1V16B

Crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
336
Chain Sequence
AHFTFQPEYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKYGKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEAAKYRYRSGDLFNCGSLTIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVASMAKEKLGVSCEVIDLRTIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDALRKMINY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-OXOISOVALERATE DEHYDROGENASE ALPHA SUBUNIT
publication title Cross-Talk between Thiamin Diphosphate Binding and Phosphorylation Loop Conformation in Human Branched-Chain {Alpha}-Keto Acid Decarboxylase/Dehydrogenase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 127
structure length 336
sequence length 341
ec nomenclature ec 1.2.4.4: 3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring).
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02779 Transket_pyr Transketolase, pyrimidine binding domain
B PF02780 Transketolase_C Transketolase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.920 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v16B01
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v16B02
5EJ8A 2OZLA 2VBGA 3F6EX 5K2OA 1X7WB 5EJ7A 5I5GA 4JUDX 4RJKA 1Q6ZA 2C3UA 1U5BA 3MOSA 1UMDA 3ZHQA 1UPAA 3RIMA 2BFDB 1OZGA 5HJEA 3AHGA 5ESDA 3AHEA 5DEIA 4MPPA 2WVGA 3EXFB 3ZHVA 1UMBB 4Q9DA 2JGDB 1QS0A 2VBIA 2R8OA 2PGNA 5DGDA 2Q5OA 2PGOA 2XTAA 1GPUA 2IEAA 1YI1A 2BFCB 3FSJX 1X7YA 2X7JA 1X80A 2BEUB 1V11A 4COKA 3HYLA 3DVAB 2JI9A 2EZ4A 1OZHA 2JI7A 4QPZA 4FEEA 2C3MA 4KXVA 4XEUA 1AY0A 4D5GA 2FWNA 2EZTA 4KGDA 1V1MB 3E9YA 5K6RA 5ERYA 3HWX1 3FZNA 1L8AA 3UPTA 3AHJA 5I51A 1X7WA 3AHDA 2C3YA 1OLUA 2FN3A 2IHUA 2WVHA 3EXEB 2BFDA 4GPEA 3EXHC 4JUAA 4MPRA 2Q5JA 5EJMA 4K9QA 3EXFA 4GM1A 4JU9A 1MCZA 2JGDA 2YIDA 1OVMA 2R5NA 5HGXA 5EJAA 1V16B 1T9AA 1TKCA 1OLSB 1NGSA 1UMCA 2IHTA 3AHHA 3DV0B 2BFCA 4WBXC 5ERXA 2JLCA 3LQ1A 1T9CA 4C7VA 2BEWB 2G28A 2BEUA 4KXYA 3DVAA 4KXUA 2C31A 3M34A 3HWWA 4GM4A 1V1RA 1ZPDA 5EJ4A 2DJIA 2AG0A 5I5EA 2G67A 2Q28A 1POXA 2UZAA 1B0PA 3IAFA 1UM9B 1OLXB 2XT9A 1TKAA 2BFBA 2JI6A 1QGDA 5HHTA 2V3WA 1X7XB 4K9MA 2JLAA 1IK6A 3EXHB 2Y0PA 3ZHRA 4ZP1A 3EXEA 5K3SA 1UPBA 3ZHUA 1N0HA 2J9FA 1ITZA 1WCIA 1NI4B 2IHVA 1PI3A 1YI0A 1TKBA 2WVAA 1V16A 1UMDB 1V5EA 5FEMA 2UZ1B 4MPJA 1OLSA 3DV0A 3M6LA 2EZUA 1DTWB 4K9LA 1UPCA 2BP7B 2BEWA 1TRKA 2Q5LA 4GM0A 3AI7A 4K9KA 1PO7A 4KXWA 2VK1A 5HYVA 2QTCA 3LPLA 2BFEB 2JIBA 2W93A 5EXEA 1X7YB 1QPBA 4C7XA 1UMBA 3JU3A 2VJYA 4MQ5A 1X80B 1YHZA 1UM9A 4JUCA 1OLXA 2EZ8A 1Z8NA 1YBHA 2C42A 1X7XA 1KEKA 1W88B 3D7KA 2BEVB 2PANA 3DUFB 2NXWA 5EJ6A 4GG1A 5EXDA 4K9NA 4K9PA 3L84A 1NI4A 2VBFA 5IMSA 3AHFA 3AHCA 1T9DA 3AHIA 5EJ5A 2PDAA 1YD7A 4RJJA 1X7ZB 3M7IA 2BFFB 2JI8A 3EXG2 1JSCA 1OLUB 1V1MA 1PVDA 1OZFA 4MZXA 4K9OA 2UZ1A 1V5FA 1BFDA 3EY9A 5I4IA 3EXIB 3M49A 1DTWA 2C3OA 1W85B 3LQ4A 2BP7A 1UMCB 2EZ9A 3ZHSA 2G25A 2OZLB 3EA4A 2BFEA 1YHYA 5C4IA 2YICA 2Q29A 4JU8A 2O1SA 3OE1A 1U5BB 3ZHTA 3OOYA 1V1RB 3EXG1 5K6TA 2Q5QA 4FEGA 4KXXA 5AHKA 1QS0B 2Q27A 1W88A 2BEVA 3EYAA 1Y9DA 1RP7A 3DUFA 4JD5A 2BFBB 2E6KA 2AG1A 1POWA 1R9JA 2O1XA 1T9BA 3UK1A 2QTAA 3FLMA 4GP9A 2R8PA 2VK8A 1X7ZA 1V11B 2BFFA 1V5GA 5EJ9A 3F6BX 2VK4A 2C3PA 5DGTA 2J9FB 1PYDA 1WCIB 3KOMA 3EXIA 3IAEA 4JUBA 1YNOA 2XT6A 1W85A 4D5EA 4RJIA 4QELA 4QQ8A 3LQ2A 3EXHA 4JUFA
chains in the Genus database with same CATH superfamily
1T8TA 1BMTA 1J0DA 1WQ4A 4YRGA 4BB0A 3NHPA 3RCBA 3TZKA 1RXIA 2JGKA 1P2FA 2PWZA 3DOUA 4GMHA 1NW6A 4IIVA 5A9SB 5EESA 4EJ2A 4XIIA 4MPTA 3WYAA 4L4ZA 3E82A 2R84A 3D3WB 2YXEA 2DWPA 3I83A 4WRRA 3GGGA 1NOJA 1U90A 1XWWA 2CLEB 5FTLA 3W6PA 3VH1A 1VCIA 1E9RA 1SNYA 2WZDA 2R79A 3LZCA 2DZDA 2YYSA 3WLMA 1TD9A 3ZDZB 1RPNA 3GEHA 2JF0A 3KLOA 3PQDA 3F98A 4IHJF 1TLFA 4IRXA 4JC4A 3PNQA 4R6WA 4XVRA 1W4LA 1X3SA 2OBMA 3PX7A 5DGIA 3HO8A 1E6UA 1ISHA 3FUVA 2GZ1A 3WIUA 3U7HB 5C8ZA 3ND7A 2G9QA 3INYA 5ER6A 2C0QA 2YZNA 1Z4IA 4V3CA 1NVTA 2HDOA 4NZPA 2QTWB 2J30A 4JOSA 1PU2A 3HXQA 3LDGA 2LGJA 4DYDA 1MX1A 1SFRA 4TMFA 2OMKA 2PBLA 3M6XA 3GLVA 2PGOA 3PR3A 4OBXA 4WJZA 2DQ4A 1Q1AA 2I8CA 2KLBA 1J39A 5KC8A 1OD6A 2F55A 4X84A 3V8NA 3ORSA 4BMCA 1UKBA 2I9PA 2QZJA 3G8YA 1FY2A 4L5YA 3O1LA 2P4SA 4PZUA 4A5OA 1YVUA 1DUVG 1DLJA 3RUAA 2W6IA 1LCIA 2PXAA 1T6BY 5HIJA 4NCNA 3MJEA 2OCGA 3GGPA 1W73A 4LVNA 4EH1A 2W42A 3F90A 4UNQA 1UQRA 1WHSA 3E18A 5F51A 3S28A 3GIDA 3U3MA 4CV2A 2O4CA 1BVYF 2WU3A 1WD5A 2ZQZA 1HURA 4KLRA 2X8AA 2P2DA 2EERA 1GN8A 1P9NA 4HOYA 5CJJA 1V11A 3NOVA 2R6CA 4KN5A 1FMFA 4R1QA 3AY3A 3V8BA 2X9NA 5L4NA 3EQ7A 2FWAA 1IUOA 2DFKB 1XTRA 3AKEA 1O97C 5JZSA 2JFQA 1N2ZA 3UANA 4DC0A 1MJGA 2JI7A 2QTGA 3PGVA 1C4WA 4MIKA 3VTZA 3DO8A 3CEHA 3FCCA 3KJZA 1W4ZA 1XDZA 4Y2YA 4HRAA 2YS6A 5B7PA 4E14A 3HHPA 1A50B 3E4DA 4QVKA 1OW3B 2G9ZA 4UUQA 5TS2A 1ZAYA 4YJHA 3TJRA 3I64A 1CVIA 3E7DA 4HAUA 1SK8A 4JB2A 1RBQA 4REOA 1HYQA 1UBJS 3WB9A 2W2MA 1KEEB 1L5LA 2X9LA 3AERA 1IL0A 5U4XA 3THYB 1ZJ5A 4DB2A 1AKMA 1WXDA 2VHQA 3BF7A 3CU5A 2F17A 3AH8A 4P36A 4TS4A 4EFDA 1GNVA 3I42A 3P9QA 4GYWA 3RH0A 1ISRA 1TU3A 4RIIA 2NZVG 3R8FA 2QY6A 4X97A 2PGXA 3NBQA 4NYJR 2O9JA 1M74A 4P92A 4PQRA 4E21A 4E5UA 1ZH6A 1OYOA 3QIAA 1GAQA 1XLWA 3OM0A 1VP3A 1IZZA 3OOHA 4RA6B 4RIHA 2OFOA 5DXAA 1AZWA 1YE3A 2YN0A 4JYMA 4I3HA 5IX8A 2PA3A 3QFSA 1RPJA 1ZD1A 5FPYA 3NYWA 4PGGA 1XRMA 3FTCA 3OMLA 3UICA 2PGJA 3L7CA 3FMGA 3UG6A 1Z3IX 4CT5A 2IHUA 5K7SA 2EWMA 3JQGB 4PS0A 5DNAA 4BWFB 4Z54A 1EFLA 3P5BA 4BLWA 4DOMA 2FZLA 3C8MA 3EXHC 3WKEA 4RPKA 4LWQA 1DZ3A 2HBYA 2JKZA 4RF5A 3K4HA 5E95A 1DQZA 5JIBA 4PO8A 3PJFA 4QDKA 4Y8VA 4DL9A 2HY7A 3R7WB 4D46A 1JEAA 4WKOA 3M6FA 3X1MA 4WD3A 4YP7A 1ZUWA 4WX2B 1UC9A 2ZIFA 3S29A 3SC2A 4US1R 2V1UA 3ZBUA 2GOYA 3U37A 1KQOA 3OFNA 2GZ2A 1VPTA 1W96A 3CIFA 5F1YA 3A6FA 3AF2A 4X3CA 1NQAO 2CKDA 4KXQA 3GUYA 4EHHA 1AB6A 4IIBA 4PZLA 3BUSA 1SQ6A 1V2GA 2Y1OA 3G2NA 5ULLA 3ZY2A 1Q84A 2Q8QA 1TMYA 3AU9A 4J0HA 2KMLA 3THOA 2WJ6A 4C7KA 1QO0D 1II8A 4NTZA 2WY2D 3VOAA 4F2GA 1T9ZA 2GAFA 3SQMA 2REXB 4BDSA 1EFPA 1IB0A 2Z2ZA 3AETA 2ZBFA 3RVMA 4LRQA 4MGYR 2RHBA 1GUYA 2HCBA 2J9RA 3WQQA 4DWOA 4NEGA 1GNRA 1I2ZA 1Z34A 1GTSA 4UW9A 2PQ2A 2RKBA 4OMFG 3D9QX 4CM4A 2FSUA 3R4CA 2VPTA 2IEBA 1FSFA 5EVCA 1WU7A 3PBKA 3BMCA 4LE1A 5K8CA 2HA3A 4IQ4A 1RHKA 3N8GA 2Q9AA 3W2FA 1A8PA 1K66A 1PGPA 2GILA 4K6GA 5AJZA 5AXDA 4DSTA 5TQ2A 4BRWA 5I3ZA 1UODA 5EJ4A 1Z2EA 4U6NA 3QBVA 1Q1GA 1W8IA 3KL2A 2P2ZA 3QOXA 4RLFA 4Q3DA 3JQ9C 2K2WA 4IMRA 3JY6A 4YJKA 4BFWA 1JZSA 2Q28A 3H3FA 3NX4A 2ZUUA 4JLMA 2HHJA 4YJDA 5ED0A 3UXYA 3RG2A 4CEIB 2OZPA 4C87A 4EW2A 1MOSA 3PPWA 4GZMA 4V39A 4BC0A 3GJSA 4M6WB 5B5SA 1Y3AA 4J7CA 1SZCA 1TI7A 3FTDA 3WBFA 5AIBA 4DG5A 3NTVA 3WKDA 5G4LA 1CEXA 2O1WA 1XZMA 2GZDA 4MUKA 4YH1A 3FAZA 4LN1A 5F2NA 2QL5A 5FV4A 4KFTA 1JGTA 3U4QB 1ONSA 4DREA 1NP6A 5ICMA 4A3SA 3VAZA 2O5VA 2Y4OA 1JEEA 1XHFA 3Q6NA 1PNOA 1U1EA 4JC5A 2B5OA 4MR8A 3I32A 4R3WA 3KKPA 2B1JA 2OG2A 2XZLA 3HYRA 1FTGA 1K9SA 4TKUA 4Q1FA 2MWMA 2FW0A 1H66A 3DAYA 1CZHA 5LA6F 5IRCD 2QN2A 4LXQA 4B6JA 3DQQA 3KXLA 1XLTC 3GH1A 3KXPA 4QAQA 1L5GB 3TW8B 4GOJA 2K4MA 4KO2S 3T15A 1RXUA 1YJAA 1YVDA 3A2NA 4J1TA 3EXEA 4D0RA 3HGQA 1RYMA 2R00C 1ABBA 5J2TA 4BKPA 1MRZA 3IURA 4BMNA 3PXDA 4D4LA 1AK2A 4MGZR 2JZNA 3P1JA 4FGZA 4RTLA 4RY8A 2H0RA 1ZR2A 4MQ4A 1DIOB 3NNSA 4TUYF 1RYDA 1ZSYA 3BE6A 1EMDA 2QE7A 1Y9AA 2PKQO 3L2OB 4E5NA 1YI0A 4HQNA 1XP8A 2YQZA 1ZMXA 2YV1A 3RRZA 1ESCA 2DP4E 2JEYA 3DEIA 3FUUA 1BWRA 1H2HA 3K2BA 3ORQA 1L9KA 4PX9A 2FRDC 2XUDA 1EGHA 3ANSA 5AXBA 2C0PA 5GVRA 3GGCA 2BFPA 3QQ5A 1X1TA 5EOVA 4IIJA 4QEZA 4CM5A 1EFTA 1QKJA 3N2GA 3RM3A 1SUCA 1IBSA 1MORA 3GRFA 2CN1A 1QGOA 4U9UA 3SZOA 3MT7A 1PEDA 3I39X 2HAEA 1I13A 1ISSA 1V3TA 2Q1XA 1KKUA 1ACJA 2QVZX 3OP4A 1L5ZA 1FXUA 3MCZA 5A4JA 1JHQA 5BUSA 4TMXA 3UB2A 5FFNA 4G5QA 1X15A 4B3JA 3F8TA 3D54D 2YFKA 1P0QA 4WZBA 2R1TB 1KVSA 4Y2UA 5BO5A 4OGGA 4IEFB 1HQKA 1L1EA 4ILKA 2CFOA 2BN4A 2WJWA 4LMRA 4WMLA 2WB2A 5E7JA 1Q1EA 5C37A 4KACA 4ZC1A 1TMGE 3KJIA 1GL7A 1QGUA 2F00A 1PWEA 2CLDX 3EG9A 3QJYA 4G5YA 1Y6ZA 1XG5A 1IZ8A 2C2YA 2BV3A 2R751 3QU9A 4ER0A 4PZYA 1TC2A 3WLEA 1L7AA 1F0KA 4WBNA 1JH9A 5IAAA 3DOIA 2JARA 1K5PA 4PINA 2MINB 1ULHA 4TWAA 2OGTA 2XIJA 2REQA 3SZMA 2H57A 2YWDA 4AWXA 4I7EA 2VJYA 4ZDJA 3CBQA 2IBSA 3HU1A 1FZTA 1MIHA 4BBAA 4M86A 5J58A 4PIMA 2Q2NA 3QLEA 1HY3A 1XHEA 2COKA 3HB1A 3LT4A 1YHZA 3FMVA 1J2UA 2ZCUA 2FFHA 3R4VA 1IYZA 1ODFA 4GI2A 4P4LA 1NVDA 1U5CA 1V1JA 5HR5A 3RSLA 3PRKE 1A5SB 1NNLA 5DBFA 1JXAA 2D1YA 5JDCC 4FLFA 2ZBUA 4DVGA 3IUYA 3D0RA 4LJSA 4R4JA 4CIDA 2Z3WA 6LDHA 1BS9A 2BE9A 2NO1A 3D1VA 3JQ7A 4Z0PA 3HYNA 3WKBA 5A9TA 5FEUA 1O8CA 1Z8NA 3MTDA 4BKOA 3CZ4A 2YZ7A 2I6FA 1L5VA 3O38A 3LUGA 1RXSA 1N7GA 1NDHA 2CVFA 2VP2A 4DLZA 2PV7A 2W90A 3B6KA 4PAOA 1RYYA 1BDJA 1XFDA 2H1IA 5JE8A 1Z7YA 1V8PA 3C43A 4ERXA 2H11A 3ZC3A 1A9XA 4RTRA 3D3KA 3JXEA 1E3TA 2CNWD 1QP0A 4E31A 1P1BA 2YTZA 4JT8A 1IY9A 1PR2A 5EXDA 3W5IA 1WA5A 2QAJA 1TAUA 1JG3A 4GYYA 4G1EB 1MDBA 4EW1A 3A0UA 2Q50A 3P2KA 1B3RA 3SZGA 3TQRA 2BI4A 2NT4A 4QOGA 4HT3B 4ZAYA 3FWKA 2H63A 5FTNA 5IFLA 1RZRA 2AT1A 1GSHA 3QUQA 1OH8A 3C5EA 2ZQYA 4LIPD 1Z63A 3UOGA 1DBRA 2XT0A 5EJ5A 4RJJA 3N8DA 421PA 3QVMA 3DEAA 1NXWA 4PTLA 3V8EA 4YIHA 1FP4A 3K0AA 5HOEA 1JSCA 4IXWA 1V1MA 4RTSA 2IYPA 1VIAA 4R0VA 2B99A 1N9KA 2VF4X 2Y0DA 1N57A 2A86A 3QI2A 4DIDA 1SQSA 2ZREA 3PFGA 3D8NA 3MUEA 3UV3A 4ZDIA 1LW6E 2IYSA 4QTXA 3T9EA 1HBJA 3RE1A 1G5FA 5MN5A 1NL3A 3O90A 4TROA 2IYAA 3OTIA 4J07A 2HQOA 1WUTA 2YWEA 3I6QA 4N5DA 4ZWNA 4I8XA 2VP9A 3RC1A 2J0UB 4GT1A 1FX0A 4UNPA 2IZ0A 1CNEA 3GT7A 1ULUA 5BQ5A 2OQVA 4DQKA 3IBYA 4M36A 4CJXA 4LMAA 5ALUA 4F6RB 5BR1A 1ZJ6A 5LR6A 2ZKIA 3Q2KA 4K88A 5KINB 5LP6C 1JB9A 5TV2A 3ZD7A 4UNNA 4N3CA 2Z2XA 2EP8A 5DLPA 3ZWPA 2HSGA 1RI3A 5DLQC 5T3YA 4YGXB 3BD7A 3WICA 2B36A 1N8TA 2Q2VA 2BFEA 3GAZA 4KNVA 3TRJA 3VYSB 1T2CA 3A7DA 1N3LA 3KAPA 3P94A 3PXXA 4JU8A 1PT5A 1T13A 3NDRA 3QHQA 1JDZA 3KQSA 2FUG6 3OE1A 4HH4A 4LXUA 4PYOA 5TT0A 2WQ6A 3L06A 3QPWA 3UMGA 1EP9A 3TL3A 3IPRA 2HFKA 3ICPA 1L8LA 3OZWA 5I47A 3MSXA 4L5IA 2B9EA 1MEEA 1UJBA 3CRVA 2GERA 1JW9B 4TWBA 4V0MA 2HK6A 1RKQA 3IB3A 1NP7A 3MHPA 2O7NA 4RL6A 3GGDA 3A1SA 1NJ5A 2N1BA 5HCIA 2ESRA 3K9HA 4UMDA 3T3DA 1L5YA 1U1CA 1X1BA 1Q92A 2NZ2A 4NPHA 3GZTB 5LPNA 1G20E 1ZIPA 1GGVA 1VRVA 4KOEC 3VUEA 5B3LA 2RAUA 2YH2A 2YNMC 3LCMA 3EEOA 1OIVA 5TPZD 2QBYA 3HP7A 3RYIA 2OXFA 3U4MA 1JA9A 2W9XA 3FB4A 4OHVA 4CM8A 5KBYA 1FEZA 2FSIA 4L8VA 5CK5A 2BEVA 3NDJA 2I7XA 4UMFA 4PPQA 3EOZA 4FGUA 3A27A 4K8OA 1CS0A 4MSUA 3ONFA 3R40A 9ATCA 2AJLI 2WT4A 3CE6A 1L4NA 2UXBB 3OO1A 1W47A 4BLRA 3CNQS 2Z56A 4UTVA 1KP2A 3TAHA 1RJ9A 4ARZA 1QG4A 4KMSA 1H8HD 4WK2B 2Q2OA 4M1TA 5CA0A 2B2CA 3E8SA 4FR5A 4Z7JA 2TMKA 3CX4A 4XGNA 1XZPA 4YV7A 5IYZF 4JN6B 5HJ7A 2CD9A 1PL0A 2XIQA 2QJWA 2OYCA 1GPWB 4YPVA 3O8LA 1P0MA 5FA8A 1NN5A 2Z5LA 3CRMA 1V11B 3T5AA 1DDIA 2Q4DA 4P35A 4K1LA 1L7RA 4J0JA 4KSYA 5K8JB 4MOWA 2BMEA 3Q0IA 1VKHA 2IQ5A 2B5WA 4IW3B 2X3FA 2QX8A 3DE3X 5DBEX 3V8PA 6ABPA 2P41A 5K51A 4DCMA 1CFJA 4D3XA 2PRJA 1IJKA 2FXIA 5HBGA 3VSDA 4ZC8A 5EE0A 4HWSA 3UK7A 1QORA 1W4AA 1JA1A 3ORHA 1IG0A 4M53A 1O03A 5HP4A 1JZQA 4CV0A 4JUBA 1GVHA 1Q3HA 3GRPA 4QICA 3DWEX 4PIPA 1YK0A 4G0PA 3STHA 1XBTA 1YAJA 4PCAA 1NW4A 3E1SA 3N0WA 3LC0A 4R2WA 5H1YA 3STXA 3FHJA 5DISB 3SP1A 4EO9A 2CB0A 4Z49A 3LQ2A 4JUFA 3O8CA 3I1IA 3PWSA 4MEAA 5UKDA 3PE3A 1XCLA 4P3XA 3DEKA 1GL9B 4F7WA 1MEJA 5FFMA 1GL6A 3DXXA 4KQEA 1FYDA 1I3KA 3MD9A 4HV4A 3QF4A 1OXVA 1TYEB 4BO0A 3T3NA 2BH2A 2CHEA 3EDQA 3UWSA 3VI3B 3R5TA 1V7CA 4JUDX 2RHLA 1FJGB 2VPZA 1JHMA 3B3FA 1DG3A 2ZAYA 3NVDA 3DMGA 1IMJA 1UWKA 1R66A 1YRWA 2AE2A 1H5UA 1VIVA 2PT6A 3D7NA 3N87A 4OAQA 4X7RA 3CC8A 5I7AA 5EGNA 3UENA 3K2EA 3SY8A 5IBCA 1B8PA 5TSDA 1GG5A 3S8YA 1OZGA 3U09A 1EU1A 1OFVA 5LMCA 1A8IA 1PAUA 3PYLA 1BEUB 2XYGA 3O92A 1LDGA 2BKEA 1W52X 2XY4A 3QLVC 4K26A 3OTOB 4IWYA 4MW1A 2H9AA 3ZHVA 3AY7A 3ZCPA 1W2WB 1UQTA 3U81A 4BGVA 3SC2B 1WDWB 2FPIA 2PGNA 2JNWA 4HEA1 3SZRA 4C89A 1G2PA 5C7LO 3QXGA 3EQ6A 3FLEA 2RAPA 4ER6A 1P1RA 1ZCBA 3AUTA 3C45A 3JPWA 3L7YA 1GR0A 4X7PA 3VI4B 1M6VA 2J67A 3DKVA 1F6WA 3AKCA 3OM8A 4U7DA 4XD2A 1FUEA 3KZMA 5IK2A 2DAPA 3HFRA 4OJNA 2P67A 1O77A 4CLOB 5GPBA 4M9CA 5JCZA 3U7IA 3GRAA 1II8B 4F92B 2VKTA 4IVPA 3DP9A 4LX0A 7ADHA 3GNTA 3AETB 3RU9A 1H94A 3GN2A 3ETJA 4KYUA 4MHOA 4NI5A 4FB5A 3A05A 3LK6A 4FDUA 2CBXA 2YW2A 1I0LA 4A8TA 5LNK6 3HDYA 4CM4B 2AQIA 3VRHA 2VO1A 1BEZA 1FP2A 2ZSAA 1KP9A 3BMCB 2JH3A 1C14A 3C6MA 3DTVA 3FPBA 4RPHA 2ANBA 5B3JA 1M6HA 1Q22A 4RGVA 3ZQJA 4B3CA 2CZCA 2E1PA 1KKMA 1MT0A 4LJYA 5ECYA 3ES9A 4D96A 1ADCA 4E3ZA 3X43A 4ZVQA 1FXSA 1VBNA 2YYAA 4GMDA 3W7BA 2ZXFA 2AR7A 4R3NA 4KXVA 3UOWA 4OLFA 5F5LA 5HRUA 1E5TA 2OXIA 5I9IA 3IKLA 4CM9D 1VFPA 2GAIA 2F3QA 1ACLA 1KFEB 5AHRA 2V59A 3OURA 5IARA 1C0IA 2I62A 3QU4A 3T1NA 3ZQ4A 4Q9HA 2Y6VA 1WO8A 1IG3A 4C3VA 1AVTA 1TRHA 1U2DA 5A5EA 3E5MA 3IBFA 3GX1A 1KZ9A 4L8WB 2XX3A 5IDQA 4XSGA 3LFHA 4ZMBA 2GZAA 5BT9A 5EZ6B 3G2JA 3JQBA 1JU4A 1ZX1A 2HV8A 1C8LA 1XJ5A 4MEBA 2H65A 4MR8B 1FNSA 4ENPA 3B60A 5GOZA 1U8ZA 2XQVA 3G2PA 3JQAA 5CX1A 4TKUB 5AOAA 5JRDS 1MTOA 2WINI 4JI3B 3IQWA 5CCBA 4BATA 1MJNA 2QMQA 2VRBA 1I3OA 3BL5A 2VLIA 1QFSA 3O0DA 1C1DA 2IOQA 3RRXA 4DS3A 5JSYA 4F8JA 3A4VA 1Y48E 5C1BA 1XF1A 5AK4A 4E70A 2JJ8A 5ESXA 4P33A 2VQ6A 3EXEB 1C0KA 2W6PA 3HCDA 2ZIXA 5B58T 1K27A 3X1JA 3UYKA 1KETA 1PZGA 2C7GA 3GDFA 5J2TB 1BYUA 1XZFA 4AN1A 1FX1A 1U3VA 1X38A 3LLMA 3WL4A 1NAIA 1MAAA 1XTJA 2WKQA 2A67A 3QYFA 5EZSA 1A77A 1TCAA 2Q5JA 1B76A 1Z0KA 3VBEA 4ND1A 3F7OA 2VSXA 4RCYA 3ACBA 3H4VA 5CIWA 5BW5A 1FUYB 4ZXPA 5ICEA 1GZ6A 3RQIA 4XUGB 1Z16A 3QSGA 3UCFA 5HGXA 5SY4A 3Q5DA 3FOFC 4DPKA 1I2DA 1P31A 1XXHE 1GSAA 3IGFA 2UVDA 2B30A 4IIJB 1GCOA 3RAFC 2OG1A 2O2JA 4KKXB 4BGIA 3K5IA 4IZIA 4KEAA 2G9UA 1NVBA 3MCAA 1IH8A 1HT2E 1YJ5A 2PZFA 3C1UA 3C1AA 3CJRA 5CFNA 1NGSA 1YR6A 4XCQA 2OZVA 1EQAA 5E1OA 3L8DA 4CIXA 2ZDHA 2WWIA 4HO1X 2VC2B 5ALDA 4WZBB 3OCJA 4UEOA 5B55A 1BQ4A 3FSRA 4WBXC 3W5CA 2V7WA 3KWMA 5EIHA 5T64A 2ZWVA 3R7BA 3JYOA 5TJHA 3GRKA 4C7VA 4JLPA 4REQA 1QGUB 5LZ4A 4CF6A 4XPIA 2V6MA 2X22A 3JAKA 5K8IA 4IWNA 4AJIA 3AVYA 4J6FA 1UQUA 2FE1A 3D6JA 1AE1A 4UDNA 3ZIDA 1YS1X 3QKSA 3ZDDA 4LOKA 4WBNB 1C7QA 2WM8A 1WV0A 1H4TA 4C21A 1FJHA 2HCJB 3R0QA 4M9QA 2C9BA 4EY5A 2ADMA 1KOFA 4FMBB 4MP3A 3C8DA 2XECA 1Z74A 1QQTA 2UZAA 2YWGA 3BKXA 1HFWA 1UAYA 3MD0A 4HNRA 4Q3EA 1Z4QA 2RGUA 5EI5A 4X64B 3AM4A 1COWD 2WNIA 2ZJ6A 4M9ZA 4OBEA 3UAVA 2QU7A 2RDMA 5F1PA 5JZMA 1OH6A 3LMKA 1HE2A 1OF1A 1YIAA 4U9HS 4C5CA 1XZLA 1Z5UA 2BFBA 3FGNA 3E0XA 3D2BA 3R0JA 4MJ7A 1U0BB 4TM7A 3I4FA 2P40A 3AG6A 4IVNA 4AKHA 4NDZA 1RI2A 3N07A 2DTDA 4YV1A 4BNGA 3GFVA 4EJMA 1R8QA 3O73A 4UBNA 3W2TA 1KFBB 2DMRA 4NHOA 3W1VA 4I19A 1WU8A 2VP3A 4B6FA 4OK6A 1A9XB 2MSKA 3DZGA 3ENKA 3EEQA 1JR3E 3BCHA 4OEHA 4E2XA 2JVKA 4Q6WA 4EG5A 5KOJA 3QX7A 1P7YA 3N0TA 4DEYA 1RFLA 2ABWA 4WK4B 1HDRA 3OE7A 2WDZA 4MYTA 5IXYA 2Y1CA 4AMGA 3DW1X 1V4BA 4EJSC 4D8VA 1N0HA 1SVSA 1ULSA 5KKNB 3K73O 2CE7A 5FQOA 1IXZA 1SPBS 1SBIA 3BWEA 3CH7A 4WJLA 1YZYA 4BVJA 1OU0A 1YJQA 2IHJA 1NMZA 3NC1C 3ZK9A 3B53X 1CB0A 1J8FA 4HDAA 4ZQEA 1LNZA 3TLCA 4CODB 3DEJA 3Q7SA 2EKZA 1UH5A 1FP4B 3P9RA 4EAAA 2GAOA 2WUGA 1BDMA 1JJBA 3E9QA 3FGOA 4FMCB 1JR6A 4JJFA 1GZDA 4Y2HA 2G71A 4RSRA 2G83A 3CZAA 4OQXA 4LEIA 1USUA 4B5LA 2IL1A 3IXQA 4H1WA 4G9BA 1XR3A 4HS9A 4H1TA 4QLBA 1HORA 2XUJA 4IR7A 3TL2A 3DV0A 1LX7A 1USVA 4X3PA 5F2OA 3IV9A 4Q1VA 1KQPA 3UMSA 1PFYA 2FWJA 1YRQA 4KV9A 4QOHA 1FX0B 5B1IA 3UAOA 3BSYA 3RBVA 5K0GA 1IN1A 2LCIA 4K9LA 2VYVD 3HWSA 1SZDA 1OYWA 3EQ2A 2JLXA 1L5SA 3FM9A 4CM3A 2BEWA 2ALJA 4OSEA 5K5EA 4HG2A 5T57A 2IYXA 4J7AA 2NW6A 1PS8A 3IC5A 3USZA 4YR9A 3F73A 1MJ5A 1GGMA 2J41A 1O95D 2H6EA 5CEEA 3UTCA 5IT5A 4J0QA 1ZK2A 3DKIA 1C30A 3S1LA 2BFEB 3NHFA 1G42A 2PGLA 4YQEA 3TDMA 1MOZA 2A33A 4XVQA 4YCDA 5E7QA 3ESYA 1SVNA 3WR5A 1XCJA 4BLSA 4DC9A 2Q1WA 3LL7A 3QVGB 1Y3BE 4KI7A 5C2JB 2C2OA 2ZUFA 2Z8YA 5TDHA 1QBKC 2X5OA 5K0EA 5JO0A 1OJLA 2P9CA 4YVFA 3VSCA 3ZKWA 1Z25A 3ZZTA 3M33A 3EPKA 3ZH2A 1V5WA 5AKIA 3IP5A 4EDFA 4AJ4A 2QR3A 4KO3S 3TR6A 1XZJA 1QFJA 3HWRA 5AW1A 2WPDA 1Z83A 4BLTA 1DWUA 3EXAA 3LECA 5COAA 4DMKA 2XOKD 2CB9A 3R3HA 4B7ZA 2Q6KA 3PYMA 5CA0F 4W5QA 1EYZA 2PUBA 1XPJA 1ZJJA 2PS1A 5CP8A 4M9UA 3A26A 1UC5B 1YBHA 2DLDA 3GMIA 4NYIR 3RYIB 1EFAA 3TI7A 2FVYA 1ZM7A 1TCCA 1Z38A 1IOWA 3M4JA 1EHYA 4CM8B 1JLMA 2PQMA 3N6VA 2BEVB 2E49A 1XZCA 4R1LA 3JQCA 3MS7A 1CS0B 2ICAA 1CY1A 4ZVRA 3RKRA 5J4YA 4CMKA 3NR2A 4LYJA 4UD6A 1FVHA 4QECA 4RWZA 1JG4A 1GXSA 3NT4A 5JDIA 3UWOA 4X65B 1BDBA 1RJ9B 4ARZB 3WK6A 3UK0A 3OC6A 1Z6AA 4G0VA 1S02A 5I9BA 4F5EA 3E03A 3E9EA 5JS7A 1K6MA 5DSTA 1FFWA 1X3LA 1Q16A 4ITUA 2O7SA 3A4NA 3AHFA 3LD9A 1Y6GA 1D2NA 1FUIA 5K4AA 3BCRA 2PDAA 4NFHA 2IYZA 4WADA 4BP8A 4W9MC 1G0NA 1ZVJA 2EJBA 3O03A 3VPFA 4DLSA 4NOMA 4LF6B 1YR3A 1N4DA 2E21A 4D41A 5AHXA 4RLSA 3D6HA 1NJSA 2G70A 1ETHA 2ATVA 2FCRA 2W2VA 3LL4A 4NZNA 4TTJA 2NVBA 1KQNA 3NHUA 2J6HA 1FU7A 2YZGA 4PS1A 1JVNA 3RFCA 2WFMA 4GR4A 4K87A 1OV6A 4MYSA 2HBZA 5JALA 1U94A 1N2OA 3OZAA 4QOJA 1QFYA 1A82A 4LGYA 3RRYA 4CTKA 4DWJA 4QHSA 3LOPA 4M0PA 4CQMD 1E2FA 1IUNA 4YRAA 3PF8A 4II3A 2IHKA 1HOXA 4OXNA 4YDQA 3D8TA 4NJMA 4WNCA 2GXAA 4C3ZA 3K0EA 1KSJA 1DAHA 1JIKA 2H4YA 5G3YA 4UJ3A 2CBGA 4XWYA 5EE3A 3VR3A 3K8OE 5GP1A 1K2VN 5DSZA 2O4UX 4L85A 2I5PO 3ROQA 3B9QA 1C3VA 1SURA 2O2SA 3ZHSA 1GT6A 2OB2A 1J25A 2WTAA 2GEDA 3L93A 1IJBA 3DZ8A 1EKXA 1R88A 3QF4B 4B3XA 1P4SA 1GM5A 2RGWA 5C4IA 4EG4A 4CPDA 4NAVA 3L40A 4G41A 4I50A 1DO2A 5HE9A 4CT4B 1A9RA 1RWOA 1XZBA 3K16A 4HNHA 3TQIA 1GNSA 4TYQA 3WYEA 3IILA 2HBRA 1JHUA 4ESOA 2GPAA 4HWRA 3S2SA 3ER6A 5TQJA 2LW7A 1TF5A 2VP6A 4DMGA 2J08A 2QUAA 3MFQA 3COPA 4CETA 5LL6P 4GGPA 3G8CA 4OJMX 3NJRA 4PZCA 3M5WA 4W7IA 4R8MA 4WY8A 2AXNA 1Y5NA 5DNDA 3UJBA 4EW3A 1VL2A 1ZWLA 1K6JA 1PL6A 4IHAA 4WLNA 5K6TA 4FTWA 3LT2A 4HDRA 2QSZA 3QG1A 4INOA 3TXXA 2OESA 1WUJS 1SCDA 4NLLA 3RREA 4KXLA 3FG9A 2RE8A 1ZD9A 2PAFA 2OK7A 2ZYIA 3W77A 2FPIB 2OM6A 2UVPA 2Z3VA 2OPHA 1QQ7A 3RW9A 3L82B 4RF3A 4AMVA 5BRNA 3S2UA 1VXRA 2ERCA 1XGKA 4CBVA 5C7IO 3REFA 3SQXA 3B1JA 2WLTA 2RSLA 5KCMA 2M6LA 2B0CA 3I9NA 1F5SA 1JJ7A 2WMYA 1M1YB 3C1OA 4P4TA 4QIHA 3A4YA 6ADHA 3W5VA 3NHZA 1SPXA 3SFVA 1VMIA 1W49A 5K6AA 4TN1A 3FHCB 4YP5A 1CUGA 3LBAA 1ISGA 1DKNA 5H9VA 3MYYA 3VR5A 1D7OA 2BM1A 2OQ2A 5ALWA 2X3YA 3V4PB 1YTUA 1DAKA 3QA9A 2IIQA 2AR0A 3N2IA 1XROA 4H4DA 1KP3A 2XCQA 3MMSA 4H27A 3DTVB 1TM5E 1ZXBA 4WZAA 3F5MA 3TO5A 3DL0A 5MHTA 1DCFA 3UJ8A 2HPAA 4J6EA 1EVQA 2A4KA 3R3SA 4PSUA 2Q62A 3UAXA 3R9XA 3IUBA 5CDFA 2QMYA 4NBWA 3LHDA 1ZEJA 4LOAA 5AR1A 4TZ0A 5BSMA 1OXKB 3RIHA 4HH0A 2AQKA 4D8TA 4B76A 3H9UA 2H1CA 2MJLA 5CFMA 1W85A 2CF6A 2ZFUA 3LH5A 3AVQA 1JDUA 4GPD1 3QWIA 4LK2A 1QPGA 1NJGA 3DBVO 1SCKA 2JGLA 3GMDA 3LXMA 4YCAA 3MBOA 1FTNA 2FDRA 3JD4A 3X1ZA 5HA5A 3VKHA 3AKDA 5JMWA 1IVSA 5DTQA 3N28A 4TL9A 1G19A 3ISTA 5EGSA 3HYSA 3OX4A 3F6EX 2K87A 3BMXA 1BXRA 2P2LA 3JQAB 3LYUA 5CX1B 2FQYA 2J07A 3AGQA 3DO5A 1NDUA 2FMHA 2GTHA 4WQMA 2O5EA 5KWIA 2PS0A 4Y9RA 2G88A 4E5SA 4JJ6A 5IZ4A 3VVCA 1C1DB 1EP1B 2PRSA 2WUEA 4WE3A 4FHGA 4Y9DA 1QRTA 2WDPA 3DLPX 3FFXA 4P3KA 2R86A 3LDFA 2OZEA 4AZ3A 5CLGA 2ZIXB 1KYTA 1N5DA 3K2IA 4N5HX 4JLDA 5ESDA 4I4NA 4H16A 2B7BA 4FBMA 3ML1A 4L57A 3SNHA 4YCBA 1FS6A 3VZPA 4YO7A 1RFGE 1HEUA 1TQ6A 2CNLA 1LZKA 3BZWA 1KDYA 4G9GA 4I4TA 2IU4A 3KKEA 1TJ5A 1UWVA 2C4NA 1A98A 2ORWA 4J0GA 4KO4S 1EBFA 3SYTA 4A8PA 3TG2A 3HM9A 4MI6A 4JIMA 1ZR4A 3VR6A 4QVGA 2KX7A 2AMYA 2VPYA 4JELA 2XZTA 4JFRA 2QF7A 4L95C 5IW8A 1ZRSA 2C7BA 4QJ5A 3ZQ6A 3C6XA 2CFIA 3EWNA 5A06A 5K3OA 3IUMA 2JZCA 3NTLA 3IVAA 2C8KA 3ESBA 5ALSA 3WLAA 2DKOA 4RD4A 5EXXA 4R1OA 2XMRA 4WFQA 4BNTA 4F2DA 1AKNA 3U3XA 4EEZA 5K8TA 3W3AD 4ND6A 2ZIZA 5CM9C 3GLHA 3MAAC 3OBIA 1Z5PA 1E6KA 1MB0A 3FOAA 4M0MA 1L5WA 1KYIA 4G81A 3WBKA 4ER5A 1R9NA 1X7YA 2SKEA 4MW5A 3CX8A 2R5FA 4FCVA 2WW8A 2ZYHA 5AKEA 4ZQIA 4ZT5A 3TWOA 1NQOA 2D1SA 5HFJA 1AS2A 4FZJA 3ROTA 4P2BA 5DYGA 1YDEA 4TLEA 5DB4A 2IYVA 4LYDA 2PMFA 1M8GA 4P7JA 4REQB 1F38A 3M1LA 4G25A 1MP0A 3HADA 4XPIB 2PL3A 1RQXA 3JAKB 1SQFA 3OUUA 4TTRA 2W8BB 3WGMA 3D7MA 1KPGA 3RIYA 1QP8A 2G77B 2D62A 4NK5A 2Y1XA 3QKSB 1DCMA 2Z6AA 2VNIA 3C6ZA 3TQHA 5JCJD 4EQZA 1AUXA 2OMEA 2O05A 4QPZA 4AD8A 2C9MA 2C3MA 3JQEA 5CCXA 1AY0A 4Q34A 4R41A 4AO8A 4E2YA 4BWVA 5AUPB 2F6RA 1J00A 2X7HA 3JR7A 4NDNE 2JJ2D 4GMXA 4YP9A 1YQ9A 4XI9A 3W4KA 4F12A 3L79A 2QWXA 1XELA 4NAUA 2J5XA 2R0QC 4G1BA 1I4OA 5BV8A 3L0IB 4BE9A 1EFDN 2HN9A 4YIKA 2BHNA 3UMYA 2V4UA 3HY3A 2V7TA 1CJVC 5KNBD 3TMYA 3C5WP 4YO8A 2HMWA 1F7VA 1UINA 3TM4A 4RD2A 2H5IA 2WSSA 3ZW7A 4OAPA 1A5AB 3HHEA 4MJXA 4TLAA 4N41A 1ZZEA 2QV0A 2IX9A 2VDLB 4GX2A 2B7LA 2D0IA 3BN3A 4OQDA 3TW6A 4DLAA 5DBOA 1NSFA 2ZJ7A 3AHDA 3S1SA 5B2ZA 1KYQA 4KE8A 5A4AA 2YMQA 4TRNA 1C4XA 3BCUA 3E48A 2HXYA 5CG1A 4F38A 1RXWA 1FMJA 1WABA 1Z6YA 3U9TA 5KOJB 3SHFA 2YVKA 4FFOA 4JIGA 3NONA 1K7FB 4JS0A 5D3QA 5M7EA 2DT5A 4YQYA 2VCEA 3F4BA 4GGOA 3B6IA 1R4ZA 4JQYA 5GQSA 4O4HF 5GM1A 4BO5A 2BFDA 2G1KA 2I1VB 3IMEA 3OEEA 1OHHD 2E9SA 1AX9A 2C83A 3EIHA 2CNKA 3ZG6A 1M73E 3OQOA 2WV7A 3QOWA 1G8JA 4DXDA 4JEMA 2V5VA 2IDJA 3QWHA 2IVZA 2YIDA 3M6IA 3WGJA 1JXOA 1SXJE 4F1WA 3FDIA 3B7WA 3OHPA 1GQSA 3RBXA 4F5YA 1SXQA 5B37A 2IE8A 4U02A 5DHAA 4HNUA 2VUTA 2WSBA 1XRPA 1GCAA 2IP1A 4CIWA 4RVNA 1YULA 4RNCA 1KOLA 1U2QA 5KWEA 1S2GA 2OILA 5DP2A 4TYWA 3KKNA 2OFFA 4AKEA 1TKCA 2PX8A 4O8CA 4QASA 5EWMA 4YUAA 3ONEA 1KMMA 3WB2A 1FZQA 2XYHA 3DV0B 4RFVA 1KH3A 1KAHA 1Q5PA 5EFOA 2L19A 2IEDA 2FEAA 3EASA 4XM0A 3F3SA 1BNCA 2YXLA 1KMNA 3T52A 2GBLA 1P91A 1M1YE 2HMYB 2WWHA 3KHSA 1VGVA 3TX2A 2RJOA 1CVRA 1EUCB 1Q77A 1PYOA 1TTHA 5ERXA 2BKVA 2FKNA 3I4CA 3P71T 3VYWA 3W9SA 4YJ3A 2HR1A 5ERGB 3ZCSA 5JCXA 4UE6A 2A5DA 2BEWB 2R96A 2AFVA 2W2OA 4B4VA 5A5VA 3VAYA 3W1WA 1NN1A 1NTRA 1KVRA 1FTQA 1Z0JA 2PVSA 4KH0A 4R2MA 4RADA 5I9NA 2JIOA 1QHHA 4DM7A 3JAWA 1Z68A 1YXMA 2RGNC 1GL3A 2XUGA 3KXKA 1T35A 1S0UA 1C30B 1JXMA 4GM4A 4TKLA 4UDXX 4ER3A 2GD0A 3HE3A 4Q1AA 1W8DA 3GFBA 4Q7LA 2M32A 4WGFA 4KZPA 2ZR0A 1FFGA 2XUQA 2ZI3A 3FRJA 2WFAA 1H2FA 4DCJA 4YI5A 3CZPA 3TW4A 1CB7A 3MOIA 5CTAA 3ECAA 5IMBA 4BVGA 3D4BA 1J90A 2ZITA 4K0RA 5AESA 1IRXA 1JR2A 4GDMA 4FYYA 3ZKWB 3SKYA 1ZZGA 4UPEA 3ENVA 3FUWA 2OCLA 4HLQB 1MDFA 2A9RA 5ILQA 4AJNA 4BIMA 5FPKA 3TCKA 2BJVA 3ED1A 1HF3A 3FJ1A 3H6GA 5H68A 3ZBQA 2OAP1 2ENUA 4DZTA 5A4KA 1YCDA 4N8DA 4Q4HB 2J9ZB 2WF9A 2WJVA 3VHLB 3E8XA 2HRCA 1SBYA 4MJ3A 2GR9A 3T7AA 2Q5CA 5A0TA 1LDYA 1AKUA 3LA8A 4WFKA 1IUPA 1LLDA 1R6VA 2ZYRA 2RGAA 1N7IA 1T8UA 3CX3A 5IEJA 4Q47A 2VDPB 3WA6A 3RYHA 1GRQA 1Z82A 2Y4NA 4RVGA 3TNYA 2HA4A 3DO6A 2HZ7A 4CM7A 4CRWB 1GXSB 3ZCXA 1UXHA 3EUWA 1XTTA 4D9JA 4S1TA 4OCZA 4HMPA 1I7PA 3VZRA 5CXXA 2QPTA 5EKXA 3QOYA 4ZO4A 3PQ6A 4MVJM 4OMCA 4UBLA 3ZLVA 1JYFA 1Z3CA 1R9GA 2DH5A 2H17A 2QW1A 3R41A 2WMDA 4Q82A 2O6HA 3HXLA 1M3SA 1Y3IA 1NXPA 3H0KA 2P4QA 4JLSA 1KXJA 4M21A 1Q2UA 2JHPA 3R6WA 4DYVA 6REQA 5J2UF 3NBAA 1Z4OA 3V8MA 4PF1A 4B7XA 2HGZA 3V7UA 1R7RA 3WGYA 2UAGA 4O4JA 1GPDG 1VSUA 5HIIA 1E61A 4AMBA 4ZCTA 1J9EA 2DHEA 2YWCA 1UDRA 3BRWA 4MPJA 2JH8A 5GIOE 3S2ZA 5J5CA 1PS9A 1ZK3A 2A58A 4FDVA 2ZSJA 4PYIA 1FLNA 2JLZA 2Q0HA 1JAXA 1U3UA 2EZUA 2NZWA 4TYPA 1AMNA 1TYDE 3EVAA 1U9IC 4I50F 3IA2A 1GG8A 3G2LA 3WSVA 3VYUB 3GH3A 1VECA 2Z1NA 3SN6A 4NJMB 1MO2A 1C3OA 3EIFA 3OCWA 5DYNA 4UNRA 1A2OA 2A9FA 3DMPA 2I2WA 2JPDA 3OPYI 1SO8A 4FMPA 5CYFA 1EFUA 1P3JA 4OQMA 4DNPA 2XH8A 1E9DA 1H3EA 1WX1A 4UPDA 4IRUB 2N1MA 4ENSA 2WWWA 5AJXA 2I4LA 4KPYA 1Q0ZA 1XZAA 4R2LA 4Q9LA 4R0NA 4Q37A 1NSTA 5FUQA 3CLUC 1HH4A 1M2NA 2P9EA 4IS2A 1B0UA 3UWKA 4CL3A 5IANA 4U2GA 3S81A 3PC3A 3UC5A 3PUWA 4FMDF 4EB3A 1FLDA 2XJ4A 4FSDA 1S3GA 5ICFA 4L9AA 2ZYVX 3KKKA 5JJLA 4X94A 1L7BA 3A37A 4OTZA 4WASA 1F2TA 2E7ZA 3DPSA 1N0UA 1ZK0A 2ZVPX 3G85A 3G5MA 3H11A 4NK4A 4F0JA 5BURA 3OUTA 4J0DA 1XX6A 1Q3KA 4ZHQF 4XWKA 3E22A 1KYYA 4NEQA 1ZLXA 4LXXA 1U0LA 4G07A 4WACA 3DT8A 4HY3A 4JLJA 4HDRB 3WV5A 4BCCA 4BNKA 1HTTA 2BFAA 5CG2A 4YBZA 1XFAA 3H4TA 1AQJA 1U1IA 3WFJA 2E55A 4XVCA 1QG2A 1DUIA 2XQFA 3X1YA 3G7NA 3WHIA 3FR8A 1O97D 1SXJC 2QL7A 3N8HA 2I71A 1EM8A 5ER9A 4BJ1A 1P39A 1G5HA 4KRYA 1JTEA 2VH2A 3MILA 2XWQA 3GDWA 4G0YA 2Q3MA 3CWZA 4MKGA 3ZWOA 1QXSA 1Z36A 1J97A 2IH2A 1J06A 3UGJA 1HMYA 2FSHA 3O8OB 2WT8A 5JARA 4GXNA 4R01A 2DE0X 4ZVSA 3T7TA 1IHYA 2W6JD 3ZVNA 3EVEA 2JAQA 4KJXA 2YOHA 1UBGA 3AFGA 1A8UA 4ND8A 4O08A 4BC1A 4M8IA 2XLCA 3I2FA 4JVOA 1M1XB 1T0PA 1ONNA 3NV7A 3IEUA 3GFRA 4KGZA 3FCXA 4NMWA 4ZI3A 1W4CA 1WMBA 3HU2A 5HZMA 1NN3A 3SLRA 1PJ4A 2JBWA 4AI6A 3W1EA 1X8JA 3CPHA 4RVDA 4OLAA 1ECBA 1E7MA 2BKAA 4LNAA 2ZKLA 5AW5A 1N6LA 2BM8A 1YS7A 4DZZA 1QG0A 1U9YA 1RCTE 4RZ3A 3R9XB 1LTHR 4KUEA 1TB4A 4EA8A 2DKNA 1XQWA 2NXJA 1S2IA 1PFWA 1Z73A 5JEEA 2JGEA 1PJLA 3DXFA 3OJFA 2IYUA 3QKRA 1FU8A 3EJ6A 1X0XA 3H2GA 4L3OA 4X1KA 3STYA 4WHMA 1JAHA 2QR5A 2YJ6A 1NASA 1W85B 2AN5A 4QUHA 2OUIA 3QEBZ 3RV3A 3UUWA 1OU4A 5HK9A 3CUEF 1PBTA 3G2QA 4F06A 2WEKA 4AJ1A 1HGXA 1T0JB 2OY0A 1MD9A 5AJHA 3V9PA 3QTLA 1NBMD 3ILVA 4OD0A 1VBFA 3RFFA 3E27A 4BS9A 2XLBA 4WEOA 1ML3A 2Q99A 4HD8A 4DUGA 1U2DC 3ETCA 1KA9H 4X8MA 1MKYA 4INZA 3V5NA 1BXRB 4QGSA 2Z09A 4DKJA 1BMFA 3DT6A 3A9WA 1IIRA 4YWJA 5K0TA 5JASA 4TYYA 2PNJA 5BUQA 4K2HA 4QPJC 4AN0A 5EXTA 3A1CA 4NVRA 1I3MA 3IE0A 3UGTA 3VR6H 1CBUA 2LE0A 1CERA 3HKEA 2ZUBA 5IEBA 3CRNA 3FWNA 1BOOA 4AZ3B 3OPYA 2C98A 4DTIA 1J2RA 4O3FA 3E7XA 1U0HC 4EMTA 3VKWA 5AW6A 4JI8B 4OUKX 3URMA 4PN7A 4CTOA 1TJNA 2JANA 3T7JA 1J8VA 1XRSB 5FI1B 4AQ7A 2QD2A 3AMVA 3II6X 3OU2A 4YI3A 3GLIE 3PC2A 4IJUA 4NP6A 4I4TB 4D9KA 2HOQA 1FS4A 2FK7A 2XVXA 1IB6A 4IO0A 1YOBA 3F7TA 1XU4A 2MSLA 2XV1A 4KMRA 1SC6A 2ERYA 2JAPA 1CUHA 2PBRA 2QIOA 1G3QA 3PE4A 4IG4A 1E18A 4WKNA 4PG8A 1GA1A 1PEAA 1U31A 2H1OA 3OCXA 2I4TA 2JA1A 3NS7A 1T8YA 5KIAA 4L50A 4M1QA 1Y42X 4WOCA 4W9NA 2I67A 1G291 4C7JA 4FYVA 1CSEE 4L4YA 2AX4A 1J0XO 4M22A 4RD1A 4KZKA 4ASUA 2GS9A 3AUSA 3DLTA 1QIHA 2ZRIA 4NC9A 3A1VA 4XUCA 4NNOA 4C2UA 5LJIA 2WIBA 2PEYA 1XNQB 3GLHB 2OECA 1IN4A 2HIHA 2RJNA 3S2FA 1MAVA 3H1BA 1KIAA 2GEUA 3NYQA 1FC0A 2IH4A 4DR6B 2QTAA 1TT7A 3KFLA 4R2XA 3RVDA 2BZSA 3R6DA 2NYUA 1PJQA 2LUOA 1I4TD 3LBIA 5K3BA 5FA5A 4ZKDA 1AGRA 1SOMA 4L74A 1CHNA 4GFDA 4H77A 5ENZA 4BP3A 2WI8A 1PFVA 2WYHA 4TX1A 4BQSA 3P19A 3WOVA 3I5XA 1JQ5A 4WPGA 4YMSA 1W46A 1M54A 3CUTA 1JVSA 2PUHA 1DELA 3FMOB 4LECA 1LKZA 4MVCA 2X0NA 3PG5A 2NSLA 5IKMA 4W5HA 1C81A 4MWOA 4N4AA 3GLQA 4R9RA 3VPCA 3OPNA 4M1YA 5H02A 4CKBA 1JE1A 2P4HX 3HFJA 3OLYA 4NMXB 1GPJA 3MQ4A 3DZHA 1W94A 3B9BA 2IP4A 4KDRA 4S0XA 4YAFA 1YQWA 1YGPA 2GWRA 2QI9F 4O2AF 3WLHA 4Z1MD 1JHVA 3LVRE 2GZ3A 4V0QA 4B8ZA 4QELA 2RGRA 4GOKA 5BQFA 2JLQA 2AFIA 4X44A 4UJ5A 3U7FB 3PTAA 2QG6A 4C43A 5J4HA 3H9GA 2PMKA 4KUHA 2YYZA 3PXGA 1DO8A 3ZWYA 2DQKA 3TL6A 5JTUA 1QQ5A 3DYBA 4TTIA 3MBIA 2YWHA 1BDHA 1NIPA 3OCZA 1W0KA 2JASA 5BOSA 5IDWA 1ECGA 4YRDA 4KFUA 1TMKA 3SIWA 1ODLA 1V48A 4YFYA 1E2HA 3R5FA 5EKDA 2XTMA 4UTOA 5AVXA 1CVLA 3H75A 4RK5A 1MW9X 3PQ3A 5ARBA 3G1WA 2EG9A 3TCNA 1ESEA 5LQSA 2TMYA 1MB9A 5K4GA 3JWGA 2QVBA 2OO3A 1PT8A 4LWOA 3T5DA 2NTVA 3VYVA 3DZFA 1NRXA 2VS1A 2BFDB 2C61A 4M2LA 4P3YA 3NDBB 2PYIA 2HU7A 3PI6A 4FD2A 2JHAA 2V8BA 2VOEA 4PFJA 3CN9A 4PLGA 2D54A 2R8RA 4HUTA 3RAEC 2BY4A 3MA0A 1R18A 3WGOA 3C97A 1V41E 1BGWA 1T3SA 5J4KA 4U2KA 2WKSA 3WQRA 2V3VA 3QPVA 4YCNA 1NRIA 1U0TA 1EJBA 1NVVQ 2DOKA 4FJ1A 2HLPA 5DVZA 1E0SA 1IAQA 3MRSA 4UREA 5B6IA 4S04A 2M6RA 1UXIA 3GEMA 2V7QD 2ZT5A 4QTZA 5M04A 4KNWA 1XJ0A 1LPMA 1KIFA 1SBHA 2RH5A 4F2PA 1DE0A 2GWHA 2Q0QA 3N05A 1YDFA 4JL8A 4O6VA 5LQKA 4PX5A 2WWGA 1AKWA 1PT6A 1SQ0A 4MMYB 10MHA 3IV7A 5DBIA 4EEXA 1FRVA 4BXOB 1W0JD 3FPSA 2OLKA 1GUBA 1YZ3A 2BEJA 5IDXA 3WWOA 2Z9CA 4ZI2A 3AJ9A 1PWYE 4YJ3B 1V8DA 4DJFC 5FIUA 3A1TA 2QJOA 1OXTA 1O5IA 3NU1A 4O0MA 5DLEA 3SE7A 1NHGA 2YVAA 5JV5A 1PR4A 3QV2A 2ID7A 3CYFA 1O89A 1NPYA 4A6EA 1PGOA 1QHHB 1Z0SA 3JAWB 5T5QA 3JYLA 3MTIA 2P2GA 3KQTA 4N39A 5JISA 1H93A 4DWWA 4BZXA 1DQYA 2GRAA 4YLGA 4YJGA 2DEUA 2PKRA 1Z28A 3SLGA 4H1UA 3DMHA 1Q7CA 4ZU6X 5HVNA 1PK8A 3L0SA 1LPNA 2IDZA 4D5GA 5MN6A 3RAPR 4URHA 3ZXSA 3WAKA 2HA5A 3HSKA 4Z0TA 3PFKA 4UXIA 3FSGA 3CXUA 1NBAA 3Q1LA 1CRPA 4I08A 2WD7B 1DZIA 3HP1A 4UASA 1NC3A 2ZVQX 1JHXA 3K9BA 3QXJA 3I04A 4LOIA 4TS1A 1GOTA 4UM8B 2I7TA 4QFDA 2QZSA 4FDTA 4RKRA 3B3QA 5JVDB 1ZISA 3Q7PA 2YS7A 3OD5A 3ZLUA 1UXJA 4M0FA 1MX9A 4NE9A 1Y4SA 4FKBA 3GRVA 3CVYA 2FPLA 5CLLA 5JSUA 4C88A 1KZ1A 2QM8A 3MMXA 3QLJA 4Z0NA 5JO9A 2QN3A 4EVIA 3IUPA 5KSWB 2GSDA 5A3SA 3F6PA 3RYHB 4I8IA 4V0KA 1HXHA 4E5YA 2RG7A 3VU9A 1RVDA 2XHEA 4KP7A 4FVTA 4RVCA 2WVHA 1DEHA 5JXGA 1L7MA 3NBFA 3Q7IA 3D6UA 4YMTA 1WXFA 1HT3A 4S1VA 3N8KA 5ADHA 2J0SA 2V5AA 1N2SA 1AO0A 1K2WA 3OX2A 4EFMA 4ZK2A 1E64A 1GY8A 5CLJA 1UPTA 5IT9A 1K7EB 2IBMA 4Y2TA 5JSKA 5KYXA 1W36B 5DCWA 1IQRA 2AN3A 1E7QA 3QBJA 4ZT3A 3SG0A 4LTMA 4EOGA 1N6OA 2WQZA 2D4HA 1FDVA 5CBPA 4AVYA 4AF6A 1C41A 4RH3A 1KMCA 2BCGY 4J1NA 1H2EA 4AJLA 6REQB 5DN6A 4ISCA 4LQ4A 2G5GX 3OQ6A 4RD0A 4U00A 1ZXLA 4Y6RA 3GEEA 4JC0A 3SQLA 3UXEA 4FHFA 5JWHA 4AF8A 3NEJA 3ENNA 4DCPA 1LH0A 1SXIA 2ZOSA 4O4JB 4PQYA 4ALIA 4OQEA 4JSYA 4IHQA 3KQLA 5EN4A 2YR0A 1DG1G 2QBYB 1K9VF 1KBQA 2P9FA 3CN7A 3ZV5A 1KR2A 2H06A 4G8DA 3LOQA 3NGMA 4V0RA 4FGWA 4DBLE 3C3KA 1NU6A 2XMZA 5JQGA 1G21A 4NPAA 3OF3A 4QGGA 2VI5A 1P6XA 3IAAA 3N6RA 4JP3A 5I7EA 5K9ZA 2GTPA 4CGZA 1XTVA 3AUJB 4HZIA 1LPBB 1ISJA 1E3JA 1C3OB 3PFWO 2NUPB 4HYTA 4C08A 1Y7HA 5FUWA 4YLYA 1NYTA 1RHQA 3GLSA 4FWIB 4YRLA 5JJKA 2Q2WA 1W87A 1UANA 3RQSA 4JAVC 3M34A 4OJQA 4NAHA 4OU5A 4YMUA 1YJCA 2RB4A 4LS3A 1M2HA 2H16A 2WHQA 4ZVTA 3I3SR 3PD1A 3RVSA 3U4AA 3LNTA 4MVJE 4C4RA 1CUDA 2IODA 5G0SA 1OWOA 3KCNA 5DU2A 2P69A 3EFOA 5AM1A 2GFIA 3TZBA 2HPZA 1L5RA 5CM2Z 4YONB 1YIDA 1SVKA 1F2TB 5A4IS 2UYCA 1UBHS 3KYIB 1JDPA 5A5FA 1ZBDA 2B5VA 4GOOD 2PS9A 3E22B 4WOKA 5DHFA 4DDVA 1CF2O 2C94A 2EYUA 3CLRC 3PTLA 2PXXA 1W48A 1BGXT 3CRZA 4OATA 1UXOA 3FF4A 3RSGA 3SPXA 1WUHS 5JAUA 1NULA 4QGHA 5BSVA 4OBWA 2AW5A 3KJEA 3TSOA 1RYBA 3USES 1MMFB 2V3WA 5F7OA 8OHMA 4ARUA 1IMOA 4BYMA 4K9MA 4KB5A 3JVUA 3VNSA 5ALTA 2RH8A 4KQKA 1EM8B 3OA2A 2OENG 3PKJA 4BLPA 3LP8A 5ED4A 3VNUA 5A04A 1DHRA 3T06B 3A3PA 3C5CA 3OJLA 4Q9JA 2AOTA 3JWPA 4CF7A 1KWGA 1X2BA 2DBYA 3PYXA 3CO0S 5CPBA 4ZICA 5DLDA 3IVMA 3THXA 3NWBA 4BUZA 3ZHUA 1ZIOA 5EHZA 2WZCA 2I7VA 2VK2A 4UC0A 3ROGA 4XQEA 2WZQA 3F3MA 1FOEB 4KQFA 2Z2JA 3WGVA 4UATA 4ND8B 2IHVA 4D42A 2X0EA 2BGJA 1KK3A 3Q40A 4LTNA 2XCTB 4AXXA 2YHIA 3P26A 1Z07A 1N4AA 3K4QA 1LK7A 5KB3A 1NNEA 1Q1BA 3MWFA 4B48A 5C4GB 2WJJA 4RHEA 1XRNA 3CX6A 1NF9A 2AKAB 3ANLA 1AUQA 4NZ9A 3AVTA 3ZW9A 3VJMA 4Q4CA 2X15A 3LUJA 4B0OA 5CB6A 2VAMA 2HHAA 4KAFA 1PR0A 5D6OA 4ZRDA 2LP4Y 5KVCA 2BELA 2H29A 1URPA 1MO5A 3D2LA 4F04A 2DETA 4UUBA 2H2IA 3QKRB 4OKSA 2HZBA 2R8ZA 3LIIA 3H2IA 3ERCA 3U4GA 2O2DA 3EZGA 1ZC4A 3I04M 5JJ5A 2IYQA 4I4CA 1Z2CA 3T4EA 2BISA 2OHFA 3MMPA 3CM0A 2Q3CA 2EHDA 2P62A 3N2KA 1RQ2A 1XDBA 3MERA 3HKBA 3IX7A 4URVR 1CUVA 1QYVA 1U3WA 1XZDA 2W2NA 4IDEA 3U13A 5E1MA 4DMUB 4U2FA 3WL7A 2A4MA 3ZD8A 2FEOA 3ILYA 4DA9A 3ENZA 3LS2A 4ZZIA 3UV7A 1NHWA 2QS9A 1OTYA 4X85A 2XB8A 4JZKA 3NOOA 4Y0NA 4WXEA 2QGZA 3WYBA 2P4EA 3D3JA 1E0JA 2PD6A 1P0PA 2QD5A 3W8NA 5K3EA 1AB5A 4RCZA 1BX3A 2F48A 4B3RB 1MX5A 1J2TA 2XQGA 3IODA 1D1TA 1JUDA 1SUIA 5AKKA 4BO6A 3HKEB 2IV2X 3OPYB 3CFYA 1KY4A 1MJHA 2NZ8A 1G41A 3N53A 4Q05A 5ALLA 4Z1OA 1NRWA 3GI1A 1YK1A 4O4IA 4OMDA 5HCNA 3A6LA 3L5KA 1TGYA 3PWTA 1CUJA 2O5RA 3ELYA 4HLCA 4X6YA 3WQBA 1IXYA 4RTMA 1IOLA 3M82A 1Q44A 3CINA 4YRIA 1TF7A 3A3YA 4TN5A 5TMDA 3T4PA 3PLAE 3LC1O 3U3KA 2XUZA 1UP7A 1Z06A 1KBOA 3ZY5A 4D57A 2JHGA 1TM4E 1HNNA 2GYVA 1SCAA 3W2HA 1QU2A 2WJZB 3QELB 4JT9A 1N3IA 5IJZA 1W6UA 2CNNA 4IDNA 1RHRA 4AECA 4P3PA 1SUPA 3QE3A 1HSOA 3GRCA 3FI0A 5EJ6A 4GG1A 1YDWA 4V0OA 2NTYC 1CZUA 1CKEA 1UDAA 3BJMA 1NG9A 3NQ41 1ND6A 1DOAA 2H1VA 3AR7A 1B7GO 1CCWA 2B4QA 2R8YA 2JFVA 2GBGA 4MDYA 5EIAA 1C0EA 2WSLA 1J8QA 5HZGA 4YUWA 4N8SA 3O2NA 1I2CA 2B83A 1R0BA 2IP2A 2PG3A 4B1FA 1VE9A 5H9WA 5IMSA 1EB9A 1W6RA 3HLTA 4JT2A 1FL9A 1VPLA 2VT7A 2FDXA 3C2QA 1OGIA 4DSAA 4B43A 4QE3A 4A15A 4DDUA 3TRHA 3RC2A 2ONKA 2O2EA 2QRPA 1J5EB 1I1OA 3TTXA 2ZB4A 5LWHA 5U1PA 1OH5A 1LY1A 1ZA1A 1M6YA 2PRKA 3R44A 5EWLA 4DJEC 1DV2A 3G13A 5KTMA 5DH9A 3HO6A 1NBEA 4HFRA 3AY0A 3RVPA 3T3GA 4CKBB 2LPMA 3JPYA 4DCSA 1RWWA 4HLDA 2DFLA 3FWYA 3GWGA 5TVKA 1EWVA 1TIPA 3PJGA 2PLWA 1EX7A 2VPQA 4HX9A 5IULC 4YROA 2JJMA 3NATA 3A2KA 2XZPA 2AFIB 4B87A 1LPOA 3MGAA 3D6NB 4GU5A 3HR4A 1Q11A 4FHDA 2D3WA 4PSKA 5LLTA 1OXXK 2IYRA 4LHWA 2IS6A 2O3TA 3UCXA 3UZUA 3V7YA 3ANNA 2O54A 3ZQKA 4BAZA 2QW0X 1V4VA 2IXTA 4BKUA 4EVSA 2GXUA 5KPJA 3ZWBA 5BOSB 1ZUNA 1DMSA 1M5TA 1ULZA 2Z2IA 3LHIA 4F4UA 4IBOA 4EX6A 2RKWA 5LYJB 2DXIA 1PVVA 4FM9A 1X87A 3H99A 1QIIA 2O1SA 3KJQA 2EXXA 1IQPA 1QOQB 4BP1A 2P1RA 2R6FA 2Q5FA 5ALYA 1WQ1R 4NYMR 3VC2A 3EEIA 3BCSA 4H6XA 5DCUA 2HT6A 4WY2A 3WGHA 4A4DA 1K8XB 3OOYA 4QDJA 4E0BA 4ZZ0A 1LLFA 3H2BA 2VP0A 5IAOA 2VJLA 2GD6A 4R1TA 2CLLB 1UIRA 3VHXA 5C8YA 2XKAA 3FD8A 4MV0A 2VIIA 3M5DA 3AONB 5B3AA 3DULA 4BV3A 3GT4A 3G5TA 3L4JA 3I12A 3C3YA 5EIWA 3TZ6A 5LMZA 2QNBA 3GJ8A 2YL2A 1XD2A 4HJRA 1Y8ZA 1EP3B 1DKMA 1SC9A 2IEGA 3SIPA 5FX2A 4RHYA 3ZWCA 2GM3A 1CZKA 3S44A 1A88A 1QH8A 4D9IA 16PKA 3EUFA 2EDAA 3KLMX 4KQHA 3GUVA 5KAPA 4R8VA 3OBBA 1RWVA 2J31A 2QUHA 3MNFA 1R8YA 2HMTA 1YV9A 1RHJA 1KQ3A 4D6PA 3H1GA 3CEJA 2ZDGA 1T2FA 5JQWA 3EZFA 3P9SA 3NOXA 1C9EA 1XMPA 1POWA 3O8NA 3RIXA 3V1UA 5E3IA 2FX2A 1YA6A 4PTYA 5TQ0A 4ZYYA 1EVEA 2B92A 1ST2A 2X0RA 1XEXB 5EHNA 4X20B 3C8UA 2CDCA 4DBZA 1WDKA 3EGIA 1M83A 4HNGA 3DV2A 4FBGA 4QG7A 1GWNA 3X0DA 2GBLC 3G17A 3HPRA 4LCEA 1NBHA 4JVLA 1C2YA 4P34A 4WKBA 3LXRA 2RI6A 3KK0A 2BDTA 4BX0A 3WMWA 2WIAA 1TZBA 3OFVA 3QVVA 1E62A 2ZYUX 3HLYA 3Q3EA 5ALOA 1I80A 4OHUA 4LDAA 4P4NA 3CBGA 2R6AA 1P2BA 2E4UA 3NRJA 4I55F 2FMUA 1QF7A 3IALA 3O0TA 4YJGB 2OL4A 1V8ZA 2OORA 5HDBB 4W7HA 2FWMX 5L7YA 1L1FA 4ESEA 4XGRA 5AW8A 1ZMBA 1YMQA 4XLZA 2ZATA 1ZD2P 1M72A 4RSGA 1P6UA 1Q83A 5K0BA 3PKIA 4YWHA 4KR9A 3GW8A 3RS4A 1YZNA 4OHBA 1QRUA 4U6QA 1ZNYA 3IP3A 3AGPA 2OGZA 1VKNA 1G6Q1 1IEVA 3MT8A 3Q8WA 4MLZA 2BH9A 1NG1A 1P2DA 1R5JA 2FW8A 1B74A 1F51E 3UW1A 5NULA 5EJ8A 4GD3Q 1QRSA 4GNKA 4BO2A 4YAKA 1NLFA 4IKPA 1T2DA 2BKXA 1WM1A 4J3NA 4DW8A 4ZANA 1X14A 2PBFA 4HQKA 4MVWA 3DONA 4RIGA 3TGWA 1HYGA 2Z8ZA 1DVRA 4L5JA 4RJKA 5I5GA 1J7KA 1GLNA 1G9SA 1MA0A 4GI5A 4PO1A 5F64A 4DJDC 4EGCB 5EHIA 2A5JA 1XPRA 5EWJA 4COOA 3AR8A 5AP9A 3OPQA 2H4ZA 1M6WA 3VU9B 3GLGA 2JFXA 3KSRA 5GMOA 1CETA 1T3GA 2VWGA 3HACA 4FXOA 3RIMA 3DFIA 3A4IA 3FTNA 5BWMA 4BNMA 4MDEA 3G2HA 3WIOA 2DFVA 1JIIA 4Y3UA 2QJRA 5FL7D 1GPAA 4IUDS 3HU3A 3M4NA 4QRDA 3VDRA 1M34E 4IP0A 3CX7A 5CBPB 1S96A 2VFAA 3KKZA 1QBGA 3NBYC 2EARA 2ZM6B 3TOZA 4B71A 1KI1A 5ES4B 3U7QA 5JEDA 3L0BA 1W36C 4BB6A 3B6ZA 2HHCA 1LSUA 3VR6D 4M1ZA 4AY4A 2Y6UA 2O8CB 1GPUA 2NVWA 3BQMB 4JA0A 4P32A 5LP1A 1GG9A 4OYHA 2VHZA 4DQXA 1G16A 1HQCA 2YJ3A 3L6UA 5K3CA 1M7HA 1RYNA 3R3WA 1E1NA 1NXVA 1S89A 2GNPA 4G23A 4RY9A 3KPUA 5JQGB 3IEVA 1G21B 2GX6A 1GQ2A 1YDHA 4J0FA 3T12A 5D5PA 1U99A 2X9QA 2XUHA 1B8VA 3I6YA 4FI3C 1RZVA 3D43A 3TW0A 3UXHA 3FTFA 4K0KB 1VP9A 4HQFA 5KQSA 3G8AA 1WVIA 1VLVA 1T3LA 1JAYA 2ODQA 3CF4A 1JYEA 1H8EA 1UPFA 2EQ5A 4W6ZA 4KWEA 1ZH2A 3DKKA 5JWRA 3VC3A 2E37A 3MPOA 3HB5X 3P4XA 3GA7A 3G5LA 4KN8A 2WD9A 4H1HA 4GZ3A 4XJSA 4PVCA 2JIZA 5EZ5A 2V96A 4PFKA 1JJVA 1PQYA 2D8AA 2GT1A 4RZQA 4RLQA 4EKIA 4HNTA 2ON6A 4YB8A 1BHQ1 1XMOB 2Y1LA 3LV8A 4UVGA 1CDEA 3O2JA 2V5UA 3CKLA 4BVBA 3WB1A 4P4UA 2VNSA 1KE2A 1PQ4A 3B3JA 2AOUA 2JIMA 3HNPA 3WV4A 5L7TA 1SHTX 4R71A 3HZOA 1H2RS 3TD6A 3HG7A 2Q9BA 4CEJA 4LJAA 3P2JA 4LQLA 3LNCA 5GONF 2W6ID 5IJ0A 4Y6OA 3LRXA 3HWX1 2XMGA 4M83A 4C1NA 2JLVA 3HLKA 2UU9B 2H07A 4UM9B 1VBMA 2G0NA 3H7AA 4P4SA 2X1HA 4BGEA 1DFIA 2TMGA 3KSUA 4IH1A 2FPRA 1LQ2A 3DNFA 3KC2A 1E9AA 4IIXA 4M0DA 4ABTA 4ARCA 3EC1A 2EFEB 2AOTB 1GKIA 2AK2A 2OYSA 1IWOA 3Q3JB 5AW4A 4L15A 3OZDA 1W5SA 1XMQB 3W5JA 4YS6A 3L0YA 2ZZMA 3DBIA 1VKJA 1B8NA 4HFJA 4L4SA 3HJTA 3E05A 4ROTA 2FVXA 1JMVA 3JV7A 3IDFA 3K1JA 3FVRA 4JUAA 2Q7DA 3ZWWA 4ZMSA 5LMNB 1HZJA 2HSEA 4PRKA 4RVHA 4F93B 3DNMA 3TK1A 5FBHA 1UJ5A 3A3NA 3K4PA 4KXMA 5K99A 2YHIB 3KZOA 1NVWQ 5A1JA 2WIFA 3N0RA 4F3YA 3A9RA 1T36A 1RMTA 2AYZA 5KZMB 2O59A 3V2GA 5HKLA 2PX2A 3PNMA 2GN4A 3PR2B 4QOFA 2GN9A 3B5EA 3WLFA 5ALVA 5HKKA 2CXPA 1T9AA 3BWDD 5C81A 3KXDA 3LQYA 4ZD6A 1LBHA 1QV7A 4KQGA 3FW1A 3PNYA 2XWBF 2C9CA 3DWFA 4RSHA 1JTFA 3ISJA 4H0FA 1VKZA 2OCDA 4I6EA 1GVNB 2PH1A 2V7UA 4EG8A 3A1FA 1L7XA 1WW3A 3B2QA 3I0MA 5EFZA 2CYCA 4YASA 3F4KA 4WL0A 4KITB 1E3EA 1WP4A 3JALA 2AFHB 3AW8A 4TXHA 3FI9A 1SH7A 4HFNA 3PFCA 3PFFA 1OXUA 3PGLA 4UHBA 1KZYC 3N2KB 4RMHA 1UDWA 1J8DA 3IDSA 3HKBB 2OOSA 3HDVA 3W5UA 3OT4A 4R7TA 3A3OA 4L9WA 1EFHA 5G1OA 3LSTA 5KMGA 4O4IF 3EF1A 3ICEA 1ZGHA 1JLKA 2CV2A 2XGOA 1CX9B 1QZUA 2DJIA 4UFNA 5DTRA 1RI4A 3CF6R 6CHYA 4JNCA 1VDZA 2ISQA 1GP2A 3E7PA 5CTJA 4RA9A 1IN6A 3TKAA 1X94A 1JBEA 2NO4A 3D8SA 4HRXA 2J9GA 4A6PA 5A7GA 1JJIA 3OFND 3T94A 3ZZMA 3IMGA 1XP5A 6YASA 2DWOA 1PSZA 2RKOA 4QKQA 3FDJA 3DL2A 3TLJA 2NQ2C 3QZUA 1AZSC 1I9GA 1TE2A 3AB3A 4K9RA 1KI2A 2I8LA 1QR2A 1TKAA 5CXSA 1AUPA 3OM9A 4QU0A 1FP1D 5JNRA 4WXPA 4XEHA 4S1NA 2GMWA 3IKMB 4I6JA 4BX8A 5C52B 3DZIA 4WDQA 2WHPA 4NRDA 1U9ZA 4KMMA 3QENA 4PGFA 1NVAA 1WBBA 3RB8A 4YN3A 2R60A 2ZUSA 1VIYA 2Y9PB 4BNIA 2PT9A 1OZAA 4TLLB 2E4YA 3L49A 4Z86A 1TQ8A 3I09A 4FZ5A 4MV4A 3VO1A 1Z0UA 3IR7A 1IPFA 4M8NE 5CU7A 5EIBC 4DG9A 4CMGA 3PE6A 1ZD4A 1QIGA 4M60A 5DIZA 4R2IA 1ITZA 1HDOA 1HDIA 1VI2A 3OZFA 3FFWA 2AK3A 4NV3A 4F6CA 4RL4A 1A9OA 2PAAA 1EQUA 5E6UA 1DKUA 3NRBA 3V7FA 1G6KA 4ED9A 1XT6A 2P30A 3TIXB 5LB4A 1JQDA 4R8LA 4W63A 5GTDA 1ATZA 4IG9A 4L0MA 3ROKA 1W4BA 1NJ6A 3QBTA 3TUIC 3WJAA 4WIAA 3X2SA 1RPAA 5D1NA 3BQ9A 3BXGA 3KHTA 3EOAI 3GFOA 4M37A 1HI9A 2P9ZA 3HJNA 4FBLA 1TZ2A 3QXXA 4RAOA 4EI8A 3KAQA 2WTNA 4UZFA 5D3MA 5FV7A 2CXUA 1E3SA 1EFCA 4L5CA 2D5CA 1XO1A 3UJDA 4LVCA 3EYWA 3VX3A 4KLCA 2Z43A 3QFHA 4FCCA 4IDOA 4IOLA 1WXWA 4L9SA 4MUYA 3MB5A 2IS1A 4CDRA 2KSQA 1DRUA 4NBLA 1YZFA 2GAJA 3GAMA 3I05A 1TRKA 5AVRA 2CCJA 4QUKA 5DCYA 4AICA 4EFKA 1CY7A 3PSHA 1G5QA 4LRUA 4CMIA 1AS0A 1BROA 1E3DA 1FQOA 2FFAA 2NU6A 2VP4A 1IM8A 2A7XA 2R66A 3HSSA 4DMMA 3DT9A 4JXXA 1VJ1A 5ELLA 2FZ5A 4BVEA 4EJ6A 4B0PA 4Q5IA 2QE7D 3QMWA 5C8YF 2L69A 4MVJG 5KCZA 1QPBA 5ECDA 2KQUA 2A9KA 3IPLA 1SG9A 1U3TA 2OV2A 1VQ1A 4JCCA 1W5EA 4LBZA 2IEZA 4KWCA 5E1DA 3C6BA 3CVOA 5CT6A 1EJ6A 1N9ZA 3H16A 1WZCA 4WNIA 4P4GA 4OHPA 1EGAA 4N5NA 1GR1A 4CU5A 1BA3A 3CY6A 4HGOA 2HWUA 1OLXA 2XPCA 3RU7A 3U9LA 2VJKA 3W05A 2JLBA 4RORA 4EGFA 3RLFA 3BGIA 4E5KA 2P79A 1ZICA 1PFGA 3JVIA 1RJGA 3VHXB 4MR9A 3DZJA 1ZN8A 3BPSA 4R98A 3BZUA 3OQ1A 1AXEA 2AH5A 2R97A 1P62B 2FZCA 2P3SA 1X7XA 3NEPX 3K5HA 4J16A 1XD2B 3NHRA 3DKRA 3P0HA 4QYXA 3K8QA 2VDMB 3P9YA 4RS4A 5FBKA 2AC2A 5CDGA 1I7DA 1QNFA 2AL7A 3KJNA 1QH8B 4E51A 1LSJA 3PDCA 2PU5A 3BXZA 4UCXA 3RAGA 3AQ4A 1MZPA 2C9DA 1ZGGA 1ZGBA 5FCDA 2YN4A 1UC4B 4NOJA 2NPFA 5D7BA 4J3FA 1NIJA 4ALJA 4K6MA 5MFPA 4UQOA 1KAQA 3FPHA 2F62A 3FPEA 1N8SA 3Q87B 1IHOA 1X7HA 4J7XA 1NN0A 3S1AA 4ZXFA 5AKXA 1NW3A 4NNJA 3SS7X 5TQ0B 3BRQA 3V2IA 5F33A 3FVWA 3KD3A 3AEYA 3LY9A 1HE8B 4NE2A 4NZMA 3OHSX 1QRAA 1QWSA 3PNOA 5DK6A 4D02A 3C7KA 4DSUA 3LWBA 1NR7A 5B6JA 1U6KA 3M7IA 2D74A 4S05A 2C7PA 1ZOIA 2IK8A 3JQFA 3B8EA 1GLGA 5JC1A 4G24A 4D9EA 1LEHA 5CT4A 5T4EA 2PIAA 1EG2A 2E18A 2AX3A 1IJEA 1UBNA 4XD7A 5DPMA 2BE7A 3ND5A 2GBFA 3GELA 4KO8A 4OXYA 2D1FA 2CZQA 3FYDA 3PR1A 3FR7A 1MF7A 1QLJA 5HFAA 3N7TA 4FS3A 3KTDA 4J1SA 1BS2A 1TYCA 1G60A 1TZCA 1CWUA 2BSAA 4AZVA 4YCSA 5KVAA 5E8RA 3D6FA 4EWLA 2GNOA 4G2TA 2PL9A 4FNAA 4L6IA 4IIFA 3VR4A 4PR0A 4DBVO 5IPFA 1YASA 4IIDA 3TSCA 2CCKA 2LBPA 5HTOA 1KJ9A 1HL7A 2IVFA 3JR3A 4B32A 5MDHA 2CFCA 2YQ5A 1XMIA 2E89A 3BGWA 3FUCA 4YRNA 3DF7A 5EIEA 2IY9A 3UO8B 1O94A 3I0NA 4CN9A 2AFHE 3WIEA 2H18A 1YUMA 4L28A 1P4AA 3O4IA 2JJQA 4RH1A 1RZRD 3FNQA 2R11A 4EG1A 4JKYA 2AJCA 3U3OA 1RQ7A 1SD1A 2WIJA 4TRMA 2XDQA 3CQ9A 2FYTA 4ECAA 1FVXA 1DGQA 3GJ3A 1YS9A 5EE9A 4UHKA 5L7WA 2X2EA 3NC0C 5EWJB 3EQZA 1GAJA 1ID1A 3L46A 4CFSA 4WUVA 4D0LB 4US2R 3NHMA 3P0IA 2DULA 5F76A 3GLGB 2QD3A 4PG6A 1NX9A 1YGYA 3SSAA 1DAFA 3UF0A 3V1TC 2W2KA 1WRBA 3T99A 5CB4F 1VMDA 3NPMA 3WOHA 1TPZA 4NOLA 4LK3A 2FSGA 3FCEA 5F9HA 3FTEA 3PT9A 1UXKA 3CVJA 4US0R 1SCJA 5JATA 2N47A 5BVGA 4PY2A 3EVTA 2IKSA 3L0ZA 5J59A 4Z0HO 5C7YA 3ZTWA 5I8PA 2E6UX 5E9QA 4EPWA 4HUQA 3ZD9A 1DKOA 1X9GA 3BIXA 4A8HA 1A5BB 2M6SA 1TADA 3K5WA 3U7QB 5IVHA 1BJKA 3SZUA 4AL4A 4I1UA 5LDGA 1E3QA 1BXGB 2GGSA 4HQLA 3S40A 1DQPA 1THZA 1DWOA 1Z08A 3L6BA 3A0RB 4FKZA 3R76A 3UC9A 3W2GA 2QEQA 2A0WA 2VR1A 2XWSA 4KV7A 1JU9A 3HJCA 1T5IA 2I3DA 4NBSA 4PO3X 4BJ6A 4CLHA 1RLUA 5CVVA 2P2CA 3S4YA 1NI5A 4HATA 5GADl 4HBZA 2G40A 1HWYA 2VF2A 2HIMA 4MA0A 4RKFA 4PGHA 1LSOA 1W2HA 1WULS 2I6GA 5JAMA 1EGQA 3L5OA 2DY0A 2X5XA 2AEEA 2CVPA 3CPEA 2HV9A 3KQOA 4JEIA 5C53B 1K4KA 3GZ4A 3RHTA 4BQNA 4AF7A 1F6BA 4RCVA 4DJ5X 1HO3A 1QCYA 2J5QA 2XW6A 4K81B 1LVUA 4JJGA 4DXAA 1A69A 3AF3A 4Q00A 3NNDA 5BSWA 1K0FA 2X4GA 2G5TA 4C4YA 3EVBA 5KX5F 2IZ1A 2RJ3A 3CLKA 3U44A 3AV3A 1WIWA 4QREA 4UUMA 3PLNA 1RQPA 2VK4A 1W25A 4WK6A 5DM1A 4GPTA 2PBZA 4M9RA 3QHPA 4YRPA 3SC4A 4DIBA 2F3SA 2X3UA 3IQXA 1TC1A 2AV6A 2ZB2A 1PYDA 4LV8B 3I5YA 1XVIA 4A8JA 1G98A 2ZIWB 2XDWA 2YRFA 1KEUA 4GPIB 1ES9A 3EPPA 4J0CA 5GVSA 3NYRA 2P6RA 1K89A 1Q19A 3KD2A 1XCGB 4GVLA 3PNPA 1TCBA 5HX7A 1KJYA 4PO9A 4V0NA 4A23A 4F11A 1FK8A 1L4FA 2AOUB 4GMGA 4A0HA 6AT1A 2ASVA 2FHPA 2H2DA 4ZV7A 1WY5A 4CEJB 2XYVA 1SIWA 4BO3A 4XLLA 4OGKA 3HQ4O 5I01A 1K7YA 2CLIB 1NW5A 3EIOA 1E1QA 3D02A 3IO3A 5JUWA 3DMRA 7REQA 1PQPA 3VJRA 2W0MA 3O4FA 1L7PA 2HO4A 4IFIA 4ANFA 4GZLA 2K6GA 4Q18A 4P4SB 5FORA 3AK4A 3DVSX 2R2GA 3CLSD 5EXSA 5ARDA 3M89A 1JL3A 4GC5A 1KO7A 1IHUA 3QKUA 5TMBA 2GI4A 3UMJA 1J70A 1K97A 1CK4A 3IP1A 3W0LB 2PZAA 3ZHQA 1UPAA 1JF8A 3I76A 4WLOA 1NVMB 4TKZA 3T7CA 5HJEA 2Y93A 4M0LA 1TTQB 3ON5A 4XYEA 4Q93A 2QYTA 1Q21A 4ZO8A 3TLBA 4OMUA 5D85A 4UEWA