5G4KB

Phloroglucinol reductase from clostridium sp. apo-form
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
264
structure length
264
Chain Sequence
MVNVKKEFVDNMFSVKGKVALVTGATGALGCVLSKAYGYAGAKVFMTGRNEKKLQALEAEFKAEGIDCAYGVADPADEAQVDAMITACVAQYGEVNILAVTHGFNKPQNILEQSVADWQYIMDADCKSVYVVCKYVAQQMVDQGKGGKIVVVTSQRSKRGMAGYTGYCTSKGGADLMVSSMACDLSAKYGINVNSICPTVFRSDLTEWMFDPESAVYQNFLKREPIGRLAEPEDFVGYALFLSSDASNYITGANCDCSGGYLTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biocatalytic Properties and Structural Analysis of Phloroglucinol Reductases.
pubmed doi rcsb
source organism Clostridium sp.
molecule tags Oxidoreductase
molecule keywords OXIDOREDUCTASE, SHORT CHAIN DEHYDROGENASE/REDUCTASE FAMILY P
total genus 108
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2016-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5g4kB00
3K92A 1P3DA 3PFWO 3OP4A 5G0TA 1NPDA 5DCWA 1U4SA 2CF6A 3GN1A 2GZ2A 4LRTB 4ALNA 1NWCA 1VJ0A 2JAPA 3DZJA 4ALJA 4IJWA 3GEDA 4BUCA 2O4UX 3KZVA 2POQX 1PR9A 4MVJP 2GGSA 1LXCA 3I23A 1A5ZA 4GX5A 1LSJA 1YJ8A 3ZDFA 3F4BA 4E31A 4EJ0A 1O9BA 2NNLD 1A72A 4JQCA 5U1PA 2IXAA 5JMPA 4E32A 3QLJA 3RUIA 4DLLA 1T2FA 4MVJI 9LDTA 3CMCO 4WNCA 1LSOA 5I9LA 5EPOA 2G1UA 2W8ZA 4MOWA 1GAEO 1P44A 1Y9AA 1ULUA 2ZATA 4W9NA 1NQ5A 3HQ4O 2P9EA 2W90A 1DIRA 1VKOA 5G0SA 4P22A 5EESA 5H83A 2FMUA 3BXXA 1YB5A 5THQA 5TC4A 1PWXA 1BDMA 1V0JA 1Z82A 4LSMA 1VSUA 4YQYA 3D4OA 1JDJA 4B3IA 2W2KB 3AJRA 4UVEA 4CLOA 3I9LA 1H6AA 2YHIB 3BZUA 1KVQA 1ENOA 1SOVA 2WM3A 4GMGA 4CL8A 3GAZA 4CM3A 4M49A 1WDLA 3DZGA 5JXWA 4GGOA 4D41A 3H2ZA 2BI7A 1Q7CA 1XHLA 5EERA 1VRWA 4J0FA 1UZMA 1HDRA 3OA0A 1A27A 1SCUA 3EAGA 4CMIB 1ADBA 1NP3A 5G4KB 1AHHA 2AG8A 4DMMA 5DCUA 4CLOB 2GO1A 4GI2A 1R4NB 2Q2WA 2QG4A 2EGHA 4XDYA 5IFLA 2EKLA 4NZ9A 1EVJA 1HDGO 1YONA 3PDJA 5DOZA 5KTKA 4ALIA 4B8ZA 1E6WA 3HG7A 3GFBA 5JY6A 4L9RA 4IMPA 2UAGA 1CWUA 4NIMA 3VZPA 1ENYA 3F6YA 1NVTA 2DM6A 5BNTA 1ZSYA 3R6DA 2FRDA 1SB9A 5A3VA 5EQDA 3DMYA 5MDHA 3OSUA 3U3XA 2NVBA 1SB8A 5K0ZA 1J4AA 1IHXA 4R41A 4RJTA 4AJJA 2A9FA 4JJIA 1GD1O 3WBFA 4HNHA 3LT2A 4BNMA 4BGIA 1I5RA 2VUTA 3UUWA 1U2GA 1IUKA 4BO8A 5CDUA 3W6ZA 4IJVA 3ZU4A 2NWQA 4JK3A 4XGKA 3DTYA 3TZHA 2ZB4A 3ZWWA 2X23A 2PD6A 3PHGA 1YBMA 2VYND 2YV1A 2ZQYA 2HMUA 3TPCA 2AQHA 1KVUA 4IDDA 2B36A 4WNIA 3TL2A 3WG9A 4EDFA 3RROA 4B8WA 1X7HA 3DQPA 3E5RA 4GWGA 4DQXA 1XELA 2OP0A 4PZDA 1DIGA 4RO0A 3F5QA 4NK5A 5L7YA 1HRDA 4S1VA 4A5OA 2XXBA 3DAFA 1AHIA 3T7CA 2BFAA 1Z6ZA 3GVPA 3AFNA 1WDMA 4QUKA 4OSPA 1H6CA 3KHUA 5U4QA 3LDHA 1J6UA 3JCZA 1VL6A 3RQSA 2OOSA 4BO1A 5JNLA 3D3EA 3QWHA 5U9CA 5HRUA 5A4DA 2Q46A 4YJGA 4A73A 3QE3A 2NUAA 5IZCC 1DB3A 4QTZA 1LUAA 3H7AA 3TNLA 4OM8A 1AGNA 2ZB8A 2VZ8A 3DC2A 3AOEC 2X58A 4ESOA 1B14A 4UVIA 1D4FA 3Q9UA 1BGVA 1ZUD1 3DBLB 1LTHR 4LISA 3GDOA 4WASA 3JQ7A 2V7PA 3G1TA 5GZ1A 4IINA 5CHEA 3UCFA 2HSDA 1VM6A 3ANMA 4WE3A 4DPMA 2FR1A 1LU9A 3ZI0A 4J4BA 5HS6A 5LDHA 1CIVA 1T26A 3NDJA 3OQ6A 1S7CA 1QV6A 2P9CA 3MCVA 2PGDA 4CR7A 3GHYA 4EJ6A 4CR8A 1UP6A 4TVOA 4HADA 3GQVA 4CQLA 2PKQP 1DSSG 1TB4A 4U5QA 1C0PA 1TEHA 2DTXA 3FSRA 3GNQA 1RM0A 4OOFA 5ITVA 3DHNA 4ZD6A 1RM3A 5TX7A 2D0IA 3UCXA 1ZO8A 2OGUA 4I08A 3LZ6A 3V2UA 5A3JA 1PL6A 2D5AA 3AOEA 4U6QA 4CMAA 1Q0HA 3OETA 1PJ2A 4R54A 3GNTA 4QT0A 3CMMA 3VH1A 5JAQA 4PIVA 4Z3KA 3T4XA 4HP8A 3DMTA 3STHA 4TWRA 4IY1A 1KEVA 4M86A 5JDCA 1PS9A 2BGMA 4R4JA 1A7AA 4UUNA 5IN4A 3HUDA 4D0SA 4XYMA 3M1AA 3JQFC 4GX1A 3RCBA 4E4YA 3VPGA 3BMCA 3WICA 1X14A 2ZB7A 5B12A 3ICCA 5ITWA 4PG6A 1C0LA 1DAOA 2VT2A 1V3VA 5T8KC 1T24A 1KOLA 4M54A 4NU5A 4BO3A 1EVZA 4L75A 3VHRA 1XWFA 3RVDA 4CM5A 3VC7A 4DVJA 4H7PA 3BTVA 4UEJA 4XR9A 4BNHA 2OORA 3NGXA 3VH2A 3FTPA 4FDAA 3Q1LA 4RPGA 1H9AA 3OF2A 3C7CB 3K5PA 2WWRA 3JV7A 1NNUA 3VTFA 1EFLA 2QIOA 5KJ1A 3WS7A 4PZEA 2C7VA 1HYEA 3EZLA 3KVOA 1UP7A 2PKQO 4I9NA 5TRTA 5A5FA 3DWFA 1SEVA 4O6VA 2ZYGA 4PVCA 3U4CA 2GN8A 5KJFA 5EJ2A 3I9OA 3PLRA 5EIOA 2BI8A 3U09A 2RHRA 5JSFA 1NTOA 3UFXA 3VPFA 1UXHA 3NJ4A 3BIOA 1UUFA 5B37A 4NBTA 3GDFA 2NM0A 4YRDA 5JYEA 1GV0A 4KMSA 1AXEA 2JJYA 2GD1O 3P7MA 1TI7A 2VYVD 4BQRA 5I8WA 3JQ9C 3ZHXA 2HMTA 2PLAA 2G82A 4MVJM 1ONNA 3AOGA 1P31A 3PVZA 4GWKA 4XYLA 3OEYA 3SEFA 4S3MA 1ZKMA 3EZYA 4DC0A 4AFNA 3WGIA 3CXRA 4ROSA 1PL7A 3PJEA 2ZB3A 3SXPA 4IZHA 1R0KA 3PZRA 4JJFA 1DIBA 3BMQA 3EHEA 4FPXA 4NFHA 2X6TA 4PLZA 3RI3A 3T4EA 2WTBA 3PFFA 3ZWAA 2NTNA 4WLNA 5GY7A 2PTGA 1IY8A 4DIFA 1CQIA 3R1IA 2C07A 4O59O 3WQQA 3O4RA 5JMWA 1OOEA 2D59A 2I76A 5TT1A 1EBUA 5BSEA 4J1QA 3FHLA 3KSUA 4KQXA 1PQPA 2EW8A 3ANNA 1EE2A 2F00A 1X1TA 1LSUA 3ENNA 3LT4A 3F5SA 4XRGA 1E7WA 2PGJA 2Q45A 1B8PA 2NU9A 1W0CA 3CE6A 1N9GA 2CMDA 3EW7A 5EMHA 5TSDA 4YB8A 2I6TA 1CETA 1PX0A 3L6EA 1MB4A 4G5HA 1XGKA 4IQGA 1R4NA 4FOOA 1NXQA 1YWGO 3TL3A 3QVSA 2JCXA 4FCCA 5F1OA 3ZWMA 1H94A 1M75A 3L9XA 3WYEA 2IXBA 3WGGA 4YT5A 3A4VA 1C1DB 1VI2A 1U7TA 3KEOA 3Q3CA 1E3IA 1KBZA 2PH3A 3SLGA 3CPSA 2P5UA 3PRJA 4J90A 4BO7A 2IYPA 1ZMTA 4J1NA 3P19A 4CV3A 4KTVE 5JC8A 2FR0A 3WIDA 5A5EA 3D3WB 1L7EA 2JCVA 4L73A 3R3SA 3OH8A 3FNHA 4RF5A 3M6IA 1ZIDA 3RC2A 1RM5A 2GRAA 3KLMX 4E12A 2GPTA 1OC2A 2VUUA 3INRA 3TOZA 3SC4A 5DBIA 4ZN6A 5KVSA 4HUJA 3WYCA 3G3EA 4FS3A 5TT0A 3W4JA 2Y0EA 1YL5A 4J91A 3WFIA 1JAXA 2Z95A 1NAHA 3OJEA 1YQXA 4ND1A 4CV1A 3DBHB 4RPHA 2CF5A 2NADA 2UUPA 1E0DA 2HAEA 2X9GA 2E48A 2W2LA 3AW9A 4R5HA 2I9PA 4MP6A 1N7HA 4Z0PA 3HFGA 2R6JA 3DL2A 1YL7A 3Q9NA 1Y5RA 1I01A 4E5MA 3PHHA 5JBIA 1HL3A 2XF8A 3BYZA 5DT9A 3HNPA 4H15A 1LDBA 1B8UA 1ZEJA 3GPDG 1WAMA 1KC1A 1PJCA 4ALMA 3QIVA 1IPEA 4QSMA 4BNFA 2A35A 1QYVA 4J4TA 1EQUA 1R66A 1NHWA 4JN6B 2DTEA 2Z1MA 4N5MA 4D3FA 5I9NA 3GGOA 2IZ1A 3FCOA 1QRRA 2AHRA 3IOYA 1E3LA 1ZBQA 3JQCA 3ENKA 3WLFA 4BO5A 2GZ3A 3PQDA 3B6ZA 1CJCA 1EMDA 4Y98A 4FJ1A 1DDOA 2UVDA 4L4RA 3UICA 3RKUA 1NPYA 1JKIA 4MO2A 3KTDA 2Y1CA 2ZQZA 3OJOA 2NSDA 4CMBA 5F1KA 4LMRA 3VH3A 3MZ0A 5L7TA 2AQ8A 2HLPA 3HFSA 1DIAA 4PG4A 4B79A 1ADGA 2CDBA 3AY3A 4YPOA 3H9JA 2YV3A 3ZV3A 4KTTE 2TMDA 4IJUA 4YT8A 5BNFA 5A9RA 4FD3A 4GGPA 5FYDA 1M6WA 4GLOA 2VWHA 2P68A 1N8KA 3BTSA 1QP8A 3MOIA 2FWMX 5GZ3A 3DMTC 4RDHA 4FGWA 4RQUA 4BNYA 1EUDA 3AU9A 4PLGA 3L6DA 5L3ZA 4B7CA 1P1KA 3JD4A 1IZ0A 1ORRA 3M2TA 4YEDA 3ZH2A 1E7QA 4A03A 3WNVA 3GT0A 4Q3DA 4K26A 3JQ8A 2J3KA 1R4MB 2VRBA 4B4VA 1E3EA 1KEWA 2HRZA 1BWSA 1ZCJA 4IQ0A 3ZNQA 1YOVB 1P1IA 2B35A 4RL6A 5A03A 5TIIA 2CZCA 2Y66A 1U3TA 2IZ0A 3DBVO 4PRLA 1BXGB 5DULA 2IYOA 4IDAA 4BL5A 1PJLA 2DKNA 3KYDA 1PL8A 4NMHA 4D3SA 4RLHA 3I9KA 5ER6A 4BO2A 2I67A 4ZHSA 3L77A 4IJKA 5TGDA 4EBFA 1PGQA 1Z45A 3LQFA 2HDHA 2HJRA 1N2SA 1NVMB 2NTJA 1E6EA 5FI3A 2BLLA 1TVEA 3P2OA 2PZMA 3H4VA 2O3TA 4A7PA 5IZCA 4EI2A 3O26A 1PJBA 1RKXA 5EN4A 1JN0A 4CQLB 3DZFA 5MGBA 5HTOA 1U2DA 4R9RA 4A0SA 1GFSA 4YAJA 4J49A 1O94A 4DPLA 3FTNA 3GMSA 4H3VA 1Y5MA 1LA2A 3KSDO 4TKLA 1MFZA 3K73O 2P5YA 5BNIA 3PK0A 5CEFA 1P33A 2E6UX 1BXGA 1LJ8A 4JP3A 4ZQFA 5L7WA 3DZIA 4Y6SA 3GFGA 2OP1A 1PZGA 2V6GA 3WLEA 3I9JA 4BGEA 4UVGA 4CMCA 3B1KA 3GZNA 5T64A 4LSWA 1E1KA 1ID1A 2CFCA 3K6JA 3TWOA 3AY6A 4CMKA 1Z73A 3BA1A 3DB2A 3O38A 3C3XA 1KS9A 4LMPA 1MUUA 2VNAA 3BTOA 4MP8A 1O89A 1DXYA 2EXXA 4MVJA 3UN1A 4YJGB 1D8AA 2X22A 4DBVO 1YDEA 3RUAA 1TT7A 3RUFA 1UAGA 4OHUA 2SCUA 4NFYA 4GQAA 4ZQGA 1ZMOA 1HXHA 3PIIA 1PTJA 1GL3A 1KETA 4L8VA 3JYPA 4OH1A 1K6IA 3FWZA 4WLOA 3D5QA 3VDRA 1BW9A 4DQVA 2CY0A 3B1FA 5F3RA 1TA4A 2Y0DA 1QKIA 1NAIA 2ZCVA 4BMNA 1P1HA 4J2HA 2Y1DA 1HT0A 1P0CA 2OL4A 1YH3A 4KDFA 1EK6A 1FK8A 2Y1GA 3PQEA 2O3JA 1PJTA 1CYDA 1ZSNA 2FSVA 3ITDA 3I3OA 2GNAA 4I1IA 1YJQA 3GG2A 1Z7EA 2G76A 1A9YA 4XQEA 3GAFA 3RBVA 3UCEA 4NJOA 1XU7A 3W1VA 3E82A 5AXCA 4CM7A 3FPLA 3EK2A 4DIOA 2YFQA 2QYTA 3BAZA 1E3SA 1EUZA 2OHXA 2HUNA 5BT9A 3RC1A 1T2EA 3KEQA 1FDSA 3IP1A 4JBIA 4AG3A 1C1DA 2J8ZA 1GQQA 5BSFA 2QRKA 1NX6A 4XYGA 4F6CA 4IS2A 3FNFA 3X2FA 4MKZA 1Q2XA 2AE2A 4W7IA 4AJLA 4CLRA 4UVHA 3IKVA 5KVQA 1T2CA 1R6DA 4C4OA 3TF5A 3ROQA 1GQ2A 4L4XA 1D3AA 1LDMA 4JGBA 3OQ1A 2P4HX 1V3TA 4OIMA 5KCZA 5IJZA 1ZFNA 2RIRA 2ILTA 1PZEA 1VE9A 1Y7TA 2H6EA 3EDMA 1B16A 4O63O 1WPQA 4XR4A 1NQTA 4P4LA 1J5PA 4GBJA 3FBGA 2GDZA 2VUSA 4L76A 4GVXA 5G4KA 1ENPA 4TKMA 4U8GA 1I2ZA 1I0ZA 1MV8A 2X4GA 3L0DA 4OXKA 3WYBA 2UV8A 1Z7BA 2PKRA 4WPGA 3WX0A 3OECA 2EWMA 1N7GA 1QYXA 2WJPA 2AG5A 5K6AA 4FFPA 3AM4A 1DOHA 5EQFA 2Y99A 2Q99A 4IS3A 2I3GA 1ISIA 3AY7A 4WECA 1V6AA 3E03A 1UXIA 3GN2A 4L74A 2Y1FA 3ITKA 1DJNA 1LX6A 4G65A 1KEPA 2Q4BA 1I2CA 2Y68A 1GCUA 4QECA 1QORA 4W99A 3PTZA 1Y8QB 4M55A 1XR3A 3KRTA 1HTBA 4UVDA 3C7AA 5G2OA 1WZEA 4BOYA 5IDYA 3OICA 3S8MA 3VAZA 2EP5A 3C1OA 1R0SA 3FN4A 1U3VA 1I3NA 3PEFA 3WMXA 1TT5A 4JLWA 1NYTA 4KUGA 4BQPA 1CDOA 1DC3A 2ZCUA 1HWYA 2O50A 4Q3BA 2EHDA 1X15A 2UDPA 4JBGA 4BNZA 1X7DA 4CM6A 2HRBA 4CMJA 2GLXA 3KYDB 1HKUA 2VHVA 5JFOA 1D7OA 4BV8A 2QRJA 1ISGA 1KIFA 2YV2A 1OFGA 1WZIA 2B37A 3DZHA 1PS8A 3C8MA 4J7UA 4D46A 1F14A 4DRYA 4IXWA 3GZNB 2PZKA 4UREA 1GU7A 5FEUA 3W8FA 4RGBA 2J6IA 4W9NC 1HE5A 3M2PA 3TFOA 2VHWA 3CZMA 4GMFA 4BNUA 4CLXA 1K89A 1JAYA 4J1TA 3LC2O 1KY5A 1UAYA 3BMNA 1NVGA 1ZNQO 5CP8A 3GVIA 2I5PO 5JY1A 1FDVA 4IQ8A 5L4LA 5LC1A 4E2XA 3CUKA 2VZ9A 3GVXA 2VCYA 3C1AA 4TQGA 3I9MA 2O3UA 1T2AA 3L9WA 4DMLA 3PWSA 4IDFA 1IZ9A 1LRKA 1MP0A 4OO3A 2W2KA 3GUYA 3T7EA 3WGHA 4CMHA 1UR5A 2FZWA 3EVTA 3H9QA 4QFCA 5ES3A 1Q1NA 3MTJA 1DBVO 1JVBA 4PG5A 1BVRA 1PGJA 1VL0A 1H6DA 2WD8A 4ZQEA 1E5LA 3Q11A 4BKOA 2XAAA 2EIHA 1LDEA 3LC7O 2RH4A 4R01A 3D5TA 4PZCA 2NVUB 4PLTA 3GGPA 2DT5A 2PR2A 1UH5A 2O23A 2YYYA 3HADA 5KJCA 4WEOA 3KETA 1FMCA 2H5LA 1B2LA 1HE4A 4BNJA 5ICSA 3DHYA 4KDEA 3AM5A 4F3YA 1ZJZA 1P77A 2EV9A 2O3SA 1SNYA 2DTDA 1GDHA 1NWHA 2JHGA 2OMEA 2Z1NA 4IMRA 1KERA 2B69A 3KYCB 4O5OA 1AE1A 2A94A 3KBOA 3KV3O 4K28A 2C20A 2G5CA 4YTEA 3KB6A 1DC5A 3PGJA 4GPD1 3MWEB 2G17A 2FPIA 4QX6A 2Q1WA 4MJLA 2PZLA 1MG0A 2BGLA 3GG9A 2BRUA 4MVJD 3LU1A 1NQOA 3TFQA 2P91A 3AUUA 2J3JA 2WD7A 4NBWA 3VPSA 1Y9EA 5GMOA 1H2HA 1JVSA 3ASVA 1HSZA 1YE3A 5L53A 1SAYA 1OI7A 3G0OA 1U8XX 4MINA 3W4IA 4I5FA 4NK4A 2WD7B 3GNSA 4LN1A 3QY9A 4BGUA 4DLAA 4CQMA 3HE3A 1FJHA 3H6KA 3D4PA 1MLDA 4BMSA 1A4UA 2BHLA 2JD1A 2F1KA 3WMWA 5K9ZA 1UDCA 4JXKA 4EGFA 1PJ4A 5JDCC 1XSEA 4YT2A 4UEOA 2I65A 3WJAA 1GADO 3KLPX 4BO0A 3VDQA 1I3MA 1E92A 3GEGA 3RUHA 5DZSA 3PGXA 3GY0A 1Q7BA 3RJ5A 3QP9A 3IDSA 3GVHA 3JD2A 2ZYAA 3NGLA 3RUDA 4Z3DA 4BNVA 3W6UA 5CPBA 4ND2A 1YBAA 4UUMA 1QYCA 1NASA 3SJUA 3DOCA 1K5HA 4MVJF 1ONOA 2VNSA 2O3QA 3CEAA 3DZBA 2VT3A 2RCYA 1EBFA 5KKCA 4DC1A 3BHIA 1GY8A 3FRJA 1PGPA 4FBGA 4PG8A 1F12A 3QA9A 4RCVA 2E49A 2E4AA 3DAPA 3UW3A 3EC7A 5G4LA 2J3HA 1UP4A 3OQBA 1K6JA 3G79A 5JDIC 2HMWA 4W7HA 3K2EA 4R1TA 2UUOA 4TZKA 2DBRA 4D3DA 4WUVA 1E77A 3ZZNA 2QQ5A 1FXSA 3L6OO 2EEZA 3S2EA 1EUCA 1GUZA 3VVCA 3UAGA 4BO9A 3ADPA 4YYZA 4J0EA 4XCVA 4IIVA 3NT2A 4E21A 5CEEA 2C5EA 1DFGA 5JLAA 4EYEA 2CUKA 1G0OA 3FR8A 4DBZA 2FZEA 1YGYA 3SLKA 3U62A 4ND4A 2GUGA 3G17A 5IXYA 3N58A 4X54A 2WDZA 1QYWA 2PWZA 5AXDA 1CF2O 5HA5A 2DUUA 4A2CA 4OKIA 3I52A 1WXDA 2YQ5A 3NDIA 3U49A 3G1UA 4AVYA 3H2SA 3RC9A 3GMDA 3WQSB 2AQKA 2Y05A 2V6FA 4IDEA 1LLDA 1HYHA 4MP3A 1T1SA 3JQGA 2QZZA 4N5LA 5IDXA 8LDHA 3HN7A 5ADHA 1TT5B 5JCJA 4R5MA 2ZJ0A 3E8XA 3ICPA 2X9VA 4QFDA 4PLYA 3ONFA 1T4DA 2C82A 3I4CA 2FHSA 3U4HA 3WGYA 3ROMA 3H5NA 1VLLA 3FBTA 1LI4A 1R4MA 1NFRA 1ZSVA 5JE8A 2BD0A 4J6FA 4XYEA 3TZKA 1PJSA 9LDBA 2PY6A 4TMFA 4Z9FA 5A06A 3LT1A 4NH4A 5KJEA 3HHPA 2BFPA 3M1LA 3WBBA 4HFNA 1A4IA 4ALLA 5LCXA 3INTA 3RD5A 2YHUA 3WGTA 2DBVO 4B3JA 3SC6A 4FFNA 3UH1A 3D64A 1SC6A 3RASA 4YQZA 1ZK0A 1C0KA 1DC6A 1BXZA 1RYDA 1X0XA 4FGSA 5TQVA 3MJCA 2W2LD 5DDIP 5IAAA 3WWZA 2IEBA 3HB5X 1L1FA 1BMDA 2AE1A 2DVMA 4JCOA 3ORFA 1JW9B 3FD8A 3KM0A 5FF9A 4EUHA 3ZU5A 4GKBA 4XIYA 4AJIA 1GTMA 3DHEA 3P5SA 5K6AC 3ZV4A 4Q3CA 5C7OO 4LRSB 4RVSA 3DFZA 2B5WA 1LQTA 1L7DA 4BNKA 4XEHA 1EVIA 3QVXA 4ZRMA 1R16A 3CH6A 3ZU2A 1GYPA 4R69A 5I7VA 1HDXA 4HNGA 4INAA 4HV4A 4E2YA 4CLEA 1I2BA 2IODA 3UVEA 1HETA 5KKAA 3HB4X 2DU8A 3WXBA 4CM9D 4QQRA 2HU2A 1BSVA 4Y6RA 3MJVA 5A1TA 4YCAA 1IHYA 4CMGA 4OMUA 3JQFA 1GUYA 3GH3A 1GEGA 4AL4A 4ILKA 5L40A 3ZU3A 5C7IO 3S1LA 1I3LA 1H9BA 3PP8A 1QG6A 4Y67A 4MIOA 4D42A 1EDZA 1LSSA 5F5LA 1G1AA 1DEHA 2VOJA 3UHAA 4JROA 2CD9A 5C37A 1MC4A 3NX4A 3AK4A 1UXJA 3OM9A 3IP3A 4TRRA 2VRCA 4WOKA 1GEEA 3C1TA 1U1IA 3VOSA 2RHCA 3N7UA 3U5TA 2EKPA 3ST7A 1GYRA 4D44A 4L0QA 2J5QA 1LDNA 5CAEA 4LGVA 5I9MA 5EL0A 1NM5A 4R68A 4CLDA 5HS4A 4ITUA 2WEKA 3B1JA 8ADHA 2PZJA 1Z75A 3QRWA 2YDYA 1B0AA 4A10A 4Z9XA 3F4LA 3QSGA 2AW5A 1IE3A 1ZK4A 1VPDA 3PI7A 3CKYA 3AWDA 2EW2A 2EGGA 1EEHA 3BMNB 1YL6A 3A06A 4LVUA 3ETDA 2GZ1A 3JQ9A 1F0YA 3DFUA 3X2EA 3H8VA 4IDBA 1T2DA 4BV9A 5I7SA 3MJ4A 3CZRA 5KVCA 1HLDA 2CDCA 1DJQA 1PGOA 3WTCA 4IGEA 4NNJA 4ZQBA 4OXNA 4UUPA 1UZLA 4IBOA 1SZJG 3CSDA 3U9LA 2I66A 2VWPA 1YBVA 1PQWA 2O2SA 4W4TA 1JQBA 4EITA 1AN9A 2XXJA 4URFA 1DO8A 1ULSA 2VRCD 1QLJA 4DYVA 4R1SA 4FR5A 4YA6A 1DFHA 2AA3A 4FFLA 3WQRA 2Y1OA 3N74A 4NU6A 4CUKA 1NHGA 3DDNA 4RVHA 2EJVA 3PJDA 5A9TA 3O9ZA 4R51A 4CM4B 2HJSA 1O8CA 2C5AA 4RDIA 3W8EA 1Q7GA 2Q2QA 4GX0A 4WOJA 4I9HA 4NHEA 1P1FA 3NT5A 2JHFA 2E37A 1LNQA 3GC6A 4NFSA 5IDWA 3SX2A 2FPGA 3ZHYA 2GN6A 5CDYA 3S2IA 5CFZA 3SVTA 1QMGA 3RU9A 2LDBA 3ZWPA 1J49A 3GLQA 3PHIA 3H9UA 5B4UA 1E7MA 3ONDA 1WNTA 4J7XA 3I83A 5ENVA 2O3RA 5A04A 2B5VA 4IZIA 3LLVA 4MVJH 4D7AA 4YAGA 1W6UA 2QRLA 3VPXA 3ZNNA 2B4TO 3TRIA 3C7DB 5THKA 4EUFA 2X86A 1H93A 3RFVA 1Y6JA 4JIGA 4D43A 1A71A 5AQ1A 1ZZEA 1MC5A 3WIEA 1CERA 2VN8A 3WSVA 5CDSA 4Q9NA 4E2WA 3Q2IA 4JJGA 3A28A 3D4NA 1UJMA 2GCGA 4YXFA 4Z6KA 2YHIA 1GPDG 2DBZA 4XGNA 2YJZA 1NBOA 2Q1UA 4BNNA 4CUJA 3LSYA 2C29D 1KC3A 2V65A 3AM3A 5DOVA 3MJTA 4GAEA 3WOHA 1YB1A 5LDGA 4XZ3A 4WLUA 2PNFA 3PIDA 1OBFO 1V8BA 4FN4A 3IKTA 2LDXA 3ROPA 1I36A 2X5JO 2B83A 1H2BA 1UXGA 2GSDA 2J5RA 4EEXA 3LYLA 4FC7A 1P9LA 1XU9A 2WE7A 3I1JA 1VC2A 3E5MA 3DBHA 4WK6A 3QWIA 4GSLA 4IGFA 1V9LA 4W6ZA 3E6AA 2DQ4A 4M8SA 1XCBA 3ZWYA 5TLSA 1K3TA 2PFGA 3KOUA 2DFVA 5T67A 1DFIA 4R3WA 3NTRA 3AUTA 4RVGA 2JL1A 5JC1A 4AJ2A 4YBZA 3A14A 4R9SA 4B7UA 4YWJA 4ZA2A 2ZJ1A 4XD2A 4RQTA 5L9AA 2P4QA 3FPCA 4CQMB 2RBEA 3U4IA 3AU8A 4PFJA 2FY8A 4FC6A 2AQIA 3C24A 4JBHA 2UYYA 1ISHA 2B4QA 4CLHA 3V1TC 3P2YA 1C14A 1E7RA 4B4UA 4WGGA 3RWBA 5COAA 1NQAO 4J4HA 2NACA 1PR3A 1QXSA 3B20A 2AEFA 1JTVA 5CEJA 4KOAA 1IOLA 5TJHA 4LCEA 3DXFA 3E9NA 4BNIA 1K2WA 3NDRA 3IQDB 3JYNA 1XG5A 1JA9A 3UKOA 2YFHA 3NJ8A 3L4BA 3TZQA 1U5AA 1OZAA 3BMQB 4HWKA 3JD0A 1WLYA 2VHXA 5FWNA 4I8XA 4EJMA 1KVRA 1ZK2A 3JQ8B 1Q0QA 4XKJA 1UZNA 3PLNA 4CPDA 5TS3A 3PZBA 2GASA 2ET6A 1H5QA 1E3WB 1BDBA 4ND5A 4UUOA 4BNWA 3EMKA 4ZJUA 1TLTA 3IL2A 3CTMA 3JD1A 4E6PA 5CPFA 5JAIA 1ZH8A 3HJAA 4CMIA 1FDWA 4XQCA 1AXGA 3JQEA 4KWHA 4TROA 3RBZA 1B7GO 3DAGA 2VHYA 5IXSA 3L07A 1IULA 2I3AA 3NEPX 5L4NA 5EINA 3ZGYA 4CM4A 3W4KA 1QSGA 3IJPA 3JSAA 3RUCA 4XGIA 2ZTMA 2OZPA 5G0WA 1K6XA 1R15A 4OL9A 2JFGA 2OBYA 1GYQA 4FSHA 4UAGA 4DYDA 2ZYDA 4QXMA 4BNXA 3UOGA 4O1MA 3RC7A 4HKTA 4RLSA 3OIGA 2PV7A 5T8KA 4E2ZA 1VSVA 5L95A 2D3TA 1C3VA 1M67A 1C1XA 4LW8A 1B8VA 3AI3A 4FFOA 4XYBA 2PH5A 1IYZA 3E1KA 3ASUA 4RPKA 1ZK3A 1E1LA 3RIHA 3VZRA 4CQMD 1V35A 3LC1O 2CDAA 4E5KA 2V6BA 5DBGA 5T5QA 1ZK1A 2O2YA 4FFRA 2GERA 2CVQA 2GR9A 2BELA 3ETGA 1R12A 4TRJA 3E9MA 4Q3EA 3IAHA 1ZVMA 4U7WA 2YUTA 1EQ2A 1N9GB 3NTQA 4B4OA 2OUIA 3S2FA 4Z9YA 4NBUA 1PJ3A 5AYVA 4Y9DA 4XDZA 1I30A 1ZEMA 2YW9A 1U5CA 4YT4A 1I32A 1T25A 3FR7A 4PLVA 2WMDA 4NR0A 2XPCA 3PPIA 1GZ3A 3U0BA 3K96A 3GGGA 4K6FA 4CM8B 3I9NA 2B4RO 2WYUA 3V1UA 2YDXA 2Y93A 1O5IA 4II2A 5JCXA 2NLOA 4FW8A 2X1HA 5KOIA 2WSBA 3RUEA 5ILOA 3OIFA 1RJWA 4PGFA 3LF2A 4Z0TA 4K9DA 4AICA 3OJLA 3JQ7B 3QWBA 2GYYA 2Q1TA 3ONEA 1I33A 5FI5A 1NR7A 5F1PA 2NVWA 3EVNA 4ND3A 3EYWA 3TZCA 2R00C 1CQJA 4EW6A 5JO0A 2QZ9A 2DLDA 4YVFA 4K1LA 5B4VA 2AMFA 3BMCB 3BHMA 3D3WA 4RF4A 4F6LA 3VTZA 5HWSA 2DBQA 4HFRA 1QYDA 2Q49A 3RKRA 1BW9B 4HFJA 2P2SA 1KVSA 4YDRA 5G0VA 5BR7A 4MKRA 4P4GA 4E30A 2YZ7A 2RAFA 4F46A 3WGQA 1A9ZA 4OOEA 5TNXA 2NU8A 3ABIA 1NPTO 1GUFA 5J23A 1JKJA 1WDKA 2CSUA 2EKQA 1NFFA 3GOHA 3NT4A 4J7CA 5IF3A 4WCFB 2HK7A 1ONPA 2OBNA 1ML3A 3WB9A 3ON5A 2HQ1A 3HDQA 3K31A 3BTUA 4CMEA 4WJZA 4CR6A 5JCJD 2Y67A 4CUZA 2NU6A 3IUSA 1EFKA 4O0LA 1R37A 4W82A 2C2YA 4J2OA 1LC0A 4P8RA 4Z0HO 1SMKA 3AI1A 3ROKA 1Z74A 2NQTA 2JD0A 4CM9A 3K8ZA 3ETEA 1VKNA 4U6SA 2X0IA 1KVTA 2QHXA 3VVBA 4CODB 5CG2A 4B3HA 4AJKA 4RF2A 1KEUA 2B0JA 2DPGA 4GKVA 1OMOA 1FF9A 2QYSA 2YY7A 4RZIA 3QV1A 5ENDA 5COBA 1PJQA 4OJNA 5HM8A 3SJ7A 1HEUA 4I5GA 1H6BA 3UXYA 2O4CA 2PA3A 3DBRB 4NBVA 3ZCXA 3PWKA 1DRVA 2D1YA 2H1SA 4G2NA 4GVLA 4TRNA 3ZHZA 3COSA 4RV9A 3RAJA 1T1RA 4BMVA 2DAPA 2J3IA 5CDGA 1PZFA 2C7GA 1F8GA 1HLPA 1GPJA 3VH4A 2AEJA 3R3JA 3AUSA 5JDIA 1DRUA 2AEMA 2BFMA 1M6HA 3BMOA 3ZWBA 1E3WA 2HO5A 2VWGA 2D5CA 4A26A 3GDGA 2FR8A 4AJOA 4CV0A 4R3NA 1DLIA 3PHJA 4TRMA 3H3FA 4TVBA 2TMGA 3DZKA 3H65A 4E33A 2AXQA 4RZHA 4YJHB 4ZICA 4N54A 4UULA 3VPHA 4MIEA 5ER9A 3TDKA 1YOVA 4YR9A 4LVCA 4BIIA 2HCTA 1Y8QA 1R0LA 1W73A 4YAEA 1X7GA 3WFJA 3K30A 3V5NA 2I99A 1U8FO 1A7KA 1MGOA 1RWBA 4DQUA 4PCVA 1DPGA 4HFMA 3OIDA 4MIYA 4L4SA 4J9UE 3E18A 4AJ4A 3JTMA 3OHSX 1Y8RB 5CDTA 2NU7A 2R2GA 4UEKA 4BHTA 4FQ8A 1O6ZA 2IEDA 1M66A 3W8DA 4FOSA 5BSHA 1SEPA 1N92A 3JQGB 3LVFO 1S6YA 3JYQA 4DTIA 3PDUA 4M87A 4K6CA 4YAIA 1EDOA 3KXDA 2CVOA 4AJPA 4D0RA 3IJRA 1I24A 3IMFA 3QVWA 1DHTA 3ZW9A 1DAPA 3A9WA 3WJ7A 1JLLA 5TJ9A 1XQ6A 1BVUA 1M76A 1VJ1A 3LLSA 2BF7A 2H63A 1YXMA 2HMSA 4FB5A 4XJSA 4RF3A 4BNGA 4PN3A 4BKPA 1YQGA 5DCYA 3HN2A 4TSKA 5DP1A 1MXFA 2DFDA 4KZPA 3MWDB 5DBFA 3WGZA 4EZBA 5ILGA 3GRKA 3FWNA 3WNQA 3ZV6A 4OQYA 3OEWA 1DHRA 3OMLA 4D79A 4N18A 4XQ9A 1YRLA 1D1TA 2A4KA 1DIHA 1KY4A 4RVUA 2VOEA 5KWEA 3O03A 5JO9A 2OXIA 1GZ6A 2JCYA 4YACA 3JQBA 2G0TA 1OAAA 4HBGA 2IE0A 5JAZA 1PU2A 3ZNPA 4U0JA 3DOJA 1LLUA 5C7LO 1U3WA 3NRCA 5A9SB 2X0JA 3NTOA 4DXHA 1LEHA 3GRPA 1JWAB 1MG5A 1HYGA 1K0UA 4M89A 1J0XO 3RJ9A 5H82A 3D1LA 2X8LA 2BH9A 4CJXA 1Q0LA 3K2BA 4DPKA 2X9NA 5KNLA 3ZWXA 4B4WA 1OC4A 4XIJA 5BSGA 3L4BC 1EE9A 2YQ4A 5JPIA 1UXKA 1GQYA 3ZNOA 4XJTA 1B15A 3WTBA 4M1QA 3RFTA 2P9GA 3TQHA 2FP4A 3HDHA 4EUEA 2Q2VA 5GZ6A 1YKFA 4Y6PA 1YO6A 4WLVA 3HDJA 5KVVA 1P1JA 4R1UA 1RYEA 3ANLA 3QW2A 5IN5A 1FDUA 2BFOA 3DBRA 3LF1A 4KUEA 3R0IA 3RU7A 1WMAA 1HDZA 4BGVA 4KWIA 1I3KA 2X7HA 1I10A 1BG6A 1MXHA 1N1EA 3DTTA 3JD3A 4ALKA 4NI5A 4GSKA 3F47A 4GLLA 3GF4A 2Y1EA 1BTOA 1P0FA 4R16A 4YAKA 3F1LA 3H9GA 1HE2A 1U3UA 3GK3A 4XRRA 3JQAD 3RFXA 3ZW8A 3F3SA 1HF3A 3OA2A 4E0BA 1UDAA 1QLHA 2JFFA 5DP2A 1O95A 3QVTA 3KYCA 1PEDA 1ADCA 3F1KA 3PQFA 2D4AA 3KYBA 3WSWA 3OJ0A 1E1MA 4DWVA 1RM4A 3KO8A 5AXBA 2EP7A 3GPIA 3FNEA 3Q2KA 4IDCA 5T6BA 3GR6A 1NFQA 3F46A 4MDHA 1F06A 4BKRA 4Q3NA 3E9QA 3QVOA 4MKXA 2E82A 4MVJE 3MOGA 2W98A 1ISMA 4BVAA 3MJSA 4N5NA 4J3FA 1GV1A 2FPPA 3PYMA 5I8ZA 2VTEA 1Y81A 3QWFA 4MVJG 3ZN2A 5B4TA 1XKQA 1YS4A 3KSZO 4B7XA 1WMBA 4CL3A 1IB6A 5AVOA 4LCJA 2EERA 3HDYA 3UGKA 1ADFA 4JP2A 4ZQHA 4PLPA 1ZXLA 4NDNE 4PRKA 4EEZA 2GF2A 1JKFA 2PD4A 1U28A 3Q6IA 1HDYA 3E48A 4DREA 5B1YA 1HZZA 5DF1A 1PWZA 4E5YA 1H0KA 1RPNA 1Y1PA 1MX3A 3PJFA 3FF4A 4J9VA 2JAHA 3BMOB 3EGOA 2HK8A 4NBRA 1NR1A 2J5KA 1E5QA 3JQDA 4WLFA 5ICMA 2X5OA 4IDGA 4PLWA 3ULKA 3ZWVA 4WCFC 4BS9A 4NJMB 4RPLA 3JYOA 3NKLA 3UF0A 1CRWG 1UDBA 4FIZA 1ENZA 4PG7A 4YRBA 3DR3A 4MPDA 1SO8A 4YJHA 3WGOA 3S2GA 4HY3A 2JKVA 5TF4A 3QQPA 4YRAA 5C5IA 2EJWA 4PLFA 4DLBA 3Q0EA 4U0KA 4Y8VA 2ZTVA 7MDHA 1HZJA 2HK9A 3PYLA 2GN4A 1XEAA 3OFSA 3PYXA 5H81A 4A27A 2FN7A 3H3JA 1ISJA 5A9SA 3ZWCA 5COQA 2EG9A 3WR5A 2BMAA 5C3MA 1F8FA 3JQAA 4OQZA 3SBOA 4YJFA 3QWAA 2IDZA 4OKNA 1XQ1A 1HDCA 3PXXA 3ZHBA 4J1SA 1ARZA 3B70A 3GVCA 5JYDA 1FDTA 4XX0A 5JW6A 2WE8A 3L4SO 2C2XA 3K9QO 3KUXA 4HX5A 1VJTA 1JU9A 1AUPA 2W4QA 3C85A 3VKUA 4QO8A 4E13A 1WP4A 5CG1A 1XA0A 3VZSA 4OXYA 4GL4A 3O8QA 3TSCA 4NG5A 1Y8RA 4CM1A 4I5EA 1EZ4A 5DN9A 5FFFA 1P74A 1U7HA 4PLHA 4QEDA 4ZRNA 2VZ0A 1U9JA 4D45A 1BRMA 3HWRA 1JWBB 3OBBA 2JD2A 3ZWNA 4KP7A 2O7QA 1PQUA 2IZZA 2O7SA 4F45A 1P45A 3AI2A 2IRWA 3AUAA 3F9IA 3HZZA 1QR6A 1HDOA 4NQZA 3PJGA 2OFPA 4IM7A 6ADHA 2VTDA 1B26A 4XQGA 1PS0A 1EK5A 4WKGA 2BKAA 1YDWA 4WEQA 1ZXBA 4ZGWA 2Q50A 1XYGA 2Q4EA 4XWYA 3PHLA 4QO7A 4DIBA 1E3JA 1C0IA 4DGSA 2PGLA 1X13A 2BGKA 2ZKLA 2A92A 2NV6A 3DO5A 3O8QB 2FOIA 1QV7A 4YJDA 2WYWA 4RVFA 1E1NA 4BO6A 1N5DA 4BNTA 4XA8A 3ZV5A 3VZQA 2Q1SA 5I7FA 5JAMA 3CINA 2PD3A 4E5PA 1X0VA 5F5NA 4H16A 4J43A 1VL8A 1LQUA 4IUYA 2NVUA 4WCDA 4BB5A 1M2WA 5KIAA 3IIEA 5IG2A 4JNKA 5A02A 3H5RA 1CEQA 4IXTA 4BKUA 3BHJA 3INGA 3TJRA 1DC4A 1I8TA 4XB1A 3QHAA 1LDGA 4DUPA 2Y0CA 3HSKA 3TN7A 4FJ0A 2X0NA 5A05A 4CV2A 3S55A 5IDQA 4OYRA 2QX7A 1XLTA 1T4BA 1LDYA 1YQDA 3JQ6A 4GX2A 4WCFA 4I9UA 1SBYA 3EY4A 1B3BA 1XDWA 5T57A 4R1NA 1EVYA 4NPCA 2R00A 2C0CA 4PLCA 1LC3A 3GEMA 2DUWA 4CMEC 2NTVA 1SPXA 3I4FA 4OGWA 1YVEI 3PWZA 3WWYA 4C7JA 3EUWA 1E7SA 3MJEA 5AXAA 1PGNA 1WVGA 2EF1A 2JFHA 3IUPA 1WW8A 1LLCA 3V2HA 6LDHA 2FSSA 5F21A 4KUHA 2VQ3A 3I5MA 4DA9A 2VHZA 3D0OA 4IPTA 3AFMA 3DEYX 4FFMA 1LRLA 1ZW1A 2CNBA 2X5KO 2ZK7A 3RSHA 3TZ6A 4PVDA 3V8BA 4CLRB 2WYVA 3V2GA 4FJ2A 2QW8A 4Q3AA 3JYLA 2D8AA 3D7LA 4KQWA 1KYQA 1X1EA 5AOVA 5L4SA 4GH5A 1ZJYA 2Z5LA 3CIFA 4Q39A 1G0NA 4RORA 4ID9A 3I6QA 3JQAB 5I7EA 4NJMA 1DLJA 1U4OA 2VYVA 1MFPA 3DONA 3ADOA 3MTGA 5DNAA 1E6UA 1F17A 3GHHA 2C54A 3NV9A 4RPJA 3H9EO 4AJ1A 4ONEA 3LK7A 1G6KA 1HSOA 3TOXA 5BQFA 1V3UA 4J16A 2RH8A 4ZVVA 4WLEA 4AJNA 4BO4A 3FNGA 1P1RA 3V1YA 5KJ6A 1D1SA 3JQBC 2V6MA 5L51A 1PIWA 3A1NA 4C7KA 3DOOA 1LBEA 3RBXA 4DL9A 5L45A 4P38A 4TZTA 1GZ4A 3VKVA 4E5NA 1XIVA 4ZU3A 4II3A 2ZIZA 1IPFA 3NYWA 4BB6A 3GA0A 3GUCA 1PSDA 2HMVA 3IS3A 2DPHA 4I5DA 3GZ4A 1DRWA 2OO5A 3WDSA 3MEQA 4XB2A 5IZ4A 1BXKA 4P4NA 2X0RA 1C1XB 3OJFA 2H9IA 3H5AA 1LRJA 2PK3A 3LT0A 4G81A 4JX8A 4N7RA 1SOWA 1TXGA 1E7YA 2Q3EA 4OAQA 4HXYA 4BKQA 7ADHA 4BNLA 1IL0A 1O0SA 4E3ZA 2GN9A 2VWQA 3G49A 3NAQA 2D2IA 1GCOA 4CM8A 2ZTLA 4AJHA 1W8DA 1B3RA 2NQ8A 2XOXA 2ZTUA 3I6IA 1LLQA 4RVDA 4IIUA 4YJFB 5JS6A 3ZWOA 1WWKA 2CVZA 2VYNA 1BHSA 1YB4A 3U4DA 4LK3A 1W4ZA 2HKIA 3NUGA 4OSOA 5HBRA 3QJ5A 3IC5A 1GR0A 1N1GA 5G0UA 1PZHA 3DBLA 2C59A 1ISFA 2O48X 4AJEA 1HE3A 2DC1A 1MA0A 3FI9A
chains in the Genus database with same CATH superfamily
3UC5A 3F7NA 2EZUA 3Q5EA 4I2NA 4ZT5A 4MS1A 3REOA 3AB7A 4MRVA 2Z30A 2DT8A 5EIWA 3JWGA 5ALVA 5G0TA 5FOQA 4U5XA 5KQMA 3EDYA 5BOSA 3DSRA 3K0AB 4HNVA 1U4SA 3KZNA 3F3KA 2VA9A 1I2MA 4IMJB 4OQFA 2RJNA 3GRUA 3C8ZA 3BE8A 3DO6A 2AK3A 4B4DA 1Y3FE 2YZ2A 3G89A 3KZVA 2TYSB 1J5XA 3KQSA 1A3CA 1PR9A 2V58A 1L7AA 3QOFA 2BEVA 7REQB 1A5ZA 5EFOA 4HAUA 4GX5A 1LSJA 1QUFA 1UJ6A 3IDFA 3ZDFA 2I4RA 3F49S 4PO3X 2ZPUA 1Q92A 4DWWA 3DC7A 2NNLD 3ENQA 3ISJA 5U1PA 2HH9A 2IXAA 3OUZA 1JDBB 4DCOA 1GSOA 2Q5OA 1G291 1YR2A 4REOA 5JMPA 4DCCA 4FN5A 4TLEA 4A4DA 1Z4PX 2ATCA 3EZ9A 4E32A 1FNBA 1QTNA 1OAKA 2JFZA 4XEUA 5G1NA 4DLLA 3IR7A 4V0ME 5AVYA 3D43A 5HKKA 2D62A 4HN4B 4WNCA 1EFRA 4D8VA 1NI5A 1LSOA 2X2OA 4U00A 3G85A 4URUR 3WMEA 4UTNA 4MOWA 2H31A 4IIDA 2Z2KA 4X60A 1P44A 3ORRA 1L4FA 1NQ5A 3DWGA 1DEXA 5G0SA 1QCDA 3H2BA 3EQ7A 4ITRC 5HP4A 3T38A 2JARA 3P5BA 1SK8A 3LXMA 5AHXA 5THQA 5KYYA 3SZMA 1LVGA 4H0FA 5IABA 4MWDA 3MLAA 5T4HA 4C76A 4CKBB 4G1EB 4P93A 5A5GA 5K0GA 2VSYA 1JDJA 3LUJA 3CURA 2G3YA 3I09A 1H6AA 4H3HB 4XVCA 3ELYA 4FQ5A 1SOVA 4KLRA 4F04A 2TMKA 1TW3A 2FPSA 4QNRA 4YMSA 5DGIA 4CL8A 2ZIXA 1AMOA 3TSWA 4G0MA 5M5BA 4QYIB 1OX5A 5CA1A 5JXWA 4GGOA 3GRYA 3LX4A 4D41A 1XCPA 2YOFA 3H2ZA 4RY8A 3WGUA 1WCV1 3IQXA 2C1EA 1GPNA 1PWHA 1VRWA 4J0FA 3OCZA 2D2FA 2R6ZA 3FVTA 1I4EB 3FUUA 1SCUA 4CMIB 5ADWA 1ADBA 1B2RA 4LJ8A 1AHHA 1P61B 3AGPA 4FZJA 2IDJA 1H4TA 5EHZA 1OB2A 1OXKB 5DCUA 2GO1A 1UBCA 1O8BA 4GI2A 4C4SA 2A9KA 1QZZA 3G8CA 4RACA 1C80A 3PDJA 1OF1A 4JDUA 4Q15A 4ALIA 1XQVA 2PQ2A 3I12A 3Q6MA 2P3SA 2WG0A 5JY6A 3PXUA 4QELA 5EJ5A 1CWUA 2WHRA 4GFDA 3LGSA 4NIMA 3VZPA 3B6EA 3F6YA 1M2HA 5BNTA 4YYEA 1ZSYA 2HQSA 3R6DA 1KY2A 3CH7A 4DR2B 2VDPB 1XTVA 2P0YA 4MS3A 2ACKA 5EQDA 3NATA 5FFNA 4RA9A 1SG9A 5A5DA 3TTVA 4MQEB 3UHOA 2R6CA 1TOAA 1ULTA 1SB8A 2NVBA 2WMNB 4N8SA 1YBHA 4FYYA 3DJFA 1OV6A 2ZU6A 4QDOA 1IHXA 2J9FB 5IANA 3EZ6A 4EGJA 3L8GA 4KRYA 1DG1G 5HMLA 2WIJA 3QZUA 1KJ9A 4DV3B 4LMAA 4A0RA 5EIHA 3VFDA 2CFRA 1R6XA 1JL3A 4BNMA 1J70A 1Z38A 1LF0A 2ZAIA 3DCJA 2YBDA 4PX2A 4BGIA 4JKIA 3IULA 1I5RA 2VUTA 5HUHA 3UUWA 1K7SN 1XRPA 1IUKA 2NXWA 2Z6AA 4Z1OA 4Q6WA 4X66B 4IJVA 2ICAA 1SBZA 2HK6A 4JK3A 4XGKA 3DTYA 3RVMA 3SXJA 3SZ3A 3ZWWA 1O87A 1SVNA 1M34A 3PC4A 1LV8A 3CEPB 2JH8A 4M9CA 4WY2A 1X1QA 4LC9A 2AQHA 2XMQA 1Q77A 2C0QA 1C7FA 4IDDA 1G3IA 4G3XA 3SI7A 3WG9A 4U2CA 1ZNWA 3S7TA 4JNCA 1Y63A 3W2TA 2QR3A 3E5RA 2BCEA 1U0SY 2Q2NA 1LK5A 4DCMA 2V0GA 1XELA 2OP0A 1F8UA 3F5QA 5BVHB 1ZD2P 1DBPA 1HRDA 1ORIA 2LIVA 2XQFA 1MJGA 2Z4RA 3DAFA 3DJYA 3GLGA 4DA8A 2PUFA 3T7CA 1FS4A 1QO7A 3IX7A 4A1FA 4WFKA 1R6BX 1DXHA 1U8AA 4KRXA 4YCSA 3B89A 3ZVNA 5ALOA 1YS7A 1VDMA 3G0IA 4QUKA 4RV5A 1O94C 1YI0A 3I05A 4ETNA 1J6UA 4EF5A 3MB5A 4BO1A 5KNBD 5U9CA 4S04A 2JGDB 2XRYA 3FBWA 3SYKA 4YJGA 4GBMA 3IV9A 4IDHA 2PGIA 2EP8A 3BUSA 3QE3A 4BMCA 5LZ4A 1UBJS 1NNEA 4JL6A 4WOCA 2NP6A 1LUAA 5AQEA 1TF5A 2QGZA 3AV3A 4DPMA 4C7OA 1AGNA 1EP9A 1ZMXA 1THZA 3OLVA 5EP3A 1NUSA 2ZB8A 2VZ8A 3AOEC 3F3MA 4QXPA 2A67A 3IODA 2XI4A 4ESOA 4I99A 2PHZA 1Z8DA 2XYGA 4Q7QA 5KWVA 5DHAA 5DI3A 2AT1A 5E1OA 6NULA 5HZMA 4DNPA 2J0UA 3RRMA 1LTHR 3AUKA 3GDOA 4WASA 3JQ7A 1EXMA 3UM9A 3RSSA 3ZTYA 4IH1A 2GMWA 2A3NA 4IINA 5GZ1A 1O0BA 2H5JA 2R3SA 1STOA 2HSDA 2FPWA 2H54A 1RPZA 3A11A 3KQHA 2XT0A 4MKIA 3WP0A 4J4BA 5C1PA 3RRNA 5LDHA 4C2TA 1TKCA 1VG8A 1XTKA 3MCVA 1TCVA 4KSBA 1QRSA 1F9EA 3M89A 3MNFA 5JH7A 1HV8A 1Z37A 6REQB 5KNCD 3QX9A 3KU1A 4U5QA 3UNXA 4UNSA 5JI2E 2ZRKA 1BVYF 1C0PA 1TEHA 1XNHA 2DTXA 2GD0A 3TI9A 2P3LA 4MDYA 1N4AA 1RM0A 3W5AA 4KPGA 3DHNA 1MR3F 1ODLA 1RM3A 1VE7A 3KHTA 4P7GA 2XE8A 5TX7A 1DKQA 2QD2A 3ENWA 3WY9A 1F0NA 5FXMA 2OGUA 3LZ6A 1PL6A 3VZCA 2D5AA 4EECA 4M7PA 1DQSA 4O2AA 4U9IS 3WWZA 1F1BA 3AX6A 3B6IA 3G68A 1G6OA 3LBYA 3ZX4A 4JB3A 4F5WA 4ZCSA 1DQNA 2GNPA 4HQRA 3S8EA 1WMEA 1PS9A 1Y6ZA 4NLLA 3S2SA 5IN4A 3U3JA 3HUDA 1X92A 2F3SA 1FP4A 4M0EA 4BEBA 3RCBA 1QGED 4ZXFA 4M53A 1MJHA 3ZG6A 4OXIA 5B12A 2P11A 4I50F 1Y9ZA 2NGRA 3M6WA 4PG6A 4RWEA 2BBSA 1V3VA 1SVUA 1KOLA 4M54A 4NU5A 4GKAA 4IG9A 2I22A 1ORTA 4D02A 3CLRC 4L75A 2FEAA 1XWFA 3RVDA 5CW2A 1OXXK 1XMOB 3OTHA 1ZD5A 1SA0B 4UEJA 5GJCA 5HIIA 2C92A 2OORA 2VAWA 3NGXA 1RWVA 4TTPA 5FA8A 3FTPA 2AI3A 3UWOA 2H4HA 2PL5A 1H9AA 3OF2A 4NICA 3U26A 3WNZA 3WYGA 2WWRA 2H11A 2QIOA 5ALMA 3VC1A 3EZLA 1NBAA 1UP7A 3EISA 2ISSD 4DDVA 1ZRMA 3IUQA 4JB2A 3PEUA 3K6RA 4ESVA 3A4YA 3KP1A 4S2UA 4PVCA 5IAOA 3KTOA 4A36A 1VGQA 5EJ2A 1S8NA 3I34X 1EH5A 2PMCA 3PLRA 1KTVA 1MDBA 4LF6B 4J6EA 1NTOA 1PD0A 4YDQA 3WLQA 2DR0A 1J8YF 1OYWA 3NEJA 5FNZA 1JG3A 1LWNA 3RK0A 4YRDA 2OQ2A 1RAAA 5FPPA 5DYNA 5JYEA 3TKLA 3KJEA 4F9TA 3LKDA 2GD1O 4PIPA 1AUQA 1V9SA 4UM7A 1H8HA 1TI7A 3RIXA 3RM3A 4DLWA 1TIBA 3JQ9C 2CHFA 4PSVA 2HMTA 3IQFA 2ZYVX 1U6KA 2NO9A 2G82A 1L7MA 3OU6A 4MVJM 3VYVA 1L4MA 3IQEA 1G64A 1A2OA 4FUTA 4GWKA 4ZAXA 2H2HA 3IIMA 5BN4A 3INNA 3KVVA 4Z7OB 2XT6A 1IDOA 4KLAA 3MXOA 3SAJA 3R9XB 3WGIA 3Q98A 5JS7A 2UUBB 3W04A 4X6UA 3PUWA 4BLWA 3BWEA 4PX5A 3PJEA 1AQLA 2XLCA 3IEXA 2G04A 2P40A 1CLUA 1R0KA 4IZHA 1W5EA 2KS6A 4JJFA 1DIBA 3BMQA 4OIFA 1CVLA 5A7FA 4W5OA 1MNAA 4FVTA 2ZBPA 2J3LA 4KYIB 5J4HA 3N5CA 2WTBA 2OEPA 2DP4E 2NTNA 1BD3A 3FNBA 4HTAA 4DBLE 4ZZ0A 6ADHA 1MZPA 4C21A 4DR1B 3PUXA 1O6GA 3EEYA 4TXLA 1YRYE 2G5GX 4MLDA 5CH8A 4DIFA 1CQIA 1QOQB 2CLCX 2Y9MB 4IOKA 5E8RA 4QG3A 5K8UA 3H7IA 5CM9C 2QG9A 3R20A 3T06B 3J81A 4XDHA 3WQQA 3K6SA 4FKBA 4I3GA 1PG5A 2AVNA 3RS2A 4BLUA 2GM3A 2I76A 3S1AA 1Y5IA 4EHFA 2LP4Y 4HGPA 1NVWQ 4DIEA 3JQRA 2VXOA 3FHLA 3KSUA 1VHDA 4KQXA 5EEHA 3Q7RA 4ZYTA 2L0XA 3EGWA 5J58A 1EE2A 4JI7B 1X1TA 2BHSA 4MCAA 3EEBA 3CCFA 3TLGA 3CX3A 1HK7A 1E7WA 2FPMA 1P5ZB 2PGJA 1B8PA 2Q45A 1Z2NX 3L0YA 1C8BA 3MTIA 1J9EA 3MRTA 3OPXA 5TSDA 3C16C 2ODNA 3A6DA 1RE1A 1PX0A 1MB4A 1W5FA 1RR6A 2WNSA 3LOQA 4L3VA 1HT3A 4Q7KA 1BDJA 1FOEB 2HXSA 4JJAA 3TM4A 1ICEA 3TL3A 1SUAA 3QVSA 3HV0A 3HKDB 1PVDA 3WYEA 2IXBA 2Q28A 3G6WA 1QIMA 2IDKA 1Z0JA 4OLAA 5TVGA 5LOVA 3PGVA 2JC3A 5AM2A 3FM9A 1E4VA 5JWHA 3ADDA 1SG0A 2O57A 4J90A 4J1NA 4G41A 3P19A 3H75A 4UAVA 2AOUB 5LMUB 2FR0A 1A9PA 1L8OA 4FUQA 5A5EA 2X0KA 4Y2JA 4QXOA 2JCVA 2J4FA 3R3SA 1II8A 1WS6A 3EW9A 3W5JA 3RYHA 3ET4A 4HSGA 4LRQA 1EAYA 4WACA 3DKKA 3KLMX 2GPTA 2Q7XA 3UJ3X 3KOXA 2OGZA 3T9BA 1IY2A 5EXXA 5L3SB 1HOTA 2HWWA 1IJEA 4HUJA 1JQ5A 5CIQA 3G3EA 4FS3A 2J0SA 3W4JA 2Y0EA 3OMWA 4YJ2B 5CA0A 1AS0A 1W36D 5AJHA 1MW9X 3VR2D 1XN4A 2DH6A 2C5BA 3H0EA 3HKCA 3OJEA 1E5DA 1T5TA 1Q95A 3PDIA 3UJ7A 4RGYA 4KO4S 4HAXA 1JKJB 1ABEA 1O58A 2ZRIA 5FR1A 1YE8A 2EDAA 1ADJA 4CHGA 4C22A 1IHOA 5TPZD 1M9NA 5AICA 1O6CA 1QIGA 4FILA 3ZQUA 2Z57A 1YL7A 4L3OA 1P8AA 2YWEA 2ODEA 1I01A 3K7EA 1P1CA 1FSFA 3MS2A 5EZYA 3ZJ4A 1FLAA 4HEHA 4NMXB 5DT9A 5ULLA 1QQAA 1EVKA 5SYMA 1B73A 3H2IA 3QNWA 1JFVA 3L3BA 2PSDA 1EFAA 3NKFA 1KC1A 4ED9A 1RYHA 2C2GA 1RBMA 3L49A 1IPEA 3UWMA 2ISQA 1TYEB 2INGX 4LTNA 2IEZA 3RK1A 2LRHA 5I9NA 4D3FA 4MI3A 3CVVA 3GGOA 1ZJ5A 2JK0A 1XNJA 3UJBA 1QHEA 2IZ1A 1YDGA 4TV9B 2AHRA 4WK4B 3EPHA 1E3LA 3EXFB 2GZ3A 2VJYA 3DLTA 3PQDA 4BP9A 1CJCA 2D2EA 5ED0A 1ZESA 4JB8A 4Y98A 2K87A 1GG5A 2UVDA 3C3MA 5K2MA 4H7FA 4MUEA 4UOEA 4MCIA 1E2QA 3PWTA 4Q1FA 2JLUA 3M3HA 4IW3B 1JKIA 3QEBZ 1B42A 1NYLA 4I4TF 1QFMA 3G0HA 1TPYA 1SIUA 2BM1A 2GJKA 3AC0A 4LMRA 2ORED 3WLOA 4E4RA 5CIYA 1YRBA 2VCEA 5KNBH 4ZGBA 2HLPA 1DIAA 1R5OA 5H1YA 3NGMA 3SIXA 2HL6A 4WNYA 4KXMA 3B5IA 1L2TA 4KSYA 3UATA 4CIWA 4KTTE 2PX0A 4IJUA 3NIWA 4YT8A 2QTGA 1E59A 3K70B 1VLZA 2G8NA 1EM6A 2KMLA 2ZJ7A 4FD3A 3BQMB 4WRRA 3WVNA 4E4TA 4P98A 1M6WA 4GLOA 2X9LA 3E22A 2GAOA 2H4WA 1T9BA 3W7BA 4LC0A 3MERA 4R9UC 1HYQA 3C39A 3WIBA 1ZN9A 4C4PA 3LKZA 4NJEA 3OZDA 3AU9A 2IU0A 4GXQA 2PH1A 2EFCB 4B7CA 3D8SA 3N86A 4MK4A 2PCJA 4KE8A 3JD4A 4N6OA 1EPUA 1ZLYA 1U63A 4PYNA 3LDFA 5JJIA 1YVRA 5E4TA 5KQGA 2EF0A 3NU1A 3QX8A 2G67A 3PBKA 3VR4D 5EHNA 4CKWB 4KR6A 1L8QA 2XADA 4JUCA 5SZIA 3EEOA 3U4AA 3GT0A 1GNQA 4Q3DA 2APJA 3JQ8A 2PUAA 3WZLA 1G21A 4MO9A 1S96A 4D99A 4F4FA 3MUOA 4BU0A 5DNEA 5HFNA 5FHRA 3C3KA 1GPKA 2FK8A 3O8OA 3KQLA 1XRLA 1P1IA 4RL6A 3K70C 3DTNA 2Y66A 3UAZA 3VR4H 1VG1A 4E08A 2DKNA 2VYQA 3KPWA 1JE0A 1EX7A 4CFZA 1KQPA 1NRJB 3UFBA 3K0FA 1DMRA 2WICA 3I9KA 4Q9DA 3R7DA 1US8A 1JEEA 3D0QA 1PGQA 1Z45A 4FZRA 2B1IA 2Z5VA 3U3RA 4FGZA 1XTPA 3HRHA 2JHAA 3ZOZA 2ZJZA 1IDN1 1ZOOA 4QYTA 4EI2A 3DWEX 4IX1A 3DNPA 4WNAB 2CHQA 4K9SA 4F1KA 4GVPA 3LQ4A 1NL3A 5MGBA 2O5CA 3EAFA 4BPRA 4KX3A 5HTOA 3PXBA 2P5TB 3CFYA 4HCJA 4YAJA 1E1QA 3FTNA 5ALJA 4RIIA 5JQGF 1RQ2A 3FKSD 4LXGA 3WSTA 3KSDO 3PC8A 4GNKA 4O4JF 3ZE1B 2UYOA 1I7NA 1TKBA 5CB8A 4YRJA 2OWEA 5BNIA 2CJFA 3TE7A 2B98A 1TVMA 4BJ6A 2E3JA 5C8YB 4FKMA 5LIPA 2BMDA 2VRWA 1IQ0A 4PFQA 5J5CA 2CFSA 2QJTA 4DIKA 3OTGA 1JAHA 2JFVA 5JZ9A 4CMCA 1RXIA 2E1PA 3B1KA 3GZNA 3QKSB 4GP7A 4LSWA 4W8HA 1FUUA 2XUIA 3W5HA 4LYAA 3OKFA 3W8NA 5F2OA 3D7KA 4CMKA 3AY6A 1JP7A 4MLCA 3E3MA 1YFLA 3BA1A 3DD5A 2YWFA 1KS9A 4NBNA 3IMEA 4Y9TA 2VNAA 3V8RA 4TT8A 3JX9A 3W5IA 2HJVA 3QPWA 5TARA 1JDUA 2VHEA 4P33A 1DXYA 1NW8A 1OXTA 3MAAC 1SWWA 4YCDA 5IJ9A 1Z13A 1D8AA 2X22A 2BWJA 1OKKD 3EGXB 4AO6A 2QTCA 4HTFA 1XOIA 2SCUA 1JVNA 1V37A 3FZGA 3HB7A 2H1LA 5GIOE 4ZQGA 2R0QC 2CKMA 4F2DA 1YHNA 1HM5A 3NNSA 1CY1A 1HXHA 1DPFA 3LWBA 1BE8A 5AW8A 4ESHA 1KNXA 3S6JA 4DBLC 2P9ZA 4IMIB 1D2AA 4QGFA 2WHPB 4HWRA 1GAQA 1EXVA 3KQMA 2V3VA 1ZGBA 5DTQA 2DWQA 1Q2UA 1TA4A 4BCBA 4NC9A 4WZAA 4D9FA 3GLIA 5EJMA 5JZBA 2QRPA 3W06A 1M74A 4NXNB 2PT5A 1FK8A 5AW4A 5AW1A 4IIFA 4XIFA 2R86A 5KOHB 2FSVA 3CNHA 2F64A 3I3OA 1KARA 4I1IA 1YJQA 4JWKA 2RHDA 3FYCA 3X0DA 2C42A 5ALLA 1CS4C 4OAPA 3HXLA 1A9YA 1ZJ6A 4DR5B 1RCTE 4XOIA 3Q12A 5HM6A 3W1VA 3VV3A 1NN3A 1Y37A 3E82A 4GLFA 3ZDYB 3FPLA 4MV8A 3E2PA 1G21E 4ZJPA 3DZ8A 3FJOA 3DDUA 3WK7A 4UPEA 2PWPA 3L43A 3RC1A 1T2EA 3M5DA 5HE8A 3DO8A 4CVNA 2NO1A 3IP1A 5GOZA 5BSFA 3U16A 1C1DA 3N2EA 5E4YA 4EZIA 2QRKA 4XYGA 4K9QA 4F6CA 3AF5A 4KL8S 3JZAA 2XZTA 3MJDA 1JGTA 2ZR7A 3AESB 5FOVA 3TRFA 2I1LA 1WB4A 1Z4OA 3EE6A 1KJIA 4C4OA 2GJAA 1WW2A 3VU9B 3TF5A 3CM0A 3ROQA 4V0NA 1ZR4A 2IBTA 1LDMA 3GRFA 1AO3A 4B45A 4JGBA 3OLQA 4ER0A 1WHSA 4OIMA 5KCZA 5G02A 4US2R 4JI3B 4M83A 1RPJA 2EX1A 1DI0A 3SZUA 1MB3A 1FFXA 1FJ2A 3NIDB 4EG6A 5IVKA 5K05A 1T1EA 1K7FB 1MD9A 2FCAA 2IS2A 3ND9A 4INJA 1OW3B 1WPQA 2D13A 4O5AA 2DJ5A 3CF4A 2DECA 1J5PA 1U0HC 3OOEA 1WQ4A 3FPKA 1O77A 3O6VA 4HB2A 4B3TB 2VUSA 4L76A 5AI9A 2OBXA 2QR2A 4JC5A 4RNCA 3M49A 3QUQA 1KH2A 3IVGA 1AKRA 3AP2A 2IYNA 3FDXA 1ACMA 3U4MA 3FLMA 3ZOKA 4F5DA 1N7GA 1KP3A 1QHHB 1QYXA 1JR3D 2B6NA 2PGAA 2YIMA 4NCIA 4ZANA 2JZCA 3FHOA 1R0RE 3AY7A 2FPLA 4MQFB 1V6AA 4WECA 3E03A 3RS7A 4BWGA 4K9PA 2BUAA 5JNUA 4QM6A 3K9GA 3WJ2A 2BBWA 3ETLA 1GZUA 4LYEA 5JZVA 1DJNA 1LX6A 2PSEA 2RG1A 3Q8LA 3I42A 3SK0A 1KEPA 3ET5A 1GCUA 3ESAA 4IRUB 4X6YA 4Y6LA 4F97A 3OM0A 4P5EA 1GXSA 4MYCA 2POCA 1JIKA 1HNWB 3W2EA 2A14A 2C03A 3OICA 1M1NB 4NARA 1EIWA 5CU7A 1H3NA 1OI4A 2P2LA 3C1OA 1UBLS 4RHFA 2OHFA 1VYTA 5DM2A 1R0SA 3FN4A 3AP1A 3HJRA 1A5AB 1I3OA 4YQEA 3DEZA 2FRXA 3BAFA 3KCQA 5JSZB 4UMVA 1EFPA 1A04A 1HC7A 5IC6A 5D85A 2ECOA 2GO7A 1IH8A 2C7RA 3N2YA 1HFWA 4YMGA 1TNDA 3OD5A 3HN6A 4BQPA 1CDOA 2ZCUA 4IIJF 1ORHA 1DL5A 2O50A 4DUGD 4AMVA 1X15A 4P2GA 2UDPA 2AYXA 4HLQB 1X7DA 2D3WA 3UPUA 3Q3EA 1AGRA 3PB3A 5F23A 3MMPA 3OJWA 2H9AA 3TW8B 2A57A 4CMJA 5C35A 1UF9A 5CYOA 1D7OA 1N7IA 4GNRA 5ALUA 4BV8A 2DLCX 1ISGA 4CMBA 4PYKA 2I7VA 5LLDA 1OFGA 1WZIA 5HW0A 3DZHA 2OFWA 1U2QA 2AX4A 1UMBA 3C8MA 4D92A 2DSTA 4DJAA 1ZINA 4G25A 2EYQA 2FSFA 1WZNA 4IXWA 2GPWA 1JZSA 2C57A 2PZKA 2WZDA 3GZNB 5AI5A 2R66A 2CT8A 3TXYA 2J6IA 5EMLA 5THKA 4W9NC 5BW8A 2XEXA 4MVYA 3A4IA 2QNIA 5UKDA 3HJNA 1C8VB 1JAYA 4MZXA 4C4YA 3U1BA 1W25A 4J1TA 3C3CA 1RHKA 4YUZA 2AC4A 1RIFA 4UXJA 4ENSA 3RAFC 1ZNQO 4QIHA 2I5PO 3A9VA 1FTNA 5JY1A 3AWIA 3ICEA 2MJLA 5ETJA 3CVOA 1W5AA 3CUKA 4GM0A 4RIEA 5FQNA 3GVXA 1T5LA 3C1AA 4TQGA 1KOGA 2O3UA 3GLHA 3R9XA 4OO3A 4C87A 1LRKA 1MP0A 1SVLA 2IUTA 2W2KA 1QIHA 3KB2A 2NOAA 1BOFA 2XE6A 1OASA 1QB7A 3DF7A 1N2CA 4PXAA 3T7EA 3WGHA 2IUFA 2Z6UA 1QK4A 1YFKA 2XHEA 3R0JA 4OG2A 1HI9A 3H9QA 3KUCA 4Q4HB 3U7QA 1DBVO 1JVBA 4PG5A 1BVRA 2QPAA 1VL0A 7ABPA 1H6DA 4FB4A 1BS1A 1IZ7A 2WD8A 1E5LA 2R84A 3F78A 1AZSC 2XAAA 4BKOA 2EIHA 2FWBA 2RH4A 1IB0A 4R01A 1SKUA 5JFTA 1UEXC 3SFTA 1IY9A 4MCJA 5E7IA 4PZCA 1U1CA 4PLTA 4KPEC 5A0FA 3UOWA 2PR2A 4DLSA 2A0XA 3PNKA 2XMRA 3ZW7A 4DLTA 3RIYA 2GARA 3IAXA 1RQNA 1FMCA 5D6OA 5CT6A 4BNJA 2FEWB 3GRCA 3DHYA 4GLBA 3TEJA 3SR3A 3HVRA 4LXTA 3IT0A 3OPYB 4FYWA 1SNYA 4W1QA 1JU4A 2FN4A 4F38A 2HZBA 1L7VC 2GZMA 4F7WA 3CVUA 1LBQA 4UM9B 2OMEA 5FTLA 3RB8A 1KERA 2Q62A 2X5XA 2ONJA 2XB9A 2A94A 1F5NA 4F6RA 4KGDA 1CTQA 3K9FC 5F98A 2FW9A 1X7ZA 2FMTA 2Q1WA 4MJLA 4ZZ2A 4MR7A 1EUDB 1MG0A 4I4CA 5FX2A 1SA0A 4YQFA 2BRUA 1SHLA 3GLIE 1KRHA 3QMWA 4AKTA 2XMGA 2P91A 2XVXA 5D3KA 4F3KA 1OLXB 3RS8A 2RMKA 4PGAA 2D00A 1HSZA 3R2JA 1SAYA 1WUKS 1UQTA 1OI7A 1VIMA 3A6KA 5AM1A 1KYXA 1E60A 2OXCA 4KMOA 2IYRA 2JJ1A 4NDZA 4LDJA 1DV1A 4KNYA 5A0VA 5F51A 3GNSA 2HPAA 3EXFA 3QY9A 4L08A 1N2EA 3E70C 4LN1A 3KOMA 4G67A 4L78A 3C8DA 3THYB 3E3LA 3D4PA 2SKDA 3NYRA 4E1VA 2RHHA 2DYKA 3L8CA 4BMSA 2BM9A 2COEA 1A4UA 3JVDA 2AHOA 4ZAGA 3ECSA 1H3EA 4EGFA 2B8EA 5EE0A 3LP8A 2X41A 3GI1A 4OBBA 1JR6A 3LUCA 1XSEA 4L22A 2WUEA 3QY0A 4KHZA 4EA6A 2IX3A 4NAVA 1SVKA 1O94D 2IHJA 2QNBA 2I65A 1K5GA 1D6JA 3ESQA 1GADO 3R09A 4FBLA 4NNPA 2I1VB 2YJGA 4O4LF 4PF1A 5ANRB 4RTKA 1BYUA 3RUHA 1Q7EA 5DZSA 3W77A 1P3Y1 3NHFA 4EARA 3VO9A 4LWPA 4IJ6A 2Q9CA 4RESA 1EJBA 1YRHA 2QWXA 3KALA 2O06A 3HUEA 3KPJA 3HY4A 3PSHA 1ZC3A 3NGLA 1GTL1 1PR1A 3QG1A 4KAAA 4Z3DA 3RUDA 3FNQA 2QTVB 4QHSA 4DHWA 2Q0QA 2E55A 1J22A 3R0ZA 1XD9A 4OI0A 1PN3A 1QYCA 1COWD 1UBGA 2QN7A 4Q1DA 2D6FA 3SJUA 1K5HA 4NV3A 1NW7A 1D6MA 1WSBA 2QI9F 2O3QA 5JSZA 5KWIA 3TX2A 4A0QA 3FRJA 4DC1A 5KKCA 2BMWA 2IVFA 1VLMA 4LHSA 4RTSA 4E46A 1SVSA 1ZL2A 2E49A 4KMMA 4OJKA 4QQKA 4ZQCB 5EP4A 4RKEA 3UW3A 5AW2A 3HJHA 1XPUA 5HGJA 3OQBA 2ZSBA 5JDIC 3G79A 2M1XA 4W7HA 4JYBA 1G8KA 3WK6A 2BTEA 5MN6A 5ECWA 1VDZA 1JLSA 1X74A 4EG1A 1ESEA 4HAVA 2DBRA 4WUVA 3WZMA 1FJXA 2RGUA 2XNSA 2WQ7A 2WJWA 5CB4A 3HACA 4EHDA 1K75A 3BB3A 2WSLA 4D9GA 1EUCA 2CCGA 3VVCA 3FDZB 3UAGA 4CCYA 4BEJA 1T36B 1LY1A 1S9DA 1CP3A 4LQ4A 4ARCA 3LE8A 2R6FA 2B2NA 4HZUA 3V6MA 1USVA 4B3FX 2FUG6 1R3DA 1IEVA 3GEHA 1KDTA 5JLAA 3RDPA 1JEYA 1X70A 2CUKA 3CS3A 3FR8A 4Y1RB 3RODA 2XUZA 5CVDA 2B61A 3NWBA 3PT9A 1S1MA 3KZ1E 3BQ9A 3KZOA 1SOMA 3DAOA 4ZCIA 1BCSB 5CFNA 1G9XA 2AMLA 4M9QA 5T3YA 5K20A 1PKXA 3FHTA 4DLYA 1KTIA 3MIZA 2C7BA 5AXDA 1CF2O 2JF0A 4A2CA 4OKIA 5EP1A 5D51S 3E9CA 1WXDA 1AKUA 2HNAA 4I46A 1XTZA 4KQFA 1C3EA 1CUHA 1BRTA 2ZVPX 3IV6A 3VJLA 2V6FA 3B6MA 1RZRA 5EIBD 3LECA 4MP3A 5CUQA 1Z6XA 4ZOAA 2QZZA 8LDHA 3HN7A 2WF6A 2V7TA 3D0KA 1TT5B 4OB6A 1FS6A 4U1RA 3P9ZA 5EUMA 3Q0IA 5K3DA 3E8XA 3IMCA 1TZKA 3QBJA 4UXIA 5DGXA 2EKDA 3S29A 4LBWA 4DCPA 5E3IA 1KSJA 3I4CA 4EQZA 3DMNA 1NVBA 3U4HA 1ABBA 1NBMD 2GK6A 3ROMA 4X62B 3G9QA 2ZZMA 3QLTA 1VLLA 2GWHA 2GVZC 2WU3A 1ZSVA 3HR4A 5DWDA 2OFOA 2BD0A 3EJWA 1T6YA 4RK5A 1PJSA 3L6UA 4UBMA 3LT1A 3CR8A 3KK0A 3HHPA 2BFPA 3PUIA 1QGDA 3LOUA 5J2UA 1QVZA 3CPEA 3BCSA 5LCXA 5LQAA 3V4OA 4TLCA 2H0QA 2H2GA 4B3JA 2R97A 3LW8A 5C46F 4FFNA 3ZJ5A 4LGCA 1C8LA 4BMZA 4ZOLA 2YWXA 3K1ZA 3RASA 4K3VA 1M1YB 5LVAA 1R5JA 1K8QA 2CB9A 3L1JA 3K6SB 1EXDA 4GU5A 4YFVA 4DC9A 1RHJA 1RYDA 3PC3A 4FGSA 1CIPA 3K6KA 3MPUA 4G0YA 1TUIA 4LY6A 2IEBA 1JHYA 5DM1A 1RKVA 1K27A 2JCBA 3KM0A 5FF9A 3TNFA 2D5BA 2WF7A 3FVVA 121PA 4XD7A 4AJIA 3OUUA 2RIPA 3P5SA 4LHEA 5CYGA 4I9GA 4ZT6A 3H1TA 4OI4A 4YRNA 1MVNA 3GXOA 4JFRA 2WJ3A 3DFZA 5DM0A 1AY0A 4G56A 1VPLA 4YMWA 1W36C 1L7DA 3TIVA 2BFBB 3VR5A 5JOQA 1SQ0A 2G83A 1T10A 4HWTA 4ZRMA 1P2TA 2PMDA 1LPBB 9ABPA 2CJXA 5JD5A 4R69A 1SRQA 3NHWA 4F93B 2ZRLA 4M46A 4RJ2A 3GLFB 3AM1A 4CLEA 1ULZA 2VBGA 4QDXA 4ZVQA 5KYUA 1PNRA 1S3GA 2CKDA 2FPIB 2F1JA 1AQ6A 4CM9D 1HNNA 3OCYA 3AERB 5AI6A 3FF1A 3OQJA 4Y6RA 4XSVA 1IY1A 1ZUIA 3PQ5A 3AF0A 1AJEA 1T3HA 2BHTA 3JYHA 4CMGA 1EYZA 1GEGA 1NMSA 1Q1GA 3DV0B 4UMFA 3IAM1 3ZU3A 1HYBA 1JFRA 4F3RA 3F9RA 2HA7A 4RLQA 3S1LA 4QPCA 1I3LA 5LFAA 3E61A 3ZEIA 2P0EA 4MIOA 1X2EA 1PTKA 5F5LA 1G1AA 2IUSA 5IBCA 2Y27A 1FL9A 2O2CA 4G9GA 5I8PA 3G0BA 2CD9A 2GAIA 3ED5A 1XMVA 3F6EX 3UK2A 5C37A 1DKNA 4QGAA 3PNQA 1UEJA 5IKMA 5JNVA 2M32A 1U3CA 3GJXC 4ZI7A 2PJUA 1E1CB 3IP3A 1HE8B 4TRRA 2XJ9A 1K9VF 2ZIVB 1H3FA 2PVCA 3EZGA 3VR6D 2VPYA 3NONA 4F2GA 3N7UA 2PBRA 5E38A 4XDGA 2VSNA 1SCQA 3S4YA 4D44A 1SIWA 4K40A 3CBGA 5F4BA 1IWOA 2J5QA 3BIJA 3EB9A 1T0UA 4LGVA 4PAWA 5CAEA 3BXFA 4MRMB 5FPKA 4WN9B 4WBNB 1OI3A 1V5GA 3PF9A 3NV7A 3UWDA 3O8OB 8ADHA 2A5LA 1B0AA 4YAUA 2YHSA 3GB9A 1HKHA 2IFTA 1THTA 5EE1A 3AWDA 1U3GA 2EW2A 3BN3A 2DB3A 1RAIA 2XDAA 3BMNB 3JARB 3LHDA 5ALWA 1ZQ9A 4Z53A 3UMFA 3ETDA 2GZ1A 3JQ9A 4RC9A 2P41A 5B36A 1JEYB 5LOVF 3DFUA 1BJKA 1Y5LA 3NWPA 4HGYA 1OQAA 3H19A 2G0AA 1G7SA 3KYJB 2R1UA 1CY8A 2H65A 2AFHA 3OU7A 3CZRA 1K0FA 1HLDA 1CZOA 3F6PA 3WTCA 4G63A 1FRVA 4MWZA 1Z8HA 4QU8A 2V7GA 3LV8A 3BDVA 4BJ3A 1UZLA 2M6SA 1CY4A 2C5HA 4INZA 4KE6A 5K8IA 1SUWA 1SZJG 5J5VA 4AYTA 2O2SA 3EARA 1FRNA 4WJKB 3F7TA 2YR0A 3CUUA 3T1OA 2PLNA 3BPSA 1DO8A 1TFUA 1ULSA 1ULAA 4BWVA 1ULHA 2NZJA 5B58T 4BLRA 2ES4A 4R1SA 2IXTA 3TYXA 2DULA 4L16A 5KX5A 1DFHA 4JP5A 1XPJA 5J1TB 4CUKA 1MAUA 3N2IA 3DDNA 3O4GA 2HF7A 1T6XA 3LMKA 4MW7A 1NJ6A 1B93A 4U3JA 2EJVA 2GKGA 5M3BA 5CD9A 1SJ9A 5FKJA 5A9TA 1JT9A 1AQYA 4N7MA 1W96A 1SQFA 3CVWA 4O4LA 4CM4B 2HJSA 3OZGA 1AU9A 4UTVA 1EEXB 3KJHA 3AIOA 5FI1B 5B1EA 2CL0X 2Q2QA 4KFRA 3EQZA 4UTXA 3T9AA 1P1FA 2AZTA 1YMUA 2OHHA 2E37A 3JR7A 2Q5QA 3PRYA 4TTAA 3RVBA 5B6JA 3KKLA 1V11B 4M0DA 4Q3KA 2BFEB 3SX2A 2CK3D 1EAMA 3JVEA 3OLWA 3WLLA 3ZHYA 3S2IA 2Q0SA 2QA5A 5K2OA 1U8UA 1Q21A 2PAAA 2C4VA 1OA0A 1YQEA 2I7DA 2J0QA 2WTAA 3UT6A 2GZHA 3DOFA 3RWOA 1SXJE 1J49A 1M5UA 4D0NA 5LP6A 1F2DA 2HD4A 4UFNA 5B4UA 1G7RA 3L1KA 5SZJA 1E7MA 1TCAA 3KG2A 2PX2A 3K1AB 5EKTA 3SX4A 2YXNA 4J7XA 4EP1A 4YIHA 1WETA 2DQYA 3MJRA 3QVMA 4TQUS 3RT9A 4MVJH 3WADA 4D81A 3ZZMA 4E5SA 2B1JA 1M33A 5C0OE 3SF8B 3ZNNA 2KJQA 5JNRA 1P17A 3P20A 1GGMA 4HRXA 4ZZIA 4MICA 3QXSA 1H93A 2E5FA 3LHFA 5AIBA 1Y3AA 1Y6JA 1CUVA 2FG7C 2ZRDA 4WVLA 3U48A 1B8NA 3WSVA 3B2NA 2NUTA 4E2WA 4D0LB 2XTZA 3A28A 1UJMA 4IICA 3CX8A 1WTCA 1G55A 1OFHA 4XGNA 3WAKA 4A5SA 1ZD1A 3LSYA 2AH5A 1VI6A 5REQB 2I34A 3AM3A 5DOVA 3MJTA 1U8CB 4JH0A 1HNXB 5CB4F 1PJRA 4FINA 3VNUA 4WLUA 4RULA 1DCMA 1F2TB 1OBFO 2ZRMA 1XCJA 2X76A 3IHWA 1T5BA 5H9VA 4BWYA 1E63A 2LDXA 4L2IB 3ROPA 1PWYE 2GYWA 1ISSA 2VJKA 2B83A 4OQXA 5J5AA 3KBBA 4ZVKA 4DQDA 4KAFA 4K6GA 2XZDA 3ZIAA 2D2XA 1Y9DA 2JAWA 3RS3A 3BMXA 1VC2A 3CUVA 3HLTA 1MV5A 3P9NA 3IQGX 3Q9LA 3M83A 2V7VA 1GN8A 3MBOA 3QWIA 3E3NA 5D87A 3SQLA 1IN1A 1K63A 4L5AA 3D6TB 4L4YA 3C3WA 5TV2A 1KZ9A 3HGQA 4M8SA 5CLGA 2F59A 2QTMA 3FLBA 2ODBA 2DY1A 1TMYA 2YVQA 4QFBA 4MWOA 2JGRA 1KMMA 3C97A 2QLMA 2ZYTX 2EZTA 1BMFA 3CH4B 2WUVA 1QGYA 3L6BA 3NTRA 4F96A 5HR5A 4DB4A 5NULA 4DLPA 3WKEA 2JFYA 1KU0A 4YBZA 3F96A 1O9GA 4Z4HA 1PT8A 1NRIA 4IRXA 4YWJA 4ZV7A 4ZA2A 4JMLA 2KE5A 2AF3C 4QHTA 1UK8A 3LY5A 4CYMA 1J25A 4W63A 1W9MA 4MS4A 3DA8A 1H1DA 4RHUA 3SP1A 4M1KA 3U4IA 4LHYA 2GX6A 5E6RA 3AU8A 3O7WA 4CQMB 4BVGA 4DJFC 2DKFA 4PZYA 5CCDA 1EUQA 3W79A 1LS6A 4LJKA 2GILA 1CUEA 4TMWA 3O8DA 1R8SA 3Q3IA 3ZJYA 2JJ1D 4F5YA 1YASA 3ND6A 4JXJA 2QXUA 4KW7A 5HFJA 3TK1A 4TYMA 1EKXA 1HLGA 1XVIA 2F17A 1LBIA 2VDKB 3KIPA 4H1WA 1BDHA 4J4HA 3MHTA 1SVOA 3RANA 5LSAA 4UBOA 1EB8A 1QXSA 1I4LD 2RI1A 4BMOB 5HGXA 1DG3A 3HO1A 2MSEB 2RI6A 1JJIA 1H0HA 3EG9A 2Q4DA 4P9NA 3IQDB 2JASA 4Q5IA 1EFCA 3KQOA 1JA9A 3IQHX 1I5EA 1JYFA 4KQMA 5GVRA 1W44A 3L4BA 2H0AA 2QL9A 2QM7A