4DIDA

Crystal structure of salmonella effector n-terminal domain sopb in complex with cdc42
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
179
structure length
179
Chain Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Salmonella Effector Protein SopB N-terminal Domain in Complex with Host Rho GTPase Cdc42.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase
molecule keywords Cell division control protein 42 homolog
total genus 61
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4didA00
2VHQA 2HYDA 4D82A 4N0EA 1KKMA 2CBZA 3TUZC 3L0PA 3THXA 3GLGA 2GILA 5TY0A 4GI7A 2EVWX 3C41J 2GBLA 4BFUA 1ZRHA 5K8UA 1TL7C 1TF5A 5HE9A 2O5VA 2J7PA 3K70B 1M1YE 1ZUNB 3W8RA 4C0SA 2H16A 5JSZA 1II8B 1BH2A 2PBRA 4IOJA 2BBWA 3LVQE 2H7VA 2QPOA 4URWR 2XJ4A 4PSKA 1JB1A 1RPZA 2FGJA 3HR7A 3LX5A 1KO5A 3OEHD 4OK6A 4RFVA 3GQBA 3SNHA 5EXXA 3KXLA 1OHHA 1WP9A 4LYHA 4UJ5A 1OW3B 2CLDX 3NH9A 2DFNA 2MMGA 4LJ8A 3EC1A 3UATA 2ZS9A 2GCNA 3MG9A 4PR0A 4M9ZA 2ODBA 4XD7D 1R0WA 4MRSA 3THYB 3U44B 4CVNA 5AUNB 1TEVA 4TYYA 1YQTA 4UNNA 1KY2A 5B57C 3W5IA 1SVSA 3Q7PA 3KJIA 4CW7A 3ONWA 2CEAA 2JDID 3RC3A 2ZQ5A 4HLUA 3FOZA 1RYFA 4Q9IA 3IO5A 5JCZA 2ZETA 3BAFA 3SQXA 3PG5A 1KO7A 3QPWA 1AGRA 3VKGA 4J0QA 1QBKC 3SEAA 3NH6A 3ASZA 3EC2A 3Q85A 2J0UB 1XCMA 1TUEA 3A58B 2GKSA 3LXXA 3AF3A 3I32A 4PC2A 3LD9A 1W5SA 4IOKA 1VG8A 2VP6A 4QJ5A 4KFSA 4R9UC 2FSIA 4M1WA 3SJCA 1WDTA 3BERA 1ZC3A 1QHIA 3IIJA 4OHWA 1OH8A 2RGEA 5JEEA 4NHOA 4F7WA 3AVQA 5HE8A 1U2RA 5CB6A 3UPUA 2RGCA 4AKHA 1P4SA 4DLRA 4PHFA 2BDTA 2LKDA 3Q9LA 1EFCA 4Q9LA 1NN0A 4AG5A 4B76A 2W2XA 2XB2A 4M4SA 1W0KD 5FOXA 3U3KA 1XXHB 5EZ6B 4L9WA 2CVFA 4URXR 2AWNA 4P0TA 2FF7A 2V1XA 3IILA 2QL6A 3A1VA 1D9XA 4OI0A 2XTMA 3MCAA 1XB2A 1ZYUA 1FP7A 2P5SA 2KBEA 2JJ1D 3SE0A 3QNUA 1OXTA 3AVOA 2J9RA 1NIPA 2C5LA 2NO1A 3I8XA 2R6GA 2REOA 3AP1A 3K0FA 4LHXA 1WB9A 3LFUA 2GJAA 4PZZA 4TTQA 5JWHA 3BFVA 1EFRA 1D2EA 1XWIA 4PXAA 1VMAA 3QKUA 5E3HA 4FWIB 2DFLA 5L3RA 3WHLA 2WJHA 3ASYA 4JSTA 5F98A 1X1SA 2AFHE 3D8BA 4R7ZA 4DIDA 1PJRA 2J41A 2GETA 2PZGA 3AGQA 1M7HA 2HLDA 2AKAB 4XVQA 1YR9A 3SJBA 3RS5A 4BGDA 1VG9B 1CEEA 3T34A 2IHBA 2RB4A 2FX3A 1YZUA 4MDEA 4PSVA 3G0HA 4YMWA 3TNFA 2MSCB 4JMPA 4PC1A 5JZVA 3R9WA 1KAOA 4TQ9A 1G17A 1G7CA 2Y8EA 1HE1C 1P2UA 4V02A 4ERNA 2O8DB 1E3MA 3C7KA 1RVDA 1S9DA 5IK2D 4DLTA 3GP8A 3KL4A 3F0TA 4NYIQ 1UKYA 4DSNA 3WBKA 1B0UA 4HLQB 1FFHA 4C0AC 2ZR7A 2E87A 4KSBA 1P9WA 1BYUA 4MGIR 3V9PA 1R5NA 2UVQA 4MA4A 2GZHA 4JYBA 4QGAA 3ZVLA 2WWFA 3GJ7A 1OT3A 2CE7A 3AP2A 4LJYA 3UWOA 3VFDA 2BM0A 2QAGA 2ZJAA 2FFHA 5DYGA 4LI0A 2IYVA 821PA 3CH4B 4DSOA 1XCPA 2FN4A 1D6JA 3CX7A 3CW2A 1AM4D 5FTMA 2ZI7A 4LYFA 1Z22A 2WWYA 1GOTA 3UKDA 5GJBA 1SVOA 1R0XA 5DN6A 4A0RA 1W4AA 3GJ4A 4ZPXA 3UXMA 4DHEA 4YMTA 4ZI3A 5KOYA 2A2ZA 1UPTA 4DLSA 2NO7A 1ESMA 1VYUA 2ZRFA 4ZIRA 2ORVA 3U44A 3LW7A 3NBXX 1JI0A 2WZQA 2YNMA 2B92A 4ZI2A 2QQ0A 4RZXA 5DN6D 1S3SA 4IEIA 2NMVA 2WIBA 2ERXA 2ZYVX 1UDWA 3CRQA 4HSEA 4XTCS 4AYXA 2REBA 3PITA 2NIPA 1FX0A 2JJ2A 1SVIA 1VCOA 5TXGA 2RKOA 1G291 3ZIAD 3GLIB 2ASEA 4CYMA 1JEDA 1CJUC 2IF2A 2IYYA 4Q4JA 3EASA 3VX4A 5H70A 3W6NA 2Q3FA 1F2TB 1G3QA 3TQCA 2DWOA 4C0JA 3UIEA 2G0TA 2P2LA 4M1SA 4MYHA 3DPUA 1IN5A 1MABB 1Z47A 1E0SA 1EXMA 2YWGA 4Q1FA 4QM6A 1JBKA 1G1MA 1MT0A 1Q1ZA 3AV0B 1TTTA 4XWKA 2Z4SA 1VDZA 3Q7QA 1DO2A 5DE3A 2QP3A 4IVPA 2XZPA 4B2PA 2EQBA 4E5UA 1R8SA 4NCIA 4OKSA 5JJIA 3HDTA 2D4HA 1CR0A 3B13B 5GADl 4BQSA 4M1TA 5K8IA 3AM1A 3BK7A 5KSOA 3EAQA 2VPPA 4UKDA 3U60B 1JALA 2QQEA 2VO1A 4V0MA 3RS7A 3SU8A 4QG7A 1U0JA 3O8DA 2A3RA 3RWMB 2J45A 4EAQA 2N42A 3GJ8A 3A4NA 3A36A 1ESNA 4BFZA 1CJMA 1NLZA 1VHLA 4QRHA 1PUJA 1SZPA 2YC2C 4AIIA 2GEDA 3EXAA 4Q01A 3K9NA 3LBHA 2ZU0C 3RANA 4W7SA 3UMRA 5KDDA 3U6KA 2F9MA 1E9FA 1YR6A 3WXMA 4A2WA 4CEJA 1OIVA 4I4LA 2G3YA 4PAQA 1P61B 1LW7A 2ZR0A 2OHFA 1LS6A 5HR5A 2PZFA 3JZAA 3VMFA 3U4QA 2OLJA 3ZVMA 1AIPA 2Z4RA 2ZRCA 2J0UA 3AVPA 3DVLA 4CT5A 4AWXA 4PSAA 4TSFA 4ZKEA 4ESHA 1LNZA 3KJHA 4KAXA 4TLDA 1Q21A 2OESA 4N3NA 1DAKA 4Q4HB 1JPJA 3AVTA 2IW3A 5L3QB 3QI2A 1W4CA 1E9DA 3ZZ0A 1M7GA 2XX3A 3K0AA 4EJSC 2RGXA 4QGFA 2AN9A 1K8RA 1RFLA 3AF0A 3A4LA 4LHVA 521PA 4OJKA 1MABA 2GTPA 5JEDA 2Q9BA 2W0SA 4WA7A 4DT1B 1GL6A 1COWA 1P62B 1XJQA 4QGGA 2IXGA 5JHGB 2F55A 1DEKA 1UKEA 1YR8A 1X3SA 3PCRB 3SYLA 1OXUA 1R10A 5DI9A 4KLNA 4GNKA 1ZP6A 2W0MA 1E2KA 1S9HA 4E03A 5J40A 5JMTA 1W47A 4DZZA 1TU4A 4HAZA 1D9ZA 2OAQ1 5TMPA 1P2TA 4XWOA 2YWFA 3AVWA 5FBRB 4CEHA 1MRNA 4KFUA 3JVVA 4Q4AA 1MRSA 2X19A 2O8BB 1XEFA 1EG7A 1O87A 3CR8A 5GJWC 4A92A 4WW0A 2IYLD 5EXSA 1KAGA 1P6XA 4Q1DA 4DRZA 4JLMA 2KB0A 4DLZA 1E0JA 2QMUA 2OFOA 3QKTA 1YE8A 1Z6AA 1DAFA 3QEJA 2R6DA 2GHIA 3CRMA 4M1OA 4NE2A 1KK2A 4ESVA 4AD8A 2KSQA 3B7GA 1E2LA 4ZCIA 2OBMA 1XFAA 4E22A 4B44A 2CL6X 1KI8A 4NYMR 3ETLA 5KNCA 2O8DA 2I3BA 1GWNA 3U2QA 1F5NA 1H8HA 3BC1A 5EE5B 4C2UA 2QPTA 2W00A 4IRUB 4GT1A 1Z0DA 4PAMA 3WBJA 4DUGD 1KNXA 1N0VC 3F5FA 1P5ZB 4WAUA 2C78A 3NBYC 1TUIA 2J7PD 3H1TA 1E1RD 2H18A 4C7OA 1II0A 2QP4A 2XJ9A 2WKQA 4BZPA 4KV9A 1TAGA 3MWKA 3UK6A 4TZ0A 5HTKA 4FCTA 2NO0A 3C5CA 1GRQA 4FW9A 4NYIR 2QGNA 5G3YA 1YU9A 3K09A 4GSYA 4M1YA 2WMOB 1UFQA 2BCGY 2GCPA 2P0EA 4M9XA 5J47A 4NPHA 3LQRA 1E0KA 1D2MA 2WJJA 5CM8B 5EP3A 2IUUA 1XPUA 1OB5A 1N6KA 1N0UA 3VHXA 1IXZA 3WHKA 5J4KA 1UKVY 1NIJA 4HB2A 4DDTA 4JBXA 1AZSC 1G7RA 4FINA 3U6BA 3EG5A 4FIDA 4RZUA 1NY6A 5IHPA 4EPRA 5BN3A 2NPIA 3SDZA 2GAAA 5G41A 3TR5A 1YR7A 2O8EB 3LY5A 4WZAE 4RZ2A 3K9LA 4Z51A 1JAIA 3E5HA 4RD6A 5CIQA 1ZM3A 2GF9A 3AF4A 2Q0HA 5DHFA 1KZGB 4UJ3A 1ZAKA 3CRVA 2Z0MA 3AQ4A 2VL7A 1VYVA 1J99A 5J5CA 1IOZA 5FH9A 5LD2C 2FE4A 2VSXA 1KDRA 2QAGC 1N6OA 1BS1A 1Z5ZA 4JVNA 4PZLA 4BFTA 3KQNA 1GM5A 1QG2A 3H4MA 2CHVA 3ADCA 4TN1A 5EP1A 1LF5A 3CX8A 3R8FA 3DM9B 2HT1A 4DB2A 3VU9A 1NBMA 5GJVC 5ANRB 2RGDA 2YWEA 4F4CA 4LJ6A 2ONJA 1CRQA 1X6VA 2GJ9A 1P60A 2XXAA 4NU0A 2CL7X 3GJXC 3AP3A 2KWIA 4MYUA 4B3DA 2QMOA 3ZVNA 1SKQA 2YC4C 3OIUA 3B60A 1EFUA 1E2JA 3KXKA 1CIPA 2Q3MA 4X8LA 3I73A 2IYXA 1CS4C 1N3BA 3S1AA 2WTUA 1ZNYA 1H8HD 1NMXA 3KQKA 4JZKA 1QF9A 2QAGB 4S35A 3KXIA 2RCNA 4OI2A 2YZ2A 2VBCA 1NVXQ 1S0UA 3K09C 2O8BA 2WSMA 4M22A 4EPTA 1OKKD 1E79D 1EK0A 1P2SA 4MQBA 3ZVRA 1XNJA 4TT3A 1N2CE 2NPFA 1QVRA 4O25A 3O8CA 5GVRA 5FPSA 5FR1A 4RJLA 1E2IA 2OFXA 3T1OA 4MGZR 1DPFA 2ZJBA 2JLRA 4A1FA 2BWJA 4GOKA 3KFVA 3VKHA 1GG2A 1U0LA 1G41A 1YZQA 5HCNA 3UG6A 5EXTA 3MMPA 3NDBB 1XD9A 4Q21A 5CIWA 1CF4A 2HF8A 2F43B 3DL0A 1XMJA 3LO5A 4G3XA 4B48A 3DZDA 3OIWA 4LX0A 3KX2A 3E1SA 4LHWA 2VP4A 1GDDA 3GLFA 4LV6A 3RLFA 1YRAA 5BYKA 2GA8A 4OHVA 2WKRA 3L8YA 4EJSB 1KOFA 1RKBA 3T1QA 1NMYA 4DT1A 2FPKA 1AQYA 2IYUA 2I1QA 5EUMA 2IL1A 1W5TA 1UDXA 1X86B 1ZC4A 3I92A 4PC6A 4M53A 4MKHA 4HEJA 1W7AA 2QTVB 2Z43A 2QA5A 1ZCBA 1R8QA 3IPXA 3ZLJA 3VNUA 1L4YA 1A82A 4MH0R 4P4TA 3P4XA 3LLUA 4RSGA 1DARA 2WICA 1ANKA 4C2TA 4JLAA 4EFLA 1UBCA 2D2EA 2JASA 4KBFA 3RS0A 4KVAA 3AEZA 1Z3IX 4DBLC 3K70C 1XTSA 3L8ZA 2DBYA 4EUNA 1U0HC 3HJNA 3CBQA 1NG9A 2XOKA 4R71A 1GNQA 3V4FA 2CMKA 2HYIC 2R9VA 2ORIA 3TAUA 3SR0A 4D25A 3MFYA 3RRMA 2H17A 2BM1A 4M1KA 1TMKA 4KVGA 5AJVB 2EYQA 4URYR 2PZEA 2GZDA 1T8UA 1E4VA 4TLAA 1OH7A 3DOFA 5F2EA 4BUJA 4A0FA 2ZEJA 1XPRA 1E1QA 3WMGA 4Q4HA 4EJSA 3U3RA 3VR2A 1G19A 4AKIA 5GJCA 1N5IA 4IJMA 2DHRA 1RW4A 1Z6GA 3WMEA 2VP2A 1N6IA 3ICQB 3VKWA 2EWVA 1OF1A 2ZI9A 3B9QA 3SZRA 1AK2A 4IOLA 4DEYA 3FFBA 3FHTA 2F3TA 4GPTA 3EPLA 1HT1E 1QHSA 4HI0E 2O8CB 2BEKA 1XTQA 2ATVA 2AXPA 5JJLA 3SHWA 3CONA 5M04A 2ZANA 3CZQA 4HYYA 4I99A 3P20A 1IY0A 4BECA 5K8LA 3IPYA 3K0AB 3SJZA 4K81B 3Q5DA 5JRJA 4PAOA 1E2PA 3BORA 4G5RA 4BRWA 2ZUDA 1J70A 4RD1A 5FL3A 4UNRA 2HXSA 3FTQA 3NHAA 2ZJOA 3KUCA 4GP7A 5LB2A 4AKEA 3CO5A 3ICEA 1DVRA 2R8RA 1XEXB 1R7RA 4UNSA 4DLWA 5E7JA 1T9HA 1N6LA 1FQKA 1L4UA 3NC1C 4MRPA 4B33A 1PVOA 5FL7A 3BH7A 3IQWA 2PEZA 4ITRC 3PXGA 1G6HA 2ZI6A 5J4VA 5FOSA 1G4UR 4JLOA 2ZRPA 3HPRA 2FNAA 2Q21A 2FSHA 4ZCLA 3PUZA 4GZMA 3W3AA 2C95A 4TL9A 2W6JA 2IA5A 3I72A 1R6BX 3QF7A 4EIWA 5FUWA 2GK7A 4BFXA 5FR2A 1E69A 3HYTA 1KZ7B 3HP1A 1ZIOA 3X1WA 3KTAB 3SC3A 3PUYA 2AHOA 2JJ1A 1JR3D 1SXJC 4GMDA 3THOA 4DIEA 4DSTA 4Q4JB 4BPBA 1N0WA 3OEED 1UF9A 5FBLB 3K9GA 2QPAA 4LZZA 2Z83A 2BKEA 2CVHA 2QORA 2ZRKA 2MSEB 3BJIC 4JLKA 5B2ZA 4BFYA 4C0KA 4D4JA 4F4JA 2EU8A 1HQYE 4GP6A 4CEIB 3HYRA 3WRYC 2VEDA 1N5JA 2EFGA 5JI2E 1OYWA 1T3SA 1OFHA 1SVMA 1IQPA 1MH1A 1ZNWA 2HXYA 1E9SA 3O8BA 3TMKA 2G83A 1ZMXA 4AG6A 1IONA 1TQ6A 2NTYC 4BFVA 2J5XA 4QJ3A 2XEXA 1E6CA 2JLSA 1KI3A 3FKSD 4Q18A 4X8MA 2WSSD 4LK2A 1UJ2A 2DR3A 2XAUA 4WIAA 4OQXA 2VSFA 4NYMQ 2V9PA 2JLWA 1E9BA 1FZQA 3FKQA 4TYPA 1P73A 4URUR 2WBLC 2F6RA 4NCHA 2VQSA 1GTVA 4TLCA 5TARA 4IXNA 3RNLA 4LC1A 3WY9A 2WJYA 2ANCA 3AVXA 1ONBA 3K9HA 4B3XA 2AKYA 2OZEA 1ETUA 4JKIA 4YQFA 5A0FA 4CF7A 2R6FA 1FOEB 4JVSB 3AVYA 2B6HA 3A4MA 4IHQA 4TMKA 2BV3A 4Q7MB 1ZCAA 2BBOA 2KBFA 5CLQA 2IBMA 3RDPA 3RABA 5LDDC 5E7MA 1NSFA 4P31A 5D3MA 3A1SA 4EKDA 3U4QB 1G8FA 1Q57A 1JPNA 4V0KA 2AK3A 3HU3A 2ONKA 2IC5A 5J4HA 1FUUA 3A6PC 1G3RA 4X8HA 3A1WA 1F3OA 3T06B 1WA5A 3GEHA 3H84A 3DDCA 2CL0X 3CF0A 2QUZA 3AH8A 3ZS9A 3EW9A 2FGKA 4HZUA 5FUXA 4KLZA 2BJVA 5FTLA 1BYIA 1FMLA 4C0QC 4HAXA 4AK9A 3W8NA 4W5JA 1RJ9A 2CCKA 4BFSA 1TF2A 5EUQB 1LFDB 1KO1A 2F1JA 4IVRA 3EPKA 2BCJQ 4L5BA 2GXAA 4QL3A 4H1VA 1IXRC 2PT7A 2ZI5A 4KFTA 3GJ5A 2CHQA 3SBEA 2PEYA 1SXJA 2GVZC 1F2UB 1KMHA 4CIDA 3AKCA 3EIQA 5BW8A 2XB4A 1JJVA 3CWZA 2LCFA 4N1AA 3MWLA 3KQLA 3NTUA 3FDIA 1E2MA 1VIYA 1G5TA 3C16C 3GLHA 2ZSBA 3KFXA 2IX3A 4JIMA 2PT5A 1NVWQ 4DUGA 3I5YA 1R5BA 2CHGA 2VA8A 4LOAA 5SZJA 2XXAB 1RE0A 4C0HA 2XITA 3GEEA 1ZM7A 1R0YA 4Q03A 2JLXA 4WXRA 5KSZA 1GRRA 2ZI4A 4HAWA 1IN4A 1U81A 1VECA 2A9KA 4BASA 2ZJYA 3E70C 3IBGA 3FGNA 5EP2A 2OCBA 2VIIA 5CDFE 2JLQA 1QHYA 4B47A 2MMCA 4PHTA 1E2FA 1QVAA 2NG1A 3VR3A 4BE7B 4URVR 2R2AA 4S2EA 4OQLA 1Z6YA 2Q6TA 2JATA 4M0LA 3I62A 2OBLA 1HY3A 1YHNA 3OAAA 3Q72A 5CYOA 2X1VA 2J0QA 2WJGA 4LC0A 4Q7JB 2RAPA 2AL7A 3A37A 2JLUA 5FL7D 1OB2A 4JVMA 3N5CA 3TAHA 3UMSA 1G20E 2V7QD 2ZUBA 4RFSB 4DWJA 1JR6A 3MRSA 1Y3AA 3ND9A 3IBYA 2XOKD 2FJUA 1TU3A 3FMPB 2DFKB 2JIZD 3V00A 5KDLA 3UMFA 3BFKA 2HV8A 1Z29A 1GRNA 2RH5A 3ZYCA 3MJHA 4HUQA 4ASUA 2AK2A 5FTKA 3CH5A 2BBTA 3SI7A 1DG3A 4HAUA 1P9RA 4IKEA 4QBIA 1G3UA 2O8FA 2XNDA 1TADA 5BWMA 1UBEA 4D4LA 1KI4A 5A5GA 2W83A 1K5DA 3R20A 5KPDA 4RY2A 3CLVA 1KI9A 4HB4A 2EFCB 2ZJ2A 3OFND 5FPHA 3D6TB 3NKVA 3GLHB 2PLRA 2J1LA 2EFHB 4PQFA 4D6PA 2QE7A 3CF2A 5FBQB 5J4LA 3L2OB 1NF3A 3PEUA 4NTZA 2QTHA 3AF1A 2QAJA 1N6RA 4RZ3A 4BLOA 1G7SA 1HA3A 1S4QA 4PQYA 5DISB 4KBGA 2F1HA 1JXMA 1YJ5A 3W90A 1EFRD 1UBGA 2ZRGA 3VAAA 4CGZA 2AX4A 5CB8A 4JJKA 2ZTSA 3D31A 2YOHA 4OK5A 1Q44A 2J7KA 1SKYE 3X1ZA 3DZ8A 1E1QD 2EW1A 3BS4A 3N2EA 4R2HA 3TKLA 1A4RA 4TQAA 1C1YA 4Z54A 5E95A 3MWYW 2BMDA 1WQ1R 4LJ4A 5GVSA 2REXB 4W9MC 2F7SA 3J81k 5G40A 4PPGA 2RGNC 4A15A 4ABYA 4QJ4A 2QMEA 1UADA 3QPVA 2ODNA 4MRVA 4BZXA 4TT3D 1MKYA 1YZTA 2W6IA 3X1YA 5CDFA 3QJYA 4IW3B 1A5TA 1DS6A 3B2EA 4L9SA 5IF9A 2IS4A 2J3EA 2G77B 4WOPA 1OIWA 2IYWA 4DLXA 2ZR9A 1J7KA 1ZNZA 3CUEF 5G53C 3BRWD 3Q8XB 1ZBDA 1NLFA 1Z2AA 1F2TA 4FMDB 2B21A 3QIAA 3KDSE 1W36C 2PJZA 3RRNA 2W2TA 3T12A 4QM7A 1SVWA 3THXB 3CNNA 5SZKB 2DWPA 4C30A 2ZJ5A 2E1RA 1E9AA 4LWZA 2BJWA 3GJ3A 4GOXA 4QXAA 2BIFA 1VCMA 2FFBA 3HR8A 1NMZA 1W0JD 2QSYA 3K70D 5FUYA 1G9XA 3OHMA 5FI0B 3TUJC 2CCJA 2YKGA 3VR1A 1Q3TA 1KI7A 4Q9HA 3P4YA 4TSFD 2XGJA 2W6ID 1H65A 2P6UA 2C9OA 1Q12A 2EFDB 2UZIR 1Z0FA 2JJ2D 4LYJA 1GNRA 2ZRBA 3K0FB 3QXCA 4KSCA 5DSZA 5B64A 2PLFA 2A7QA 1XEXA 1JXOA 3U3JA 1G18A 3K53A 1N6NA 2DPXA 1QHHB 3B9PA 3KKPA 4A4DA 3R7WA 1IY1A 1OYYA 1MV5A 1Q22A 5G3ZA 2JA1A 5F9HA 1S96A 2O8EA 2OCPA 2JLVA 3DHWC 4QNRA 3QKSA 1ZU4A 1TQDA 3BOSA 1OIXA 1Z2CA 1Q3HA 3GEIA 3I1FA 3TH5A 2OBNA 1YRBA 1NVUQ 2XSZD 5KHOC 4DLUA 4AC9A 4HDOB 5DHAA 3QKRA 4BZQA 2AWOA 3MGCA 3LBIA 2OO7A 2QM8A 2KE5A 1U8ZA 4DDUA 3T1TA 3ADBA 4B3GA 4OI4A 2WHXA 1KO4A 2R62A 3RRYA 3BXZA 5K8TA 5L3QA 1W36D 2JGNA 2ZRJA 3CRRA 2QY9A 2WWHA 4PC7A 2GEUA 4L15A 3QSYA 4V0LA 1GILA 2BHRA 1W4RA 2ZJ8A 3U7EB 3TIFA 1F60A 1W2HA 3IIMA 1V5WA 2QRZA 2A5DA 4DCSA 3TVDA 1NVVR 3EZ9A 3MD0A 4ASUD 2WPDD 1KK0A 3IIKA 3QBTA 1ZINA 3M6AA 3WP0A 4LHYA 5C46F 3CPHA 3EPHA 2HJGA 4LYAA 4GOJA 1BMFA 2VP0A 5FOUA 4DCUA 2WMNB 2JLYA 1OLOA 4HZIA 4BWYA 4P3YA 2H5EA 4MKIA 3ZDQA 4B34A 5KUTA 4POAA 4MGYR 3MWJA 1QHHA 1XP8A 1E2GA 4OL0A 4LBYA 2FPLA 3CR7A 3X1DA 1UEJA 2GRJA 3SYNA 3U61B 3NBFA 3SHFA 4MYTA 3P1JA 4B2LA 4B6FA 3RC8A 4MRNA 3QOFA 2CJWB 2D74A 2ZIAA 2HCJB 4A8JA 2DB3A 1RRCA 4LJAA 1ZM9A 4EDHA 2WWGA 1G4AE 4CZ2A 3SBDA 2ORWA 3CPEA 1KDTA 3S1AB 4DB4A 2G88A 2WOJA 3C8UA 4N0DA 5FFMA 1Q0UA 1Q1BA 2O52A 1KKLA 5CJ2A 3GMTA 2FH5B 5FI1B 2W2VA 1JJ7A 2NGRA 2F43A 4OYHA 3ADKA 3L0OA 3NEYA 2ZRMA 1AS2A 1T0HB 5KDOA 5EXPA 2ZYWX 4A82A 1KSHA 4DKXA 3BIFA 4YXWD 4Z1MD 3CIOA 3LXRA 1GZSA 1UEIA 2J87A 2NZ8A 2VHJA 1Z0JA 5AR1A 2IS2A 5B30A 1M2OB 3X1XA 1XZQA 3NC0C 3QKRB 1UKZA 3LLMA 3NHBA 1HH4A 4CDGA 1Z0KA 2QSZA 2WSSA 4PPFA 4Q1BA 3BH0A 3A8TA 3GLGB 3MUFA 2N1BA 1G6OA 4HUTA 3VQTA 2ZSAA 1VKJA 2ZVPX 3AB3A 3GJ6A 2WWWA 5H68A 3AKDA 3JZMA 2WV9A 1IY2A 2JAQA 5BXQC 3EA5A 1NBME 2RGGA 3QXXA 1X8LA 2ZVQX 4PO9A 1EWRA 4RD2A 4Q19A 5HZHA 1X8KA 1FPMA 3RS3A 4JLJA 3AUYA 2ERYA 4B2IA 4DCNA 4D0GA 2FFAA 4L4UA 2V54A 4LBVA 5L3VA 4BLTA 4K46A 3ND8A 2V1UA 1SQ5A 3O8RA 1VCNA 5F9FA 2QP9X 1WMSA 4R2IA 4PTLA 4Q9KA 1HV8A 3UANA 2OEPA 4FMDF 5CLLA 4DCVA 1OPXA 1MO4A 3FMIA 4PQRA 5JS8A 3W6OA 4IDPA 2B8WA 1QHNA 4A0HA 1I2DA 5CM9C 3TUIC 5KU1A 1W1WA 1YZKA 5AUQA 3ADDA 2F3RA 3DEFA 2C9YA 5FOVA 2RGBA 2XNSA 3IHLA 1S3GA 3D7MA 1Z6XA 121PA 3TW8B 3T15A 4ZDJA 1A2KC 4LBWA 3H2YA 3GJ0A 4PFSA 2IYQA 4G5QA 1NN5A 5EE1A 1DELA 1XEWY 4D80A 1KHTA 4DLVA 1OHHD 2O0HA 2AD1A 4ARZB 4W5WA 2YWHA 2GESA 5FPTA 2QT0A 4Q66C 4TLBA 1JR3E 4G5OA 1OKKA 4KJZA 3T5GA 3ZD7A 1LS1A 3KKNA 2VHCA 2R44A 2VHTA 3TK1A 4B6EA 1SKYB 2V8OA 4WVFA 4EQ6A 1WE2A 4A2QA 3CM0A 1SULA 3OFNA 5AJZA 1HQCA 1U90A 4DEXA 3HU2A 1SXJE 4NBSA 2DFTA 1NRJB 4QBGB 4PX9A 1NI3A 2NOAA 3TSZA 1QRAA 1FW6A 1VTKA 3F3YA 3I5XA 1OH5A 2ODWA 2D06A 2ZRDA 4PHHA 3LQQA 1XRJA 3KKOA 2JIZA 4DXAA 2BBSA 3C15C 4JBWA 1KSGA 3NEJA 2O8FB 1J8MF 1GNPA 4OJQA 4ZKDA 1EWQA 3B82A 2C8VA 8OHMA 1RC8A 2EYUA 2RGNA 2AFIE 2OT3B 3QENA 4M21A 2FSGA 5CK4A 1KY3A 2MSDB 1SVKA 3SQWA 4IDNA 2QT1A 4FMCF 4TMZA 4IXMA 2P6NA 2V6JA 4ACAA 4C4PA 5JECA 5DO9A 1P7CA 4ARZA 3QG1A 2O0KA 3IO3A 2OUKA 1L2TA 2A5GA 4XD7A 4GL2A 1YKSA 1IJFA 4BLPA 2X77A 2QTFA 3C14C 2V4ZA 2XTZA 1T91A 4EPVA 4EQ6B 2A5YB 2ECKA 2OV2A 4YLGA 4URZR 4GRAA 2FU5C 3IQXA 1HE8B 4AKGA 1I4DD 2C04A 2WAXA 4G0NA 2ZSDA 4LUCA 1EGAA 1Z0IA 2ZROA 3K8YA 4UQOA 4D4MA 4U02A 2IYRA 3PFIA 4WZ6A 3KKQA 3EARA 1G5PA 2ZE8A 4B71A 2NQ2C 4FD2A 2I4IA 2IYZA 2CK3A 4Y0VA 4JLDA 3QBVA 1TF7A 1E32A 4RCZA 3BWDD 1ZD8A 4LDJA 3WYGA 2GAOA 4DDVA 2EWWA 3A1TA 1E98A 2C9CA 4LPKA 2QG6A 3C5HA 4LRWA 3RVBA 1D8TA 4AURA 2JLZA 1BMFD 2IUTA 1E2NA 1NJGA 5LBIA 3ZZTA 4PO8A 2B8TA 4KODA 4WXPA 1FP6A 1KI6A 1KDOA 1PZNA 4RCYA 3WNDA 1G8GA 4EFNA 3GLFE 5JLJA 3B8HA 4LJ7A 1HYQA 4JT2A 3IEVA 4RD0A 1VHTA 2AD5A 3AKYA 4HAYA 2P6RA 4GDFA 4A36A 2CNWD 1E96A 2G1JA 3FYHA 1XCGB 2ZRAA 1FUKA 1KSJA 4TL6A 3T5DA 2NO6A 1XDBA 1YZLA 1WRBA 1O3YA 1F48A 2VRWA 3LW8A 3NIBA 2PX3A 3WNCA 4H1UA 2WWIA 4QNMA 2ZS7A 2FOLA 2IXFA 3CF6R 2IWHA 3IDQA 4A0GA 4DSUA 5AJXA 1MR3F 3T35A 4KITB 4BLRA 3RRZA 2GJ8A 2IWRA 4LY6A 1E9CA 2K5UA 4MKGA 2IHYA 4MKFA 3QKSB 3BB4A 4HDCA 1CTQA 2VF7A 1BKDR 4P4SA 4JL6A 5KTYA 2WJIA 4I1SA 2XZOA 4P4UA 4XH9B 5HKKA 4TQUS 2QBYB 4HDQB 1N5LA 3QY0A 4HB0A 2H57A 1X8JA 1NP6A 3KUDA 4W5HA 2JCSA 3GFOA 2GXSA 1KGDA 1G8PA 3ZS8A 4RD4A 1LY1A 3JVUA 4WBSA 3QG5A 3QVVA 2ZRHA 1FX0B 1VIAA 2HCBA 4UXJA 1UAAA 1CJVC 3PENA 1RJ9B 1W0JA 1YZNA 2QZ4A 5DI3A 3TQFA 4TMVA 4A8JC 4XVUA 2ODEA 2OSBA 4FI3C 1US8B 3MAAC 1AJEA 1COWD 3PJRA 5AUOB 3FVQA 2WM9B 4KYIB 1GL9B 3CWQA 2H8KA 2GWHA 2H92A 1ZJ6A 1GUAA 2ZAOA 1JECA 1SXJB 1QG4A 4F91B 2FPMA 2BMJA 3K0CA 4JBYA 4TTPA 4ZDWA 1P75A 3DO6A 5TDHA 1TQ4A 2IYTA 4B73A 4F92B 4NDZA 3B1ZA 1L7VC 3FB4A 4RVCA 4B3FX 1JR3A 2KJQA 3RYTC 4CEJB 4FXPA 4NP6A 4PO1A 2G6BA 1WCV1 4LBZA 1NG1A 2CLCX 4QHTA 4TL8A 1DAHA 1TX4B 3UWKA 3W3ZB 1F6BA 1AKEA 1XTIA 3W5JA 2JDIA 1Z83A 4OQFA 3U7HB 2ZUCA 1FNNA 3QE0A 1E79A 4HLDA 3GLFB 421PA 1IN7A 1XTJA 1VPLA 4HB3A 1S2MA 2ZE5A 4XIGS 4XSHA 5AJWA 221PA 4GBMA 1DBSA 3A1UA 4K8OA 3HWSA 2WIAA 4MITA 1U99A 2GZAA 1EFHA 3OIYA 3KTAA 2C77A 3L0IB 1DE0A 3QUSA 2VTKA 1J2JA 1T3LA 2ZM5A 3LA6A 1G5RA 1IHUA 3FHCB 4P4SB 2QENA 2GK6A 4Q47A 1IAQA 4QHSA 4E07A 2OXRA 2D62A 3CNLA 2HEIA 3EIHA 2GDJA 1G8YA 4MYCA 4TMWA 4D81A 5P21A 2CDNA 2PCJA 4JL8A 1N5KA 4KU4A 1HURA 4JL5A 1CBUA 1JQJC 2G9NA 3AUXA 1KNQA 1Z8FA 3OZXA 3LBNA 2ZPTX 2HT6A 3BBPA 4B75A 5JI3E 2YOFA 5AUPB 1GITA 5DI3B 2FZLA 2CK3D 1JQLB 3ECCA 4I1VA 1VG0B 2PL3A 3W34A 2X2EA 1T6NA 2IYSA 1D5CA 3B85A 1AA9A 6Q21A 1PUIA 1YVDA 5DNYB 2OM2A 1KIMA 2V3CC 4GFDA 3NBZC 4PPNA 1DAMA 1T8TA 1ZM2A 4EFMA 4KFRA 1GSIA 4JLBA 3R9XA 3WYAA 5FUVA 1ZUIA 2WVJA 4JSYA 1BOFA 3T61A 1KI2A 4JJZA 4OBEA 3ZIAA 2ZREA 2OILA 3H0KA 2OXCA 1ELOA 5EQTA 1CR4A 4ZDIA 1FMJA 2J46A 3AVUA 3LWNA 1E9EA 3FFAA 1GVNB 1ZVQA 5J4YA 3KKMA 1IJEA 2N46A 3U7FB 1E0AA 1P3JA 3LV8A 3VTKA 1P72A 4US2R 2A30A 5LB4A 2IEYA 1XEWX 3EA0A 2ZSFA 3O47A 4PANA 2OCYC 5CYPA 1PLJA 2UZ3A 3TR0A 3P27A 1FNMA 2QGZA 4KHZA 5D3QA 4B3CA 4DJTA 3KZ1E 2AXNA 5C1BA 2D7CA 3RS4A 3TLXA 5KSPA 2X8AA 4XWAA 5FTNA 1OXVA 4Q1AA 1P2VA 4V03A 4D0LB 2OE2A 3D3QA 2HUPA 2QMHA 3N2IA 5E4FA 2ZAMA 3GCGA 1UM8A 2VP5A 1CJKC 3T1VA 4JKYA 1G64A 1KI6B 2R65A 2ZU6A 4L16A 5FOWA 5JWRA 2IF0A 1KJZA 4LV5B 1OFTA 1I4LD 3AF2A 2RHDA 3KB2A 4MDFA 1AKYA 4PZYA 4C0BA 1US8A 5JCPA 5JWOA 1PLKA 4FWTA 2R6AA 4M8NE 1R5OA 1RZ3A 2WWXA 3I8SA 1HTWA 3L0SA 1II8A 1EX7A 1KO8A 4US1R 1VYTA 2QRNA 4MRRA 5JBQA 1HUQA 1XMSA 3OE7A 1KMQA 4D2IA 4PC3A 1CR2A 1Z63A 4IDHA 3LX8A 4ILEA 4LCBA 1C9KA 4XJXA 4YDSA 3EWSA 5C18A 2JEOA 3SYKA 4B43A 4QHYA 1XX6A 2Q9AA 4NONA 1CRPA 2BMEA 4RD3A 5H8WA 3ZD6A 2A5FA 2BKUA 4PPQA 2GXQA 1LB1B 2GF0A 2OG2A 2RMKA 5SZIA 4NCNA 1EFTA 2WOOA 2J0SA 4C3ZA 4D0NA 1XTKA 4CRWB 1OE0A 4QKQA 3QXSA 2X2FA 1Z0AA 5FBVB 2ZRNA 4F38A 1I2MA 4QGHA 4CEIA 4HATA 3AKEA 4V0ME 4KXFB 4QOSA 1XBTA 1M7BA 1RIFA 5TVKA 2KI5A 5EE0A 1AQUA 1KI1A 3B6EA 4G1UC 2XNDD 3W9YA 3G5UA 4JVLA 1JEEA 1KYIA 2Z5FA 5FOTA 3THWA 4G01B 3EZ2A 3GLHE 1M8PA 1HT2E 1CJTC 1GKUB 5L3SA 1NBMD 4D26A 4AYTA 4JS0A 5AK0A 2P3SA 4EPXA 2ANBA 3TSOA 1QDEA 4CT4B 3PEWA 3KQUA 4KCGA 5L8VA 1GKIA 1DADA 5JSZB 4TL7A 3SFZA 2SHKA 3DMNA 3QXHA 5DH9A 3VR6A 3R9IA 2QEQA 4I81A 3AVVA 1E2HA 3PUVA 2QM7A 4GZLA 3OEEA 1TEXA 4Z1MA 1ODFA 4OHYA 4PHGA 1SGWA 4DCTA 4TTRA 4TYQA 3QEOA 5KO2A 3CX6A 4YONB 1ZIPA 2HF9A 5CJPA 2ZRLA 1W4BA 2A5JA 4TZ6A 3CKLA 4BLSA 4BLQA 1NVVQ 4RKFA 3NVAA 4HZUB 3DKPA 1W44A 3PEVA 3PV0A 4QBFA 2A78A 1A1VA 2IS1A 5C4GB 5JFGA 3WNBA 3BE4A 1WXQA 2C96A 3ZH9B 2FDCA 3BD9A 3GD7A 3QPUA 4KYUA 4XVRA 5UKDA 1GL7A 1RRPA 4M2LA 4OK3A 3WMFA 4ACBA 5HZKA 4ZO4A 2GCOA 4JLVA 1W49A 2GEVA 3KJGA 1YZGA 1SHKA 1C4OA 1LF0A 1W2GA 2CNWA 3AGPA 2G0NA 3HU1A 1ZD9A 2QI9C 3GPLA 4LGMA 5DGXA 2CLSA 2ZE7A 3EPJA 1W48A 3IGFA 1MO5A 4U5XA 5C4MA 5FPKA 2PMKA 2FV8A 3K0CC 3IEUA 5HCIA 2P67A 2I1VB 4A6XA 1S1MA 2ZYTX 3OEHA 3RSOA 4OQMA 4LJ9A 1N25A 1SXJD 4A2PA 4LJ5A 2FG5A 2D7DA 4Q02A 5F3WB 1XTRA 5SZHB 2P65A 2WPDA 4F4IA 2HDNB 1AGPA 1PLLA 3E2IA 3K1JA 2IXEA 4NYJR 4V0NA 3K0SA 1E1RA 4XSGA 2WAYA 3QQ5A 4I1UA 1U98A 3VU9B 3LH5A 2ZI3A 3CRW1 1Q1QA 4O2RA 1J8YF 3QF4A 3LNCA 1CR1A 2BVNA 3L43A 2B7CA 2OAP1 1CP2A 1XXHA 4G5GA 2C98A 4Q4AB 4ZV4A 3UG7A 4MGKR 4UXIA 4CEHB 3EZ7A 5IRCD 5D3MB 1NKTA 4EPWA 4FMCB 2YINC 4AY2A 2V55B 4O2LA 3P26A 2WKPA 2O0JA 2PCLA 1R0ZA 1KJWA 2XSZA 4OI1A 3TW4A 3R7WB 1H8EA 1XJCA 3I3SR 4Q9JA 1GAJA 2Z6VA 2OLKA 2GCOB 4TMTA 1G8HA 4DLYA 4V0OA 3EWAA 1N6HA 4NZYA 3QXJA 1L8QA 2C03A 4RFSA 2ZE6A 4Z8YA 5JS7A 2WJVA 4L8GA 4Q4LA 2AR7A 1Y63A 1X1RA 1LTQA 3B78A 4Q5IA 4UNQA 3OF5A 2O8CA 5C2JB 3OE7D 1Z08A 2FZ4A 2IT1A 3PR1A 4QFMA 621PA 5DYIA 1XXHE 4O3MA 1GFIA 2ZITA 1U8YA 2RGAA 2PMDA 3HPQA 3PQCA 1W46A 1A2BA 4YMSA 1M34E 3ZZUA 4C7OB 2YJTD 3X2SA 1FQJA 4B74A 1IN6A 3B5JA 721PA 1NL3A 2QNRA 3QF4B 2FFQA 3THWB 1K5GA 3U7GA 1XD2B 1CULC 1XMIA 1MO6A 3KQHA 1GIAA 1Z06A 4JYCA 3RHFA 3EIEA 4AYWA 4OHXA 3I61A 4Q7LA 1AZTA 3PIRA 1AS0A 2L0XA 2NZJA 4C0LA 3GLGE 3I4LA 4JLNA 2HLDD 1Z28A 3WRXC 2IEZA 4FCWA 5LD2B 1NKSA 1XU4A 4YDHB 5EP4A 4B35A 3NDPA 4NCJA 1FL9A 1Q1EA 2C99A 3ZJYA 1IN8A 2GBLC 2J59A 3LDAA 4IDOA 5EJEA 1S1CA 1NN1A 1OV4A 3W6PA 4A9AA 1ZUHA 1U8AA 4P33A 2BOVA 1A7JA 1S8FA 3M4YA 2W6JD 3Q5EA 4I1OA 4XOIA 4A8JB 1OH6A 4MUBA 2F1RA 1VCIA 2QROA 1DAEA 5KSYA 2GNOA 3OESA 1DAIA 1T5LA 3VR5A 5AJYA 4UXHA 1N6PA 4Z8XA 4U7DA 4F93B 3P32A 4QC2A 2HJVA 4U00A 4KI0A 4YC7A 3DM5A 1PV4A 4Y0AA 1G21E 2CXXA 4BEJA 3H86A 3B1XA 3SFVA 4KO8A 3QVUA 5HPYB 4TYWA 1MOZA 5KYKA 3M1IA 3CB4A 1B23P 1G3IA 1W0KA 2FMXA 2VHUA 2QE7D 4TLEA 4C9BA 1CLUA 3BB3A 1EX6A 1CKEA 5ELXA 1WBDA 1NSTA 1XF9A 4M9QA 5L3SB 3IKJA 2FA9A 4BRUA 5KNBA 5BYJA 4LV8B 1NN3A 2VLIA 1OXXK 1G16A 3TBKA 4H9GA 1DAGA 5TB5A 5JHHB 1ZU5A 1KTVA 3TSWA 4IDQA 1M74A 3LAWA 2BC9A 2F9LA 3TVTA 4Q1CA 1FTSA 2XZLA 3PUWA 2OFWA 2YHSA 1SHZA 2OCAA 4OQNA 3RS2A 1U94A 1LVGA 1E9RA 3N70A 4IOMA 4WZBE 1TNDA 1XPOA 1T0JB 2ZYUX 3EZ6A 2F1IA 3L82B 2E9SA 2JJ8A 4Q7KA 1K6MA 3MLEA 4P32A 4JLPA 3TGPA 1CXZA 3C4JA 1I4TD 1EESA 2Q3HA 5FTJA 2P5TB 2UKDA 3CNOA 3F8TA 1BIFA 1XJ0A 4QBHA 2R6CA 1ZM4A 4IEEA 2ZXUA 3RWOA 1II9A 1IBRA 1RRGA 1E4YA 1T4GA 5DIFA 2CE2X 4YMUA 2RHMA 1OSNA 4US0R 4B32A 1U9IA 2QBYA 2DYKA 3NWJA 1Z6TA 2B7BA 4DDWA 3U5ZB 4EPYA 4X8OA 3IHWA 4NL4H 3TJZA 4II7A 2VH5R 1WF3A 2ZSEA 4JT4A 2D2FA 1R2QA 3G82C 4O0MA 3RSLA 3ZGXA 2XTNA 4TMXA 3CZPA 1TPZA 1MO3A 2DCUA 3FMOB 3GFTA 1D2NA 1RYHA 2DY1A 4R98A 4NH0A 3MSXA 1TQ2A 1AS3A 3FWYA 1WBBA 1NJFA 3VX3A 3EX7C 3MJRA 2BMFA 4HLCA 4D4KA 3DMDA 1T3HA 3V4RA 1LV7A 1NLYA 5DLQC 1KK1A 1DTSA 1E2DA 3TE6A 2J0VA 4YMVA 1DO0A 4M9SA 3NXSA 1Z07A 5EE9A 5FBWB 4TYNA 3FMFA 5IK2A 1DG1G 4ZDKA 2GJSA 2D3WA 3M0EA 4FMBB 3SS8A 1OJLA 2GJKA 2PJRA 1IM2A 3BH6A 4TWZA 5HKKD 1R4AA 3PEYA 2C2HA 2FSFA 2V6IA 1NY5A 1KK3A 4ZIRB 1XD8A 2QN6A 1OXSC 4UNPA 4DC9A 5E7IA 3FHOA 2ZJZA 3IUYA 4LPSA 5EE3A 3ZQ6A 3B1VA 5FPYA 4IFBA 4M1MA 3ZQJA 1XZPA 3REFA 3THYA 3PVSA 3B1WA 1T5IA 3B1YA 4NMMA 3BFXA 3VHLB 1GKYA 3WYFA 4A6PA 4IFEA 5BQ5A 5JJKA 3KJEA 2ZS8A 2EFEB 1IXSB 1G7TA 2FEOA 2IS6A 4NCKA 2LWIA 3LRPA 4Q00A 5TV2A 3SJAA 5H1YA 1BO6A 1OFUX 1HEIA 3CPJB 2LKCA 2QU8A 2GVDC 1E2QA 1FTNA 1GP2A 1QHGA 3RAPR 3Q3JB 5B58C 5IT5A 1P9NA 2H1LA 3U3MA 3FKSA 1ZW6A 4Q48A 1XD2A 1Q20A 2YYZA 1U9IC 1KDPA 2YV5A 4BFWA 3WP1B 4ZCMA 5A4JA 4XTRA 3VNVA 2TMKA 3GLIA 2VSOA 3FE2A 3EZFA 3SOPA 2FEMA 1ZNXA 3VR4A 2CCGA 2BEJA 2YOGA 2DWQA 3LVRE 3GLIE 2Q9CA 1F2UA 1KMHB 1QHXA 4IVQA 4G5SA 4LHZA 1E2EA 4HUQB 4Q1EA 4OHZA 3TRFA 3U3OA 2G1KA 4FN5A 2NO9A 4MUAA 1SVLA 4B3BA 1J90A 1DOAA 4FCVA 5KNDA 4LSGA 2PH1A 4ON9A 4YXWA 3R8CA 4AI6A 2VP9A 2IUSA 1AN0A 1W36B 1OFIA 3OIVA 1E94E 1M6NA 1UBFA 3BGWA 3GFPA 4NYJQ 1QZXA 2FWRA 4E09A 2V7QA 2VF8A 3FPAA 5CITA 1VG1A 4HLUC 2ATXA 3NG1A 1ZD1A 2CJWA 1KJYA 2W58A 4RKEA 2ZRIA 5BN4A 3REGA 2YVUA 5AWFC 3OAAD 1E99A 4GMXA 5EZ5A 4DVGA 1KSFX 1NNEA 4BEBA 2PX0A 4NKRA 3K0EA 2IK8A 1G3MA 1H8ED 1JAHA 2VYFA 4HAVA 1RRFA 5IDVA 3SN6A 5JRZA 3PUXA 2GXUA 3KB1A 1XMVA 3DKVA 1JNYA 1CU1A 5CK5A 3BB1A 3DOEA 5BN5A 5LPNA 5KPJA 1V43A
chains in the Genus database with same CATH superfamily
1SZJG 4X85A 3H4TA 2IU3A 2HYDA 3UWMA 4FEYA 4ZV9A 4XPIA 5EMNA 4YHHB 3TCNA 1EVKA 5CX1B 4DANA 3GLGA 3GJSA 3OQIB 4GI7A 1A97A 3BJMA 4IV0A 5D6OA 5BSFA 1JBQA 1QH9A 5LBTA 5TQVA 3ZK9A 2B36A 2PK3A 1UFOA 2YWXA 3L6OO 1YK0A 3D5TA 1TF5A 1NGSA 2XRYA 2O5VA 5A9SA 3BFJA 5A2GA 3L6UA 4EMTA 1DI0A 2X58A 2EJWA 4C0SA 1II8B 3F6PA 2GYUA 3GMIA 3PJDA 2XUIA 1ZD4A 3O38A 4BNWA 3IERA 4DG5A 1JQKA 1Z38A 1Y9EA 2V6MA 1RPZA 3PRYA 4BO4A 3HR7A 4TV8B 2NUAB 3VHRA 3LX5A 3PRHA 3LC1O 2BGRA 4OK6A 1H6DA 2GPTA 3LVBA 4RFVA 3QJ5A 4LG1A 1EQ2A 1JHDA 3TX6A 3W7AA 1J0AA 3I9MA 3KYJB 3IMGA 1PZEA 3IR5A 3CLKA 3ICWA 1I5RA 3NO4A 3OD5A 1JU9A 2ZIGA 3QELB 3JTMA 2ALJA 3EBLA 5B3AA 3NH9A 4CFYA 3C45A 5IG2A 4L4XA 3Q9SA 5FTWA 2X0JA 3FPFA 4XD7D 1R0WA 4YJ2F 2E1PA 4L07A 4MRSA 4OGWA 3RYIB 3U44B 2E82A 4LF7B 4IYJA 5AUNB 3SJ7A 4S04A 2ZP1A 1GN8A 3TLGB 3CY6A 1H2YA 3ZBTA 5B57C 4FFPA 3GRPA 1CDDA 4FSHA 1GPNA 1DKRA 1OAAA 2I4RA 3A0UA 4J7XA 3ND5A 3WZ2A 4HLUA 3FRIA 3CR3C 1NXXA 4I9HA 1TYBE 2ZB4A 4NBWA 3QPWA 3ETGA 1PKXA 1KYYA 1AGRA 4JODA 4YI3A 3VKGA 8ABPA 2DMRA 5SY9A 3KTFA 2LTAA 4NDAA 2YN4A 3CLHA 5I7UA 1ULUA 3NH6A 3SEAA 4XJSA 3RFVA 1WY7A 2J0UB 4Q9AA 3TLKA 5HA5A 2GKSA 1DZ3A 4HNTA 3NZEA 1HDGO 1Q6YA 1P0PA 1XRMA 3AF3A 3I32A 4MTLA 1W5SA 2R85A 2VP6A 4IOKA 4QJ5A 5DVZA 3SJCA 1IC6A 4H15A 4MUIA 3BERA 4BKOA 3MWEA 1H1LB 2CLMB 1KEEA 5E6SA 3N6RA 1WXGA 4RJTA 5JEEA 1A7KA 4DCCA 5LKAA 3FNIA 5ICEA 4F2DA 3GUZA 1IE3A 3UJDA 5JZMA 3DDSA 1P4SA 4YV1A 2GK3A 3DDWA 4KN9S 1M6WA 2HDWA 2LKDA 4BC1A 3FPCA 3NHLA 5H59A 4BP3A 5CYGA 2Z2KA 4Q9LA 1NN0A 4JOBA 5DWVA 2JIRA 4UTRA 1O5OA 5AM0A 3E2MA 1NUQA 5FOXA 4R8VA 3U3KA 1XXHB 2FJ0A 1FVXA 2XKJE 1HFWA 3D6AA 2BN4A 3VHXB 3IXLA 3CVOA 2FF7A 1Y6QA 2WNSA 2WTAA 3L5OA 4KG7A 1NW4A 3A1VA 2R00C 3ER6A 2GRAA 4E5YA 2FYTA 5JXJA 4ENSA 1U0EA 3HJHA 3IAM1 1XB2A 2BY4A 5IM5A 5EXEA 2P5SA 2KBEA 2JJ1D 2I6TA 2QXUA 4D8WA 3QELA 2LDBA 4NBVA 2PTHA 4GQBA 2WUFA 2WWRA 5KEIA 2HHAA 2WD7B 3VVCA 4U63A 1P19A 3HUDA 2REOA 5JZSA 2GCGA 4P81A 4EJ6A 1YFLA 4PZZA 3WWOA 4PRLA 1GG5A 1EFRA 2VBGA 4EBFA 1UMCB 4E12A 4PXAA 1VMAA 1EX1A 1I24A 3QKUA 4FWIB 4Q39A 4X71A 4YAWA 2GPWA 3KPYA 2OHJA 4LNAA 1JAZA 2EP7A 2WA1A 2WJHA 3P0IA 4FMPA 4FZVA 4RHXA 4ZAVA 5DM60 4XWWA 3EXEB 3D8BA 3DTTA 4DIDA 1WU7A 1YU6A 2AMLA 3AGQA 3DE5X 2P1DA 4XR4A 2XVZA 5CNKA 3RS5A 4BMCA 3T34A 1EJ6A 1CW2B 1VSTA 3TTUA 1ADYA 1H9CA 4YMWA 3K5IA 5TQJA 3TNFA 2CXRA 1CUDA 16PKA 1G7CA 2H4HA 3AM5A 4K9OA 1X7XB 2FP3A 1QQ6A 2ESRA 3DEJA 4RPJA 1GTJ1 1R9GA 4CN9A 4I9UA 2P2SA 5H80A 2UUBB 1QYRA 1E3MA 3N0WA 4BXOA 5H4GA 2XMQA 3HFGA 4RW0A 3F0TA 3LPNA 9ABPA 1ODSA 1R00A 3WAKA 1AK9A 1O9HA 2GUGA 5JCJA 2GB4A 2PUVA 5E6SB 2CZCA 1YQWA 4DTIA 2QL7A 3FROA 4YGYA 1P9WA 2WU1A 3A6FA 3FYTA 2J8ZA 2NZYA 4KAJA 3V9PA 3BEOA 4IHJA 2LXNA 3ZVLA 1U3WA 4S1VA 2WWFA 4UUPA 5ALDA 4ETIA 3AP2A 5FORA 3ZDCA 1VHJA 4CNBA 3MTIA 1UXGA 3KSUA 5BWCA 4Q3CA 3KQSA 2X6QA 3R1IA 4MIYA 3KALA 3CH4B 4DSOA 1L3BA 3JQPA 2NADA 5GGYA 4MV3A 3GU3A 3KR0A 3GWGA 3CUWA 4M7OA 2ZI7A 3KDPA 1L7QA 4F8YA 3TF5A 4IDBA 2QLLA 1K8XB 2D1SA 3EY9A 1SVOA 2PUAA 3JQAD 1W4AA 3QFCA 1FYVA 4ZVSA 1TRKA 2H4FA 3PFWO 3TFWA 5LQSA 5I5GA 4Q37A 4BCCA 4DW8A 2VQ6A 2QRGA 2G70A 3D0QA 3HUFA 3QH4A 1T9GR 3KOXA 4ALJA 4DLSA 4JGIA 4ESOA 1DLJA 3LF1A 1IK4A 4GE0A 2ORVA 4HMOA 4QOFA 3U44A 2VJOA 1WHTB 3AESB 2VKTA 5JNUA 2O6LA 1A95A 4KQMA 5FWDA 4QG3A 3QZUA 5IMBA 5A03A 4KREA 1JHPA 4Y7DA 5FIUA 1JYSA 3G9QA 1A9RA 4FFRA 5BSKA 5DN6D 4CQJA 4IQ0A 2D1YA 2ERXA 2ES4A 5TMBA 1C1XB 4HSEA 4XTCS 2I87A 2WUEA 3ANYB 5I45A 3PD0A 2ISCA 4NSNA 2REBA 3HEBA 4H7FA 2NIPA 1FX0A 3E5MA 1V8BA 3W2TA 1DQPA 1V3QE 3OTIA 2Q4BA 2IHUA 2Y9MB 2YV4A 3NDRA 4LXIA 3TIGA 2BFDB 3V55A 3ZIAD 3BPSA 2ASEA 1HLFA 3GARA 2VWGA 4NBUA 3V2GA 4BBAA 4BO1A 4CYMA 4W9MC 1L3CA 3VX4A 2IYYA 5BW6B 4JFRA 5AVWA 1TMGE 4Y18A 1YD7A 3NV9A 2C58A 4D9MA 3O4FA 2H52A 3ENKA 4R1UA 4A8HA 1G6Q1 4M1SA 1Z47A 1T4BA 4NR0A 4H6WA 1JBKA 1Q1ZA 1TTTA 3L7BA 4JHXA 4LYYA 4XWKA 2C8LA 4F84A 1DO2A 3LMKA 3ZZMA 2QJOA 1UT6A 1XNGA 1SC4A 2ETXA 2XZPA 4IVPA 3D1VA 4PINA 4E5UA 1T36B 1TZ2A 1JG4A 4QTYA 2G9UA 4M8SA 5GADl 2REQB 4DWVA 1EEHA 5K8IA 3AM1A 3K4QA 1SA0A 2M9MA 1BDBA 4P22A 3WIVA 2VO1A 4OIFA 2B1JA 4L0MA 2WYHA 4V0MA 1QV7A 1PDOA 3RS7A 4TZKA 4PE5B 4MQLA 1GPLA 2R8PA 1U0JA 4O1MA 3O8DA 1HNZB 2A3RA 4QUHA 3VOSA 5ED4A 2MYNA 2QN3A 3EZGA 3WL6A 4LC9A 5DM0A 3O9VA 4L9RA 2YMLA 1FS4A 3A4NA 1JEQA 2VNKA 3A36A 5DX8A 5TGZA 5A0VA 1NLZA 3S0JA 4QRHA 1SBTA 1EVLA 1PUJA 2YC2C 1GADO 4LF6B 3DBLA 3EXAA 3F3MA 3QPAA 4MQEA 4UCWA 3K9NA 3EGOA 1K0FA 2XODA 5D1NA 4E0BA 1EUQA 1ZPDA 3HBLA 5KDDA 2F9MA 4GGMX 3WXMA 4QU5A 4NJMB 4CEJA 5GTDA 1AKWA 4BVLA 2X9QA 3MERA 3K2BA 4U2FA 1SU6A 4A0QA 1FBTA 3UA3A 2BM9A 2DT8A 4UUBA 4CM9D 3CLTC 5CH8A 2YFQA 1AIPA 3AHHA 3ED5A 3QU2A 4IQFA 3GP3A 3NS7A 1R0BA 2PSJA 5JH7B 1IEVA 3VR6D 3VDNB 4B84A 3NHYA 1LNZA 1TM1E 1FDTA 1J22A 1UXKA 2OQ2A 1Q21A 2ZTHA 3TL3A 3MILA 2ZM6B 4Q4HB 4LJRA 1VL1A 1JR4A 5EWJB 2PKYX 2RAFA 2DU8A 4BJHB 4UVEA 3FGZA 2I76A 1QTQA 4HX5A 3PLNA 1CYDA 2AX3A 3GRRA 1O94C 1EXDA 2X8WA 3DV0B 1W4CA 3T7CA 1E9DA 2PGAA 4WMLA 4DJ5X 4TPKA 3O2NA 2EJVA 3I2YX 2Z2XA 2X86A 2RGXA 2XE4A 3K0AA 3N8GA 4JR0A 4YP5A 2XUZA 1RFLA 2C4HA 5D7NA 3Q8MA 1X70A 2GTPA 4X95A 3TB4A 4G23A 4DT1B 3PFBA 1Y5MA 1GL6A 3NUZA 1COWA 1P62B 3IQHX 5EJAA 4RVUA 1ECPA 3R3SA 4H31A 4IR7A 3T9FA 1IOLA 4A6EA 5KJ6A 3T0GA 2IXGA 4WBNA 4G1FA 4BMOB 2F55A 4GYWA 5IAGA 2R1TA 4PZ0A 1HFJA 1H2XA 1YR8A 1J0XO 1RRVA 1U2SA 1DEHA 2IOYA 2WYOA 2PZBA 2OCXA 2X9LA 4FUQA 4ZC8A 1B0ZA 2JFVA 2A1TR 1SA0B 1SCKA 4GNKA 1E2KA 4GRDA 4EJSC 3DL7A 5C81A 2WTNA 5HMLA 1W47A 3FYCA 1TU4A 1L6RA 3JV7A 4DZZA 3AVWA 1P2TA 2DJ5A 3EFHA 4XWOA 1NXQA 2CMHA 3FGPA 5FBRB 3RHZA 4B7AA 1AKMA 4A3SA 1EXVA 1B6RA 4Q4AA 4DNXA 1MRSA 3BZUA 3HH8A 3PNYA 2Q99A 1CQJA 1TC1A 1ULSA 2I54A 1O87A 2AN1A 4G0QA 5GJWC 4QTUB 3M5PA 1YB7A 2IYLD 3C8MA 3ONVA 2XBUA 1DKLA 2EG9A 3G2OA 2NZUG 1E0JA 5CLIA 2QMUA 1XA3A 1YE8A 2D2IA 2VZ9A 3BWCA 1VA4A 2D0DA 1O4WA 1MP0A 4MVJD 4YRJA 1KFKB 2FXIA 1KK2A 2ZUUA 2GEFA 2JI7A 2QLNA 3HVJA 3MWGA 3OPNA 1IH8A 3RYIA 4GXNA 4E2YA 4EI8A 3RUHA 4G37A 2Q5JA 2G40A 4E6EA 5DTRA 2K7FA 5BSVA 2NPOA 1XFAA 1OZGA 1R3UA 1C30B 4B44A 4NYMR 2OC9A 5KYUA 5CHEA 3WC4A 4FVTA 5M7EA 2JBWA 3F2IA 3KV1A 1F5NA 1Y8AA 3BC1A 3K3PA 5EE5B 1LX7A 3AI7A 2W00A 2JK1A 4QPZA 2COKA 3LP6A 2CNBA 3FOAA 2AZDA 2O05A 2AG1A 1TUIA 3I28A 1EUDB 1XZGA 1ZOSA 3D59A 5KKCA 2O4UX 2QP4A 2V7XA 2XJ9A 4DREA 2WKQA 3DV0A 4LGVA 4KV9A 4IF6A 5M34A 5HKAA 1JAXA 4JI1B 3C5CA 4XAQA 5F3RA 1EINA 1RQ2A 2C2MA 1D2CA 3CMCO 4DCGA 1XZLA 1O94A 1BW9A 3EK2A 1T5SA 3RRBA 2W6QA 3E9NA 3K09A 1VJCA 4GSYA 5DX0A 2WMOB 4AF8A 5BSWA 1UFQA 3I42A 2C5BA 4ZAXA 3INTA 3GLSA 2VHEA 4HL6A 2P8SA 3DDZX 1GZ7A 1ZA1A 4ZO7A 3STYA 1Y5IA 5EP3A 2Q46A 1TQ8A 5KINB 4I4CA 2BTQB 2QXTA 1OB5A 3EY4A 3PB3A 4JB2A 5FWAA 5EERA 2IH4A 1MQAA 1DIRA 1IXZA 2QJFA 5C4IA 1PT6A 3DKIA 3HL4A 1CR6A 1CQJB 2ISSD 4GGPA 4MINA 4YJHA 5TE9A 1O89A 2C0QA 2GWRA 4EHDA 4DDTA 4BMNA 1GTG1 2QW0X 5CX4A 1SU8A 3WE7A 3OFKA 3AB7A 3K9FC 1F4VA 2FW9A 2QTRA 1YO6A 3MEQA 4FIDA 2DEUA 4MA5A 4M8LA 4EPRA 1M33A 1P39A 3EG9B 1PJLA 4QO7A 3AZQA 4MIEA 4RMGA 4J7UA 5LQMA 1YR7A 2HO4A 4WZAE 4IO1A 4NG4A 4RZ2A 4YJDA 1WETA 1GGHA 3VPXA 3IAS6 3VNSA 5A5DA 4B7ZA 3L84A 5CIQA 4C7KA 1ZM3A 3JZDA 1WMDA 4MVJE 1U3GA 4WBNF 3LLCA 4XSVA 3BMXA 4G63A 3CRVA 3QOWA 3L1UA 1U8UA 3WQQA 4C7VA 2XOXA 4DCOA 1DQZA 1J99A 5J5CA 3TRJA 5BSTA 4B8WA 1IOZA 1BCSB 4KLRA 3RK0A 2CV1A 1N6OA 2QAGC 1BS1A 2YV2A 4BFTA 4E88A 1I6WA 3MF4A 4FR0A 3HGTA 4P84A 3H4MA 3AW8A 2L18A 3PICA 2AG0A 3SC6A 3I9V6 1HG1A 1LF5A 3ETNA 4GR9A 2RGDA 1TVKA 1FC0A 1JVSA 1PT9A 3ESCA 5FWYA 4CLHA 1X7XA 2FLWA 1IVSA 4HYTA 4ZOLA 1PFGA 1XTVA 3PDCA 1CUVA 4MYUA 4LE1A 4YJFB 2GN1A 5EKSA 3LYHA 1XZJA 1RCUA 3EEBA 1CUBA 1UXIA 5AM3A 2PT6A 4W1PA 1E2JA 3ILHA 2X0RA 2Q3MA 4FHDA 4I1IA 2R7LA 1PR1A 3S8YA 1N3BA 2WQ6A 1FNDA 4K9NA 1Q0TA 5CD1A 1U1CA 1WU8A 1H8HD 1NMXA 2YL2A 3GDHA 3Q8LA 2XUOA 4BVBA 3CLSD 1SUBA 1ZN7A 4PXSA 4Z0PA 4D97A 5DW3A 5B6PA 2PJUA 3KP1A 1AY0A 1T5DX 4M22A 1BJKA 3KAQA 1V96A 1OKKD 2RK3A 3ZVRA 5K99A 3CIFA 3SQMA 1JHAA 1XNJA 1O9BA 5IKPA 2Y0PA 3CINA 2Q9UA 3HB4X 1C7JA 4JDUA 4DM4A 4X7PA 4ETNA 4MZXA 5FPSA 3CVWA 3ETEA 5FR1A 2HQRA 4YCJA 4YJHB 3T1OA 1EZZA 1PDVA 4B4UA 3KFVA 4RTSA 1C8VB 2JGEA 1OXKB 3R75A 1YZQA 3CW8X 4BBPA 4X54A 3UG6A 2V3WA 1MVNA 1EVYA 4Q21A 2WWYA 3SF0A 2NN3C 1CF4A 2GZ1A 2Z08A 3BKXA 3VZRA 2HF8A 2ZYHA 3DL0A 4O4IA 3UC9A 2EW8A 2HPZA 2IQIA 5DWQA 2VWQA 4LHWA 2PSDA 3E1SA 3QUTA 1UUFA 3ZK7A 3GLFA 5IP5A 1GA6A 2NW6A 2PGOA 3GPDG 4GMFA 3I9FA 3DHYA 3OLWA 4NABA 4RIEA 5ALNA 5BYKA 1WMBA 1IHOA 4D3DA 3L8YA 1J9EA 2BISA 4D9GA 1B42A 1KOFA 4BU1A 1RKBA 3T1QA 3BWBA 1UBNA 2I1QA 3LGSA 1DEXA 3IVXA 1XFDA 4M53A 4PC6A 4Y9SA 3WMWA 1A7UA 2P9FA 1N4DA 4MKHA 3MJCA 5JDCA 1ISJA 5KX5F 2AC4A 2QA5A 3KK0A 3L93A 1GCOA 4ZEVA 4FR2A 2ATCA 1V26A 1FTQA 2R6JA 3GYBA 3V1LA 3AUSA 3GYGA 2FXVA 4AJHA 3HL0A 4RK4A 3IODA 1JMVA 1SBHA 4XYGA 1J1ZA 4LDRA 4C2TA 4EFLA 3NTXA 4J4TA 2D2EA 4X1OA 3U4AA 3DGFC 2F8TA 3RS0A 4KPYA 3L7LA 2P69A 3ZXSA 5I4KA 1EFPB 4AS1A 1XTSA 5J23A 3DE1X 3CKMA 2PX6A 2QD5A 5HMMA 1GAWA 5LBUA 3AEKB 1X9GA 3WIOA 1U0HC 2RGYA 2B37A 3GWZA 1NG9A 5HQ3A 1TO2E 1GNQA 3MMSA 2HYIC 1JYFA 2ORIA 6REQA 3TAUA 2BR5A 1CS0A 3I6YA 1DFGA 2PAAA 2JFHA 1QVZA 1TT5A 2QIPA 3GCZA 2XUJA 1TO1E 4QU9A 3VPDA 3M34A 4N6OA 3OJFA 1TMKA 2A58A 4KVGA 4RVFA 1P7PA 5E1BA 2GZDA 3QVOA 2IOFA 4PBTA 2H4YA 1SB9A 4WLUA 4XPZA 2AJCA 5DM1A 4GM4A 4BUJA 1P3DA 1WO8A 2D1RA 1DBQA 1U0SY 3BF8A 4F56A 2DWCA 4EJSA 1TK9A 3VR2A 2FSVA 3IE1A 4AKIA 3DB1A 4J94A 2DHRA 4QEDA 3DAOA 1Z6GA 3MB5A 4WZAB 3WI7A 3PNMA 2VP2A 4RHYA 3FPBA 2O5EA 4X6LA 1X94A 4QYXA 2EWVA 4DMRA 1W581 3AETB 1D4FA 3KPJA 2M1XA 2FX5A 1QCYA 1NQVA 1E9VA 1RM5A 1SBYA 2UZ0A 3DLAA 3MGAA 4D42A 4HI0E 1K8YB 1P44A 1H6CA 1TJ5A 2BEKA 4AF6A 1EHYA 1U0TA 3OU2A 1M6EX 4F8EA 4R2WA 3TPZA 1EFDN 2ZANA 4GOOD 4RF2A 4R1NA 1RRMA 3KOZA 3KYBA 4I99A 1R4NA 4NH4A 2FN7A 1B26A 4OY3A 1NNLA 4CF6A 2O57A 1E2PA 3BORA 4KRFA 2J6IA 5K7SA 4UHDA 4MSUA 1MF7A 2POQX 2QTCA 2HXSA 3FTQA 3INGA 5EHNA 1OI4A 1V8ZA 1U2GC 3PD7A 3BXGA 2Z6UA 3MOIA 5LB2A 1XQWA 1SFRA 2HWXA 2UYQA 1DVRA 1S2NA 1UZUA 2YIMA 3JSXA 3NWEA 3PFNA 3IQEA 1R7RA 2QDXA 4HFJA 1IHPA 3QMWA 3C5WP 1DZIA 4LDPA 5SICE 5E7JA 1MHPA 2JRCA 3AEKA 3KCNA 4RVHA 5HILA 5HFNA 3ACDA 1O96B 2BI8A 2GF2A 4ND1A 3P2OA 1UJCA 1C50A 1IIRA 1RLJA 1V2HE 4C5AA 4ZI5A 3RFCA 3PXGA 1P2DA 2ZI6A 1ATZA 2FRDC 4MR7A 3VNRA 3WISA 1G4UR 2RJOA 2VUSA 4EUEA 1EP1B 2VDNB 2BSXA 1NQAO 4WCDA 3DOHA 3N8IA 1KDYA 3PUZA 4GZMA 3G59A 1CB7A 2C95A 5BSRA 2W6JA 2Y0CA 3V7WA 3K5WA 2YIJA 1ZMTA 5IYZF 2IA5A 3QF7A 1R6BX 2BSAA 1Z7WA 5IEBA 4RXTA 4E3WA 2GK7A 1YTLA 3EDYA 3RSGA 4HUJA 5K9ZA 2FUCA 1E69A 1WCXA 2QYSA 3O4VA 1ZIOA 1YOVB 3EUEA 3X1WA 5E4TA 5TR9A 1PWZA 3N7UA 2JJ1A 1JR3D 3ZY5A 4ENRA 3EGXB 4DSTA 2E4YA 3CNEA 2YZKA 5JS2A 3SZ3A 4ZJUA 4OX9Y 3M5WA 1LI7A 3K9GA 4FKBA 4B0OA 4LZZA 3ZW9A 2BKEA 4FHGA 5GAJA 3BJIC 1Z12A 4JI2B 4ZWNA 1GEGA 1QMGA 4GP6A 4PSCA 4H16A 3HYRA 1EVZA 1XKLA 1N5JA 2FR8C 3WGTA 1ECLA 1VPWA 2RBGA 3VR4D 4B5KA 1ZNWA 1QVWA 1SVMA 2YY7A 1HL7A 4NV1A 1BVHA 1UCFA 1GTRA 4G2TA 4LF4B 4UPDA 1C7ZA 4BLUA 1NUAA 3KV3O 2CUTA 2IHJA 2J5XA 3HV0A 3NBAA 3ZYZA 1JHQA 4GXTA 4Y6SA 1QC5A 3AW9A 1A04A 3FKSD 1FXWA 1OREA 1X1QA 2WFLA 2WTBA 3BAZA 1C8BA 4FILA 4X8MA 3FSGA 2R86A 4LK2A 4AMYA 2NU8B 5GONB 2XAUA 4RVSA 2ZTMA 5T57A 1X8XA 3WBFA 1M34B 4RTNA 5E9AA 3TZEA 2F6RA 1P4GA 4NCHA 1UBKS 4UM9D 2VQSA 1AHNA 4KXNA 2AEEA 3DFIA 3OM9A 4QWWA 3DYIA 4F71A 4F0JA 4Q9NA 1ILWA 1CNFA 2QTWB 1RPNA 4LSZA 4Q7EA 4P0QB 3HVKA 4KHPB 1ETUA 2K7ZA 4QT4A 2ABWA 2IYNA 5EJIA 3DBVO 2I2CA 5F51A 5A0FA 3F7OA 4MR8B 2OZPA 4HNSA 4TMKA 2BV3A 4Q7MB 2A9OA 1ZCAA 2BBOA 4IDGA 2I3DA 3MJSA 2OLEA 3RDPA 1NSFA 5D3MA 4EKDA 3CRZA 5EN4A 1X7ZA 2I4LA 4TTVA 5ITVA 3HU3A 1BROA 3NHPA 1LLUA 5FPYA 3FHLA 2Q1XA 4MXDA 1G3RA 4X8HA 3A6PC 3A1WA 3JARA 3GEHA 5BMOA 4OM8A 1ZVVA 1ZK2A 1ZDMA 3CF0A 3OI7A 4K0RA 1CEXA 4MROA 3GBVA 4OGGA 2WT9A 3DBHB 4QYTA 1RJGA 3IQIX 5H4HA 1ZVKA 1BYIA 1FMLA 1R66A 5FF9A 3LQ1A 4U9IS 4AK9A 5G1NA 5IC6A 4YK7A 1Y7PA 3R23A 1RJ9A 3E53A 4ZZ0A 5EUQB 3HWWA 4IVRA 1KO1A 2F1JA 2R96A 4HPWA 2BCJQ 3DEIA 4MARA 2QQGA 1PQ4A 4E5SA 4A8PA 2I4OA 2W9XA 3CO0S 1V11A 2PFSA 2J85A 2CHQA 1R9NA 3DD1A 3SQNA 4CM7A 4CT0A 1E8MA 4PN3A 2V5VA 2GVZC 2C7BA 5CT8A 1UK7A 3AM3A 5BW8A 1ETHA 1EGQA 3CWZA 2LCFA 4N1AA 1DBWA 1ZA2A 2CYCA 2Z2YA 3MWLA 3DOUA 2H5JA 4TMFA 1G5TA 3C16C 3GLHA 4ER3A 4YRNA 1AQNA 4BQFA 4ZGGA 1ADBA 2CFOA 1ND6A 3PTLA 3BUSA 1NNI1 3C43A 3D0OA 4GUDA 4WKOA 2J33A 5T4BA 4D96A 1QC5B 4Z4EA 1BDMA 2RK6A 3M5CA 4BL5A 1E7WA 1EP9A 1YQ9A 2JLXA 3PC8C 1ISGA 1MZVA 1UJNA 4WXRA 3TLZA 1B6SA 3VHQA 1GRRA 2DTEA 1MQ8B 2ZI4A 4HAWA 1IN4A 1U81A 2A9KA 4K6KA 2XUFA 4NATA 3HKEB 1GT91 1BEUB 5EP2A 3FVWA 2PZKA 3RT1A 1HOXA 3D64A 2AHRA 4NFYA 5JAMA 1G2IA 2VIIA 4RY0A 4V1CB 4OHBA 3F74A 4OA8A 5TIIA 1JHZA 1QHYA 1A7AA 5LOVA 2XZDA 3A6JA 2SKEA 4QEKA 4J3NA 1TVEA 4BE7B 4URVR 2R2AA 1AC5A 4RZSA 5CPFA 3TIVA 1EUZA 2TMDA 4BAGA 3I62A 1YHNA 3OAAA 2PL5A 4UBNA 2X1VA 1EQAA 2DGDA 3ILYA 5LYJF 2J0QA 4LISA 1CZRA 4JHLA 2RAPA 2AR9A 3EMBA 2RKWA 3GJZA 3Q4GA 3A37A 4XGIA 5FL7D 5EJ6A 3EQ9A 2O54A 4OL9A 3IURA 2B1IA 5ALGA 1Q0SA 2XQIA 3BXEA 1MFPA 4DWJA 2AMYA 3VVBA 3ZE8A 4Y1RB 4DC1A 1Y3AA 3H1AA 2B69A 1DOZA 2FQQA 4BYGA 1QYIA 2HB6A 5F21A 4HDAA 3H9BA 1B0PA 2B78A 2JIZD 3ZV7A 1TVCA 3RIEA 4GPAA 1I2BA 4ALKA 4K9RA 4ONEA 1T1EA 3TYXA 4DXDA 4IJWA 4ZYVA 3G79A 5IZCA 4CNQA 3MBKA 4H0NA 4WHMA 4J1NA 4AFNA 4HAUA 2DT5A 4P5DA 1ZOPA 1PD0A 1DUVG 2NTEA 4EFKA 1N77A 2HJSA 4D4LA 5A5GA 3RGWS 2FCRA 3TXAA 4L2IA 5JLAA 5KPDA 4RY2A 2X42A 1FZTA 3F6SA 5TGDA 4HB4A 1M10A 2ZJ2A 4PG4A 1LSSA 4IDAA 3QVTA 1R6VA 3GLHB 4A91A 4PQFA 4D6PA 3GGOA 5P8WA 4DLLA 3K6JA 3JD4A 4HAOA 1NF3A 1UDBA 3ZI4A 4C7MA 3HG7A 1YOBA 3C8ZA 1OX4A 5LXTF 4CL3A 1HA3A 4WXEA 2BCEA 3N6VA 1Y82A 1L7EA 1PGNA 4QXMA 1YJ5A 3S7TA 3R40A 2J3DA 1QOZA 4XLTA 1RAEA 1VKOA 3AFNA 3BRQA 2XCQA 3I04A 1YI0A 5ALXA 2WT8A 5EWLB 2YOHA 4AY3A 5CBPB 3DOCA 1QR6A 4OK5A 1X14A 3VR2D 3FFXA 1Q7RA 1SKYE 3DZ8A 1E1QD 3EHDA 4RQTA 1KBQA 5B7QA 4RFLA 1L7XA 4BP1A 4PRKA 2IVZA 2P78A 2AZXA 5E95A 1GPH1 3MWYW 4LJ4A 5KCZA 3EVZA 4OJNA 2F7SA 1G8JA 5G40A 2X3UA 2B82A 3GMSA 1W25A 2WYVA 3HYCA 4B8YA 3O1JC 4WUTA 2WUDA 5TSDA 4AX4A 2EKLA 1XDZA 4TT3D 4EO7A 2CMFA 3RVQA 3N0XA 3UM9A 1A5TA 4WXYB 1YRHA 2QVLA 3B2EA 4L9SA 4BYMA 3DBHA 1D09A 4UPEA 3WOHA 3HMKA 1VJ1A 4KDRA 1QYCA 4KPUA 2NTJA 4YPFA 1U2GA 3CUEF 2RGRA 1E1DA 1IATA 1K08A 3BRWD 1Z2AA 1F2TA 1Q16A 3N75A 4UEKA 3CUKA 3V5NA 4AJNA 3NHUA 3E7XA 4FBLA 3VJLA 3KDSE 4X7RA 2W2TA 3T12A 1BXGB 4FYPA 4X62B 1C1DB 1H5QA 2FG7C 3PCXA 4K87A 5KB3A 2BJWA 3SYMA 5A1TA 3HR8A 1NMZA 2Y2UA 1X2BA 3BWVA 3DEHA 2GCEA 3UCFA 4DPMA 1WDMA 5FUYA 3UAZA 1G9XA 2HIGA 4C14A 2YKGA 4L8WB 2A0KA 4OCZA 5BUCA 1KI7A 1H85A 2OYCA 3N9IA 5IAAA 3KHUA 3L05A 3P4YA 2QRPA 2QVGA 4XZ3A 4TSFD 1I10A 1V9SA 1CP3A 2P6UA 3GNLA 3PFHA 2R8BA 4IXDA 2MINA 5ESDA 2Q8QA 1Z0FA 4PLYA 3TLGA 4L4RA 3QXCA 4KSCA 5TNXA 4HEHA 4RAQA 5EOVA 3DQQA 1IZ9A 1XEXA 1N6NA 1QHHB 4L0QA 4NV0A 2D3TA 3L4BC 2JFOA 4L74A 4P6VF 5FUMA 2JA1A 1KVQA 5K0LA 4AP6A 4KEAA 1CY8A 2OCPA 3OJWA 2JLVA 3DHWC 5HM8A 4RULA 1ECJA 1L4BA 1PHRA 3K8ZA 1EAYA 1TQDA 3QKSA 4N3CA 5KAPA 2WE7A 1OIXA 2O9JA 1Q7EA 2NXWA 1IJBA 3A25A 1A27A 1Q3HA 3I1FA 4UM9B 4CKBA 5JRDS 2OBNA 3ZQKA 2QRJA 4AC9A 1X7WA 2G09A 4R2LA 3MGCA 2A0WA 4KC0A 3GJYA 4OKNA 5G4KB 4TVOA 2XV1A 2C4WA 5J2UA 4Z4CA 3WVNA 3HCWA 4OI4A 4BKRA 1KO4A 1IZ8A 3H9CA 5I7EA 1GKKA 1W35A 2OOKA 1N2HA 4G5HA 5CT4A 4DR2B 3KG2A 1GCIA 2ZAIA 3CRRA 3WSWA 4ICIA 3TQSA 1COZA 4TYMA 2BHRA 4V0LA 3IIMA 4BKUA 1LZKA 3I5MA 3L7DA 1SXIA 2HSDA 4DV4B 7AT1A 1YVRA 5C9ZA 5CDTA 1KK0A 3TW6A 2PTGA 1DXQA 1ZINA 3M6AA 3WP0A 1T8PA 5C46F 3KWLA 4GOJA 3PQDA 4ENTA 1D07A 5FKJA 3HB9A 3PBKA 2JLYA 4HZIA 5L40A 2H5EA 4MGYR 4EG1A 3MWJA 3DVQX 1QCDA 4K1LA 1E2GA 3CJQA 2X5XA 1JLLB 3FHJA 1R6AA 5H5JA 3SYNA 3SHFA 4FZRA 4YDRA 1CFZA 5IAOA 1WCIB 3IKLA 4MRNA 3WV5A 4JEMA 4TV9F 4NCXA 2C7OA 2CJWB 2JFYA 2Z8ZA 3VDRA 2EWMA 4DLBA 4CHGA 2HCJB 4NHEA 1O57A 2JIQA 3S29A 4LJAA 1RRCA 1ZM9A 3BIWA 4FI3F 2WWGA 1I6MA 3H19A 3LYUA 3GRYA 5F5XA 3KXPA 3S1AB 4DB4A 2G88A 4WCVA 4AUNA 1XLUA 1NC3A 4N0DA 2VT3A 5FFMA 3SF8B 4DWWA 1Q1BA 5JNTA 5IVHA 5CJ2A 3JYLA 3RVPA 2FH5B 2QZPA 4KX3A 1JJ7A 1AT1A 2EX4A 4N54A 3KAJA 3RRJA 2F43A 2ICAA 5AHRA 3NEYA 3EWNA 5KOJB 1LWOA 2B7LA 2XYQA 2OHGA 1AS2A 1T0HB 2C3MA 2HA5A 4CIBA 5EXPA 4M0MA 2GZSA 3ZWMA 3KVOA 5DLYA 3L4BA 4DKXA 2BF4A 4FDLA 4OU4A 4ALNA 4YXWD 5KQMA 3GELA 2B4AA 3LXRA 1LSJA 4BXOB 3HEAA 1Z0JA 2XNCA 1X7ZB 3EWIA 2GYVA 3NAZA 1XZQA 4XQEA 3TRDA 4GQAA 3TRKA 3X1XA 2Z1MA 3ESZA 3LLMA 3ZLBA 5DW0A 4CDGA 1VFNA 2QSZA 3RUCA 4PPFA 1Z7EA 1QQ7A 1NPDA 3A8TA 4KE6A 2PBLA 5JVDB 3GLGB 1S89A 1HL3A 1PW7A 1YS7A 2F9FA 1TT7A 2QYOA 1EUCA 2ID8A 4OAQA 4XDYA 2B94A 2WWWA 5H3CA 5H68A 3G2HA 4I3GA 2EXXA 3JZMA 2WRZA 2WYUA 3RU2A 4LDZA 4GU5A 2ENWA 1PBTA 5BXQC 3EA5A 3EE6A 1J24A 3MFQA 4IKOA 1X8LA 2WI8A 4RD2A 1EWRA 5KOHB 4G5XA 4Q19A 5HZHA 3LQYA 1X8KA 1FPMA 2DH6A 4HQ6A 1OWNA 4Z9AA 4JLJA 3RS3A 4B4KA 3HWRA 2ERYA 4B2IA 3MJFA 4BDTA 2DPYA 1E7QA 2CDAA 1P31A 1VE5A 1J5XA 3COJA 2PYZA 1H2RS 3O8RA 1DCMA 2J0EA 3OM8A 4R2IA 3RBZA 3N39C 3MJ4A 2DTDA 3BA1A 4MJLA 1UPBA 2WQZA 1XWFA 2WW8A 2GHQA 5J5VA 2WSLA 4DCVA 2XYPA 1U31A 2IY7A 1NVMB 4Q7QA 3R2JA 4IDPA 5KWJA 1HMPA 1EVEA 2B8WA 2V9ZA 1JEYB 1QHNA 1U2TA 4RHEA 4MRMA 4XEHA 2NVOA 3QMPA 1DC7A 3EDMA 3QVLA 3DVAB 5HBRA 1DMSA 3C98A 4OGFA 3UBMA 4ARBA 4WKGA 2Z6AA 3HVHA 4C7JA 3ADDA 4XCVA 3FCAA 3FLAA 4HQOA 5BPHA 2O1SA 1H2EA 1U3CA 2ZJ4A 3EDQA 2XNSA 3MT0A 1Q5PA 4H7EA 4GOMD 4PQEA 3SVZA 1S3GA 3D7MA 3T15A 4KOEC 1AVTA 3GVXA 4LBWA 4ZDJA 5I7RA 3S81A 3T5BA 4PFSA 3WRWA 2PUEA 1IWPB 5TMEA 5EE1A 1DELA 1XEWY 2G9VA 4D80A 4DLVA 1X7WB 1OHHD 2JZNA 2AD1A 4QYIA 4W5WA 4IQGA 5FPTA 1RHMA 2QT0A 3NM5A 1JR3E 2HKIA 3GQVA 4FZ3A 3WGNA 5HKLA 1RNLA 3TG2A 1BDIA 2EDCA 4UMVA 3KKNA 5ENZA 1TZCA 2VHTA 2VYQA 3GHHA 3TK1A 1H22A 3E35A 3WDSA 1HLDA 3CCBA 5ARBA 3W77A 1XC7A 2V7WA 3P9QA 3AF5A 4WVFA 4EQ6A 3TD9A 2ZR8A 4U7GA 5ARCA 1OYOA 4DIUA 1XNQB 3VTAA 5AJZA 2V97A 4F72A 5KVSA 4E5MA 3QE4A 3AOEA 4NEQA 2DFTA 1WSBA 1NRJB 4QBGB 4EBBA 4KN6A 4UVGA 1FW6A 1POWA 3QX9A 4YT5A 1TIKA 3ZDYB 4L75A