4DIDA

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division control protein 42 homolog
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase
total genus 61
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4didA00
4PC3A 3VQTA 2QP4A 1IN4A 1CEEA 4P33A 3RWMB 1NIJA 1HUQA 3ZVRA 3HPQA 1Q3HA 1FUKA 1KDOA 2FGKA 2IYTA 2QRZA 2NGRA 3A8TA 5KSPA 3W8RA 2VP5A 3AEZA 4KFUA 1LF0A 4HUQA 4RD4A 3TLXA 3T12A 1E4VA 2FSGA 1XWIA 1VCIA 4BLRA 5BW8A 3VHLB 1JB1A 1X3SA 1VCOA 3L0IB 1VYUA 1NSTA 1S0UA 2X8AA 5G40A 2IS2A 2PMKA 5KSYA 2VHUA 2G1JA 1D9ZA 5FTKA 1A2BA 3W6NA 3VU9A 3NWJA 1W36C 1DG3A 1RZ3A 3K0FB 4C0BA 4A1FA 3I5XA 4JT4A 2OAQ1 4NCIA 5EZ5A 3IO3A 1II8A 4FXPA 2BDTA 2UZIR 4LGMA 4OKSA 5HKKD 4Q03A 3MFYA 1AGRA 4AG5A 4B44A 3QENA 4JYCA 4C9BA 1F2UA 2ZREA 2ZS7A 2FFHA 4URZR 3NBXX 1XNJA 2LWIA 4JZKA 3N70A 3QVVA 1V43A 4CEHB 1YZTA 1F2TA 2ZU6A 1ELOA 1KZ7B 3AF0A 2FFAA 1WE2A 2ZUCA 1OIVA 4XH9B 2GJ8A 1MRNA 3OEHD 4ESVA 1L8QA 3CPHA 4MUAA 1IAQA 4YDSA 1Q44A 4KV9A 2NIPA 1R0WA 3AVYA 1GRNA 3HWSA 5FL3A 4QHSA 1I4LD 3V4RA 3BK7A 2RGEA 4B75A 4EQ6B 1EFCA 4A6XA 3V00A 2ZIAA 2KBEA 4RFSB 4Q4AA 3LDAA 2FV8A 2GA8A 1CJMA 1NKSA 3D8BA 2H5EA 4U5XA 2N46A 4YONB 1E0JA 1EGAA 4GSYA 4TLEA 3C8UA 4EJSA 1RFLA 4JLJA 3FGNA 4TMWA 1VHTA 3EIQA 2LCFA 1YZQA 2ZRAA 4MKGA 5AJYA 4BGDA 1QG4A 2ZRJA 1VYTA 1G6OA 1E1RA 4IRUB 5GJBA 5L3QA 1EFRD 1N25A 2F6RA 3QKTA 5FPSA 3WNCA 1XXHA 2QA5A 2XOKA 4Z54A 2W6JD 3GQBA 3LLMA 2ZRFA 4ZO4A 2F3RA 4WZ6A 4DKXA 1PVOA 3MG9A 1XD2A 1S1MA 2L0XA 1JXOA 2VP4A 4GPTA 5E7MA 3WRXC 4QHTA 3SYKA 5J4VA 1SULA 4QM7A 2V1UA 1LFDB 4V0MA 2JLYA 4M9QA 2XB2A 1E1QD 4PC7A 2BM0A 1GNQA 3PEVA 1KTVA 3PITA 1YZNA 2CDNA 1BMFD 3H4MA 4KSCA 4MYUA 1Q1BA 4IXMA 4XJXA 4HAZA 4KLNA 2XEXA 5H1YA 2F3TA 3D6TB 4P3YA 1AS3A 1R2QA 2J41A 4ZDIA 2QTFA 4JLPA 4CDGA 5EQTA 2VHQA 1JEDA 3AF1A 3MWYW 2YWGA 3DZ8A 3U44A 1YQTA 4BEBA 2CJWB 1CR1A 3RS0A 2KB0A 4MRNA 1UBGA 2IYRA 2GVZC 5JJLA 4AYXA 4ZCLA 5KUTA 1F6BA 3CNLA 2W6ID 3TSWA 4LWZA 2NMVA 2ZI4A 1ZIPA 3AF4A 1Z08A 2V54A 1CJTC 1HV8A 2JLSA 2PL3A 4NE2A 1KNXA 4Q7MB 1W4RA 2GZHA 2W0MA 1S8FA 4D25A 2R8RA 3VR1A 1P75A 1XPUA 3BE4A 3VR4A 5FPHA 1K6MA 1P2VA 3CNOA 3SYNA 1M34E 1T5IA 4FCVA 1EWQA 2FPKA 2CVHA 3ETLA 4TT3D 4YXWD 4KO8A 4QJ3A 4E07A 4Q9LA 4JL6A 1G3RA 3C5CA 4C2UA 4E03A 5G3ZA 5KNDA 1WDTA 3HR8A 3K0FA 4RKEA 2GAAA 4KODA 5KSZA 1SXJE 1HQYE 5GVRA 5IF9A 4CEJA 2H57A 4HYYA 1VG9B 4DIEA 5B64A 1E0AA 1XTJA 5EP2A 2HF9A 4NHOA 4L16A 2OBLA 4M1YA 5FH9A 4XWKA 5TB5A 1IM2A 1AM4D 5BWMA 2RGBA 1N6HA 4JVNA 1E0KA 6Q21A 3EC2A 5CLLA 2CHGA 3Q72A 3S1AA 2HLDD 4BZPA 3F0TA 1NIPA 4PR0A 4U7DA 4AKHA 1Q0UA 3M4YA 5HE8A 2B8TA 4CEHA 1E96A 1GKUB 4NU0A 2BJWA 1P9RA 4Q4HB 4BUJA 3LXXA 1Z2CA 3AP2A 5DN6D 4QM6A 4TQUS 3VR6A 4B35A 4V0NA 2NTYC 2AK3A 3FMIA 4C0SA 3LVQE 1E9AA 1OKKA 1GFIA 2ATXA 1R5BA 2EFGA 4QBGB 3EZ9A 3VFDA 2J0SA 1KI6B 4PPNA 5IK2D 5FBRB 4BFVA 2GRJA 4IOJA 3B1WA 1IY0A 2AL7A 4TL7A 3CB4A 4B48A 4OQNA 1DTSA 3I73A 5K8IA 4WIAA 4BQSA 3PCRB 4TLBA 3AKEA 1OFTA 1KO5A 3UPUA 4EPWA 3OIVA 1NN5A 3QJYA 3W3ZB 5EE5B 1KOFA 3CZPA 4DSTA 4LPKA 1YZLA 3A6PC 1B23P 3OESA 4OQMA 1VYVA 4HDOB 2Z43A 5FOWA 4A4DA 5DE3A 4B2IA 1CJUC 1DAGA 1P2SA 2OCAA 4TYWA 2JJ1A 4DLSA 1E9RA 4F4IA 3FMOB 3P32A 4DLRA 1JR3A 1OIXA 4B6FA 1E2EA 2HT1A 3KFXA 3GJ5A 1BS1A 2F55A 1DADA 4WOPA 2CK3A 3RS5A 2QQEA 2UZ3A 4II7A 4C0KA 3U7FB 2XNSA 4BFSA 1ZCBA 3AGQA 4NH0A 4BFUA 1G4AE 1XJQA 3GEIA 2CCJA 1A7JA 1U90A 1XMIA 3EZ6A 1JAHA 4HLQB 4LSGA 4ZDJA 2ZSAA 4O0MA 1XMVA 3EW9A 2CBZA 2H17A 4KCGA 3VNVA 1MT0A 1YHNA 4X8LA 4ABYA 2MSEB 2IWHA 2NO0A 1AZSC 2Z5FA 4KVAA 4L15A 1Z29A 4OJQA 4M8NE 2IT1A 3KXLA 5J47A 5HCNA 3GLGA 1G3IA 3TMKA 2WZQA 3UMFA 3OIUA 1CRQA 1LVGA 3SJCA 1ZUHA 3CW2A 4FMCB 3KXIA 5LB4A 4JL8A 4JBWA 4UNNA 3DKPA 5BN3A 5CB6A 2PCJA 3I62A 1W49A 1TPZA 3IEVA 1M7BA 3LH5A 4BLSA 2WM9B 2WKQA 1XCMA 1ZW6A 4ILEA 4LC0A 3OEEA 4KI0A 1OXSC 3EZFA 2X1VA 4KLZA 4LC1A 2CJWA 2ZRNA 2RHDA 4US0R 5SZJA 4LZZA 2DB3A 4URYR 4PFSA 2FZ4A 2AWOA 2FEOA 5FPYA 3AP3A 1HT1E 3UK6A 3RC8A 1J8YF 1JECA 4MRSA 3LO5A 1M7HA 1TU4A 5SZHB 1DAEA 4O2LA 3L0OA 4D0NA 1M8PA 4XOIA 3ICEA 2YC4C 2Z83A 1W47A 3A1TA 5KDDA 2J59A 2ZRPA 3QBVA 3UMSA 2H7VA 2W2XA 4MRPA 1OIWA 4A2WA 4TTRA 1OFUX 1W0JD 1KDTA 4WVFA 3KQNA 1KI7A 3E5HA 1EX7A 2H1LA 4KAXA 1RVDA 5FBQB 3SJBA 4TYQA 3DZDA 2IS6A 1TQ6A 1YE8A 4E09A 1XZQA 2GNOA 4QJ5A 4QC2A 4C7OB 2O8EA 1FMLA 4MUBA 2QPOA 4B6EA 2JIZD 1W36D 4NKRA 2CMKA 4XTCS 5DNYB 4EIWA 2WAXA 4OHYA 2QG6A 1XZPA 4RY2A 1SZPA 4IFEA 4B3GA 1RPZA 3DOEA 2XX3A 4LBYA 4URUR 4JLOA 1ZAKA 1UBFA 4Q4HA 4NYJR 1T9HA 4PO9A 3GMTA 3WMEA 3NG1A 5G3YA 1XD9A 3Q3JB 1G20E 1NBMD 4HDQB 4US1R 2ZUBA 3EASA 4JLAA 2FGJA 2Z0MA 4QXAA 1FPMA 1NMXA 1P4SA 2FG5A 4DRZA 2DWQA 4M1MA 2QE7D 1U8ZA 3T5DA 1W5TA 1TUEA 2IYXA 1Q20A 1Z3IX 2XSZD 4LV6A 4Q1AA 5FOVA 1X1SA 1M74A 2GK6A 4URWR 4DXAA 1COWD 2PEYA 4DDVA 1TQ4A 5CM9C 1G21E 2YYZA 4V0ME 1A4RA 2GZAA 5K8TA 5DHAA 2WTUA 2ORIA 4RD3A 5UKDA 1C4OA 1RYFA 4P32A 5KSOA 4XD7D 4Q1CA 1D8TA 4B3FX 1AKEA 3GP8A 3GJ4A 3EARA 1HH4A 2GCPA 4NYJQ 3DOFA 2ZI3A 3OIYA 5AJZA 4B47A 1EXMA 2WJIA 1MV5A 3MSXA 4TSFA 1G17A 4UNSA 3QY0A 2K5UA 3A1WA 2P6UA 2C04A 3SYLA 4KVGA 4BFTA 5FUYA 1X8LA 1K8RA 2ZTSA 5J40A 1GG2A 2OCYC 4LBZA 4Q9JA 1DELA 1IY2A 1KI2A 4JMPA 3W8NA 4JLBA 2F1HA 2ONJA 4BFZA 2YWFA 4F93B 2JJ2A 2QPTA 4GP6A 2R6DA 3NDBB 1TADA 5K8UA 2YKGA 2AHOA 3C5HA 3RANA 1ZUIA 4PC2A 4Q19A 1Z8FA 1DE0A 5IT5A 4CGZA 1R0XA 1G8PA 4ERNA 4URVR 3X2SA 3BGWA 3ZZTA 1VG8A 5C4GB 3RC3A 3DPUA 4PHHA 3CF6R 2NO9A 2QNRA 2XNDA 4EJSC 4KXFB 3CRVA 4A82A 1XF9A 2XAUA 5GVSA 2XTNA 3I4LA 2IS1A 4FCWA 1H8ED 2PH1A 1JPNA 5IRCD 3B2EA 2C03A 1UKEA 1ZM3A 4B2LA 1FX0B 3GLIA 3N5CA 3V4FA 2HT6A 4JKYA 3KL4A 4GZLA 3LFUA 121PA 2ZEJA 4RD1A 1LW7A 4US2R 2EFHB 1YU9A 1QHIA 2IYQA 4Q5IA 2CE7A 3IPXA 2LKDA 1TF7A 1Z0FA 1KI1A 2GF0A 5C4MA 4FIDA 2OHFA 3UG6A 2FFQA 4F7WA 3VR5A 1D2NA 1G291 5A5GA 1UJ2A 1TL7C 3OF5A 2X19A 4HB2A 4N3NA 4DWJA 1IXZA 5CLQA 1ZU4A 5FL7D 4KU4A 3SE0A 1D9XA 1XP8A 2E9SA 2QGZA 4C7OA 4DLWA 1W4AA 2Q6TA 2HDNB 2WJHA 4C0LA 1T8TA 2P2LA 4DB2A 3BORA 4FMDB 4OBEA 4TL8A 4ESHA 3Q7QA 1OH6A 4WXPA 1AJEA 2A5YB 4P0TA 3A4LA 2EFCB 4FCTA 4QBFA 2EYUA 4HB3A 4MRVA 1G64A 4LYHA 3I3SR 1E9FA 3U7EB 4GOJA 5BN5A 1YRBA 2ZS8A 3X1YA 3IPYA 1XRJA 3FKQA 2ZE7A 4JKIA 1E6CA 3FHCB 3PUXA 3GLHA 4W5JA 4L9SA 3SR0A 1LB1B 1QBKC 2IF0A 1GM5A 4B2PA 1JR6A 1QVRA 4L9WA 4NDZA 3IBGA 4IDOA 4IDNA 3VMFA 5JEEA 3Q7PA 3WBJA 1YKSA 1VIAA 2JLUA 4GL2A 2C2HA 1QHHB 1E98A 4IDHA 4OQFA 1II8B 2IF2A 3PUYA 3RDPA 2BMJA 2GCOB 4LX0A 2FPLA 2RGNA 2JDID 3CUEF 1HA3A 2WSSD 2C5LA 3LD9A 4I4LA 1W48A 3K9NA 4N1AA 3TAUA 3GFPA 4TMXA 3RWOA 4ASUA 4DCVA 4F4CA 2ZAOA 1L2TA 1TUIA 5TV2A 2PLRA 1G3UA 1E2KA 2OBMA 1NN3A 1KAOA 1NG1A 3TNFA 1E69A 3B5JA 2Z4SA 2CEAA 2NQ2C 2J7PD 2PJRA 3R9WA 1KO8A 4QGHA 4Q18A 4XIGS 4IFBA 2QPAA 3GLGE 1EG7A 4WW0A 4EPRA 1XBTA 1UFQA 1DAMA 2BMDA 5TVKA 3EWSA 3O8RA 3K0AB 3CPJB 2PCLA 2J0UB 1VKJA 2RKOA 3U7GA 1E2IA 2OILA 3TAHA 1G16A 4I1SA 1L7VC 5KDLA 3QG5A 1XEWY 1Z22A 2V55B 4K46A 1SKQA 5G53C 3HPRA 2GBLA 4K8OA 4LK2A 3OAAA 1E2DA 2Q3MA 2WBLC 2VLIA 5DISB 5KNBA 4CIDA 4XWAA 4DCUA 2BMFA 3N2IA 5BXQC 4LJYA 4CT4B 3AM1A 3K1JA 4LY6A 1SXJD 3TRFA 5EUQB 2ZRCA 2PJZA 5HCIA 1DAHA 5B2ZA 1KJWA 1KJZA 4Q1BA 3EZ7A 3HYTA 3PUVA 5L3QB 2ZRBA 1BYUA 1XXHB 3IIKA 3FDIA 2RGCA 5GADl 1FP6A 3B1VA 2GJSA 5TMPA 1TEXA 2ONKA 1AZTA 1ZD1A 1N6PA 2OG2A 1GSIA 1Z47A 2VPPA 3CH5A 4GMDA 2BBTA 4YMUA 3DO6A 1XD2B 4IDPA 3F3YA 4JBYA 4MH0R 3AVWA 2YC2C 4TTPA 4G01B 1K5GA 4GMXA 4C3ZA 5SZIA 1U99A 1KI9A 2OAP1 4LUCA 4QRHA 4B74A 4JLDA 5KTYA 5GJCA 1E2PA 2R2AA 1CXZA 2FPMA 5KO2A 3ADDA 2G1KA 3ND8A 4XWOA 1HE1C 1HYQA 1P73A 721PA 2OV2A 1R5NA 3W6PA 1OJLA 3CX8A 4RKFA 5EXXA 3HU1A 5IHPA 5AJVB 1HT2E 5AJXA 2JEOA 3OFND 4EPXA 1G6HA 2V7QD 3NDPA 2JLRA 2R6GA 4GP7A 3TUJC 3NHAA 2J9RA 4QBIA 4GI7A 3D31A 1AN0A 4MRRA 5JHHB 5JS7A 3P20A 4M53A 2GJAA 1D6JA 2QMOA 4TYPA 2WJGA 3R9IA 3B85A 3KUDA 2DFTA 2CCGA 1JBKA 2Q0HA 1G1MA 3BH7A 3RLFA 1DVRA 2C9OA 1KY3A 1L4YA 1ZC4A 2EQBA 3QXSA 4LOAA 1RRFA 5B57C 5EE0A 1P7CA 1Y3AA 2QU8A 4JYBA 3Q8XB 1VPLA 3KB2A 2I4IA 4NYIR 3GCGA 2FSFA 3FFAA 3THOA 1ZM4A 1UBEA 2B7CA 1PUIA 2QUZA 2B6HA 3CWQA 1G8HA 2C8VA 3BB1A 1U0JA 4UQOA 5TARA 1W4BA 3BH6A 5JECA 3LV8A 5J4LA 5DLQC 3BJIC 3Q85A 2VH5R 4B3XA 2H8KA 1DAIA 3EPHA 3CRW1 5L3VA 3VAAA 1QHSA 3AVOA 2LKCA 4XTRA 3U4QB 1VIYA 4TMVA 4R2IA 4HAWA 4GT1A 1X8JA 5F98A 1NJFA 1QHHA 4CEJB 2ZI7A 3LRPA 3HYRA 4LBVA 3W34A 2ZRKA 4LJ8A 1E94E 2GCOA 3SDZA 1R8SA 3R7WB 1OLOA 5JWRA 3IHWA 1Z83A 1JQLB 1WMSA 2C77A 3P27A 5HKKA 4NYIQ 3WHKA 2HCBA 4IVPA 3S1AB 2IXFA 2OLKA 2UKDA 4X8MA 3PVSA 2QGNA 3THXB 2YWHA 3PENA 2ZROA 5CJ2A 1GVNB 4JIMA 5HR5A 2ANCA 4PANA 3V9PA 2IXGA 3FYHA 4G5RA 2AR7A 3JZAA 1IY1A 2ZR9A 2IS4A 2Q3FA 4LRWA 3REGA 1E0SA 1N6NA 4ARZB 3QNUA 1MH1A 3K0AA 4JLKA 2J0UA 1CIPA 3I1FA 5FI1B 3TK1A 2R62A 3OEHA 2ZI5A 1NI3A 2A30A 1HTWA 1ZYUA 3GLIE 3RRYA 1NN1A 2W2VA 3PJRA 2IWRA 4JSTA 4O25A 2D2FA 2FSHA 1WF3A 2AD1A 3LQQA 4Q4JA 2GCNA 2QT1A 4Q47A 2EYQA 3WXMA 2QROA 2VYFA 4BFYA 3I72A 3NC1C 2GXUA 2NPIA 3PEUA 4MGKR 3IBYA 1G3MA 5FTMA 3H0KA 4XVRA 3MGCA 1NG9A 4AD8A 3LY5A 2ZSBA 2CE2X 2Z4RA 1EFRA 1QVAA 2ZI6A 3K9LA 2GJ9A 2W6JA 1TNDA 3KKMA 1YZKA 5EXSA 3CO5A 4P4SB 2V9PA 4TLDA 3EAQA 3ASZA 3NVAA 4HLUA 2I1QA 2RGDA 4URXR 4TZ0A 3QKUA 221PA 3IIMA 2ERYA 1G7CA 1TMKA 3RRNA 1GKIA 1YVDA 3QVUA 1NY5A 4FN5A 1G7TA 4FD2A 3B8HA 3GFOA 1KK0A 3KKPA 1A1VA 4KBGA 1W0KD 1E2NA 3GLGB 1ZNYA 2R9VA 3I32A 1BMFA 5KU1A 1TEVA 2ERXA 2ZS9A 2VSFA 4M9ZA 4TZ6A 1TQ2A 2OXRA 3O8DA 5KNCA 2P6RA 4Z51A 4G1UC 4M1SA 3CRMA 4Q1EA 2GWHA 3VX3A 4G5QA 5CJPA 1J2JA 2PLFA 1DAFA 3U3KA 1QHXA 4G0NA 2GF9A 5HE9A 4XVUA 2ZJYA 2ZYVX 5FBLB 3M6AA 1T3SA 3NEYA 2FWRA 4FI3C 3IEUA 1QHGA 5FOUA 1KI8A 2AFHE 1E2FA 3TW4A 5A4JA 4W7SA 1DBSA 4HAUA 4UXIA 2JLVA 2W6IA 2WWIA 2A78A 3BIFA 3MJHA 1S4QA 3NBYC 821PA 1Q21A 5JLJA 3SFVA 1XTSA 3ZS8A 1Z2AA 4AKIA 4Q7LA 5AR1A 3B9QA 1J8MF 3AQ4A 3QKSB 3GEHA 1KSFX 2WWXA 4AK9A 5JEDA 4PHTA 2JLXA 2VP0A 4W9MC 1OHHA 4W5WA 4BLOA 2ZU0C 4TL9A 3SC3A 4I1UA 4PSAA 2ZRGA 2NG1A 2V6JA 4JBXA 3O47A 4TT3A 2IYUA 3WMFA 1KJYA 1A82A 1MO5A 1QF9A 3U60B 1IN8A 3AB3A 5C46F 3U4QA 1II9A 3K0CA 2O8EB 4D4JA 2G0NA 2ZJZA 4G5SA 1P62B 2H18A 4HI0E 5P21A 1UPTA 1FQKA 3NBFA 1P61B 4M1OA 1U8AA 4M9SA 1Q57A 3R7WA 3IKJA 2FZLA 2IYWA 1G5PA 3GJ7A 4A15A 5HZKA 2GXAA 1T6NA 4PO1A 1MKYA 2VL7A 1C9KA 2V4ZA 3BAFA 3ZLJA 1Q1EA 1CP2A 3NHBA 3ZVNA 3THXA 2CL6X 3CBQA 4BLTA 3AV0B 3E70C 4IOMA 2KSQA 3SQXA 2DWPA 2W0SA 4BLPA 2NZ8A 1J99A 2JA1A 4PZLA 5DN6A 4ARZA 2CCKA 2WKRA 4LYFA 5JCZA 1FL9A 2ZRMA 5L3SB 2QY9A 2HYDA 1G18A 5KOYA 2VP6A 4HAYA 1XX6A 3AVUA 2O8BA 4ACBA 3WRYC 1S3SA 2QM7A 3LWNA 1A2KC 4A8JB 2BEJA 2QSZA 4Z1MD 1E79A 3QEOA 1KSHA 5D3MB 3SBDA 4Q7KA 2JLWA 2OCBA 5FBWB 4A6PA 4EKDA 4M2LA 2HYIC 1XCGB 1GRQA 3AVVA 4OHVA 1ZCAA 4DT1B 2FF7A 3BC1A 1CJKC 2VP9A 4C0HA 1YRAA 4B3BA 3WMGA 2HXYA 4DLUA 1ZMXA 1OKKD 2B8WA 4PZZA 2RGNC 3T15A 2ZJOA 1GP2A 2VEDA 4DUGD 1G8FA 2DFLA 5AK0A 3DM5A 1MO3A 5AUOB 1WQ1R 5A0FA 4Q00A 1ZM2A 1ESNA 4HLDA 2GKSA 3FKSA 2JAQA 4NYMR 1TU3A 3CONA 2ZJ2A 4P4SA 2OBNA 3K70C 4DBLC 3QF4A 1VG0B 1RRGA 3LQRA 4NL4H 2O5VA 2WWWA 1OXVA 2IYZA 2PZFA 1WBDA 1ZNZA 2JJ1D 4RCZA 3RS4A 2IA5A 1N2CE 3MRSA 2J5XA 1UKYA 2GBLC 3SU8A 2CK3D 1N6KA 1NVUQ 5EP4A 5FUXA 3SN6A 4D4KA 1OXXK 4YQFA 5EJEA 1PLKA 2D74A 2TMKA 3KJGA 3SJZA 4C0QC 3I61A 1C1YA 2PX3A 2A5JA 3T1OA 1T3HA 4NYMQ 2ZYUX 1KK1A 1PUJA 3HU3A 2B92A 1BYIA 1UEIA 4M21A 3CR8A 1GL6A 4KFSA 2J87A 1M2OB 2IXEA 2KWIA 3L82B 4K81B 4DZZA 3DMDA 3EIEA 1DAKA 3LBNA 3GLIB 1G8YA 4CVNA 2DWOA 4B73A 1NL3A 2KE5A 3MJRA 5FOSA 2GXQA 4CT5A 4MDEA 2C95A 1S96A 2NO6A 3G0HA 4LJ9A 3KX2A 3U3RA 1MOZA 1RC8A 3RVBA 2R6FA 3FVQA 421PA 2HV8A 3R9XA 1KHTA 3MMPA 4JSYA 3QKRB 2QEQA 3X1XA 3QKSA 2GTPA 1X1RA 4DSNA 3J81k 3SBEA 3UKDA 1R6BX 3CH4B 5LB2A 2YHSA 1R8QA 4BASA 1W0JA 2W83A 4OHWA 3CX7A 3THWA 3UG7A 3MCAA 4A2PA 5FTLA 2D3WA 1KAGA 1WBBA 4QG7A 2FSIA 2W00A 2JASA 3C14C 4ZI3A 4UXHA 3JVUA 2IYSA 2CHVA 1Z6GA 3KQLA 2G3YA 3BERA 3CIOA 2ZR7A 1U9IA 3IGFA 2JIZA 2VSXA 1D2EA 3L2OB 1X86B 3EC1A 2XGJA 5KDOA 2AKYA 4JLVA 1N6RA 1IN6A 4A0RA 2MMGA 1Z0IA 1ODFA 2AWNA 3B60A 1DO0A 3P26A 5CK5A 1OH7A 3GLHB 5JSZB 1SKYB 1T8UA 3BB4A 1VDZA 3LW8A 1YZGA 4RD6A 5JJKA 1XXHE 3ZD6A 1ZD8A 4CZ2A 1G3QA 5L3SA 3OHMA 2O0JA 2ZJ5A 1NBMA 1HQCA 4OHXA 2FE4A 4QJ4A 3G82C 3QXJA 4A8JA 1IOZA 2QZ4A 1FNMA 4BZQA 1E9BA 2QENA 3K8YA 5D3MA 2QE7A 3K9HA 2OT3B 3ZIAD 1UKZA 4DT1A 2ZANA 2R44A 5CYPA 4CEIA 1CULC 3SOPA 1COWA 1FTSA 3B6EA 4M0LA 5FFMA 1ZC3A 4DCSA 4C2TA 1D2MA 1N5IA 1NKTA 1EX6A 3K70B 5JWOA 5GJWC 4JL5A 4MDFA 1F48A 4BFWA 3E2IA 1KKMA 1MO4A 2AXNA 1IJFA 1N0UA 2XXAB 2JLZA 1QDEA 3JVVA 1R0YA 2VTKA 3C15C 4ZDKA 4WAUA 5CDFA 4TYYA 1G4UR 1FQJA 4PAOA 4IEEA 4ZV4A 3PV0A 4Q01A 4M4SA 4NCJA 3HJNA 4GOXA 2FJUA 3CKLA 3AVTA 3EWAA 1ZP6A 4MYHA 4F4JA 4PSKA 4TSFD 4ZPXA 3AH8A 2FEMA 2FOLA 4PQRA 1VECA 1OT3A 5EXPA 2WPDA 1UF9A 5LPNA 3X1WA 3U3JA 4EAQA 3IUYA 5LBIA 2JJ2D 2G9NA 1AGPA 3SFZA 1JPJA 3NEJA 1WB9A 3U3MA 4WXRA 4L4UA 1Z06A 2RGAA 3ZVLA 1FW6A 1SVLA 1FFHA 1VHLA 4W5HA 3ZJYA 1V5WA 5IDVA 2AFIE 4BECA 1XPRA 4B3DA 4JVMA 3PEWA 1SVIA 1GDDA 2CVFA 3ZH9B 3EG5A 1UEJA 1U98A 1KK3A 1ONBA 3BRWD 4HLUC 5L3RA 4AIIA 1N0WA 3Q5EA 2QT0A 2G6BA 4V0LA 2A5FA 1XB2A 3QKRA 4M9XA 1E2JA 1GRRA 2GAOA 1T5LA 2FNAA 1PJRA 1UAAA 3OE7D 4HZUB 4GNKA 4PC1A 4NCHA 5JI3E 2N42A 2ZETA 2IUTA 3ZS9A 4BWYA 1K5DA 4LHVA 1KK2A 1I2MA 3TW8B 3LXRA 4DLYA 1XJCA 3PEYA 1YR7A 2CNWA 2ECKA 3RSOA 2R65A 2WICA 4GBMA 2IL1A 3C4JA 3TE6A 3Q9LA 1F5NA 2XJ4A 1KDRA 3CNNA 5K8LA 1EWRA 5HTKA 1ZU5A 2F1IA 3RS7A 1BO6A 2EW1A 4A92A 1GZSA 2J3EA 2RHMA 4YDHB 2KI5A 2NO1A 3T1QA 5DHFA 1G7SA 2FDCA 1YZUA 3TVTA 2O0HA 4AYWA 4OK5A 1IQPA 1O87A 3LBHA 1E9DA 3THYA 1NP6A 4F38A 1M1YE 2HUPA 3LNCA 5JSZA 1DEKA 5EP3A 4BE7B 5AUPB 3IO5A 1MRSA 2ZE8A 4EFNA 4QGAA 1JR3E 1BOFA 3PXGA 3IDQA 3VKWA 4DLXA 3MD0A 1KMQA 3EZ2A 2ZUDA 1A5TA 2O8FA 4DSOA 1FNNA 4I81A 3VR2A 2WKPA 2JDIA 3K0CC 3QPUA 5F2EA 2BKEA 3SJAA 5JRJA 3NH9A 5LDDC 1Y63A 5DYGA 1NRJB 4IW3B 1N0VC 3B13B 2X2EA 3LX5A 1TAGA 4M1WA 1HURA 1OE0A 4HAVA 4LHXA 1U8YA 5FOTA 4FW9A 1UDXA 1UKVY 5GJVC 2CHQA 1TTTA 2D4HA 3TQCA 2VO1A 1SHZA 2C9CA 2XXAA 2AKAB 3SEAA 5J5CA 2B21A 4F92B 3B1XA 1GNPA 4JVLA 2C78A 3KB1A 1ETUA 2QN6A 4UNPA 4NP6A 1FOEB 2P3SA 2GDJA 3VR3A 3CM0A 2HJGA 4TQAA 3U6KA 3K70D 3TKLA 4LJ7A 3BFXA 3RRMA 2HEIA 4QL3A 2BMEA 2RCNA 4Q4JB 1GUAA 2AN9A 1GNRA 3MAAC 5JI2E 3MWKA 1NLFA 4O2RA 2WOOA 3QOFA 2A2ZA 4LI0A 1U0LA 1H8HA 1SXJA 3OIWA 3JZMA 4TMKA 5C1BA 1YR6A 4D82A 4LJ5A 5KHOC 3LVRE 3OAAD 1AQYA 2FX3A 3AKDA 4KSBA 1P2TA 4DLVA 5EZ6B 2EVWX 2F1RA 3HU2A 4P4UA 1JEEA 3VNUA 3QXCA 1EK0A 3WYAA 3GJ3A 1Q1QA 2AXPA 3W9YA 4QKQA 2Q9BA 1Z63A 4MGYR 2PT5A 4KYIB 4IKEA 4TWZA 2IYVA 3LAWA 5BYJA 5SZKB 2IEYA 4U00A 2V8OA 4YLGA 5ELXA 1W46A 3GJXC 2VP2A 2BBWA 2WMOB 3KJHA 3PFIA 3KZ1E 5H68A 3L0SA 3VTKA 5ANRB 4HLCA 4JLNA 3TSZA 3FOZA 1E99A 2XZLA 5JHGB 4Y0VA 1CTQA 5EUMA 3ICQB 3WP0A 3A37A 1KY2A 1ZINA 2WVJA 4HZUA 2ORVA 1NMYA 4TL6A 3TR5A 4YMWA 4Q21A 5LD2C 1J7KA 3T1VA 2FMXA 4LHZA 3FPAA 2OFXA 2PZGA 2ZVQX 2R6CA 3FHTA 4GRAA 2YV5A 1ZNXA 3GJ0A 621PA 2WIBA 3AVQA 1NBME 3HP1A 2WIAA 4EFMA 5FPKA 2BOVA 1HY3A 5JMTA 1CR2A 5TXGA 1NNEA 4V0OA 4ZCIA 4NBSA 3K0SA 5JJIA 1XEXB 5FUVA 3M1IA 3NTUA 1S3GA 4KFRA 4YMTA 4Q7JB 4MKIA 3U2QA 1Q12A 3M0EA 5HPYB 1Z07A 2QMEA 2E1RA 3DKVA 4LJAA 1KNQA 3FHOA 1SVOA 4QOSA 1SQ5A 4DB4A 2D2EA 5CK4A 3KKQA 4OI2A 1VMAA 4CRWB 2ASEA 3TJZA 4BFXA 3B7GA 4YMSA 1N6LA 2YJTD 5FI0B 4AC9A 3RS3A 1KO1A 1R7RA 3CX6A 4PXAA 2ZI9A 2YOFA 4EDHA 5CDFE 5H8WA 1GILA 5J4YA 2ZQ5A 1JI0A 4Q1DA 3PR1A 5DSZA 2GESA 4LYJA 1VCMA 5KYKA 1AKYA 2GXSA 3AUXA 4KHZA 3LX8A 2VHTA 2O8CA 4V03A 3A4NA 4BRWA 1U9IC 2EWWA 4HSEA 1W4CA 1LY1A 2WWGA 1XTIA 2PT7A 3QI2A 2IUSA 2N1BA 4HUTA 1KSGA 3AKCA 2ANBA 1OB5A 4AURA 1CU1A 5KPJA 1U0HC 2QSYA 4QNRA 2O8BB 1KO7A 2BBOA 3W6OA 5DGXA 1WP9A 4Q02A 4X8OA 4CW7A 1W2GA 1N3BA 3PQCA 5FUWA 3KTAB 3E1SA 5EE1A 4MYCA 2MSDB 4BLQA 1P3JA 1RJ9A 2J45A 4YMVA 1W2HA 4MKFA 3SHFA 1T4GA 2X77A 4J0QA 4S35A 1JJVA 3QE0A 1N5KA 3KFVA 1FMJA 3REFA 5F3WB 5CIWA 4Q1FA 2NZJA 3AF3A 3ND9A 1P2UA 4IVQA 4A8JC 4B76A 1ESMA 1HE8B 5G41A 2E87A 4KFTA 4B71A 2WAYA 2NPFA 1QG2A 3O8CA 4PPFA 2BJVA 4EUNA 2Z6VA 4H1UA 4A0GA 4N0DA 3AP1A 4LYAA 3D7MA 3GLFB 2ATVA 2ZR0A 1T0HB 2QMHA 4LPSA 2DY1A 1Q3TA 1KDPA 3MLEA 2V1XA 1G19A 1LS1A 1N5LA 3W90A 1LTQA 1JQJC 3A58B 4G5GA 1KMHA 2QAGA 2IYYA 2QQ0A 1MABA 1X8KA 2CL0X 2J1LA 3KJIA 3QXHA 5BQ5A 3QF4B 2ZSFA 3TBKA 2P6NA 1UM8A 2QTHA 1OH5A 1I4DD 3ZGXA 4JS0A 4LV5B 3ZYCA 2EFDB 2YVUA 4ON9A 4NZYA 1E1RD 2ZE5A 2W58A 3QEJA 4ZIRB 2RB4A 4NCNA 4MQBA 2XOKD 1CBUA 1E1QA 1VG1A 3GEEA 1Q1ZA 1G8GA 4RJLA 2OM2A 2F43B 4OK3A 5LD2B 3DEFA 1W0KA 2PBRA 4PAQA 4UKDA 1MO6A 4LBWA 4RZ2A 1VCNA 4LHYA 3KKOA 2YNMA 1I2DA 2BEKA 3T34A 4IHQA 2DFNA 4NTZA 2OUKA 5KPDA 3WP1B 3GLHE 4B33A 3OZXA 3U6BA 3ZD7A 1QRAA 2BHRA 1SKYE 4UXJA 1GL7A 3RSLA 1R5OA 4CF7A 3L8ZA 3H2YA 2A9KA 1TF2A 1WXQA 1TF5A 5TDHA 1NLYA 5DI3A 4TTQA 1G9XA 2Q3HA 4PPQA 1E2LA 4JLMA 2REBA 3ADCA 4AI6A 4PTLA 3DL0A 4N0EA 1GTVA 4YC7A 1XD8A 1QHYA 1DPFA 4QGGA 3WYFA 3CF2A 4A36A 2VRWA 4WA7A 5FPTA 1XEXA 3WBKA 2A3RA 3EPKA 3HR7A 4OI1A 2P67A 2YINC 4LV8B 5E3HA 2J0QA 1AQUA 2O8DA 1W1WA 2DYKA 4JT2A 4DCNA 3ADBA 1OYWA 2Q9AA 4I1OA 4OQXA 1LNZA 2NOAA 2OXCA 4B34A 5CITA 3PIRA 3R8FA 1E3MA 2F1JA 3W3AA 4B32A 2D06A 4OK6A 4Q9KA 3KUCA 1GIAA 1AIPA 1S2MA 2A7QA 2WJJA 3THWB 3LBIA 3PG5A 3KJEA 4YXWA 4PO8A 3MUFA 2ZITA 4KBFA 4Q9IA 2MSCB 4O3MA 1KKLA 3A1VA 3LLUA 4RZ3A 3EA0A 3SZRA 4GFDA 1NSFA 4QHYA 3RS2A 3EPLA 3UWKA 5E7JA 2GZDA 3DMNA 2C99A 3QBTA 2CLDX 3B9PA 4C0AC 3RNLA 3CPEA 1X6VA 1W36B 4POAA 3AVXA 4QFMA 1N5JA 1OHHD 3BXZA 1CF4A 4HB4A 521PA 2EFEB 1XMSA 3NBZC 1CKEA 3CRQA 2V6IA 1XCPA 1F3OA 3P1JA 4FMCF 3TH5A 2HLDA 1O3YA 5EE3A 3T06B 3UATA 2IX3A 4LHWA 1IXRC 2Y8EA 2VF8A 3QSYA 2RH5A 4R7ZA 2HXSA 1N6IA 1IN5A 3C16C 3B1YA 3RAPR 1AS2A 4CYMA 1OFHA 4KJZA 2WWYA 4G3XA 3C41J 2P5TB 3NH6A 3ZVMA 3BFKA 3KTAA 1AS0A 2AK2A 1KZGB 5AUQA 5IK2A 1SVSA 4TYNA 2GEUA 3PUZA 4TMZA 2P5SA 2WOJA 2BVNA 3O8BA 4Z1MA 1E2GA 4AY2A 3QUSA 3U3OA 1CR4A 1D5CA 1Z0JA 1PZNA 3W5IA 3TR0A 4CEIB 1ZIOA 4HB0A 5B58C 1IHUA 4FINA 2VF7A 1HEIA 1AA9A 2JJ8A 2RAPA 3NKVA 2FU5C 1PLLA 3GLFA 3CRRA 3LA6A 3P4XA 4HDCA 4TLAA 4DUGA 1E79D 3A1UA 5FR2A 3BBPA 3H86A 3WNBA 4EQ6A 3KXKA 2BIFA 4DDWA 4PAMA 2PZEA 4RFSA 2P0EA 2B7BA 2H16A 1IN7A 2BV3A 1WCV1 1US8B 4Q9HA 3SHWA 2QP9X 2CLSA 1XTQA 1KSJA 2ODNA 4IOKA 4PQYA 2FA9A 2OESA 3U7HB 4R98A 5J4HA 1GITA 3R8CA 4C0JA 1DS6A 2OE2A 2OZEA 1DO2A 3Q5DA 5DH9A 4TN1A 5JS8A 4ZIRA 1LS6A 1Z6TA 3FB4A 2ZJBA 3I92A 3TGPA 1Z6AA 3AGPA 5JWHA 1JR3D 2WWFA 1YR8A 3FKSD 2VQSA 2OEPA 2ZSDA 3K09A 4TLCA 3UANA 5CIQA 5BYKA 2C98A 1RIFA 3I8SA 2ODEA 2F43A 1S9DA 1ZBDA 4WBSA 1JALA 1P9NA 5E4FA 3HDTA 4GZMA 1RRPA 3UWOA 3H1TA 1SVKA 1RW4A 5M04A 2DFKB 4ACAA 2X2FA 3G5UA 2J46A 1SXJC 1KYIA 1ZD9A 2WMNB 3KQHA 2IEZA 3ZZUA 2WSMA 5DIFA 3DDCA 3WHLA 1EFUA 3EPJA 2QL6A 2ZRIA 3X1ZA 2JATA 2CXXA 2DCUA 1XDBA 2J7KA 2F9MA 5JRZA 4C30A 1LF5A 5AJWA 2XZOA 3KQKA 2GILA 3FFBA 1KGDA 1R10A 4ITRC 3T5GA 4RD0A 4DC9A 5L8VA 2BCJQ 2VIIA 4RVCA 1FUUA 5F9HA 1OF1A 3H84A 2BM1A 3N2EA 1JXMA 1SHKA 2HJVA 4OI4A 3OEED 4ZKEA 2YOHA 3CLVA 2GJKA 2JGNA 1UDWA 3KDSE 2PEZA 4D0GA 2G88A 2EWVA 3I5YA 3I8XA 2ZM5A 4IVRA 4OI0A 1JJ7A 3F8TA 4A2QA 1ZM9A 5FOXA 1ZNWA 2H92A 4UNRA 4MGZR 3BD9A 2FFBA 2CLCX 2QORA 5FR1A 3SNHA 2F9LA 3FE2A 3L43A 1R4AA 2QRNA 3BH0A 4S2EA 4LDJA 3B78A 2MMCA 1RE0A 2R6AA 2VHCA 4R2HA 4DEYA 3IHLA 5JFGA 4IEIA 4P31A 1OH8A 5F9FA 2SHKA 4ZI2A 4M1TA 4M22A 3AVPA 1KI3A 2ZRHA 1T91A 1NVWQ 4AG6A 5B30A 2VSOA 4U02A 1RKBA 3TSOA 3GJ8A 4AKEA 3THYB 2JLQA 3UXMA 2QP3A 3ADKA 3EX7C 4LJ6A 1Z0AA 1E4YA 4BRUA 3DVLA 3GJ6A 5CYOA 1ZRHA 1NLZA 1W7AA 1OXUA 5JBQA 2C9YA 1CR0A 3IQXA 4MKHA 1G5TA 1Z6YA 4D4LA 2ZXUA 3VHXA 4GOKA 2O8FB 1CLUA 1KI4A 3VKHA 1FTNA 4Q66C 4FWTA 1UADA 2XSZA 2ZE6A 1GAJA 4BEJA 3ZIAA 4XSHA 4IXNA 3DHWC 1ZVQA 4DEXA 3WYGA 4HATA 2OO7A 2P65A 4AKGA 5H70A 1Z5ZA 2GETA 5J4KA 3CZQA 4I1VA 2IUUA 3NIBA 1KI6A 2ODBA 3BS4A 4XD7A 2ZSEA 1YR9A 2IHBA 3ZZ0A 3B1ZA 2D62A 3FTQA 3L8YA 4WZBE 4DLTA 3QXXA 1H65A 4PPGA 2ZYWX 3B82A 4LJ4A 2WJYA 1P9WA 4Q48A 4ZCMA 2GHIA 4FMDF 1XFAA 3BWDD 2QM8A 2ZJ8A 3R20A 1US8A 2A5GA 2VBCA 1NN0A 2Q9CA 3TVDA 4DDUA 4DSUA 1G41A 3GD7A 5DO9A 1R0ZA 3WY9A 2DPXA 1T0JB 4HZIA 3ZDQA 1FZQA 3TIFA 1P6XA 3RABA 4F91B 4OYHA 2RGGA 2UVQA 3T61A 1XTRA 2QAJA 3F5FA 1NY6A 2IW3A 2DR3A 4JJZA 3RYTC 4UJ3A 3FMPB 1S1CA 1GOTA 1TX4B 3ZQ6A 1Z28A 3QG1A 1SXJB 2XB4A 4HAXA 2PMDA 1ANKA 1G7RA 3C7KA 4XVQA 5C18A 4RD2A 3BFVA 1U94A 4PC6A 1II0A 5TY0A 1YJ5A 4Z8XA 2QBYB 1H8EA 1EESA 1E9EA 3EIHA 4G5OA 1OPXA 2BWJA 3AUYA 4L5BA 2RMKA 2D7DA 4A0FA 4DJTA 5FBVB 3FMFA 3TUZC 1M6NA 1IJEA 4RSGA 3VKGA 5E7IA 1AK2A 1W5SA 2KJQA 2QAGC 4EPYA 1E9SA 2WPDD 2RGXA 2XNDD 1ZUNB 1Z6XA 3QPWA 4PQFA 2IHYA 2DHRA 4H1VA 2ZYTX 1WRBA 3BOSA 1Z0KA 3IQWA 4XSGA 4NPHA 4JJKA 1XEFA 2QI9C 2VA8A 3K53A 1IONA 1XTKA 3ECCA 4JVSB 1Q22A 1KO4A 2KBFA 1E2QA 3OE7A 1CJVC 4BPBA 1NJGA 3AKYA 4TQ9A 4V0KA 2FH5B 4MYTA 4EPVA 4L8GA 2NO7A 1I4TD 1NF3A 1TQDA 1PLJA 2G83A 3NC0C 5FL7A 1U81A 2JCSA 3DM9B 3KKNA 1XJ0A 1Z0DA 5BN4A 5AUNB 1GL9B 1ZM7A 2XTZA 3U61B 1OXTA 4D81A 1OFIA 1VTKA 1J70A 1P72A 1P5ZB 2I3BA 3U5ZB 3T1TA 3EA5A 2OCPA 2WWHA 2ORWA 4DHEA 2CNWD 2Q21A 1U2RA 2OLJA 2ZVPX 4D6PA 4EFLA 4IJMA 3AF2A 2IBMA 4E5UA 3SI7A 2OFOA 2HF8A 4UJ5A 3GLFE 2YWEA 4OL0A 3A36A 5HZHA 4WZAE 2ZAMA 4PX9A 1OSNA 4RZXA 2J0VA 2F7SA 4PSVA 1J90A 4C4PA 1E32A 4HEJA 2V3CC 2O0KA 4A9AA 2PX0A 4HUQB 1M7GA 4TMTA 1KIMA 3K0EA 1GWNA 1F60A 2ZRLA 4KYUA 2CL7X 2WJVA 4EPTA 1XU4A 2FN4A 2WSSA 2BCGY 4DLZA 3X1DA 3WNDA 1N6OA 3QF7A 1NVXQ 1LV7A 4FWIB 4QNMA 5JCPA 3KQUA 4AYTA 2O8CB 1W44A 1EFHA 4NCKA 4AWXA 2XJ9A 3VU9B 4MITA 3RHFA 4DDTA 3CR7A 3W5JA 1XMJA 2J7PA 1CS4C 3PUWA 2DBYA 3GFTA 1L4UA 1IBRA 4LCBA 3ONWA 4OJKA 2C96A 4UNQA 5AWFC 4PHGA 4D80A 2ZPTX 4P4TA 3T35A 2REOA 2EU8A 4ASUD 5D3QA 1EFTA 4DIDA 2G0TA 4Z8YA 3IIJA 3NXSA 1F2UB 1RJ9B 4D4MA 5DI9A 2GEVA 3SQWA 3LW7A 1P60A 4H9GA 4RFVA 1SGWA 1F2TB 4A0HA 2GK7A 2ZRDA 4X8HA 5E95A 2OFWA 2W2TA 3MWLA 1QHNA 2WHXA 4D26A 2O52A 4R71A 3BB3A 1OYYA 2OSBA 4BZXA 4PHFA 1S9HA 1RYHA 2QMUA 2XTMA 2YOGA 2BC9A 1GKYA 3MWJA 3FWYA 1SVMA 1RRCA 2AX4A 1E2MA 4Q4AB 4NMMA 3TUIC 4I99A 1KMHB 2QAGB 3QQ5A 1BKDR 4FMBB 1MABB 4IDQA 4M1KA 2QBYA 1CRPA 1UBCA 3ZQJA 4RZUA 8OHMA 1DARA 4EJSB 1MR3F 2ZJAA 5FTJA 1WA5A 1JNYA 1OB2A 1H8HD 3VX4A 1G5RA 3IILA 4Q4LA 4D0LB 2IK8A 4DCTA 2XZPA 3QPVA 4PZYA 3SS8A 2GEDA 2QTVB 3GPLA 2HCJB 3L0PA 3RRZA 4NONA 5EE9A 3QIAA 1JAIA 1NMZA 1DG1G 4KITB 4OHZA 5CB8A 2ODWA 2XITA 5JZVA 4V02A 1XPOA 3D3QA 2GVDC 1DOAA 1NVVR 1BIFA 4DVGA 2D7CA 4ZKDA 5DYIA 3EXAA 1FX0A 1OW3B 2REXB 2AD5A 1IXSB 1XEWX 3A1SA 3OFNA 5EP1A 5EXTA 4B3CA 1OV4A 2V7QA 2WV9A 3K09C 5FTNA 1PV4A 3CF0A 1E9CA 1ZJ6A 1E2HA 3P4YA 4R9UC 2BKUA 2G77B 5DI3B 2A5DA 3UMRA 1B0UA 3A4MA 3CWZA 4QBHA 4ZDWA 2YZ2A 3ASYA 4D2IA 2IYLD 4E22A 3K9GA 4GDFA 4IOLA 2I1VB 4RCYA 5CM8B 4B43A 3TQFA 2BBSA 2VHJA 1SVWA 3UIEA 1BH2A 4OQLA 4QGFA 4MGIR 1FP7A 2O8DB 4MA4A 1T3LA 5C2JB 3U44B 1NVVQ 1QZXA 4Y0AA 2IC5A
chains in the Genus database with same CATH superfamily
3DQPA 1NW8A 1SU8A 3KC2A 3Q7EA 2CNLA 3AR5A 3VQTA 2QP4A 4BLUA 1IN4A 1TVMA 1C1XB 2GF2A 2XOXA 2FLVA 3L5OA 2VNJA 4BB9A 1WZUA 1OFGA 1QS0B 1HUQA 3LXUX 3W79A 5DYWA 3RFVA 2DG2A 3RF6A 2FGKA 4PLPA 5EWJA 5KSPA 4JBIA 3U1TA 3LNTA 4KFUA 5KWIA 4F2DA 3TB4A 4WZZA 5BSMA 1LF0A 4HJXA 3N74A 3UHFA 3T12A 1WCWA 1E4VA 3DHVA 2FSGA 1VCIA 1ZDMA 2CKDA 2ZBGA 3VHLB 1P4HA 4WMLA 2JG3A 2WE8A 3R0IA 1FE8A 5AVZA 2XR1A 4OP1A 1VCOA 1NSTA 3CLRD 2X8AA 5TLSA 1ZJ4A 1IPEA 1KC3A 2XRMA 4YJ3A 1L5LA 1ZHFA 4Z2AA 2G1JA 3CVWA 4GBGA 2ZWOA 3IAXA 1NATA 4Y2QA 3LPNA 3F7OA 3FUTA 1U63A 4F56A 3PFBA 4ZEXA 3KK0A 5ES4B 5ALNA 2Z5LA 3I5XA 4RELA 2OAQ1 3HSKA 4CN9A 5DT9A 4FBLA 5EZ5A 2PUAA 1EVEA 3HCCA 1C3OA 2YRFA 3D8RA 1OX6A 4JB8A 2CEKA 1MRZA 4IQ8A 4OKSA 1V26A 1ZICA 3JZDA 3ANMA 5IM4F 3IIIA 4AJOA 1O4VA 4MIKA 3RIYA 4YWHA 5JAMA 1KFKB 2FUG6 4JYCA 4M60A 2ZREA 2HA7A 3DLCA 1U9YA 1YKFA 1C3LA 4RW0A 3WIVA 1JP7A 2ZZNA 1XNJA 3DTVB 4KO2S 1KTIA 3MCTA 3N70A 4P81A 3MTAA 4C3UA 1A5ZA 1YZTA 2ZU6A 4U9HS 4EAAA 2ZWMA 3TM5A 3AF0A 5KOJA 1XQ9A 3DW1X 1WE2A 3SD7A 2PD4A 2GJ8A 3OEHD 2YV4A 4UHKA 5CNMA 4BAZA 5JSHA 1WUIS 5JYEA 3ZE9A 1IAQA 2JI4A 4AY6A 4F6CA 5B1IA 5JQWA 3ET5A 4M9UA 4Q15A 3MJTA 1GRNA 3A2NA 2E37A 3QI7A 4TWIA 3ANXA 3FTCA 5FL3A 2RGEA 5DV9A 4F3KA 3JQQA 3TZHA 3NTLA 4GZ5A 4A8PA 3VDQA 3DA8A 2KBEA 4RFSB 2CZGA 3L4BC 1F8UA 3B3FA 2FV8A 2FEPA 4KMMA 3SF8B 1CJMA 1NKSA 3H1EA 4IDAA 3NBMA 3JD0A 4LNHA 4U5XA 3EGOA 2OZKA 1E0JA 3MAJA 3H16A 3N2LA 3QOXA 4RC9A 3WI7A 4RSMA 1N0HA 4BAGA 5KVSA 1J8VA 4R40A 2H7XA 3FGNA 3T4UA 3KSBC 1X7YB 1WKBA 1YZQA 2LCFA 4BGDA 3OA0A 3IDFA 1ZBQA 3KR0A 3FUVA 3QKIA 5I8ZA 4MW4A 2J5BA 3LKZA 3KXDA 3Q6IA 1EFRD 3NHFA 3LUJA 3QKTA 3IKLA 1G20A 1C81A 5DIZA 5ARBA 3GQBA 4U6NA 1YCFA 2I4LA 1DWUA 2RJ3A 4GUDA 3D7LA 4B31A 3DBHB 4LEIA 3RSHA 1PVOA 3MRVA 3G0CA 1BA2A 2I66A 2E55A 1S1MA 3DAHA 3MYRA 4CMIB 2OHIA 3GUHA 3S27A 3FR7A 2QDKA 1IZ7A 3K92A 1F12A 5FJJA 2NZ2A 1SULA 3L1HA 3VZQA 2DPLA 3S2IA 5B7NA 1JG1A 2ARKA 2A4KA 2JIOA 1LSOA 1Z4IA 3KAQA 1YZNA 4PHCA 1BMFD 1JLRA 5EMHA 4EO4A 4TTSA 1TDJA 4EGQA 4IXMA 1HXHA 2XEXA 1RQNA 4P34A 3GRRA 4ZYZA 1DEAA 1R2QA 1Q1AA 1PKEA 4ZDIA 2JIBA 1CUHA 1RKXA 4X7PA 3Q3HA 2YFKA 1U0NA 1FFYA 3OFSA 4MS1A 5LQNA 4CDGA 4IFTA 2H3HA 1XNGA 5DBFA 3MWYW 2YWGA 1JJBA 3CT4A 5ICFA 4YRZA 3R3WA 1YQTA 3V4LA 2JANA 4YAFA 3FGZA 5JCJA 1EXNA 2KB0A 1GPJA 4ZCLA 3UMCA 1TD1A 4CLOB 1E1KA 1ZVJA 2BRUC 4W9NC 1F6BA 4CDMA 3BZBA 3F3MA 4KR0A 1M66A 2RHGB 2HI0A 4GI3A 3E7PA 1NUTA 4I14A 1VJDA 2RE8A 2IOYA 5DBEX 1RXIA 1J97A 2WM8A 1W4RA 1FLDA 1ZIXA 4AZTA 4D25A 2R8RA 1P75A 1XPUA 2CUZA 3VR4A 2P9JA 2PO7A 3D5QA 1T1JA 3UF0A 3L7NA 3CNOA 2CFSA 1M34E 4EYKA 2FPKA 2W37A 2F59A 3I9KA 4FI3F 3BWXA 3CSUA 1S7CA 4BNLA 4ZAFA 4QJ3A 3LBFA 4JL6A 1G3RA 3C5CA 2P8JA 5CVJA 5CA0B 2QRPA 5LXTA 1ECJA 4C2UA 2HW8A 3RVNA 1UBOS 1H0KA 3BXFA 1V37A 4KQ1A 3HR8A 2FPGB 5EYPB 4HTFB 1HQYE 5FO0A 5H3HA 4YB8A 5IF9A 4R7TA 4CEJA 4L0MA 2C57A 2RJNA 3E6AA 4DIEA 3HGTA 2AB0A 4IZOA 5B64A 2MYPA 2HF9A 4CR8A 5E6UA 2N1MA 4JVNA 4WY5A 2B2CA 2CHGA 2VHXA 1K7CA 2FOXA 4FDAA 3S1AA 3V7YA 3OZUA 4BZPA 3E61A 1Q0UA 4U7DA 3VSBA 4MHTA 3QKWA 3INNA 2NVBA 3WKDA 3ZDBA 3L0YA 5EWLB 4BUJA 3FPCA 1NX9A 1WD7A 2SKEA 3AP2A 3LWDA 2CGEA 3I4FA 2NTYC 4IDDA 2W2KB 3I9NA 1KJNA 4ZCQA 5EMLA 3U81A 2GEFA 3M1LA 2JAOA 1T1RA 4QBGB 2J0SA 4ZOLF 3WQSB 3QX3A 1KI6B 2CBGA 2PHZA 4XM0A 4RA9B 2GS9A 4PPNA 2V4UA 2EHDA 4BFVA 3ZI0A 2GRJA 5I7SA 4NBKA 2NO5A 2IZOA 4DBZA 3NQ41 2DKNA 1EM6A 4O0LA 1IYZA 2HU2A 3FF1A 1KP9A 3L49A 4AZVA 1IQ0A 4AZWA 2XQIA 4EPWA 2H59A 3B53X 3GVCA 4Z7QB 3W3ZB 2IZZA 5KAPA 4RKRA 3SP1A 1VSUA 2B4YA 3I01M 1OBHA 2K87A 4LXHA 4OQMA 3RAGA 4B2IA 1F8GA 5DE3A 4IQGA 1XZJA 2OCAA 2JJ1A 5EEGA 4DLSA 3ZNPA 3IHKA 1E9RA 2B0JA 4D9BA 4F4IA 4PCVA 5BRNA 3H3XA 4GMGA 3C4QA 5IH7A 1ST2A 4Y2TA 3TF5A 2GCGA 2EKLA 1BS1A 2ENWA 1UZUA 1O58A 3CLHA 1NWHA 4AY3A 2UZ3A 3AV3A 2GEJA 3GH1A 4LOKA 3PFFA 1BHQ1 1V5EA 1KMIY 1Z4MA 2P9TA 2XNSA 2Y0EA 4P80A 3LU1A 4L57A 4BFSA 4BFUA 2D4AA 3RSGA 4NOMA 1YO6A 1XMIA 1ZJ5A 4KL8S 5FYDA 5SY9A 1JAHA 1L5HA 5DVZA 5HIAA 2ZSAA 4MUXA 4CF6A 2AYZA 4D3SA 3EW9A 5FNVF 2H17A 4KCGA 1A04A 2GN1A 2YUTA 1MT0A 3WLKX 3VNVA 2X0NA 3G7NA 4JEHA 2IHJA 3G85A 4KX3A 4NESA 2FZVA 4WKOA 5KCZA 2NO0A 4KVAA 3S81A 4NPCA 4OJQA 4M8NE 1PEKE 5JO0A 4X5OA 3SYTA 2WLSA 2YMPA 3TMKA 5JY1A 1UOOA 3L7JA 3OIUA 1E3LA 2CC2A 5AJHA 1QZ3A 2ZJFA 3SZMA 4DCJA 2VTEA 3CW2A 4FMCB 1RAIA 3KXIA 2P2YA 4C6RA 4YWJA 3SYRA 5LNK6 5CB6A 4N18A 4YIHA 1CD5A 1NRWA 1MGOA 1DJQA 3ROGA 1TPZA 1UDCA 1RM0A 3LH5A 3QTTA 2VTBB 3HDYA 4C0XA 1NXWA 3L05A 4OL9A 4LC0A 2Z2XA 4LC1A 3OOYA 1DEXA 1CQJB 1V8OA 1TCBA 3L6BA 2YXLA 1O9BA 4LZZA 4US0R 3E4CA 1T0UA 1YS9A 2WA1A 4O63O 5ISMA 2PXCA 5FPYA 4XIFA 3T1HB 1J42A 1J8YF 1MPTA 2FB9A 3OLXA 2PUVA 3N2GA 2NSJA 4MRSA 1NXXA 3IYLW 4O2LA 4RHFA 4DZTA 3ED1A 2I99A 3HDJA 2YC4C 2Z83A 3OC0A 4EYOA 1UPFA 1VBMA 1XF1A 2ZRPA 3QBVA 4M1QA 3SC6A 1EJ0A 4MRPA 3O4RA 5HF5A 1ACMA 3HJBA 1D09A 1SCNE 1BN7A 3WHPA 3HL0A 4CHTA 4G86A 2IDJA 2YDYA 1LK7A 4DCPA 1Z36A 1U0RA 1KI7A 4N3BA 4DWOA 1DHRA 2OTCA 3KQNA 4WKCA 3TIGA 3KSMA 2SCUB 4U7HA 2J5KA 3CW9A 4MUGA 1PL6A 3I9V6 3DZDA 4J3JA 3SJBA 1EJBA 3ZZMA 5KTSA 1P9OA 3MCUA 3I9OA 4E09A 2GNOA 1JEQB 3FOEC 4Y2SA 1FMLA 2V7BA 2BZSA 2QPOA 1XHLA 2CV0A 2R1TA 3G5MA 4KKXB 2JIZD 1O94C 3EMBA 4EY6A 2PN1A 4K9MA 4OHYA 2IU6A 2W6ZA 4P4NA 4W7IA 1N77A 1SZPA 4H0NA 3L02A 3Q7IA 1W4ZA 4WCFB 3C74A 4CKCB 2Q4OA 3CEHA 4X94A 3R41A 4D5EA 2Y1KA 5I7AA 3PHCA 4Q3EA 4JLOA 5B3JA 1ZAKA 2QJRA 3PQ3A 4BCBA 4NV1A 5LYJA 3AVWA 1SQSA 4NYJR 3ZDRA 4DJ5X 3IELA 4HX2A 4NVRA 3GVXA 4JY7A 2C07A 2NUBA 3AIIA 4N5DA 1OWOA 1NPDA 2FHPA 4OXRA 5G3YA 4HFRA 1NBMD 3I1JA 4US1R 1H1LB 4CM8A 3QWAA 1RLTA 2HCRA 2I4MA 4H3KB 5KEIA 4DUYB 4M1MA 1G9TA 5EZYA 4GX2A 2XWQA 1NF2A 3T5DA 4DG9A 4DR7B 3D2CA 2Q1WA 4KR3A 1Q20A 3NRBA 4CM1A 5LP6A 1IN1A 4FEYA 4L78A 4IGKA 4GL4A 1RXSA 4XCXA 3WRWA 4DXAA 5IZ4A 9MHTA 4MW6A 1COWD 2PEYA 3IQDB 2OA0A 1YHYA 4A5SA 1NVBA 4GQIA 2WTUA 5HOQA 2VDKB 5DW0A 3HA5A 2CNBA 3HP7A 3OCWA 3UJCA 4BYGA 2PX6A 2PQ0A 2O1SA 2P27A 5GM1A 5A06A 1D8TA 1XMQB 3EARA 1RAFA 1UFVA 1KVQA 4HWRA 1T43A 4IQ0A 1E3IA 2A67A 4NYJQ 3DOFA 3WK8A 4JEUA 3OIYA 5F52A 1M5TA 2EJTA 3R5XA 4MEBA 5E4TA 6ADHA 3CUVA 1G17A 1WMEA 1XXLA 3KUXA 3QY0A 4NFYA 3WMXA 3RI3A 3QK7A 4KVGA 6CHYA 1BEUB 1X8LA 2WQZA 2RAUA 2XI4A 3NDJA 4CIVA 5KYWA 4L3OA 3R3SA 4UTZA 4Q9JA 2O0MA 1QDUA 3WISA 3IB6A 4TSRA 2F1HA 2QPTA 2WUDA 2R6DA 2I6GA 3LZ6A 4CCYB 5LZ4A 4XLLA 4JJ6A 2RIRA 5DGTA 1HLFA 3S70A 3ZY2A 3V6LA 5CTJA 5ADWA 1Z8FA 1VB3A 1VI6A 1DE0A 1YR1A 4KDCA 3TBFA 4CM5A 5IT5A 4O1MA 1GTRA 4CGZA 1YTUA 5I3CA 1LWNA 1DV2A 4URVR 4FFMA 2X9VA 3S2SA 4RTQA 3DPUA 3H9GA 1OWMA 1QOZA 3CF6R 3KHKA 2C29D 1JG4A 3CRVA 2XTNA 2PH1A 1LBIA 4QBKA 3WA6A 4DQUA 4BNVA 2H65A 5ALUA 2NYVA 1XZIA 3B2EA 4L7QA 2VAWA 3U19A 4AY5A 4I4TF 4ZVRA 2TMYA 3OWHA 1BDIA 1FX0B 1I36A 4QJBA 2M2IA 3DE1X 3PQDA 3U5TA 3N2KA 3N5CA 2QZ9A 4FGKA 5BP7A 3GLKA 2HT6A 4RTJA 2AZXA 1RJEA 4JKYA 5JBNA 3IP1A 3UGJA 1M1NA 4TLLB 2G28A 4Y9UA 2FR0A 2Q4TA 1IBSA 1BCRB 3U9LA 4MAAA 3FOFC 4WHMA 2QUKA 4US2R 2B1IA 5HEKA 2CE7A 4MS4A 3IPXA 3ZW8A 3NHKA 1MC4A 1TF7A 1O96A 2G9QA 3R7NA 1BE8A 4N03A 1X1CA 5JVDF 5C4MA 1XVUA 3DSRA 3HEAA 4RMJA 2UZ4A 1B2LA 3LUCA 1FU7A 3MGAA 4OSPA 4EG6A 3RYFA 4F7WA 1TJPB 2AJBA 4I46A 4P3KA 3CN9A 1LLFA 2H9AA 5BY2A 4DNPA 3VR5A 1ZIDA 2XGOA 1G291 5CAEA 3OF5A 1XQ6A 1U4OA 2X19A 4HB2A 2BE7A 1L5ZA 4N3NA 4E5YA 1NXSA 1EZ4A 3U3ZA 1XKLA 1QQ6A 1RRVA 1D9XA 1XHEA 3IC5A 4LY0A 5TMEA 1SRRA 2QGZA 4DLWA 1W4AA 4DB2A 2HDNB 1TYEB 1ZL0A 1SVUA 4FMDB 3C3DA 4NU6A 4TL8A 2I91A 3R3YA 1UMCA 4IIYA 1FEZA 1DTWA 1DC3A 4V2UA 1QOQB 1AQ6A 3GJZA 3OZ7A 4WXPA 1EJ6A 2WWTA 1PI3A 1Z37A 1G64A 3RNOA 3NALA 2DPHA 3BM5A 4MUMA 1TCVA 5BN5A 1E3EA 5EIOA 1YRBA 2CVPA 4CFZA 2A9RA 5KJ1A 1CNEA 4LVUA 2W2OA 2BT4A 3IPYA 3MILA 1NVDA 4IJ5A 4M1EA 4C04A 4EHBA 5KNCH 1M6YA 2VRNA 3FHCB 3ZWQA 3NBQA 3H9UA 4M8SA 3KKEA 4GBED 4BX2A 4K40A 5AVYA 3PUXA 4ES6A 4EX7A 1QIEA 1AG9A 4YJ3B 4ONEA 2EW2A 4ZYTA 4R51A 3WGHA 1TJ3A 4JN6B 3PEEA 3Q88A 5CDTA 3EZNA 3V2GA 3T9DA 1YS2X 1FDSA 2DBQA 2JGDA 4IDOA 5CA1A 4NSNA 1TQ8A 2G06A 4ND5A 3GOHA 4D98A 2A1UB 3GXOA 1AU9A 1ZA2A 4GL2A 4QDKA 4OB7A 1NI4A 1V7QA 2AEJA 3EWNA 1Y3HA 2BFBB 3GRKA 4Z9XA 4P5EA 1C3OB 3DPIA 5DU2A 3TIVA 4B45A 1C3EA 2GCOB 2YS7A 2FPLA 2JDID 4M46A 3JAWB 2WSSD 3ZV6A 1W48A 3K9NA 1CRLA 5ITVA 1RYDA 3EOAI 3OX4A 2PGJA 4HLNA 4HXGA 4MYRA 1Z73A 5DNEA 1I6MA 1ZVKA 4ASUA 3VR4H 2NSDA 2FPXA 1L2TA 1TUIA 2P90A 1WB4A 3LMKA 1G3UA 5TV2A 5AQ1A 1VXOA 2YCBA 1EE2A 3TNFA 3ZDDA 1E69A 4YRDA 1TZMA 3PFGA 4DA6A 2NQ2C 2J7PD 3G2OA 4IQ4A 5CBKA 4RPLA 4HRAA 1IL0A 1SCKA 2BGLA 2XKBA 1N2XA 4C29A 5KOJB 4RPKA 2E5LB 1MIOA 1DAMA 1PFUA 2O2XA 4L3WA 4H1HA 2H1RA 2JPDA 3HACA 2VSNA 1FMTA 3S2EA 5J58A 3O8RA 3EVFA 3AB8A 1UBSB 2JHFA 3CN7A 3WLRA 1G2OA 3BJMA 3R3ZA 3SQLA 4CNQA 1XQXA 1N7GA 1FQWA 3NORA 4I1SA 3K5PA 3UHJA 1M5UA 3EISA 2HF2A 4PLVA 1XEWY 3Q3EA 1LPSA 5EGNA 4FC7A 5ALDA 5HNKA 4C0WA 2WAAA 3QGMA 1YIDA 4Z4CA 4RLFA 1K8XB 1UFRA 2E4VA 2Q3MA 1ZH0A 4M54A 1QG6A 2G72A 3PJEA 4DCUA 1DINA 2NTVA 1CQPA 2BZ0A 5JADA 3LRTA 4CTKA 3O8NA 1WZ2A 3UA4A 3K1JA 4BAUA 3IEPA 4LY6A 1SXJD 2ZRCA 2EQAA 4QE3A 3CXRA 4JQOA 1KJWA 5B2ZA 1FYEA 3EZ7A 2NQTA 3HYTA 3PICA 4BHTA 4G0UA 2ONYA 1BYUA 5EKDA 1NP7A 2J5RA 3FJOA 3JQGB 3MF4A 2RGCA 3GQBB 2OFFA 1VMEA 4L9AA 3C6YA 1N6PA 1U7DA 1ZY2A 4PWYA 2FUNB 5FHQA 1CY8A 2L69A 2G4LA 3TB6A 1QE0A 3KG2A 4XWOA 2PZ8A 1RM5A 4AO8A 1YOVA 2NVWA 2BH9A 5EJGA 4TTPA 4G01B 3U9TA 5F77A 3WK7A 3P96A 2MU1A 1CC1S 3H5TA 4HN9A 4ENQA 1X1TA 3HJAA 4B74A 3ONNA 4JLDA 5DDIP 2W48A 2R2AA 4KO4S 2ZAYA 1F8YA 1CXZA 2NSHA 3ADDA 1E3JA 3QMMA 1B4DA 1MJFA 2G1KA 4NNJA 5KKAA 5CLHA 4NZPA 1UDAA 4J29A 5BNFA 3KU1A 4F9GA 3MJFA 4TV9A 3EF1A 1PW7A 4RKFA 1GV0A 5CEJA 1DJOA 1VOTA 5EXXA 4AP9A 1HT2E 3URMA 2EF1A 3A11A 3K9WA 5HGXA 2RARA 1Y3CE 2DGDA 3L8MA 1VM6A 5GY7A 5J1TB 4DSZA 2MSWA 1XLVA 3Q3IA 3CLTC 1N34B 4EO9A 4QBIA 4DABA 5AP9A 1CZOA 4HFMA 4CUKA 3P20A 2M6SA 2VYVD 2DBZA 4MV3A 4PX5A 2IHVA 3DV9A 3NYRA 5I9MA 5I7HA 4G97A 2P4QA 4MQEA 4D4HA 2P9GA 3I5AA 3F6RA 3PRYA 1Y7IA 1Y98A 3VA7A 2CCGA 1JBKA 3EAGA 1G1MA 4GUAA 2PSSA 4NQZA 1DVRA 3RLFA 1MV8A 1L4YA 3ON5A 3TEMA 2EQBA 3NUGA 3UW3A 4EJ6A 3A27A 3OI7A 5A2QA 4LOAA 3WAGA 2QSJA 3DHNA 1N2CA 2FWPA 5B57C 4XI9A 5EE0A 4RZHA 4X7MA 5JV5A 1F20A 4IICA 2PD3A 1Y3AA 4K6KA 4NYIR 2I4IA 1DKOA 4K28A 1MVLA 4KTVE 2APJA 2OMEA 3FPLA 5IABA 2H9IA 1UBEA 2FUEA 3AEUB 4C7VA 2AG0A 1V1JA 2B6HA 2QUZA 1WS6A 2XWSA 2X9LA 2HU5A 3O2QB 4RK1A 4EFDA 3IRUA 2Q0SA 1RRMA 1E58A 3RS9A 3T5AA 1EP1B 4JOSA 4EEKA 1SXQA 4KP7A 3LV8A 3L6CA 4ENVA 5J4LA 3ID6C 2VH5R 4C06A 5A4FS 4YV0A 2HMUA 3R4CA 3EPHA 2Z3ZA 3LYLA 5L3VA 3AVOA 5LXTB 2LKCA 2R79A 3DH0A 3EDRA 3KVNA 4XTRA 3U4QB 1VIYA 4TMVA 1AK1A 4HAWA 3GUZA 1HDIA 1X8JA 1JHUA 1NJFA 3EB9A 5J2TB 4CEJB 3B6MA 2H7CA 3CLSC 1R37A 3HYRA 3W34A 3NVKI 1T5SA 2QG4A 2IP1A 4IGEA 2X5NA 2FWJA 4LJ8A 4OHMA 4Z9AA 1OLOA 1V16A 2UYQA 4MVJI 3AK4A 5AVXA 1Z83A 3H1AA 4MHSA 4V38A 2AOUA 2ZTMA 4NAVA 5JZSA 3Q9UA 3EEIA 2DX7A 2RB5A 1EUDB 2HDHA 2VQDA 1EPUA 2HCBA 3EY9A 3MRXA 3QPBA 4QUBA 2CYBA 5AOAA 1UQTA 2FQQA 2QZJA 2XDQA 2ZR8A 2QLLA 1B0AA 3N8HA 3L6EA 1IFXA 4ZD6A 2AEEA 1MP0A 3QVXA 3FYHA 2AR7A 2ZR9A 3VVMA 2WTXA 4L4ZA 1E0SA 1N6NA 2C4UA 2V58A 3OJWA 3ZWPA 4BNIA 1MH1A 4G8DA 5B3JC 1CIPA 1WPRA 4HRXA 3TK1A 1VL2A 2R62A 3OEHA 1G1AA 4HR7A 4C07A 4IS3A 1NI3A 4HN2A 4MP6A 3L7YA 4MEJA 5T8KA 3JYPA 1X14A 2GT1A 1KRHA 5JE8A 3A6EA 3H9JA 2FFJA 1Z0ZA 1CDDA 3L40A 1GR1A 4ALLA 3TTTA 2R84A 3MNFA 3RRYA 2VDWA 2W2VA 1Y8QA 1EE9A 3IMFA 4U7JA 3ZBQA 4I4IA 4EHHA 5AI4A 2EFJA 1EDBA 4JU8A 3P19A 1NR7A 1RWPA 4RIHA 2JB9A 3ZKAA 3VNQA 2FTKE 4LF6B 2NPIA 4MGKR 1M1YB 5LP6C 3H0KA 1JDUA 3IESA 1NG9A 4X1KB 1JTFA 5H16A 1TAQA 1POWA 1YNSA 1ZMTA 2V65A 3LY5A 4KIGA 1ONOA 2CE2X 4DC1A 2H2HA 4D41A 1EFRA 4OGFA 1MQ9A 1JMYA 1U7OA 4QRIA 3K9LA 5CX1A 5EXSA 1YZKA 2F9FA 5CG2A 1Z5PA 4NZOA 1FTWA 2Z9BA 2ZB4A 4G1MB 1IK4A 1GTJ1 2BM8A 4TLDA 3NVAA 4N41A 2KHZA 4HLUA 2RGDA 2GK4A 4FFOA 2DTDA 2V6BA 1KKUA 4AXXA 4YAIA 3SGLA 2LUOA 4TWBA 1L5HB 1G7CA 3AONB 1TMKA 3RRNA 2ZYAA 3ZC3A 1GKIA 1EE1A 3IQIX 3NHSA 3DMGA 3RARA 2C59A 3HO1A 1NY5A 5U1PA 5BWBA 5IVHA 2XE7A 3G8BA 3KKZA 2NW6A 4QTUB 3JVEA 1HFWA 4QYTA 1PZHA 4RGQA 1GT6A 3U7JA 1YDFA 4DRXA 5AVTA 2JKYA 1E77A 1KK0A 1TW3A 1TIBA 1OWPA 4CMBA 2R9VA 1ORIA 1OZFA 5K6RA 1BMFA 1BMTA 2XMPA 1IB6A 2AOVA 1ONNA 3CKYA 3JWGA 5I8PA 2YNMD 4R8MA 4TZ6A 1K1EA 1TQ2A 2PLAA 2WFZA 4UVGA 2OXRA 2O2EA 2X0RA 2YQ5A 1Y3IA 3CRMA 4IMPA 2WQ7A 1JDVA 1B16A 1OAKA 3S5UA 1CQZA 2GWHA 4G5QA 4K9OA 1J2JA 2FCAA 5CJPA 1DAFA 4YO8A 3CKKA 2YMMA 1QHXA 4ZZIA 2BI8A 4PU0A 4OQDA 3TKAA 3VJRA 1GGMA 3ZNQA 2IGTA 3UK2A 4R8KA 5FBLB 2JGIA 1KH3A 2FWRA 2HJRA 4KQKA 2E4YA 2Q5LA 5CB0A 4IILA 4PX2A 4ZAYA 5G0UA 4X60A 1Z12A 5HUHA 1KI8A 2AFHE 2VCHA 3PJGA 2XUGA 2M6KA 1AH2A 1BDMA 1T36B 3AR6A 4HQFA 4HAUA 3UOAB 4UXIA 3N2GB 10MHA 2JLVA 1DQZA 1LBTA 5IF3A 2P9YA 4D6YA 1Q21A 3BMQA 1VRCA 1Z2AA 2QLBA 4Q7LA 4E3WA 2X5JO 3NXKA 3AQ4A 1JVNA 1OA0A 3GIDA 4PO3X 3LIPA 3RC9A 3CRZA 3E9YA 2KW5A 4JBNA 4O2BF 3X44A 1T15A 2H5LA 2HYIC 4PHTA 2C8KA 2VP0A 1OHHA 1L7AA 3KOWA 4BLOA 4NOKA 4F6RA 3PQ4A 2W6CX 2DR2A 4DCMA 3GPDG 2GO1A 1OZHA 4YRLA 1YBFA 5SYNA 3B8EA 3V7WA 3U60B 1NJ2A 4UCWA 5E0KB 1IN8A 4DAEA 4UZSA 1KP3A 3ZCXA 4D8UA 3VZPA 4DA0A 4HI0E 1J24A 1UPTA 2DTXA 2R1TB 4K03A 4ZQFA 1FQKA 2GN9A 3G2KA 1U2QA 1U8AA 4EGSA 1KF0A 1LZLA 3R7WA 3IKJA 2FZLA 1G5PA 1Z13A 3I37X 1K8QA 1ND6A 1H05A 5C8DA 1MAVA 4PO1A 1PJTA 1MKYA 4HN4B 2YIJA 3GC6A 1E4EA 5A7HA 3FYSA 5JSFA 1M8KA 3THXA 2CL6X 3VR5H 4K2HA 4Q05A 2X86A 3E70C 4IOMA 5LYJB 4AWAA 2Z2YA 4MO9A 2WB2A 1O03A 1P29A 4UM8B 2I2WA 1JTVA 3HY3A 2YTZA 3R6DA 4J6EA 4QUEA 2NZ8A 1G6Q1 4M0KA 1UL1X 3GYGA 3KLNA 3R7FA 4IYRA 5ARDA 4ARZA 1QZUA 4ER5A 4Q6WA 3JWPA 2J85A 2ZRMA 2O8BA 1YI8A 4WLFA 3DDWA 3ESAA 5JD6A 3JQAD 1GARA 3ORSA 3WLSA 1BWQA 5IW8A 2IYOA 4WK2B 3OQJA 5EZYB 3GU3A 1Q16A 1N2ZA 1E79A 2IHKA 1KSHA 5AK5A 5FBWB 4EKDA 1DDIA 4YJ2A 4OHVA 1WABA 3NT4A 4OXIA 3AVVA 5BW6B 3VR6D 1CQIA 3QFSA 1NBEA 2HHLA 5BNWA 1R1DA 2VI5A 4JFAA 4DLUA 3SKVA 4BBZA 1FBTA 5IDQA 3E9ZA 1QTIA 1NW6A 3G88A 3QUAA 2B8WA 5SYMA 5IN4A 1QP7A 1QF6A 1KYQA 1JLMA 3G9UA 3W4JA 1M0WA 4UNIA 5C4IA 2ZJOA 1SXHA 4O4IA 1OBCA 2VEDA 3S5JA 3ZHBA 1G8FA 3R5TA 3WFIA 1BWPA 1KQGA 3JVIA 5EJMA 4PBRA 5TT1A 1NVFA 2HZ7A 5A0FA 4O33A 2XDYA 4C6SA 2LCQA 4CBVA 2Q3LA 3LFHA 4I4NA 7ADHA 4OV6B 4J6FA 4JI4B 4P4SA 1OUMA 2Z5VA 4DBLC 2Z95A 1XZFA 5CT6A 3OT4A 4V0SA 4YRSA 2VJKA 3ONDA 2HRQA 3T5TA 2WEKA 5ULLA 2XEDA 3PDJA 4ARIA 4PGHA 1VIVA 4G56A 2IYZA 4MDYA 4UOZA 4J75A 2OPBA 1A96A 2GHQA 2JFFA 5TF4A 5MGNA 2HTEA 1W75A 1N5DA 2V5VA 2RI1A 5BV1A 1GPYA 3BVPA 2JJMA 2Q5IA 3BDAA 1N6KA 2MYNA 5EP4A 3TI9A 3D3NA 4ZYUA 5HGJA 2VN8A 4UEOA 2VJOA 1SKUA 1NLMA 1PLKA 4JGBA 3O8OA 4DMFA 3HNOA 1P4JA 3E7WA 2H08A 4R1QA 3VI4B 2EATA 3BE5A 3GEDA 1UEIA 1GL6A 1ATZA 1OI4A 2IXEA 3LIIA 4K81B 5ALXA 3O83A 4FX2A 4ZRNA 4DZZA 1CRPA 1G8YA 3N87A 4AJ4A 4CVNA 5K03A 2DWOA 2Q6LA 2GASA 1NFFA 4S2UA 3T1YB 3MJRA 2YFHA 4KE8A 3I42A 4CT5A 2AG8A 3A32A 2NO6A 1J20A 4H1TA 1IZYA 1RKVA 5DN9A 2W42A 3QITA 4EHLA 1QQ7A 4MS4B 2ORYA 2R6FA 1KHTA 4CGYA 3MMPA 2AOXA 1KGSA 3WLMA 1DDOA 4RESA 2AI3A 2MYUA 1ULZA 4RM2A 1HRDA 2UUOA 4R1SA 3P2YA 2HRRA 4DSNA 3G5TA 1EFDN 2AUNA 3V1MA 4EVSA 1ZGJA 2O48X 5K3DA 1U0BB 2OC4A 1I5EA 2W71A 2I34A 2Z3VA 5CAEB 4NJEA 2DJIA 1X87A 1UODA 2SKDA 3UG7A 3MCAA 3A14A 4A2PA 5FTLA 2D3WA 1X9IA 1FRNA 1V5FA 2EOAA 3JQEA 3ER9A 4KN6A 2VKTA 2Y1WA 4JP3A 3JVUA 4QARA 1CLEA 4CM6A 4ZOQI 4FR2A 3UHAA 5BNTA 4CUJA 1DTWB 2G3YA 3U1BA 4X0EA 3KQLA 3O74A 1P7VA 2TRSB 2JIZA 5LZ5A 4LKOA 2G8NA 3ILSA 4YA6A 3SXJA 1U0OC 1ZMRA 3QHAA 1D2EA 2EP5A 1X86B 2YVAA 3G2LA 2NYAA 1PIWA 3BQ9A 1KDYA 1BVHA 2I6FA 4JFRA 4G8CA 1L5FA 2BFDA 4JLVA 4QQKA 1N6RA 4BMXA 4XJVA 2QMQA 3CX3A 1Z0IA 2C61A 1CCWA 1R50A 2FPIA 2I2CA 1XVLA 1RCTE 2HSDA 1DO0A 4RTMA 1CZNA 2WM2A 4HDKA 1OH7A 3D4NA 3O4FA 3LVFO 4HNUA 1C7QA 2O2CA 2QXUA 3W5VA 5JSUA 1K7EB 2IJGX 5JSZB 1VDZA 1MUUA 1PNVA 3LW8A 1NBHA 4FHCA 4DQ0A 2JGDB 1C7JA 2X4GA 1G3QA 3O03A 3EFOB 5CA1B 2YIVX 3OHMA 4PGMA 4FB4A 3EWIA 2YH2A 2O0JA 4I2VA 2UV8A 1NBMA 1QMPA 3A25A 2H1IA 3I0ZA 3PHIA 1NI4B 3QXJA 4FHFA 4A8JA 3DV0A 4UMFA 4R8RA 3QA9A 3GZNA 3K8YA 2ATIA 3BF8A 3IAS6 4FYKA 1COZA 1Z5UA 5D3MA 5HIMA 1TYCA 4GHWA 3BMCA 1L1FA 1VHQA 4L8YA 1VPVA 2BDEA 5M3BA 1YRLA 1UKZA 3B2QA 5ENZA 1VXRA 3GRZA 1CULC 3I28A 4IIJA 3T1NA 1COWA 3B6EA 4C03A 4D8YA 1UMBA 4N76A 2SNIE 3WFJA 5EGSA 5BVHA 1UPBA 3HJHA 1DC8A 1CUYA 5IAKA 1EX6A 4FFBA 3H83A 3TINA 1HM5A 1MIOB 3EVZA 2BKVA 4NG4A 2AC4A 3A3OA 1RI3A 3NW9A 3AFMA 4XA8A 5GGXA 4PNPA 3TTUA 2EEZA 4BGEA 1N0UA 2OUIA 2WAOA 3ANTA 4RY0A 5AI8A 2AI1A 4BE4A 1JMVA 5BOSB 2VTKA 4ID9A 3C15C 3VHRA 4PBSA 2PS0A 1RI2A 2ODPA 3M6IA 3TLGA 2E49A 4P38A 4IEEA 2WFMA 3SZLA 4NCJA 3HJNA 2HHHB 2QUBA 2XE8A 4JP5A 3UZUA 2H4WA 1QPBA 4MKXA 3R5KA 1TK9A 5T8KC 1D2RA 3EWAA 4DANA 4F4JA 4TSFD 3WXBA 4WXHA 4YDRA 2MIIA 4A6EA 4DRYA 3OVMA 4ZC8A 1SJ9A 3M4NA 4A27A 3OKCA 1CY7A 1MC8A 1VECA 2Q3EA 4L07A 1OT3A 5JAPA 5K51A 2UXCB 4OAQA 1I7SB 1UXGA 3OTHA 3PIIA 1UF9A 1SQ0A 5LPNA 1B8NA 2PKQO 3HO8A 1TUGA 5ALRA 4LJKA 3ZV4A 3C87A 2OAEA 2WD7A 1SB9A 1U28A 3IUYA 4JD5A 4KXLA 5EQJB 5LBIA 2ID8A 1ZX1A 1Q91A 2G1AA 3L8CA 1H93A 2XGMA 3R8XA 1JPJA 3NEJA 2YY7A 1WB9A 1C30A 1EFAA 3PSHA 1Z06A 2RGAA 1ZHHA 4L4UA 4RH1A 5G0SA 2XWPA 2C7VA 4RWEA 1V5WA 3ZJYA 1YOVB 4D42A 5K09A 2C7RA 1YAHA 4JVMA 2AYXA 4QREA 3PEWA 3TECE 4FXOA 3VH4A 3GJQA 2HIAA 4YI3A 1SIOA 3EG5A 2PPVA 3KVRA 1M1XB 4KREA 4HFNA 3GZ4A 3NTQA 4BMZA 4HLUC 3KVVA 1KR2A 3IHTA 3FCSB 4QPPA 5CD9A 1KOLA 2WUFA 4TV9B 2BEUA 5KYGA 1X1AA 2F3SA 5E2IA 2A5FA 5EOVA 1BKYA 3QKRA 2Q62A 4M9XA 4P82A 5TNXA 4OGGA 4CDNA 6ABPA 3IPCA 4XRRA 1PJRA 3H04A 2C8LA 3ROFA 3AZOA 2DH6A 1O4WA 3C3WA 3M3PA 4H4CA 1SC9A 4QDOA 5TE9A 3VYVA 3VVCA 2BPOA 4M88A 1I2MA 4N6NA 5T5QA 3ZCRA 4DLYA 1XJCA 4UTNA 1KQ3A 1N2GA 1MNAA 1YR7A 3KYIB 4BO0A 4C08A 2ECKA 3RSOA 1QE5A 4MMXB 4KPYA 1M5RA 4LJLA 4G37A 4PRZA 1N2CB 1APBA 2PRSA 2WKWA 1DNPA 1EUCB 4KMSA 4QPCA 5REQB 1CPYA 2XJ4A 5A7GA 1UK7A 3UWPA 3H13A 3BCRA 5JIBA 3KTDA 1C7FA 1JLLA 1CVRA 1ZU5A 2H54A 5AKYA 2EW1A 2RHMA 4DHWA 4TN5A 5HUJA 2O1XA 3QVTA 3W9SA 4ZYXA 1KC1A 3LRXA 4PICA