2IHZA

Crystal structure of multifunctional sialyltransferase from pasteurella multocida with cmp-3f-neu5ac and alpha-lactose bound
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
388
structure length
379
Chain Sequence
MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSALNNPYVKVMRRLGIIDESQVIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Alpha-2,3/2,6-sialyltransferase/sialidase
publication title Crystal Structures of Pasteurella multocida Sialyltransferase Complexes with Acceptor and Donor Analogues Reveal Substrate Binding Sites and Catalytic Mechanism.
pubmed doi rcsb
source organism Pasteurella multocida
total genus 134
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA01
4V3CA 2IHJA 2Z4TA 2ZWIA 2IY7A 2IY8A 2IIQA 2EX1A 4R9VA 2C83A 3S44A 2EX0A 2IIBA 2IHZA 4R83A 4R84A 2ILVA 2IHKA 4V39A 2II6A 4V2UA 4V3BA 4V38A 2C84A
chains in the Genus database with same CATH superfamily
5HIKA 4TWRA 4NBLA 1KARA 1W4CA 3RTBA 2PGOA 1NOKA 1QORA 1RXYA 2D3TA 4LQCA 1QGOA 2JDIA 4HDAA 4J43A 3ZCUA 1OZGA 3ESYA 2QORA 1IRXA 4D8YA 2YASA 3UG6A 3BH0A 3SHVA 1YKGA 4EKNB 4CRWB 4ARZB 1T8SA 3FETA 2W22A 2VDJA 2NZJA 3GW8A 4S1OA 1ORRA 2OPBA 1W0CA 3I9V6 4NBVA 5GZ1A 4MYCA 5DRYA 1GL3A 1KI7A 3SQMA 2M1ZA 2IF0A 4DYDA 1RS0A 3AEXA 2ACWA 3IDQA 4H7JA 4OU5A 2PCLA 2D2IA 2WIFA 5DEIA 5F3RA 5BOSB 2F55A 1E1NA 3SS8A 1OVMA 2VUIB 1O08A 2YUTA 3WHIA 1KEVA 2Y1OA 4QU0A 3T4UA 2YH2A 4BQEA 5A7FA 3JRXA 1Z13A 2WWVD 4F06A 1IDOA 2QR2A 4NYMQ 5C8YF 3MCWA 2WSMA 4GX5A 2R8OA 1U2GC 3WWEA 1R3DA 4JENA 1P18A 2C88A 3TMAA 3DDCA 2OC4A 5AW5A 3QRWA 1KTIA 3S0JA 1J2UA 2EQAA 1UMBA 4D45A 3DYBA 3QU9A 5FPYA 3ILSA 2YJ4A 1DS6A 3GLFA 1CERA 3T7RA 4TS4A 1R5JA 1YL7A 2NPOA 2H5LA 2ORED 1ZIXA 1A9QA 2QLLA 4HAIA 3M4JA 4DVGA 2QVZX 4D42A 4NE9A 2J4CA 8ABPA 4E70A 1ZNWA 3O38A 3V7WA 4OHVA 4CF5A 3RODA 1T9GS 3RFFA 1MQ9A 3L1KA 2RG1A 4HDKB 5K4AA 4YCJA 2RHMA 2X8JB 1JIIA 3OE5A 4YMIA 1CY6A 4DLNA 1VE9A 3F78A 2CXSA 2JFHA 1KJWA 1OA1A 3HI4A 3GEDA 4MS4A 3CRW1 2VLBA 2AFIE 4NPHA 2EJWA 3A6DA 3L0CA 4KBGA 4WUTA 2YBDA 3JQGA 5IKMA 1IG0A 3L84A 2QRKA 5MN6A 5LLSA 4LY0A 1A9XB 4B31A 2EKLA 4IVQA 4W8GA 3PEEA 3NCTA 1KEEA 3LF2A 4CUZA 4I8XA 3RUHA 4C1BA 5ITZB 1I8TA 1PJBA 2ZE6A 1DP4A 2AQKA 1GCOA 3MMZA 3WQHA 1JG2A 4XIJA 5IM5A 3UQYS 3ZDEA 3NYRA 3W1WA 4YJFA 2PS3A 5KAMA 1VCMA 1RDFA 1U8XX 1GZ5A 2G6BA 1Z36A 1K7YA 1WF3A 5E2BA 3HA2A 3HFGA 3H5OA 1G6OA 1CVRA 3AUXA 2WT8A 3TB6A 4BN0A 3IQIX 3Q3CA 1SOWA 4GF5A 4H0CA 5BQ5A 2EKZA 2NVUA 4E15A 4FGKA 1Q7BA 3TVTA 1DBVO 5I7HA 2W2NA 3FLMA 2XTZA 3BMQA 3O1JC 5C2JB 3OY7A 3K9FC 2B5VA 5BR7A 1ZINA 3M34A 4O5AA 2V8BA 4QU5A 1INLA 3BPSA 4A2QA 3DMTA 2F8SA 2ERYA 2HLHA 3QBVA 5C37A 3EQ7A 4KUHA 3SZUA 2D00A 1ZHHA 4HGNA 1LLUA 1U0FA 2VHVA 3TMYA 2RH8A 4Q48A 5BSUA 5HIAA 4MCAA 3IBSA 3ZGLA 2O0LA 3EZ9A 3Q7RA 1USIA 2OY0A 3GJSA 5FHQA 4ZHQF 3ELYA 2AL7A 3W8FA 4HAZA 1DAOA 2W4MA 3AEYA 1YFLA 1Z5NA 4BFWA 1I14A 4DNFA 4HUJA 3TD6A 3FNFA 5FWNA 4Q1VA 1KSFX 3H2SA 3PSAA 1KI8A 4S24A 4ZYUA 3M4XA 1LPOA 1SCKA 3LHIA 3R3XA 3VC3A 8OHMA 3DEZA 3FDZA 5DYTA 3T9DA 1MPXA 3DMFA 2J9ZB 4UXHA 3PV0A 4AZVA 5EQJB 2AXEA 2YYAA 2WE7A 4IR7A 1NU6A 4NBWA 1P1JA 3CV3A 5EJFA 5LA6B 3RVLA 2A0FA 4X64B 3HU2A 1K5DA 5IUNC 4F4IA 2X76A 2JGLA 1PT5A 1QGAA 1SXHA 4DG8A 4GWLA 1LPPA 4RIHA 5IDWA 3D2BA 3OZBA 3HFJA 1OW3B 1O95D 2GYYA 4QYIB 3AR4A 1V6CA 4LPKA 4KBFA 3M3DA 1RR6A 4OPMA 4TTPA 2PX4A 5GJCA 3SXUB 4DMFA 2AEFA 3K0CC 3TPFA 1SNYA 1WOMA 4C5BA 4B3GA 4R1OA 3DFIA 3IP5A 4O4IB 5ALSA 2QBYB 1KETA 3MHPA 3ILHA 3RS3A 3BJRA 1H65A 3UJCA 3D0QA 3EIXA 3FGOA 4OSOA 3O84A 3UMMA 2VUTA 4DSOA 1E7MA 2LW7A 1Z0ZA 2AOUB 2WJ4A 1EK5A 1WULS 3MUNA 3VGPA 5GTDA 3SQWA 3ORRA 2CSXA 3A3NA 3G0DA 4TS1A 1JLLA 5F7XA 3VOAA 4WHMA 4JBHA 2FPGB 3RIEA 3ROFA 2VWHA 4F2PA 5D2CA 5BVGA 4I5GA 2WU3A 3OZAA 1X74A 4I1SA 3LC0A 4TYQA 1UFRA 1WUJS 3C7DB 4YIKA 4ZVQA 3WY9A 4EB6B 1ISGA 4H9GA 5B2EA 3UXHA 2IPLA 2VQ3A 1WQ4A 1XF9A 1RW4A 5A4KA 3ES9A 3NS7A 1Q0SA 2RGUA 1XG5A 3I04M 1C0LA 1DV1A 3P2MA 4WFIA 2ZRHA 4KYUA 2C2YA 2DZDA 3I8OA 3UICA 3QQPA 2CL5A 2DTEA 3X1YA 3U1VA 4JLVA 4E5VA 2LKCA 3OM0A 4P83A 3IO5A 2Q1XA 2WWFA 2HJVA 3MFQA 1KXJA 3CCBA 2XAAA 2B99A 5CP8A 1NT2A 3N58A 1UZMA 3BHNA 1C7ZA 2JBAA 1QFSA 3BFVA 3QXHA 1LW7A 3U44A 1FW8A 2CV1A 4QTYA 2I7XA 1NF9A 2BEJA 1BGVA 3E5HA 3RVSA 1ECJA 1P4AA 1Y7HA 3GLRA 4QEDA 3GCWA 5KOHA 5K1ZA 2V3CC 2O8EA 5JHHB 3MWEA 2C1EA 3CUUA 5KJEA 3RHSA 3GP5A 3A3YA 5E1MA 1NSTA 3VHXB 3NTLA 1UPUA 3AH8A 4CM4B 2D0PB 2OAEA 1NZFA 3DTNA 1M0EA 1QGDA 3OOJA 5LC1A 1CE8B 2PUAA 4PR0A 2B37A 4G4IA 2A3NA 1L7NA 4EATA 1PL8A 2W6MA 3TNFA 1QX4A 4KR9A 1Q0UA 3ZQUA 2PL9A 2VJOA 2Y0CA 3B5EA 3ONEA 4W5TA 1Q57A 1IFXA 1NQVA 3VI4B 4ZJPA 3WXMA 5IFKA 5ARCA 3H2YA 4OI0A 5T64A 1DKUA 1PTKA 4U5XA 4CPDA 8ADHA 3K70C 3ZLJA 1NOIA 2LP4Y 3N8NA 4LJ5A 3UHAA 4AJHA 4WZAB 1NUHA 4Y3UA 1V95A 3WFZA 5J4HA 1GZDA 1CUVA 2XUHA 2H1RA 3D5TA 4DMHA 1M0SA 1L5GB 4F92B 1KPGA 2O3TA 2E6KA 1WKCA 3RS5A 3I9V1 1XRNA 4M99A 4U4AA 2FFQA 3KZOA 4HG2A 5LP1A 1N34B 1H9CA 4H18A 5K45A 3LX5A 3E1SA 4LQ4A 4MV4A 4ZANA 2CDAA 1BNCA 4KN6A 4D4KA 2I6QA 3NKFA 4GSKA 4UFNA 3AUTA 4PY2A 3KCNA 2C5HA 3CO0S 2JKZA 3GR6A 4G4GA 3LX6A 5FORA 3RVKA 3U17A 1A97A 3UH0A 1U1IA 4WKPA 3W3ZB 1J0BA 2A78A 2I2FA 2BGLA 2X23A 1ZCBA 1VKOA 4JT4A 2ATXA 3VBCA 3R7BA 1VP3A 4ZU3A 1E1LA 2Z8XA 3GLFB 3FDFA 3H9QA 2FZWA 2IYVA 2NN3C 1NUAA 1F9EA 2PDAA 2CFRA 4G5FA 1E2KA 3T1QA 3UW1A 3KLOA 3VTAA 1YZYA 3H2HA 3NTQA 5JQGA 3IKJA 1CJSA 4MJ3A 5J63A 2B94A 5IAJA 3TNDA 3I62A 2XXAA 3ITDA 1IQ0A 2WT9A 3FFTA 1MIHA 4NS4A 2CMGA 3UJHA 1BE8A 1TO1E 3B52X 4UD6A 4XWKA 3LUBA 4JU8A 1V6AA 1YK0A 2IHZA 4PYLA 1M7BA 2HQRA 3LLMA 4ZTBA 1GGHA 4F60A 4MPTA 1JLMA 1ETUA 3R0IA 3G6WA 1WKBA 2F9LA 2HA5A 1QFZA 2G1JA 5DWDA 5FLXA 2R87A 4MS4B 1IUPA 4Y2VA 4RV5A 1AUQA 3WMEA 4EA6A 3TKLA 2O2YA 4MITA 3WRYA 3ZVNA 1T8RA 2G76A 5K3AA 2HN9A 1KEEB 5KYKA 1GZVA 1V7PC 3T61A 2J85A 2RBGA 4G5QA 4ZCSA 1GRVA 1SHUX 5D51S 2JFBA 2AG6A 2WKWA 3O4IA 2QMQA 1P2FA 1FXWA 1THZA 2FPRA 2GUWA 2ZJBA 3GJXC 3NV7A 4B84A 1G64A 3ND9A 3SC6A 2ZE5A 3LCMA 1N2GA 5LP6A 1E0JA 2RG7A 3EA5A 3NIDB 1GZUA 5ALFA 1RWWA 3PJGA 1I0LA 4EKYA 1IHYA 1K8YB 4JJ6A 4KN5A 3KHSA 1KZYC 4P31A 1YCFA 2FZGA 4I4LA 2OQRA 5BY2A 5AK3A 4KGZA 1IY8A 3MTQA 3V33A 1OAAA 3NRCA 1QKJA 4JUCA 2AN4A 1I1QB 1JIKA 3DBVO 3ETEA 5CT5A 1XFAA 3PGA1 3DHEA 2UKDA 3T3MB 4L5JA 4U2BA 3M6FA 1L5QA 4RZQA 3I6YA 4MYRA 1UC5B 4RS4A 3A4VA 5EEHA 6REQA 4R1QA 4NL4H 3OZRA 4OG2A 2DXIA 1GNLA 1E2HA 1Y8RB 5AI4A 5BW6B 2JAQA 2G71A 3LFTA 1I3MA 1ECGA 2GZ3A 1QONA 5KOJA 3ET5A 1VMDA 1XTKA 4CT4B 3MIIA 1A27A 3DEYX 3N05A 4R7TA 4BDSA 3RC8A 3KPJA 4EJ0A 1KIAA 2WJ3A 3HY4A 1D9ZA 1UBLS 1A9ZA 2QW8A 1YE8A 1BE6A 1AE1A 1VIVA 4PU0A 1ZQ1A 4JLJA 3BDAA 5FTMA 1BFDA 1JTEA 4HPWA 3L04A 4C7VA 1KFCB 2JFPA 4NJOA 3ASYA 1IXSB 2WTAA 1ULHA 2Y68A 4IUCS 2PLRA 4LI3X 4NY1A 2VPQA 1PVVA 4TTQA 2VVTA 1KP3A 5DM60 4DWOA 3OP1A 3ORSA 1MABA 1O6ZA 4HNGA 4IYJA 2MDTA 3OQ1A 1GCUA 4ECAA 5DN6D 5A2GA 3F9CA 3SYRA 3DNFA 3LUAA 4GPAA 1P7CA 1QHYA 4BECA 4BNTA 1L4LA 2ZW9A 3F2VA 1KFBB 4R5HA 4HRVA 3OFSA 2I9KA 1N7HA 3WB2A 4CF6A 2XHEA 5C8ZA 1J21A 1ID8A 4FTWA 1F8XA 3IP7A 2VHUA 5AVWA 2QUZA 3AIIA 4J91A 5JISA 1FLVA 2G63A 3QVMA 3REQB 3CLUD 3FSRA 3MRSA 4LV6A 2IWRA 4TROA 3FHTA 3OE7D 3CKMA 1JJBA 1JLLB 1I2MA 3ETCA 1DRJA 4XGRA 5DYIA 4XJXA 1HSZA 4NFHA 4ZOQI 2EZ8A 3H1TA 5BVGB 3I45A 4Q66C 5KOIA 1C3EA 2CFTA 4YP6A 5J59A 4RDXA 2FEOA 3EG9A 5LZ7A 5TJHA 4F7DA 5JOQA 4PPNA 4C0JA 3AR8A 1Z17A 3KXDA 5AW9A 4WJKB 1EEXB 5IKXA 5HR5A 3P27A 2HJSA 1ZSYA 2RHDA 3TZEA 3UQZA 4EGJA 4M8IA 1MJNA 3OHPA 3MJSA 4M87A 5AP9A 1MHTA 4K9PA 2UU9B 1BXKA 1E3DA 2PYZA 3C1UA 4FGUA 2WG2A 3DP9A 3IVRA 4LFAB 2BMVA 2JBHA 3H65A 3NRJA 3VPCA 2NUBA 3OCJA 4HQRA 4ZO4A 2QNIA 3U3ZA 3WYEA 1Z2DA 1K9SA 2HBRA 4IHKA 4UTPA 4LF6B 4ME6A 5I9MA 4OLBA 2JBAB 3NAZA 3ZI7A 2FUG6 4KIGA 3QUSA 4PLCA 1SCAA 1YDHA 3PC7A 3UUWA 2FR8C 4FDLA 1T15A 4KG7A 1E4EA 3F5QA 1R10A 4TL7A 2XB2A 2OYRA 2FYTA 2Q1UA 1G8YA 3EIOA 3HV2A 3IVXA 1Z12A 4PZPA 4PC2A 2O8EB 1PT7A 3NJ8A 5FQOA 4PPYA 4MQ4A 4ASUD 1E0AA 2WU4A 2YFKA 4NC9A 2FSUA 2I8CA 3WBKA 4CTNA 2VSYA 3LQYA 1L7RA 5E8JA 4QOIA 4TV9A 1KZHA 5AR1A 2BFCB 4N0PA 1L6IA 4B44A 5DHAA 3GNQA 2W4IA 5IMBA 1CY2A 1KY5A 2GO7A 4M0DA 4QGGA 1LZKA 2QZZA 1N9ZA 1VLJA 3C7CB 2Q62A 4GGOA 5CFRA 5GJBA 1JWLA 2JA2A 2YOHA 4I4TF 1ILWA 3AERA 1G5HA 3OZXA 1D2MA 2Q50A 3HJGA 2HHLA 3EXHC 2C57A 2WINI 2AJBA 1JEYA 8MHTA 3P0JA 4GEGA 1E3WA 2QF7A 3GDOA 4G0ZA 4RC9A 1PIWA 1Q5PA 3DCIA 1VQ1A 4LK3A 1AUPA 3O82A 4P38A 4EIWA 1PG0A 2EGGA 1MBZA 1UFVA 5THXA 5DASA 5FBVB 4HAOA 3G1TA 1QU2A 2I2WA 1QJCA 1LSUA 3IVCA 5HJ7A 2JCYA 3BRQA 3K53A 4DA8A 1RP1A 2DWQA 1AM4D 3ISVA 2VAVA 2YC2C 3DHNA 3GBPA 5M2QA 2NQ8A 3NUZA 1OX5A 1ODTC 3GOQA 4JLSA 4UHJA 4B7CA 4OF4A 3GGOA 3AVVA 1F14A 5ALXA 3ZDBA 5EKSA 1N0WA 1ZW6A 1JHYA 1F8YA 1QLHA 2CDNA 1K5PA 1JZSA 1RWVA 2Z2IA 5AK4A 5L4NA 3T7AA 4US1R 4BE9A 1YZ3A 4P4TA 1WCWA 2WUWE 2AJLI 2OHXA 4G5RA 1T3ZA 1E1CA 2HMSA 3KU4A 4JHXA 5JQGB 1MUUA 1O8CA 1YVUA 2BR3A 4LRUA 2EL9A 2YV5A 1NQTA 1BX3A 2JGMA 3EUFA 4ALJA 4G0QA 4KMSA 4TUYA 1MV8A 2R6AA 1WQ3A 5L51A 2Q9BA 1XSEA 4QBFA 4F97A 4LE1A 5HFAA 2P41A 4N82A 4FD3A 1VDMA 1JBQA 3WLOA 4WKGA 4X7RA 3KUUA 2A9VA 3VO1A 1XZBA 1ML3A 2I29A 1CJUC 3LUHA 4F6LA 4KQJA 1M8GA 1G55A 4MI3A 1TQ6A 1UPTA 1HLDA 4E32A 1NVMB 5CA1F 5AHOA 4PBSA 3ST7A 3THYA 2R8RA 2IHTA 5GIOE 5KNCA 5FOXA 3I58A 2HJRA 7REQA 3KYDA 2Q5CA 4NYJR 3RJ5A 1ZOOA 3O94A 1A69A 1QLJA 3HUFA 1EP3B 1RLTA 2BEWA 4OHRA 5LYYA 1X42A 2PY6A 3PXUA 3FNQA 3KU1A 5JSQA 3ZZNA 1YE3A 3IR5A 4NBTA 4V1CA 1G4UR 3GGSA 1FP7A 4ZI7B 1MMFB 2IPNA 3H0EA 5LP6B 5EMKA 2OQIA 2GJKA 4WGGA 3N3BC 2PT9A 2VK8A 5TVGA 3Q8LA 3DZ8A 3T6KA 2DUJA 2B9EA 4RMNA 2AV6A 1W25A 2PX6A 3C6BA 1ENYA 1COZA 4G8BA 1T1EA 2QHXA 4IINA 4KFTA 4D96A 4QELA 5H83A 1N3YA 5IN5A 1ZRNA 3MCZA 1HFWA 1G6Q1 4QICA 4E0BA 2OLKA 3ICPA 5EE0A 4HK4A 3KQNA 3U3JA 5JCOC 1PDOA 2FKAA 1Z07A 1V3TA 1C2YA 3OCXA 4N48A 2QPTA 3AUYA 5D7BA 4AJ2A 5C3MA 2ZCJA 1QE3A 2I3ZA 1F3OA 1AK2A 3OOWA 4LRWA 2W4QA 1RYYA 2FFJA 6REQB 2EW8A 5MDHA 2QRJA 1YI1A 4P3XA 1NJSA 2PVSA 3U7RA 1A0OA 2G9NA 3ONDA 2G1KA 1SXJA 3QTBA 2GN1A 2MR6A 1P75A 1QQAA 1EB8A 2VWQA 4EZIA 2J3IA 3LGAA 4F2HA 3E18A 3HNRA 3IQWA 1M8FA 4P4NA 4YCBA 2ZYWX 4D43A 3BXXA 4PHFA 1R1DA 2P65A 3I9KA 4IZ6A 3FI0A 1ZFNA 2ECKA 1ENOA 4XJVA 5I4CA 1MABB 3P5BA 1PUJA 3MWLA 5K51A 1T3SA 3NEAA 1ZOSA 1SU6A 1ABBA 4EA8A 2VRCD 4EZEA 1P1BA 3DUFA 2ETVA 2H2FA 1RI2A 4C22A 5A9RA 4IEEA 2ZULA 4LZOA 3NHAA 4BYMA 1U8ZA 1AKNA 3F5MA 4NCXA 3NDPA 3GU3A 3U09A 2YV3A 4RL4A 4W1QA 3OLVA 4YROA 4YJ2A 4I08A 1ZJWA 5LM3A 4K86A 3PGKA 1LQ2A 4YCMA 1L4FA 1UBGA 4N9WA 1TEVA 2PZ8A 1P0FA 1VPVA 4MB2A 1PL7A 1QYIA 5K6AA 4YYEA 1EFDN 3DLHA 3OO1A 4TPKA 3W7VA 3MT9A 2P7IA 2W6JA 3ND7A 1P2UA 1EQ2A 3PPXA 3P9ZA 4F9TA 2Z4SA 4GO1A 1VIMA 2VHTA 4UTOA 3QF7A 4WY2A 1Z4PX 4HF7A 3NMUF 3AVTA 1U9ZA 3EG9B 2YXNA 3TUIC 5C4MA 1P5RA 4PRZA 2PBRA 4LC1A 1E2JA 3IVAA 1DBPA 4AJ1A 2HREA 1KYWA 3VR5D 4H4EA 1EUCA 2R66A 5A9SA 3LY9A 4MVJI 4MWDA 1GADO 2R3SA 4MVJE 3JD0A 1GA6A 4DLBA 5IXSA 4EYEA 4BKMA 3AYXB 4EECA 3DWEX 2YY6A 1E4OA 2ZE8A 3LRPA 3MJTA 4F5WA 1MRZA 1PT6A 5A5EA 1UXHA 3RBZA 4C14A 1GKYA 1N2BA 2I1VB 3EGXA 1KSJA 3PCRB 2JD1A 5EKXA 3LKZA 1I0IA 5TE9A 1I80A 1VGVA 4PX2A 1YRYE 1O9GA 3TL2A 4XD2A 1P9OA 1OLXA 2R62A 2YDXA 1C8BA 4W5JA 3AJRA 2CSUA 1G21A 2FUG1 3WJ2A 2RJNA 4XQCA 1L1FA 3WK7A 3FOWA 1TUBA 4MJLA 4JXXA 3SXJA 3I5UA 3EBOA 3HYNA 2GEJA 1UH5A 1IY0A 1J5EB 2J09A 3OHMA 4FWTA 2J07A 4KO4S 4TV9B 1EGMB 3PX7A 3OJ0A 4L15A 5HS6A 1UT8A 1V2HE 5CXQA 3THXA 2GR9A 5A3VA 4TMXA 1OGJA 3D6JA 2QD1A 2A33A 5LQJA 2DAPA 4Y9RA 3UATA 3DF9A 3EGDB 1XF1A 5CVUA 3IL2A 1O9BA 4Z4IA 3DC7A 3AERB 4FGLA 3FPEA 3HYRA 1XZ8A 1JEYB 3AKDA 3LQ4A 3MHTA 2F62A 1E3WB 3IA2A 4KBYA 4CIWA 1E89A 2C84A 3F98A 2B82A 2CL0X 3PYMA 4R0VA 4WT7A 3RE1A 1RZRA 4M36A 4NJMA 4TX1A 4DQLA 3HCRA 2XQFA 3ONVA 4BQQA 5ALDA 4IICA 4QSHA 2FOLA 1QH0A 2J9YB 4MGIR 5A4MS 3GK3A 1QS0A 3GT4A 1T2AA 3NANA 4MUJA 2QM3A 5C35A 4PLGA 1OUMA 2X6TA 3OIVA 1SCBA 4L9WA 4RIFA 3NAGA 4R05A 4ZRMA 1CUUA 2IZOA 1BRTA 5EL0A 1V47A 4UNSA 3D7NA 4TKMA 5G41A 1XB2A 2GCEA 3FMVA 3K4QA 3P0FA 1GKIA 5K7SA 3PQ5A 5F3WB 1Y3FE 2X8AA 3ABSB 3HA7A 2DKNA 4TWAA 4CN8A 3E9NA 3R74A 1O58A 4IM7A 2CXRA 1ACMA 4IHJF 2ONJA 4EFLA 1WS6A 1YAHA 2BT4A 2BCGY 1XJWA 1Z2OX 5JLJA 1KBOA 1N5IA 2HPHA 4QQKA 1JQJC 1MXFA 1T1RA 3LK7A 2CHUA 4KIFA 4DTCA 3ETJA 4R69A 3I2GA 4JBYA 3C2QA 4ND7A 4IS3A 4RJLA 3EGOA 3GT0A 2UZ1B 2X4DA 3L8HA 4QBGB 5BSWA 4YUVA 1L5MA 3H4VA 5IU6A 2QTTA 1MFZA 3ZU5A 1V1JA 3DTTA 1BQ4A 4UHHA 1WMBA 1S5PA 1TF2A 2M6KA 2YXDA 2RIPA 2O3QA 1I2BA 1FQWA 1KC3A 1XLTC 3PUKA 1E5LA 2FG6C 1R9NA 5BQFA 3WIDA 1CDEA 3AUUA 5TQVA 6YASA 3LQKA 3CHYA 3GLFE 5A4AA 2WD7A 2B7CA 4HNVA 4KQHA 1KWGA 1EE9A 2QT1A 4DSNA 3RTGA 2DU8A 3DDNA 3SX2A 2OGUA 1PGPA 1QAOA 2WAXA 5C5DA 5EIEA 4J16C 3R5JA 1MAHA 5J1SB 4E5YA 3GLGB 2VHEA 3GRFA 2R6GA 4XR9A 3KYDB 1I7LA 1ZL2A 4IKOA 2JAWA 1X0VA 4L8FA 1QIHA 4EW6A 3FW1A 2GKSA 3ZHBA 2AXPA 1CR6A 1SO8A 4Z54A 1GU7A 3PWSA 5JSFA 3T1OA 4C4ZA 3CZAA 1H0KA 1T5OA 2WD9A 4I2NA 2B98A 1SKQA 4B2PA 4M7RA 5U4QA 4V1CB 1P7ZA 1W36D 3W9UA 2PMKA 4FOSA 3EVTA 4BNUA 5GV7A 3HO8A 2ZTMA 3B7GA 1TVEA 3IMEA 5EXEA 5HKOA 5KPJA 2X5XA 1GQ2A 2G5TA 4HFMA 1X38A 4DA7A 2BTOA 1D1QA 5MHTA 1II8A 2FQQA 1HF3A 3AINA 3PD1A 3NDRA 1KOFA 1MJGA 1DV2A 2CDBA 3QLVC 5LMCA 2XCSB 1TKAA 4BP3A 2IOHA 4OQYA 4Z51A 3NZEA 1TM2A 2Q0QA 3KPUA 3SFZA 1P0QA 5FPPA 1EUYA 2VTBA 2WNSA 2ACVA 1J09A 2AX4A 1FMFA 2IELA 1A9TA 1IN4A 1NF3A 1UXOA 3KG2A 5KU1A 1UKVY 1IQRA 2GM9A 3CN7A 2ZRQA 2NVOA 4YGXB 1I7SB 3UMYA 5CTAA 3PHHA 3IKTA 2DLNA 4QQFA 1N2IA 2H1FA 4XYGA 3UXYA 2XOEA 3P9KA 4TMZA 3LZCA 4HJRA 1YULA 7MDHA 4O2AA 3RIXA 4E08A 4O4HF 3BICA 2NU6A 3RVJA 2B20A 4I5DA 3L43A 4KQ2A 3UJ7A 4YAWA 4FHFA 4MKXA 3JV7A 1BJKA 2NZYA 1TA4A 4UZSA 3W2IA 1V6SA 2PGLA 3O9MA 2XADA 4ZQGA 3WP0A 3ANLA 3GCZA 1UP6A 3DW3X 3BMXA 4Q7EA 4W6ZA 3WVNA 5JZ9A 3SJ7A 2WRZA 4KXMA 4PIMA 3U7EB 4NG5A 2G7ZA 5KTRA 3KSAC 1R6BX 4AURA 2Y1WA 3B13B 3G68A 4NFYA 1QLWA 2NZ2A 1OFUA 2AQIA 3AMVA 3HYSA 4LV5B 4EWLA 1T2CA 4E30A 1CR2A 3ZOKA 2DPMA 1PJ4A 1U9IC 2EARA 3I23A 1OBOA 1XD9A 4Q05A 3W8RA 4CWAA 4OX9B 4XEUA 1A8QA 1BJRE 1CJVC 1DQNA 1LNSA 4YJ2B 3PDIA 3N0RA 5LQKA 1C81A 2OFOA 2QQFA 2PKEA 2NO5A 4X44A 2IS2A 1KEPA 4P5PA 3A2MA 5KWIA 1V5WA 4NMHA 2QUBA 3I8XA 4G1VA 5EHQA 4RYDA 1MTOA 3GELA 3LLVA 2A9KA 3CUEF 1LBHA 1UQUA 3P9NA 1IZ8A 3A3OA 5AI5A 2XOKD 1NI4A 1Q84A 5IBQA 2VCEA 5CGQB 5KI6A 2OHFA 3M6LA 5C3UA 3TWOA 3U7GA 1VL2A 4V0LA 2IXDA 3B9RA 3O7MA 4EYGA 1U0RA 4Q47A 3BH7A 3MTJA 1NZDA 2GILA 1OC4A 4PLVA 5IAEA 2GBGA 4P53A 1EUCB 3WLRA 5IK2D 5A9SB 1RWKA 4JYAB 1N6LA 3UC5A 5C81A 3D3KA 4K6MA 3DB1A 4G0XA 3TQCA 2OBXA 4UDNA 5CA0F 2IYYA 2WJGA 2XR1A 1UKAA 1VJCA 4AMZA 1I33A 1J8VA 1KNQA 2QRLA 4WW0A 1SHKA 2VOJA 3ANMA 4L1KA 3ETLA 1YF3A 4G37A 1ENZA 1E5TA 2QN7A 4FBLA 4KAXA 4YCDA 3V1NA 1R5BA 5LUBA 4P58A 3D3WA 4UPEA 1JI3A 2WR8A 3M89A 1H1LA 3PJEA 4UE6A 3RG2A 4RH1A 1UPAA 1AXGA 2WJJA 1GN8A 3V3KA 3IPYA 1OLXB 2AMJA 1GIAA 1O94C 1NP3A 3OTIA 4LN1A 1NMXA 2PZAA 3RJMA 3QOFA 2HU8A 5ADWA 2AA3A 1ZOIA 3HJNA 2HTEA 1U8FO 1VYTA 4JOBA 1TUBB 4G5XA 2KYRA 4J0IA 2ZEJA 2WLSA 4EENA 3GYGA 1T5LA 3SZGA 4Q4JA 3NG1A 3AIMA 4WV3A 1UMKA 3PXEA 3TOXA 4D9IA 3HTXA 3DYVA 4X1IB 3HXTA 5HPYB 1KEKA 1M2OA 7REQB 1Q0ZA 4ARSA 3ABQB 1SUFA 3P9QA 3K9QO 4NXNB 3NIFB 4Q7LA 2PUDA 5HEKA 1QH9A 3L05A 1LC3A 3Q9SA 2NU7A 4RPJA 4U7HA 2Z5LA 4CM1A 2NQTA 3G7UA 2ZR0A 1HE4A 5I3CA 1O5OA 2BMJA 1FNDA 3TLJA 1B2RA 5BN3A 1GJRA 3GJ3A 1AKTA 3AHHA 4LJLA 4MS1B 1DJNA 2WTXA 1C14A 1CC1S 3ETDA 5J1TB 4O2RA 3TS1A 1DC6A 4HXFB 3CR3C 4HEQA 1O95A 3H3FA 3IQGX 1QS0B 1J0CA 4BLTA 2BFBA 1ZGCA 4HTFA 1IB6A 4FC6A 4JC5A 1DJLA 4MUNA 4HSEA 4O33A 4N7MA 3BAZA 1XCPA 4Y2TA 1XZJA 5FI1B 3I3SR 5B7QA 5DCUA 2VC2B 5ELXA 1XDGA 3VI3B 5HW0A 4RTMA 3O0TA 4GOMD 5H3HA 1JR3D 2OKGA 1VE5A 1CF9A 1P8JA 3NHRA 1VJ1A 4FXOA 3UT5A 1VJ5A 3W8DA 4II2A 3HDQA 1WSAA 4OATA 4DIDA 3MCAA 3WLHA 3L6EA 3EJWA 3C3YA 3G9ZA 4Q16A 1SU7A 1Z08A 2XE7A 2WYUA 2KS6A 2R7NA 1H6DA 3UMCA 1LS1A 1GGMA 3V7FA 1IIBA 5DI3A 2IW1A 1YASA 3AHJA 3Q10A 4ZT7A 1OOEA 3TCKA 4ZWNA 3KHTA 5J4VA 2P0YA 4D74A 1BWPA 3LPCA 4HZGA 1DG1G 3KQVA 3KLNA 1QIDA 1HNNA 2AQHA 2WABA 2ORWA 2W93A 2FHPA 3AK4A 1XLVA 3L7AA 4UATA 2E6UX 3GXOA 4Q4LA 4UM8B 4BFVA 4WACA 4UEKA 2HNAA 4B3MB 3PFKA 3EZ7A 5E9WA 3DP7A 2WD7B 3I73A 4HB0A 5A3SA 4M7WA 2OORA 4P93A 4S04A 1DAEA 1R64A 3DT9A 1U6JA 1TU0A 1GZSA 1ORWA 2QSYA 3CS3A 4K03A 1CIPA 3FTCA 1VYUA 4GMHA 4JGIA 2FDXA 2G07A 3G23A 3PGJA 4K1XA 2FW0A 1CR0A 5JTUA 2NQ2C 3HEBA 5HILA 5FTNA 2YVKA 4KPUB 2B4TO 1LH0A 2F43A 2RGNA 4WEOA 3ZKAA 2QX9A 3NYQA 5F3DA 3GVXA 3ZK9A 3I92A 3ZS8A 1I4DD 4MSUA 1W5SA 4QG7A 1XA0A 2P35A 3SPXA 1VECA 1E79D 4IWYA 3O8BA 1ZAYA 1KJYA 3DMPA 3LSYA 4RJJA 3NC1C 1Y80A 2CV0A 3RUPA 1S2LA 4YFYA 4HUQA 1E9FA 4G1FA 4QUIA 5CBPA 3FPAA 5C18A 1GPNA 2EFYA 2XUGA 3ZBQA 2NXWA 1II8B 3R9WA 2PGIA 2V98A 5JSZA 2W98A 4U2EA 2CVFA 1C3VA 4FYYA 4I1YA 3QPVA 3PE4A 4IXNA 5FOVA 2JIMA 3GRCA 2UXDB 2R47A 1RXEA 1ODSA 1Q0PA 3H0KA 4K6CA 2VTBB 3HYLA 4O4LA 3B3JA 1OX4A 3SK0A 3COYA 3AL0C 3B78A 2ACEA 4H0FA 3C3CA 4AG3A 3TEMA 1U0NA 2XIJA 4RIGA 1CR1A 2AJCA 4DSTA 3TIXB 2HA4A 3BA1A 4O2AB 2YQ5A 5CFOA 2NU6B 2OXFA 4AO7A 4YO7A 1TO6A 1WW2A 2NUAA 4PLPA 5BSEA 3EVCA 3B1WA 4B40A 4JI1B 1MGPA 4G5YA 2O9JA 3UWDA 2Q0SA 5C5CA 1D04A 1M1XB 1YB1A 4DEYA 1GA4A 2FRXA 5FUMA 2EIHA 4GUAA 1I6KA 4WBNB 2AN1A 4D2IA 3D5QA 1BFKA 3T5MA 4YI5A 2CYCA 2DULA 2ZJ5A 3HLKA 4GBJA 1EBBA 1EWVA 3T7CA 1A4UA 3T1TA 1L1QA 1KC1A 1DMSA 1YA4A 1TRKA 3LRTA 4IFIA 4PQFA 3NFRA 1JXAA 1ABEA 4JXKA 2OCBA 3E7PA 3Q85A 2B2NA 4PEVA 5JW6A 1GN9A 1UKEA 2KSQA 3DOUA 1U7XA 3IRUA 1P0IA 2YFHA 3KK0A 3MWDA 3TMKA 2JHCA 1VKZA 3LUFA 5ABPA 3OQ6A 5HF8A 3GLUA 5ADUS 4BB5A 5B1EA 1JNYA 3ZJTA 3ENNA 1PFWA 2FSFA 3DNPA 5IX8A 2XTNA 2B1JA 5IP5A 5TF4A 3EPRA 3MA0A 3A25A 4M4SA 4B8ZA 1P6UA 4WESB 3EHEA 3R3ZA 3ZWNA 5JPDA 1NI4B 2RKOA 4WLNA 3TE7A 3DE4X 3H05A 4JA2A 4FYKA 3MNFA 2GPNA 4HDOB 4OHBA 2ZRIA 2TSYB 5IT5A 3S8EA 1P31A 2VCYA 3E9CA 3UM9A 2H4WA 2YHAA 1D5WA 2DPXA 3PT9A 3QA9A 4J1QA 3L7IA 3OU6A 4BN5A 4DFDA 1NXWA 5EUCA 4FI3F 5HGXA 2QV0A 3NC0C 4IDEA 4RF5A 5A7GA 3D43A 2BZGA 2VQ6A 2Q8NA 2CVZA 3ZWCA 2WG1A 1JJIA 1FNMA 4ZYXA 4QE3A 3ITKA 1U6IA 2ZSJA 4M49A 5T6MA 4KO3S 1CFJA 4B4VA 1P9WA 2J41A 1P39A 5E4FA 3I34X 3D3WB 4RKFA 1GPYA 4KQXA 1H1LB 3B3AA 3R0VA 4QJBA 1GG5A 3WX0A 3K8OE 4D4GA 4ZIRA 2O8CA 2L2QA 2NZ8A 2BP7B 2YV1A 2OV4A 3QOWA 1RRPA 4A73A 5DH9A 2PX8A 1R15A 4B7ZA 1GUZA 1MG0A 3JZIA 5CK5A 3QEJA 4U2GA 4H1WA 4UVIA 1YACA 4B8WA 5HA5A 2DHDA 2NSDA 3C5HA 2ZIEA 2VF2A 4C7OB 1WP4A 1P4GA 1T9CA 1UBRS 2RC5A 3O95A 4Q4JB 1R4ZA 3EEBA 4R8VA 5DBGA 5HIIA 4ZZ2A 4F4DA 2HLDD 1CB0A 3T3PB 5FXMA 2OGWA 1R0KA 3JALA 1JLRA 3WYAA 1MA3A 4AG6A 4C0WA 4DLWA 3RTDA 1M2OB 4ITVA 3D6MA 1F0YA 2V7EA 1XZCA 3QYFA 3TBFA 4BFYA 2P6RA 3FPKA 1KY2A 1D03A 1XWIA 3INRA 4D8XA 3F7MA 3ZX5A 1P7WA 2ROQA 2KE5A 3C3JA 4M0LA 3G02A 1PQWA 1ZM3A 2CJYA 2YC4C 3SOZA 4R9NA 3THRA 3NCHA 4ZARA 3V9AA 1U0EA 2ZFUA 4IUBS 5B6IA 2OXRA 1G3QA 1Z74A 3PHBE 5BN3B 5BPFA 4RELA 1WXDA 4H7PA 5D5QA 3IODA 1SY7A 2R11A 4CL3A 3H42B 3C5VA 4H2DA 5DN6A 4BU0A 5L4LA 1DWPA 5EP1A 1RYMA 3NOQA 1GQRA 1L8QA 2BFBB 4HTFB 3U37A 2EEZA 5TS2A 1NDUA 3G2OA 3MN1A 3ZNPA 1BO6A 4NAVA 2Y4OA 5A2QA 1K4YA 1C0IA 2D7JA 4QYWA 1NUUA 1JSLA 4L3WA 1TFUA 2JVIA 1KS2A 3HCWA 3ZQJA 4PG8A 3GEHA 4C06A 3AY7A 3O7WA 3ZUGA 4IDNA 1GITA 1SC6A 1TF5A 2NW6A 2IK8A 4KRYA 4CMEA 5TT1A 1IUKA 1OYYA 3ADBA 1XALA 3HUTA 3M5CA 3OE7A 2GBCA 1CSEE 4MGZR 1T6NA 1Q11A 2GZMA 2P69A 3ZGVA 5JIBA 1U3UA 2OK8A 2I3GA 2F17A 2FY8A 3BCHA 4X3PA 1B16A 4IV8A 3WBBA 1GQYA 2WWHA 4WLOA 3RRYA 4BRUA 1D1PA 3KYCA 4FOOA 2JFZA 1V41E 4RY8A 3T95A 2HIAA 4ONEA 5KSYA 9LDBA 2XMRA 3QEMA 3MTGA 4NMXB 4BJ5A 2WWTA 1QHEA 2HI0A 3HGTA 4LF8B 1XZAA 3D6FA 5FULA 3SE7A 3H4TA 1JEOA 3KBOA 3TNJA 4LHEA 4RW0A 2P4QA 1P45A 2HDOA 3GXBA 4Q1FA 3OE1A 2P75A 1OAOC 1CEQA 1PU2A 2PMFA 2QR3A 2VPYA 4LGYA 1H5QA 1P6XA 4PCUA 4KXUA 3S81A 1QP0A 1OASA 3WA7A 2VDPB 2AVDA 3DMDA 3TRJA 1WXEA 4GNKA 3RRMA 4EO4A 1T9ZA 4N9QA 2A1UA 2A7QA 2YRWA 4P36A 5E4JA 3PFNA 1IULA 4QDUA 1N2OA 1VLHA 3QFCA 2AR0A 1ULZA 2GEKA 2Z1MA 3OZIA 4O08A 5TV2A 3RABA 3E8SA 2F9FA 2PGXA 4FT4A 3IAEA 5FR2A 4B3HA 4H16A 4IDGA 4ASUA 1U2TA 2XRYA 1NVDA 2D5CA 4KIWA 3ZE9A 2PA3A 4TTIA 3MUOA 1GZHB 5HCUA 1J2JA 3AU8A 4V39A 1Z8HA 1G6KA 3DZBA 3R3YA 4TWJA 3UJ6A 4L50A 5CBPB 1Z37A 3ZZUA 2HFKA 3CH4B 5EMNA 2R84A 2KB0A 5CNJA 4AYWA 3CMMA 3M3PA 2OAP1 2Z83A 4OGFA 4Y6GB 4AO8A 4CM8B 1R4NA 2VK1A 3ZWOA 3UGJA 4L5YA 5DXFA 5JI2E 2ZI9A 4JLMA 1B41A 2CV2A 5CIYA 2X58A 4O4LB 3R9KA 1JA9A 1ORHA 1OX4B 1B0AA 3FKJA 4GMXA 3ZEIA 5A04A 3AF5A 4ZAYA 4V1CI 3BCUA 4KL8S 3CLTC 1G5FA 1RAHA 3NTVA 1QRUA 2PXCA 3OQJA 4GXQA 1KOJA 1RXUA 3CSSA 3LGSA 1RAAA 1J0EA 2ZAIA 1JFFA 4ENQA 5KUTA 3E7XA 1R0XA 5FWXA 1BDHA 1DAMA 2NNWB 1N5KA 4L85A 3ZWWA 2K4MA 3FMPB 2P30A 5CM8B 2AT1A 1F2TA 3LV8A 5H16A 2CNDA 5BSTA 3L6OO 1L5OA 2HUNA 2ZSBA 4Z49A 5IAAA 1Y7IA 5K8TA 4D9GA 1PS8A 4EYQA 4H1TA 2ZRMA 1VG1A 5EE9A 2P3SA 1EDZA 3CNOA 3ITNA 4GL2A 1T9AA 3EVFA 3EXG2 2WPNA 2ZKLA 1TYCA 1EYZA 1TGVA 3KB2A 4OREX 5AKEA 4HKTA 1XU9A 5KJ1A 1SXJE 5LNK6 3HJRA 1JYFA 1KMNA 5G1OA 4G09A 3EYWA 2KMLA 2WWXA 4JB2A 4DCOA 2NUTB 4BV3A 3X1XA 1C9JA 5JMOA 2FE1A 2CL7X 1VI6A 2GF9A 2CF5A 3ESCA 4ARAA 3MWDB 4DXDA 4FR0A 2B69A 3H17A 5ICEA 3M1AA 3GPDG 5FF9A 2X42A 5BT9A 3VPFA 1QF6A 5CR9A 1Q50A 3EGEA 3DSRA 3DOCA 3PLRA 1GEEA 4YP5A 1ZXLA 1CETA 1SVIA 1DEKA 4UUAA 2VCHA 2IH2A 1R4AA 3WB1A 3EIUA 1OWLA 4BMVA 4QVKA 1FYDA 2GCNA 1U1GA 3GMTA 4KE8A 3AQ4A 4MVJM 1CF4A 3AR3A 3BXGA 1K75A 2Y0EA 3NGMA 2BONA 3GVHA 5DZSA 4MI9A 5BYAA 3STYA 3JYNA 1XELA 2O0KA 5CURA 2XEDA 2W71A 4B4WA 1BFUA 5L7YA 5F9FA 1UFOA 1AGNA 1P19A 2E4YA 2ODAA 3DD1A 3NALA 4JJGA 1GZ3A 1G9TA 1VBFA 4FFPA 4OVKA 3Q0EA 4OIFA 2P9EA 3IPAA 4B79A 4XX0A 1Z06A 3REGA 4YMVA 2CZCA 2OLJA 1DDOA 4KTVE 4DDKA 2M1XA 2QZ4A 3KOWA 1MR3F 5C7YA 2I7VA 3INGA 4KIUA 4M7PA 2Q2QA 4U39A 1YVEI 4OUKX 4BGEA 1SK8A 2XCUA 1R6UA 1HORA 1W4BA 4NAHA 5CPFA 1OXMA 1KFKB 3LP6A 3PYXA 2RAVA 3NWEA 4FFLA 4QBTA 3G8BA 4L8LA 4EHJA 4EEKA 5B6PA 3BF8A 4Y9SA 2PM8A 4JH0A 2XQVA 1IZ0A 1E2LA 4WKOA 1PEAA 2IEIA 5JAHA 3C8ZA 4FGSA 2YIJA 5EWMA 3CNQS 4CM7A 4FVTA 1CQIB 5AJXA 3ZBPA 4WOPA 4XRRA 4EZBA 6LDHA 1JKFA 1DDGA 2XTAA 4P35A 4A6XA 1Y9DA 1Y8ZA 3GVIA 5BQXA 4YBZA 4BKRA 1GUBA 1KHHA 2KHZA 3NT5A 4FKMA 1ESZA 4DDMA 4EQ6A 2H0QA 1AZLA 1NSYA 2ZROA 3KEMA 4LYFA 2ZU6A 3OSZA 4E2YA 2PFSA 4CNQA 1EK6A 2PQ0A 3INTA 3JYHA 3BB4A 3EWNA 4W4TA 2QNBA 5ALJA 4QLAA 3ESRA 1P77A 2P2CA 4JOCA 5E2AA 5I7RA 1RU3A 2IS6A 1G21E 3DOIA 4OGLA 3QHAA 1XRPA 2GK4A 1G20A 5KJCA 2BMEA 2WJPA 3N8DA 4ZK2A 4ZXFA 1ZG3A 1VG9B 1DDIA 2ZYSA 4Z3DA 2Q5EA 3AF6A 1D0IA 4CF3A 4JCOA 2EG5A 1E99A 1DHTA 2JZOA 4GHWA 3DBOB 4RBNA 3WP1B 3H5VA 2WYIA 3PF9A 4MW7A 1QVVA 1LX6A 2FMIA 3KQPA 3A1VA 3D6NB 2CE7A 2OHJA 2VRCA 3HFRA 3PUWA 4DSUA 3MRTA 1D4AA 5GV8A 1T6XA 3PCTA 1RIIA 3OKPA 3PFFA 4TLCA 2QRVA 1JZTA 5CB4A 5ECWA 1VMAA 2C7GA 3VH2A 1ONOA 2X0KA 4IZIA 3SMQA 5JS8A 1QB7A 1JJVA 3TIGA 2Q3JA 2X8BA 3I6BA 2FPLA 1DZ3A 4W9NA 1BDIA 3L8ZA 2IYPA 3AM3A 1W2HA 3SJCA 3IE1A 2DC1A 4DMUB 3GDHA 3TR6A 4F93B 3B8HA 1Q22A 4MZXA 2Z58A 3TEFA 4IF6A 3MTDA 4RTRA 1BC5A 4RV9A 4G1BA 1SGWA 1IY9A 2NO0A 1IM5A 2P3LA 3F5FA 4NU5A 1GRNA 2RKBA 4R2IA 1GTZA 3KT0A 4MLZA 2BJWA 4RK6A 2AGVA 3EZGA 3VJRA 1BGXT 5EWLA 4V3BA 4MWGA 4ER6A 1P80A 4DIFA 3DQPA 1GT6A 1NJ1A 2AYXA 2ID8A 3IAFA 2RHOA 4JI5B 3VR5A 3ZEAA 4BKQA 3QEMB 3DZIA 1X1AA 1O5TA 3LVRE 3PA8A 4MKZA 4X20A 4YS6A 4ZEOA 3ANYB 4URFA 3WGTA 2F8LA 4KVAA 1O3YA 2GEVA 1SZPA 1PK8A 4NDNE 4WFQA 3EGVA 5BWOA 2FEPA 3DH0A 3G49A 3KB1A 3OIFA 4FFWA 4MZDA 4BO6A 2G9RA 4JSTA 3PNVA 3LTEA 2NSYA 3L6DA 3WHKA 4XLZA 1JECA 1M67A 1JGTA 4I7EA 3FZNA 3ZWAA 1RAGA 2OBMA 3LOQA 3DMTC 4TMYA 1FFSA 2IXBA 3STVA 3JQQA 1ONSA 4TSRA 1MAWA 4MQUA 4QDJA 5LYJB 4B6RA 1X1SA 2JLAA 5KNDD 2PSJA 4KREA 1BA2A 1ZKMA 1KS9A 1KDVA 4FYHA 3OLYA 5AJUA 5J9FA 4GRAA 4OMFG 4GP9A 5B7NA 2D74A 4RUKA 3SDZA 3SY8A 2BZSA 4JITA 5A0FA 3WNDA 1SR8A 1NDHA 2I3BA 2P6NA 3B82A 3C6QA 4HLQB 4X8HA 4ZC1A 5HJ5A 1N57A 3SJZA 4CNBA 1N2JA 1ZH8A 5FV7A 2AUTA 3SQXA 2Z04A 3A4TA 3K16A 4WCFA 4X7MA 1DBSA 5ALHA 3RWOA 1R4NB 1X8LA 4FK8A 1FSFA 1RCTE 5AVYA 3ETNA 1J90A 4L8GA 3UMRA 3F6EX 2PL3A 5CFLA 4R1LA 3I0ZA 3CNLA 5BXQC 4JSYA 5HKAA 4V24A 1RPJA 2NXJA 5K9ZA 2MWMA 2Y1LA 4RF3A 4KXXA 1WY5A 4ZT5A 3TL3A 4KFSA 4Z9XA 5L9AA 3KSBC 4IQ4A 1I5OA 3G1WA 4XCQA 1CUYA 1N8TA 2I4TA 1CU1A 2Q5HA 3DCNA 3L40A 4RV4A 5FFNA 4QSMA 9ABPA 1UKCA 2IV7A 3REOA 3FBGA 3EQ9A 4AN1A 1HE8B 5FWXB 1R6DA 3ZGZA 4JDPA 1G8KA 1W85A 1TMYA 4LSGA 4CW7A 2X13A 1FP4A 1F2TB 3CR7A 3IH5A 3BC1A 2RK3A 4TMWA 4U02A 4DCNA 3GMSA 4OHXA 3FDIA 3SQNA 4B45A 4PCAA 4YMLA 4OKIA 2JARA 2P9BA 2VSXA 4UCFA 3KQHA 1FYVA 1F9AA 2ZR9A 3I30X 5K20A 3GNLA 2X1MA 4OHMA 1J70A 4KEAA 2WHEA 3UY4A 5BN5B 1NBIA 1PO7A 5BYBA 2VZLA 2XITA 2HTFA 1J00A 2G1UA 2WD8A 2X5JO 4IOMA 4JL6A 2XYHA 1BSVA 1W5BA 2GK3A 2HD4A 3NHYA 1TAQA 4NZZA 3RU9A 3RSLA 4A6EA 1KZ7B 2A5JA 2HWXA 2FETA 3K35A 4EY8A 5HUHA 3COJA 1MLDA 1ZRHA 2WU0A 3IR6A 5LNK1 1X94A 3JQCA 4M88A 4YAGA 3LQ1A 1T5IA 4JUAA 1YQWA 3PNMA 1C0PA 1OKKD 2E7ZA 4MAMA 4XQ0A 1KJQA 1NT4A 4F1JA 3KPWA 2WZQA 4FILA 1M1YA 2IXAA 1B00A 1S7CA 1P0PA 1W52X 3NT4A 4FCVA 2HADA 4S1PA 2GCGA 1LJLA 1LVHA 2VLIA 3SG0A 2X1VA 1XCJA 1MCZA 2QENA 1TM5E 3ZWXA 2EBWA 5HOQA 3TJRA 3U6KA 4C5CA 1RTKA 3KEOA 5ICSA 4AZSA 3O92A 4F4FA 1ADCA 1IRIA 1P33A 4C04A 2IV3A 2LPMA 1XTIA 1ZYUA 2OD7A 5KDOA 2J3LA 4I6GA 1L7VC 3ZHXA 1YZQA 2NUPA 2QEQA 2FWAA 3DZKA 1IN5A 1CY8A 1TM7E 1Y48E 2M9MA 5G40A 4LTNA 5EZQA 4A10A 5BV2P 3ICQB 1JHXA 1RQXA 3HVKA 1ZR2A 3T0GA 4BGIA 4DUPA 3AVUA 3HGQA 1ZLYA 4LTMA 4MQLA 1N5OX 1PBNA 3IVMA 4IYRA 4L3OA 2LE0A 3IP6A 3SIWA 4XX0B 4HQLA 5GINE 3IERA 5TGTA 4Y2HA 1NX9A 2BGTA 2E85A 5JVDA 3JQAD 3OFJA 4MMXB 2DLDA 1XYYA 2E18A 4KNYA 2PLFA 3NBXX 1ZVVA 1ADYA 2HSGA 1A76A 2H4XA 3HP4A 1XTRA 2IDKA 4M46A 4GYKA 3ZDAA 3PR3A 1L9XA 2DFTA 2GKOA 2VZEA 3KNZA 5L7TA 1E3JA 2BKUA 3P52A 5EWMB 1P9RA 1T9KA 2CCJA 3KKKA 4ZEXA 4DABA 1DTSA 1AJEA 5IC6A 4O2BF 3ISTA 4LDNA 3VH1A 4TWZA 2AN3A 1V9LA 4MHSA 4TMVA 5TQJA 4OD0A 3ZHSA 3WGYA 3CQ9A 3L6CA 1GR0A 3ZXYA 3C1OA 2GNPA 5DYNA 3ZGNA 4G5OA 2QGNA 4J4HA 5I8ZA 4MGKR 1JQBA 4HQNA 1C3XA 4HAUA 1Q44A 4L9SA 3ACBA 1MRNA 1Z38A 5F35A 2BI4A 4TUYF 3R7LA 5HQ3A 1XMVA 2BFNA 2VF8A 4TRRA 3E82A 1U65A 5JYEA 1JVSA 1RFGE 1W29A 1S6YA 4H1HA 4LYDA 4X61A 4LFBB 1G7CA 4FHGA 2GZDA 1Q1NA 3BTSA 1E2NA 2MYTA 2RHTA 5JRJA 3CW2A 3MERA 1IVSA 3Q8XB 3ZD7A 1QCDA 4BBJA 1TM4E 3PQEA 3SCZA 2PV0A 1AK1A 3TW6A 4LY6A 1XVTA 2R5WA 3ZW7A 1QVWA 4NX2A 3VM6A 4EI7A 3EPLA 2JW5A 1ZN8A 3BB1A 7ADHA 4BXOA 3MINB 4NXMB 2QRVB 5AM5A 5B58T 5CB4B 2CDCA 4LY3A 1K7EB 3VVBA 3WIVA 4Z4EA 4AKTA 4IJVA 3H1GA 3SKYA 3TLXA 1ZIYA 5C34B 1Z5OA 2X0EA 3PQ3A 1XHEA 2XNHA 1N2XA 1XV5A 2ON6A 3WQSB 4LMPA 4EVSA 4A92A 4ZQIA 3JAMA 2L0XA 2C2OA 3TZQA 2BFOA 1AQUA 1XLUA 3TDMA 3GUVA 3KVVA 2BJHA 1W5EA 2FJPA 2XOKA 1DIBA 1MJFA 3GGGA 4IMJB 1E77A 3WRYC 3MCVA 1THGA 3OO0A 4WECA 1FA9A 3D8SA 4PTLA 1ZDMA 1DXHA 1JHUA 1N6HA 5AJVB 4FMDF 3R0ZA 3DLIA 4KKVA 4LECA 2FRVA 1PQPA 2BPOA 1LC0A 5HG0A 3WXBA 1T26A 1DX9A 1UBMS 3B6IA 3TIFA 5K8IA 5IK2A 3R0XA 4O4JF 1NNEA 3K6SB 1RWOA 5JCJA 3S28A 5CFNA 5F1PA 5JD6A 1KYIA 4MK4A 1X2BA 1OI3A 4NLLA 5LP6C 1GAWA 3H6GA 1GQQA 1CUEA 3SBDA 6Q21A 1A5SB 2F2TA 2O52A 4B3XA 2V7QD 2P91A 4RTJA 3KSZO 1XRLA 4DT1B 1OAKA 1JHZA 2J3HA 1M74A 4QPDA 2ZYAA 1UBNA 4H7EA 3IOMA 3SZLA 4RY9A 5LQSA 1MX1A 1IPFA 1V35A 2R8PA 4OM7A 2Y05A 3CVWA 4HMQA 1EVYA 2F67A 1YQEA 2JHAA 4I4CA 1QHFA 1EXMA 2JAXA 3MTEA 2AZ4A 2Y8EA 5IANA 4JL8A 3HCAA 2JKVA 4JYBA 3QEOA 3TDKA 5IYZF 3QGMA 3BT7A 4G89A 3GZJA 3K0HA 2QTZA 3KAQA 3FIJA 2W7TA 3UB2A 3D81A 3TNLA 3TOCA 2BHLA 1MO5A 3I53A 3LT5A 4O0LA 3C85A 4WCFB 4XB2A 4UPVA 2Y4NA 4OJQA 3RSOA 2Y1FA 3HB0A 3NJ4A 3MRVA 2FZVA 2IOQA 3K6JA 1M2FA 3A9WA 1N33B 4HDCA 4KACA 3Q2OA 3GD5A 5KWSA 2LKDA 1E1KA 3T38A 4OK6A 5BQOA 3ZZTA 3R5KA 3U16A 4HX5A 1X13A 2ZSIA 4M21A 2C3OA 1U6KA 5DXAA 4K88A 4X6LA 1JL3A 4UMEA 4LIPD 1WXHA 4DMCA 1KKMA 2FZKA 3IPRA 4TS9A 5DCLA 3A1EA 4J0DA 3B85A 4DLAA 5J2TB 3RAPR 3OH8A 1YU9A 4I5IA 2DLCX 1EXWA 2I1QA 4IIDA 3SQOA 1E2GA 3A10A 1Z9BA 2ECOA 3Q7QA 4QYTA 3N2ZB 3ZIAD 3AFHA 4DSZA 1MT3A 2O1SA 2J30A 2GAJA 2H57A 2VATA 3HKBA 3OPQA 3ZLVA 2W6ID 1J1ZA 4XUDA 4PS0A 4U7PB 4B3SB 2APJA 3LUGA 4UM9D 2G9ZA 2CWWA 3GX1A 2AG8A 4ENTA 1JR3A 1Z6PA 3P9XA 4HWPA 3EVNA 4UEOA 4G0OA 3AF4A 1VSVA 1U7DA 4KYTA 2Q7DA 1CKEA 2PL1A 1UP7A 3ADOA 1NVTA 4FEEA 4INAA 3LS2A 4XPIB 3UKOA 1JZQA 1VLQA 3JASA 1SUPA 1OU0A 3QUAA 4QO7A 4MR9A 3VJMA 4QOEA 1FS6A 1MVLA 2HA7A 4OYHA 3QUBA 4JROA 4DVJA 2D13A 2VYFA 3PRKE 2HCRA 3GRZA 4UREA 3P2KA 2D2XA 1T4DA 5JLAA 3SP1A 3FCAA 4NNPA 4BTEA 3FYSA 5DNDA 2GEFA 2VAPA 4F5YA 4U6QA 3EH2A 4KGDA 3TJZA 4EO9A 4JBLA 2XIQA 5BWMA 1W581 5AT1A 4BEVA 4ZHSA 1QP7A 2PFKA 3JYOA 2M32A 3RSFA 2GJ9A 4LXUA 3BBPA 4R3NA 5HM6A 3A7EA 4PYQA 2A9QA 4ZU6X 3DO6A 3RC7A 1E3IA 3G0GA 2ECFA 1OH7A 1WTAA 4BCBA 4MQFA 4DXAA 5LMUB 4DWJA 1C4XA 2AKEA 1L8LA 4K9LA 4R16A 1SPBS 3PIDA 4EAAA 4JJIA 2R86A 1U3FA 3AW8A 3MJVA 4X84A 4ZMBA 1C1DA 1P1RA 2ZYRA 3HUDA 3KZ1E 5EI5A 1X2EA 4RFLA 3PXGA 3PHGA 2P2NA 1R00A 1G16A 4LV8B 4BFUA 1AZTA 4G01B 4WTOA 1CULC 2O2SA 2CZQA 1FRZA 1T8WA 1W36B 3OKCA 4DZRA 4EHHA 1E79A 4E11A 5JVDB 1L4GA 4F3YA 1S89A 2W2LD 3HWRA 4N40A 4PPGA 2WFZA 1UDXA 5DHQA 1KK3A 1F38A 2E5FA 4EKGA 2PUGA 1ESDA 1P29A 2PZGA 2PH7A 4I66A 3S8MA 1YUNA 4FB5A 1TADA 4F5ZA 4PNEA 1SBQA 2HNBA 4HAVA 4IDPA 2C2MA 4TL6A 1TDJA 4V0KA 5HIJA 1IAQA 1DJOA 4HH1A 2ZBFA 1XK6A 2VJQA 2B7LA 2IT1A 3DMHA 3H4MA 2JH9A 1U28A 4MYUA 4EVRA 4ZEWA 4Y6SA 4WAUA 1N3IA 4D99A 3CRRA 2A0KA 3EGWA 4GYJA 1V9SA 5JAQA 3VR6D 5H9WA 2QXUA 3OQBA 1XZFA 1R5OA 2AKYA 2H1LA 4LBWA 4MW2A 4XDZA 3STHA 3TTXA 4BO5A 1RKQA 2N3ZA 2HQSA 3M6UA 4P81A 4QOJA 2VH1A 5HQ3B 2ZJ2A 4Y2SA 3EZNA 4PS1A 3ONNA 3SJUA 3VJKA 3WNZA 3QFSA 3QWAA 3R3HA 3I9JA 3K0SA 2DR2A 3FYDA 5H7XA 2QZJA 4DWVA 3ZHRA 5DNYB 4UARA 3U4QA 2FW7A 5T3YA 4WKBA 4ZYLA 2OO7A 2PTHA 1S3SA 4G0VA 1IEWA 5JAPA 3AKYA 1LF0A 1I1HA 5CTJA 3RRBA 1W1UA 2RB4A 2KI5A 2FVXA 4PGGA 3JVIA 1ISFA 1A96A 1NHWA 4YCNA 1JSXA 1K86A 2WUGA 3F7NA 3ISJA 4LJ7A 3WWYA 2R8YA 1JDZA 2CFOA 1A7UA 3B1ZA 5A3QA 1RLJA 2VQEB 3GZTB 3IXQA 4PG4A 1ZESA 4BXOB 3DYIA 3PZBA 4GEKA 4FYJA 4GPEA 5KYTA 3G0CA 3DR5A 5G0WA 5LOVF 4RL6A 1Z3IX 4H7DA 4DR7B 2P1ZA 5EJMA 3HUUA 2P5SA 4FQ5A 3UC9A 4N8DA 2VPXA 1I32A 1MEJA 2HDHA 3WDMA 2IS4A 3WS7A 3HNPA 3KVYA 4QULA 1MW8X 1HR0B 4EI9A 2QTBA 2A1TR 4QA9A 2ORYA 3MOGA 4F9EA 4M0UA 2HJ9A 4UHFA 4YJHA 3I8SA 4BNNA 1RJWA 3GLIA 5BYJA 3DFKA 3ESDA 2W6ZA 3L0SA 5D87A 4BAGA 1GSHA 2CFCA 2I0FA 3VH3A 3I6QA 4DL9A 2G09A 1E6KA 3MT7A 3QVKA 4YMWA 1QM5A 2H4FA 4M38A 3WGQA 4JBIA 4PZLA 2JCSA 2REQA 4G0UA 3W78A 1Y5LA 4RVNA 4QDKA 4NNJA 4OHKA 2QLNA 3SF8A 4JWKA 4BRWA 4L4YA 3LBYA 2D5BA 3NPMA 3PUHA 2VWGA 1DRKA 3LQ2A 3PXDA 2R7KA 4FLEA 3X2EA 3O8LA 2XYGA 4XTRA 5JALA 3F8SA 3PP8A 3NATA 4P7FA 5CITA 2WJIA 5JI3E 4MA4A 4UAUA 1RC8A 4YAOA 2NXEA 2J46A 4YI3A 1FFHA 5GAJA 3W1EA 2XKAA 3A6FA 3T4XA 5ECGC 1AA6A 1U63A 3DKPA 3M9WA 4ZQBA 4K5QA 1TM3E 1GL9B 4AXBA 3DV2A 3Q11A 2JJQA 3NXSA 1AKWA 2IU4A 2R00A 1E1QD 5IW8A 2NSHA 5KHAA 1NJ6A 4OI4A 1BKDR 5CW1A 4D41A 1N36B 3VPHA 4RETA 5SICE 3WAGA 3U0VA 3RUEA 3VDNB 2FEXA 4RAOA 4POOA 3NOVA 4PSAA 4S0XA 3HM9A 1OTYA 3HDYA 1KP9A 3PKJA 3PPYA 3N70A 4YJDA 1RBMA 5FI3A 3WL4A 4KVZA 2HLDA 2FSSA 1R9JA 1SXJC 5TVKA 3VQTA 5H1YA 2PGAA 3P4UA 4COKA 2FCAA 2K87A 2YN0A 2YWEA 3B36A 1P4SA 1EJ2A 5AKZA 1AU9A 3Q3HA 3S44A 2OBYA 1ES9A 1ZJ6A 1DXQA 3VYRB 2XQGA 1EG7A 5F52A 1O4WA 5IARA 3HCBA 4AROA 2L42A 3S1SA 1WBDA 4IHAA 4Y1GA 2CK3D 2TMKA 3MEQA 3O1IC 4CN9A 3BE8A 4L8WB 1ZN9A 4AECA 4LRXA 4EFKA 2VJPA 2HRCA 3FDJA 5JUWA 2DP4E 2I91A 4PCLA 4F9GA 4ZO6A 2XI4A 3EVGA 1CUIA 5AKIA 2YUIA 2F3TA 3LUJA 1NULA 3C45A 3FTPA 1UDRA 1Y1TA 1CJCA 4INZA 4KVGA 4BS9A 2P4UA 4CLXA 3FSEA 2XWBF 1KQGA 5KNCH 2GI4A 2C3PA 5L6LB 2ZXEA 3OZFA 2W2XA 3I4CA 5JARA 3HKBB 1KORA 2VXOA 1E0KA 3IDAA 5KC8A 3GVCA 4NECA 4HGOA 1ITZA 3KB8A 2L17A 3HYCA 1Q6YA 4IKPA 2QL6A 5HVNA 4RFSA 1RJEA 2EC5A 1I94B 2X41A 3FF4A 5KTKA 5JWRA 5K6AC 3H9UA 4BVFA 2O3UA 1HV8A 3UTDA 1F2VA 3JASB 2HIGA 3UXMA 4DIMA 1C9NA 4H27A 5DNVA 1USGA 4MR9B 3IIIA 2RJ3A 3OLXA 1GYQA 2X9QA 4LVOA 1YB6A 2QP4A 4TZ6A 1PD1A 1J24A 2OENG 1J56A 3LBHA 3AXTA 3L8CA 3OX1A 1GUAA 4EI2A 3LHFA 1CUFA 3NP9A 1T2NA 1J7JA 5A4DA 5DB4A 2VUUA 3IX7A 2ZLBA 3KV1A 4MWCA 5D3QA 2ZE7A 3DJFA 1NI5A 1ODIA 5H9VA 4MDYA 2F9MA 2FUKA 2BMWA 2IEDA 1EFTA 2DY0A 5SZKB 1L7BA 2A58A 3E0XA 3Q2IA 4AZWA 3WZLA 2IE0A 2FX5A 3Q6MA 3L3BA 1JMYA 4OQXA 4A0HA 2GPYA 1I24A 4FIDA 2Q0XA 4MDEA 4MQFB 3W2EA 2GPTA 3OUZA 4Y30A 5DXJA 4XGNA 3ZWBA 3P0IA 1PGQA 5B64A 1VKNA 3L06A 1C1DB 1G8FA 2OB1A 3IT3A 4J7XA 4M9UA 4Q34A 4DC1A 3ER8A 1X1QA 1O6BA 4OOFA 4TMKA 1FX0A 1C7IA 4N1AA 1ZZEA 4ETMA 2XPCA 3DTVD 1BS2A 2O06A 1L5ZA 1XKQA 4FMBB 3GEMA 3R1IA 2Z1NA 4OGGA 3TBKA 3L01A 1AQYA 4NYMR 1E9BA 2VYVD 3E7WA 5J2UB 1GT91 1RQ2A 1SKUA 4Q9DA 2FMUA 1FTQA 1TGYA 3JVDA 4Q7JB 4DMKA 2C61A 5C5EA 1X92A 4J6EA 5KVVA 5BRNA 1OBHA 2OESA 3KXLA 2B3DA 1DRUA 2QMHA 1TJ3A 4KQFA 3T8YA 1NYQA 2IH4A 3DXZA 2BUBA 1A50B 1TEXA 2X1LA 2EIXA 3LA8A 4N3GA 2G7MC 4CG3A 4DIBA 2XWSA 4FP9A 3T1YB 2WJWA 3FWHA 3L7CA 2EWVA 1VCNA 4DNOA 3WBJA 1W7AA 1VSBA 2PGNA 3WMXA 4QGBA 1UANA 1P5HA 1EIZA 1ICEA 4HQ6A 4M8SA 4F3RA 3DZHA 3HWWA 4UEQA 4PFJA 3EMVA 1TA0A 3WDLA 3K9BA 1E5XA 1NYTA 2JVKA 2PBZA 4Z6KA 5LQUA 2CT8A 1XQWA 3EFOB 3GJ0A 1G2OA 1NW8A 2FWMX 1OFHA 3RKSA 3V4ZA 1TVCA 1LBQA 2D0IA 1DB3A 3K1ZA 1VPDA 5HSGA 2ZJAA 1GCIA 4XZ3A 3R3WA 1FL9A 4OFBA 1NNLA 1U8YA 2XDYA 3GJ5A 4UAGA 1J8MF 2JH3A 4HNAB 3U4QB 3L77A 4MKGA 5AYVA 5C8XA 4UW9A 4ZOLA 3FYCA 5JYDA 2BEVA 2H11A 1XRQA 2IYEA 3ZX4A 3E22A 4EF6A 5K0CA 3T5BA 1U4SA 1WX1A 4R2KA 4A82A 4EYKA 1NY6A 2OHIA 4P2GA 4R6WA 5AHXA 1FDIA 5BQ3A 2WYHA 1T36B 5A1TA 1Z7YA 1FPQA 1ECPA 5F4ZA 1E6LA 3RT9A 1YQXA 5HYVA 4WK0B 1V45E 1WPQA 2GF0A 4TL9A 3K94A 2GAFA 1IJBA 2HUPA 4EOGA 3QF4A 1JE0A 2KWIA 2OV6A 4DUGD 2C9BA 4KC0A 5LKAA 4QLBA 2D0DA 4MGYR 1G20E 4A0GA 4QTZA 5CDSA 3C0KA 3ICEA 3ZVKA 5FA8A 3FCSB 1KH2A 3D6HA 3H75A 1CR4A 1JLHA 2AR7A 2H85A 2NXNA 3LNCA 3M4NA 4OMUA 1OH6A 1QIMA 3V8MA 3GPIA 2JCVA 1QMPA 4EG5A 2FWNA 4KWCA 4PVCA 4YJHB 1VPWA 4XGKA 2P4HX 3GLIB 4N18A 1CLEA 4BX3A 3L02A 1T2FA 1BYIA 3C5WP 5KVSA 3LUKA 1XL1A 5DM70 4V0SA 1U90A 3QG1A 4K28A 4QTTB 1DXOA 3PHCA 4EK9A 2REQB 1BWSA 1L7PA 2VNAA 4IDCA 2XLCA 4JP1A 4RK7A 1T0IA 1UF9A 3SDSA 5JATA 4DMRA 1IHXA 3KR9A 4KWIA 3PNYA 2VPZA 2CF6A 4PRYA 3SF8B 2ONYA 1A8HA 3C3KA 1CV2A 2HMAA 2V6IA 3LOUA 4NYIQ 5B2ZA 3WDKA 4XQEA 1EEHA 2QAGB 1C8VB 1NL3A 1ZVQA 3WE7A 4YCLA 1S9HA 4A15A 5FBQB 2ZT8A 5F78A 4IG4A 4Q37A 4LZNA 4NV0A 2PUTA 3IGFA 3KJHA 3UB3A 4YUWA 3OF5A 2OILA 3IYLW 1PHRA 2DR0A 3ILXA 3WNBA 4ZJUA 1BGWA 3MPUA 4DV6B 1WUHS 4RPLA 3RWBA 4QBHA 1DAGA 2GSDA 2Z2YA 4MYTA 4UXJA 1ZH0A 4DQUA 1TTHA 2VF7A 3NX4A 4B5LA 3FNRA 9GPBA 3E03A 2E21A 1LCIA 2Q21A 4FLMA 4AKIA 1SB8A 1WCYA 1U4OA 4IQGA 1E9VA 4XB6B 1ISMA 4MRRA 3QM1A 3GJZA 5A6VA 4NDZA 1NA5A 2RHRA 1G5QA 4GLFA 5HNKA 2DBRA 4RULA 3UH1A 1RXWA 2N9UA 1NASA 5A5FA 2OD9A 1W2WB 2DERA 2IPMA 2GZAA 2ANCA 1J1IA 3DV9A 4Q12A 1NV9A 2H92A 4FYPA 3EFHA 3RAJA 4ITUA 5FV4A 1LNQA 2QTWB 4P92A 4QARA 2WZCA 3MJEA 3T0IA 3W8EA 3AJAA 1ADFA 3BMCA 4HEA6 1EXDA 3TLEA 3V8NA 2GA8A 4JN6B 4LX0A 2X8WA 4GPIB 4KLRA 4QOFA 1DUSA 1E7WA 1NYRA 2GRUA 1G8MA 1MJGM 4IIJF 3RRNA 3P97A 3FI9A 1U3WA 1NVXQ 1TEZA 4XLLA 2IYUA 1G5TA 3TD2A 1TUEA 5ALVA 3JTEA 1NVVQ 2XA9A 1QHHA 2H0RA 3PUJA 3DWIA 1GSIA 2Z98A 3BKWA 3S7ZA 3IUNA 1QUFA 1OLUA 3TE6A 4R81A 4LYHA 3R9XA 5ESDA 2FV8A 4NS1A 3S70A 3ZNOA 4FW9A 4RH3A 1Q20A 3BE5A 3DAOA 1JQ3A 4J1NA 2AJDA 4N4AA 3E1KA 5AK5A 4RFSB 1QUEA 3JSXA 5AJZA 3G85A 4RIIA 4DY6A 5KYWA 3G1UA 2QLBA 3UJNA 3WLSA 2CW5A 2Q3CA 2P2SA 1KU0A 1Z0IA 1P5JA 4BJ3A 3P96A 2P9QA 3H2JA 1HDGO 1D5CA 4R83A 1RVV1 2XB8A 3D31A 5EMJA 1XUOA 1T4MA 1QWOA 3OIUA 4C4YA 2W2MA 3QY9A 4FB4A 4BZWA 5CLHA 2H1CA 4DUGA 2PJDA 2V0NA 2O4UX 1CZNA 2E4WA 5CXUA 3K71B 1HUQA 4N5MA 2VHCA 1VLMA 4NK5A 3D5EA 5IHXA 5DTEA 4ND3A 1JIVA 1XTVA 5C7OO 2YQZA 4AY3A 1UBSB 1B0PA 3LC7O 3S2UA 2GJSA 4CVNA 3M1YA 3EODA 2BWJA 3F8WA 5AOVA 3WTBA 3WSVA 4DPKA 3QKSA 3BMOA 5KQRA 5IDVA 3V7UA 4B6GA 3VISA 1DCMA 2OBNA 4JVLA 1M1YE 5EZYB 4ZVRA 3RJTA 2WTEA 1FX0B 5DSTA 3O75A 1ZK4A 3KZKA 4TTAA 4B0OA 5KNDA 1EU1A 1GGKA 2H2HA 2NV2B 2QJWA 3SOPA 4UUPA 5BSFA 5D5PA 4C29A 4ZOEA 4Q39A 2IU6A 3EZ2A 2F8TA 4MQMA 3RUDA 1SCJA 3WL8A 1EDOA 3ASVA 1M83A 1PNOA 1PL6A 2WM9B 3JS5A 4KNWA 3COVA 4EM6A 3BDVA 5JNSA 1E5QA 2CHFA 1H0SA 1NUTA 2D1SA 2MYUA 3HY6A 4LHSA 1L7DA 4YJKA 5AKYA 3G2PA 4KKXB 4CG2A 3B2EA 1ZO8A 2CKMA 3QVJA 4KQMA 4E1BA 3RRJA 2D0OB 2EDCA 2VNHA 3PEYA 1LF5A 1WD5A 2RHGB 4IJ6A 4YUYA 5DTMA 3MWGA 4N6GA 1UBOS 3B6EA 4QKQA 5JFTA 1FB5A 4UUNA 1JLSA 2BC9A 1T9HA 3KCQA 5JMTA 3D0RA 3KPVA 2PMWB 1PW7A 1Y8QA 1O95C 3VZBA 1XFDA 4BC0A 1W30A 3BHIA 4RD0A 5IH3A 3TG8A 4RPKA 3W2HA 2W00A 4TZTA 2G3YA 4H59A 4ZHQA 1WHTA 2HQOA 1EIWA 2AG5A 1CHNA 1T3LA 2I99A 2E49A 4WSOA 3CF4G 3DONA 5HJ2A 3CXUA 3L41A 3RK1A 4WZBA 4BWFB 1EGHA 3PFGA 2AF3C 2IP4A 3TINA 3EOZA 4MKRA 4ZOLB 1GRCA 2FWBA 3D7SA 4HFRA 1SG0A 4I1OA 4ILKA 3E22B 1CJBA 2VHZA 5KYVA 3NEJA 1WBBA 4UKDA 3KFVA 1QZUA 3BTUA 4LNAA 1X8KA 1X39A 1Y4AE 2LTAA 3IAS6 1O6FA 3V00A 3AHFA 4GD3Q 2PZJA 3SIXA 5K99A 5M7EA 3TRIA 5K8VA 4L9RA 1BS9A 4QUKA 3H84A 3E35A 4Z7OB 4HFJA 3QVGA 3IAUA 4HFNA 4BKPA 4ENUA 3NUGA 5K6TA 1JWAB 4J0EA 3QF4B 5ALNA 1DJQA 1OKKA 2WUDA 3UBMA 3SDBA 4JJKA 1MOSA 4E7PA 4H15A 3HCNA 4L5AA 4AB1A 4DJFC 4M60A 4FHDA 4PQEA 4BO7A 5J47A 3NTUA 1AXEA 1FU7A 4KLNA 1OROA 1ZNZA 2OORC 3W3AH 2ZVPX 3CF4A 5ES3A 4YX9A 3X1MA 3A4NA 2JEZA 2PKRA 1PI3A 2QVLA 2YVLA 4BV2A 2GF2A 3UKJA 1TK3A 3ZZ1A 4BV8A 2OSBA 5DLQC 4DJJA 3R0JA 2IA5A 4LJ4A 3ZCQA 5LFAA 4EGAA 4DCVA 1TKRA 4RD1A 4C4TA 1ZVKA 2XJ4A 1HI9A 3EARA 3IUJA 4PC7A 3OU2A 3Q3EA 4FN5A 1MF7A 4BU1A 4CYMA 3DQZA 3EASA 2RGNC 4E09A 5BSKA 2O6HA 3EVBA 1PVDA 4UHCA 1J1UA 1XZIA 3GFBA 3W5SA 1U2SA 1QHSA 5L3QA 1N75A 1NMSA 3CWZA 4BQNA 3G2MA 3FAKA 4BQIA 3JQAA 2WSBA 3E4CA 4O3FA 3SR3A 3Q6IA 3D6TB 1UR5A 3FFBA 3UK0A 5JT1A 4CUKA 2RE8A 1MB9A 4II3A 1QXSA 4RS3A 5F21A 2G5CA 1NUPA 4AM8A 3BRSA 2I4NA 2WFLB 4Z0HO 2D1QA 3CCCA 1VZ3A 2FSIA 3M8KA 2VA9A 2QUKA 4EKIA 2A2ZA 2BTEA 1T8PA 1XU7A 4C2AA 1GM5A 1E6UA 4HWTA 2CGEA 3QENA 5DLPA 2G4LA 2EBFX 4TQ9A 3RYHA 2XYPA 3BUSA 1XD2B 3DT8A 1SQGA 1J8QA 2GZ2A 3N8KA 4LDPA 4OJNA 4W8OA 4WZZA 3FNHA 5EE1A 1Y6ZA 2WHXA 5K01A 4N76A 1EDDA 1B0ZA 3CNHA 3W77A 1XXLA 3WRXC 1UUFA 1HQCA 5TMBA 2GLXA 4TWBA 3E7FA 1BXZA 3O74A 3Q0IA 3D4NA 3QVLA 3IUEA 2YVUA 4DSAA 3J81k 3MK31 1KU6A 4N0EA 3MG9A 1W4RA 2ZUSA 3BMCB 3NDJA 3O21A 5HMLA 1ZGZA 4GECA 3AYZB 4R1MA 5JZMA 2P79A 5KKAA 4WPGA 4KQ6A 5HTOA 2C9ZA 4TVKA 5HHTA 4HEA1 5ALZA 4GI3A 2I6TA 4N0MA 3TSAA 2R6R1 3DMGA 1KEUA 5EXXA 3IAM6 1ODJA 4BFXA 5BRJA 2PUCA 4MV1A 4RKYA 1Y6FA 2C31A 4FBGA 2YXPX 3F3MA 1JVBA 4IKEA 3HJFA 5KNDH 4MB6A 1POXA 3PDWA 2IYLD 3ORFA 3H5NA 5LVAA 1ZI6A 4K87A 3UMBA 3PPIA 4M1WA 1OLUB 1PLLA 3R9XB 3VJLA 3L0OA 4CGZA 4KXLA 2YX1A 5FUVA 1C7EA 3DLTA 2VJMA 3OLCX 3NLLA 4KX3A 4IWXA 1X9GA 2O2ZA 3D8NA 4D9MA 4F0JA 4LOLA 3RW9A 5K0SA 2ZJ1A 5IT9A 1T9BA 5H4HA 3E4DA 4YRSA 5C8YB 3B3QA 1PSWA 3R24A 1K0UA 1WZCA 5KYWB 1HDIA 2JH8A 2QL5A 1UFKA 1CW2B 1K6MA 3W5IA 2KJQA 2NT4A 1I7PA 4PX3A 3WGNA 4ZV4A 1X0XA 1JAZA 4C89A 4EHBA 4R2MA 4RD2A 2XD4A 3Q5GA 5L7WA 2P0EA 4OMCA 1JH8A 1TVMA 4YMUA 3KWMA 2GRAA 3C8HA 4HRYA 4GAEA 1O2DA 2IVFA 3TCNA 4F4JA 2OO5A 3G0OA 5B3LA 4C7KA 1H3NA 2ZM5A 3W79A 4G1CA 4IV5A 3FNEA 1H85A 4G67A 4MTCA 4OKSA 1XWFA 3FCEA 1ZCFA 4WXHA 3OA0A 4IVRA 1YDMA 3EZFA 1E9EA 1JR2A 1JR3E 3C3XA 1CNMA 3K0BA 3LE8A 3EF1A 3O83A 2OCXA 2N1BA 4OHCA 4XWOA 5A06A 5JRZA 1YR2A 3B38A 3E70C 3T5TA 4H7IA 1A7JA 5ILOA 1YONA 4GOXA 2OM2A 4KYVA 4Q9IA 1FW6A 1KYZA 5CM9C 2LZ0A 1YRHA 2EX4A 2V4UA 4B6OA 3CBQA 1XAJA 2V1XA 1JFTA 1PJ3A 3QKSB 2V7QA 3HXLA 4CTOA 1G0NA 4BPBA 4QC2A 4J90A 3HN7A 1BQ3A 2FUNB 1WBJB 3IIJA 3P4XA 1PZEA 5KO2A 3A1WA 4FZRA 4D4HA 3EIFA 3LBFA 3O3NB 2E5WA 4D3DA 3EPKA 2V97A 3ZJVA 4K81B 5DP1A 5FTJA 4AUKA 1XRSB 2W0MA 3DVQX 4H6PA 3PQDA 2VDVE 2VJYA 3IE0A 4J2HA 5CHEA 3H5AA 2BSXA 2AWNA 5CPBA 1A4RA 5AHRA 1N0HA 2BUAA 2JLBA 3RO7A 1P4HA 1G2PA 1KDPA 5DVZA 3IIMA 5EFOA 1GLVA 5AKXA 1PKXA 3MC1A 3ZDZB 4TT3D 3VAAA 5FUBA 5I7EA 3KELA 4NATA 3HQ4O 5FFMA 1DELA 1YRAA 3HBJA 1YRBA 4B81A 5IVHA 4PYRA 1KAHA 4PTZA 5DWQA 4TTVA 1ZMXA 4QFMA 4RQTA 2AE2A 4QUJA 4PBTA 2NYAA 4Q3EA 5B5SA 4QNMA 3WISA 1VRVA 4RLQA 2COEA 3W9YA 2HPZA 2OZEA 4AMUA 1WMFA 5EXTA 3I61A 3FTEA 3I9FA 4PG5A 1SG6A 1GFWA 1Y8QB 3TFWA 3MQ4A 4AZ0B 1XDDA 3BRWD 4M83A 2ZREA 1K98A 4WIAA 3G3EA 1WHTB 3VSEA 1CNEA 4DXHA 1NOJA 1QANA 4U00A 2EFHB 2QSZA 3ICCA 4UU0A 3ZIAA 2ECPA 3AEQA 4X45A 4WZBB 5EA2A 2W6IA 3K2QA 2ZPUA 1SU4A 1J0AA 1T0BA 2DE0X 5FNVB 1HT2E 2HB6A 2WIJA 3TR5A 1JPNA 4CMEC 3MS2A 2ZTHA 4U2DA 2WKRA 3TLZA 3LOPA 3H0CA 4CKWA 5TB5A 2TECE 1XNHA 5BOVA 2F3PA 5AOCA 3WG9A 4BAZA 5L3SA 3IAS1 2FXIA 3A27A 1LRKA 3GLQA 5IBCA 5ITWA 3QVGB 1MU0A 2E1PA 4OO3A 5JO9A 3AZPA 4LVUA 3GJ4A 3KKMA 1X19A 3V4VB 3HI6A 4R8RA 1ZGBA 1IOLA 3ZWPA 4BNJA 5KWEA 3OMWA 4QAJA 2YS7A 5BURA 4FSXA 3SM9A 3WYGA 2VT2A 5LU8A 1GYPA 1P73A 2W42A 1N0VC 2II6A 3ZU3A 1BROA 1ZK2A 4QHSA 4DDUA 2H31A 2ISCA 2VSOA 1ZZGA 2PIAA 4NHOA 1EVJA 2GZ1A 5CD9A 2F1RA 2IYQA 4TMTA 2QL9A 3PE3A 1B93A 4RMIA 221PA 3WWPA 4WJLA 3STTA 3QH4A 1S0UA 3BFKA 1FSPA 3AL2A 1FTNA 121PA 2BHRA 1J22A 2HEIA 1ULBA 2JIPA 3QPDA 1H3FA 5KJFA 3LCJA 3EXIA 2J48A 4YMTA 2J3DA 2BM1A 2W8ZA 5NULA 5L3QB 3DAGA 4UUQA 3UJ3X 5MF6A 4MULA 1GR1A 2XDAA 1LQUA 2H2AA 2O3SA 4EEXA 4C43A 2CJFA 9ATCA 1GARA 3ZY6A 2W2LA 1SAYA 4AT1A 3DULA 2A5DA 2C97A 2EBHX 2MYNA 4B80A 4C4XA 4I8DA 3GLIE 5SY6A 4I0WB 1KI4A 2EV9A 3QMPA 1PZMA 2SHKA 2WIAA 5C46F 5DBHX 5CLFA 3CNEA 4UTNA