4DIDA

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase
molecule keywords Cell division control protein 42 homolog
total genus 61
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4didA00
3E70C 3QVUA 1Z6YA 1FW6A 1R0ZA 2IWRA 5KDDA 4WZAE 3AKCA 3L43A 3E5HA 1U0JA 1MO3A 2QTFA 3JVUA 3PENA 2FFHA 2BWJA 3QBVA 4GRAA 2FFBA 3FHCB 2O8FA 1WRBA 4LJAA 4NMMA 4U5XA 3NTUA 2ZS7A 5JMTA 2FSIA 2V1UA 3U2QA 4YONB 3WNDA 1FQJA 2CJWB 2C77A 4GZMA 3SYLA 1ZYUA 3Q9LA 1YZGA 3OF5A 2BOVA 1NVVQ 5DNYB 5A0FA 3TR5A 1G291 4TTRA 3A58B 1EFCA 1XTKA 4B48A 4D25A 2A5DA 3A4NA 3RS7A 4B2PA 3FDIA 1P72A 5BQ5A 4BUJA 2DB3A 1Z83A 3P4YA 4GP6A 1P2SA 2X77A 3AUXA 1KI3A 2QNRA 3R8CA 2IYYA 1TMKA 3MSXA 4LBZA 1GL9B 5J47A 2J0UA 1XXHB 1QVRA 1W47A 4KSBA 3ZIAA 1XX6A 4HAVA 2LWIA 3KUDA 5KSYA 3QKSB 4QBGB 3IQXA 1ZUNB 4LPKA 4ZIRB 5JJLA 1Z06A 3WY9A 1OV4A 4HAUA 1CKEA 4RZXA 3UMFA 3B8HA 1FP7A 3CF0A 4QJ4A 1UKEA 4OJQA 2C8VA 4MKFA 4FCVA 1NP6A 3MUFA 3ZVMA 1KSGA 2C03A 3GLGB 3GLIE 3EZ7A 5GVRA 721PA 1L4UA 2AK2A 1E4YA 4Q7MB 5DISB 3R20A 5G41A 3SHFA 2Z5FA 4I81A 1IBRA 5L3VA 3V4RA 1W49A 2RGAA 1US8B 2ATXA 5JHGB 1NNEA 1AQUA 2QY9A 4X8HA 3ZH9B 4LYJA 1TL7C 3LX8A 4TSFA 5UKDA 3WRYC 4BLOA 5B30A 3U3RA 3H2YA 1VKJA 1TQ4A 2VSXA 1DG3A 1KIMA 2PEYA 4NP6A 3RS4A 2ANBA 2NGRA 4D4MA 3THYA 4PHFA 1X1SA 2P5TB 4G5SA 2QMEA 1Q20A 2VP5A 1H8HA 2F9LA 3AVQA 2ZRMA 1G5PA 3ZDQA 5FL3A 3UK6A 4AG6A 1S4QA 4DLRA 5C1BA 2W6JA 5AR1A 1EX7A 2Q3MA 2QENA 3BORA 2GVZC 3U6KA 3GPLA 4UXJA 1AS2A 1W2HA 2CCKA 2XTZA 1JBKA 4LYFA 4D4JA 3W6OA 4YDSA 3OE7D 1UBGA 4QM6A 1E2LA 3BH7A 5G3YA 5K8UA 4LX0A 1JAHA 1MABA 1IXSB 3U3JA 1Q3HA 1GSIA 3GJXC 4E03A 4TQUS 2IYUA 2J5XA 4HB3A 3CX8A 4YMSA 4EDHA 1KDOA 4BLSA 4M53A 1VCIA 3AB3A 1P6XA 2YYZA 3BGWA 1WXQA 5FBLB 1A4RA 1RW4A 2ZRPA 3VU9A 4YQFA 5DYGA 4OI0A 4CT5A 2XNDA 3PITA 4F93B 3EW9A 1MO6A 4Q9LA 3RANA 3NXSA 4TL6A 1KO5A 2G1JA 1YR8A 1YZTA 1DARA 3DKPA 3DPUA 4IKEA 1E2EA 4RD6A 5JZVA 4G5QA 4M1MA 3KXKA 3DZDA 4Q03A 1F48A 1R8QA 4V0OA 3BH0A 3ZD7A 2PZGA 3CWZA 3FKQA 1JQJC 1OFTA 2WKRA 1GOTA 2ZVQX 3SBDA 1ZNXA 3B1XA 3EAQA 3N2EA 4HLUC 4LJ4A 3T5DA 2C98A 3NHAA 2WVJA 4Q4AB 2C9CA 4Q1BA 2EFGA 4AKEA 2W6JD 2JATA 2P6NA 3EWAA 5L8VA 1AJEA 4WW0A 5TVKA 1KSFX 3TMKA 1AKYA 3CWQA 3LAWA 1T91A 3U6BA 4GFDA 5LB4A 3QXSA 1R0WA 1UBCA 4XSGA 3KQHA 2KB0A 2GJ9A 1M7HA 2P3SA 4Z51A 4MGYR 4NU0A 2C99A 1T5IA 3REGA 3WP1B 3PQCA 1W5TA 2C9OA 1G18A 5FTKA 1RRGA 4TT3A 3I32A 2OFXA 1X3SA 1ZU5A 4UXIA 2GF9A 3R7WA 3A1UA 2OM2A 2D4HA 4A1FA 1DELA 4D81A 4US0R 4M9SA 3EZFA 4TMTA 1LS1A 1NY5A 1WMSA 3U7HB 4QHYA 3IBYA 4B44A 2BKEA 2KE5A 3QG5A 1II0A 4K46A 3FE2A 4FINA 2ZANA 1U99A 5DLQC 3VU9B 2DFLA 3G0HA 3QF4B 4CIDA 2IWHA 1G41A 1KK0A 3H1TA 2ZS9A 1N0UA 1ZBDA 3IPYA 2IL1A 3K53A 2OESA 4DCTA 2CHQA 2WOOA 4H1UA 1ZUIA 2WPDA 2FX3A 4IVPA 4TL7A 1P9RA 1YQTA 5HCIA 5FBWB 1XJQA 4B43A 2ZRKA 3W8NA 3ZZTA 2ZUCA 3KJGA 4JVMA 1UFQA 5FPSA 5JI2E 1RJ9A 3I61A 4LHXA 2CNWA 3BD9A 4LWZA 2DYKA 1W0JA 3B13B 3OIVA 3ETLA 2RAPA 3QUSA 1IXRC 4B75A 2QI9C 1XP8A 1EFHA 4ILEA 4PFSA 1I2DA 2IT1A 5DO9A 4PSAA 5E7IA 1KMQA 2X2FA 3AVUA 1E2PA 4C7OA 4V0KA 3T12A 2REBA 4C0KA 2AD1A 2VF8A 3LDAA 1OPXA 3QF7A 1Z0IA 3HU1A 1YRAA 1J70A 2AFHE 4CW7A 2R6DA 2QORA 2JIZD 4AK9A 5JWRA 1V43A 3FYHA 3PR1A 5DN6A 1OW3B 4EFLA 3BFVA 2GA8A 3A36A 3LVQE 2FGKA 121PA 3GJ5A 3LLMA 4D0GA 4OI4A 2RGNC 1GRQA 3K09C 3Q5DA 4MDEA 3AGQA 1JNYA 2YWGA 4JLAA 2O0KA 4OQNA 1AK2A 3OESA 4RSGA 4WXRA 3B5JA 2QBYB 2HJVA 3VKWA 3RRMA 4R9UC 4HB2A 1T5LA 3QSYA 1LF0A 1YZLA 2R6GA 2WICA 3BB4A 4ZO4A 4GOKA 3ZJYA 4MRPA 5L3QA 2CK3A 4B33A 4OKSA 3UG6A 3THWA 5JJKA 1YR6A 1G5RA 3PEVA 1EFRD 4DDWA 2O8DA 2BBWA 1HUQA 1Q44A 4CF7A 2QRNA 2GJKA 1DTSA 1S1MA 4II7A 1NG9A 2CL0X 1KTVA 5AUQA 4BLPA 2IS4A 4TLAA 5FPYA 2YVUA 3E2IA 4JT2A 1ZP6A 1QHNA 4QNMA 3SJBA 1Q0UA 3W6NA 3W5JA 3D3QA 3REFA 2D2EA 3LLUA 1J8YF 1Q1QA 1R5OA 1YZKA 4FXPA 4JLKA 3IUYA 1E2FA 2MMGA 3TR0A 3R9IA 3B6EA 3C4JA 3NC0C 1T8TA 2OFOA 1LFDB 2KSQA 1E79D 5FOXA 5EUMA 1G8HA 1S9HA 4HLQB 2B7BA 2CDNA 4KBFA 2QM8A 3ASYA 3SJCA 4US2R 4QG7A 1UKZA 1DPFA 4G1UC 2ZYTX 3TSWA 5FOWA 5CYPA 2BC9A 2G1KA 2B92A 2FEOA 3IO3A 1L2TA 3QVVA 3CNNA 4DKXA 3X2SA 3K9GA 3VX4A 1U8AA 4CYMA 1P7CA 5KNCA 1Z0AA 3S1AB 3CF6R 3MWKA 3U3OA 1YVDA 2RHDA 4KFTA 2NZJA 3LD9A 1IY0A 2HXYA 4L15A 3K70B 2QSYA 4Q01A 4W7SA 2QT1A 5JCZA 1HT1E 1BYUA 1IY2A 3K70C 3Q3JB 1K8RA 3KJHA 4R2HA 1K5GA 2ZM5A 1MKYA 4BEBA 1G4AE 1P9WA 2IYVA 4Q02A 4Q7KA 3GFTA 4Q48A 4ZDJA 3W3AA 3CO5A 3CZQA 3MMPA 4GOJA 4R98A 5EP4A 4DXAA 4IVRA 4LY6A 2RGEA 1VYVA 4CRWB 1NLZA 3KUCA 4FMBB 2O8DB 3EC2A 3IHWA 5TV2A 3U3MA 4PHHA 2KJQA 1ZD1A 1JECA 4D4KA 2FNAA 2ODBA 1FFHA 1AN0A 2ZYUX 1AS3A 1Z2CA 4L16A 3H86A 5B58C 2WPDD 1JI0A 1VMAA 1F2UB 2QG6A 1LF5A 3CNLA 4QC2A 2F1HA 3NIBA 1QHIA 2PJZA 3WYFA 1C9KA 4WOPA 1OLOA 1QVAA 1FTSA 1AGRA 2QQEA 3W5IA 4QM7A 5CK4A 3AP1A 2IX3A 2WIBA 4NCIA 4DJTA 2IXEA 1JXOA 1ZMXA 2DY1A 2IYZA 5FTJA 3RS3A 3GLFB 2AN9A 4I99A 3SHWA 2WZQA 1Q21A 4NYJQ 4Z1MA 4OQFA 5FFMA 5F9FA 3BB3A 4B2IA 1NN1A 2CHGA 4TT3D 1E0KA 5J4YA 2V1XA 1XB2A 1GITA 3GLIB 4CT4B 3P32A 3C5HA 4Q4JB 4HLDA 4YMWA 2FDCA 1T0HB 1XTSA 5JJIA 4HEJA 4B32A 4PPGA 2ZSBA 4KYUA 1HY3A 4UNNA 5HZHA 4NYMR 2J41A 4JYCA 5B57C 4LI0A 1FMJA 3VNVA 1WBDA 4HLUA 3K0AA 2DWPA 1KO4A 1BOFA 2ZRGA 5F9HA 1FPMA 2XSZD 1IONA 1T8UA 4B74A 2GEDA 4H9GA 3QQ5A 3MWLA 1G4UR 5CM9C 3T5GA 2VSOA 3OEHD 4FWIB 1ZD9A 1R4AA 3SZRA 3K8YA 2JDIA 2JLQA 1L4YA 3VR6A 2IUUA 3BS4A 2GAAA 1KI1A 3QENA 2AD5A 1E99A 2P5SA 4P31A 3DM9B 3PUVA 1GFIA 4KSCA 1KMHB 3EA0A 2ZSAA 2ZE6A 2O52A 3OHMA 4V0ME 2VP0A 1OXVA 3RC3A 4IFEA 1XRJA 4URXR 4ZDKA 2J87A 1Z22A 2C9YA 2AWOA 2UZ3A 2IUSA 1EWQA 4P4SA 4FMDB 3SE0A 5CLQA 4GSYA 3HPQA 2PZEA 1II8B 3U44B 1YZNA 3TRFA 4UXHA 4FN5A 3HU3A 1SKQA 4NONA 4FD2A 1GG2A 4NYMQ 2NMVA 5JS7A 1N6RA 4DEXA 1IN6A 3CLVA 5AJYA 1Q57A 3ZVLA 1XMSA 4NPHA 1QHSA 1S9DA 1JR3A 4KHZA 2H5EA 2GILA 3AP2A 3GCGA 1RIFA 3ND8A 3OE7A 2XAUA 1ZC3A 5TXGA 4IHQA 1KO8A 5J4KA 1GP2A 4WZ6A 4LPSA 3TE6A 2J59A 1BH2A 1AZTA 4TQ9A 4BFVA 4DWJA 1PJRA 1XD8A 3EASA 4QGGA 5FTNA 4Q7LA 5BXQC 4IFBA 1CRQA 2RKOA 221PA 4QFMA 1UF9A 2JCSA 4XD7D 2ZREA 2OT3B 1H8ED 4DSUA 2PT5A 3O8DA 5IHPA 3IDQA 2QGNA 2XOKA 3CRQA 2BEKA 2HYDA 5FOSA 1FZQA 2CNWD 3HPRA 1I2MA 2X19A 1F6BA 2D74A 3JVVA 3Q5EA 4TMWA 5DH9A 4M0LA 4UKDA 2ZJOA 2F6RA 3LFUA 1E9FA 4B35A 2D06A 3I3SR 1N6IA 4J0QA 1D8TA 1M6NA 5CB6A 4JBXA 1W36D 3MAAC 4XVQA 4E09A 1VG1A 2LKCA 3C16C 4AI6A 3NEYA 4G5RA 3RS2A 2FN4A 1DO0A 1MRSA 1GILA 1N5JA 4MITA 2EW1A 4B34A 1OKKA 4BQSA 2BMJA 1KI7A 2BDTA 1U9IA 4N0EA 2RGBA 4MGZR 4KITB 3SYNA 2FMXA 3EIHA 4NCJA 2YWHA 2FGJA 4CDGA 4F4CA 3GEEA 5GJWC 2JLUA 3Q72A 4JZKA 3PEYA 1Z5ZA 1EGAA 4PO8A 2ECKA 1OH6A 3MGCA 3MWJA 1ZM7A 1NJFA 4A0RA 1DAMA 1G5TA 2BCJQ 3QG1A 3GLFA 4IDOA 2ZAMA 2A78A 5DGXA 3T34A 4TQAA 4AURA 1N5IA 2WJYA 4NZYA 3SS8A 4EQ6B 4OHYA 2EFCB 1N6OA 5JHHB 2VHJA 4DVGA 5FBVB 1Z8FA 2EWWA 1O87A 1S3GA 3B1YA 1E2JA 2C2HA 2FU5C 3CRVA 4GMXA 2A5GA 1PV4A 2JLYA 1IN5A 4EKDA 2C04A 3BRWD 3GP8A 2F1IA 3IGFA 4KI0A 1JXMA 3DKVA 1VIAA 1OXUA 3AKEA 3AF0A 1T3LA 4HLCA 3EX7C 1SHKA 2Q3HA 3K0CA 2GBLC 4PZZA 2ZRDA 4B6FA 1MABB 2WJIA 4JSYA 4PTLA 2VL7A 3B60A 5L3RA 3TVTA 4BRUA 2FA9A 3TGPA 5JFGA 4TTPA 1SHZA 4DZZA 4Q4LA 2BIFA 1Z28A 4BLRA 2W0MA 4GT1A 2RB4A 4X8OA 5SZIA 1E9AA 1QDEA 1G3MA 1SXJE 1VHLA 2O5VA 3UANA 2QP9X 4IRUB 4NYIQ 4DLUA 4B3BA 3J81k 1KI2A 4NHOA 1E0AA 1SQ5A 2IYLD 2D3WA 2JJ8A 3SR0A 2YNMA 1CXZA 3NG1A 3B9QA 3ZS8A 3ZVNA 3NH6A 3KJEA 4ZIRA 4FMDF 1GAJA 1OFIA 2VO1A 2VRWA 4NDZA 3AVTA 3BWDD 3RDPA 2G0NA 4RD1A 1BS1A 1ODFA 2VPPA 3AV0B 4WBSA 1HA3A 1NMXA 5EP2A 3GEHA 4LV5B 2JLRA 2V9PA 2XSZA 2ZRCA 5H1YA 3DHWC 4QL3A 3UATA 4PHGA 1IQPA 2GJSA 2G9NA 1H8HD 2OEPA 1D9XA 4P32A 1XEXB 1B0UA 2V7QD 4BZXA 4KYIB 2BJWA 3RLFA 4URUR 4IEEA 3SQXA 2KWIA 5GJCA 2YKGA 3U7FB 2WJHA 1Y63A 4CGZA 3UMRA 3RS5A 5HPYB 2G3YA 3HWSA 4TSFD 4BE7B 4Q1CA 4Z1MD 2IEZA 3W6PA 2OUKA 5FI1B 3NBXX 4PPFA 3WBJA 4Q1EA 4DUGA 3F3YA 1NKSA 3T61A 4EPVA 3D31A 2QE7D 3FMOB 1RPZA 2OCYC 3M4YA 2P65A 4URVR 3RAPR 4URWR 2FOLA 4NYJR 3R9XA 4QBFA 3QIAA 2HJGA 1EFTA 3TAHA 3TUIC 5K8IA 4ASUD 4EPXA 2XB2A 2A5FA 2XZOA 2QP4A 4HUQB 5BWMA 1AGPA 1FX0A 4M9XA 3W9YA 2QAGA 4JYBA 1HV8A 2GTPA 5HKKD 4PC6A 3KQKA 4HDOB 1VIYA 2FSHA 1XD2B 2J0QA 3I4LA 2ERYA 2GEUA 1NVWQ 4IOMA 1T3HA 3T1TA 4LBYA 2QAJA 2JLWA 4JJKA 4Q9JA 1PUJA 5B2ZA 4X8MA 2ZJAA 3EXAA 4DRZA 2RH5A 4A2QA 1VG9B 3P1JA 5FL7D 4B47A 2NO9A 4B76A 3CONA 5AWFC 2ONJA 2RGCA 5BN5A 2WWIA 3LXXA 3A4LA 4NE2A 2VBCA 1COWA 4C7OB 3UXMA 4FWTA 4JLBA 2DPXA 2J0SA 1E9BA 1S3SA 2EFEB 2QRZA 5EXPA 4P4UA 2OBLA 4D2IA 4TL9A 4BASA 2AKAB 4A2PA 1XCPA 4OQMA 4Z8XA 1E69A 1E9CA 2IYSA 1TF5A 2A7QA 3QJYA 1NBME 2ERXA 1TPZA 2C95A 2ZSDA 1IHUA 2GNOA 1G20E 2E87A 1Z63A 3KXLA 1JEDA 3TW4A 3AVWA 2A9KA 2ZEJA 1OIXA 1LS6A 2VH5R 2YINC 4HB4A 5FBQB 2IBMA 2O8CB 1G9XA 2ZRJA 1GKYA 1TAGA 1R8SA 5KOYA 1E9DA 5IK2D 1W4CA 2IXFA 2GWHA 3PCRB 5L3SA 1G3QA 3X1ZA 4TYPA 3KDSE 2CHVA 1EG7A 3AKYA 1KOFA 3SEAA 3ECCA 3X1WA 4OHXA 4JL8A 2MSCB 2W83A 1EESA 5EP3A 1M8PA 1SXJB 2F9MA 4PR0A 1M74A 4RD3A 5KYKA 1P61B 1SVMA 2CLDX 2P6UA 4NTZA 3CM0A 4ZI3A 5IT5A 3ADCA 1E6CA 1TNDA 4FW9A 1BIFA 4AKGA 4DSOA 3ZD6A 3CZPA 1NVVR 1QG4A 2AWNA 2ZJBA 3QF4A 1HH4A 1Q12A 4DCSA 2VHTA 1S8FA 3UWKA 2ZTSA 4B2LA 1W0KD 2GETA 5DYIA 4C0JA 4A15A 2DBYA 4DCVA 5JEEA 2HCBA 4GOXA 2F7SA 1G8GA 4HZIA 2IF0A 4D6PA 2Q6TA 3OFNA 4X8LA 1FNMA 4PC1A 2ZIAA 1J90A 2IUTA 1E2HA 2R6CA 4RCYA 5EXSA 3ADKA 4A9AA 4RJLA 2DFNA 3RWOA 1EFUA 1WB9A 4BWYA 4DLYA 2CLSA 2G77B 5EE9A 2OLKA 1IJFA 1Z0JA 4US1R 3SNHA 4D80A 5KTYA 4BFZA 4A8JA 1J99A 3QPUA 2ZUDA 4MYHA 4ZI2A 4MUAA 1XEXA 3B1VA 2ZR9A 2I3BA 1NF3A 2BCGY 4XTRA 4LHYA 4DDUA 2Q21A 4D4LA 4EJSA 3CH5A 3K09A 5AJWA 4A36A 4G3XA 4OHVA 5ELXA 1CJKC 2NQ2C 3GLHB 3I8XA 2W6ID 2CEAA 3THXB 2EYQA 4JLOA 2H57A 2QUZA 1QF9A 1NI3A 3A8TA 1F3OA 2ASEA 5DI9A 3HYTA 4BRWA 5AUNB 1AKEA 2PLFA 5JI3E 1A2BA 1P9NA 2K5UA 2VP6A 3U4QA 4B3DA 2YC4C 3KB2A 2O8EA 2HCJB 1IN4A 5EJEA 2HT6A 2QPOA 1RZ3A 3WP0A 1S1CA 2UKDA 3D8BA 1WA5A 3N2IA 2DWOA 4JLPA 1Z08A 4V0MA 1CP2A 5C4GB 5FTLA 2QAGB 1KNXA 4GMDA 4HUTA 3TSOA 4Q66C 2GCOB 4YMVA 4GI7A 5JWOA 4AY2A 3MG9A 2GCNA 3PUXA 3PG5A 1NIJA 3AF2A 4TMZA 3QOFA 2XXAB 2O8FB 2IS6A 3GJ4A 2GZAA 3HP1A 1GM5A 1KAGA 2P0EA 2JGNA 1A1VA 2WIAA 1P5ZB 1VCMA 5JEDA 1OJLA 4TZ6A 4AC9A 2Q3FA 2YV5A 2HF8A 4N1AA 2IHBA 2XITA 2OV2A 3DOFA 3W3ZB 4URYR 2JLSA 2CL7X 5TB5A 3VKGA 2GF0A 3QE0A 4LYAA 2ZRFA 1G7SA 4RZUA 1M2OB 1XTJA 2YZ2A 4M1YA 1N3BA 1W48A 3ONWA 2NO6A 4JLNA 2AKYA 1CRPA 1GWNA 1VYUA 1SKYB 2HDNB 5HTKA 2W0SA 1TQ6A 1XMVA 4AYXA 5DI3B 2ZE7A 2YWEA 2NZ8A 2ATVA 2ZRLA 1Q1BA 2QL6A 1A2KC 2EFDB 1ZNZA 3FWYA 2VP9A 3RSLA 1E2QA 1CJVC 3K0FA 4TLBA 1KKLA 5CYOA 2R62A 3AF4A 4DIDA 3P4XA 1OHHA 4KFSA 3N5CA 3U44A 4QNRA 1YR9A 1KKMA 1U81A 2QMHA 5KUTA 1VHTA 1WDTA 2FPLA 3BB1A 1GL7A 5J4LA 5FUYA 4BPBA 1II8A 1A5TA 1UDXA 5E95A 3T1OA 4DDTA 4N3NA 4XWKA 1WE2A 2GCOA 4BLQA 1T3SA 3CNOA 1N0VC 4K8OA 1XTRA 2ORVA 2FWRA 4PC2A 1KHTA 4D0NA 1I4TD 1UADA 3LO5A 2J1LA 1D5CA 3FB4A 4RFVA 1P2TA 1LVGA 1Z07A 3NWJA 4LZZA 2QQ0A 3VR5A 2FF7A 2PX0A 1YRBA 2OG2A 4QRHA 2NOAA 3NBZC 1MRNA 2QPTA 4L9WA 2N42A 3C14C 3K9LA 3NVAA 4XVRA 3FOZA 3SN6A 5JBQA 3FMFA 2QROA 4GL2A 4MKHA 2QTHA 4ZCIA 3TQCA 4GPTA 1Z6XA 3D7MA 4L8GA 4LJ5A 1ZNYA 2A5JA 4NH0A 4Q4JA 2GRJA 1OT3A 3HR7A 3LVRE 1N6NA 1R5NA 5SZHB 1CLUA 2CJWA 3PUZA 4JSTA 4PO9A 4ESVA 1K6MA 3EPJA 2CL6X 4PX9A 3SBEA 3SJAA 2P67A 1DAHA 2RGDA 3FGNA 4H1VA 2PZFA 4RY2A 4LJ6A 4JL5A 4JJZA 2PMKA 4P33A 4Q47A 1XWIA 2J0VA 1Z47A 3L8YA 5D3MA 5EE1A 1E2IA 3QPWA 3PEWA 1N5LA 3LW8A 2B7CA 1HYQA 3SYKA 1TF2A 4B6EA 4PAOA 1ZJ6A 4RD2A 3PIRA 4PPNA 1E9EA 4P4SB 4EJSC 1SXJD 2VLIA 2ZI5A 1QZXA 2OHFA 2Q9CA 5F3WB 4OI2A 5FR1A 2RGNA 3QXJA 3JZAA 2XTNA 2X2EA 3RC8A 2MMCA 1Z6AA 1Q3TA 4KBGA 4HAZA 2FH5B 1NJGA 4DSTA 2WAYA 3P20A 2WKQA 2ZI6A 3OIYA 4TLCA 3ADBA 3I62A 3A1SA 1GTVA 2A2ZA 4XVUA 3CPEA 2OAQ1 4DCUA 3KTAB 3LX5A 4TYWA 4LUCA 2PEZA 4V03A 1OH7A 4Q4HA 1BO6A 3EZ9A 1BMFA 1P2UA 3C5CA 4RFSA 2OBNA 4C4PA 3ICEA 1G7CA 2AX4A 4AD8A 5CM8B 2QN6A 4IDNA 4U02A 1BYIA 2SHKA 5FTMA 1TADA 3UG7A 2P2LA 2OXRA 3T35A 4CEJB 4PXAA 1IOZA 1NN3A 3GD7A 4N0DA 3VFDA 1W46A 4OK3A 3IO5A 4TWZA 2VQSA 2V6JA 5FOTA 3P27A 1Q1EA 3DVLA 1JJ7A 4QHTA 2BM1A 2J7PD 4DLWA 1XEFA 2R65A 3BJIC 4CEIB 3VHXA 4LV6A 4Q9IA 1LTQA 4BZQA 4DCNA 2ZYVX 4NCNA 2BMEA 4JLDA 3L0OA 1CR0A 4IOLA 4ZDWA 4IJMA 2OFWA 2Z4SA 2IEYA 5J40A 3QPVA 1RYFA 2DWQA 1KI4A 8OHMA 4MDFA 1N5KA 1U8YA 2ZSEA 1F2TA 4JBYA 4C0LA 3LY5A 3U5ZB 2DR3A 2H18A 4ITRC 3RWMB 4DLZA 4ON9A 3RSOA 3TBKA 2BBOA 1XPUA 3QKRB 1OH8A 3RNLA 2UVQA 1SVIA 2JLZA 4Z54A 1VG0B 1LB1B 3WYGA 5J4VA 3X1DA 4MYCA 1T6NA 2HF9A 3ZGXA 2YWFA 3VX3A 2L0XA 3B78A 2G6BA 3KZ1E 1GZSA 1HE8B 1BMFD 1HEIA 1DAEA 2Q0HA 4RZ3A 2ZR7A 3EWSA 3UMSA 1E94E 2C5LA 3ZZUA 3BOSA 2IF2A 1X6VA 3AVVA 1H65A 1N25A 2FPKA 2RHMA 5AJXA 4D82A 3OEEA 1S96A 2JJ2D 2ZI7A 2VSFA 3CPHA 1P4SA 2QAGC 5DHFA 2WHXA 1D2EA 4UNRA 3VQTA 3RS0A 1KK1A 1JR6A 1NVXQ 1ZCBA 3UIEA 2XZLA 4CEIA 1AZSC 1CTQA 1UJ2A 3I92A 4JVSB 2B8WA 3MJRA 2OE2A 1ZCAA 1DEKA 3FMPB 4KLZA 3SOPA 4A8JC 3RRYA 4ZV4A 4L9SA 4OHWA 2DHRA 4D0LB 2VHCA 4V0NA 4OI1A 3OIUA 1GRRA 2FG5A 5HCNA 4AKIA 4MRRA 2PCLA 4Q9KA 4U00A 4W5HA 1FTNA 3K9HA 1W44A 3NC1C 3A1WA 4BECA 5C2JB 1G8FA 5M04A 2WKPA 4KVGA 5J4HA 3U61B 4KLNA 4A92A 1VYTA 3C41J 3H4MA 4Y0AA 5P21A 1OH5A 1P62B 1OIVA 3B85A 5CDFE 1G8YA 1YZUA 4NBSA 3U7EB 3R8FA 1KY3A 2ZI3A 3LXRA 3V9PA 4UJ5A 3T15A 2G88A 5FH9A 1GRNA 1IJEA 2FEMA 4C0SA 4Q18A 4FCTA 5D3QA 3EARA 2F43A 4QKQA 4M8NE 5LPNA 5BW8A 2IS1A 1NMZA 2XJ4A 3G5UA 4KVAA 1XCMA 3OAAD 4LJ7A 2O0JA 4IDQA 4D26A 1VPLA 1CS4C 1WQ1R 4ZDIA 5E7JA 1V5WA 4EUNA 3P26A 4NL4H 5EE0A 1MH1A 1E2NA 2QA5A 3M1IA 3C8UA 3UPUA 3W8RA 1PVOA 2O8CA 4C0AC 3O8RA 4IDPA 1Z0FA 3WMEA 4RFSB 3B9PA 5K8LA 1W2GA 2BMFA 4IXNA 4A0FA 4DDVA 3LQQA 4QJ3A 4IEIA 1E1RD 1QBKC 2ZJ2A 3KFVA 2A30A 4CEJA 3M6AA 3N70A 5FBRB 1VTKA 2VEDA 3KJIA 1OIWA 1GUAA 4F92B 2ANCA 4OK6A 2QMOA 3CIOA 1E96A 2FSFA 4RZ2A 4G5GA 4DT1A 4A0HA 5L3QB 1GNQA 2YOFA 4HDCA 1BKDR 1A7JA 2V8OA 2KBEA 4QJ5A 3SJZA 4Q00A 2ODEA 2W2XA 5DE3A 3BERA 4F4IA 4XOIA 2V55B 1ZM4A 4LGMA 1W5SA 4KU4A 5A4JA 2PX3A 4OHZA 4UJ3A 5TARA 1B23P 4WZBE 5EXXA 1OSNA 3EPHA 1U0HC 2XGJA 5CIWA 4ZKEA 3B82A 4LRWA 2IYXA 3CB4A 2ZRAA 3X1XA 5K8TA 2Z4RA 4JLVA 1D2MA 2GZHA 4HZUA 1F2TB 2NTYC 3KKNA 2D7DA 4LK2A 1P60A 3BAFA 1RRCA 1TF7A 3VAAA 2WWXA 4CZ2A 3A1VA 1VDZA 4A8JB 3MWYW 5CITA 3ZLJA 3OIWA 3BC1A 1EXMA 4TLDA 1II9A 3OEHA 3CBQA 3ASZA 1G1MA 5CIQA 4BFYA 2JA1A 4XH9B 4G01B 2BM0A 2YOGA 1P3JA 1R10A 2ODWA 3CW2A 2HV8A 4RD0A 1JPNA 2R8RA 1NRJB 2LKDA 1W4BA 4JKIA 4O0MA 4ERNA 4KFUA 2ORIA 1CR1A 4FMCF 2J45A 3THYB 2Y8EA 1KYIA 1T0JB 2WAXA 2JASA 3FFAA 1ZC4A 5HE9A 2ZITA 3AQ4A 3TSZA 1E32A 2PL3A 2IYWA 2VP2A 3THXA 2GXUA 2PJRA 5LD2C 1FOEB 1UDWA 3ZYCA 4POAA 5JSZA 4KO8A 2R6AA 3IIKA 1HTWA 3LV8A 4Q7JB 4AIIA 3ND9A 1SULA 2IYRA 1GNPA 2VF7A 2ZU6A 1KGDA 4TZ0A 2NPFA 4LDJA 1SXJA 2JJ1A 1CJMA 5DIFA 5FI0B 3G82C 5TDHA 1U94A 2J7KA 3U3KA 4ESHA 5L3SB 1WBBA 5JECA 2REOA 5KNBA 4YXWD 1E9SA 5FR2A 4JLJA 3QY0A 4LHZA 4C3ZA 1K5DA 3EZ2A 1E2GA 2F1JA 2AK3A 4UNPA 1E3MA 4IOKA 2G83A 1HQYE 2C96A 1XDBA 3FTQA 4M1WA 2V4ZA 3RHFA 2FFAA 2XXAA 1P2VA 4MRSA 3BH6A 4FI3C 1UKYA 4IXMA 1EK0A 4PPQA 4ZKDA 2BVNA 1M1YE 3VTKA 4DLXA 3K70D 3TUZC 421PA 1CEEA 1DAKA 1KZGB 1IN8A 4GZLA 1R6BX 1J7KA 3AEZA 5LBIA 2QGZA 5B64A 2CBZA 1SZPA 1XFAA 4JT4A 5KDLA 1XXHE 4LSGA 1JEEA 1LW7A 2GJAA 4PSVA 4Q4AA 2GVDC 3UWOA 3AP3A 4RD4A 3TNFA 2FV8A 1XD9A 2C78A 2XZPA 3FKSA 3K0AB 4MRNA 1FNNA 3K0FB 3DOEA 5FUVA 2H92A 3K0CC 4PAQA 3DEFA 1KY2A 3OFND 3T1QA 4BFUA 4TYNA 1M7GA 4W5JA 3KKOA 3BE4A 4B71A 1TEVA 4RCZA 4IW3B 3WHKA 4ZPXA 4IDHA 4TMXA 3IKJA 1TU3A 1UBEA 2CLCX 1CR4A 1KJZA 2ZE8A 3V4FA 4P3YA 2QMUA 4JBWA 2ONKA 1U90A 2YJTD 4EPWA 1IM2A 2CXXA 3QEOA 4NCKA 3F0TA 5JS8A 1UPTA 1KZ7B 2J9RA 5EZ5A 1CIPA 3TW8B 3QXCA 5KHOC 1N0WA 1W4RA 1YKSA 1XEWX 1S0UA 1DS6A 5HE8A 2H1LA 2D7CA 3QXXA 1X8JA 3KKQA 2J7PA 1G7TA 1E0SA 2XEXA 5AUPB 4BFXA 5IK2A 1EFRA 2HEIA 2ZPTX 3CPJB 2O8EB 3EZ6A 1E2MA 5G3ZA 1D6JA 4A4DA 3CRMA 3BK7A 4BFTA 3LRPA 4EQ6A 2ZQ5A 4EPTA 1E1RA 2ZRIA 2CCJA 3CR7A 5JRJA 1CU1A 1MV5A 1YE8A 2BJVA 2W58A 4OJKA 3B7GA 1PLJA 1TX4B 1RJ9B 2BBTA 1ONBA 1YR7A 5BYJA 3IIJA 4A6XA 3A6PC 3NBFA 5CJ2A 3CX6A 2W2TA 2ZROA 2CVFA 1RVDA 2JLVA 4KCGA 5FPHA 2ZJ8A 3OAAA 4MGIR 2WWFA 2JLXA 1COWD 2D62A 2DFTA 3CUEF 5KPDA 3KQLA 2V3CC 3QXHA 5GJVC 1F5NA 4OQXA 4DC9A 5BN4A 1KAOA 3QBTA 5LDDC 1KI9A 3GJ6A 1VCNA 1XPOA 2OBMA 3CRW1 3GFOA 1XTIA 1ZIPA 2FSGA 2NO0A 3SFZA 2QEQA 4YMTA 4UNSA 4YXWA 1RC8A 2QBYA 2FE4A 5HKKA 1CF4A 1ESNA 1KO7A 1AM4D 3LBIA 3PFIA 1DE0A 1QHXA 1XZQA 2A3RA 2REXB 3DL0A 3O8BA 4MYTA 2VHQA 2ZJZA 4TL8A 3A1TA 1KI6A 2ZS8A 2QTVB 1EWRA 1X8LA 2E1RA 4MH0R 2ZETA 3DO6A 2VA8A 4ASUA 1VCOA 3UKDA 1G6HA 1L7VC 1NLFA 4DEYA 3AGPA 1NLYA 4QGFA 4M1KA 4KFRA 3CRRA 3I8SA 3KQUA 1CR2A 1CBUA 4Q21A 4KAXA 2BEJA 1AQYA 1CJTC 2R6FA 3MFYA 3WRXC 3ZQJA 4F4JA 4JLMA 4BEJA 3SQWA 1Z3IX 1OB2A 2PT7A 2Q9AA 4M1TA 2BBSA 2EFHB 4YMUA 3KKPA 4ACAA 3L0SA 4LCBA 4LJYA 3TK1A 4F91B 1TQDA 1NVUQ 1SVOA 3B1ZA 1NN0A 3W34A 3AVPA 3OEED 2IC5A 3PXGA 1XMIA 1C4OA 2XOKD 4P0TA 2GBLA 1JB1A 2V6IA 2DCUA 3RABA 5E3HA 3HR8A 2WWGA 3BFXA 3LNCA 1OFHA 3IIMA 4XSHA 1T9HA 3O8CA 4L4UA 3LBHA 3TIFA 5KU1A 4U7DA 1HURA 1YZQA 4NKRA 3U60B 2OCPA 1HE1C 2AXNA 4OBEA 1IXZA 1X86B 5F98A 3L8ZA 4HSEA 1U9IC 4HB0A 2F3RA 4HI0E 4LJ8A 5EQTA 3SDZA 1MT0A 1QHHB 2ZAOA 3KL4A 4HUQA 2H8KA 3F8TA 1W0KA 3NH9A 3ADDA 821PA 3F5FA 3WNCA 2DFKB 1U0LA 2PH1A 3NKVA 4QBIA 2VYFA 3GJ7A 3OZXA 3QKSA 1KK3A 1G6OA 1LNZA 2OO7A 2ZRBA 1E4VA 4C2UA 1W1WA 2WJJA 2ZI4A 3QNUA 2X8AA 4OYHA 1JJVA 4AYWA 1KI8A 1OHHD 2Z0MA 5EUQB 5D3MB 3VHLB 3AVXA 4KV9A 4I1OA 1DADA 2AR7A 4RKEA 3WNBA 1W36C 4RVCA 2GXAA 3GEIA 4ARZA 3CX7A 4HAYA 2NIPA 4MA4A 4MRVA 3GLHE 4CVNA 2OILA 3MCAA 1AA9A 2WSMA 4G5OA 4QGHA 4A2WA 2A5YB 5C4MA 2UZIR 2HYIC 1GIAA 2XJ9A 4MKGA 3W90A 4M9QA 1RFLA 3LBNA 1ZD8A 1P75A 5EZ6B 1DAGA 4E07A 4L5BA 3K9NA 4M4SA 3SU8A 1DAIA 4YDHB 2AFIE 2OCAA 1YJ5A 3HDTA 3PEUA 2F55A 4PC3A 6Q21A 5G40A 2WMOB 3NBYC 4XJXA 4Q4HB 1NN5A 1NIPA 1UEIA 2F3TA 1XJ0A 4E22A 2GCPA 1SKYE 4LHVA 4O2RA 5FOUA 4JMPA 1KDPA 1DAFA 3IPXA 4DBLC 5DSZA 5FL7A 1UBFA 4QGAA 4M21A 1ZIOA 3I72A 2XB4A 3Q8XB 2QZ4A 2H17A 2H7VA 3BFKA 2XTMA 5FOVA 1DVRA 2RGXA 3IILA 3DM5A 3NDBB 4WXPA 4C0QC 2WWWA 1XXHA 3VR3A 4TN1A 1KMHA 4ZCLA 1QG2A 2GZDA 5IRCD 3CR8A 2XNSA 1E98A 4Q9HA 3PV0A 3ZVRA 3DMNA 1X8KA 2G0TA 3D6TB 3ZIAD 1NMYA 3FFBA 3EPKA 2NO7A 1FUKA 2Z43A 1XJCA 1KJYA 1XD2A 2B8TA 1X1RA 2AXPA 4LC0A 3SI7A 1SXJC 2EU8A 3I5XA 5LB2A 1OXTA 4B3XA 2BKUA 3WXMA 3IEVA 4Q5IA 2VHUA 4JVLA 2F43B 3TUJC 4EPRA 1US8A 3M0EA 4WIAA 5KDOA 2EYUA 2OAP1 4FMCB 1P73A 1ZM2A 2JAQA 4QOSA 2VP4A 3QKRA 1SGWA 1U8ZA 4KODA 3VR1A 4CEHA 1FP6A 1KDRA 1PZNA 1G16A 1G7RA 1R0YA 2EVWX 2OZEA 2Z6VA 5C18A 1KO1A 1MR3F 1G8PA 1LV7A 3R7WB 3GQBA 5FPKA 2QT0A 3WBKA 3MJHA 521PA 2V7QA 1G3RA 3PUYA 3KKMA 3U7GA 3WMGA 1VG8A 4I1SA 2Z83A 3FVQA 4JVNA 4DT1B 1T4GA 4TTQA 4B3FX 1KDTA 4Z8YA 1GL6A 2WM9B 1OE0A 5JWHA 1FUUA 1TEXA 1E79A 1SVWA 2EQBA 1G64A 1NKTA 1XF9A 2QU8A 1C1YA 4TYQA 1ZW6A 1OB5A 2P6RA 1R2QA 4JL6A 4PO1A 5ANRB 3MLEA 1IY1A 1EX6A 3NDPA 3B2EA 3QKTA 4R2IA 4C30A 1NY6A 5IDVA 3FPAA 4LHWA 5BN3A 3HU2A 2ZRNA 5H70A 4WAUA 3JZMA 1S2MA 4R71A 1XPRA 4EFNA 1RRFA 3DDCA 4F7WA 1OF1A 3IEUA 2R9VA 2FFQA 4S35A 2ZVPX 2FZLA 3AM1A 1U2RA 4MUBA 3VKHA 3RRNA 4I1UA 1TUIA 1M34E 5JCPA 2QP3A 5EXTA 1E0JA 4KXFB 1QHGA 1FQKA 2HT1A 1ZAKA 2V54A 1DO2A 3FKSD 1ZUHA 3AH8A 1UAAA 1E2KA 3EG5A 4XWOA 1XCGB 1NBMA 3E1SA 2YC2C 1IN7A 1TQ2A 4LV8B 3BBPA 4GNKA 5F2EA 2ZXUA 4CEHB 4C0HA 4Y0VA 3LH5A 1KSHA 4XIGS 2J46A 1N6PA 4O25A 4DHEA 3R9WA 5JLJA 1NSTA 2MSDB 4M2LA 5DI3A 5DN6D 2LCFA 4XTCS 3O47A 1XTQA 3WYAA 2FPMA 3I73A 2EWVA 1I4LD 3L2OB 5AJVB 4IOJA 4EFMA 1Z6TA 2J3EA 3LW7A 4PHTA 4DB4A 3DZ8A 1GNRA 2KI5A 2WSSA 1NL3A 1M7BA 1TTTA 1NSFA 2ZYWX 4MKIA 2ZUBA 1U98A 2AL7A 2W2VA 4FCWA 4UNQA 1ZM3A 5E7MA 1XNJA 4V02A 1XEWY 2X1VA 2GK7A 1DBSA 2VTKA 1ZNWA 4XWAA 3BIFA 2GKSA 1UM8A 2IK8A 4M22A 5KSOA 3CH4B 2JEOA 2JJ1D 5CJPA 1XMJA 4BGDA 2ZE5A 3GLGE 4NYIR 1FX0B 2H16A 4PQYA 1R7RA 1IAQA 3ZZ0A 3MD0A 4G0NA 5FUWA 1OKKD 2ZSFA 5CLLA 2CMKA 4Q1AA 4PANA 3VR2A 4BLTA 3DMDA 2ZRHA 4AWXA 3K0SA 3ICQB 2W00A 1MO4A 4PAMA 4W5WA 3AF1A 2QE7A 4LJ9A 3SC3A 1JPJA 3GJ3A 4DUGD 4B73A 3GJ8A 1Z0DA 2BMDA 3BXZA 2IXGA 2IYTA 4LBWA 4PQFA 4HZUB 2O8BA 5KPJA 5GVSA 3EIQA 4C0BA 1JR3E 4Q19A 2HLDD 4S2EA 5HR5A 4EPYA 2ZU0C 5AJZA 3IQWA 1MO5A 2ORWA 1SVLA 4PZYA 2GESA 2HUPA 2OLJA 1GVNB 4ABYA 1RE0A 1FL9A 4MYUA 1H8EA 3ZQ6A 4XD7A 5KSPA 1PLKA 4I4LA 3X1YA 4DB2A 4Q1FA 2OXCA 3LQRA 3SFVA 2YOHA 3NEJA 1N2CE 3AVOA 2ZJYA 4GDFA 2N46A 2WMNB 3Q85A 1JAIA 4EIWA 1PUIA 3QI2A 1OYYA 2RGGA 3L0PA 5KSZA 2CVHA 2WWHA 3Q7QA 2OCBA 3QKUA 1OXXK 1ZRHA 1TUEA 3EA5A 4JS0A 1G3IA 4HYYA 1F60A 1KSJA 3B1WA 5TY0A 1W7AA 1JR3D 1UKVY 4B3CA 2WJVA 1E1QA 2TMKA 2FJUA 5H8WA 1RRPA 5JSZB 3L82B 5G53C 4TYYA 3FMIA 2GAOA 3AVYA 4JIMA 5BYKA 3THWB 3A37A 2I1QA 4WVFA 2PBRA 3KFXA 1G3UA 5A5GA 3CF2A 3IHLA 2AHOA 3RVBA 3EIEA 3Q7PA 5H68A 4HDQB 4PQRA 2XX3A 3RRZA 4LBVA 5EE5B 3TAUA 2GHIA 1A82A 1ELOA 4M1OA 1UEJA 3T06B 1Y3AA 2CK3D 1XBTA 4OQLA 4URZR 3FHTA 1W4AA 1XU4A 4IVQA 1WCV1 3GFPA 1KK2A 1DOAA 2RCNA 3LWNA 2WWYA 4EAQA 4O3MA 1LY1A 1KNQA 1YU9A 1E1QD 2NPIA 2O0HA 2ZR0A 3IBGA 3KTAA 4BFWA 1I4DD 1OFUX 1XZPA 5TMPA 5HZKA 2PLRA 3FHOA 1L8QA 1N6LA 3WHLA 4LC1A 5AK0A 5GADl 2QM7A 1Z29A 4YC7A 5AUOB 3T1VA 2JIZA 2IHYA 4RKFA 4BZPA 4K81B 2WBLC 4Q1DA 3I1FA 1G17A 1QHYA 4B3GA 3TVDA 3TJZA 1Q1ZA 2D2FA 3PVSA 3V00A 4DIEA 2GEVA 4PSKA 4DLVA 1JQLB 1N6HA 2CE2X 1J8MF 3VNUA 4NCHA 1O3YA 5CB8A 3NHBA 1AIPA 1KJWA 1W0JD 3AUYA 2ZI9A 3A4MA 1Z2AA 3L0IB 2KBFA 2HLDA 3S1AA 1DG1G 1OXSC 4C2TA 5C46F 4HAXA 2BV3A 5IF9A 2BHRA 4LYHA 4M1SA 3TLXA 5EE3A 1FMLA 3U4QB 4P4TA 2N1BA 1E9RA 3KQNA 1G21E 4TMVA 4F38A 3HYRA 1ETUA 3KX2A 3MRSA 3GLGA 1J2JA 1OYWA 1F2UA 4I1VA 2PCJA 2E9SA 2VIIA 1R0XA 1JALA 3KXIA 5E4FA 4AG5A 4DLSA 1NG1A 4DLTA 4BFSA 1VECA 2W6IA 5CK5A 2WTUA 5CDFA 4W9MC 4UQOA 3C15C 3EPLA 3RYTC 5FPTA 4QXAA 4QBHA 2NO1A 2GDJA 3VMFA 4HATA 4AKHA 2QPAA 2JJ2A 2CE7A 3LA6A 4TLEA 1GKIA 4GBMA 2OSBA 4DSNA 1ZINA 2IYQA 1Q22A 1AS0A 5KO2A 4GP7A 4A0GA 4A6PA 1ANKA 3H0KA 2WSSD 5DHAA 5SZJA 4M9ZA 3GLIA 2B6HA 4C9BA 2FZ4A 3K1JA 4WA7A 4A82A 2O8BB 3I5YA 4LOAA 5EP1A 1WP9A 3THOA 1Z6GA 4ZCMA 2GXQA 2HXSA 1YHNA 1HT2E 2PMDA 3HJNA 5KNDA 1TU4A 4E5UA 1E2DA 4MGKR 2I4IA 3C7KA 1CULC 2GJ8A 1HQCA 4OK5A 1Z0KA 3GLFE 2Q9BA 2YHSA 1N6KA 3PUWA 3EC1A 3PJRA 1ZU4A 1NBMD 621PA 2R44A 5JRZA 4TMKA 3TQFA 4HAWA 1D9ZA 3QEJA 4OL0A 1SVSA 4MQBA 1QHHA 2MSEB 3TH5A 2IA5A 5LD2B 4EJSB 2ZJ5A 1CJUC 2CCGA 2GXSA 3GJ0A 3CKLA 1R5BA 2WV9A 3TKLA 3ZS9A 3GLHA 1ZVQA 1ZM9A 5SZKB 2XNDD 4V0LA 2WJGA 4JKYA 5J5CA 4O2LA 5FUXA 1G19A 2RMKA 3GMTA 2J0UB 4FIDA 2WOJA 1MOZA 2GK6A 1W36B 1PLLA 2R2AA 1GDDA 1RYHA 3AKDA 4PC7A 3WMFA 4ARZB 1ESMA 3K0EA 4PZLA 2IS2A 1D2NA 1KI6B 3VR4A 3H84A 4QHSA 4ACBA 1GKUB 4KJZA 2JDID 2B21A 2F1RA 1SVKA 1RKBA 2I1VB 1WF3A 2NG1A 4AYTA 2QSZA 3KB1A 2IW3A 4R7ZA 4YLGA 5GJBA 1QRAA 2ODNA 3AF3A
chains in the Genus database with same CATH superfamily
4WBNF 4JJGA 2I5PO 1ISGA 1Z6YA 2IZ1A 1ISSA 5C80A 2EV9A 2AUTA 4EX7A 1HWYA 3HYSA 5IBPA 3PENA 2QJTA 2ZWPA 3JVUA 4GRAA 1M8JA 2FFBA 4JZYA 3H2HA 1BU5A 3DBLB 4Q37A 3U7IA 4NMMA 2X40A 4U5XA 3LBAA 3VHQA 4MJ3A 5JMTA 2VYNA 2JEYA 1MW9X 2Q1WA 2V3WA 5G1OA 3TDKA 4Q93A 4QFDA 3U2QA 3UQZA 2YRXA 4HNUA 4YONB 4U7PB 4ARUA 4F2PA 1RAHA 5I4IA 3A32A 3PQ7A 4RWEA 2C77A 1TAHA 3ZTWA 1H5NA 5JJ5A 4F6LA 3C39A 1JXAA 3OF5A 1NVVQ 4P7BA 5A0FA 3TR5A 2PLAA 4TTRA 5SYAA 4D25A 3FGOA 3UQYS 2PUEA 3H04A 4I4TA 2CUKA 2VDOB 3FDIA 5BQ5A 3W5AA 2DB3A 5ES3A 4HRYA 4C4RA 1P2SA 2CFTA 2QLMA 2X77A 3LP5A 1KI3A 2AF3C 2DZDA 1E7QA 5K3CA 4B6JA 3D4IA 4MXDA 3EZXA 5GV7A 4QZVA 3WLTA 3P8ZA 2YV1A 1XXHB 3DV9A 1W47A 3WRXA 5T4FA 4M0DA 1JWBB 2ZYHA 5K3DA 2LWIA 4JC8A 3EQ6A 4BLUA 1IY9A 1ESCA 1ZUNB 3NORA 3D7KA 3SHOA 1O5OA 3MJVA 3WY9A 5JZSA 1PYOA 3P94A 2PKYX 3CF0A 5DWVA 4UZFA 2E4VA 2C8VA 2FW8A 2JAHA 1H1LA 4I5DA 3TOXA 2YS7A 2FVXA 3O91A 3OQNA 1KSGA 2C03A 1JIKA 1IWOA 3HGMA 1BX1A 2AMJA 2HADA 2HJWA 3RUAA 5LZ5A 3WWZA 5BVGB 5CFQA 1MD9A 5G41A 3SHFA 2Z5FA 2FLKA 4DNXA 3KD2A 5BUSA 1IBRA 3V4RA 5C8YA 1US8B 2DFDA 3SX4A 4FVTA 1LPBB 2ZBPA 1ISHA 1NFFA 1O89A 1TL7C 4LYJA 2ODTX 1S2OA 2BFFB 3ZH9B 4BLOA 4OGGA 3H2YA 3VPXA 5K20A 2P5YA 1VKJA 4ALIA 2VSXA 2GYUA 2NU7B 5G0SA 1MZVA 4L5AA 1VI2A 2GYWA 5KJ6A 2YMQA 1VPTA 3CN9A 3RS4A 4LE0A 4D4MA 4R2WA 4G5SA 2VP5A 2OCXA 2VNKA 2JS7A 2C54A 2ZRMA 1G5PA 1U2GC 1S4QA 1QH1A 2QYOA 1TD1A 4QAQA 1QF7A 2QENA 1B6TA 1IG3A 1EE2A 3L46A 1AS2A 2OPHA 1HYHA 3LYAA 1JWAB 1XHLA 4GE3A 4LYFA 4PZEA 3W6OA 3A28A 5C7YA 3A26A 4XYEA 3V2HA 4AZ3A 3U1TA 4ZZIA 3RYFB 3T94A 4GL4A 3NAQA 4PGFA 1S8AA 2BFDA 1AKTA 2WB4A 3IDSA 1TQ8A 4LX0A 3EVTA 1IXSB 1P5JA 1KJIA 5DX0A 1QYRA 1T5TA 4KQXA 4MOWA 4TQUS 3EPJA 1GNLA 2COKA 3GRYA 1H4SA 3A10A 2JKVA 2FTKE 3UJ6A 2XB6A 4M53A 3SF8B 2HGZA 3IODA 4XM2A 1DIBA 1P6XA 2KMLA 1WXQA 4QASA 1ZKDA 5FBLB 4YJHA 1KOJA 3FTNA 4H31A 4KRXA 4QOGA 4Y98A 2YWBA 4Q39A 3L7DA 4DV6B 1YS4A 2YVAA 3JQEA 3PS9A 4GEGA 4N0MA 3E1KA 2E55A 5KINB 1TKCA 4DXHA 5FJJA 3J81k 1BCSA 4A5OA 3EGIA 2FEKA 1DARA 2VDWA 3GRUA 2JHCA 4RD6A 1H6AA 4R1PA 3RCBA 4CMJA 1T2UA 4D41A 5JD6A 1EVEA 1X7ZA 4NJOA 4QTUB 1BX3A 1PZMA 4E31A 4OFXA 1F48A 1R8QA 3IVCA 1AUQA 1PFUA 1E3JA 3BH0A 2EGHA 4JP1A 4Q3NA 1JSCA 3F90A 4V0OA 1OFTA 1EK1A 1EB8A 1YI0A 2ZTHA 5THXA 5BSEA 2HSZA 4J3FA 1ZNXA 5G02A 5B7QA 2A35A 4KXXA 4B82A 1AZWA 1W85A 4HJRA 3BFPA 2VI5A 3K9CA 1ZCJA 2WVJA 2CXTA 2C9CA 1JHZA 4G85A 4OMCA 5AK6A 3ZWNA 4BUZA 2CDCA 2EFGA 3ISTA 4AKEA 1Q91A 2A9OA 1TA9A 5A9TA 4N48A 4WK4B 3OU6A 2JD2A 1BDJA 5DASA 4OIMA 5L8VA 3CEMA 2ZB2A 4MS3B 3EFEA 4WK0B 1YI1A 1R6UA 4QA9A 3CWQA 4L4YA 4DLNA 3U6BA 2G1UA 3NB0A 3A9VA 1PDWA 5BQXA 1UBCA 4BWFB 3BE8A 3KQHA 3VO2A 2PGDA 2HEGA 2P3SA 3PJEA 3IDOA 1Z33A 1ZVVA 2XDAA 4GUDA 3JAWA 3PC4A 3OQHA 2VF2A 1XYYA 5DTQA 4DUYB 3JRXA 1X3SA 2Q46A 3R0XA 2NAPA 1NMSA 2YX1A 2QN1A 4B5KA 4QODA 4PXSA 3EZFA 4TMTA 4PGMA 4FNAA 3L3BA 4B6SA 3OJOA 3EQ2A 5FIUA 3U7HB 4QARA 2Z2ZA 2ZOSA 3QG5A 1II0A 4WOBA 4N03A 4CDNA 1X80B 2ZANA 3ND5A 5DLQC 2NSDA 1MB9A 2DFLA 3M1YA 3QF4B 1SUAA 1Z5OA 3JQ8B 3TW0A 3VR2D 2I0FA 1KK0A 3JTEA 4AJEA 1U3DA 3NHUA 4CM8B 1ZBDA 2DPMA 4KOAA 2WOOA 1VL6A 4XPIB 3I6QA 1EP3B 2CY0A 2GMWA 5C0OE 2MR5A 3MYRA 4TL7A 1H66A 1YQTA 3CCCA 3T38A 4RADA 5FBWB 1EWYA 1XJQA 4LF6B 3BF8A 4JVMA 3C5EA 2NU6A 1DKOA 1UFQA 4EG1A 1NC1A 1E3LA 2BF4A 3R74A 3BEDA 2XADA 3UEOA 2BGRA 3N39C 4H7DA 4LWZA 4FNGA 3W8DA 1ZSNA 1BS2A 1XP8A 3BL8A 1HQDA 4WECA 1XKLA 4PFSA 5JASA 4G81A 5IKEA 5BN5B 2P27A 3VNSA 1Z62A 2FB9A 4EO4A 2QY6A 3G5AA 4V0KA 5EWJA 1LGYA 1GD1O 3U7JA 4C0KA 4YALA 4P83A 2A1TR 2R47A 2VF8A 4MV7A 1PR3A 3HU1A 1XZJA 4Z1OA 2H1SA 2R6DA 4P54A 2FYTA 1FSZA 1NW3A 3EHDA 4QVIA 1AKVA 5DN6A 5GONF 3BFVA 3UAVA 2P9BA 5HIKA 5K09A 2OC4A 1GDHA 2FGKA 4IDFA 3EH1A 3GJ5A 3L92A 3ZI7A 5K6TA 4KGDA 4MEJA 4N12A 3RK0A 3U40A 3BGIA 5DM70 1M6EX 2AA3A 3CX4A 4DJ5X 2AZXA 3HLKA 1SQFA 4HGZA 2P2SA 3OESA 4Y8VA 5ED0A 2JCVA 4CKEA 4EA9A 4G0UA 3B5JA 5FWYB 2FW0A 3RRMA 5CDUA 4YH1A 3TPZA 1AG9A 1I3CA 1T5LA 2GFQA 3VH2A 1LF0A 1PDOA 2HWYA 4C88A 3QSYA 4HLNA 1XHEA 3JYLA 2BGKA 4L57A 3RYFA 1AXRA 1U0TA 4BL5A 1ZRSA 1EFRD 1YB2A 3WSTA 1V8DA 1GTL1 1PQ4A 2VWQA 3H16A 1BDHA 4EVQA 1HDCA 1MPTA 4II7A 5AHOA 3VU8A 4CL8A 4Q0MA 3AFOA 2CL0X 1KTVA 4PVDA 4BLPA 2LR0A 2NU8B 2TECE 5FPYA 3ZOZA 4Z6KA 3HVHA 3KHSA 1ZP6A 1QHNA 5ITZA 2P77A 3KLBA 3HN6A 3PXUA 3W5JA 1G20B 3OCWA 2C20A 4CG3A 4PPYA 3LLUA 1Q1QA 1R5OA 1YZKA 2ID4A 5HHTA 1AMOA 4JLKA 5I9TA 2ST1A 1IZ7A 1H1DA 2MIIA 3BL5A 1E89A 4HDMB 5CNKA 3OLWA 3G8YA 3TQTA 1T8TA 3HACA 2KSQA 1U5BB 2OFOA 3EEBA 4P80A 2Y68A 3WK4A 1G8HA 1S9HA 2B7BA 3D8NA 3L5OA 3OZRA 1ZGZA 3TPFA 1H6DA 5BO5A 1M2KA 2EJCA 4NY1A 2GTHA 2C3UA 1UKZA 1KRXA 4UATA 4WLNA 3FF1A 4NU8X 3DAYA 5HKLA 2HA6A 1BMTA 5EJ7A 5IBRA 4J9UE 2BC9A 4ZI5A 4BP9A 2G1KA 4JGIA 4BCBA 5HJ7A 3PI6A 3WIUA 1L2TA 3QH4A 4E2XA 4MINA 4DKXA 3WDKA 1JDVA 3VX4A 1U8AA 4BX0A 1ZH0A 4HDKB 4CYMA 5KTOA 2H4HA 5IP5A 1Z16A 1Y4SA 5F64A 2PZMA 1T0UA 1JJFA 4I3GA 4MQ4A 4D8UA 4YJFB 1PS0A 1ZMRA 3BWVA 1NW4A 4ZYYA 2QSYA 5LLTA 2DEUA 2XUHA 4RUKA 1LBEA 1V7PC 3FRIA 1K8RA 2ZM5A 1ORDA 3UH1A 1MKYA 2ES4A 1P9WA 4BEBA 4FDTA 4FYJA 4Q48A 2CVZA 2FKNA 3DLCA 4X3PA 4ZDJA 1JA1A 1L8XA 4BOYA 5EP4A 3LPLA 4LQ4A 2YXLA 2NVWA 3NT2A 3MCZA 3RU2A 2YDXA 1BGWA 2O8DB 2H07A 3W77A 3KP1A 2L17A 3OVMA 4D4KA 1SCIA 1JECA 2XB8A 4D92A 1XMXA 2JGAA 2ZYUX 3O31A 4UOEA 2K7ZA 4ZHSA 1V16B 2CLLB 3H86A 3KPJA 5KCMA 1JI0A 1XDDA 4K9DA 1F2UB 1KFBB 3R3YA 2QG6A 4UCQA 4QC2A 1RQLA 3TM5A 5KNBD 2PJZA 4PZCA 1WNFA 2PT9A 4C6RA 2OK7A 3JR3A 3G8BA 1JTEA 1AGRA 2O50A 3I6BA 3P9YA 2QQEA 3W5IA 4CFYA 3KXDA 1XC7A 5EVCA 5BSHA 2E3JA 5HJ5A 4CMGA 3DXYA 2VS1A 2VYVA 2YJ3A 4HRVA 3GLKA 4NCIA 4DJTA 4IRXA 2F3UA 2J6IA 4BNVA 4KKVA 4YPOA 2DY1A 2H29A 3ZE7A 3EFHA 5FTJA 1XAGA 3V4ZA 3GLFB 4KFCA 4NYJQ 4Z1MA 5JZOA 3BKWA 4B2IA 4BAUA 1GGNA 4GRDA 1XRPA 1QIGA 1TJ4A 1UEXC 4F5ZA 5A5FA 2WQ7A 1GITA 1Z88A 3L4SO 2BM8A 4D7AA 3IUPA 3HV0A 5CCXA 3AFNA 1TOAA 4Q4JB 5EN4A 3NU1A 1ONNA 3DL7A 3HRHA 2ZSBA 4KYUA 1HY3A 4UNNA 4RCVA 4JUFA 3RIHA 4B3JA 5HZHA 1Y6GA 2J41A 1B16A 5FBKA 4B3TB 1FMJA 1Q95A 3VNVA 3A6GA 4HLUA 2DWPA 3W9BA 1TGYA 4IX1A 1TIBA 4AT1A 5F9HA 3LPCA 4E13A 1KYVA 5BQFA 2XSZD 1Z5VA 2IDJA 1PVVA 4D8VA 1Y1RA 2CNBA 3LC2O 2C07A 4MARA 4KN5A 1NBWB 4M0FA 1RQ2A 1G4UR 1NX6A 5ALPA 5DNAA 4DGQA 4NZOA 3E9RA 2WUVA 3AI2A 2IUUA 5FNVB 4LYYA 3S68A 2Q4EA 4PYLA 1K2VN 2MYNA 3BIJA 2XRYA 1DFHA 2AD5A 5LYJA 1E99A 3K35A 4J7UA 3WE7A 4YRNA 1MB3A 4L6IA 4KSCA 4ERXA 5JD4A 3Q3CA 1NI4A 2FQXA 3SHTA 2ZE6A 2O52A 4K6KA 2Z04A 4JXJA 1YULA 1C7EA 4ZO9A 3RIXA 4O8CA 4ZDKA 3Q8WA 2Q8NA 1E5LA 3VJKA 2UZ3A 4CQNA 2EC5A 3KVVA 3Q7SA 4EELA 3U09A 2ZLBA 1EWQA 4FTWA 2YMMA 3C48A 3SE0A 3E03A 5JJBA 4YXFA 4IHAA 4LISA 3V33A 2QV7A 4JB3A 3TRFA 5D2CA 2HK8A 1M75A 1SB9A 2ORYA 2IVFA 4MP8A 1XMPA 1AHIA 3ZBPA 5KYXA 4ZJUA 1EQUA 4QXQA 1F06A 4JJ7A 1N6RA 4QPJC 4DEXA 4YGXB 1LRLA 1AKRA 2WWRA 2PUTA 1XMSA 2Y1DA 4WMLA 2E21A 1IHPA 3WSWA 1QHSA 3ZW7A 4KHZA 2VRBA 2H5EA 3H1AA 3UB4A 1ZGGA 4NOLA 1RIFA 1TYCA 4F2GA 4EMUA 2UUBB 5TXGA 3S1LA 1KO8A 3BDVA 4XRGA 4QD3A 5J4KA 1B43A 1YR3A 4O4JF 5TMDA 1FRQA 1RTTA 3TGLA 1DBRA 5GTDA 4QPDA 2QTAA 4CIBA 1BH2A 2PGOA 3EFOB 3ILYA 4GAEA 5B12A 4C04A 1PJRA 4I5IA 4WNCA 1REQB 3EASA 3RSFA 4ZOLF 1SCAA 3B5IA 3X2FA 2XW6A 3DTVB 4BMZA 2I55A 2V6MA 5BXQC 2QG4A 4X1YB 1CRQA 2RKOA 221PA 4C6TB 4Y6LA 2DGDA 2WUFA 2FI1A 5AICA 3T1YB 1GEEA 4FGKA 3RHZA 2QUJA 3AUSA 3BILA 1ATZA 3FOFC 1ICIA 2XOKA 3T7CA 3L7BA 2HYDA 2P9HA 3KSZO 1L5OA 2ZYAA 1FZQA 5EJ4A 5J1SB 1DNPA 2A8YA 2IVZA 1U2DA 2YVKA 2VA9A 4TMWA 5DH9A 2FOXA 4DL9A 4M0LA 2ZJOA 4FONA 1Q0RA 2SKCA 3LY7A 2HMYB 1N6IA 1D8TA 1MPXA 1M6NA 1NVTA 3CXUA 3ME5A 3ZXSA 2NSLA 2YFKA 1VG1A 4BC1A 4G5RA 5FF9A 3RS2A 1E5DA 4H18A 4RANA 3VKFA 1FU4A 4M89A 1GILA 1QIHA 1XCLA 3OTWA 1YACA 3A3KA 3PKZA 4JQOA 4N01A 1A50B 4EA8A 1B1AA 1TD9A 2YZKA 5FV4A 1TPYA 2P35A 1V9CA 1U9IA 1DUIA 4MGZR 4KITB 5DOZA 1J2RA 2FMXA 2IXAA 2YASA 5KYXB 3AHGA 3NVMB 3T5AA 1D2GA 4CDGA 1QKJA 1YB5A 1ZD3A 4MVJE 3GEEA 4P86A 2ILVA 3OICA 4AY4A 3AG6A 4BX8A 5K4GA 3NDRA 5BXYA 1A98A 1Z0UA 2CXHA 3MLAA 4JZKA 2Q41A 4RTSA 1HSOA 3DDSA 4MIKA 1YIDA 3EOZA 4JT9A 2QTGA 1JLLB 3GL9A 3HA2A 4S24A 4EO9A 2Z1DA 4KR6A 3PGXA 1SVUA 3T9BA 3N07A 4PN3A 2R8YA 3IJRA 4WNYA 5E0OA 5J2TF 4JBLA 1U8FO 5CVDA 3T3HA 4IDOA 1PEDA 2JBHA 3T34A 2XA1A 2AOUA 4MUFA 4AURA 1SA0A 3B89A 1K3TA 4G4JA 4YMIA 4YQEA 4DVGA 4B7CA 1K9SA 3FHJA 4FP9A 1ZH8A 3G0CA 4HQKA 4HXFB 2C1ZA 4NZNA 4XFKA 1S3GA 4XYBA 3O21A 4EGJA 1WS6A 4GMXA 1PL0A 5D5QA 4E4YA 1CQIB 1K75A 3GP8A 4MQMA 4CKBB 4E32A 4NS1A 3BXEA 1O2DA 3DKVA 2PQMA 2D8AA 3QBJA 4RJKA 4X62B 2DHCA 3IT0A 3DVRX 3K0CA 4UREA 3VNAA 3ZG6A 4PZZA 3RTBA 2E4WA 2ZULA 4BQIA 5K0GA 4O2AF 2VL7A 3DV0A 3B60A 3RYHB 2ZAGA 5ALUA 4BRUA 3H6KA 2CKMA 1SHZA 4WKCA 4BNJA 1JAZA 2VHXA 4KW7A 4O5OA 4BLRA 4V1CB 2W0MA 3WLHA 4GT1A 2H2DA 5T3UA 1VYHA 3HB9A 4X8OA 2PGNA 1LI4A 4C5AA 1G3MA 1QV7A 1NVGA 1PGOA 1RMYA 3FWKA 2ZUVA 1XGKA 1VHLA 3W79A 3NAGA 1JKJA 2HHHB 3UANA 3DVSX 1Z4NA 5MDHA 3TX6A 1F8XA 4B3BA 1E0AA 3PB3A 2NT3A 2XMRA 1W34A 1YK1A 3DB1A 4NNJA 2D3WA 3SR0A 3B9QA 1DRJA 3FNRA 4D9MA 5LIPA 3A4IA 1JQKA 3N86A 4AG3A 3QYPA 1BD3A 2VRWA 2RHJA 2ATCA 4WOJA 3RDPA 3CLRC 3E3NA 1SBHA 2VPPA 3BCHA 1RRMA 1AY0A 3AV0B 3FUUA 4KXNA 4O4HF 4DE5A 2VWPA 3KJZA 2V7PA 2V7XA 5KWIA 4G56A 2JLRA 2WYVA 2ZRCA 1O6ZA 2GLTA 4BNFA 5L95A 1VPVA 2MOKA 4PHGA 3U80A 1QU3A 1H8HD 1IEVA 4P32A 2DWCA 4CJXA 2FW9A 4KYIB 3SPXA 1JHVA 3M1AA 4ME6A 3RLFA 2XD9A 3D5EA 1JHMA 4IEEA 2V6GA 4L5IA 4Q16A 4Q1VA 2RHHA 5GJCA 3GUVA 1HDGO 4WT7A 4WASA 4WERA 2X0DA 3IPRA 1RQNA 4DIKA 3RS5A 3ZU3A 2B1JA 3ML1A 1Z8HA 3C5VA 3EZGA 1UXOA 3R3ZA 1C1XB 3OQBA 2D5BA 4Y2PA 5I7OA 1Q1GA 5FI1B 1L3BA 1E3WB 2IY8A 3NBXX 4JBHA 4ZRNA 3VSDA 4P35A 4Y9UA 2W6NA 1O4WA 1RBMA 4Q1EA 3TE7A 3AF5A 4DUGA 4EB3A 1NKSA 1AKMA 4J1SA 4JOQA 2QE7D 1F1JA 4PLGA 5DM60 3FCXA 2OCYC 3M4YA 1XTZA 1BE1A 1FTQA 2WM2A 2YZ7A 1L4KA 2FOLA 3INRA 2OP0A 4NYJR 2PK3A 4QEKA 4D8WA 4RTRA 1VKRA 1GGEA 2FR8C 1EFTA 4MS4A 3OBIA 1U28A 2Y76A 3L02A 4DQXA 5KNBH 1O6FA 4HUQB 4UE3S 4B3IA 1EE1A 4YJHB 3ITEA 3NO4A 1AGPA 4ZA2A 3W05A 2O5EA 4M9XA 1JHYA 1COZA 4YYEA 1TO6A 1TTHA 4PC6A 4YWHA 5LYYA 1ULTA 1VIYA 2ACEA 2FSHA 2N9UA 5IC4A 4ARAA 5JJKA 3LU1A 4FZJA 1U2PA 6GPBA 3KVYA 1FQOA 1VHDA 2E1PA 3CNQS 1SOWA 3HEMA 1KEPA 2OR3A 4OCZA 5FT9A 5KOHA 3BGVA 2JLWA 4RHXA 2ZJAA 1B0ZA 3EXAA 4DRZA 1E1MA 3ZX5A 1JMKC 3CTPA 5I9NA 4WEQA 4KB5A 3CONA 5AWFC 2ONJA 2RGCA 3V8MA 3A6KA 2A57A 2HTFA 3FUXA 3A4LA 4UDYX 2Q5CA 1B14A 1MG5A 4B7UA 1COWA 2CLKB 4EG8A 4MAMA 5K0SA 3ZOKA 3E8MA 1MEEA 1EK5A 4JLBA 2POCA 3AMVA 1E9BA 2ZQYA 4XWTA 5CEFA 1UK7A 2EFEB 4GH5A 1QVWA 1UR5A 2OBLA 2WHEA 1SO8A 1ZUWA 4RO0A 4D2IA 5C8XA 4B17A 2H7YA 2R85A 4Y6RA 3EGVA 1NASA 3BL6A 3GPCA 1IZZA 1C7FA 1FCJA 4RK6A 4URHA 4Y2SA 5IG2A 1E9CA 2I33A 3LS2A 4LHEA 5DCUA 3UICA 3UK7A 2A7QA 1GCUA 1JLRA 3HB5X 4MW1A 1QRDA 2BZSA 5TQJA 1YA4A 1IHUA 1T0BA 2WDZA 5KQPA 2VAMA 2NP6A 1OYVA 1U0SY 1R00A 3IEXA 3RADC 1YF3A 1TZJA 2O8CB 1DLJA 3UWSA 4XUDA 4EJ0A 2ZRJA 1E9DA 1JDNA 2XVXA 4GS5A 3WJ2A 3JQAD 2X23A 3QGMA 5L3SA 5IDYA 3I6IA 4QVGA 4CHTA 3LGAA 2W2NA 2CHVA 3AKYA 3H9JA 3G6WA 1SBTA 3OZSA 2WTNA 2E2WA 2XT6A 3LX6A 3ANTA 4JL8A 4OA5A 1I8TA 4PCLA 3RTCA 4F9EA 2W83A 4LFBB 5TF0A 1U7HA 1M8PA 1SXJB 2F9MA 1X80A 3BZBA 5AVJA 4DSZA 4EYOA 5I7SA 2GAIA 4K05A 4CIVA 3O8OA 2HIHA 4RD3A 5KYKA 3D4BA 3KZNA 1PRYA 2P6UA 5IT5A 1PZEA 4RHEA 3I5MA 1TM1E 3M3HA 4FW9A 1KH3A 3N2ZB 3GQVA 4AKGA 5DIZA 3ZD6A 1IXKA 1ISRA 2VTEA 1K6JA 2AWNA 2HA4A 3SHVA 1U3VA 2DBRA 3QF4A 4H2DA 4R7GA 3TN7A 4EB8A 4G0WA 5HUJA 2IRWA 1S8FA 2G1AA 4FFSA 5E6UB 4QQFA 1W0KD 4MW4A 2FK8A 2MDTA 4IUCS 1H2XA 4CM8A 5B7NA 1M2JA 1NLUA 3OKPA 1D0SA 1VC2A 2JZNA 4DLPA 2HCBA 3PUJA 3HUTA 4HGNA 4J91A 5CCEA 2LCIA 2QRQA 2O2DA 4X8LA 4AP6A 3JQDA 2HWUA 3L7CA 1ILEA 2ZIAA 1GRVA 4DSAA 2R6CA 4N9QA 2BFWA 1ZQ1A 3M6MD 3NRJA 4I55F 3ZY6A 1JVSA 3NOQA 4IIBA 3O8LA 3KYIB 1YL6A 4A9AA 1EFUA 1LNQA 3DAHA 1WB9A 4RTPA 5EE9A 1Z0JA 4HDKA 2R11A 5FULA 4NABA 2Q2WA 2WB2A 4A8JA 4ND8B 3PHJA 1HR0B 3QPUA 2ZUDA 2BELA 3LO8A 1DWQA 1W4LA 5IEBA 3KTFA 3PD1A 3IRVA 2CVPA 4A73A 4MIOA 2BCGY 1KE2A 3FCEA 4DDUA 3ETNA 1ONOA 4EJSA 3IVXA 4J0EA 1YVPA 4X7PA 4CFSA 5LKRA 1S2IA 2W6ID 1K5HA 2CEAA 3DHEA 4JLOA 3R3XA 2H57A 5I7EA 5JRDS 3HL0A 3TRIA 3WGYA 1K7CA 3A8TA 2ASEA 2UYCA 1UPXA 3E3LA 1DRVA 2BTOA 3EPPA 5DI9A 4ZCPA 2V7VA 2ZB8A 4YMLA 5MN6A 1HDYA 1SQ0A 2K5UA 2VP6A 3SEFA 3V7FA 3V8PA 5LJLA 1DJMA 2GZRA 2BR4A 2YC4C 2PQ6A 4MLDA 4NZMA 4ZT4A 2BTEA 5IVKA 1HE3A 2O48X 5EJEA 5JXIA 1BCRB 5MHTA 2MT9A 5CNIA 4N5DA 5BQPA 1VMKA 3KB6A 2BGNA 4L0DA 1F6WA 2NU9B 1ZJYA 2JGLA 1ZN9A 5SYMA 3C45A 2O07A 4ZRMA 1Z08A 2AEJA 1JDUA 1WMBA 2JFBA 1Z4MA 4GMDA 3STVA 1H22A 1I5OA 3QIVA 3ZQUA 3VXKA 2X8BA 4HUTA 5COAA 2GCOB 3OWHA 1U5CA 1EGMB 1EJ0A 3AI3A 4KQKA 4Y1RA 4HYQA 2B5WA 1NUHA 4AY2A 5HIMA 1X13A 3JWHA 5LLSA 1ZOOA 4UTVA 3ZWWA 1J5PA 4WWHA 1KAGA 5DF1A 1GM5A 1ILWA 2GK3A 2QUAA 5FI5A 4P4NA 4Y1EA 3WXBA 2W2PA 1Q7CA 4X7RA 4BKOA 2EKPA 1JZTA 1VCMA 2GERA 3ON5A 4BMSA 4GYWA 1WU7A 2JI6A 2Q3FA 4HQOA 5FAXA 1UFRA 2OV2A 3L7LA 2QF7A 3LFTA 5BSMA 1Q74A 2CL7X 2GO1A 4EW2A 1P0QA 2Y2VA 3G9UA 4WUTA 5BORA 4RWZA 4RZUA 1XTJA 5EHXA 3BG5A 1WSAA 1ECGA 4FX5A 3ZBTA 2YZ2A 3JQFC 1YBMA 4U7GA 3TSCA 4JLNA 1GZ5A 1WKCA 2BHSA 3CSUA 5HIAA 5E9WA 1KQ3A 3W2TA 1TQ6A 2OGZA 4S2UA 4P7JA 2FN9A 5DI3B 4E21A 1SIBE 3FZGA 2YWEA 2NZ8A 4OXNA 2XTJA 5EMLA 2C4TA 4ZVUA 3B20A 1ZA1A 4INAA 2EFDB 4K6MA 3PNOA 2VP9A 2F3PA 2QVBA 4M46A 4TLBA 4LQLA 1DC7A 1KKLA 4QXMA 2I71A 7ABPA 2IYOA 5F23A 4FFNA 1PG5A 3P4XA 5AQEA 4F2HA 5FADA 1MORA 1F7VA 4H6PA 1V37A 5MGBA 3ORQA 3PNYA 1KKMA 2QMHA 2IIPA 5KUTA 4CIWA 4XQGA 3EYAA 3PUKA 1DC8A 2AS0A 1T3TA 3FDFA 4GPEA 2GN9A 5J4LA 1USGA 2IYFA 4DW8A 1KFCB 1GJRA 3CPSA 4BPBA 1GN8A 1RI5A 1EIWA 1UDXA 5E95A 3W9SA 3EOBI 3ANLA 2IX9A 1TYAE 2PL9A 3RI3A 3KD3A 3A3YA 3OT4A 2Y1LA 4P3XA 2PPVA 4ZAXA 3RGWS 5TPWA 1MXFA 4ND7A 4RJ2A 5EXDA 4XWKA 3W6ZA 3E9EA 2OZKA 2IHUA 2Z95A 3DBRB 2PX8A 4X6YA 2HDOA 4R8SA 4BLQA 4BN4A 3DV2A 1XTRA 2FWRA 1KHTA 1UADA 4RQBA 1CUSA 1W0CA 2J1LA 1D5CA 1Z7YA 1LUAA 2VCHA 4MVJF 1UBJS 4GOKA 1P2TA 2HRQA 3K6JA 4GM1A 1Z07A 4K40A 4RFVA 2YY7A 2R5NA 4D74A 4I1YA 2FF7A 2PX0A 2R3SA 4RKQA 3TLYA 1ZAYA 2HA7A 1YBFA 2O7SA 3PDWA 1MRNA 2QPTA 1GHTA 1ORVA 4L9WA 3DE5X 2HQOA 2N42A 3R09A 4M9RA 4XVRA 4AZVA 5E4TA 2EJVA 4MDHA 4GI2A 2EKQA 4MCJA 5IX8A 5C81A 4MKHA 3T4XA 2XD4A 2RHBA 4OGKA 3OJ0A 4GPTA 4RMGA 4OQZA 3D7MA 4Q4JA 3UK0A 1GQRA 5IDQA 1G59A 1GZ3A 1SC4A 4IMPA 3P45A 4UBJA 4X1KA 1OT3A 1ZXBA 3MMSA 4YAKA 1C7QA 1W75A 4J76A 1FFAA 1Y1KE 4BAGA 5A3RA 3DJYA 5D3ZA 3HMQA 4AXBA 1ENYA 1FDUA 2H54A 3F7NA 3PWKA 4M8LA 4EW3A 4ESVA 4ZAYA 3WWCA 2O5RA 3TECE 2PUJA 1A7AA 3SYTA 1XCOA 2BSXA 3K8QA 3Q7TA 1W25A 1EUDB 2JI4A 4HPWA 4JJZA 1EA5A 2PMKA 4NLLA 4P33A 4L3OA 1NW8A 4BJ5A 1YS7A 5EE1A 3BMXA 2JH9A 3TDNA 3X2EA 2RE8A 2PX4A 1CUCA 1H4VB 3UF0A 2CV2A 3QW4B 4X1IA 1GYPA 4RVDA 3QMWA 4LGCA 3E7XA 2B7CA 2GRUA 4JQSA 5BNFA 4X64B 1VRVA 1X39A 2A33A 4E30A 3HDJA 4FNOA 3SJUA 4KO2S 5FQOA 1DCMA 3F2IA 5ESWA 3ROFA 1CUXA 2I6QA 3E7WA 3IOCA 5TT0A 4UUBA 4Y3UA 2RGNA 4XEUA 1UBOS 1BFKA 2PT6A 5EWLB 5A4AA 2N0SA 3MCVA 1Z26A 3PFBA 2MMCA 2NTNA 3QQPA 1OZAA 3LLVA 1E7WA 2XZTA 1LEHA 3TL2A 2GPBA 2I6GA 2QJRA 4EF5A 2R6HA 4XI9A 4DSTA 2WAYA 4OHBA 3OIYA 3MTDA 3A1SA 3K31A 4Z3OA 3HBMA 3I30X 4XVUA 3S2SA 2OAQ1 4X7MA 2YWJA 1Y3DE 2P4QA 4EABA 2AOTB 4NDNE 4D3XA 1Z36A 1R0SA 1BVRA 1FVXA 1UZAA 1HQKA 4JITA 4WKPA 3IOYA 5G4KB 2RKBA 5T3YA 1BO6A 3EZ9A 4UVIA 1OH7A 5JYBA 1EP9A 1M6VB 3P9XA 3UV7A 1G7CA 4C4PA 3ICEA 2X42A 4WH0A 3CUYA 4BIMA 4IDNA 4NS4A 4U02A 3KU1A 4KAAA 2PR7A 4R05A 5IFLA 2HQ1A 1C8LA 1QC5B 3NHRA 1QS0B 3OZEA 1HK7A 1NYQA 4PXAA 1IOZA 2QLTA 4WESA 4RK5A 4TWZA 4Q05A 3JD3A 1LDMA 1QIFA 3CCFA 1P4GA 5HJ2A 2QRVA 2X8WA 1NQ5A 1UDBA 4IQFA 4F06A 4G0VA 4AO7A 1UDCA 3PJFA 3JWJA 1JJ7A 3L7YA 4QHTA 3NAZA 4HNRA 4XVCA 5DNUA 1WNTA 3BJIC 3ZDDA 3VHXA 4LV6A 1LDNA 1OY1A 5I01A 2WVGA 4BZQA 1FFSA 1ZJ4A 3NWEA 4ALLA 1GAEO 1CY7A 2ZYVX 1PGQA 1S6YA 3L0OA 4ZU1X 1LK5A 1LBIA 3MQ4A 4FDUA 4IJMA 3RKRA 3V6LA 2IEYA 4LFAB 1NE2A 5BSFA 4D45A 3HKBA 4BO5A 1KI4A 8OHMA 2EHDA 1U7XA 4MDFA 1C9NA 3T7SA 4LTNA 3W8EA 1PS9A 1X70A 1D1SA 1NU8A 3WWYA 1O57A 3EG9A 5KYNA 4N8EA 3RWMB 3A7DA 4ON9A 3RSOA 3FPLA 1FMFA 4B4VA 1GKLA 3EXHA 1I7NA 3QKIA 4E94A 5LQAA 4Q3OA 1XPUA 4PW0A 1OH8A 3P9NA 3RNLA 1JHUA 1QR2A 4G41A 2QDKA 2JLZA 2FP4A 3ZXIA 4C4ZA 4B45A 4Z54A 3MBOA 3HI4A 3KHKA 4E0BA 4V38A 4J94A 1VG0B 1X2EA 2VAXA 3IP3A 1RLUA 5ALSA 4GWGA 4UMVA 1DT3A 2Q5HA 4OQEA 3WGJA 1L7RA 1HKHA 2BGIA 3KDAA 4GXQA 4MYCA 4NOKA 3NHSA 3GLUA 3ZIUA 4AIRA 2Q5FA 3JWEA 3TOZA 1XA3A 3ST7A 3B78A 4HRXA 1FJGB 1EFLA 1IL0A 3I1YA 3T7IA 1S89A 2NXNA 3EK2A 1DAEA 5CXSA 3RTDA 4ZK2A 1Y7HA 3DC2A 2ZR7A 4OXKA 3EWSA 4PX2A 4YQZA 1OAOC 1U0OC 1S4MA 3R4VA 1LXCA 1R27A 3IQZA 1DX9A 4RZQA 2IF2A 1Z74A 2Z3WA 1Q0PA 2LDBA 2Y92A 3DEHA 4LMRA 3LIPA 5TQ2A 4TKMA 1QIDA 3SBOA 2PS3A 3KRTA 1JIXA 2OHGA 2AC4A 3D43A 1GPWB 4MPTA 4NRDA 5AOCA 3T5BA 3T9FA 2VZEA 3TRHA 1Z75A 2JJ2D 4CKXA 2YXNA 1FNBA 2ZI7A 2VSFA 3CPHA 1U0GA 4NI5A 4RM3A 4BKUA 4Z7OB 4WZAB 1IWBB 4UNRA 4MV9A 4ZVMA 1KK1A 1WL8A 1NVXQ 1ZCBA 2EF0A 2Y05A 4ZEXA 4K1LA 3TI9A 4BBPA 3E3OA 1J06A 1CTQA 2VDQB 3KQPA 4R6XA 4W5QA 2HMUA 4EKGA 1CUBA 1DEKA 1IZ9A 2CWWA 3FMPB 4HVAA 2IYAA 1W4ZA 4JROA 4RHUA 1C4KA 3IAHA 5ICMA 5KYTA 3EZNA 1IPEA 3IULA 4OHWA 4MEAA 3K4PA 1DB3A 1H69A 1Z5PA 3I6YA 1VHQA 2GEBA 1XN4A 4EG7A 5F1PA 4Z9BA 2FG5A 5J2UA 3B2QA 3HB7A 2QRPA 2Z09A 3TTWA 4W5HA 3K9HA 1P5FA 3A1WA 1FEZA 1G8FA 5M04A 4YRRA 4F2DA 1PD1A 3U61B 4KLNA 3C41J 1XE3A 3DDUA 2H7CA 4OM7A 5DM4A 4V39A 1DC5A 1P62B 5AW1A 1V4BA 1N4AA 2NADA 4RA9B 5L7TA 3DDHA 3MTQA 4NBSA 5ALTA 3U7EB 1WEKA 2VZ9A 1EDDA 2ZI3A 3LXRA 2G88A 2JHAA 5DLDA 1GRNA 2L18A 4YVFA 3GN1A 1V0JA 4Y2UA 2CHFA 3S3TA 4FCTA 3NANA 3S5UA 4F86A 4G6ZA 3ZGYA 4DMRA 1EIZA 2XJ4A 4HPXB 4FEEA 1H2ZA 2DM6A 1XCMA 3OAAD 4YI5A 4LJ7A 1DXHA 3D1JA 4YWJA 4UPVA 4D26A 1U6IA 1VPLA 2W6MA 2WK1A 3CVJA 1QFSA 3FCYA 1EHIA 1E6UA 4ZDIA 1X7WB 2V5AA 3GZNA 1L5HA 4BATA 3QPDA 4CLDA 1MH1A 1E2NA 1Z0SA 4L4RA 4F6RB 3Q8LA 3GWGA 3M1IA 1PVOA 1UQUA 4JDPA 3P0EA 3IKTA 4ARBA 4RK0A 2Z98A 5G4KA 5KNLA 5DM2A 5FB3A