5G4KB

Phloroglucinol reductase from clostridium sp. apo-form
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
264
structure length
264
Chain Sequence
MVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDADCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
source organism Clostridium sp.
total genus 108
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4kB00
4IY1A 1IHXA 3AUAA 3BIOA 3N7UA 4L76A 3UFXA 2FSVA 3PJEA 4ALIA 5I9NA 4INAA 2X23A 4RF5A 4BV9A 3TF5A 3DC2A 3GMSA 1KIFA 1Y5MA 4IM7A 4W4TA 4BL5A 3VZPA 4KQWA 4FFLA 4BO5A 4RJTA 2JHGA 5BSFA 4O5OA 3ZWWA 2B0JA 4IS2A 4NU5A 3KUXA 4TRRA 5JS6A 3H9EO 1D4FA 1OI7A 4HX5A 4BNXA 2I9PA 4CODB 3CTMA 3OA2A 4GAEA 1UXHA 3OA0A 3S2IA 1C0KA 4A73A 4BKPA 1C0IA 1KVTA 1QYDA 1DHTA 3AY3A 1ADGA 3PWKA 2O7QA 4L0QA 1SC6A 1T2AA 3O4RA 4E13A 5DN9A 4DGSA 4JBGA 1O5IA 1EK6A 1HWYA 1NVMB 4RPGA 3OIFA 4YA6A 3WWZA 4R69A 4GI2A 3GAFA 3I3OA 5L9AA 2W98A 1L7DA 4MP3A 3BZUA 4HNHA 1N1EA 3FBTA 2AE2A 5ADHA 2PFGA 2JCYA 4GVLA 3WMXA 2PZJA 1KC3A 4NBTA 4AVYA 5I7EA 1JKFA 2FPIA 5JSFA 2VYND 3RUAA 2C5AA 3C1OA 3DTYA 1E1KA 4W7IA 4WLVA 3L9WA 2QW8A 3TRIA 3VTZA 2FR0A 3BTUA 5JDCA 5JMWA 3OEWA 3Q2IA 5A3JA 4UUOA 4B7CA 5BNIA 1CF2O 2D59A 4Y9DA 3ANLA 3EDMA 1C1XA 4UVHA 3DFZA 1VC2A 3U4IA 4ZD6A 1T1RA 1PJTA 2JKVA 3JQBC 1YWGO 1XWFA 4MIEA 3NT2A 1T2DA 5BR7A 2YHIB 3ZNPA 4CV3A 1WMBA 3PVZA 2BFPA 5BNFA 3ORFA 4RDIA 4E30A 1NYTA 1PSDA 2X9NA 3BHJA 1QYCA 3ASUA 1LDGA 2ZYAA 4ZQEA 3VTFA 3RUIA 3F4BA 4ZQBA 2I6TA 2O2YA 3VVBA 6ADHA 3FNFA 5IDQA 1LUAA 3JQAB 5L53A 2DPGA 5TC4A 2IZ0A 5FI5A 1MC5A 3HADA 4GVXA 2BI8A 2PZKA 5KVVA 1JKIA 1SEVA 1R4NA 2PD3A 4OOEA 1TVEA 4D3DA 1K6JA 4D45A 3DFUA 2EV9A 3OH8A 2VWPA 1PJSA 1D1SA 2V6GA 3I23A 5F5LA 9LDTA 5FEUA 3O03A 1V3TA 3BYZA 2DBVO 3W6ZA 4C4OA 5ITWA 4KTTE 1VPDA 3V2HA 4ALMA 3CUKA 5CDSA 2O23A 3AM3A 1NPYA 4YJGB 5TRTA 3D7LA 1A7KA 3DEYX 3E18A 3ETGA 1PJLA 1DC5A 1HT0A 4XQGA 3VHRA 1GPDG 4MVJE 1NAIA 1MX3A 2Q3EA 2J3HA 5A9RA 2LDXA 3H4VA 4HP8A 1V3UA 4MJLA 2Y1CA 2DUWA 4N7RA 1BXGA 3BTOA 1MG0A 3PJFA 5JDCC 4BNIA 1WZEA 3PHGA 2VHXA 3AUTA 5COAA 3MJVA 3ONEA 3IL2A 1CIVA 2UV8A 4R9SA 3JQEA 3U49A 3VKUA 2PA3A 4LISA 3RJ9A 2X5KO 3UAGA 4QSMA 3OJ0A 1LU9A 3P2OA 4D79A 1JLLA 4IMPA 5I9MA 3DBVO 1P77A 2WDZA 1X7DA 1T4DA 1KVQA 4RORA 3DMTA 1L7EA 3QP9A 4BQPA 4CMBA 1DIHA 2WM3A 5DF1A 3ZNQA 3F4LA 4HBGA 3MEQA 5G0TA 3SVTA 2VZ8A 4J49A 1YB5A 3D3WB 1AXEA 1HLPA 2DC1A 2YFHA 2ZB4A 3UCXA 3FD8A 1KYQA 1PZHA 5TF4A 5H81A 1P45A 1YONA 2FOIA 2NU9A 1GZ4A 1PL7A 4GKVA 4WJZA 4CM4B 1HE3A 2ZATA 3BMCB 1HYEA 2VZ0A 4E2XA 3OJFA 4NJOA 1MV8A 4OXKA 4Y98A 1B8VA 3U4DA 2P68A 4IZHA 1KC1A 2NQTA 3H2SA 4CUKA 5A04A 5IZ4A 3FWZA 4I5EA 3QVSA 3Q0EA 4BGEA 1ZK1A 4BHTA 3RQSA 4DTIA 4R4JA 1U8XX 3MWEB 2IEBA 2D3TA 1LBEA 2WMDA 1GADO 5JE8A 2J3IA 1F17A 1M67A 4GWGA 1OFGA 1YQDA 1DC3A 3W4IA 2A35A 4CMIA 1VL8A 4R01A 5JAQA 5C3MA 2V6MA 3KTDA 4CMKA 4FJ2A 1VJ1A 3D4OA 1DDOA 2P2SA 3VAZA 3M1LA 3I9KA 3OP4A 1J4AA 2OFPA 3LSYA 3TOZA 4D42A 3QWBA 4R68A 3W4JA 4NBUA 2B83A 2X1HA 4FFNA 1UZLA 1WWKA 3PJGA 4OQYA 2UUPA 4PG8A 2EKPA 4QO7A 2Y99A 5G4KB 5IXSA 4FGSA 1GEEA 3LZ6A 2ZJ0A 1SB8A 2PD6A 1JWAB 3GRKA 1JQBA 2VTDA 4YRAA 4J0EA 4IIVA 5IDYA 3G0OA 4E21A 2Q4EA 2QIOA 4DPLA 1HETA 3EMKA 3WWYA 4A03A 2IDZA 2ZK7A 3RUDA 3QA9A 1A9YA 1IHYA 3QLJA 1XGKA 3DMTC 3SC4A 4B7UA 4RPKA 4FS3A 1HXHA 3IC5A 3SLKA 4PLWA 4A7PA 1X13A 4EUHA 2G5CA 1XHLA 4GMFA 4L74A 4XQCA 4Z3DA 1M2WA 2O4CA 3TL2A 4RF2A 4F6CA 1GUZA 4P22A 5IN4A 4OMUA 2NADA 3SJUA 2J3KA 3LC1O 1KERA 3LF1A 1ZK4A 2NV6A 5DOVA 4C7KA 5LC1A 2C54A 3AI3A 2DKNA 4CL8A 4IPTA 1GY8A 3EW7A 1JWBB 1Z82A 2NLOA 1U5AA 2H6EA 4YT5A 4E4YA 5T67A 1ULSA 5ER6A 3I9LA 1SO8A 3A4VA 1XELA 4FSHA 5KJ1A 3B6ZA 1X0VA 4TKLA 1LLQA 3UKOA 3ZN2A 3RBVA 1X7HA 3UCFA 3PQEA 1K3TA 4Y6PA 2V6BA 3CKYA 1I3MA 3GG9A 1UDCA 3GQVA 4J3FA 1K2WA 3VZQA 3FF4A 2CDAA 4CPDA 4EUFA 2D1YA 4B4OA 1Y5RA 3ZNNA 1KOLA 5TSDA 1GTMA 1P0FA 4HY3A 3U09A 3RD5A 1CEQA 3B1JA 4YT8A 2RH8A 2NVUB 4BOYA 2HO5A 1YBMA 4U8GA 2P9CA 1EDOA 1KS9A 3RU9A 4W9NA 2EXXA 1N92A 3DAGA 4PG7A 4HV4A 3ONDA 4R41A 1E0DA 1S7CA 1PS9A 3GHYA 3IAHA 1ZUD1 1E3WB 2DTEA 3WBFA 3GFGA 4WLFA 4LMRA 1ORRA 1BHSA 4GX1A 1PU2A 4ZU3A 5B4UA 4J1TA 3VZRA 4E3ZA 3DHNA 3HSKA 1U7HA 1VRWA 5EQFA 1F8FA 2B4RO 3MJ4A 1PL8A 2H9IA 3EK2A 4JJGA 4RQTA 5KNLA 3GK3A 2JCVA 2Q4BA 4BO0A 3EGOA 1F8GA 1E7MA 4P4LA 1TXGA 3VPHA 1V6AA 1M6HA 1N7HA 5B4VA 2Q46A 3JD3A 3F9IA 4IS3A 4DVJA 3IJRA 5B12A 1HE5A 1IUKA 3L9XA 3C85A 4KZPA 2PGJA 1NFFA 2NVWA 3GDOA 3HQ4O 1KY5A 4NJMB 4Y8VA 1NXQA 4WLOA 4NH4A 3KB6A 4BUCA 1VKOA 2Q50A 3E9NA 4FN4A 2HMVA 1DIBA 3EY4A 1E7WA 5JCJD 3D3EA 1JAYA 5CEJA 4YT4A 2AW5A 1GL3A 1IYZA 3JTMA 3LU1A 4ZVVA 4DRYA 3X2FA 4EJ6A 3UUWA 2NU7A 4YDRA 3Q9NA 4KOAA 1BG6A 1G1AA 1NHWA 4CMJA 1Y1PA 1OOEA 2I3AA 5DCYA 4PG6A 3PGJA 1MFPA 3GZNB 1T26A 1YKFA 4QFDA 4RV9A 2JAPA 2YHIA 4DC1A 1Y8RB 3HB5X 4E12A 5LDGA 3AY6A 4O59O 4K28A 1DEHA 1NASA 2GF2A 1YL6A 1R4NB 1AHHA 2BFMA 2NU6A 3ZGYA 4K1LA 3L07A 4PG5A 4W9NC 1Y8QB 2I65A 4Y67A 1MC4A 3GN2A 4XYBA 2GZ3A 2PTGA 1WDMA 4GKBA 3RU7A 3PHJA 5JXWA 1P1RA 3WBBA 3ZWCA 5DZSA 4PN3A 2QRLA 4AJEA 2F1KA 2HRBA 5KCZA 5L4LA 1MGOA 1U4SA 4I1IA 3K8ZA 3PYXA 4I8XA 4CM6A 1TT7A 2WYVA 2JD1A 1P74A 1YXMA 4UAGA 2O4UX 2AEMA 1E77A 2AA3A 1G0OA 3L4BA 2CF5A 4NFHA 3KLMX 3H5RA 4LK3A 3ZCXA 3VPGA 5CEFA 5DCWA 4YAJA 3UXYA 1IPFA 3LDHA 2WD8A 3LK7A 4URFA 3WNVA 3FPCA 3IKTA 4MP8A 4I08A 4R5HA 3T4XA 4P8RA 3WOHA 1BXGB 1E7QA 1X0XA 5AYVA 4AJKA 4YJGA 3NDIA 3WQRA 1QV7A 1RM0A 1I01A 4DC0A 4OM8A 1LNQA 2IZZA 3OF2A 2V65A 3G79A 1Y7TA 1NFRA 1KEVA 1LDMA 3WGZA 3G49A 4II2A 1PR3A 3V8BA 4PLYA 4BMSA 4GSLA 5KJFA 4FFRA 2Y0DA 4G5HA 1PGQA 4NNJA 5IF3A 3NTQA 1ZH8A 4J6FA 1DJQA 3QRWA 4BNJA 1PWZA 3AK4A 2TMGA 2WD7B 3IP3A 4TMFA 5CDTA 1S6YA 2OP0A 1WPQA 4CM5A 2NACA 2UYYA 4O0LA 4FQ8A 1H93A 4E2WA 2PH3A 1GDHA 4R1SA 4WLNA 1IZ0A 3PHIA 4I9NA 1EQUA 2SCUA 2W2LD 2ZYGA 3HN7A 4M8SA 2Q45A 4NBVA 1M66A 5ENDA 2GCGA 3T7EA 3E48A 2ZQYA 3K96A 3VDQA 3JQAD 4DYVA 4GGPA 1KETA 1OC4A 1VJ0A 1GUYA 2PGLA 1GYRA 3Q3CA 1GV1A 2WE8A 3FWNA 3Q1LA 5ICSA 1DSSG 1R16A 2YV1A 1CWUA 1LSJA 3MZ0A 2P4HX 3KO8A 1C0LA 5TJHA 1LSOA 1JA9A 4CLDA 4CM4A 3BMCA 2BF7A 4BO6A 1LLUA 3GFBA 3W6UA 1RWBA 3L4BC 4CMIB 4IZIA 4LW8A 3BTSA 4BNGA 3E9QA 4XIJA 1ZSVA 4DMMA 1T25A 3DB2A 3MOIA 1YRLA 4ZRNA 1VL6A 2C5EA 2J8ZA 2IZ1A 4FBGA 3QIVA 4IQ8A 1NQTA 3K73O 1C3VA 3H5NA 4WOKA 4R3WA 1XU7A 1GUFA 2QX7A 3DMYA 5T64A 5AVOA 2GUGA 1WMAA 3RASA 4BIIA 4OQZA 4YJFA 2ZJ1A 4M86A 3ROQA 5JY1A 1J0XO 3OECA 4RGBA 1ZEMA 3DBHA 4IMRA 2PLAA 3P5SA 5CP8A 1AGNA 1WVGA 1O89A 5BSEA 1IY8A 4BGVA 3L6OO 2DVMA 4GLLA 4WCFC 3GEGA 3DZKA 1Z7EA 1I32A 2Q1UA 4OYRA 3KZVA 3JYPA 3RKRA 1R0KA 4N5MA 1YOVB 3GG2A 2W2KA 5H83A 2FWMX 4YRDA 4Z9FA 2R6JA 1I0ZA 2Y67A 3ZU3A 3KETA 2OOSA 2W8ZA 3ETEA 4Q3AA 2DAPA 1DC4A 3RC2A 4L4RA 1QV6A 2GN8A 4AJ1A 1ML3A 3H9QA 2P9EA 1G6KA 1HSOA 1ID1A 1IB6A 1NPDA 3K5PA 1EVIA 3I6IA 4MP6A 3JD2A 1ZFNA 4LGVA 2VN8A 4RQUA 5TLSA 2DFVA 2JFHA 4KUHA 4CM1A 1U9JA 4A5OA 1U2GA 3C8MA 1UXJA 3PFWO 4W82A 2FY8A 4XYLA 3ZHBA 2VT2A 1LDEA 1GR0A 3U5TA 2BI7A 5F1OA 3DDNA 1JAXA 4JBIA 4QTZA 4UVGA 5A03A 3H6KA 1V9LA 5JDIA 3DZHA 2G1UA 4BNTA 2QZZA 3ZW8A 3OICA 3PI7A 4WK6A 5DCUA 3NT4A 4NFSA 4XJSA 3VPXA 3FNEA 1BSVA 1NVTA 2AG5A 4IQ0A 1IL0A 4IGFA 4ZN6A 2WE7A 4DIBA 2P9GA 4W6ZA 2Q2WA 5FYDA 1WLYA 4B3IA 1HZZA 1E3SA 3OEYA 4TQGA 1U2DA 5ILOA 1HTBA 2EHDA 5F1KA 3B1FA 1U7TA 1R4MB 4FIZA 2GPTA 4YXFA 3C7AA 5BQFA 1V0JA 3GUCA 1E6UA 1EDZA 4QFCA 4ND4A 1E5LA 4AJ2A 5KVCA 3VPFA 1ISFA 2NSDA 1U3TA 1N1GA 2NVUA 1Z75A 3H3FA 5TS3A 3S2FA 3DBRB 4K26A 3RIHA 1X14A 1HDCA 4IJKA 2EW2A 4RZHA 1E3WA 1PZFA 4ZQGA 3SX2A 1GCOA 3WFJA 5HS4A 1BXKA 3GVXA 5JAZA 1EUCA 1QLJA 2I99A 1ZJZA 1PJ3A 3JQ6A 4J4TA 4YTEA 1V3VA 1K0UA 1BTOA 3DQPA 4GX0A 1ZSYA 4Q3CA 4AJJA 1E3JA 3HDYA 3HNPA 1UJMA 3TDKA 3WGHA 1GYQA 3JCZA 4YJHB 4IDGA 1MUUA 2YFQA 2DFDA 2X7HA 5IAAA 4M49A 3GA0A 4QEDA 1UAYA 4CM8B 4XZ3A 2Q1SA 4WOJA 2X9GA 3E03A 3Q2KA 4KUGA 4QX6A 4YJDA 3PZBA 5JMPA 3OIDA 3FR7A 1KBZA 3KYDB 1QLHA 2YW9A 2CVOA 3ZWXA 4GSKA 4XGIA 4TZTA 5I8WA 1HYGA 3DTTA 4WEQA 2NUAA 5A1TA 3G3EA 1RJWA 5CPFA 4NJMA 2C07A 5JDIC 2EWMA 2PZMA 2X9VA 1MP0A 2WYUA 4N5LA 5CAEA 3MTGA 5AXDA 1W0CA 4DPMA 4Q3DA 4JXKA 1JU9A 2HUNA 1R15A 2YHUA 4FR5A 3ZWAA 3E5MA 3PGXA 3CSDA 1PJQA 3DZJA 2Z1NA 4L75A 1SMKA 1W4ZA 3GGGA 4F3YA 1GQ2A 4D44A 2F00A 3V2GA 1YE3A 4NG5A 5BT9A 5IZCA 3GDFA 5KKAA 1DRWA 3O8QB 3LYLA 3GH3A 5TGDA 5A4DA 3HN2A 3AU9A 3NDRA 3GZNA 1H2HA 1XYGA 4L8VA 4XX0A 3F5SA 3S8MA 1QR6A 1Y8RA 2GSDA 4UUMA 4MVJG 1SZJG 5HBRA 1VM6A 2AQKA 3O26A 4MKXA 3M6IA 5F1PA 3DOCA 2VUSA 4KDEA 3DWFA 1Y8QA 3JQGB 3B20A 3NTOA 2LDBA 1EVJA 4MIYA 4O63O 2VRBA 4H16A 3ZWNA 5T5QA 1N2SA 1K6IA 2VWGA 4NFYA 2IEDA 3H9UA 1RYEA 1P1FA 4U5QA 4XB1A 1H2BA 1SCUA 3TWOA 1JVSA 4QXMA 3ZHYA 1DAOA 4L73A 4S3MA 3RI3A 3STHA 3JQ9C 3AJRA 2J3JA 3WFIA 4YAKA 3GNQA 1LX6A 3GDGA 2YV3A 1W73A 2AE1A 3INRA 3GT0A 1HZJA 1NFQA 1X1EA 1ENYA 3ADPA 1GCUA 4Z0PA 3MJTA 1LLCA 4QT0A 2HSDA 3W8FA 2JD0A 3VH3A 2YDYA 4RVFA 3OIGA 2VNAA 2VWHA 1BVUA 3COSA 4FJ1A 3PFFA 4II3A 4YAGA 2RAFA 4I5DA 1ENOA 4WCFB 4J0FA 4Z0TA 3I9JA 4K6CA 2G0TA 1AXGA 3L6DA 1PGJA 4YQZA 1H94A 2P5UA 3RSHA 2BMAA 2VUUA 3HDQA 3SEFA 1HE2A 3NV9A 4YAIA 4WE3A 1YDWA 2POQX 3JYNA 1U4OA 4JBHA 2AQHA 2DBRA 5TT0A 3JQDA 4ND1A 3LT4A 3GC6A 1FDSA 1R12A 5DDIP 2PKRA 3JQ7B 4KWIA 2WD7A 4YAEA 4CQLB 2CUKA 3N74A 3QHAA 1UZNA 5HWSA 1QORA 5IZCC 2D2IA 3EZYA 3UCEA 1P31A 2DQ4A 2B37A 3IUPA 4J9VA 4LCJA 3WGGA 1WP4A 2EKQA 5TQVA 2O48X 5CEEA 4R51A 2PV7A 3FN4A 4J91A 5H82A 4CV2A 1JN0A 1GU7A 4BKUA 3WSWA 3TNLA 3DZFA 3WX0A 1T24A 1HF3A 4BNWA 4FW8A 3O38A 2EJVA 3AOEC 4BVAA 1IZ9A 4J1NA 1ZSNA 5EINA 1C1DB 1LLDA 1ZCJA 2X0NA 4CLOA 2EP7A 3U62A 1M75A 3AUSA 3DL2A 5K9ZA 3VOSA 1RM5A 1HDYA 1P44A 4LSWA 1E1MA 3NEPX 4YPOA 5KVQA 3HB4X 1YL7A 3RVDA 4BO7A 4ILKA 2BFAA 3VDRA 3WQQA 2B5VA 1E6EA 1R0SA 4IDDA 4XDYA 4BKOA 1PZEA 1DOHA 1RM3A 5L95A 1V8BA 2XXBA 5EERA 5ES3A 3RKUA 4YYZA 1ADFA 4YJFB 4XR9A 1YGYA 5KJ6A 3A28A 3MTJA 3R0IA 2PKQO 2C82A 3DZIA 1NTOA 3HFSA 1E3EA 2CVZA 3DBHB 3ZU5A 5AXAA 3OHSX 1BDMA 2D8AA 4DIOA 2GR9A 3L77A 4BB5A 1XIVA 2RH4A 4J7CA 4RCVA 5G0SA 1E6WA 4PVDA 1JDJA 2OORA 1QG6A 2W2KB 3CINA 4IINA 2GASA 4DA9A 2XAAA 3NAQA 6LDHA 2EKLA 3R3SA 4IXTA 1N7GA 3TZCA 1LI4A 1I3NA 2XOXA 3LQFA 1MLDA 1GD1O 2VWQA 4R5MA 5GMOA 3ZHZA 2P91A 5L4SA 4FFMA 1T2CA 1NM5A 1I3LA 3AUUA 4CR6A 1YOVA 3PYLA 3LC7O 5KKCA 4DXHA 4D3FA 3WGOA 2BGKA 3ROKA 3UHAA 1FDTA 5IXYA 2Y0CA 4BNNA 2O3JA 1DBVO 1QP8A 3JD4A 4I5FA 2VOJA 3F1KA 1UDAA 1KEWA 4IBOA 4E0BA 8ADHA 2OHXA 1YJ8A 1FDVA 3K31A 3PDJA 1MA0A 3G1TA 1YQGA 3RUFA 2C2XA 1YL5A 2FZEA 1UDBA 3I4CA 3RUEA 4E5PA 7ADHA 4B4WA 4TVBA 2HQ1A 1ZKMA 1UH5A 2BH9A 5COBA 3WLFA 5KJCA 4UVDA 1HDZA 1Y9AA 2UAGA 4KMSA 1CQJA 4MKZA 4Q3BA 4CL3A 3VPSA 1PGOA 3VH2A 1Q0QA 5DBFA 4TRMA 2DBZA 3IJPA 3JYLA 1NR1A 3JQCA 3RBXA 3RUHA 1A27A 5DP2A 1TT5A 3I9NA 3OQBA 5C7IO 2ZTLA 4GL4A 2OZPA 5GY7A 2JFGA 1WDKA 4Y6SA 1E92A 4CJXA 3KV3O 1HE4A 4CM9A 4J2HA 3P7MA 5DOZA 2X8LA 1SBYA 2GN6A 4OL9A 1H6BA 4QQRA 4OXNA 1ZMOA 5JBIA 2GD1O 4DLAA 2C7GA 2ZIZA 1XQ6A 1BW9A 1B14A 1I30A 3LF2A 3R6DA 1EVYA 1JKJA 5G0UA 1QKIA 4AG3A 2GN4A 2GYYA 4ITUA 1R4MA 2YDXA 3S2GA 1DIGA 2GZ1A 1FDWA 3GRPA 2QG4A 3BXXA 5C7OO 1NBOA 2E4AA 2B36A 3WS7A 3ZV3A 2ZCUA 4PZCA 4EJ0A 1XDWA 2QZ9A 2I66A 5TT1A 4W7HA 1C0PA 2EG9A 4UREA 2O3SA 4WUVA 2Q2QA 1H9BA 3ITDA 3DBRA 1XLTA 1E7YA 3TOXA 3ICPA 1OC2A 4ZHSA 4CLRA 1MFZA 1J5PA 3FI9A 4CM7A 3F1LA 4E33A 4S1VA 5FWNA 5DBGA 1I24A 2D0IA 1IE3A 1VSUA 4O6VA 4P4GA 1QMGA 5DNAA 1CYDA 1WAMA 5TJ9A 3WMWA 4DMLA 2PWZA 5K0ZA 1EQ2A 4D43A 3HDJA 4WGGA 3HZZA 3TN7A 5DULA 3S1LA 4RZIA 5LDHA 4JIGA 3H9JA 5JNLA 4YJHA 1SAYA 3NDJA 4TZKA 3WYCA 1E5QA 5COQA 2G17A 1PL6A 4BKQA 3RC7A 4CM8A 1MXFA 2OP1A 2PNFA 4CLEA 2HK9A 1TEHA 1FF9A 4FJ0A 3E6AA 3KYDA 2CD9A 1ZJYA 3V5NA 1ISMA 5KWEA 4MVJM 2Y1OA 1T4BA 1XG5A 3IMFA 1Z6ZA 1B26A 2GN9A 4ZQHA 4B3HA 4CUJA 2WJPA 5A05A 4EGFA 1EFLA 4WLEA 1YBVA 3FTNA 3ITKA 4HFNA 4OSOA 3FNHA 3KXDA 4FOSA 1HDRA 4D0SA 5EJ2A 3GVCA 1YH3A 3DOOA 1DC6A 3TQHA 1U3VA 3AWDA 3QJ5A 5CG2A 2DBQA 2XPCA 3A9WA 3OJEA 5LCXA 2HMUA 2VHVA 5A06A 1XQ1A 4NPCA 1SOWA 4GGOA 3H9GA 2BHLA 3O8QA 4TRNA 4L4XA 4FB5A 2QYTA 3HG7A 4YACA 1Z45A 5ICMA 3WG9A 3ENNA 1EE9A 4MINA 4XCVA 3GPDG 2Q99A 3H5AA 1UUFA 1P0CA 4JJIA 3KVOA 1PQUA 2GGSA 1DAPA 2DLDA 4U6SA 1ISGA 1B0AA 3V1YA 4GX5A 2VRCA 3JQGA 3SLGA 3WNQA 4KQXA 4U0KA 4GMGA 1G0NA 9LDBA 3X2EA 2Q49A 3LVFO 3PQFA 4XDZA 4BKRA 2CZCA 2Q2VA 3H8VA 4KWHA 1O8CA 3PTZA 3DAFA 5TIIA 4OOFA 2IXAA 4H15A 3ASVA 1SB9A 3C1AA 3FR8A 4YVFA 2HKIA 4FD3A 8LDHA 3AM4A 4AJPA 3GPIA 4NQZA 4NR0A 3ZW9A 1XKQA 3IIEA 1R37A 2Y93A 3GN1A 5AOVA 1UR5A 4AFNA 4BGIA 3AFNA 1SEPA 2EP5A 2VHWA 2Z5LA 3BAZA 4EEZA 1P1JA 5BSHA 1E3LA 1GV0A 1YDEA 1B15A 5DBIA 1RKXA 3F3SA 4HFJA 3RFVA 4WNCA 2W4QA 2Y66A 3V1TC 5IN5A 3MJCA 1BVRA 4R1UA 1O9BA 5K6AA 5L4NA 1SOVA 1NVGA 4F6LA 4WCFA 2VYVA 4N5NA 2C0CA 4UEOA 5FFFA 3WB9A 4UEJA 1DIAA 2UVDA 3QVOA 1DLIA 3WQSB 3Q6IA 2HDHA 3JQBA 2FZWA 1HLDA 3GZ4A 1QXSA 3KSZO 3AI1A 4R3NA 3NX4A 3H3JA 1L1FA 3I5MA 4ZA2A 5FF9A 3GF4A 4K9DA 1XA0A 2ZTUA 3ABIA 1ZEJA 3JQ7A 1P33A 4CQLA 1DJNA 4DBVO 4BNKA 1B7GO 1W6UA 2EGHA 3H7AA 3INTA 5HA5A 4CLHA 1ZK0A 2B69A 2FMUA 4FGWA 4J9UE 1I8TA 4CLOB 3DOJA 4NMHA 4F45A 4Y6RA 3JD1A 4G65A 2FN7A 4GX2A 3GHHA 2QYSA 4D41A 2AQ8A 3EHEA 3DR3A 4HWKA 2VRCD 4M55A 2VQ3A 4Z6KA 3DBLB 5G2OA 4G2NA 1C1DA 3ZWYA 3CH6A 4Q9NA 5C37A 3M2PA 1O94A 4RVSA 4XR4A 4AJOA 1EEHA 4DLLA 4E32A 3U0BA 3UOGA 1IPEA 1BRMA 1ZK2A 2BKAA 4XGNA 5GZ1A 3BTVA 1LJ8A 4CQMA 3NYWA 5AXCA 2QHXA 5EN4A 2JHFA 1LEHA 1HEUA 3KSDO 5THKA 4NHEA 3K2BA 4E6PA 1M76A 1N8KA 2DUUA 3BA1A 2X0RA 1M6WA 1OBFO 4R16A 4ZRMA 4ZICA 1QYXA 5I9LA 2RHCA 3ONFA 2WSBA 3OFSA 5U9CA 3QQPA 2FR8A 5K6AC 2XXJA 3NJ4A 4IGEA 3WGQA 4D0RA 2YUTA 1LC3A 4A10A 1ONNA 1I3KA 1HKUA 1YJQA 3GY0A 4P38A 4Z9YA 4A26A 4BNHA 2Y05A 1I5RA 4BO3A 4J2OA 1YO6A 1QRRA 2NTNA 5MGBA 1X1TA 2CDBA 3NTRA 3JYOA 4Q39A 2XF8A 1WW8A 3PWSA 1LC0A 5HRUA 3BMQA 5L7WA 3WXBA 5F3RA 3BHMA 2D5CA 1Z7BA 1U3WA 3PWZA 2Y1EA 4PCVA 4TRJA 2RCYA 1FDUA 1DLJA 2Z1MA 1P1HA 1PQWA 1DO8A 3PYMA 2X6TA 3WTCA 2FPPA 2QRJA 1UP4A 3WR5A 2JL1A 2PK3A 4B4VA 4OJNA 3NGLA 3ICCA 3FTPA 5ILGA 2R2GA 4J43A 5IDXA 2C29D 3I1JA 1HSZA 3K6JA 4RVHA 3GVPA 4J4BA 3HWRA 2PGDA 3HE3A 5JY6A 1RPNA 2BLLA 3LT0A 5HTOA 5JYEA 1TT5B 3KEOA 3I52A 1H6DA 3LT1A 2E37A 5U4QA 3HJAA 1NQAO 3OJOA 4P4NA 5B37A 4UVIA 2RHRA 2ZTVA 5CPBA 1OAAA 4HUJA 3RC9A 1D7OA 1BW9B 3CMMA 3RROA 5A5FA 2H1SA 3OQ6A 2VYNA 1GAEO 3F47A 3HUDA 4A0SA 1A5ZA 4WECA 1GQQA 4CMEA 4J7XA 5L51A 4HFRA 3TZKA 1I2BA 2VZ9A 2RBEA 2YQ4A 3AM5A 4QECA 1NPTO 4BB6A 4XYMA 1RYDA 4HFMA 2OMEA 3K92A 3L6EA 3BMNB 3C7DB 4OO3A 3MOGA 1A7AA 1ZIDA 1UP7A 1AUPA 3JYQA 4B8WA 1FJHA 5KTKA 1ZK3A 5A5EA 4CLRB 4U6QA 5C5IA 3KRTA 4DQVA 1NQOA 1OZAA 3UW3A 5EIOA 1PTJA 3HFGA 4R1NA 1GFSA 3FRJA 3GOHA 3M1AA 1PWXA 1ZW1A 4ND5A 3ST7A 3GUYA 4J4HA 4TROA 1R0LA 2FHSA 1Z73A 5DP1A 3OJLA 4NU6A 4C7JA 1UXKA 3QVXA 4RL6A 3JQ9A 2DTXA 4XKJA 4XB2A 1DB3A 2FR1A 3QWIA 1Q1NA 3CEAA 3JD0A 2HRZA 4JCOA 4R54A 1GZ3A 1ENZA 2X58A 2BD0A 2DT5A 1EBFA 3I83A 3KSUA 2QRKA 5I8ZA 4PVCA 4YWJA 5I7VA 3EVTA 4XYGA 4YEDA 3ANNA 3UICA 3PRJA 1B3BA 3CZRA 2Q1TA 3KOUA 1LRKA 3W4KA 3OM9A 4CV0A 4MKRA 1H6CA 3VC7A 3VH4A 5J23A 1IOLA 1ZXBA 1BMDA 2I76A 2PH5A 1K6XA 1W8DA 4EUEA 1LDYA 3QY9A 1EE2A 2P4QA 4IUYA 4KUEA 1JW9B 2CFCA 2X86A 4XYEA 1BXZA 5U1PA 3JQ8B 3AU8A 5B1YA 4YRBA 1NAHA 2YJZA 3NUGA 4IJUA 4RVUA 5THQA 4B4UA 3PHHA 3R1IA 1ZBQA 4H7PA 4CMEC 2OL4A 4UEKA 2IODA 4M87A 1QSGA 1FK8A 3OETA 4RPHA 4AJNA 3TJRA 3GNSA 1KY4A 1Q7GA 4XEHA 3TSCA 5AQ1A 2YV2A 5F5NA 3NGXA 3GEDA 3B70A 1Y9EA 1A4UA 3MJSA 2OBYA 4EZBA 4JX8A 4CLXA 1U1IA 3E5RA 3GLQA 1O95A 3AOEA 3ZZNA 4QO8A 1BWSA 1P3DA 2WTBA 3DHEA 4MVJF 1QYWA 4GPD1 3WGYA 4CMCA 3G1UA 1Q0HA 2E48A 2WYWA 5EL0A 2CMDA 4BS9A 4OSPA 4NI5A 5EMHA 2ZCVA 2EIHA 2Y1FA 3ZH2A 1NP3A 4J1QA 2JCXA 2ZB3A 2CDCA 4DQUA 4HKTA 4CMHA 1LDNA 2YYYA 3UVEA 1H5QA 3IP1A 1VLLA 4FFOA 1V35A 2CSUA 3ZWMA 2BELA 4D7AA 5IDWA 1FMCA 4LVUA 4ND2A 5MDHA 3D0OA 4J7UA 1N9GB 4JK3A 3O9ZA 1U28A 1H0KA 4BNFA 3SJ7A 3GGOA 1PIWA 1XEAA 3WJAA 2NNLD 1MXHA 2B5WA 2O2SA 3ZHXA 4EBFA 5JC8A 4LN1A 2BRUA 4JNKA 4CMGA 4XIYA 2EF1A 4PLHA 2OO5A 3ZDFA 4EITA 3FHLA 1ONPA 1VE9A 1PJCA 1I33A 4BNLA 4J1SA 2CY0A 4PLCA 3VZSA 2A92A 5IFLA 4XJTA 5EESA 4UULA 3KYCB 2G82A 3RFXA 3WDSA 1C14A 1DPGA 3EVNA 3ULKA 4CV1A 5KIAA 4MIOA 1UXIA 2WWRA 1KEUA 2QQ5A 1P9LA 4OHUA 1O6ZA 2HAEA 5JO0A 3PPIA 4JROA 2X5OA 3WYBA 5T6BA 1BGVA 1TB4A 5IJZA 2JD2A 1PEDA 2PD4A 1YBAA 3QWFA 3BMOB 1WXDA 1PGNA 2B4TO 2NM0A 3EC7A 3KHUA 2VCYA 4MDHA 2ZKLA 1PJBA 4RDHA 1EK5A 1EUDA 3E9MA 1A9ZA 5L45A 2V7PA 3GGPA 4BO8A 1K89A 4FFPA 3CIFA 3OBBA 2IXBA 2UUOA 4UUNA 5KVSA 1NX6A 4PIVA 3EZLA 1AE1A 2DU8A 3ZWPA 4ALJA 3K30A 5A3VA 2CVQA 1ZNQO 4L4SA 2GNAA 3DBLA 3PP8A 4CQMB 3S55A 3FSRA 4FPXA 4RLHA 1PGPA 1BDBA 1ZMTA 4MO2A 4BMVA 3H65A 4ALKA 1QYVA 2NWQA 1WZIA 3DONA 3EUWA 2I3GA 4CMAA 3UGKA 3C3XA 1CERA 1I2CA 1Y81A 4WNIA 1ARZA 3PQDA 1ADBA 2Q1WA 2AQIA 2UDPA 1JVBA 1NWCA 4GWKA 1F06A 1ADCA 5JPIA 4IDCA 2Z95A 3W8EA 1KVSA 4LCEA 3LLVA 1DFGA 4B3JA 1P1KA 2DM6A 4WLUA 1CQIA 3U3XA 3MWDB 3C7CB 4I5GA 4NBRA 5BSGA 3PIIA 2ZYDA 2E6UX 3ROPA 3KM0A 3N58A 2ET6A 4OKIA 4PLZA 3V1UA 1XU9A 1KEPA 4NDNE 1MB4A 5A9SA 2AEFA 1J49A 3JQFA 3BMQB 4CR7A 2JFFA 4N18A 1WNTA 4K6FA 1R6DA 3M2TA 1ULUA 5TX7A 2ZB8A 7MDHA 5C7LO 1VSVA 1U5CA 2A9FA 2H63A 2IE0A 1JTVA 5A9TA 4RF4A 3ZNOA 4E31A 3E1KA 4NK5A 2BGLA 4IIUA 3F5QA 2FSSA 3F6YA 4PGFA 2ZQZA 2O50A 4E5KA 3ZWBA 3KBOA 4EDFA 5A02A 3QVTA 1Z74A 3FCOA 3NKLA 1DHRA 1O0SA 2RIRA 2VT3A 2VHZA 5T8KA 4MPDA 2AMFA 5EQDA 3W8DA 1VL0A 2I5PO 1D3AA 4JP2A 3C24A 3CXRA 4OGWA 1LDBA 3QVWA 4MVJA 2B4QA 2X4GA 3ETDA 4NK4A 4XWYA 3RBZA 1GPJA 1X15A 2X5JO 4OAQA 4XQEA 1GYPA 4XRRA 1B16A 1I10A 2H5LA 2GERA 3CE6A 4QUKA 1HDXA 3AFMA 4KDFA 4IDEA 4DPKA 3RFTA 3OMLA 4L9RA 4LRTB 5JLAA 2JAHA 1ISIA 1CETA 5L7TA 3AI2A 1A4IA 2EW8A 3D5TA 3P2YA 1I36A 4H3VA 4BNZA 5JAIA 5JW6A 2AG8A 4PLVA 4GBJA 3RJ5A 4YBZA 2Y0EA 2J5RA 1E1NA 1UZMA 3IOYA 3Q11A 4XD2A 4CM3A 1N5DA 5JAMA 2BGMA 2FP4A 4YR9A 3K9QO 3DZGA 5JCJA 4DYDA 1U3UA 5CDYA 2A4KA 2Y1DA 1LA2A 4A27A 4N54A 1LQUA 3GEMA 5ENVA 4E2YA 2V6FA 3KEQA 2ILTA 3BMNA 4DWVA 3PK0A 2O3RA 1Q7CA 4AJLA 4ND3A 2HMTA 4I9UA 1EZ4A 3I9MA 3WGTA 4ALLA 3QWHA 1YB1A 3JQFC 4E2ZA 4PG4A 1VI2A 1TLTA 1CDOA 3QWAA 4BGUA 2EERA 5HM8A 1A71A 4DQXA 3U4HA 5KOIA 5CDUA 4J90A 1ZO8A 3QW2A 4HADA 1AHIA 3RUCA 3I4FA 2GZ2A 4MVJP 3NJ8A 4B79A 2GRAA 4HXYA 5G0WA 4MVJH 1LXCA 2DPHA 4YT2A 4E5NA 4KTVE 4JN6B 5CG1A 4LRSB 3CZMA 1F0YA 4WASA 4WCDA 1ZVMA 5EPOA 4DREA 2NQ8A 1EBUA 4MOWA 3S2EA 1B2LA 3KLPX 2HJRA 4MVJD 5T8KC 3ZWVA 2D4AA 3B1KA 1Q0LA 3SBOA 2O3TA 3QE3A 3PEFA 1UP6A 2OXIA 4F46A 4W99A 4AJ4A 4ALNA 4BO9A 3GVHA 3RAJA 2GO1A 1E7SA 4EYEA 3HHPA 4DL9A 1SNYA 4O1MA 5G0VA 4G81A 3R3JA 2OUIA 3G17A 3PLRA 4HNGA 4JP3A 4R9RA 4U0JA 5JYDA 2VHYA 4M1QA 5T57A 4EJMA 1EMDA 1SPXA 3V2UA 5DT9A 4CM9D 3UH1A 3DXFA 4JJFA 1EVZA 3PJDA 4IDBA 4JQCA 3RC1A 1C1XB 5KJEA 3AY7A 4PRKA 4E5MA 4JGBA 1DRVA 1YS4A 5G4LA 2EEZA 4YB8A 1E7RA 3H2ZA 1FXSA 4FC7A 4B8ZA 2Y1GA 4X54A 4TKMA 3LLSA 4OXYA 3JQ8A 1NQ5A 1VKNA 2W90A 1HL3A 4JLWA 3DAPA 4YQYA 5JFOA 1B8UA 1DFIA 1HDOA 2R00A 4ROSA 1GZ6A 1RM4A 3ZU4A 3L0DA 4TVOA 2PZLA 3T4EA 3TZQA 4KP7A 1T1SA 5I7SA 2TMDA 4GH5A 2HK7A 4FC6A 1IULA 2P5YA 3CPSA 3L4SO 3RWBA 2FRDA 4U7WA 3WIDA 3MJEA 2WEKA 5CFZA 1LQTA 3TZ6A 3LT2A 1TI7A 3UF0A 2ZTMA 3ADOA 2W2LA 4NIMA 1ISJA 1XSEA 3D5QA 4A2CA 3GAZA 4ZGWA 5ER9A 4UVEA 3WYEA 1J6UA 1NHGA 3AOGA 2O7SA 3CMCO 3JQAA 3ON5A 2AHRA 3OSUA 4RF3A 4WEOA 3WTBA 2YQ5A 4AICA 1E3IA 3A14A 4PLTA 1PS0A 1LTHR 3VVCA 3ZV4A 3IDSA 4BO1A 5ITVA 3FNGA 4DUPA 2BFOA 1LRJA 5HS6A 3KYBA 3TL3A 2IRWA 1ISHA 5CDGA 3A1NA 3HDHA 4BMNA 4XA8A 4BNVA 4RVDA 4MVJI 3IQDB 4IQGA 3T7CA 1NNUA 1N9GA 1K5HA 4BV8A 2AXQA 5GZ6A 1NWHA 3VKVA 3PIDA 5GZ3A 1I2ZA 3AW9A 2CF6A 2J6IA 4D46A 2YZ7A 3Q9UA 1A72A 5B4TA 4PFJA 3I9OA 4D3SA 1PS8A 2O3UA 3NRCA 4DLBA 1GEGA 5IG2A 4TWRA 5JC1A 3JSAA 2I67A 2NTVA 4M54A 3ZV6A 1UAGA 5L3ZA 2PY6A 2C7VA 2HLPA 3VH1A 1WDLA 3WLEA 3KYCA 4BNYA 5FI3A 2X0IA 4M89A 3NT5A 4EI2A 1CRWG 2HK8A 4OH1A 1R66A 2JJYA 1Q2XA 2D5AA 3DHYA 2VNSA 1DRUA 1PX0A 2R00C 1HRDA 1F14A 3PZRA 4NBWA 4ZQFA 1Q7BA 1U8FO 1PQPA 2OBNA 3IUSA 3WGIA 1HYHA 2HMWA 5BNTA 1E1LA 1T2EA 1CJCA 1B3RA 4NZ9A 2VOEA 2HJSA 1AN9A 1NR7A 1VJTA 4WKGA 4BNUA 3WIEA 2OGUA 2HMSA 3BMOA 4FCCA 2EGGA 4XRGA 1ENPA 1H6AA 1ONOA 4AJHA 4YCAA 3LC2O 3ZU2A 3ANMA 5L40A 4IDFA 1KVUA 3TZHA 4UUPA 5F21A 2E49A 3D3WA 2IYOA 1ZXLA 4DBZA 4LSMA 3D1LA 4GLOA 2EJWA 3INGA 1Y6JA 4ESOA 1DFHA 1P1IA 2A94A 2X0JA 3PLNA 3K2EA 2ZB7A 4Z9XA 4AL4A 4B7XA 3WICA 1DXYA 3EYWA 1EUZA 3UN1A 1HDGO 1MG5A 3DO5A 4IJVA 3TPCA 4R1TA 2C2YA 4PZEA 2VUTA 3TFOA 4IDAA 2NVBA 4RLSA 3FBGA 2CNBA 4Z3KA 4XQ9A 1YVEI 4XGKA 1F12A 1GQYA 3IS3A 4IJWA 3ZWOA 2VYVD 4RO0A 3ENKA 1PR9A 5A9SB 2HU2A 4PLPA 3U9LA 4BQRA 3E8XA 2C20A 2GLXA 2HCTA 1D8AA 2DTDA 3SXPA 3ZI0A 3ZV5A 4IXWA 1PZGA 1T2FA 1B8PA 3TFQA 1EFKA 2B35A 1LRLA 4BNMA 2GDZA 2E82A 3D64A 4CUZA 3D4NA 4EEXA 3JV7A 1YQXA 3EAGA 2X22A 1X7GA 4Q3NA 5L7YA 3F46A 1ZZEA 1PJ2A 4PZDA 1UXGA 5TNXA 5G4KA 5AXBA 4RPLA 4Z0HO 3WJ7A 4Q3EA 5JO9A 4DIFA 1XCBA 5I7FA 2FPGA 2YY7A 4CR8A 1LSSA 4AJIA 1PJ4A 2J5QA 3RCBA 4FOOA 4ONEA 3C1TA 4FDAA 3IKVA 3MCVA 4BO2A 3PXXA 1KVRA 3BHIA 3GMDA 2PR2A 3SC6A 2PKQP 4BO4A 3P19A 4EW6A 3I6QA 3QSGA 5JCXA 4E5YA 3U4CA 4RPJA 3W1VA 1D1TA 4TSKA 3WSVA 4PLGA 2NTJA 4J16A 4LVCA 4PLFA 4WPGA 3GNTA 3D4PA 4OKNA 2J5KA 2NU8A 4LMPA 1LSUA 3PDUA 4I9HA 1H9AA 3FPLA 4CQMD 4GQAA 1OMOA 3PHLA 5CHEA 4PRLA 2IYPA 3DZBA 1DIRA 3OQ1A 3GR6A 4OIMA 4ZJUA 1YB4A 2AEJA 3QV1A 2G76A 2C59A 3GVIA 1TA4A 3E82A 4RVGA 3ROMA 2O3QA 2Y68A 3A06A 2VTEA 1XR3A 4ID9A
chains in the Genus database with same CATH superfamily
3PV0A 1E1CB 1IHXA 1WCIB 5JJBA 3N7UA 3IBTA 4L76A 4L08A 4TN1A 1P7PA 5JQGA 1DX9A 3O2QB 1N9KA 3QYFA 1UFRA 3IBFA 5F33A 1HTTA 3L46A 2GBLA 2XWSA 2XVYA 2ZJ4A 3DC2A 1L4UA 3COWA 5BV2P 1P2UA 1KIFA 3TIXB 3I0MA 2ZIEA 3AUXA 1XE3A 2PJUA 4W4TA 1PK7A 1H2XA 2BFCA 4KQWA 4Q9IA 5CYOA 4E14A 2Z1DA 1EJ6A 1F8YA 4UNSA 3FUXA 3DVAB 4BO5A 4GXQA 2C1ZA 4O5OA 4UNPA 3I30X 4IS2A 2O2XA 5AVJA 4DNQA 5KOJA 5EA2A 1BFDA 1P2TA 5JS6A 1LX7A 4HN9A 4B6PA 4HDRA 2FGJA 4G3XA 1I94B 2NN3C 4CWAA 1D4FA 4BNXA 3H2BA 3CTMA 5AWFC 4WBNA 4GI7A 2M6LA 1UXHA 3OA0A 3UJ9A 1SHJA 4HWSA 1XZHA 3K09C 4JLNA 1AQIA 1C0KA 2JLQA 4A73A 2YJGA 5HQ3A 3N39C 1BDHA 1PNRA 1Y33E 3UUFA 4WWHA 1QNLA 3EISA 2XDQA 3RRBA 4E13A 3NEAA 4B3DA 1BE8A 5DN9A 1VSTA 2BEJA 2N1BA 1CHDA 1EK6A 1RP7A 4RPGA 3OIFA 3WB2A 3WWZA 4BTVA 3GAFA 3I3OA 2W98A 2LP4Y 1FDIA 1QIHA 2HMYB 2MJLA 4MP3A 4MYHA 3VR4H 5JD4A 3QKTA 2V1XA 4L5YA 2YOGA 5CH3A 3RDPA 2YXDA 4X6XA 5FLKA 4KPYA 3ZIAD 4F11A 4YXWD 2R8EA 3DLHA 3IT0A 4AVYA 2QTRA 5FPHA 1ZJWA 5KOYA 2VYND 3RUAA 2CBZA 3C1OA 4GXTA 3RU3A 5L40A 3W3AA 5CD1A 4AF7A 4W5QA 1MEOA 4PSAA 1RVV1 2OK8A 4B0PA 3W5SA 3M70A 3RVJA 3GD7A 1ZH0A 3EDMA 1WV0A 4YMUA 4GI3A 1WXQA 3DT6A 3E9EA 3U4IA 1GQFA 3O84A 4ZD6A 5BMOA 3H5TA 5LMCA 3G82C 2P2YA 4L85A 5BYJA 4F4FA 1XWFA 3H84A 2G5TA 1FQKA 3BD6A 3GAAA 4L5CA 2QUHA 5LZ5A 1TKRA 4C0QC 2ZWOA 3W9SA 2YHIB 4UOZA 3PF9A 2FSVC 3RYTC 3HB0A 3RPEA 4RDIA 1HZZC 3HLTA 4AC9A 4E30A 3SR4A 4Y6LA 3TLGA 1U2DC 3ASUA 1MABA 3R3YA 1I7QB 2GM9A 3VTFA 4I3FA 3RUIA 1SKYE 3ZDCA 2O20A 1XZCA 4PBSA 5FTKA 4LY9A 4YRIA 4YCNA 2O2YA 3LRPA 3OF5A 1V45E 1OT5A 3BCUA 4NMXB 3FNFA 4HTAA 5IDQA 6ADHA 1GDDA 3ABQB 3JQAB 3NBZC 4AURA 1R0YA 3T7TA 3ROFA 3ET5A 1ESMA 2WA2A 1C7RA 4BRUA 2Z2YA 1SZCA 1N2CE 2O0LA 4JYMA 3UHPA 4QTYA 1T9GR 2P6NA 3LOQA 4F86A 3ETNA 2PZKA 1W75A 2QTMA 1KSHA 2OC9A 3PRKE 2WPDA 4PS0A 1ZHOA 4BMXA 2QTHA 3B1WA 3K0FB 1A9XB 1MPTA 3QG1A 3TVYA 1K6JA 1RE0A 3UWMA 2JG3A 3AVPA 3LECA 4QEKA 2O1SA 3JWIA 3LLMA 2V0GA 2XD4A 4YREA 2Q2OA 2IHKA 1YFLA 1WPGA 4RHCA 4GP7A 5IMBA 3W6ZA 4C4OA 1V41E 3HJFA 4LNUA 4KTTE 4XVCA 3HCRA 3D6TB 1U8AA 4LC1A 3V2HA 3D7NA 4ALMA 3ZDQA 2O23A 3I1FA 4RKEA 2SKCA 2RARA 2WILA 1NPYA 5CT4A 2QN3A 1EK2A 1NBME 1R9MA 2ID7A 3HKDA 4ZQIA 2Q27A 2P1RA 3DEYX 3E18A 4PRYA 2A67A 4AF8A 3ZHSA 4OM7A 3BSYA 1GPLA 4EJ0A 2BFFA 3KDAA 5DRYA 5EIBC 4YUXA 1GPDG 5EXTA 2W6IA 4YCLA 4IQ4A 3B12A 4OQ4A 4K81B 2CE2X 4ZXPA 5A9RA 4IIJF 1S8FA 2IS6A 1EGVB 3K6RA 4AO8A 1QONA 5EWLA 1SQSA 1L8OA 5JDCC 5KDDA 2YW2A 1J0DA 1WEKA 5A0TA 4MRRA 2RGYA 3DW1X 2G9RA 3AUTA 1URPA 2MIIA 3RYHB 2XWQA 3IL2A 3U49A 2VP5A 3GRAA 1C1HA 5AJUA 2VDOB 2AZXA 3C0KA 4LISA 4X7MA 2G83A 2X5KO 3D8RA 4Z99A 3UAGA 4LRYA 4ZVUA 2BKVA 2QVCA 3P2OA 4FFBA 3RIEA 3FPEA 4Y2VA 2ZULA 2RGAA 1J0BA 3DBVO 4M1OA 1P77A 2Q5EA 3L1KA 4M36A 4EY3A 2RD2A 3I73A 1II0A 1T4DA 2QN2A 1H4QA 1EA7A 1KIMA 3TW6A 3EZ6A 5DF1A 2BEWA 2HHLA 1L3IA 4ZYZA 2RDMA 4WL0A 2V96A 1M5TA 1N25A 1V8DA 2VG8A 4HBGA 4K7JA 5CNKA 1ODCA 3B3AA 1HT3A 4YMIA 4BDSA 2FPSA 4EJSA 3AEKA 3D3WB 4RTRA 4CTJA 2BDEA 6PFKA 2A1UA 5KYXA 4L5IA 2QMQA 3V3KA 3D4BA 2C42A 2BTOA 1W2HA 5BSKA 4FP9A 5A0VA 3R4VA 1IVYA 2O5CA 4YAUA 4OP1A 3OOWA 9ATCA 1BJKA 4XWTA 4M0KA 2P69A 4NS4A 2AFIE 1QF6A 3FYUA 2X0DA 3CVYA 4WJZA 1XVIA 3L7CA 4QDXA 4RESA 4X8LA 1SOUA 2ZATA 1HYEA 2VZ0A 1THMA 2JFXA 1YRBA 3P9KA 4B3CA 1B8VA 1AZLA 1AZWA 3RRZA 5HKAA 1DCTA 1R3UA 1Z34A 2P68A 3KTFA 3PXBA 4H2DA 2AR7A 3LVBA 4CUKA 5JALA 2CFSA 1EJ2A 4N4AA 1W7AA 5CX1A 1CFZA 3PEVA 3MMZA 1V2GA 2LV8A 3TBKA 3QVSA 4DR7B 1IRIA 3Q0EA 1YA4A 2P8SA 2E4WA 2V6JA 2KLHA 1OWPA 3TLKA 2QTLA 4DE5A 4OI0A 2GAIA 1CNFA 2V3WA 2XTMA 1N1MA 2WMDA 3BH7A 3A6PC 1VB5A 1RRVA 1V11B 5CM2Z 2CYAA 1M67A 2GTPA 2YRXA 1OFGA 2UYHA 2GN2A 2IHZA 5E1BA 1QCCA 1E5VA 2A35A 3OVMA 4R01A 3CNLA 2I4TA 1N0UA 3KPWA 2D74A 2I8LA 3PENA 4LY3A 3K16A 4QBGB 3NNDA 5FL7A 3G7NA 4YMSA 3K8OE 5AVKA 4JD5A 2ZR0A 5AW2A 1C7FA 3HXPA 4JJ4A 1JSRA 4GOXA 4YP6A 3FLEA 5A6SB 4NBUA 1S2GA 1LPAB 1PFUA 2P65A 3NBYC 5KSWB 1XTTA 1WWKA 2RC6A 3E27A 3CKKA 3GEBA 2EKPA 2O1WA 5IXSA 2YVUA 3HMKA 3IDQA 4QPNA 2GJAA 2PD6A 1TQ6A 3KOZA 4ANFA 1RQLA 1R5BA 2HDOA 2JGDB 1JE0A 1YI1A 2ZROA 4BYGA 1KO5A 2Q4EA 3K15A 1QB7A 2GEJA 3ICVA 3N7AA 3EMKA 2C1EA 2VPPA 3WWYA 1CLEA 4JLSA 4ND7A 2PUFA 1NV9A 2Q3LA 2OFFA 4RYLA 2R7KA 1RHMA 1NATA 4LYJA 4GZMA 3RUDA 3W8NA 1KPIA 1RNLA 3QLJA 4YJ3F 1DZIA 3JPWA 3C4VA 4B7UA 5KTMA 4TZ6A 4FS3A 2CD7A 4QOJA 5DK4A 1ZD8A 3HZOA 3MERA 2X5XA 2ZBEA 1X13A 1PEYA 1QWSA 5IYZF 2G5CA 2GT1A 4YCSA 2EFHB 2X7XA 4LZPA 4XQCA 1DT3A 1SRRA 5K05A 3WE7A 3PJRA 2YOFA 4OQEA 4XOUA 4E1BA 5K0GA 2XDWA 4O4HA 2G07A 2C5GA 4KYTA 4TUYB 3TYXA 4DDHA 3FPJA 3V6LA 2NO1A 1TAUA 3BXEA 2SECE 4DIEA 1G5RA 1THZA 3AUYA 1OXTA 4L9WA 4OQFA 2QR2A 1N6IA 1OIWA 2R1TB 1E2KA 2O52A 1AV7A 1YA8A 3N2KB 4C7KA 3KYJB 1RPAA 2FE1A 3LY8A 5E4FA 5AJZA 3RWMB 1T5OA 4QBIA 1QU3A 3EW7A 2ZUEA 1USKA 1Y4ZA 4BJ1A 5J58A 2GXAA 4E4YA 3UMGA 2YWXA 5SYMA 4FMBB 3FWYA 3I9LA 4G36A 4WBSA 5HIJA 3A4VA 1XELA 5JQGB 2IOYA 4FSHA 1QGAA 1YR7A 2WIDA 3GQBA 1KYZA 1QP0A 1PVOA 1C9EA 1QIKA 4TKLA 1LLQA 1SBNE 5K8TA 4R7GA 4GYWA 3B6MA 5D5PA 5DV9A 3SFZA 4JGIA 4G1BA 1K3TA 4XVRA 3ELYA 4Y6PA 1VYHA 1E2HA 2MSLA 3I5XA 3OPQA 4W63A 3VZQA 2N47A 3FF4A 1XPRA 4R2LA 3DH0A 2XWBF 1W8IA 4P4TA 1SCNE 2D1YA 3VR6H 1RZRA 2O54A 1ZGJA 3ISTA 5B57C 4CIBA 4LHSA 3CRNA 3KKQA 1E9BA 5KS2A 1TIKA 3I04A 1K2VN 2GK6A 2XUKA 2I91A 1P0FA 4RCYA 3U09A 3LY7A 4BECA 2ZBUA 4JL8A 1J2JA 4TM8A 4P36A 3OU2A 3PGMA 2HIMA 1FRNA 2R3SA 4FW9A 2P9CA 2IXTA 4HDRB 4I4IA 4W9NA 5HK8A 3THXA 2EXXA 4W5JA 5HGJA 4ZGBA 3BK2A 3EWNA 1Y9DA 2D13A 2XR1A 2YWFA 4HGYA 5EUQB 1S7CA 3TD6A 4AJ9A 4WBNB 5HIAA 1Y6QA 3IAHA 3D8UA 3QU7A 1FNDA 1N1DA 1QX3A 1RKVA 1CKEA 1ORRA 5HQ3B 3J81A 1PU2A 2Q3JA 1TCBA 1QHSA 4UEWA 3ZXIA 2O2GA 4E3ZA 2G1JA 2R8ZA 4F96A 1U7HA 1OXXK 3EZ2A 5AVRA 2XDQB 3ZE1B 1VRWA 4PYLA 2ZSEA 1AO0A 4JXXA 4O1HA 1DWQA 1PL8A 2H9IA 4R7TA 3EZ7A 2R62A 4J0JA 3BDVA 1ZS9A 4B8YA 4NTZA 1G8GA 5T41A 4ETWA 5LWHA 2CXOA 3X44A 4P4LA 4LQCA 1Z08A 1V6AA 2XRFA 1M6HA 3HA3A 4LF6B 1VPEA 2FJ0A 2IU6A 3SP1A 2HCBA 4BWGA 4ISCA 4LJYA 1L4LA 3TRJA 4IS3A 1EINA 3B3QA 1A5TA 3TB4A 4NNOA 3STTA 5LNK1 3CB4A 4DUGD 3R9XA 4OLJA 4MW2A 2R25B 3HQ4O 1CDEA 4C7OB 2V5UA 1KXZA 5EJAA 1PNVA 3FI0A 2PKXA 1HEYA 3WL4A 2F17A 1F9EA 5LNK6 3E9NA 4LJSA 2J7PD 4RMHA 2XCIA 4X0EA 2CNLA 2YHSA 2XZPA 1E7WA 4PWYA 3KBBA 3IHLA 2UUBB 1JAYA 5CEJA 2QTCA 1N32B 4AU1A 3RGGA 1U2ZA 2C00A 3OG9A 4MLPA 3L7OA 3L40A 3LU1A 2YJTD 1DBRA 3KTOA 3TAXA 3TLGB 5JVDF 2NU7A 5FUXA 3A36A 2O5EA 2B1IA 1NHWA 2PBZA 2WWIA 3KZXA 2ATCA 4BASA 4KBGA 1X7YA 1Y1PA 4R1LA 1FX0B 4ZDIA 3TNJA 4PG6A 3AVOA 1PT8A 2NYVA 4I55A 3N6XA 4E4TA 1YKFA 4QFDA 3GCXA 3VVLA 1JSZA 4MKIA 3ND9A 4DC1A 2XMGA 4TL9A 4E12A 2XT9A 5LDGA 2C3MA 3QX8A 1NASA 4R05A 1USVA 4YI3A 2RK3A 5I3CA 2YMMA 3KKZA 4OPMA 2EF0A 4Y2PA 3LHFA 2PSFA 4XWKA 2DF8A 2P4UA 3MWJA 3L07A 4K1LA 3ZV7A 2CYCA 4PG5A 3DLIA 3AYXB 1XRPA 4B35A 3V2IA 5JEEA 1MC4A 4JBYA 1UBCA 3E0QA 4GKBA 4RTLA 4RD4A 5IULC 1JZTA 1YRWA 4M7PA 5JXWA 1UBMS 3LD9A 2NZJA 3HMQA 3WBBA 1E2QA 1FPQA 3I6YA 3BDAA 4HBZA 1OY1A 4QTXA 2Q6OA 2VNHA 3CLVA 3RJMA 2HRBA 1Z12A 3SD7A 5FBZA 1MGOA 3A6GA 1PR6A 1SCUB 3C5HA 2C4HA 3FKSA 3PYXA 1VTKA 2H00A 5C8YA 3F2VA 1OLOA 2BZ0A 2ZU6A 2R87A 3LUAA 2AEMA 2AA3A 1UWCA 1YDMA 3D2CA 1KI6B 3EYAA 4M0MA 2PUCA 3KLMX 1JG6A 1XZ8A 3A3KA 2P4EA 2R6CA 2QAIA 2VDLB 3C16C 3AR9A 3ZCXA 3VPGA 1U9YA 3KU1A 3UXYA 5ADUS 4ASUD 4HLCA 4GE3A 1P19A 4WHMA 3LDHA 3U56A 3ERCA 3AFHA 3VR5D 4KXWA 4CG3A 2DLCX 4MP8A 4R5HA 3FGNA 3ZHVA 3A6ZA 3IA7A 3Q9LA 3WOHA 4OEHA 5DM1A 1TMOA 5EWLB 1OFUX 4KAFA 4EF6A 5IT5A 5KSOA 4YJGA 3WQRA 1LBHA 1G7CA 1I01A 1RM0A 1X8JA 4MMZB 5CFPA 2IZZA 4H4DA 5BOVA 2V65A 2AOXA 1OVGA 4DIKA 3MCAA 4Q16A 4ZODA 2J5XA 2Q4OA 4ID9A 3FTFA 1PR3A 3DOUA 1P9OA 3E7PA 3OLXA 1G38A 3PC3A 4GSLA 1SVUA 2ATVA 1EHCA 1WMEA 2ZBDA 3LAWA 3RIYA 1VG1A 4O4JB 2I2BA 2OEPA 4YRMA 1ZH8A 1II8A 5IF3A 4J6FA 3E23A 2SHKA 3FIUA 4DSTA 3EPJA 3R8XA 2CHGA 1TFUA 4FNGA 1WJGA 4KGZA 1HFJA 1FYVA 2PT9A 4IF6A 1JMYA 2BEWB 5I48A 2OP0A 2UYYA 1W9MA 2E1PA 4P6VF 2X6RA 1UJ2A 2FWBA 4QQ8A 3T1OA 4EJSB 4FQ8A 2IH4A 2XNDA 4OAOA 3L84A 5JYCA 1B8OA 4X8OA 1G3QA 1H93A 2NSLA 2O8DB 2WNIA 3GXOA 4N8SA 1KTIA 2PH3A 1NXTA 3ED5A 1TJYA 3G9XA 4KH1A 4NDAA 5CCBA 2SCUA 3T7EA 2ZIUB 5CIYA 1GFZA 3BFXA 2X8AA 2GCGA 3FYUB 2Q6IA 3EGCA 3K96A 1GU1A 3ILHA 3BERA 5INTA 2VP0A 2B25A 4GGPA 1PZXA 2XMDA 4JVSB 1VJ0A 3C48A 4MLCA 4J3JA 3T9AA 1OXMA 3Q3CA 5EXXA 1GV1A 2WE8A 1EXMA 1FFGA 3FWNA 2RBGA 1YZFA 4FLMA 4D4IA 2MSDB 4EUNA 5DGTA 4RABA 4L07A 5CXUA 2CCKA 3KO8A 1LSOA 1LJLA 4QG3A 5AH0A 5DHTA 1OF1A 2XQKA 4CM4A 3HLKA 4TYNA 3BMCA 10MHA 3OX1A 4H6XA 5LQDA 3KJGA 4OUDB 1M83A 4RAQA 4CFYA 4EMUA 1C8KA 1RWBA 2C9ZA 4QVGA 1KOJA 5CFRA 3KOMA 1NY6A 1ULHA 2Z5GA 4LW8A 4BNGA 3ZTYA 3DMPA 3RVRA 3VGJA 4E22A 1BA3A 4DMMA 5ECYA 1PV4A 2WHYA 1YRLA 2J8ZA 5K0SA 5H0IA 4EUKA 5BUSA 1PLJA 2KWIA 4AWXA 4BRWA 3K73O 4YRPA 1N8NA 4HYEA 1JI3A 4BVJA 2OAP1 2OV1A 1UZUA 4AIIA 3JTEA 1WD5A 5C1BA 4XIFA 1QZXA 1NJFA 4EG8A 5AVOA 2ZI4A 1K8RA 5AKYA 3S81A 2WOJA 4ERXA 1YZVA 4IWYA 2R96A 4E09A 1WMSA 1XTKA 4HGNA 2WU4A 4E08A 4I2NA 3U3ZA 5JY1A 4KKXB 1SWVA 2R4QA 3QFHA 1ZEMA 2I2WA 4Q24A 1WVGA 3WGNA 4BGVA 1C7ZA 1E9VA 4KPFC 5BUCA 1L7QA 1SXIA 3ZD9A 5C32A 3K09A 4FE3A 1EGHA 1T6NA 3RKRA 2VK4A 5H83A 1R5OA 2B8NA 2FWMX 4YRDA 4BE9A 4Z9FA 4MA4A 2Y1WA 1U0LA 2OOSA 1E63A 4YCJA 2D00A 3A1VA 2ONYA 4EHLA 1QV6A 4O4HB 3JASA 5EVJA 1QVVA 3EQ6A 3FCCA 1G6KA 1UM8A 2O8NA 4RZ3A 1D7AA 1IB6A 4D8UA 1NPDA 1GNTA 2C83A 3TIGA 3RR2A 2NAFA 5DTQA 3O9MA 3JD2A 1MAAA 1ZFNA 2ZXUA 3NBKA 5B1SA 1PG0A 5LP1A 4CM1A 2Q07A 2PVSA 4W8GA 3JU3A 1YGPA 2J6BA 5K3SA 1I7PA 2F1HA 3FNRA 3ZHBA 1WA5A 2BM8A 4DNFA 4NMMA 4ZI7A 1YCDA 1FCJA 2JI9A 2BI7A 3EXEA 1G3UA 3FPSA 4HWOA 4DN6A 3S68A 2GQ0A 2ZSDA 1JAXA 4JBIA 5KNDA 3SJZA 1F51E 2C4VA 3GQBB 2X3FA 5JDIA 3B7PA 3BE8A 3DZHA 2XMRA 3GLGE 1OTHA 1K6EA 3B60A 5KAMA 3ACBA 5H3LA 3LP5A 1LTQA 4L0CA 1NT2A 3VMFA 5B6IA 5BWBA 5J63A 1Q6YA 3W1EA 1Y7LA 3G0DA 2JZOA 5DCUA 4MUAA 1WXFA 3O3MB 2J9FA 2NO9A 1G2PA 1UBFA 3KQOA 3OIUA 1R0XA 4HWTA 4WADA 4XJSA 5H9VA 1OBHA 4NAVA 3KFVA 1EESA 1NVTA 1XTVA 1IL0A 4FMCF 4U02A 1T0IA 3QHQA 1XNHA 4W6ZA 2P2ZA 5HUQA 1C3OA 4JJZA 1CUJA 1HZZA 2QMEA 4Q4LA 3U3OA 3WWCA 2BBSA 4EHJA 1QFMA 1U2DA 2DECA 5KNCA 5ILOA 4M7OA 3FFAA 3QEMA 4JR0A 4YRJA 4B3FX 1U7TA 1WBJB 2PE5A 2B2XA 3THXB 3RTAA 1PR1A 3LSTA 3N5CA 5FTNA 1Q83A 1T4CB 1YQ9A 2Q9CA 1OIXA 1QG2A 3VHQA 5KBYA 1E6UA 3COPA 3F6PA 1E5LA 4LDJA 3URKA 2NSDA 5AMXA 2HTFA 3N2GA 1GTL1 2IV3A 2ALJA 3GMTA 2NVUA 4OYHA 2QOEA 4RC9A 4K26A 2QUBA 4H3HB 1EIZA 2GYVA 1DC8A 1U04A 1X14A 1E4OA 1HDCA 2ZI7A 4MUGA 3UKDA 1XMOB 1JU3A 4X9XA 5FUVA 4Q3KA 4QPDA 1AA6A 3AZQA 1KXJA 1Z37A 1PZFA 1SHZA 1SUFA 2IE8A 2WSSA 3IIIA 2QD3A 2CWWA 4Y2SA 3I42A 4C4TA 5JAZA 1EUCA 4DIMA 2CXUA 1BWRA 2WHXA 1FL9A 3GD5A 1ZJZA 5KYKA 4J4TA 4OK3A 1D4AA 4YRTA 5G3ZA 3ADDA 1Z35A 1RYBA 3VTKA 4RFLA 5TPZD 2HX1A 1ZCBA 3PEUA 4WV3A 3HNPA 3SM3A 1ZHFA 1A8UA 4C03A 2H57A 4YJHB 3OMXA 3S40A 1RBMA 3GRCA 1PUJA 2FLWA 2QZSA 3GA0A 4M49A 4RJJA 5C4GB 5TQ2A 3R7NA 4BNDA 4F56A 5ICGA 2Z4RA 2ZJBA 1UQRA 1R27A 2OLEA 3R9IA 3N8IA 4Q3LA 2ZYUX 4YJDA 4F1KA 2PGIA 4GM4A 3KLNA 3AL0C 2NP7A 1NXVA 1GTVA 2I87A 4JX9A 4K6GA 4OD0A 1KBZA 1TUEA 4RK1A 5L6MB 3Q8KA 2FF7A 3KE9A 1ZGAA 4WKPA 4GPBA 3SKVA 3FBWA 3QXXA 3GBVA 4TZTA 3DTTA 5LQSA 3V7YA 7AT1A 2NUAA 3N2LA 3DLPX 3M3PA 1RJWA 5CPFA 1QH8B 1ZN2A 2GS9A 2ZJ3A 3QOYA 4TLBA 3D7RA 1U4NA 2ZIGA 1RAAA 1MO5A 2HIHA 1GFWA 4RZXA 5AW0A 4PPYA 2OCYC 3VQTA 3RYCB 4P7JA 2UYOA 1X7YB 4Q3DA 4UAVA 4DPMA 5GINE 4X66B 3DYIA 2YHUA 4I55B 5LZ4A 2HIGA 1OLXA 1ATIA 2HMAA 2QVBA 3B53X 3PGXA 3C1UA 1U2SA 4C4RA 1CYEA 1SMKA 2WWFA 4MR8A 1SU4A 4CKYA 5BVGA 1VJRA 4D44A 2Q0QA 3IH5A 3VAAA 1Z6AA 5EJFA 4P1ZA 1VJGA 3B1XA 5EHGA 3GDFA 5BT9A 3RF6A 4DA8A 4F2DA 1EGMB 1JEDA 1DRWA 1UT6A 3O8QB 2YN0A 3DMGA 4MV0A 2IYTA 4G0UA 4I1OA 3A2KA 1H2HA 3F78A 4AS3A 3F5SA 3Q40A 3ENQA 3U3JA 2FQWA 3C3DA 1XNGA 3C3YA 1MH9A 1YTLA 3EPRA 4MVJG 5HBRA 1LI5A 1TM1E 3F5DA 4B83A 4EF5A 3N28A 2AJDA 1A8QA 2AFHA 2NGRA 1A9PA 4WH0A 5JZSA 5F1PA 1P7WA 1NULA 2VUSA 3DOCA 4ROTA 1T1GA 4GM0A 3SQXA 4MVXA 1Y3IA 2ZIVB 3HRHA 2YBDA 3FCXA 3MMNA 4NECA 3JQGB 5A4AA 4L0MA 3RJTA 1E94E 4KJZA 4F84A 4MI6A 1GGFA 2G4CA 1EWKA 4JEHA 2H1FA 4L27A 3TQOA 3LHSA 3R5KA 1UANA 4PC1A 3IAS1 1QHNA 3UYKA 1YVDA 1K6IA 3EASA 3Q3EA 1QAOA 3H9UA 4AYTA 3AC0A 4QOSA 4XB1A 2BBOA 2P0EA 1H2BA 2PX0A 1I51A 3HWWA 3EF3A 3H1PA 3PUXA 1LS6A 3STHA 3VJRA 1YSCA 2HC9A 5DHAA 2J3JA 3GJTA 1L5HA 5FHRA 5LM3A 1LX6A 3GDGA 3D8BA 3ENZA 3IAS6 2BBTA 2FXIA 4L3VA 2AE1A 3ZHQA 1YRQA 2IC5A 3GT0A 3ZLJA 1K6MA 1EX6A 4BEVA 1NFQA 3KB2A 3O3NB 4MROA 5SY9A 3JARA 3MJTA 1LLCA 3LX6A 4BQIA 5AOCA 2HSDA 3VH3A 2YDYA 5KWVA 2BE9A 1U1DA 4FJ1A 2JI4A 3HCEA 2LD4A 4YAGA 1Q21A 4N49A 3RH0A 1CZHA 1HG0A 1AG9A 2PQ2A 4K6CA 5E6RB 3WHIA 1IXRC 2G0TA 2VI5A 4C2BA 1RAEA 1PGJA 3F7MA 2P5UA 1EGAA 3NORA 5JECA 3RSHA 1XD2A 2BMAA 1LPNA 2HRCA 2VUUA 3CJQA 3L0BA 4JJEA 2BCJQ 5CM8B 4UPDA 3PRHA 3LQ2A 3VOBA 4G89A 2YXBA 3M89A 4MTCA 3SKYA 3HXLA 4YY3B 1II9A 1Y1LA 5DDIP 4KWIA 4YAEA 4I8IA 1R8XA 1GUDA 1T1IA 4K8OA 4XQGA 2UKDA 3N74A 3QHAA 1UZNA 4ZOCA 4G5XA 5IZCC 5EY5B 1V43A 3U7EB 4BEWA 4HVLA 4ZI5A 4HDQB 4QHYA 5K01A 3IUPA 4IRUB 5GTDA 1MJFA 3FZGA 3SSOA 2QPOA 1WP4A 2EKQA 3PCRB 5TQVA 1KJWA 5JJCA 2BHNA 4GZLA 5K4GA 1B8NA 4R51A 1W0JA 5EGNA 2BZGA 3I01A 5EG5A 3P2MA 1JN0A 4P4SB 4EHAA 1DUIA 4BKUA 3R23A 4CF7A 1TM3E 3SIPA 3SS8A 1QUFA 5HRCA 1T24A 5DEOA 3BZBA 1O95C 2A3RA 3AOEC 4Q4AA 1C1DB 2I7XA 2P75A 1N5LA 5ALLA 2EP7A 3UMVA 1M75A 3AUSA 1LNZA 4M38A 4AUNA 1OZGA 3UAXA 4KQMA 4OQQA 5K9ZA 3ZDZB 1JJFA 1X80B 3ZE2B 2Z3VA 4LSWA 1JAZA 1U02A 2WAAA 3ESXA 4RFSB 3PC2A 5MN6A 5KVQA 2QYHA 1YL7A 3HB4X 3RVDA 2JGJA 3PUJA 2B5VA 3A7DA 1OCEA 1VCIA 2X40A 3GUHA 3SU8A 4XDYA 2C2WA 1MVLA 1N9ZA 4X6UA 3CSSA 5F78A 2CYBA 1RM3A 1XKTA 3O47A 2XXBA 1DAGA 4GYJA 3IOMA 5ES3A 3RKUA 1A95A 5CVUA 3SZGA 8AT1A 4R8KA 2CL7X 4XR9A 2Z8XA 1YGYA 3LX8A 3MTJA 5AK0A 5KJ6A 1EFTA 4ZYVA 3S8YA 1L4KA 1U8CB 2VP9A 3AQ4A 3JY6A 4FHZA 3ZU5A 4AWAA 2O0MA 2D8AA 2I2DA 4DIOA 2ZXEA 2JLCA 4TX1A 2PX2A 4BB5A 2XSZA 3C3AA 4DSNA 1VSBA 3RHTA 3OAAA 3LUBA 4CT5A 3BCHA 1JDJA 2OG1A 4UU0A 5JADA 3T3EA 3AT1A 4DA9A 1B00A 2ATEA 3M6AA 2VF7A 2QMUA 6LDHA 4AP6A 3TZCA 1EFRA 2BVNA 4IV0A 2XOXA 3LQFA 3QI7A 3JASB 2HCRA 4NARA 4OHBA 4R5MA 5L4SA 5KQPA 4FFMA 2BM0A 1RXSA 1AB6A 1GPUA 2R6ZA 3CJTA 4PTYA 2EFCB 5KHOC 2E5FA 3R3HA 4H1VA 4RWZA 4XM1A 5GJBA 1YOVA 2VQFB 3LC7O 2B6NA 2FPPB 3A9SA 5BPFA 4MUEA 4NEGA 1E96A 4D3FA 2BGKA 1SA0A 3ROKA 1XXHB 4EIWA 1BVHA 1NY5A 1UQUA 4QGBA 3UZUA 1QP7A 4H7DA 2QX6A 2LR0A 2Y0CA 1RYZA 4LYEA 1DBVO 4BNNA 4ZI7B 3FTQA 3HJRA 3GFOA 4WKBA 3D6FA 1CF4A 4IBOA 1HRKA 2V4MA 4MW5A 3PT5A 8ADHA 1YJ8A 4LZWA 3OCJA 1MA0A 3G1TA 5ALQA 4Z7OB 3IEVA 1E59A 3UWOA 5DHUA 4PGAA 3RUEA 4E5PA 3REQB 3UJNA 3SVZA 4DYHA 2I2CA 1TD1A 2IYAA 2WUVA 3PNKA 3IFSA 4G25A 2OO3A 4JLKA 1UPUA 3WLFA 2NYUA 2UAGA 4P3NA 3AGQA 3IHTA 4Q7KA 3V8EA 1QZ3A 4S2EA 2OCXA 2DBZA 3JYLA 1UBJS 4ZJZA 4H7HA 2OGWA 5ALEA 3RBXA 1EB9A 1A27A 5DXJA 2WY2D 4X60A 2QORA 2ZTLA 4GL4A 1ELOA 2OZPA 2P3LA 3G5LA 2J48A 3ANYB 4V0NA 3HVHA 5GY7A 3P96A 4AD8A 4CJXA 3IALA 4EB6B 2PZFA 2ZRAA 2C9CA 4J2HA 2WG0A 3P7MA 4JB2A 1PWEA 4U2BA 1ZIYA 2HXYA 2X8LA 1SBYA 4FKZA 4P2GA 5C8ZA 5JAOA 5IS2A 4EOGA 1Y1SA 3GJ3A 1AC5A 4Q1AA 4D5EA 3D8TA 4BLQA 3D6JA 1XQ6A 4H6PA 3O2NA 1BW9A 3CNEA 3N2GB 1X7WB 1VB3A 2XHZA 3AY0A 4WERA 2NZ8A 1SUDA 5BT8A 4HD8A 3IVAA 1QKIA 1JQDA 2GYYA 2J59A 1UM9A 1UMKA 3AJ9A 2VF4X 3MTQA 3O7WA 1BJTA 3LHDA 4ITUA 2HHJA 5AM4A 5JZ9A 2VXYA 3UBTA 2BE7A 3GRPA 1GLNA 3QOXA 5CLIA 5K3FA 3T35A 1PRYA 2WM8A 7REQA 2E4AA 2JANA 4LZZA 3ZV3A 3TB6A 3NH9A 3SOZA 3ZD7A 2OORC 2V45A 1P2DA 4PZCA 4BRSA 4E03A 1RWVA 3K53A 3CISA 3N8DA 3KJEA 3PUVA 4W7HA 5TT1A 4BUJA 4CF5A 4ZZ0A 1JECA 2JLUA 3IKLA 1WW2A 1MKYA 4HATA 5IAJA 1E7YA 1UK7A 1M3SA 3ADCA 1P0MA 3OFNA 2ZBFA 4M1ZA 1W48A 1MFZA 2G72A 1J5PA 2ZJ8A 2R84A 5K8LA 2OPBA 4QL3A 1CUWA 1RQNA 4I1YA 3H9BA 4R2WA 2BFBB 1XCJA 3E8MA 4BNDB 1I24A 2SKEA 5L8VA 2BGWA 4O6VA 2H4FA 2P78A 4RM3A 1CYDA 1WAMA 3GFSA 3STVA 2V58A 3BWMA 1EQ2A 3PFIA 4WGGA 2UZ1A 3KR0A 2YZNA 4GE0A 1N6LA 3AVQA 4DLKA 4AKTA 1QDLB 3G2NA 2CFRA 3O95A 4UHKA 4RZIA 5LDHA 2RGNC 2NUAB 1Q20A 4FHCA 1OHHA 1YJXA 5JNLA 1Q2UA 3CNHA 3HABA 3LKDA 1JQKA 4TZKA 5JXHA 1KMIY 5LDDC 3NHZA 4F4HA 2AIRA 2EGUA 4JI0B 3RC7A 1PFYA 1TCUA 2LGJA 4CLEA 2RGXA 2Y0PA 3VPXA 1FF9A 4FJ0A 3WNCA 2CD9A 4P82A 4C6TA 1ZJYA 4ZDJA 2EBFX 1WE2A 1XEFA 1OLXB 2XEDA 3TEFA 4URHA 1UC4B 2FW7A 3OTQA 4O08A 4E94A 1XG5A 3IMFA 1SCKA 2GN9A 1QZZA 4B3HA 3BUSA 2WJPA 4MR8B 5A05A 1JFFB 2XTAA 4TMXA 3HKEB 1J07A 2VSOA 3QLUA 4TQUS 5KO2A 1EGQA 2N46A 1W96A 2QRVA 2B61A 3FNHA 4OSOA 4AQDA 2G36A 1SU8A 1BQ3A 3FROA 4MS4A 1CUZA 2QLBA 5AUPB 5JLJA 3R7WB 1P2GA 2PMBA 4A8JC 2W7TA 2Z2JA 1P5RA 4TYMA 1K92A 4ZI2A 2ZUSA 3EFEA 1JHVA 3K1TA 2AFHB 3MT7A 5CGQB 4XUCA 4NPCA 1BCRB 1SOWA 1PG2A 2QRZA 4HQLA 4WINA 1J23A 4GGOA 4QYXA 1KJIA 1T35A 1ESEA 1S8AA 1GL9B 2JIOA 3BEOA 4X5OA 1Q95A 5FPQA 3ZCUA 3B7GA 5D1HA 2AJTA 4YACA 4JQYA 4XD7D 5HVNA 1Z45A 3ENNA 3FFXA 1JG1A 1SKMA 5J2UF 2Q99A 3DLAA 1NF8A 2QTVB 1L7MA 2X5NA 1Z15A 1EQAA 4L95C 4RENA 2FPMA 3IELA 3RLFA 1A0OA 4J0HA 3ER8A 3EBPA 5F5XA 4Y6GB 3CA8A 4TQAA 1J8FA 3C6BA 1IM5A 1ISGA 2JIDA 2NT4A 1JBQA 3LA8A 4Z1MD 1WVIA 2XNJA 1CR0A 1V48A 4U0KA 5GONB 3CLRC 4GMGA 9LDBA 3X2EA 1JG4A 4NL4H 4U63A 1TM2A 2PUWA 3TBHA 5C3UA 1ZA1A 1N34B 4ICIA 3LVFO 3PXGA 4K3UA 2J1LA 4D9IA 1O8CA 3JARB 1G9TA 4JLAA 1A2OA 3DGFC 4JOQA 3UMCA 4QM6A 1F2VA 3EN0A 4OOFA 3W5DA 2JBHA 1FP7A 5FNVB 5CDFE 3AM4A 3UHFA 1ST2A 3PX7A 4NR0A 4QPZA 3EGIA 1Y6FA 1XKQA 2NOAA 3C15C 3UG6A 4QEZA 3OZXA 3DGEC 5AOVA 4A16A 2VHWA 5JISA 3D59A 2P35A 5HE8A 3WRXC 5M2QA 1E3LA 5KZMB 5DBIA 1Z8DA 1RKXA 2XCUA 3C3KA 1H2FA 3QW4B 4LVNA 4D4LA 2ZSIA 2QY9A 4WXHA 4ZQCB 1SOVA 2O8CA 2VDPB 2YN2A 1GPMA 1J2UA 2VNIA 3H6HA 1G291 1H2AS 2VCEA 3H5IA 4N5NA 2C0CA 3WB9A 4UEJA 5JRJA 1F3LA 3ZDBA 2Z43A 4B3GA 2HDHA 4MA5A 1NN0A 4RHXA 4MJ7A 1FFDA 3D43A 1EBBA 3T5PA 2FZWA 2WJJA 4TTJA 2HHCA 3NX4A 1OKKA 3H3JA 2FB9A 4I1VA 4YO8A 3AVVA 2Q5FA 4IUBS 3IVCA 2PSSA 2XRYA 1QGUB 1WX1A 1RJGA 4D9HA 3CF0A 5J4HA 3TEMA 3MCWA 3OCYA 5AKKA 5A4JA 4DIDA 3KEFA 4AZ3B 1QRDA 2BL4A 4BNKA 1W6UA 2EGHA 2ZPUA 3DE0X 3H7AA 1P81A 4ESVA 2KB0A 2ZWMA 4Q4AB 5LJIA 1HUQA 4A6PA 3TIFA 3OZSA 4X7BA 1I8TA 3DOJA 4LE0A 2CUTA 1G63A 4G65A 4ARAA 3E35A 4ZYXA 5IJWA 4D41A 3P71T 4QASA 1CJSA 1E2UA 4HWKA 2IYSA 5DKFA 1HFEL 3TQCA 5IASA 2HU8A 1R0ZA 1GHTA 2QP9X 3FFBA 13PKA 1AKRA 4M22A 4QYMA 3PNYA 4G2NA 2VDJA 4QXQA 3X43A 3UMMA 1F48A 2RH5A 3I8OA 1FUYB 1KJNA 2Q1YA 2CEAA 3Q72A 4REOA 1ABEA 3GXBA 4RY9A 5DCLA 2HO4A 1GWNA 2XW6A 3HU2A 1AGXA 4X00A 1O94A 5E95A 2Z58A 5CVJA 1JSLA 1ZISA 4EHFA 1GN9A 4XR4A 2XUQA 3LI2A 3N59A 4ZAYA 3U0BA 3Q87B 1BU5A 2OO7A 1BRMA 1SC3A 1Z6TA 3K9GA 1OROA 4LY6A 3TLAA 1JP7A 3WGLA 4CE6A 4EYSA 1NA5A 3G89A 1JQAA 2CMHA 1TCCA 4M1WA 3ZGOA 2Z4TA 5EJEA 2JJ2D 2JJQA 1GRVA 1Q84A 1ZN8A 4AECA 4DLPA 1XZQA 2P9HA 1S89A 2XB9A 3KQUA 2L2QA 4XUGB 1JAHA 5A4MS 2VSQA 3KSDO 1TM5E 5IMSA 1QP4A 2G0NA 3H04A 4FBMA 2X2OA 4KYVA 4NHEA 4E6PA 1APBA 5E1MA 1FTSA 1NJ5A 2O9JA 2RGWA 4REQB 4R16A 4KRXA 5BQ3A 5TEWA 2RHCA 4J29A 3OFSA 3FNBA 5K0BA 4XGRA 1JE1A 4R2MA 1QIGA 2HSWA 3WGQA 2HNAA 3CHYA 1LC3A 4F4JA 2WOOA 1I3KA 1HKUA 1N5OX 1YJQA 1L7BA 4M0DA 4P38A 1CQPA 4BNHA 4HJRA 2RGRA 4B1FA 1M54A 3GLFB 2GZMA 4J2OA 2Z5VA 1QRRA 2P40A 2YQZA 1POXA 1X94A 2CDBA 3JYOA 1SA0B 1MGPA 4Q39A 5A7HA 5HRUA 3BMQA 2QQ0A 3MTEA 2GZDA 5F3RA 3N8HA 1Y4DE 1G16A 2PL9A 2PS9A 3AKYA 1X2BA 3AZOA 1Z7BA 4TVKA 1G6Q1 4PSUA 5GOTA 1U3GA 2QRGA 5FI0B 4MRVA 1HY3A 2CUNA 1EDBA 1N5RA 2QRJA 4ZTBA 3I39X 3WR5A 5DEIA 2JL1A 5LP6B 5FLXA