3KQVA

Crystal structure of hpnmt in complex adohcy and formanilide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
b'ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
molecule tags Transferase
source organism Homo sapiens
publication title Fragment-based screening by X-ray crystallography, MS and isothermal titration calorimetry to identify PNMT (phenylethanolamine N-methyltransferase) inhibitors.
pubmed doi rcsb
total genus 94
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3kqvA00
2YXDA 5M5BA 1JG2A 1EAMA 4HRAA 5EMKA 4F84A 1AV6A 4RV9A 4XUCA 3BWBA 3PVCA 1PRYA 3SMQA 5K03A 4L7VA 2CKDA 2BR5A 3DH0A 4A6DA 3CVOA 4DCMA 3Q7EA 4YUXA 2ORED 3HCCA 5EGSA 2ONYA 4DQ0A 1SKMA 4AZVA 3OE4A 3TLJA 4E2XA 4IWNA 1Q0SA 2OZVA 1YFJA 3FPGA 4OBWA 2XYQA 2PLWA 3EGIA 1KYZA 4PYKA 5JUWA 3I58A 3P2KA 1V39A 2GA9A 2HTEA 1SQGA 4GOMD 3NWBA 4PYQA 1NW8A 2BR3A 1SUIA 2PBFA 3CJQA 4PCAA 1NV9A 2G71A 1L9KA 1ZGJA 3HVKA 2EJUA 3LBYA 3DTNA 4QDKA 5HIMA 3ELWA 3BZBA 3B3GA 3OCJA 4GBED 4JXJA 5DT2A 3OU6A 4U7TB 3OE5A 5DM0A 3AWIA 5GM2A 2G8NA 3REOA 3TMAA 5HILA 2EFJA 3E8SA 2PT6A 5DSTA 1RJDA 2PSSA 3JWGA 3G2QA 3IYLW 5EG5A 4QVGA 5FHQA 1TPYA 3MAGA 2O57A 3IHTA 4QQKA 1QANA 2BR4A 5E2AA 2ESRA 4YUZA 3O7WA 4WXHA 2JHAA 5FA8A 3FUWA 3HP7A 4R6WA 5K0BA 1R74A 1RI1A 2B2CA 5K0LA 2ZFUA 1IY9A 4PCLA 5GWXA 4GC9A 3FYDA 4QPNA 5DM2A 3OU2A 2AS0A 1SG9A 1XCJA 2GB4A 3LDFA 3AXTA 3FZGA 3I64A 3JWHA 5CCBA 4PYIA 3Q87B 3DMGA 2ZZNA 5KYGA 3C3PA 4Y30A 3FRIA 3ORHA 1NBIA 3KPJA 3CCFA 4BLVA 1NW7A 5LQRA 3LCVB 5CVJA 5GP1A 3LECA 3RIEA 4WVLA 4DA4A 5EMLA 2ZBPA 3SM3A 3G5TA 3TQSA 1N7IA 4ZTBA 1KPHA 2NXJA 4K6MA 4AZTA 4M36A 5LR6A 4DKJA 3KQVA 3VC1A 1ORIA 2C7RA 1KPIA 3TRKA 5K09A 2ZULA 4RVFA 3HVHA 1L3CA 5EMMA 1JTEA 3MERA 3HVIA 2XVAA 4CWAA 2XYRA 3K0BA 3IEIA 3KR9A 1KXZA 3KQMA 3HEMA 4YV1A 4CXMA 1JQ3A 1WG8A 5FHRA 4OQDA 5H02A 4QPPA 5DX1A 1G55A 1P1CA 3THRA 5DRYA 2YX1A 4EK9A 3PTAA 1Y8CA 4KIGA 1EJ6A 1O9HA 3PB3A 3EGEA 3A27A 3GNLA 3BKWA 2ZSUA 4KVZA 5EZSA 3BGIA 1KHHA 4FT4A 1NBHA 4R6XA 4C08A 4XUDA 1O9GA 1XXLA 3DLCA 2GH1A 5EKUA 3MTEA 5FUBA 2P1DA 5T6BA 4CTJA 4E2YA 3K6RA 3OPNA 3KR0A 3P8ZA 4X60A 2P3QA 4LWOA 3C0KA 1RI4A 5EZQA 4POOA 3KQPA 5EPEA 3TFWA 4FSDA 4HH4A 4RTNA 5DXAA 1QAMA 2XYVA 1QAOA 3FPEA 3M4XA 2GPYA 1M6YA 1ZKDA 3EVDA 2NNWB 5DTQA 2IDKA 5E8RA 3TM5A 2QRVA 2ZZKA 2EX4A 4GOOD 3FUUA 4YV2A 3HA3A 5HIIA 2IH2A 3AXSA 2OO3A 4XCXA 5K0NA 4E31A 2P8JA 2O06A 3BUSA 3MB5A 3P9NA 4HTFB 3GXOA 1L3BA 4PYOA 1PJZA 4CKBA 2P40A 4EMSA 3I9FA 1R6AA 2Y1XA 1R8YA 1VIDA 5FQOA 3GRRA 4M38A 5ICEA 1JQDA 2AZTA 3CC8A 3DXXA 3B89A 3MQ2A 4PGGA 1JG3A 3FRHA 3FUXA 1XDUA 2PWYA 2O05A 5CM2Z 1WXWA 2JG3A 3E7PA 2H1RA 1N2XA 3NJRA 4PINA 3G5LA 4AX8A 5E2BA 3V97A 3GCZA 4GEKA 3PX2A 4HGZA 2BZGA 2JHCA 5GIOE 5CVUA 4AUKA 3UA4A 1WZNA 3BGDA 3RODA 2ZZMA 1G8AA 3KU1A 3LGAA 4PYJA 3NDJA 1P39A 2EJTA 4FP9A 5FTWA 4ER3A 4RVGA 3AY0A 3FTCA 3UWPA 1R8XA 1VPTA 3M6VA 5EQJB 5ICCA 3VYWA 4E2WA 5LQJA 4MQ4A 1ZGAA 3QOXA 1N7JA 2ZIFA 1M6EX 3TM4A 5DTRA 3G8AA 1JQEA 2B78A 5E1DA 3T7TA 4P7JA 5EOVA 2IP2A 5K05A 3KQWA 2VS1A 4DCGA 5K0FA 3BWCA 1ZHFA 3C3YA 4LWPA 3FPHA 3I53A 1G60A 3UA3A 1X19A 3NVKI 5HEKA 3P2EA 2IGTA 1FP2A 2V7EA 3P71T 4ISCA 1TW2A 2ADMA 2DPMA 3GU3A 4QQNA 4A6EA 4UOEA 3KKZA 1UIRA 1IM8A 1O54A 3KR2A 4GOLD 4X63A 5U4XA 3FTFA 3M6XA 4RTRA 1UFKA 1VBFA 1VP9A 2AVDA 3EPPA 5G02A 2FK7A 4LECA 1R00A 1XDSA 1XJ5A 2PX2A 3HA5A 5DM1A 4RVHA 2PX8A 4ATNA 3O4FA 4M7RA 1DL5A 4C03A 1VQ1A 5EIWA 3OU7A 3SVZA 4DM3A 4F85A 3HCBA 4HC4A 1D2CA 3PFHA 3G2MA 3JWIA 3ER9A 2AOTA 4MHTA 2ZTHA 1KIAA 1KR5A 3R9XB 2B3TA 2P35A 4H0NA 2F8LA 5HIJA 4EKIA 3FPFA 3UJAA 3ELDA 3EVEA 4KIFA 3DP7A 4PGHA 3GRZA 1EQAA 2FRXA 1TW3A 4HSGA 1KYWA 1BKYA 2PY6A 1FBNA 4R8SA 5DWQA 2QRVB 3EGVA 3KPYA 3ANXA 5HFJA 4YUYA 1DCTA 3MHTA 1YF3A 2BH2A 2YTZA 5K8VA 2FYTA 2P7IA 2WK1A 4R8RA 3L8DA 2VDWA 5KVAA 3PT9A 2ZWVA 3M6UA 1X1BA 4PYNA 5B1SA 4DF3A 1MJFA 2XVMA 2CMHA 2PXXA 2PV0A 2FPOA 8MHTA 3TOSA 3S68A 1NT2A 2PX4A 4C04A 3E23A 1JR4A 4MIKA 5EIFA 3B3FA 5E8JA 4PONA 3LKDA 3MCTA 5D1HA 4X61A 5E1BA 5JR3A 2C7QA 2IFTA 3KQYA 4RSRA 3V8VA 1X1DA 5DTMA 3GRUA 4MWZA 4PIPA 3T7RA 3FYCA 3P2IA 5MHTA 1ZQ9A 3EEYA 3KQTA 2OYRA 3ID6C 1I1NA 3FUVA 3VC2A 2HNKA 2OB1A 3UJ6A 4RTOA 3GIWA 2H00A 5HIKA 4EVIA 5EMJA 2PVCA 3DXZA 1BOOA 3ER8A 3FUTA 3QV2A 4FSXA 1BC5A 4PNEA 4YMGA 1DUSA 4DZRA 4O29A 5FQNA 2VP3A 3ELUA 5CVVA 3UJBA 5DPMA 4ER6A 3NVMB 4OBXA 5CD1A 3EVZA 1M0EA 4ER5A 2C7PA 4PYMA 2AOVA 2G72A 1SUSA 3LCUA 3CKKA 4PIMA 4E2ZA 2G1PA 3TR6A 3LCCA 2JH9A 5BW4A 2DULA 4YUVA 3EMDA 2O07A 2YUIA 3EVBA 4KRGA 5C1IA 1EJ0A 3FPJA 1I4WA 2Q41A 1KP9A 5IH3A 1VLMA 2VDUE 4BP1A 4CKEA 4P7KA 1XVAA 5LQUA 4G56A 3SSMA 3DMFA 4DMGA 1HMYA 3UJCA 3UZUA 3R6TA 2EG5A 4RTMA 3LKZA 2AVNA 2ZW9A 2ZIEA 3I5UA 1NW3A 2NYUA 5D1NA 3GRYA 2A14A 3IV6A 4B17A 2FCAA 3EVCA 3JWJA 2K4MA 3MGGA 5IKMA 2P3OA 4C06A 3HVJA 2E5WA 3GRVA 5CVDA 3TKYA 5K0EA 2AOXA 2BM9A 3HCDA 2GS9A 4AZWA 2B9EA 1VP3A 1YZHA 3BXOA 4GQBA 2ERCA 1ORHA 4IV0A 5HZMA 5F2KA 3GJYA 4GUAA 2UYHA 2CWWA 3LSTA 4BP3A 3R3HA 2IDJA 3GWZA 3G88A 3QOWA 2WA2A 4OQEA 2I7CA 1VL5A 4PYLA 3CJRA 1NW6A 3DMHA 1P1BA 3G2PA 4YV0A 2ONZA 1G6Q1 5EC8A 3U81A 4ER0A 5BP7A 2KW5A 3LL7A 2OXTA 5EVJA 4GOND 1YB2A 5FADA 2JJQA 3BWYA 2PWPA 3KQSA 5DSXA 1YZ3A 5K01A 2FK8A 4ER7A 5BXYA 4R05A 5E1MA 5CCXA 2Z6UA 3LHDA 2AOWA 3A25A 4X1OA 4V0QA 3PX3A 5GINE 1NKVA 1WXXA 2AN4A 2YVLA 3T0IA 5K0GA 4C4AA 4CKCA 4KW7A 2OY0A 3B5IA 3C6MA 1RJFA 2Y1WA 3OZSA 4X41A 5E9WA 3A7DA 4Z2YA 2XBMA 2P7HA 4P58A 3HNRA 5ICGA 4OA8A 2UYQA 3M70A 2B25A 1X1AA 4RWZA 2NP6A 1B42A 3F4KA 3M33A 2QY6A 1RI2A 3G2OA 4P7FA 3SR4A 2YQZA 3KR1A 5LQCA 1L1EA 3UJ8A 3DULA 1FP1D 3KHKA 3NTVA 1XCLA 1JTFA 4FGZA 1JSZA 1SVUA 2AR0A 1JG4A 3DLIA 5DXJA 2OB2A 1WY7A 3KQQA 3EEOA 4GC5A 3BGVA 2UZ4A 2PX5A 4OA5A 3C6KA 4QTTB 2AOUA 5DRTA 3KPVA 2LD4A 3OZTA 2NXCA 2R3SA 3T7SA 2YXLA 3VSEA 2FHPA 2V74B 2BM8A 2YR0A 1ZG3A 4QTUB 1AQIA 2JHPA 3UJDA 3HTXA 5LQNA 2VZ9A 3P9IA 2P41A 2AN5A 1RJEA 3CGGA 3P97A 2IH4A 5DX0A 10MHA 4RTQA 1QYRA 3R24A 1JG1A 1NV8A 2IPXA 2PGXA 2HMYB 4IV8A 4AZSA 5C9ZA 1RJGA 3EVFA 3ME5A 5KQRA 1WS6A 1U2ZA 1D2HA 3UJ7A 3D2LA 2AN3A 3EVGA 2HWKA 1T43A 3KPUA 3P9KA 2NXEA 5T64A 5BW5A 3MTIA 4RVDA 5HOQA 3HCAA 2I9KA 2I62A 2PT9A 4FS8A 1L3IA 5EKXA 3UJ9A 2QYOA 4C05A 4RYLA 5C0OE 4CTKA 1AF7A 5FCDA 4E30A 4RTSA 3FTEA 4BLUA 3BT7A 5CIYA 5EEGA 5DM4A 1R18A 3EMBA 5EHGA 2GLUA 4EKGA 1EIZA 2OKCA 3ERCA 4RTJA 3G8BA 3BKXA 4P7GA 2GAFA 5GOZA 5DX8A 3DUWA 4KWCA 4Y2HA 1XDZA 1Q0TA 4RTPA 1G38A 2H11A 3NDIA 3PLAE 1VE3A 2I6GA 3CBGA 5LQKA 2JH8A 3HCFA 2CMGA 1OR8A 5F2OA 4C07A 5FWAA 4F86A 3MCZA 3BWMA 5K0CA 1BHJA 2NXNA 3NWEA 4GF5A 4HTFA 2C7OA 2YXEA 2CL5A 3TKAA 1HNNA 3OZRA 1F38A 5ERGB 2OBFA 3DXYA 3SGLA 4KDCA 4E32A 2IIPA 5CUQA 3DR5A 3EVAA 3THSA 3NMUF 5EHIA 5DLYA 4FR0A 5ICFA 3CJTA 4QVKA 4RX1A 2NP7A 3ELYA 4FZVA 3GDHA 3SX0A 2HR1A 4BY9E 1FPQA 5CVEA 3G7UA 2PXCA 3M6WA 3TPZA 5GIPE 1EG2A 1FJXA 1F3LA 4IKPA 2Z6AA 2PJDA 2R6ZA 3E05A 4LG1A 5P8WA 4EQZA 3SSOA 2ZBRA 1JSXA 1D2GA 3B7PA 3H2BA 3FTDA 3LX6A 2ZLBA 5F2NA 2OPBA 1NW5A 3KQOA 3UFBA 3GGDA 2VDVE 2AOUB 2IBSA 3B3JA 2ZIGA 3NW9A 5EEHA 4OX9Y 2N47A 3HM2A 4KDRA 1H1DA 5KQSA 1XTPA 1G8SA 1MHTA 3OFKA 5FULA 4V0RA 5FWDA 5LSAA 1IXKA 2UYOA 3G89A 5E9QA 5E9JA 4QDJA 3GO4A 2HV9A 4HG2A 4NECA 4PWYA 4E33A 2P3LA 3HCEA 2IBTA 2ZWAA 2UYCA 2G70A 3R0QA 7MHTA 1P91A 5K0JA 3RW9A 2IH5A 1INLA 1I9GA 1X1CA 1RI5A 3AJDA 1UWVA 4BLWA 4RTLA 2ZCJA 9MHTA 3HA7A 1Z3CA 1KPGA 4U7PB 1AQJA 3WSTA 1YUBA 2PKWA 3O31A 5FA5A 4YMHA 3A7EA 3PFGA 5GM1A 1NE2A 3P9CA 2ZVJA 3KPWA 4HGYA 1YFLA 2QE6A 4M37A 2QM3A 3UBTA 3A4TA 5E1OA 1QAQA 3SSNA 3LDUA 2Z6QA 2PXAA 2O0LA 2AOTB 2WA1A 2ZBQA 3LPMA 4XUEA 1RI3A 4FT2A 1QZZA 3A26A 4E70A 3X0DA 4YUWA 5T67A 3PS9A 3SXJA 4MTLA 5KS2A 4RTKA 5LQAA 3OFJA 3LDGA 1SQFA 3DOUA 3LBFA
chains in the Genus database with same CATH superfamily
1N1MA 1MV8A 2FUKA 3M1YA 5K3SA 1V95A 2QX9A 1FVHA 1FFDA 4CQLA 2PWBA 3WG9A 5B30A 3Q8LA 2ZBUA 4WWHA 5JMTA 3C7TA 3P0FA 3VAYA 4WLUA 3ZKWA 3CRZA 1X38A 1M0TA 3N2ZB 4QJIA 2DH5A 3T4PA 3KZXA 8OHMA 1YS7A 3ZK7A 2W93A 3GVCA 5BNWA 3HGTA 1Y5IA 4PFSA 1V41E 5FPKA 3W77A 2D62A 3IJEB 4I3GA 1O6GA 4MS4B 1GNRA 2FGJA 4JQCA 3P2OA 1ZI6A 3W78A 3ZK9A 2C61A 2Q5CA 3G9XA 5DCWA 521PA 4TXJA 4OFBA 4BJ6A 3FYUA 1L8LA 1VIMA 4CF3A 3K6SA 5DEOA 2D2EA 3VDNB 1HT1E 1Z5NA 4CMJA 2ZDHA 2HO5A 4ARZB 4EW2A 4Q3LA 2B92A 1UKEA 3CJQA 5IZCC 2IRWA 3E5NA 1NV9A 1Y6GA 2GHRA 5ALYA 2HA7A 3E3MA 1SXJA 3K2BA 2CC2A 4YREA 2HWWA 4BNYA 1EBFA 2W6IA 3ML1A 3OETA 4G23A 1PVDA 1KO5A 2ZJAA 2B99A 2SHKA 1L7VC 2WPDA 1JYSA 4W5NA 3IOBA 5C80A 5T4HA 1VOTA 3EGXA 1ZNWA 4QQKA 4X71A 4FE4A 4PSKA 4R6WA 2I1LA 4O4LB 3OQBA 3ESAA 3PHBE 2IXDA 2Q50A 4KKVA 4RFSA 4X1IA 1VBMA 3GAZA 1O57A 3S44A 4BKMA 4CLRA 2FWRA 3UTDA 4YCMA 3GPLA 1T4GA 1KKMA 3FZGA 3KT8A 4PYIA 2VRBA 1P0MA 3KEQA 3G6KA 1JQBA 3V32A 3UMYA 4H6PA 4Y30A 1OIVA 1SZCA 4NRDA 2XMDA 2WFZA 3O92A 5LQRA 5SY4A 2I4LA 2V4MA 3RANA 3ZDEA 2XWJI 4MMZB 3WXMA 3AL2A 3BD6A 1AMOA 4YAEA 1SKUA 3UHAA 1UMBA 5JXGA 1TTHA 1RHMA 4W5QA 1JLRA 2QTGA 3FRJA 3Q5GA 4ZA2A 3D5TA 1L7NA 5TARA 2ZBEA 2X4GA 4BWYA 3GLHE 1WBBA 1OAAA 3DGFC 5CJPA 5AVUA 4GMHA 4A36A 5JEEA 3GJQA 3EYAA 3EMVA 3ZHZA 1KXZA 2GCIA 4P93A 5AICA 4DJDC 1NRJB 2EZUA 5KPDA 4JL5A 2QVBA 1ZXLA 4ETWA 4AO6A 2FA9A 2BT4A 5K2OA 4PGAA 4RDCA 3DE5X 1YMUA 4LCEA 4P7BA 4G65A 1FX0A 2FOIA 1TVKA 4DG5A 1YBVA 3DTVB 4IIBA 1GQQA 2B1QA 3HRHA 3G0IA 4NF2A 5TY0A 4L5CA 2OHVA 3I2IA 1MOPA 3R7BA 4CFZA 3F9CA 4OSPA 1WRBA 2VYNA 5CH5A 4QKQA 3ROXA 1WHTB 4CU5A 3DFUA 3NS7A 4IXWA 1HT2E 2V1XA 3ZE0B 1U2GC 3M1LA 1XFAA 1THTA 3QK7A 3WKAA 2MT9A 4QRHA 2VT3A 4DEYA 3W9BA 2OA0A 1W5FA 5A05A 2Q46A 3D8RA 2JPDA 5HS6A 1PJ4A 1GDDA 1MRNA 4OIMA 5ALNA 2PUVA 1PU2A 4M87A 4W7SA 3ADCA 4Q7LA 1GU1A 2MSCB 4QFCA 4DNXA 4ABYA 4YV2A 3V4LA 4OFXA 3B7WA 3MGAA 5E6SA 3TLCA 4JMPA 4KK4A 1DQYA 4QASA 1D03A 2BFOA 2CB9A 2DYKA 2JLUA 3OOYA 1F2UB 3TZEA 1L3BA 5LC1A 3V8PA 1L7EA 3PQ3A 4DCJA 2IHKA 2V6MA 2R8OA 2DBQA 4N5MA 1KI7A 2EFEB 1V5EA 2AQ8A 3KG2A 5SYMA 1UKYA 5K8IA 4J94A 5CFOA 1KBZA 5LNK6 2JG3A 2HIGA 3RSOA 4B3GA 4Q9KA 3U3MA 3H87A 3MWGA 3ZZTA 1N2XA 4GZ5A 1QH0A 2VTBA 1RADA 4FIZA 4CCYB 2Z5GA 3QMWA 4WINA 4DDHA 4UDNA 1GGFA 1I36A 2M32A 2Z98A 4FFDA 4HGZA 4LF4B 2BDTA 2VSNA 2ZIXB 3TZQA 5GV8A 4EYEA 2RIRA 4JITA 4N5HX 3WBKA 1U2QA 4NOLA 2XSZD 4QZVA 2FPXA 1TJ4A 2A1UA 3E3OA 2BBWA 2Z83A 3GW8A 4HGPA 4DIDA 5AW4A 2V9ZA 4N03A 1IY1A 3RAJA 5I5EA 3THXB 1BVUA 2O3TA 2HT6A 2D1QA 2J87A 1N9GA 2M9MA 2ST1A 3FLEA 3OQIB 4FBMA 2P30A 4YLYA 1NX6A 1FDVA 2C83A 2IP2A 3MJ4A 3ZWMA 5P21A 1AB6A 2E2WA 5AJXA 1JPVA 3FNIA 4LX8A 4XARA 4ERNA 2C58A 2Q5FA 4MV8A 4XJVA 1H6BA 2QRPA 4XM0A 1PUIA 2QQEA 5FB3A 5M04A 3C7AA 5EJMA 1LB1B 2Y6VA 1CRZA 4EUNA 2IPMA 2PTHA 1CC1S 3EMKA 1N4AA 4DCNA 2QAJA 2BFBA 2A7QA 3DYBA 1H2AS 5JZ9A 4R2HA 1SG0A 2QENA 1RQNA 3U5TA 3CX7A 5I47A 5I7UA 1CS4C 4ZVMA 1AXRA 2WTNA 1I0IA 4MUGA 1T4MA 1U7TA 2VP4A 3BQNB 5KYXB 3ZHCA 4AKGA 4LVCA 4DWVA 4LJ9A 4MKXA 5C5IA 1Q7CA 4PRKA 1P3DA 1KR5A 3ZV5A 1VCOA 3QPDA 4OQLA 5A2QA 4UQLA 2XDYA 1L4HA 2IPOA 3UJAA 1G59A 4KIFA 1NFRA 4LSGA 4CKWA 1SCUA 2SKDA 2IHNA 2NU7B 4QOEA 4TTQA 5JZOA 2QRVB 2HHAA 1ID8A 3EGVA 1V2GA 3BN3A 1DCTA 1I14A 3I28A 1JAZA 4MR7A 1K0FA 2JIPA 3TLKA 1HDXA 5AOBA 1ECGA 3A1FA 2WYOA 3RBAA 2ISSD 1CWUA 4BXOB 3GFSA 3O2JA 1IC6A 1D4AA 2FPOA 1GFWA 1RAEA 2O3UA 1YCGA 2V6IA 3LYHA 4H6WA 2QLMA 4LDAA 1QFXA 3WRVA 3MB8A 4YDHB 4OJYA 1YTUA 1SCQA 3KUKA 1J24A 3W06A 1QO7A 2IFTA 4WKGA 4LDZA 2Y1GA 1TZCA 2B69A 1AUVA 1M2JA 2OHGA 3MJDA 5A3RA 2P4UA 2Y92A 1N2SA 3T9AA 3UAGA 3RKSA 4HVAA 1NDQA 4HK4A 3VNVA 2VK1A 4CR6A 3FR7A 4DV2B 4MI3A 4D98A 1XZDA 3I0ZA 2MR6A 3AFIA 5D87A 2F9LA 4CT5A 3JAKA 3O8BA 1JFFB 1P0IA 4O2RA 1XNQB 1GAWA 3AG5A 3LQ4A 3F8TA 1PV1A 1ULUA 3NETA 3RAPR 1T3HA 5IWAB 1BE8A 2AHRA 3EXEB 2Q49A 1H94A 3SNKA 4RKRA 5F73A 3BH6A 5FQNA 3TAHA 3DWGA 4BP8A 1IM5A 3OEED 3CUSA 2C7PA 2JAWA 1RPZA 2WWTA 2X0KA 2O3JA 2J9RA 2WKPA 3CKKA 2A8YA 2IZOA 5G4LA 1RYFA 3CRMA 4D4IA 2YS7A 1NHWA 1WA5A 2HYDA 3PITA 1XK6A 5TX7A 3RUFA 4TN5A 2DULA 2VSQA 3EVBA 5KAMA 3VPFA 4JUIA 3L79A 1I4WA 4I4LA 2YHAA 4DOMA 4EKNB 3G0DA 5A04A 5EPUA 1QRRA 2ZETA 3LGXA 4BX2A 4YT4A 3UZUA 1QH8A 2DPGA 4NULA 4Q4CA 3PR1A 3T7DA 2RKBA 2FDCA 1KC3A 4NNJA 3KBBA 3GRYA 1EB9A 1VG1A 2B8JA 3D6UA 1NTOA 3WJ2A 3L2OB 4CM9D 2ZUEA 3OZCA 3QLVC 2PSHA 1I4OA 5CURA 1A72A 2ZYGA 4QUJA 2JLRA 3VH4A 3L1KA 2E5WA 1CDDA 1IBCA 2G4VA 1Q20A 3GOQA 3HSYA 2NADA 3HYRA 3D8BA 3LPCA 3Q6IA 4P0TA 4R8LA 4EG7A 3CV3A 7AT1A 2OZEA 1B1AA 3HZOA 1Z0ZA 2D1FA 2RAUA 2VYVA 5LXTB 3WX0A 3BSFA 4OQPA 4OMFG 1XL0A 3E48A 1W2GA 3A32A 4GP7A 4CIVA 4OUDB 1BFKA 5EUCA 2G09A 2Z9CA 1E7YA 4H0CA 5AK6A 2BHRA 2DHEA 3DEIA 3DMHA 3G2PA 3LA6A 5FL3A 3RSSA 5CFLA 5LA6A 4KRYA 3P0IA 3CT4A 5BP7A 1YUNA 4LQ4A 3T3PB 1H4QA 4ENPA 1FYWA 2FGKA 3QKUA 5B5SA 1REQB 2MIIA 1EI9A 1E9CA 1MVNA 5SICE 1YR3A 1PFGA 3L0PA 3D3NA 5IFKA 5JROA 1VJCA 4EJSA 4MCIA 4MV0A 2FCRA 2HAEA 3T0IA 2PKYX 1NX9A 4EWLA 2WSLA 2C54A 5DNEA 4ETMA 5F98A 1FP4A 2Y1WA 3CW9A 4Z1MA 3ZHXA 1GPBA 4U2DA 2IYXA 4XYEA 5EE0A 3LIPA 2R86A 2HA2A 1QH1A 3TD9A 3C6YA 4XWGA 1R4ZA 2BKLA 4LRSB 4D3DA 1MC8A 5G0UA 2R96A 2PK3A 4YRNA 5EVCA 4C0QC 4G41A 4A0RA 2J48A 4TLCA 1IZ8A 4UNRA 2DWQA 2BISA 4PS0A 2HRCA 2PD6A 2QN8A 1XMJA 1CUHA 3FCEA 4KPUA 1QG6A 2JCYA 4W7IA 2G8LA 1WKVA 1PT5A 4K5QA 4AUNA 4RVOA 3FBWA 2W2LD 4PFJA 3I09A 4N0PA 1KQ3A 2AUNA 2HB6A 2B4TO 5L4SA 4QTTB 5CYOA 3PXEA 1JZSA 3GZJA 3VKHA 2W6ZA 5ES3A 1E96A 1RVV1 1TYEB 1HE5A 1GITA 1XVUA 2NXCA 2NUPA 3MUEA 5JO9A 2MSLA 2C2HA 2FHPA 3WHKA 1EDDA 1BSVA 2VXYA 2Q21A 2OYCA 3T41A 3TFOA 4PR3A 2CD9A 3O03A 1KH1A 1PUJA 5FWYB 1ZVVA 4Q4AA 5ADVA 2C8VA 3EG9A 2YZ2A 3HBAA 3M9XA 4OXRA 1JBQA 3C3KA 1YRBA 1OBVA 5JQWA 2YXBA 2BD0A 5LBUA 1U2GA 1UBNA 1YB1A 2G6BA 3BH0A 4FGKA 4BLTA 3L7KA 1IB6A 1SKYE 1AV7A 4QU0A 3MOIA 3QXSA 3WQSB 1JTVA 3MTIA 1JEDA 5I8ZA 2QZJA 2HBQA 4MQLA 3TIGA 1XWWA 1QUEA 3LYLA 5DTIA 3TPFA 1SBHA 1E1QD 1YTLA 3HQ4O 5AI8A 3ZXUB 4C05A 4KZPA 4RTSA 4N6GA 2ZUWA 2R62A 3ZDQA 1W4RA 1E61A 2EGGA 1I3KA 1X7ZA 2AFHB 3LT5A 5L7TA 4G0OA 4ESOA 3QMPA 4PG6A 4A82A 1JXOA 1S96A 4EATA 2VL7A 3EHEA 3CLTD 3FTQA 1W73A 4RZSA 2YBEA 3QVSA 4L51A 4W6QA 1VE3A 4AG6A 3PLAE 1WMDA 2EFDB 4HADA 1M6VB 5B1IA 3TUJC 5CDUA 1R3UA 4I66A 2I1WA 4TVSA 1H9CA 2WT9A 2EW8A 1L7RA 2JKVA 4PC3A 3ZV4A 2HC9A 3ZZNA 3VAAA 1GGVA 2YXEA 3NHBA 4X7PA 4YP7A 5C37A 2C7OA 3T0GA 3QSGA 5T7BA 3TW0A 3O7MA 3ICCA 1DELA 4BVAA 4CV2A 3DR5A 1M10A 3PUWA 1A97A 3HKBB 3THSA 4TWZA 2FFRA 2JLAA 3INYA 2K5UA 4R3NA 3VYSB 5ERYA 3AF6A 4TZ6A 5T5QA 3ELYA 4AD8A 3K6SB 5F52A 4BFCA 3TLGA 1A9YA 4B75A 3STWA 1U11A 1UBHS 2G25A 3VR6D 5FEUA 3URMA 4Z7OB 3VV2A 4MS3A 3ZJUA 4K87A 3T52A 3FROA 5LDGA 1P9WA 1D2GA 1P9LA 4KQ9A 1JEQB 2Q2OA 1Y0BA 1N2ZA 2ZLBA 3C14C 2CKMA 2AI2A 3RJMA 3IUMA 4CEHB 3AR9A 3D8SA 3Q12A 2W22A 2J7KA 1G8JA 3I05A 3WMEA 2C1ZA 3ESRA 4CM3A 5KYKA 5M7EA 5GJVC 4G5SA 5SY9A 2CNOA 1KZGB 3VMMA 3A2NA 1CUFA 1GPWB 5A02A 4QODA 4EG8A 3G89A 1KBOA 5L45A 4WACA 1SY7A 1A8QA 2IIQA 4HG2A 2IBMA 4YJDA 1UBCA 1PQUA 2FWBA 1CFZA 2XF2A 2XB8A 3ODPA 2E4YA 2H0QA 2V58A 2UZ0A 2OHJA 1J22A 3AEYA 1Q6YA 4H4CA 4WSOA 4BLWA 5CLGA 4KO3S 3DKKA 2VG8A 2QTCA 1Z0KA 3UMCA 3WSTA 1IVYA 1ZFNA 4NU5A 1WEKA 2ZSIA 3SX4A 1YJ5A 3FNEA 3O1LA 4OUKX 2R1TB 4C0JA 1AURA 2OUKA 2ZYHA 4C4TA 2G9QA 1M75A 1U1CA 4GLJA 3E5RA 2QUZA 2GN8A 1V5WA 1YNSA 1TZKA 2AOTB 4O4HF 4BBJA 5CNJA 1LPPA 5B2EA 1A88A 2PD3A 3D0QA 1QTRA 4WKBA 1A95A 1EXVA 4D92A 1TVMA 3RIGA 3VHQA 1VSBA 2FFQA 2Q4EA 1G9XA 3PD7A 4P5PA 2JJMA 5FL7D 1RZRD 4TZTA 4MVJD 3PDUA 2M6SA 2I8LA 4AKHA 4KXLA 4XUCA 5ALRA 4D5EA 3ND7A 1PRYA 3L0CA 3NASA 1AKTA 2WQ7A 3UMVA 4X1YB 3DT8A 3NHYA 1EP3B 4RF3A 4UBJA 3BF8A 5GPBA 3RSCA 3GFFA 1VKJA 2AD1A 2WWIA 3CF2A 4KLRA 1SKMA 2FKNA 2A6PA 5JH7A 4YC7A 3KYBA 3U61B 2HCBA 2O48X 3ONFA 2O0KA 3EGIA 3G6WA 4YYZA 1GADO 5JHGB 1OYVA 2Z8YM 2P9FA 1IEVA 4R1TA 4BB0A 1K7YA 3T7CA 1RU3A 3CE9A 1G3MA 2HA3A 1P2BA 1GKUB 1TC1A 1M76A 2AJTA 4WADA 3AOEC 3ET4A 2PX0A 4KYIB 2YYZA 5AI0A 5TGZA 4GXNA 2G71A 4J0EA 3PFFA 1L9KA 1CQPA 2LCIA 2WJGA 3LBYA 4WOPA 1T5IA 2QRKA 2H2AA 2VDPB 5HZGA 3E9QA 1C4XA 4U7TB 3REOA 2IYRA 1FMLA 4OTZA 2E4VA 2IKSA 3RT1A 4Z3OA 2ADFA 1QK3A 2NUTB 1AS2A 1MX9A 3VZRA 1SUPA 1NNI1 1Y8QB 1YZQA 4CMAA 1ML4A 5E2AA 2HU7A 3AHDA 3A3PA 4GXQA 4NENB 1V6AA 1DXHA 1NUQA 3SXUB 1DBSA 1QE0A 3M6IA 3GRPA 3RFUA 1DPFA 4QPNA 5DM60 3K9WA 4DV1B 3ENQA 2OAP1 1XCJA 1CHNA 2I54A 2YQ5A 5LN1A 1SBNE 4AO8A 1PV4A 3RB8A 4LTMA 1JMKC 5LM3A 1E3EA 4OO3A 2H2DA 3KHUA 5DYGA 1QB8A 2IXTA 2ZUVA 4F72A 1A5TA 1DJLA 1UKVY 2Q1SA 3EQ2A 3KZOA 3PU6A 3ZS8A 1TAUA 2RG7A 2CJPA 4ZQFA 2QGZA 3G5TA 3HY3A 3QELB 1UXKA 3OAAA 4KIJA 4O4LF 1AKUA 4LC9A 1EZ1A 3PDHA 4G5XA 4HB3A 4DNQA 3K31A 1UADA 2YNMC 5CHEA 1XNJA 1EFDN 3JSAA 1QKKA 3KQVA 3F3KA 3ZU3A 1VIYA 3TMYA 2BFCB 2GASA 1SXJC 5ELLA 3VOAA 2NO0A 2JJ1A 1L7OA 2HJHA 1H2ZA 2VYVD 3V9AA 1JTEA 2GQ0A 3DPSA 2XUGA 1U6IA 1ZONA 2QMHA 4HL6A 4RM2A 2G0TA 1LLQA 1YDHA 4CWAA 1M1YE 3IL2A 3EUAA 2JBHA 2C95A 3HZHA 5A6SB 4CXMA 2VF4X 1ZCJA 1GNTA 2L17A 1HQKA 2F43B 3BORA 3HS3A 4FDTA 4HI0E 3FNQA 3KETA 4DSZA 5LXTF 4ZYYA 4EK9A 3ENZA 3LC7O 4G37A 3FZYA 5F78A 4M1OA 3U3JA 4BMCA 3A27A 1KO7A 4DRZA 3RRZA 1TUBA 1RAAA 3L7JA 3BGIA 1IQRA 1NMEA 4Q1CA 2YHUA 1F20A 4BUJA 1C9JA 1II8A 1T9BA 3I04A 1GSOA 1U9JA 3CRQA 2UXCB 1S89A 4ZV7A 5FUBA 1IQ0A 4WXPA 1V1JA 1LDEA 2P1DA 4ACBA 821PA 3T1HB 2GCPA 3OPNA 1E5LA 2ZAGA 4P84A 5IT4A 2XMSA 1WOMA 2N3ZA 4U63A 2VYND 1GN8A 2G9NA 3JZFA 5C7OO 1KQNA 4EFDA 4POOA 3V1UA 2CT8A 4HH4A 1EHIA 1OWMA 1YVEI 4WJKB 2IVFA 3BMQB 1NVGA 2RBGA 2XHEA 3M4XA 4LDQA 3ET5A 3ZBTA 3ZZ1A 3C3BA 3MJCA 1GGEA 2OQVA 5K2MA 2BGIA 1A69A 4ES6A 2ZWPA 3QHPA 4N48A 1XTVA 2BV3A 2HSDA 3AL3A 5TQ2A 1LBQA 3VV3A 2FSFA 3GLGE 1F6DA 1U9IA 2Q7XA 4PYOA 4UUAA 2DHQA 4K86A 2HCFA 2QB5A 4EMSA 4O0MA 4Y9SA 1EHCA 2HV8A 2MU1A 3NIGB 3QXGA 5BSWA 2AZTA 3N53A 4TPKA 5KVQA 4X1KB 1JG3A 5IC5A 3V8RA 1X80B 2PWYA 4ZQHA 3VZPA 4F9EA 5FNZA 4YCCA 2GVDC 3NJRA 1S4MA 3ZEAA 4W4TA 1OC2A 1NJFA 1ZWKA 3ANLA 4P32A 3WK4A 4GMFA 4DZZA 5JBQA 3UMMA 1KFBB 2XR1A 1DNPA 2D00A 3PLNA 2GAJA 4OQMA 4RD2A 5KSOA 5GIOE 3JAMA 2F3RA 1U99A 5KJEA 1DX6A 3ZY6A 1T5OA 4LGMA 4JVMA 4ER3A 3AY0A 2YW9A 3KIPA 2HSGA 3NIFB 4LSMA 3CWZA 4Z9FA 4A2PA 3NVDA 5BQFA 2LZ0A 3BJEA 1AH2A 1UOPA 5KHAA 3MWKA 1I0LA 1N7JA 4JEMA 3WWPA 1MO2A 1T3LA 1RRFA 3DO8A 3T7TA 5AUOB 5IKPA 1SQ0A 2Q4TA 3CN7A 3R6GA 3UH1A 2PUJA 3C1TA 3RG2A 1VZ3A 3W2EA 4O2AF 4X3PA 2AMVA 4IV5A 3DDSA 1SBCA 1F12A 3HU1A 3U4QA 3PZBA 1BYUA 2P11A 4IIJB 4WTOA 4ZQCB 2GD1O 3FGOA 1X19A 1JQJC 3UA3A 2NM0A 2IGTA 2PA3A 4GZ6A 4MVJE 1HM5A 4LK3A 1G98A 3BTOA 1UDBA 2XOKD 4A6EA 5AVKA 5CFZA 3LCJA 4YCSA 3WO1A 3RHTA 2DECA 3GEIA 4L5YA 1YJQA 3N8HA 1G2IA 3M6XA 1ARZA 1CB7A 3AERB 1TCVA 3LLCA 1J8YF 3EAFA 5G02A 3R6LA 4MUNA 1R00A 1XDSA 1XJ5A 2Q4RA 4Z4IA 3N58A 5TF0A 4YN3A 1T0JB 1OFHA 1V8FA 4Y98A 2CL0X 1GFIA 2E87A 4HC4A 3W9SA 4DLLA 1K3UB 1VHTA 2P4EA 2OWEA 2VAPA 2WYHA 4TS1A 1O3YA 1Z4LA 5A6VA 2BRUC 2A5LA 2B3TA 3DE3X 1X7DA 3MUNA 4H0NA 4JJ6A 1YR2A 2PU7A 4X44A 4YRPA 4LE2A 3EVEA 2I2DA 1F8UA 3UG7A 4AF6A 1FFAA 4PGHA 3LC1O 2W6MA 1KYWA 1MZVA 2XA2A 3ND9A 5AJTA 4PZEA 4OHKA 2QMUA 2O7NA 3IQXA 3KPYA 1ZOOA 3VU3A 1YB4A 4TM7A 2CNLA 4QTYA 5BOVA 4DQLA 1JWLA 1Z15A 1V9SA 3B51X 1ZJWA 4EI2A 1QIFA 4XPIA 4DF3A 4LBVA 3R7FA 5JAPA 1N5DA 4DB4A 4NICA 2XOEA 2MINA 5FNVA 2LCFA 1KYVA 5K3BA 1JKMA 2XEDA 1FFCA 1U9CA 4MIKA 5FUWA 3FHJA 1I33A 4HXEB 3MWDA 3R7WB 2NSYA 1NQXA 3KQYA 1PZXA 4I55B 1BQEA 3GRUA 1C9YA 1AVTA 1JHPA 2QT9A 4V1CI 3HCOA 2IS6A 1GPH1 4RMGA 3AKEA 1ZQ9A 1E4YA 3ZLUA 1MUUA 1YK1A 3NVAA 1RHUA 1RXYA 1VE5A 3OFNA 3ON5A 3PPXA 4QO8A 4TV8A 4M0MA 2YWFA 3V1LA 3IPLA 4C7JA 4FI3C 2Q2NA 2X5XA 1U0FA 3OCYA 4FYWA 4M53A 4JY7A 1D1QA 5FWXA 1T4CB 3USES 4UARA 3DOHA 5TQVA 4PNEA 5LOVB 3CVJA 4UHKA 2IYEA 4M60A 4J3JA 1NJSA 2RAVA 3FSEA 3JYHA 3AVWA 5D3ZA 3N76A 1E2BA 3HO1A 4URZR 4NK5A 3VKGA 2PGLA 3P9ZA 1S6YA 1E8MA 2FN3A 4NOKA 1ABEA 1C0IA 2ODEA 3GGPA 5AM1A 3WTBA 2DUJA 1C7IA 2MWMA 5AOAA 3FCSB 1AZWA 2CBZA 1QOPB 3EBPA 3I5MA 3IIJA 1UOOA 2EG9A 1WCWA 4IVQA 4KPGA 3ZW8A 2Q5IA 2FMUA 4KRGA 1Q16A 2I5PO 1X8LA 2XA9A 1S0UA 4G5OA 5EXDA 3S55A 4CKEA 3TLGB 2HD4A 1ZNYA 1U65A 1LI5A 1XVAA 3UPUA 2FV8A 3L84A 3GPCA 3NKLA 5HA5A 5TPZA 3LPAA 3UJCA 4DT1A 5C8YB 2O8FB 1G291 2Z3ZA 2X4LA 3W8DA 3JQGA 4BPRA 3WFZA 3WBBA 2CLSA 3EVCA 1Q17A 2IU3A 3DHYA 2XQFA 2Q8PA 1WUJS 3AUSA 4D0GA 2LXNA 4F9TA 1OFTA 1FFWA 2GRUA 4RD6A 4UDXX 3D6AA 3MGKA 1W46A 5AHOA 4ZEXA 1YKGA 4B5KA 1P4GA 1RYNA 1Z88A 3D9QX 4N0MA 2GS9A 5JAMA 2GDZA 1TL7C 1FFEA 2GN4A 2NXWA 1CUBA 2X4IA 4RHCA 4GQBA 3JD0A 4N12A 1Z6QA 2RHHA 2XUHA 3I1FA 4K8RB 1MFZA 1L5GB 4FILA 4IJ5A 2XCQA 3WGZA 2ATCA 3MLBA 2IDJA 1OFIA 3M0EA 4Q82A 2ZS7A 4YJ3F 5A5GA 4PN7A 4JOBA 4MVWA 1RWQA 1TAGA 1AKMA 2JAXA 1O2DA 3G2KA 3AC0A 3FE2A 3PGLA 5CDSA 2P4HX 4TKMA 2OXTA 1JSCA 2PBRA 4WERA 5EVJA 1YB2A 4K6KA 4BFUA 5DLDA 2JIZA 4D6PA 2DHRA 1PZHA 1WZIA 2R1TA 3Q0EA 2JLXA 2GCOB 3IQDB 3M7IA 2DKNA 1G5HA 1SGWA 4ZVOA 4A1OA 1NONA 1XMQB 2X1MA 3DAFA 1D6MA 1JNYA 3IMKA 1GCIA 1PQWA 1O95D 2BHTA 3PXDA 2EHDA 1Z74A 4WJZA 5HRAA 3CLTC 1KDOA 4QLAA 2FW1A 1DKLA 4Q1FA 4YH1A 1G8KA 4XB2A 3RC9A 4G9BA 1JH8A 1SK9A 3HNRA 3ODGA 4QO7A 4C1NA 3O9MA 3E9CA 2F67A 4NONA 2P6OA 3I76A 2E1RA 3M33A 4J16C 3PEEA 3HXLA 2I55A 5A7FA 4UC0A 5LQCA 5HE9A 1SXJD 1U8XX 2G63A 3HGMA 1Z68A 2BHSA 3H5IA 4TSFD 4XB1A 2PMCA 2YNMD 3OTIA 4IDQA 4URWR 1K92A 5DXJA 2CEAA 5JPDA 2GD0A 5TPWA 2AEMA 5JISA 2JI6A 1GUBA 3L5KA 1UBGA 3QUSA 1SHTX 4KMRA 4ML3A 2QJTA 1BHO1 4MUFA 2YN4A 2WHQA 3B36A 1YO6A 1L4GA 3A10A 3V6LA 2E0IA 2I4MA 3E7FA 3NAGA 5JO0A 1U0HC 5JFTA 1G8FA 5CB6A 2VNHA 3GGOA 2GN2A 5LKAA 3EPRA 4N39A 1AK9A 2VNIA 3E84A 3HTXA 2QPAA 5J4YA 5JNRA 4J9VA 4MWEA 3NBUA 1Q83A 1ODKA 3QLUA 1VRVA 4GLOA 1L4LA 3FFXA 4PICA 1AMUA 3R24A 2XTAA 2ZPUA 2D54A 4BMZA 1CRLA 3A9WA 1FVXA 4R1MA 3LP6A 5EE1A 3VDQA 3VU9B 3TWOA 1QX4A 4FYPA 3ZHBA 1Y98A 3PZRA 3QEBZ 1C30B 1SFRA 2JJ2D 3TXXA 5LOVF 1QIGA 1JMVA 4FU0A 4BCDA 3WWOA 4TRMA 3FVVA 4BQPA 4AZ0A 2OC4A 5A03A 5ALKA 4UMDA 4JT4A 3WA7A 2CWDA 1YD7A 2J5RA 4Y1RA 4GVXA 2FZCA 3JYLA 4AXXA 2Q5QA 3V00A 4MGHA 4GR4A 3W1VA 1KY2A 4B0PA 5I3CA 3SOZA 2GYWA 4ZICA 3BKXA 3HFJA 5I45A 2QM7A 2IYVA 1ZMOA 2VTVA 1D09A 4X94A 1Z39A 1DBPA 3N0VA 2I6GA 1THMA 5FL7A 2AQIA 2WZCA 1Q92A 1GU0A 1E8NA 2QTFA 3H75A 3TZKA 3MYRA 2CGEA 1G21B 1J5XA 2W2MA 3BXZA 3F5SA 3H8JA 2BFCA 3KTAB 3WQQA 1QTQA 2HIHA 4LNHA 2VUSA 1K97A 1NJ2A 2I6TA 3CEJA 1M2NA 2PO7A 2V54A 2PKRA 5JH7B 4BE9A 5CUQA 1OXKB 1CR6A 3PHIA 3KP1A 4JVNA 5EHIA 2XEXA 4G25A 4FDLA 1GNQA 3WGVA 1KJNA 2VBGA 5DU2A 2A0FA 4MLPA 5E7IA 2J5QA 3FYUB 3IDAA 3N8GA 3C6QA 4OLJA 3RFTA 3SC4A 3UT0A 4S35A 2OAQ1 1B1CA 1LSUA 2RH9B 3VOBA 1XWIA 1KI6B 4D9CA 2XUJA 1ZH6A 4K9NA 2PRIA 1T0BA 2I66A 2L69A 4MJLA 4TYMA 3TCXB 3TX6A 1XEXB 3E5HA 1IUPA 2ZRKA 3BDIA 2ZRIA 4M9QA 4H2DA 4OK3A 2LCQA 5IVPA 5JQGA 4D26A 3M6AA 3DB2A 2C1EA 3FW1A 1QSGA 1MN6A 2FG5A 4NFLA 2F4VB 4NARA 1SHUX 3RYHA 5KYVA 3CEAA 4GECA 4ZOLB 4LI3X 3UXHA 2HWUA 2MYNA 4OX9Y 4C5CA 1R0SA 721PA 1KIFA 3HI4A 3ZY5A 2J3EA 1C4WA 4MW1A 2M6KA 5KOYA 1CJBA 2O2GA 2QTZA 1UQUA 4W8OA 2BI4A 1ABBA 5C3UA 1QTIA 4FKMA 3U7IA 4KO4S 4DUGA 4E33A 1W8DA 3KQLA 1PG2A 5A0VA 2B9VA 4DILA 3KOMA 3R0QA 1RPTA 4QEDA 2GN6A 3KLOA 3PCTA 1FNNA 5A0FA 7MHTA 1KWGA 1I9GA 1MAAA 5CLQA 1VXOA 3T9FA 4RTLA 2XWBF 4YCLA 4EUSA 2NV6A 2QTTA 1QYDA 4GP6A 4H08A 4KZKA 5C1BA 2RCNA 5EJ7A 3A7EA 1GQ2A 2B98A 3U7EB 4KWEA 2ZJ7A 2IYFA 2QN7A 4CMHA 5EZ6B 1QHNA 3M1AA 5E1OA 4CKYA 1MIHA 1TFUA 4HX5A 2CUNA 3TZ6A 1N8KA 1C7FA 1G9SA 3LPMA 2BFMA 3FWPA 3P4UA 3QIAA 1GL7A 2Y1EA 3EQ7A 1OI7A 1O94A 2Y0CA 3G2JA 1UPTA 5B1EA 5IU6A 4B4VA 3VNRA 4CUKA 2Q3FA 3JARB 5TF4A 2PMDA 1KY3A 3MG9A 4Z4CA 1YAHA 4FR5A 1BQ3A 4CL8A 5D84A 2XCLA 5AJYA 3LLVA 1GYRA 4R2KA 1FJHA 1XQ9A 4RA9A 1YR8A 3LF2A 1ZGGA 1NT4A 2XB4A 2XUAA 1YZUA 4EMUA 1J1UA 2AXPA 4G0ZA 1E3WB 4WZAB 3AEKA 1QHYA 3OY7A 2GEVA 1JL3A 3RU9A 4N0DA 2ORED 3PQ8A 1UJNA 2FDXA 3M6LA 2W2KB 1D4OA 3NEPX 4DQ0A 4ENQA 4FM9A 2OD2A 3ILVA 5TRTA 2WTBA 4KB5A 4UEWA 1A5AB 3QWHA 5JSYA 1JX6A 3IA7A 3FJYA 1N6OA 4PAQA 3NDBB 4FINA 1RQ7A 1ZLXA 1J8DA 1VLZA 1O94C 2B20A 3BGWA 3Q8WA 5CM8B 1JT9A 5B4TA 2WWGA 2WC1A 1GZUA 3FJOA 4RW0A 3ZLVA 5A9RA 4LHZA 4CLDA 2N46A 4D7AA 4ARAA 1BIFA 3B82A 1N6PA 3CO5A 4BNFA 2QL9A 3FD8A 4UMVA 2Y71A 4UMFA 1RYBA 3DJYA 4K9PA 4XEHA 1PLJA 3KSRA 3QNUA 4RKEA 1C80A 4F2DA 3WYBA 3GN2A 3KWJA 3DE6X 3CMMA 4L9SA 5D86A 5BVGA 3I45A 5C31A 4YUZA 1NQAO 4XIFA 3ZCRA 4RETA 4B4DA 1IY9A 2I7XA 5GWXA 3K5WA 2WFLA 3OCVA 3OM1A 5ESXA 4OBBA 3U4HA 2CLOB 3IT3A 1HL3A 3H05A 4TT3A 3U0BA 3U4CA 2JGFA 4WKNA 4CNBA 3FJ1A 4ITUA 3HCRA 1WAMA 8ATCA 1S7CA 1WP9A 1HTTA 2UUOA 4H1HA 4MMXB 3ZLBA 3WSVA 3ZZMA 4RIIA 1KOFA 3ESYA 3DTTA 3FMPB 3WB1A 3VR5H 1P8AA 3LC0A 4WFJA 3VVLA 4A8HA 1KPHA 5BORA 3HLYA 4MQUA 4PANA 4YV7A 3BXHA 1DMRA 1QIDA 4BDTA 4IMIB 1P33A 1SELA 3EFHA 2JJ8A 2RG1A 3CUVA 4KO8A 4L7QA 4M86A 4XDZA 1ATIA 3OA0A 3B8HA 3GN1A 1FFHA 4QFDA 4LF8B 4ND8A 2HBRA 4E0BA 1ZOSA 4WCFB 1OU4A 1DPGA 2HK7A 3TG8A 1OH6A 1V7QA 3E4DA 5FX2A 1X86B 1XXHE 5BSGA 2FWIA 2A9OA 1TTPB 1BDIA 4UM7A 2AJDA 3TOVA 5B7QA 1QZUA 3NOOA 4FEAA 4S2EA 1Y8CA 1NWHA 4IFTA 3TNYA 5FWXB 2TMYA 3HSSA 4XCQA 4QVIA 3EE6A 3ADDA 2GZMA 5KINB 5K0SA 2LPMA 3TTUA 4ASUD 1ORDA 5DIZA 2QOEA 3J81k 2W42A 1QOZA 1HNXB 4EFKA 5GJCA 2VIIA 2VPPA 3OJEA 5U4QA 3WE7A 4NBLA 1RDFA 2ZJ4A 2PGDA 4OF4A 3P2MA 1RFLA 4KFSA 3SC2A 5IFLA 3OZ7A 4YLEA 1BZYA 1GVNB 1AE1A 4WZAE 4O4IA 4PO8A 2BGGA 1GU7A 1CEXA 4R2JA 3Q3EA 4F71A 4U4AA 3L43A 2DJIA 1XYVA 1W88B 3L7NA 3H1PA 4XM2A 1QAOA 2ARKA 3FPEA 2JFFA 3VNQA 4D8YA 3T4EA 1MO5A 1EWQA 4JEHA 1U1GA 2BGJA 4FZJA 4QBIA 1ZNXA 5IC4A 3IO3A 4ZJZA 1V5IA 3H4TA 1QKJA 1M0SA 4DWOA 3KD3A 1VIVA 5FIUA 1FW8A 3RFXA 4CKBA 4IZOA 1ECBA 3DAHA 1DP4A 1CK4A 3ZDRA 4XOUA 4RFSB 1I4DD 4LHEA 2Q0HA 2X8JA 3I32A 1E9EA 2HJRA 5FKJA 4D3SA 1GPKA 2D3TA 5I9LA 4YUAA 4Y6SA 1Z29A 1XPRA 1Z82A 1QUFA 3NBZC 3RFVA 1KZYC 3QI7A 1TM2A 3NO4A 1X1QA 3USCS 3BSWA 2EEPA 4X7BA 1IRIA 4YRSA 3SQOA 3GCZA 1EVJA 2JHCA 2ZIVB 4OGFA 3T15A 4N3AA 2FWMX 1DADA 5DLPA 1ZM4A 1ZZEA 1CD5A 4OHUA 5AMXA 4KQHA 1SCJA 1YHYA 4KPEC 1F8GA 3HJTA 4MR9B 4C7VA 2G9VA 4KQGA 4RAOA 3PJGA 1MTZA 3M6VA 1OQAA 1ELOA 3VGPA 1G64A 4E2WA 4E4RA 1QYVA 3FOBA 1ZITA 2RSLA 2H2FA 4ZHQF 1D2MA 2NZUG 2FR8A 3L07A 4WOCA 1P1HA 4YMWA 3KT6A 4JXKA 1FC0A 3IP9A 3GT0A 1V9CA 3HPRA 3FR8A 4E21A 2PL3A 4GAEA 5BYKA 2ZT5A 3IRVA 4JC0A 2JGKA 4TLDA 4A91A 3HA2A 1O03A 3E1SA 4GWGA 4UBOA 1TW2A 1HDRA 3OHSX 4XE5A 3ZKAA 3ETCA 2DQ4A 3KKZA 1UIRA 1T6YA 2AXNA 3FTFA 1Y1RA 2P5UA 1QU2A 3VH3A 1VBFA 1E4OA 3QHQA 4B6FA 4MYDA 3BQ9A 3TSAA 1QP0A 3JQGB 1AHIA 1II0A 4H7PA 4EPXA 4ZKDA 2I87A 2PX8A 5BMVF 3KJQA 1YAJA 121PA 3UJPA 3SHOA 3G2MA 3QE2A 3U13A 3AZOA 4AJ9A 2IEYA 1JPUA 1UKZA 3JW8A 3JTMA 4DIMA 1JHZA 3OTWA 4MRRA 1BDBA 5J5AA 4ZYZA 1OI4A 3UUFA 1BKYA 1ZGZA 2OXFA 2PZFA 2GWRA 2Q9BA 3A1UA 1SBTA 4NC9A 1G8HA 5DWQA 5ECDA 2OGZA 1EVEA 2Q8NA 3SS9X 1BNCA 3S3TA 2AN1A 3VPDA 1P17A 4LJRA 1OLSB 3K0CA 4MYSA 1H2FA 1PR9A 3IB6A 4DUYB 2A0YA 4W5WA 3FMIA 3T3EA 4ROTA 2JLYA 4MLZA 1ZIDA 2HHHB 3KYJB 4G1FA 5A9TA 3RYTC 2Q7OE 4E51A 1QQBA 2WSSA 1D7OA 5GONF 3QVVA 5EIFA 5LMNB 1DUVG 1Z06A 1ZNQO 1OKKD 4EJFA 2R8PA 4V0LA 2O5VA 2RGRA 3NT4A 3WFJA 4IH4A 1K68A 1SVSA 4D97A 1ADFA 2Q3BA 2V7BA 3IDFA 1MB2A 4FDMA 7ADHA 4P0PB 5KDOA 1PFWA 1E5VA 5LUAA 3RKUA 3LJKA 3NHPA 5IASA 1JN0A 1I1NA 4NI5A 4EY4A 2JFYA 3STTA 4ZJPA 4RTOA 3RIHA 3AX6A 2AI1A 3HBFA 1HDZA 1NFQA 2QW1A 3W5JA 3BSYA 3F78A 1YBMA 4DV4B 2AF3C 1TEVA 4KDEA 2HFJA 1JFSA 1FTQA 2HLHA 3GA0A 3F67A 4OXNA 4F12A 5CD1A 3EOZA 3MILA 3W8RA 2AOVA 2CJFA 1SUSA 1FNMA 3P27A 3UXYA 3ICPA 3DKPA 1FUIA 2C59A 2GJKA 4IUYA 1ULSA 1ZIOA 4RHXA 2GI4A 3FVRA 3GLGB 2BFFB 2VPQA 3O2QB 2FLVA 3F3SA 4QBGB 3WRWA 1OPRA 4IDPA 4LQDA 1K3TA 4P4SB 3LY9A 1VMKA 3F7MA 3LKZA 3B1YA 1JSLA 2AVNA 5PNTA 1EYZA 2ZIEA 2ZIWB 3R5JA 3NM4A 3E2IA 2VDRB 3IV6A 2A14A 4LZWA 1J1ZA 3OAAD 3BWDD 5AKXA 3F4BA 4FSHA 5DK4A 4ZRMA 4ZRNA 1JAXA 1OU0A 1T10A 1UPFA 4FDAA 3T4UA 1F2UA 5K0EA 2FPIB 3I9MA 3R5KA 2BM9A 2WJPA 1U0RA 4NBNA 1V45E 4GKKB 3DL0A 3ZVMA 4IINA 4KXVA 1WB9A 3BXOA 1ZD5A 3VYTB 1OPXA 2A4MA 4GUAA 2B7BA 2FPWA 3EXFB 1ZOPA 3P26A 1QGDA 1U7XA 2BJVA 5T6MA 3AESB 4EHJA 3BVPA 3U1BA 2VTBB 3KKPA 4II2A 2YZGA 5EWJA 4DIUA 1V43A 1X7ZB 1P4AA 5B2ZA 3AU9A 3VI4B 1WCIB 3FOFC 1G6Q1 3FMOB 3EAGA 4NG5A 1Z73A 1L5HB 2ID4A 3DTVA 3F97A 2V1UA 5FI0B 4IVPA 1FS6A 1X8JA 2BCJQ 3E9YA 1M8JA 2WLTA 4UUBA 3BSSA 2YOHA 1THGA 1WABA 1WVGA 2Q29A 1USGA 3O75A 2XKBA 2JARA 1EWRA 1NRWA 1JNXX 1DG9A 1DZ3A 2ABWA 3A25A 4OEHA 3OQIA 4PG4A 3W8EA 1GAEO 1SK8A 3WMWA 1KETA 4KW7A 4JLJA 1T9GR 3AVXA 4L6IA 4IJUA 1CUSA 3RG8A 1Q57A 5BT9A 3ZCUA 1U31A 3SI7A 4M1EA 4UVGA 1A7UA 1RYZA 1IEQA 2IT1A 4L15A 1HNWB 1LBTA 1RI2A 2JVKA 3ABIA 3E9RA 4EABA 2XZOA 1T2VA 1GA1A 1WLSA 3GMTA 3PA6A 4QNNA 5CG1A 1VJ5A 2FUCA 5HK9A 1CVLA 4BKPA 2VAXA 1DCFA 1OWLA 1IWPB 2XRYA 1IDOA 4IHKA 1JTFA 4FN5A 2OECA 2AZMA 1JG4A 4BEBA 1Q7TA 4ERXA 1PK7A 2BFAA 1JHYA 1A9TA 4JT8A 4DXDA 5FI5A 1CHDA 2MHCA 4GC5A 4AWBA 1E5TA 1RWOA 1A8UA 4O08A 1QGED 2QVGA 4C0LA 1IXRC 2FX5A 3NTQA 1ZINA 2ZTVA 2P9JA 4HXYA 1CQZA 3OZTA 4HQRA 4OU4A 4X00A 1PCXA 3T7SA 2WM2A 3LM8A 1QVVA 5IAJA 1R0XA 3V8EA 2RMKA 2OLJA 3BD7A 3G2HA 2O3QA 3OLZA 2IQ5A 3R5SA 4RVNA 1O96B 1Y6JA 5ALEA 2O8CA 4LRTB 5AUQA 2PG3A 4LNUB 1JU9A 3UQZA 4MEJA 1TMGE 4Y1GA 5DP1A 3UK6A 1JDBB 5A06A 5CEJA 4H3HB 1TPZA 4IDDA 1X7XB 1PJ8A 4F91B 5KQRA 2I71A 1RJ9B 3KAQA 1P8JA 3EVGA 3R40A 5H59A 4JLOA 1MVOA 1VJTA 1SD5A 3QE4A 4AN4A 2DY1A 3HCAA 4HR7A 1CZRA 4IDNA 1F60A 4RMHA 1BDHA 1R5JA 2AHOA 2FSVC 1AF7A 2I2FA 1F8FA 3EC1A 1FB5A 4INOA 4NAVA 1WSBA 3AW9A 2Z5LA 1Z2CA 2R68A 1JALA 1KNXA 1CY7A 4HBGA 3WL5A 2XUPA 2GEKA 3EXAA 5DXFA 4KR6A 4OHXA 4OD0A 1NDUA 1HBJA 3U4MA 3IKJA 1XHFA 4Q19A 1EFHA 3U7HB 2FTKE 2H11A 1Y48E 2G1JA 2OM2A 3Q2OA 5JS7A 3CUWA 5GONA 5I7WA 2F4NA 2ZANA 2Z2YA 1RLIA 4AXBA 1NR5A 5FUMA 1PZEA 1C0LA 3DCIA 1J09A 3AR2A 2H4YA 4PV7A 1WNTA 5ETJA 3E82A 2DQKA 4Y2SA 1FEZA 4BTEA 4JFRA 4YIHA 4KDCA 4ZZIA 2IIPA 1VJ0A 4G1EB 2BCGY 4NDZA 1ESDA 1Z5PA 2DBRA 4LJYA 4FR0A 5DYTA 4B7CA 4QVKA 4K9MA 3RUAA 3DDCA 5M34A 1U7UA 3CE6A 4NIMA 4EHFA 4D57A 1Y34E 1XC7A 4FZVA 3HYCA 3PI7A 3FIJA 3UJ3X 3AVOA 4BY9E 2K2QB 1RTTA 1K9SA 1EG2A 2ZYWX 5IT5A 1R9JA 3KQNA 3KWFA 1UPUA 3T5DA 1L9XA 2GEJA 1BA2A 4X6XA 3MLEA 5FPQA 3W3AD 4JB2A 2CVQA 4WV3A 5ER6A 2IZ0A 3FTDA 1DJMA 1TCUA 2WWFA 3VO9A 1H9BA 3WL8A 5F51A 4GI5A 1NSTA 3T5TA 3T3GA 1O89A 4PM4A 1DVRA 4TXLA 5ALWA 4MW9A 1GWNA 4NJEA 1N5MA 5HTKA 3TK1A 2CSXA 1POXA 3K09C 4LTNA 2G5TA 1E1RD 5FBLB 1GPLA 5C5EA 2NUPB 1XYYA 2QSUA 4NENA 1XTPA 3LP5A 1A9OA 3OPYA 3OFKA 1MHTA 2CXXA 5F12A 1LX6A 1RM3A 4GR5A 4L50A 4AIIA 1KEEB 1G42A 2X9VA 3MT8A 1OXMA 1WQ1R 2HA4A 3PD1A 3UC5A 2ZWAA 3EW9A 3WLNA 4DMLA 1DOZA 1IUNA 4PEVA 4O4IF 4EYQA 4FFBA 2IH5A 5KTRA 5BW8A 3O8CA 4F4CA 4EHHA 3C85A 4U7PB 2I65A 5FD8A 1YUBA 3DMYA 3WRXA 4FW8A 1CY8A 1UF9A 3A1TA 4K0KB 2RI1A 2H8KA 2A3NA 1MH1A 5A9SA 2JFOA 3KPWA 4B4OA 4BEVA 4GGOA 3URKA 1E60A 1HFJA 1ZN8A 1LDGA 2ODTX 3FCXA 4G89A 3WYFA 2V0NA 3KZNA 3MWYW 1SKQA 2VCEA 5EI5A 2RK6A 3BIJA 2QS9A 3QZUA 2PWZA 3SYTA 1PEKE 4I1YA 4I5FA 4O4JB 2UUPA 1LX7A 2JGIA 3EZ6A 3ZGNA 2CVOA 4RTKA 1YOBA 2DBVO 3WK8A 3WMGA 2ZT7A 4P33A 1EAMA 3WLQA 1QG4A 1Q22A 1R88A 3DPUA 4U00A 3R9KA 4GSLA 3DVSX 4KNVA 3IUPA 4UBMA 3LHFA 2LRHA 1EUZA 1V3VA 3KJGA 3H6HA 2DUUA 3C6ZA 4KPUB 3B9BA 5EGSA 3A2LA 4MVJH 5DI3A 4YA6A 3VXKA 3ZU6A 3ZWOA 4BU0A 4F9GA 1FDTA 2QU7A 2ECPA 4FDVA 4WBNB 3EQZA 2QRQA 3LXRA 1CDZA 1VPLA 1ZM7A 4GPIB 1A7JA 5IUKC 4BASA 3JU3A 4F3YA 3EF3A 3T06B 1LNSA 2GK3A 1RM4A 3QYAA 1U3WA 2WIDA 3MOGA 4L08A 3BMNB 2AFRA 1IVNA 1Q77A 2CE2X 5FYDA 1MOSA 1OZGA 3F1LA 4BNWA 3IE1A 4ALLA 4OM8A 4A23A 3RIYA 1RWWA 3CG4A 2TSYB 3L41A 1KBQA 4GYYA 3Q7IA 4L5JA 4QXAA 4V03A 1Y8RB 2EJUA 3DTNA 5LLSA 3V4PB 3ELWA 4C89A 3FWNA 3OCJA 3RW9A 5GM2A 3OU6A 4UW9A 2BEJA 3CNEA 1DKRA 4B8ZA 4OGWA 4C2BA 4BX9A 5HILA 2ANCA 2YVQA 3MYYA 3Q88A 4YASA 3E6AA 4KRFA 1QE5A 4J76A 1BMTA 2JLSA 2C8JA 2FMFA 1XF9A 2BR4A 1ESNA 3GUYA 3O7WA 2FEXA 2JHAA 1VI5A 3OIGA 2GZ3A 2J9GA 4Q9HA 5A3QA 4LYEA 1PSZA 1T13A 1UAYA 2EJBA 3CKYA 4LHYA 1CZKA 3LH5A 1XHEA 3AB8A 5DM2A 3AVYA 1AA9A 4U3JA 3Q98A 5GVRA 4EITA 1E3TA 2NO4A 2VUIB 2FPKA 2XBUA 3K16A 3MS4A 3MMNA 4HRYA 1PG5A 1W52X 3EA4A 3H5VA 1FDSA 3IBCA 3M2PA 2V3VA 3PUIA 4YCAA 1A9QA 1NBIA 3I73A 2YCLA 3HRKA 3O4RA 4RD4A 2XMZA 3MELA 2P67A 1CR0A 4TT3D 4ZEWA 4DYHA 5KQGA 1GT6A 4Q9NA 5I7AA 5JFGA 1IIRA 3P7MA 4PGMA 3TQSA 3CVWA 1N7IA 1G4UR 1H3NA 1Q7EA 4JJGA 3TEJA 4AG3A 1DV1A 4JELA 2HCTA 1OD6A 4PE5B 5IDWA 1A27A 1VDMA 1ZM3A 4PC1A 1O77A 3WIVA 1Z0UA 3BHIA 4C01A 3H5AA 3WGYA 4F4FA 4HGNA 1GLNA 4ZRDA 5FTKA 4MZDA 5JDCA 2W71A 1P1JA 5D3KA 1LZKA 3UATA 1XKXA 3A1VA 4J0CA 2YV3A 4LE0A 1W4LA 3UM9A 1QIEA 9LDTA 1P6XA 4FWIB 1DRJA 2D5AA 2OSBA 3E4CA 1VMIA 3FKQA 3LO5A 4JVLA 4MB6A 5HCNA 3FOWA 2NACA 3MT7A 3PHGA 3T1YB 4OQDA 2J9ZB 2W43A 3G1UA 2P6UA 3A9RA 3JRNA 1PL6A 2YX1A 4HQLA 4B1FA 4I1PA 2ZI3A 2NYRA 1Q44A 2FW7A 3FGZA 1B73A 4LZZA 4MS3B 1NP6A 2XGJA 4KVZA 1A9SA 2IOQA 1NIJA 1USVA 3JQ9A 4K40A 1XTRA 5T6BA 2QL6A 1JKIA 3F7NA 4FK8A 3RS2A 4AZ3B 1A8IA 5GVSA 3LRPA 1K1EA 2QEQA 1GKYA 1LC3A 2OHIA 1I2BA 1Y37A 2EX0A 2O50A 5FEMA 3KQPA 4RTNA 4PBTA 4Y2JA 1AHNA 4M22A 1XHLA 3K9HA 2JZCA 3AU8A 3HMQA 4BX3A 4Y7CA 1Y3IA 2ZRDA 1DKNA 1J33A 1PGJA 2FFBA 2NNWB 4J6EA 3PP8A 3LQ2A 2J46A 1Z5WA 3EXIA 5DTQA 3O1JC 4M7WA 1V1RA 1F4VA 3GRAA 5EQTA 4BJ5A 1OX5A 2JA1A 3W8NA 2ZI7A 3GD7A 4E31A 2I33A 2BY4A 7YASA 4C4XA 4GKBA 4JBWA 3BJIC 3VDRA 4HB0A 1PJZA 4XPIB 5LL6P 2VTEA 3FUCA 3MIIA 2GPJA 2Q3LA 1QM5A 3A37A 3PFKA 4XSGA 3W7AA 3ZY4A 2H1FA 1D2EA 1JQDA 2OFPA 3A4NA 1ICIA 4JP2A 3PF9A 5CM2Z 1IMJA 1Z13A 1Y1LA 4MV4A 2CVFA 1NBME 4GHWA 3STXA 3D3WB 4Q34A 1HH4A 1EJBA 4PHHA 1QJCA 2QPOA 3PFNA 5IXJA 3O8RA 1W0JA 4MPJA 4Z7NB 1JYFA 2GZDA 1N6LA 4Z9XA 5THXA 3TD6A 1H05A 3DZKA 4QWMA 1R50A 3OESA 5CDYA 5INTA 3DHWC 3MD9A 2VAMA 3JQ8B 4I5IA 1L4UA 2Q0XA 4H3VA 2JA2A 1DJPA 1L5HA 4Q0MA 4LXHA 3UV6A 3OC0A 3VPSA 4DG8A 4M83A 3PRJA 1DAGA 3WGOA 5ICCA 3X43A 5JPIA 4JQOA 2I6QA 1L5KA 2DBYA 2I8CA 3G8AA 3NM5A 5KNCD 1XZMA 2O2JA 2J0VA 3TIXB 3V80A 2DR3A 4RDXA 1XLUA 4BAUA 3B9QA 3HJFA 3QKSA 5IMSA 5K0FA 3KZKA 3LLUA 3IVXA 5CTAA 4M98A 4PY2A 5AW1A 1NVAA 3O5AA 4J0DA 3AO0B 4BGDA 3DF7A 3QSYA 3RREA 3SQMA 1Z33A 2PR2A 1H2WA 4WXYB 4RCZA 4INZA 4ARZA 4GICA 1UC8A 3F5MA 5GQSA 1W4CA 1OAOC 4QM6A 1IM8A 2XWQA 4NG4A 1XPJA 3MJVA 3DJFA 2JS7A 2VPXA 3DNPA 2GD6A 1C8KA 3WLTA 3RVMA 3ZV7A 1E0AA 1C50A 3I1YA 4FE7A 5C8VA 5L51A 5DM1A 4ZVRA 3UQYS 2E48A 2Q6IA 3SEFA 1LDMA 1LK5A 2R25B 1AA6A 2X1LA 3JWIA 3BXFA 4F4IA 3RUCA 2ZU0C 4RHFA 3O8LA 5KU7A 1WDWB 3GVHA 1HTWA 4BQIA 2RIPA 1EP2B 1QPZA 3H5TA 1A8HA 1TD9A 3L1IA 2ID7A 2NV0A 1NVEA 3PT5A 1K06A 4GG1A 4M88A 4TMKA 1GGMA 2C03A 1ZY2A 4IDFA 2PGNA 4TL7A 3S0JA 3KSMA 2O2YA 2PAFA 4DLUA 2JCBA 2H18A 1YIOA 4OXKA 1OAOA 4AJ1A 3SG0A 4H4EA 2L19A 2WK1A 5B58C 2YOGA 1O97C 4EUFA 3BB1A 4QQFA 1YQDA 2EFYA 2ZWVA 2X9LA 4P86A 2IOFK 2J33A 2ZU6A 4XD7A 2CMHA 1UZAA 1BOFA 1JLSA 2GM4A 3S68A 2HWYA 5F4ZA 1VMAA 4DADA 5BN5A 1X7GA 4YRZA 1JR4A 4QICA 1QQAA 3A3NA 1SOUA 1XA3A 2D5CA 4TWBA 4X61A 4PLVA 1RHQA 4RGYA 1T9DA 2VJQA 3K9NA 1YE8A 2Y76A 3ER6A 1C3VA 4PLYA 3U6BA 3EQ8A 2HJ9A 1J06A 2OCPA 4H7FA 4RCYA 1NKTA 3GRCA 3LYUA 2NNLD 2QM0A 1CVIA 3GLHB 4GLBA 1PR0A 3VO8A 3T1TA 3KQTA 3C39A 2OB1A 1RBQA 2YIDA 3UJ6A 5J4LA 3O91A 3A58B 4OHCA 4J8PA 4CBVA 5HIKA 4D9JA 1AUQA 1L8OA 2QMZA 3H65A 3ER8A 2NUTA 2DPXA 4DZRA 1TU4A 3PUVA 5AVQA 2EZTA 4OIFA 4BMNA 3H4VA 1RRKA 3KJIA 4B46A 1E2FA 1B8OA 5LWHA 1M2EA 4D56A 1ZL0A 3ZN2A 5MGBA 1WSWA 4NCNA 2QN9A 5IRCD 1BXZA 4R81A 1IEWA 1TIPA 2COUA 1VL6A 5L3QB 1OX4B 2VKQA 2G36A 5H83A 1YS6A 3IJRA 3BMQA 4G8CA 1WO8A 2BKXA 4HEHA 2QZSA 2VAVA 4HFNA 4O4HA 3R6TA 4WY8A 4ZGBA 5CB4A 4E5SA 4WFIA 2CLIB 1HPLA 3FDJA 2JFXA 1MT3A 3H19A 3RTBA 1HRKA 2M2IA 2ZSJA 4RMNA 1MW8X 5IC6A 4YRCA 3K9LA 3HDQA 1U4NA 2HUPA 3PEUA 1U8CB 1U1DA 3HUEA 3SQLA 2JCSA 4EY7A 3JQ6A 5B57C 4PTZA 5DNYB 1DMSA 1T8PA 1CUUA 1C30A 1L5VA 3D4NA 4FLEA 1DIOB 4I46A 4AZWA 1XZ8A 1QP4A 1EUYA 3FWHA 3SHWA 4JIGA 4OXYA 1EFVA 5JAUA 1BFUA 1GZ4A 2RHWA 1ZSNA 3QVWA 3WMFA 5HKKA 1KERA 1Z6AA 1NVKA 3PUKA 4L5IA 4O2BF 4DNOA 1CLEA 2ZUFA 2WA2A 3UC9A 3HZRA 3DQQA 3EGCA 4PAOA 2E6UX 4RY0A 4CI0B 3CJRA 2XQGA 1UM9B 3FSJX 1GA6A 4FZ3A 4HH1A 4J49A 1JA9A 1KAHA 4KR0A 4ZARA 1C1XB 1XCGB 2PLRA 2XUZA 5A5DA 1TUBB 2XIJA 3LL7A 4KJZA 3ZGZA 1P77A 4XFDA 1TCBA 2PWPA 1WCV1 1WW8A 3VZBA 1RC0A 3EEQA 4WVFA 3TI9A 2B7CA 1DOAA 3L7BA 3LLSA 2NVOA 3C3XA 3ZWKA 1F0PA 1F0YA 1WXXA 4KQ6A 4YRGA 4R1SA 1P4RA 5K3EA 4O4JA 4YCNA 1M7GA 3FDZB 5KZMB 4P6VF 1GPDG 1SC1A 2W5UA 4ZYTA 4MKGA 4OHVA 1EFRD 5KB3A 4XPZA 3SCZA 4QG7A 4CV0A 2FB9A 4UEKA 1GTJ1 2OD7A 3ETNA 4YYEA 4KQCA 3CHYA 1JEJA 2R47A 5IDVA 1F14A 1IK4A 4L2IA 1N2OA 4U7DA 2CNWA 2H7YA 4UHHA 4ZD6A 2X3YA 4KH0A 3UFXA 2BFBB 2CEKA 1SIUA 3A4VA 2ZYIA 3L9WA 3V7NA 3BIFA 4NBKA 2BP7A 3N2GA 1GKIA 3LT1A 4LXGA 4C2AA 4AULA 1TADA 5K4HA 4LRQA 1X80A 2FP4A 3O26A 5LJLA 1GNSA 4BB9A 2VNKA 1OYOA 1IJKA 1WQ3A 3QKRA 4ZIRA 1CJSA 2P9TA 4LVNA 4MJ7A 1KSGA 3IB3A 3OPYB 3TNDA 1F2TA 2CFSA 1JZTA 5GMOA 4BO2A 1KEEA 2Z56A 3H8SA 4EX6A 1UQTA 4DT1B 4A2CA 3MAJA 4ANFA 1YI0A 3HUTA 2ATXA 3L0IB 3WIBA 1QC5A 4FS3A 3GAAA 2CNDA 2FEPA 3PIIA 1DO0A 4UNNA 3SEZA 2ZSKA 1QBKC 3L46A 4NU0A 3ZJVA 5HKAA 3EZNA 1WS6A 2JFZA 4OJQA 2I3BA 4AS3A 3INGA 2D74A 1R5BA 2XXJA 3MMSA 4EO9A 1PN3A 3FPSA 3BRSA 4EAQA 4D25A 5L3RA 1XP5A 1IN8A 4G0WA 2XZDA 2YJNA 5K0TA 1Z16A 1I7DA 5LA6F 1PT6A 4PIVA 1BVRA 3R7AA 3ZVLA 4S05A 2ZYSA 3KOOA 3BMCA 1LF5A 1XMIA 1PNTA 1RLMA 2JIBA 3PXCX 4Q3KA 4ZI3A 5KYNA 2YZ7A 1M7HA 4JI5B 4J0HA 2PUAA 5BW6B 3EXG1 4QHTA 1SWVA 1U7WA 3X3HA 5LKRA 2IE8A 3HWWA 4RELA 5I5GA 1GXSB 4LDJA 1QHHB 4KWCA 1QF6A 1XCOA 2Z5FA 4KLCA 2BGMA 3R0ZA 2V8BA 2FWNA 1X0XA 2DWUA 1MJGA 3BK7A 2PEYA 2QI9F 4GBMA 4GNKA 4BO5A 5IUJC 5LQKA 2ALJA 5KYUA 2RB4A 1TRKA 2G4CA 1P1FA 4FYMA 3A1CA 3GCWA 1UMCA 5IAGA 3J7TA 1GL9B 2ERXA 4YJ2A 3TCNA 3EZ2A 3OIUA 1G3RA 1CUJA 3QXJA 1UJ2A 3G2LA 1R8SA 4XH9B 5FV4A 1NASA 2R8RA 3EVAA 1ZOLA 4U2FA 4YWJA 2PKXA 4NP6A 4AKEA 4D0LB 2FMXA 3CJTA 4ZMRA 3GELA 4BGVA 3RBVA 3TTXA 4HNHA 1Y9AA 2DJ5A 3U4DA 4YPFA 4D4JA 4DS3A 1KO1A 2JI7A 3LU1A 3RSGA 2C2MA 1C9MA 4RGVA 2FDRA 5JADA 2J3LA 2WILA 2XDQA 4GMKA 3ZGYA 2HHJA 3TG2A 1SUCA 1D8AA 5C8YA 3FTNA 2X5KO 2D1RA 3E35A 1WMAA 3MFYA 4YEDA 3VR6A 4Y9DA 4Q47A 3LX6A 4EOGA 1PT9A 1OIWA 1J2YA 1JEEA 5EKDA 1AKQA 4CYMA 4M6WA 3UFBA 2PSJA 1JLMA 2ZB4A 4KR9A 1GY8A 4BS9A 1PZFA 4GOKA 2HIAA 1T5HX 1ZX1A 4S24A 2Y66A 2FETA 4EEXA 3AUXA 3QEMA 2XTZA 5FULA 2WSIA 3BBLA 4D4HA 2WFLB 3ZWWA 2UUAB 4EDFA 5BWOA 2C9YA 3I34X 4HS4A 3CLRC 3WWZA 1RD4A 2VDNB 4RXUA 4WLNA 1U8TA 1MW9X 1QXSA 2QP3A 3DMTA 4O2AA 1MAVA 3LPNA 2HSWA 4LAFA 3A05A 3PPIA 1IJBA 4FJ0A 4M8IA 1Z3CA 1AQJA 3KYIB 4JLWA 2KBEA 3O31A 2YMQA 3II6X 1HURA 4H35A 3K5PA 4RF2A 4X54A 4YCDA 4R8VA 2QRMA 5AJZA 1BJKA 3F6SA 3FX2A 3W9UA 3TVTA 4C4SA 3K0SA 5TXGA 2J0QA 1HF3A 1EBBA 4FVTA 1T24A 1CDEA 3P20A 4KAAA 4UAGA 2HGZA 2O0LA 3CNQS 4MV6A 5CAEB 4PVCA 4CJXA 4DGQA 3AHGA 1O7JA 5BY2A 2RHDA 1SD2A 6CHYA 5H9VA 3ZJTA 1C1YA 3GMSA 4MTLA 2J07A 3ICEA 1ADBA 1YDMA 2Z4RA 3LDGA 3OFJA 3PWKA 3DOUA 3B13B 2QD3A 5ENDA 4Y6OA 1I2AA 3IHKA 5CXQA 4BCBA 4CQMA 3OEWA 3GG2A 3QRWA 4CPDA 4TTRA 3D4IA 3FHOA 1QFJA 2IUEA 3DCNA 4XD7D 4IXDA 4DJ5X 3S2SA 4CM4B 2ZBGA 1HLPA 4IWNA 2B4RO 1ZJ4A 3QKSB 3DM9B 3ASUA 4PG7A 5KNLA 1DBVO 2UVDA 4MYRA 5JOQA 1A5ZA 3Q6NA 4G81A 4HXFB 4ZV9A 4CLRB 5MFZA 3I6BA 4UHFA 3VOSA 4JUAA 1J6UA 1HEUA 2AG1A 5FUYA 4D02A 3NWBA 5JXHA 5KI6A 4URUR 4Y2GA 2O7QA 3HSKA 4FYVA 3IBGA 5IVKA 4HQOA 2WNHA 3IUEA 2ZTLA 1QPGA 2WW8A 3PWSA 2AJCA 4IFIA 4ALMA 4KYVA 4DLRA 2F3UA 1YQWA 2NT4A 4HFJA 5HIMA 1ZGJA 4MKIA 5FTLA 4YP5A 1LKZA 1T25A 2PX3A 3B3GA 4L4XA 3N0WA 3OE5A 5EWLA 3FPCA 3H18A 2YY5A 2XXAA 4FJ2A 2EFJA 1KMQA 3W5SA 1E3MA 3TW6A 5C53B 2XTJA 2PYIA 4CUJA 5FHQA 4QVGA 3K70C 2WYIA 1Q21A 1BHSA 2C2XA 3N6VA 1P5JA 1TAQA 2I6UA 2P5TB 3O4VA 1QGZA 2EOAA 4IKEA 3OQVA 3JS5A 3C5WP 4JLSA 4DC1A 1NLZA 5A0TA 1CEEA 1SG9A 2CSUA 5ER9A 3VISA 2C94A 3OUTA 4UZFA 5KTYA 5LYJB 4HWPA 1N2HA 3QWIA 2AFHA 5EP3A 4OHZA 1ZI9A 2F64A 4UJ3A 2Q2QA 3VVCA 1FMTA 2EP8A 1GUZA 2ZYVX 4GM4A 4DY6A 5JC8A 3LCVB 1CIVA 2V7QD 5LZ4A 1Y3CE 2O14A 4M8NE 5DO9A 3KC2A 1WU7A 3RBZA 3SM3A 2XMBA 3F5QA 4RORA 2D7JA 4AM8A 5K3FB 2IPNA 4TQAA 4JJ4A 3ZHUA 4QM7A 2JBWA 2XMRA 3TZBA 1HFEL 2H6EA 4KO1S 3SIWA 4ZVVA 3VC1A 3HDVA 1MLDA 3B5JA 1BU5A 3C8DA 1KPIA 1KP3A 2FE1A 1V9LA 1T9KA 2HDHA 1Z4PX 1IXSB 2OQ2A 1UJMA 3AILA 3CLHA 3GARA 3Q15C 4I08A 2PMWB 1HXHA 2NUBA 3B9RA 4O5OA 1NG1A 3KQMA 5BSHA 2H1VA 5IJWA 1L5QA 4HN9A 3KYDB 3TJZA 2Y1DA 4DN6A 2R8YA 2I22A 3E3AA 3UVEA 1FLDA 3HKDA 4HH0A 1H6AA 5DGIA 3WZMA 1HE1C 1Z6GA 5F7XA 1EVIA 5CLIA 1XJWA 1UBUS 2C2KA 2VSFA 3A6JA 2VATA 3CUYA 1B6TA 1GQYA 1LCIA 1VTKA 1X2BA 2OVFA 2QTLA 3DFKA 1X7YB 4KN8A 4LYFA 2PZAA 1JR2A 1K2WA 2WD8A 1I8TA 5AJVB 5IVIA 1VKHA 1VSVA 1KOGA 3ICOA 3C6BA 4LFBB 3MTEA 4MKZA 5ADHA 4QJBA 1G8MA 4MQ6A 4V1CB 3VR5A 4EI7A 4RQTA 3MXOA 3O0TA 4LWOA 2ZYTX 4QJ3A 1YIDA 1E1MA 1ISGA 2DWOA 2PZ8A 5IANA 4RABA 5KDDA 1G3UA 2I2AA 5LP6B 3SHFA 4CT4B 4E6EA 3ANTA 4O2LA 1O6ZA 3D2CA 3A8TA 5JWOA 1J5EB 3W2HA 4MAAA 3AB3A 5F33A 1ZD8A 4FKZA 2H4JA 3AQ4A 2CNWD 3K8YA 4P38A 4FFOA 1P62B 3BEOA 1H8ED 1JF8A 2XAAA 3G17A 1O6CA 1G21A 3GJ4A 2OK8A 3K20A 1S2IA 1SUBA 3P9NA 1Y4UA 1K7XB 3OEYA 3M3DA 3F5DA 3ZDBA 5LJIA 1PIWA 2I9PA 2OBYA 1EA7A 3HCWA 2Y1XA 3L5OA 3IILA 3IUJA 1L8QA 4QDUA 4B2IA 4D0NA 5AXAA 3I9NA 1P2GA 2B5VA 3PNVA 4PLHA 3UH0A 4B9AA 5IF3A 1GZ3A 1JE0A 5ALVA 2PKQP 4WNAA 2HPVA 3ZWYA 2ZT8A 3R4VA 5DMXA 3TVDA 1QIJA 5I8WA