4DIDA

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase
molecule keywords Cell division control protein 42 homolog
total genus 61
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4didA00
4JYBA 5L8VA 2QY9A 3RYTC 3WP0A 1T8UA 4A9AA 4ACAA 1VYVA 3ADKA 4E5UA 3KQNA 2QSZA 4B32A 1U90A 4QBHA 1XCMA 2KBFA 3MGCA 4CEIA 1SXJE 3ZYCA 1ZNZA 4FMBB 5CLQA 2QM8A 4URYR 3SDZA 4F7WA 3EASA 4YMTA 4IXNA 1AS3A 2PZEA 1CS4C 1IHUA 3LBNA 5LB4A 3QE0A 2CJWA 1JB1A 3L0PA 3PEYA 1LVGA 5A4JA 2WAYA 4HB3A 4AKEA 4DLVA 4JLKA 2JAQA 5J4LA 2FH5B 2MSEB 4GOXA 4Q19A 1IONA 3QPWA 2OCAA 3K0AA 4JLVA 3IIKA 3P32A 4NE2A 2QNRA 2V55B 4TSFD 4WAUA 4GMXA 4Q9JA 2ZPTX 2QENA 4Q1AA 1GKYA 3QKTA 4LRWA 5B30A 1GNQA 3GP8A 4W5JA 1W46A 2IBMA 3EPJA 3CZPA 3GCGA 3Q5DA 2J5XA 3WMFA 4LC1A 1DE0A 4Q18A 1R0XA 3SZRA 2ECKA 4IOLA 1EFRA 3NBZC 4L5BA 1P2UA 1MH1A 1EFTA 2CNWA 4N0DA 4NP6A 1TX4B 2R6CA 3RS7A 4AK9A 1Z6TA 4K46A 3QENA 1OIVA 1G7SA 1XJQA 3PCRB 1XPUA 3WNBA 2WMNB 4FMDF 3KTAA 4I1OA 5EZ6B 2F43B 2XJ4A 5EE5B 1G291 4EPVA 4HLDA 1P61B 4GNKA 4B75A 4PAMA 2ZROA 1S1CA 3D3QA 3CH5A 2DWOA 5HKKA 2ZE7A 4F4CA 2PMKA 2BBWA 2GF9A 3RC3A 2VHQA 4PTLA 3E2IA 5KHOC 1RPZA 1OFIA 1JPJA 1LW7A 5C46F 3SHFA 1G3MA 2BEJA 4HLUA 5FPHA 3TR5A 4C0AC 3O8CA 5DYIA 4BASA 4LJAA 4S2EA 1VG9B 1DELA 1SVWA 4FMCF 5LD2B 4LHZA 3U7GA 1VMAA 3B5JA 4WZAE 5DLQC 1U0HC 4OQLA 4D25A 1R7RA 3FGNA 3IO3A 3AVVA 3I62A 5DO9A 1U9IA 5EP2A 2OAQ1 2BCJQ 2GNOA 1NL3A 3PUWA 4E22A 3SN6A 4HB4A 3VR5A 1GKUB 2HJVA 3RWOA 1TF5A 2FE4A 1AQUA 4Q47A 2N42A 5EE9A 2PX0A 5JZVA 4ZI2A 1A1VA 1CF4A 4R9UC 2X2FA 3EZ9A 2LWIA 4LV8B 2O8FA 1MV5A 2IYVA 4LV5B 1WBBA 3G0HA 1ODFA 3OESA 5DN6A 4B3BA 2ZE8A 4PAOA 4QC2A 2YWEA 2Q21A 3C15C 3BE4A 4A6XA 4BFVA 2C8VA 4ZDWA 1RYFA 2ZQ5A 5KSPA 3TW4A 3EPLA 3MWLA 5FL7A 1N6KA 3RANA 1II9A 3TSWA 4DLXA 3CF6R 3ZQJA 2ZI3A 1NLYA 2FF7A 4NCNA 1GTVA 2W00A 4XVQA 3A58B 5KNCA 3F5FA 1SGWA 2QTHA 3OFNA 2ZJ2A 3W8NA 4DIEA 1ZD8A 1VYTA 1Y63A 1R10A 1U81A 1J8MF 2DWPA 4C4PA 3TUIC 4TTQA 2WIAA 1RRFA 3RS4A 1U98A 1G5RA 1U8ZA 3EZ7A 4AC9A 2ODWA 3TGPA 2C9YA 3FKQA 3AGQA 1M8PA 4RJLA 2H57A 4YONB 1R5BA 3GEHA 1YRAA 3TLXA 2IS6A 3DMNA 2ZJOA 1LS1A 1F60A 2Z4SA 2ZJBA 4LSGA 4KVGA 1SQ5A 3U3KA 4ZIRB 5KSZA 4PR0A 3TBKA 3D7MA 1H65A 1UBEA 3P20A 1Q0UA 2QPAA 1DAGA 2W0MA 4J0QA 4MA4A 3ZD7A 4YMWA 1O87A 4OI4A 4HUQB 3Q72A 3W5JA 2ORVA 1G20E 4KU4A 4YC7A 1E0AA 1NSFA 4TLBA 3NHBA 2I1QA 4A2PA 1PLJA 1E4YA 3SJAA 4EFMA 2QAGB 1F6BA 2F1JA 1SULA 5J4HA 3IEUA 4CYMA 2IX3A 2DFNA 2F55A 1DAKA 4ZDKA 1WXQA 2CK3D 2R6GA 2W2XA 5DNYB 1TQ2A 4QM6A 2ZI5A 1DAFA 2WOJA 1R6BX 1UBGA 2NO1A 4G3XA 4DBLC 1Q44A 4JVMA 1EXMA 5AJZA 3RSOA 1XMJA 4UQOA 2QAGA 3M4YA 4B35A 1OH5A 1GITA 2HT6A 1WCV1 4B3FX 1KSFX 1OFTA 3AUXA 3AF1A 2ORIA 2FSHA 1Z0IA 2ZRAA 3PR1A 3WXMA 4AYXA 3REFA 4GT1A 4GP6A 3CBQA 1JQJC 1WP9A 1OKKD 3P27A 1Z07A 4IEIA 4CIDA 1G8GA 2OXRA 4PHGA 4GP7A 1YZNA 3GLFE 3L2OB 2UZ3A 4JSTA 2QBYB 1X8KA 5KPDA 3FTQA 1YZQA 2JDID 1ANKA 2ZYUX 1RW4A 2A5GA 1W2HA 4D0GA 1Z0KA 1OXUA 4AKHA 1NVWQ 4M9QA 2GA8A 3THYB 4MGYR 1ZNXA 2PLRA 1D8TA 2CHQA 3K0FB 3AB3A 1X1SA 1YRBA 3KTAB 4JLMA 1VG1A 1NLFA 2VYFA 3AF4A 3U3RA 3VR4A 1CJVC 3A36A 4CRWB 1Z0FA 3U61B 4Q1CA 2ZIAA 3EIQA 4P4TA 4EPTA 3NBXX 2AD1A 2B92A 4PFSA 3EARA 3QG1A 4BZQA 2HYDA 4XSGA 1XZPA 4Y0VA 5DI3A 1AS2A 4PSKA 4DRZA 1GFIA 4OHYA 4XIGS 1SVKA 3QKSB 4U7DA 2B8WA 1IY2A 2EYQA 1W5SA 1XD2B 4CZ2A 2EW1A 5KU1A 2XB2A 1NBMA 1G64A 1XWIA 2WWIA 1W0JA 4DCVA 1VCOA 4M1MA 2V1XA 1JECA 3QF4A 5EUQB 1KNQA 2Q9AA 4KHZA 4EPWA 3UWKA 1CJUC 1JJ7A 4Z8XA 3CNLA 4A8JB 1FPMA 4KCGA 3F0TA 2F9LA 3FDIA 1XCGB 4Z8YA 4JLDA 3SJZA 4GPTA 1UDXA 3QXJA 3ETLA 3K53A 2JJ8A 2IT1A 3BK7A 4KODA 3ZS8A 5HR5A 4HUTA 3EWAA 3MWJA 4TL9A 4D0LB 3D31A 1CJKC 1S0UA 1KDOA 2GHIA 4L15A 3NH9A 1IM2A 5JWOA 1G19A 2NGRA 4JYCA 2P3SA 3ADBA 3UATA 2ZRKA 2H18A 4DZZA 4Q7JB 2GCNA 4TLAA 1IAQA 5AUNB 3WHLA 1SVSA 1VDZA 3BFKA 1A4RA 1XPRA 3BH0A 1QBKC 2ZI6A 1UEJA 1SZPA 2AKYA 3CF0A 2DYKA 2OBMA 1NNEA 4MQBA 4OHZA 1D9XA 2VHUA 5JMTA 4M2LA 2QMUA 5FTMA 1HQYE 5TARA 2PZFA 5K8IA 1SHZA 3THXB 4F4IA 1Z6GA 3PVSA 4IFEA 2W83A 5JBQA 1E9DA 4RZ2A 2OBLA 1NVXQ 4KBFA 4RD2A 4ZKEA 2O8DB 2LCFA 2E87A 3BXZA 2GVDC 3CZQA 3U4QB 3QY0A 4TT3A 4BFWA 2H92A 2W6ID 2XGJA 1CRQA 1P60A 2YHSA 2CMKA 2D06A 4Q9LA 1VG8A 3DPUA 3OEEA 4D0NA 2WSSA 4BFTA 4QGGA 4QGHA 4D80A 3BB1A 2BCGY 2J41A 3BWDD 4NYMR 1GL9B 2IS4A 4ZPXA 5H1YA 1XU4A 2ZR7A 1Z0JA 2O8EA 1E0SA 3PV0A 3QXHA 3OIUA 1XRJA 4HLUC 1RJ9B 3Q7PA 4YDHB 2VQSA 2ZRPA 3LD9A 3NC1C 3OIVA 4X8HA 4KJZA 5KPJA 3QBTA 3IBYA 3CPJB 1JEEA 4K81B 3B85A 1GNRA 4LWZA 2P0EA 4MGKR 2FZLA 4PZYA 4LZZA 4HATA 4UXIA 2GXSA 2YJTD 3MWKA 2QRNA 5JEDA 4HB2A 4NBSA 4DUGA 1TU4A 2TMKA 3W5IA 1GKIA 1UKVY 4IHQA 2GBLC 4ESVA 2ZRNA 4KO8A 3RS5A 4A1FA 3U7HB 5EE0A 3LVQE 4B48A 4DCSA 1Y3AA 2H1LA 1G8PA 4JT4A 1NN1A 1ZM7A 5JHHB 3ZH9B 2QP9X 3CRRA 3KQHA 5FOWA 2DPXA 3TUJC 1LTQA 4A2QA 1OSNA 4I1SA 1N5KA 3RS3A 4YMVA 5JSZA 3L82B 4MYHA 4RD6A 3CONA 3KQUA 2O8CB 4XTCS 1EFHA 2HLDD 3B9QA 4POAA 2WHXA 2IL1A 1AN0A 1S4QA 4EQ6B 4IVPA 1RYHA 4P32A 4U00A 2GETA 3FOZA 1E2KA 3M1IA 1NN0A 2XZPA 4F38A 3I5YA 4TZ6A 1G5TA 3TSZA 4ZCIA 2IF0A 2W6JA 2BMFA 3NEYA 4HAWA 1S9DA 3LBIA 4KSBA 3TAHA 3RRYA 4FCVA 2JJ2A 3E70C 5L3VA 5DE3A 4MKHA 2F3RA 4PO1A 3VNVA 4CT4B 5GJCA 1QHHB 1BIFA 4PC7A 2R62A 4A6PA 2JJ1A 1TNDA 2OHFA 2MSDB 2GKSA 3IDQA 4JBYA 4OI0A 2VHJA 5A5GA 4PC2A 3T34A 4P0TA 2X8AA 1K8RA 2JIZD 1VTKA 1U8YA 3B1WA 1G3UA 3MRSA 4HZUA 1F2UB 4L9SA 1D9ZA 1KSJA 1Q3TA 1XD2A 3EAQA 5E7IA 4RSGA 3TRFA 4EAQA 4BLPA 2HCBA 3FFAA 1GDDA 1HEIA 3X1YA 5DHFA 4US2R 4TZ0A 2WJIA 1FZQA 1MABA 4DSOA 4YXWA 2GK7A 3KJHA 4FIDA 1ZYUA 2O52A 2ZETA 3U2QA 1P7CA 2XOKA 1G9XA 2ZVQX 3RRMA 1F2TB 3PJRA 5GJBA 3UANA 4BLOA 1R4AA 3K0FA 3L8ZA 4C0SA 5B58C 2IYXA 4O3MA 1E2MA 4DLUA 3GJ6A 4TQAA 3ASYA 1NY6A 3QNUA 4WXPA 5KSOA 5LD2C 2WJGA 3ZVMA 1WMSA 2IYSA 2OILA 4HLQB 1GZSA 2P65A 1U2RA 2NPIA 2E1RA 3LRPA 1HYQA 2RH5A 2ORWA 3LXRA 4MUAA 4WW0A 1W48A 4MYCA 2QZ4A 3QF4B 1EX6A 2AXNA 2VF7A 1FMJA 2VSFA 5FBRB 2FV8A 3TH5A 3AVUA 5FUYA 3GLGB 1E2DA 1RE0A 3A4MA 4HYYA 2HXSA 1PLLA 1Q1QA 3HU1A 4LHVA 5HTKA 3LBHA 1IN6A 3QKSA 3R9XA 3I1FA 4Q7KA 2CBZA 5TMPA 2AR7A 4URZR 1W0JD 4O25A 3EXAA 3K9GA 2GTPA 2J59A 4QL3A 1N0WA 5EUMA 1PUJA 4GMDA 1SXJD 3PIRA 4YMSA 4C0LA 3EC2A 2X19A 1Z5ZA 3OF5A 3U44B 2GXAA 2ZI9A 2XSZA 1YVDA 3AF2A 3GLHA 2C9OA 3L0OA 2HT1A 1GRRA 2EFHB 2GDJA 3AP3A 3BB3A 4B44A 1DS6A 3UWOA 3GLIA 1T3HA 1L4YA 1VECA 3MD0A 4BEJA 1E2PA 1NMXA 2BV3A 2EWVA 4LOAA 5EQTA 3PUXA 4RD0A 4IJMA 1MO5A 2V4ZA 2H7VA 1YR8A 2QA5A 3BOSA 1AIPA 3FHOA 3KKQA 4NPHA 1AQYA 1MO4A 1VCIA 1KK3A 2VP0A 1CR0A 2WICA 2BHRA 4JKIA 4JMPA 4M9ZA 4NCHA 3CLVA 4DEYA 4OL0A 1XMVA 4PPNA 2V3CC 1II0A 5CIQA 1G5PA 1R0WA 1XP8A 2D62A 5EE1A 1D2EA 4UNQA 1JAHA 3IO5A 4OK6A 1L4UA 2QG6A 2RGAA 2QQ0A 3CW2A 4B71A 1NKSA 2ZS8A 4RZ3A 1W36D 2BBTA 4M0LA 4YMUA 5JECA 3T12A 3OE7D 4DDVA 3DZ8A 2VP4A 3MJHA 3UMSA 1Z0AA 4B2IA 5SZIA 1TADA 5JS7A 1CP2A 2J0VA 4JL5A 4MGZR 4WZ6A 4Q9HA 3AF3A 3ZJYA 4A0RA 1E2LA 3HDTA 4I99A 4TQUS 2FEOA 2QRZA 2Q6TA 2WSSD 3KUCA 1CKEA 3K1JA 4XWAA 1F3OA 1GL6A 1KY2A 1N5LA 1AGPA 2VP2A 5FOVA 4HZUB 4OI2A 1KI6A 5FPYA 1SVLA 4Q4LA 4MH0R 1HH4A 1E6CA 3U60B 3MMPA 1XXHA 4OQXA 5G53C 3KJGA 3W6NA 1OF1A 1JXOA 1KO5A 4P33A 3U6KA 2WKQA 2PEYA 2V9PA 1KI8A 3IQWA 3B82A 3T1OA 1NIJA 2VIIA 4M1SA 2ERXA 4Q4AA 2CDNA 1BS1A 2P5TB 1M2OB 3SQXA 4LK2A 4G5GA 3QUSA 2AHOA 2NTYC 4Z54A 1E1RD 1YR7A 4MRRA 1G3RA 1NSTA 5IT5A 4ZCLA 5L3SA 2AKAB 1YR6A 1JPNA 2OO7A 4NZYA 4YXWD 5FBQB 2REBA 4NYJR 1V43A 3L0SA 4D4MA 4OJQA 1XNJA 1VIYA 3M0EA 721PA 3EX7C 1WB9A 2CL0X 2ATXA 5IF9A 4DC9A 2QE7D 2WMOB 3KL4A 2NPFA 4AG5A 4FN5A 1G4AE 1N6HA 1SXJB 4NTZA 2QPOA 521PA 1A82A 2WSMA 4B3DA 4BFSA 2CHVA 1WF3A 2BC9A 3C4JA 1G3IA 3EA5A 3V9PA 1YZTA 2IYRA 4M9SA 3TUZC 2F43A 4HEJA 1II8A 1CTQA 2F1RA 2GILA 2ZTSA 1GSIA 3NHAA 1EK0A 4LBVA 4S35A 821PA 1KO4A 3B7GA 4R2IA 3A1UA 1CULC 2ZRDA 5HCNA 1QVAA 1U8AA 4GOKA 1E1RA 2X2EA 1RRPA 1NMYA 1KK1A 4OHWA 2A30A 3T15A 2AK2A 1R5NA 2QBYA 4O2LA 1DEKA 4A8JC 3K9HA 1LF0A 1RJ9A 1E2GA 4F93B 2R9VA 3T1TA 1RFLA 2R65A 3RAPR 3ZVNA 3B8HA 3T61A 3HU3A 3RHFA 4RFSA 4R71A 2PCLA 1E9RA 4IKEA 4EPXA 4OJKA 1ZNWA 2C98A 1L8QA 4E07A 1IXSB 3DM5A 3IILA 2L0XA 2FX3A 4UNNA 3EWSA 4JIMA 4LPKA 3QF7A 3ZZTA 3WBJA 2XB4A 1M7HA 3GJ4A 2RGEA 3AKCA 3TE6A 3SR0A 3TMKA 4ZDIA 4TMXA 1J7KA 2YWGA 3NKVA 3GFTA 4HI0E 1AZTA 1UF9A 4NMMA 3PENA 1C9KA 2QROA 1ZAKA 3QKRB 4XD7D 2F3TA 4P4SB 4TTRA 5DN6D 4R2HA 5K8TA 3ZIAD 2O8BB 4M8NE 4CDGA 4DKXA 1KI3A 1N2CE 1R2QA 1YKSA 2I4IA 4Q00A 2O8DA 2G1JA 3P1JA 2REXB 3GMTA 1KO8A 4HLCA 3WY9A 2EU8A 3B1ZA 3KZ1E 4A82A 1N6PA 4LY6A 1TTTA 2CNWD 4LJ6A 5DH9A 3SFVA 3K8YA 4DLZA 1HURA 2ZSEA 2LKDA 5FOXA 2GAOA 3X1XA 2JIZA 1FP7A 2G77B 1AM4D 2ZUBA 1ZC4A 1D2MA 1OV4A 2QUZA 3Q9LA 2GCOB 5J40A 3KJIA 2AWNA 2J0QA 4MGIR 1NN5A 2J3EA 1G7RA 2QAJA 3HYRA 4H1UA 4JT2A 4Q1FA 4RZUA 1JR6A 4D4KA 5H70A 1HA3A 2CCJA 1GOTA 2FG5A 3BB4A 3GJ7A 1NY5A 1E79A 1VG0B 3VKGA 1AK2A 2F6RA 4M1KA 2ZSDA 2QMEA 1F2TA 4Q9IA 4V0LA 5J5CA 1WE2A 3X2SA 4K8OA 5JWRA 3RWMB 2Z4RA 2X1VA 3B6EA 3ZZUA 3Q3JB 1T3SA 4HZIA 4FCWA 2C03A 1QZXA 1XZQA 4MITA 1GAJA 5ANRB 4C0KA 1ZCBA 3U5ZB 3KFVA 1UKZA 2YWHA 3G82C 4NCKA 4A0FA 2J7PA 2JEOA 3P26A 3W8RA 4Q1BA 2Z6VA 4JKYA 3VR3A 1BKDR 1N6IA 2OLJA 4ASUD 2HV8A 3DKVA 4G5RA 2WM9B 3I3SR 5JFGA 1SXJC 2O0HA 1E9FA 3BS4A 6Q21A 1CEEA 1KDTA 1MRNA 3QIAA 2WKRA 2Z83A 2OXCA 1XD9A 2QL6A 4BGDA 1DAMA 1UDWA 1FFHA 2AD5A 5EXSA 1VHTA 2B7CA 3VHLB 5F3WB 2GXQA 5G3ZA 3WYAA 5BYJA 3DOEA 3QKRA 1OXXK 3FMIA 5AJXA 2IYUA 2WBLC 4RY2A 4Q48A 2RGNC 1KNXA 3MCAA 2QAGC 1NN3A 3THYA 4M1OA 3AV0B 2QM7A 4EQ6A 4KFRA 2CLDX 2IA5A 4A36A 5DHAA 5F9FA 2GJ9A 4A0HA 5GJWC 4AKGA 1T5LA 2P6UA 1W1WA 2ZRFA 5JEEA 1GG2A 5CB8A 4C7OA 2JDIA 2ZAOA 3VFDA 3K0SA 3CKLA 4Q21A 4OYHA 5IDVA 4D26A 1ESMA 1ZCAA 4UXJA 3KJEA 1KYIA 4BFXA 5CITA 1CU1A 1KGDA 1JAIA 4G5QA 5CB6A 3A8TA 3W3AA 4IDHA 1ZIOA 1Z08A 2ZEJA 4UNRA 3QVUA 2D2EA 5H68A 3OHMA 4Q01A 1JR3D 2V8OA 2YVUA 5LPNA 1TL7C 4AYTA 4C2TA 2R2AA 4TYWA 3R9IA 4NHOA 3UG6A 1W0KA 1QHIA 3V4RA 2NMVA 1T9HA 5JI3E 2ZS9A 1XTQA 3JVUA 2AFIE 1MRSA 1QF9A 1XTSA 2OCBA 3NXSA 4QFMA 3TKLA 3QPVA 1YZKA 1UFQA 5KOYA 3TVDA 3HWSA 2C99A 4PQYA 5L3QB 3GD7A 2FMXA 3CF2A 2HCJB 5J4VA 4W7SA 1DPFA 2CK3A 2IUTA 1Q1ZA 2XITA 3DM9B 1S8FA 5CLLA 2R6AA 3FMFA 1IN4A 2HXYA 3QEJA 4ILEA 3I4LA 4FXPA 4D81A 4PSAA 1G3QA 1VCMA 3H84A 3AVTA 2HEIA 4MYTA 3DZDA 5SZKB 1T8TA 2YOFA 1NJGA 4Z1MD 2WOOA 4PZLA 4AYWA 1NF3A 5EE3A 3SEAA 2ODEA 4R98A 2WWGA 221PA 3CO5A 3HYTA 3TQFA 1NKTA 4MDEA 4LYJA 3TNFA 3VKHA 3FMOB 3CRMA 1E2HA 4I4LA 3SE0A 3HPQA 4CEIB 5FTJA 5JLJA 4NYIR 1RRGA 4Z51A 1VKJA 4QBGB 4AI6A 1KAOA 4QRHA 3DL0A 1Z22A 5FOTA 4KLNA 3K70B 1N6LA 4RD3A 3MWYW 5BQ5A 1Q1BA 1E98A 4MRSA 3R8FA 2CCGA 3ZQ6A 3A1TA 1FW6A 4IVQA 5C18A 3ICQB 1S9HA 2IYYA 2NZ8A 5CM9C 4NYIQ 4M9XA 1OH8A 1MT0A 3K0CC 2IUSA 4QOSA 3OFND 4I81A 2D4HA 5KNBA 1O3YA 1SHKA 2WPDA 3NDBB 1KK0A 1G6HA 4FWIB 2I1VB 2PEZA 1N0VC 1KKLA 1BO6A 1F48A 4NKRA 5C4GB 4JJKA 2DR3A 3CPHA 4R7ZA 3ADCA 3ICEA 2OM2A 2VL7A 4XOIA 5D3MB 5AJYA 2BJVA 1UADA 4GSYA 4RVCA 2GEVA 3RRNA 5KNDA 3UXMA 2GZHA 3QOFA 1KJYA 4PC3A 1OHHA 1SKYE 3WRXC 3BH7A 3T1QA 4TQ9A 1E94E 1ZD9A 2BMEA 2XEXA 3KKMA 3MSXA 5AUQA 1OIWA 3K0CA 5HZHA 3RC8A 2VEDA 2OUKA 4TMVA 3SC3A 5C2JB 1D2NA 1E96A 1IN5A 2EFDB 3DO6A 2XXAA 3V4FA 5EP1A 2DFTA 4AURA 1GM5A 2FSGA 3TSOA 4IDQA 4DLSA 1L2TA 3H2YA 3ZVRA 3IEVA 2VTKA 4GRAA 1T6NA 3P4XA 3EPKA 1IY0A 1ZBDA 4P4UA 3VX4A 4DSUA 2YZ2A 3JZAA 1E69A 1XB2A 3MFYA 4HDOB 4LYHA 4Q4JB 1HV8A 4B43A 4LHYA 4JLOA 4TTPA 3FHTA 2ZJZA 1BH2A 5JJKA 1L7VC 3ZGXA 1AJEA 1HUQA 5FBLB 4I1UA 2ZITA 3TR0A 2REOA 3THWB 2FU5C 3CRW1 4PC6A 3C41J 2GEUA 3VQTA 3KB2A 3KFXA 1KY3A 4P3YA 5SZHB 3NH6A 1Q22A 2AK3A 2IWRA 1N6NA 3WMGA 3N5CA 4IRUB 4P4SA 4MRNA 3LLUA 4QBFA 3GLHB 2RGGA 3ZLJA 2ZRGA 1OYWA 4N0EA 1NLZA 1YZGA 3SYKA 1EWRA 1IJEA 1QHYA 2YC4C 3H1TA 2N46A 2RCNA 5FBWB 3R7WA 2JASA 1JQLB 2V6JA 2W2TA 1A2KC 1K5DA 2IW3A 3EG5A 4JL8A 2A3RA 3AH8A 1KZGB 4IDOA 5GVSA 1R0ZA 1FUUA 4JS0A 5ELXA 4RZXA 4TLDA 2GJKA 5FPTA 3SHWA 4OKSA 5AK0A 3K0AB 4YDSA 2DBYA 2ZSBA 1ZU4A 4PANA 3VMFA 1E2NA 3FFBA 2XXAB 1W7AA 4AWXA 2XOKD 2RHDA 1XPOA 4OBEA 2OFWA 4LJ4A 3PEWA 3HPRA 3BJIC 1NG1A 5E4FA 1XX6A 4RKFA 5JJIA 1N25A 2OCYC 4MKIA 1XF9A 4US1R 2BDTA 2HLDA 2FA9A 1II8B 2ONKA 3Q5EA 3QQ5A 1KAGA 5C4MA 2D7CA 2K5UA 1JXMA 4LI0A 2ZYVX 4RCZA 2GF0A 4LPSA 3RS0A 5IHPA 2FGKA 4IOKA 2C5LA 2A5JA 2UKDA 3JZMA 4HSEA 1XMIA 2ZJYA 2WWWA 1Z2AA 2P67A 3UPUA 1HT1E 4V0NA 1P9WA 2ZU6A 3N70A 4JLAA 3VR2A 3W34A 5E3HA 3IQXA 4NCJA 2WVJA 3I61A 2ZYTX 4C0QC 3SYLA 1GVNB 1CIPA 2FN4A 1T91A 1G8HA 2BMJA 2R6DA 2G88A 2ASEA 2O8FB 3SYNA 2QPTA 2ZJ5A 3A6PC 2FPLA 3T35A 1OKKA 2F1HA 4BQSA 2FWRA 2EQBA 3B1XA 4DLYA 2IYQA 2YC2C 4G1UC 2RGDA 2RGXA 4TYQA 3A4LA 2D74A 4Q4AB 4Q66C 3SQWA 2BM0A 4JJZA 5FPKA 5LBIA 2VA8A 1FX0B 1FNNA 3FPAA 4ZI3A 3IHLA 4EJSC 4EIWA 3CNNA 3NDPA 4FMCB 3NWJA 1G18A 1P5ZB 2UVQA 4QJ4A 4B2LA 1FL9A 1YZLA 3GLHE 4OQMA 4QXAA 1S96A 3DOFA 1YE8A 4X8MA 2R8RA 3LWNA 1W4BA 5KYKA 2ZM5A 3TAUA 1AGRA 2OLKA 4MKGA 4CEJB 3BAFA 4NYJQ 4JBXA 4TL8A 1P72A 2ZE5A 4G5SA 2ZE6A 2IYWA 1W4RA 2GJSA 2LKCA 2OT3B 1PUIA 4AIIA 1DG3A 1KI9A 4PHHA 3VHXA 2OSBA 3HP1A 2FDCA 4D2IA 1E2IA 3W9YA 3EW9A 1KO1A 3D6TB 1IXRC 3W3ZB 1ZUHA 1HQCA 3BH6A 3K0EA 3Q85A 5CDFA 4NH0A 4TYNA 1J90A 4CF7A 2ZRJA 1ZMXA 1ZU5A 4QBIA 1RC8A 2PMDA 3K09A 4ON9A 4C30A 2D3WA 2NQ2C 4E03A 4ESHA 3H4MA 3NVAA 1K5GA 3K9NA 3LFUA 4KFSA 4AG6A 3OAAA 2WJYA 2XZOA 1OH6A 4V0KA 1XCPA 1CR4A 1QVRA 3D8BA 3L8YA 4PHTA 4RFSB 4A4DA 1NG9A 3PG5A 5LB2A 2F9MA 1TQ4A 2PJZA 4RFVA 5B64A 2JATA 2DCUA 3CNOA 3AF0A 1GIAA 5FPSA 5HE9A 5B57C 1SVIA 2B6HA 3O8RA 2WJJA 1P2VA 3SS8A 1RVDA 4HDCA 4KYIB 2GZDA 1XTKA 1KO7A 3ND8A 1KDPA 3C7KA 5FTNA 5AWFC 4B6EA 4DLTA 5E95A 2NOAA 1TQDA 3GPLA 1XBTA 1DG1G 3U44A 5FOSA 3UMRA 1FQKA 4BFZA 1FTNA 1TF2A 5AR1A 4QNRA 1KKMA 1N0UA 2NG1A 4LGMA 3GFPA 5GVRA 5K8UA 1UEIA 1R0YA 2AXPA 4XVRA 5L3RA 2XX3A 4QHTA 3O8DA 3R8CA 3BGWA 2GEDA 1BMFD 3MJRA 5KDOA 4B6FA 1HE1C 3GJXC 4QGAA 2ZREA 2KB0A 3HR8A 5D3MA 1KMHA 1OFUX 3CPEA 2VF8A 4BWYA 4PPFA 2FSFA 3GLFB 3M6AA 4EJSB 2GESA 1H8HA 4KXFB 2GJ8A 2FFBA 2G0NA 4TSFA 1E4VA 3CRQA 4RD1A 5FFMA 1IOZA 3B1YA 1Z63A 4QM7A 5L3SB 3KB1A 1G17A 2JLSA 2VLIA 4ZO4A 4RD4A 4DT1A 2VHTA 4HDQB 5JCPA 2IXFA 3B9PA 4V0ME 2DHRA 4B76A 2WAXA 4GBMA 3IBGA 1XEXA 4Z1MA 2PH1A 3FHCB 3T5GA 4TYPA 4PHFA 4DCTA 1IBRA 4JSYA 4LV6A 3DVLA 5UKDA 4KBGA 2IYZA 4KITB 3OE7A 2O0KA 4M1TA 3X1WA 1XXHB 2IWHA 2KSQA 5CM8B 2C95A 1G8YA 5C1BA 1XJ0A 4PZZA 4DLRA 3NC0C 4LYAA 3FE2A 2ANCA 1ZM9A 1JALA 4L9WA 4U02A 3QG5A 5JHGB 2ZI4A 1IY1A 4DUGD 1KOFA 2A78A 3NG1A 4OQFA 1AS0A 1QDEA 2Q0HA 1QHHA 4IVRA 3SNHA 2X77A 4XD7A 1I2MA 1P73A 3QVVA 1D6JA 2D2FA 2ZSFA 1ETUA 1FX0A 2PLFA 5HKKD 2O8BA 1MOZA 3DKPA 3CR7A 1X8JA 1PZNA 4TMWA 2JLWA 3HU2A 3ADDA 1Z6YA 2PCJA 2PT5A 4PQRA 1U9IC 1J2JA 2SHKA 1UBFA 4A8JA 1Z6XA 1E32A 5CK4A 2JLZA 4RKEA 3GLFA 2YINC 2WWFA 3IGFA 1NVVQ 1HY3A 2A5FA 3W6PA 2HJGA 1Q20A 4PAQA 4PSVA 4CVNA 1E9AA 1NVUQ 4JLJA 2JLRA 1E9SA 1I2DA 1U0JA 4PO9A 1W36B 3CR8A 5HZKA 1RZ3A 1G16A 4UNSA 5IRCD 1W44A 2BWJA 2ONJA 1P6XA 4LHWA 4AY2A 1Q57A 1N3BA 2VH5R 4C0JA 4G5OA 4OQNA 3REGA 1S3SA 4DB4A 2ZUCA 4JZKA 2EFGA 1XDBA 1YR9A 4IFBA 5CDFE 3GJ8A 5FUXA 2XJ9A 3C5HA 1PJRA 1KI1A 2I3BA 1KDRA 3HJNA 3LV8A 1N5IA 2GBLA 5FUVA 3QBVA 4TWZA 5BW8A 4B3XA 1DAHA 1ZIPA 4HB0A 3IUYA 1C4OA 1UPTA 4CT5A 2P6RA 4B3CA 4QKQA 3NBFA 3SBDA 3IKJA 1A7JA 1G6OA 3MG9A 2F7SA 2Z0MA 3CRVA 5JWHA 4EDHA 3U3OA 1IN7A 1ELOA 2IYTA 4Q02A 4D4JA 3RSLA 4OK3A 4XH9B 3I5XA 3S1AB 3RRZA 3RLFA 1S3GA 3EIEA 2IEZA 4KV9A 4V03A 4V0MA 1KI2A 1Z28A 1FQJA 3VKWA 4TLCA 5F98A 1NMZA 1CXZA 2IC5A 4GZMA 1J8YF 4U5XA 1P2SA 2A5DA 3LX5A 4UXHA 4Q4HA 2G3YA 4ERNA 5KDLA 2Q3FA 2IS1A 1KJWA 2GRJA 1N6RA 1VPLA 1OIXA 1XEFA 2BKUA 4DDTA 4FINA 2FNAA 1JEDA 5G41A 3Q8XB 1E2EA 3DHWC 1QHNA 3I8SA 3EA0A 4OHVA 3BIFA 2BKEA 2VBCA 4PPQA 3WBKA 3GEIA 1CR2A 1OW3B 3RVBA 2NZJA 4Q5IA 3ZS9A 1Z8FA 4V0OA 3KXLA 2OAP1 1OH7A 3CX8A 4D4LA 2EFEB 5FR1A 2GK6A 3LH5A 4MRVA 3VU9A 1BOFA 4QJ5A 1J99A 1Z06A 2QU8A 4LX0A 2FFQA 2KBEA 3QXXA 3UIEA 3ZD6A 2J7KA 3OEED 4HAXA 2WKPA 4M53A 3CUEF 2D7DA 1KI7A 4HAVA 1MKYA 2ATVA 2W6IA 2J1LA 2J9RA 2CE2X 4L4UA 4FD2A 5BN3A 2Q3HA 4BZPA 1LF5A 1VHLA 4C3ZA 5E7MA 2QGZA 1KMQA 5A0FA 2JLXA 2PJRA 3H86A 2BVNA 1FOEB 2XSZD 3MAAC 2H5EA 3VAAA 1KI6B 3MUFA 2IXEA 2ZJ8A 3A4NA 4A15A 5EP4A 4Q7LA 1Z6AA 2CLSA 2Q9CA 5JSZB 2RGNA 1FTSA 1M7BA 1GP2A 1BYUA 3B60A 3AP1A 2CLCX 3KUDA 3LQQA 3B78A 2OBNA 5HE8A 3WYGA 2ZRCA 3GJ0A 4WA7A 5L3QA 1GUAA 3KXIA 4TYYA 1B0UA 4PX9A 1I4LD 3EC1A 1G4UR 5CYPA 2NO9A 2NO0A 2JLUA 2JLVA 2G9NA 4D82A 1JBKA 5FBVB 2W2VA 4GZLA 5TVKA 1E9CA 3ASZA 1NJFA 2KJQA 4HAUA 3PUZA 1P2TA 2ZUDA 2EYUA 3T5DA 4M4SA 4MDFA 1G7CA 1JI0A 3TW8B 5JRZA 1GNPA 1ONBA 2ZR0A 4FI3C 4JBWA 2BBOA 3EIHA 1OXTA 3AVOA 4B74A 2VSXA 3AKEA 3SU8A 2AFHE 1EESA 4NCIA 3SOPA 4WZBE 3AVQA 1OXSC 2DWQA 3N2IA 4C7OB 1CJTC 1JNYA 1Q1EA 2ZR9A 5EP3A 2V1UA 2P5SA 3KKOA 2V7QA 2UZIR 3K9LA 1OHHD 3I72A 3RABA 3F8TA 2BEKA 2CJWB 3KKNA 4LJ8A 4E09A 1ZM4A 1E9EA 4LBZA 1CJMA 1QHXA 3U7FB 1UJ2A 4TMZA 3A1WA 1AKEA 2OFXA 1SVMA 2IEYA 4KVAA 4FMDB 1DO0A 1T0HB 2OESA 1UKYA 1U94A 4UKDA 3U4QA 4Q1DA 3A1VA 3P4YA 1MABB 2IF2A 1YHNA 4FCTA 1FP6A 4JVSB 3V00A 3L43A 4LBYA 5CK5A 4IDNA 2PBRA 2ZRLA 4DVGA 1TAGA 2CHGA 4GI7A 5FTKA 2OFOA 4W5HA 1SKQA 1X3SA 1P62B 1LY1A 2WV9A 2ZRIA 4ITRC 1R5OA 4BLQA 2J45A 4HUQA 4US0R 3VR6A 1R8SA 1W5TA 4KYUA 3OIYA 4A92A 4N3NA 4X8LA 4C9BA 3QEOA 3C16C 4LJYA 2H8KA 2CEAA 3SJBA 4DLWA 3QSYA 1XD8A 3KKPA 2OCPA 4BEBA 1A5TA 3PQCA 1GRQA 2QT1A 4GOJA 5F2EA 1Z3IX 4BLTA 3I92A 2O0JA 4M21A 2CL6X 3BD9A 4URXR 1KHTA 2FZ4A 1BMFA 3HR7A 5AJWA 1IJFA 1OE0A 4GFDA 1TPZA 2YYZA 2IUUA 2XZLA 1G1MA 1VIAA 4DT1B 2ZI7A 1ZW6A 4L16A 4DEXA 1CR1A 1T0JB 2JLQA 3VU9B 2J0UB 4H9GA 1T4GA 1HTWA 3EPHA 4GL2A 3BERA 2RHMA 2C9CA 1H8EA 4V02A 1YQTA 2AN9A 3B13B 4EJSA 5TDHA 3QPUA 4C0HA 4EFLA 1G8FA 4DCNA 3CX6A 2E9SA 2VSOA 3BORA 1DTSA 2HF8A 3NBYC 2WWYA 2RKOA 5CIWA 4WOPA 2EWWA 3ONWA 4KFUA 1EFUA 4BRUA 2PX3A 4Q4HB 3AM1A 2N1BA 1X1RA 3SFZA 2ZS7A 3FVQA 4DSNA 3BBPA 5KSYA 5AUPB 1E99A 5JS8A 2Z43A 2XNDD 3LXXA 3GJ3A 4YQFA 4XJXA 5DI9A 1OB2A 4G0NA 1OLOA 4H1VA 3KXKA 2QORA 1JR3A 4A2WA 1XJCA 4G01B 4OHXA 2WPDD 3TQCA 4QJ3A 1B23P 1YZUA 4PXAA 3IPYA 5J4KA 3AVWA 3OEHA 3U7EB 3I73A 5FTLA 1W4AA 1D5CA 1E0JA 1KSHA 4F91B 1AKYA 3KDSE 5CJPA 1W4CA 2GCOA 4II7A 5FUWA 5DIFA 4AKIA 3LLMA 2JA1A 4M22A 1DAIA 1GILA 1GRNA 1DARA 2C96A 2C78A 4M1YA 2FOLA 2YV5A 2HF9A 1FNMA 1TMKA 3ZDQA 3C14C 1TU3A 3G5UA 4TT3D 2W58A 3FWYA 5GADl 1X8LA 2RGCA 4ARZA 4BE7B 3SBEA 1H8ED 5BN5A 2OV2A 1Z2CA 5TY0A 2JCSA 3OEHD 4PC1A 4XVUA 1VCNA 3LVRE 2FGJA 4ARZB 1YU9A 2WZQA 2ZJAA 4LBWA 1UBCA 2CXXA 4X8OA 2EVWX 1C1YA 1E1QA 1TUIA 4TMTA 4B47A 1XEWX 4LDJA 5AUOB 1E9BA 2CVHA 2G6BA 1G41A 3CIOA 4DXAA 3X1ZA 2XNDA 4TMKA 5H8WA 1KSGA 1FUKA 1XXHE 4JLBA 4O2RA 4PPGA 621PA 4LJ5A 2XAUA 2Z5FA 3TJZA 4UNPA 2BOVA 4OK5A 3W6OA 2IS2A 1RKBA 4XWKA 4QG7A 1M34E 1TEVA 1ZD1A 2QP4A 4FW9A 5G3YA 2J87A 1QRAA 4QNMA 1TF7A 2Y8EA 5IK2D 1OB5A 4BRWA 2GAAA 2J7PD 2QSYA 4LJ7A 1Z47A 2YOHA 2ZU0C 5TB5A 5FI0B 4IOJA 1E1QD 1FMLA 1ZUNB 3AGPA 3PEVA 4XTRA 2WTUA 1QG4A 2NO6A 5DISB 1Z83A 2GVZC 3CH4B 3J81k 1ZINA 2XNSA 4CW7A 1P9NA 1M7GA 3ZIAA 4DB2A 2NIPA 4IOMA 1SXJA 1NRJB 4ZV4A 4GDFA 3NTUA 1GL7A 2H16A 5G40A 1LNZA 3W90A 3FYHA 2RGBA 2ZSAA 3AVPA 2IHYA 3E1SA 4ZDJA 3UG7A 2G83A 5CYOA 3IHWA 2WJVA 2DFLA 4NL4H 4XSHA 3WYFA 2A9KA 3JVVA 2A5YB 3GJ5A 4M1WA 5GJVC 1PVOA 1WA5A 2J0UA 2XTNA 4JL6A 3AVXA 2B8TA 3QJYA 4WVFA 5B2ZA 2GZAA 4CGZA 2QTVB 2VHCA 5EXTA 2B7BA 2OZEA 2F1IA 1W49A 1KK2A 4DJTA 1OT3A 4F92B 2JLYA 2FSIA 4ASUA 5J4YA 3VNUA 1W47A 2JJ2D 4LCBA 1OYYA 5FL7D 4JLNA 4CEHA 3K09C 1DVRA 5BYKA 1E2QA 4WBSA 1IQPA 3C8UA 4MRPA 3KQLA 3X1DA 4QHYA 3UKDA 2A2ZA 1CRPA 2FFAA 4LJ9A 3LAWA 1KIMA 2QN6A 5DSZA 1Q21A 1I4TD 1ZM3A 3GEEA 1Q12A 4TN1A 4UJ5A 3R7WB 5DI3B 3ZVLA 3GLIE 3U6BA 1QHSA 3PFIA 5DGXA 2FPMA 2RMKA 1E0KA 2WWHA 2DFKB 3IIJA 4P31A 1ZM2A 2JJ1D 3PXGA 2Q3MA 4MUBA 1NIPA 2FPKA 1XTRA 1TQ6A 4KSCA 1X6VA 1HE8B 2CCKA 2GXUA 1E3MA 4BFYA 5TV2A 5HPYB 4URWR 2C77A 2CE7A 4Q9KA 2OEPA 1XMSA 3U3JA 4AD8A 1W0KD 3THWA 4IDPA 3CM0A 3TVTA 4BLRA 2AWOA 3K70D 4EPYA 2MMCA 5EZ5A 1US8A 1T5IA 1AZSC 4Q4JA 1ZUIA 2IK8A 3GLGA 2PT7A 1KZ7B 2CL7X 1XTJA 5CJ2A 2ZXUA 3CB4A 1I4DD 3UK6A 3WNCA 2V54A 3I8XA 3VR1A 2C04A 5D3QA 3BC1A 4DIDA 3DMDA 4ZIRA 4Y0AA 4IEEA 2PZGA 1NI3A 2BM1A 3SI7A 2PL3A 1YJ5A 4O0MA 1VYUA 1G7TA 4D6PA 5EXPA 1EFRD 1OPXA 1CBUA 2VO1A 3FB4A 1EFCA 3BRWD 4YLGA 4UJ3A 3LO5A 3LX8A 1JJVA 2ZANA 3LQRA 1DAEA 3PUVA 4HAYA 4Q7MB 5J47A 5F9HA 1W36C 4NONA 1EWQA 2KI5A 1MO6A 3T06B 2R44A 1SVOA 3U3MA 3PEUA 4QHSA 5BN4A 1N5JA 4B34A 5FR2A 3FMPB 3BFXA 1NBMD 3GFOA 1UAAA 2VRWA 4CEJA 2QGNA 3LY5A 3MLEA 4EKDA 1KI4A 4NYMQ 1A2BA 4W5WA 3IIMA 1ZJ6A 3OZXA 2V7QD 4HAZA 3WRYC 1NVVR 4EPRA 5KUTA 2XTZA 5EXXA 3PUYA 1CLUA 1KTVA 3IPXA 4B73A 4W9MC 2GWHA 4FWTA 1RRCA 2ZRHA 2QEQA 1J70A 5KO2A 4LYFA 3N2EA 4DHEA 1G21E 4CEHB 4DCUA 3EZ2A 1QHGA 4XWOA 1XEXB 4F4JA 1NP6A 2BBSA 4LUCA 5TXGA 1LS6A 3AVYA 2HUPA 2P6NA 2ODBA 4B33A 421PA 4NU0A 1Z0DA 4BLSA 1H8HD 2BIFA 2BMDA 3QXSA 4L8GA 1EG7A 4DSTA 2QMHA 4C0BA 2B21A 2J46A 4TLEA 4ABYA 3AUYA 8OHMA 2WJHA 1E79D 4BZXA 4I1VA 3L0IB 5JJLA 4ZCMA 2QTFA 2IYLD 1KMHB 4EFNA 3BFVA 1S1MA 2YWFA 3GLGE 2G0TA 3CX7A 3AKYA 2VP5A 3GQBA 1E2JA 4JVNA 3O8BA 3O47A 4B2PA 3A37A 2KE5A 3F3YA 5HCIA 5BWMA 4IW3B 5BXQC 4C2UA 1PV4A 3DEFA 1IXZA 2ZRBA 5JI2E 1U99A 3GLIB 2R6FA 2GCPA 5FI1B 5JCZA 1XTIA 1N6OA 4KAXA 3VTKA 3RS2A 3WP1B 2WIBA 4EUNA 1WRBA 2YNMA 3AP2A 3OIWA 2ZRMA 3Q7QA 1XFAA 1U0LA 3S1AA 1COWA 2OE2A 2QMOA 2VP9A 3CWQA 3DDCA 3QKUA 1V5WA 4Q1EA 1UM8A 1R8QA 4KFTA 2ZAMA 1GWNA 3NEJA 1W2GA 1K6MA 3LA6A 2QE7A 3OAAD 1M1YE 2EFCB 1TEXA 3WHKA 2J0SA 3LW7A 3ND9A 1WBDA 4URVR 1WQ1R 1LFDB 3AKDA 2VPPA 1ESNA 1P9RA 3C5CA 5DYGA 2GJAA 1ZRHA 1OXVA 3QI2A 2FEMA 3ZZ0A 2JGNA 5FL3A 4B3GA 2O8EB 3T1VA 1US8B 2A7QA 4A0GA 4BFUA 3R9WA 3A1SA 3LNCA 2QI9C 1DOAA 3TIFA 1QG2A 4PO8A 3R20A 2QP3A 3H0KA 1WDTA 3FKSD 5IK2A 2V6IA 1NBME 2XTMA 1M6NA 1S2MA 4JVLA 5AJVB 4MKFA 1LV7A 1P4SA 1Q3HA 5KTYA 4QGFA 1P75A 3AEZA 2RB4A 2HYIC 4DDWA 4PQFA 2WWXA 1SKYB 1MO3A 4ACBA 1ZC3A 2Q9BA 3B1VA 5K8LA 3THXA 4KLZA 3WNDA 1M74A 5EJEA 5KDDA 2ODNA 3THOA 2YOGA 3VX3A 1ZNYA 2FJUA 1EX7A 4BUJA 1ZP6A 3QXCA 1X86B 2MMGA 1HT2E 5FH9A 4URUR 4DWJA 2IHBA 2HDNB 5SZJA 3ECCA 4LC0A 2YKGA 2C2HA 3AQ4A 2QT0A 2ZVPX 3KX2A 1ZVQA 1LB1B 3TK1A 2O5VA 3NIBA 4NDZA 4MYUA 5FOUA 2CVFA 1T3LA 3KQKA 4RCYA 1Z29A 1DBSA 3FKSA 1RIFA 5JRJA 1OFHA 3CWZA 2G1KA 1UKEA 4KI0A 1P3JA 3UMFA 1BYIA 2ANBA 2VP6A 3B2EA 3LDAA 1PLKA 3EZ6A 1AA9A 1F5NA 2ZYWX 1E2FA 121PA 1IN8A 3LW8A 1OJLA 4N1AA 3SJCA 2DY1A 2DB3A 4WIAA 1KJZA 5E7JA 3WMEA 4LHXA 2QQEA 3E5HA 4WXRA 2KWIA 2O8CA 4Q03A 5M04A 2AL7A 3PITA 4TL6A 4BPBA 5P21A 1DADA 2P2LA 2RAPA 2NO7A 2MSCB 3I32A 1MR3F 1F2UA 1EGAA 4TL7A 4OI1A 4ZKDA 2BJWA 5LDDC 4DDUA 3K70C 1TUEA 4BECA 2FFHA 2IXGA 2H17A 4JLPA 3EZFA 2ERYA 3RDPA 2OG2A 1DO2A 1COWD 1JR3E 1XEWY 2W0SA 2W6JD 4IXMA 3RNLA 2AX4A
chains in the Genus database with same CATH superfamily
3PKZA 4JYBA 5AFSA 2QY9A 3HKDA 1SCIA 3RYTC 4BO8A 1IEWA 3GVPA 1KAHA 3DQZA 1IEVA 1L4KA 2QSZA 5F33A 4QBHA 4DRYA 1XCMA 1AHHA 5FBKA 4PLZA 3V8NA 4H15A 3DS8A 4FMBB 4URYR 4YMTA 1TECE 1RXCA 1LRKA 4BNMA 3MTDA 1AS3A 1TZMA 1CS4C 4JZYA 1VL8A 3R0QA 4H4EA 2A1TR 1Z62A 1PU2A 1LVGA 2WAYA 3H8VA 5J4LA 1CYEA 2FZCA 2O3QA 3OCJA 5ALPA 3D4PA 4GD3Q 4BTEA 1F2VA 3ON5A 4DR4B 2WP8J 3ZW9A 2ACKA 3G2NA 2RC6A 3HB4X 4GMXA 4WAUA 4E12A 3KT8A 3PT9A 4UZFA 2ZPTX 1ORWA 1YULA 2QENA 4N3GA 1YL5A 2WYOA 2OP0A 2ZTHA 3SQMA 5F7XA 4Y2SA 3GP8A 1MB4A 3EPJA 1P1CA 3H9CA 3O8LA 3Q5DA 2J5XA 4C2AA 4E5PA 2HHHB 5BR8B 2VBFA 1ZBQA 1VI5A 5KX5B 1RXEA 2ECKA 4LOKA 1EFRA 1BWPA 3DW1X 2V98A 1BDIA 2XHEA 4FONA 2O7RA 1ZKMA 1M1UA 2OGSA 1TX4B 3NGLA 4AK9A 3WBFA 2VFAA 3EJ6A 4K46A 1Q83A 4XM0A 3DA8A 3PCRB 4U7WA 5AI5A 3TLEA 5M5BA 4D79A 1VC2A 4FDMA 1XQ9A 3KZVA 4I1OA 2XJ4A 1AZLA 3HV2A 2R8YA 2UDPA 3RR2A 2Q3JA 3ASUA 4HLDA 4GNKA 4FFWA 3DYIA 4GL4A 4PAMA 3VBCA 4TZKA 4L95C 1R0SA 3I4CA 3K2QA 4DC1A 1SUDA 2IGTA 1C8VB 3G88A 4KMOA 5KHOC 4PTLA 1I1HA 3E2IA 5DW3A 5J5VA 2YIJA 1T10A 4F3TA 3CSSA 2WM3A 4L27A 3TCXB 4K2HA 1G3MA 2BEJA 3O8CA 2ABWA 3K96A 4EABA 3SY8A 4BASA 5A02A 1RAAA 3UJ7A 2NUPA 2WW8A 2JHFA 3T7IA 3R6TA 1DWPA 5GOTA 1U7WA 2X41A 3U7GA 2FW1A 3IVAA 1WB5A 1KE2A 1MVOA 1VMAA 3Q3IA 2BUBA 2X2OA 3B5JA 4CM8B 1C29B 3CKMA 2KHZA 2VDOB 3GPCA 5FWAA 3FGNA 3IO3A 3I62A 3HKBB 1YOVA 5AIAA 4EG7A 2Q9UA 1R8YA 2GNOA 4E22A 5CYGA 1HF3A 2UYCA 4LDNA 1GKUB 3H11B 3CLRD 3N0XA 4GBED 3VO1A 1TF5A 2JFXA 4KAFA 4PR3A 5B5SA 2H9AA 1ATZA 1JILA 2YICA 1N0IA 4ZI2A 1KETA 3MAJA 1FRZA 1PFYA 2LWIA 2O8FA 2IYVA 5J43A 2ZSKA 1WBBA 3OESA 4P83A 1NU6A 3L8GA 5DN6A 4PAOA 1D6MA 1XE3A 2BISA 2P9GA 2GN2A 3FWPA 4BBPA 1CDEA 3PTAA 2C8VA 2GK4A 4G97A 1TTPB 1KJ9A 3RANA 1II9A 4ILKA 4QO7A 3ZQJA 1I3LA 3N59A 3P2YA 2FF7A 3R7BA 1UBKS 2L2QA 2ZJ7A 4LZWA 1NSYA 1GNTA 3H65A 4FYPA 1PFKA 2RARA 4RL4A 5JVDA 1XMOB 3QFSA 4Y9SA 1UJNA 2QRQA 3DL4A 3KDAA 3IESA 1L8OA 3IRVA 3LT4A 4HGPA 3G02A 4RF5A 1ND5A 4BE9A 4HAOA 3TUIC 4O4HA 4TTQA 2PMEA 3DE7X 4PVCA 2IH2A 1U98A 5AJHA 4AC9A 1O58A 3GFQA 2Q1YA 4K9OA 3FKQA 5BNFA 4LDPA 4MAAA 4OLBA 2PAFA 4NPAA 1TMYA 2RI1A 1M8PA 1E6EA 1JJIA 1RM0A 3CRZA 3DV9A 1C8KA 3UHJA 3RU3A 4DFDA 1H0RA 3DMNA 4YBZA 1F60A 1A2OA 4LSGA 2RFLA 1GUFA 4K87A 1SQ5A 4OQEA 3EW7A 3U3KA 1NF2A 5JANA 2JIDA 5ECWA 4CDNA 3TBKA 1L1EA 2OZKA 4PG7A 4FGKA 1UBEA 4EO7A 1I5RA 5BORA 1DAGA 2VJQA 2W0MA 4YMWA 2DGDA 3F96A 5AVSA 3C6YA 2A0WA 2DE0X 2OYSA 4JJ4A 5AKGA 2I4NA 3M7IA 3W5JA 1OGIA 1E0AA 4UHDA 5CR9A 1XZDA 3Q8LA 5MFZA 4XGNA 5IJZA 3PLRA 1UIRA 1PLJA 2Z2IA 2G40A 3G49A 4M0UA 4EFMA 1F6BA 1J0XO 4CF5A 1BROA 2BGUA 5J4HA 3QKIA 4B17A 3W8EA 1RCFA 4B3HA 3LUGA 2ORYA 3MAGA 2IX3A 2DFNA 3HXMA 3NHYA 4ZDKA 3EEQA 1LGYA 1N34B 1JAXA 1ZH4A 2CK3D 2UU9B 1BXRA 2W2XA 1A8QA 3O2SB 3CT6A 1SG9A 4OSOA 2GPBA 2OSVA 4FW8A 5DNCA 2JLBA 4BVGA 1Z4IA 3HJCA 4MA0A 2NO1A 4OH1A 5JCOA 4DBLC 1A77A 4JJIA 1LBTA 1Q44A 2GR9A 4JVMA 4EW1A 1NP3A 2QAGA 2O3RA 4UQLA 3ZHVA 2XWQA 1OFTA 2YY7A 2Y05A 2O7QA 2ORIA 2FSHA 3G2MA 3JALA 2UV8A 3TFQA 3WXMA 4CTOA 3REFA 5A1TA 4M37A 4R51A 5BW4A 1JQJC 1OKKD 4JLUA 3RODA 5JS6A 5JSZB 1CW2B 1G8GA 1TO1E 1GTG1 2FMFA 2OXRA 3QBJA 1YZNA 2XXJA 4NULA 1MJFA 4KO2S 5ADHA 3QPDA 1HXHA 2UZ3A 3N2ZB 3L8FA 4JGIA 1DBQA 4AUMA 1N7GA 1S8NA 1O9GA 2BM8A 2JDID 3UV6A 4CKBA 3EZYA 1E3EA 1Y4AE 5TC4A 3ZGLA 1NVWQ 4M9QA 2GA8A 3SS9X 3FDXA 1BU8A 2R7MA 1PJBA 2CUNA 5KYGA 2ODPA 3JAKA 5ENVA 3AB3A 1M6YA 4IP0A 3ONFA 2VYFA 3DZIA 4JLMA 1MENA 1Z0FA 3QWHA 3HA7A 4KUGA 4Q1CA 3CVYA 2LBPA 4EPTA 3NBXX 4DCMA 1HDGO 3A70A 1A7KA 4PFSA 5DWQA 2YJ5A 3WGYA 4IGKA 1Q7CA 2IZ5A 4S04A 5JO9A 3GXBA 4TS9A 1XZPA 3JZDA 4NI5A 5B3AA 1VMIA 1BKSB 1IM8A 5TT0A 5GOZA 1GFIA 2R1TB 3FFTA 3T4EA 5ICSA 3R40A 9GPBA 4KNYA 4EEKA 2XB2A 5CJJA 3E2PA 1KYXA 1WDLA 4YN3A 1W0JA 1T4MA 1VCOA 1UMBA 3ML1A 4Q39A 3ZWQA 4CM7A 1Z3CA 4JR2A 3JQPA 3WNZA 4R0MA 1QWSA 1SUPA 4NBWA 3NBMA 5DSTA 2EKPA 2BH9A 2MT9A 2C9BA 4IIGA 4IJ5A 4MMXB 5L40A 4GPTA 3KG2A 1VJ1A 3IUJA 1TYCA 1Z0SA 2CB0A 2JJ8A 5KYVA 1CY4A 3M5CA 3R4VA 5C51B 2Q0SA 3IQIX 4PYRA 5BRJA 3OQ6A 4CQNA 3BZBA 1GRCA 1C1XB 3D31A 1JLHA 4ZODA 1S0UA 1T4CA 1WDKA 1FNDA 2BFEB 3EQ2A 3M1YA 4GR5A 5DBIA 1PNRA 3FOCA 1IM2A 2R48A 1E1MA 1JQDA 3DLIA 4PZ0A 1G2PA 4EB0A 1B16A 3GPBA 4Q7JB 5D6OA 3HLTA 3EUFA 1Y0BA 3BTOA 4WESB 4WSOA 3ZHBA 5AUNB 1SVSA 3ZCPA 5I9SA 4UFOA 3IBFA 1OREA 4UPVA 1QBKC 4XIYA 1X39A 1B76A 1UEJA 1Z5VA 1DEAA 1HYHA 2AKYA 2X8BA 2ZI6A 5I47A 2JI9A 2OBMA 1DUIA 5IFKA 4BN0A 2Q3DA 1D9XA 5JYEA 4MDHA 5JMTA 3WGOA 1RQGA 5TARA 2PGIA 2PZFA 3W79A 4BMYA 3KZCA 3THXB 3O7MA 3PVSA 2YWJA 3WFIA 4F2PA 1E9DA 2WTBA 1DIOB 1NVXQ 1J06A 4JOQA 4GPEA 3W1VA 1WD7A 4GSLA 3Q15C 2AF3C 1P91A 1FUYB 2GVDC 2C5HA 5J2TA 2EZUA 1NOIA 3L06A 2ON6A 4PYQA 4RCVA 1N2OA 1Y5MA 2H92A 2IYPA 1CRQA 4JX8A 2YHSA 1QORA 1V8OA 4ROSA 5JZSA 2D06A 1FFEA 2QRJA 2VHXA 3E0QA 4HADA 5AXBA 2FWPA 4YRAA 5HOEA 4DADA 1VG8A 5F3RA 5BR1A 3RAFC 4QREA 1EQUA 2WSSA 3IT1A 4BFTA 4QGGA 2YN0A 3S7TA 1Z7YA 1JKJB 4JP2A 3U13A 1FNSA 1JEQB 1P5JA 2H4WA 2OZVA 2RI6A 3D7KA 4OLJA 4QGHA 5LWHA 2Z2XA 3EC7A 4IUCS 5FJJA 3RHTA 1NBAA 3EEIA 1POXA 4ID9A 5AW0A 1QUEA 2XUOA 1RC0A 2VSYA 2XPCA 2DUNA 3JQ9C 4ZPXA 3UFXB 3ZXSA 4RTLA 2ZR7A 3ZIDA 2O8EA 2C61A 4GPD1 2W2OA 1VIDA 3OIUA 5EJ6A 4HLUC 1JDZA 5T5QA 1RJ9B 3BIWA 8MHTA 1HRDA 1SELA 2G71A 3BDAA 4YDHB 2PUWA 3UUWA 3NC1C 5FIUA 4X8HA 4YP5A 1NVAA 4RA6A 3RVKA 2PA3A 2YBDA 1WKCA 4YLYA 1ZK2A 5DGCA 2VYVA 1TVKB 3T9CA 3PUHA 3I6QA 3DNMA 4GNRA 2CJFA 1RABA 1C81A 2QRNA 3JYPA 4TV9F 2XA1A 3VSCA 3L7OA 5ALDA 4DIUA 4DUGA 1PR1A 1NJ5A 2PT9A 1GKIA 3OPNA 5KKAA 1CEXA 3VHXB 3W5IA 2X0FA 3ZZMA 4G4SP 3RS5A 4CMGA 4F06A 4BVBA 4F11A 2D5AA 3KR0A 5EE0A 3WLFA 2PX4A 1VE1A 4AKSA 1FP4B 4B48A 3OE5A 1ISSA 3B8EA 4M3NA 4BKMA 2XF2A 1QVWA 2I8LA 1YCDA 3FCYA 1PJ2A 2BGIA 4O02B 3WC4A 4OOEA 5JHHB 2QUIA 2C2GA 3UJDA 3ZH9B 1P0QA 2HMYB 2DOKA 5G4LA 3KQHA 2QRUA 1OBCA 4AFNA 3TUJC 1LTQA 1V3UA 4YMVA 4LXUA 4I3GA 3L82B 5A06A 3NANA 4XTCS 1EFHA 2HZ7A 1ZEJA 2NSLA 2WIJA 3UTDA 2QXUA 3KVOA 3AUAA 1G5HA 4FXOA 2HNBA 4IVPA 5EPEA 3T5TA 3BMNA 4C6HA 2YFQA 3II6X 2GETA 3IALA 1Z6PA 4E21A 2O2EA 2XDYA 3KWFA 3M1IA 2XZPA 4F38A 4DL9A 3C1OA 4TZ6A 1B0PA 3LBFA 2QX6A 4MUNA 1PN3A 4GWGA 2XE8A 2BMFA 2DH6A 3V3KA 3O2NA 3OG9A 4FSDA 4L6AA 4P93A 3LBIA 2ESRA 3VPAA 3RRYA 2JJ2A 2PXHA 3PFWO 4MEBA 1Q3KA 2PGLA 3NIGB 3O95A 2JBAB 4MKHA 4R9VA 5DE3A 3ILYA 3T9FA 1E5TA 3TZCA 5JQGA 1RJFA 2ZWIA 2RSLA 4QJIA 3TOZA 4C0BA 5TLSA 2JD2A 1TNDA 4LF9B 2NT4A 2GKSA 3CY6A 2WLTA 3WKAA 2VHJA 2AR9A 5GV7A 4KPEC 4PC2A 3G9UA 1S7CA 3ROZA 1J49A 3HO1A 4P0TA 5T41A 1P80A 5D8DA 2JIZD 1VTKA 5JPIA 2VHZA 3OQIB 1R4ZA 2O6HA 4GZ5A 3AL2A 2VN8A 1U63A 3UV3A 1U2DC 1KWGA 4ZYXA 3EAQA 1N1EA 1XD2A 2FSPA 4RSGA 1U7TA 3I1JA 5CHYA 5E9AA 3RABA 3ETHA 4AP9A 2HCBA 4F1JA 3GP5A 1FS5A 1GDDA 1VHWA 3E58A 4ZI7B 1QGAA 1QVVA 3WLLA 2BSQA 2IY7A 5DHFA 4US2R 4TZ0A 2J85A 3TLJA 4GE0A 4LYYA 1F6DA 2V65A 1KVQA 3ROFA 4IIVA 3DLHA 1N8NA 4I9UA 1EUZA 1DCTA 1JYSA 2ILTA 4OQDA 1AB6A 2O52A 2ZP1A 2IIVA 4PAWA 5KVSA 5IT4A 1Y3BE 3QVMA 3RM3A 4XQ9A 3K0FA 3TZBA 4JFAA 2PH7A 2VHYA 5K2OA 3G9TA 3VJKA 3KJZA 4TQAA 1HL7A 3D8NA 1M76A 1PZMA 1SK8A 3QNUA 1DNPA 5E9JA 5KSOA 2WUVA 5EIXA 3H5AA 2OILA 4HLQB 1GZSA 2P65A 1U2RA 2NPIA 2XTAA 1XYVA 1SCKA 2RH5A 3LXRA 3KYCB 4OIFA 1IZ0A 2Q5JA 5IJWA 1T9GR 3OC6A 1EFPA 3CIFA 2WI8A 5FAKA 1AKVA 1E2DA 3A4MA 1FYDA 1PLLA 2Q5OA 4AX8A 4QODA 3QKSA 5KVQA 3GUVA 4QICA 2AR7A 2EQAA 3NX4A 1MW8X 4LWOA 4F97A 2D54A 1NW3A 5M29A 1HE5A 3MWGA 2GTPA 4KIFA 4QL3A 4IVNA 1XQ1A 4IX9A 2GGSA 2WUFA 1L4LA 1SXJD 1V25A 2FR8C 3PIRA 1TW3A 1HMYA 4PRLA 2GHQA 1R6DA 1P2BA 3LT2A 2C84A 4LOIA 3U44B 5T3UA 3MCZA 5CNJA 2NSYA 1OBFO 3AF2A 3GLHA 4EY8A 3FAZA 3L0OA 3FA2A 2EFHB 5IAGA 5IC6A 1ODCA 1O9BA 3UWOA 1M75A 2HU5A 1L5WA 1T3HA 5LU9A 1YVEI 5FF9A 3MD0A 1YB4A 3H19A 4BEJA 1E2PA 1JQAA 4PV7A 2G82A 2YY5A 4J94A 5E4TA 4DUPA 5HIKA 3F9RA 3RSGA 1OROA 1E6MA 3B1KA 4N18A 4V0RA 1C4KA 3G85A 3DV2A 4RLFA 1D3AA 1RRVA 2ZDQA 4B1FA 1AIPA 3FHOA 3L3BA 1KK3A 4C03A 3OC0A 3SJUA 4NG5A 1X7HA 1C3EA 1M9NA 2LIVA 2JIMA 4JUBA 4NCHA 4OL0A 3ZGZA 4PPNA 2QSUA 3OMWA 3QVXA 4G5YA 4OIMA 1G5PA 4UM9D 4BV3A 1R0WA 4HNSA 1XQVA 3N8HA 2CWDA 4CL3A 3OM0A 1JAHA 3IO5A 1P1JA 4OK6A 2QLLA 5LM3A 3PNQA 3CW2A 4I36A 2ZS8A 3TNYA 4BGEA 4YMUA 3VUEA 2XMPA 1WP4A 1U8EA 5JECA 3UHOA 1NVTA 1PP4A 3KYJB 1D2RA 5LYYA 3T12A 5EJ4A 3MJHA 3UMSA 3NAGA 3C6MA 2XDQA 1VLLA 4TWRA 3KQTA 2WK1A 2LPMA 1GR1A 2LP4Y 5SZIA 4IYRA 5F4BA 2EEZA 2V7GA 2WSLA 2BEVB 1T3TA 3G9XA 2J0VA 3LUBA 4G5FA 4J7XA 4Q9HA 1JGTA 1FVOA 3JQ6A 3MTQA 1E2LA 3HDTA 4AJ2A 4TQUS 5E1BA 2QRZA 5AHKA 2Q6TA 5JU6A 4KOAA 2YXNA 7YASA 1GL6A 1N5LA 2VXOA 4AJJA 4J2OA 4QARA 4HZUB 3L1KA 1KI6A 4OI2A 4RXUA 1ZL2A 1YAJA 2NYAA 3TTWA 4FIZA 1HH4A 1E6CA 4GRDA 5CDHA 2LE0A 3W2GA 2MINB 3MMPA 5T7BA 1XXHA 5B58T 4ND4A 5G53C 3W6NA 1ST3A 1OF1A 3EY4A 1GXSB 3NHFA 4B9EA 3CLUD 3C3MA 1OV6A 4FSXA 1KYQA 4NZNA 4BC1A 1V95A 2IYAA 1E6LA 2V9PA 3IQWA 4FYMA 3Q9NA 3H4IA 4M1SA 4RK1A 2R2GA 5TQVA 1R6VA 1Y7IA 2CDNA 2PSEA 1M2OB 3KWJA 1W85A 3SQXA 1XWWA 3I0NA 1W85B 5ISMA 1A9SA 4I8DA 4WECA 5KPDA 3FDZA 2AHOA 1N7IA 3EDMA 4MRRA 2C00A 1B73A 3G8YA 5IT5A 3SX0A 3R7LA 4FBGA 3NT2A 1YR6A 1FS4A 1JPNA 2OO7A 1FJHA 5CA0A 1LNSA 4HWPA 4J8PA 1FJXA 4DGSA 4KQIA 3WLJA 1P0MA 2NVOA 4Z86A 5IZCA 3ACBA 4JI6B 4D4MA 7REQA 1KEEB 1X42A 1XNJA 2B4YA 1VIYA 1SXHA 1U3UA 5HXAA 3HUEA 4XXHA 2CL0X 1O5IA 4PX2A 4OP2A 1V11A 1EIZA 2W42A 1UMCB 2QPOA 2QX7A 2DJ5A 4J2HA 521PA 4MO9A 1PNQA 1OI2A 5HMMA 3U39A 3V9PA 2BC9A 3M4JA 3ZDFA 3LUDA 3IUBA 1AB5A 2C2WA 3U5TA 3LLVA 3GEMA 3TUZC 2IDKA 2F43A 2IOYA 1II8A 2ASVA 4GUDA 3V8MA 2RAFA 3WGJA 2ZTSA 4OHOA 1BH6A 4LBVA 5KYUA 1L6IA 4ZQCB 2QTWB 1KO4A 2O7NA 2EP5A 1CQIB 3FNRA 4NS1A 3WRVA 4FU0A 3DE0X 3IOBA 4L4SA 1QANA 13PKA 4HQKA 5IEBA 5CDGA 2WKSA 2X2EA 1NMYA 1IVNA 1RWNA 3CINA 1C0IA 3MCTA 5AW8A 5KWEA 4PLFA 1DIBA 2DBRA 5BPHA 2AK2A 3SYMA 1DEKA 4CG1A 5JCJD 3T1TA 2R9VA 2WJ6A 4LCJA 2JK1A 2R8XA 1BE6A 1SOMA 2R7KA 4HNTA 5JTUA 3FLMA 1C0LA 1VMDA 3Q0EA 1ZOSA 3RHFA 3K1YA 1LI5A 2PCLA 4BHTA 3KYCA 4OJKA 3QQPA 1I1NA 2C98A 4N7MA 2KM1A 3R6LA 1ENOA 2XBLA 1DWOA 2L0XA 1SB9A 1OQAA 2G1UA 3B9BA 3MELA 4QUAA 5DHPA 2HA7A 5L7YA 3GAAA 4P3XA 4AMYA 1M7HA 1N2IA 4OQYA 3TE6A 4TV8A 4QYXA 2J5RA 3KVVA 3PHLA 2QJFA 3NJ4A 1PNOA 2D2VA 2HM7A 1DKLA 1I1OA 2PTHA 3GGGA 4QUHA 5ESRA 3X1MA 1MEOA 3HXOA 3AEUA 3L7LA 2QROA 4DQLA 1OXKB 4Q3BA 3AR3A 2HJWA 5DN6D 4R2HA 3ZIAD 4CDGA 1N2CE 1RQNA 1YKSA 4CIXA 2XA9A 1ZA2A 4M7RA 2FQYA 3VBEA 4CLDA 2G1JA 3WK7A 2NO5A 3MTBA 1CNMA 1EHCA 1KFBB 3OLYA 2JGIA 1DBPA 4HLCA 4GXNA 3WAGA 1GKLA 2IPOA 4I9FA 4ZARA 3ZCSA 3DTTA 3UB2A 5J2TF 3O0DA 3QVSA 2CNWD 4LJ6A 3SFVA 4IS3A 4XYEA 4BIMA 2E4WA 3OZCA 2GUWA 2Y67A 1TFRA 2X1MA 3SC2B 1W76A 4LVNA 3F4LA 3ROPA 3TE7A 4YAKA 3O3MB 3WSTA 9LDTA 3MPUA 1ZC4A 2BI4A 2FI1A 3L5OA 3OT1B 4XEUA 5E6RA 4J0CA 1K75A 2I7VA 2AWNA 5DJ5A 1W6UA 1NN5A 1DXOA 1O5TA 2J3EA 3BREA 4ZVRA 3AX6A 3EXEB 3MD9A 5IDXA 3DZFA 1SWWA 3AW9A 1MV8A 4LQDA 5KX5F 4ZT2A 1AT1A 4EHLA 2WUEA 2F6RA 4AUKA 2PUFA 1SKAA 3BMOB 3KYDB 4MVJD 2QMEA 5JXGA 2A92A 1C2TA 1F2TA 1LH0A 4Q9IA 4YJHA 1RTTA 4V0LA 5B6IA 3I5UA 1WHSB 1T43A 3GUZA 4HAIA 5FNVF 4BKOA 1Z9BA 4CIBA 4YH1A 2JL1A 3ZZUA 4KGZA 4MW2A 1LBIA 4OOFA 4E94A 1YS4A 4ARAA 2UVPB 3PGA1 5A5VA 5LNK1 4C0KA 2WJWA 4XIIA 1B2RA 2G1PA 3N0RA 2OOSA 4UHCA 5CLHA 5KHLB 1BMDA 3G0OA 3AHCA 3BIOA 4O1HA 1DQYA 1O6FA 3O4GA 4AF8A 5G0WA 3SZMA 4YMIA 2A0KA 3HVKA 4X24A 3P26A 1IJBA 3E53A 5SV2A 1JYFA 2Y1CA 4L78A 3EOAI 3F71A 3VR3A 1P81A 3TZHA 3CKYA 4DQXA 5L7WA 2YVLA 4AMBA 4LF5B 4LTDA 4EELA 4KQXA 4RTNA 2TMGA 2YW2A 3GFSA 3N9IA 5JAIA 2WM9B 3LPCA 1WCYA 4OKIA 3LHKA 1UFOA 3D8HA 4ZCPA 2GN1A 2OBFA 3IQEA 4JN6B 4ZJPA 5K6AC 2UUBB 3D7LA 2CSXA 2ZB7A 1K4MA 5AKZA 1HNXB 2R8ZA 4QU5A 5F3WB 3BHJA 3PD0A 3PB3A 1KGSA 1STOA 3O73A 1ZK3A 2BKVA 3L0ZA 1Z4QA 5HJ2A 2H2AA 3DWEX 3T5BA 2ZFUA 4BBJA 1C1DB 1DKUA 4XYLA 2NU7B 4QT4A 3QU9A 4CT0A 2PBZA 5ALNA 3A28A 3S68A 2QM7A 3UWDA 4KFRA 2CLDX 4CG3A 5LP6A 5F9FA 2GJ9A 2Y4NA 3PKIA 5GJWC 3I6MA 2P6UA 4I5GA 3IUSA 3M5PA 4IG4A 1EK2A 3EG9B 1GG2A 2G1AA 4PYIA 5JEEA 2RC5A 2JDIA 3TQIA 3RE1A 2XGMA 3OQHA 1JIKA 1T26A 4QPJC 5IDVA 4BVJA 4XM1A 3LXUX 3BSFA 4QOFA 2MR5A 1CU1A 1KGDA 3AHGA 5SICE 5CFQA 2ZXEA 2ZEJA 3NHMA 4HQ0A 3UUGA 3GLUA 4UNRA 4RIEA 3OHMA 5LPNA 2V8OA 3HBNA 1RHRA 2Q1XA 3NKLA 1N3LA 4AYTA 4LFBB 2R2AA 2EL7A 4N5LA 4IIXA 1U5BA 3UG6A 1QHIA 2HU2A 3ELUA 1T9HA 2NMVA 2VUSA 2ZS9A 1W88B 3DULA 3I5MA 4MV8A 5ALEA 1PG5A 2AFIE 2YY6A 4OJNA 1ZGBA 4JBLA 4EH1A 3QPVA 1SG0A 2P5YA 4LY9A 4YCMA 1H9BA 1USUA 5J4VA 2CK3A 4I4IA 4OQZA 4ZU3A 5JIBA 4R2LA 4E33A 1Y7LA 4OSEA 3TDKA 4E6EA 1J2YA 2Q49A 1AUOA 2G06A 2HSEA 2ID8A 3FMFA 1IJKA 1C0EA 3QEJA 4NAHA 3ZEAA 5EJ8A 3E15A 4PZAA 5EVCA 4BL5A 4PSAA 1G3QA 4MVJE 2EDCA 1CS0A 3MS7A 3O94A 4FZVA 1RJEA 4WY2A 4R0VA 3DZDA 2TMDA 4I9GA 3U37A 1PYGA 4Z1MD 1NW4A 2H65A 2ZCJA 2QX8A 5CVJA 3EFEA 4CF3A 4PZLA 5LYJA 1NF3A 2BSXA 3AYZB 1CP3A 4HGOA 2V3WA 3CO5A 221PA 3G9QA 3HYTA 4P86A 3WKDA 3AR2A 2O48X 4YAJA 4CR6A 4WMLA 4I4LA 3W3AH 2RBGA 5AMXA 4B2YA 3SDSA 4CEIB 3KSMA 1CQIA 5FTJA 4ZVPA 4NYIR 3WIBA 3DOIA 3HH8A 4QRHA 4QXPA 5FOTA 4OGWA 1DX6A 1UIMA 1N6LA 1WO8A 3MWYW 2YZMA 3FRIA 3JYQA 1Q1BA 5ENZA 4X7PA 2J3HA 1P7VA 2ZIGA 3LC2O 2F3PA 4FKZA 3VDXA 2PPLA 3NOOA 4N3CA 4IM7A 3SKXA 1WBJB 4ZO6A 1EE2A 5JCXA 1Z4PX 3PFKA 5F9HA 1NU8A 1IL0A 1YMVA 2IYYA 3ICQB 2HBQA 4MVJA 3KETA 4WFQA 2E82A 2MINA 4A2CA 4M99A 1UDCA 2QF7A 2K2WA 2QVYX 2XYGA 3AJDA 4QOSA 9LDBA 3AV3A 2SCUB 1WMBA 2P2YA 1YRYE 2WRZA 2PT6A 3BHIA 2O2SA 1U6IA 1ZI8A 3QYJA 4BDTA 3CUKA 1SHKA 3G5AA 2CV2A 1DZ3A 2VDNB 1FFGA 3D8UA 1F48A 4FN4A 4JJKA 1Z35A 3CPHA 2R3SA 5U4XA 5I7VA 2Q6OA 1ZO8A 5AJYA 4EYGA 4YCDA 1DMRA 1V3TA 2ALJA 4NR0A 3QLJA 3RRNA 3UXMA 2JFWA 1IXKA 1SKYE 2E4AA 2OGUA 1R8JA 2PFKA 1EFVA 3MSXA 3KKMA 3WK6A 4OQ4A 3K0CA 3SC3A 3S55A 1QZTA 3WL8A 1IN5A 3DO6A 3DBLA 3MA0A 3V4FA 2VTBA 5EP1A 2DFTA 1NC3A 4QBKA 1FLNA 4K9DA 1D2AA 1EQAA 3G79A 3R0ZA 1TAUA 4I2VA 1T29A 5C52B 1MGPA 1EH5A 3DWGA 5IDYA 5I8ZA 3G8AA 4P4UA 1KAEA 1K7YA 1OYVA 3D0OA 3TTUA 3VX4A 3JZAA 1XB2A 3MFYA 4IIBA 4F46A 2RD2A 4DIOA 3L18A 4Y67A 2JEYA 1F7UA 4TTPA 5MGNA 4QAJA 1YI1A 2ZITA 3CRW1 2RK6A 3EXHC 4C3OB 3KB2A 4HQFA 2GM3A 2E48A 3NATA 3O9ZA 4P3YA 4OV6B 2GBPA 3PPYA 3OPQA 2B30A 2AK3A 3NMUF 1N6NA 2JGKA 3BGIA 3EBPA 4OG2A 4LQ4A 2J07A 1CWUA 1ZJYA 4KXVA 5FOSA 4AICA 5GMOA 3B2QA 3F4BA 3LLUA 4DSZA 4E1BA 3WB1A 3V34A 1T4DA 2PZ8A 1YZGA 4BNIA 4YCLA 2B5OA 3JQBC 1S8OA 4MJLA 3PU6A 1QHYA 1QONA 2H9YA 2A8YA 2XNKA 3FUCA 4NECA 3FMGA 3TZLA 2N46A 1IYZA 1JPUA 5FBWB 3I05A 4Z4FA 1U4SA 1UKAA 5IF3A 1K5DA 1I6KA 2A3RA 3MOGA 1KZGB 2XUPA 4PQGA 4EI2A 1R0ZA 2VT7A 1W30A 2YMLA 4YJ3F 5ELXA 4RZXA 5KNLA 4D9MA 1M0WA 5AK0A 3QEKA 4Q6WA 3USZA 1EK1A 4X71A 2DBYA 3PXDA 1ZU4A 4N3BA 1FBNA 4PANA 4CR7A 2KS6A 1U0TA 2TMYA 3EUEA 2RHWA 3L7KA 5B3JC 4AWXA 1VPVA 4KN9S 4FLFA 1BVUA 2XOKD 4MWCA 3MCVA 5G0VA 3W2FA 4JWTA 2QTLA 3HPRA 1RD4A 3BJIC 2XMGA 4W1RA 4CL0A 5CBKA 1JFSA 1KVRA 1JMVA 1JFRA 1RI4A 3N7AA 2HWKA 3F7TA 3L02A 3AFIA 2JCXA 2JGDB 2BDTA 1OC2A 4OVKA 5CXXA 3R76A 2CYAA 5C7IO 1LC3A 1XK6A 4N9QA 1SU6A 1MB2A 2X4GA 1PGOA 5C7LO 1W6RA 2ZYVX 4BIIA 4ER0A 5BSKA 2Q1TA 3H42B 5B4TA 3AHHA 3DR3A 1BHJA 1D0IA 4N40A 3RS0A 5IHPA 2FGKA 2QX9A 4E88A 2G28A 1CQZA 3ZV6A 3QOYA 2PLAA 3JD2A 1LBEA 3H16A 3NOQA 1HT1E 3G2IA 4LZOA 4TMYA 4V0NA 4ZZ3A 2W2PA 3UPUA 2AW5A 2PX6A 2ZU6A 3N70A 3RQIA 5LNK6 2WFLB 3CZ9A 1U6JA 1JX6A 1Q11A 3I64A 4FGUA 4UASA 3CLTD 5CFRA 1GVNB 1ZS9A 1HM5A 1KJNA 1T91A 3KOWA 1G8HA 2BMJA 5ESWA 4E15A 2O8FB 1TM1E 4JJAA 1H2HA 7ADHA 2N3ZA 2QJTA 4JEHA 4I19A 4UCXA 3ZOZA 3T35A 4UE3S 2Q5FA 4MARA 4DUZB 4F85A 3HDQA 1P1RA 4YUZA 4DLYA 3H8SA 3F6BX 2YC2C 4G1UC 2RGDA 2WU8A 4YPVA 1WDWB 3A4LA 4Y6SA 4YY3B 3VNAA 2ZAYA 3SQWA 1GTRA 3L1IA 5FPKA 3A4YA 2PA0A 2B1RA 1JIJA 2LD4A 1FNNA 2QTVA 5CH3A 3IDOA 4Z0TA 4OHRA 1W5BA 5HCUA 4EIWA 4MI6A 4FMCB 3OZBA 4QJ4A 2E2WA 3OLWA 1RPTA 5EUCA 1QDLB 5TRTA 1FL9A 2GYYA 1XNGA 4N12A 2XZDA 3MUNA 4BVLA 4CV2A 2NUPB 4CIAA 2IBTA 1M34A 4FR5A 4BTLA 4X8MA 1A72A 1DLJA 2YXPX 3I2GA 5IANA 1TVEA 1WKBA 2IY8A 3GG9A 1XLUA 4ZEXA 4D43A 5CA1F 1YDEA 4UOEA 1E6KA 2B82A 1AGRA 1XNHA 2OLKA 5LMCA 4MKGA 3BAFA 2HUNA 3EWNA 3BF8A 4D8WA 1AXGA 3FSGD 1E3LA 4KLRA 4G5SA 2ZE6A 4LXIA 3NBQA 4YCJA 5DLDA 3W7BA 1CUSA 1RQXA 2LKCA 3GELA 3GJSA 5F12A 4ECAA 1TYAE 3GGSA 1CDZA 4PHHA 3RW9A 4AO6A 3QLVC 1MOSA 1R0RE 2VWGA 1SBNE 3HP1A 4NX2A 4AN4A 4FYIA 4BATA 3GH3A 4D2IA 2PUHA 3L93A 4ZMRA 3W9YA 1KMCA 1B8UA 1TA9A 3D6TB 1XJWA 1RHQA 1ZUHA 3EW9A 3BH6A 3T4XA 1IVSA 5FP0A 1R9JA 3H2ZA 1QQAA 3X2EA 3Q85A 1NASA 2Z3VA 3PGMA 3M82A 8GPBA 2C5BA 1PSWA 2Z8XA 2B4AA 3JZFA 2DQZA 3PWSA 4N7RA 1E3WA 1VJ0A 4CF7A 3OPYB 4EBFA 2ZRJA 3PC7A 1XCBA 3L6CA 3BRQA 1ULZA 4JP5A 2B98A 1RC8A 1SBCA 3LX6A 2P3QA 2WTAA 5AW4A 1TM5E 3O6VA 3TEMA 1E5XA 1LU9A 1MAVA 1Q95A 1QG0A 1JDSA 2FR1A 2HJSA 2NQ2C 2V97A 3K9NA 4FFNA 3ZIUA 4CUZA 2PYDA 2GBIA 4LNHA 4EKYA 5ICEA 4G0VA 4V0KA 4B7AA 3MCWA 4S1OA 2XCOA 5EKSA 5I45A 4CN9A 4CQMA 2F9MA 4RF4A 4G37A 3STXA 1TQ4A 2PWAA 3PHCA 4HNUA 3ZJVA 3CNOA 3T1YB 3ROXA 5EZQA 4L8LA 2VDMB 1VL1A 1L5HA 3WGKA 3GLVA 3RTBA 2PFGA 2PXXA 3FTCA 1ZJWA 1SCQA 3VKUA 2QYTA 3NJRA 4HDCA 2QZSA 2GZDA 3B9RA 3BD6A 1GAWA 1KDPA 3ND8A 4KYIB 2O06A 1R74A 3L9WA 3OX1A 5AWFC 2SICE 4DLTA 3GPLA 3IPLA 3OCCA 3P9SA 2ZJ1A 5ADUS 1RQPA 1T9DA 1TU0A 2V9ZA 4TV9B 2NN3C 3UMRA 2WWVD 3K4PA 2NVUA 5K8UA 3GFPA 5GVRA 1P9OA 5T6MA 3T7AA 4X91A 1G4HA 1UEIA 1R0YA 2AXPA 1XI2A 2AQIA 4CM9A 1JKMA 4HNAA 4PYNA 4QHTA 1QGUB 2BMWA 4NV3A 4KR7A 3INYA 4PU0A 5DYYA 4L8FA 5T8KA 3R74A 3OQOA 3ABZA 2R1VA 4HS4A 1M73E 1HE1C 4MUXA 1DXYA 1V11B 3QBEA 5EEGA 4A8PA 5D3MA 1KMHA 4EY5A 4YV2A 3GYGA 4IJUA 4BWYA 5BWNA 3GLFB 2YV3A 1FJGB 3I45A 4IIHA 5BV1A 2G7ZA 3NU1A 1JFFB 5EMMA 5AYVA 4LJKA 2AS0A 1HMPA 1N2GA 1J33A 4H0NA 1Z26A 3AI1A 3LSYA 2FFBA 1YRLA 2VF5X 4NENA 5KOIA 2YFKA 4TTJA 3R5XA 3ZZ1A 3LLCA 2BFEA 2X9QA 1E64A 1N1DA 3KOYA 3LY8A 3ZWBA 2V4MA 3K35A 1H2RS 3PGVA 4DT1A 3MMXA 1YWGO 4WGGA 5A3VA 1LBHA 1FDWA 1X7XB 2QU7A 4WDRA 5AJTA 2DHRA 2FFJA 2WAMA 4MQEB 4GBMA 1EA5A 1WUTA 2D3TA 4WCDA 2PKEA 1JTEA 1XEXA 2WMYA 4FB4A 3C3CA 3B70A 3T5GA 4PHFA 4D6YA 4FDAA 4P84A 4LV6A 1YJ8A 3ONNA 3FNQA 2QVGA