2IHZA

Crystal structure of multifunctional sialyltransferase from pasteurella multocida with cmp-3f-neu5ac and alpha-lactose bound
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
388
structure length
379
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSALNNPYVKVMRRLGIIDESQVIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-2,3/2,6-sialyltransferase/sialidase
publication title Crystal Structures of Pasteurella multocida Sialyltransferase Complexes with Acceptor and Donor Analogues Reveal Substrate Binding Sites and Catalytic Mechanism.
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Transferase
total genus 134
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA01
2IY7A 4V39A 2EX1A 4R84A 2C84A 2ZWIA 2IHKA 2IIBA 4V3BA 4V2UA 2IIQA 2IHZA 2IHJA 2EX0A 4R83A 2Z4TA 2II6A 4V38A 4R9VA 2ILVA 2C83A 3S44A 4V3CA 2IY8A
chains in the Genus database with same CATH superfamily
1HDXA 5M5BA 2Q4DA 4XWTA 1C9DB 4MEAA 3KZNA 2XNKA 1JMKC 2O7QA 2FRDA 2XWQA 4YMIA 3IPCA 5DBOA 4O2AF 4OFWA 5FQOA 2ZB2A 2VK2A 3KQTA 2XGJA 4AP6A 4CM3A 1XJ5A 3R77A 3RS9A 3GCDA 3OI7A 4RTSA 3RHTA 5JZMA 2XPCA 2I6QA 2TYSB 5GMOA 3KOXA 4TWRA 1A7KA 3ECCA 4I1IA 3OPYA 1AKQA 4QE3A 2H4FA 2GD2A 1CC1S 2AQHA 3HJHA 4YJHB 5G02A 1IHOA 1OZ0A 3B85A 2XUAA 3ZWWA 4A0RA 2XKJE 2O2CA 1JP7A 3IJPA 3LH5A 3UA3A 3BB3A 3D4IA 4P5DA 4XLTA 2BTEA 1RJ9B 4B4DA 2A67A 3ANLA 1QOQB 2AHOA 3B6ZA 4HQFA 1HZJA 4A8JC 4DBLE 5HA5A 1DIAA 5AW7A 1VB5A 2JAQA 3EIXA 3LX6A 1ZLXA 4EA6A 5J4VA 1OVGA 1ZNWA 4WINA 1YNSA 1AQUA 4X60A 2IBTA 2PA0A 2FN8A 2BFBB 3NCHA 2QD1A 2I7CA 4TMYA 5AK5A 3U0BA 1ZD4A 2MSLA 3KX2A 2G5CA 2RCYA 3PRYA 4G1CA 2ZB4A 1K66A 4BVEA 3NHPA 4EABA 1SWWA 4OHOA 4LWPA 1U8YA 4YFVA 1VCOA 4BB5A 2INGX 3K7EA 4QEZA 5AW1A 4E03A 2IXAA 4LPSA 3CT4A 4LXGA 3NKLA 2FMIA 4H3VA 2WAOA 4BXOB 1AX9A 2G17A 4RPKA 4NBLA 3B36A 4PBSA 2BEKA 2WJWA 4QO8A 1N5JA 1SQFA 1FLAA 1RFLA 3N28A 4IEFB 5AVKA 2P65A 5TVKA 3TE6A 1OE0A 4AKEA 4AWAA 4DM7A 3B5EA 1Z38A 1BJKA 2GWRA 4GUDA 1NHWA 1JJBA 3GOHA 3SDBA 4JGIA 4ZVNA 1SFRA 4PLPA 1O0BA 3ZWBA 3H5TA 2FLWA 2XVAA 2XWBF 3NFRA 1ZH2A 1S8FA 4G1VA 3RVRA 2BEUA 3VC7A 1Q0TA 2ROQA 4QVIA 4RACA 1JLHA 4BLSA 1PG2A 4KXVA 5EZYA 1XTZA 2OXFA 3U4QA 2X14A 3FDZB 1O1YA 3KB6A 1XAGA 4LHEA 2W6CX 1L0BA 3GZ4A 2Q8PA 2IZZA 3FPJA 2PZEA 2ZREA 4X97A 5F7ZA 721PA 1IM8A 2W6JD 3E61A 4KQIA 4V0LA 4FB5A 3WLFA 2HA6A 1G7RA 3AEQA 4MUHA 5ALIA 4IZIA 4WXRA 2XBLA 4I5DA 2PWBA 3I04A 4ND4A 3SZRA 1U31A 2BDTA 3GGGA 2JA1A 3HCEA 4EA9A 4F4DA 5B1YA 4FGJA 2UVQA 3A3KA 1X2EA 2JCBA 1G9TA 5KNCA 4FU0A 3FCAA 3CVOA 3GD5A 4GICA 4JLOA 2IELA 4LV6A 1VGQA 2VUSA 2IIPA 5D5HA 2VATA 1Y4ZA 2CHUA 2II6A 1WMAA 4EY3A 2I6XA 3EGDB 5JIBA 3P2MA 3NEJA 3T9EA 1UADA 3L43A 2PZJA 2XF8A 4G8BA 1U5BA 3TKAA 3UHAA 3W77A 5LD2C 1N92A 1Q7GA 3TLMA 3HJFA 2K2QB 4PZZA 3DPSA 1DADA 2G5PA 3L05A 1QVWA 3ETGA 4HLUA 4Q1BA 3L1KA 1A2QA 4B76A 5JCOC 1X6VA 1KQGA 2R6R1 4DCCA 1NONA 2VDWA 3E48A 3JQ8A 4ZCIA 3PKZA 1RLTA 4KXXA 5HS4A 4G23A 1MO3A 1X42A 2DQZA 4PQGA 4OYRA 4RADA 4LEIA 5D3QA 1FU8A 3I5XA 3E9CA 3BXHA 4KKVA 1GQOA 2DY0A 4MYTA 1NMZA 1ZUWA 4Z99A 4ZEXA 5DNVA 3GG9A 3RK1A 2PANA 4K7JA 1DJPA 1N2IA 3QU7A 1RXCA 1VKNA 1IG3A 2HA3A 4ZGBA 1OIWA 3FKSD 5B4VA 5JAIA 1PS9A 2LCIA 2D62A 2W6QA 2BBWA 4L95C 4ZKEA 4XOUA 3X1MA 3W5IA 2GRJA 2OWEA 2CXUA 4F0JA 4D5GA 3QWHA 4ZT5A 2JFNA 4QYTA 1QHNA 4UEJA 2QLJA 2VDRB 3D2AA 1Q0HA 3PLNA 4ENPA 3WYGA 3CISA 5JRDS 1YS6A 2A5DA 2ISSD 4RLFA 2I2BA 1QO7A 4IICA 2YASA 2KSQA 5A1TA 4FT2A 4XVCA 3PP8A 3D8TA 1A98A 2CLSA 1G4HA 4MDFA 2WE7A 3I9NA 3LPMA 3D6UA 5ALPA 5JNRA 5KTMA 3TUZC 4TLDA 1ACLA 1HEUA 1WPGA 4NICA 2YCBA 1S2DA 1BMFA 2G06A 3V7NA 3ANNA 3MGAA 3THWA 3Q0TA 1SB9A 3MOGA 1K1EA 4AY5A 4WESB 4F1JA 3CF6R 2AR7A 1C4XA 3N39C 4G5HA 4Y9DA 2B2XA 1GPWB 1PKXA 3KR2A 2ZS9A 1NKSA 4D8WA 4QJ5A 4GU5A 5LA6A 3SHFA 1JHDA 1GP2A 2ZRIA 2ZI4A 3BTSA 3C5CA 5LKAA 4AWXA 3OT1B 3SYRA 3KZKA 2IYNA 2OZLB 3R6DA 4FFMA 4IV8A 3SP1A 3K0BA 3WTCA 3X2SA 1CT9A 3AG6A 2RAVA 1PNOA 1CQJA 3TIFA 4CIAA 1H9AA 2RJNA 1PZFA 1QIGA 3K0FB 5LP6F 3L8EA 5BW6B 3HVIA 3RSZA 2RHWA 3CKMA 4CDRA 4K03A 4KBGA 1FLDA 1AURA 4J9UE 5IJWA 4YRKA 2GEJA 4DDMA 1T5LA 4G0OA 4MPRA 3G8AA 5F7XA 1JKIA 1EM8B 3BE4A 3PGMA 4IDCA 2H2GA 4RZXA 1HFKA 1PYDA 2H92A 3PDWA 1Q1EA 2GBLA 1ZM3A 3GQBB 4RKYA 3AINA 4L9WA 1XZJA 1FRNA 4FNOA 1EEHA 1KJ9A 4RA6B 4TTAA 5DW3A 3L0CA 5JAMA 1FU7A 4MMZB 1EQUA 2HAEA 3D8RA 5CLJA 4UCFA 1PS0A 2Q1TA 2ZWPA 3UANA 1QVZA 3RWOA 4BMNA 3TUIC 2XSZD 5AJZA 3AUTA 1PR2A 4BFWA 4K2AA 1H0HA 5J5CA 4MCAA 2X3UA 1JBQA 1AA9A 2G8NA 2CUZA 4AZ0B 2YKGA 1XMOB 1ZI6A 1ADCA 4FNAA 1NOJA 1UZLA 4R01A 3RFFA 1WUYA 3ZNPA 2IK8A 2ODAA 2GF2A 3UB4A 1C8KA 3ZWMA 2JCGA 3E3OA 1Y8RA 2IBMA 3R7WB 2FPGA 4C76A 5CA1B 2ZVDA 1NI3A 1G7CA 2AOTB 3UENA 2GXSA 3QPDA 3FMVA 3JXEA 2V5AA 3SQNA 1GPUA 2CJXA 2H1SA 1KVQA 2M9MA 3LHDA 4H60A 4LSZA 4UHJA 2Q7OE 3W1EA 2GEDA 1EXWA 3OCJA 4MIEA 3SMQA 5TGDA 1N5IA 1P1IA 2OKGA 3TBKA 1QHYA 2WUEA 2OV2A 4QBTA 3MF4A 4EGCB 4CG1A 2CXQA 3KUUA 2PXHA 4CF3A 1EMDA 2FRDC 6REQB 3M6LA 4KEAA 3QE0A 3WIBA 2IZ0A 5JISA 2CVZA 2PPLA 1NE7A 3NP9A 4ZXPA 3UJBA 3G59A 3ZQ6A 2OVBA 1H65A 3ETCA 4BMDA 1RKXA 3SR4A 3DEHA 3GJYA 3U3MA 4A2WA 3LAWA 2YYAA 4QUKA 3ZTWA 1X7WA 4W7IA 5D1NA 4R1UA 3THOA 5FA5A 4Q9NA 4ERXA 4YMGA 3RTDA 2JJYA 2CL7X 5CPBA 3GROA 3Q2OA 2XZTA 1H94A 3ADKA 3R6GA 4R2JA 1BG6A 4NE2A 1ZXBA 3WE7A 3CRZA 2MSEB 3HG7A 3E05A 4XM0A 1XQ6A 1I6MA 2R8YA 4F8YA 3I12A 4UVEA 4ZZ3A 1BFUA 3DVAB 3PNQA 4E2FA 2X4GA 3PR2B 1H4VB 1KHTA 5BMVA 2GN8A 3JQAA 2AJLI 4FGSA 3WOHA 1JR6A 3U9LA 2QBYB 4EECA 4URZR 1US8B 5IN5A 3HBMA 4MQEA 4JQZA 3UT6A 1FXSA 4P3NA 5HGXA 1GLNA 1GAQA 2GAFA 2FEOA 3ODGA 1SVUA 2DQSA 2IUFA 2Y1WA 5BY2A 1H5NA 2R00C 4LRUA 4CIYA 1SVKA 1COWA 1LDMA 4LYYA 1CRWG 2YXLA 1ZWLA 4ZYWA 2YXPX 4RSHA 4IR7A 4FBLA 1CS0A 4FDVA 1JALA 1LTQA 3D6JA 3DAPA 2E4AA 4A36A 5BYKA 1CUHA 5BSGA 2Q49A 3RG2A 2NPIA 5DNYB 1IOVA 1Z5UA 4AJHA 2GXUA 3QP9A 1QZTA 5JSZB 5KJEA 3ZNNA 4ZYLA 5JCJA 3IBFA 4KI7A 3PXBA 1U0OC 1H5UA 3JALB 4G86A 3UC5A 5TEWA 2Q3HA 3PQ5A 1EFUA 2OV8A 4Z4HA 4FIDA 1OBOA 5AVZA 4M9QA 5F52A 3X0DA 1PTKA 4Q7LA 2JZNA 5EQDA 2QP3A 2WE8A 3GARA 5KSOA 1A27A 2ZTLA 4Y9TA 4PGGA 2QTMA 4G5QA 1EBUA 2V1UA 1L4EA 3R6TA 1U5AA 1U9YA 3DBHB 4U7GA 1YQQA 2P0AA 2PZ8A 4CR6A 5E3IA 4N7BA 2ZUFA 1DAMA 1KDRA 3Q88A 5BW8A 2GKGA 1L7XA 3AJDA 3D0KA 1B8OA 1F4VA 2JPDA 4ZV4A 2AK2A 1A5BB 2FI1A 3DTYA 1CIJA 5K09A 4C7OA 1HE8B 3PS9A 5KYUB 3DH0A 2EXXA 3OVMA 1U4SA 1UXGA 2AN5A 2QM0A 3B6MA 5I7VA 2VYVA 3AFOA 3DOOA 2G8LA 2P9GA 4ZT7A 1GA4A 2PZFA 3CR3C 1L5WA 1E4EB 3ZBUA 3IP7A 5KSWB 4DZRA 2SBTA 2FZVA 1U28C 4X45A 3OQMA 1UXOA 1PZMA 3HXMA 4LZPA 3SQLA 2OMEA 4HLUC 4QDJA 1G8YA 1LLDA 3I4FA 3ZHYA 1Q6ZA 3C4JA 3GLUA 4JEMA 2JD1A 1CFZA 4MYDA 4MUGA 1L5NA 4BATA 4CKEA 3PCRB 4DABA 1KWKA 5A3RA 2QMYA 2NYRA 2PX0A 1U1IA 4QXOA 2WQ7A 4BKPA 2BFFB 2PEYA 4MUIA 2VJKA 3UUFA 4U2GA 4NNOA 1LBTA 4IJMA 5ESRA 3SOZA 1A9RA 2FP4A 3QPBA 4I3GA 4Y0NA 4DT1B 2LIVA 5LN1A 1BX3A 2OD7A 4MEJA 4JXKA 1XA4A 2PMKA 2QTVA 3NTQA 3OQPA 5DYWA 3OIWA 1PFGA 3L77A 4NG4A 1QQ5A 2XMPA 3H11B 4JR0A 1P7PA 4XX0B 1XMSA 2OP1A 3EYWA 1QSGA 3O4JA 7ADHA 1U0TA 4C29A 3P0IA 1D1PA 2IKQA 2G1JA 1N1DA 1HO3A 1PW7A 1XIVA 4L74A 4X9XA 1BEEA 2AR9A 2B7BA 3FNIA 5SY6A 2MU1A 1TMYA 5LOVA 3HA3A 3KJXA 4J2HA 1SCIA 2WJGA 4P9NA 1MG0A 1O6CA 4MUMA 4XJSA 3HWRA 1KI6B 1XZNA 2B3DA 5ALFA 2WNIA 2NUPB 3DDOA 4WWHA 1RMYA 1BHQ1 3BKXA 1KEEB 3UMCA 4AXXA 1VL1A 2WIBA 2PX3A 3WYAA 4QPPA 5EE9A 3RIMA 1IQUA 1O54A 2AN3A 2DLDA 3QOYA 4L76A 2EBUA 3RRXA 3OTOB 5IBQA 2HLNA 2O5EA 3OPYI 3MT8A 1QAQA 4IDGA 3U7IA 5L4NA 3HN2A 4RPCA 3OJCA 3HK2A 2JAWA 5FPHA 5ILGA 3RJ5A 4POAA 1N2XA 3HADA 2JEZA 2HWUA 4HQNA 5HKBA 1ZH6A 1CUGA 2X58A 1Z0JA 3DTNA 3IGFA 4KV7A 2DUMA 5L3SB 2ZYRA 1Y1LA 2ZBQA 2QROA 2GB4A 2R1VA 1XWIA 3C24A 4LSWA 1PWZA 2REQA 1EGVB 4R7TA 4CF7A 3BUSA 3O9MA 4B6QA 1LS1A 1AQYA 4EAQA 2XW6A 3GEPA 2VH2A 1JIVA 1NUTA 5JO9A 4Z49A 2OXIA 4J90A 5IWCA 3B1JA 5IAOA 2IH5A 2BM9A 1J25A 4R5HA 2IEAA 3E22A 3GFVA 3H13A 1MFZA 1C3LA 3AR2A 5A4KA 2ZI5A 4GLOA 3JQQA 3BTOA 3MFQA 3UFXA 4JEIA 4Q4JB 5FNZA 1SCUB 1RP1A 2VJOA 1LK7A 1DLIA 3MJRA 1R0RE 2HU8A 2BONA 3JRXA 2XECA 3GEMA 4JI7B 1SUAA 3PLAE 2F43A 2ZVJA 4DMCA 3K20A 5I9SA 3JATA 4I6JA 3AUAA 1IOLA 3ASZA 3CIOA 1S2GA 4JHXA 4QYWA 3AYXB 5IAAA 5LQUA 2C00A 3S1SA 3GDGA 1NVMB 1QBKC 1T4DA 1ZINA 3GR6A 3WSVA 3EXEA 3KR0A 2CD7A 3UAYA 2XUPA 3QKUA 3WDLA 1MXFA 3TQHA 2BIFA 1KTIA 1EUCB 3D5QA 3JR3A 3BMCB 1YBAA 1V16B 1JZSA 3MGGA 3ORYA 4URWR 4YTEA 4AQDA 5DYYA 2POCA 3CU5A 2EJTA 3CS3A 4PLTA 5AWFC 1ZK2A 1CU1A 3HO6A 4LJ5A 4QYIA 5FJJA 3ZDDA 1CZRA 1EJ2A 3O82A 4C2AA 5CFPA 4J1TA 4KMMA 1JTFA 1VHWA 1L7DA 3CPSA 1XDZA 3FLAA 4PFKA 4WKNA 1WZEA 4Y2GA 4A1OA 4RCZA 1AVTA 2HLDA 4I66A 4PVDA 4WOBA 1B16A 2OZEA 3FE2A 5A7HA 4DLVA 2YV2A 1PGNA 5B4TA 2PM8A 3HLYA 3I9MA 1MRZA 1VI5A 3MGBA 2HI0A 4KI0A 1KI2A 3LCCA 3PIIA 2Q3MA 5BOVA 4RKEA 2DF8A 3DEKA 3AZQA 3SEQA 2QN6A 1H3FA 2R66A 3IQDB 4LFCB 4E5YA 3NKVA 1FDSA 1IJEA 1HQCA 4GO1A 2C2WA 2RH8A 1KFBB 3PR3A 4PGHA 4YJ2B 4NU6A 2VAPA 2EQAA 4RDXA 1AXEA 1X7HA 3JTMA 4EF5A 3FXAA 3HKDA 3EF3A 3STYA 1GEEA 2BHNA 4FKMA 1VPVA 1JGTA 1RYZA 1T9ZA 2DXIA 1MO6A 1UWKA 4KW7A 3PRJA 5JS6A 4ZQEA 1I5RA 5EZYF 3L01A 3LHIA 4L5IA 4LI0A 3WLIA 2WWYA 4HXYA 3EEYA 2P2ZA 4DSNA 4AY6A 3GLHB 1WMEA 1RZ3A 2Y8EA 1N8TA 3HCDA 3ASYA 2JI9A 2NUBA 2F67A 3P4UA 1DIGA 4LGVA 3KVRA 4IUDS 1XDWA 4PTZA 2BYTA 4CFYA 3ESCA 4KRFA 4CLXA 2PUWA 3EIWA 4HQ6A 5EZ6B 2E4XA 5DMHA 5IEBA 4E5KA 1SUEA 1OBFO 1WY7A 4NI5A 4RD2A 3ROZA 3EYAA 1K7YA 1QGED 3NV7A 2ZRFA 1RKVA 1TCVA 1IH8A 3I30X 3TLGA 2OMKA 3O75A 1H8EA 2W48A 2YHIB 1OLSB 3MB8A 4DLRA 3NVMB 4TKVA 1IBSA 3AEYA 4HDRA 1GNTA 1DKOA 4NZYA 3C7KA 4LMBA 1FZQA 1HT1E 4TUYB 4HNGA 2WIAA 4UTPA 3LHKA 2JD0A 4X3OA 4JVNA 4KYUA 2QZZA 2JAXA 1WW3A 2I1QA 3MCWA 4Q1EA 4R3WA 1U02A 1XR3A 2GSWA 2YR0A 3LZ6A 3C8ZA 3D1LA 4RMGA 1X39A 2NN3C 1AKYA 3CZPA 3WGTA 4JXJA 3R9XA 4HUQA 2QD2A 4GOOD 3ZOKA 1EVKA 4O2RA 1E69A 4L8GA 3RC1A 5I01A 1QC5A 1UM9A 1GNRA 1NP6A 4B6FA 4F9EA 2YWFA 1ZRNA 1WLYA 5F73A 3NVAA 3WGHA 1GSHA 4MICA 4RA9B 1V5WA 5CG2A 1P6UA 1J9GA 2AR0A 2QX6A 3HB4X 3RBAA 4AURA 2RGRA 4EZIA 4KXQA 2UUPA 3WYDA 4CQJA 4J4BA 3NRBA 2V3WA 2CJFA 4ZZ1A 4F4JA 2ZXUA 3EN0A 2C07A 2GEUA 2I71A 4M1KA 4RVHA 1IZZA 1SK9A 4D9KA 3AVPA 1C1XA 3WGIA 4QGGA 1Q11A 1R0WA 3ES9A 2QD3A 3I01M 2YJNA 2YMMA 4WNAB 2IY8A 2PR7A 5AOVA 5JFGA 3MN1A 5FO1A 2DJ5A 4YLGA 4HYQA 3GJZA 5T4EA 1IN4A 1OA0A 3WXMA 4F4FA 1E1RA 4L75A 4B3IA 1T26A 1GTL1 1H1TA 1TL7C 3HXKA 2PSSA 1B6RA 5AM0A 4BVHA 2FZCA 1WPQA 4EHKA 1G0NA 3OO0A 1TEZA 1EG7A 3RAEC 5A6SB 1OJLA 4PAWA 3X1XA 1KEKA 2KI5A 2EV9A 2BH2A 3KLNA 3WADA 2K6GA 3ABSB 4QBGB 5HF5A 1HLFA 3OLYA 4HDMB 4WXPA 4AAYA 2QWXA 3GF4A 2H1LA 3AK4A 5CIWA 4MVCA 4DTIA 4Z3OA 1E2JA 4L4XA 3FROA 3LQ4A 1T0BA 5DYNA 5CFZA 3J7AC 1O8BA 2HIMA 4IL5A 3G9UA 3AYZB 5BYBA 2MWMA 10MHA 1CJCA 2IV7A 4R71A 2EP7A 4PNEA 2HWXA 5AW3A 1QAMA 4M76B 2PL5A 5LA6F 4TKUB 2I03A 1IPHA 4C30A 1EGAA 2DFTA 2BEWB 1LRKA 1WZUA 2F3SA 1HYEA 2OHVA 3OJ0A 4M6WB 3DO8A 3GDFA 4OXKA 1EX1A 5K2MA 2VBGA 4CEHA 1Z12A 1U0SY 1ARZA 4BECA 1OBCA 3CVYA 3W5SA 3UJAA 1T1EA 3HJTA 1V9CA 1A8UA 2RBKA 1KI3A 5DYTA 4BVLA 1SQSA 3SE7A 1M7GA 3R23A 4ZHQA 1AHPA 2J3EA 2YY6A 3B12A 1JLLA 5DTIA 4BFUA 2VH5R 1UP7A 2XMQA 4X7PA 5CBKA 1I4LD 4IO1A 4MO2A 1WHSB 2VQSA 2D2XA 1EX7A 3B13B 2NOAA 3PVZA 3L1VA 3DMFA 5B2ZA 3ZU4A 5CMLA 1T9BA 2FPSA 1JT9A 4TS9A 2CMDA 2QUBA 4H7EA 2WB2A 1H2FA 2H0QA 1Q7EA 4MVYA 5HJ7A 2WZCA 3I62A 1GXSB 1WKCA 1VSVA 3QYJA 4YS6A 5DT9A 1ISHA 4N3CA 1C0KA 3PHIA 1S3IA 5IJZA 1VBMA 1NXSA 3TYXA 2VLIA 3TQCA 4LGYA 3ZHCA 4D4JA 4EEXA 4B6JA 2J0UB 4NBTA 4J0GA 1HZZA 2DLCX 2WAXA 2QTCA 3CN9A 3QMPA 4WLNA 5D84A 2C94A 2IIQA 2XVXA 1Y1PA 4CG3A 1UBHS 2WHXA 4Q3CA 3ZWAA 2H8KA 3KHUA 1OC2A 3AT1A 2XMRA 1CB7A 3OZEA 2FSVA 4IDDA 4DJAA 4QWMA 2I0FA 3V1YA 3I1IA 3D31A 4HXGA 1YR8A 3BRSA 2WF8A 2A14A 3DWFA 3UJHA 5I7WA 2Z6UA 1Z74A 3ZLUA 4IIFA 1T24A 2OORA 4MVJE 4KO1S 4DIUA 1TVEA 4DY4A 3W6UA 2D54A 3ZN2A 3G0GA 4CKCA 1Z4PX 2J9FB 1XCGB 3N0WA 3SEAA 5A06A 2E82A 3SQMA 1DC3A 3AY6A 1II0A 4YJKA 5BSVA 1DBWA 2FMXA 2ZWIA 4Q1CA 4RH1A 4B3TB 4EQZA 1VCIA 1ZCZA 4WFIA 2F3PA 1C1DA 5K8CA 4NMWA 2W11A 4PIPA 3RJTA 3RBZA 1MPXA 3HYCA 3V8BA 3OTGA 2RHRA 3T61A 4D7AA 2IPNA 3UT5B 1J24A 4RHTA 3AB7A 4NONA 3BA6A 3EDQA 3IPAA 4INZA 4EYQA 4CKWA 4UASA 3T41A 3N2KB 3D4NA 4YJ3F 3SVLA 4LZNA 2NTYC 1H2WA 4F9FA 4TPKA 1XMPA 1BMQA 1KDTA 3PQ4A 4PYKA 2JIZA 4J2TA 4WCFC 4ARIA 3HWX1 4UNQA 2NAPA 3DE0X 4LY0A 5FDFA 4A8JB 1E3WB 1N6OA 5HR5A 3L4EA 5KTRA 1U1CA 1ZVVA 1YB2A 3ZCUA 1HE5A 2F8MA 2H5EA 3H5NA 1M0EA 3RFVA 1V1JA 4J7UA 1MJHA 5E0OA 4AJJA 1ENZA 1QWOA 2WDZA 1VMKA 3A4VA 4J0FA 4NXMB 4FHFA 2FW6A 3D6TB 4H77A 4TRNA 5DJ5A 5L6MB 2XYHA 1G5RA 3CW2A 3IODA 3FDIA 5LQSA 1PYGA 4J1TC 1MB3A 1NSFA 1T0UA 1XEXA 1TD9A 3EUFA 4I1UA 5ALSA 4GYJA 2IOFK 4CM9A 1U2DC 1YVEI 2JGFA 4AU1A 1F2UB 1RYYA 4RVNA 1I2DA 3KCQA 2EHJA 3NNSA 5E6UB 2DFKB 1JW9B 1YI8A 3KKMA 3SX2A 4GXTA 5FWAA 5JBIA 4ETWA 1U0RA 4BBPA 4UNPA 2QGNA 2HDWA 5ILQA 4IDHA 2YOFA 2NO4A 4BN4A 2VQDA 2BDUA 1VJTA 3DPUA 3PUKA 5EKDA 3RB8A 1GL9B 2HF2A 2J3DA 1TECE 4QQKA 5I8WA 1UBGA 4AD8A 2Z95A 4R68A 1N7GA 1W4BA 3M49A 2BBSA 4TLLB 4WUTA 2YICA 4YT4A 2CXOA 1KO4A 3NB0A 5DX1A 5CJ2A 4JFRA 1Z82A 3N2ZB 2ZRJA 2Y1GA 4G0MA 5CXUA 5FTLA 4BAUA 5EHNA 1JEQB 1QHSA 2ADMA 2PUTA 3EIHA 4E4YA 3ENVA 1H6DA 2WJ6A 2WSLA 4M8NE 2YJGA 2I2CA 1G6HA 2PXAA 4JJIA 4MWDA 2GNAA 3CEAA 2GZHA 2WAMA 1X7GA 3TLXA 3AZPA 4S1TA 1G8KA 2F9FA 4MNTA 3DPIA 3FWHA 2D4HA 3QVVA 4TXHA 2ECOA 2FFHA 2R7MA 3KHTA 3ENZA 4OAQA 5ITZB 2I91A 2D7CA 2JLWA 2GETA 3JVEA 4PN7A 1BDIA 1X2BA 4XR9A 3T34A 1QH1B 4CYMA 3SC2B 3NBFA 1Q7CA 4ZDKA 2UVPA 3SYMA 3DZHA 5DOZA 3DMNA 3RIEA 4LC1A 3NBAA 2D5AA 4MYRA 1KR5A 3HWWA 4MGEA 1IXYA 2XCLA 4EFNA 3VRHA 2DETA 3FUVA 5FF9A 2OP0A 1RM3A 4Q02A 2OHJA 1R15A 5LSAA 2AFHB 4TQUS 3RM3A 1PV2A 2FWAA 3AH8A 4PSDA 4AJ1A 4F2PA 5LD2B 4IVPA 4C03A 4FI3F 1CIPA 1ZI8A 3PUIA 1IE3A 2IXDA 4S0ZA 5E8JA 1Z0SA 2AHRA 5LMNB 2JI6A 4FZRA 5HQ3A 3NC0C 3A6FA 3KL2A 1NU6A 2LDXA 3BMNA 3L0DA 2M6KA 2L0XA 5FRDA 3G17A 4NWIA 4GPIB 3L0OA 3W5JA 3NNDA 3PITA 2ZIVB 4IV5A 3IAXA 4G2TA 4CIWA 1SU7A 1HE2A 4E32A 1C7IA 4MMXB 4MVJF 2QY9A 3I53A 1H2XA 1N5DA 1OASA 3ZTTA 1WULS 4QREA 1VOTA 1D8TA 1UM8A 4BU0A 3ADPA 2LW7A 4YJDA 2WMDA 3KQQA 2R6AA 3RBXA 1UXIA 2JARA 2VF8A 5FJIA 4NYMR 3EWNA 3WR5A 4BEJA 3T7KA 3FSEA 5KYKA 5DXFA 2JHAA 1RBQA 2QSZA 1Q0UA 4LX0A 4I55A 4DDVA 3ADBA 1M6YA 5FLYA 5E4YA 1O08A 2RI0A 3S2ZA 1Z2OX 3TKYA 3ZE0B 2NUTB 2F48A 4IFIA 4PWZA 4R9UC 4D98A 2FMTA 4H17A 4C5BA 4NQZA 2FZLA 3DFIA 3U6KA 3E0XA 3LOQA 4HX2A 1C3EA 3WNQA 2BKUA 1IK4A 1W1UA 2ZQZA 4NOMA 4S0XA 4X95A 2YX1A 3PWSA 2WYIA 4S1OA 3U5TA 4RF2A 4HBZA 2QRZA 3GLFA 1SN7A 2Q9CA 3L49A 5DNUA 1H69A 3EHEA 1H23A 3ABRB 1FNDA 3DFMA 2HXYA 1DJLA 3HYSA 1KEUA 1UBKS 3W6PA 4HGPA 1U7ZA 1CLEA 4TS1A 5LJLA 2R68A 1LFAA 3PGJA 4HAIA 3EASA 5TT1A 1M2OB 3EVFA 3VBCA 3WWPA 3WWOA 4AZ3B 2WJZB 3EQ6A 1SVMA 4XYGA 4AULA 4QNNA 4W5WA 5B57C 4JBNA 1UK8A 2JLBA 2WG2A 4OHRA 2EAUA 5CP8A 2D5BA 4EG0A 4UBIA 1NVVR 4CUJA 2ZRLA 2FUCA 2W83A 1Z0ZA 4S2UA 4R2MA 5H80A 1JHPA 1CJBA 2H2WA 4LVOA 1WB9A 4RXUA 5A1JA 3Q6NA 2KW5A 1ONSA 2FZ4A 2QNRA 2XIQA 4FZVA 4HWTA 4IVNA 1ZI9A 2H4ZA 3HCRA 2VG8A 4EB3A 2NU9B 4EDHA 4Z4EA 2VYCA 1RWMA 1D4ZA 4Z1MD 4NBWA 1X1CA 3RYCB 4PFQA 1E60A 1O87A 5C5IA 1CLUA 1QXSA 5EWMB 2X2OA 2FXVA 4P38A 4EJ2A 3UYLA 4JBLA 1V9SA 5CB8A 2WY2D 1GZ7A 4UMVA 4CF6A 3W2TA 2GTHA 2ZDGA 1L4HA 2BR5A 4G9EA 1OX4B 2EW2A 3IEXA 1FYVA 2VBIA 4RAOA 5BWMA 1FS4A 4HN4B 2IITA 1SHKA 4IH9A 4QQRA 4KJXA 1XC7A 4GXRA 4L0CA 3IAS6 4NE9A 2OK8A 4J91A 3ZJ4A 1ULUA 3ISTA 4BMCA 5JDIA 1HZZC 1H93A 3R3SA 4XB6B 4PZ9A 1BEUB 4D99A 5A02A 4Z8XA 2OCYC 1QV7A 1PE0A 5C8DA 2ORVA 3IOBA 1ZCFA 1DDIA 1IOZA 2B30A 3GUUA 3DLHA 1S5PA 3B78A 2H1CA 4B4OA 1AXGA 4C21A 3DV2A 5LUBA 3GNTA 1IRIA 2D3TA 3HXQA 2OORC 4CM4A 2J7PD 4QA9A 1NYQA 1OFUA 1VG8A 3DS8A 4IDQA 4XJXA 2XB2A 2OZKA 1QIKA 1WM1A 2V7BA 4L15A 3GAMA 1RXWA 1EWQA 4JK3A 2WLTA 3M1LA 1KU0A 4DCSA 1QHIA 1WP9A 1IBLB 1UUFA 4X6UA 2G1PA 4MRSA 4AN1A 1P4AA 4YP7A 1E2EA 3HJAA 5HTOA 1SOAA 4NFYA 4QZVA 3RUCA 4L1KA 5EWJA 3PFKA 4FM9A 1IHDA 4Y6LA 2HV8A 3UXHA 3GT4A 3PUWA 3RSOA 4AUKA 4JA0A 4DJ5X 2C9DA 3REOA 3ZIAD 3RIHA 2OFXA 1FP4A 2ZBGA 3I0NA 3QPCA 3RYFB 2HK8A 3PX2A 3OPYB 2DBQA 2I6FA 5HKLA 2G36A 3PFGA 1KQFA 2OYSA 4U5XA 1NAIA 2DFLA 4JLUA 2EKLA 2ODQA 4K81B 4NFSA 4M53A 1UJ4A 3TOVA 3TXXA 1NZFA 3T1NA 2JAOA 5DM60 5IT9A 2Y0CA 3VJKA 2XEDA 3LMKA 1T0PA 2PHZA 4I4CA 4Q4AA 3KQPA 2V58A 2NXNA 3UAXA 3TD6A 2FKNA 4EG5A 3GVCA 2FPIA 3OM9A 4FX5A 1D4OA 4GD3Q 2R48A 4J7CA 1T13A 3PU6A 4H4CA 3OIUA 2FGJA 1U1FA 2VLBA 2XDYA 4ZAGA 2HPHA 1D0IA 1MC4A 3EWSA 3KTDA 3KYCA 2P2SA 1CJUC 1RRVA 1RT9A 5JG7A 4OD0A 3MJDA 4HK4A 3FOZA 1MQ8B 3GI1A 4JAVC 4IHQA 4URUR 4RTPA 1PWEA 1OWPA 4UVHA 4DJEC 4UM5A 3NBYC 4JX9A 4RQUA 2RHMA 1X3SA 4P1ZA 1KDVA 4FFPA 1GL6A 3DG9A 1IEXA 1PDOA 3MSXA 5BN4A 1JLMA 1MP0A 5EMJA 2CWDA 4JVMA 1QO0A 2WZDA 4G36A 2HNAA 3KV3O 1LD3A 3ORHA 3PA8A 4M1SA 4KIJA 4R05A 1IN7A 4FFNA 3FMPB 4JIGA 4B81A 4YRLA 1M8GA 2Q6KA 4PS0A 5B7QA 4IGAA 4DC9A 2P30A 4M0FA 2HT1A 2NP7A 3RREA 3B3AA 2XDAA 5K8UA 1Z33A 1DDOA 5A4MS 4URFA 4F5ZA 2JGAA 1ZOPA 2BT4A 3L07A 4LG1A 1CR1A 2BEUB 3CA8A 4C4ZA 5FORA 3M5WA 4FEGA 2XT6A 4KR3A 2NZ2A 2PTGA 4V3BA 2H2FA 1I4TD 3IMKA 3MAAC 4IOJA 2PYIA 1SKBA 1Y48E 4K1LA 2Y6VA 1C7ZA 2ZRQA 5AUQA 3R7SA 4XCVA 1LBEA 2NTNA 3U4QB 1VXOA 2C7VA 4P4LA 1GU0A 1PD0A 4B1FA 3GV0A 4Z0PA 3CLSC 2XRZA 4MPTA 1GA1A 1TQ8A 4DRZA 2QT1A 3JZDA 2IF2A 2FCAA 5AHOA 2OA0A 3VU9A 3ROEA 1GAWA 4M87A 3UTCA 4GT1A 1T2FA 2DUJA 1KJIA 2Q07A 1DX9A 3KD2A 3MCAA 5G53C 2ZYHA 1REQA 1T9GR 4AJ9A 2Q62A 6CHYA 4HWPA 1N7JA 1QR6A 1VE9A 4IG4A 1ETUA 2GCOA 2GPJA 4LGMA 2WV9A 1ORDA 4KNWA 5ALTA 1HQYE 1R7RA 4DBLC 4C0QC 2WKSA 4JWTA 2BPOA 1QHFA 3BIFA 3R3JA 3PFIA 3L1JA 2YC4C 3UEOA 3OM1A 4F5DA 1PJ3A 4GPBA 3H3JA 4ZD6A 1ORRA 4MJ3A 2C0CA 4RSRA 3ZW7A 1D2HA 3QWIA 1U5BB 4D0LB 3G5AA 4LJYA 4R2KA 3H2JA 3ETHA 4B6RA 1T0JB 2GK7A 4XTCS 3WLOA 5KQGA 5MN5A 1R4NA 1KE2A 1XVVA 2Y67A 3ZX5A 2VDWB 5SV2A 3CYFA 4FDUA 4KGXA 3BGOS 3JQ8B 2A92A 4HGOA 4TSFD 5EE3A 4JU8A 2PMBA 3QJ5A 4BL5A 3IAM1 1JKJA 2Q8NA 3A0RB 1M1YE 3WNZA 1IK6A 1CB0A 4R8VA 1WXEA 1FFAA 2PRSA 3AR6A 3EIOA 3LA6A 3RHSA 3X1YA 1SKMA 4ZHQF 3K9CA 1TJ3A 3TB6A 3MELA 5J2UF 2HRZA 3AERA 1UCFA 4KAFA 2XCSB 3BBPA 1IIRA 2W8BA 2W6IA 3TFOA 4J1SA 1UAGA 2C5BA 4ZC8A 1GRNA 4QDOA 4NCAA 3U4HA 3ST7A 1V2HE 3HL0A 5G1OA 3Q5DA 3VC2A 1T5SA 3H4MA 1C9YA 3LOUA 4BO5A 1IN8A 3KVNA 4ZK2A 3U7HB 1QRUA 2ZWVA 4ISCA 4HS4A 2C97A 4RFSA 5ELLA 5IC4A 2QG9A 3OESA 4Q12A 3IESA 3RR2A 4CIDA 2HIHA 2YL2A 4DIKA 4LBYA 2RHTA 3O26A 3HZZA 4YRAA 2Z8YA 3MERA 4QVKA 4PSAA 3W78A 1DTWA 4MSUA 3HYLA 3PEEA 3LBNA 3TLJA 2XOXA 5BW4A 3VZBA 2NM0A 3THWB 1FXUA 2YIJA 1W88B 5A04A 1HYQA 2D1QA 3IUNA 3H5WA 1TYEB 5BV0A 2C4KA 1UF9A 1I0LA 3ZK9A 4LOHA 4BPRA 3FR8A 2E87A 2Y76A 3A4LA 1M2JA 2V7QA 2XRFA 4LGCA 2YRFA 5B6PA 1Q17A 2E3JA 1LEHA 1V37A 3G6KA 3GJRA 5CT8A 5E1OA 4ARAA 3QKSB 1SXJC 4DR2B 2O48X 4GX2A 4LWQA 1EUZA 5AHWA 3VOTA 4WNYA 2PT5A 3O93A 3PV0A 1J5PA 2NVUA 3Q98A 3P26A 4GEKA 4ZT6A 1YS4A 3BKWA 4J0CA 4P3KA 1W8IA 4H59A 5AFSA 3UHJA 5IKEA 3OZTA 5JJCA 3BX1A 4YRFA 2FZWA 3S27A 2PQ6A 4K26A 2EQBA 1Z5ZA 4MS3B 4ZOAA 3C6KA 4OGGA 1SEVA 1X1EA 1XWWA 2DWOA 2P6NA 2ZIXA 4YEDA 4AQ7A 4WJKB 3ABIA 4OMFG 4Q16A 4TMWA 2PXXA 3M3DA 4QTXA 5LZ4A 1LW6E 3USES 1GTSA 3ML1A 3A31A 1D0VA 1HURA 1ZH0A 2H6EA 4H35A 4OXXA 4L51A 4RD6A 3U80A 1E6UA 3DP7A 1ND5A 5CXSA 3GLFE 2DHCA 2EFCB 3HHPA 3HU2A 1WHTB 2PNJA 4KVGA 3QPAA 1WXGA 1XN1A 3GLQA 1GZVA 3EX7C 2XR1A 4QUJA 1KU6A 4CEJA 2NX2A 1BROA 2OD9A 4NVRA 4WLOA 3AHDA 1W5BA 1WVIA 5JDIC 5BSTA 3WGQA 1QYDA 2WWFA 4MR7A 4Q6BA 3F2VA 1YONA 4URHA 2YWDA 4EW3A 4RETA 5A7FA 3A6KA 1C9MA 2Q7XA 3FHCB 3PQ3A 4MXDA 2C0PA 3QYPA 3TX6A 3FUWA 3M83A 2LXNA 3PG5A 1KAGA 5LQNA 2GUWA 1KDPA 1EKXA 2FPGB 3V2IA 2PH1A 3EAQA 1XTIA 1MO2A 5B4UA 4EP1A 4EO4A 3IXLA 1EVEA 5SZJA 4DDTA 2QQEA 3ZWXA 4Z4FA 2XNDA 2ANCA 3GJ6A 3UTDA 5AVRA 1XL0A 2HK7A 3OC0A 4EF6A 4MRNA 3CB2A 4YRBA 1JDTA 1E5VA 5J1TB 3A3NA 4PLYA 3BE5A 3KVYA 4EFMA 4MV4A 5KMGA 5F9MA 5BV7A 4W1PA 3RF7A 4OBBA 5IC6A 3EDCA 1U0HC 1YU9A 2BBTA 3E3AA 2Z2ZA 1OR8A 1Z4OA 4FWIB 3UQZA 1TVMA 3D64A 4HRAA 3TQOA 1HI9A 3T7RA 3MTQA 2AGVA 3TK1A 1E1QD 2NO5A 4MV0A 2DLNA 4IGIA 1WU8A 3TAHA 4BRWA 1TCBA 4DQDA 3C16C 3SWWA 1X7WB 3BSYA 1JTEA 3H5AA 3RU9A 3KXLA 3TTUA 2IZ1A 1GKKA 4WE3A 3PKIA 3QJYA 1E5DA 3AXTA 3KKOA 4J0QA 1VBFA 1RWBA 3B5IA 5KYYA 4R41A 1T29A 2NO0A 4PZUA 2NAFA 3CURA 5BMVB 1UQUA 1UBNA 3E5HA 2HT6A 3HP4A 3JQAB 3KWMA 4DYDA 5DO9A 2DR3A 1K4KA 5TLSA 4DW8A 5FI3A 4OHCA 3MCTA 2WHEA 1KYTA 2DBVO 5K0ZA 3WA7A 5IMBA 3OE7A 1J56A 4MQEB 4YREA 4ID9A 3IDFA 4RQBA 2R60A 1SKYE 2I6SA 3EG9B 3DKRA 4YMHA 5EY5B 1W73A 1QGAA 3VZSA 5LIRA 3Q4GA 4U7TB 2YN4A 5H16A 1OYYA 1SHLA 3JQ9A 4X1KB 3RADC 1M34A 4GL4A 2COUA 2IH4A 2HBZA 2I8AA 3ZLTA 5BV8A 1E2UA 4LE0A 4PLFA 1ZVJA 2IWHA 1NXPA 4ER7A 2JLVA 1KK1A 1YVUA 1KK2A 4GGPA 1PT5A 4BIIA 3T94A 4YACA 2FQQA 5BWLA 5GPBA 4K9QA 3H16A 3GLRA 3E2MA 2HXGA 4ENQA 2FZGA 3THYA 1P31A 4HAZA 2XUKA 4B17A 3REQB 3LUAA 4YRTA 4EITA 1ENPA 1W75A 4JGGA 2O0MA 3RF6A 3UUGA 3ZCSA 3TIVA 1I2BA 1CUUA 3VZDA 1M3SA 4QUIA 1YDWA 3H3FA 4JB2A 1ACJA 1XDDA 1T6XA 2O1EA 4M8IA 4QAJA 1N2ZA 3HSYA 2BN4A 3LX4A 1FTGA 1G5HA 1J7KA 1YAJA 3PLRA 4YAOA 3UIEA 3W6NA 2XIJA 4AXBA 5K03A 1SHTX 1YC2A 3FNRA 2DFDA 1E5XA 2ZSUA 4PR0A 3OKFA 4EGQA 1YC5A 1JL3A 3EWAA 3VR5D 3D5TA 5B53A 4Z54A 2VHVA 3DBOB 3LKZA 3DAFA 2AW3A 2HTFA 3CNHA 4GVLA 5JAUA 1N6NA 3OPVA 4NMHA 4C7OB 4INAA 3K15A 3I8OA 4DPLA 4BJ5A 5DSXA 2UU9B 4E2XA 1UP4A 5LLDA 1UMCB 3GX1A 1Z63A 2GRUA 1FVOA 1YZKA 1PSDA 3ELUA 5IBCA 1UBFA 4AJEA 4FLFA 5AK3A 4FCTA 1I8TA 1SUDA 4O3FA 2ZR8A 3O84A 2FSHA 3NWPA 1YZNA 5FI1B 5B7NA 3BXZA 1LPBB 3OF2A 3SEZA 4KUGA 3VO8A 1FMTA 4TT8A 5KOIA 5CGQB 1QVVA 1E61A 1C7QA 3C8DA 3VTAA 3IHWA 1NXTA 5GONA 2QTWB 3PC7A 3C3MA 3CLSD 1B41A 1J06A 1L5VA 4YXFA 3D8SA 1NLFA 3G0CA 2FR8C 1JG4A 2BR4A 2FJPA 2RFLA 1A88A 1W4CA 3Q7SA 4JFAA 4L50A 3A9WA 3NEPX 5K3CA 4EX7A 2DRIA 1P0PA 1E8MA 1MW9X 1ZGCA 4IGKA 4J0EA 4QVGA 1BN7A 2JF0A 4RZ2A 5AXAA 4DMFA 5LDDC 3WQRA 2FP4B 2WTBA 3EFEA 3KT0A 5DULA 4Z2YA 1XDUA 2Q2NA 3D4LA 5M2QA 5MFPA 3S2YA 1YR3A 3QF4A 4D3SA 2QTVB 1DQYA 1MDFA 2CZGA 2D59A 2VK4A 5CLGA 1PJ2A 5CU7A 4ASUA 4X85A 4EYEA 3KALA 4P33A 2B5OA 3T35A 2CCKA 1FRFS 3B8EA 2G1KA 4O3MA 3U49A 3PGVA 3FGZA 4NECA 4NMMA 1BDJA 1ADGA 1MJGA 3RU3A 3FG9A 1OFIA 3T3EA 2WW8A 3AF1A 3W2IA 2XZLA 2IYPA 2D2VA 2P41A 1EHYA 5LOVB 1Q92A 5K1ZA 3Q85A 1EK6A 1OFVA 5G0VA 3UICA 3A9CA 1MAWA 3NTRA 1N32B 1N6RA 3ICPA 2CXTA 4N47A 2C88A 3OCCA 4L3WA 3S5JA 1ZCAA 4JJFA 4S1WA 4I1OA 4RKRA 3G0DA 4ABYA 4YCMA 1CUYA 3T4XA 4KFSA 1GSAA 4L6AA 5EIXA 2EJVA 4ZARA 1U65A 2PZKA 2WLSA 4XQ9A 1TGVA 3UG7A 4DYVA 2VNKA 5ICSA 2BFOA 1J7JA 3KQHA 1ZRSA 1ZVQA 1CDOA 3WL5A 3QTTA 1GYPA 1VHTA 4NH0A 4Q1FA 5CLQA 1YF3A 3MWEB 3RS0A 5SICE 4BFYA 1RI1A 2A57A 5BNWA 1Q0PA 1GITA 2I4RA 4DIFA 5FHQA 4NR0A 2N42A 1Q44A 4IEEA 4R1OA 5FXMA 4DQVA 1XDSA 3WBJA 3HVHA 3C5EA 4QYSA 1Z6ZA 1ZZEA 2O7SA 3AHJA 3LT1A 2VWQA 2I4NA 2XEXA 1TIKA 4RY9A 4BE7B 4ZDIA 1JH8A 2WK1A 4G41A 2ZJYA 1JG2A 1SD5A 2AFIE 1O94A 2WEKA 3G0BA 3R3UA 3LDFA 4E14A 5JOQA 3E22B 2CGEA 1OWLA 1UKVY 1QF7A 4DEYA 1VHLA 2PBLA 2B1JA 3TQIA 1G8MA 5CT5A 3UFXB 3SSAA 3FPGA 1YZVA 2J4CA 1OA1A 3SKVA 2X9LA 2RC5A 3NWJA 4EK9A 1ZM4A 3Q3GE 3QXHA 1OH7A 1E3SA 4BLPA 2VHJA 3IAUA 3HBLA 3QLEA 4D9EA 1PD1A 1KI9A 4G84A 4WCFB 4IDBA 1Z18A 2YNMD 2BOVA 4CM5A 5KPDA 3E8XA 1UKAA 3LXUX 2M98A 2NYVA 2PSDA 3K35A 4N65A 1QQBA 1PQUA 2EX4A 4LJ7A 4DV1B 2NZWA 3EXEB 1PR5A 2Q5OA 3DE7X 2POQX 1QORA 4UTZA 1SXJD 3GJSA 9ATCA 1XQ1A 3A7EA 3CX7A 1B8VA 2X0DA 5IM5A 1ISMA 4M0DA 4UZFA 2K5UA 1QV6A 2B98A 4H7IA 1X9GA 3F5DA 1PK7A 2I7XA 2YQ5A 4QYIB 4BBZA 4B3SB 2BM8A 2IOFA 2WTNA 4WZBE 4DLLA 1Q0QA 5ILOA 4P81A 4WZAE 2FOLA 1E59A 3C3AA 2M2IA 5ICFA 1HK7A 1X74A 4G0VA 4L73A 4TQ9A 2HSJA 7MHTA 2G7ZA 5D3MA 3HYNA 4U02A 1SBQA 4TVBA 2AWOA 3S8MA 4ZZ0A 1DCTA 1L1FA 2VPXA 5IJ0A 3BZWA 4Z9FA 4QU5A 2CN1A 4R1PA 5HILA 2PLNA 3HZOA 1UPXA 2RDMA 4HATA 5GIPE 4OI0A 3P5SA 1VDZA 1ODFA 2QTGA 2WPDD 2BE7A 3D7LA 4FLMA 4C78A 1N2JA 3Q8XB 2VQFB 2AVDA 4JSYA 4RV9A 1KFEB 2GYVA 2NIPA 2E55A 1ECJA 1S3SA 3HKDB 4OI4A 1R2QA 4A5OA 2QRKA 3O5AA 4R69A 2AYZA 2R3SA 3VZCA 5DDIP 3SIPA 5FLKA 3ROGA 4D92A 4KQGA 3CX8A 3OPXA 1YB6A 1KC3A 4DSZA 4PSVA 1SNYA 2ZT5A 3KYIB 2IXBA 3A06A 4MX8A 1T36A 3ICOA 1VECA 2VQ3A 2W2MA 3FMFA 3OSZA 3PI7A 5FQNA 4HOYA 3AKEA 2ZCUA 2ETVA 5A4AA 1NRWA 3G8CA 4HDSB 1ADBA 5DISB 4DIOA 4NESA 5HSGA 5JMWA 1FTQA 1QZ3A 1KTVA 2OGTA 1OC4A 1HTBA 4NP6A 3RUHA 1XMJA 3VR2D 5IRCD 4HSGA 2NU6A 1XALA 1RYDA 2UXBB 1Z75A 3TLGB 4FYWA 3WMXA 3VPCA 2PR2A 3WK8A 1BHJA 4MLDA 1WIWA 1VHQA 4YO7A 5JAOA 3GJ3A 1A2BA 1XNRB 1NR7A 3O94A 1CTQA 2JC3A 4YJFB 4C0JA 4CETA 2QZ9A 4CTKA 5LQMA 2DERA 4HDRB 2W2KA 3F8SA 3IAHA 4QOGA 4HQ0A 5GJCA 1CQIA 4OHZA 4C6SA 4I4NA 3M9XA 5BVGA 2CSUA 1JH9A 3PFNA 3FW1A 4N0MA 3D7NA 4ECAA 2RGCA 3HQ4O 4OBXA 5DCYA 3RPEA 3W0LB 3THXA 5DE3A 4KR7A 2B1QA 3FTNA 1YZ3A 3I73A 3D6MA 2J6IA 4GM1A 2JAHA 2H2AA 1V5IA 2J31A 2H4JA 1YZQA 5K3EA 5P21A 1RE1A 2O0KA 3OBIA 4H31A 5KYGA 3R9XB 4LY9A 2Z4SA 3MWFA 3LV8A 4BO1A 3OFJA 2ZSHA 2BF7A 2B20A 3TR6A 2IQ5A 1QC5B 2Y1DA 1HEYA 4ZALA 4BGVA 3G5LA 1Y7IA 2Z8XA 4ANFA 1VKJA 4LYEA 3W9BA 3WV4A 2VTBB 4LVNA 2XB8A 2IFTA 1OFHA 4K1XA 4IG9A 1FY2A 5DRYA 5U9CA 2FLVA 1DJNA 3RRJA 4BVAA 3RC8A 3K0SA 2B8WA 2PMCA 3QX3A 2MMGA 1O0SA 3QKTA 5A0TA 1UQRA 4TKZA 3KEMA 3EGIA 4C06A 3W1WA 3F6RA 5ICGA 5LU8A 1YQEA 1ICEA 3TMKA 1G41A 1JKMA 1VC2A 1NOIA 1C1XB 2ZU0C 1MX3A 2HL6A 2N75A 2NZUG 2PL9A 4RGYA 2JJ2A 2JZCA 2DYKA 1VL5A 3VGJA 3AVWA 3LK7A 3EFHA 4E7OA 2BFDA 1LC3A 4RZHA 3UXMA 2GRAA 4G1MB 1QDUA 1MF7A 3NT4A 2V7UA 4XB2A 4HVTA 1J00A 1OYWA 4U5QA 5FO0A 2P35A 3RTGA 5JAQA 3WKEA 5CB4F 3B6KA 2GM5A 4I5IA 4HPXB 4OREX 1PL8A 4TTPA 3RHFA 3SZ3A 3GFSA 2IGTA 2PGJA 4KQXA 3HI4A 4M0KA 3TLAA 1BN6A 3PCXA 1QCCA 1Z5GA 1QH0A 3BJIC 3BWCA 5E6SA 4IJKA 2B8EA 3BHJA 5AQ1A 4OVKA 4TYMA 1G21A 2XLCA 3PTLA 3COWA 5JECA 5JYDA 5U4QA 4TVSA 1G8AA 3T0IA 4MW5A 3O9VA 1F17A 1M1ZA 3JS5A 3TR5A 4LNUB 2X8LA 3A9SA 3WJ7A 3FCCA 2PT6A 1XJWA 3QHAA 3I5AA 2Q28A 2ADFA 2Q5FA 3NC4A 3FBWA 4NL4H 2OBMA 2PQMA 5I7UA 2DPYA 3DV0A 1NSTA 1XPJA 1P0MA 2WSMA 3T6KA 2IYRA 5FOTA 4LF6B 4KZPA 3CKKA 3S70A 4HNSA 3WWYA 2W6OA 2YWRA 2HQ1A 3LLSA 2M1ZA 4B43A 3ZDYB 1DXYA 4JNCA 4CMIA 2I34A 1SC9A 3BFVA 4GRAA 3S2IA 4ZAWA 1EE1A 2FMKA 2GJ9A 4QOJA 2ZIAA 5GV8A 1N2HA 3VC1A 1S8AA 2HBRA 2P1ZA 2RHLA 3DE4X 3COJA 3SHVA 3WGZA 4TTIA 4ZYUA 3UUWA 2AJDA 4BGDA 5C35A 2J6BA 2XOEA 1N2GA 2LR0A 1C14A 4UUQA 4JBXA 1TEVA 3QQ5A 1HMYA 5KDOA 3A1UA 1LCIA 4TRMA 3O9ZA 5JSUA 3KR1A 2VDNB 4ZVSA 4QSHA 2CBZA 4XIYA 1I3CA 2WSYB 4IF4A 2C2XA 4ZEOA 1U6KA 4JB0A 1GNQA 2DHDA 4AZVA 1N8NA 2CBXA 4MTLA 2H1OA 2VDOB 2I8LA 3A2NA 4MLPA 3ACDA 1M6HA 2JB9A 1GNSA 3SFZA 2JJQA 1NBEA 4NBVA 1PV4A 4LDPA 5FL7A 1RDFA 2F3QA 2ZJBA 1YJQA 4KG7A 4DZZA 4QG3A 1Z29A 2QTFA 3G1TA 3ESZA 2RAFA 2VRNA 5BSMA 2GUGA 3S2UA 4XVHA 3EK2A 4G63A 1GU1A 3A9TA 5DWDA 5BN3A 5IBPA 5H9WA 5L7TA 3FZGA 1JEOA 2AXNA 1MJ5A 2C8KA 121PA 3K9WA 3N6VA 4IIEA 2O8FB 2CNWD 5AI4A 1LLUA 1Y3FE 4JZYA 3RRMA 4CLOA 5K0GA 1BHSA 3KQVA 1Z25A 4BGEA 1Z7BA 1WDKA 3BB1A 1PTJA 4BOYA 4ND7A 3CZMA 3F6CA 2YJTD 2YV1A 3VYRB 1F6WA 1V7QA 2Q6VA 4HWRA 3WGYA 3ICVA 1H4SA 5FUMA 4BNIA 1QCZA 2B1RA 1F2TA 1SQ6A 3AHEA 2ZJAA 4XM1A 4JV5B 3DDHA 1JDJA 4UU1A 1YCHA 2ZR0A 2IHNA 2QI9F 4AKGA 1HDGO 5JH7F 2IDKA 4TTVA 1P3Y1 2AT1A 1ULTA 4KDEA 4NCBA 3VYVA 1BTOA 4OB8A 4IQ0A 3EZ7A 1VE5A 3AL2A 1THMA 4CNBA 1ZW1A 3GLIE 1GNPA 4K6MA 3ZIUA 2HGSA 3AONB 5JSFA 1QDEA 4D0SA 3IUPA 2IYEA 5K8TA 1YIOA 4GNRA 3PNBA 5AKIA 2QNBA 3D0QA 2QPLA 1B76A 3PHJA 1TLLA 3UWSA 1PLJA 3V4LA 5T7BA 1XLVA 3CNNA 3OIFA 2VNSA 4QPNA 1U3WA 2UZAA 3QKRA 1T2UA 2QN7A 1E0KA 4LOJA 1TUBB 1VYHA 3JVUA 3A6JA 1XLTA 4L9AA 4DCMA 4EG7A 2C2GA 3EGWA 1XXHA 1XEXB 2WUVA 5EIBD 3MT7A 2J67A 3NBKA 2CLOB 5FT9A 5LLTA 1V48A 3EUEA 5EXDA 5DM0A 5EJ7A 1KYZA 2W6NA 4RTRA 4W63A 2BZ0A 3GYBA 4NNJA 2QMHA 4FFBA 3PR1A 2R7AA 5GVSA 5DI3A 3C39A 4ZQGA 1NG9A 2NZJA 5AMXA 3R8XA 3SLKA 5AVWA 5HDQA 3HDTA 4UUOA 1Z9BA 1LU9A 3QOFA 4B8ZA 1ORTA 3FRIA 4NYJQ 1NVDA 2ADOA 3WAKA 3DEIA 3QLUA 3SJAA 3F0TA 4OL9A 3E35A 1Y9ZA 4OLAA 1RWKA 2BKAA 2FW8A 2Y0BA 3IA7A 5H9VA 4CL8A 1R4AA 5BR1A 3FYTA 4WXYB 5FHRA 1KP9A 3HB7A 5C31A 2ZT8A 3NOOA 3TZBA 4MHTA 2AZDA 5JLJA 2ZDQA 1TDJA 1FP2A 1L5YA 3DONA 5J9FA 3RYTC 2XITA 2AS0A 4N5DA 4WFKA 5BPFA 3W5BA 2O8BB 5GVRA 3VPFA 4IZ6A 3GEDA 3CPJB 3JVDA 4U39A 3KG2A 1CUJA 3PCTA 5G3ZA 3VBEA 4DNFA 1R1DA 4YCAA 1ZEJA 1BH6A 4L0DA 1H3NA 1JZQA 1G4AE 2Z6AA 4Q9HA 3SQWA 5JYBA 1K2VN 2VHTA 3AFNA 1BQ3A 1KDOA 2XTMA 1YB7A 1MEOA 1I24A 3LC7O 5A7GA 3U3OA 3HGTA 3CCBA 4IQ8A 3O8LA 5IJXA 1JBEA 2AUNA 2O5CA 4CTOA 4LSGA 2JFGA 1SCAA 2QTNA 4NBUA 1EWTA 3GLSA 4ER5A 3L5KA 1AOXA 3ESYA 1ABFA 1DAPA 3EF1A 5HQJA 2FG7C 4IIJA 2GHQA 3AVQA 5GONF 3KQKA 2I2XB 5KJFA 1R5JA 2DBYA 5E9AA 5HQ3B 2NV0A 1O89A 3BMNB 3A27A 5EUMA 4AS2A 4WGFA 3RSLA 2Y9MB 4I2VA 2CUTA 4MUKA 4E09A 1T8TA 2VUIB 5LNK1 4FS3A 4EL5A 4Z4IA 5JQGB 4G5FA 2ZI9A 4TM8A 3TDNA 1CR0A 4DHWA 3W3AD 3BXPA 3EEFA 4Q4HA 3CVUA 2GMWA 2J9XB 4C0WA 1HR0B 1RYEA 1Z2EA 1GGFA 2V4MA 4BNDA 1R0CA 5IVIA 2D7DA 3C48A 3GAZA 3ECSA 2A3NA 5KNDD 3OE4A 4EJMA 5C1DA 4LXTA 2PGNA 1U2ZA 1Q7BA 1G5TA 3WBKA 4P4NA 2JAPA 2VRCA 3OF3A 2A6PA 3ELYA 2ZB7A 3ZGYA 3G2JA 5GY7A 3HCWA 4DSOA 4FONA 1J8MF 4IUCS 2YYYA 1PSZA 5EEHA 2F4VB 4I55B 4B2PA 3KM0A 1MH9A 3OX3A 4MKZA 3AHGA 2QVGA 4G0NA 2YMPA 1A9QA 3ZU3A 3RJMA 1MHTA 2Q6OA 3SKXA 4D0RA 4EMBA 1F9EA 5EHZA 1MB4A 3KYBA 5SZHB 2R2AA 3ESBA 3LNTA 4GMXA 2WWWA 2ZTUA 4RZIA 4XWGA 3RIXA 4ER3A 2GD6A 3K9GA 3FWYA 2QJTA 1K3TA 2VC2B 2VHCA 1Y5IA 2BTQA 3OJXA 3JYPA 4WKBA 3R7NA 3TVYA 2WJ4A 5EJMA 2A0KA 4MW2A 1K2WA 2KS6A 4EG6A 2O54A 3IOEA 1J0AA 2WFLA 3VKFA 4Z9YA 1W52X 1ZNXA 3LZDA 1SC1A 3GFFA 1JU4A 2WYVA 1TAHA 2VDMB 5AHRA 3M6IA 1U3FA 3ZZNA 5CLFA 1NBME 2PGIA 2C5AA 3TG2A 5KHLB 4MINA 4Y0AA 3KUCA 2JH9A 2QMOA 4DMHA 2ODPA 4C4PA 2XD9A 3W2GA 1SXJB 1YRQA 2FETA 5BSRA 1NQUA 3IX7A 2HDNB 1DHRA 3N2YA 1LLQA 3A4IA 2MINB 4LRQA 3BREA 1WXXA 2AI1A 2NWQA 1S7GA 2QRJA 3ETDA 1R0YA 2RSLA 2WF7A 1USGA 2RJ3A 4D9FA 4YONB 2GCPA 1L7VC 3PXAA 3C3PA 3SKYA 2OHOA 3A8TA 4C4OA 3DFKA 2JHPA 5DKFA 5L7YA 3BS4A 1MOSA 2B8TA 3FAKA 4QUDA 3JAKB 3ZI7A 5IW8A 3BYZA 1CULC 3A1FA 4Q48A 1DEKA 3M5CA 1U99A 4D8VA 5HMMA 4M1OA 1T1RA 4MCHA 3F5FA 5JALA 2XYVA 2VKQA 4NG5A 4Q3NA 3NMUF 2CKDA 1M72A 4ILKA 3L6CA 3FH0A 3RABA 3M1AA 1F8UA 1A9YA 3KLBA 2ZSAA 4YAWA 3QE2A 4ZOLB 2C2HA 5LDGA 2BMAA 1EDDA 4HNAA 3QX7A 1IN5A 4B6OA 2ECQA 5JFTA 1TMOA 4MVJP 1U4OA 3BFPA 3O74A 1LBSA 4QRIA 5D01A 4E30A 3EPKA 1TO6A 1VIMA 4IWYA 5G1PA 2JLUA 3JR7A 1OGJA 2QGZA 3LNCA 2FH5B 4Q3BA 1Y6GA 2V54A 4Q7QA 1FJ2A 1RKBA 1Z08A 2E4WA 3MLEA 4HBGA 4E1VA 4PC6A 1S9HA 4Y0VA 2CDRA 4R3NA 3NTXA 4AJNA 1F9AA 1NBWB 3I2JA 2G82A 3RFUA 1LQUA 4WI1A 3KUXA 5TT0A 3ZZ0A 3OAAA 3KSRA 3OLQA 5AR1A 3NANA 3M4NA 1FJHA 4N7JA 1E3LA 1M2WA 3RLFA 2V5VA 2FPPA 3GA0A 4HAOA 4K6FA 4G8JA 1C8LA 2BLLA 4N7RA 2P5TB 1DX6A 4LHYA 2QLNA 5C0OE 4YCLA 1N9GB 4HDQB 3ND9A 2XB6A 3ROPA 3V8EA 3O8OB 4IUBS 4D8TA 4DNQA 1JI3A 4OUKX 1ULZA 2RGDA 1E7MA 4RVUA 1JFRA 2CVHA 1AKEA 2H7XA 2VZEA 1Z0FA 2X19A 2D5CA 4QARA 3W2FA 2PN1A 5E2IA 1TM2A 1VJDA 2O0HA 1HQKA 1YBMA 5DHRA 3AIMA 3ZZ1A 4CMCA 4KDCA 2QRUA 1OX5A 2P9YA 4A4DA 4DUPA 5IF9A 1ZRMA 5T3UA 3Q0IA 1BMDA 3X44A 1EK2A 3GH1A 4AP5A 1WVGA 1THGA 1F6BA 3WB9A 3LIIA 2CC2A 2GVZC 3KQNA 5I9BA 2EKBA 4DMGA 4DNPA 1HL3A 3ONDA 3ZGZA 1O6FA 1SIBE 2CBGA 4Q4AB 3AHFA 4RXMA 4PX5A 1T5HX 4DUZB 1QYRA 1MQSA 3AILA 2WDPA 2FPIB 2A1TR 1ZIXA 2ZVQX 3KWJA 1XCJA 1YOVA 2WVJA 3RS4A 3TLKA 3KYCB 2P91A 5FAKA 3MLBA 4BB9A 1GR1A 3A1EA 4HLQB 4JENA 1Q7TA 4O6VA 3RROA 1EM6A 1N3LA 1U9CA 3EZNA 2HU5A 2FE4A 1VGVA 3NC1C 2E2WA 4FDAA 1EFHA 1H1DA 2CUKA 2B0CA 4MB0A 3USCS 3VNBA 4QICA 3PDJA 4BX9A 2IOQA 4C0LA 1O58A 2BKEA 1BMTA 3KP1A 2B6HA 3M89A 1YZHA 3AUKA 5DBIA 4S1PA 4AZTA 4TMVA 3DOHA 2YZKA 3VPSA 2HJ9A 1PDVA 2IUEA 3GQVA 4LQDA 2C83A 3G2IA 1BAPA 2CLLB 3ZIDA 1CNMA 1RP7A 2H4YA 2HA4A 3KLPX 1NM5A 3L92A 3OJFA 3P1JA 5CJJA 5DCLA 5BQOA 3VYWA 6YASA 1DC5A 4YECA 4C7MA 2A0XA 4G4GA 4O4IA 4RMNA 3QLUC 3MHTA 2R4UA 4XVUA 2NXEA 1F14A 1JXAA 3H5IA 1NP7A 3EVZA 1NYTA 3P52A 3FD8A 3NYRA 4BFVA 4RK0A 5BT9A 2BUCA 1E18A 1Q1QA 2W98A 2NQTA 4DDKA 5CFNA 5HQTA 1K75A 4JKYA 1R0LA 1Z68A 4Q05A 1Y6RA 3A9VA 1IMOA 1D0SA 4KXWA 5A2GA 3J81k 5B30A 3TH5A 2JGDA 3VU9B 4NPAA 1E9CA 3Q7RA 2I22A 1NNI1 2RIRA 3AB8A 4KXNA 5JSQA 1ST2A 4FHDA 3IUSA 1XLWA 2Q4BA 4ZU3A 1JSZA 4LOKA 2HPAA 4PLHA 3WB2A 1ZJZA 3K1JA 4F4IA 4RJIA 2XTNA 3O3CA 3WQSB 4RLSA 2QORA 1CUWA 1AB5A 2HJWA 3AR4A 2HADA 3SC3A 2ZBFA 1IVYA 2ZJ8A 1D2NA 1P62B 1YIAA 4QXPA 1MDBA 1R8QA 1XAHA 4B80A 4Z6KA 4JYAB 1XNQB 4LYDA 1TT7A 2JFBA 2IVZA 3EVBA 1XQ9A 4REMA 3VUFA 2GXQA 2W7TA 3L4SO 3FDJA 2OVFA 4KIWA 4ENRA 3NZEA 4IHAA 3RU2A 2RGNA 1P7ZA 3WFZA 1XLUA 4DLTA 1PWHA 2Y05A 4YCDA 1J97A 1CVLA 2LCFA 5LZ8A 4FK8A 2QRGA 3DSRA 4EHBA 1ODJA 2QN1A 4R9VA 1BS2A 3K96A 4YC7A 4YI3A 2PLAA 5E7QA 3JV7A 4GBJA 3LC0A 1WMSA 1XSEA 2V4ZA 3GZNA 4IIDA 1Z2NX 3I2KA 3OZGA 3RVKA 1VLJA 1EP2B 3P9NA 3U4CA 3GRAA 2R86A 3AF4A 2K4MA 1B42A 1EZ4A 1F0YA 2HWYA 2IL1A 2XOKD 1LY1A 4WN9A 5FWYB 1DC8A 3VOAA 3ZHQA 5HRCA 5L3QA 1ZQ1A 1SPBS 1O5OA 1G8GA 4GYYA 4O4HA 4QGBA 2BWJA 1CCWA 3DD5A 3JTEA 1OI2A 3U40A 1EGMB 2F8SA 3NLLA 3R09A 4DANA 1TIBA 2YJZA 4WCDA 5KYNA 1XTUA 5A0FA 4J8PA 2OQ2A 5CR9A 4X00A 4PINA 3K6SA 1RIFA 4P8RA 4GI5A 4DLWA 4YRSA 1X1QA 1GYQA 5FWDA 2HA5A 3LXMA 4RFSB 5GM1A 5HFNA 2OFOA 2YVQA 1KOLA 3WZLA 5ALOA 4OQQA 2JAUA 3LVFO 3DM9B 1ZW6A 3L6EA 4LBZA 3VR6H 3KPJA 1DTWB 4PWYA 4PCLA 1SG9A 4LZLA 5JRJA 1PQPA 1HXHA 2GZ2A 1C29B 1CEQA 1JKFA 5IYZB 3TE7A 3EEIA 4FWBA 1BNCA 4K6OA 5I4IA 5AW9A 4F6RA 1N57A 3N0RA 2VT6A 3V00A 1XZIA 1OWMA 2ZIUB 1OAOA 3FCYA 4X92A 1U0NA 4B34A 4DAEA 1Z5NA 5F21A 1QS0B 4OV6B 4V1CA 5C3UA 4FGUA 4EY5A 3LX5A 4XGRA 4YGXB 3W7VA 4AWBA 4A6EA 3A26A 1ZZGA 4FDLA 2DT8A 2X9QA 4RXTA 2FPMA 1Z45A 4HTFB 5B12A 1L5OA 3PVCA 3JQFC 2JJ1A 4CJXA 3DL7A 2NVUB 1B4DA 4ZYYA 2X0KA 3GIDA 3R5HA 3OY7A 1H4TA 4R1SA 1SCNE 4H08A 4U3JA 3U7QA 1D1QA 4AM8A 1CNFA 4ZODA 4AJIA 5AVOA 4BP3A 4UUBA 4RY8A 3KQSA 5TE9A 3VVLA 4J6EA 4NABA 4B8WA 3PUHA 1ZJWA 2BM1A 1KP2A 4YUXA 2ZIXB 4O4LF 3AQ4A 3IALA 4X8OA 3RVMA 1A7AA 4PG6A 1EP9A 3I6QA 4JUCA 2BI8A 1PSWA 3WKAA 4A6PA 3C97A 4B9EA 5A5DA 2J08A 1ZH4A 2I7TA 4N5LA 1ZXLA 2OSVA 1WZ2A 1O5TA 2PX6A 2MMCA 1NASA 3ETNA 2ZUSA 3IP9A 3NV9A 4N6OA 5JD3A 5IT5A 3RSHA 1NNLA 1HLPA 1WTCA 3MXTA 1JLSA 3N5CA 4KQ2A 5DM1A 2P6MA 2ONJA 3W6OA 5I9LA 3MEQA 2HNBA 1T2DA 2HCBA 2GILA 3ILVA 3CO0S 3L7OA 4Y9UA 5ADVA 4CEJB 4PZDA 1GR0A 2QKYA 4GMKA 4LQ4A 4U0KA 1NUUA 4MR7B 3H4TA 2R8BA 3EFBA 1ZNZA 1A8IA 2BFEB 2ZBPA 3GFRA 1JSRA 1P2VA 1DTEA 2HMWA 4JSRA 5CEEA 1PP4A 4EHFA 3JASA 3UN1A 2FUKA 5HWSA 3IUQA 5ELXA 1E1DA 5FD8A 2GJSA 3QE9Y 2C2MA 1E8NA 1NW6A 4XUGB 1RSZA 4XXHA 2ZZMA 4LJAA 1W5EA 1WUKS 2C96A 2VHYA 2SKCA 4F71A 4DIDA 4MUAA 4DUGA 5K05A 1ZHOA 2DPXA 1YQWA 3R3ZA 1Z2CA 4QQ8A 3V8QA 3SZMA 2JKZA 4XD7D 1W35A 1YL5A 4Z0HO 3W4KA 5SY9A 3TW6A 1WWKA 4D81A 5JCXA 2IU3A 4G0UA 4FYVA 1HDIA 3KIPA 2H5LA 4D9GA 2ZP1A 3P9SA 2ZIFA 3CZAA 2NQ8A 4ND6A 1JWAB 1ECCA 3DV9A 4FYMA 4NATA 3K9FC 1R6BX 1MQAA 1M67A 5EUBA 5CRIA 3E1SA 2C5HA 2WT4A 3OTWA 2E6UX 1BA3A 2ATIA 2P5SA 3BD7A 1FUYB 4KRGA 1TTHA 4Q00A 5AM5A 3RYHB 1XQXA 2G0TA 3G13A 3WNVA 1G20A 1U7PA 1NULA 3KQOA 3TGWA 3ZYCA 3QUAA 2VHQA 2G08A 1NQWA 2X7JA 4XDGA 3CLTC 1R64A 3I09A 4AKHA 3TW4A 2OLJA 4NU0A 1N5MA 2HJSA 4EEKA 1QFZA 4JQOA 4YV2A 2WUDA 3QENA 3WG9A 5I6DA 1SHZA 3VR4D 1FEZA 4Y6PA 1BE1A 1ONOA 2QTTA 4QTYA 4I3HA 4ZXFA 1HV8A 3PZBA 4CQMA 2QF7A 5K3FB 1FPQA 1XB2A 2BUAA 3TLBA 3CF4G 1J0EA 1M8KA 2IEGA 4OIMA 3BGWA 2AJBA 3NDIA 4Q15A 7AT1A 2VK1A 5HUJA 3I4LA 3UXEA 4G9GA 4B4KA 4BQNA 1Q1ZA 3L2OB 1Y7TA 1EDZA 1Z0UA 3HE3A 4MVJD 4QPDA 2IYWA 4BQFA 3AESB 3AVUA 4I99A 1P9LA 4LXUA 1L4GA 2ZVPX 2BL4A 1X77A 3H0CA 1EP1B 1QQ7A 4KN5A 1LVGA 3O83A 5CHEA 1I10A 1EFLA 2C5GA 1E92A 1WXDA 3ASUA 2C9BA 1RLMA 1X7ZA 3CZCA 4P36A 4PHTA 4PNPA 1CY4A 5H0IA 1EK0A 1FNMA 5ALWA 3SBEA 3IEMA 4LKOA 1DU4A 1RZUA 1K6IA 2WHRA 4NDZA 4O2BA 3FPCA 1AQJA 2FY8A 3PHHA 3ANTA 821PA 4CEIB 5K3BA 2FHSA 6AT1A 2C92A 3E70C 2HA0A 5KCMA 2QOEA 4IIJF 5DGDA 2BGWA 1XRJA 1EPUA 3G9ZA 1W85A 1SQ0A 4M0EA 4XE5A 3B9RA 3P71T 1Q1BA 1OKKA 5L95A 2BCJQ 1QJ4A 2X5XA 3B70A 2Y68A 4RSMA 3VZRA 3THYB 1GOTA 1XMVA 4GXNA 2WUFA 3IUBA 1QP7A 3O21A 4E1BA 4EHIA 4F92B 5C1BA 4KFTA 2AOUA 2P77A 3ADCA 1E79A 3M82A 4U8GA 5T6MA 5HZKA 3RVQA 1VQ1A 1MB9A 1N2OA 4GP7A 3ZJYA 3PUJA 3AIKA 4CN8A 4U63A 4GHWA 5ECYA 1CXZA 4BKUA 3JYNA 4V0SA 3JPYA 4HH4A 3R75A 5AJWA 2PIDA 5JVDB 2AV6A 2OBNA 1K6MA 2IS4A 2JFVA 2R2GA 2YFKA 1HSOA 4AMBA 2WHPA 2Q7DA 1KGSA 2QDXA 3AFGA 5CDUA 2YC2C 1QK3A 3MVEA 3SR0A 2FGKA 2Y2UA 3FOEC 4GECA 1GVHA 3RS3A 5I45A 4YJ2F 5FBKA 5CNJA 1T1SA 4IKEA 4M98A 3RC2A 2V0CA 3AWIA 1IOWA 1R50A 1YKSA 4MW4A 1CY2A 4RKQA 2WTAA 4OJQA 1QGZA 3BL8A 3Q6IA 1Q21A 3DM5A 1XQYA 2OHFA 1E2BA 4E07A 1MPTA 3OECA 2NG1A 1FUKA 4MH0R 5DMXA 1GTZA 5HFJA 4LK2A 4WPGA 4B71A 5IK2D 5KQPA 4MQ6A 4BFLA 3E9QA 1AZWA 1P1HA 3DEAA 2P9HA 2PS1A 4UUPA 4DLXA 1J0XO 5B58C 2EVWX 3LJKA 3DO6A 1K06A 2LUOA 3LGSA 2RGNC 2FQ1A 3ETLA 1ZDMA 2OAGA 3FLMA 3L7CA 4GSYA 1U2GC 1OB2A 4F5WA 1RJ9A 2J87A 3G2OA 1JHXA 5BUZA 4J29A 1KMMA 3V8PA 2BD0A 4DJTA 3GBVA 4NOJA 3WK4A 3S1LA 2OBFA 3I6ZA 4JXXA 3MGCA 2YS7A 3DKVA 3KEFA 2C7GA 1JQBA 3WO1A 3N2GA 1STOA 4FNMA 4FYPA 3UJCA 2BFBA 4N82A 1BX0A 2ZETA 3DOJA 3DGFC 3OCUA 2DMRA 1RHUA 2FW7A 1LKZA 1AGPA 2RHDA 3ACCA 5JYCA 3OMLA 1Q77A 3QF4B 4WBNF 4H18A 1XFAA 2QE7D 3QUCA 3CWCA 5AXDA 4QEDA 3WDSA 2HDOA 2P9ZA 5EIOA 1TFUA 5TIIA 4LC9A 5TJHA 2E1RA 3ELBA 2VN8A 4BXOA 1KR2A 1ELOA 1Q0RA 3T5PA 4D26A 3V8VA 3QHPA 3O91A 5K8IA 2OSBA 2A0WA 4Z0TA 3X43A 4WDQA 4ZWNA 3COVA 5HMLA 1E2HA 1KXJA 4OG2A 4F8JA 5JROA 5IKXA 1NDHA 1Q15A 2ZOSA 1XZBA 3IA2A 4WXEA 4F8EA 3K70C 3U3ZA 1WBDA 1T3HA 4HNQA 3UMBA 4XWOA 1E2GA 3MOSA 4OFBA 4ZJUA 3TPFA 3OOJA 1S4QA 4BNKA 1PQWA 3P2YA 4EUNA 2EWVA 2MYUA 2E6KA 4JX8A 1FYXA 4YVFA 3GELA 5AK0A 1N9KA 1ACMA 4ZCSA 3VHXB 4NMXB 1DHTA 4JT2A 4JLMA 4HDAA 1XZDA 3Q3HA 5AKYA 4PZLA 5FA6A 1VHJA 5JHHB 4R4JA 4OATA 3WYBA 3CR8A 1IAQA 2NSLA 4NBKA 2PUFA 4N76A 2VTVA 1JHRA 2XXJA 5KYWA 4JP5A 3KDPA 3N2EA 4C07A 5CTAA 4YP9A 3B2EA 4FE3A 4FQ8A 4KLRA 3GPDG 4ZRNA 2O2DA 2GTIA 1P1CA 5CFMA 2DJIA 2FEXA 3CRRA 4FFRA 3P9RA 2MSKA 3KOZA 4G5XA 2I55A 4LC0A 2FZKA 3AIIA 3S5UA 2XNJA 3V1NA 1TA9A 3D4BA 3TLCA 4C7VA 5JR3A 3DUWA 2IU6A 4Y1GA 2ODNA 3IPLA 1LV8A 4KGDA 1LUAA 1SEPA 1DO0A 1OXSC 3OZVA 4H15A 4M21A 4EW1A 1GAXA 2ECPA 5LP1A 3O92A 2DFVA 1Z6GA 2QZSA 3QEJA 1GUDA 3KOYA 4DBZA 3T7DA 1H85A 4MWCA 4QIHA 3AKYA 5BR8B 3Q7IA 4HLCA 3K6JA 3MZ0A 4A0SA 4R0NA 1WCXA 1OPRA 4C3VA 1I6WA 4F85A 4YCNA 3HCPA 3DLBA 4KX3A 4LAFA 4ARZA 2PY6A 4XWKA 1X94A 3PE4A 4OFZA 5CBPA 3F8WA 2PWPA 3WL7A 2JHCA 2WOJA 3LYAA 1IRXA 4YIHA 4DV4B 3IEIA 3HZRA 3R40A 3IO3A 3ZEAA 4RPHA 4MJ7A 2G9NA 2HK6A 1HA3A 3ACBA 1B14A 2WKPA 5H1YA 5H70A 4F96A 4BNYA 4TV8A 3SZLA 1TTQB 4OM7A 3QV2A 4HAVA 4UOZA 5B3KA 3O1LA 3LQQA 1K0FA 3EISA 4I14A 1HTWA 4OEHA 1IVSA 4CODB 1O0CA 2WWGA 5DOVA 4J3JA 5K99A 2SHKA 3FTPA 5IZ4A 3MQ4A 4RMHA 1PBTA 1GTVA 2B25A 2XHEA 4PLWA 3TUJC 1LDYA 5GQSA 2Y1EA 4RJKA 5IJ0B 1L8LA 1ZM7A 4ALIA 1DXHA 1OVMA 1G5FA 4IMPA 5CT4A 4UEWA 2JLSA 3QY9A 2I78A 1JE0A 3A4MA 3HBFA 3O6VA 3RQSA 2H16A 2GI4A 4W6ZA 4OX9B 2I4IA 2WT8A 4TMFA 4O4IF 1BVYF 2QR2A 3R0ZA 2IUUA 2OV3A 3AC0A 3DKKA 4MO9A 1SRQA 4RF5A 5CH8A 2ZI6A 4UNRA 5ER9A 4UTVA 4BRSA 1W2HA 2XCRB 2QPAA 2EF0A 3TOZA 5I48A 2PSHA 5G4LA 4U6NA 3L79A 1T6BY 4KOEC 4RDIA 3WRYA 3ZK8A 1Y7HA 1YI1A 4ERNA 2X2EA 3R5KA 5A6VA 3GLGB 1MOZA 3KQMA 3HVJA 2DCMA 1T1JA 4OGLA 4HV4A 4DPKA 2FPXA 2OZLA 1L5FA 3GT3A 3QTBA 2HSWA 4MWZA 3IKLA 5JDCC 1EU1A 3R5TA 4QNRA 2FK7A 1YRYE 3EVAA 4WA8A 4X0EA 2RMKA 3EG5A 4ESEA 3T3DA 1UOQA 4ZZ2A 4G1UC 2LP4Y 1JQKA 1Z22A 2FWIA 3BERA 2F8LA 4F3YA 2Z2KA 4LMPA 4OU4A 2W6PA 4G37A 2QQFA 3AF2A 3GDHA 3GVIA 3K0FA 4PO8A 3IXQA 4BLUA 1Q16A 3GEIA 4FPXA 2W43A 4DL9A 2AG1A 4MZDA 3WMFA 4CIBA 1VRWA 5HIIA 4P54A 1NW3A 1GPDG 1MD9A 2IU4A 2R8XA 3V4PB 2G83A 1CQIB 3TQSA 1XZGA 5BVGB 3WIOA 3D4PA 1A76A 4C6HA 1G98A 4EUEA 4X65B 3O8CA 1KH1A 2JVKA 3OOSA 3ZV3A 1XYVA 2PAFA 3GQBA 4I1YA 5T64A 2XT9A 4WHMA 5CA0A 1LPPA 4RA6A 4HEJA 5DRTA 3IPRA 3BRWD 1E5LA 1HDYA 1XZQA 2PKCA 1BDHA 5KKCA 4BNFA 5MFZA 3C4VA 3D3WA 1DPGA 2EBFX 4ACAA 3C7AA 1RYFA 2I5PO 5CNMA 4CR7A 1OB5A 4MOWA 3W4JA 1SIUA 2D0IA 4AZ0A 4Q37A 1MEEA 3IQHX 3BM5A 5ALMA 2G88A 1RABA 4NCNA 3SDZA 4V1CI 1GGJA 1QYIA 3L4BC 3RH0A 3P7MA 4B6SA 3AP3A 4GZLA 2IEBA 3H97A 3R7WA 5CA1A 2EKPA 1KKUA 2AOTA 4E5DA 2OILA 2IHKA 3R3HA 3M6WA 1WPXA 3ZBPA 2CDCA 2W9XA 1DIBA 3KOWA 2G1UA 3L82B 4OQDA 2CHEA 1QCDA 3LQFA 4YRCA 3U56A 2TMGA 5GGYA 2NSYA 1WSAA 1CJVC 1LZKA 1T8UA 4XQCA 3RT7A 4CDNA 2BGJA 4Q66C 2BFDB 2CFSA 2IV2X 5IABA 3GOQA 1IULA 2EJBA 1VL8A 1GL7A 2O2EA 3TRIA 5KVCA 2GVDC 2IOHA 3NRCA 1RAFA 1IBRA 1NF8A 2Q2OA 5FR1A 1BE0A 1KI1A 3H8VA 5AK6A 1PJ8A 5PGMA 2E5WA 5AQEA 1G7SA 3PQ8A 1EFCA 3QLTA 4TZKA 5E6SB 1A9OA 3JWPA 1HT3A 5ENVA 3IIIA 1ZSYA 1TYBE 4M2LA 3OX1A 1G21B 3RT1A 3V1KA 1C9EA 2AE2A 3QMMA 3C1UA 4FLEA 1L7RA 3QXXA 4Q7JB 1L7EA 4UVDA 1RXSA 3U7RA 1RRCA 4G0PA 1Z2AA 4GF5A 3A10A 3HR8A 4GBED 4FFSA 3Q1LA 5EKUA 3ZDCA 4W5HA 4AP9A 3L6OO 4GMHA 3RE1A 2ZB3A 2O19A 4MQFA 1V2GA 2SKEA 3DV0B 5BOSB 1F8YA 4E22A 1VKOA 1KSJA 1PJBA 1TYDE 3VSAA 2ZSEA 2JG3A 1DELA 1N2CA 1T2EA 4IUYA 5FFNA 1J6UA 3BWVA 4IEIA 4B79A 1US8A 3UVEA 1Y7PA 4N5MA 2Q4EA 3MTGA 1SBNE 4LDQA 1YACA 4GI3A 1X15A 2CEKA 2HCFA 4RM3A 3FJYA 4QUHA 2IXTA 1Q1NA 2BI4A 1F0KA 4Y2PA 4LHVA 1TZCA 3W5VA 2ZIWB 2P9JA 2A3RA 2EL7A 5CVJA 5FADA 2Z2YA 3EZFA 1XJQA 2A4MA 3VPAA 2XAUA 4LRSB 4QUBA 1K7XB 4P58A 4B3XA