5G4KB

Phloroglucinol reductase from clostridium sp. apo-form
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
264
structure length
264
Chain Sequence
MVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDADCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
source organism Clostridium sp.
molecule tags Oxidoreductase
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
total genus 108
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4kB00
4PCVA 5T67A 2YZ7A 2EEZA 4H16A 4XX0A 4WJZA 1CWUA 4I5GA 3FTPA 5AXAA 3QWFA 4YT2A 1N5DA 4IZHA 3WMWA 3UCEA 2W2KB 4WCFC 4EEXA 3NTOA 2CF5A 5ITVA 4DPLA 4M8SA 4FIZA 4LVUA 3OFSA 2POQX 2X22A 1DIHA 3NUGA 3FR8A 4CM6A 1ENOA 4FFRA 3QW2A 3S8MA 3OETA 4D0SA 1RM3A 2AW5A 3NTQA 4YAEA 4DREA 2HCTA 2C29D 1HLPA 3BMOA 3BTSA 4YJFA 5L4SA 2ZTUA 3PIDA 1BVUA 2B69A 4AFNA 4YQZA 2FHSA 1NR7A 2GF2A 5ER6A 2SCUA 2OXIA 3ZV6A 3DZBA 2PKRA 5TNXA 1E3IA 1LSJA 3K2BA 5A03A 5BSFA 1X1EA 2AE2A 4JP2A 5BNIA 3F4LA 4YRDA 1UXJA 1ZJZA 1WMBA 1YQXA 2OHXA 1ZCJA 3FBGA 1XQ6A 4ZGWA 4CMKA 4KDFA 1G6KA 3EMKA 4DTIA 1A4IA 1VL8A 4W9NC 4S3MA 2DU8A 2AG5A 5L3ZA 1ISJA 1LDGA 2EJVA 2JFFA 3GY0A 3NV9A 3B1KA 1ZZEA 2G17A 2VUUA 2X9VA 3G49A 1U3WA 1V3TA 3MJSA 4DA9A 4BNMA 4IDAA 1ULUA 2EXXA 3PWZA 3DZIA 1NP3A 3WYCA 2Z1MA 3LT2A 4ND3A 4E33A 4I5EA 3MJVA 5C7OO 1VLLA 4G5HA 2P4QA 3TZKA 2VZ0A 5U9CA 4BNJA 5JDCC 4J49A 4R3WA 4U0KA 3N58A 1YKFA 4WEQA 4HP8A 4PVCA 1X14A 3T7CA 3WIEA 1B2LA 2C59A 3JQAA 4CQLB 1QR6A 3HFSA 3MWEB 4PLZA 3L6EA 1NQAO 3OA0A 2G5CA 3L07A 3C1TA 3PP8A 1M6HA 1XEAA 3RSHA 2V6GA 3KSZO 2FR1A 2Z5LA 3GHHA 1C14A 2O3JA 2OFPA 4FC6A 3CZRA 3PHHA 3ASUA 5CG1A 2J8ZA 4NK4A 3VZQA 2A4KA 4B3IA 3K2EA 1NAIA 3GEMA 4J16A 1B3BA 1JN0A 1ZK3A 3HJAA 3I9JA 2IDZA 1P1HA 4IJUA 3LT0A 4GMFA 2NVWA 3Q1LA 1O95A 4S1VA 4PLGA 2IXAA 2IRWA 1C1XB 1V35A 3FHLA 3I3OA 5CFZA 3E5MA 4WNCA 2E37A 5JPIA 4R68A 3TOZA 1CDOA 1WNTA 1E1NA 3E1KA 4EW6A 5JYEA 4K9DA 2HK7A 2OUIA 2D8AA 3BA1A 2GNAA 1GQYA 4BS9A 2ZB3A 2CFCA 3RUCA 1N8KA 4MVJE 2NTJA 5TGDA 4B4UA 3ZI0A 1Y8QB 3CXRA 3ADOA 1RM5A 1ZEMA 2PWZA 3B70A 3VZRA 2J3KA 1M2WA 3PIIA 4CPDA 1GTMA 2E48A 5KJCA 3KBOA 4CMIB 1Q0QA 1LU9A 3RFVA 1CETA 4RZIA 4W99A 2DBRA 1ZMOA 1DDOA 2B4RO 4NI5A 3AOEC 4AJOA 4RVFA 1A27A 4LGVA 4JN6B 4MP6A 3KOUA 1WWKA 3GVIA 3AW9A 3SXPA 3GMSA 4BMNA 3UN1A 3AI3A 2EP7A 4GBJA 4NK5A 4QFCA 1Q7CA 4WLFA 4ITUA 4R54A 2Q2VA 4UUPA 5U4QA 1I30A 3V1UA 4CQMA 1GPDG 1SMKA 1U3VA 2BMAA 3FNGA 2AQKA 2OGUA 4ZA2A 1WDKA 5TLSA 4KQWA 1LDEA 1WVGA 1IPFA 5KKCA 3ROMA 3KEQA 4CM4B 2XXJA 1IULA 1B16A 2E4AA 4GQAA 4D46A 2LDXA 4BGIA 4JK3A 4ID9A 2H1SA 3GDFA 3VPGA 1TLTA 1NHGA 3WGYA 1EDZA 4WLUA 4GX0A 3WWZA 3GF4A 4Q3NA 1K0UA 3CMMA 5BNTA 1I3NA 1Z74A 2BF7A 4P8RA 1R4MA 2B37A 1AUPA 2H9IA 1SEVA 4L4RA 3KLMX 4YRAA 1YJ8A 4GAEA 3IUPA 4DMLA 1HLDA 4LMRA 4WASA 5G0VA 2JCYA 4H15A 4Z9FA 2W4QA 3OHSX 2VWHA 3JQ7A 3MJEA 3RBZA 1H2HA 1ISHA 5T5QA 2DBQA 3V5NA 3JQ8B 1QYVA 3RKUA 3VH1A 1QRRA 2ZATA 3DL2A 3HN7A 3O8QB 5T57A 1GD1O 1HXHA 2Y1GA 3JQAB 1PJBA 3K92A 1I32A 4DYVA 3GEDA 4YTEA 3GGGA 3ZV5A 2UUPA 2JD2A 1K6IA 1Z73A 2FSVA 3HDQA 4JJGA 1H5QA 1DB3A 3TZHA 4E12A 2FZEA 2Y1FA 2JFHA 1PJLA 3GZNA 2PZMA 1BTOA 4UUNA 1UDAA 1BWSA 1XGKA 2VQ3A 3RU7A 5IZCA 1QG6A 2B5VA 2AHRA 3EZLA 4FFLA 3AUUA 4AJHA 3S2EA 4EGFA 3GVXA 1X0XA 2AE1A 3QHAA 4FJ2A 3INRA 3Q3CA 4BIIA 3KYDB 1RYDA 3BTUA 1C0KA 3W4KA 1GZ3A 2JCXA 3QJ5A 4GMGA 2P9EA 3FPCA 3TZ6A 5KVSA 3E48A 3VAZA 3GK3A 2O4CA 2DUWA 2DTDA 3MOGA 5BR7A 4BKOA 1HDOA 1ZJYA 4XGIA 1ZVMA 3X2EA 1DBVO 4KWHA 1E5LA 1TXGA 3HFGA 5KVCA 1DEHA 3P2OA 2X5KO 1X13A 4P4NA 4TRNA 3PZRA 2QX7A 5EINA 5G4KA 1HSOA 4I8XA 1A9YA 5TT1A 1L1FA 3ONEA 3GOHA 4J9VA 3P7MA 5U1PA 3ZWOA 3ULKA 3GVCA 4JBGA 1U1IA 3PXXA 3QWBA 5AXDA 2ZYDA 1I01A 2JAPA 5F1OA 3AJRA 3AU8A 4E21A 4GGOA 5KTKA 4GL4A 4Z9YA 4Q3EA 3GVPA 3KTDA 3RAJA 5H83A 4RJTA 3WGZA 2JAHA 2VCYA 4MJLA 3VKUA 4NFSA 3V1TC 3GHYA 2A94A 2EGHA 1GFSA 4FC7A 3QSGA 1ZFNA 2I99A 4YT8A 3PLRA 5EERA 2Q45A 4WCFB 3DR3A 2PKQO 3I6QA 1QMGA 4CUJA 3ZHYA 3PPIA 4UUOA 1NAHA 4HADA 5ENDA 4II2A 1EFLA 3I9LA 4DLLA 4O59O 2RAFA 3DZFA 1QV7A 2O48X 3PFFA 5K0ZA 3W4IA 2UVDA 4KTVE 4A03A 5F1PA 4EI2A 3JQCA 3AWDA 1NPYA 3NDRA 3L9XA 4PLVA 1WAMA 2X86A 1OFGA 4TKMA 5JCJA 4ALMA 2JCVA 1LSSA 4HX5A 4B3JA 3G1TA 1EDOA 2Y1DA 5L45A 5IDQA 4YT5A 1YRLA 4ALJA 5B4VA 6ADHA 2EKLA 3H8VA 4RDIA 4RVSA 3KO8A 5ER9A 2NUAA 3PI7A 1J5PA 4II3A 1PR3A 3WBFA 1LQTA 4ND2A 4RGBA 1BW9A 2HAEA 4E3ZA 2P4HX 3TZQA 1WLYA 2QRKA 1JDJA 2UDPA 4FFPA 4XQEA 3ITKA 3RQSA 2GERA 3LF1A 4IDGA 1HE5A 2EKPA 3U4DA 3BHMA 1DRWA 4DGSA 3RUAA 1TEHA 2BH9A 4B8ZA 3IP1A 4NHEA 3S2IA 1YXMA 1X7GA 2YQ4A 1PU2A 4BV8A 5ILOA 1NR1A 3ONDA 4CM5A 3DMTA 3O38A 3QWAA 1LLQA 1ADFA 1FDSA 2QQ5A 3PFWO 1DFGA 4F3YA 2C2XA 3UAGA 3D4NA 2HMTA 3H9JA 2FZWA 3DWFA 2O2YA 3ITDA 2VNAA 1JAXA 4QSMA 1MXHA 5IZCC 3F6YA 2WJPA 2D59A 1OMOA 2BRUA 5KVVA 1DLIA 4N5LA 3TF5A 2CD9A 4BNUA 3JQGB 4XYLA 4YYZA 5CDTA 3F5SA 3PWSA 3R6DA 1KY5A 1PQWA 3OSUA 3KSUA 5ICSA 1HSZA 5I9NA 3CSDA 5CPFA 1Z7EA 2UUOA 1E3WA 3DONA 1SCUA 3DC2A 3KSDO 4BKPA 1ISIA 1DSSG 4F45A 3DZKA 4IM7A 4BNFA 2Y0EA 3VH4A 3WWYA 2PLAA 2VRCA 4W7HA 1T1RA 1BG6A 4NZ9A 3F1KA 2ZK7A 3MZ0A 5DULA 2IXBA 2A35A 5CEJA 1ZO8A 3DZGA 4W7IA 5LC1A 2GLXA 1DLJA 3ZHXA 2BFAA 1KEWA 2WM3A 1T25A 1EUCA 4MDHA 4DLBA 2Q99A 3QVSA 5A4DA 1X15A 3BXXA 5IAAA 1LSOA 4XKJA 2HJRA 3PJGA 3WG9A 1I36A 3BHJA 2B4QA 3HB4X 1RYEA 5G0SA 1ZH8A 1GCUA 2B4TO 3D1LA 4QFDA 4CLRA 1LEHA 3DHNA 1UXKA 2Q4BA 3TPCA 3WQRA 3H9GA 4GI2A 3PZBA 2YFQA 3RROA 3WX0A 3E9QA 4BB6A 3ON5A 2ZIZA 3PEFA 3DHYA 2O4UX 3FNFA 2PD6A 4RF5A 3MWDB 3RUEA 1B0AA 2PNFA 3W6ZA 3D5TA 1Y8RA 4Q39A 4A0SA 1A71A 1U4OA 5DNAA 4D79A 4R9SA 4WGGA 3NT5A 4J7UA 3QWIA 2Y99A 5BT9A 3ENKA 3K30A 2NACA 2Y67A 1U5AA 1EUZA 3H4VA 5EPOA 4BV9A 4U5QA 1GQ2A 5ITWA 2PH5A 3JD0A 1B8PA 1YBMA 4J0FA 1P1IA 3ZWPA 4OJNA 4Y6RA 1EEHA 4NBRA 5IFLA 4R4JA 3KETA 1I5RA 2EV9A 4HFJA 2YW9A 4R1NA 1VKOA 4WCDA 1IY8A 3ZCXA 4DIBA 4EJMA 4CV2A 5HTOA 3OQ1A 4I1IA 4L0QA 3QVWA 4ONEA 3PHGA 4I9HA 4KOAA 4JGBA 2QRLA 4ZD6A 4NJOA 1LXCA 1PZHA 4YPOA 3HDYA 1B26A 4U8GA 1FDWA 4R3NA 4AJ1A 4BO6A 1AE1A 1OZAA 1WW8A 4UULA 3Q6IA 1UUFA 4J2HA 4PLYA 1EVZA 4U6SA 2ZKLA 3HUDA 3M2PA 4TRRA 4AJNA 1BMDA 2DFDA 4A2CA 5JS6A 4O5OA 4PFJA 3IL2A 1LRLA 1TT7A 5I7SA 2F00A 3WS7A 2PGLA 2WWRA 3L4BA 4FGWA 2Y1OA 1MLDA 4HFNA 4TQGA 1ADGA 3JTMA 2G1UA 1SAYA 2GASA 5THQA 1SEPA 2J6IA 3ZWXA 1QYDA 1IUKA 3BMNB 4XYMA 5L40A 1O89A 4CM8A 3K31A 3ANMA 2HK8A 3KV3O 2B0JA 5EQDA 1RM4A 4WE3A 3DTTA 3UICA 1PJQA 5A5EA 2FMUA 1UZNA 4MVJH 3G3EA 1HDRA 3WR5A 1GDHA 4ALIA 5DP1A 4NPCA 4CMBA 3EC7A 4RVHA 5EQFA 3ZU5A 1GZ4A 5IJZA 3I1JA 2WYVA 2OP0A 3D3WB 1DC6A 5CAEA 1EQ2A 4IXTA 5LDGA 4ROSA 1S6YA 4ZICA 3IKTA 1W6UA 2X0NA 4OMUA 5GMOA 4DRYA 4RV9A 4FB5A 3FBTA 3EUWA 1PL7A 4IS3A 3PHIA 5ENVA 4GVXA 3A14A 4CR6A 4GH5A 3D3EA 2DPHA 2GPTA 1R4MB 4BO2A 3I9MA 4R69A 5IDYA 3RFXA 2NTNA 1NTOA 1YQDA 4KMSA 2D5CA 4WPGA 2I9PA 4J4BA 4LW8A 1DXYA 4XDZA 2BFOA 1NBOA 1YVEI 3MJCA 3VHRA 4J9UE 3ZDFA 5C3MA 3TFQA 3HN2A 2WTBA 4IQ0A 3WMXA 4CM9D 4D0RA 1LDBA 9LDTA 3AY3A 3PGJA 1P44A 1EFKA 1WPQA 5A1TA 2GDZA 2J3JA 4Y6SA 2AEJA 4M89A 4KTTE 4J7CA 4C7JA 3L4BC 3CINA 1JW9B 1ISFA 2CMDA 4BQRA 3SVTA 1UP7A 3WYEA 4TRMA 5JY1A 3NDIA 3R0IA 1UDBA 3GA0A 1ML3A 3KYBA 4NBTA 1T26A 3C3XA 2D1YA 5A3JA 3QV1A 1I3MA 1CQIA 4B3HA 1HL3A 3GAZA 3D5QA 4TVBA 1R37A 4OM8A 1I33A 1GEGA 2PTGA 3TJRA 2OMEA 4Q3BA 4N5MA 2NV6A 4TWRA 1A7AA 4LSWA 3KRTA 1GR0A 2CY0A 5J23A 1UXHA 2DFVA 1BHSA 1NX6A 4KQXA 4XB2A 4B4VA 3SC4A 2HRZA 3CIFA 4ND5A 4E2YA 3ZHBA 1PSDA 1W4ZA 3DBVO 2ZJ1A 3HB5X 4PZDA 4L74A 3INTA 3U9LA 3ZWNA 4TMFA 4ZQBA 3NT4A 1SZJG 3NYWA 1HYEA 2G82A 4DQUA 4A10A 1HF3A 3E82A 3L6OO 1P9LA 4YACA 1PL6A 3OJOA 1AN9A 3H9QA 5B4TA 4TZTA 1W8DA 1F17A 4Z0HO 4BL5A 1C0LA 3FNHA 1QLHA 5HA5A 3WFIA 2P5YA 3OJLA 1F12A 3I83A 1FK8A 5TC4A 1C1DA 1YQGA 4L76A 1PJ4A 5CDYA 3L77A 4PRKA 4AJIA 4OSPA 4RPLA 2DT5A 3PGXA 5KJEA 1O9BA 4NU5A 3VPHA 2V65A 1TT5B 1E7MA 1PS0A 4K6CA 4ZJUA 4YVFA 4R41A 1BDBA 4M49A 3OJ0A 1PZGA 1XU9A 4EUEA 4HBGA 4L9RA 3VTZA 4CJXA 2NU9A 1CERA 1ZXLA 2ZQZA 4MP8A 4OXKA 3W1VA 4MKXA 3GNSA 2D2IA 2B35A 5KWEA 2D0IA 4GLOA 2WD7B 1XR3A 4Q3CA 1R16A 5A05A 3U4CA 2B83A 3C1OA 2Z1NA 4FJ0A 4DMMA 2P5UA 3VPSA 5BQFA 5JDIA 2R6JA 3PWKA 2X0JA 1IZ0A 3IMFA 1NPDA 3PHLA 3QVXA 5EMHA 2CVZA 2W8ZA 1R0SA 3GMDA 5JYDA 5L95A 4Q3DA 3PDJA 1RJWA 1VSVA 5FWNA 2I6TA 1B7GO 4CMIA 3K73O 5DF1A 3FI9A 1JWAB 1C1DB 4YAKA 5A02A 3TOXA 3RI3A 5JXWA 5JDCA 2YV3A 2JL1A 1YDEA 2JD0A 3NAQA 2PGDA 1SB8A 4RQTA 1JAYA 1H9AA 2OO5A 3GH3A 3FTNA 4CM8B 4GKBA 4XIJA 2Q49A 4BNZA 1U28A 5THKA 3ONFA 1VM6A 3F4BA 4X54A 4CUKA 4IZIA 3JYOA 1VJ0A 4YJHB 1JA9A 1HKUA 2C20A 3JQEA 4I9NA 4KP7A 4YJGA 5DN9A 2VRBA 1NVTA 2P91A 4TSKA 4BO7A 4WK6A 4AICA 2GUGA 2GSDA 3VZSA 5JCJD 4TRJA 4OXNA 1ARZA 1IPEA 1HE2A 3DOCA 2FP4A 4J4TA 1DJQA 5ILGA 3C7CB 4I08A 1I3KA 1LLDA 4E2ZA 2RHCA 1NQ5A 2VYVD 4XDYA 1OI7A 2JD1A 4BNGA 3VZPA 4DYDA 4QUKA 5JLAA 1PJTA 2PGJA 2WYUA 4WOJA 2HUNA 2O7QA 1PQUA 3RC2A 3NDJA 4AL4A 2FPPA 2HRBA 1KEVA 4E31A 2DUUA 5A06A 1UAGA 3BMNA 3EZYA 1NPTO 4R9RA 5KJ6A 2PV7A 3LC1O 4OIMA 3RKRA 4IS2A 3JYQA 3JD3A 2I76A 4W6ZA 2VYND 3BMQB 1GY8A 5DCWA 4BO0A 2GN8A 1D8AA 2PKQP 4WLOA 4KZPA 3FWNA 2PY6A 4QT0A 4XEHA 1YGYA 4OYRA 4WLEA 4BO8A 1IYZA 2WEKA 4FJ1A 3PQDA 3HG7A 2OORA 4YB8A 3IAHA 3H9EO 1J4AA 3WGTA 4PG4A 3ZWVA 4R51A 5A9TA 2GZ3A 1XIVA 1XELA 3V1YA 1SB9A 5C37A 1WZIA 4IDEA 4UAGA 4NBVA 1N9GB 2HKIA 3RASA 5JO0A 1Q0LA 1I3LA 3DOOA 1V3UA 1HDYA 4GWKA 5I7EA 4PLTA 3M1LA 2Y0CA 3NGLA 4OH1A 2P2SA 3GZ4A 3MTJA 1GUYA 2NM0A 3LZ6A 1KVQA 4J1SA 2D4AA 3UKOA 1G0NA 4DC1A 1HTBA 1MG0A 4W4TA 2ZQYA 3IP3A 2Q2QA 1LSUA 2XXBA 2VHYA 2PH3A 1DAPA 1PR9A 4CMHA 2PA3A 1M66A 5K9ZA 3AFNA 3C85A 2X7HA 3ORFA 1C3VA 3EY4A 4IMRA 4BVAA 1V8BA 1GPJA 5CDUA 1GUZA 2Q1SA 3C24A 2YJZA 3B1FA 3DAPA 1LQUA 5KIAA 4TZKA 1T1SA 4IMPA 4M1QA 1R4NB 1Y81A 3Q11A 3EW7A 5JAIA 4JNKA 4NBUA 4R5MA 3W8FA 2AXQA 5TIIA 5AVOA 4IDDA 2Q46A 5L7WA 2CDCA 3T7EA 2Q4EA 4RF3A 4XGNA 1P0CA 2EW2A 3ROKA 1EUDA 1DFIA 2VHZA 1SPXA 1ZEJA 3VC7A 2NU6A 4L4SA 3WBBA 4FBGA 3OQ6A 1UJMA 4BNNA 3I5MA 4OOEA 5KNLA 1T24A 1ZNQO 3R3SA 3RFTA 1LUAA 2G0TA 1QKIA 5COQA 1LDMA 5EESA 2NU7A 4RORA 1U3UA 4JP3A 4KWIA 1PJ2A 2W2LA 3W8EA 3GN1A 4TROA 1BXZA 4AJ4A 3SJUA 2CZCA 1UXGA 4IIVA 1ENZA 2Y93A 1AHIA 5A9SA 4CLRB 4JBIA 4YBZA 1NVGA 3OEWA 4RF4A 3RBVA 1PGNA 4WUVA 5G0UA 1Z6ZA 1MX3A 1XA0A 2RCYA 2DBZA 3WICA 3E18A 3JQFA 4CV1A 4YJDA 3CEAA 3GUCA 3DBHB 3QE3A 4TKLA 4E5NA 5K6AC 1M75A 4NR0A 3R3JA 1RPNA 2XF8A 4LRSB 1JKFA 3AUTA 3TWOA 4HXYA 4WNIA 4YJGB 1XLTA 4EDFA 1FDTA 1Q2XA 2XAAA 4RLHA 3PJEA 2YFHA 3D7LA 4BMVA 1LLCA 1Y9AA 1CJCA 2X8LA 3Q9UA 5JAZA 3D0OA 5I9MA 2BI8A 1C0IA 1DHRA 1E1MA 1K5HA 4N54A 4E30A 2EERA 4BNIA 4DXHA 4MVJF 1L7EA 3LYLA 1JKIA 3EGOA 3W6UA 1LJ8A 1D4FA 3OECA 3I52A 4CV0A 2CF6A 2NLOA 1BVRA 3A1NA 3C1AA 5FI5A 3P19A 4XYBA 3AFMA 3QA9A 1VL6A 5CEFA 4CM4A 3UVEA 4GX5A 1M76A 2R2GA 4NMHA 3RVDA 3I23A 1E1LA 4B7CA 4EZBA 4PN3A 3PQFA 1KY4A 1OBFO 3WSWA 1DC5A 3FNEA 4R1UA 1EVIA 1SO8A 2YYYA 4PIVA 5IDWA 2BKAA 1I2ZA 3WYBA 4IDBA 3U4HA 4FD3A 4E5PA 1YB5A 1H6BA 1HEUA 2JHGA 3LF2A 2C7VA 2HU2A 2NVUA 1DO8A 3UUWA 4OKIA 2YQ5A 1YO6A 4N7RA 2HLPA 1IE3A 1SNYA 5CDGA 5I9LA 2HK9A 1PJSA 5ICMA 3A06A 4CUZA 2HMSA 3QLJA 1BW9B 1LDNA 1F14A 5I7FA 2IZ1A 2O3QA 4Y98A 4BQPA 2DVMA 3S1LA 4J7XA 4J1QA 3FRJA 2C5EA 3JQ9C 4MOWA 2DC1A 3UOGA 3E5RA 1MXFA 5DDIP 5GY7A 3X2FA 2AEMA 1SOVA 3NRCA 4JJIA 2DTEA 3P2YA 2AG8A 4KUEA 4DL9A 4E0BA 2Q3EA 2X9GA 3CH6A 1GCOA 4WLVA 2QG4A 3LLVA 3ZU4A 2ZB4A 4MINA 3NT2A 2DPGA 2IYPA 4UEJA 1HYHA 1I10A 1PJCA 3ZV4A 2CUKA 1LBEA 4LCJA 2QHXA 5TRTA 3ENNA 3GLQA 3HWRA 4XYGA 1UP4A 2EG9A 2Y66A 5FI3A 3PDUA 3DMTC 4CLEA 1PGQA 1P1KA 4P22A 5F1KA 4D45A 3OA2A 5C7IO 1QXSA 1SBYA 7ADHA 1ZK4A 4CM7A 4ND4A 3S2GA 4H3VA 4ZN6A 3ZW9A 2HSDA 5G4KB 3GZNB 8ADHA 3AOGA 3U09A 3NJ4A 3B6ZA 1TB4A 4UVEA 5EL0A 5FFFA 7MDHA 3BTVA 3JQ8A 1RM0A 4BKRA 1ADCA 4D44A 1N2SA 4CMJA 2IEDA 1H2BA 3E8XA 2W2LD 1HDCA 1S7CA 1ONNA 2ZCUA 4K26A 1PS9A 2P68A 4J4HA 2FPGA 2O3UA 2PZJA 3WJ7A 4E6PA 5C5IA 5JMPA 4BO4A 3MCVA 2NWQA 1D3AA 2WD8A 4IPTA 1KVSA 4JBHA 4JJFA 4O0LA 5FEUA 1MGOA 4E2XA 2O23A 3UGKA 4K1LA 4CL8A 1AHHA 1PZEA 3GQVA 4ZRNA 4PZEA 2X9NA 3DTYA 1F8FA 3E6AA 4MP3A 4RVGA 2FY8A 3G0OA 1CRWG 2P9GA 3IUSA 2P9CA 1I0ZA 1MC4A 1N7GA 1T2CA 4P4GA 2GRAA 3GT0A 3JQBA 3JV7A 3ZH2A 4D3DA 2VTEA 4Y67A 2VZ8A 1J49A 4HY3A 4EJ6A 2Y1EA 2AMFA 3UCFA 4F6LA 2D5AA 1AGNA 3JYNA 1PS8A 2UAGA 4R01A 3KHUA 1PWZA 2W98A 2E49A 1YH3A 3CMCO 2X5JO 2O3RA 3OBBA 3UHAA 3GRPA 1NFQA 1PWXA 5B37A 1ID1A 2WMDA 3DAFA 2UV8A 5JFOA 1LC0A 4GPD1 4M86A 2BFMA 1Z45A 4BUCA 5CG2A 1CYDA 2WD7A 3A4VA 1VJ1A 4B79A 4DBVO 3UF0A 1MG5A 3ZU3A 3E9NA 1FDUA 1VC2A 2EGGA 1DIRA 3GAFA 4E13A 4C4OA 3CUKA 3IIEA 3SEFA 2ZTLA 1QP8A 1YWGO 3K6JA 1PQPA 4CR7A 1GL3A 2PR2A 3DEYX 4OQZA 5BNFA 1U5CA 1N7HA 2Z95A 1OC2A 1GV0A 1CQJA 2J3HA 3A28A 4E5MA 3ZNQA 4MPDA 5KOIA 3IDSA 2ZCVA 3VKVA 3H3FA 2QW8A 4Z0PA 3U49A 1U8XX 3WNVA 3I6IA 4AVYA 3CZMA 1YJQA 3JD1A 4YAIA 1ZBQA 2GCGA 4HWKA 4A7PA 2WSBA 4IGFA 4W82A 3TN7A 5IZ4A 4MKZA 1X7HA 4YJHA 2HDHA 5KJ1A 1U3TA 3PHJA 1YBVA 4XB1A 3WB9A 4HV4A 1XQ1A 1O6ZA 1I24A 2XPCA 2PFGA 3ROPA 2VNSA 3BTOA 1BSVA 4B7XA 1B8VA 3IQDB 2NQTA 3T4EA 3ZW8A 4D42A 3ANLA 2H63A 1R66A 5JY6A 4L75A 1YB1A 4XRGA 4J1NA 5DT9A 1U4SA 3KUXA 3DAGA 5T6BA 1IB6A 3GPDG 3VH2A 4C7KA 2A92A 4DPMA 2ZB7A 1YE3A 4CMGA 4ZRMA 3OH8A 2YY7A 1E6UA 3WTBA 1NYTA 2EW8A 3ETGA 1ULSA 5HM8A 4IQGA 3HDHA 4RPKA 1D1TA 4MVJP 4IDCA 4EBFA 1MA0A 5A5FA 3HQ4O 1JVBA 3TL3A 5TQVA 1GZ6A 1CF2O 1I2CA 5DCUA 3NX4A 2NVUB 4B4OA 1M6WA 4YA6A 3CKYA 4D43A 1A5ZA 1YL6A 3N7UA 1UAYA 1IZ9A 4JQCA 4URFA 2YUTA 3RUFA 1D1SA 1Y1PA 3O4RA 1HDGO 3PYXA 1ZKMA 5F21A 4AJPA 3JYLA 3PJFA 1I2BA 4YDRA 4I5FA 1KEPA 1K2WA 3B20A 3N74A 3ETEA 2CDAA 1T2DA 1OAAA 3EAGA 1P77A 1XHLA 4J3FA 1E6WA 1QORA 4NBWA 1U2GA 3LLSA 3CE6A 4YCAA 2CDBA 3HNPA 2Q1WA 1ZSYA 2FN7A 5JC8A 1E92A 3CPSA 2E82A 4WECA 1KOLA 4DBZA 3DMYA 4DPKA 2YDYA 3QVTA 4IBOA 4PLPA 3RC7A 4B7UA 4CQLA 1XG5A 4EJ0A 4XR4A 3Q0EA 3LDHA 3RC9A 4YAGA 2B36A 3ICPA 1E3LA 1IHXA 2TMGA 4GWGA 4Z3KA 3DO5A 3TQHA 3U62A 4CM3A 1EBUA 3KB6A 3NTRA 1K6XA 4BGUA 1WXDA 1YONA 2O7SA 4MVJA 4BGVA 3IJPA 3L0DA 4PZCA 1U7HA 2C54A 5GZ3A 3M1AA 4IGEA 2PZLA 4PLCA 1XYGA 5DZSA 3GPIA 3BMCA 3IKVA 2IODA 3JQ6A 2HMVA 1AXEA 4PG8A 1R4NA 1KVTA 1KETA 1PZFA 1GYPA 3ZWCA 1ADBA 1E77A 1HZJA 4ZQHA 1PEDA 4OKNA 4MO2A 1UDCA 3C7DB 2FRDA 3JQAD 1GV1A 4EYEA 3GGOA 2I67A 1JU9A 3GG9A 4IUYA 4DLAA 1EE2A 1GU7A 2FPIA 3ADPA 4INAA 4OO3A 4NQZA 1BDMA 3ST7A 5F5LA 1GQQA 1EK5A 3E9MA 4FCCA 2YHIB 5IDXA 1WP4A 5L9AA 3STHA 3D4PA 1MUUA 3OICA 4GSLA 2FSSA 4AJKA 1U8FO 5AYVA 2V6FA 3ZNNA 1ENYA 2DBVO 1P74A 1QYXA 4RPJA 5HRUA 3JSAA 1FF9A 4NU6A 1ZMTA 4MVJI 5BSGA 5H81A 1KERA 1E7RA 3LT1A 3H3JA 1FXSA 4J90A 5F3RA 3W4JA 1DRVA 5IN5A 3NKLA 2BELA 3KXDA 4CQMD 5JBIA 4OL9A 1NFRA 4HKTA 2VRCD 4MVJG 4RCVA 1O5IA 2CVQA 4J91A 4NH4A 1PX0A 1VE9A 3ZV3A 1Y6JA 1KC3A 2GD1O 3GVHA 3L9WA 1DRUA 1NXQA 2IYOA 3RUDA 1D7OA 1AXGA 4IDFA 8LDHA 3SC6A 1R12A 3F47A 4PLFA 2VYNA 3JCZA 3INGA 3GN2A 4R1SA 3JQGA 1H6AA 4Z0TA 1EK6A 3RUHA 4OGWA 1PJ3A 3OIFA 2DAPA 2JHFA 1VI2A 1Y9EA 3QIVA 4ZVVA 1NVMB 2V6MA 4O6VA 5JC1A 1DAOA 2C82A 1F8GA 1E7YA 2A9FA 3I4FA 3RU9A 4IIUA 4XIYA 3OM9A 1V9LA 1EBFA 3I4CA 3I9OA 1YDWA 4MVJM 5L7TA 3O03A 1ZK1A 4YR9A 4DVJA 2PD3A 3BZUA 4OSOA 5CP8A 5DP2A 2Q1UA 3WXBA 1WDLA 1IOLA 5HBRA 1M67A 2J5QA 3ZU2A 4E32A 4ZQGA 4P4LA 1X7DA 3OIGA 3BMOB 5CEEA 1ONOA 3RC1A 4CV3A 3HE3A 3K96A 1ZXBA 3DOJA 1PIWA 4GGPA 5TJHA 3K9QO 5HS6A 3WQSB 2PD4A 3AK4A 4N5NA 1A72A 3FCOA 5MDHA 1FMCA 3KYDA 4BB5A 2R00C 4IJKA 3DFUA 3O9ZA 3EHEA 3LT4A 1ORRA 1KBZA 1DIAA 1R0KA 4PVDA 4HNHA 1DC3A 4DIFA 1K3TA 4MIEA 1ENPA 2QYTA 3I9NA 1ZK0A 2BD0A 3DBLA 3VTFA 1H94A 1IHYA 1Q7GA 4ALKA 4NNJA 5KJFA 4EUFA 2ZTMA 2FWMX 3QRWA 2YV1A 1JWBB 1DIGA 2RHRA 3JQFC 3KM0A 3DZJA 4OQYA 3WGGA 3H2ZA 2HMUA 2QZZA 3ZWMA 5TT0A 4J0EA 4DQVA 4Z3DA 3DDNA 5IN4A 5HS4A 1YBAA 3AI1A 1TT5A 4J43A 2OZPA 4OAQA 2X0RA 3FR7A 5T8KA 1T2EA 4YT4A 3NEPX 4B4WA 2RBEA 3JD2A 1LRJA 2CVOA 3U3XA 4H7PA 1QSGA 3KLPX 3Q2IA 2E6UX 4FFNA 3AM3A 3PTZA 2I3GA 1E6EA 2WE8A 2ZB8A 4R16A 3WNQA 1P1RA 4RL6A 1FJHA 3VDRA 4WEOA 4XQCA 1P33A 4AJEA 4AJJA 1H93A 1Q7BA 5A9SB 3F5QA 1V3VA 4ZQFA 1VKNA 1UR5A 2NADA 3BMCB 2VOEA 4BMSA 1R15A 5JNLA 4BHTA 3FF4A 4BNVA 1KVRA 3DBRA 1E3EA 5B1YA 2VT3A 1N1EA 1ZUD1 3GUYA 3GDGA 3AOEA 4HFMA 4BNWA 1WZEA 1DFHA 1PGOA 4KUGA 2VYVA 3WGOA 4LMPA 4UEKA 2IZZA 3HDJA 3JYPA 4RO0A 3DHEA 3KYCB 2VUSA 3FWZA 4ZHSA 5L53A 5L4NA 2ILTA 3ASVA 4XWYA 3V2HA 4HUJA 4A5OA 4WCFA 3WGHA 4LVCA 3DBHA 4O63O 2YHIA 3SBOA 4CLXA 1VSUA 4YXFA 4XJTA 5EJ2A 3LSYA 3SLGA 3DZHA 4Z9XA 3PK0A 2Y68A 3RJ9A 3UH1A 2ZYAA 4CL3A 1EE9A 3O26A 3ROQA 4UVDA 2VN8A 3TFOA 2OL4A 1G0OA 1DPGA 2EKQA 3AU9A 3BIOA 1NHWA 3OF2A 1W0CA 5I7VA 3MOIA 2XOXA 4JXKA 3H5RA 3ICCA 3S55A 1KC1A 1W73A 3RBXA 3DB2A 1O94A 4FOOA 4D41A 4MKRA 4TVOA 2EHDA 1EVJA 3GNQA 4LSMA 5F5NA 4EEZA 3GGPA 3AM5A 4FFOA 4M54A 3C8MA 1H0KA 3UFXA 5AOVA 2VTDA 3IJRA 3U4IA 5AQ1A 3PQEA 2Y1CA 5GZ1A 3EK2A 4BNXA 4G81A 3EDMA 4L8VA 4MVJD 3E03A 1KS9A 3JQ7B 4ALNA 1LA2A 4UVGA 5I8WA 1LC3A 1P1FA 1T4DA 1T2AA 3F3SA 2WYWA 4PG5A 5IG2A 3AUSA 3G79A 2AQHA 4IXWA 3JQDA 3LQFA 4IJVA 3ANNA 1Y8QA 2VWQA 3LU1A 4WLNA 4BNHA 3DBLB 3PVZA 4D3SA 3BYZA 3TZCA 3H5NA 2UYYA 4F46A 3WOHA 5B12A 1YL5A 2OP1A 1PTJA 3GNTA 1E1KA 1LI4A 4PGFA 2H5LA 2W90A 2VWPA 1QLJA 4ND1A 4IINA 1JVSA 1NASA 3TRIA 1L7DA 2I66A 3ZNOA 4YJFB 2X4GA 1E5QA 2QRJA 3R1IA 3OQBA 1YB4A 3DFZA 4XZ3A 5T64A 3WTCA 4A26A 4RVUA 4CLOA 4XQGA 1ZK2A 4FGSA 3SLKA 1HDZA 1X0VA 1QYCA 2EWMA 1V0JA 3KEOA 4FW8A 2Q2WA 1P0FA 4E5KA 3ZHZA 3OJEA 3F9IA 2O3SA 2X6TA 3M2TA 3LC7O 3Q2KA 4ILKA 2BGKA 4XR9A 4YWJA 3IOYA 4GKVA 1YOVA 2DLDA 5K6AA 2JJYA 4PG6A 5JMWA 2QYSA 5TX7A 4BNYA 5IF3A 3IS3A 4LN1A 4OXYA 2IEBA 1KVUA 1DC4A 4M87A 3DQPA 3HADA 3PYMA 3RUIA 5KCZA 1Z75A 3IC5A 4GVLA 4BNKA 4Y6PA 1I8TA 1KEUA 1HYGA 2CNBA 2NTVA 1B14A 2AEFA 2VWGA 3W8DA 4QX6A 4XQ9A 3S2FA 3U0BA 1TI7A 1LNQA 4I5DA 4BO5A 3AY6A 4W9NA 4WOKA 1N92A 3EVNA 1HZZA 1EMDA 2RH8A 1MFPA 4ZQEA 3FPLA 4U7WA 1J0XO 5I8ZA 2RH4A 2C5AA 2HJSA 1A9ZA 4RQUA 5BSEA 1RWBA 2TMDA 5A3VA 4M55A 4WKGA 1XDWA 3VDQA 3VPXA 4D7AA 5G0TA 9LDBA 1QYWA 1YOVB 1NWCA 1Q1NA 4QO7A 2GN9A 3VVCA 3AM4A 3CTMA 1A4UA 3K8ZA 1WMAA 4NJMB 3F1LA 1R0LA 4FPXA 1BRMA 1HDXA 2AA3A 5LCXA 3H2SA 1Y5RA 1E7QA 3MJ4A 3SJ7A 1Y8RB 3D64A 4NJMA 3ZWBA 3QQPA 4L73A 5JE8A 5A04A 4UREA 1DJNA 4CMCA 1NNUA 2C7GA 2OOSA 2VHVA 5H82A 1E7SA 3AUAA 1IL0A 4FS3A 1P31A 3GEGA 2OBNA 4CM1A 4QO8A 3HSKA 4GX1A 2V7PA 2DTXA 5AXBA 1UZLA 2GN4A 3FSRA 1RKXA 3TNLA 4NIMA 2GZ1A 3G1UA 4JLWA 1JKJA 1DHTA 2BHLA 2NU8A 4YEDA 4CLHA 4XA8A 4J2OA 4RZHA 4PLWA 5IXSA 3ZWAA 1UH5A 3VPFA 3C7AA 3LK7A 4MIOA 2ZTVA 4E5YA 2ZJ0A 1H9BA 4GSKA 2X1HA 4J6FA 5ES3A 3SX2A 5DOVA 3VH3A 5JAMA 5TJ9A 1VL0A 4BNTA 5L4LA 1C1XA 3UXYA 2HQ1A 1DIBA 3A9WA 4I9UA 4CM9A 4DUPA 1MFZA 3WQQA 4BOYA 3WGQA 1GUFA 2GZ2A 3GG2A 1HE4A 3COSA 1HWYA 1VRWA 4HNGA 4JROA 4Y9DA 2DKNA 1XWFA 3OJFA 3TDKA 1U2DA 2PZKA 5JO9A 4CQMB 4QQRA 4YAJA 4BKQA 4EITA 2J5KA 3WSVA 4BO3A 3JQBC 5TS3A 4CLOB 3H9UA 2WE7A 2VT2A 2RIRA 1B3RA 2YV2A 1GEEA 4FFMA 2FOIA 3B1JA 1HE3A 4UEOA 5MGBA 3VOSA 1JTVA 1UXIA 1H6CA 3H7AA 5CDSA 4K28A 1BXGB 2X5OA 3F46A 1H6DA 4A73A 3HHPA 3LC2O 2GO1A 1T2FA 2NQ8A 4GLLA 4BGEA 2I5PO 5DBIA 2EF1A 2I65A 2J5RA 1HETA 1MP0A 1TA4A 1Y7TA 1B8UA 4ESOA 2G76A 2Q50A 5EIOA 4ALLA 1JQBA 1B15A 1Z7BA 5HWSA 3V2UA 2ZYGA 5JSFA 4QXMA 3V2GA 2R00A 1ISGA 4RPHA 2X23A 3WIDA 1F0YA 6LDHA 1LTHR 5BSHA 4U0JA 1XCBA 3GRKA 1Z82A 4ZU3A 2V6BA 1EQUA 5TF4A 4CODB 1KIFA 4XJSA 3ETDA 3EYWA 1ZSVA 4XD2A 3WLEA 4XGKA 1PL8A 4QTZA 5CPBA 4RDHA 1SOWA 4B8WA 3WLFA 4CMAA 3G17A 1MB4A 3RIHA 2FR8A 4RLSA 3L4SO 2VHWA 4G2NA 4GX2A 4Q3AA 4IQ8A 4Q9NA 1CIVA 5B4UA 2GGSA 4O1MA 1ISMA 2HMWA 2GN6A 3H65A 3WGIA 4FOSA 4KUHA 3T4XA 1Q0HA 2Y0DA 3MEQA 1E3SA 1G1AA 3GC6A 3L6DA 3QY9A 2EJWA 5A9RA 2O50A 2BI7A 2VOJA 1E3WB 4DQXA 1GYRA 3GDOA 3H6KA 2F1KA 3RJ5A 3ZWYA 1XSEA 2DQ4A 4IJWA 2Q1TA 3NJ8A 2LDBA 4E2WA 2QIOA 1TVEA 1YL7A 5JDIC 3AI2A 3WFJA 4PG7A 2AQ8A 4LRTB 5DCYA 4CMEA 1YS4A 1O0SA 3RD5A 5EN4A 2OBYA 2X58A 1NWHA 3ZWWA 1DOHA 4FQ8A 3Q9NA 4PLHA 1A7KA 2W2KA 3LVFO 3QVOA 1R6DA 4K6FA 2JFGA 1C0PA 2X0IA 4A27A 1J6UA 4R5HA 1PGJA 4P38A 3MTGA 4UUMA 3ZN2A 4NFYA 3ZGYA 1MV8A 3DBRB 1ZIDA 4DIOA 4AJLA 3FN4A 4OOFA 1LX6A 3QP9A 4FSHA 3KZVA 4UVHA 3KYCA 3DXFA 1P3DA 3ZZNA 1O8CA 4NDNE 1GYQA 4FN4A 4YQYA 4RPGA 3MJTA 2O2SA 4XCVA 3ZNPA 4XYEA 1ZW1A 1EZ4A 2D3TA 3GFGA 1QV6A 4N18A 2BLLA 3I9KA 4RVDA 4JIGA 5CHEA 1U9JA 3ABIA 1OOEA 3KVOA 4UVIA 3NGXA 2GYYA 1OC4A 4G65A 1P1JA 3OP4A 1E7WA 4OHUA 4E4YA 1CEQA 5ADHA 3JQ9A 3PJDA 3O8QA 1NQTA 2NNLD 4R1TA 3UCXA 4BKUA 1BXKA 1T4BA 2YDXA 3JD4A 1MC5A 4LK3A 3PLNA 3GFBA 1KYQA 5KVQA 1K89A 4LCEA 4NG5A 5GZ6A 5DBFA 5G0WA 5COAA 4CLDA 2ET6A 3PYLA 4JCOA 1X1TA 3P5SA 2C2YA 4RF2A 2IZ0A 3H5AA 1WDMA 2I3AA 3U5TA 1F06A 4KDEA 1E3JA 1XU7A 1EVYA 1PGPA 4DC0A 3HZZA 1UP6A 4F6CA 2CSUA 4QEDA 4U6QA 1VPDA 2VZ9A 1NM5A 2GR9A 1U7TA 5JCXA 2EP5A 2O3TA 2FR0A 3VVBA 1GAEO 1LLUA 2B5WA 5COBA 1UZMA 4Z6KA 3WDSA 4BNLA 3D4OA 5JW6A 3M6IA 4DWVA 3TL2A 2NSDA 2BGLA 3BAZA 4CMEC 3QWHA 4Y8VA 3AY7A 5TSDA 1Y5MA 4AG3A 1BXGA 4FDAA 5IXYA 3GR6A 4LISA 1ONPA 4CR8A 2H6EA 5C7LO 1SC6A 2QZ9A 4YRBA 3PRJA 2JKVA 2WDZA 2C07A 3K5PA 1BGVA 1HRDA 2J3IA 2YHUA 4MIYA 1LRKA 1JLLA 5G4LA 2VUTA 5DOZA 3OMLA 3V8BA 1K6JA 5JAQA 5LDHA 1NQOA 1XKQA 3EVTA 5KKAA 3UW3A 4XRRA 3WJAA 1ZSNA 1FDVA 5FF9A 1LDYA 5G2OA 2Y05A 4JX8A 1NFFA 2NVBA 4BO1A 3BHIA 2BGMA 5L51A 4AJ2A 1E0DA 3OIDA 3OEYA 2HO5A 4EUHA 1P45A 1HT0A 2EIHA 5FYDA 4L4XA 4BO9A 3BMQA 2VHXA 1N9GA 4J1TA 5L7YA 1V6AA 5T8KC 3FD8A 4QECA 4D3FA 2AQIA 4IY1A 2IE0A 4PRLA 4HFRA 5AXCA 2DM6A 3D3WA 2PK3A 1VJTA 4FR5A 1N1GA 3RWBA 3TSCA 2C0CA 1GADO 3RCBA 2BFPA 4NFHA 5DBGA
chains in the Genus database with same CATH superfamily
4G1FA 5ICCA 1Z2PX 1X1QA 3HU5A 4U7TB 4WJZA 5GGYA 1CWUA 1KSJA 5DRYA 1LJUA 2CFIA 2QRVA 3FTPA 3HP4A 3QKTA 2O2DA 5DYYA 4TTTS 4IZHA 2ZJ4A 2RGRA 3DZDA 2A58A 2OAGA 3S8YA 3H04A 2WZBA 1Z0JA 3H11B 2VS1A 3NTOA 3TTUA 5IH7A 2XT6A 4NEHB 1MVLA 5IBQA 4IEEA 1HOXA 1O94C 2C96A 3H5LA 3EFHA 2POQX 2D3WA 4DNPA 1E3QA 4OMCA 2ASVA 2WKWA 3NOXA 1UM9B 4Q02A 4P1ZA 4ZP1A 3DTNA 3TX6A 2GETA 3PITA 4B84A 3Q9SA 2PRYA 2O1XA 2VDPB 4HDRA 5BQ5A 2VXYA 2IVFA 3GEBA 1ZUWA 3PTLA 4YJFA 3SJAA 2ZTUA 4UBNA 3PHBE 4Y2UA 5HOEA 3DDUA 3LYUA 4KV9A 4YQZA 3GAMA 3S7ZA 5ER6A 1QOQB 5ENZA 3T41A 2AX3A 2YX1A 3BE4A 5TNXA 2CHFA 4DKJA 4JI1B 3HBAA 4R05A 4GPZA 3K2BA 1PLJA 1NLUA 5FO1A 5SYAA 4CFYA 4M7WA 4DMRA 5DKFA 1FFSA 1UXJA 2XDYA 2QL5A 4TWIA 3RHFA 4KE9A 3PI6A 2XMCA 1T4CB 4OMFG 3WBKA 1ZCJA 3FBGA 4MYDA 5CW2A 4KDFA 4INOA 1EDBA 2FMKA 2ZBDA 4ENWA 1FX0A 1PG2A 4NU8X 4S3MA 5DGTA 2G1JA 4UBLA 5KPDA 5KTOA 1AO0A 1KQOA 1ODJA 2VHCA 1DS6A 4BMPB 1DKMA 4ETNA 3RSGA 3FDIA 2BFFA 4LYHA 1U6IA 4B75A 2JFFA 4XX1A 2HF7A 1Y9ZA 4ZMBA 3RG8A 1NATA 1WEKA 4JJ7A 4QOFA 4DA9A 3WO1A 1XTVA 4IDAA 1DKPA 2HLNA 5U4XA 1A9SA 2WVJA 3DUFB 3ZE8A 4C0KA 1CUJA 3LT2A 5BSMA 4YREA 4E33A 5C7OO 4U02A 1QAQA 4G5HA 5TGZA 5F7OA 1XVUA 5F7JA 2OFFA 4KR7A 1T2VA 1J2JA 5D84A 1L4FA 3T5TA 1P29A 1V39A 4JAVC 2WG1A 5ALOA 3U1VA 5K0GA 4M36A 1YF3A 3DE1X 1R4AA 2JIQA 1RCFA 1PFYA 1X14A 2Z8YA 4ZVOA 3EPHA 3DOFA 4HQOA 4BRUA 2Q6VA 2R11A 4JDPA 1QR6A 3HFSA 1QRSA 1P8JA 1NQAO 3OA0A 4IUDS 4F8JA 2OE2A 1P1CA 3C1TA 2LR0A 4I1YA 3PP8A 5DWDA 3W78A 1X1BA 1XEAA 2G07A 4AXBA 5AW5A 4Y2TA 2R8EA 3OQHA 4BZPA 2VJPA 4PNEA 3M9XA 1VIYA 2Z5LA 3ONNA 2H9AA 3CNEA 3O9VA 3I62A 4N7MA 1C14A 2O3JA 2XUZA 4FC6A 3O1HB 1YJCA 3ASUA 5IK2D 1FMJA 2J32A 4TS9A 3EQ6A 4WJLA 4B82A 1W36D 3VZQA 3GEMA 1TJ4A 5L3QB 1KK1A 3M81A 3PNOA 4ZAGA 2A5JA 2QJWA 2VXCA 4KHZA 4XFJA 1D9XA 4DW8A 1B1CA 1CY6A 1N5LA 4JLOA 1E0SA 2GCPA 3BWXA 4IJUA 4PZUA 2PH7A 2NVWA 5HF6A 1O95A 3ETLA 4PLGA 2FX5A 3ZEIA 5J47A 2AT1A 3R8CA 2IRWA 2Z3VA 4KI7A 1XDDA 5DXFA 3WRVA 1OB2A 1V35A 2CJYA 2XD4A 2YY5A 4GE3A 1NVUQ 1GSOA 4I19A 1K1EA 5BWBA 1X7WA 2AOUA 1BH2A 3I3OA 3VU1A 1CS0A 1UINA 4WNCA 3QKIA 5C35A 1NE7A 4QUBA 1WNTA 1GAJA 1Q21A 3E1KA 2BR3A 3BA6A 1P7YA 2OD9A 2WB4A 2B99A 2OUIA 2D8AA 3A8TA 3BA1A 3CBQA 3DO8A 3GJZA 4UASA 4XARA 5ALSA 3WLKX 4DNXA 2CNWA 3LPAA 2PUJA 2CFCA 3LW7A 3RUCA 4BMXA 1N8KA 5TGDA 2NTJA 5KB3A 1ST2A 4XFKA 1E79D 1Y8QB 1ZN8A 2HWYA 2XYQA 3ADOA 3AR9A 2H57A 4L2IA 4YAUA 5I3ZA 4NESA 1M2WA 2GBGA 3EVBA 1G21A 3EOAI 5KJCA 2HSWA 2PLWA 2QMHA 3CM0A 3OTQA 1M1YB 3KBOA 4L16A 4KPFC 4PU0A 3SN6A 2BPOA 2WIGA 4JHLA 4W99A 2XWJI 3BERA 1HV8A 4GKAA 5D2CA 5EJ4A 2E5LB 3QNUA 1DDOA 4B48A 2V7WA 4A26A 1CDDA 5DNYB 3N2GB 3SM9A 4NI5A 1QIEA 2FZVA 3AOEC 3HDGA 4LIPD 4UW9A 2RDMA 4P3KA 2GK4A 4RVFA 1WA5A 4QPPA 2QAGB 4MP6A 4C0HA 2P2CA 3QNWA 3GVIA 3AW9A 3D6AA 3SXPA 3K0CA 4P80A 4QATA 4GBJA 3UN1A 3F7TA 1EWRA 1NV8A 1OZ0A 3MMNA 4ENUA 4WLFA 1JG7A 4ITUA 5U4QA 3QITA 2IW1A 4S24A 3FNGA 2BMAA 3NH6A 1Z63A 3S1AA 3FHTA 1WDKA 5F4BA 5TLSA 1WNFA 1N0HA 2YW2A 4I2VA 1WD7A 3D1JA 1J06A 4RZSA 5LZ5A 3RYFB 3FUCA 3PX3A 1JG6A 1L5WA 1GXSB 5DGCA 2CV1A 2FEAA 2ONZA 3G23A 4I50A 2FZGA 4DEVA 1OROA 3AV0B 1NNSA 2XECA 5CEJA 4BGIA 3TSOA 3FOEC 4RXUA 3D31A 3I1YA 1P9OA 2FUG1 3E70C 3ESDA 3GDFA 3VPGA 5EXXA 1BD4A 1NHGA 3L5KA 4MYHA 4PWYA 4OK3A 3WWZA 4EYSA 5DTEA 5BVGA 3GF4A 3Q3HA 3HPQA 3WL3A 5BNTA 4KQ1A 1NMXA 3DLBA 2WHPA 1EZZA 2REXB 1E2FA 3IEIA 3ABQB 2NXWA 2PL5A 2ZI3A 2X8BA 1R4MA 4Q03A 1AUPA 4D2IA 5C8YB 5BUQA 1OSNA 4Z4EA 4HQFA 4G4GA 4L4RA 4YRAA 3HXKA 3MLEA 5K6RA 3UPTA 4KIJA 5G0VA 3K0HA 4H15A 2HHAA 1FFEA 5B1SA 2JI8A 3P0FA 2OXEA 4M1ZA 3SDSA 3J80A 1EUYA 2FFAA 2W2PA 3PUIA 1R8YA 1PR5A 1W85B 2PSEA 1H2HA 3QVLA 4TLLB 1S3FA 3T34A 1GCGA 3V5NA 1R00A 3HN7A 2Z57A 1E69A 5C5DA 2Z08A 3O8QB 5JNRA 2WOJA 4GR9A 3AHCA 4JS0A 2JB9A 1UBTS 2Y1GA 1MTOA 1PJBA 3DMNA 1I32A 3JQAB 1JG3A 4KSYA 4QYWA 4EO9A 3IKMB 4LJ8A 4WRRA 3ZV5A 3JW8A 2Q0SA 5KZMB 2JD2A 3TZHA 3HDQA 1Y5IA 3OLYA 3QPCA 4E12A 1DB3A 3SQWA 4F96A 2Y1FA 2OFXA 4C06A 4EARA 3FY4A 5IT0A 3IB6A 3IAS1 3GZNA 3EXIB 2N42A 1OW3B 1E0KA 1YMQA 2R86A 4GM4A 3T54A 2YXEA 4WA7A 3K0EA 4A0HA 2GJSA 3ESBA 3JSXA 5JRDS 1IWBB 5IZCA 2ZI7A 1RZUA 3KWFA 3DCIA 1M7BA 2OUKA 4WI1A 1HNZB 1FQWA 2PRSA 5EI5A 5D3QA 3F6BX 3PD7A 2AJCA 4QQ8A 3INRA 3OQOA 5SY4A 3LX5A 1LWNA 2FPGB 4LF4B 1GZ3A 2C1EA 2IGBA 3FCSB 3KT0A 2P9EA 3AHHA 4HWTA 4IQ4A 1JEAA 4K7JA 5KVSA 1A88A 2NUTB 5D8DA 1KDRA 3GDWA 2J0UB 1CNFA 4ZTBA 5B64A 2DUWA 1S2LA 3OU7A 5AIBA 1ZJYA 3X2EA 4TGLA 2JIZD 1TXGA 4MLDA 3BREA 1ZONA 2X5KO 4MYTA 2COKA 4MV5A 3ONWA 3MERA 3PZRA 2ZREA 2I4OA 4Q4DA 5G4KA 2PT6A 4M9XA 1QVWA 1A9YA 1ZMRA 1GNRA 5TT1A 1U2EA 1R2QA 1L1FA 1ADJA 3P7MA 3HKEA 1Q6ZA 1JI0A 3PC6A 5E7MA 3ULKA 2VDOB 4YRNA 3RADC 2PUAA 4PSVA 5AXDA 1NULA 1I01A 4MVXA 2X0FA 4KQHA 3AU8A 4E5VA 1S4QA 4GR4A 4Q3EA 2F3PA 4MX8A 2GI4A 5HP4A 5H83A 5E95A 2AFIE 3AR4A 4JD5A 3TUIC 4E1VA 5KSOA 1I7QB 4MULA 1T5LA 1R5BA 3WRXA 1T2NA 4L8GA 4XGQA 1GAQA 2WF6A 2RGNC 4FC7A 3QSGA 5JIBA 2X2OA 2I99A 1Z7GA 1YHZA 3OLZA 1N7IA 4A5SA 5EJ5A 1XZIA 2YC2C 5DI3A 5AHOA 5INTA 3CCCA 2NUBA 1NL3A 3VBCA 5KDOA 2BEUA 3ASZA 2Z09A 2JGRA 3BSFA 3E7DA 3LXMA 4HO1X 3S2ZA 3ZW7A 1EFLA 3IHKA 1G6OA 2I6XA 3ND9A 1XL1A 3C0KA 1A5AB 5E2BA 1EG2A 2R96A 3I9LA 5KYKA 1NNI1 2ECFA 4LC9A 4D8WA 2O48X 2Z04A 5E8JA 2NSHA 3HL0A 2VCEA 4N0QA 4AY5A 4LNAA 1U28C 3W4IA 3ZE9A 2JLVA 2UVDA 2IHUA 4UDYX 1YS7A 1NJ2A 2VL7A 4BPRA 4EI2A 1VJ5A 3AWDA 3MB8A 3NDRA 4H1HA 4WY2A 1WAMA 3EH1A 5L3VA 1KJNA 4TKMA 1KOGA 1LSSA 4REMA 5JCOC 4QM7A 4G5RA 4B3JA 3G1TA 1OXXK 3DGEC 1EDOA 2Y1DA 1AIPA 2R1TB 2O8VA 4FX5A 5HK8A 4ALJA 2COUA 3H8VA 4RVSA 6ADHA 2NUAA 2F8MA 4MO9A 3AX6A 4D7AA 5I5GA 2XX3A 4OU5A 3G9QA 4M83A 1KDVA 4EP1A 2TECE 5KINB 2XUGA 4FUTA 3RYFA 4EIWA 3GCWA 2ZYVX 3TZQA 1K75A 5K0SA 5JADA 5JAUA 1CUFA 4C76A 3RQSA 4XQEA 5GV7A 2JFWA 2JK0A 2BFDA 2GERA 3BRQA 3ITKA 4G5OA 3ZR4B 3FFAA 2NV0A 4G97A 5KQGA 5AVKA 1POXA 1HE5A 2P5SA 1JFLA 3G0HA 1G7CA 4L6CA 4EYQA 1H9CA 4BQNA 1ZOPA 5I48A 5B30A 5I7HA 1KJZA 3S2IA 1YXMA 2YC4C 3A0UA 1QZTA 3KYJB 2XZTA 3ML1A 3DA8A 2P2GA 3MCAA 1VA4A 2BGRA 3RJMA 2P9QA 3DMTA 5CJ2A 3GFFA 3LUCA 1NXPA 4U00A 4ZYUA 3AERA 2EBFX 2QQ5A 3PFWO 3CN7A 4CKEB 1DFGA 4RH3A 4F3YA 3P9CA 3UAGA 2EYQA 1RCUA 3HDVA 4KSCA 4BJHB 3M4NA 1VFNA 4HVTA 3OQIA 5F77A 4A0QA 2FZWA 3U16A 3EUEA 4KLNA 5JS2A 3ITDA 1YR9A 2IDKA 1UJBA 5CFQA 4EFLA 2IIBA 4JBYA 4AQDA 2QXUA 5AKHA 1LZLA 2RONA 3F6YA 3AF6A 3ND6A 2D2XA 1D8TA 2J1LA 1QFXA 3N2ZB 1U8AA 2I80A 2W4IA 5KVVA 4N5LA 4Y18A 5BNZA 5KTSA 1G2QA 1X87A 3RTCA 2ZBVA 1LPBB 2A84A 3JALA 5CH5A 5JH7B 2GJAA 4O2LA 5EKXA 2SKEA 5ICSA 3VYUB 5I9NA 5EHQA 2CNLA 4TKUB 3MAJA 1E3WA 2VPIA 3LRXA 2OZLB 2FG7C 3DHWC 3TSWA 2QMQA 4BKPA 3RRJA 4F45A 4IM7A 3F49S 2ZU6A 1AK2A 3MINB 4FZ5A 2QD4A 4F4FA 4Z3OA 3VH4A 4HSEA 3WWYA 2PLAA 2WYHA 4B6JA 1ESMA 2OHIA 3KJQA 4MRVA 1BG6A 1SVWA 3F1KA 1E66A 4FYIA 4BQFA 2DEUA 1CG6A 1ZO8A 2PFKA 2J45A 2ZIXA 3TTYA 3MPOA 3RBAA 4HQKA 1WKVA 1DLJA 1FDIA 2GLXA 1HKHA 1QQ7A 2YV4A 4WOPA 1RC8A 1KP3A 3KUCA 3AW8A 1GNPA 2GPJA 3VYVA 1QRUA 2IV3A 5EHXA 1EUCA 1VMKA 4C3UA 3L1HA 5DEOA 1KSHA 1I7NA 2AR7A 4IZOA 5B1IA 2RD2A 3F74A 1MX9A 2OWDA 2M6LA 4QTXA 1MBZA 1LSOA 4XKJA 1KY2A 2HJRA 4H7JA 3P8ZA 3PJGA 5ALPA 1ACMA 4UOEA 1SWWA 2KI5A 3KE9A 3C6QA 4KLAA 2XB6A 3COPA 4PQGA 5M3BA 3RIGA 2WM8A 1V96A 1IDOA 1QJCA 2B4TO 4QFDA 3CUYA 1PRYA 3OX3A 3D4LA 3NATA 5E7QA 3REQA 4NECA 1NM5C 3RROA 4GI2A 1XAGA 2ZLBA 3ZGXA 4ATNA 3COJA 1R9MA 3DHYA 2O4UX 1E6KA 3MWDB 3U5ZB 2ATIA 1Y8RA 2JHAA 2UVQA 4N0PA 4OH7A 1NE2A 4BFXA 3VU0A 4R9SA 3O4FA 3PR3A 1TZMA 1QO0A 2P6NA 3G0GA 3QWIA 4J7UA 2N0SA 5BT9A 3G13A 3IR6A 3RS3A 1KH3A 1U5AA 3L8CA 1EUZA 2A5YB 3BXEA 1ZUNA 4J94A 2XGMA 4BV9A 2AOVA 2V3VA 3BF7A 5K0NA 4RD4A 3JPYA 1YBMA 4XJVA 4G0PA 1P1IA 5K1ZA 2HH9A 3ZWPA 2UZ4A 4OJNA 5FHRA 4ZTZB 3LYHA 1KI4A 4LE1A 1N9ZA 4L8YA 1SUFA 1I5RA 1A69A 5DYGA 1RPAA 2YW9A 3FHJA 4WCDA 4QYXA 4JEIA 4EJMA 5A3RA 2GD6A 1KH2A 1NW5A 3GEIA 2FLVA 1IFXA 1Q84A 2EDAA 1QC5A 2EFDB 3HO8A 4WN9A 4XTRA 3VRHA 4ONEA 3HJFA 4I9HA 3C2QA 3LIIA 1QPZA 4ZD6A 4CXMA 4NJOA 2IY7A 2NAPA 4YJ3A 3O90A 1D6NA 5J1SB 3U4MA 2X0KA 3KQQA 3RW9A 1FDWA 4CQJA 1U0NA 3CG0A 4CBVA 3ESAA 1WW8A 4JJ8A 4UHHA 2V3WA 4TL6A 1UUFA 3FA2A 1F6BA 1EVZA 4U6SA 3V7NA 5FAXA 1G8SA 1L4NA 1LFAA 2ZKLA 2BM1A 1STOA 1BMDA 2Y71A 3L7CA 1ZX1A 2ZRFA 1L3IA 5CLQA 4DJ5X 4IRMA 3OE1A 1T91A 1IXRC 3EN0A 3TRKA 3IL2A 1B1AA 1LRLA 1TT7A 5I7SA 4QBGB 3L4BA 4BRSA 4DR7B 1KYTA 5ICGA 3IKJA 3ABRB 1ADGA 2B6HA 3GQBB 3MMPA 5JHGB 4PPFA 4XLZA 3RV4A 3U39A 4EQ6A 1KZ6A 5IARA 3ZWXA 2Q3LA 2XUIA 3K8YA 4ZCIA 5IUJC 3OC6A 3N5CA 3LT5A 4HDMA 4XYMA 5CBPB 4WV3A 1WQ3A 4RJIA 3R5JA 5FV4A 2HK8A 1TE2A 2B0JA 1L7AA 3DTTA 3M6AA 1F1BA 4RK7A 5G1NA 2AWNA 4ARSA 2O8EA 4F3TA 1E1QD 1XMQB 3IFSA 4AMYA 3WR5A 3KEGA 1NP7A 1YRQA 4DZZA 4KPYA 4QPCA 4CMBA 2VIIA 5AKXA 3CN9A 4KO8A 5IJZA 3RE1A 3BK2A 2WYVA 3W9BA 5D3ZA 4CKEA 1I4EB 3OZIA 1SK9A 5CAEA 1Z33A 1PG5A 1WLSA 1WSDA 3EWIA 1OZFA 1K66A 3HL4A 3K4QA 4B87A 5A0TA 1FB5A 2OXTA 3KAKA 4B74A 3IKTA 1IAVA 4DRYA 4FB5A 4JYCA 2OAEA 3S99A 3FBTA 1A8IA 3EUWA 2PZFA 1TVMA 2XQGA 3KR1A 1TOAA 4CR6A 5KNCA 3KQHA 3KZKA 3ROGA 4EABA 1N8SA 3BXGA 3D3EA 3GT7A 2HJ9A 2NVOA 5SYNA 2PL1A 1R4MB 1KSFX 2Q29A 3K94A 2PCLA 1E64A 4KXQA 4BO2A 2AZ4A 7REQA 3PSAA 3PQCA 3S70A 1YQDA 2CXTA 4KMSA 4NABA 4QWMA 2I9PA 2VNIA 4J4BA 4X61A 2FF7A 4A36A 4M1OA 4MUFA 4QC2A 4NICA 1W59A 2UZ1B 3DPIA 4JA0A 3CZCA 3INYA 3UAVA 2BFNA 3HN2A 1U5BA 2V74B 3LBIA 3ZBTA 1Y8ZA 3FVTA 2W6QA 3OKPA 3QW4B 1B6SA 4JLBA 1P44A 4F12A 1WPQA 5BWNA 4ZV9A 1YGPA 2GDZA 1E1CA 4JYAB 5F2EA 5DM4A 4M89A 1RBYA 3V34A 4KQFA 2PR7A 1RYHA 5D1NA 4C7JA 2CZGA 4ZKEA 3IMGA 1MO3A 2XCTB 4HDNA 4QXQA 1ZIXA 1OA0A 3M4YA 5HKOA 1JW9B 5MGNA 3FGPA 4BQRA 3HC7A 2ZROA 3ISTA 4TRMA 3DL7A 3FLBA 1QLWA 3WYEA 1UDBA 4O33A 3SZMA 5AKLA 3E1GA 3L0ZA 3R3VA 4KQ9A 2ERXA 4DCCA 3C5EA 3EGWA 1I3MA 1W88B 1HL3A 3I2GA 4FDTA 3K3PA 3JAWB 2D6FA 3B1XA 3T5GA 5FJJA 2UUCB 4DOMA 2QN7A 1RWPA 1R37A 2EBWA 3I6MA 3FSGA 3A3OA 1A7AA 4LSWA 3IX7A 1GR0A 1RWWA 2VYQA 2YXBA 1RJDA 1PNOA 1BHSA 4CHTA 3P20A 1A1VA 5GVRA 4N7JA 2HRZA 2J0UA 2OXFA 4ND5A 4Q4HB 2MOKA 3ZHBA 3IALA 1W4ZA 3DHVA 4E2YA 5C53B 3PLAE 2IZ6A 3IO5A 3KPUA 3VFDA 3INTA 4Q1AA 3ZWNA 3MFQA 3S7TA 1NC3A 3TL6A 2SHKA 3E0QA 4FZJA 4V0ME 2G82A 3AEKB 4DQUA 5LP1A 3RANA 1XZPA 1GM5A 4D3XA 3BDAA 3VNSA 2HPHA 2ZJBA 2OD2A 4YACA 1KAOA 4A0GA 2F17A 3EAFA 3WE7A 4YI3A 1AN9A 3H9QA 1HH4A 4ZYZA 3H2BA 4FOLA 1F17A 4Z0HO 1ZQ9A 3DWIA 2VDWB 3CZQA 4BL5A 1C0LA 5A3QA 3FNHA 3HP7A 3ZJUA 4U7FA 2P5YA 3OJLA 5FOUA 1GNQA 1VG1A 1YQGA 3U7GA 4RAOA 1Z28A 3I2HA 2FJ0A 3NEYA 1XZJA 4AJIA 1CZRA 2G6BA 2MINB 3EPJA 1YC2A 2AOXA 4XXHA 3BRSA 3FVWA 4C4PA 3VPHA 2FXVA 1FTSA 1E7MA 1PS0A 1X38A 3EQ9A 4J0CA 4YVFA 4FYXA 1IM2A 2WOOA 1E2KA 4UTNA 1BDBA 4EHKA 1S02A 3OJ0A 1XU9A 4ZVLA 4F2PA 1NF3A 4RPIA 4WFKA 1OU4A 3R3YA 5DEIA 3MSXA 2NU9A 1CERA 1ZXLA 4AUMA 3KQYA 2QMOA 3W1VA 3RVBA 4OCZA 2B35A 5KWEA 4C07A 4YPFA 1Z5WA 5BYKA 1JEEA 3RVJA 3CB2A 1E2HA 4Q3CA 4Q4LA 2G83A 5A05A 1C9DB 3V55A 5ALEA 2AZDA 2PRKA 3C1OA 4RKQA 3ERCA 3HCFA 4DMMA 1JV2B 3A9UA 4MHSA 2CHVA 4E94A 2R6JA 2RGEA 4QREA 4DV7B 3HRIA 5EWMB 5KNCD 1Z5ZA 2Z4TA 3IQZA 1DG9A 1PZNA 3B6JA 5EMHA 3UV6A 3DCNA 2W8ZA 4GZMA 2YZKA 5L95A 3GCGA 3HUEA 4Q3DA 1XTJA 5HFJA 2RE8A 2NU8B 1VSVA 4YCNA 1PQ4A 1B7GO 4CMIA 1EJ6A 3BRCA 1ULAA 3EVFA 3K73O 5DF1A 3WYFA 3AL3A 3C8HA 4DRZA 5KYYB 4DR4B 4ACAA 1XEWX 3MK31 4F5DA 3RI3A 3A31A 5JXWA 2BGIA 1RWOA 4TXJA 2JRLA 2VDLB 4HQ0A 5JDCA 4RE5A 2N75A 2B21A 2JL1A 1ZYUA 2DLNA 3KJIA 1EH5A 3KT3A 3N2NA 1L7BA 4GMDA 4C03A 4IUBS 1SB8A 2HU7A 1QZUA 2JK1A 1H9AA 1L8XA 1SU8A 3LP6A 4JXXA 3GLHB 3VJRA 3F4BA 3HACA 3WIUA 1YR6A 3SFTA 1NBMD 3JYOA 3M49A 1VJ0A 4YJHB 1WZUA 4D0GA 4TV8B 2W6JD 4I9NA 2PS0A 3EBPA 4C2AA 4V02A 2ZWMA 1PVVA 4BVEA 4QYSA 3ED1A 3OE4A 3PJRA 2XKBA 3QF7A 1U3GA 2HXSA 2I4NA 2GSDA 2WTMA 2ZAOA 3PFBA 3RS2A 5JCJD 2D7DA 3AEQA 4TRJA 1ARZA 4QYIB 1IPEA 4DDKA 1LF0A 2AMYA 2F9FA 1HE2A 3FFWA 4WZ6A 2WP8J 1E2JA 2H5IA 3L8GA 4PTZA 1AF4A 2J0SA 2FP4A 4ZZ1A 3H11A 2XXAB 4F5ZA 2ZUBA 4BEBA 1XDSA 2EFYA 4FFBA 1O9HA 4I08A 4C6SA 2NAFA 1NQ5A 2OV8A 2X77A 5DHRA 2VYVD 4PBSA 1OI7A 3GRRA 2JD1A 1EXNA 3PPWA 1J0AA 3N0TA 3ZXSA 2I78A 2WQ6A 1C7ZA 3NCTA 4BBPA 2PANA 2WYUA 1RTKA 3OD1A 5J4YA 1KF0A 4IW3B 3OZGA 3M83A 4JL5A 4E31A 2AFIB 2I4IA 4QXAA 2WICA 1ZLXA 1Z25A 2QTRA 2GHTA 1Z5GA 4OG2A 1DBIA 1UAGA 2A0UA 1J8VA 3EZYA 2H1CA 2BRUC 2ZAIA 3O2NA 4S35A 3RVPA 6AT1A 1OBHA 2ECOA 3E0XA 3H2YA 3IXMA 4LRWA 4D99A 3CYFA 4EMTA 4JLVA 1AXRA 1GAWA 5HM6A 1I9CA 4CDGA 3JAMA 1FFBA 2Z58A 4FT4A 5DV9A 3BG5A 4EMUA 3ANTA 2FRVA 4RTPA 1I94B 3JWHA 1DG3A 2W2NA 4B45A 4PHFA 4BO0A 1OH5A 2QYHA 4BP3A 3D4BA 4WLOA 3FWNA 3PEEA 2L42A 4XEHA 2YHSA 4BLTA 2FEOA 4OYRA 1J8DA 1O96B 1P80A 4BO8A 4F6RA 4JNCA 1OLUA 3IMKA 1SJ9A 1WCYA 3PQDA 3WVNA 3LPNA 5IN4A 4CKXA 1HORA 1J4AA 4KQCA 1UKBA 5LL6P 2HW8A 2WWIA 4PG4A 5HKAA 4LDJA 1JBQA 3R40A 4TXMA 1NXWA 1SB9A 1GRNA 1MIOB 3L7DA 4L72A 5SYMA 2XCRB 1N9GB 2HZ7A 3RASA 2DYKA 1I3LA 1FVFA 3DOOA 1V3UA 3FVRA 3ZX4A 5C1PA 3PT9A 3U4GA 1TO6A 4ARBA 2VSXA 1KZ7B 5I7EA 3KSMA 4PLTA 3V4OA 2Y0CA 3CV3A 3NGLA 2WAYA 5EVJA 4J1SA 1UMDA 1MIOA 2NM0A 3QUBA 4HGQA 4DC1A 1NONA 3RIMA 1ORWA 4W4TA 2O5EA 3LSTA 1M2VB 2ZQYA 5LWHA 5AJVB 3CGWA 2ZIGA 1Y3IA 2Q2QA 4CIVA 2VHYA 4JB8A 5E1BA 5K0JA 3LL4A 1PR9A 4I6GA 5K9ZA 1M66A 4ZOLF 1BX0A 1JEYB 1C3VA 2D2FA 1H2FA 4Z5XA 3HNRA 3UMRA 1EWKA 1V8BA 1II0A 1EZ1A 1GPJA 3BFKA 3I4LA 3I8XA 1U2QA 4L8FA 1C7RA 1AB6A 1YS1X 5J9FA 5CB8A 4URXR 1P91A 2P3SA 1SCNE 3EFOB 3PFIA 1T1SA 2HLDD 4LDAA 1R4NB 1TECE 2FWRA 1FUIA 2ZT7A 4X45A 3F3YA 2CD7A 3NZEA 3EW7A 3B9PA 4R5MA 2PRZA 1E9DA 1D0IA 2H0AA 2PRIA 2Q46A 4G1CA 2JJ8A 3BCHA 2AJBA 3QUCA 4E09A 1KMHB 3KBBA 1N32B 2CDCA 2XR1A 3HCWA 1K3UB 2H9YA 4RF3A 5FTJA 1P2BA 4JWKA 1NA5A 3TSZA 1DI0A 1EUDA 3DW3X 3VC7A 1A9TA 3WRYC 4FN5A 4BAZA 4G8JA 3H97A 1K6MA 2WVGA 2ZJ3A 1UJMA 3I76A 3OZSA 3PDIB 4UHEA 3ZTYA 1I7DA 4ZJPA 1ZNQO 4HB0A 2J0QA 1QKIA 3FOBA 1QNFA 1BFUA 2AI3A 3V4LA 5EESA 4AG5A 1QP4A 2FFQA 1U3UA 3KZCA 4TKZA 4TOIA 2OKCA 3R9IA 2XWSA 4QG7A 4Y2HA 4A8JA 1AUQA 1S3GA 4MB0A 2DFTA 2XDQB 3GN1A 3RVSA 1OXSC 4A8JC 4AJ4A 1BXZA 5DXJA 2IHNA 3SJUA 1WB4A 4Z4FA 1VZ3A 1S89A 3DP9A 5FPHA 5ALDA 2FW9A 4RF4A 3RBVA 4YMLA 1B73A 1AT1A 3GJQA 3HR4A 3KJXA 4WUVA 2A2ZA 5G0UA 2HO4A 2H31A 1PLKA 1Z8NA 1U98A 2RCYA 3FWKA 3OBIA 1PQYA 4X6UA 4EGQA 4GHWA 2CE7A 2IEYA 4TKLA 3TEMA 5AK5A 4RIEA 2GOYA 2II6A 3V8PA 4D8YA 5E0KB 3AR8A 3BWBA 4LPKA 3LOUA 1N6KA 3OEEA 3PNMA 3R3JA 3TVDA 5DASA 2XF8A 3TWOA 3DMPA 4B76A 4HDMB 4OA8A 2XE4A 2V55B 4WNIA 1FDTA 2WMNB 5GJWC 3PJEA 3D7LA 3SX4A 3WK9A 4BMVA 3IHTA 1NUHA 4N5DA 3S81A 5JTUA 3UA4A 2H1VA 3KZ1E 3SM3A 1E9CA 3A2LA 1QO9A 3NVDA 4HGZA 3OM8A 4UCFA 3PGMA 4N54A 1E1MA 4Q4CA 4CIWA 1A2QA 2CUTA 4MKGA 4MVJF 4DXHA 3CX8A 4LTDA 1L7EA 1MU0A 1USIA 2N9UA 2WVHA 4JYBA 3MYYA 5IAEA 1EE1A 3KQWA 4CV0A 3NMUF 4FKZA 2QTAA 2CF6A 5ALGA 5A4IS 3A6DA 2Q8QA 1OBVA 2OHOA 1Z29A 4XYBA 4RENA 3AFMA 3QA9A 1VL6A 1YJBA 3UVEA 4EDHA 4E1AA 4UM9D 1KZYC 3C15C 5JD5A 1QGZA 3I23A 3RYTC 3ELBA 5T3UA 5EYPA 2ZPTX 1DU4A 4O08A 3EXG1 2F2TA 4LXIA 3EIXA 1BFKA 3ROZA 1SUIA 4PIVA 4WFJA 4AZ0B 2HIAA 2WJGA 3VZCA 2RAVA 3VDNB 2GESA 3I9FA 3U4HA 2VNHA 1Z6GA 4R2HA 4TS3A 4E5PA 3CQ9A 3T1TA 3LF2A 3OIYA 1W7AA 4DA4A 2WHYA 2C7VA 2QLFA 4WDQA 1DQRA 1DO8A 5L3RA 1YU9A 1O9GA 3EWSA 1WU8A 1JVNA 4N7RA 2HLPA 1IE3A 2OHGA 5CDGA 5I9LA 3DSRA 1RRMA 5ICMA 2VUHB 3T7AA 3D2AA 4LHXA 2W83A 1WTAA 5AFSA 5FLEX 5KNDD 2CLSA 1J7KA 1T9GS 1K08A 2VLBA 4II7A 3LCRA 1OXVA 5ES4B 1QH1B 2PZ8A 1AKMA 2AKYA 2DVMA 1M8JA 3NU1A 4J1QA 2IXDA 1ESCA 5JATA 1OWLA 2I6UA 3FRJA 4AS1A 4B3RB 1R0ZA 2QUZA 3AXTA 2RK3A 3QLEA 4MPRA 4Y6LA 1DTSA 3CVXA 1QU2A 3PQ7A 3E5RA 2N1BA 1YK1A 3PPVA 3EVZA 5K03A 3FOFC 5DDIP 4I55F 5BSUA 4X1KA 3NP9A 1R6TA 3R7AA 3ZLVA 4D4KA 4ZYXA 1U2SA 2Q3FA 3MMSA 3F96A 1SOVA 4GOLD 4N41A 2R9VA 2X9GA 4BEJA 2QBYB 5SICE 1U3DA 1V5EA 1JDVA 3B85A 3TQOA 2UUAB 3RUPA 2FN8A 4MVCA 4KQ6A 1M74A 2O2EA 4LHEA 2XQIA 1XTKA 3VQTA 1HYHA 4FFWA 4LHYA 2B6NA 1L7PA 5KDDA 2F64A 3INNA 4LCJA 2POCA 2FDRA 2QHXA 5B7NA 4I8IA 4B2LA 2G28A 2EG9A 1L7NA 4QNMA 4B47A 5KYXA 1P19A 1YA4A 1GPAA 3K2QA 2B9EA 3BCUA 5ALJA 1PGQA 4P22A 3W6NA 1N3LA 4D45A 5LQRA 3M3HA 3ICEA 1PV4A 1SBYA 5BYBA 1J9EA 2F3TA 4MVYA 4XSGA 5CXXA 4M60A 3S2GA 4H3VA 4K8OA 1F2VA 1TC2A 2HSDA 3IR7A 4DR3B 4C2TA 3O2JA 3OCJA 1C3XA 3B6ZA 1CFJA 2HWXA 3BTVA 1WCV1 4RV5A 1M5UA 4ZO4A 3PXEA 1RM0A 1LTQA 4BKRA 4R2XA 4W5OA 1E5VA 1P17A 1RLTA 1BCSA 1N2SA 1VCMA 2PSSA 3IP8A 1H2BA 3E8XA 3K70C 2MTBA 3ECAA 2ONJA 3MT8A 1H4TA 1WEHA 4KL8S 3HCCA 2A78A 5GINE 1RAGA 5JMPA 4EB6B 4L3WA 3I2IA 3MCVA 5FA5A 4ZI7A 3L1UA 3ZBQA 4DJTA 1OB5A 5FTNA 1RPJA 4QLBA 1UBGA 3ZHUA 2O19A 4IPTA 1NJ1A 2WD8A 1KVSA 4R2IA 2A8YA 4IV5A 1MGOA 2G4CA 3FIJA 5KOJB 1B8OA 1B2RA 1SC9A 2O23A 2GXAA 4GO1A 3PXDA 4X20A 2A5DA 4IIYA 3R74A 1C9YA 1WZCA 5EPUA 4K1LA 1G6HA 1XNHA 3CUWA 4YC7A 2SECE 3IAEA 4ES6A 1PR0A 4JJ6A 4PZEA 1MO4A 2X9NA 4WBNA 3E6AA 4KVGA 4MP3A 4L51A 4RVGA 4NONA 1RE1A 4MSUA 1CRWG 1Y3DE 3LD9A 3GH1A 4GC9A 1I0ZA 1MC4A 4U3JB 1P0QA 1AKTA 2OENG 3L7NA 3GRYA 3LKZA 2VZ8A 4MRMB 5LBIA 4U7GA 4DWJA 1NRJB 3OE7D 2G0AA 2Y1EA 4MUKA 3SIRA 3VI4B 4F6LA 5AH0A 2Q5HA 4IIJB 3ZQJA 1AGNA 1UQTA 3JYNA 5HKKA 3W8NA 5LQKA 3GNLA 1KEEB 1SBHA 4MNTA 1YH3A 2O8NA 2C58A 2P9HA 4PSUA 3CEJA 1Z0SA 2PMDA 1ID1A 3HCDA 3HLKA 5HEKA 5B37A 2WMDA 4D9HA 5IAOA 4PN7A 4V0OA 3OCYA 3IHLA 2WJZB 4NDAA 5LMUB 2AYZA 3IVMA 3UUFA 3ANSA 2H85A 4MI1A 5CG2A 1SC3A 2H17A 2WD7A 4WFQA 4BTVA 5ESRA 5CBPA 2RIPA 4RMHA 4F71A 1VJ1A 1WXWA 2JH9A 10MHA 2QLLA 3UF0A 3B3QA 2QTWB 4UMVA 3VI3B 2XW6A 4UE2A 5ALVA 3H83A 1MA3A 2W2VA 3GAFA 3W06A 4C4OA 3IIEA 3RYIB 3KU1A 1GSIA 5EJ9A 3OOWA 1YWGO 3R6GA 3BAFA 1OXBB 4BMYA 3GEPA 3TECE 3K9NA 3QX3A 1P72A 5DM1A 2ZBRA 2QVZX 3NKVA 3W2TA 3C5VA 2Z95A 4R0VA 4R7GA 1GV0A 2WSSA 1CQJA 2RAPA 4ZHQF 5KOHB 2R47A 5FUMA 4MPDA 4DM7A 3HCPA 1BHJA 3H3FA 1Y48E 2A88A 5BSWA 1AD2A 1X9GA 4OI1A 4RZXA 4AURA 4FQ5A 4L22A 3R7FA 3UXHA 1IM8A 1N57A 2GCGA 4QYIA 3AUFA 2I7DA 3DE6X 3RT9A 1BXRA 2WSBA 4IGFA 5AI9A 3AB8A 3QIAA 1KAGA 4YP5A 4MKZA 4ZCSA 2WJYA 2HDHA 4DY4A 1N2BA 3PHJA 4NCBA 1FP4A 1YBVA 2G88A 2V6JA 4HTAA 4UHKA 1ZM2A 3ICVA 4XB1A 3WV5A 4HV4A 1I24A 5KC9A 1PVOA 2HYIC 4B7XA 3IQDB 4NMWA 4CF3A 3FX2A 2G0NA 3QHPA 3SF8A 4NARA 4ETWA 4ZC1A 3E5NA 1TAGA 3WIBA 3FZYA 1Q50A 2D1QA 3EZNA 2IIQA 4G1MB 3HKDA 1Z16A 5K6TA 4U9HS 3VH2A 1GZVA 3OZVA 1IRIA 4XM0A 2ORWA 2QMYA 3CPEA 1UBMS 3NNSA 4RE6A 3AFGA 2Q7DA 1CZLA 1E6UA 5LQDA 2CXHA 2IOYA 1TEVA 3ETGA 1ULSA 1UKZA 4JVNA 4LV6A 1GN9A 2C4TA 2IWRA 4HEHA 2ZS9A 2KSQA 3BHNA 2XE6A 3GJRA 3TLXA 4BX9A 1TKRA 3K1ZA 4V0KA 5LUBA 1MA0A 3D6FA 5A5FA 3DUFA 2DGDA 1ECPA 3HKCB 4RADA 4XPZA 2NVUB 1CF2O 5DCUA 3GLKA 4DMHA 2HIMA 3ET4A 4DIKA 1IN1A 4KXXA 1J0DA 4OJQA 4YP9A 4MAAA 3VC3A 1YL6A 1HURA 1WO8A 1EFVA 4EJ2A 5JVDF 1ZVVA 4DR6B 1YKGA 1ZRNA 4URFA 4OSEA 1CC1S 3S0JA 2YIVX 3V9PA 3KSRA 4MXDA 5CB4A 1CJSA 2IS4A 4FILA 4D1YA 4UBOA 2J08A 4AJPA 1H42A 3JYLA 5D3MB 4Y2PA 1WXHA 1UMDB 1I2BA 3EJWA 1VMDA 2XGGA 1Z6YA 1GUAA 3D7RA 3KJEA 4JKYA 1KEPA 2IDMA 1BX1A 4MITA 1MJNA 2H11A 4KACA 4MICA 5HCUA 2WTXA 3EXHA 1SXQA 1T4CA 2R4QA 4IF6A 4C6RA 4I1OA 3HWSA 4MHTA 1QBGA 3QEMB 3M6XA 1SCAA 4J3FA 4EEZA 1Z7YA 4K2HA 4B1FA 4NBWA 4V03A 1U2GA 3LLSA 5CIWA 2NXNA 4M0PA 3ZI7A 2WT8A 4DCMA 4QU0A 2CDBA 1XJCA 3H8WA 1TUGA 2PXCA 2QPLA 2UZIR 3RYHA 2LRHA 4MS4A 3JX9A 4DBZA 1NI3A 1MVNA 2WABA 3DT6A 1N8TA 4NF2A 2D00A 4A1FA 5EUBA 4PLPA 3CRQA 5C8YA 2KWIA 4B7UA 4CQLA 2SKCA 1KI9A 5FNVF 3AH8A 2V7VA 2YIDA 1GO2A 2QZ4A 4YAGA 4BJ1A 1Y82A 1JTEA 2ETXA 2J9FB 3EIFA 1E3LA 1IHXA 1PG0A 3NC0C 3U62A 3NV7A 3WYAA 1NG9A 4BJ5A 1TDJA 5JASA 3BS4A 3RFVA 3CE9A 1X2EA 2YIMA