4DIDA

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase
molecule keywords Cell division control protein 42 homolog
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4didA00
5CLQA 2WWYA 2O0HA 4DJTA 3R9IA 5L3SB 3CWQA 4HUQB 1G6OA 2GVDC 1E79A 1YZKA 1NIJA 2FPMA 4KITB 1GL6A 1YR6A 4G5RA 1R0YA 3NDPA 5FOTA 4CEJA 2GBLC 1R4AA 1D6JA 4A82A 2QGZA 1OIXA 3T1QA 1IJEA 4IDNA 2QPTA 2ZRKA 1FTSA 4POAA 2OLKA 5DN6D 1K5DA 1XXHE 4KODA 4Y0VA 2LKCA 4FCWA 1VCOA 5CK4A 1XBTA 5IRCD 3K9NA 5B57C 1QHNA 4OQMA 2HCJB 1FFHA 2OXCA 1X1SA 2Z4SA 3ASYA 3K0EA 3KTAB 4G5GA 4Q5IA 3TUJC 3DEFA 2OLJA 4NDZA 2X19A 1DAEA 2ZAMA 4KU4A 2WMOB 4QJ5A 1E32A 2J0VA 3GLHA 3TJZA 5EJEA 2Q3MA 4LHWA 2R6GA 4LWZA 3QKTA 3GMTA 4R9UC 5HR5A 1SVWA 4AY2A 3EPJA 3AKEA 3MJRA 3SYKA 3U3RA 3SYNA 4Q4AB 1UDXA 5CIQA 1R5OA 2WJHA 2PJZA 3IEUA 2IYXA 1KI6A 1Z0AA 1E1QD 1MOZA 2BCGY 2P67A 4X8HA 1HH4A 3TKLA 2GEVA 4S2EA 2GTPA 5E7MA 1N6HA 1V43A 2ONKA 1XPUA 1S0UA 2V1XA 4CEHA 1JR3E 4OHXA 3ZQJA 2WJJA 3QIAA 5HKKA 4IKEA 3GJ4A 4JBXA 1ESNA 2LKDA 3KL4A 2OAP1 1II8A 2V6JA 2XX3A 3AKCA 4ABYA 5LB2A 1M7BA 1TF7A 2YOFA 2MMGA 4QHSA 1LB1B 5CYPA 3CPJB 3L43A 3CIOA 4FMDB 4C0AC 1HT2E 1WCV1 3FYHA 1BKDR 3LX5A 1TQDA 5KPJA 2VL7A 3K8YA 3WP0A 4Q9IA 5KYKA 3K0AA 1UKVY 4ILEA 1JXOA 1X86B 1Q0UA 1TU4A 4PQRA 421PA 1OXXK 3Q5EA 1KJYA 3CX7A 3ZS8A 1IONA 3T06B 5JBQA 1TX4B 4UQOA 2ZEJA 1TUEA 3AVWA 3Q9LA 3AH8A 5IF9A 1NG9A 2C9OA 3RABA 4V0MA 3T61A 3CNLA 1I2MA 2HEIA 1KI3A 4TMZA 5DN6A 1LFDB 2UZ3A 1VG0B 4AD8A 4FMCF 3DPUA 2GZHA 1OIWA 1ZP6A 3UWKA 3U3KA 4IW3B 3FKSD 5AWFC 2XNSA 1MO5A 1HV8A 3W90A 2OBNA 3EZ6A 1D2NA 5FBWB 3UATA 2ZSAA 4NU0A 3ZH9B 2ZRCA 1RRPA 2Z5FA 3I8SA 4CZ2A 2QGNA 2RMKA 1A5TA 5BYKA 4TYWA 2ZROA 3SS8A 5CYOA 4QBGB 3IUYA 4IOMA 3QPUA 4YQFA 3VX4A 1AGRA 3KX2A 4KBGA 2ZI9A 621PA 3GLGA 2IYYA 1FX0A 3P32A 3NKVA 2BEJA 4CYMA 1QDEA 4A4DA 4Q03A 3I3SR 1CRQA 2H17A 4CEJB 1NBMD 4US2R 1IAQA 3AF4A 4QNRA 1E1QA 3F0TA 1TNDA 4G1UC 1AQUA 1UPTA 1GL7A 2ORWA 1UM8A 3X1WA 2IYTA 2ZJ8A 3RRZA 4NYJR 3VQTA 4M9ZA 4Q47A 5JCPA 4Z8XA 4X8LA 1MKYA 1G16A 4YDSA 5DNYB 1UFQA 1PLKA 2G83A 1E69A 2ZI4A 4DWJA 1T6NA 2A5DA 2QU8A 2OV2A 4JL5A 2XGJA 3U4QA 2GCOA 2BKUA 4LGMA 1KAGA 2PCJA 2P6UA 4HB2A 3AGPA 2DWOA 1IXZA 3GLHB 1Z5ZA 3CF6R 2D2EA 4XIGS 1LVGA 4HI0E 4ZPXA 1UBGA 1GP2A 2OZEA 2WV9A 3B7GA 4RD3A 1J90A 1IN7A 1CJTC 4WZBE 1Y63A 1SVSA 3WMFA 4D4MA 5B30A 1R6BX 4KLNA 4B43A 3CNOA 5TARA 1W44A 4BEBA 3T34A 1YHNA 1CJVC 3BS4A 4R2HA 4C0BA 4C0SA 4OL0A 3SJAA 1GAJA 5CB8A 4BWYA 5M04A 3TSZA 2DFKB 1KZGB 5FL7D 5JRJA 4BASA 3A4MA 2CE2X 4CEHB 3ADBA 2JJ1D 1ZUIA 4DBLC 4KFUA 1ANKA 3A58B 1KNXA 1E2LA 1NF3A 2NQ2C 3BOSA 1NSFA 3FKSA 5K8TA 4BE7B 3CF0A 3WMEA 3AVYA 2ECKA 3EWAA 4NTZA 2O8BA 1II8B 2YWEA 3AVQA 4BLOA 5FTNA 3L2OB 4LDJA 4PQYA 1SXJC 5TVKA 1KAOA 4OQFA 4ZCIA 1AK2A 1QHIA 1YKSA 3EXAA 4Z8YA 2R8RA 5GVRA 1Q1EA 5AUOB 2HF8A 4OHWA 2OT3B 3AF0A 5CJ2A 1KI2A 5L3QB 4G3XA 3W3AA 5F2EA 2VHJA 2KBFA 5LD2C 2W83A 4QGFA 2ZTSA 3IIJA 4MRNA 2AXNA 1P62B 2OEPA 2O8CA 4C30A 1NSTA 2XEXA 4MGIR 1KO5A 3UMSA 4EAQA 4TWZA 3THWA 2XOKA 3U6KA 3UG7A 3JZAA 3NBFA 4FN5A 4IXNA 4PO1A 4HAYA 2ORVA 3KKOA 3Q8XB 4JLVA 4LYHA 1HUQA 5FUVA 2YVUA 4C2TA 4DXAA 1E4YA 4JLPA 4LJ9A 3EW9A 4QBFA 4P31A 3C15C 3EPKA 4BFZA 3PJRA 1OJLA 2ZSDA 1EG7A 2RGNC 1QBKC 3E5HA 4L15A 4Q9LA 1XX6A 2J7PD 1W5SA 4RSGA 3GLGB 2RGNA 1FX0B 2ZRFA 3EZFA 3X1YA 1U98A 5IT5A 1JR6A 3LFUA 5HPYB 3GLIE 2V1UA 1P2SA 2YHSA 3C8UA 4PTLA 1IM2A 2CNWD 2R44A 3LNCA 1R5BA 5JZVA 1XRJA 4WBSA 1WA5A 4NYMQ 2XZLA 3I62A 1Q21A 2JJ1A 2IYSA 3TRFA 1E2IA 4EIWA 121PA 1XTQA 1VYTA 4A36A 4K46A 1WF3A 2XNDD 1EXMA 1E1RD 2B92A 3DKPA 2RGCA 2GCOB 3IHLA 3U4QB 2VP0A 2QMOA 4KFRA 4IOJA 4EFLA 3A37A 4L9WA 5TY0A 2BCJQ 1J8YF 1HE1C 1QRAA 4LV8B 2BBSA 2XJ4A 2ZRIA 1XCPA 4ACAA 5L3VA 4BFWA 5LB4A 2G77B 3DKVA 4PPNA 3HWSA 2A3RA 5A0FA 3BWDD 3EX7C 3VHXA 2QMHA 1T3HA 4BQSA 1H65A 2GJSA 2WSMA 4JZKA 2PZGA 2EU8A 1ZU4A 1CR1A 4NE2A 5GJWC 4PHGA 4AKEA 1G3UA 3TLXA 4FCVA 1BOFA 2CCJA 3E70C 3ND8A 4AC9A 1W4RA 2MSDB 4DCTA 2BBTA 3FHCB 1W36D 4F4IA 2H57A 2GZAA 1IY1A 3GP8A 1OFHA 2O8BB 2OILA 2F3TA 5JJIA 1XMVA 1E2GA 3MCAA 3PUYA 2KSQA 3ZD6A 1QVRA 1Z6AA 1TQ2A 3C16C 4Q00A 1L8QA 3SBEA 1GWNA 4Q4JA 1JPNA 3K0FA 2FE4A 3MWLA 3SU8A 1ZM2A 3EPHA 4GI7A 4HDCA 3TW4A 3TE6A 3K70D 3BAFA 2R9VA 2V3CC 1XTJA 5CJPA 4LC1A 3CRW1 3GCGA 5EE9A 1KNQA 4DLYA 2DPXA 2IEYA 4H1UA 1E9CA 4KBFA 4LBZA 4YMWA 4LJ4A 2CNWA 2DFLA 3MFYA 3QF7A 3THWB 2FGKA 2G0NA 1TADA 4TLCA 4DVGA 3HR7A 2IXEA 4JVNA 3ADCA 1ZM4A 3BE4A 4B71A 1S9DA 3U3OA 1GKIA 4BFYA 3R9WA 4Q18A 2V6IA 4DDUA 3UXMA 4HDQB 1DO2A 3CNNA 3T1TA 4ZCMA 2VIIA 4TYPA 2XNDA 1E1RA 4JT2A 5DO9A 1FNNA 1GRNA 4C3ZA 3AF1A 3H2YA 2IXGA 1CR2A 1AIPA 2Z43A 1H8HD 1XMSA 2UZIR 5BN5A 3FHTA 2CLDX 3AP1A 1DAFA 4A0GA 3U7FB 4JVSB 3PEUA 2VP4A 1MT0A 3P4XA 4ZDJA 8OHMA 2ODNA 1KDPA 1JB1A 3RS7A 2XTNA 2RGBA 1Q12A 2PLFA 4II7A 1NVXQ 1TL7C 2D7DA 5EXSA 1II9A 1E99A 1G8HA 4V0NA 4LRWA 2ZQ5A 1P2TA 1HA3A 1NVVQ 3LLMA 3O8DA 3UANA 3VR5A 1W36C 2JJ8A 4G0NA 4Q1CA 5JJLA 2G9NA 1GFIA 3EASA 2P6RA 5A5GA 4PAMA 1Z6TA 4EKDA 1OKKD 3UPUA 2W6IA 4DHEA 3C5HA 4GZMA 5KSYA 1C1YA 2C9YA 1A7JA 2RGXA 1YRAA 4DLRA 3UIEA 4XSGA 3AKDA 3KZ1E 1VECA 2G6BA 1TQ4A 4PR0A 1HEIA 2GCNA 4WAUA 4B32A 1F6BA 1JI0A 3H86A 4M0LA 1U94A 1GKUB 1G19A 1FTNA 5DSZA 3K09A 1E94E 1VCNA 4LYAA 1Z06A 1Z6XA 1AS2A 5AJWA 4Q4HA 1CR4A 4DEYA 1KO7A 5KSZA 4W9MC 1ESMA 5FTKA 1OXTA 2IF2A 3M1IA 1QG2A 4PC7A 4QL3A 4ASUD 3RANA 3LX8A 5J4YA 3K9HA 3WYFA 2H8KA 3WXMA 4IVRA 4AIIA 3VNUA 1J2JA 2QA5A 2VSOA 3N2IA 3AQ4A 3IO3A 2EFCB 3NBXX 3I4LA 3K53A 3MRSA 4CGZA 2D62A 4NCHA 1H8HA 4O0MA 4Q4JB 3K0FB 1N6LA 1UBCA 1WRBA 3ZD7A 3CR7A 1CKEA 2KE5A 1G291 1SXJE 2ASEA 2HJGA 2QM7A 2REXB 4AG5A 3NBZC 3L0IB 1P5ZB 5JSZA 3R8FA 5KU1A 1U0JA 4Q21A 4MKFA 5SZJA 2PBRA 2WVJA 4M4SA 2PJRA 2WJVA 3WRXC 4P3YA 1ZJ6A 1E9BA 1ZM9A 2QPOA 4LHVA 1YR7A 5DHAA 2UKDA 1JR3A 1MO4A 3KJEA 2FF7A 3BB3A 4FWTA 3AVTA 1P2UA 4GPTA 4O2LA 2IS1A 4MKHA 2WKPA 3FGNA 4NYIQ 1XJCA 4TQAA 2RHDA 2GK6A 1XP8A 2MSCB 1PLLA 1G5TA 2P2LA 2QE7D 3AKYA 4YC7A 5A4JA 3FWYA 5EE5B 2G3YA 4PC3A 1IY0A 5LBIA 5KTYA 1DELA 4UNQA 5FBQB 1KI7A 1O3YA 3QKRA 2IX3A 1SVOA 2IC5A 1VKJA 1Z0KA 1XMJA 3VKGA 2GWHA 1W4AA 1Q3TA 2EQBA 2G88A 4NPHA 3N5CA 2MSEB 2QZ4A 1COWD 4TMVA 2CE7A 3VMFA 3WY9A 3I5YA 4UJ5A 2ZI5A 1VCMA 5KUTA 5BWMA 4ASUA 2GJAA 1P3JA 4M9SA 3KQNA 3T1OA 5FR2A 1Q20A 4EPXA 3U44A 1NL3A 4JSYA 3G0HA 4D6PA 2C98A 2JASA 4DCVA 4QGGA 3FTQA 3W34A 1TTTA 3KXIA 1W49A 1OT3A 1GDDA 4PC2A 4EFMA 2C03A 3KJHA 2ZE5A 2WHXA 3SYLA 4ZIRA 3G5UA 1EFCA 3PR1A 2ORIA 1L4YA 3REGA 3TR0A 3B1YA 3K70B 4C0JA 5HZHA 1FW6A 1RJ9A 3KTAA 4JBYA 3VKHA 3K0SA 1W4CA 4C2UA 5EP2A 3M4YA 1M1YE 4YMVA 4Q4HB 3U60B 1Q57A 5IK2D 4QOSA 4HB4A 1E9RA 2PEYA 2FFQA 2WWWA 4B3CA 3HU1A 1E2QA 3L8ZA 3VKWA 5J4KA 4A2PA 2C04A 2HJVA 1S3SA 1UKEA 3D31A 2DYKA 4MGYR 5DLQC 1I4TD 4M1TA 5FH9A 5EP4A 3CH5A 4N0DA 1KSFX 2ZRPA 3P27A 2QROA 3LBHA 4BUJA 1HY3A 1Q3HA 2NPIA 3DHWC 2QE7A 1UEJA 4DUGD 3VX3A 2EVWX 2IBMA 2V4ZA 4XWOA 4IEIA 1G7RA 1Q44A 1GIAA 3BH7A 3QG1A 4MGKR 4RD0A 3CRVA 5JSZB 4BECA 5FI0B 1CULC 4YMUA 4OJKA 4JIMA 2QM8A 1COWA 2B7BA 4JLAA 4GBMA 2CHGA 4R2IA 4G01B 1GM5A 2AK3A 2O0JA 1N5IA 3DOFA 3H84A 2VQSA 3SI7A 2QTHA 1OHHD 3TBKA 5JS7A 3I92A 3SHWA 5K8IA 3A1WA 1P72A 2JJ2A 3ZZTA 2HDNB 3SNHA 1ZM7A 2EW1A 1K6MA 2Q21A 4LHYA 2DWPA 3QG5A 3PVSA 4QNMA 4BLSA 1PLJA 3MD0A 1FMLA 2C8VA 3WRYC 2ZJBA 1NG1A 2ZANA 4Q1DA 2HXSA 2QAJA 2OM2A 3FMOB 3FPAA 3GJ0A 4LK2A 5EZ6B 4KVGA 3U5ZB 5E4FA 1N25A 3GJ6A 2VLIA 3QNUA 1ZMXA 2XTZA 3QKRB 1JQLB 2W0SA 2IWHA 1NVWQ 3UMRA 3GLFE 3QY0A 3IKJA 2J5XA 3WYGA 3AM1A 1CRPA 2O52A 3BH6A 4A9AA 1N0VC 1E9SA 1TF2A 1OB5A 2QT0A 2A9KA 3CX8A 1F5NA 5L8VA 5E7IA 3MG9A 3THYA 2XB2A 1T8UA 5CIWA 1M2OB 4DLWA 5EQTA 2OFWA 1LS1A 3U44B 3TUZC 4BFUA 3BXZA 4YMTA 3WBJA 4OBEA 2NTYC 4HB3A 4XTCS 1EWRA 3X1DA 2A78A 2EYQA 4AKHA 4KCGA 4GP6A 1Z2AA 5KNDA 5DI9A 1XPOA 4I4LA 4EPVA 1RKBA 5FFMA 1N6IA 2H16A 4DCSA 4B75A 4DUGA 4XVUA 4IXMA 4ZIRB 3QSYA 2IT1A 3KQUA 5SZIA 1CIPA 4A8JA 5E3HA 2IXFA 2GVZC 1P2VA 4CDGA 4RCZA 4D82A 1QHYA 2ZRJA 2ZRDA 2ZSEA 1RJ9B 1JAHA 4Q02A 2N1BA 2ODWA 5FUXA 3LW7A 1G64A 4UKDA 3F3YA 1NJFA 1G21E 2AFIE 1P7CA 3M0EA 4YMSA 1EFRA 3O8CA 4F91B 3IIMA 3HDTA 2VH5R 1HYQA 1OHHA 1K8RA 3GJ7A 1KJWA 3R8CA 2NO1A 5EXXA 4F4CA 1XCGB 1JJ7A 1D9XA 3EIQA 1KK3A 3LQQA 4OK5A 3ADDA 1AJEA 1KTVA 1DOAA 4C0QC 2YC2C 3AF2A 1FUUA 4KHZA 1GVNB 1TQ6A 4B2IA 2WOJA 2QRZA 3BD9A 3H4MA 1GUAA 1KO8A 3ASZA 4FI3C 1IBRA 4L4UA 2RB4A 5FPKA 5F9FA 1FP6A 2O0KA 3SJZA 4O3MA 1J70A 2X8AA 4X8MA 3CBQA 1D2EA 3SJBA 2ZITA 1A2BA 1KDRA 4NH0A 4D2IA 1AS0A 1R0XA 3PUZA 4P0TA 1ODFA 3W6OA 1TF5A 3B82A 1YRBA 1ZRHA 2B21A 1SKYB 3ZDQA 1ZYUA 1WBBA 4LJ8A 2J59A 2GAOA 2ATVA 4MUBA 3MWKA 1P9RA 2P0EA 2QNRA 5C46F 5L3QA 1G6HA 2DB3A 1II0A 2ANCA 2G0TA 3CZPA 1DARA 1KY3A 4B35A 1T0HB 4TLEA 4U7DA 3TIFA 1Q22A 5AJYA 4LV6A 1QVAA 521PA 2F43A 2WJYA 3I32A 4DSTA 4OK3A 2Z4RA 1KO1A 4BLTA 4NP6A 4RD2A 2QY9A 4B76A 3ND9A 4E03A 3REFA 3MSXA 3ZVLA 4V0KA 5TDHA 2OUKA 5UKDA 4FMBB 3SOPA 2J41A 3FHOA 5J5CA 2D4HA 1KI4A 2IL1A 2OSBA 2FU5C 4YXWA 3C4JA 3ICQB 1MV5A 4UXIA 3B85A 1ZNWA 3GD7A 3QPVA 2CJWA 2F7SA 1Z8FA 2OFOA 3L0OA 4TTPA 1W1WA 2VRWA 4MITA 1SVMA 2HUPA 1YZNA 2LWIA 2VHQA 2WPDD 2E87A 3OEED 4OI4A 2NIPA 1S3GA 1Y3AA 3B60A 3THYB 1E9DA 3FMPB 3ICEA 4JJZA 4WOPA 1PJRA 4IVQA 2ZI7A 4YONB 2QT1A 4HLUA 1ZIOA 1R2QA 2ZI3A 4JL6A 2JLUA 3B1VA 3I61A 4PO9A 1W7AA 2IEZA 1RE0A 2XOKD 4V03A 4UXHA 2BKEA 4NCNA 2JLZA 4BPBA 5KSPA 2VHTA 1E96A 1XD8A 1VTKA 1XEWX 2AHOA 5DGXA 3MLEA 4PPQA 2ZRHA 4A8JB 5DH9A 1TPZA 5H68A 3VR3A 3X2SA 1GTVA 2FSFA 4G5OA 4LJYA 4LV5B 1Z0DA 1WB9A 3BORA 4QHTA 4M1YA 4M53A 4QJ4A 1CLUA 1OW3B 2RKOA 2NZ8A 2VTKA 3LXRA 4DSOA 4WIAA 4JLKA 1JAIA 4JKYA 2IK8A 1EGAA 2VSXA 3GQBA 4NONA 1G9XA 2JEOA 4WXPA 4AG6A 1U0HC 3QEOA 4YDHB 2NPFA 4EQ6B 1E4VA 1OXVA 3A8TA 3QE0A 4RY2A 4ZDWA 3IQWA 5G41A 1G4UR 1HT1E 4D4JA 4M22A 2O5VA 2QQEA 3O47A 3KXKA 2HT1A 3HJNA 4Q7LA 1P4SA 1WXQA 5SZHB 3LXXA 2GAAA 1IQPA 4I1UA 3THOA 3LAWA 2I4IA 1R10A 1LTQA 1ZNYA 1F2UA 3I1FA 4UNNA 3IEVA 4LOAA 2L0XA 2VF7A 1OV4A 4QG7A 5EUQB 4AYWA 4OHVA 2KI5A 3R9XA 3SR0A 4I1VA 4L9SA 4TL8A 2O8DA 1VYVA 4JLMA 4MGZR 2WPDA 3OEEA 3NC0C 3BB1A 4FMDF 2GRJA 2WMNB 2KWIA 1UEIA 1JJVA 1XNJA 4KYUA 1RPZA 1SHZA 1N5JA 2F43B 1AZSC 1G3RA 5JWHA 5CDFE 3RRYA 1N6KA 1XZPA 2J9RA 3CR8A 3LRPA 2QMUA 4AK9A 1NMXA 5FTLA 1YZUA 4R7ZA 2A5YB 4PZYA 3ADKA 3IIKA 1KK2A 1EX6A 4PAQA 4GP7A 1P6XA 2V55B 5FOUA 5GJCA 2B8TA 2AXPA 2ZR0A 5FR1A 4AYTA 3GPLA 2F6RA 2CJWB 1X6VA 4GOXA 5E95A 4HATA 3QKUA 1C4OA 2W58A 3VAAA 3KKMA 1EX7A 2OBLA 4GMDA 1IXRC 3D3QA 3THXA 3AVXA 2DFNA 3ZVNA 1S1MA 4BZPA 2IWRA 4S35A 1X1RA 2JLXA 1NIPA 1ZVQA 2RAPA 3DDCA 3AUYA 4E5UA 1OFIA 1E2NA 2CK3D 3C7KA 1OSNA 3EZ2A 4DRZA 2ONJA 5IHPA 1VPLA 3QPWA 4DLUA 1NLFA 3S1AA 3T12A 3A1VA 2KJQA 5CM9C 4LI0A 3RSOA 4GT1A 5JJKA 1Z0FA 3K0CA 2ZJOA 4A0HA 3KQKA 5KDLA 2O8EA 4B2LA 4B6FA 1A1VA 2Q3HA 1E2DA 3ZQ6A 2QMEA 2TMKA 1NI3A 1KKMA 2GZDA 3CRQA 3GLHE 4PPGA 4MA4A 1BH2A 3LW8A 4JYBA 2WWXA 3UKDA 2XXAA 4V0LA 3QQ5A 821PA 4IRUB 5H70A 5SZKB 3OZXA 4JL8A 1QG4A 3R7WA 4Q48A 4TLBA 3NEYA 1C9KA 1Z28A 4NYJQ 1AKEA 1SULA 1BMFD 3N70A 1XWIA 4GOJA 2FSIA 3RS0A 1T5LA 4MKIA 1H8ED 3F8TA 4HAWA 1G20E 4MRVA 4P4TA 2AD5A 4F93B 2KB0A 4KLZA 1EFUA 1R0WA 1F2UB 3AVPA 2CCGA 1VG1A 2CEAA 2XITA 4JSTA 3FOZA 2IHYA 2W6ID 1LNZA 3CONA 1W4BA 1X8KA 3BB4A 4LJAA 3NTUA 3VHLB 1G5RA 2QSZA 2IYWA 2GXAA 3PIRA 1ONBA 2O8DB 1D2MA 1ZUNB 3VR4A 4TT3D 2ZUCA 4Z1MD 4IFBA 4PHFA 5F3WB 3QJYA 3VNVA 1OIVA 4A1FA 1M8PA 2FDCA 2FEMA 2ZM5A 1ZD8A 3OIWA 2CK3A 2C99A 4AKGA 1IJFA 1OH6A 2WJGA 2YWGA 4B73A 2AD1A 4JLBA 4V0ME 4MDEA 2ZU0C 4H1VA 2BJWA 1VHTA 4B48A 3CRRA 4HDOB 1N0UA 1XEFA 2CVFA 2K5UA 2ZU6A 1KZ7B 2CBZA 3OEHA 4LUCA 4W5JA 5JMTA 5K8LA 2PX0A 2ZUDA 2AR7A 2ZR9A 3I73A 1YZQA 4B3BA 5AUPB 4Q1AA 4AI6A 3PEWA 1AN0A 4M2LA 3U2QA 2ZRMA 2R6FA 3B5JA 2HF9A 2WWFA 2H5EA 3A4LA 3U3JA 3GJXC 1NY5A 2YOHA 2YV5A 4TTQA 3W9YA 5G40A 2JDIA 3THXB 5JRZA 4RZUA 4D4LA 1GNPA 2OAQ1 1Z83A 2FX3A 3UK6A 3GLGE 3TQFA 1SHKA 1E2JA 1US8B 1GITA 3L8YA 5B2ZA 1E2MA 1PZNA 2R2AA 2ZS9A 3D8BA 4KV9A 3AF3A 2QN6A 3S1AB 4DSNA 5C4GB 1JNYA 3B6EA 1BMFA 2CL0X 1LY1A 3KUCA 2ZRLA 1H8EA 1JR3D 1NN1A 2ZE7A 3LDAA 3W3ZB 1ZD9A 3BIFA 1W2GA 1JQJC 3L0PA 4TQUS 4XOIA 5CK5A 3WHLA 4CT5A 4ZKDA 1P75A 4QKQA 5JFGA 2O8EB 4LJ6A 2V54A 3LWNA 4NZYA 2XZOA 1SVKA 1ELOA 3SZRA 2OO7A 4DLXA 3B1XA 2ZVQX 3K70C 2DWQA 2OCBA 3K09C 4UNPA 4ON9A 4TSFD 3T5DA 2QP9X 1Z63A 1SZPA 4UNSA 4TT3A 2XXAB 3NVAA 4GSYA 4Z1MA 4BRUA 3EIEA 1XFAA 4IDQA 4DZZA 3HU3A 4ITRC 1W0JD 3R7WB 3RC3A 2GHIA 1FL9A 5KO2A 4KFSA 3EIHA 1T91A 2FPKA 2RCNA 1KK1A 2PT7A 2WIBA 3QXCA 3W5JA 2HXYA 5FOXA 1E9EA 3GFOA 1NLYA 4IVPA 5J4HA 3LA6A 3RS4A 1UJ2A 1MO6A 3PUXA 4PANA 1Z6YA 4M9QA 2FFAA 3OIYA 3RDPA 1XXHA 2R65A 1YZGA 1Z47A 3P4YA 4B3XA 2I1VB 4RFSB 1DAHA 3OF5A 2X2FA 4A6XA 2IYUA 3EZ7A 1E2HA 2IYLD 1XZQA 4KAXA 4QC2A 2P3SA 1G8PA 3DM9B 1CR0A 1G8FA 5JHGB 2E1RA 4DB4A 1ZD1A 1P9WA 2DCUA 1VIYA 2WWGA 5JI2E 1F60A 1FQKA 5EXTA 4LZZA 2ZJYA 1D9ZA 3E2IA 3OE7D 4MYHA 4DLVA 4E07A 1NBME 2PH1A 2OCYC 1W47A 4FCTA 5TB5A 5C18A 1G8YA 5FTMA 5KDOA 2NO0A 3QXJA 4MYTA 4LPKA 5DI3A 3V4FA 1L2TA 4FXPA 1TMKA 4OQNA 4Z51A 2YJTD 2IS4A 1NP6A 5DISB 3BFKA 4P4UA 1G7SA 4IHQA 3U6BA 4MDFA 2D06A 3NH6A 3E1SA 4P4SA 2YC4C 2FEOA 3RWMB 1UKZA 3I72A 4XTRA 4LCBA 3Q72A 4TSFA 1KYIA 3ZGXA 5KHOC 3FFBA 1MABA 4GMXA 2DHRA 1W0JA 4IOLA 4PFSA 2JATA 1T5IA 3PENA 2ZJAA 2V9PA 2QBYB 1NRJB 5CLLA 2GF0A 4TTRA 2J46A 1DE0A 3K9GA 2GEDA 3QXHA 2H18A 4OJQA 3IQXA 4IJMA 1ZNZA 2JJ2D 1NY6A 1AGPA 4PHHA 1PUJA 2N42A 3ZVRA 1E0JA 4JVLA 1EWQA 2J3EA 4W7SA 5JI3E 3SQXA 1K5GA 2YOGA 2ZSBA 2PX3A 2Q9BA 5JEDA 221PA 1W0KD 1SQ5A 4RJLA 3TH5A 5EZ5A 2BDTA 3D6TB 4M1OA 1XTRA 1E2PA 3QOFA 1CTQA 1D8TA 4I1OA 5FPSA 2OHFA 4OI1A 2F9MA 3ZZ0A 4F38A 1N6PA 2GJ8A 1R7RA 3OE7A 4B47A 2IS2A 1GL9B 3TUIC 4DDVA 5C4MA 2VSFA 1R0ZA 5HZKA 4JYCA 3LD9A 1XDBA 2PZFA 3FMIA 2NMVA 3NXSA 1GRRA 3WNCA 4LX0A 4UJ3A 1XXHB 3B2EA 1OFTA 3VFDA 2YWHA 4GZLA 4DCUA 4ZI2A 2Q9AA 5FOSA 5J40A 4KSCA 4TL7A 5JEEA 1G17A 1KI9A 1YR8A 4TZ6A 3TQCA 1JEDA 2VBCA 2VHUA 1DPFA 5E7JA 5HE9A 2IUUA 4BFVA 4BLPA 3MAAC 3LLUA 1G4AE 2IW3A 2A7QA 4MRPA 1QHXA 2ZRNA 4JKIA 4PQFA 1M7GA 4IDPA 2J0QA 4KXFB 2JA1A 1CJKC 4XJXA 2IYZA 5BYJA 4UXJA 3EG5A 4EJSA 3B1WA 4TMWA 3LBIA 4D26A 1GNQA 1SGWA 1FP7A 1P60A 1WDTA 4RVCA 5AK0A 1KKLA 4OI0A 3KQHA 3TGPA 1PVOA 1E0SA 3PEVA 1RFLA 1EFRD 2FPLA 3RNLA 4DLTA 3RLFA 2F55A 2WAYA 4Q19A 1GNRA 1I4LD 3CX6A 3LVRE 2W6JD 1WMSA 1TUIA 2GJKA 4E09A 1KIMA 1VG9B 3O8BA 4JMPA 5DI3B 5KSOA 4Q4LA 3B1ZA 2N46A 2F1IA 1IN8A 1V5WA 3IPXA 1KSJA 1LF0A 2V8OA 3R20A 5FBRB 1IHUA 2C9CA 4HAXA 3RS5A 3ZZUA 4B44A 2EFHB 4OKSA 5JS8A 3SQWA 1JALA 1QF9A 2AKYA 3ECCA 4YLGA 2BMFA 2FH5B 2H92A 2IYQA 3NWJA 4RKFA 3IHWA 4P4SB 1U2RA 1BS1A 4PSAA 3RSLA 4ZDKA 4Z54A 2WKRA 2OCAA 4KFTA 1L7VC 1W0KA 5JCZA 1BO6A 4DKXA 1OYWA 5KNBA 2ZE8A 3NEJA 1N2CE 4BFSA 5G3ZA 1W5TA 1DBSA 3EA0A 1IN4A 1MABB 1B0UA 4MQBA 4DC9A 1EESA 3BJIC 5BW8A 3U7HB 4TZ0A 3P26A 4O2RA 3FE2A 4A2QA 1T9HA 1Q1QA 2CLSA 2BVNA 1W48A 3EC1A 1QHGA 4QBIA 2C77A 3GFPA 4EUNA 4L5BA 3RRNA 4FMCB 3IPYA 1RW4A 3P20A 4LJ5A 3X1XA 3FB4A 4JLNA 1KI1A 2ZVPX 2DFTA 2AK2A 4D0GA 3W6PA 1DAKA 2EFGA 2PMKA 3KFVA 1KDTA 1KO4A 1S2MA 2EYUA 3DZ8A 4B74A 4LBVA 1W2HA 4A8JC 1BYIA 3CO5A 1FNMA 4OK6A 4ACBA 2ZRBA 5ANRB 2J0SA 3DL0A 5EE3A 1YJ5A 4U02A 4WW0A 3NBYC 1AZTA 4YXWD 1R8SA 2VYFA 4RFVA 2HT6A 1N6NA 4TLDA 4H9GA 3PG5A 4Q1BA 3V00A 3GLIA 2ZE6A 1XJQA 2Q0HA 3DM5A 3OAAD 4B3DA 4B34A 1UF9A 2J0UA 1Z3IX 3SFVA 1F2TA 3SDZA 1EFHA 4GDFA 2JLSA 1G7TA 1R8QA 3VR1A 4XH9B 3LO5A 1N3BA 1J99A 1N6OA 4EQ6A 2ZXUA 1X3SA 3OFND 1UBFA 2GBLA 1JECA 3FMFA 2W6JA 4OQLA 4Q9KA 3KQLA 1Q1BA 4URVR 3BFXA 4GL2A 2JLQA 2BEKA 3WHKA 4JBWA 3TVTA 1EK0A 3V9PA 4QHYA 4I81A 2GCPA 1VYUA 2QUZA 4MYUA 1DADA 4FW9A 3SJCA 4DCNA 4RZ2A 2FA9A 2JLWA 2P5SA 1UDWA 2CVHA 5G3YA 1OE0A 1DO0A 3QEJA 5BQ5A 2NG1A 5D3QA 721PA 3IBGA 1DG3A 3OHMA 4LC0A 2EFEB 4FINA 4EJSB 3B9QA 5DIFA 1ZM3A 4ZI3A 1WBDA 2O8FA 3BERA 3AB3A 2CLCX 4TYYA 2R62A 4HLQB 2ZPTX 4W5HA 5BN4A 2FWRA 1G7CA 4WZ6A 2BC9A 2FZ4A 3EA5A 1S1CA 2ZETA 2WWIA 1CXZA 3BBPA 4ZDIA 4AKIA 4EFNA 2WSSD 3H0KA 3TSWA 1U99A 3AEZA 3AVVA 3FKQA 4JS0A 3RYTC 1G1MA 4DT1B 4M1MA 2XSZD 4WXRA 4C7OB 1YU9A 2ANBA 1MRSA 2NZJA 2F1HA 3W8NA 4IFEA 2HCBA 2RGGA 2F3RA 1IN5A 3GEHA 4XVQA 4QXAA 3QBTA 1BIFA 4PC6A 5DE3A 1P73A 5FBVB 1XPRA 3RAPR 1UADA 3F5FA 2BIFA 2P6NA 3SE0A 3OAAA 2B7CA 1VG8A 5DYIA 3QXXA 6Q21A 2XAUA 4LJ7A 2H1LA 4TL6A 2D74A 4HLUC 3FFAA 4M1KA 4RZXA 4OHYA 3A36A 4HZUA 5KPDA 3OFNA 1T3LA 3VR6A 4K8OA 2JLRA 1VDZA 2YINC 2IUSA 1E6CA 2IYRA 4M1SA 4MRRA 1KK0A 1NKTA 2QG6A 1OH5A 3TAUA 2PMDA 4NYMR 2EWWA 1ZINA 1RC8A 1KJZA 2AN9A 2VA8A 2WAXA 2FFHA 3ZVMA 1YR9A 1Z2CA 2VO1A 3FDIA 2QI9C 4TYQA 2BM0A 2C78A 2QTFA 3DZDA 4HEJA 4TMXA 1E0AA 1M34E 3QENA 5FPTA 3WP1B 5C2JB 1CP2A 2AX4A 1SVLA 2H7VA 2KBEA 4GOKA 3CPHA 2FMXA 3AUXA 1SXJD 2JCSA 3SHFA 4NMMA 1CU1A 2Z83A 3OIVA 1U8AA 5EUMA 2FFBA 2SHKA 3GLIB 3TW8B 2BHRA 3ZIAD 4TN1A 2J0UB 1MRNA 1U81A 1O87A 3X1ZA 2DBYA 2IF0A 1F2TB 2R6DA 4EDHA 3IBYA 2RHMA 4V02A 2WSSA 1YZLA 3CB4A 1NJGA 4B33A 1KSGA 1G3IA 1VIAA 3TAHA 4BFTA 5CB6A 2W2VA 1YQTA 3GEIA 4QBHA 4C0HA 1E2KA 2W2XA 2OCPA 3GEEA 2GXUA 5L3RA 1FMJA 2J1LA 2XSZA 2F9LA 1A82A 4C0KA 2JIZD 4B2PA 2QSYA 2J7KA 2WZQA 4TMTA 3SN6A 1AM4D 3V4RA 3RHFA 3C14C 2D2FA 1LF5A 4K81B 1NN5A 1RRCA 2O8FB 1U8YA 4QGAA 1OLOA 5HCNA 5B58C 4L16A 2FV8A 2PL3A 1KI6B 3G82C 3ONWA 1SKYE 2VP9A 4D80A 1XCMA 2DR3A 4A2WA 2QQ0A 4GNKA 3EC2A 4MYCA 2WJIA 2F1JA 2MMCA 2D7CA 2JGNA 3LH5A 1N6RA 1RVDA 3AP2A 4JLDA 4U5XA 2R6AA 1RYFA 2RGAA 4TL9A 2QORA 4GFDA 4PC1A 5FPHA 3C5CA 1RYHA 3A1TA 3BK7A 3VU9A 4HZIA 2EWVA 1M7HA 2Z6VA 3KKPA 4TLAA 3PXGA 1MH1A 2ZYUX 4C0LA 5AJXA 4R71A 5LDDC 1XMIA 2ZJZA 2YNMA 4QGHA 4QRHA 5AUNB 5GJVC 4LBWA 4EPWA 2XJ9A 4KJZA 3K0AB 4KVAA 5FBLB 4LHXA 3VTKA 5JLJA 1SXJA 3KKNA 3MUFA 1Z08A 1QZXA 4DSUA 5BXQC 4CRWB 3RS3A 4RZ3A 1L4UA 3HYRA 2CL7X 4A6PA 1KI8A 1CJMA 3ZIAA 1F3OA 1G41A 1NBMA 2VP2A 2AWOA 1KOFA 1OFUX 1NLZA 2GXSA 4HZUB 4PO8A 5CITA 2ZRAA 4TYNA 3KJGA 4MH0R 4Q7MB 1U0LA 3LY5A 1YVDA 2HYDA 3PFIA 4AYXA 1US8A 3Q7QA 1NVVR 3DMDA 3CW2A 5C1BA 2GETA 1VHLA 3TVDA 3AVUA 4RKEA 2WWHA 3K0CC 3PQCA 2AWNA 2ZS7A 3OESA 2FOLA 5G53C 4TQ9A 1NN0A 1OXUA 3OEHD 2JIZA 1TAGA 2ZR7A 2JLVA 2BMJA 5ELXA 1FQJA 2VP5A 1R5NA 4ESVA 1JXMA 2WIAA 3U7EB 2Q3FA 2ZI6A 4BZQA 4PPFA 2GK7A 1I2DA 2J45A 1G8GA 3CF2A 3RS2A 4JLOA 3BC1A 3CH4B 4Q1FA 4NBSA 2JDID 3ETLA 3RWOA 4HAZA 4PAOA 4PHTA 4EPRA 5GADl 2AFHE 4QM7A 1XB2A 5FL7A 1IXSB 2J87A 1RRFA 1NNEA 1G3QA 1M6NA 2IUTA 2OE2A 3CM0A 4Q01A 5P21A 3I8XA 1A4RA 1HTWA 5EP3A 4D81A 4LYFA 4KYIB 4MRSA 2A5GA 5DYGA 1E2EA 2ZS8A 4D25A 1JEEA 3OIUA 2ZSFA 3NG1A 1DG1G 4N0EA 2F1RA 2HLDD 1LV7A 1WP9A 4FIDA 4ZCLA 4A15A 1U8ZA 5DHFA 1GRQA 2FNAA 2ZYWX 2V7QD 4RFSA 1JPJA 5K8UA 3KB1A 3KXLA 3QF4A 4L8GA 4PX9A 3FVQA 3Q5DA 5GJBA 2REBA 2Z0MA 3B13B 3QKSA 1ZCAA 4G5SA 4LBYA 2VHCA 1CF4A 1GILA 2E9SA 2QENA 4N1AA 3DMNA 3W5IA 4FD2A 1DAGA 1TU3A 4P33A 2FZLA 1XU4A 4D0NA 4LPSA 2CHVA 2FN4A 3KB2A 4URYR 2WTUA 1F48A 2IS6A 4Q9JA 2A5JA 1TEXA 2QPAA 1XF9A 2ODEA 5FTJA 2JLYA 4CEIA 3QBVA 2BOVA 1YZTA 2QEQA 3VU9B 1FPMA 5F98A 4QJ3A 4DLZA 1E9FA 1M74A 1EFTA 1HE8B 2CMKA 4RD1A 4NYIR 2QP3A 5FUWA 4ARZA 1ZC4A 3HU2A 3J81k 2J7PA 1E2FA 3VR2A 1P9NA 4KI0A 4A92A 1SXJB 1Z29A 3WNDA 5FL3A 5HTKA 1KSHA 4RD4A 1XD2A 2PCLA 5AJZA 3A1UA 4O25A 1E98A 3U61B 4BLRA 4ESHA 2ZIAA 1RRGA 2O8CB 2FGJA 2GF9A 3ZS9A 1ZC3A 1DAMA 4BGDA 5IDVA 5LD2B 3CZQA 4WVFA 1OH7A 2RGDA 1UKYA 3EARA 3PUVA 1ZBDA 3SFZA 1GZSA 3UG6A 2ZRGA 4HSEA 3QVUA 4HUTA 2IHBA 4XWAA 2QBYA 4I99A 3RC8A 2GESA 4OYHA 1DAIA 2QRNA 2YZ2A 4DDWA 1GOTA 3T1VA 2P5TB 2WOOA 2YYZA 3DO6A 4HYYA 3MJHA 2HLDA 1N0WA 4CF7A 1J7KA 1S4QA 1KMHA 2V7QA 4PXAA 3GJ5A 4TMKA 2RGEA 5JHHB 2ZYTX 2C5LA 2BV3A 1KDOA 3GLFA 2GEUA 4F92B 2HV8A 4XD7D 2IA5A 2PZEA 5AUQA 3QUSA 2XB4A 4ZO4A 3WYAA 4Q66C 1NMZA 2PT5A 3KFXA 4KSBA 3T5GA 1N5KA 1XEWY 4IDOA 1X8JA 3C41J 2OESA 3P1JA 4HAUA 5H1YA 4NCJA 4BRWA 5JWRA 3SC3A 4B3FX 4NCIA 2D3WA 1XD9A 1IN6A 2Q6TA 1MR3F 5CM8B 2W2TA 2X77A 3HR8A 2BWJA 3BRWD 3LV8A 2GKSA 2B6HA 3QVVA 3A1SA 5FI1B 4WZAE 4EPTA 2ZUBA 3ZYCA 4JLJA 3U7GA 1JBKA 1CS4C 2BJVA 3B78A 4MUAA 3AV0B 1BYUA 3PCRB 4PSKA 3PUWA 1T4GA 3QF4B 4G5QA 2I3BA 4LHZA 5JWOA 3KUDA 3QKSB 1ZCBA 2OXRA 3EWSA 3SBDA 3CWZA 5TXGA 3PV0A 4DB2A 1U9IC 2B8WA 5EE0A 2G1KA 4US0R 3IILA 5AR1A 3LVQE 4LY6A 3TR5A 4QFMA 1KHTA 1CEEA 1U9IA 4AURA 1IOZA 1UBEA 1HQYE 2NOAA 1AS3A 1RIFA 4CEIB 4ZKEA 4C9BA 1LS6A 1XEXA 4BLQA 1D5CA 4RD6A 2RH5A 3HYTA 5EP1A 1Z22A 2ERYA 3NDBB 1GG2A 1NMYA 3RRMA 5FUYA 2PLRA 2NO6A 2FSHA 5GVSA 3WNBA 5KDDA 1LW7A 4ARZB 3AP3A 2W00A 4HAVA 4OI2A 3HP1A 1U90A 4M9XA 3TSOA 4DIDA 3BFVA 2Y8EA 3EAQA 1ZW6A 5HCIA 2CHQA 4B3GA 1XD2B 3RVBA 1QHSA 1S96A 3EZ9A 4NKRA 4DLSA 4V0OA 1N5LA 4Q1EA 4XD7A 2YWFA 2GJ9A 3QI2A 4J0QA 4E22A 4CVNA 2QTVB 4R98A 3W6NA 5J4LA 2HYIC 4URZR 2ATXA 5D3MA 3ZLJA 3MWYW 2QAGC 1T0JB 1CBUA 4A0FA 1HQCA 2ERXA 5EXPA 4HLDA 4CW7A 3NH9A 3A6PC 2G1JA 3NHBA 2QAGA 2A2ZA 2OG2A 4RCYA 1T8TA 2A5FA 4M8NE 1E3MA 4US1R 3MGCA 4NHOA 1TEVA 1NVUQ 5F9HA 3WBKA 3AGQA 1OKKA 1VMAA 1GSIA 4DT1A 1HURA 2NO9A 4W5WA 3ZJYA 1PV4A 2FJUA 1PUIA 2QP4A 2ZJ2A 2BBOA 3K9LA 4WA7A 3TMKA 1FOEB 3GJ8A 4X8OA 3CRMA 2AKAB 4IDHA 4IOKA 4PSVA 4CT4B 4OHZA 4M21A 3H1TA 4JVMA 1KMHB 1Z0JA 1AA9A 2CCKA 4DEXA 2R6CA 4I1SA 5KOYA 3W8RA 4ZV4A 2VP6A 3JVVA 3GLFB 4D4KA 5J4VA 1VCIA 2GILA 4PZLA 4CIDA 3TK1A 2C96A 1Q1ZA 2OBMA 1KY2A 1S9HA 2BMDA 3SEAA 3CPEA 4BFXA 3KKQA 5H8WA 1QHHA 3O8RA 2GDJA 1T3SA 3IDQA 1X8LA 5L3SA 4HUQA 4URUR 1Z6GA 4P32A 2P65A 3KDSE 4DDTA 3BH0A 3KJIA 3U3MA 5B64A 3CLVA 1XTSA 1OXSC 3DOEA 2ZYVX 4Y0AA 2WBLC 4NL4H 5J47A 1DEKA 1W36B 1DTSA 2UVQA 1WE2A 2ODBA 3PITA 3UWOA 4AWXA 4N3NA 2XZPA 3Q3JB 2GNOA 2NO7A 2DY1A 2PEZA 2BBWA 2X1VA 2VEDA 3NC1C 3AVOA 3NHAA 5HE8A 4F7WA 3T35A 1DS6A 2XTMA 4IEEA 4Q7JB 3GJ3A 3T15A 1AQYA 4HB0A 3TNFA 4XWKA 2I1QA 3LQRA 4D0LB 2BM1A 2CXXA 1Z0IA 1WQ1R 3A4NA 4UNRA 2AL7A 3NIBA 2BMEA 3HPRA 4XVRA 3L82B 3IO5A 3I5XA 1NN3A 4EJSC 4URXR 1GKYA 3QXSA 1B23P 1Z07A 2VPPA 2WICA 2ZREA 1E0KA 1S8FA 3UMFA 3BGWA 1XTKA 2W0MA 1E79D 1ZAKA 4F4JA 3JVUA 5TV2A 3LBNA 1NKSA 3PEYA 4Q4AA 4FWIB 4GRAA 2LCFA 1XEXB 2WM9B 2FG5A 2FSGA 1YE8A 2GXQA 5EE1A 4ERNA 1IY2A 5BN3A 2ZJ5A 1G18A 3GFTA 3MMPA 1KGDA 1ZNXA 5KNCA 3M6AA 2A30A 3L0SA 2REOA 2CDNA 2NGRA 4URWR 2C95A 1ZU5A 4M1WA 2X2EA 4JJKA 1CJUC 4B6EA 2WKQA 1OB2A 3B9PA 2GA8A 2ZAOA 1OYYA 3WMGA 4C7OA 1OH8A 1SVIA 3MWJA 3CKLA 5D3MB 1A2KC 3Q7PA 3D7MA 4MKGA 1XJ0A 5FOVA 3HPQA 2IYVA 2EFDB 3B8HA 5TMPA 1OF1A 2QAGB 3DVLA 3IGFA 1SKQA 4Q7KA 5JECA 1FZQA 5FOWA 3N2EA 2VF8A 4DIEA 4LYJA 5CDFA 1RZ3A 4Q9HA 1FUKA 2JAQA 4A0RA 4KO8A 1DVRA 2CL6X 4U00A 1ZIPA 2OFXA 1G3MA 4JT4A 5AJVB 4HLCA 5HKKD 1P61B 3Q85A 4PZZA 3K1JA 1OPXA 4C4PA 4EPYA 3EPLA 4NCKA 1I4DD 1ETUA 1MO3A 2Q9CA 3JZMA 4XSHA 1G5PA 4LSGA 1UAAA 5FPYA 1AKYA 1W46A 1XTIA 4OQXA 4BZXA 1J8MF 2C2HA 5LPNA 2YKGA 4QM6A 1KMQA 2QL6A 3CUEF 5IK2A 1E9AA 1ZUHA 4BEJA 1QHHB
chains in the Genus database with same CATH superfamily
4S1NA 2II6A 3CWQA 3R9IA 1XLTC 3V5NA 1G6OA 1CUUA 1E79A 1JNXX 1ZGHA 1IEXA 5AW6A 3RVNA 1P29A 3CSSA 1R0YA 4G5RA 1QMPA 2BZ1A 1D0SA 5FOTA 1G8SA 2QYTA 1JKMA 4M46A 3G2JA 3T1QA 5KU7A 2JFOA 4QU9A 1SWVA 2QPTA 2Y92A 4IR7A 3OFVA 4J0JA 5AK4A 1GQFA 3FDFA 1XC7A 3FR8A 1KFCB 1R0LA 4OA5A 1XXHE 5EKXA 3A3KA 1FJXA 4BKRA 2LKCA 5JXWA 4FCWA 1USUA 2GZMA 3CW9A 3IKMB 2P2NA 1XBTA 2J08A 1HOTA 1SVUA 2HZBA 4QSHA 4MXDA 1E8MA 2A0YA 2X8BA 5H9VA 4NDZA 1DAEA 1U7DA 2IZ6A 3FIJA 4ODIA 2ZBUA 3TBHA 2FVXA 1YK1A 3F7NA 1KZ6A 3I1JA 4KYVA 2R6GA 4P2GA 1C1DA 1ZN7A 3GMTA 1WVMA 3PC6A 3AIOA 3EHDA 5HR5A 1WXFA 4JR2A 4LTMA 1TMOA 3ECAA 3AKEA 4X61A 1AZLA 3U3RA 3SYNA 1CY1A 3U7JA 2JAHA 5CIQA 1G2PA 3L40A 2WJHA 1BS9A 1C7FA 3IEUA 3A2KA 2CHUA 2QYHA 1Z6QA 1E1QD 1MB3A 2XA9A 4LQLA 4PRLA 1Z13A 5TPZA 2V74B 2IHKA 3DZHA 3WVNA 5THKA 1KEWA 4S2EA 3RYFB 2B8NA 1YB6A 3T52A 5CA1F 1N6HA 1V43A 2Z8XA 5BUQA 5KX5B 1G20A 3RE1A 3W7BA 3U1BA 4CEHA 3M5CA 1AD2A 2I29A 4WBNF 1FQWA 5BOVA 4IKEA 4N12A 4C20A 1JSZA 2YWJA 4R6XA 3AKCA 2YFYA 4ABYA 3P9ZA 1TF7A 5IKPA 3LTNC 2MMGA 2WUEA 1TJ4A 3LPNA 1FDVA 1O54A 3WYBA 1XE3A 4L4SA 1M5RA 3CPJB 1T4CB 4HOYA 3DB1A 3LX5A 4EKYA 4Q6BA 1RIIA 3DONA 1Q6ZA 2VOJA 4Q9IA 3LIIA 2QVZX 4QO8A 1Q0UA 4K9DA 3PDWA 1OXXK 1T5OA 2AG1A 3IAUA 1KJYA 4JJAA 1NLMA 2XKJE 1ODKA 3HZHA 1V8FA 4AP6A 3KYDA 4INPA 3W05A 1QLWA 4UTXA 2IPOA 1TX4B 2OVFA 2QL9A 2X3UA 4BQFA 1DEHA 4Z9BA 3AH8A 2OQRA 4MVXA 1EWKA 2UU9B 3CNLA 2JGDA 3GOHA 1BFDA 1SIOA 1IU9A 2PKXA 2A1UB 4JUCA 1FSGA 3IEKA 1V5FA 4KDRA 1NFRA 1EX9A 4ZVVA 4S1PA 2JBAA 1WUTA 1FYWA 1LFDB 3FTPA 4BTEA 5TF4A 4L57A 3WLTA 4DPMA 3UWKA 2J5KA 3U3KA 4GU5A 5ICEA 3GA0A 1HDCA 3I01M 1MO5A 1PV1A 1HV8A 1KFBB 2AEMA 3EZ6A 4BEVA 1JLSA 4XVCA 2YASA 2ZSAA 5GWXA 3ZH9B 2ZRCA 4OHPA 1RRPA 1G8KA 2YNMD 4WCVA 2XE7A 2BY4A 1C0PA 3HO1A 4R1NA 2K7ZA 5GTDA 1AGRA 4XZ3A 3CZ9A 4YP0A 3VGJA 621PA 2IYYA 1UM9B 1JFVA 4P81A 4QXMA 2BEJA 1ZEMA 2MWMA 3SLRA 1SK8A 4Q03A 5F33A 1TW2A 4CEJB 1L1RA 1NBMD 4M1ZA 4MLPA 4UMVA 4FFSA 5CX4A 5BOSB 4US2R 1EXDA 3PLRA 4EI2A 1TAUA 4R3WA 1Y7PA 3X1WA 1EVKA 2C2GA 1UM8A 1TD9A 2JIMA 2ZJ8A 1T26A 3KPWA 3NJRA 2DU8A 5DHRA 5K9ZA 4E7PA 5CA0F 3AK4A 1RABA 4AMUA 2WSIA 2GN8A 3H0EA 1VLMA 2EQ5A 4CF3A 5EIEA 5EZQA 5IT4A 5DNYB 1UFQA 1T6NA 2LNDA 2P4EA 2OV2A 2QU8A 2QX8A 4TWAA 2GCOA 4FFNA 1HL3A 4LGMA 3OE5A 3E18A 5AHXA 2I66A 3RADC 1IXZA 1RI3A 1CY7A 1Y8RB 2H51A 2LVBA 2NW6A 3KHUA 3LT4A 1UBGA 3HUEA 1NVFA 1Z25A 4HI0E 3WL6A 2FMHA 4D8VA 5BW5A 2WV9A 1AMOA 1J90A 1H1DA 1UK6A 2V8BA 1Y63A 2VQDA 1A9YA 1L5YA 1J8QA 3RSQA 1E5TA 4LMBA 5B30A 1NMQA 1GQ2A 4JI6B 1M67A 2AIRA 3RUFA 3VZDA 2VDOB 1CJVC 4HFRA 3URMA 3KZCA 2O3TA 2YFHA 2E4VA 3SR4A 2CNNA 4CDMA 1DWUA 1VJTA 3DR3A 1GAJA 1TMYA 3TSZA 2DFKB 1CYEA 3ORQA 1DWQA 4RWEA 5FL7D 2IV7A 1D2AA 4WZAA 3A4MA 4A6DA 3OZFA 4BASA 1FYDA 3OKPA 3E3OA 3W5BA 3GGJA 2JJ1D 4MQFB 3BMNA 5LP6B 3ADBA 2AUMA 3HN6A 1U0OC 5BNFA 1QYDA 1E2LA 2CLLB 4RV4A 3BOSA 2J3MA 3FKSA 1T2AA 5K8TA 2WR8A 1EAYA 2Q7XA 2C4NA 4KAJA 1G6KA 4MKXA 4CLRA 2O8BA 3FYUB 4MSUA 1UIMA 3PNKA 1IXYA 4V3CA 3L2OB 2JAPA 1M5TA 4UTVA 2JRLA 3CLTD 3K9BA 3PHIA 2QRLA 1U28A 2J3QA 4D3ZA 1KOLA 1GPLA 1CUJA 2JARA 2JJQA 2YV2A 4WJLA 4TMYA 4OHWA 5IHXA 2ACWA 2OT3B 3AF0A 3SKXA 3VZQA 1KI2A 1NKVA 1RKVA 2DQZA 3NOVA 3S8MA 1BOOA 5L3QB 3ZHCA 5JYCA 4TTIA 4HK4A 4JWTA 4MRAA 3PD0A 2QRUA 3OZBA 4Y1EA 2W83A 4QGFA 5CEFA 2P9GA 2QHXA 3IIJA 4V24A 2GPSA 4CCSA 4CM6A 4N48A 5T4EA 3VHRA 3GVCA 4DWOA 2VRBA 4EAQA 4LNAA 3GIWA 1VJGA 3AY3A 3CLSC 3N07A 3THWA 2WKWA 4DR3B 3PQ5A 1ISPA 3G0BA 4BP3A 2XMBA 4BRZA 3AEUA 4I1RA 4ND7A 1EMDA 1QO7A 1V4BA 2KHZA 3F7TA 3PFCA 4G4GA 4NVRA 1DIGA 1GTJ1 3VVBA 5C1OA 1Q2UA 2BFPA 1HUQA 4LYHA 4EATA 4EHDA 5KWIA 3IAM6 1KEUA 2FVYA 5DCWA 5JCXA 3DBOB 4OH1A 2JFYA 2O7RA 4LJ9A 4HBZA 4K88A 4QBFA 3B2QA 3C15C 3S2EA 3IV7A 5JUWA 4XWTA 3EPKA 5JXJA 1B0AA 5HJEA 1B6RA 1OJLA 2H9YA 4WEOA 2ZSHA 3HCDA 3NT2A 3SSNA 2YJGA 4Q9LA 1M8GA 3E5HA 4BLUA 4IX9A 1XZLA 1XL0A 1HNXB 1E1KA 1FNSA 4NLLA 1T0PA 3CMMA 3WDKA 5KVSA 2BFFA 1J4AA 1W5SA 2NAPA 4I50F 4DRYA 2AI1A 1XTZA 4RSGA 1AMUA 3H42B 1RMTA 1UIRA 2E89A 5F23A 2V4MA 4KPUB 2Z9DA 1HDZA 3X1YA 2QSUA 1CE8B 4L22A 1EE9A 2GYVA 3DPSA 1XJ5A 3LFUA 1P2SA 4BGEA 1RWXA 2V1UA 4Y6GB 1IM2A 1Z88A 1EB8A 2DT8A 4N39A 3TXYA 1KQFA 1YA4A 3AR4A 2WG1A 4MHSA 4NE9A 5IM5A 3T95A 2HK9A 4X1OA 5LZ4A 4WBSA 1BXKA 4GXRA 4YLYA 2BGIA 2R8ZA 5BSRA 1BWQA 5KYGA 4EIWA 4F4JA 5JH7A 121PA 1ZGAA 2DUJA 3NRJA 5EOVA 2OV8A 1ZAYA 1QF6A 1HDEA 1VYTA 4A36A 4ZYLA 1WF3A 1YCHA 3DKPA 1JAYA 3KP1A 1WL8A 2FSVA 2GDZA 3RB8A 3U4QB 1FIUA 2I4LA 1NOIA 2O8NA 5AVZA 4IOJA 4EFLA 1ACJA 1SIBE 3A04A 1OLUA 1J8YF 1JLRA 1XVIA 1NU8A 2A4KA 1V35A 4RC9A 1W4LA 2CUZA 3WA6A 5B2FA 2K2QB 4G81A 4BFWA 3IMKA 3DKVA 1MB9A 2AEFA 3HWSA 4RTLA 2FWMX 4ZT4A 1HG0A 2PG3A 2JJYA 3SZUA 3BGSA 2JAXA 1H65A 1XOIA 2GJSA 3EVTA 2HWXA 1L4KA 3RBAA 2C7OA 1CR1A 1RM4A 2Z04A 4IDAA 4O4IF 4L6CA 2WAOA 3PHGA 4KIFA 1IVNA 1JU9A 3FTEA 1W93A 3TLXA 4BXOB 1L5OA 1BOFA 4GUDA 1EHCA 1P4JA 2V03A 3D1JA 3D7NA 3IUPA 2EQAA 3IVGA 3NHPA 3PYLA 4HGYA 3D7SA 1R0SA 4JA0A 4LHSA 1LWOA 4XYGA 2Z6AA 7GPBA 1N4DA 1KYWA 3DKKA 1UBLS 1GA4A 2D2IA 2XF8A 3D2CA 3PUYA 4X60A 4UBJA 1I51A 1V1RB 3WICA 1TQ2A 1POWA 5ELLA 5K0JA 5IC5A 3U4GA 3AUSA 4XCXA 3MWDA 3T8YA 4CG1A 2HDOA 4EVQA 3L0DA 3P5SA 3OQHA 1ZM2A 1Y6ZA 3M2TA 4K40A 5ALVA 4DPLA 2SCUA 2Y6UA 4HDCA 3TW4A 4PZ9A 1JT2A 3IFSA 3KSDO 4R4JA 3OT4A 4PGGA 4N4AA 5CJPA 3JY6A 3GUHA 3KT0A 1E6LA 1H5QA 2CJFA 1I9GA 2DPXA 1JZSA 2OBYA 1CQWA 3H2SA 1JDTA 4N6GA 3DE1X 2O2SA 4LJ4A 2CNWA 2DFLA 2B5WA 3QF7A 4UEJA 4D3XA 6NULA 4QFCA 2ILVA 1TADA 3AMVA 4XUEA 4JVNA 1KEEB 4HWSA 1YS4A 1TM4E 3UT5A 2NLOA 1ZCJA 3ZU2A 1SC4A 1V37A 1QGUB 2LGJA 2PR7A 3GP3A 2V6IA 2PVPA 4V1CA 3HJGA 1THMA 3KWJA 5KQPA 1BMTA 3GH1A 1DO2A 4I5DA 4O2BA 3T1TA 2H0RA 3MMNA 2E4UA 1E1RA 4Q15A 3CZ4A 2BGWA 3QH4A 2XCLA 4C3ZA 3ZGNA 4DR5B 3V8QA 1PFGA 2IXGA 2PKWA 2Z43A 4YFYA 2CJXA 1X14A 1FK8A 3Q11A 1ECJA 1PG5A 1GPNA 2CLDX 5CM2Z 4QUGA 3UAWA 4PGHA 5EYPA 3JQEA 5ALSA 1KH2A 4V2IA 4WT7A 3WYDA 3ROZA 3EC7A 4Q34A 2VP4A 4AP9A 3NP7A 3P4XA 3Q7SA 4EEXA 8OHMA 1N2CA 1UBKS 1S2IA 2AZTA 1T6XA 2WMDA 1MZPA 1K3UB 4WDRA 2B30A 3RS7A 1VGRA 4BVEA 5L4SA 5BWCA 4AMZA 1NVXQ 3BQNB 4HVTA 3WK6A 1R0CA 1NM5C 3TLMA 2PLWA 2FLKA 1EFLA 1T8PA 2OORC 2Q41A 1Z5PA 3NTOA 1W85B 3P8ZA 4Q39A 4QQRA 5C8YB 1ZQ1A 3KLMX 4NOKA 3KAJA 3IV9A 1PFKA 1V8ZA 2YZGA 1GFIA 3LLCA 1A1SA 2VZEA 3FWZA 1DC8A 3L7CA 3EASA 4G4JA 5A5GA 4K9PA 3REOA 5DBOA 1L7NA 3A6ZA 2QWXA 4O02B 5EFOA 2BH2A 4BN0A 1E4OA 4YAFA 1SG6A 5E1BA 1K8XB 5HF5A 1C4WA 3RVMA 2C2XA 3P7MA 4KSYA 4B9EA 2Q27A 3HEAA 2G08A 1OVMA 1ST2A 4IGFA 1HEIA 1EXVA 3V8NA 2IEAA 1WB5A 4YUZA 2RJNA 3C6KA 3H86A 1RWMA 4M0LA 4LF8B 1UBJS 2RAFA 3ETJA 5FIUA 3K09A 3PKJA 4PIVA 3OTOB 3FD8A 4FGUA 3M6LA 4DR7B 1M1NA 4J3NA 3DFZA 1AS2A 1IC6A 1LZLA 2BEVA 3ZHZA 3ZTYA 4AB1A 2CLEB 4DEYA 4CDRA 1ESMA 4WPGA 1DCFA 1OXTA 4PC7A 3VPSA 1D03A 5DNWA 5EKSA 4EG5A 4NBNA 2JB9A 3HWRA 5C80A 1V3QE 4EUEA 3EQZA 2P1RA 3LX8A 5J4YA 4OLHA 1Y48E 4RHXA 2RI0A 2RKWA 4PX3A 1QIEA 2V65A 5JPIA 3W4JA 4U7PB 4CTJA 3VNUA 3GGDA 1ULSA 3N2IA 2BSXA 4J07A 4DXHA 4QZVA 5JSQA 3UMYA 4L8VA 2ZCJA 3IJRA 5DRTA 2GI4A 4GOLD 1QKJA 3AQ4A 4B3HA 4JYPA 3A6LA 1ZK4A 2VG8A 3SQOA 2VZLA 3HB5X 3DT9A 5SYNA 2D59A 4AT1A 2D6FA 3U39A 4O0MA 4G1EB 1JEQA 3K0FB 4MTCA 5DRYA 3TW0A 1UBCA 4CDNA 4Q3KA 3FGZA 2VAVA 1CUDA 4DV7B 3CR7A 1G291 2FUKA 4MR7B 3R7DA 4Z4CA 1URPA 3F9RA 3ZK9A 3FCXA 4YBZA 5JSZA 4LF6B 1U8UA 2QRMA 1U0JA 1XNHA 1UJCA 3JQRA 3WKEA 2AOWA 2FN3A 5D2CA 5JFOA 1JAXA 4QASA 4YJFB 1GHTA 5AVTA 1PGJA 2ZYHA 2H06A 4P53A 5TNXA 4QOIA 1ZM9A 5LLTA 2FF5A 2P35A 3BWXA 4L50A 3A6JA 4K0RA 2M32A 1JR3A 1MO4A 4TT8A 3BB3A 2Q4TA 1JWBB 2IS1A 1NDUA 3CF4A 4MKHA 2WKPA 4UEOA 5AVVA 2MYNA 3R3UA 4LY0A 5IYZA 2R1ZA 2VCHA 2DLNA 4PTYA 2X8JB 5IT0A 2GPYA 1XP8A 2ACVA 2Q62A 1UOQA 3HCFA 4X64B 3C48A 3RYHB 4QTYA 4QICA 2D5AA 3LG2A 3OHSX 4JT8A 2BM8A 1LDEA 5EE5B 1IY0A 5LBIA 3CVWA 2GARA 5K3AA 3RSFA 1EH5A 1EP1B 3TECE 4UE2A 1DELA 1GU1A 2VWPA 1XQ6A 3MJVA 4IO0A 4X6YA 4BMDA 4AZTA 1KI7A 1O3YA 1L5KA 2IX3A 1PR0A 1SVOA 4MYDA 3A9VA 3P94A 2GWHA 3U3DA 2XMCA 2EQBA 4BVHA 2NZ2A 2CJPA 2GN4A 2ZAYA 3CT6A 3FPBA 1COWD 4TMVA 4RTPA 2E5LB 3OLVA 3WY9A 3I5YA 4FYIA 2PX4A 4UJ5A 1BJTA 2VF5X 2ZI5A 3HJCA 5FRDA 4ASUA 3PYMA 1YFZA 2GJAA 4MI1A 4ZVOA 2EARA 1Y3BE 3O9MA 4N3BA 5K5EA 3JATA 5HJ7A 5C0OE 1KEVA 5ENVA 4WNAB 3GARA 1AB6A 4ZQFA 4D6PA 3A1CA 5FAXA 1KJ9A 3TZBA 2DKFA 1BE8A 5LZ5A 1FB5A 3OJOA 4MICA 4YIKA 3L6UA 4DJFC 4IH4A 4K28A 3ZLUA 1YS6A 2WF5A 5AOCA 4AZWA 3EVBA 3K8ZA 1GDDA 4KQCA 4YA6A 4ZEMA 2EJUA 1QANA 2C03A 2P2YA 4DYVA 1ESCA 1JJBA 5DTJA 1EFCA 5HZGA 1L4YA 3LA8A 4BTLA 3B1YA 3H9GA 3ROEA 2Q6KA 5ELMA 2VTDA 4HKTA 1KQNA 4Z4QA 4Y2RA 5TS2A 3OLQA 4WMLA 4JBYA 1J21A 1EE2A 3L06A 4UHCA 1W4CA 5EP2A 4XX1A 1C30B 1M1YE 2D5LA 1M66A 3W6ZA 2AC7A 3V7FA 4C4YA 4F12A 2FUEA 1ZKDA 4Z4GA 1XUOA 2WWWA 4R7GA 3HU1A 3K5WA 1VBMA 3TPZA 1XTPA 3W04A 3AW9A 3L1VA 3PL1A 2HJVA 3PQ6A 2Y1DA 5ALXA 2TMDA 4TROA 4YJ2B 3HKBB 1W5FA 3HQ4O 4BQOA 2DYKA 2HD4A 3U0VA 1JYEA 4HS4A 5A7HA 4BWGA 4NRDA 2H0QA 5EP4A 1ORWA 4X7PA 1GAWA 4BN4A 2X8WA 3L18A 1DBWA 4X9XA 2QROA 4X7RA 2JS7A 4BUJA 3ZJ4A 2NPIA 1QH0A 1ODLA 2P4SA 2UVPB 1JQBA 3DHWC 1TA9A 2WU3A 1ML4A 3MGKA 1C8LA 2QIOA 4K1XA 3MS4A 3ZWKA 2P75A 1RI2A 2IBMA 2PZKA 2V4ZA 3R3VA 5REQB 1MB4A 4XWOA 1ZJYA 3EVNA 4MMYB 1NR5A 3GXOA 3SX4A 4DG9A 1ECCA 4JV5B 1Z45A 2Y9MB 1PJ3A 4OJKA 4KPEC 4EWLA 2OY0A 1RS0A 1RADA 2CHGA 3E5RA 4I55F 1ABEA 1WM1A 2FLVA 5KYXA 2XECA 4R05A 3DOFA 3SI7A 2VQSA 7YASA 3NHMA 3VNRA 1DBQA 1N2JA 2BJHA 3BK2A 3PPYA 5JS7A 2CVQA 4K9MA 5K8IA 3A1WA 3E7FA 4KQ9A 3SIRA 4YGXB 5IJ0A 3QQPA 2RD2A 3TSAA 3DMGA 3OT1A 1X7YB 1V2HE 5CLHA 5KJ1A 3Q3HA 1REQA 5EJMA 2XNKA 4EUFA 5LQNA 2HB6A 2DWPA 2I3GA 4LHYA 1TVCA 1PLJA 2EZ4A 3DF9A 2RGWA 1VXOA 2ZJBA 5JMPA 4RYDA 2ZANA 2H1WA 2P9FA 4Q1DA 3FYSA 1QH8B 3HA3A 1TZBA 1F8UA 1U1CA 2HHLA 2VPIA 4KVGA 3GJ6A 3QNUA 1ZMXA 2XTZA 5ABPA 2RJ3A 2Z3ZA 3C4QA 5DGIA 5HF8A 1AX9A 1JQLB 2IWHA 1C8VB 1WV1A 2CMHA 1NVBA 3IKJA 5B2EA 2QVLA 3MJEA 4BJ1A 3BH6A 5E1OA 1XO1A 1M2HA 1PJAA 3RFUA 3OZDA 5I8WA 4YRBA 4Q12A 4X1YA 2XB2A 3GIDA 3IQZA 2WAMA 3WSWA 4X1KB 1E2BA 2UYGA 3MUEA 3JYQA 5FD8A 2DSTA 3BXZA 3E4DA 1JIVA 1QO0D 2B6NA 3BHJA 3F6RA 1E62A 4OAPA 4B2YA 2EYQA 1ULZA 4LF5B 2ZSUA 1V8OA 1EGVB 5TQJA 1Z2AA 2QR5A 4KPFC 4L28A 3O8OB 5KNDA 1SEPA 4YJ3A 3NAMA 2B3DA 1N6IA 1UMBA 2CNBA 3KWFA 4DCSA 4BP1A 2V9ZA 5AVYA 1V45E 2Y66A 3F71A 3PDUA 4RM2A 4UBIA 3LQ4A 2P6PA 3BD6A 1QGOA 5FWXB 1S2OA 3L1KA 1UBHS 3OA0A 3GAMA 1JJAA 3NRCA 3TQIA 5J1TB 2ZSEA 1GUZA 5G02A 4A1OA 4L1KA 2HWWA 2ODWA 3T7RA 4A3SA 1ZVJA 1SUDA 3F3YA 3IDFA 5K05A 4YJDA 2VP3A 1R4MB 4I6JA 3I83A 5C5CA 3M0EA 3D8UA 1OU0A 3EG9A 3PT9A 4N65A 4U9HS 5JYDA 5JG7A 3HVIA 2IUFA 4RVUA 2QX6A 1F8GA 3ZGVA 3KLNA 2BR4A 1VFNA 1GGVA 2WKSA 3GJ7A 3UWDA 4CQMB 3U4MA 5AHWA 3R8CA 2KS6A 2HQBA 1BHJA 2WM3A 2YZKA 2ZG6A 4MHOA 3RKSA 3EIQA 4OLFA 4WECA 3U4IA 1KU6A 3LQQA 2OGWA 5DYWA 5LUAA 2XYVA 1E1NA 2W4IA 2HK7A 3LK6A 3MW8A 1K1EA 3S29A 3VV3A 2IBTA 3UHFA 4B3TB 5PNTA 2WOJA 3BD9A 3EEIA 4IS3A 4J0IA 4JH0A 3B51X 4F6LA 1ZOPA 1AUQA 2J6HA 2HNKA 2NSHA 4FI3C 1YDMA 1WS6A 4ZYUA 4YMLA 5FPKA 3CZRA 2O0KA 3DTVD 3BWEA 1NDQA 1J70A 1P17A 2FWJA 1J0EA 4DQLA 1CNEA 1A4UA 3IOEA 3VU8A 1D2EA 5HRUA 3HCAA 3IPAA 2RI6A 3ONFA 5TGZA 3SJBA 2X76A 4JAVC 3H9UA 3COYA 1FFGA 1UMCA 5K0BA 1AS0A 1R0XA 4GI2A 1EK1A 1ODFA 5IKOA 1TF5A 2C3PA 5DK4A 1SKYB 3BRCA 3ZDQA 5KQMA 1ZYUA 3HGQA 3PCXA 1ZD3A 3QFHA 4LJ8A 2SECE 4TS3A 3RFXA 4F72A 3MWKA 1RWWA 3T41A 1DJPA 1G59A 2P0EA 4YV7A 3CZPA 5T41A 1T9GR 1U2ZA 2I87A 4DLPA 4ZOLB 3O26A 4W63A 4ER3A 2JI6A 1Q22A 1GA6A 1JF8A 3WLOA 2BFMA 1QVAA 3Q2IA 1XCJA 3IBSA 4Y2VA 3DSRA 3HGMA 521PA 4E46A 5L53A 2Z4RA 2PUGA 2QY9A 2AZDA 4E03A 3SZMA 1E7MA 1B74A 1Z37A 2WFMA 3CA8A 3WS7A 1C0LA 5UKDA 3DNMA 1YA6A 1G55A 2H2GA 1G4HA 3NIFB 4FMBB 5K6RA 2XMDA 2J41A 2IY9A 3OCWA 2D4HA 2GPJA 2EDAA 1KI4A 7ADHA 4FILA 3T6KA 2WV7A 3QLTA 4ID9A 2IQIA 4PQEA 2CJWA 1KC1A 1Z8FA 4JP3A 4ED9A 3L0OA 5L4NA 3KSAC 1H9CA 3HMKA 1W1WA 3KO8A 4DMHA 4U7FA 4CIXA 4YWHA 1YZNA 2LWIA 2WPDD 3OEED 5CB4F 1S3GA 4QBTA 5KNDH 3WGMA 3BREA 2GFQA 3K9WA 1PJRA 2PWZA 3ANLA 1B0PA 2ZI7A 3V8MA 1GUBA 1YS7A 2QT1A 2VSNA 2Z08A 3J80A 1C9DB 1P2BA 4MVJA 3B1VA 3WLMA 5K03A 1ID8A 1OXBB 4YQZA 1WJGA 2GTIA 3OPXA 3L93A 4K6HA 4F97A 5LU8A 1NHWA 2O0LA 3ZG6A 1KARA 1L4NA 4L08A 2VJMA 5KSPA 2VHTA 1DB3A 2V0NA 2OXTA 1VTKA 2D1FA 3MLEA 4TLLB 5E9JA 4QG3A 1X7HA 3D6UA 4KQMA 3VR3A 3X2SA 1BGXT 2EJBA 4LV5B 4WOKA 4U9UA 4EJ6A 4M53A 3GROA 4B31A 3EWIA 3PQ3A 1OW3B 1ZD2P 1LVHA 3S27A 1W35A 4QVGA 2KM1A 2PA3A 4JLKA 4WIAA 1BMQA 4EEKA 1YVPA 2IK8A 2PUVA 2VSXA 1XAIA 5LVAA 1TUBB 3M33A 4OQPA 4BYMA 4YDQA 2AFHB 2BHSA 5EWJB 1NA5A 2O9JA 4YDHB 5TMEA 5LZ8A 4HGPA 4W1PA 4EQ6B 1QOZA 3A8TA 2OHJA 4RY2A 3HFRA 3HZOA 5G41A 4ZT7A 2NTNA 3IR5A 2B20A 3ML1A 3CB2A 4CMIB 3NVKI 3G9UA 1BHQ1 2O5VA 5K3EA 3KXKA 5CTAA 3NHSA 3Q3IA 2GASA 2W2KB 4K7JA 4R9NA 4XDGA 1QYVA 4Q7LA 4UU1A 1NJ6A 1EFPB 4MYSA 4EY4A 5CFMA 2HBRA 3A6HA 1ENYA 3IEIA 4JBGA 3LJKA 1ENPA 4S2UA 3VYVA 3VJKA 4AN1A 3UB4A 1KAEA 1NVDA 4I1UA 1V3TA 4BP8A 4CV1A 5KYYA 2I4IA 1F51E 1R10A 1A9OA 1LTQA 1TLTA 1ZNYA 4XARA 2HA4A 3V80A 1PT8A 3HRKA 1E6MA 4YECA 1RI1A 3IEVA 4LOAA 4GSKA 3ZKAA 1NR7A 4YRZA 2DJIA 4ZMBA 3ENQA 4QG7A 1X1TA 4WFJA 3WZMA 5HWSA 3EVZA 2BUBA 4MUJA 2O2HA 1TU0A 2YUIA 3AHGA 2O8DA 4EHLA 1SZDA 4JLMA 4MGZR 2XVZA 4HQLA 3GNSA 1QE3A 3WZ2A 2WD7A 3HUFA 1Z8NA 3ESRA 4JNCA 2WMNB 3AI2A 3ETDA 1KP3A 3LHSA 3ZTWA 4CV2A 3K6RA 4BOYA 1H1LA 1N8SA 4LX8A 2AOUA 1GXSB 4X24A 4XAQA 1USVA 1V1MB 3HA2A 3LQ1A 4K6OA 2HNAA 5T4HA 4BZZA 5JWHA 1G3RA 2OP1A 4TWRA 4XM0A 3RRYA 5C1DA 1BN6A 1KFKB 2B3TA 3F2IA 2J9RA 3DJFA 4KNVA 4NG5A 4C0XA 4XASA 5K4HA 2R1VB 3NU1A 3A70A 3L7AA 4WOJA 4DUYB 4A8TA 4AK9A 4WCFB 1NMXA 3B1JA 5DKFA 2QM0A 5KSWB 4R7ZA 4PZYA 1ADBA 3P2OA 1U02A 1S6YA 3MPOA 4BMOB 1FUEA 1CVLA 1G8JA 5DZSA 5DBFA 3OQ6A 2X86A 3OUZA 1AUVA 4RMHA 1X7GA 3UAYA 5FR1A 5IG2A 3GPLA 1B1CA 2Q0QA 1KJJA 1GGMA 1LQTA 5K0NA 5E95A 2YBEA 1Z2EA 1ZMRA 3QITA 4GXNA 4MVJH 4ZQHA 2RGRA 1C4OA 2VHVA 2W58A 2Y4OA 5J2UA 3KKMA 1ONOA 1IXRC 1B42A 3D4IA 4KZPA 4LHEA 1JEJA 2ID4A 1LU9A 3BDVA 2BUCA 2LP4Y 2PFKA 3PDIB 2IWRA 1V7CA 1QXSA 3W6UA 1FU4A 3Q3CA 4DXDA 3NHFA 1O6CA 3ECSA 2P4HX 4UFOA 3W9UA 4REQA 2WHPA 3BPSA 5IHPA 2ONJA 1VPLA 3QPWA 1M73E 4NNOA 3AL0C 5AW2A 2WUFA 1JHXA 2XPCA 4OUDA 4RK7A 5AW9A 3SQNA 5JNTA 1FP2A 5CM9C 4HFJA 3MJFA 3RSOA 3M4XA 4ZVQA 5AP9A 5EJFA 3C6BA 3MTAA 4GT1A 5JJKA 4B85A 2OA0A 1XT6A 1DL5A 1IPHA 1L4HA 3FMVA 1YOVB 3OCVA 1MGOA 4ZGGA 5GOTA 3WADA 1XQ9A 3M6MD 1UMKA 1Z4NA 2Q3HA 1E2DA 3A6DA 2R7AA 5AIAA 4WSOA 2QU7A 3ZQ6A 5CBKA 3QEMA 2VK1A 4LVNA 4DG8A 3UZUA 2TMKA 3WIEA 1USGA 1FEZA 2GZDA 3FDZB 4MA4A 1BH2A 4JYBA 3UKDA 4LRQA 1FSZA 2H2AA 2WIKA 3OETA 4OB7A 4X41A 5FYQA 1J2UA 1ZN2A 2ZGVA 3BBLA 1D1SA 2RH4A 2CUKA 3N6VA 4G4IA 4V0LA 2OFFA 1GNTA 3KWMA 3DZJA 3FNHA 4QPPA 1XN4A 5L40A 1ESDA 4Q48A 1G8AA 1J2RA 4FDAA 1BEUB 4TLBA 3K3PA 5ARBA 5GIPE 4RQUA 2FSIA 1M83A 1G20E 4P4TA 1EJ0A 4WI1A 4CI9A 1VE7A 5MGNA 2QTBA 5FJIA 1VRWA 1R0WA 3HCPA 4HWOA 2CCGA 1VG1A 2XITA 5CRIA 2PBLA 4XFJA 3LHIA 1TGYA 3NB0A 4NH4A 1LFAA 1ORDA 3RASA 1GUDA 4U9IS 3F6BX 3R9XB 1JKFA 1J7JA 2F64A 3G1WA 1UOOA 1JQDA 2G76A 2JJMA 2PWYA 3ESZA 2A9QA 4KX5A 5DF1A 1D2MA 1GZ6A 1ZUNB 2Z95A 1SIUA 3B6ZA 4B4VA 4Z1MD 1QH1A 5MN4A 1YE5A 2EGHA 3BWCA 2FG6C 4NQRA 3UK1A 3Q8KA 2FEMA 4CQLB 3W7VA 2M1ZA 1LVUA 3D5EA 1RLJA 1MJHA 1OH6A 2WJGA 3I6ZA 4B73A 4JLBA 1N3LA 2C2OA 1APBA 1WW8A 2O2EA 2WYIA 2K4MA 4Z9AA 1Z7BA 8GPBA 4Y2SA 1PR3A 1Y4AE 4K86A 3ZWWA 1Z5OA 3I9FA 5F21A 2RAVA 4NJMA 3UYLA 2CYBA 2K5UA 4LUCA 5JMTA 2BE9A 1KZ7B 3K15A 5GGXA 4DA7A 2RHHA 3CINA 3F4LA 3AR2A 4JLWA 3FUTA 4AI6A 3PEWA 1YC2A 4LYYA 1RYZA 3ED1A 3ME5A 4YRDA 5B4UA 4NENA 4UDYX 2Y27A 2R6FA 1I3LA 3UGKA 3KYCB 2HF9A 1O8CA 2XUOA 3I76A 3U3JA 3D3JA 3E3LA 2XUFA 5JTTA 3M1YA 1ZR4A 3T7SA 4L07A 2IU6A 2PTGA 1R0RE 4WKBA 4BUZA 2K6GA 3W9YA 2PRJA 5G40A 3WLKX 5E6RA 1C8BA 1M2GA 3WKCA 2J4FA 4UDNA 4RZUA 2CXTA 3A31A 2XZTA 4I9GA 1AKWA 1Z2OX 3UK6A 3MS7A 1N2GA 3M6FA 5EMLA 1SO8A 3OCCA 4B5LA 1PZNA 5DSTA 2SBTA 2JLCA 2GB4A 4PXYA 1XP5A 1Q0QA 2O2ZA 5CPBA 5KQSA 4TVBA 2QN6A 3HYLA 3S1AB 5C4GB 5I4IA 3GELA 4GSLA 2VXYA 2QTNA 3FBGA 3ZX4A 4UDOA 5DM1A 5YASA 1U6IA 3WLPA 3BIFA 2HU2A 1W2GA 1P0IA 4Z4IA 1R66A 1OFGA 5EY5B 4TQUS 4FJ1A 1F38A 3EGXB 5EJ8A 3C1OA 3LC0A 2CBXA 1U0SY 1DI0A 4PLGA 3BZUA 1V26A 1BD3A 5ICMA 2C42A 3ASUA 1RRKA 4G24A 5AMXA 5CAEB 3SZRA 1RAAA 2PL1A 3D3WB 4DLXA 4AQ7A 2DWQA 1XDUA 1A0OA 1S89A 4GICA 1UPXA 3DD1A 1N7GA 4P8RA 4PAGA 4QU5A 3GCWA 4QTXA 4UNPA 5TSDA 2QP9X 1AGXA 4CV3A 1Y8ZA 3T5AA 4E5NA 1EAMA 2H7YA 4DQ0A 1XFAA 1EZ1A 3HU3A 3GT3A 2EL9A 1HFKA 3E53A 3RC9A 5KTTA 4H7IA 4J1TA 1T91A 4MKZA 3KAQA 4IVPA 4DRXB 1NLYA 4F5EA 1I4EB 4EZBA 1MD9A 1K98A 2I2XB 2VNJA 4PANA 4R54A 5T5QA 3RRXA 3USCS 4TUYF 2XF2A 2H4XA 2BN4A 2R65A 1YZGA 2X5NA 1W581 1B26A 5B1EA 2ZPUA 1Z47A 3P4YA 1X1QA 3HADA 1VRVA 2CNLA 1JDUA 1PFUA 4JLSA 3KOWA 4R1MA 1YBMA 2B2NA 4UVDA 1WIWA 5LLSA 1WZCA 3RHZA 2X2FA 4U8HA 3FA2A 3MTBA 2V7WA 1RC0A 3LYHA 5EWMB 5CX1B 4EY3A 4YAEA 4FTWA 2BTEA 1GNSA 1UK7A 4Y2HA 4KAXA 3WSTA 5E6UB 5GQSA 2P3SA 4ZJZA 4A7PA 1Y34E 5C7OO 3DM9B 1TT5A 3S5UA 1PNVA 1G8FA 1L5LA 2E1RA 4FHFA 2WP0A 4OBBA 4DB4A 3DYVA 3I05A 1PZXA 2WWGA 5JI2E 1X19A 3CVVA 4I66A 5KREA 2JVKA 3OE7D 1D9ZA 3E2IA 4GX2A 4I5GA 4YLEA 1DDOA 4M98A 4DLVA 3BL6A 5KYWA 5E6SA 4MW5A 5AM4A 3IDOA 3UW1A 1P5FA 4PCUA 3NAQA 1DJQA 3IUJA 3KKLA 5TB5A 3TIGA 3TOXA 1G8YA 4UPVA 1TMGE 3KS9A 2NO0A 4KQGA 1SC9A 5DI3A 1RACA 1TMKA 2WT8A 4EKGA 4H15A 3S81A 3UK7A 2IS4A 1NP6A 3VC1A 3WGYA 4IJQA 4IHQA 2HA7A 2FJPA 4E21A 3OTQA 2D06A 2X5JO 3USES 3C3AA 5J2TB 5LL6P 3KOXA 3N7TA 2YC4C 2FEOA 2XRFA 1UKZA 3PHCA 5BMOA 1X0XA 3O6VA 1BWPA 1YD7A 2WFLB 3O95A 3UEOA 1EK2A 1TM7E 2TYSB 3AZPA 1SD2A 3H5AA 4XTRA 3KEOA 1S2LA 4ENUA 3J81A 2CKDA 2DE0X 1KYIA 2O2DA 3FYDA 1FDOA 1B1AA 2IYPA 4M0KA 1T9DA 3QVGB 5DX8A 2DHRA 1L4MA 4MPDA 1NATA 4PFSA 3RVSA 2WF9A 3DL4A 2E85A 2ZJAA 3PDJA 3PLNA 1CJBA 2V9PA 3H13A 3OMXA 3PD1A 2QBYB 1CUFA 3RVLA 4C7KA 3HB4X 2C61A 1GCAA 2WYOA 2GEDA 3AESB 3FTNA 4PLWA 5I47A 5GAJA 2XMZA 1WXIA 1JFRA 1NXWA 1XLUA 1N75A 3IQXA 4IJMA 2PUDA 2JJ2D