MMPA 4G24A 4YNBA 3RLIA 4DY6A 1QKIA 4BAZA 3UJAA 2Z0MA 2ZCJA 3HZZA 3W8EA 4B79A 1AD2A 2A0XA 2JARA 4B4WA 2GXQA 2EDCA 4XDZA 4AYWA 4P5EA 3PFKA 1KSJA 2Y76A 3KTAB 1R0CA 1B15A 2JLRA 1D2NA 3OQ1A 3QVVA 1NXVA 2R8ZA 4Y2JA 3TTYA 4BLSA 3OE4A 4MTLA 1KYVA 1TB4A 4ZREA 2I3AA 3TCXB 4ABYA 1RWVA 2G25A 1U2TA 2WAXA 3E5HA 5IM4F 3FTPA 3R6GA 1YU9A 2Z4RA 4H2DA 4RGVA 4CTKA 2VJAA 4U39A 3RRNA 3AX6A 3HU1A 4LECA 5HIIA 4KGVA 4F6CA 1PR1A 3E0XA 3KQTA 4CMHA 1JIVA 4HXYA 1EPUA 1PJAA 2CMGA 3DV9A 3STVA 2H5LA 1U9IA 3M4YA 1T9DA 2QL7A 4DLVA 3CKLA 1TK2A 3DD5A 2AN1A 3NKLA 3PBKA 4RMGA 1WY5A 2CMKA 2Q9AA 2VWHA 4U8HA 1M5UA 3SQNA 3OLWA 1M1UA 3LQYA 2JASA 3CBGA 1MC8A 1OLSA 5HKBA 1V4BA 1CUSA 1VYUA 4M9QA 5DNYB 1QHGA 1YGYA 3QPAA 1I6WA 2I71A 4BNDB 3NHJA 1T6BY 2OGWA 2O4CA 2BLLA 2Q3FA 1VECA 4DJTA 2JC3A 1KOFA 3FDXA 1ESEA 1FDRA 2BGRA 4YMIA 3J7AC 5KWSA 2NUTA 1ND5A 1WUJS 1G9SA 4EZBA 1DB3A 1ENZA 1VA4A 2WDPA 3OP1A 2EW8A 2VQ6A 4PBSA 3V4VB 4QL3A 4NBTA 3WAJA 1XN4A 5AT1A 3AFGA 4ALIA 1JR3A 2P1RA 3BHIA 3EC1A 4FYVA 4LJYA 1G6HA 1GRVA 3JQ8B 3JZMA 2RGAA 3VH2A 3AF4A 4B6PA 3OCUA 3VKGA 3OF5A 2YQZA 3OTIA 1T6XA 3NB0A 2GRJA 3E53A 4Q4HA 4C07A 3FTQA 1I3LA 1IHYA 3AIOA 1QJ4A 4ZYTA 2WKWA 1U7PA 3I4FA 3IP9A 4FE3A 3S8YA 1CWUA 4GKVA 2J32A 1XLUA 2JHPA 2C58A 1GITA 2XA1A 4URWR 2J1LA 2W58A 1WEKA 3X1ZA 4WKOA 5JMPA 5LD2B 2VRCA 3BVPA 4YQYA 2B83A 3JAKB 4EM6A 2ATVA 4DEXA 5L3QB 1ZM9A 1YS7A 1QIIA 1K8YB 3HJCA 3PP8A 1RXWA 2QP3A 2GTHA 4QODA 3TLMA 3VV2A 3WIOA 1XU9A 2H5IA 1U2EA 1EK5A 3DLBA 3AT1A 1VJ0A 1PWYE 4IIGA 2LCFA 4FLMA 4AROA 3ZWMA 2ACEA 2GCGA 3K9LA 4I55A 4XGQA 4XJSA 3GLGE 3QY0A 1ZGHA 1YMQA 4TQUS 4AP6A 4B4UA 1YIAA 5JSKA 4KWHA 4B4DA 3G9UA 4UCWA 1L0BA 2D1QA 1K8RA 2FAXA 3HE3A 2Z9DA 5DWQA 3RS0A 4BQRA 4CKCA 5BUCA 3LLMA 1ADFA 4RPCA 4ZICA 3LWNA 5AHOA 3REQA 3S81A 1ADGA 2DQZA 4KAXA 4LDQA 2B3DA 1HEIA 1V8BA 1IMOA 1Y3DE 1HMPA 2F7SA 2V7QD 1YDHA 2YY5A 1ZRNA 1ZQ9A 4OXKA 4Y9RA 2KS6A 5ERGB 4A16A 3RSZA 2OILA 1OIVA 2RGYA 5IUNC 2XY4A 2F3PA 1JYSA 4RWEA 3EXFB 4E11A 4HRVA 4KO1S 1JXMA 2I6UA 3EG9B 3RYHA 3UY4A 4LY6A 3H97A 2EKLA 3PNQA 4LF6B 2XOEA 4F6LA 4GVLA 5E4FA 1S7CA 5CYFA 5FPYA 1JZSA 2DLDA 3AR7A 3P0JA 1JI3A 1QFMA 3FAKA 1JNYA 4OB8A 2A1TS 5TVKA 4BN4A 4V1CB 2QTAA 5GZ1A 2NMVA 3CPEA 4ISCA 4Q82A 3E3LA 4ZHSA 2AI1A 1U94A 2J0EA 3CSUA 4LJ4A 5EJ8A 5FI0B 2FDCA 2BTOA 4TS3A 3R7FA 3KBOA 3I92A 3ZI4A 1IL0A 3ISTA 2JAXA 2PR7A 5ICEA 3EOZA 2FQWA 4Y1EA 2NO0A 1EFPB 3I76A 2QW8A 4M1WA 2XKKA 3F0TA 5KWIA 5EJ6A 3MGCA 1BEZA 4QTYA 5AW8A 3HJGA 1R0KA 5IAOA 1SA0B 1UDBA 4IZIA 5EA2A 1B8UA 3NORA 5CH3A 3WHKA 4XXHA 4JJGA 4E12A 4HNAB 2P35A 2B1RA 2B4RO 5EIBC 3VR2D 1DEAA 4DAOA 2EL7A 3ZGZA 4HEA6 1I4EB 1P31A 4N6OA 2WW8A 1KI2A 4LRQA 5G4KB 2J9GA 3O3OB 3EEBA 4E5KA 3UMBA 2Z6QA 4D79A 3WNBA 1OX6A 2DBQA 3R0IA 4NZ9A 4AFNA 3TD2A 4LAFA 4RE5A 3L7JA 3R9IA 1DJLA 4HQ6A 4P9NA 2BKUA 3TZQA 4AZ0B 4ERXA 1D7OA 3O1HB 1PEYA 1SUIA 3QA3E 3M3DA 2ODTX 3EIXA 3OCCA 1A7UA 1Q20A 2R7AA 5DZSA 5ENVA 3WQBA 3F5MA 4B8ZA 2NUPA 4ALLA 3I9V1 2B1IA 5IG2A 3OZIA 2QROA 2BW0A 3LHSA 3A4IA 3W1EA 4BTLA 4TV8B 5CPFA 2DUUA 4O2BF 2XT6A 2QPAA 5EGSA 1F8XA 1Z3IX 1IXKA 3ZBUA 2FLKA 1IBMB 3KWJA 4NH4A 3KETA 2G9QA 5IXSA 2O5VA 2ZYSA 4IDNA 1MB0A 1V1MA 3SJUA 1NYRA 3VH1A 3KOWA 1FQWA 1GSOA 3ZZTA 3KSAC 4U5XA 3SEAA 1WTCA 2QT1A 5D7BA 4E5YA 3JRXA 4DEYA 3VVCA 4OX9B 5DX0A 1QO9A 3LW7A 4DSOA 4ODIA 3RVMA 2X9VA 3GOHA 3T9EA 3WSVA 2F3RA 5A06A 3O03A 3OQIA 3LZ6A 1GUAA 1ZD5A 3CX3A 1XD2A 2H4HA 1UBKS 4QYTA 4WKNA 5IDQA 2HREA 2EZ9A 4OXXA 2ZYRA 1JKJA 3IMFA 4TXJA 3MOSA 1ZINA 1Q19A 1ZH4A 1QQTA 1TZKA 3CLSD 3OFVA 4I5DA 1OAOA 1P1HA 4YXFA 2JRLA 2ODPA 1OYWA 4XQGA 3JQGB 3T1OA 4COOA 4DIMA 4U7FA 1MD9A 3UWKA 2MHCA 1NFFA 3MERA 3H2JA 1YZLA 2FOLA 1OH6A 3GIWA 1J24A 2IC5A 1EP9A 4PCLA 1DDGA 4X6UA 1IHOA 1OMOA 3TZBA 5J2UF 1L3CA 8AT1A 2I1QA 4ZCMA 3I2KA 3OEYA 5HKOA 4U2DA 3FB4A 2BKXA 3LKBA 1W49A 1I6LA 3AHGA 3LHDA 4G9GA 4BIMA 4ESVA 2F8TA 1TK3A 2EFDB 4L4SA 3VZRA 4TZTA 4Y0AA 3SLRA 2RI6A 2BEJA 4QFBA 3QKSA 2R8PA 2O7RA 4K2HA 5AKYA 4YAOA 1JP7A 3DT8A 1H2WA 1H1LA 4HTFA 2OBNA 2UXCB 2CCJA 3AHCA 5G0VA 3T7SA 4BFSA 1EKXA 4C4SA 1NBEA 3T4UA 3E05A 4J9VA 5IK2D 3QENA 1QHHA 3CH7A 4M1MA 4RUKA 4ZAXA 4EL0A 1U2SA 4J43A 1AGPA 3GAZA 1OH5A 2IHJA 1EFAA 2V6JA 3LCCA 2V5UA 4I2NA 4JT8A 1Q7BA 1SK9A 2GOYA 4WV3A 2IU6A 5EI5A 1X1TA 1XXHA 3OU2A 4M9RA 4MR8B 2CK3D 2XDQA 3GVHA 1UJCA 1I0IA 4XQEA 1U2DC 1A8UA 2ZQYA 2X8AA 2ZJ5A 3CE6A 4YP1A 4Z4GA 4JI8B 3HVRA 1XA0A 4MLPA 2QK4A 1TA0A 5IKMA 2J5QA 2FZWA 4C7KA 3RU9A 1DRJA 3PFGA 3WKCA 1SVUA 2BHTA 1WUHS 2IOQA 2O8EA 2EZ4A 3IAM1 3JCZA 2Z2XA 3Q88A 3U4CA 2CKMA 5HWSA 5L9AA 3N2LA 1OZFA 3GDFA 4KL8S 1B43A 1GZ3A 3OX1A 3QE9Y 3EDRA 5CCEA 5T4EA 3NT4A 4JASB 4QE3A 2XCRB 3S44A 2CNNA 3GCDA 4FD3A 3CLHA 1WCWA 2J9YB 3LK6A 4IMIB 2OXIA 4QJ5A 2EBWA 2DR0A 2E4VA 5IJ9A 2AHOA 4Y6OA 1EX9A 2YXBA 5TS3A 4MIOA 4GYYA 5CNKA 4FMDF 4M1YA 5I8ZA 4N5HX 1TYCA 2IYVA 3H5IA 4GR4A 4D45A 4Q3AA 4WK2B 3GGGA 2V96A 4D4LA 5JQGA 3TQIA 2AFHA 1FW8A 2ZPAA 4LUCA 4QHYA 4CPDA 4B4VA 3IBYA 1E6KA 1BMQA 1E2QA 2XYVA 3BSYA 4E4YA 3DNFA 1ZCFA 2Q3JA 1BVRA 3AF0A 1L6RA 2IIPA 3LBNA 4YUAA 1CV2A 1H2ZA 1PZXA 2ALJA 3ORFA 3PQCA 4TRRA 3B78A 1AN0A 4RM3A 5JXJA 2ZSAA 1GSAA 3IBSA 3KPYA 3DE2X 3N3AC 4J75A 4IDDA 4R05A 4CLEA 3L9WA 5BW4A 1H1TA 5IHPA 1N34B 3IDAA 3QLVC 5IBRA 3CZ4A 3VYSB 5JI2E 3PVZA 1L7PA 2WVHA 2J9ZB 3EA0A 5MN4A 3SXPA 2WWIA 1B6SA 2NNLD 4BFXA 2BGLA 4KMOA 1I0LA 3BXZA 4J0KA 1VZ2A 3WYNA 4WZBB 5DK6A 3BXOA 3ZDFA 2VP5A 4DDWA 4H3VA 5KEIA 3D02A 4UHHA 3WLPA 4ICIA 5KNCA 2A0FA 3C8UA 2XXJA 1AJEA 1QYCA 2BEVA 3P26A 1E5DA 4REOA 1ZOPA 2A5YB 1ZISA 4D41A 4YXWD 1W0KA 2VP3A 5FWNA 1FXSA 1KEKA 3BXHA 4KQFA 4LSWA 3L1JA 1JDZA 1JA9A 3PNLA 2RH5A 3B7GA 3RIGA 3E35A 1S2LA 1XZJA 1ZOIA 1NXWA 1MRNA 1J5EB 3M9XA 4P86A 5JADA 3NBKA 4OJKA 2FW7A 3MRTA 5GIOE 1TEXA 4WXHA 1O7JA 1RJ9B 1U8XX 1UQUA 1CQJA 2AR7A 2C5LA 2X22A 1SUFA 4LSMA 5K6AC 5ALEA 3B1ZA 1F6DA 2DFTA 4OUKX 4TVSA 8OHMA 4HX2A 2YOHA 3TDMA 4URZR 4KQIA 1PQWA 3INNA 4Z9AA 4RHCA 1E60A 2XLCA 4C0KA 4JD5A 5EKXA 2BP7B 1KVSA 1N2HA 3EIFA 3VDRA 1NLFA 3KAPA 1CQIB 3P9QA 4PC6A 2HSEA 5DDIP 1SAYA 5DNVA 2EFEB 5EWLA 2BFFA 4ZVMA 5ILGA 2C77A 3LQKA 2GCEA 4Q47A 2NZYA 3OMWA 5SICE 3K1AB 2HYIC 1SQ5A 4NJMA 4QPNA 2BCGY 3V7NA 4N18A 3HYCA 1CUWA 1VLZA 3OLXA 4PFQA 3UB4A 5BOVA 1O9GA 5NLLA 2IOHA 1YS4A 1I4LD 1VG1A 3K0EA 4OSPA 1QRRA 5TF4A 2ZS8A 4LG1A 2YJZA 3GROA 3R6LA 4EBBA 2JAWA 3JD2A 2MCFA 1U1IA 3TZEA 4FCTA 4DJDC 1S2OA 2IYWA 4LYAA 4RLFA 3K5PA 4EPYA 3LPLA 1PFUA 4BKPA 1MEEA 2WT4A 2YOFA 3CXRA 1QMPA 4GXTA 4KXFB 2RGWA 4DDUA 3HXTA 2W6JA 5ITSA 5B37A 3WHIA 1OWPA 3BPSA 1COZA 4QOJA 3L0ZA 3O2NA 4C04A 1T2DA 1K7EB 2B4TO 2XNKA 2AZTA 4X5OA 1X9HA 1G6KA 1II0A 1YR7A 2GK6A 3DUFA 3E9MA 3LI2A 3TSWA 3U62A 5BSVA 4A6PA 1GV0A 2UVDA 2VFAA 2ZAYA 4FFDA 4UUBA 3VU9A 1ZOLA 5JC1A 1DIGA 3B5EA 3ZU6A 3QMPA 1ULUA 2XCLA 3L1UA 3AESA 4WJZA 4ZV9A 1P1FA 2X5OA 3UFXB 1D03A 1WXQA 1YUNA 2PZJA 1DAHA 1V5EA 5FBLB 2DZDA 3RRFA 3O8BA 1CSEE 3ZUGA 3L0DA 4BX9A 3LL4A 4YJFA 4W1PA 4CTJA 5DOVA 2CZQA 3K0HA 4DLRA 4PE5B 3ZTWA 1ZM3A 3IP3A 1FIUA 2HWXA 3R9XB 2R8YA 5DE3A 3RHZA 5MN6A 5AKJA 2CUZA 2B0CA 2HXYA 2GWHA 1ZK3A 2NYVA 1UFOA 2P1DA 2PQ6A 2RHLA 4V0OA 3VU3A 4BEJA 3IPAA 2QQ5A 2ZJBA 3AVOA 3EZFA 4IQ8A 4PXSA 4TXMA 3U13A 4E4TA 1X80A 2JAQA 3QX8A 4RE6A 4XGKA 3W77A 1FP1D 4RA9A 5HF6A 1EWQA 3SG0A 1IZ7A 1GZSA 3F2IA 1CZLA 1D9XA 4BMVA 4UMFA 2PS9A 4LMPA 4KN5A 2YN4A 1H23A 4ZZ0A 3QHPA 3W04A 2HAEA 3DVLA 4NEQA 4KR0A 3WGVA 2RBKA 1LFDB 2ZLBA 3FSJX 3BE5A 1N6KA 4P98A 1KY2A 4OKNA 3P0IA 5TQ2B 4G1UC 1R2QA 3OH8A 2Q6VA 1F2UB 4K28A 4CM3A 2DECA 4DMUB 2V0GA 5DHUA 4ENQA 1G41A 2M6KA 5GQSA 1MX1A 2EL9A 1FUYB 3ET5A 5BWCA 1TCBA 4DRZA 4GOOD 4QQFA 1QTNA 4U2BA 4AAYA 1XPRA 2GD1O 1L5WA 2DFKB 3LYHA 2QRLA 3O75A 1V37A 2QG4A 2PD3A 2VDPB 4P36A 4E33A 2C95A 4J91A 1WV0A 1VSVA 4TVKA 3T7TA 4GMGA 4HFNA 4OBXA 1QDEA 3KFVA 4O2BB 3QKRB 1QIEA 1JQJC 2Q2VA 2VYVD 1OHHD 3C1TA 5B5SA 1V35A 1BMFD 1ZZEA 4MDYA 4P1ZA 5F7OA 1ES9A 1BHJA 4N12A 3I09A 4CMAA 5LJLA 4ROSA 3RS9A 4B3IA 3RC2A 5B2FA 2O0JA 5HDQA 1VPTA 1IEVA 2V3WA 2WEKA 3O84A 4NCXA 4XGIA 5C7IO 1KEUA 4PLYA 1MO6A 1YQGA 2HJRA 1KR5A 4BQQA 4NX2A 4V1CI 5JYBA 3S29A 2D4AA 4KQJA 3LTNC 5FKJA 2B8WA 4CNBA 1JEJA 5ILQA 2EZTA 4NCHA 5L7TA 3TBHA 3V8PA 3T5DA 4PC1A 1HG0A 3UHOA 3VPAA 1UKEA 2YXLA 3A4NA 1EFTA 3OQHA 3K5IA 4LPKA 1V3TA 3FI0A 3U4MA 4S35A 1CR1A 2C4HA 2Y71A 3C5CA 4JI5B 2IZ7A 2QD4A 4B3CA 5A7FA 3U6KA 2HQRA 3CW9A 3HUDA 4UHKA 1CUZA 3V7WA 4D3DA 5EJEA 1XROA 5CVEA 1YVDA 4YH1A 1U2PA 5HRUA 1ZRSA 2ZE8A 4MNTA 1DDIA 4FE7A 4RV4A 1C9KA 3B12A 3LHKA 3BDVA 1IDN1 1N77A 4HWSA 4P3NA 4GFDA 2PWBA 4CMJA 1F2DA 4P5PA 3H3FA 5A5EA 4TL6A 5F64A 2FQ1A 4NY1A 4Z99A 1X1EA 4HQNA 4S3MA 3JAMA 3PUIA 2GPWA 2PNJA 4TT8A 2VZ8A 1JEQA 1FFXB 4OI0A 4OREX 3NI2A 3PFWO 5JUWA 3BGSA 4RVNA 4JYPA 4CU2A 1FZTA 4UM9D 3DAHA 5FNZA 1ID8A 1O8BA 3A1DA 2D7DA 3T7DA 4AMBA 4B0OA 1DXHA 2ABWA 3CG0A 3KKQA 4W99A 2FPKA 3CKKA 3M6UA 3HBLA 1L2TA 3KSRA 2WY2D 3DOJA 3RJTA 1FLNA 1KY5A 1X15A 1BDIA 3I3SR 3FW1A 3VPBA 4X7MA 3WBBA 3DR5A 3AVVA 5JSZB 1YOVB 4X94A 1RWPA 2RG7A 1LQ2A 2AXPA 3D4OA 2JKVA 3DP9A 1R4MB 5ABPA 5BMVF 4IDGA 1PL8A 1LSUA 4HAWA 4JJKA 3HM2A 4BVKA 1EJBA 1XU7A 1ONOA 4N3NA 4UU0A 1QONA 3FAZA 1E2MA 1ZJ6A 2BSAA 1QHFA 2VP0A 5DASA 1UJ6A 4HDOB 4QLAA 4U3JA 3K9HA 2P3SA 5JROA 5FX2A 1WM1A 2Q6TA 4B3GA 1QVZA 1UDCA 3L01A 3O90A 1RZ3A 3ZOKA 4RM2A 2P2GA 2VQ3A 4DV6B 3WGJA 3LBIA 3WB1A 4CT4B 3U4HA 3ADDA 3MWJA 4RPHA 3HZRA 1ZMTA 1K8ZB 1JR3D 3K9WA 2EHJA 3B1VA 3FMOB 4MGHA 1GNPA 4FBLA 5AP9A 4U1RA 4P83A 2FP4B 4FDMA 3GD7A 2DHRA 3H4TA 3H13A 3M70A 5K3FB 1NXPA 4QOEA 1QFZA 2F59A 4ZRNA 1I3KA 1QO0A 2PXAA 4L51A 1LVUA 4WY8A 1KRXA 3F6PA 5CBKA 1ZRMA 2IDKA 1OXVA 2PS1A 2P2LA 5LU9A 1HR0B 2PRKA 4FMDB 3WGLA 4BAGA 1P2FA 1K7XB 3JASA 1NBME 2ORYA 5KNCH 4AU1A 2L17A 4MGIR 3WWDA 3ITNA 1ZMOA 1T2NA 5K0BA 2PVCA 2R3SA 1PLKA 1QG4A 1JEEA 2GBLC 4YDRA 3FZNA 5GVRA 1U8ZA 4ZHQB 1I7LA 1NNEA 1G55A 1P4AA 1BVYF 4R1NA 1N9ZA 3GP8A 3WK8A 2NO5A 3V8VA 2G7ZA 2FN4A 4R1MA 4QDTA 2IX9A 2QX9A 5IT0A 5FUQA 3RTBA 1EVYA 1NBAA 1XZ8A 4OATA 4ILEA 2WYWA 4IIUA 4RYLA 2SICE 4BU1A 4CIWA 3ETHA 5K6RA 1VE1A 3PC2A 2IPLA 4TSRA 3D54D 1C80A 2RDMA 4PGMA 4Q1BA 2QU8A 1Z83A 4A8JB 4NJEB 2XWPA 4UMDA 3KO8A 3LV8A 1IUPA 3O94A 3RW9A 2MINA 3UATA 2AF3C 4W8OA 4FFRA 1QORA 5GZ3A 4E14A 2EEPA 3HDTA 3I64A 5H68A 3V1TC 3IQFA 1SXJB 2HMVA 3LIIA 4ZALA 4F56A 1N3IA 1O95C 4NNJA 3G2QA 1NR7A 3TTUA 2Y1CA 2Y68A 6YASA 4MVJA 1KYQA 3EBLA 3NCTA 3VYWA 4I50F 1Z7BA 1GA4A 3R8CA 1M6YA 1TI7A 1KF0A 3NGMA 3G2KA 2YKGA 2DC1A 3FCOA 4P2BA 4G1FA 3LYAA 1DV2A 3FLBA 4KN6A 2I3ZA 2R8BA 3N39C 4LNUB 3TNLA 4G6ZA 4ALKA 3S2YA 1CDDA 2P5TB 3OE5A 3QVSA 4L75A 1YQWA 3KWMA 1EK0A 4MYRA 1QNFA 2FOXA 3A9SA 1TGYA 4N65A 1T13A 1PZNA 5I7OA 4RS3A 1L5RA 4WN3A 1FK8A 3OY2A 3ZXXA 1PW5A 1BDBA 2JLBA 2EF1A 4CMGA 3R09A 2IK8A 2GN0A 5EXXA 4ZT4A 5A4JA 1I33A 4BBAA 3ASVA 3EEYA 4ZC8A 3CW8X 5T67A 5G4LA 2WDZA 3W9YA 3DDCA 2C04A 3K1JA 3KL2A 3TLCA 4C20A 1RWOA 3FPSA 1FMJA 1R5BA 3T95A 3IVXA 3HYNA 3UK7A 4P7BA 3GGJA 4TUYB 3EQ6A 4LHXA 1Y8RA 4MW4A 2AOTA 3SJZA 4GD3Q 1MEJA 2EBHX 2REQB 4FOTA 4G37A 4MINA 4K26A 1JKXA 1L4MA 1VDMA 5DYWA 4F4DA 2BFCB 5DSXA 1YQTA 2A9VA 1LPBB 1N5RA 4KOAA 4LDAA 5KX5F 4C4PA 3SWWA 1MZVA 4FI3C 1OI3A 5F78A 1U2GA 5ADHA 1NUPA 3PGKA 2WF7A 4EPTA 3C3YA 3IE1A 3MINB 1E3QA 2RGXA 2ZUEA 1PR6A 3EXG2 1R8XA 4JLKA 4G1EB 3PFIA 2G3YA 4JBNA 1BE1A 2X5JO 1XLVA 2I87A 3R0QA 1UANA 4A82A 2FX3A 4MGYR 5FOWA 3U7QB 2FJPA 5AFSA 3KR0A 4NU5A 4DMHA 4QGFA 1SVLA 2UVQA 4D8TA 5B3LA 2ERCA 4C5BA 4RQUA 1Z6ZA 3MK31 4KQCA 4CKBB 1AGXA 3AUXA 3WOHA 5BSGA 4B3MB 2K87A 1DHTA 1MIOB 1YHYA 2I5PO 4G0ZA 3WYBA 3GOQA 4XWWA 1OXTA 3O4RA 3DMFA 4W9RA 3BH6A 1JBKA 1I9CA 5HQ3B 2X0IA 1TAGA 3LOPA 4KFRA 1YZ3A 4J94A 1WUKS 5IMSA 4UVGA 3EB9A 1SVKA 2RH8A 3D8TA 3OUZA 4MWZA 1CS0B 2O50A 5GOTA 3ZK9A 2QW1A 3X1XA 5K0NA 5F1YA 3QWHA 2GDZA 2QSJA 4FVTA 4HLUA 4G5YA 5IAEA 3ZKWA 1JPVA 1Y33E 2ESRA 3KXKA 2OA0A 1GZ4A 1T4MA 3CZPA 5C53B 1SU7A 1Q6YA 3DLCA 3DDSA 3MZ0A 4HLCA 4Q21A 3ZH2A 2FSFA 3O2QB 3U5TA 3FSEA 1FJXA 5FNVA 4KXUA 2YS7A 5E2BA 3LRTA 2O2GA 3JXEA 5SY6A 3U4GA 1UJ5A 4H0FA 4FYPA 2IXGA 1WF3A 1DLJA 4HDRB 1TPZA 3OPQA 2G6TA 2PLNA 4HEA1 3VKFA 5DP1A 4DM4A 4JEUA 2Q5HA 4H0NA 4E0BA 5K99A 4KLCA 1DKPA 3Q2IA 4YCMA 4GM4A 5HKKA 1V5GA 3MM4A 2X14A 1LPAB 3OT4A 1Z0KA 1Z5OA 1Q12A 1CU1A 2VP6A 4OHPA 1QS0B 7MHTA 2XZLA 1QHNA 1IVYA 3ERCA 2CSUA 1R0RE 4XJTA 1USUA 5JCZA 2ERXA 5E4JA 3DKVA 4LVCA 1DG9A 2QL5A 4L0QA 1NF8A 2OCXA 5TDHA 4RABA 4A03A 3GJ7A 4AXBA 3W3ZB 1LBHA 2AJCA 3HU3A 2DE0X 4O4LB 1IN7A 2NO6A 4D3YA 3HHEA 1E89A 2VJKA 3TRHA 1TEVA 2YFQA 3N8IA 1T3TA 5LR6A 2Y1DA 4A92A 5L3VA 2YL2A 1KAEA 3WK9A 2GRUA 3L8EA 4X66B 3ENQA 3KKMA 3LC1O 4I9NA 4DBLC 4ENVA 5AJWA 5BYKA 2ZE7A 5I9TA 5FL7A 3PFCA 3P0HA 3RVOA 3NHYA 2RI1A 3PHBE 4ZEWA 4CIDA 2IBSA 4ZIRB 5CLGA 4L28A 4H0CA 3AG5A 3I5MA 1TYBE 5A3JA 2A3RA 1Y1QA 1UP7A 4WN9B 2HNKA 3MAJA 4W5TA 1VLHA 3K1YA 3NXKA 3B9QA 1LB1B 1RRVA 2A57A 3DLPX 3DT9A 3G0BA 3GJXC 2OCGA 1T8WA 3OESA 3HFRA 1K7YA 4JI1B 4DC0A 3F5FA 2JVJA 2OZLB 1YSCA 1K5HA 5HX7A 1WPGA 1I01A 4F72A 3AF6A 2Q41A 1BAPA 1UH5A 3DZ8A 1BX0A 1PUXA 5J43A 2B5WA 4L4XA 1NFRA 1QXSA 1GPH1 1KJNA 1Z5ZA 3WLEA 4I6GA 2DFNA 3LBHA 1XHLA 2GJAA 3FLMA 3K92A 3PGMA 3SJCA 3W2HA 3WMRA 3LQFA 3ZWDA 2G82A 2FPPB 2CLLB 3E8XA 1NONA 1SHKA 3GV0A 1T9HA 3GZNA 3MUNA 1DXOA 1EWYA 2PA3A 4WCFA 5EERA 1PRYA 4CF7A 1E9DA 1Y3IA 1UT6A 3SYKA 4YR7A 5LXTF 4MVYA 4I81A 1A9YA 2IZ0A 4RDCA 5E9JA 3GLFB 2HFJA 4LGYA 3DBRA 1C4OA 2H3HA 2OXFA 4DEVA 2D1RA 4XDGA 4JVOA 1NULA 4XM2A 2HRDA 3B1FA 3BWVA 5C8XA 4X84A 3SK0A 1TCAA 2IWHA 4YRMA 4AW9A 3D2AA 4QM6A 1D2RA 2XZPA 9MHTA 5ECGC 5BWMA 1W0CA 2LV8A 1M6EX 2I8AA 5H3CA 4BNIA 2CMFA 2Q49A 4Z9FA 2XDYA 3M6VA 3S5UA 4W5OA 4ZT5A 3K70C 3CVOA 3JQAA 2D59A 2YWBA 4Y30A 2ZYVX 4PYJA 2H11A 1P1JA 2DHCA 4GLFA 4AECA 2NTJA 2IV7A 5KYXA 4GWKA 4PPYA 5JQWA 3RFXA 2OAGA 4P54A 1FVXA 3WSTA 5DX1A 1YNSA 3MPUA 4YJGA 5AQEA 4E32A 5HDBB 5BMVB 3GA7A 5AW2A 5KNCD 2P6PA 2ZWVA 1F06A 1TQDA 2EHDA 4K9OA 2AD1A 1E2DA 2CHFA 4NENA 3W8NA 4D4KA 5C7YA 3T8YA 5A5VA 5HRAA 5IHXA 3D9QX 1MB4A 1N5LA 1QHXA 1W0KD 2GCPA 2OB1A 3FLAA 4Q7LA 4JVLA 2Z08A 5CG1A 4DCSA 1E69A 3AUSA 1NYQA 2EC5A 1L7OA 4HDNB 3TLYA 5A62A 4LC1A 2GB4A 4KN8A 1ZK4A 1ZUIA 3LLVA 2BHSA 1HF3A 1DGQA 4KQ9A 4TMZA 3DVAA 3V7YA 5B6IA 1H94A 3BJZA 2ZU0C 1X7XB 5CIYA 1JLHA 5DGXA 1KIFA 3E22B 1Q21A 2LIPA 2ZCVA 5FA6A 1JQKA 4Q9AA 2P3OA 1R7RA 2V45A 1QIFA 1YE3A 3HCRA 3NTRA 1XK6A 2PV7A 1A3CA 1QYXA 5AW5A 3KKLA 2AIRA 1LI4A 2QYSA 3DJFA 1KH2A 3FB1A 5EQJB 1CY6A 1XVIA 2BTQB 2YIJA 3DFZA 1W5AA 4MGEA 4Q7EA 1FDSA 2QPOA 1YS1X 3BIJA 3L8HA 5LA6B 3CC8A 1NSYA 1NR5A 2IV3A 4CM6A 5JAHA 4GIBA 5C0OE 3LF2A 1JG1A 1X3LA 3H99A 5LD2C 3RYFB 4MVJH 5A05A 3RRXA 3EG5A 2EGUA 4FHCA 5D87A 3TFQA 1XZKA 2VQDA 3TSZA 4AJ2A 1EJ0A 2D5BA 3AEQB 3AR4A 1USVA 5HCNA 4A3SA 4PGGA 1NT2A 1JXOA 1YZVA 4O59O 2OQ2A 5HS6A 3CPHA 4YMHA 1ZCJA 1QP7A 3I9NA 2DQKA 1PQYA 4NBLA 4LCEA 3SHQA 2CUNA 1ACLA 4A0SA 3MWKA 1X42A 1JUDA 2QTVA 1SRRA 3DEAA 3D4NA 4RC9A 2D5CA 1DKOA 1OBHA 2W6JD 2W6PA 4BQPA 1TYEB 4Z4FA 3W5AA 2Q62A 3B53X 1FRZA 4AL4A 5CDYA 1F8UA 1V6AA 1JIKA 4RK0A 3A11A 4PM4A 5GVSA 1VHDA 3OU7A 3ANXA 5EJFA 5LIPA 2W42A 1YDWA 2AXNA 4EG6A 3OM0A 4DSNA 4XPIB 3ENKA 3UT5B 2LTAA 1R37A 2HA7A 3G0DA 4YVFA 2OCIA 1UDXA 4WKGA 4ZQIA 4DCUA 1OROA 1ZSNA 1Z8DA 2X2OA 3OE7A 3OZGA 1PF7E 1YI8A 4IOJA 1KYIA 1W4BA 2VBIA 1OBOA 4KAAA 3MJCA 4QYMA 3NAQA 4UHBA 3G5AA 1E9VA 4XB6B 1PEDA 2H1WA 1M0TA 2H0QA 4PTLA 2HADA 3AR5A 5AK0A 3IOBA 5HS4A 1AHHA 5EUCA 1CIVA 3I6MA 2OENG 1CEXA 1XRNA 3K1TA 2DKFA 3G7SA 4KR2A 4PLZA 1JXQA 1T8PA 2R1TA 2JJMA 5DXFA 3ANTA 2IF0A 3AYZB 3LXMA 3PUVA 2FSHA 4GC9A 4O1MA 3QEKA 5D7NA 4G0OA 3ZOZA 3HXQA 1JR3E 3MTBA 1E94E 2ZSFA 4NARA 2Q5EA 3JR7A 2YVUA 3FNQA 2GT1A 2Q21A 1LSSA 3MBIA 3NRJA 3UVEA 5L6LB 3QOWA 4YMWA 3GLRA 3URKA 4RCZA 1L5LA 4O25A 2QTFA 3JQRA 5EAIA 3EXG1 1VOTA 3TPZA 1FP7A 4WASA 1QG0A 1U8FO 5J23A 3SU8A 3TIXB 5L3SA 1A8HA 5T57A 2FHPA 3PJRA 1P9OA 1RI2A 2RB4A 1A7JA 2ONKA 4CM8B 2D5AA 2GZAA 2VLIA 4MITA 1EUDA 1CJCA 1M2EA 1Z2DA 4N3BA 3SY8A 1SC3A 1JSCA 4TT3A 2ZREA 1HDEA 1PR5A 3C70A 3N3BC 1M6VA 4QIHA 4DT1B 2QI9C 1PQ4A 1IY1A 2GCIA 1TCCA