2IHZA

Crystal structure of multifunctional sialyltransferase from pasteurella multocida with cmp-3f-neu5ac and alpha-lactose bound
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
388
structure length
379
Chain Sequence
b'MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSALNNPYVKVMRRLGIIDESQVIFWDSLKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-2,3/2,6-sialyltransferase/sialidase
molecule tags Transferase
source organism Pasteurella multocida
publication title Crystal Structures of Pasteurella multocida Sialyltransferase Complexes with Acceptor and Donor Analogues Reveal Substrate Binding Sites and Catalytic Mechanism.
pubmed doi rcsb
total genus 134
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA01
2EX1A 4R9VA 4V39A 2IIQA 4V3BA 2IHJA 2II6A 2C83A 3S44A 4R83A 2ILVA 2IHKA 2IHZA 2IIBA 2IY8A 2Z4TA 2IY7A 2ZWIA 4V2UA 4V38A 4R84A 2EX0A 4V3CA 2C84A
chains in the Genus database with same CATH superfamily
1XTQA 3G2KA 4AULA 1TCCA 5C52B 3VYRB 2CCJA 1ODCA 2K7ZA 3LKBA 3TXXA 3M6UA 2EFCB 1AMUA 3HVKA 5IAKA 3KUXA 1EHCA 4H0CA 1NBEA 3MT9A 4ZHQF 3DWGA 4FGJA 2B8NA 3ZGNA 4M8LA 3DF7A 3T4XA 4C7OB 3HKCB 2OFPA 4YRRA 1M6NA 2JJ1D 3QUTA 4OGGA 4YFYA 4UTVA 3AM1A 3GLKA 4I3HA 1OI2A 3BJZA 3QK7A 3GVIA 2TS1A 2FY8A 3I6IA 4JODA 5IJXA 4B73A 4BJ3A 2LDBA 1C14A 2PWPA 2ERCA 3IEUA 3DEFA 1GCOA 3EVEA 5IAEA 2Q1WA 2FEWB 1P17A 2PZMA 3A4MA 5I5GA 2BEJA 3DBRB 2PQ6A 2AZTA 2ID8A 2TECE 3KYDA 3W1WA 3U4IA 1GP2A 3AR6A 3I2FA 2XB9A 3FZQA 3E9YA 1I4DD 4LJKA 1WPXA 4DMGA 5FXMA 2OCLA 2HF8A 3VGPA 4ER6A 1IM5A 4M88A 3ABQB 3ENQA 3O4VA 4ZT7A 4E12A 1RR6A 1YHYA 4P84A 2CHQA 3QEAZ 3IQXA 2VZEA 2PAFA 3LXRA 5AH0A 4EHAA 3BL6A 1DQSA 1U8ZA 4BLTA 3THRA 1IOZA 2XNSA 4YDSA 4TZKA 2UU9B 1MH9A 2Q2VA 1C8BA 4QJBA 4ZDWA 4NP6A 3RHSA 2QD2A 4TL8A 5EOVA 4Z4CA 2FOXA 1E2PA 2FE4A 2XYGA 1JKXA 1F12A 3QFRA 4NAUA 4OHVA 3DJFA 1QE3A 2GYWA 3VYVA 4QM6A 4A73A 1SXQA 1GY8A 3LCMA 2CNNA 4DJTA 1EFVB 2R8EA 1E92A 4L85A 3VHXB 3W5VA 4TZTA 3IQDB 1JQJC 2ID4A 2Q5QA 3FN4A 4DSUA 3Q8LA 2FPMA 3UK1A 1ZN9A 4BEVA 3R0JA 2J4CA 6Q21A 4ZQGA 1EQAA 1SBYA 3HSSA 9ATCA 5MHTA 2BM1A 4AN0A 2VK2A 4MKZA 4N7BA 2GEBA 3OQMA 2G8NA 2FSIA 2XUKA 1GUDA 3HKDB 1SQ0A 4FCTA 4IZHA 1XEAA 4LMRA 3JWPA 4RGQA 3RPEA 1M0SA 4ARSA 2VBFA 3STYA 5JRZA 5MFPA 2ET6A 3D4OA 2XXBA 5LNK6 2DC1A 3GVPA 4RPHA 4CZ2A 1XNGA 1Y6RA 2Q5CA 4ZJPA 5IZ4A 3NKFA 2HTFA 2QAIA 1MZPA 4BIMA 3OE7A 4B0PA 4WBNF 5C1BA 2R7LA 1I7SB 3KOMA 1TMGE 4LF7B 3PHHA 4MX8A 3RU9A 1CLUA 1JLLA 3HVUA 1W35A 3E48A 2H4FA 2RAFA 2VPYA 3H5LA 3QF4B 1YBAA 2RKWA 4KTTE 4Z51A 1M8KA 5FI1B 3RODA 1E7WA 3D4LA 2PX2A 1W0KD 3SMQA 1G4UR 1QIEA 4FKBA 3DAOA 3P32A 2IIPA 3V8PA 3UMJA 5IH7A 3Q9UA 1Y89A 1L4LA 2WJJA 4D92A 5EMNA 1EUZA 3OZDA 5FF9A 3LDUA 1QHIA 4PGFA 3TQQA 2A9JA 4EO7A 2VJCA 3OCXA 5BW6B 3DCIA 1NVTA 1UADA 4L5BA 3SK0A 4DMUB 4GOMD 1JIJA 1UOEA 1V1MB 3AL3A 2GA9A 3DAFA 4G8DA 4A15A 1FNNA 3G2HA 1M83A 4G6ZA 1PFGA 5HOEA 3IUNA 3T9CA 4IW3B 2N0SA 3QOFA 1ULTA 4FYYA 4E1VA 1WNTA 5KQRA 5B1EA 2QW0X 2W93A 1FX0B 1M3SA 5DWDA 2GBGA 4H6WA 1E2MA 3RBZA 2B5WA 4FHDA 5A2GA 2NN3C 4CUZA 1X7ZB 4XRGA 4E2FA 2FFQA 1U1DA 2CL5A 2WMYA 1N1GA 2C94A 3FVVA 2ZIXA 2NUTA 1PS0A 1G291 3W77A 1TU0A 3C3MA 2Q3MA 4F96A 5BNIA 1P2VA 5JBIA 2Z6QA 5IABA 5EXDA 1L9XA 2A9OA 2NXNA 1X1EA 2A57A 2NUPA 3AILA 4B7AA 4GKVA 2H52A 4XJTA 4RJKA 1T5BA 4YPOA 4Z86A 3G59A 3DXZA 1QONA 1MA3A 4WFJA 1YJ5A 4DDWA 3RGWS 1G5QA 2QN9A 3U0VA 2AVNA 1SXJE 3QXXA 4OX9Y 5EZYA 2MSEB 3DAYA 4IOMA 2J9ZB 2PNJA 5EHQA 4AJ1A 4FSDA 3KSMA 4BX9A 4N4AA 1G5HA 5GIOE 2GM9A 2WW8A 3WL5A 4DR2B 3JQDA 5KYNA 1XZLA 3DMDA 4JS0A 1RRFA 1M2OB 3VR4H 2LKDA 4PXSA 3QWIA 3W2FA 2ZPUA 4JA2A 2IWRA 4QM7A 4YCLA 5JSQA 5IDYA 3QYFA 4IILA 1TJ3A 3OU6A 4X54A 2Q2QA 3W9UA 3KHUA 3OT5A 3JD0A 1Q84A 3WL3A 1QG2A 5TRTA 3DOUA 4L08A 1WZ2A 3UMMA 1G1MA 2GCOB 2XB4A 3JQEA 1CY2A 4BUZA 1JFSA 1TZMA 1IXRC 2VHWA 5KQGA 1FDSA 3C45A 3HWSA 2FUCA 3GYGA 3NHLA 5K3EA 3AL2A 2AJCA 5J2TB 3AMVA 1LNSA 2YL2A 2ZRKA 3OEWA 4LTMA 5CLGA 3TLYA 1H2HA 2HK7A 2XKAA 2PQ2A 4RK6A 4WD3A 1Z5OA 4F85A 3UPDA 2O8NA 5LU8A 1E60A 1PZNA 3GARA 3DV0B 2VP9A 3SZUA 4ADSG 2VP0A 1ZESA 4B35A 1WF6A 1MV5A 3FXAA 1DBWA 1KZ9A 1A4UA 4M0EA 4FEGA 4TT8A 3GP3A 2AOWA 4LGVA 1ZM4A 2QYSA 4LXYA 3A6LA 3C6XA 1W4CA 3TN7A 4MWEA 1LW7A 3O92A 1C7EA 1ZD3A 1BOFA 3DMFA 1MW9X 3KLNA 5ALJA 4N48A 5DM0A 4G0VA 1LV8A 1XRJA 3E82A 4EGAA 1TPZA 3JYNA 3V6MA 3GLGA 2F1HA 1NLUA 2VP5A 3BHMA 3ZGYA 1R0BA 1YC5A 5H3HA 3VNAA 4YMTA 521PA 5GINE 2XQGA 2CLMB 3C7CB 3NKLA 4FE7A 5LBUA 1QAQA 3H83A 2R1TA 2EC5A 1FQOA 3GR6A 2R8XA 5K03A 2CK3D 1IHXA 3LL4A 3WL7A 8ADHA 2Y6UA 1R3UA 4Y8VA 5AK3A 3H8JA 3EF0A 4WIAA 2J3IA 5SZHB 3DLHA 2PBRA 4HZIA 4AMGA 3Q7PA 1M2WA 2WBLC 2PJZA 3WIEA 2J9FA 3U60B 3IBCA 3TAUA 1BCRB 1XDWA 3IA2A 3WQBA 5IDXA 1TJYA 3EUEA 3WKCA 4ABYA 4GT1A 1KFCB 1G2PA 1TX4B 2BSAA 3DWEX 1U0HC 3G2PA 5EIWA 3OZRA 1YACA 4XQEA 4ETNA 1FQWA 2MHCA 4BOYA 2H4JA 2WF5A 3AONB 1KZ6A 3T5MA 4H2DA 3V7WA 1F1JA 1EUYA 3UICA 3J7AC 2IHBA 5JJBA 1BDMA 2DPMA 2WZDA 3CSSA 1KI8A 2DH5A 3EARA 5KPJA 2ZRPA 4TWZA 3LHKA 3NC4A 5FNVF 1LUAA 3EIXA 4I9GA 4WEQA 4E5PA 1T9AA 1JI3A 1I1QB 3ZBQA 5L7TA 2GCNA 3HP1A 4YAOA 5ETJA 4Q4HB 2VZ0A 4QJ4A 3PFCA 5CA0A 5HR5A 3GC6A 2V1XA 3HWX1 1G63A 1CQPA 2QTTA 3L7KA 3UOWA 3I39X 5ALHA 4FFOA 4R98A 2XB6A 1E1QA 4XWYA 5GOZA 3E9QA 3TGPA 3TLJA 1SUFA 4XIJA 3WMRA 2Q45A 4GXNA 4MQ5A 3GN2A 1N1MA 4RPKA 4CETA 2G6TA 5IKMA 3WK8A 2B4YA 3D8SA 1UDWA 3A70A 3DDOA 4FE4A 1T4CB 2P91A 1J2EA 3DDWA 3KKEA 1X13A 2PZFA 2B3DA 1JTFA 3MLEA 5HF9A 3RBVA 2JVKA 5J3JA 1XEWY 2MYPA 2QD4A 3IEIA 3WGLA 4IIJA 4CKCB 2LTAA 1BKYA 2Y9MB 4DCVA 4IH1A 4I55F 2A9RA 2ZETA 2HRCA 3V4VB 2XXJA 3S2ZA 5CYOA 4C0WA 4JQYA 3O8OA 4RHTA 5EYPB 4DEXA 2JK0A 1BSVA 2R7KA 3MBKA 4IEFB 4NQRA 4Q9KA 3CW2A 4F9TA 421PA 1CVIA 1NF3A 2MINB 5DP2A 2PYZA 4JVMA 1S0UA 3LVBA 4WN9A 2GPBA 4F97A 3NAGA 4Y2XA 1Y3AA 4RA6A 1RKXA 2WF6A 1ZR2A 4DA4A 3DM9B 2ADFA 1MOPA 1JU9A 3K15A 2NTEA 4ZO8A 2WSIA 3MMNA 1L4MA 3OMWA 1NA5A 2I6GA 4GR4A 1B23P 1PYOA 3DMHA 1NSFA 4ER7A 3FSGA 1ZKDA 4C0LA 3FA2A 4DM7A 4EWLA 1EQ2A 2R68A 3Q10A 3TSOA 3EA5A 5IKPA 2ZE5A 2Q9CA 4KUGA 4XLZA 3ETLA 4NPCA 5DE3A 1SD2A 5JNUA 1Z0SA 3U7GA 1T26A 3WSTA 1T9KA 1V37A 3R0VA 2EX4A 1PK7A 3HB0A 3LKDA 5GVRA 1UMKA 2C07A 3EODA 4DIMA 4GBJA 1BE0A 2K7FA 3DDNA 4HDMB 3GLHA 3KCQA 4O1IA 2IEGA 5E4TA 2Z08A 1ADGA 1Z62A 1JXQA 2I2FA 3EXHA 3BJRA 2PJRA 5CJ2A 4M7PA 2IHTA 5K0FA 4DR5B 2XITA 5KYGA 2Z4RA 1JEQB 2B99A 3UJNA 4YJHA 3VNBA 1RRPA 2CLOB 3H8WA 3TGWA 3TM5A 3VKWA 2GX6A 2POCA 2OVFA 3DBLB 1O0CA 1LRKA 5AOVA 4OAOA 2P3OA 1TZ2A 3L7BA 3VOAA 1QTRA 4WY2A 1S2IA 2F8SA 3JAKA 3O3CA 4KQ9A 2OHOA 3V2HA 2Q29A 1LDYA 1YIDA 4C04A 5H0IA 5A3SA 2EU8A 1AT1A 1IBKB 3AFMA 3MERA 4HSGA 3EXG2 2G07A 1YMQA 1H9BA 1KAEA 1KY4A 2YZGA 3CNNA 1K7XB 3JS5A 3AKZA 3RHZA 3AI7A 1DDIA 1YASA 2G06A 2XMPA 4IIFA 4QQKA 1IOVA 4RDHA 5AP9A 3PGMA 4E15A 5EJ4A 4PLWA 3EZXA 2PX0A 2VHTA 3F6BX 5D2CA 1G42A 1E1LA 1NW7A 4YRQA 4DPKA 5LA6F 2CN1A 1DG1G 3A9RA 1QTNA 1WL8A 4LPKA 4F5EA 1OJLA 1NBMA 3QKUA 4M8NE 3EPHA 4D8XA 1CUBA 3F71A 3NS7A 4CCYA 3EVAA 4PFKA 3ENNA 3BICA 4J7UA 1L1FA 1M9NA 4LXUA 4BRUA 1MCZA 4LSMA 3P52A 2DBYA 2X0DA 3C2QA 1PX0A 4AIIA 4CL8A 2ID7A 4MWCA 2W2LA 1I10A 2O8CA 2Q62A 4YR7A 3DLBA 4P34A 3U56A 1MJGA 4FGUA 2JF0A 3UGTA 4X7MA 1QG6A 1Z75A 5AW5A 4CI9A 4CKCA 5BMVB 5HKBA 1Q1ZA 2ZJFA 2BFDB 3LHFA 3QKIA 2Z5FA 4RM2A 1P9RA 4GSLA 3SQDA 1XU9A 2GVNA 2ZS9A 3IJPA 1JLHA 1Y9ZA 1E6KA 5BSEA 4JCOA 3OQHA 3EZYA 2BEKA 2QEQA 3LQ2A 4L78A 3COJA 2PWYA 3K7EA 2GLXA 2X4LA 3FD8A 1ULZA 1E6MA 2JI7A 3IP5A 5U4XA 1ZA2A 2C5EA 3H0CA 2O2IA 1Y7PA 3L8EA 4P80A 4Q34A 2ATEA 2ZAGA 3ODPA 3NXSA 4CLRA 1M34B 3CLVA 4HYYA 1Y7HA 3CUUA 3AUTA 4J0HA 4YAEA 3QEOA 4M9RA 4TGLA 3P27A 3RNOA 1W9HA 3ZGVA 3FPGA 4DKXA 3DE0X 4I5GA 4Q21A 1OT5A 2A58A 1GV1A 1T2EA 5WRFA 1C7QA 3F96A 2PH5A 4TOIA 4YT4A 4B9EA 3PKJA 1AGXA 1TGYA 5CG2A 2H4YA 3OLYA 3LK6A 2CJWA 2FNAA 1IMOA 2DUMA 1VE3A 1U1FA 1VLVA 2AMVA 2ZQ5A 3F5MA 4UBLA 3CZQA 3VR6H 3RT9A 1EHIA 1AUPA 1MP0A 3X1JA 3EEQA 3CF0A 1RNLA 4QNNA 1YS1X 3S55A 4ENWA 1WB9A 2WUEA 3DMNA 1E1CA 3NM6B 2IYFA 1PD0A 1OYVA 2PT5A 2I1WA 3K5WA 2BCEA 3R77A 3NZEA 3IV9A 4AAYA 5TMPA 1H2RS 1IMJA 3M7IA 3MNFA 3EVDA 4GBED 2CFTA 1Y7TA 3VDQA 1SUBA 4RD3A 4ARIA 5BWBA 4HEJA 4TTAA 4YRDA 4FEEA 4Y7DA 2XUAA 3IKTA 2PFGA 1CY6A 1M72A 3S7ZA 1NMEA 3AVXA 5I4IA 1I32A 2FR0A 1OXMA 3NALA 3VMMA 3VR2A 3KSZO 4IJKA 3E4DA 1G20B 3BE6A 1C1DA 3H5WA 3ZLBA 5ALIA 3OTIA 2LDXA 2RCYA 4QFCA 1NJ5A 5HE9A 3R7DA 1UF9A 5DM60 1I5OA 2H48A 1VE9A 3PL1A 4JLSA 4WK0B 4BBPA 1ENOA 3QPDA 3DMTA 4H08A 2A84A 5CFQA 5K1ZA 3DZIA 1R2QA 2NPFA 4G1EB 4TMVA 1FUYB 3TI7A 4UNRA 3J80A 1Q7EA 3CEJA 5IT0A 1R6UA 2RKBA 2JJ2D 4GMGA 4G09A 3P4YA 1WMBA 3KYDB 4RZIA 2Y1LA 3UANA 3KQUA 2E4WA 1I6MA 2FB9A 3R7BA 1XZEA 3MWYW 4D0SA 1PZEA 3OOHA 1KH2A 2D4HA 2MR6A 2I55A 2EKQA 2G17A 5BPHA 1L7NA 3PD1A 1XYVA 1DKUA 2FW8A 4V1CA 4OB8A 4W7HA 3TLXA 3AESB 4FR0A 5B2FA 4PPNA 3ZE0B 1GNLA 3B1WA 5GADl 3FCYA 1N9ZA 2YC4C 3UGKA 3MLBA 1UPFA 4LTDA 1LCIA 2B1IA 4DR1B 2MJLA 7MHTA 3ANXA 2PBZA 2R6JA 1N0HA 4MQFA 4N0MA 3R3WA 2YYYA 1Q3KA 1G59A 1QHHA 1CUDA 1GAQA 4QEDA 3PTAA 4QU0A 4Y9TA 3CGWA 4WXMA 5FPPA 4I08A 1FDIA 4GECA 4U6NA 5HIAA 3TH5A 5IP5A 2HX1A 4UU1A 3RSOA 4BO5A 1EXDA 1GKLA 2BBTA 1DAIA 2PANA 1EA7A 1I2CA 2AFIA 3DDHA 3PIDA 3X1WA 4OUKX 5FRDA 1XTPA 1RJGA 2PZGA 4FIZA 2VJOA 3NEAA 4LRXA 1RRGA 3PF8A 5KNBA 1AQ6A 5EUBA 1M6VA 5BSGA 1P4JA 3HB9A 4BNHA 2PJUA 2ZYDA 2I03A 1T9ZA 1U80A 2HMTA 5EUCA 4AJ4A 2BMAA 3S2FA 3OCCA 1TCVA 2HBYA 1E3EA 3ITKA 3MMZA 4KXMA 4QHTA 5D3KA 4BO2A 4C2AA 3SEAA 3G0BA 4YUWA 3ZWOA 4KMOA 3L84A 1QHYA 2I3AA 4AM8A 5CEFA 2VIIA 1NVUQ 4HWPA 4PHCA 1DBQA 2PL3A 3C6QA 3KSUA 3ZYZA 2ZSKA 4JYPA 5DLQC 1X9HA 2RHBA 1NLMA 2ZUWA 3QBTA 1HDIA 2PXCA 1E1DA 2XV1A 3OA2A 3HV0A 1O87A 4FX2A 3A6DA 3SHOA 2HZBA 4HAOA 4J1TA 1XWIA 1GAJA 4E51A 5A4AA 2YXLA 3JCZA 4AF6A 5ADVA 1ULSA 2PGNA 2EFGA 1AKEA 4YJKA 4ARUA 2HGZA 2J87A 2XOKA 2CNWD 4EX6A 4XVUA 1PFYA 5FUMA 4GMDA 1T36B 4RH1A 2OWDA 3OZ7A 3VZDA 1EJBA 1T2UA 1UCFA 3L4SO 1U8TA 4OQDA 4Y6GB 3E9CA 4WZZA 4FHEA 5EP1A 3TTTA 3RTAA 3ONWA 4DUGA 4EUFA 3D6VA 2I6UA 5B4VA 1MQ9A 3PFKA 1ZICA 4GX0A 4QAJA 1V4VA 4FMBB 2I2CA 2NSYA 4MLZA 4AN1A 2WZQA 4J1NA 4BX3A 5CB6A 5KYKA 1ENYA 1ND6A 1NXWA 4B43A 4YCMA 1OTXA 1W5AA 3GPLA 3LT0A 2XYQA 4O2AB 4X6XA 2VDVE 3D64A 3OUTA 4FXOA 3M1LA 3H19A 4W1PA 1BQ3A 5CH5A 1NWCA 3JYHA 2W2QA 5AM3A 4EBBA 1MEOA 1KVTA 5LCXA 2W43A 2XTJA 3V97A 1KDPA 1OREA 2PGJA 2VI5A 2XDWA 3IEPA 3UMCA 1OXTA 2BGKA 1JAHA 5EE9A 4LJAA 2X0IA 1HTBA 1E2KA 3HMKA 1EM8A 2NQ2C 3IPCA 4QYTA 3DEIA 1REQA 2X0EA 2HA5A 2HWKA 3S27A 2IZ5A 3GHHA 4D5EA 1G8MA 1H05A 4EYSA 3BCUA 4D99A 1YQDA 2RH9B 3VZCA 2VSXA 3GDFA 4WKPA 3B13B 3IEXA 1WQ1R 3SZMA 1R4NB 5EZ5A 2YWHA 3DWFA 4M9CA 2Q6TA 2W6NA 2P9JA 4N5LA 1ODLA 3G7UA 4WHMA 5REQB 1Z22A 4NIMA 3LC1O 3VFDA 1Z9BA 2EFDB 4PYMA 3HWWA 3HA2A 3L6DA 1CEQA 3BWBA 3MRSA 5B36A 1AHNA 2XMGA 1K2VN 3IE0A 1YVRA 5HIMA 5KHAA 1L7AA 4ZYVA 1WDMA 5AW1A 4H7PA 1Z56C 1YQUA 1KHHA 3H0KA 1HQCA 3GQVA 3KR0A 3LQQA 4KPUB 4PQYA 4KO8A 2FOLA 4TPKA 3ZS8A 4BE9A 5BUSA 2BEVA 1RAEA 4HPXB 2NZ2A 4MMXB 4PR3A 1ANKA 3NTXA 3G5TA 4AQYB 4EZBA 2NU8B 2JFWA 1V0JA 2XVZA 1TEHA 2C4KA 3HY4A 2ARKA 2C5BA 4GX5A 2PKRA 3L7YA 3WDSA 5IM4F 1V47A 1H4VB 3D0KA 4M38A 1ZK1A 5AI4A 1JXOA 5FBKA 3W2HA 2VDUE 2WYOA 4HSEA 1VM6A 2COKA 1ZUNA 4K28A 2NYRA 1KFJB 1PUXA 4M54A 3P0HA 4X7RA 3B8HA 1EFUA 3CCBA 2D2XA 3R20A 5IUKC 3RVJA 3USES 5C35A 1M6VB 2JGDA 3V46A 1DCKA 1F8GA 4DIFA 2B9EA 3P5BA 1PYDA 4NOMA 1HT2E 1GPUA 3DLCA 4HQFA 2WT8A 2WSLA 4WA8A 2L69A 4JB0A 3VHQA 1QDEA 1T8UA 2BZ0A 1KJWA 3KZCA 2BFEB 1FP1D 2WJ6A 1D0VA 3E5HA 5CVUA 5IT9A 1YZVA 3N05A 1DP4A 1L9KA 3W6NA 1OLXB 4MHSA 5LWQA 2HIHA 4TZ0A 4D4HA 1QH1A 3INTA 3OZFA 4R1QA 4Y1RA 3RABA 4QKQA 1N3IA 3BTOA 1KEPA 3GGPA 4DA0A 5JSUA 2C2KA 3I5MA 3D81A 1QYWA 3AWDA 3FCAA 4FGSA 3STXA 1FU4A 1CUGA 1Z74A 3AF0A 3ND7A 4B84A 2QLJA 3CB4A 4V0LA 1ADFA 4QBKA 3KQQA 2UVPB 3T99A 4C4AA 3HUUA 2DWQA 3REQB 4FW9A 5BQ5A 3RH0A 4Z4IA 3A2NA 3B9QA 4GZLA 1CQXA 3EYAA 4YAGA 4RZSA 5KBYA 3M1YA 3VU0A 5LPNA 1HQYE 2NU7A 1N6IA 1TCUA 2YHAA 3HVJA 2HHAA 4ZI7F 2H07A 4RHEA 3UGJA 2CVQA 2AKEA 2IODA 4MDYA 5JSFA 4NU6A 1L4FA 4H7KA 1GQYA 1NL3A 4OMCA 3SYRA 1HYQA 5CITA 5JNTA 3K1JA 1WAMA 3CH5A 1ORDA 3ER8A 1T13A 2HXGA 4PSUA 5CDHA 2A8YA 2JEZA 2HO5A 2PEYA 3MEQA 5DU2A 3TXAA 5HKKD 3DFKA 2CF6A 1NNEA 5AT1A 4XFKA 3GUCA 2CLFB 4J2OA 2WYHA 4NS1A 4ODIA 1V1JA 2CLKB 4IX1A 4L95C 3P9RA 5A02A 4Z9AA 3W1VA 3DBHB 4TRRA 1RWPA 1DWPA 3TGLA 2A9QA 1N0UA 4KRFA 1WVGA 4N82A 3JR7A 2XMCA 2PZLA 3GVHA 4DLYA 4D9CA 3CRRA 5FQOA 1DC7A 2QTGA 4H18A 4LYHA 2Y2UA 2GD0A 1ZN2A 3MOSA 1BD3A 1RQ2A 4IYRA 4C30A 4R2WA 4Q9IA 1Y4UA 2RB4A 1SBHA 3QG5A 4N03A 4DWJA 3F4KA 2XY4A 5F9HA 5A9RA 4C88A 4RTNA 1G1AA 1N2XA 2EJUA 2XMDA 4GLJA 3SM9A 5BSFA 1MO2A 2FZ5A 1M2NA 4DMHA 3PKIA 4FB5A 1IWBB 1PJLA 1SXJC 3FLMA 2J3KA 2D1SA 4C7OA 1GA1A 1GGKA 2UUOA 4IEIA 2EKBA 2Z04A 4IS3A 3BD8A 4BKRA 1N2IA 3C6YA 2VJPA 2FK7A 4EQ6A 2DR2A 1PNVA 1Q91A 4TTPA 1JALA 1OY1A 1ZJJA 4M3NA 2WTXA 1WX1A 5ESXA 1U0FA 4QGSA 2VAVA 5EKDA 1G21A 2CCGA 2OENG 3SCZA 4MHOA 4DV2B 1XDDA 1I7QB 2HR1A 1ZCJA 4RS3A 5I01A 1LC3A 4MJXA 1TZBA 1GUZA 3DL7A 3VTKA 1J33A 1C9DB 1HZJA 3UV6A 3NUGA 2K2QB 3CA8A 3OEYA 3PQ4A 4YRCA 4BL5A 2PZEA 1YIOA 3FRJA 5BXQC 2J0UA 5JT1A 3KPJA 1R6XA 3HKEB 2ZT6A 2C1ZA 3BGOS 5KNCA 4RQTA 2B25A 3PXXA 3UAXA 1JDZA 5EPEA 3LT2A 4C6RA 3QPBA 4UU0A 1UFRA 3SHWA 1P2SA 3NFYA 3ODGA 2J9XB 1QIIA 3HPRA 2OBXA 4OHOA 4UUQA 5FD8A 3V7YA 2V55B 3GFFA 1FRQA 4JLJA 3SX2A 3TKAA 4BNYA 4TMZA 4Y2GA 4QTYA 4YACA 5JBNA 5FIUA 1YMUA 3MD0A 1RI2A 4OY3A 1XCGB 2V6JA 4EVSA 7GPBA 5ARDA 2HDNB 4EVQA 4G84A 1PWZA 3I2JA 4AW9A 4YCAA 1LPPA 2RJNA 4EB0A 5H81A 4D9NA 1N3LA 3C16C 1V45E 2IUFA 2I22A 1PR4A 3JD1A 3LPNA 4JDPA 4LFAB 2IYZA 1EKXA 1YFZA 1N2CB 2OCAA 3H87A 4LEIA 3H84A 1BAPA 3E0QA 5L8VA 2B5VA 1DARA 3EDRA 1TPYA 3AG5A 5A03A 4KK3A 1J24A 2ZJ4A 1W2WB 4A82A 3GDGA 3N2GB 5CCDA 1N8NA 3KBOA 1JH8A 4ZGGA 4TRNA 1NYLA 1D4AA 3H16A 3COYA 1B8NA 1J8MF 3WGQA 3A3PA 2XB2A 1EFKA 3QE4A 3R5TA 1UWLA 3ZQUA 1Z4LA 3WLTA 4O0LA 4TLBA 3ZWBA 2R11A 4UHKA 3ILYA 2ORIA 1SUWA 4NZOA 5G0TA 4Z0HO 1ZNZA 4I6EA 4ZCPA 3IQEA 2A5JA 3FB1A 3TK1A 5JWOA 4FC7A 2AE1A 3QITA 3VO2A 1B1AA 1PWXA 2MSCB 3IOCA 3L4BC 3O74A 1UT5A 4OI4A 4KXLA 5ESWA 1S8NA 3IURA 1Y4AE 2V03A 4Z0NA 1P29A 4ACAA 4ZCMA 3FB4A 3U7QA 1EYZA 1SZCA 1P39A 5A62A 1SFRA 3ABRB 4M7OA 2NIPA 1JHQA 1KMMA 1CT9A 3E22A 1N32B 4QDTA 2Q8NA 1QS0B 2CVOA 3CC8A 2DULA 2XYVA 1JBEA 2G76A 2Q0XA 3ETEA 4G5HA 4C4PA 5FBZA 2ZZMA 4AKIA 5CFLA 4J0DA 2C5GA 3KKQA 2XGMA 2ZBUA 1X42A 4L9SA 3QWFA 4I8IA 1XJ0A 2OGUA 3I76A 5JHGB 5CJPA 3CPEA 4HYEA 2QVGA 3QELA 2ZB2A 3MM4A 3CSDA 5AW7A 3FMIA 1CZHA 3KZXA 4MB0A 2CZCA 5TPZA 4X1IA 3NW9A 1K75A 3CBQA 4MVJA 1AHPA 1GZ7A 3K9CA 5IM5A 3G6WA 3HO1A 5BWNA 1RHJA 3R41A 5CXSA 1AKWA 1P6QA 1HR0B 1O6CA 4JXZA 3HBFA 2HF7A 3Q72A 1TYAE 4Y98A 5CXUA 4CW7A 3KQHA 4URUR 1C9JA 4UUMA 1T5OA 3OJ0A 4AKGA 1RT9A 5BQFA 3RQIA 3HKEA 4X7PA 1X9GA 3VTAA 4AZ3B 2PUJA 1Z4PX 3MAGA 3K6SB 2P5SA 2UZ1A 1M1XB 2JB9A 5CPBA 4QOSA 3LOPA 1H66A 3L8MA 4HX5A 4XD7D 1JR2A 1M1ZA 5KHLB 3OC6A 2QUZA 1FYDA 5CIWA 4GL4A 3U4DA 2PGXA 4G85A 4RL4A 2CFIA 3TBHA 3KJHA 3HEMA 3ED1A 2Y76A 2D1QA 3TZHA 4BLPA 1K6XA 2EWWA 2X0FA 2X8BA 1O6GA 2I4RA 3GUVA 4CV3A 3PYXA 2A9VA 4G1UC 2ADMA 3ET5A 4PNPA 1EIWA 1DLIA 4JT4A 4HOYA 4O2BB 4GM4A 4DZTA 3CWZA 4OREX 1FYFA 1ZG3A 4JIGA 4A0QA 5ES4B 4YP7A 4GICA 1IWPB 1UBFA 2HHLA 3SF0A 3UJAA 5JXIA 1AKTA 2B21A 3P9NA 4MWGA 4ARAA 4BVLA 1YO6A 3RAPR 1DJMA 2P4EA 3QUQA 4G36A 2H3HA 3AXSA 3PNOA 1BFUA 3R8XA 3AR2A 3VKFA 4YAKA 2XCIA 4MUBA 3LO8A 1NXPA 3NANA 1JJVA 3WGNA 2NO1A 1M67A 2WAXA 5CDYA 5MDHA 4W5TA 1O9HA 3LY9A 2F1KA 5D1HA 3DNPA 4LHZA 5H8WA 3B9RA 3ZE8A 1P1IA 2D13A 2V0CA 3AUXA 4DR6B 2WIJA 1IZ0A 1SC6A 1OU4A 1P3JA 2BJHA 1YI0A 4L74A 1NOIA 3DBHA 3DKPA 5KC8A 2PCLA 3I8XA 3FFXA 2C58A 4YAFA 5TGDA 3LRPA 4C43A 2CZGA 3M8KA 1ZJYA 2QZJA 3THSA 4ZYTA 1HDZA 1NVBA 5A3VA 3M6WA 1AS0A 1UOQA 4QNRA 3PV0A 3T0IA 1BJTA 5AM5A 2HU7A 1IXSB 2WWWA 2GB4A 5KYWA 3ZJVA 3ZGZA 1JEJA 1VBNA 1SC1A 3EBPA 1F3OA 1VHJA 3ILXA 4C4RA 4N5MA 5DCWA 1D07A 1UWCA 5KTSA 3TM4A 4BKUA 3BMQB 1IK4A 4I9NA 4XQ0A 5C1IA 1O8CA 1G6OA 1EDOA 2VRBA 2O54A 3PNMA 1NUHA 1Y7IA 3MUNA 4ZOEA 5BRJA 5JNLA 2BISA 2OHJA 3WGYA 4EL5A 4WBNB 1UBTS 5M29A 4TMWA 4US2R 1VL1A 1NASA 3M1IA 2Q99A 3ND8A 3DZFA 1AB5A 3GDHA 3KT8A 5BVGB 9MHTA 4KBGA 1W2GA 2H2HA 3ECAA 1PV4A 1D6SA 3R3UA 1CSEE 1FLDA 5JDCC 2O3JA 4CQMA 1YE8A 1OE0A 4G2NA 3GROA 1JIIA 1WHTB 4EI9A 1M2VB 1XR3A 4CKYA 2CXXA 3C3XA 1A9ZA 3L8YA 4MB2A 4P4SA 5D8DA 2XNDA 5FL7A 1KMHA 4GXTA 5FKJA 2FF7A 2NXCA 1PR3A 2AH5A 4UD2A 4EG6A 2D5LA 5DEOA 5NLLA 4W82A 3A14A 4HLUA 2Q49A 2YWBA 5CVDA 4KREA 4UJ3A 4D0LB 4CWAA 3DE1X 1OVGA 2JFPA 2ZTUA 4FBGA 5DHUA 4B31A 1NXQA 4HWSA 4E03A 3IR7A 1OFHA 2JI8A 4QPPA 3UMSA 3HXTA 1UWKA 2JIDA 3BFXA 1W49A 2UZ4A 1ST3A 4WCDA 1D2NA 3EGOA 2AT1A 2A1TR 1N6OA 2H51A 3DR5A 4OKNA 1DIAA 2R84A 4Z4EA 2HMSA 2KSQA 4WK6A 1CV2A 1WB4A 3TQSA 1UP4A 3W6UA 1MB2A 8AT1A 2ZR0A 2O6HA 1A8HA 2IA5A 3D3NA 2XW6A 3CX8A 4MGZR 2OBYA 1JIVA 4BQRA 5AJXA 5JQWA 2QAGB 3X1ZA 1OBCA 1MO6A 1LI7A 3WWOA 2VJLA 3WTCA 4RD6A 4OGFA 1T5IA 1IZZA 3EPPA 1PZFA 4MEJA 2MSNA 3I2IA 4ZXPA 2A86A 1K92A 4B6QA 5KC9A 3A1UA 2VXOA 3L77A 4BEJA 2IU6A 3EH2A 1KEWA 3RS5A 4JJ4A 4RIFA 1DT3A 2GBFA 3WK5A 4DV6B 2ZFUA 2FGJA 3FM9A 1VKRA 3P71T 5BSVA 5CHEA 4BO0A 4UEOA 3TDKA 1JLMA 4WAUA 5T3YA 3K9QO 4GZ3A 4IHAA 3TZLA 2DE0X 1DBPA 1J8FA 1RZ3A 2QTHA 3TJMA 3ZLVA 4EO4A 2C9OA 2I2WA 4CR6A 4KACA 3UG7A 4KMRA 2ON6A 3H18A 3IV7A 3ZKWB 1MPXA 3Q9NA 4B44A 2G4LA 3I8OA 3V7UA 4IUCS 1AS2A 1NFQA 1EVZA 2O0KA 4FOSA 4R6XA 1KZYC 1X70A 3RRMA 3MCTA 2WDPA 4Y6LA 2Z2XA 4P0PB 2PUAA 2B83A 3EMBA 2F64A 3FPSA 3N6VA 2JCGA 3BRQA 2WWGA 4BFXA 2GAJA 1N2ZA 1HLGA 2EP8A 2NTNA 2BLLA 4FJ2A 4NULA 4PRLA 4Q0MA 1EFDN 4NFHA 5F9MA 4CIAA 4JL8A 3K70B 3CUSA 3L0SA 3I9V1 1ECBA 1OPXA 5IAAA 3C3JA 1R5OA 1CEEA 4H7HA 2ISCA 3PQ7A 3GAFA 2W6PA 3EWIA 2OAQ1 4BJHB 2ZM6B 2FPGA 2WWIA 4JJZA 1MB4A 3SDZA 1J25A 3LSYA 5CA0F 2D1RA 4G01B 4PX5A 5GM1A 5A5GA 1T1SA 1U4OA 3FJ1A 3QV2A 4GXQA 5TS3A 3BFVA 1T4GA 4G81A 4H3KB 3VO1A 1JFTA 1C9YA 3GHYA 3PLAE 2P9QA 3KB2A 2FW0A 3EMKA 1XJCA 4U9HS 3VPHA 1XVUA 2QRQA 4HQ0A 3CH6A 4S0ZA 1CS0A 2VYQA 1X3LA 1WEKA 1G4AE 4BMZA 5JADA 4ITRC 2RAVA 1LPNA 1GSIA 2SHKA 2AK3A 3R5HA 3EQ7A 2BFWA 4RWZA 4B5LA 2VTDA 4XIGS 1J5EB 5HCNA 3MB8A 2DHEA 3O1LA 2Q9UA 2JJ2A 3D5EA 5EHGA 5UKDA 3ZUPA 2HJVA 2R25B 2ZYGA 5EVCA 1LX6A 3VOTA 4X1KB 1O03A 3HCEA 3MOIA 3HI4A 3A6FA 1UQUA 2PTGA 3CVJA 3K16A 4QULA 4O1MA 4ASUD 5AVQA 5LD2B 1T1IA 3F4LA 2ZRFA 4WCFA 1GNSA 4CG3A 4X20B 4DCSA 3Q1KA 3Q3CA 2JGKA 1U3UA 3AIMA 3VO9A 4OQFA 1KI6A 1CR4A 5E6UB 5EL0A 1ZGAA 3PDWA 2WIFA 4J4HA 2BFDA 5EMJA 3BGWA 3A2MA 4HLQB 5KVQA 3CZCA 4EKNB 2WAAA 3T4UA 3HQ4O 4QHSA 5BR7A 4JR1A 3VSAA 5B30A 2VTKA 1CRLA 1Q1QA 1BYUA 1PQ4A 1Y5RA 3MAJA 3RE1A 5CLJA 2QMOA 5HS6A 4AKEA 3D8NA 5IS2A 1R9GA 3O4RA 4NFLA 3OU7A 5JS2A 5I7VA 5KO2A 5LZ4A 4DLZA 3QTTA 5L9AA 4MV7A 1ORTA 2QU8A 2H1SA 2QT1A 2IU0A 4P6VF 4KAXA 1WZUA 5DMXA 2ZCUA 3FTPA 4HT3B 3PPIA 3V7FA 1I2BA 1E94E 2ZKIA 3MCAA 3NDIA 1ZUWA 1S3FA 3AHIA 4IGIA 4KXXA 5CCBA 1GARA 2KPOA 2IGTA 4RIHA 4RGBA 4BS9A 1CF4A 2JFBA 2F2TA 4AFNA 1VKNA 2PO7A 4FYVA 4KLZA 2I3ZA 2BH2A 3L18A 1RPZA 1M10A 2NZJA 3L6EA 4UE6A 3JQ8B 1QK5A 2E9SA 1QQAA 4WNIA 3VU8A 1E3LA 1PZXA 2HLNA 5BYAA 2J6HA 1E3MA 3MBIA 3LX4A 4UTOA 1FP6A 1G8JA 1R00A 2ZBFA 3EK2A 3E3LA 3LIIA 4L2IA 4L4UA 4U7JA 2HIGA 3IP6A 3DTTA 5TVGA 2JAQA 4EH1A 2EGHA 5F5LA 1M0EA 2R6HA 3ZNNA 1RKVA 1SQFA 3FDIA 1QQTA 3FCUB 3H0EA 3LMKA 1XZAA 1NX9A 2EKLA 4LVNA 4FK8A 4LHEA 2GBCA 5H59A 3U37A 5ILGA 5B4UA 3G82C 2AFHA 4J16C 1QLWA 4MA4A 1D7AA 4MEAA 3BVPA 5AUQA 5HUJA 1GTZA 3PX3A 5K0JA 2EW1A 2FX5A 2Z9DA 3HFRA 5HM6A 1UBNA 1W85A 5LC1A 1HMYA 1V7CA 1WDWB 3AP3A 4A2QA 4EYEA 4X24A 3TZEA 2V0NA 4YJ3F 1Z2AA 1Z6GA 3E3AA 3PE6A 1N2SA 1Z7GA 4HB3A 5JLAA 2VQFB 1BWPA 1EBUA 4GPAA 4ZAXA 2EDAA 1AD2A 1EFRA 3QVVA 2IVZA 5LMUB 2VNSA 1X92A 3JQBA 1JHDA 4ETIA 1YL6A 4PX9A 1SO8A 4W9NC 4YGXB 3RGGA 4R1UA 3G5LA 4BPRA 2IVFA 4FM9A 1L5KA 4HNVA 1IQPA 5CG1A 2IW3A 3BWEA 3NDJA 4B6EA 2H06A 3DEYX 3DV9A 1H4TA 1D0SA 4IMRA 1KBQA 3EVNA 1WUTA 2G67A 3EG9A 2JGRA 5JWHA 4RQUA 2Y9PB 1JR3E 1LW6E 3QRWA 3UJCA 3D43A 3OQ1A 5EJEA 1RABA 3ELBA 2ZQZA 3MLAA 4I55A 2ZI7A 1NN1A 5J63A 3KG2A 2H7CA 4FSXA 1JHYA 2GJ4A 2ZJ0A 1PGNA 2GWHA 3BDAA 1LSJA 4JVOA 4XYEA 1ZMTA 4IO1A 3ZV6A 3HRHA 2GH1A 2KBEA 3WHLA 1L7VC 4BMPB 3R7FA 4OJYA 1W5TA 2YUIA 3QKTA 3UWKA 1YR8A 1VLLA 2POQX 2FWAA 4ZC1A 4WVFA 1TEZA 1WXEA 2QX4A 1E2IA 1V7ZA 3QFFA 2H11A 4OB6A 4ZPJA 1HQKA 1UC9A 3ANLA 5BV0A 4C05A 1X1QA 4BVEA 2WIGA 3AUAA 4XYBA 3OF2A 1HFWA 3N87A 3DOOA 2OCKA 2OXTA 1ONOA 1ZJ5A 1DQRA 4IPTA 4K26A 2UZ3A 5HX7A 1HL3A 2H2AA 4DPLA 4C7VA 3HXKA 2I87A 2X1LA 4K87A 4MITA 4CQMD 3N8IA 1A77A 4X8MA 4AJPA 1YQ9A 3AR8A 4OA5A 3GVCA 4AO7A 1FUKA 2I8LA 3BB1A 4X0EA 1Y9DA 1ACMA 3REGA 4DF3A 2IK8A 1IN5A 1JKIA 1VL6A 1GUBA 4I4CA 4NBWA 1Z6TA 3OQOA 1O96B 4JL6A 4UNIA 5C8DA 4ZT5A 2J6CA 3QVOA 1E5DA 2B8EA 2GBIA 1C9NA 2FGKA 3HKCA 4O4HA 1QKKA 3PX7A 3K0KA 5K3SA 1OI7A 1R9NA 1U28C 3HS3A 4L22A 4DHWA 4J0KA 4BLUA 4PAOA 3V2UA 1FQKA 4Y2PA 4CF5A 2DP4E 4C2BA 1AK1A 4XDYA 5T41A 5KINB 1AGYA 1AO0A 1MLDA 3CY6A 1DAKA 2A78A 1QRUA 4CEIA 3DHVA 3K9FC 1TUBA 2HDWA 2IYOA 2QM0A 1CK4A 2Q4OA 2VSQA 4S05A 2W6IA 3DVQX 3CMCO 3B9BA 4ZEWA 5IXSA 1L7EA 2CWWA 3BA1A 3EDOA 3OPYB 3UKDA 4HTAA 4R71A 3MWEA 2CFCA 3R44A 5EN4A 3WB2A 4JBIA 4AC9A 4C20A 2ZRGA 3Q88A 4UVIA 2ZRAA 3DE2X 1U7PA 1G3MA 3IVRA 1S2OA 1R18A 5JH7F 2ZSEA 5EMKA 4X9XA 3RCBA 3SS9X 2GJSA 1RADA 4BDTA 4GM1A 5J5AA 4GUDA 3GPDG 3CN7A 2VDQB 4YT8A 4CQNA 4UZSA 1YONA 4NTZA 3D8TA 2UYCA 3R09A 1H0KA 4DV1B 4ZREA 4F6RB 3K71B 1F8UA 5EE0A 2IDKA 3CVXA 1FTGA 1VZ3A 3ZVMA 1GUYA 4MCAA 4F04A 1WXWA 1ZUIA 4IS2A 3NBZC 4OAPA 1E58A 1EXWA 2B1GA 3AJDA 3DV2A 3GFBA 2C2ZA 3JQFC 3R2JA 1RJ9A 2OTCA 3OT1B 1RFLA 2HNKA 2PX8A 2YHIA 5SYMA 1Q0LA 3R9WA 2IKQA 1MIOA 1NZDA 5GJVC 1DNPA 1HZZC 1YCHA 2H59A 3HJCA 3CV3A 3UH1A 4LF8B 3M6XA 1SEPA 4JGGA 1W96A 1EI9A 2E7ZA 4DRXB 1N0WA 2L42A 4U2FA 4GE3A 1OGYA 2CMDA 3W5JA 5KTKA 4NMHA 3C48A 3F1LA 5AW9A 1CY1A 1UKEA 2UVQA 3URMA 3KL2A 4DJDC 3OG9A 5JD4A 1L3CA 3L02A 2QMZA 3O7MA 5EHNA 1XC7A 1YFJA 1YB2A 3HBNA 1IBMB 4C0HA 5G53C 1XT6A 2P8JA 4AZ0B 1SIBE 3AIKA 4MVWA 1TW2A 2K87A 2O14A 3PI6A 3DONA 2ECQA 2FUG1 4HF7A 4ILEA 1MABB 4E14A 4NF2A 1CTQA 1WVMA 4PE5B 1ZPDA 5FQNA 1OLSB 3QY0A 3I4CA 3FOWA 3CXUA 1XSEA 3WDLA 3JWJA 4G65A 5DI3B 1L5RA 2W8BB 4ZZIA 3GQBB 1VOTA 1I3KA 2J5BA 3QPUA 5HF6A 1MX9A 2ODWA 2YRFA 1E7SA 1G5TA 1DINA 3IPRA 1NUQA 2EZ4A 4MS3A 4IFEA 3H8SA 4C4ZA 4HDKB 1Z12A 2R5NA 4QX6A 1PSWA 2VJBA 3R75A 1Y6GA 3WHIA 2GYVA 4K3VA 1KJIA 3HR7A 4RKWA 1CJMA 4YRLA 3RFVA 3TR6A 3GLIE 4TTQA 4LOJA 4PLYA 1NP7A 3HP4A 2A0YA 1PJTA 2PLNA 4CL3A 5B64A 3FZGA 2IY7A 4BWFB 3RWOA 1BCSA 4EB8A 1VFPA 4L8LA 1SU6A 5FOQA 3ABOB 1BVYF 5FTLA 3EXEB 4C29A 1FDTA 2GN2A 2PGDA 1AF7A 1J7KA 3SDSA 3L7MA 2W9XA 3F2IA 3VZRA 4BNGA 2IU4A 3VQTA 1F7UA 1OWNA 3AOEC 1QZTA 4RSRA 5THKA 5H16A 1GILA 2PWBA 2JCBA 4YO8A 5IJAA 2Q3FA 4MQBA 1L3BA 2R8ZA 2C59A 1RPTA 1QVRA 1X1RA 1HWYA 1HYHA 3L6UA 4G9EA 5DSZA 3T5GA 1WUHS 3C3DA 1JFLA 2YRXA 3DTNA 3ONDA 1XLWA 4Q00A 3VPAA 4CDGA 4Q4CA 2Q5IA 4DMFA 4OXKA 2PVPA 4MWBA 3ZEAA 1NX6A 1S2DA 3LJKA 1S9DA 4K2HA 4UBNA 3F97A 1H2AS 3WMXA 2IYVA 2WFLB 1EX6A 3FGOA 4HGZA 5HMMA 4CRWB 1W4AA 3P9XA 2HT1A 4F6RA 2VTBA 4EKGA 1PR6A 3OQ6A 1T5SA 1WS6A 5D3QA 4HDOB 4O2RA 4ZQBA 4DNFA 2WFMA 3CLRC 2QDKA 2WDZA 2AI2A 1JG3A 4RHCA 3Q3GE 3ZWWA 4EF6A 4GMHA 4YRIA 1H1LB 2HA4A 2O2DA 1QQ7A 5LQDA 3KPYA 4JCCA 4FP9A 4S35A 3ELWA 1X2BA 1XRMA 2JGMA 1ZD2P 4D44A 5LQCA 5EP3A 3WHPA 1LVUA 16PKA 3M2PA 3U7IA 2OA0A 1FFXB 1VPLA 3LUAA 2C7PA 2QRLA 4UMVA 5CR9A 2FFHA 1I01A 4J3NA 3I34X 1LZLA 1D6JA 4NYMQ 5DEIA 1IZ9A 2H0AA 1Y3DE 5AD1A 4IIHA 4IFTA 4IDBA 3A3KA 1VPEA 1GTRA 1Y6ZA 4OFZA 1ZJ6A 3B1ZA 2IPOA 1DWUA 4M9UA 2H2IA 2I66A 2UYGA 4R01A 1QFYA 5FO1A 3KB8A 3GY0A 4V03A 1USKA 2NZVG 4DGQA 2BBSA 5EXXA 4HH0A 4NONA 3URKA 5BN5A 3K30A 4F3TA 5FOXA 3QXGA 2WSBA 1UC8A 4GIBA 2XWQA 1OUMA 3GLHE 2IPMA 1JR3D 2JFYA 3DDSA 2VJQA 4LOHA 5FO0A 4NMMA 5G0SA 3MRVA 1WW2A 2WOOA 2O8DA 2QHXA 4LVUA 3AV0B 4Q7KA 3B78A 1JB9A 4PYNA 3UXYA 1KOFA 4IXMA 3CUKA 3P19A 2IBSA 2WM2A 2JD1A 3OESA 1MEJA 2LV8A 2YNMA 1ISJA 1K27A 4NOKA 4R5MA 4UTPA 1AO3A 4QTUB 5JXJA 1RBYA 2O1XA 1AKUA 3DHYA 2FEPA 3P9ZA 4PZDA 2Z58A 2QOEA 3QFCA 3EY9A 4E31A 3G9XA 1NXVA 2OLJA 1M1NB 4K3UA 4MLPA 5G0VA 3WRXA 1XTSA 5HW0A 3PWZA 2X77A 3L9XA 4FD2A 1DV1A 4Y6RA 5JRDS 1AE1A 3DVAB 1CCWA 1ZRNA 5GJCA 3SE0A 3ETHA 1DIHA 4B3SB 1MX3A 3MTAA 1U8FO 3BH0A 2HSGA 4ALKA 3RSZA 4MS4A 1K7FB 3NBYC 1WP9A 4TKZA 4REQB 1G9SA 3FDZA 1L4NA 3MT8A 4MP3A 5IRCD 3HGQA 3KPWA 3VDRA 3X2SA 1NQVA 5B12A 3Q0EA 2C9ZA 2VBIA 4LY3A 3UXHA 4JYAB 2SCUA 3AU9A 1KF0A 2XNHA 1GNRA 2PKWA 3MWJA 1SG9A 3V1LA 3VYUB 3O1HB 3U7QB 3R7LA 2P41A 4M7WA 4U6QA 4EUEA 4OGKA 4URWR 4BNXA 4COOA 5K0BA 4XASA 1WCWA 2ZRMA 4Q3KA 5AM2A 4LIPD 1JZSA 2YNMC 1PBNA 2A5LA 3PUWA 2QRVA 4YIKA 1EVLA 1QLJA 1PVOA 3S1LA 3O84A 2AB0A 5J1SB 5IF9A 4K9NA 3S40A 4AMYA 3QP9A 4A03A 3A1DA 1F0PA 1XN4A 2R751 4G24A 2CLLB 3AOGA 4M8IA 4KW7A 4ZT6A 3B8EA 3M6LA 4J0IA 2EOAA 1SCDA 1FOEB 2YS7A 1NKSA 1ZA1A 2X0JA 2AE2A 3NHKA 4K1XA 3UMRA 1JHOA 4Y1EA 2B3TA 1ZMOA 4P7GA 5K0NA 2DT5A 1JHAA 2VH5R 2XQFA 3GFVA 3NV9A 1KAOA 3EQ6A 4U39A 4Z9YA 3AVUA 1IK6A 5IXJA 1JR3A 1EHYA 1QIMA 2C4TA 3DD5A 1OIWA 4F2WA 3LF2A 4OBWA 2HGSA 2ORYA 4E7PA 3B3GA 4A2WA 2I3BA 2G77B 2CNLA 2X6TA 1GCGA 1M74A 1NVMB 3BZUA 2CMFA 3GFRA 3GWGA 3IOYA 3KOZA 4L5YA 4LI0A 5K3CA 3ZY3A 1UPUA 3OQVA 1JPJA 2Y1OA 3GDOA 1PG2A 1SUCA 1U1EA 2W22A 1DQZA 1J39A 4DIOA 1YR9A 1AQIA 1A8UA 1UQRA 2NO5A 3A7DA 4Y9SA 5C4GB 1ZXBA 2DJIA 4WESA 1J09A 1ZDMA 4NCXA 4MIYA 3BQNB 5DX8A 3UUEA 1PLLA 3H5VA 4Y2RA 3SVTA 1WCIB 2GN6A 4PZPA 5EIFA 3PC6A 1EP2B 1LNQA 4X95A 5SYNA 2VP3A 4AG5A 1ONBA 1ULHA 5DI3A 1TK3A 4A0FA 3EXFB 2XAUA 4HQRA 5L3ZA 3TLKA 2GF9A 2Q4DA 3CR7A 2IE8A 4ZVQA 3RC2A 2Q50A 2DSNA 4RTJA 2PSDA 5CCXA 1DQNA 4YTEA 2JH8A 5I47A 1QHEA 3SXPA 2ORVA 3DT8A 5DM70 2PLRA 4PRZA 3AFGA 4XX1A 1JE1A 5T3UA 1LS6A 3C8ZA 1IUOA 1VE7A 3EIWA 4L8VA 4YDRA 2UXBB 1FYWA 3H6GA 1PDVA 2XYPA 1PJ2A 4KWIA 3FUWA 4QDZA 2MSWA 2ZWMA 2VK1A 1KJ9A 2OCGA 3RG2A 2WNIA 1YDGA 4I2NA 3I09A 3EZLA 2VJMA 3IR6A 2G80A 4CLOA 2R4TA 4RY2A 1A96A 5AW3A 2R5WA 2GOYA 3WNVA 2FMIA 1EUDB 1PNOA 3MC1A 2CBXA 2FMHA 2Q0HA 1HE8B 4JB3A 2VBCA 4RLFA 3IPXA 3GZNA 3ZU3A 1DRKA 2WWHA 3JVUA 4NK5A 5DYTA 2ACEA 2EJBA 1I1NA 2B30A 3B48A 1WUJS 3DFIA 4I7EA 4B3HA 3AXTA 3JZIA 3QUCA 4B80A 3FETA 4WV3A 4XLLA 4C4YA 1PN3A 4OKIA 2D00A 3GG9A 2FX3A 2R48A 3HYCA 3AM4A 2FEAA 3PRYA 2YXNA 3QX7A 4S12A 4RTRA 3ZHSA 2JCYA 2XZTA 1LK0A 4PONA 4YJGB 3JVEA 3NHYA 1J06A 1PJAA 3PUVA 4HAYA 4HDRB 4KGDA 5C8ZA 1QBKC 1VI5A 1CPYA 1WU8A 3UF0A 4XGNA 3JD3A 3W1EA 1IB6A 1H93A 1G4HA 2PH7A 5AW4A 2AFVA 1VLJA 1W59A 1ZOOA 5ESDA 4JT8A 1OX4B 2OORC 5DHPA 1AQNA 1T8YA 2FJ0A 2X9LA 2WG2A 4MI1A 4NCJA 3VVBA 3KHSA 2IBTA 2VYNA 2VP2A 1TKRA 4CVNA 2LBPA 4NE2A 4RGYA 1X77A 2I1QA 2B6NA 1Q7GA 1RYFA 3K2IA 2F55A 3EXG1 4LHVA 2VQEB 1SC4A 2ZIAA 4ALNA 1K66A 4WBNA 2O7VA 5AK5A 1KR5A 4HDNB 2H2WA 4C9BA 1RRCA 3BEDA 3IVAA 3CG0A 1B8PA 4G26A 3ICEA 3WQQA 2BGRA 5E1DA 2PWAA 3CBGA 3TIXB 3GEMA 5KMGB 1IOWA 4MRSA 4PZUA 4W1QA 2RI6A 2WHEA 3NHSA 5EJ5A 1O5IA 2ZVPX 3IB3A 1K6MA 4TXHA 1RC0A 3K0FA 3AR5A 4FFLA 5DBIA 1WHTA 2DLNA 3H1GA 4QUDA 3U5ZB 1XKQA 5FUBA 5H4HA 3VKGA 2VDKB 1Z6AA 2HQBA 2QLBA 3DULA 2IPLA 4CEHA 1C30B 1FNSA 4U7DA 3BIXA 3IELA 1C2TA 2QM7A 1Y34E 3DNFA 1HC7A 2GXAA 1LJLA 3PC7A 3E58A 3WBKA 3T1TA 1N1DA 4P2BA 2H00A 1UDCA 1RMQA 3EASA 4B3FX 2G9VA 2QSYA 4RK0A 1FFDA 3JX9A 3OUZA 4LSGA 1Y82A 2CXOA 1PQYA 1CXZA 4QYXA 3GLFA 1GAXA 3L0CA 2ZWVA 3AF2A 2GZDA 5DCLA 4O29A 2GCPA 5IWAB 1JHXA 2EQBA 3DQQA 1WSBA 2JLWA 2QN1A 3OHPA 5HHTA 3M4YA 1EGAA 1QGZA 2ZATA 2WU0A 4KL8S 1VI6A 3Q7QA 3T35A 1I7DA 1G5PA 4YRGA 1MTZA 2OSBA 3A9SA 1Y3BE 4FYIA 4TT3A 5IN4A 1PUJA 4B4KA 1F7VA 1NUPA 3WB1A 4KFSA 4TV9F 3W05A 5KCZA 3OMXA 3BA6A 3PE4A 5CT8A 2TYSB 1EX7A 4R8VA 3R5JA 4ZV7A 3ERCA 3DNMA 1L7XA 3DKKA 4HUTA 1QV9A 2WG0A 1JFVA 4PS1A 5HM8A 2LRHA 1ZNYA 2FQWA 4IG9A 3GXBA 3E18A 3IIEA 1JG6A 2BHRA 3D3EA 5KQPA 5I7SA 3K2BA 1YZYA 1Z39A 3NP9A 3RUDA 3ZWYA 2OV8A 5KAPA 4CM8B 5AI9A 1Q57A 4KAFA 1KK3A 2WYWA 3NWBA 1KZ1A 1TTHA 1XLUA 1DKNA 4KV9A 2VDWA 1OA0A 5L40A 3AW9A 1NG9A 3GMDA 3JZMA 5TLSA 1CFZA 1Y5MA 4QQRA 4TLMB 4BE4A 5I3ZA 2HQOA 1EBBA 2EJTA 1C7RA 1JTEA 3FDZB 1PL0A 3ZWPA 1W36D 5JAQA 1DBIA 2W6ID 5JCXA 1JDVA 1HL7A 3CKLA 4MUNA 3WB9A 2AJLI 4Y2UA 1U28A 3M5PA 2MCFA 2CVHA 2X19A 4BBAA 1XX6A 2IOQA 3CZPA 4DG5A 1X0VA 2B7BA 2JBWA 1AGRA 5J5VA 4EPRA 3IMKA 2PUEA 1QE0A 3PF9A 1Y9EA 5DTJA 4IWNA 2PMDA 1E6LA 1P33A 2L0XA 3PUKA 1F9AA 5CLFA 1H8ED 1Y7LA 4Q1VA 1ISGA 3AFOA 2GXUA 2PT7A 2Z0MA 1JKJB 3L0IB 3OE1A 3OCUA 4JUAA 5JTTA 1SIWA 4XGIA 1G38A 1ZUD1 1H3NA 1T6XA 4Z9FA 1AM4D 4P81A 2VP6A 1H94A 5K7SA 1E2GA 1Y8RB 1XOIA 3PHJA 1RW4A 2ZDGA 4M0FA 4YDHB 2F48A 4BO7A 4DLLA 2X5OA 2NO7A 1NW5A 5A4MS 2OG1A 1CJTC 4UVGA 3K2EA 2AYYA 221PA 4DRYA 5HYVA 1XZJA 1DV2A 1OKKD 1QG4A 2VDOB 1G5RA 2V7PA 3PR2B 4B09A 1WY5A 4BGDA 2HJHA 2P4UA 2XJ9A 1PNRA 3RSLA 2FPPB 2X8AA 4DWOA 3QIVA 3EIOA 1J8VA 4R7TA 3U3XA 4EY4A 3FRIA 4CXMA 1W5SA 3GCXA 3H1FA 3UMVA 2IDZA 4X45A 2CL0X 2QBYB 1HDRA 2I7DA 3HJHA 4UHBA 2GDZA 3E03A 2SICE 1ZCZA 5ARCA 3EDYA 2WY2D 2QIPA 1BROA 1EVEA 2WD7B 1P72A 1U2PA 2ZT5A 1U0TA 1ZW1A 3IHWA 1THTA 1YT5A 3MIZA 1SVOA 4L28A 4D6YA 1I33A 3H9EO 2XIQA 1X1AA 1X7DA 2REQA 3L7DA 3S2UA 1IONA 2BUCA 2NW6A 1VCIA 1Z2CA 4RANA 3TLGA 1S2MA 4LQCA 1UL1X 4XE5A 4QQ8A 4UMEA 3U1VA 4ARBA 2YFHA 4CM4B 4DOMA 1C0KA 1NW6A 3I01M 3OECA 1WBBA 4CCAA 1T6NA 4L4YA 1L6IA 3WWYA 1G55A 1DXYA 2FSVA 2PQMA 3GXOA 5GOTA 3H5TA 2XZLA 1F5NA 2OBMA 2R00A 3B3AA 1XROA 4PTZA 3T1QA 3X1XA 3U26A 2F8TA 4OL0A 5E0KB 2CKMA 3WXBA 2GZ1A 1HDGO 1ABEA 1Q16A 1Z8DA 3FIJA 1E5VA 2QMYA 3RTCA 3W7BA 5JISA 1ES9A 2NTYC 3AUSA 3S2SA 2CYAA 4RW0A 3ZW8A 2OXEA 1W5EA 3LVFO 1FLVA 1L8XA 4NAHA 3A1EA 2G9QA 5JNSA 1IVSA 2R97A 3HI6A 5EJMA 4KDFA 1MPTA 3BE4A 1JU3A 1KXZA 2QUBA 4ZOBA 3ZW7A 3GNQA 1J22A 1RCUA 4BEWA 3H2JA 1T91A 1SC9A 1RS0A 3OO0A 3PQ2A 1JR4A 3PXAA 4U00A 1GQ2A 1VCHA 4CMJA 3DZHA 2JG3A 1DBSA 1R64A 4LOKA 3GIDA 4JLWA 3UJDA 5KCMA 2CHEA 2E21A 3WAJA 3FYTA 5KYUA 3ZOKA 5BUQA 2WU3A 4JBLA 4YJGA 3FKSA 3GJYA 1Z73A 3GJZA 4HAWA 2PL5A 3SYNA 2OQ2A 3BS4A 1YIAA 2Z5GA 4ID9A 2AFHB 5TPZD 3UQZA 4J07A 5T57A 1G3IA 3QOWA 4TTVA 2OD2A 2Q5FA 1R8SA 1V1RA 2NV6A 2F7SA 1N9KA 1WPRA 1TYZA 1XTIA 2DPHA 1W581 3Q11A 4HRYA 5G2OA 1AKNA 5A71A 3IBYA 4AJOA 4IQFA 5FOSA 5JCOC 3BJEA 3ECSA 3M5CA 4YHBA 1DIGA 4CHGA 1J8DA 3PXEA 1DADA 2OFXA 3ANMA 3LVRE 2EZ8A 2QQ5A 4OIFA 4RAOA 2ZI9A 3HBMA 4L3WA 5BQOA 1RRKA 5HIIA 3HGMA 2ZM5A 5J5CA 5JECA 4RJJA 5JS7A 4QA9A 1R0RE 2HLDD 3K53A 2ZBVA 1E9BA 2BT4A 3K9NA 3MPUA 3OQNA 1HFJA 3I53A 1G64A 2QRNA 3FUTA 4WASA 1JWAB 3DDUA 4P36A 4HVAA 3TQFA 3ASZA 4PG8A 1O0BA 1LU9A 4X44A 1PTJA 4DR3B 3C4VA 1E8DA 1PGPA 4FOLA 1SKYB 4P93A 4MARA 3HCDA 5CVEA 1LH0A 3TX6A 4CGZA 4WOCA 4EPVA 1BZYA 1NOJA 1IY2A 3BBLA 3DV0A 2XBLA 1B6RA 3EMDA 2NXJA 5F77A 5EQJB 4U7GA 3KC2A 2A9FA 3QF7A 4A27A 2PZAA 4DLRA 2DR3A 5JSKA 5EE5B 1ZIXA 2Q1YA 2ATXA 3NVAA 4QO7A 4ZAVA 3V1TC 3AR3A 4PHHA 2AWOA 3DDZX 2P0EA 1PJCA 1VG8A 1YVEI 2XF8A 3KQSA 5CFRA 3FSGD 3QVUA 3INYA 2X1HA 2YXPX 3JRXA 3NPAA 4QOEA 1QO9A 1Q1AA 3D9QX 3NYQA 3RJ9A 3KOOA 3GJSA 4ZK6A 5EWJB 1QO0D 2YC2C 2IJGX 5FLXA 3DZCA 3KDAA 1IHYA 3QHPA 2OT3B 4EFMA 4R3UC 1A2KC 3D2CA 5JVDF 1Q22A 1U2ZA 4P0QB 4FFBA 4WUTA 5DNEA 1Z5ZA 2A1UB 3PGA1 4KVFA 3IUYA 4O08A 4XJVA 2H1OA 1U8UA 2Q6KA 1NJGA 2GBLA 3QBVA 1TC1A 4IFIA 3V3TA 1GKYA 3H4VA 2VWPA 3B1JA 3GI1A 3JWGA 4JIMA 4PPYA 4K6OA 1PSZA 5J2TA 2VDLB 4IGFA 4JJ8A 1SB8A 1CQIA 3HU2A 4N7RA 3DMRA 4BN5A 1JLLB 1U1CA 3I37X 1DG9A 1PL7A 2IEBA 3IP8A 3NYRA 3QFSA 3STVA 4YT5A 2X42A 3BGDA 3OI7A 4U2EA 3U9TA 2HW8A 3OCVA 3T38A 1NRJB 1Z06A 2GBPA 4EKEA 2BAGA 3M1AA 4EI7A 1BWSA 4LNHA 1ADCA 3LW7A 4G89A 3FPLA 1YL7A 1REQB 4ZU1X 3UUWA 3W7VA 2FPIB 2O2YA 2VLIA 4GLFA 3H9QA 3HA5A 1VL0A 2PAAA 4NCKA 4B3JA 2HBRA 3C8UA 3CKYA 2GBLC 1HBJA 2BM9A 1UXKA 4C4TA 3E5NA 1Y1QA 2ONYA 2IYLD 2N1BA 2IHJA 4PVCA 3EGXB 3NDBB 3MCWA 5GIPE 3QMWA 3GNSA 1XZQA 2GVDC 2NP6A 4KRYA 1LDEA 1N3BA 1RZUA 2YJ4A 3IERA 3IT2A 4TSRA 3VDXA 3RB8A 5K8TA 4DUPA 3B53X 1AGPA 3D6MA 3MT0A 4RC9A 3A2LA 4FFWA 3JQ7A 4XKJA 2JANA 5IBRA 3KVRA 3OEED 2IWHA 4CMGA 3SX0A 2GNOA 4ECAA 4YY3B 4EY7A 3AC0A 1QYCA 1KI9A 1KPGA 2QS9A 3ORSA 5A5VA 1V8DA 2WJVA 2VUSA 5TPWB 4KLNA 4EYKA 3I0MA 2QPLA 2QN7A 3CRMA 3OHMA 4RFSA 4TYPA 1BRMA 2FCAA 1UMCA 3DMYA 3D7NA 1VBFA 3H6KA 3VR5D 3GJXC 3LQKA 2JI9A 3WWPA 1GHTA 1KZ7B 4G0NA 1GCUA 1B7GO 1W4BA 3A4IA 1U90A 1U2RA 1XXHA 4NBNA 1II9A 1NYQA 1RLOA 4XD2A 1F14A 3KSBC 3THYB 2JGNA 1F5SA 5JBQA 3DE5X 2VNJA 4QJIA 5HDBB 2RHJA 2V8OA 2Q3HA 1OQAA 1XMXA 5TQJA 3P4XA 3CPHA 3K4PA 4FGKA 3FHJA 1Z16A 1HSZA 4J0JA 4XB6B 5CT9A 2EQ5A 1TD9A 1LPOA 1NDHA 3IBTA 4LECA 5JDIC 1ODTC 3HH8A 2WVGA 5JCJA 3WWEA 2ZTSA 1QDUA 2AX4A 4CG1A 4EENA 1XVAA 1WA5A 4Y6QA 3NWPA 4L72A 2AC7A 1NW4A 3V8BA 4DCJA 3I9LA 4QUEA 3G1WA 4IH9A 3S99A 3V4FA 1EG2A 3EUFA 3RBXA 1DXHA 1NGSA 3M70A 3D7SA 4ND3A 4AKSA 3BE5A 3IB6A 1G60A 2QV0A 3NVMB 1UBJS 2XDQB 1U02A 2CHUA 3GOQA 4TQUS 1XZ8A 1W1IA 4J49A 4RZQA 2XRYA 3N2NA 4BQIA 3U44A 4JBYA 2CEKA 2JCXA 3IMGA 3NUZA 1Z4KA 3DZBA 4P54A 1I3OA 5FI0B 4YAIA 1RYZA 1UKBA 1YKGA 2DHQA 4A8JC 1EVIA 2C99A 4CLDA 1E5QA 2JFOA 1F4PA 1WU7A 1FFYA 5JFGA 4V2UA 1PR1A 3AM3A 3G3EA 2NADA 4TV8B 3JAKB 4Z8XA 1L4YA 2G4VA 4K9RA 2Y67A 1PW5A 4S1TA 3TRHA 3TEMA 3D4BA 5DLEA 1SA0A 1QHXA 3DW3X 2YOGA 1U0SY 3ORHA 1RWNA 2YNMD 4R9VA 2YH2A 3HCOA 4URFA 5T4HA 1UBOS 4JNKA 3QBDA 4LBYA 1FXWA 5BSTA 5HGXA 4XUCA 1BS2A 3DMPA 2B1QA 5TIIA 3WR5A 1NOKA 1F3LA 1OAKA 2VT7A 4HXYA 1TUBB 4B4UA 5DLDA 2R6AA 2ZYRA 4RF2A 3VKVA 4TKVA 5CTJA 4ZGBA 2YKGA 4BXOB 1R6DA 4AMZA 5H80A 2BP7B 1JHMA 3ZDFA 3OM0A 1FW8A 4EG1A 2HJ9A 3IBGA 2QG9A 3E7WA 2FDRA 4B71A 3PFBA 3UQYS 4EG4A 1FBNA 3HRKA 3E22B 4QYSA 1K88A 1NVWQ 2JHPA 4C6TA 1XNQB 2FWRA 1H2XA 4EKDA 3OLQA 3O95A 2GK6A 4Y9DA 3V00A 1HEIA 2RHOA 1C4WA 3QVGB 4KVGA 4O1HA 5ER9A 3N2GA 4NXNB 2MTBA 4BV8A 2WJ3A 4RGVA 1WE2A 1M8FA 4AZSA 5KX5A 4GGMX 1KYWA 3JQBC 3LV8A 4HUQA 1U9ZA 1VCOA 2YN0A 3A1FA 2JGJA 3KM0A 3HNOA 4AYTA 3DPUA 4F9GA 4MI3A 3E1GA 5CU7A 2PL1A 2PWZA 4BN4A 3KJIA 2RGNC 2GO1A 4G5OA 4KXQA 1GQQA 4M1TA 4NJOA 4N8DA 2E0IA 1B8VA 1AHIA 2QXTA 3MINB 2XHZA 3TTSA 3MJDA 1AMNA 5BMVF 3CRZA 5F64A 1ZHHA 2I5PO 3PEUA 4E11A 5LD2C 3IT0A 4J1TC 3PG5A 5LR6A 5LXTA 1M1UA 3L0ZA 5HBRA 1LDMA 5DP1A 1I7LA 3T95A 2WHPA 2ZI5A 3KQPA 5F7XA 4F1JA 4KQ2A 2YQ4A 5HMLA 5IBQA 4LF4B 1LF5A 4G9GA 1KDRA 5J4VA 4MVCA 1S3GA 1UXJA 3A6EA 3T9EA 2C2OA 1X2EA 1UXHA 1RWVA 4GPIB 3CJTA 3PDCA 3BTUA 3ZCSA 1TVKB 1YKFA 4TS3A 3MJSA 3ESQA 3QXHA 3I6YA 4F0JA 1FRFS 3OFKA 4DLXA 1ZZGA 3KALA 4KUEA 2PKXA 4K9LA 3SC4A 3EWSA 3SFZA 2GWRA 4C7MA 5E6RA 4E08A 1ONPA 4EGCB 1J5PA 1NMXA 2YIDA 3FVTA 1F17A 1RI1A 3QLVA 3L1KA 3K1YA 4Z5XA 3NBXX 3UJ7A 4PHTA 1FVOA 2BBWA 2J46A 4JOQA 2R65A 4DL9A 3A32A 4Z3OA 3TKYA 3ZGOA 1XTRA 2EW2A 4PWYA 4HNTA 4BN0A 4MVJD 3HDQA 5GGXA 2CNWA 2ZSBA 1M75A 2VK8A 3ANYB 2ZBEA 4PSDA 4DCUA 1KQOA 1XWFA 2KHZA 3MGGA 3RI3A 1UK6A 2UUPA 3QXSA 4ZTZB 3TG8A 2O06A 3GRRA 3JALB 2FUKA 4RF4A 3ZD7A 2EG5A 4MW2A 4YXWD 3ABSB 3WY9A 1GN9A 1XELA 4N65A 4GBGA 6ABPA 3H9UA 4LNUA 2FQXA 1IU9A 2GSDA 5ECGC 5LQJA 2OUIA 5FI5A 3OBIA 1Q6ZA 3O94A 3EXEA 4RAQA 2C9YA 4ALMA 1I7NA 4Q66C 3NQ41 4L51A 1BE6A 1TW3A 2QYTA 3BOSA 3FYSA 2N46A 3INNA 4LRUA 1SD1A 4ML3A 3ZDZB 3GELA 3B20A 1EWVA 4B9AA 4EI2A 5M2QA 3GJ5A 4AF7A 5LM3A 2C54A 1YRHA 3L0DA 4G63A 3P9YA 4TMFA 4X90A 3NTOA 4IGKA 2VBGA 3R4VA 4EX7A 5BN4A 4YMGA 5IJ9A 1BXGB 4ZGWA 3T5AA 1OH8A 2J3EA 1XMIA 3T3IA 4C1BA 2HTEA 4DQVA 1K89A 2PMKA 2WJIA 6GPBA 1XD8A 1NG1A 1OD6A 1L4EA 3CZ5A 4Q24A 4R5HA 4X6UA 5ALTA 1GZHB 3N8GA 5K6AA 2D7CA 4PLGA 3IP1A 3QTLA 4XEUA 2M6LA 2C7GA 2H5LA 3LU1A 4I2VA 4OQYA 2WWYA 3NMUF 4RHYA 1RQNA 2QZPA 5JMPA 4KKVA 3RC9A 5KPDA 4B6SA 2JAOA 2FFRA 2JPDA 3C7DB 3W8RA 1LKZA 3LP5A 3MVEA 3OPVA 1I2MA 3B85A 1E9VA 4K5QA 2BMVA 1B74A 1P31A 1UJBA 2DUWA 2QD1A 3ISJA 3M6VA 4R1OA 3TS1A 3TRDA 1C1XB 1IYZA 3K09C 4PIMA 3DAPA 3ZDAA 2ACKA 4EHJA 1E3DA 1UMCB 3R6GA 1YRAA 3L49A 5CAEA 3C87A 2GPWA 2AN3A 1LQ2A 2IHKA 2UUCB 4EG8A 4MO9A 1MG5A 1JVBA 4MAAA 1DTWB 2BD0A 2EATA 3BJIC 4YQYA 4Z9XA 5A6SB 3VVMA 3VZBA 4EY6A 5B6JA 3STTA 4F4HA 1DIOB 3HA3A 2VK4A 5DN6D 3VOBA 1X7XA 3CNBA 4KG7A 2FPKA 4PNHA 3WQRA 2ZAOA 3KVOA 1Z2OX 3MS4A 1MG0A 3FY4A 1BE1A 2PRIA 1MDFA 1X86B 1VL8A 2H6EA 2BFEA 4YGYA 5HIKA 2IPXA 2JAWA 4I1YA 4PC7A 2BI7A 1LBHA 3SXJA 2O3UA 3K1ZA 1MQSA 3PUJA 3CZAA 5HPYB 1ZMXA 4BNUA 3JPYA 3GLGE 3WLKX 3FBWA 2V1UA 3Q9LA 4NU8X 3VJKA 2RGGA 5K0GA 4M6WA 1XK6A 4BFSA 1Q7TA 2DWPA 2YJZA 5CT6A 1LX7A 3WNCA 5CA1F 2EGUA 3K0CC 1GL9B 2WHYA 1G8FA 3MAAC 3E27A 4P9NA 4ZXFA 4UAGA 2HF9A 1RDFA 1MNAA 2BKVA 4NJEB 4G4SP 1TLFA 2Q4BA 4KZKA 3RFUA 1G6HA 1CIVA 1P2GA 2RHGB 3NOVA 4KDCA 1KYYA 2VF4X 1JPUA 4FR5A 1K7YA 4LMAA 4S1NA 4WZAE 5AJTA 4HLDA 1YHZA 2JBAA 5FADA 1J42A 3V8VA 1R5NA 1U2QA 3I3SR 3AY0A 3KZKA 4LZOA 2PIAA 1QGDA 3PRKE 1UC5B 1K5PA 1A1SA 4BFVA 2XX3A 1Q7BA 2R1VB 1EP9A 2WAOA 3BCSA 5BNFA 2DTXA 1PT6A 2WRZA 1PFQA 1V8ZA 3I73A 1GRQA 1SCUA 2RGEA 3C0KA 2WJHA 3R5FA 4HS9A 4IJVA 4IRUB 4OMUA 4QBHA 1CVRA 2BHLA 3TZCA 2WI8A 4BP8A 4OOEA 3LOUA 2WWXA 5DK6A 2ZWAA 3DW1X 4ERXA 3KQKA 1UT8A 2FMKA 1E1CB 1I3MA 3HVIA 4JOSA 5CFZA 2P4QA 3IDZA 3RIGA 4RTPA 5K3OA 3SBXA 4DR4B 3FFWA 3Q3HA 1TVEA 3AHFA 4OG2A 3AFHA 4KOAA 2WTMA 4I1UA 2XWSA 4K46A 3EGIA 1H1DA 3ILHA 3KHTA 4GP7A 3W4IA 5BORA 1FSSA 1Z5VA 3TL3A 3VYTB 3ZZTA 5JD5A 2ZI3A 4RK1A 1DI0A 1XQ1A 1M2OA 1BMQA 2W6CX 4HAIA 1R0LA 2OE2A 1YS7A 4FMCF 8OHMA 5AKKA 2CJXA 2C7QA 3OZEA 4UCFA 3DPIA 4ZHSA 4PPFA 1YI8A 5IK2A 5ICCA 1P9NA 4CDNA 1EDDA 3GA0A 2QB5A 4R9UC 4F91B 5BV2P 1HLDA 3ZWAA 1PJQA 3RV3A 3BHJA 3I45A 2F1IA 3O4GA 3WWCA 3NASA 1U94A 5FB3A 2WA2A 3IGFA 3RFXA 3V4ZA 3NTLA 5DK4A 3ZQKA 5LLTA 2J0EA 1GR1A 1LB1B 3PDIB 3FHTA 3G88A 3T6KA 4GQIA 2C98A 4M2LA 4OMDA 1FJXA 1M2VA 4TWAA 1O54A 3HJTA 4U9IS 4F2GA 5L3VA 4JI7B 3WMGA 4HKTA 2I76A 3LLUA 5ES3A 3SN6A 4H7EA 4NBLA 3RSQA 1N2JA 5I7WA 3K92A 4X61A 5JU6A 1IN7A 3RRBA 3WLJA 4HCJA 3ZDXB 2Z2KA 1Y1TA 1L5HB 1RBZA 3KRTA 1FFGA 4E5NA 2HWUA 4M1QA 1BIFA 3LRTA 2QKYA 3E23A 4MIKA 4ZZ1A 2NSDA 3ZHOA 4B3MB 1DO8A 4N8SA 4WESB 3AL0C 2B35A 3IVXA 2V58A 3JVDA 4Q4JA 3A9TA 3ZY2A 1AV6A 1D2AA 1NF9A 1WDTA 3V1MA 1DFGA 2IEAA 2Q3DA 2FEKA 2XKJE 3G8DA 3KJNA 3WLOA 3P0FA 1W52X 3OD1A 1RP7A 4DNOA 1YD7A 4IHKA 1I4WA 2W48A 3C4QA 3EXFA 3FHOA 3AF1A 4OYHA 3WQSB 1SCIA 1XPJA 3UJPA 2PBLA 4DREA 4B82A 1EP3B 2HHJA 2X4DA 1FFEA 2D2FA 1J99A 5B1YA 3AY7A 4KAAA 4YP0A 3PB3A 4DA7A 3WP1B 5IC6A 3Q40A 3VYSB 2QRJA 1OXXK 2CWDA 3R5SA 5B57C 4KITB 2HL6A 4ID3A 1I2AA 2JZNA 5E3HA 4CM9D 4D57A 5DMHA 4HAXA 1L5LA 1CS4C 4I4IA 1MVLA 4Q4LA 2BFPA 1J0AA 2H17A 4XM1A 4ZT2A 1T2CA 3WWDA 5T4FA 3NHWA 5CLIA 3VTZA 4ZIRA 1BQEA 1OWPA 2F9MA 4B47A 2O8EA 3PNPA 4IJMA 2XODA 1N8KA 1U7ZA 4F8EA 2VQSA 1ZW6A 2PX3A 1EUDA 1QJ4A 1Z28A 4R2IA 4ARZA 3ICWA 3PFGA 3CH4B 1ZRSA 1X80B 3IUSA 4NNOA 4ZANA 5J43A 2G9NA 2HHCA 1JH9A 4WH0A 2JHCA 2XMBA 2YY6A 4DDHA 5C8YA 1N2OA 4KR0A 5E1OA 4BNZA 5BN3B 4BNDA 1Q2UA 4X94A 2N75A 1U7OA 3FPAA 2PUFA 5HQ3A 3K1AA 4A6XA 3V8QA 2R7AA 4C7JA 2A3NA 4JUFA 5HFJA 3CJRA 1V3UA 1OKKA 1DJOA 4BFWA 3N28A 4ZP1A 5KNBH 2H8GA 4RH0A 4Q37A 3PUZA 2QJWA 1Y1PA 2GF2A 2PU5A 3H1PA 1H2FA 1T0BA 1HLPA 1EA5A 1SUDA 2BGMA 1O57A 2GEDA 3HB4X 5EINA 1YRYE 2Y27A 2OGZA 4Q1EA 3M49A 2QLLA 4V1CB 1PP4A 3E5MA 2IYSA 3TUZC 4HEQA 5L3RA 2JNWA 1QNFA 5EKUA 1SMKA 5ITZB 3WAGA 1OXUA 4UCWA 4G0WA 1P4AA 4W8GA 1MAUA 3QKSA 3VPXA 5CD9A 3RYCB 1XA0A 2P7IA 3K0EA 1A7UA 1ZNWA 3FFAA 2AFRA 2ILVA 3FSRA 4LDQA 1WIWA 4R9NA 4LGYA 3DCNA 3RUAA 1E0AA 4D5GA 3VM6A 2XA2A 2B4KA 4OYRA 2P27A 3H4MA 4Z53A 2KE5A 2ZIUB 1XALA 2PD4A 1UJ2A 5HKAA 5I8WA 1XXLA 1RYNA 10MHA 1Q44A 4PCAA 3ZCUA 5HUHA 2WMDA 4FMCB 2JI6A 2C78A 1EBFA 4HAZA 1NTRA 3OOJA 1B2RA 3RVSA 3QNWA 1TFUA 4EB3A 1BYIA 3O8DA 4FYWA 3OM9A 6PFKA 4TL7A 3S29A 2YMPA 5KOHA 1SU7A 3JAWB 5LUAA 1X7HA 2CUZA 1PGQA 3Q0TA 4M22A 3MWLA 4PLPA 1N36B 1TMOA 3QU5A 3NDRA 4JN6B 3ZDQA 4LTNA 3PYLA 3EUWA 2A30A 2TMKA 4WEOA 5IW8A 4AI6A 2YYAA 3FPFA 3EX7C 3FIUA 4UUOA 5F21A 1ZMRA 4EY3A 2CFRA 3ILVA 2V3WA 1JRLA 2OCBA 4MKXA 4PN7A 5HTOA 1KK0A 5SY4A 4JLUA 1U9IC 3CNEA 4BZZA 1OJ7A 4L5IA 4XXHA 4J7AA 3PU6A 1NNSA 2CMKA 5SICE 1J1ZA 3UHJA 2IZ7A 5AVKA 3IPAA 3UJBA 9GPBA 3VJRA 3II6X 1NY5A 4IR7A 1XCMA 3FOFC 1GUFA 1L6RA 3I1IA 4CTMA 2XMRA 5BO5A 1SVMA 2BZGA 2JL1A 3ROXA 3FTNA 13PKA 5KTPA 4P5DA 2R1UA 3BIFA 4UM9D 4V1CI 1P80A 2PS9A 2ODPA 2QVYX 2YQZA 1IJBA 1AQLA 4BO8A 2IS2A 1CZLA 3QU7A 5HKKA 2ECFA 1OTYA 1GIAA 1XRLA 3N7TA 3OVMA 3GJRA 3OJFA 2DWUA 1U3FA 2FLVA 1Z5PA 4JBWA 3W5SA 5CA1B 3LBYA 1N2HA 1NHWA 3I64A 1IXZA 1E7QA 1GFWA 3MQFA 5KUTA 3M83A 3EZ2A 2PD3A 5T8KC 1RTKA 3OE5A 4PAQA 5EE1A 2E55A 5H7XA 1TZKA 3R3XA 2WR8A 2H5IA 4E32A 2IUYA 3BILA 4Z1MD 5JHHB 1N77A 1TAUA 1UXOA 1K3TA 1RXYA 1N9GB 2NV0A 3H5AA 1HTWA 2ZLBA 3CJQA 3NJ8A 4IP0A 1COWA 2WSMA 1PVVA 3DMTC 1PJBA 1SURA 3L1JA 4XWAA 3WFIA 1SOMA 2P9EA 3Q7SA 3AEKA 3S1AB 4BNFA 2J07A 3TD9A 4D9MA 4XIFA 4Q1CA 4BFCA 4JI3B 4BP9A 4COKA 4MHTA 1X3SA 3JVVA 1EJ6A 4RD1A 1EB8A 3AFIA 1XZCA 2XIJA 3IUEA 4DSZA 5BRNA 1KTIA 2WQ6A 4YCDA 1J07A 5LP6F 1E1NA 5ITVA 2PR7A 1W93A 3FYUB 1X38A 1EPUA 1TGVA 5K01A 1I4OA 1ISMA 1RKBA 1TDJA 2VDRB 1E20A 1O0SA 1TEVA 3DGEC 3NWEA 5F1OA 4YV0A 2AG6A 3IUBA 4I9FA 3BORA 5LDGA 3SF8B 1SEVA 1C4XA 4Q19A 4ZMRA 2NU8A 3KPVA 2A94A 5BVGA 1XRPA 3S5JA 3DAHA 1NTOA 2NNLD 3ZK8A 3UV7A 2EERA 3LQFA 2IH5A 1SB9A 1ADBA 3DKIA 3OZAA 1CZKA 1TVCA 3H17A 3X1KA 3RS8A 5TMDA 2IP2A 4ZVSA 4IVRA 1E9SA 1PQUA 1UPTA 2JRLA 2OV6A 3QM1A