2IHZA

Crystal structure of multifunctional sialyltransferase from pasteurella multocida with cmp-3f-neu5ac and alpha-lactose bound
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
388
structure length
379
Chain Sequence
b'MKTITLYLDPASLPALNQLMDFTQNNEDKTHPRIFGLSRFKIPDNIITQYQNIHFVELKDNRPTEALFTILDQYPGNIELNIHLNIAHSVQLIRPILAYRFKHLDRVSIQQLNLYDDGSMEYVDLEKEENKDISAEIKQAEKQLSHYLLTGKIKFDNPTIARYVWQSAFPVKYHFLSTDYFEKAEFLQPLKEYLAENYQKMDWTAYQQLTPEQQAFYLTLVGFNDEVKQSLEVQQAKFIFTGTTTWEGNTDVREYYAQQQLNLLNHFTQAEGDLFIGDHYKIYFKGHPRGGEINDYILNNAKNITNIPANISFEVLMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSALNNPYVKVMRRLGIIDESQVIFWDSLKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-2,3/2,6-sialyltransferase/sialidase
publication title Crystal Structures of Pasteurella multocida Sialyltransferase Complexes with Acceptor and Donor Analogues Reveal Substrate Binding Sites and Catalytic Mechanism.
pubmed doi rcsb
source organism Pasteurella multocida
molecule tags Transferase
total genus 134
structure length 379
sequence length 388
ec nomenclature ec 2.4.99.4: Beta-galactoside alpha-2,3-sialyltransferase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11477 PM0188 Sialyltransferase PMO188
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ihzA01
2II6A 4V3CA 4V39A 2IIQA 4R9VA 4R84A 2C84A 2C83A 4V3BA 4V38A 2IY8A 4R83A 3S44A 2IY7A 2IHZA 2IIBA 2IHJA 4V2UA 2IHKA 2EX1A 2ILVA 2Z4TA 2EX0A 2ZWIA
chains in the Genus database with same CATH superfamily
5DTEA 3N8GA 3H1EA 2PX2A 3CEAA 2G76A 2PL3A 1KC3A 1NLMA 4UBNA 2IDMA 3KT3A 4BFWA 4HSGA 2JRLA 1XD2A 4XI9A 3VI3B 5C53B 3JQ7A 1NQOA 3I39X 4OXYA 2VHEA 4B6FA 5LXTF 5IVHA 1UDBA 3I32A 1NJFA 3EGOA 3HA2A 4B3BA 4CTNA 1A0OA 1K5PA 4D6XA 4W7IA 3QH4A 4NK5A 3AB8A 2AC2A 1GU7A 2JGDA 3LKZA 4JP5A 2XYPA 3IDOA 3IDSA 4MAMA 1QNFA 1OV4A 3PNOA 4MRRA 1YB5A 4CV3A 4NCAA 1KL7A 4JUAA 1UIMA 1MC1A 2JGKA 3AMVA 3PL1A 1JTFA 2WUEA 2OAEA 3VO8A 4D45A 1FVFA 1JQLB 1J97A 2WTNA 1UZUA 3NATA 3P9PA 3RG8A 3DDHA 3D0RA 1BJRE 2GSWA 1XDGA 4JLOA 5D3ZA 1ZHFA 3D3WA 1YU9A 13PKA 3IUQA 4B09A 3KEGA 1UP7A 2HBRA 2VAPA 2WSMA 5U4QA 4BZWA 4AP9A 1MA0A 4AY4A 1KS2A 4NJMA 1IXKA 4I1OA 1CY6A 3W5UA 4D9JA 3FCCA 1U7HA 3RK0A 4FHEA 3WIDA 1E1DA 3DOFA 1DC5A 4C9BA 1VL6A 3LHSA 3GFBA 2B83A 4N5NA 4RK0A 5AVYA 1RHMA 3VR0A 1AGPA 3CSDA 3I2KA 1YS6A 3CGWA 4LHZA 2V74B 2ZAGA 2B1IA 2WHYA 5AVQA 3D7NA 2FZWA 1Z3CA 2BI4A 2NNWB 1H69A 1PBTA 3NOXA 3P2OA 4LRSB 4RABA 4WLEA 3PX3A 2ZYSA 4BJ3A 4A8HA 2VNKA 5BMVB 2JIOA 5BW5A 1GPJA 1ULHA 3O3MB 1K6XA 5BRAA 4WKGA 3ZW8A 4NH0A 3PQ3A 1QP8A 1FDUA 4LDNA 2JEYA 4D0GA 1QZTA 1DVRA 2P9GA 4MTLA 4RK7A 1P9RA 4HADA 3H9BA 3T35A 3NQ41 5IAOA 5HRAA 1QOQB 4ZOLF 2CB0A 1KGDA 4KXNA 1RI4A 2SBTA 2Z58A 2WJ4A 2YWFA 3VNUA 1JL3A 4EABA 4NJEB 3UJNA 3H1PA 4ALJA 4B80A 2XBLA 1JQ5A 3T7TA 2ZETA 3T7RA 1RYMA 3UVEA 1XQ1A 4D7AA 5FBKA 4H4DA 3QXXA 2P78A 1FNMA 2ACKA 3NIBA 1QKJA 3TOVA 4HHEA 1T9BA 2O20A 1O87A 1T13A 1FQKA 2V7VA 1U8TA 5K3SA 1GT91 4MGYR 5AVRA 5CX1A 1T6NA 4HRYA 5JUWA 2ZR0A 4CTKA 3TGLA 4MGKR 4QELA 3RS5A 2I29A 3GK3A 1T8UA 1TIBA 2J9FA 2BGMA 3GFPA 5MF6A 3NNDA 3OT1A 4KMMA 3K0CC 4FDAA 4R6XA 3L9XA 5HFNA 3NETA 4Z7QB 3VPSA 3SAJA 3MFYA 1WXDA 1VFPA 1PFKA 3RVSA 5IXJA 2WWVD 2QRZA 1LPPA 4HO1X 4RHXA 4B4DA 3AHJA 4DAOA 5B58C 3SVTA 2FPPA 3TF5A 4Y9RA 1GQSA 2C4VA 4K6OA 3NGXA 4J8PA 2YRXA 4ALLA 1DKQA 3PXXA 3F6YA 1JILA 1G4UR 5C31A 1SXPA 1ENOA 3K53A 2GVZC 1C7ZA 4N40A 3TECE 2A5GA 4NCXA 1HTWA 2CKMA 3UK0A 5TLSA 1W35A 3W6ZA 1DQNA 2CDAA 4MR9A 3T7DA 4YQFA 5ITZA 4FT2A 1J1UA 3LK7A 1W8IA 4D4LA 4MUJA 1LGYA 2XUFA 2ERXA 1RYEA 2R1VA 3NASA 3PFIA 4QX6A 4UE6A 4IG9A 5HUQA 2ZROA 3E1GA 3QHPA 4RJIA 2GPJA 4EENA 1T3ZA 4O5OA 2BUAA 3IR5A 2EU8A 4YDSA 4DWOA 2V4UA 3F8SA 1M66A 2I7DA 1LW6E 1TCBA 3C8UA 5CNIA 2XADA 1BFDA 3NYIA 5DN6A 3BREA 2Z0MA 3ANSA 3OEHD 4CLDA 2HD4A 2HA4A 2IX3A 3ZK8A 1G98A 1ZN9A 4R1LA 5REQA 5HYVA 2ZI5A 3GVXA 1FA9A 3T1TA 1M72A 4RHFA 1YFLA 4FHCA 3SLRA 1IM8A 2Q6IA 1AG9A 3Q98A 2ILTA 1UPCA 3AFMA 3OT4A 3QBTA 3EXG1 3HP7A 1Z4NA 1FUYB 4NU5A 1SO8A 1S4QA 1RJEA 2GPBA 2HMUA 1G63A 1VZ3A 3LQYA 4IQ0A 4QDZA 1YVRA 5F1YA 2WU4A 1WZIA 3IKLA 4L15A 4B3CA 4NMWA 3G2JA 1ACJA 4BKUA 4JLPA 2NU7A 3WDMA 4RVSA 4RK4A 1QWSA 2PQ6A 4JJ4A 3AXSA 1JG6A 4RIFA 4QFMA 3IPYA 3TCXB 3HKEB 5EJ5A 1JVNA 1AGYA 2FW1A 3PLNA 2GEVA 5DDIP 4AZSA 1GKYA 1PWYE 2QS9A 2X15A 3L0CA 3GIWA 2IYRA 3IJEB 4X84A 2YKGA 2VDVE 5J2UB 1JHQA 5K3FB 1XHFA 4ZCPA 3WFIA 3AYXB 1BU5A 1E2MA 2Q2QA 3KXIA 4DLLA 3U7QB 1IOVA 3QVVA 4E07A 1Q0UA 4BZPA 4FW8A 2C94A 2D2VA 5DX8A 5A3QA 2GBIA 2XVAA 5E6SA 4EO4A 2JA1A 4OXNA 3MWDB 4L0CA 3FJOA 2EW1A 3I62A 4D4IA 3MB8A 3KR2A 4BU1A 4YMIA 1P6QA 2EW8A 2VSOA 1IDN1 1N1MA 1Q44A 5DBHX 4F2HA 3J7AC 1T2DA 4O29A 5BQFA 4DB2A 1ZA2A 4GMDA 2RBGA 3LM8A 5EWMB 4MW4A 5AJHA 5A05A 2IEBA 2BFNA 1EGAA 1D2CA 1LBTA 1OX6A 5DTIA 3SX2A 3DOEA 1JHXA 1P80A 2OUIA 2QRGA 1CUEA 1HDOA 3TW4A 3IPXA 1VB3A 5DW3A 4ZKEA 5TY0A 4ATNA 4AZVA 1MLDA 2AN5A 4K9QA 4EPRA 2X8BA 3Q3VA 4OHXA 2PS0A 4JENA 1VA5A 2ZRCA 3DW1X 3KUCA 3HCWA 1M2VB 2NSHA 1Z6QA 3TE7A 2O57A 2VBCA 1H4QA 1TADA 1QP4A 2C2GA 2Z5LA 3DMYA 3AR7A 1Y9DA 2OBFA 1N6IA 2NSYA 3ESQA 3K73O 3LYHA 2IYQA 2PH3A 1A95A 3FLBA 4OQLA 5D87A 1OXBB 3LQ1A 1UBHS 2HPZA 3H2SA 4KN9S 1IULA 1Q6ZA 5G4KA 3WMFA 2WA2A 2EHDA 3JQEA 3KUUA 4H3SA 2HA0A 1X1DA 4ZYLA 2RHTA 3IIMA 2UZ3A 2E1PA 2JHGA 2O14A 2YXLA 3DOHA 3OTGA 4NBRA 4L3OA 3SE0A 1ZUNA 4M55A 1UBRS 3K70C 1N7HA 4UFNA 1DG9A 3UJCA 3AV3A 2PS9A 1R74A 2W6ZA 3ZXXA 2A9RA 3HUFA 1KU6A 1X7ZB 2NN3C 4BX3A 4GIBA 4K9SA 3AJRA 5FWDA 3CPHA 1N5OX 5FORA 4LTNA 1VIDA 4NYMR 2Z9CA 1OX4A 1ULZA 3G5MA 4PPGA 4ZKDA 5IKEA 4B7CA 4HYYA 4UPVA 1WDWB 3MJDA 2XQFA 3ESDA 4JC4A 3UXHA 1E1KA 1RIFA 1W4AA 3QBDA 4DLVA 4MI6A 1ZOLA 3F4LA 4RPLA 1AN9A 3D5QA 1Q7EA 4II7A 1U9CA 2ZYUX 2ZZMA 1IVNA 1OKKA 2I71A 1BFUA 1NWHA 3LY5A 5A5VA 2X9NA 2ZSJA 5F12A 3KDAA 4QOSA 1J06A 1I13A 5IM4A 2F9FA 2PUWA 3L7JA 3REGA 3V7UA 5KYUB 1D04A 4FEYA 3MCAA 7ABPA 2FFJA 1A7UA 3BSSA 4UU0A 1C8LA 1GGHA 1CVLA 1FTGA 1QH9A 4TVKA 4GPTA 2JJMA 4TRNA 1OBFO 4YRQA 4AFNA 5AK5A 3ROTA 3O8OA 2ZAIA 4F91B 4YN3A 4K0KB 2ZYTX 3IDZA 3WLRA 3MWYW 3BK1A 3UXYA 4NH4A 1COWD 2CYAA 2VJMA 4MDFA 1ODTC 4GSYA 5EZYA 2EKQA 1FFWA 3UMRA 4IQGA 4TRJA 2ZXEA 3HJRA 1TE2A 4I5DA 5H7XA 4TWJA 1BKDR 3R76A 3H1AA 2BKUA 1Y1SA 1XYGA 4R8VA 3AUUA 5KUTA 2PAAA 4ZJZA 2I6FA 3SJUA 1RJGA 3HUUA 3FE2A 4G24A 4IGIA 3AYZB 2VSNA 4BVGA 1WW2A 1W2WB 1HT2E 1Q57A 2CKDA 4HTFB 4ZU1X 3UTCA 4CMIA 1IY9A 3I34X 2ANCA 2POCA 1TGVA 3BXEA 4OHZA 4F4FA 1AA9A 2VR1A 3B7PA 4G8DA 3K9HA 2WU1A 2BE9A 4PRYA 1Z33A 4INOA 4RPHA 4BO0A 5IUNC 1PW7A 5KNBA 2HYIC 2FDCA 4DNOA 2VJCA 4B73A 4DRZA 1NUPA 1TVKB 1EK0A 3M49A 4FONA 1JKMA 2J9XB 2QUIA 3EC1A 3K2BA 3QENA 3VPHA 3ZLJA 5EKXA 1V47A 2JLSA 1B2LA 3U7EB 3H5NA 2YL2A 5LQMA 1SXJB 2OK7A 3G8BA 4OYYA 4QUGA 1JLLB 3NFYA 1GPH1 2P65A 3T9FA 5AO9A 4D8WA 4X65B 3KAPA 4JB3A 4KKVA 3ZUGA 2BFCA 4K28A 1ZINA 3M6VA 2PTGA 1P81A 3ELDA 3NM5A 4A03A 1OWPA 4GKVA 1DIOB 1DTWB 2PJRA 4JNCA 4MV8A 1W5FA 2W6IA 1FFXA 3SHFA 3LOQA 1QV9A 3UK6A 1K8ZB 3OOJA 4DRYA 1TNDA 2O9JA 3AVQA 4PVDA 4KGZA 4YMGA 1LRLA 3ZY4A 4IGFA 2XWPA 1MGOA 1ZM4A 1MO6A 3OLCX 5C2JB 3ZLBA 4CM3A 4QVIA 4IGKA 3TLGA 4R1NA 1BE0A 1EVEA 4TMXA 2PLAA 3WBBA 5JRZA 3OI7A 9MHTA 3RIGA 2CJPA 3I4FA 5ILOA 1N8SA 2XECA 3VH3A 3JQAA 5ES4B 4DXDA 4E3ZA 2GGSA 3G8DA 1Y1TA 1NDHA 4RWZA 1X74A 3TR0A 1ISMA 1EAMA 3E8MA 4DQKA 3ADCA 4CL8A 1L3BA 4AUEA 1SBIA 2GJKA 1EWQA 1U5CA 2FTKE 2PMWB 3JWJA 4DSTA 3GDWA 5F2OA 4RY8A 1U3GA 4UFPA 3PPXA 5KJ1A 1GFWA 2XB8A 2X5XA 4JP8A 3UBMA 1CRWG 2Y05A 3SIWA 2AZTA 3RU3A 4GKAA 1G8PA 2QENA 1LPOA 3FBTA 1R6VA 1RPZA 1M6WA 4IG4A 1DX6A 2MINA 4RL6A 3THWB 4Q1VA 5BQ3A 2HRBA 2K5UA 4GZMA 5DYNA 4YQZA 4OYRA 4F45A 1GT6A 2EARA 1P1FA 1JDSA 3CMCO 3ORFA 3Q9UA 4O2AA 4YDHB 1M8GA 2FPIA 2ZJ8A 3EE6A 4FXPA 4HUJA 4YUVA 4M7OA 1F17A 3C5VA 4B3GA 2F55A 3EIFA 2JH3A 2K7ZA 1RJ9A 1WMBA 2Z09A 1PJ8A 2D2XA 4GPZA 2QBYA 1YBVA 4KBFA 1LNZA 5J47A 4RHTA 2DVMA 3A3PA 1ID8A 1IATA 1EK1A 1I0IA 2HK6A 3F7TA 4IV5A 3W3AH 3ZX4A 1CZRA 3S1SA 3W4IA 4GPEA 3B5EA 2XCRB 1XP5A 3DVAA 4RETA 2BT4A 4MWCA 1CWUA 2C4NA 3BZBA 2QUBA 4JGIA 4M9RA 1Z0AA 2W2OA 4G4SO 5KOYA 1Q74A 2ASVA 3UM9A 2AJ8A 2IUFA 1WHTA 1QGOA 3EWAA 4UBJA 4US0R 1UUFA 4PINA 4FHGA 4BLWA 5KHLB 4ARCA 3N8NA 1WCIB 1XJCA 2A0WA 3IC5A 4RKRA 4AJHA 1XO1A 5LA6F 1GPLA 4H16A 1M6EX 1PIWA 4M37A 2RC5A 1JJVA 2MSCB 2ZJYA 1ARZA 1VE1A 3AKEA 2JIQA 4BC1A 4CLEA 3L49A 1E2BA 2H59A 4AXBA 4EUNA 1X8XA 2YJTD 3GGGA 3VU8A 3EQ9A 2O8DB 1V45E 4KQJA 2AC7A 5FTWA 2YV4A 3KYCA 2ZATA 1ORVA 3JYQA 3L1HA 2PRYA 4YVFA 3BK2A 3EMDA 2W2VA 1NXVA 4I7EA 3SQDA 1TZKA 3SIXA 4MCHA 4CKBB 2QL9A 3M6LA 1UKAA 4TSKA 4HNQA 1V95A 4TV9A 1JWAB 3QWBA 2HU5A 4B47A 1ZCAA 1SCKA 4OQXA 4C08A 3RRNA 1U0FA 3NDJA 3IHTA 4K9PA 5KDLA 1L5RA 3EGCA 4PQGA 4KOEC 3ZNQA 4ZOEA 1P5FA 3GQBA 4UTPA 1D09A 2XVYA 4JQCA 2P1DA 3QE4A 4UMFA 4X90A 3NRCA 5JXHA 1CP2A 2ZSBA 1TTHA 1N7JA 2DZDA 4HUQB 4DCMA 3AM1A 1VSVA 3I9V1 4Q21A 5CBPB 1DFIA 4JKYA 4TTRA 5L7YA 1NNLA 2HT1A 1QYRA 1JIJA 2YNMC 4GL4A 3WMRA 2O3QA 1ZMXA 1AO0A 4BRWA 4ZQHA 3CX6A 3E8XA 1GCAA 1B0AA 2GM5A 4JLMA 4LGMA 4ZXFA 3OIVA 3QE3A 5BNIA 2YCBA 3FI9A 1W19A 4HMQA 2YCLA 4YJ3A 3ZGXA 4C43A 3RW9A 2PZMA 3D2AA 3F3KA 1D6JA 1G21E 5GJWC 1QIDA 3HY3A 3ID6C 5B3JC 1Z28A 3H9EO 4CEHA 1DEOA 3JTEA 3M83A 5DO9A 1X0XA 3IP1A 2BL4A 4PLGA 1I7DA 4D80A 1D9XA 1PZXA 4M7PA 4LX0A 5FWXB 3DXXA 3BQMB 3PNKA 4QICA 2IE8A 4RHUA 1GL7A 2MSKA 2QAIA 1P75A 4JJFA 4P4SB 4NU0A 4YLYA 4AK9A 2VK8A 3ND9A 1PG0A 3SR0A 2NAFA 3I9KA 2DERA 3WP1B 5KYYA 1RI1A 1EFTA 1EQ2A 2PX8A 3PU6A 1WB9A 4N18A 1GNPA 4PHCA 1NXTA 2ZYRA 3FVTA 3QBVA 1BD3A 4RADA 5EL0A 1XRPA 1JKFA 5B57C 5DWVA 1KHHA 3VDMA 4NU6A 1X7HA 2AG5A 1Y1LA 1P3Y1 4R8KA 5JQGF 3A2NA 3TBKA 2R6CA 1FFAA 2GN6A 3GC6A 4YONB 3T5GA 1CJMA 1KQ3A 2R5NA 2VYNA 3H5TA 2NTNA 3VPFA 3E7PA 3VO9A 4C07A 3E9CA 1HL7A 3B6IA 1WUKS 1XJWA 1ZICA 4P5EA 5BW6B 3CVWA 1MAUA 4B8WA 4ZOQI 2NYUA 5U4XA 1KI6A 4CRWB 3GELA 4GC9A 4ZK6A 1HH4A 3L41A 3OCZA 5ALMA 1XRLA 2JIZD 3H1FA 1UC9A 1OI2A 2D1RA 4RF5A 3JVIA 4ZEMA 1YB7A 1PNRA 3SEQA 3COPA 2SHKA 3W78A 1LNQA 1VCMA 2R8YA 4V0SA 1JWLA 1BIFA 1V1MA 2GVNA 5CG1A 4BEBA 3EVAA 3K72B 5DRYA 3GDFA 4KE7A 3I42A 5BORA 2EYUA 4J0HA 3Q2OA 3ZCSA 5ED4A 4QAQA 5D1NA 3RAJA 4HVCA 2V7EA 5JSYA 1FFEA 3JATA 3NOVA 2N0SA 2IV3A 4PHTA 3WSTA 1OI4A 2R0QC 4L16A 4KR9A 4F3RA 4M8KA 5E1MA 1LSUA 4CM5A 4ME6A 2WWRA 1QSGA 3DKIA 4IR7A 4P1ZA 4L02A 3SC6A 1FMTA 3QEOA 2Z3WA 3IOCA 2HPVA 1T9KA 2Q3LA 4C2TA 5ALSA 5I7SA 4AY2A 1NNI1 1RP7A 5JPCA 3V2GA 4OA5A 1YZFA 4WJLA 5IEJA 5BPHA 3C7CB 2CZCA 2IPXA 4N7BA 1Q3KA 1YE8A 3T3EA 3NOQA 1GAJA 3F6EX 1WXXA 1VMKA 2CXXA 4FK8A 3K9WA 5HDBB 5CA0B 1W5EA 2XODA 3WV5A 2GMWA 5ESRA 3FKSD 1E6KA 2IYOA 3NHJA 1AKNA 4GZ5A 5DNVA 4ZN6A 3Q3CA 2PT5A 3FGPA 2WYVA 3AUXA 3AB7A 2QZSA 4ZZ2A 4F0JA 4I14A 5LN1A 1UK7A 2ZRPA 4Y1GA 5DSZA 3IIJA 4W1QA 2FWRA 3CF0A 1S89A 3EA0A 4QBFA 5SZIA 5JG7A 2I2XB 4JP2A 1YI0A 4KLNA 4CM4B 5EZ6B 4DKJA 2WRZA 4JB8A 1QORA 1CUGA 4C0LA 2EKBA 5H81A 5LMCA 4MP8A 4DYHA 5KC9A 4N8SA 4F4CA 4FYPA 4BBZA 2O0MA 3S99A 5H8WA 1FP1D 4QXAA 1Z0IA 3AVPA 2JHFA 3NP7A 1KDOA 1ND6A 1SU7A 4TMZA 4XYEA 3ZHVA 2VO1A 3WGYA 1SVNA 2JA2A 5I45A 2FGJA 3KU4A 1KYYA 1ZKMA 4XSHA 1XR3A 1OMOA 4UBLA 1U0RA 2XIJA 5TF0A 3ROFA 1NG1A 3PWSA 5KQPA 1XRQA 1RYBA 2GZSA 2F4VB 4TV8B 5T64A 3T7IA 1NAIA 4DN6A 5BSHA 1PJLA 5FV4A 2QG4A 2QAGC 4QNRA 3CUTA 4Q1EA 2P0YA 5EG5A 4LZWA 4RCVA 3RAGA 1TVEA 6Q21A 3QQPA 3AQIA 4QU5A 5EUCA 1K06A 1IVSA 3FDJA 1XD2B 1LI7A 3GEPA 3JQ7B 2VJQA 2O7VA 2WA1A 3ILXA 3JD1A 5H5JA 1CP3A 1YDEA 1JHPA 3H75A 2RC6A 2RHJA 3CVOA 4UE2A 4DKXA 1IFXA 1UMCA 3TRJA 3FDXA 1LNSA 1OLSB 3B8EA 3LC7O 3KUXA 1TMKA 4LKOA 1N33B 1T3GA 3C3CA 4IEIA 1NPTO 3WRXA 3CLSD 4MCAA 4OXIA 2QX6A 2VG8A 4S1OA 4Z2YA 1T5LA 1OU0A 3LC2O 4CYMA 4NNJA 3FHCB 2PBLA 5LVAA 4ZYVA 1FJGB 2IV2X 5FBHA 4BEWA 1LZLA 1EH5A 1KEEB 3W2IA 3Q40A 4EARA 2CV0A 3LBHA 2J3MA 3PHGA 4L3WA 3NC0C 5K8UA 4MUYA 4A0FA 1ACLA 3AEXA 3QVUA 4QODA 2MTBA 1BX1A 2X22A 3R8FA 4K8OA 3BKXA 3P9YA 5FX2A 2R1TB 3FNEA 4Z0NA 4C78A 3QY0A 1QLJA 1N8KA 1SZJG 4QUHA 1H2YA 1NVVQ 3RTAA 3F7MA 3A6JA 4JCOA 4K6GA 3ICEA 4GDMA 5FOSA 3LUPA 5D6OA 1PLJA 3K2EA 3QUTA 3IR6A 3UPTA 5AVSA 2V4MA 3EGIA 3RPEA 5J4LA 4RNCA 3HYNA 2V65A 2PT7A 5DK4A 5BWCA 5K0JA 3LSTA 4HB0A 4MUMA 1SXJC 4L8WB 3IGFA 3VUEA 1XN1A 4RJTA 2YN0A 1B4DA 2VDPB 4UNPA 2ZB8A 4MB2A 1SC9A 1H05A 2QM7A 1QLHA 3ZI0A 1DXHA 3PNSA 4XVUA 4ZC1A 2GEUA 4Y9SA 3Q7IA 4S1PA 4BKQA 1F8XA 1M9NA 1SOVA 1XEWY 4JMPA 2FF7A 1ESMA 2R751 3VHLB 4HV4A 1N2IA 4DMRA 2VA8A 1FLAA 2QX9A 3IPCA 4NG5A 3K1AB 5KNLA 3AZQA 4PU0A 5TJHA 4DNXA 3O7MA 5L45A 4MI9A 4PX2A 4AO6A 4BQEA 3TOXA 2PRJA 4RX1A 2PSDA 5B5SA 5HIIA 2IZZA 3M6MD 2E5LB 1JAHA 1JPJA 3AI7A 3I6ZA 4P6VF 2HMWA 1FP2A 2IYPA 4JUBA 3DO6A 2YZ2A 4RQTA 1OTXA 2HJRA 3EGEA 4TTJA 2CYBA 5BN1A 5K01A 1X38A 5HKKD 3FWZA 1FQOA 5TGDA 3BFPA 5JH7F 1FYWA 3A10A 1CY8A 1S2IA 2BZSA 2DR3A 5TPZA 1HDGO 2LXNA 2PUTA 3M5WA 1E5VA 2WHPA 3OT1B 4ZI3A 1C8KA 1JEJA 4IILA 4II2A 3WQBA 3UG6A 4IIJA 3T1NA 3DB1A 5F3WB 1O6BA 1ZGBA 4XB2A 3NVDA 5KU1A 3L01A 2FPPB 1NNSA 1SFRA 4MO2A 4BB6A 4HNUA 1FW6A 3TD9A 4JUFA 4LXTA 5CIQA 3KQUA 1ZXBA 1IIBA 1Y4AE 3G0IA 3ZWOA 4CF4A 4Z7JA 1SXHA 2FSSA 2GD1O 1OT5A 4BNZA 5IT9A 4DZZA 4U00A 4AN0A 3DLBA 1QG4A 3B82A 1F06A 1Z2OX 2BMDA 5KQGA 2JLYA 1AKMA 2GXUA 3A4TA 4JC5A 5DTJA 3W2TA 1N2JA 1CFZA 2R1VB 3EC7A 3SF0A 3RUDA 1LDEA 1ORWA 2F48A 4O4JF 1FU4A 3GJ4A 4PX5A 2JCGA 1MZVA 1JH8A 4AU1A 4DDTA 2B9VA 3ZU4A 1MHPA 2CMGA 4REOA 3TM5A 4YMVA 2KX7A 2BYTA 3TL3A 4HATA 1LF5A 3A0RB 3AGPA 3OF3A 4LI3X 4O33A 1G19A 4KQ9A 1X2EA 2HGSA 1BHO1 2VTDA 2XUOA 2G1AA 1FNSA 1VE5A 5REQB 1OFVA 4CKZA 5CCEA 4L22A 1Z5VA 5IAEA 1HSOA 2H2DA 1DUSA 2RGCA 1SQFA 3B1YA 1JLSA 3PJRA 4I4TA 1DP4A 5EIWA 4DYDA 5CITA 4BP8A 1VI2A 1NOJA 4WXRA 4XWAA 4P22A 3HB4X 2A9KA 4JXJA 4CUZA 4DS3A 4MV7A 3T3MB 2JRCA 3E2PA 4JSRA 1E61A 1WXQA 4ER6A 1E77A 1JZSA 1QQBA 1X15A 4UCQA 3BE5A 3WIUA 1SULA 1A9ZA 1H2AS 3QWIA 1YZ3A 4GP6A 1LRJA 1Q1ZA 4TT3A 1F0NA 2NU7B 3B1ZA 2C59A 4MJXA 1GTL1 1Y3FE 1TXGA 1Z06A 2D5BA 3JYHA 3SYRA 4A2PA 4F96A 2GTIA 3NEYA 3U3JA 3RJZA 4FFOA 4Q7KA 1H2WA 1RBMA 1U2TA 3QVGA 3TSAA 2H00A 3KFLA 5KNDD 4BVJA 3T4XA 2H57A 2XUHA 4FE7A 4BIMA 1LSOA 3ORHA 2HNAA 2V5UA 2IBSA 4FR5A 1JJAA 2PT6A 3NM6B 5CRIA 3WY9A 3LXRA 4M9QA 5K0SA 2XNKA 1LC3A 3L7OA 4WFIA 3K35A 4IHQA 1VIAA 5H3LA 3ETLA 2AN1A 1MENA 3AVVA 3W7BA 4EHFA 1CS0B 2JFXA 2XAAA 2CJWB 4KJXA 4CMEC 4ARBA 3MTJA 4YBRA 1HE2A 1VPLA 3LPAA 4XM0A 2ODBA 3FTCA 2AR9A 2OHVA 3LLCA 2PX6A 1SKUA 2AS0A 1GIAA 2CEAA 4RELA 2E5WA 4G1UC 3RTGA 5H3HA 1TJ3A 4O59O 4OHRA 2YJ3A 3T4PA 1P4AA 3I6IA 3D3EA 1X7GA 3WAJA 2Y0DA 2F3SA 4JIMA 4LCEA 1Z63A 1WABA 4CF6A 3BWBA 4QOIA 2WKRA 5LDGA 2ZIEA 2JAHA 3UGQA 3Q5DA 4JI0B 1VRWA 3O91A 1ESZA 1PJRA 1HV8A 1P9WA 1QMPA 3M34A 1P2DA 5C35A 2C3OA 5LMZA 2R96A 4ARVA 1AV6A 2AG1A 1YQQA 1K4KA 2P9YA 2YV2A 5LKRA 2VP6A 1S1CA 3D8RA 4IZOA 4LY0A 4UVIA 4UTZA 3OUZA 3QTTA 3CPSA 4AX4A 5LYJB 3ZD6A 3EXIA 1L3IA 1XVUA 3HVHA 1MHTA 5D00A 3VHXB 3CXRA 4XPIB 4C3OB 3ETHA 2QM8A 3MTDA 1XTVA 4MVXA 4IMRA 2Z04A 1YRHA 4BZZA 2P7IA 2WAYA 2H9IA 2YS7A 1K0UA 1PQPA 2C9BA 1ZUNB 2O4CA 3I5YA 3VTZA 1T1SA 1R0CA 1G55A 3DLIA 2QM0A 3ZXYA 4QBHA 3LJKA 2Z9DA 4PG7A 2YIJA 4DVGA 1QGDA 4NZNA 3U1VA 5JDCC 2BZGA 2JCVA 5GP1A 4H4CA 4TMVA 4X6LA 2V9CA 1QDLB 1UDCA 2HCTA 2VH2A 4S1TA 1V6SA 1K3TA 1L7NA 1NAHA 1RRVA 4M99A 4MWTA 4DCSA 3X1KA 1N5LA 1MNQA 2DAPA 1Z7BA 3FHJA 3G2QA 3N2NA 2GEJA 4EG4A 2DTEA 3O2SB 3FWPA 1OUMA 1EMDA 1JQJC 4MW9A 3ZZMA 3RG2A 4IFIA 3KQKA 2BONA 2HCBA 2QLBA 3WNZA 2IITA 1T29A 3VKFA 3RDPA 4FZVA 1N4DA 4MQEA 4V3CA 2IIQA 3RH0A 5DNAA 5JVDF 4YP1A 2D5IA 1NLUA 2ONYA 5GONF 4EYOA 1FX0B 4B6JA 1RXVA 3MRTA 3IFSA 1X7XA 4GW3A 1I6MA 4MVJP 1LCIA 4QOFA 4DLAA 1O0CA 2FVXA 1ENPA 2YHUA 3OJEA 4QYIB 3AEQA 3JWPA 3HLYA 5GM1A 2IXBA 2C1XA 2PJUA 4E5SA 4BQFA 2X3UA 5TMPA 3BIXA 1TK2A 3C3XA 2WJZB 3ESXA 5CLGA 2NIPA 1S3IA 4MLZA 5A3SA 4M98A 4QJ3A 1GKLA 3ENQA 3FMGA 3ZHUA 2AI2A 1FL9A 4WGFA 1JDZA 4FNAA 2G0TA 2TSYB 5HF9A 3VVBA 2FE4A 1UKEA 3B5JA 2JGMA 1PHPA 1OV6A 3EQ2A 3TCKA 1AT1A 1Z39A 4RIIA 3ZW7A 4ER7A 3P9CA 3LCUA 1UBTS 4OSEA 5IF9A 4W5RA 3DXYA 3HJTA 4KN6A 1XOIA 2J0SA 4GL2A 1WLSA 5DNEA 2V59A 3ICVA 4OYLA 1GUAA 1V5FA 4GXTA 1O54A 2PXAA 3KTAA 2ZR9A 3Q0IA 5F3DA 3IPRA 1SOAA 2WSBA 1VE9A 3JZMA 3F9IA 3VPGA 3R6DA 3UK1A 3MWKA 4XA8A 2LTAA 3ZHBA 1JB1A 1GRRA 4I9HA 4G41A 4U9UA 4UPEA 4P81A 1XK7A 4OBBA 1EUCA 1X3LA 1SELA 2RHDA 5AM3A 3BUSA 2VTVA 3G2HA 4ZQGA 1H1LB 4MIYA 3K8ZA 3F6RA 3C14C 1E58A 5LMUB 2IYSA 3KHTA 1QLWA 3PT5A 2BFCB 1E9BA 3NHSA 1FNCA 2VKTA 4FCVA 5LL6P 4EBFA 5BN4B 4LEIA 1FFXB 2BOVA 1G17A 3GQVA 1ZUIA 2R44A 2XDQA 4PYNA 5HIJA 4FW9A 3GLHB 4Q7QA 5I3ZA 3H5AA 1CFJA 3CLVA 3PPIA 5ADHA 3NPAA 3RVNA 3ZZ1A 2HIAA 1US8A 4L6CA 5D85A 1QGED 3PIDA 5F23A 3GJ7A 1UBEA 1Z5WA 1SC3A 5DULA 1TUBB 3K0FA 2X8WA 1KIFA 4MUAA 3SN6A 1PX2A 3NTXA 4PLVA 1YMVA 1P6XA 2P8SA 4WDQA 3W6NA 4E6EA 1GTRA 1TIKA 4H1HA 4IS2A 1KE2A 1E66A 4F2DA 3LW8A 2HL6A 3CVXA 1SIWA 1SKQA 4KWIA 4ES6A 5LPNA 5JQWA 1HSZA 3GEBA 1KSHA 3NYWA 3BX1A 5BSGA 1KJIA 1N2OA 1AXEA 4KQ1A 4KQIA 4KQHA 4EELA 1S5PA 4DABA 1GZ4A 2X5OA 1D1PA 4PSDA 1WULS 2QTZA 2WAMA 5K0FA 3VJRA 2PVCA 4OP2A 3Q8KA 3QWFA 3Q7TA 4FD2A 1D8TA 1K7XB 1X3SA 4KVGA 4M49A 4C14A 4ZZ1A 3RJMA 4BPRA 1SU8A 3W77A 1JN0A 2EDAA 5COQA 2LR0A 4V0KA 5F5NA 3DONA 1BFKA 2W11A 4MNTA 4OSOA 5HIAA 1K2WA 4BFZA 4D41A 2KHZA 2O0HA 3OCWA 3VHRA 1Z5NA 2QUHA 2AJTA 2HQ1A 3P97A 4V03A 3FTQA 1IOZA 4Y8VA 3OY2A 3M2TA 2OWEA 2X41A 4CG1A 3ASUA 1D7OA 2ZIWB 2ZYIA 3HUEA 1LTKA 2H2HA 2GHIA 3THRA 2A58A 2JAPA 2FPIB 2OK8A 2R7AA 4YACA 1BGVA 1VYUA 3CIOA 2FSVA 3FPFA 2E55A 3OZBA 4FNGA 1K89A 4O5AA 5EIHA 1RJDA 1RQRA 3RBVA 3II6X 3KWMA 1NC1A 2HAEA 2XGMA 2F2TA 4HMPA 1W73A 1IBRA 4O08A 3BMOB 2IYAA 3ADOA 1ICIA 1ZI6A 1IHDA 4I1IA 2OA0A 2ZWMA 1EFKA 1TD1A 3LIPA 4TXLA 5EE1A 4JT8A 1LD3A 1KA9H 3HNRA 3OH8A 3T3DA 2JEZA 5IFKA 5AJXA 4YCDA 4YWJA 3IP3A 4KQ2A 521PA 4E31A 1P6UA 2XJ9A 4U7FA 5AK6A 3VOTA 2WT4A 1YL5A 2XXBA 4LVUA 4CLOB 5T7BA 1PFWA 1KZGB 1XA4A 3AWIA 4Y1RB 4F46A 5CD1A 4I2VA 4CQJA 1CJTC 1MQAA 1E7RA 1M0TA 3BXXA 3DEHA 3EDRA 4HLUA 4QGBA 1G6KA 3JCZA 3U9LA 4D9IA 5JO0A 2H1OA 4M21A 1CQIB 1PL6A 4ZJPA 4JT4A 2B2NA 2IHKA 1NBIA 1Y7HA 1PNOA 2PPVA 3CLKA 4Z4HA 5ICSA 2D0IA 1SVMA 3E15A 3O0DA 3EEFA 3IQEA 1Y8ZA 3IUBA 1U94A 1LK7A 3EULA 3IJ5A 4DT1A 1TAQA 3RSFA 4U6SA 3KYCB 3EDQA 4HF7A 3C3DA 4RO0A 1IEXA 3IAS6 2VHQA 2IHVA 4G3XA 3GZ4A 1JNXX 3RRXA 1EB9A 3KNZA 1NMYA 3RHZA 1TRKA 4QVKA 4PZZA 4RMNA 4DAEA 3C3PA 3RWOA 1GGJA 4O4LB 1IWPB 4F5ZA 4AMBA 1WB6A 3GH3A 3LIIA 2V6IA 3TFOA 1JR2A 3KOMA 3ZHOA 4Q9NA 4BLRA 3GQBB 1N1DA 1XKLA 2A5JA 5JZSA 1SD5A 2HH9A 2Z8ZA 4RJ2A 5B37A 4YRPA 1KBZA 4ZRMA 4JP1A 1J8FA 2QL5A 4PO1A 1XFAA 3RRZA 4P7FA 1MQSA 2ALJA 2W8BA 3AV0B 3N6XA 1E8DA 5AVTA 2AK3A 3V8VA 2DUNA 3ER6A 3WMGA 4A9AA 3QFFA 3FTPA 4OD0A 6YASA 2X0DA 2TRSB 3DLCA 2DPHA 3DE1X 1H8ED 1Y5MA 2Q3DA 2W0SA 4RV9A 1NATA 4HEQA 3TRFA 2N75A 5KZMB 4BRZA 3JQ9A 4KUEA 1CVRA 2ODQA 1XZCA 3PE6A 3PXDA 3GGPA 1IN6A 4BDSA 4Y2VA 2YVUA 5E9QA 1OOEA 2B4QA 1N32B 3O75A 3C7KA 4AJPA 5KTYA 4IIDA 3W1WA 1Q3TA 3PC4A 5E4TA 4NBVA 5CHYA 3H04A 3QVLA 5I6DA 2D1TA 4G56A 4RCZA 3DPIA 5AM5A 4A7PA 2GK3A 1L8LA 2DBVO 4X63A 3E35A 2OGUA 3ABRB 1KSGA 3ZQUA 5A9RA 1P0IA 1FVXA 1W0JA 2WYWA 1RCFA 1NJ5A 1BG6A 1JEQA 2EFHB 3JSAA 1JSZA 1X7WB 2YYAA 1P3DA 5LQSA 5HR5A 1C30B 3NNSA 1G8KA 1UWLA 2PEYA 1J7KA 2VRCD 4MVJG 3C3KA 1EWRA 2B25A 3AP3A 3ASVA 3IMFA 3O2QB 2I7CA 4HXYA 4OQEA 1VZ2A 1WD7A 1OW3B 4KUGA 5TQJA 2IDKA 2Y1OA 3ZYZA 2UUBB 1IN4A 1QGUA 3HV2A 4G0PA 5CH3A 2LUOA 3M82A 5AM0A 1DXOA 3HCBA 3WWCA 3CLUD 2IY7A 1XHEA 4G63A 1ZK0A 1J5EB 4CEHB 1KOJA 3GJTA 1STOA 3U09A 1W30A 5IZCA 4G84A 4LV5B 4DB4A 1N9GA 2DHEA 3S5UA 1JMKC 4HB2A 3ZIAD 2UZ4A 3EYAA 4BUCA 2HV8A 1LTQA 3A06A 1RZVA 2DHQA 4L5IA 3CX3A 5KTRA 4LVNA 3JZIA 1NR7A 1PR6A 4TMWA 3IEUA 2HA6A 4NXNB 3BWEA 3FH0A 3L6BA 2PFKA 4KN8A 4A8JA 4H3VA 2FWIA 1JZTA 3IR7A 1FNNA 4NCNA 4NHOA 2BEVA 4GMHA 2WNIA 4MGEA 2G82A 4W5NA 1W4CA 3R20A 3V33A 1JYFA 3CNNA 3LOPA 2QLJA 5A4JA 1HZZA 2CLIB 2OBNA 2XCOA 3DFFA 3IMEA 1EYZA 2OXIA 1P2FA 1UJ4A 3U3XA 4DMUB 4NZ9A 2ZUFA 2MYTA 3N70A 1BNCA 3IE2A 3RU7A 1TJNA 4PRLA 3UJDA 3JATB 3M6WA 1BMTA 2H63A 3CIFA 4JHXA 4H0FA 4UUNA 2FEKA 4YJKA 4MZDA 1WAMA 2C03A 5BWMA 3JU3A 2NZYA 5C5DA 4EB3A 5FL7D 1J24A 4E12A 4NABA 2FP3A 2VJKA 3BQNB 1JDBB 3GMIA 4MHTA 3F7NA 4MS3A 1N78A 4NONA 3BM5A 3C3JA 5M5BA 2ZTLA 1K7CA 4TXHA 1U1EA 1TA9A 3G17A 1BMFD 1C0PA 1PQYA 1VG9B 3GN2A 4ZI2A 4K6CA 16PKA 2FAXA 3B6EA 2Q8NA 3GCZA 4M0CA 5C8DA 1LS1A 1DAGA 2QNRA 3FRIA 3K9GA 4TWIA 4TYQA 5JJIA 2QL7A 1L5MA 4MYHA 2F62A 4OQMA 1XCGB 3O3NB 4J7CA 5JWHA 5LNK6 4KPYA 3WK5A 3C8DA 4LGCA 1A8QA 4U2KA 3DF9A 4O63O 3ZXIA 1G21A 2D6FA 1RYNA 1ULAA 2J48A 2TMDA 3QVWA 1PR4A 3HKDA 2M6RA 3KOWA 5G0WA 3PYLA 3FPBA 3PRHA 4IX1A 2FPXA 4GZ3A 2VTEA 1QP7A 3JY6A 2BBOA 3HXKA 2B20A 4DLSA 3A9WA 1YQXA 4XIJA 4ZVNA 2NPFA 2CLHB 2CLOB 2EGHA 2FQXA 4RDCA 4YT8A 2IS1A 2TMGA 2J08A 4K03A 1D0IA 1GPDG 5LUAA 2DRIA 1Z12A 4R1MA 2WUDA 2HTEA 3N2KA 1EFHA 1WU8A 4QYMA 1ZCZA 5FA8A 1CC1S 1NMZA 1DTSA 2MU1A 3I2JA 4ANFA 1SH7A 2QTBA 4G0MA 1M7HA 2FLWA 4UNSA 5BQPA 4F85A 2BP7B 3K4QA 2VTKA 2DPGA 2J85A 5FTNA 5E1DA 2UAGA 4MYRA 4GOJA 1PZGA 4ND8A 5DLDA 4PYKA 2CVFA 1LVHA 3WLOA 1USWA 5B1EA 2C7RA 4KDRA 3L8MA 4MITA 3Q15C 4N47A 1VIMA 3T3IA 1ZM2A 3IX7A 4IJUA 4MXDA 2Q8QA 2ZVQX 4EI9A 3K6KA 5BR1A 3SWWA 2C4MA 1QH1A 3NEPX 4N3NA 1AU9A 3ZV5A 5KYNA 4ZZIA 2NPOA 2Q28A 2EWWA 5FBLB 3OPYB 5EXSA 5EQJB 4JELA 3UK7A 4KREA 2YMLA 1IMJA 1SUCA 3RC1A 3VTKA 1BXRA 1JIXA 1PWHA 1O03A 5FV7A 1LUAA 2I99A 3HACA 3IP9A 4KLCA 3DMTA 4HDMA 4D26A 3DB2A 3U4CA 1R27A 3HB7A 4HEA1 1GPUA 5E9AA 1T4GA 5AOBA 4B6GA 2QMUA 5ITVA 5K6RA 2QN1A 5C32A 1MF7A 3IEKA 4QQRA 5J2TA 1YZGA 1EE1A 1K92A 4BNXA 4OYHA 4N3GA 4OTZA 2D0PB 2JG3A 2WIDA 3EHEA 4YT5A 4I6GA 5IUJC 5T57A 1J20A 1XP8A 3D7LA 4LNUB 4MIKA 4JL5A 4Z9AA 3WS7A 4YNBA 3OC6A 4QRHA 1L4KA 1Y3DE 4XQCA 4EHKA 4CKCA 3QNWA 4OGWA 3HDQA 1KWKA 1R0ZA 3NHMA 1JKJB 1TMGE 2XH8A 5AVOA 1EZZA 3WG9A 3K5HA 1M8PA 4RS4A 4X5OA 1PNQA 5DLPA 4IDCA 1R16A 1UEXC 4KBGA 1PQ4A 4AKHA 5FNVF 4ALKA 1IB0A 1H6BA 5ECYA 5FBRB 4QSHA 5BV2P 2WPDA 3RS4A 2RGWA 2CBGA 2XSZD 2R6FA 4M7WA 1BD4A 4QLAA 3QNUA 5AFSA 2AFHA 2RAVA 3NANA 2X9GA 2XBMA 1AE1A 4FQ5A 2WABA 3TOSA 2DKFA 4K87A 3D64A 3SZGA 2EFJA 4OXKA 4PTYA 3DAYA 4OL9A 1GXSA 5KWEA 3B9BA 1DV2A 1WOMA 5JRDS 5LB2A 3L7IA 5ER9A 2G9VA 3U6BA 3DMRA 4UHFA 2H06A 1U2DA 1CJSA 1AX9A 3KQOA 1WCYA 3ZTYA 4ZARA 3H4MA 2WWIA 2RFLA 5TVGA 5CAEB 3EK2A 3ORYA 4L5CA 3T38A 4HUTA 2O7RA 4RSMA 3HSKA 1DLJA 2R9VA 5IULC 5FLEX 2L69A 1SHKA 3I12A 3KR1A 3O47A 4EGCB 3D7MA 1Y3HA 2EZ8A 1ZD4A 2GM4A 3GGCA 3OPQA 4TL7A 3PTLA 3EBPA 2CMDA 3A0UA 3FF1A 2ZBGA 3N6VA 2V54A 2UV8A 1MO2A 1N0HA 1HT3A 3PXAA 2CDRA 2ZR8A 4ECAA 1U28A 1EVYA 3VU1A 1ZH6A 4HQLA 2HRCA 2N42A 4U9HS 1DBPA 4Q18A 4EVRA 3AR4A 5ICCA 1WO8A 1JSXA 1K27A 2AHOA 1OBVA 1Z2DA 1FSZA 1I3MA 4R9NA 3WAGA 5DBEX 1AQ6A 1ECPA 2YZNA 3GZNB 3RUEA 3VBCA 4IIJB 2GAOA 1EVZA 4Q4HB 4YJGA 4ZVPA 1M2EA 1U9ZA 1WMSA 1E0KA 1I8TA 1Z25A 5AHRA 1VYTA 1XQVA 2X2EA 3QYAA 4A27A 1IVYA 3EXEA 3GIDA 1DUIA 5DT9A 1IDOA 2FRDA 1I2AA 2Q4RA 3DLHA 1F3OA 3JQPA 1HQDA 2WB4A 5BOSA 1OBCA 5ALJA 4HTAA 2WG2A 2ISCA 2WIJA 2X8LA 2BIFA 3NO4A 3PGVA 5AI5A 3AFHA 5AI4A 5CLIA 2FFBA 4JVMA 1TYBE 4YR9A 5L7TA 2ZIVB 1B0UA 2QMEA 4GU5A 2JJQA 1FDRA 3KQQA 1GQYA 4R9RA 3R77A 3PDJA 4AZ3A 5L3QA 4M9XA 4B3MB 4K6MA 2JFPA 3BJMA 4TKVB 1NW3A 4MRMB 2H0RA 2XMRA 3UJ3X 1PZHA 1TO6A 3ENNA 1I6WA 2FK8A 3PKIA 4JJEA 4TQUS 5LP1A 4XVRA 4DNQA 2VRNA 4WY8A 2VEDA 1CHDA 1SUEA 5TQ2B 1JHRA 4AWBA 4Z9YA 1GV0A 2FUG1 5DH9A 3KQMA 3SY8A 3KZXA 1FZQA 3FBWA 3NYQA 1DIGA 3K4PA 4I4TB 4MVJA 3SJZA 5T67A 3JWEA 2E18A 2HEGA 3DMGA 1LDYA 3KQYA 4UEJA 2HTFA 2IW3A 4UU7A 4FM9A 1PFYA 3D6MA 2Y68A 1E9VA 4FUTA 4P3NA 4ILEA 4GX2A 2BW0A 1TM2A 1L4BA 3TW8B 1XL0A 2O8FB 4C0KA 3UMJA 1E5XA 5TQ0B 2ZRAA 3V46A 3EZGA 2J9RA 3BHMA 3SLGA 3ZZUA 1WBJB 4DBZA 3OQHA 1BKSB 4QUEA 4ZTUB 2VJLA 2X5NA 3GVCA 3UNXA 2PUVA 2IY9A 1NKTA 3I6YA 2I8AA 1IJEA 1NL3A 2V1XA 4I4IA 4AMGA 3GP8A 2OECA 4ZEXA 1R6BX 4YMTA 4YI3A 4KYTA 3OMXA 1CUVA 5LOVA 3VH1A 1ONSA 1RAGA 4YI5A 3VJLA 3WGKA 3RSZA 3NJ4A 2BFAA 2P1ZA 3UATA 1JG4A 2PYZA 1FP6A 3D43A 4GI1A 3N5KA 4IF6A 3CUVA 1Y1RA 2P4EA 3JARA 2OXTA 4IIBA 3QMMA 1DG3A 2QRVB 5F9FA 2C3UA 2IOHA 4AG6A 3A8TA 5JT1A 1EBFA 3JQ8B 1VMAA 4R16A 5DWDA 3V5NA 3Q8XB 1QS0A 5COBA 2OD9A 1ODLA 3BJIC 1JFVA 4HYTA 3BTSA 3R5JA 3AKCA 4UUAA 3PITA 3IUMA 3T4EA 3IUPA 4G26A 2CD9A 3M1LA 4PAQA 3RADC 1MP0A 1BA2A 3N0RA 1HK7A 4NZYA 3PF8A 5ALNA 3ZDAA 4GOLD 1EVLA 3FCEA 2YWGA 3HBLA 4GLBA 1Q1EA 5L9AA 5TF4A 2DQYA 3BMQA 3OIWA 4RM3A 2ZI7A 2VDOB 1DHTA 4RD4A 4FVTA 1L7XA 4HWKA 5EFZA 3RKRA 4ER0A 2PX3A 5AUPB 3PDHA 4LBVA 2B3DA 2OZPA 3THSA 4AF7A 2I4OA 3C3BA 4F2WA 3KSAC 4LYGA 4QTYA 1CD5A 1THZA 4K81B 5CXSA 5EJ8A 1SG6A 3OP1A 2BMEA 3OWXA 2I1LA 4H3HB 2OGWA 2V03A 4JP3A 3WO0A 1CF9A 6ADHA 4CTMA 4FCCA 1Z16A 2E48A 2IHBA 1E3IA 3UB2A 2OC9A 3TRKA 4MV1A 3AUSA 3RC9A 4GOOD 4WFJA 2C1EA 5JAOA 4KAJA 1MN6A 3A1EA 1M33A 1TUGA 4JLJA 1CR4A 4IH9A 1RPTA 2JFVA 3O6VA 4JEUA 1QH0A 3G3EA 3STWA 4IUDS 4B3HA 4C89A 1EI9A 1IHOA 4L57A 1QAOA 2GARA 2C8KA 4RS3A 5KJCA 1P39A 3PVSA 3QU5A 3FPEA 3PQDA 3LTNC 3TGPA 1QJCA 3UFBA 4FP9A 1RKBA 1YRWA 4EF4A 2EJWA 2QY9A 3LLVA 1KJQA 3DDUA 4JR2A 4QARA 5G40A 4YREA 5ULLA 4B3DA 5JZ9A 5IUKC 1M54A 4Q3LA 4QUKA 1MUUA 2OM2A 1N0WA 1VMEA 2NNLD 4R05A 4OPMA 4P83A 3VNBA 4YCNA 5EIXA 1LBHA 2Q4DA 4KO3S 2CJFA 2AGVA 3H2ZA 1NJ2A 1SGWA 4RLHA 3RV3A 2EKDA 2BC9A 2ZRJA 5TT0A 5JXIA 1ST2A 2YASA 2Q0XA 3C3YA 1M8FA 3L7AA 4PCVA 1P45A 5C37A 3WJAA 3OHMA 1EP2B 2NO4A 4HGZA 5IARA 2BLNA 1LPAB 1DJPA 3B3GA 4NECA 4PV7A 4BQIA 2D7DA 2O1WA 2A7QA 2XKAA 3B70A 1GZSA 4RH0A 1KQGA 3JAKA 1I5EA 1KVSA 5C9ZA 1A98A 2JAXA 3HKBA 2ZWPA 2QVLA 5LP6A 1BVUA 4JJKA 1NTRA 1Z6PA 5KKNB 1K4MA 1XZIA 3W5BA 2PZBA 2ZQ5A 3E84A 1KIMA 2C2YA 2G72A 3Q6IA 4BQOA 1X92A 4X1YA 5CIYA 1SXJD 2CNNA 1SAYA 3KZMA 1G5PA 1L4UA 1NFQA 2ZAOA 1DX9A 2PR2A 5FI3A 2G67A 1QK4A 2B3TA 2B0CA 2EX1A 4MR7A 2B6NA 1YXMA 2Q50A 2V6BA 4R5HA 3PXGA 4WD3A 2O48X 1EBBA 3AOGA 1K75A 1RAAA 1BDJA 1NBMD 2L19A 2X2FA 3CY6A 1Q16A 1QH8A 1XEWX 2Z2JA 4OHWA 5DX1A 1R9MA 2ORED 4NE9A 2VQDA 4PFKA 4YIHA 4E7PA 4WZBA 4M36A 3NNNA 1W85B 5K03A 1J09A 1K3UB 1Q84A 3GROA 3OZTA 5CVUA 5KBYA 4O4IA 3CT6A 2GZDA 3R2JA 1C7RA 3RLIA 3QFRA 4WKPA 3WKCA 4NL4H 5M34A 2WILA 4IAOA 2BFMA 5HBGA 3TQSA 3BXGA 5C7YA 3ITEA 5A6SA 1E4OA 3E22A 5FOQA 4X95A 2C7OA 3PRJA 4GI3A 2KM1A 5BUQA 2JCSA 4XB6B 3C7AA 5BO5A 2R97A 1Q11A 2B5WA 4H7KA 4X97A 3S2GA 1H9CA 4MYTA 3LX6A 1UJ2A 3EASA 1U6KA 3FFBA 3NTRA 3PEEA 3QVKA 3TBHA 4QATA 1OXXK 4BBJA 4R2KA 4ISBA 4PEVA 5SZHB 2A1UB 2WHEA 3L4JA 3EF3A 1MV8A 1W93A 3FFAA 3RSQA 1HFEL 4GM4A 1YJ5A 1TYAE 1GGFA 1RXWA 1PEKE 4EG6A 1OX5A 1XTJA 1D2EA 4LZLA 4D42A 1IAVA 3FZYA 4HDRB 1VGRA 2CXQA 4R81A 5DHRA 5JCOA 3K71B 3R0XA 4CEIA 1M5UA 4E5DA 1AXRA 4PLFA 2YRWA 1C2YA 3GGJA 1IBLB 5D1HA 2O3UA 2YWEA 4DGQA 4LX8A 1H93A 3GY0A 3MF4A 3OZ7A 2GRJA 3MC1A 4EBBA 4HG2A 4JI6B 4URUR 2B8TA 2XCLA 2PGXA 3WRXC 4E2WA 3ZIDA 2Q1UA 3IKTA 2H1FA 4XUDA 2NYRA 2Q9BA 4QXPA 4H59A 5HZMA 3A2MA 5A4AA 4V1CA 1XUOA 5JATA 1R8XA 1YFJA 2FMHA 3KKPA 1ODSA 3DOJA 1W52X 1SR8A 1DJQA 2EKZA 1YR9A 1G7TA 5IRCD 4LHVA 3NT4A 4RESA 4UHBA 2EJVA 1QF6A 2PSJA 4ZOBA 1G1AA 1H65A 3X1ZA 1AO3A 4LYHA 4OL0A 1T3TA 2HX1A 2JH9A 1OZAA 5EWLB 3VPBA 3ZE9A 2OYCA 4IM7A 3OZGA 2RI1A 4KU4A 3H0EA 2D8MA 4IJMA 4A1OA 2EGGA 4JLUA 5LBTA 1LWNA 4HL6A 4UCWA 2HK7A 1Z6XA 2N1BA 3REFA 1DRVA 2HEIA 2REXB 3EGVA 1Y6FA 3SMVA 4GRDA 3D1VA 2O23A 3EXHA 3SU8A 5DXAA 2C2BA 1K1EA 5BQ5A 2AEFA 3JQBA 5JS2A 2RGDA 4QOEA 1ZD3A 2AVDA 1JEAA 3HSSA 4XX1A 5CLHA 2AOVA 3OPXA 3K0SA 3K30A 1EFPB 4RACA 4PBTA 1MU0A 5EJ7A 5CFLA 1PQUA 2YMPA 3CSUA 1HXHA 3SZOA 4FYJA 3DWFA 4NZPA 4BE7B 1Q1GA 2HXGA 3VOAA 3ZOZA 3U1TA 1CDEA 2B5VA 2FF5A 2E85A 2OQIA 1UDAA 3JV7A 2J4FA 4IKEA 4PHHA 5HF5A 4BTLA 1AB5A 1PLKA 1Z47A 2CUZA 2FPLA 3OJCA 3OSZA 3PXEA 4C4YA 1IPFA 4EJ2A 1T6ZA 1GEEA 5DBIA 2QZZA 3U3KA 4ZHSA 4ZGWA 4H7DA 4MX8A 3A04A 3X44A 1Z4QA 1JFLA 1IN7A 1E1YA 2BCGY 4O4HF 4QG7A 4W8OA 5A4KA 5H83A 1C1DA 3VVMA 3E8SA 4RVNA 3OZXA 4TTIA 4HSEA 2PSFA 3DCNA 1DELA 1P1JA 1PEYA 1UBJS 4KWTA 3VU3A 4DC1A 1PT5A 5KNDH 3D6TB 2O7NA 5ES3A 4RMHA 4AROA 3Q8MA 1YJXA 2IU6A 2DY0A 3OX2A 1V35A 3W9BA 1JHZA 2RAFA 4LPSA 4UU1A 5KMGB 1C29B 4N9WA 1EINA 2PCJA 3DP9A 5DNUA 5FUMA 3HYCA 4QPCA 2H0QA 3TVDA 2CMHA 1CBUA 1U2GA 2IE0A 5JCJD 2NU9A 3N9IA 3PS9A 3TKLA 1KWGA 3KYDB 1XMOB 4EI7A 4GSKA 2IP1A 3P0RA 2KLHA 1J0BA 1I3LA 1UADA 2D13A 2EKPA 2YWHA 1X1QA 3G7NA 3KLPX 3RASA 4CLRB 2B61A 2HU2A 4P93A 2W8BB 3WZMA 4YXWD 2WE7A 1FLNA 1HE5A 4Y2GA 3G0OA 3N7AA 5BQOA 3KELA 621PA 3K20A 5KYWA 5CFNA 4YHHB 4D92A 1RAFA 4BPBA 3CUWA 5IC6A 3AERA 1M8JA 2X1MA 4J2OA 2WD7A 3P9RA 1C7QA 1U0NA 1E7MA 4G8JA 4C5AA 3KT8A 3UYKA 4P0TA 1W29A 3X1WA 2JI8A 2P75A 1JDTA 4HEHA 4REMA 3PQFA 1BXKA 3WB0A 1TU3A 3F8TA 3DSRA 4JBHA 4K86A 4Q4JA 2XCQA 3HCPA 5I5GA 4I5IA 3O83A 2WVHA 3U3MA 4CNQA 3RAPR 5CA1A 2KSQA 2ZJ2A 5DXFA 5FAXA 3OD5A 3SHQA 5EINA 2RGYA 2ZRGA 2BFWA 2NLOA 3PQCA 4NE7A 2BGTA 2FZVA 5CM9C 3VSCA 3ZGLA 3ZNPA 2H4WA 4RH1A 5PNTA 2QD3A 3P2JA 4Y1EA 4KKXB 5K7SA 1NLFA 2KMLA 3GYGA 1BVHA 1DCMA 2WJHA 3ZOKA 2GHQA 1X7DA 1RWKA 1Y0BA 3FY4A 3O8QA 4Q24A 2I66A 3DULA 4QDUA 4DTIA 4I1PA 4UMEA 4PX3A 1VFNA 1GKIA 1MQ9A 1YB1A 5HTKA 4N76A 4F2GA 2FUEA 5JNUA 4A23A 1Z2NX 1YK1A 4C1BA 4M0FA 4F1WA 3PDIB 1CZLA 2XOXA 3HGQA 3KZOA 3GBPA 1B26A 2QYOA 3G7UA 3UMVA 3V6LA 3DKKA 3I73A 5FUBA 5IJXA 2VT6A 4YAUA 1VKRA 4Z4IA 2XZLA 3TNDA 1QYCA 4U2BA 2O1EA 1OT3A 1O0SA 3OM0A 3L07A 3F9CA 5I9TA 1MBZA 1ZNZA 2CSUA 3NV9A 1T0IA 1WY5A 2H92A 3G5UA 4DCPA 1I7NA 1QJ4A 1PR9A 1J9GA 1FQWA 1NY6A 1P4HA 2HPHA 2IELA 2QUKA 2W2XA 2AOUB 4G5OA 3THOA 3U40A 4D9EA 1YQ9A 2GN1A 1R6XA 2BEVB 2AT1A 2FRXA 3CX4A 4OCZA 3C48A 1U04A 5GOTA 2HJHA 2JB9A 2I7TA 4LQDA 4BNKA 4RY9A 3SHOA 1B8VA 4ER5A 1O4WA 1EBUA 1R7RA 1KARA 2X8AA 2XDWA 4W4TA 4B9EA 4EIWA 4B3FX 3TMYA 5DSXA 2JHPA 3P5BA 1DWQA 1ZK4A 1Y3BE 4TXMA 3X1DA 3ZE0B 4FJ2A 4J7XA 3M5DA 3DP7A 2CT8A 4FLEA 4BE4A 5KC8A 1A27A 2X1HA 1WEHA 2ZK7A 1T8TA 3AF2A 1GV1A 5AW7A 1FPMA 4MS3B 3OU6A 3QKIA 4PGMA 3EFHA 5J2UF 2VPQA 3KRTA 3AO0B 4HDCA 1C9JA 4E5UA 1N77A 5EWJA 1ZK2A 5ICFA 3ZWVA 1L5KA 3EBLA 3N05A 4UM9B 2NMVA 3R5FA 2XDAA 4BP9A 2Y6VA 3UV7A 3EIQA 1HTBA 4X71A 4FGLA 2LIPA 3EFOB 1ODFA 3WIBA 4CGZA 9LDTA 1GL6A 1WKBA 4DSOA 5AXAA 1KFKB 2IXGA 3CR3C 2WSYB 3RRJA 2NM0A 4OUKX 2YVQA 3IQDB 2DQZA 2QXYA 4EHNA 2D0DA 1ZM7A 2QG9A 1JNYA 1H9BA 4AC9A 4YRAA 1OVGA 4NAHA 1W1IA 3BMCB 3WGGA 3VJKA 4LF9B 2HO5A 3O8CA 3BD8A 2QTWB 1JWBB 5EJ4A 3PL5A 3AIMA 3DQZA 1Z8NA 2EBHX 1U63A 4B85A 4DUGD 2P40A 4DV0B 1OROA 1S7CA 1S3GA 5DI3A 3SS7X 3UY4A 4IXTA 1QYDA 3MCWA 1D1QA 1KI1A 4OLAA 2YQZA 3CPEA 4DLPA 5JWOA 2E37A 2VCHA 2YVLA 3PHJA 1P5ZB 4L9WA 1NW9B 4FHZA 5HS6A 5D5QA 4E88A 3EVEA 2AE1A 5I7FA 3MTIA 3GRYA 3WHLA 1LBIA 2GF0A 2NAPA 1K7EB 2WMOB 2XKJE 1T4CA 3WLQA 5IZ4A 1FJXA 2PZGA 3E5RA 4XTRA 3E7XA 4NNOA 1AGRA 3DT8A 3MK31 4NBLA 4QXRA 5D2CA 3ZLVA 4A26A 1ULUA 3FSEA 3NALA 1P61B 4CM8B 5AVWA 2F67A 2HPAA 3UJPA 1VM6A 1HY3A 5KINB 3PEWA 1EFCA 3FZEA 1BC5A 4ZV7A 3E1KA 4WGGA 5JZMA 2D54A 1RADA 3AP1A 5FUYA 5B2ZA 4DIOA 5BOVA 5BV0A 4LN1A 1M34E 2OCIA 2TECE 2NXWA 4ZFNA 3WDKA 2RHWA 1DFHA 2OZEA 2POQX 4JITA 2Z6AA 3QXSA 4R1OA 3W8DA 5JCPA 5J9FA 4FILA 4XAQA 3L0SA 2DE0X 4ZCRA 1U4SA 5INTA 3ISVA 3PXBA 4J1SA 2EYQA 1Y8QB 4NULA 4UMVA 2LCIA 3AZOA 1PS8A 3GBSA 5BYJA 1OY1A 2YWXA 4AURA 5ALDA 4GG1A 1UBFA 3A6LA 3PKZA 2O19A 4I9FA 5EGNA 3M9XA 3C1OA 3R3UA 3WYNA 1C81A 3KDPA 3OZUA 5H59A 4F4DA 5AESA 3WB1A 1EG7A 1MOZA 1TZJA 5FYQA 4EPTA 1CQXA 2ZAYA 3FFXA 2V9PA 4U39A 2XYQA 5AJUA 2V6FA 4GE3A 1KI3A 4EVQA 1QP0A 2XE4A 4WX2B 3EOZA 1OIVA 1F0KA 2OCXA 3TZCA 1L7VC 2V7WA 4C5CA 2BM9A 1UAGA 2GJ9A 2IGTA 2NTYC 3HB5X 3IYLW 2G17A 4O0LA 3D8SA 4LYDA 1N0UA 4TS9A 2XGOA 3MNFA 4OJNA 4B4UA 1PD1A 4F5EA 4EY4A 5B3LA 3ZVNA 1XPUA 1V4BA 1A5AB 3C6ZA 4F5YA 4BGDA 1XCJA 1E64A 4K9LA 1W1WA 6CHYA 5JY6A 4I1UA 3WV4A 2XOKD 2GAAA 4A92A 4B6EA 2NVUB 1E4YA 1SU4A 3A9CA 3NEJA 3R1IA 4UNNA 3WL6A 1SQ0A 3JAWA 4PG8A 3IKMB 5SY4A 5EERA 3I1FA 4YAGA 4GKBA 4EGSA 1Y6RA 1GM5A 3Q72A 3FB1A 5H82A 2OKGA 4FFPA 2Q9UA 2YXPX 1I36A 1GPKA 4ONEA 1Q2UA 1C4XA 2H8KA 2OC4A 4TN5A 2FPWA 2IUEA 2J0UB 3BFXA 3K6RA 1YE3A 3ANNA 4HQFA 3G9QA 5HTOA 1O9GA 1ZM3A 2Q6TA 1U9IA 4E6PA 2H07A 5IYZA 4LHXA 1FYEA 1KQNA 1LFAA 2ZUSA 4BGVA 2P4SA 3DHNA 2FOIA 4FYHA 1P72A 4B32A 4ENWA 4GUDA 4X3PA 4IW3B 2J0EA 3ANLA 4P35A 4RANA 3L7DA 1EXVA 4LJKA 2HSEA 2HUNA 2NTEA 1NBHA 1UDRA 3CUUA 3WK8A 1UM9A 5B1DA 4B8ZA 3OQOA 1FP4B 3P9ZA 1KRXA 3ROMA 3NOOA 3UWOA 5EMMA 5B1YA 4BB9A 1UJNA 2V8BA 4OK6A 1CIJA 1K3FA 1KC1A 3G1UA 4Q4CA 5K8JB 4F1KA 3MGAA 1NYLA 4DCUA 2ZJZA 5CH8A 1P1BA 5CFMA 4IKPA 2YN2A 221PA 1AV7A 3D2LA 1AA6A 5DFAA 1BEUB 1JVBA 2ERCA 2HHCA 3M6XA 1X7YA 4LECA 3KVOA 5EMJA 5B2EA 5IXSA 1PK8A 3E61A 5IT4A 1TA4A 3ONVA 4J0KA 4KO2S 5ALZA 4KQXA 3ROGA 1GTSA 1N1EA 2I0FA 3F4BA 2XZTA 3MQ2A 1D4AA 2XE6A 3MOIA 4EFMA 4YMUA 4MWSA 3LYUA 3E9DA 3I45A 4JQSA 3KLNA 3NPMA 4GGPA 4WPGA 3RTDA 3QF7A 1EWVA 3DVQX 4JYBA 4I55B 4AMYA 3DDOA 1EHCA 1WW8A 1SUAA 3G2IA 1VP9A 7GPBA 1LDGA 1QNLA 2V55B 2ZRLA 4IYRA 5T4HA 4N12A 4RJKA 2FSVC 1DC6A 1IE3A 2OCGA 1NBEA 4JB2A 2AR0A 2WSLA 4Q66C 2OFFA 2PUJA 5BR4A 1OHHD 5ALQA 5GONA 3AONB 3KYJB 3LUJA 5TE9A 2Z5VA 2GLXA 4CNBA 1B6TA 1Z4MA 4KQKA 4YJHA 1NXQA 4EB8A 2E7ZA 3W0LB 3ANXA 5JAQA 2I7VA 4PZCA 3VTFA 1XE3A 2PX4A 2QU8A 5CB4B 3SICE 1W36C 1R6DA 2FR8A 5G53C 3JS5A 1S01A 2WZCA 5H4HA 2BKVA 3FOAA 4U2EA 2PANA 3UB3A 1PR5A 5C34B 1SA0A 2PK3A 4Q9LA 5EIFA 2AN4A 4OM7A 1YRQA 4J7AA 1NW7A 1QRDA 4HLUC 4XWWA 3ZI7A 1O5OA 2X0IA 7YASA 2J33A 4EG7A 4OKIA 3FSGD 3GU3A 3H2BA 3IB6A 4UAGA 2KWIA 3R3WA 3LX8A 2X86A 3FKSA 2IV7A 1X9GA 4Q47A 1E7SA 1RRGA 1ZCBA 2G40A 2NQTA 5F52A 1W8DA 3HWRA 5EKTA 2RGRA 1SEPA 5CFQA 2FV8A 3EC2A 3WLHA 3NTOA 4DJDC 4TTAA 5FOTA 4JLAA 4MVJI 1KRWA 4A5SA 3T5PA 2PXXA 3DD5A 2NU6A 2B7LA 3CW2A 3NG1A 5BN3A 4EDHA 1QVZA 5HGJA 2VBIA 5K99A 1E92A 5KIAA 3GJYA 2XNDA 3CM0A 4Z51A 1XMSA 5MN6A 2UVPB 3SF8B 2R2GA 4HXGA 2NT3A 4QHYA 3VDXA 3PFNA 4R2LA 2AV6A 4LF5B 1YONA 3KEMA 4HFRA 4UCXA 4WLUA 2V6GA 3EEYA 1AVTA 3I01M 4IP0A 4DOMA 4MMYB 4EHJA 3IEIA 3EY4A 3SYTA 2IUTA 4EY8A 3JARB 3V1TC 4PZ0A 4ALNA 4IEFB 1UKZA 1UH5A 2C9ZA 3UWDA 4IWYA 3BA6A 1DJOA 2GOYA 4MV6A 5KREA 4IVPA 1EDBA 1VKOA 3K2QA 3ZWYA 4F5DA 2BGKA 4TXNA 1L9XA 3RCBA 1B7GO 2V7QD 3UW3A 3MUNA 1U0JA 1N2SA 2ZKLA 3R23A 5JNRA 5KYTA 1GL9B 1QQ5A 2EWMA 3RFVA 1ELOA 3KJXA 3M3PA 4G8CA 1MEEA 3JQ9C 3ENKA 4NARA 4QTXA 3BC1A 4XJXA 3G5AA 1HT1E 4JT2A 5F51A 5HILA 3C15C 1R5JA 2WIGA 5FF9A 3LHDA 1V0JA 2E4AA 4F7WA 2OO3A 2WV7A 3DGEC 4LYEA 3NGLA 4DQDA 4WASA 4RD3A 5LDDC 1RBYA 3OPMA 5BXYA 5EHNA 3RVDA 3GP5A 4P32A 4ZAVA 1WVIA 2VSQA 4IICA 3G0BA 2B30A 2ZULA 2IYLD 4I1YA 5AM1A 1P0FA 2CMFA 4U5QA 3G1WA 3WJ7A 1H2EA 1JQ3A 2G7MC 5AVJA 3VDNB 1UJ6A 4DR3B 3QG1A 3PUKA 2FXIA 1TUIA 2BHTA 2EVWX 2OXFA 1JX6A 2WP8J 3FTNA 3W1EA 1NXWA 4EUKA 4QT4A 5JXGA 2VVTA 5L3SA 4JBGA 5J63A 4ZI5A 1C3JA 2CXNA 3I9V6 4I08A 4AKTA 5JJ5A 4JK3A 4P54A 4FOPA 3UAYA 4NHEA 3TFQA 4D8VA 4PSUA 3M6AA 5ETJA 1K5GA 1O97C 3SYNA 1EP3B 1XF9A 1JHOA 1V9LA 4N0EA 1Z37A 4G6ZA 1E1RD 1P5RA 3G89A 4V3BA 4D0SA 1G18A 5IZCC 3S81A 5GM2A 3HE3A 3DKPA 4RZ3A 4QNNA 2FW0A 1K08A 2J07A 1Z0UA 4X3OA 3V2IA 2HXSA 3AY0A 1QQ7A 3QOWA 3SOZA 3ZWCA 5J58A 1TKRA 3GGDA 1I9CA 2DBZA 3GLTA 1NVBA 3HSYA 4IBOA 4IQ4A 1KPHA 3VO2A 4A8JC 4YJFA 3OFND 3WX0A 1E2EA 1DT3A 2CN1A 3DTTA 4GKKB 1CUXA 1EE2A 4WLVA 4HLQB 1DBSA 4PAOA 1F2TB 1HZZC 2EFCB 2OHJA 4KUHA 4L0MA 1X1EA 1U4NA 2R6ZA 1WWKA 3RTCA 4BNNA 1E1CB 4HKTA 4WN9B 4FMPA 1ECCA 4AWAA 3K8YA 2VJOA 2OLEA 4G0XA 4Q1AA 4TM7A 1W1UA 1T8WA 1WJGA 2XYGA 3D8TA 1P60A 1K5HA 1QHGA 2P7HA 3DTNA 3LCMA 2HNKA 1GRNA 2NVWA 1G8MA 3DVRX 3OICA 5KNBD 4QPDA 4BB0A 5L6LB 2JJ8A 4LZOA 4QTZA 2UZ0A 4QHSA 5CVTA 4G1VA 4J0EA 2YV1A 3V80A 5HKKA 5CCBA 1L4YA 3KYIB 1XXHE 1Z2PX 3L6EA 2CZQA 3UO8B 5EHGA 1U8XX 3OBIA 3DZBA 3D54D 4MR7B 4C4TA 1M10A 5GJVC 1ULSA 3VYTB 5KYWB 1WCV1 1ZGCA 3QW4B 2ZBVA 1XAHA 4NMHA 1N6RA 2WJPA 2I3BA 4FYVA 4Q39A 5FPYA 4IO1A 1JLKA 4IOLA 4EYQA 1NF8A 1QDEA 4M3NA 3H13A 5AW9A 3HC7A 2PWBA 3RSOA 4IMPA 4LF8B 1I4OA 3LU1A 1QG2A 3M6IA 3STYA 3O8NA 1P0QA 1OYYA 3DHYA 5CDYA 2CLEB 2W00A 3M4NA 4HNAB 3VSBA 1JDUA 3AI1A 1H0RA 4L4SA 1NZDA 4L2IA 4DJ5X 3L8CA 1E5DA 3OUUA 1J0AA 4MYCA 4WERA 5GJBA 2R86A 3TNFA 3MB5A 3ZCVA 4C0AC 1L4HA 3V48A 4IDOA 1CR0A 1E3LA 2OO5A 4YJ2B 2R8EA 2VRWA 1UOQA 2WU8A 2Z43A 4INJA 3FYUA 1B6SA 1W0CA 5FUVA 4MA5A 1G5QA 2DWOA 2GYVA 3ET4A 3S27A 1K8XB 1NBWB 3AVUA 1IRIA 4LGVA 4E4YA 3ESYA 4YRKA 1GAWA 2E5FA 4GHWA 4F4IA 1EFVA 4LQ4A 2PRIA 4M8IA 4PIVA 4Z9FA 2J5XA 2YINC 2R1UA 3IV7A 4W5OA 3CLTD 5CIWA 3AKZA 4OQQA 2RI6A 3CNEA 1GRVA 3NBZC 5C8YA 1I0LA 3K0AB 3IO3A 4JC8A 1TYDE 4EB6A 2I87A 2RG1A 5ALUA 4QFBA 3HO6A 3A6PC 1B3BA 5B4VA 1XMIA 2EXXA 3TTYA 3D6UA 4EPXA 1OAKA 3LF2A 1V8DA 5JD5A 1RZ3A 4CEIB 3VOBA 2RH9B 1YUMA 4YYEA 2WKQA 4X8MA 4ICIA 2V7UA 3KPYA 3CEHA 1CEXA 3O8LA 4QBIA 2A0KA 4RZHA 2P35A 3DLPX 3HJBA 3HZOA 3R4VA 3S1LA 1QHIA 4BFTA 4PTLA 4LWPA 2JJ1A 5AW6A 2PZAA 3ASYA 2F4NA 4F3TA 2ATXA 5D8DA 1PVVA 3DMTC 1N3IA 5FJJA 1IQUA 1H2HA 2PD4A 4R71A 3TG2A 2MR5A 5C5IA 1HRDA 1R0YA 2OGSA 5DLYA 5CDGA 1ZLXA 3O94A 3I2IA 3MBKA 4I5FA 1GNQA 4V0NA 5I8ZA 3VNRA 2FHPA 5BRNA 3W2HA 2XR1A 4ZDIA 1L8XA 3MTBA 3ZCQA 2GD0A 4X6YA 1HE4A 4YUYA 2PJZA 3KXLA 3PBKA 1NXSA 4Z4CA 1ZN8A 1RLTA 1QM5A 4FEAA 5LC1A 1V43A 4I8IA 3ZH2A 4NCBA 3JPWA 3FDZB 1U7XA 2I6TA 1C0LA 2IW1A 1EFRD 3NI2A 3JASB 4HN2A 4ND6A 4TRMA 3ZWDA 1XTIA 2X7JA 2W42A 1MMFB 2HLNA 3PGXA 3GCWA 4N4AA 4F3CA 1LSJA 4KXXA 1MB0A 1LI5A 4HZUA 4JOCA 1LVUA 5F73A 5LSAA 1A9QA 2WJWA 1ZJ4A 3KC2A 4J9VA 2YS6A 4XDGA 3T9BA 2EKLA 1Y1PA 3A6EA 4W5HA 4D97A 1XQWA 2BGGA 5IBRA 3ZDYB 4F9GA 1L5NA 2X2OA 3N53A 4FGWA 8OHMA 5CW2A 4Z7OB 4OKNA 2HWUA 3QLTA 1XQXA 3ASZA 1E9FA 1TT5A 2EZ4A 4C7MA 2DH5A 4DR4B 4LOHA 3EZYA 3OPVA 5K5EA 2CXTA 3PUIA 4B34A 2YWDA 2G63A 1GLVA 4MUXA 4EKGA 2FDRA 3OKFA 1ZH0A 4M83A 3WIVA 4BUJA 4ENQA 5C3UA 1U2DC 4TLDA 1UPBA 2ORIA 3DBHB 3R5TA 3OU2A 4FDMA 2DUWA 1E1QD 1RS0A 3ACCA 3CHYA 4IRMA 3TLEA 2I6GA 4LF6B 3ESCA 3VC2A 1JFSA 2W9XA 3L4BA 5JDIA 4Z4FA 3CRRA 2AF4C 2CHGA 2LZ0A 1FU8A 4FU0A 4AG5A 3A7DA 3H9CA 4FDLA 1KAMA 3LHKA 1ZH4A 4N6OA 2IZ1A 4OHPA 3ZJUA 3DAFA 1KPGA 2XTMA 3LO8A 1C1DB 5KYKA 1C2TA 4KH1A 4C88A 1U28C 2FOXA 5EMKA 3VDQA 2C8LA 3AWDA 1QCZA 2VDWA 3AHIA 2D2IA 2CVZA 4X66B 3PIIA 2BFDB 3U3ZA 2HR1A 1GU0A 1N3BA 3QELB 5TGTA 2ZS8A 3V55A 1ADJA 1T0BA 2Q2WA 4L76A 2V9ZA 2XD4A 4CF3A 3FCXA 5LB4A 3TK1A 1PJ3A 1BWQA 1Z8DA 1RZRA 4HAUA 5ALTA 3Q7QA 2DPXA 2O6LA 2UUAB 3TL2A 3ODPA 2F8TA 3C6KA 3FJ1A 2FRDC 1L7AA 2XHZA 3UJ9A 3EPHA 4AIRA 3ED5A 3KE9A 4MW5A 3MPOA 1YHZA 1LPBB 5JJCA 4DIFA 3N8DA 4E08A 3CPJB 2VHUA 5F7OA 5AKZA 2BTOA 2MJLA 1Z7WA 1GDHA 2FP4A 1R9GA 5C51B 1AD2A 3WYGA 1UT6A 1RM5A 2PTHA 4B74A 4PC2A 4RH3A 4UTOA 1T26A 1C7FA 3KYBA 4AMVA 3Q1KA 3Q5EA 3WBFA 3G79A 1E4VA 3WLSA 4CMHA 4ZYTA 4TLCA 2OXEA 1IEWA 5F33A 4C7KA 3GAMA 3D02A 2R60A 5JLAA 1TF7A 2P67A 4L3VA 1TMOA 2ZKIA 5NLLA 4BO2A 3UPUA 3EX7C 1WP9A 3KL4A 5CA1B 4P7KA 3FUXA 4L0DA 4CV2A 5HS4A 4R51A 3UOAB 1QIKA 3QXGA 5JLJA 4O1HA 1UXIA 1KGSA 2QUZA 2FUKA 1KSJA 2PIDA 1NVUQ 2XEXA 4H7IA 3SQMA 5KX5B 1WR8A 3WK9A 1AIPA 1XROA 2QNIA 3FF4A 1FX1A 1WXHA 3C70A 4UE3S 3SS9X 1GZDA 3W05A 5KNBH 4D6YA 3NHLA 2PV0A 1TMYA 2Z8YM 1R0WA 2IFTA 4NBKA 1ZI9A 5CR9A 2O8EA 3OEED 1FC0A 3UT5A 5D3MB 4F11A 3EGXA 2DT5A 1BWRA 3BOSA 4YFYA 1C4WA 5FXMA 1I3NA 2OR3A 4QPJC 3CRMA 1GN8A 3BXHA 4YCCA 5T3YA 4B43A 4BVEA 1YK0A 2HY7A 3MOSA 1IWOA 3RO7A 3L6OO 1HOTA 1P9OA 1T5DX 1JR4A 1TX4B 4MPRA 3DE6X 3K31A 3PNPA 3ZXUB 2FWNA 1XDUA 1A9XB 2ZTMA 3WFZA 5JYDA 5MN5A 1SWWA 1LLFA 1P5HA 3OQVA 4CL2A 3EZ6A 1IXZA 3E4DA 3QEBZ 1R8SA 1AF4A 1E9AA 3DOIA 1MGPA 4X1IB 1XVAA 3EDYA 4YUZA 1G20E 1T43A 2FMXA 1DKLA 2RONA 3DMPA 4FGSA 1I2BA 4M0EA 3WKBA 4BMNA 2G04A 2C4UA 2NUPA 3SJAA 3FYDA 3Q85A 5FPTA 1A1SA 1LLUA 1RWOA 2QVXX 1GPNA 3LUBA 3QX7A 2ZI6A 5FWNA 1BXGA 2QTLA 4GLFA 5JAPA 1QV7A 2DULA 1Z5PA 4NDAA 1E18A 1JGTA 3FCAA 3KLBA 4B0OA 4DXAA 4LNAA 2R25B 1P3JA 2C88A 2PLNA 1DKMA 4RFSB 4LE0A 4YALA 2C84A 4ZI7A 3RF7A 1HQKA 2IODA 4NENB 1L4GA 3PUHA 1I94B 3VXKA 1OZFA 3FGNA 4F56A 2AOWA 4HYQA 3D1JA 3V1LA 2Q5OA 3D5TA 1PK7A 1DWPA 1N2ZA 2XGSA 3SQNA 1AMOA 1MX5A 4PYIA 1J8VA 1P2VA 2GCOB 4ND3A 3PGLA 1AUPA 4ENUA 3HBNA 1QFXA 3HPQA 1CKEA 4Q7MB 5BPFA 3LH5A 2P90A 3ZHRA 1WPGA 5DISB 1ZWLA 2XUGA 4AJJA 1PYOA 5EMLA 2R8ZA 3HBMA 4WESB 4MMXB 3RYFA 1TVMA 5L4LA 2H3HA 1ZXLA 2FX3A 2ZBEA 3DHEA 1QCYA 3OLZA 2LKCA 3V6MA 4O2BA 3FYCA 3HVIA 3IB3A 4UHDA 4OBWA 2YC4C 4UVDA 5ARCA 4BQRA 2LCFA 2X4IA 3HLTA 1N8NA 1W94A 2HQOA 4MVJH 2HZBA 4WUTA 1PR2A 1QRSA 1I14A 2B0JA 4FKBA 1XGKA 4NC9A 4QLBA 3DNFA 1KYTA 4C0HA 1VA4A 1XTZA 1YZKA 2OCYC 4OUDB 4QTUB 4QU9A 2ZG6A 4CR8A 1YA4A 2HF9A 2P62A 1V8FA 2LGJA 3F2VA 5LZ8A 4PGHA 3GRUA 5JECA 1ZOIA 4JLNA 1NI4A 4XM1A 4G4IA 4AYXA 3MMNA 4ESOA 3SIPA 2QV7A 2A59A 3CLRC 2OB1A 1CIVA 1T4CB 1WB5A 2PVPA 3CUSA 4RFLA 1O08A 3AHCA 3F1KA 4WFQA 4ESVA 2OHXA 3NHZA 1U2PA 4YRFA 4HR7A 1FYVA 1ILEA 4RTKA 4RDXA 2CUKA 3OCVA 4HBGA 4UTVA 3HZRA 2X13A 3F7OA 4PSCA 4N6GA 4I19A 4UVHA 4ZXPA 1T34A 4GOND 3TX6A 2PR7A 1P9LA 2NG1A 4MP6A 5LQUA 2JIBA 4CHTA 2Y71A 4FGZA 4Z99A 5TARA 2MCFA 4EFDA 5HWSA 4JLSA 1KOLA 1QKKA 1BTOA 3DDCA 3G2PA 2BFBA 1Z5OA 1MKYA 3MWJA 4KQ6A 3PEFA 4B76A 4M1YA 5K4AA 4ALIA 3IEMA 1ZI8A 1UXKA 2YZKA 1RMQA 5JYEA 3TEFA 4WXHA 2B35A 5LP6C 1XJQA 4MROA 2XZDA 5A1JA 1Q92A 1QPZA 4OP1A 3DZ8A 3S2ZA 5AUOB 1HWYA 4FXOA 1M2NA 3PI7A 1S2OA 1J0DA 1NSFA 1LX6A 5CLFA 1YR8A 2IJGX 3NZEA 1DFGA 2P69A 1HT0A 4M4SA 4OFZA 5ALXA 1UMDA 2BKXA 5B4TA 3RHTA 3SBOA 3NHRA 3PD7A 5ECGC 4OI1A 1HLDA 1YCGA 1Z0KA 1G9SA 2ZYWX 2VZ9A 2W2NA 3JVDA 3NP9A 3OQPA 5IM4F 3HP4A 3E7DA 1Q83A 2XMSA 4EF6A 3L7LA 3C4VA 4U7DA 4CTOA 1OD6A 4PWYA 2QTGA 5FA5A 4J9UE 3T1VA 3HXMA 2H18A 1AUXA 1E2UA 4DCOA 2CUNA 5LR6A 2P9JA 2ZXFA 4U2GA 2GEBA 3RF6A 3Q4GA 3IIEA 4DSZA 1TTTA 1ZH2A 1S4MA 1Y98A 1G41A 2Q46A 4YWHA 4RGQA 4TSFA 1E3JA 1U80A 1KI8A 4RM2A 4MRAA 1E7WA 1GG2A 2DWUA 1VI5A 5EZYF 4XKJA 5CNKA 4BMOB 4EI8A 5HKOA 2Y1CA 4M1MA 1E3MA 2J09A 3AC0A 2B1GA 4AI6A 2WTUA 2HUPA 1P2GA 1H8EA 3ZBTA 1XZQA 4L4ZA 5BYBA 5I9BA 2X14A 3V1NA 3LQ4A 3HVRA 3K9CA 2BISA 5FT9A 2WG0A