4DIDA

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 42 homolog
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase
total genus 61
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4didA00
1E2FA 2BMJA 4M1SA 5A5GA 2LKCA 3CR7A 1R0ZA 4OQXA 1P9WA 1HA3A 1K5GA 1TU3A 3ONWA 1M34E 3QPUA 3RHFA 3EWSA 5HPYB 1GKUB 3B60A 3SQXA 4PPNA 2HF8A 3QJYA 4WAUA 2ZRJA 2FN4A 2ZR9A 1YVDA 1DO0A 1D2MA 5CYPA 5H1YA 2AR7A 4Q01A 2XZOA 3MMPA 1E1RD 3QKSA 4Q47A 3THOA 2JLRA 4HLQB 1T3HA 4DUGD 2IYLD 5CIWA 4GOJA 5HR5A 1OB2A 2VHCA 3CIOA 1FX0B 3RRMA 3K8YA 3PG5A 4B2PA 2WWYA 4QGAA 5A4JA 2OE2A 4NYMR 1XX6A 2WM9B 4DIDA 2FZLA 1G3IA 2HXSA 4A1FA 3PCRB 5B58C 4P31A 4L15A 3QXJA 2GXQA 4OHXA 2J41A 2EU8A 1I4DD 1JR3E 4TLEA 1G4AE 1G8FA 1Z06A 2RGNC 3NIBA 4TLBA 1AQYA 2JASA 4QXAA 1QDEA 3EIEA 3K0AB 4GBMA 5EP3A 3ZYCA 2QT1A 2D2EA 2ZXUA 1J70A 3BB3A 5JCPA 2ODWA 1ZU4A 1GP2A 1H8ED 5FTMA 2HT1A 4CEJB 4AY2A 4QM6A 5B57C 4IHQA 1ZCAA 1LB1B 4V0NA 3B1XA 5LB2A 3MRSA 2HJGA 1P62B 4EQ6A 1FOEB 1HQYE 3ADKA 1Z6XA 2ZETA 3DPUA 4BFSA 2O0JA 2RKOA 1OH7A 3UANA 4MKIA 4QHYA 3RS3A 2BCGY 2Q9CA 1MT0A 4RFSA 5AK0A 5B64A 2GVZC 2ATVA 1HH4A 1E2GA 2WOOA 1XD9A 4NPHA 5KU1A 2J0VA 4EFMA 3Q7QA 1OLOA 4M1KA 4DJTA 5LPNA 4TTPA 2D3WA 4LJ5A 4NYIR 2F43B 2I3BA 1KKMA 1NG1A 3GEEA 1Q0UA 2CHGA 4PPFA 2BEKA 2JJ1A 2L0XA 4PR0A 2OBLA 5EP2A 3T61A 3TIFA 3TSOA 2IYXA 4AYTA 4M53A 1S1MA 2ZI9A 3L8YA 1IONA 2BJWA 4EPWA 3KB2A 2N46A 2DFLA 4N1AA 3CRMA 2JJ2D 3DZ8A 3TMKA 4NYJQ 5CITA 4MGIR 4MUBA 4DXAA 2WIAA 1J8YF 4ZDJA 2FFHA 5FL7D 4K46A 1WXQA 2QMOA 1FUUA 4AC9A 1IXRC 5CJ2A 4C30A 3TJZA 4AI6A 4NONA 1RJ9A 1IM2A 3J81k 1XU4A 2GJ9A 1G4UR 1ZUNB 4FCTA 2VP2A 4RFVA 4M1OA 3GJ7A 5FBVB 1II9A 3DM9B 1JAIA 2VP9A 4HLDA 2AFIE 1OH5A 1AK2A 2XJ4A 1UKZA 1A82A 2H92A 2VIIA 2CLCX 4KITB 2J3EA 1E2JA 5BN5A 1IJFA 2I1QA 1KY3A 1N6IA 4QGGA 3AF3A 2XXAB 2JIZD 5L3RA 1XEXB 1N25A 3LVQE 4TSFD 2Z6VA 4TL7A 3Q9LA 2CNWA 4MUAA 1XTJA 1N5JA 3IKJA 3AP1A 3CH4B 4N0EA 5IDVA 2PCJA 1Q3TA 3PUVA 4P4UA 5H68A 4GPTA 2CJWA 4GZMA 2FX3A 2GWHA 4YQFA 2A2ZA 2PMKA 1F60A 4PPQA 1M7HA 4GRAA 4OBEA 4BRWA 4CEHB 3AH8A 3THYB 1EX7A 5JHHB 3OIVA 2YV5A 2O52A 5LB4A 4MRRA 4F91B 4P4SA 2QGZA 2D2FA 3NDPA 4DCNA 2V3CC 3T35A 2CHQA 1RZ3A 2HXYA 3BE4A 2VHQA 2QE7A 2O8BA 4POAA 3OAAD 2PZGA 5TVKA 2GJ8A 3NDBB 1IN5A 1ZMXA 3PR1A 2B8WA 2ZSAA 3PUZA 2H16A 3RYTC 3K9GA 1KK3A 1GG2A 1ZM7A 2Q3HA 2TMKA 1ONBA 1Z0KA 3P27A 5AJWA 4Q1AA 4AURA 2ZUDA 5JI2E 3AVWA 4R2IA 3UATA 4C7OA 1ZIOA 1FQKA 3TR5A 1M6NA 1OFIA 1CS4C 1OYWA 2ZU6A 3UK6A 4Y0AA 4A0HA 3I1FA 3MCAA 4R2HA 1KI9A 2HUPA 3RWMB 3ZIAA 3TGPA 2AL7A 5DIFA 5J4HA 5L8VA 5FI1B 1RKBA 4GT1A 4IRUB 3VR3A 2ZEJA 3IIKA 4JLOA 4JBWA 2FFQA 2NZJA 2OEPA 3KJIA 2J7KA 2WOJA 2DWQA 2ZPTX 4P33A 5L3VA 3AF1A 3R7WB 3F0TA 3LW7A 3AVTA 4YMTA 1YZLA 4I1OA 5L3QB 3ZD6A 2GRJA 2VSOA 1E2LA 3IIMA 1EWRA 5JHGB 5EE9A 1AZTA 4HAVA 1S9HA 4DIEA 2R2AA 3AKYA 2XOKA 4PZZA 1VCMA 2OZEA 1HT1E 1E9FA 5TXGA 1GFIA 4JIMA 6Q21A 2BJVA 1NIPA 3MD0A 5EXPA 2GILA 1JAHA 3T15A 4A4DA 3GD7A 4V0KA 1DAFA 3D31A 3AVYA 2FSHA 1G9XA 2YINC 4H1VA 2XX3A 5JEEA 4DDVA 4DSUA 2JLYA 3LO5A 4JBYA 4KYUA 5FPKA 3QKUA 3M0EA 3QKRA 4BLPA 1E9RA 4LOAA 2HF9A 3TVTA 4HLUC 1OW3B 4ZPXA 5HTKA 2AWOA 3EPJA 2MSDB 2EYUA 2V1XA 3I62A 1E2DA 1GAJA 2ORWA 1WF3A 2GEUA 1EGAA 2ZJ2A 1CKEA 1JPJA 2ZI4A 2VF8A 3ND8A 4PAMA 3A4LA 4L9SA 2GETA 1AM4D 3OESA 3VKHA 2CLSA 1Z83A 2RB4A 1SVKA 1H8HD 5FI0B 1E96A 3BAFA 3L2OB 4EFLA 4B3DA 2D4HA 4O3MA 2WJHA 1NVVQ 4TT3D 1XEWX 1ZVQA 2KE5A 2WIBA 2VA8A 4PC3A 5D3MB 4AG5A 4GZLA 1T5LA 3EZ9A 1LS1A 1G7TA 1NMYA 4EJSA 4HB2A 1OXSC 2G0NA 4NCKA 4AK9A 2VHJA 1YJ5A 3K09C 4KO8A 2VBCA 3T1TA 1JEDA 1XJCA 2V7QA 1KMHB 3TBKA 5JS8A 2ZRNA 4XWKA 1E9CA 5AUNB 2OHFA 3TAHA 4MRSA 1DE0A 2Q0HA 3VX4A 4KHZA 4MKFA 3CRQA 1U9IA 3SBDA 4URVR 1G3RA 4QOSA 4HAWA 5JJIA 3AEZA 1DAMA 1QHHA 1RFLA 3CRVA 3EAQA 2FJUA 2ZE8A 1OPXA 2YWGA 4MKHA 5C1BA 2ZRIA 4V0OA 1S3GA 3VNVA 3GJ0A 1U0JA 5DLQC 3B9QA 4LHVA 3BFXA 2NPIA 2C5LA 1L4UA 2GZHA 2G0TA 2PMDA 3R8CA 2EFGA 1I2DA 1GZSA 1CIPA 1VHLA 1NJGA 4A15A 1HUQA 5JFGA 1NBME 1FZQA 2IA5A 1Q1BA 4LRWA 3K0CC 5SZJA 1GSIA 1LFDB 5FPYA 3IEVA 4YMWA 5P21A 2FZ4A 421PA 3ZDQA 2ZS8A 2QAJA 3QG5A 4KSCA 3Q7PA 4P3YA 2QL6A 2ZE6A 1ZAKA 2GCNA 2XJ9A 4CVNA 2ZRGA 3LBHA 3WYFA 3EZ7A 1KNXA 1ZNWA 4PHTA 3OF5A 221PA 2GA8A 3U5ZB 1GM5A 4WA7A 3B82A 4XVRA 3U2QA 1NN1A 1ZNZA 3H2YA 4URUR 1CR4A 2BBOA 3V4FA 3GLGB 3TR0A 3B7GA 1QRAA 4M1WA 4TTRA 5FBWB 1Z2AA 4BZPA 1LS6A 3IDQA 1DAEA 1GVNB 1VHTA 3X1ZA 4KYIB 2QMUA 4S35A 3ZGXA 1XCPA 1JJVA 4C0SA 1E1QD 1EX6A 2V55B 1FNMA 1G7RA 1SVWA 4HAZA 2HCJB 1NN0A 4NL4H 2VYFA 1G5RA 2H7VA 2Z4SA 1G8HA 5F2EA 2WMNB 2BMDA 3OE7A 1VIAA 4IDPA 1N5KA 4LV6A 4M4SA 4WIAA 4RZ3A 4Z8YA 5L3SB 3X2SA 2IYSA 4PQRA 4F4IA 2XB2A 4QG7A 2QP9X 1ANKA 4LSGA 3FMPB 4M1MA 4MH0R 4G5SA 1NLYA 3AP2A 4RSGA 3PEUA 1KI8A 4LZZA 1YR6A 2W0SA 5EXXA 3KJEA 3EPKA 1Z2CA 2WKRA 3ZVMA 1GKYA 2K5UA 5EP4A 4BLRA 4Q66C 1HV8A 1MKYA 1V43A 2O8CA 2NO6A 3ZZUA 1GWNA 1Z28A 5JECA 1OIVA 1BOFA 2A7QA 3NTUA 4HB0A 3G0HA 2LCFA 1AS3A 1S9DA 1ZM2A 3HYRA 3V00A 1VDZA 1KI2A 1Z6GA 2OM2A 4AKGA 1ZBDA 3KFVA 4M1TA 3IBYA 2ZAOA 4NTZA 3NBYC 3OEHD 4Q21A 1FTSA 2C77A 4XJXA 1JNYA 4NBSA 3X1YA 3W6OA 4AKEA 3DKVA 1G8PA 4V0ME 1MR3F 1E79D 2FPKA 1II8A 1QZXA 3GEHA 2VTKA 4D4KA 4NKRA 1DAHA 4U7DA 5JCZA 3EPHA 3K9HA 2IS2A 1NSTA 3AUXA 3B85A 2Q3MA 5C4GB 1KDTA 3U3JA 5CM9C 3MSXA 1NMZA 2N1BA 3H86A 4LJ7A 1T0HB 4B76A 4EPTA 1OHHA 2GDJA 3NVAA 1KK2A 1L4YA 1IN7A 1R10A 2ZRCA 4JT2A 4LV5B 4RD1A 1XNJA 1Q20A 3DOEA 3KXIA 1HT2E 3PITA 4PZLA 2WPDA 2OAQ1 3F8TA 2H5EA 4QBIA 4XVQA 1W0JD 3O8DA 4UXHA 2IF2A 3HR8A 3AF2A 2PT5A 2H8KA 4J0QA 3SZRA 121PA 1S4QA 4W9MC 4Q7KA 3REFA 2IEYA 3P32A 1ZRHA 3OEEA 2P0EA 1W5SA 5DSZA 4DLVA 1Q1ZA 1CRPA 1YE8A 5EZ5A 1OKKA 3ADDA 2W6ID 4DBLC 3KJHA 5TY0A 4BLSA 1E0KA 3GJXC 4MYTA 1G3UA 4LBVA 2ZAMA 1SXJA 4H1UA 4UJ5A 5SZHB 2NIPA 3B6EA 3QE0A 1S3SA 5SZKB 3B13B 3GLFA 5B30A 3HR7A 3NBXX 1XZPA 3ZVRA 4DCSA 4B34A 3W5JA 3OFND 3LWNA 5J4YA 1E2EA 1M2OB 5KDOA 1W4AA 3KTAA 3FFAA 4FW9A 1XMSA 4PHFA 5HE8A 4FWIB 3TUZC 1Z0AA 5CM8B 2A5FA 2VSFA 2HYDA 5KSYA 2Q6TA 3GLHB 1ZC3A 3PV0A 2QBYB 2A5GA 3I32A 5GVRA 1R0WA 1TADA 3P20A 2QSYA 2CCJA 5IK2A 4F4JA 1RRFA 5HKKA 1Y3AA 4GNKA 3T34A 3ICEA 3WXMA 4I1VA 1M1YE 1W0KA 3CM0A 3RC3A 3GLIA 4B3CA 4OI0A 1HE1C 1Z0FA 3BOSA 5JEDA 3TH5A 4DSNA 1XD2B 1OB5A 1AN0A 3O8BA 1MH1A 3JZMA 4B47A 4BEJA 2WTUA 4JLBA 1P2SA 2ZIAA 2C8VA 1JQJC 3B2EA 2SHKA 3N2IA 4A0GA 5F9HA 3H84A 3BXZA 4TL8A 3TKLA 2ZRFA 5JI3E 2RCNA 3MJRA 3SR0A 2CE2X 1US8B 1GNQA 4G5QA 5JSZA 4ZI2A 3S1AA 2GEDA 3DMNA 1AQUA 3A8TA 3CO5A 4OQNA 3ICQB 1BMFA 1KI6A 3HU1A 4D2IA 1GILA 5BWMA 4X8HA 1JR3A 2F1RA 3SBEA 3RABA 2KBFA 3RS4A 4ARZA 3DVLA 2W0MA 3QBVA 3KUCA 4DT1B 2J59A 1YRAA 2O8DA 5GJCA 3OHMA 4Q9JA 2A5JA 2F9LA 5AUPB 2X8AA 5G40A 3SFZA 1JB1A 3ZZ0A 1W46A 1E69A 4EIWA 4YONB 2J7PD 1CR0A 5DI3A 1XTSA 5EE0A 1XD8A 3EZFA 4MDFA 4D6PA 1OIXA 4O25A 4PO9A 1ZCBA 1UBFA 2YWEA 3GJ5A 3PEWA 4Q19A 2QRNA 4D4JA 3BBPA 5JJKA 2ZRDA 4UNSA 3AM1A 1GL6A 4TMVA 2DWPA 5CYOA 4Q7LA 4XVUA 5HZKA 4TYQA 5FOUA 1KMQA 1FP7A 4US1R 4OK3A 3IPYA 4LCBA 3QPVA 4CYMA 4NCHA 1MABA 2BCJQ 2QN6A 4Q02A 1NVXQ 3CRW1 2IXGA 5C46F 2QAGA 1XP8A 2RGAA 4LJ4A 1XEFA 1E32A 4E09A 1HY3A 2AXPA 1ZD8A 4CEIA 3M4YA 2O8EA 3LAWA 1MO6A 1SQ5A 1WBDA 5BYKA 4RD0A 1LW7A 2IYQA 1KDOA 1Z29A 3H0KA 2JLUA 3DO6A 4LUCA 4C2TA 4BZQA 4IDHA 1NN3A 4OQMA 4C0KA 5TV2A 2CLDX 1YU9A 3SN6A 5BXQC 2JA1A 4U00A 4JSYA 2GAOA 5UKDA 1ZM4A 1U8ZA 1I4TD 3P1JA 5C2JB 4LYJA 4RVCA 4PC2A 1HTWA 1UDWA 3Q5DA 1U90A 4KLZA 4NH0A 5DE3A 3GEIA 1X86B 3QKSB 2XSZD 1EFUA 2DY1A 4LPSA 4EPVA 2R62A 2IT1A 3BFKA 2QGNA 4GOKA 1E9BA 2G3YA 1BIFA 1CJVC 1GNRA 4FMCF 2ZSFA 4IEIA 2RGCA 5IRCD 2QM7A 4Z8XA 2PX3A 2JAQA 4JKYA 3NBZC 4KVGA 5DYIA 1N0UA 2IUTA 3BD9A 5GADl 2EWWA 1KTVA 2AD1A 3RRYA 2F3TA 2IF0A 3GLHE 3EPLA 3CR8A 3PXGA 3QSYA 4W5WA 2ZITA 3CW2A 2HYIC 1UJ2A 3SEAA 1KHTA 3NC1C 2ZI7A 1E94E 1U0LA 4P4TA 3TSWA 1OFHA 1NRJB 3BWDD 4JVSB 2ZE5A 4ACAA 4NE2A 3AVVA 4M9XA 1ZP6A 1R5BA 2V6JA 4HAXA 3FDIA 3KXKA 1DAIA 4TLCA 1AJEA 4NYIQ 2D06A 1P2TA 3B1WA 2PX0A 4JLNA 2LWIA 4EQ6B 5F3WB 4UJ3A 1J8MF 3QXSA 1II0A 5DGXA 2XNDD 3B1YA 2WSMA 4BECA 4D4LA 4RFSB 3BK7A 2VP0A 1RPZA 2B21A 2AFHE 5C18A 2QQEA 4FCVA 1D5CA 2PL3A 2QT0A 1FP6A 2AXNA 1KAGA 3W5IA 1SZPA 2F3RA 1T8TA 2XGJA 5FBRB 3EG5A 3F3YA 1FX0A 4IOJA 1Q44A 2QG6A 3EC1A 4CDGA 1ELOA 1KK0A 1YZGA 2FOLA 3ETLA 3RS7A 2C04A 1CU1A 5KPJA 2ZRLA 2GVDC 4URWR 2ZJAA 5TARA 5KYKA 4B3BA 3CH5A 4Q03A 3EZ6A 4Z1MD 3EX7C 4FMBB 4HZUA 4DB2A 3BC1A 1N5IA 1QBKC 3CRRA 5K8LA 1G5PA 4A92A 2GCOA 2JATA 4IVPA 4HLCA 1G7CA 3W34A 4TMXA 4IW3B 4CEJA 1RJ9B 4CF7A 5FOTA 3K9LA 4P0TA 2I1VB 3U3RA 3W3AA 3VR2A 4C0BA 1TAGA 5KSZA 1NY6A 2BMEA 2AN9A 1FUKA 3L0IB 1E6CA 4YXWA 1G41A 3TW8B 4NHOA 4QRHA 3WMGA 2C98A 2GAAA 4MRVA 2F1HA 2JDID 4ZCIA 4YDHB 2EW1A 2X19A 2KJQA 4MYCA 1H65A 3SJBA 3U60B 4KXFB 1ZUHA 5JMTA 4Q1FA 4TMZA 4NU0A 3RSOA 2BKUA 1CULC 3U4QA 2QTHA 1TUIA 3CUEF 1H8HA 1E2KA 4AYWA 3AGQA 2CJWB 1DBSA 4JZKA 4LBYA 2CCGA 4LHZA 3K0FA 4HUQA 2W2XA 2OILA 1W4RA 1P5ZB 3FKSA 2ZYUX 2ZI5A 5E7IA 4D82A 1KGDA 4FN5A 4F92B 4AG6A 1X8LA 1N6PA 5EUQB 2W6JD 4S2EA 2IYTA 3QPWA 5KPDA 1R4AA 2ANBA 4FXPA 4TWZA 4P4SB 1W49A 2OESA 3WBKA 3VU9B 2A5DA 1QHIA 4D0NA 4UQOA 4ERNA 3WMFA 2R6DA 2ZYTX 1G7SA 4OHYA 1QVAA 2VF7A 2Y8EA 2YC4C 4QL3A 5J40A 2O8BB 2ZRBA 2QU8A 2FF7A 3K0SA 4PFSA 2IW3A 4NYJR 4C3ZA 3FTQA 1BO6A 1EFRD 1XJQA 2PT7A 4C0HA 4PHHA 5A0FA 1KO1A 2P6NA 5J4LA 1N3BA 3B1ZA 4ZV4A 3KQLA 3PUYA 2AX4A 1ESNA 4Q9IA 4D81A 4IDQA 2I4IA 3O8CA 4JKIA 4C7OB 4PSKA 1XF9A 2CE7A 4B44A 4LDJA 5DNYB 4TZ6A 1X8JA 3LX5A 3OIYA 3A1WA 4LY6A 3C41J 2QENA 2V9PA 1UFQA 2WJGA 3IIJA 3DOFA 5FPSA 5GJWC 4DSTA 4Y0VA 2R9VA 4DLTA 4LYHA 4EPXA 2GZDA 1SULA 1TL7C 2C78A 2OLKA 2W2VA 4MQBA 5FR2A 2QM8A 3I5XA 2OBNA 3QEJA 2RGBA 5G3ZA 3SOPA 1FPMA 5AJYA 4DDTA 2GBLA 3RLFA 1R0YA 2QUZA 4Z54A 4ESHA 1VCOA 3IO3A 1DELA 1F2UA 3KKOA 4QHTA 4Q4AA 1NBMA 4RJLA 4NMMA 1QVRA 3Q3JB 5AR1A 2FPMA 3E70C 3BRWD 2CMKA 1K6MA 2C9OA 5AUQA 3CF2A 3KX2A 4LGMA 2CK3A 2YHSA 3X1WA 4KFTA 2ZROA 1TU4A 2GK7A 2ZS9A 3FKQA 1NY5A 2G9NA 1KY2A 4QFMA 3CWQA 3WHLA 2HCBA 4GOXA 4ZIRA 2D7DA 1TEVA 4L5BA 4U5XA 5CB8A 3A37A 3QKRB 2PEYA 5G53C 1XMJA 4ZI3A 3UPUA 3MWJA 821PA 1EFTA 3VX3A 3TRFA 3RANA 2QNRA 4D80A 3UMRA 2NG1A 3U44A 3ND9A 4LHWA 4OL0A 1LTQA 2BBWA 1C1YA 4YMUA 2ZRKA 1P60A 3BH6A 2V54A 4B71A 5J47A 3B5JA 4L4UA 1R6BX 3SFVA 1UDXA 5FUVA 4EUNA 4EJSC 2IXFA 2ZRHA 2VPPA 1A2KC 3E5HA 1J99A 2J1LA 1G64A 1UKVY 2JJ1D 2QROA 2R8RA 2WVJA 3C16C 3MWKA 1OFTA 4DLUA 4KFSA 1CF4A 3C15C 4PC7A 5BW8A 5JJLA 1F6BA 4JLKA 1WRBA 3R9WA 1K8RA 1U9IC 1XBTA 4CT5A 4JLDA 1DPFA 4B6FA 2G1KA 3W8RA 1RIFA 3O47A 2LKDA 2QP3A 1HYQA 2X2EA 2ZS7A 4M21A 2ANCA 4EJSB 1JALA 4Q1DA 1PV4A 5EJEA 3C5HA 4F4CA 1FMLA 5KUTA 3A1TA 1M74A 4HAYA 2H1LA 2WV9A 1E99A 3FWYA 5CIQA 1GRNA 4DHEA 4N0DA 2V8OA 2YWHA 1WDTA 1DO2A 2Q3FA 1G291 5FOWA 1EFCA 2Z5FA 2CBZA 1QHHB 4KSBA 3U61B 2ZANA 5CLLA 4LHXA 2REXB 1VYVA 2GESA 1CJKC 1MRNA 2C9CA 4DWJA 2KB0A 3QF7A 1GRRA 3QIAA 2ZRAA 2KI5A 2FSIA 3LNCA 1W2GA 4FMDF 4Q4HB 5E7JA 3SYKA 1W2HA 2GCPA 5K8TA 1IQPA 1NKSA 4LPKA 5HZHA 4V0MA 2CNWD 4YDSA 1E9EA 4D4MA 5LD2B 4IOKA 2Q21A 3MFYA 4BE7B 3WNDA 721PA 3T1OA 1RRPA 5JZVA 4RZXA 1FFHA 4C9BA 1K5DA 2BDTA 5JWHA 1RC8A 1SHKA 1RW4A 1T4GA 2VO1A 5EP1A 2IYWA 3Q85A 4JS0A 2YOHA 2NZ8A 4M9SA 4PXAA 3U3MA 4CW7A 4A2QA 3Q5EA 4HI0E 1W36C 2VLIA 1VKJA 1W4BA 3UWKA 1P72A 2OCBA 2DHRA 4WXRA 1SGWA 2VHTA 5EXSA 4MRPA 2Z4RA 4BPBA 1ETUA 3RS2A 2R6AA 3EA5A 2WKQA 4A36A 3CPJB 3KQKA 3VR6A 3RC8A 1Z0IA 5M04A 1NVVR 1P4SA 2QE7D 2IWHA 4O2LA 2NO0A 1W36B 4AKIA 2GHIA 4RD2A 1V5WA 3K09A 2IYYA 4D0GA 5DISB 2WSSA 3W8NA 1VCNA 4ASUA 2BBSA 2ZR7A 1MOZA 4LJ8A 4UXJA 4B48A 4C0QC 3L43A 1E4VA 3FMOB 2WWFA 4QBGB 1VECA 1P9RA 3NKVA 4PHGA 1GDDA 2G77B 1EXMA 2CL6X 2QMEA 3V9PA 3ZIAD 2W83A 3ZQJA 2J45A 3K53A 2XTNA 1COWA 5IT5A 3TLXA 4DCUA 3TAUA 3DHWC 3BFVA 3UG6A 2B7BA 3NHBA 2ZM5A 2A5YB 1CJTC 4KCGA 3IQWA 3QOFA 4CIDA 1XXHB 1S8FA 3C4JA 2O8CB 1MRSA 1TF2A 1KSFX 1ZINA 3TVDA 4BWYA 4EDHA 4B3XA 5JBQA 2FV8A 2XOKD 2IWRA 2F6RA 3CNLA 2XNSA 2HV8A 3D6TB 3BH0A 3A4NA 4EKDA 3FE2A 1Q1EA 1J2JA 4OQFA 1YR7A 1A5TA 2ZSBA 3VR4A 1N6OA 3JVUA 2ODEA 4Q5IA 1KZ7B 2F55A 1P7CA 2ZJOA 2PLRA 3DM5A 3TW4A 3VFDA 1KJYA 1N6NA 4V0LA 1W48A 3VTKA 2OBMA 3WHKA 1CR1A 1Q21A 4JVNA 2PBRA 3QQ5A 1Z0JA 2C99A 1II8B 2DCUA 2GF0A 2J9RA 2FEMA 3WBJA 3PENA 1YHNA 1U94A 4O0MA 5L3SA 1C4OA 2BIFA 4HB4A 5IHPA 4TQAA 3T12A 1E9SA 4F93B 4DKXA 3SC3A 2XEXA 4BLQA 4XSHA 1N0VC 2YWFA 4Q9KA 4TYYA 2OFOA 1JQLB 1G6HA 1XZQA 3FHCB 1NN5A 1PLKA 2O8FA 1PLLA 4C0AC 4D26A 2FE4A 3TQCA 4I81A 2V6IA 1CJMA 1SXJC 1B23P 1SKYB 2A30A 1MO4A 4K8OA 5AJVB 3GFPA 4QGFA 4JLPA 3HP1A 3KJGA 2NPFA 1W47A 1E9DA 1T8UA 4IOLA 3VAAA 3IHWA 2QQ0A 4IEEA 5EE3A 4B73A 1SKQA 2AKAB 1T3SA 2V7QD 2XTMA 3X1DA 2V1UA 1CLUA 3PFIA 4FCWA 1SXJB 2RAPA 4JYCA 1XTRA 4EPRA 3Q8XB 3CKLA 3CWZA 3N2EA 4FMDB 4HZIA 5DN6A 1XMVA 1OH8A 3PEYA 2J0UA 3EW9A 3GLFB 1ZW6A 2VRWA 2YOFA 1KDPA 2A78A 2OO7A 3NBFA 1ZC4A 3LVRE 1UEIA 3QVUA 3E1SA 1ZNXA 3BORA 1Q22A 2BVNA 1Z07A 5EXTA 3SYNA 4JJKA 2ZJBA 3HPQA 1JI0A 1E2QA 1KSHA 3P26A 4RD4A 4IVQA 3EWAA 1ZM9A 2GJAA 1OXXK 4HSEA 1WA5A 3ZVLA 3KKQA 3MG9A 2HJVA 3GFTA 4CRWB 4NP6A 4XIGS 2HLDA 4RZUA 3FYHA 4MGYR 2GKSA 1G6OA 3WP0A 3IGFA 3KUDA 1GOTA 4PX9A 1TQ6A 3QEOA 4OI1A 4AWXA 4LI0A 3SQWA 1NP6A 3U3KA 1BKDR 4B43A 3CZQA 3HDTA 2G6BA 1XCMA 4C2UA 2YJTD 4KAXA 3GLIB 1WQ1R 1SVOA 5EZ6B 2G1JA 4YMVA 4JLAA 1L7VC 3U7FB 4NCJA 1DG3A 1Q3HA 3GLGE 4A8JA 4PZYA 2QI9C 3U7HB 1GIAA 2RGXA 1XPRA 1E1RA 2CVFA 4JBXA 2QSZA 3C8UA 4M9ZA 4DSOA 5FBLB 4B3GA 2EVWX 4WVFA 4TYWA 4G0NA 4DUGA 3QNUA 1JBKA 4XH9B 3F5FA 2ZRMA 3TK1A 4BFUA 4LX0A 1Z6YA 2OUKA 4JVMA 1W36D 1GUAA 2MSCB 2QPOA 1KO5A 4GMDA 5FL3A 1TQ4A 5JSZB 4Q4LA 4QJ3A 4CZ2A 3QXCA 1XEWY 1Z3IX 1XMIA 2R44A 3S1AB 3FVQA 4DB4A 1GRQA 4CGZA 3CPEA 4BLOA 2PH1A 2J87A 1KI6B 2BBTA 1MO5A 5DHAA 1XRJA 3QF4A 1R8QA 2JJ8A 3EARA 1NL3A 4R9UC 1NG9A 2WWGA 3FHTA 2WAYA 1E0JA 1VG8A 2ZJ5A 3OE7D 3RRZA 2IK8A 4ARZB 1XXHE 1OH6A 2QBYA 1H8EA 2OXCA 4F38A 1OXTA 1G16A 2GEVA 2O8DB 2ZRPA 3AF4A 1CP2A 3GJ4A 2IX3A 2FFBA 4QJ5A 1Z8FA 4JLVA 4PQFA 1VIYA 2QZ4A 4L9WA 2IEZA 3ZD7A 3THXA 2BWJA 2OCYC 5DI3B 4LJYA 5E7MA 4OI4A 4OJQA 4DCTA 1G1MA 4DZZA 1E9AA 3DKPA 4QBFA 4M9QA 5GJVC 4BFWA 3EIHA 1WP9A 4PC6A 4LJ9A 2P6RA 4LBWA 5J5CA 2F9MA 4FIDA 5BN4A 4PPGA 1VG9B 2RGDA 4HDCA 3TUIC 3W90A 4RD6A 5GJBA 2QAGC 5FR1A 3C5CA 4O2RA 1KJZA 2QORA 2NTYC 2QMHA 3GPLA 1RRCA 1P6XA 3O8RA 3LV8A 1ZU5A 3LLUA 4DCVA 4NCIA 4ZKDA 5H70A 1OXUA 4EAQA 1MABB 3A58B 1RVDA 2JJ2A 3L8ZA 2RGGA 3EA0A 2QAGB 3RSLA 4Q1CA 1KI4A 5FL7A 1TPZA 3RNLA 3VR1A 2C95A 3NWJA 4LC0A 4URZR 2A3RA 2WMOB 4W7SA 5D3QA 4BASA 2H17A 4CEIB 2O8EB 4FWTA 1D2NA 2ORVA 2ZREA 3SDZA 3ZH9B 1CTQA 1KI7A 3BERA 4OHZA 5DH9A 1I4LD 4B3FX 3OZXA 1OHHD 3RS5A 2KWIA 5FTKA 3FOZA 1YR8A 3M6AA 1EWQA 1DVRA 2CCKA 1KOFA 1EK0A 4UNRA 3K0EA 3KQUA 3AQ4A 1W1WA 2WPDD 1ZUIA 3LXRA 2JIZA 1Z08A 4QNMA 2X77A 5FBQB 2JLWA 2AK2A 4TSFA 2OT3B 2ZJZA 1SVSA 5JWOA 5KSPA 3R9IA 2YNMA 2DWOA 5AUOB 4PC1A 1KZGB 4US0R 4A9AA 1T3LA 3OEED 4NYMQ 3P4YA 2W6JA 2HDNB 2AK3A 1NVUQ 4LJ6A 1OKKD 4MYUA 4CT4B 2YOGA 3FGNA 1OT3A 1E0AA 3NC0C 4WW0A 1LF5A 4GP7A 4PTLA 1IXZA 1SXJD 2DBYA 1N6KA 1R8SA 3A1VA 3Q72A 2WWHA 3LDAA 3P4XA 1SVMA 1FQJA 5KDLA 3CNNA 4BFYA 2UZIR 4N3NA 1N6HA 2O0HA 4KJZA 2FU5C 3E2IA 1LF0A 5JRZA 2FSFA 4G5RA 1XPOA 3SHFA 1D9XA 4Q4JA 5KNCA 4Q7MB 5C4MA 5JWRA 2OCPA 4PQYA 2ZYVX 1PUJA 3I5YA 4LC1A 3H4MA 3DZDA 3AVQA 5FPHA 1NLFA 1F3OA 2VP4A 4V03A 2IUUA 4DLYA 2EYQA 1F2TA 5E3HA 1X8KA 4FD2A 3OAAA 3CB4A 1NSFA 3THWA 4AKHA 1TX4B 4LJAA 5FOSA 3GLIE 1QF9A 5J4VA 4JT4A 2PZEA 621PA 4RY2A 3GJ6A 1E2IA 1M8PA 1Z47A 2REOA 4OI2A 4URYR 4TYNA 4HAUA 4E03A 2D62A 2R6FA 2EFCB 1JPNA 3G5UA 1BYUA 4YMSA 5FUWA 5IK2D 3GCGA 3ADCA 1JR6A 4I1SA 4KVAA 1CXZA 3U3OA 4PAQA 1OF1A 2OG2A 5HKKD 1X6VA 5LDDC 3TUJC 1W0KD 2O5VA 3NEJA 4DDUA 2NO7A 3CF6R 5EE5B 2VEDA 4Q9HA 1X1SA 4XD7D 4NCNA 1UBCA 1D2EA 3BJIC 2G83A 4A0RA 1T91A 3AB3A 1G8GA 1KSGA 4MA4A 4JJZA 4A2PA 5TDHA 5CDFE 3EXAA 3CBQA 3LLMA 2CEAA 4HZUB 5FOXA 1OSNA 4A6PA 4P32A 1P2VA 2JGNA 1A1VA 4IOMA 3HU2A 4BEBA 2R65A 2GCOB 1NLZA 4UXIA 1OFUX 1U2RA 3HU3A 3QVVA 2GK6A 2J0QA 3FPAA 3G82C 1NIJA 3AGPA 3SHWA 3RWOA 521PA 4Q18A 1BMFD 1YZUA 1FTNA 3K0AA 1U99A 4XTCS 1JR3D 2OAP1 1TEXA 4TLDA 2XAUA 2OSBA 1AS2A 1DAGA 4BGDA 3QG1A 3C14C 4XWOA 1ZJ6A 4BFTA 3GJ8A 2ZVPX 3IQXA 1HURA 2NQ2C 3I4LA 1BYIA 2D74A 1GITA 3QKTA 1XDBA 3LBNA 3WNBA 4B2IA 4W5HA 1IBRA 2RGNA 3I3SR 3U7GA 1N6RA 2D7CA 1GNPA 3U4QB 5EE1A 1S2MA 2WWIA 1HEIA 2E1RA 4E22A 2FDCA 2FA9A 2AD5A 1WCV1 3NXSA 2IYVA 3K0FB 4HUQB 3NH9A 2Q9BA 1Z63A 2F43A 3K1JA 5KOYA 2ZJYA 4L8GA 4DLZA 3BB1A 1G19A 2R6GA 1U8AA 4M22A 5CK5A 3ZQ6A 4ESVA 2BV3A 5HCIA 3K9NA 3B1VA 1JECA 1Z0DA 4TT3A 2FGKA 3TNFA 4KODA 1O87A 2GJSA 3ASZA 3OIUA 4Q1EA 1Q12A 4I4LA 2QRZA 4G1UC 1OXVA 3SJAA 2WZQA 5B2ZA 4LK2A 3UWOA 3SJCA 1WBBA 2BOVA 1IAQA 1CRQA 4JVLA 1YQTA 3V4RA 2NO1A 3ZZTA 4UNPA 1KIMA 1O3YA 3LD9A 2W58A 5KNBA 4ZO4A 5DO9A 1EG7A 5FUYA 4II7A 3K70C 2WJIA 1KO4A 2ZSEA 3N5CA 4G5GA 2WAXA 1GL9B 4AD8A 2F1IA 1LV7A 1XTIA 3WMEA 3L82B 1X3SA 4ITRC 2A9KA 3KZ1E 1J7KA 5KO2A 2GBLC 1G21E 1Z5ZA 2NO9A 5G41A 2JLQA 2XZPA 2P65A 1ZD9A 2EFHB 2IYUA 3ASYA 3D8BA 3FB4A 1NVWQ 3KKPA 2ZVQX 3VQTA 2XXAA 1Q1QA 1XEXA 2IS6A 2H18A 2RHDA 3AP3A 2W2TA 3IEUA 3K70B 1QG4A 3W6NA 1AKYA 4BQSA 3BH7A 1Y63A 1SVLA 3WNCA 5KHOC 4R71A 2FG5A 2P2LA 3I8XA 5H8WA 5K8IA 4FMCB 1J90A 1DARA 4PANA 4R7ZA 1VPLA 5ANRB 4JLMA 1JXMA 1R0XA 2DFKB 1F2UB 5EQTA 4Q4AB 3VU9A 4GDFA 4B2LA 3RDPA 3QBTA 1PLJA 4CEHA 2BM1A 4A2WA 3THYA 3ZVNA 1W4CA 2AHOA 1FMJA 1TF5A 2P67A 4B32A 3RVBA 4RCYA 1DS6A 3I73A 3SI7A 4TZ0A 2BM0A 3PUXA 4IDNA 1DADA 4JYBA 1T0JB 1A4RA 3GJ3A 2EWVA 4BLTA 1E2MA 3LA6A 4K81B 2G88A 3FMFA 1F48A 2YZ2A 4C0JA 4ZIRB 4TL6A 4DLRA 2OCAA 3NG1A 4BZXA 2ERXA 1NMXA 5DI9A 1B0UA 4QNRA 3QY0A 1AGRA 2ONKA 1NI3A 3ZLJA 1E98A 2UZ3A 1KSJA 1E1QA 4RKEA 1P61B 3U44B 1R5NA 2BC9A 1XTKA 4V02A 1YZQA 1CR2A 1YR9A 2ZU0C 4DDWA 2RMKA 1QG2A 1WMSA 4ZCMA 1PZNA 4W5JA 4L16A 5HCNA 1E0SA 1OV4A 2NGRA 5FTLA 4Q00A 1A2BA 4XTRA 1KYIA 4EFNA 1PJRA 2H57A 3HJNA 3QI2A 2ZTSA 3BGWA 1E2NA 2P3SA 1KJWA 2IYZA 1YKSA 4OJKA 1W7AA 2JLSA 4ZKEA 4G5OA 1UBGA 2WHXA 2DPXA 4LYAA 1XWIA 3R7WA 5L3QA 2KSQA 2QPTA 2BHRA 1TMKA 3VHLB 2JLXA 1TTTA 3KKNA 4B75A 1IN6A 4JLJA 2ZUCA 2F1JA 3QXXA 1E2HA 1T9HA 2GXUA 2QPAA 3CX8A 4ABYA 1TUEA 2C03A 1GKIA 5GVSA 3UKDA 1RRGA 1N5LA 3MLEA 4ZDWA 4YXWD 4U02A 1AA9A 3RAPR 1RE0A 3KFXA 3OEHA 1MV5A 2AKYA 1QHNA 3L0SA 3LXXA 3KB1A 3VKWA 3ADBA 3AKCA 3GP8A 1P75A 4ACBA 1IN4A 3D7MA 3LRPA 1N6LA 3A1SA 4TTQA 2MMGA 1T6NA 5LD2C 1E79A 4MRNA 4TMWA 4NDZA 3FMIA 3UMSA 3PJRA 1R2QA 4YLGA 3M1IA 2XITA 3WY9A 2DFTA 4LHYA 5BYJA 4DLWA 4TYPA 1Q57A 1JEEA 2JEOA 2VQSA 2NMVA 3JZAA 1ODFA 4IFEA 4OYHA 4DVGA 1P73A 3WRYC 2WWXA 3CF0A 4M1YA 2P6UA 3T5DA 5HE9A 3W6PA 1YZNA 4JMPA 2IS4A 2UVQA 3LFUA 3FKSD 2DFNA 3A36A 1UPTA 3I61A 4HLUA 5IF9A 3A6PC 2OLJA 1DTSA 4QM7A 3LY5A 1MO3A 2E9SA 1U98A 1X1RA 1Z22A 5FPTA 4M2LA 5ELXA 1W0JA 4M0LA 4RD3A 2E87A 3R20A 5D3MA 4ZCLA 4PSVA 2PLFA 2EFEB 2ORIA 4Q9LA 3KQNA 2YKGA 2J46A 2QTFA 3VNUA 1HE8B 3JVVA 1KI3A 2J0SA 1KMHA 1W44A 1LVGA 1WE2A 2W6IA 3QUSA 2OFXA 3QENA 3W9YA 1S96A 1ZIPA 3IUYA 2FH5B 1IN8A 2IXEA 2KBEA 5KTYA 2F7SA 3I92A 4IXMA 3H1TA 4Q4HA 1VTKA 4GFDA 4QKQA 2ATXA 3AVUA 3LQQA 4KBFA 1T5IA 1GTVA 4DC9A 4URXR 2X2FA 2B8TA 2P5SA 1AS0A 3WYGA 2ODNA 3QXHA 3AVXA 1DAKA 4UNQA 3N70A 3EASA 3OFNA 2FWRA 4QC2A 5G3YA 3WYAA 1I2MA 2RH5A 3K70D 2CDNA 3FFBA 4PAOA 3PEVA 5AWFC 4WZAE 4DEYA 4BUJA 2V4ZA 2IBMA 1G3MA 1AKEA 4G3XA 4OHWA 4OQLA 2Z83A 8OHMA 3KQHA 3CX6A 2CL7X 3B9PA 4UNNA 3MGCA 5BN3A 1UBEA 1QHGA 1VMAA 1QHSA 4A82A 3D3QA 4TN1A 1M7GA 2BKEA 1NBMD 3GQBA 3OIWA 3W3ZB 2GXSA 2IS1A 3TE6A 3L0OA 3AF0A 4C4PA 2XB4A 3DMDA 4GP6A 2CK3D 4EPYA 5LBIA 2EFDB 4XSGA 5J4KA 3MAAC 1IJEA 1TF7A 3IBGA 1KAOA 2IC5A 1M7BA 3U6BA 4TMKA 3K0CA 1VG1A 2Q9AA 3REGA 3GLGA 4KFRA 1GL7A 5K8UA 1KDRA 1P3JA 3KL4A 3FHOA 1XB2A 3CLVA 3AUYA 3LX8A 4WBSA 3LBIA 2Z0MA 5JRJA 3MUFA 2PCLA 1C9KA 2B92A 1E2PA 1QHYA 3NH6A 1W5TA 1DOAA 4WXPA 4PSAA 4TMTA 2JLZA 3TSZA 2MSEB 3ECCA 5TB5A 3LH5A 4D0LB 4B74A 4MGZR 1VYUA 1CJUC 3T06B 4BFXA 2CL0X 2GXAA 4WOPA 2ZE7A 3CNOA 1FL9A 1E3MA 3VKGA 1CEEA 2FGJA 2GNOA 4IVRA 3UG7A 4ON9A 1UF9A 4QBHA 3AVPA 1UADA 2C2HA 3VR5A 2O8FB 2ERYA 1XXHA 4OK6A 3U6KA 3DEFA 2J7PA 3EC2A 3AKEA 1L8QA 1DG1G 1YRBA 3HWSA 4AIIA 1EESA 2FNAA 2FFAA 4FI3C 5AJZA 4KBGA 1JJ7A 1OJLA 2XZLA 2DB3A 2JCSA 2IUSA 3AKDA 3LQRA 3GFOA 1VYTA 1IY2A 4JL6A 3ZS8A 2B6HA 1TQ2A 3UMFA 1R7RA 2ZUBA 3CPHA 2UKDA 1UAAA 2CHVA 5DYGA 4RZ2A 4MYHA 2FPLA 2ZR0A 1EFHA 1RYFA 4RCZA 2J0UB 3BIFA 1KNQA 2ODBA 1IY1A 1XPUA 5AJXA 2HT6A 4TL9A 2DYKA 3AVOA 3B78A 3L0PA 2P5TB 4LWZA 1P2UA 1N2CE 2QTVB 1G20E 4I1UA 1XCGB 4E5UA 2VHUA 2QA5A 3NEYA 1AGPA 1BS1A 4PO8A 2C9YA 1WB9A 1FW6A 3BB4A 1NNEA 4KFUA 4R98A 4X8MA 2WJJA 5EUMA 5FTNA 4IKEA 4TQUS 1L2TA 4DLSA 4A8JC 2EQBA 1KO8A 1FNNA 2QEQA 3KTAB 2VP6A 5FOVA 1DEKA 4JL8A 2ZYWX 4KLNA 3SYLA 5JS7A 3IHLA 1KI1A 1LNZA 2ECKA 4Q1BA 1ZD1A 1TQDA 3RRNA 3I8SA 3MJHA 4M8NE 5CLQA 3GMTA 3WP1B 1Z6AA 4BRUA 5DHFA 3KKMA 3CONA 2PJRA 1NF3A 2B7CA 4Z51A 4LBZA 2WJYA 4G01B 4AYXA 4A8JB 4E07A 4YC7A 1ZNYA 3I72A 1ESMA 3A4MA 2YVUA 3EIQA 2R6CA 2XSZA 4QGHA 1CBUA 1OIWA 2N42A 2NOAA 4X8OA 1SHZA 1BH2A 1KO7A 2C96A 2CXXA 3SU8A 3DL0A 5CJPA 2DR3A 2YYZA 4X8LA 4JSTA 2QP4A 2IL1A 3HPRA 5JLJA 4HYYA 3T1QA 1KKLA 1R5OA 4KU4A 2ZI3A 2WSSD 4US2R 2XTZA 4ASUD 4KI0A 1IXSB 1JXOA 2VSXA 3QF4B 4HDQB 4H9GA 3EZ2A 3SJZA 2GJKA 1A7JA 1U8YA 3PVSA 1D9ZA 1NJFA 5TMPA 3IO5A 3SS8A 4Q48A 4ZDKA 1COWD 4RKFA 3UXMA 3GLHA 3BS4A 2QY9A 1TNDA 3THXB 1AZSC 4GSYA 1S0UA 1F5NA 4C0LA 1QHXA 1UKEA 5SZIA 4TLAA 1YZKA 2FEOA 2ZJ8A 3B8HA 4JL5A 5E95A 2XNDA 2X1VA 3PQCA 4XD7A 3X1XA 4OHVA 2ASEA 5BQ5A 2WBLC 4HATA 4ILEA 3MWLA 3RS0A 1U0HC 4B35A 4MITA 4MDEA 3PIRA 2O0KA 4KV9A 1XD2A 3ZS9A 4B33A 1XFAA 4BFZA 2GZAA 2REBA 3AV0B 2W00A 2FSGA 3NHAA 3T1VA 1OYYA 4IFBA 2VL7A 4PO1A 2ONJA 2IYRA 4IDOA 1OE0A 1NKTA 4GL2A 3DDCA 2RGEA 3CZPA 4GI7A 4Z1MA 4IJMA 2WJVA 3MWYW 4LYFA 1VG0B 2GTPA 3PUWA 3HYTA 4HDOB 1P9NA 2JLVA 5CDFA 1US8A 4A6XA 2BMFA 4WZBE 2ZQ5A 2PEZA 1XTQA 1IHUA 4MKGA 1G3QA 1KK1A 4HEJA 2YC2C 4DEXA 1E4YA 2AWNA 3LW8A 5KDDA 4B6EA 4XOIA 5F9FA 4DT1A 3U7EB 3VMFA 1LY1A 5FH9A 1SKYE 4XWAA 2VH5R 5CB6A 4F7WA 2OV2A 2JDIA 4D25A 5CK4A 1XJ0A 2GF9A 1UM8A 2ZSDA 1SVIA 2Z43A 2ZI6A 1ZM3A 4A0FA 4Q7JB 4DLXA 4DRZA 3WRXC 2FMXA 4WZ6A 1PUIA 2PJZA 2WKPA 5KSOA 2WICA 4OKSA 1SXJE 2J5XA 4NZYA 1G8YA 2OFWA 4HUTA 1YZTA 4ZDIA 3R8FA 2IHBA 2PZFA 3T5GA 2RHMA 1ZYUA 4UKDA 3GLFE 1HQCA 1Z6TA 4QHSA 3CX7A 1S1CA 3IILA 2BEJA 2HEIA 5DN6D 5FUXA 2WWWA 4FINA 4MGKR 3ZJYA 1AIPA 4HB3A 5F98A 4GMXA 4Q4JB 5KNDA 4QJ4A 3SE0A 3VHXA 3SNHA 3UIEA 1D6JA 1N0WA 3TQFA 1UEJA 1IOZA 4BFVA 4LV8B 1F2TB 1G5TA 4I99A 3C7KA 1U81A 2CVHA 1UKYA 3KXLA 1VCIA 5E4FA 2VP5A 5FFMA 1G17A 1D8TA 2IHYA 3IPXA 3THWB 2MMCA 3KDSE 1EFRA 4TQ9A 5FTJA 4OK5A 1IY0A 2OXRA 3R9XA 2HLDD 1G18A 1PVOA 1RYHA 3A1UA 4IXNA
chains in the Genus database with same CATH superfamily
1E2FA 5HUJA 4M1SA 1XZLA 2XYVA 2LKCA 1BE6A 4OQXA 5FEMA 1P9WA 1PWZA 4HNRA 1FUEA 2XTAA 1HEUA 2O8VA 2BI8A 1VBFA 3AETB 3JYPA 1IIRA 3MELA 4KPFC 1X0XA 1X1BA 1GKUB 1RYNA 3DBRB 4PPNA 4CLRA 2XIJA 4AZWA 4RLQA 5COBA 1CDDA 4TRJA 4EF5A 5K0FA 1O6FA 3EXIA 5H1YA 2AR7A 4Q01A 5DN9A 5BUSA 2VEOA 1U2QA 4RF3A 1JG6A 4NOJA 2R8YA 3MMPA 3RFVA 4Q47A 3RVMA 1JH8A 1WW2A 3SR4A 2Z58A 1I6MA 1MAUA 4UM9D 5BRAA 5C8VA 1WXWA 5TQ2A 4YP6A 1GPUA 2O2XA 2P9ZA 4XB2A 1GZDA 2CVQA 4XGNA 4YCSA 3PYLA 3B7PA 3K8YA 4B2PA 4EMTA 3W5CA 3DTVA 3P9ZA 3ITNA 5A4JA 2OE2A 4N48A 1WDWB 4EJMA 1EG2A 2RAVA 3PJDA 3CR3C 2VUHB 4WECA 1UDRA 4YVFA 1T2UA 2B4YA 2HA4A 3ET5A 3MILA 4ZEWA 2GXQA 1KOLA 4D8XA 2GYWA 4JHLA 4OAOA 5CDHA 3RGGA 3OPVA 1U65A 1G4AE 3MGGA 3HFJA 3NIBA 3OP4A 4TLBA 4Y2VA 3OJWA 3IVMA 5EP3A 3EIEA 3BX1A 3DA8A 1Q0HA 4QBKA 1YRHA 2P9EA 2CFTA 2G5PA 4KX5A 5FTMA 4DOMA 2X0RA 5KJFA 2HHHB 2HT1A 4WPGA 3EYWA 2NV0A 4AY2A 4COKA 4ILKA 5JVDA 4QM6A 1RAFA 3KSZO 3LDFA 5D01A 4KPUB 5LB2A 4AF8A 2UUAB 5CMLA 1U8FO 3K32A 3L5KA 4EQ6A 1ZL0A 1FNDA 3ADKA 5CFQA 5DRTA 4PGFA 2B37A 4BFSA 2RKOA 3COVA 4H7FA 3QNWA 5D86A 4OVKA 1NUHA 5HIMA 1OH7A 1HDEA 4QHYA 1NYQA 2BCGY 1E1DA 4QFBA 3PB3A 4RFSA 4JP8A 4Z99A 4ZV9A 3EXEA 4MARA 2ZYRA 3AERB 2Q3CA 4K2HA 4NPHA 5CLHA 4Z9AA 5L7WA 2J0VA 4MDHA 3C3DA 2YMPA 4DJTA 3KEOA 4TTPA 4KMRA 4I3HA 4NYIR 2I3BA 3TZHA 5ALMA 3GEEA 2QV0A 2X8JA 3U09A 2B4RO 1RADA 4EGJA 2IYXA 4M53A 4H4CA 3GXBA 4K6MA 4I8IA 1NI4A 1NW3A 5E1DA 4EPWA 1VE1A 2KHZA 4CTJA 2IH5A 1DUSA 5B57C 4YRSA 3UK2A 1VGVA 1A9XB 4NYJQ 3TMKA 5BW5A 5CITA 3FCUB 4MGIR 4DXAA 2WIAA 4OCZA 1J5EB 1J8YF 4C08A 3E6AA 3PQ5A 4F96A 2C5GA 1EHCA 2QMOA 4KQXA 1FUUA 2GARA 4LKOA 4NK4A 4C30A 5JQGF 2HB6A 3BAZA 3E8MA 3TJZA 4AI6A 1LI5A 3IP9A 1ULTA 4LDNA 2CEKA 3GG2A 4AKTA 2C4WA 4NBRA 4TM8A 5D5PA 4EYQA 5TIIA 2BTEA 2GJ9A 4ICIA 5AI5A 3O83A 4RFVA 1DRJA 3GJ7A 1SXQA 3DM9B 1R3UA 1JKFA 2P68A 4IV5A 1A4UA 3N2NA 1JAIA 2PT9A 3AB7A 2VP9A 4QTXA 5HS6A 5KZMB 2H92A 2CLCX 1VQ1A 1CEQA 1V11A 1ZGBA 2QD3A 3GG9A 5BN5A 4V2UA 3DLHA 1V8FA 2V7BA 3W04A 4AB1A 4CG1A 2WTBA 3AF3A 1CPYA 5L3RA 3I0NA 4NAVA 4MZXA 3L18A 1N25A 4GR5A 1SUPA 1C7ZA 5I9TA 4HVAA 1QVWA 4YPOA 2QJFA 1WMBA 4I9HA 4K6KA 1YS2X 3RT7A 2ETXA 1LK7A 4O3FA 1D2HA 2IKSA 3VBEA 4UTZA 5BR7A 3IKJA 5HMLA 1G38A 4R68A 3CTMA 4ODIA 2HSGA 1OA1A 2BI4A 3RAEC 1Q3TA 1U3DA 2JGFA 1JW9B 4GPTA 3ZZ1A 4QX6A 1ORTA 1RLMA 4QGBA 3F5MA 4K9NA 4DZTA 2E85A 5IJ9B 5L53A 1XA4A 1KAQA 2P4EA 2QRUA 2IJGX 1QIIA 4OBEA 1PZGA 2HWUA 2EQ5A 3AH8A 2YWBA 1BMQA 3V3TA 1OVMA 5IASA 5DM0A 2OYSA 5JHHB 1CUEA 1SQFA 3IP7A 1A7AA 4MRRA 1RPNA 5D7BA 5LB4A 3Q3VA 4MWBA 1H93A 3G5MA 1VB3A 1SZDA 1GA6A 2JJMA 1IE3A 1AHHA 4GX2A 4ND1A 4V38A 2QTLA 3ICCA 1RQPA 3O26A 4QO7A 4FGJA 4DV4B 2HXYA 1N7GA 1L5RA 5BR8B 3RADC 1V16A 2V7WA 5DTQA 5TVKA 2GJ8A 1IN5A 4FVTA 5DCYA 1WVGA 4UM5A 2MYTA 1KEUA 2FW1A 2FN3A 4K6GA 4F3TA 1DMSA 2Q3HA 1ONBA 1IPEA 3P27A 3W2FA 4G56A 2PGDA 1J2RA 3WGJA 3L46A 3EGEA 5KJ1A 4YCDA 1MORA 3OTWA 4MLDA 1XTZA 3EC7A 3HCDA 4R2IA 4EMSA 2K2QB 1ZIOA 2Z09A 3QLVA 2IGTA 4GEKA 4C7OA 1N36B 4LNHA 2D00A 2HMVA 2QM0A 2C7QA 5EYPA 4EO4A 3UK6A 4A0HA 4HGOA 3O21A 2PVSA 2WIGA 4E6EA 2FKAA 4R2HA 2XOXA 3D6FA 3TGPA 3DQPA 4HGYA 1QE3A 5J4HA 1FFEA 1HDYA 2P0AA 2BEWB 1SVUA 4IRUB 2OGTA 4W5RA 4EEZA 5ALPA 4ZU3A 4WZAA 4CMBA 2NZJA 4NZ9A 4BHTA 2QTWB 1VLZA 2VAWA 3ZZMA 1AKWA 1AOXA 4X93A 3R7WB 5BSFA 1O0CA 3AVTA 1YZLA 4XW2A 3M7IA 2VSOA 1XXLA 5DM2A 1QO0D 2ID9A 3D4IA 3HHEA 1LLDA 3OUTA 4MQFB 3TM4A 4DNXA 2LTAA 3OCWA 3UH0A 3YASA 4QAQA 3AY3A 1FFSA 3G7UA 2Y4OA 3HKBB 1KBZA 4HAVA 4UDYX 4DIEA 3RTCA 5K3EA 3EIWA 3NHSA 4Y2GA 1FP4B 2UUBB 2R2AA 3L7AA 1M6YA 5TXGA 4BO7A 4JIMA 2QIOA 4CQMB 3FNQA 4KQFA 3C6BA 3TTUA 5DTMA 1YV9A 5EXPA 3C3MA 1UJ5A 4U5QA 1AHIA 1UC4B 3H6KA 4MV6A 1JAHA 4DTIA 1G8SA 4KAAA 3GD7A 2YXLA 4G07A 2OFPA 2ZBGA 4KZKA 1R6UA 4JBYA 4BJ3A 3SVZA 3R4VA 2A0UA 1SKUA 2BZ0A 2W4MA 3M0EA 3QKRA 3UT0A 1E9RA 4BLPA 5FPKA 2N1MA 4LOAA 2OYRA 1LC3A 1LZLA 4JCOA 2V9CA 4RUKA 4TZKA 1J5PA 1N4AA 4FEGA 3EPJA 4BU1A 5IAEA 1YGYA 1A71A 2EYUA 2V1XA 4MCHA 1MAHA 2JVKA 2RI6A 4FHZA 2ORWA 1F51E 1FSZA 3PGKA 1WF3A 4Z7NB 2GEUA 1BNCA 1R0KA 2ZI4A 2VF8A 1QFSA 3OETA 5FFFA 4UTRA 1N77A 1MFPA 3A4LA 3H0CA 4I6GA 1JPUA 5TLSA 3G2KA 3RR2A 1UK7A 3HXKA 3UAOA 3WG9A 4CETA 1EJBA 3NDJA 4X6LA 4X92A 4CDMA 2G63A 4B40A 2CLSA 1SA0B 1Z83A 4QU9A 2HREA 3BILA 4QDTA 1ISIA 4B3DA 1ZJYA 4KG7A 5LMCA 1XA3A 1Z15A 3JTMA 3OCJA 5JDCC 2KE5A 3DKIA 3Q11A 4Z7JA 2VA8A 1JRLA 4H2DA 4AG5A 2OCXA 1L8AA 1XAJA 3OF2A 1LS1A 3V4OA 1NMYA 3VZCA 1RDFA 1YJBA 2O3RA 3W5SA 4FGSA 2G0NA 1T9BA 2J5KA 4FP9A 4AK9A 5JQGA 5M5BA 1JT2A 1YJ5A 3K09C 5CH8A 2DJ5A 4X3CA 3PQDA 1KMHB 3AM3A 3IEXA 3JY6A 4XWKA 3EAGA 1HSOA 4Q7EA 3MAGA 5K8CA 5KNBD 2J6BA 2JRLA 4ENPA 5HKAA 5GGXA 3CRQA 4OKNA 1UPUA 1G3RA 4HN4B 4RLHA 2RH9B 3TO5A 1QHHA 2FJUA 2I7XA 2ZE8A 2M32A 3MWDB 4YGYA 5FLKA 3CEPB 4D8WA 5KTNA 4HBGA 3X43A 3AUKA 4DR4B 2QPLA 3ZGLA 1S3GA 4WA8A 1KKUA 3ELDA 3FNIA 4J0EA 3P8ZA 3PQ3A 1U0JA 4KGZA 4JP5A 2ZTMA 3G5AA 3KSUA 3Q98A 4X84A 2QRJA 1XLWA 4LHVA 5DLQC 5EFZA 1Q7CA 1N2CA 2XY4A 3U49A 2V9ZA 2Q1XA 3R8CA 2H2GA 1I2DA 2YVQA 1SCJA 3PNYA 1NBME 1LV8A 2IA5A 3KEFA 1Q1BA 5LQNA 2P6MA 5H9WA 5K3FA 2C57A 4CQNA 1ZJJA 3KSMA 3MF4A 4P83A 3IEVA 1NR5A 3P9PA 4FOLA 3T1YB 2BH2A 1IVYA 421PA 2ZS8A 2QAJA 5MFZA 3K6SB 4P3YA 2HTFA 1BE1A 4Q3OA 3KOZA 1ZAKA 1U1EA 3LBHA 2TSYB 2FCRA 4LF8B 3V3KA 1KNXA 2NYAA 4G85A 2SCUB 2UZ0A 2PDAA 1GM5A 1Z2EA 4WA7A 3MOSA 2ABWA 3DBHB 4D3FA 1R0CA 5CT9A 1YDMA 5KCMA 4QLOA 3TR0A 3HS3A 2CJXA 7YASA 5A4IS 3FLAA 1QRAA 4OO3A 3NYIA 1WCIB 2IEBA 2FN8A 2Q4BA 5FBWB 3FWPA 1NFFA 1RWQA 1IK4A 1LS6A 1WHSA 3UTDA 1DAEA 1GVNB 2WF8A 5DGHA 4BZPA 3AY6A 3OZIA 4KYIB 5I9SA 2QMUA 4HWKA 4EHHA 2DTDA 2LV8A 1JJVA 2X9GA 3AU8A 4K40A 3STTA 5HYVA 2JIBA 5JPDA 2G1AA 1U0FA 2Y68A 1UWLA 3O3NB 1V1RA 3LCMA 4FX5A 4JP3A 1NVKA 4NL4H 4BGVA 1MNAA 1YJ8A 3AI3A 2BMDA 1ND5A 3BIOA 1SQ0A 2W2LA 1N9ZA 1N5KA 2VDVE 3KJFA 4EY6A 3O6VA 1I7DA 4Q6BA 1UM9B 5JH7B 5L3SB 1H9CA 5EIOA 3X2SA 4X66B 4JJGA 5DGDA 4PQRA 4Q34A 5JY6A 4RTMA 2OP0A 2D8AA 3TEJA 3GFBA 3UAVA 4F4IA 1ANKA 3RSGA 3FMPB 4M1MA 3FUXA 1X13A 4MH0R 4XIFA 3KOYA 3DLAA 3N6XA 2YVAA 4HCJA 3T7JA 1K9SA 4HG2A 3BE8A 3DGEC 1HTTA 4LMPA 5EXXA 5HBGA 1PGOA 3MHPA 1S4MA 2AW5A 2AFVA 1B6TA 2B1RA 3GFFA 4XYBA 4EL0A 3D5TA 3IAXA 2NO6A 4NECA 1Z28A 2NZYA 4YAFA 4HJXA 4LXIA 3BE6A 5JSKA 3K71B 3G0HA 2G7ZA 4RPLA 2JPDA 3PDIA 2WKWA 4RENA 3O3MB 3GIWA 1C7QA 1H9BA 3OLZA 1VDZA 1UR5A 3G2IA 4UM8B 1F8GA 1XMOB 1QRRA 1Z6GA 1FUYB 2FSSA 2OM2A 1ZBDA 2W6ZA 3KFVA 4M1TA 3IBYA 1LRKA 1XRNA 2IV7A 5ADHA 5FLEX 1FTSA 4TLLB 3SC2B 2C77A 1NOKA 3L02A 3P0JA 3TS1A 4EG6A 3X1YA 2Z6AA 2DERA 3W6OA 2XE4A 1G8PA 1P5RA 1XNGA 4UPDA 5I3ZA 3ZKAA 4D5EA 1MIOB 1ZMOA 2IPAB 3QLUA 4MQ4A 2BUAA 2ZFUA 4EYKA 3GGGA 3BMNB 4IEFB 1HL7A 2WTEA 5ERXA 4RBNA 4B0OA 4G37A 2WF5A 1CP3A 4ZQCB 3L77A 4IHJF 4AUEA 1FRFS 3AUXA 3KU4A 4WZBA 1DIOB 2FUNB 1KDTA 5DHQA 3EAFA 2HBQA 3A3YA 1L5MA 1TDJA 5BV7A 4L0MA 4W5NA 1G0OA 3ZKWA 1VIVA 4B76A 2EX4A 1OHHA 1DL5A 2DVMA 2R3SA 3ORYA 1KK2A 4RANA 1KEKA 4O6VA 1R10A 1JDTA 3CQ9A 1UIMA 1P0FA 3DOEA 5TRTA 1HT2E 1NTRA 3IL2A 2DWCA 1I2BA 1M1ZA 4QBIA 4XVQA 1KL7A 1XP5A 3IHKA 3OA0A 5JDIA 5FO1A 3ZU3A 1YAJA 1QZ3A 5C8XA 1F14A 5A4KA 1ZIDA 2ZM6B 3AF2A 5BN1A 2H8KA 4J0QA 1H2ZA 1CRZA 3DLTA 2EJVA 4LVUA 5DHSA 3DHYA 3C8HA 3C5WP 4KO3S 3D6MA 1U0NA 2O2CA 1IZ9A 1RLUA 5CCXA 1W6RA 1IY8A 3N2LA 2G09A 1W5SA 2QYHA 4DLVA 4G1MB 4NSNA 4DZRA 3FOEC 3DKKA 4MI6A 1H94A 5D3KA 4AY3A 3V6LA 3KJHA 4BLSA 1JYFA 2XE8A 1TAUA 3S7TA 1YBHA 4A7PA 2ZAMA 4INOA 3TMYA 1POWA 4Q1VA 5KYTA 3UJ8A 3VNQA 2ZJ0A 3AJDA 2EWMA 4XDYA 5SZKB 5MN6A 5TGZA 3DEYX 3OTGA 2ATEA 2WD7B 5B30A 2KLHA 4OB8A 4WNYA 4W9MC 1Q2XA 4P3PA 2HV9A 1N8KA 2HRQA 2JGEA 2FR1A 3N0XA 5DM1A 1AXGA 1L1QA 3OFND 3WGQA 1E2EA 2IDJA 1CUDA 2PRKA 5KDOA 1CEYA 2A84A 3LTNC 2G71A 3TRKA 1XMSA 2HRZA 2C2WA 4PHFA 1KDVA 4LQCA 1GUFA 3G13A 4AZTA 3UM9A 4OSOA 3PPWA 3GNSA 3QBDA 1J8QA 1T2EA 2OMKA 5JCOC 2Q6TA 2IU6A 4PFKA 3A6LA 4FS8A 4A26A 3PV0A 1IB6A 3HYLA 1P91A 1ZRSA 3TDMA 2QBYB 4D3SA 1JMVA 2FG7C 5GVRA 5JPCA 1Z75A 2EHDA 3ND5A 4A2CA 3ZGZA 1ICIA 2PD3A 3GLSA 1YTUA 5ADVA 2QSYA 2CCJA 5IK2A 1ABEA 2IXAA 4D02A 3OX2A 4U2EA 1E66A 2WTXA 8LDHA 2BYTA 1M76A 1U4OA 3ICEA 1CUJA 3WXMA 3RC3A 4DCPA 3CM0A 4W82A 4OI0A 1Z0FA 4Y2YA 2ACKA 5G1PA 4DSNA 4DGQA 2FQQA 5TJHA 5F7XA 4B47A 4B79A 3HJGA 5GGYA 4L95C 3BA1A 4LYYA 5DOZA 1T3TA 3O8NA 1DO8A 1GQRA 1UIRA 3TKLA 1U28C 2ZRFA 1EVZA 4G8JA 3G7SA 3H5OA 5I7AA 5TJ9A 2CZQA 4N40A 5LYJB 2C54A 1UMBA 2CE2X 3ANXA 1J1ZA 3ONDA 5FJIA 5THQA 2PJUA 1CF2O 3KVYA 4ZI2A 4BRSA 5HTOA 2J6CA 4FHCA 4YUXA 5C7IO 1FMCA 1AQUA 3UBTA 3CO5A 1XL0A 4OQNA 1Z3CA 3JWIA 3ICQB 3IPRA 2I6UA 3AG6A 4D2IA 4D56A 1T15A 4OHRA 2I7CA 3EVNA 5IS2A 1H4SA 2FLVA 1ISPA 3SBEA 5JG7A 3DVLA 1RBZA 4FYKA 3FNHA 4MYDA 2PNJA 5GJCA 1WUJS 2JB9A 5AUPB 5SY9A 5JOQA 3E84A 3LWZA 1QUFA 3KWMA 3OX3A 4ZT2A 3SFZA 5D6OA 1E69A 3F67A 3LOQA 1KMCA 4J0FA 1DRVA 1KP9A 3UV7A 3OTOB 1S8AA 2J7PD 1JH9A 1KYVA 4WINA 1PL0A 1SCNE 3KQOA 5HS4A 1N1EA 5EE0A 1XD8A 4B09A 4MDFA 1SC1A 1VGQA 4G81A 5IKMA 1ZK4A 1TW3A 3BXXA 4FQ8A 4O25A 1MQ8B 1ZCBA 3AEUB 5IX8A 2AF3C 1EJ2A 3PEWA 2XW6A 1QANA 4MJXA 1H2YA 3L8DA 2W37A 4NOKA 4UNSA 2J4CA 1PR9A 3LLSA 2WF9A 2VNAA 4OBBA 3V8QA 2XUIA 2P9BA 3D0KA 4Q3EA 1AMUA 1GL6A 5BV2P 5CHYA 2JVIA 2W4IA 2RHLA 3L7CA 3SR3A 4QD3A 5FOUA 4C6SA 4N8SA 1KMQA 1FQOA 1FP7A 3ZCSA 3MS7A 1U7TA 3ABZA 2BFWA 1TQ8A 4GPBA 1AUOA 1MD9A 2QN6A 2BCJQ 4E12A 4O4JF 2DLDA 1NVXQ 2XUPA 4CKWA 4RMGA 3VHXB 4BNDA 4BS9A 4D46A 5K09A 1GLNA 5C46F 3ANMA 3QA3E 4AZ0B 1PGJA 1FDVA 2O4UX 4XIYA 5DX1A 3RYFB 4FT2A 2AXPA 1H5UA 1MJFA 4CEIA 3M4YA 3BCRA 1MO6A 3OT5A 4UDOA 1ZD3A 2HA2A 3BXGA 4C87A 5MN4A 3MJEA 1K8XB 1NNI1 5ECDA 1P8AA 2VWHA 1LW7A 4RORA 5CFZA 1DINA 2Z5VA 1Z29A 1TB4A 2JLUA 3DO6A 2HD4A 4JLWA 1KJ8A 4IDHA 3RUFA 1M2KA 3JVIA 1BCRA 5TV2A 3K1TA 1JR2A 1YU9A 3S68A 1PWYE 3SN6A 2XUGA 4U00A 2RDMA 4JSYA 3WAGA 1I4EB 1JDSA 3G2PA 4IMRA 1T1JA 4R3UC 4QFDA 2VH2A 4LYJA 4BUCA 5EIXA 3EB9A 1UDWA 1U90A 5JV5A 2IQ5A 4M0UA 2FZWA 2YWDA 5CU7A 3PHIA 3QKSB 4W5QA 1M33A 1EFUA 2XSZD 4FLFA 3QMVA 4Q4DA 1JT9A 5FULA 3UBMA 2IT1A 1U1IA 1B0ZA 2CW5A 2QGNA 4GOKA 4R2XA 4CG2A 4CUKA 1GNRA 5JAHA 5JZMA 4FMCF 5U9CA 1JEAA 2ZQYA 2MSLA 4IEIA 4LQLA 2C9DA 3NBZC 1LLQA 1ECLA 4OFWA 1ENOA 1SUCA 3D0QA 1YBVA 4KVGA 4RSRA 5DYIA 2IUTA 2P5YA 4MS3A 4YJFB 5JCXA 3K1AA 2ZYHA 2FXIA 2QVXX 3IOEA 1KTVA 1NDQA 4NNJA 3M34A 2QN2A 2WAOA 1QZTA 3EWNA 2IH2A 1O89A 2FMHA 3ZWAA 4BNYA 1UBOS 3F6EX 4TKVB 3CR8A 1YR2A 2B8JA 5JPIA 3UKJA 1J56A 1BKYA 2H1CA 4PZAA 4E2WA 2IYOA 2VZEA 3QA9A 4BUZA 1KZ9A 4RTOA 2Z57A 3AJ8A 2QLTA 4ACAA 1HFKA 4UEOA 2ZE5A 2OUIA 5IU6A 5JAUA 4BMPB 4UHFA 4GLBA 1SOVA 1X42A 2CHUA 3D8UA 2FEWB 3RD5A 5L4LA 1NHGA 4CM4A 2YX1A 3EXFB 1VLVA 3AETA 2PX0A 4Y9RA 3DZFA 4I55F 5DCLA 1GTMA 4K28A 1C1XB 3VSEA 1YOVA 2I1WA 1PR3A 2H2HA 5DGXA 4H1TA 3QEMB 1OC2A 3RB8A 5ULLA 3BK7A 3CZRA 4M0FA 3CN9A 2UYGA 2HU2A 4M0PA 2LCQA 3OJOA 2AFHE 5T5QA 1FLDA 3ES9A 2QQEA 2ZPAA 2PL3A 4RNCA 4B46A 3W5IA 3RG2A 1T8TA 2XGJA 5FBRB 3KYBA 1CIVA 1MOSA 2J3MA 3B12A 4LSZA 5DULA 5TSDA 1RMYA 3EC1A 1P6QA 1NC1A 3HA2A 4EECA 4QPNA 1HE4A 2FOLA 1CRWG 4R5MA 4DLAA 1VJCA 3QLEA 2IP4A 2V58A 1J5XA 2GVDC 4C4RA 2GEKA 4ER3A 2CXRA 5TARA 3ZE7A 1KU6A 5KYKA 4AQ7A 3P9NA 3EX7C 4FMBB 1ODTC 3GBVA 4GX0A 4ARBA 2YZMA 4DB2A 4TXLA 1N5IA 4ROSA 4FYXA 3DC2A 1A76A 1KBOA 4HN9A 1A5BB 5T57A 3EGXB 3LT1A 4A92A 4DBLC 3GEDA 2QUIA 1P18A 1CB7A 4HLCA 1G7CA 3JD1A 3W34A 1MC1A 1KEVA 1XQ6A 3Q9SA 1RJ9B 5EHGA 4HQLA 3K9LA 3BSYA 1F6DA 1V1JA 3O2SB 3QX8A 4JVOA 1EB9A 3U3RA 4X44A 1XKTA 4C0BA 1NJ6A 3W2EA 3EF3A 5AVKA 4IDFA 4B5KA 1TAGA 4FFBA 4BBAA 4INJA 5KMGB 2AN9A 1M2VA 2Y0BA 3TW8B 1G41A 2ENWA 5CX1A 2OGWA 3E61A 4NJMB 3CLSD 3ZGOA 3FZNA 1YO6A 2GAAA 4MRVA 4ZCIA 1QFZA 2PGIA 1Y8ZA 1MJGM 2X19A 2KJQA 3OM9A 5GQSA 3ACBA 1B26A 2GSDA 3AERA 3GUZA 3IE2A 3TX6A 4HQKA 4C5BA 3F4LA 4RH1A 5JMTA 5KYGA 2EKQA 3ZZNA 3RQIA 2PWYA 4PYNA 4U6QA 1RZRA 3AJAA 4N3AA 4BKQA 3D64A 1MXHA 5KX5A 2PYZA 3CUEF 4OJTA 1U7HA 4EP1A 4J0CA 1W9MA 3FCOA 1Z7GA 4QPZA 3BF8A 3VU3A 2Q28A 3L6CA 1DBSA 3BMXA 4LBYA 2CCGA 2QVYX 1INLA 4PGAA 3U7QA 3K15A 4QU5A 4OGFA 4MIOA 4MWGA 5FJJA 3KOXA 3RRBA 4G1CA 3FBTA 4R54A 1AO0A 4N6GA 3SYTA 1V1MB 3KEQA 2J3HA 1C0EA 2VQ3A 4AG6A 3W7AA 1N6PA 1UL1X 3CC8A 4FKMA 4LRYA 3A9SA 2I29A 1I0ZA 1K7CA 1Y98A 3N86A 3O8QA 3QPWA 3ZCTA 5KPDA 1W49A 3WBKA 2C5SA 3L4BA 2BGTA 4ER7A 1XALA 4WCFB 4I1YA 4ERNA 3IVRA 1G8JA 4U2KA 3KKLA 1NXSA 2OD7A 3QLVC 1G7SA 4CT0A 3GCWA 1WL8A 4WY2A 1XLVA 1P4JA 3ABIA 2VF7A 2Y8EA 1G0NA 2YC4C 5K3DA 4CM9A 1ABBA 2FF7A 3H5NA 4PFSA 4Y2TA 4DE5A 2C0CA 4MUEA 3W4KA 4DQLA 1QKJA 3KXDA 1W25A 3EUEA 5AK6A 4C0HA 1GZVA 4WBNB 4UBIA 2PX5A 3LUCA 3OQBA 3QVKA 3KQLA 4MKRA 1DLJA 1FJ2A 1GR0A 4OMCA 3G1WA 4RIIA 5F3RA 4D81A 3ON5A 3CXUA 3O8CA 5CBKA 1C29B 2C9BA 5DBGA 3K8ZA 3ZVKA 1T8RA 1PG2A 3K5WA 4TZ6A 3OIYA 1VHWA 2B1GA 3EQ9A 3LUGA 2CF6A 4OFXA 3C41J 3R5JA 2QENA 1Q0RA 4LY3A 1QYXA 3ROPA 1B76A 3DOFA 5I7RA 2A1UB 3H16A 1BX1A 3I1JA 4Y0VA 3C3CA 4BMSA 1SY7A 1J8FA 2GZDA 5AVJA 4QPJC 3ZNPA 2QM8A 1EFPB 2RGBA 4JU8A 5GWXA 5TQVA 4CI9A 1O57A 3IAAA 2FPPB 4JI2B 3PNQA 8MHTA 3WLAA 2RHOA 5AJYA 4DDTA 3PJGA 2QUZA 5ALXA 3P96A 4YGXB 3NALA 5BNIA 2VJDA 2R7LA 2J6IA 1AKTA 3KKOA 3O31A 4MPDA 1MW9X 4OOFA 4QHTA 1EGMB 3ITDA 2WUFA 5AR1A 1L4MA 2IUYA 2AG0A 4F46A 1K6MA 3CF2A 1M6VA 1CE8B 3KX2A 2CK3A 4C1BA 1YZVA 4X95A 4ZWNA 5FHRA 2I8LA 3ADOA 1HI9A 1PFQA 1T1SA 2IIQA 3FKQA 1NY5A 1ZOIA 2FMUA 2QTAA 2V45A 1CQZA 3C3BA 3KZCA 2G9NA 3A6GA 2R0QC 2YYSA 4Z53A 1RFGE 3CWQA 3V46A 2VCEA 3WHLA 3VDNB 3DV0B 4DNPA 2A33A 4GOXA 3MIIA 3M6LA 2RBKA 4RY8A 5CJJA 2ZP1A 5DYWA 1KH2A 3UPDA 3SQMA 3I0MA 1JG3A 3NHWA 5DXFA 1CLEA 1EE2A 2SICE 4I55A 2PUFA 1Y6ZA 2JH8A 1EFTA 2B5VA 3PWTA 5H5JA 3TRFA 5FEUA 5LMUB 2ST1A 3UMRA 3ND9A 4LHWA 4OL0A 4R8KA 2BBWA 4DQVA 3UOGA 2JK1A 3JQRA 2V54A 4RY0A 5J47A 1R6BX 4PN3A 1K86A 1OPRA 4QYWA 5ICGA 1JZSA 4HNAB 2ZYDA 3PBKA 4B8ZA 3TLCA 4PO3X 1G64A 2AQHA 1N9GB 4OQLA 4AZ3B 4MQFA 5KQMA 3GK3A 4ND4A 4PYRA 2H65A 3EN0A 1M66A 3KT6A 5FLYA 5JJLA 3TLJA 1RVV1 1TUBA 1WRBA 3FA2A 1EU1A 2L69A 3DHVA 1K8RA 1OZGA 3MFQA 3ZE0B 3E9ZA 4JLDA 5KQPA 3CSDA 5IYZA 1PKEA 2UYCA 3W8RA 3I2KA 1EQUA 2VAXA 2ZT7A 1YQQA 3OU7A 4MVJE 2OXEA 1HYQA 2C7OA 5ILOA 3HCBA 1IIBA 1EEXB 2YW9A 2W6NA 2DUWA 3C5HA 4RMJA 2DULA 4C88A 3NFRA 1R9JA 2WV9A 4B6SA 4CQLA 1ZA2A 1JQDA 4DHEA 1QP7A 1NNLA 4N0DA 4X85A 2V8OA 2YWHA 3N3AC 4V39A 2Y1LA 2BMVA 1I7LA 1E5QA 4JBHA 5A3VA 1LK0A 5FOWA 4Z6KA 1NF9A 2BW0A 4KSBA 1BJRE 1RXIA 3JWEA 1SOUA 3M6MD 3P2JA 4KR0A 2QRMA 2ZANA 3PDCA 4PG8A 5C1IA 3P71T 1U9ZA 1MRNA 5E1MA 2C9CA 4DWJA 3QF7A 2ZRAA 2PU5A 2FSIA 2DHEA 2HA0A 3MLBA 1F8UA 4LF9B 1QKKA 4K9DA 1NKSA 1G2PA 3JATA 5J3JA 1EUYA 2XH8A 1I94B 4X1IB 4YDSA 3ROXA 5KTTA 1E9EA 4D4MA 1QB7A 3W1WA 5LD2B 4QRIA 2Q21A 3BTUA 2A7XA 1KETA 4R9NA 4IXTA 3WNDA 3F9CA 5FORA 5JZVA 4EUKA 3OLYA 3L7MA 4GBJA 5AW8A 2GN4A 1DBQA 1K5DA 3ZI0A 1RC8A 2PU7A 1RW4A 3B1FA 1TGYA 2IYWA 3RGWS 3P9SA 2YOHA 4JS0A 2Z08A 3D5EA 4PXAA 5TR9A 4CW7A 4K3VA 3B9RA 5TQJA 1CJSA 2GZSA 1D7OA 4F71A 2VLIA 1YACA 1WSAA 3VPHA 3P0IA 2ZJFA 2GTIA 5A4AA 3NHPA 3E0XA 4WXRA 1SGWA 3DE6X 1M6HA 1QWSA 3E22B 3OJEA 2P2GA 1Y3BE 1FFAA 2P62A 3C24A 1F3LA 3JYOA 3RS2A 4ZYZA 3LGAA 3WQSB 3TSCA 2WKQA 4AJJA 5ALGA 4YAEA 4G0WA 1NVVR 1B8UA 1OB5A 2AF4C 2IWHA 4R31A 1EVIA 1FFXB 3LI2A 3HGMA 4OQ4A 5C8YA 1ZOSA 2Z2ZA 3OQNA 3GPBA 2HBRA 2IYYA 2ZAYA 1N8SA 2PR2A 1YT5A 1R74A 5DISB 3PX7A 2RG1A 2WSSA 5E3JA 4UMEA 4G0XA 4KR2A 3T5MA 1T0PA 2AZXA 2QTMA 1MOZA 3ZE6A 1GYRA 4HQRA 2AMJA 1BWRA 2FOXA 4RIGA 4AULA 3L43A 4QBGB 1VECA 1DHRA 1Y9AA 2YXNA 4R9VA 1V9LA 4E7PA 2PV0A 1TA9A 1PJAA 3C8MA 2G77B 3HSYA 2CL6X 3LMKA 2MOKA 2GUWA 2W83A 5EHIA 3OSUA 2H8GA 4N6NA 2PNFA 5F1YA 3K53A 3PQEA 3SAJA 2HJHA 1COWA 5IT5A 1EJ0A 5AK3A 3SC4A 2HMUA 5DK4A 1EFVB 1OBFO 2G7MC 2JNWA 2KMLA 3RG8A 2ONZA 1B0PA 4BNLA 5CCBA 3AV3A 1JIXA 1V35A 4JGGA 4RQBA 1L7AA 3N8IA 2FMFA 1HLPA 1Y5IA 1TFUA 3ZHRA 3RUCA 4CCYB 4QZVA 1XXHB 3CV3A 2ZWOA 3N8KA 2ZBPA 3C4JA 4LE1A 4MV0A 4R7GA 1MRSA 1NV9A 1TF2A 4DXHA 2JGJA 4LNUA 4ZO8A 4E5YA 1Z36A 1B2LA 1VLLA 2PUTA 5JMOA 3GARA 5JBQA 1FX1A 4K03A 2FV8A 2VZLA 2XOKD 1ML3A 1YOBA 2CFOA 3CNLA 4M8IA 3D6TB 5BOVA 3V32A 2DEUA 3BH0A 4EKDA 1GQYA 4UM7A 3V6MA 3O1LA 1V4NA 3TTYA 4O4IB 2O05A 3VR4A 4CMIA 4J7AA 3UPUA 4Q5IA 1QCZA 5HM6A 2F55A 2FYTA 2IODA 1KJQA 1P7CA 1DKMA 1YIAA 3WZ2A 1UPCA 1ZRMA 4QU0A 1GZ6A 2PUDA 3VTKA 2AUNA 3H9JA 4DARA 3QVLA 4NZMA 2AIRA 5EQDA 4YMHA 3KG2A 4Z9FA 3ZX5A 4AIRA 1V95A 1F9EA 4MW9A 3PVCA 1OMOA 3RLIA 1UM9A 3PENA 3BTOA 3QI7A 5L3SA 1XSEA 3GVXA 3P2YA 3DULA 5JDIC 1CUBA 2UUOA 2NTNA 3T3MB 1E9SA 1XVIA 3H5VA 2H5LA 4FU0A 4F93B 1V4VA 3A7EA 4IM7A 2JFYA 1PZXA 1QK5A 2AGVA 1BQ3A 3A70A 5FUBA 4KE7A 3KYCB 2JFXA 4F1JA 1AF4A 3C6ZA 3G9TA 1FDUA 2FLKA 1GARA 3UZUA 2NSJA 3NONA 1UFRA 3CZ5A 4LDRA 1PLKA 2O8FA 2G76A 3DV9A 5HF5A 3HO6A 4QULA 3RC9A 4D26A 1P1CA 3FCAA 3F6CA 1Y5NA 3LKBA 5J2UF 2WKSA 1NW7A 1PEYA 1SKYB 1U3FA 1MO4A 2A30A 1FE8A 4JC0A 4QEZA 4WSOA 2XB8A 1QQ6A 4QGFA 2F8TA 3LKZA 3HP1A 2NPFA 1Y5RA 1FTQA 1QC5B 1E9DA 5ABPA 4QUHA 1CJCA 1OROA 4EY4A 2ES4A 2QQ0A 3IHWA 4IEEA 1WNFA 5G1NA 1C1DB 1U8TA 2CYAA 1AY0A 3JQ8B 1F1BA 4JFAA 4F9TA 1JVNA 1PRYA 3VPCA 2C2OA 3D6NB 3X1DA 1Q0PA 4B5LA 4UTPA 1AO3A 3EGDA 3R6DA 3UXHA 4N0PA 5DWVA 1OAAA 1SXJB 4HXYA 4X7MA 2RAPA 2Z9CA 3GUVA 3OOJA 4EPRA 2WUWE 4CIBA 1JXAA 2GPAA 1IUPA 4FW8A 4MPTA 5DKFA 4D44A 1OH8A 3EW9A 5IC6A 2VRWA 5G1OA 2I3AA 2YOFA 5I8WA 3P2IA 3LFTA 3NIWA 4JT8A 4I5FA 1F8XA 4KPYA 4QELA 1MU0A 1ZNXA 3I05A 4QYXA 4XRRA 5BSEA 2DT5A 2F4NA 1J0DA 1UKAA 1DWQA 3SYNA 3R4CA 3I1IA 1NONA 3H8JA 1PGNA 4IVQA 1CDEA 2JRCA 1H5QA 1KS2A 4JGBA 1V5GA 4FQ7A 4HF7A 3ONVA 3FVTA 1RKQA 3KKQA 3R0XA 4RPCA 4Y6SA 1AX9A 1K4MA 1WSWA 3FNRA 3R3ZA 4KVFA 4KXVA 2II6A 5BUZA 3N2GB 1P80A 2FLWA 4IZHA 2IPMA 4RA6B 4TTSA 3WP0A 3KUDA 2WDZA 1OWOA 1W8IA 2AZ4A 2YV1A 4PX9A 5AHRA 3QEOA 3GZNB 3I62A 4AWXA 3UJ6A 1TJYA 3KOWA 4LI0A 3TYXA 4YT4A 1V45E 1MPXA 5DW3A 4OA8A 2CMFA 1QTIA 4C2UA 4KAXA 3GLIB 2NXJA 5FT9A 3WFZA 3K30A 2BEVA 2EL7A 2NAFA 2Y6UA 4MLZA 1L7VC 3WTCA 1N2OA 1HNXB 3U7HB 5F4BA 3GH1A 1E1RA 5FXMA 1SUFA 1T5SA 2CVFA 3OCXA 1VE6A 4B3GA 3CYFA 1ZL2A