2I22A

Crystal structure of escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
192
structure length
179
Chain Sequence
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDNDIFSRYVEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIHILIQLIEKEMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoheptose isomerase
publication title Structure and Function of Sedoheptulose-7-phosphate Isomerase, a Critical Enzyme for Lipopolysaccharide Biosynthesis and a Target for Antibiotic Adjuvants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 179
sequence length 192
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2i22A00
3M5PA 2WU8A 1VIVA 1NUHA 2VF4X 5LMNB 4LF4B 1X92A 2XHZA 3G68A 1C7RA 1XMOB 3LJKA 3T1HB 4B3MB 4LF7B 3CVJA 3HJBA 4X62B 4OX9B 5BY2A 2UXDB 1J5XA 3FF1A 3UJHA 5LMUB 4DV7B 4LF5B 1JXAA 2Q8NA 2CXOA 2V4MA 1FJGB 4AQYB 2CXRA 2ZJ3A 1IBMB 2CB0A 1XTBA 5LL6P 4DV4B 4NXMB 3EUAA 4JI6B 5IT9A 1MORA 1G98A 2AMLA 1N36B 3JX9A 1U0GA 4K0KB 1VIMA 4B3RB 1IATA 3ETNA 3J7AC 1X9IA 3QKIA 5A2QA 1VI6A 4DV2B 4EM6A 2UXCB 2CXQA 2PGIA 1J5EB 4LF9B 4IVNA 3Q88A 4DV0B 4LF8B 1M3SA 3I0ZA 2CXSA 1GZVA 2UUBB 1HM5A 1X94A 1C7QA 4LF6B 2PUWA 4LFBB 2CXPA 3IFSA 1Q50A 3KNZA 5BR8B 1JLHA 2J6HA 1XMQB 1U0FA 4AMVA 2E5FA 2UU9B 4DV5B 4LFAB 2CXUA 4YHHB 1HOXA 1IBLB 1I94B 2UXBB 4B3SB 1DQRA 4X66B 4DR2B 3BCHA 4U6NA 2YVAA 4DR7B 3FXAA 1IBKB 4S1WA 1IRIA 3Q7IA 4X65B 3TBFA 1HNZB 4JI1B 3SHOA 2ZM6B 2DF8A 3T1YB 4DR5B 1N34B 4DR4B 4S12A 4DUYB 4M0DA 2F4VB 1TK9A 2A3NA 4JI4B 3J80A 3HBAA 4TOIA 1MOSA 2PUVA 4GKJB 4X64B 2CVPA 2I2WA 1MOQA 4LFCB 2UUAB 1JEOA 1NRIA 2XBLA 1JIQA 1U0EA 2VQEB 4DR6B 4GKKB 3BJZA 1HNXB 2E5LB 5FLXA 3FKJA 4JI3B 1WIWA 4DR3B 4LZJA 1N32B 3PR3A 4B3TB 3NBUA 1XNQB 1T10A 3OOJA 3OTOB 1HR0B 1GZDA 2VQFB 2O2CA 2O2DA 2X3YA 2UUCB 5I01A 4JI0B 3ODPA 3TRJA 1VI5A 4YY3B 1XNRB 2PUTA 4JYAB 4DV1B 4JI2B 2POCA 4JV5B 1N8TA 4DV6B 2DECA 2I22A 4DR1B 1N33B 4NXNB 1KOJA 1B0ZA 4JI5B 5IWAB 1X9HA 1TZBA 4DV3B 1ZZGA 1TZCA 4JI7B 4JI8B 4KHPB 3C3JA 1HNWB 2ZJ4A 2VF5X 2HHHB 3FJ1A 4DUZB 2CXNA 3J81A 3JAMA 2CXTA
chains in the Genus database with same CATH superfamily
3THXB 5G4KA 3PQ6A 3JQAB 3OX2A 1L7NA 2OGWA 1E2PA 3QVOA 4KBFA 4WK0B 3RJTA 3BK7A 5JD5A 3HJCA 1U63A 2QL7A 4JYCA 3QU7A 1CZHA 1HDIA 1OJLA 4IPTA 2I3DA 4CL3A 3WMXA 2VDQB 4CLOA 2BCJQ 5J2UB 1ZN7A 1ZUHA 3FSGD 3L5OA 4ZVQA 1GDDA 4LGCA 3MWEB 3MK31 2JFOA 6YASA 1N2CE 1CLUA 4JB0A 2H31A 3RVNA 1AQLA 2JJYA 3L02A 1BMTA 3CGWA 3EIWA 3SBXA 4ALIA 1M2FA 2ECPA 4LOIA 4LYGA 4DWVA 3GC6A 1CUDA 4BRZA 2J9FA 5EHZA 2QRUA 3QWBA 1K97A 1NV9A 3OQPA 1SULA 3PHIA 3AYZB 3VM6A 4ETWA 3QVVA 2D06A 3LK7A 2FPKA 2MMCA 2P8SA 2RG1A 1ENYA 3LHFA 1PP4A 2F3RA 3K9BA 1P5FA 1RFGE 4L6IA 4MGZR 4RZIA 3OZBA 2ZFUA 4K6FA 3RVKA 3RR2A 1C1DB 4RM3A 1LC3A 4MWEA 3DKIA 3S55A 4HN9A 3AEKB 3NTOA 1XB2A 4H3KB 3N87A 3JZMA 1Y1RA 5E1BA 1PIWA 2RGCA 1CU1A 2FPLA 3BHJA 5C18A 4XM0A 4F6RA 2YX1A 1QQTA 3C6ZA 3LFTA 3FUUA 4DNFA 1M1YE 1GTMA 2DUWA 4UVIA 1YXMA 1RM5A 2J9XB 2GNPA 3E3NA 1E9CA 2JZCA 3KB6A 3CXUA 4GEGA 4C29A 1WWKA 1YO6A 3VZPA 3EEOA 2GS9A 4TUYF 2GR9A 1FQWA 3BB4A 4QECA 4X6UA 4YMHA 5B7NA 1U3FA 1B6RA 1YR8A 4KO8A 2YVAA 4CTNA 1ONNA 1KP3A 1A4RA 2OLEA 2QS9A 2YDYA 2OZLB 1FS4A 1YUBA 3FIJA 4HB3A 4PPFA 4UAUA 3PKJA 1KZYC 1BQ3A 1JFLA 2RD2A 2II6A 4J4HA 1KFEB 2NSLA 1NLZA 4Y67A 1VIDA 2ID8A 5G41A 3U44B 2I8CA 2ZTVA 4E3ZA 2PLFA 3BTVA 1XZHA 1FL9A 1R6UA 5CYFA 2DFPA 2O0JA 5DO9A 4D80A 4Z54A 2HRRA 3LHKA 4O5AA 2NAPA 1Y3FE 2ZRIA 2VHEA 2Z6VA 3K1AA 3N0VA 1MQ9A 4LNAA 3EISA 4FI3C 3LQ1A 2IHYA 4MVJM 5KYTA 3QPDA 4HLUA 2XQKA 1GPBA 2QKYA 3KZKA 3A9UA 3JVIA 4MZDA 5FRDA 1SCJA 4J49A 4PZPA 1AU9A 2ANCA 3ZBPA 1XVIA 3PFCA 2FR8A 4YAOA 1FXSA 1SC9A 1Z6PA 5BSKA 3QTTA 2W83A 2PIAA 1E2FA 2QNRA 4YJGA 1JMKC 1GFWA 3PICA 3OWXA 2RHTA 1UT6A 1IULA 3FH0A 3OD5A 3QELA 3QUQA 3B7GA 4DPKA 3HGTA 4XGQA 1WA5A 1I6WA 1XD2B 3IJPA 2HBRA 3UKJA 1TAGA 1P91A 2IEZA 1KWKA 3BMOA 5IABA 1MFPA 4UEQA 3R5FA 1CW2B 1RKQA 3DHNA 1SBNE 2ATXA 3DKPA 1XEAA 2DUUA 4U7WA 3S7TA 5AW7A 1N2OA 1KIAA 2RHRA 4QDOA 3DUWA 1T6ZA 3HACA 3PCXA 4MH0R 1UJNA 3V4PB 2QM7A 3LT1A 1E1DA 2CFTA 2C3OA 4L8GA 1NN0A 5EJ7A 1E2EA 2TMKA 1EFVA 1EJ6A 2C2HA 1Z73A 5FUVA 2VPIA 1XELA 1JDTA 2ATVA 1KJ8A 2GA8A 1THGA 1U9ZA 2PKEA 3A9TA 1QCZA 2BLLA 2JVJA 2VCHA 1SKYE 3JQGA 3L8DA 2UYOA 3ANTA 4EF4A 1S8NA 4C5AA 4WQMA 5K1ZA 5J9FA 3GJ5A 4YUAA 2QNIA 2VP6A 3E7FA 3CNBA 3I34X 4MK4A 2QROA 4DYHA 5C1PA 2VPPA 3DMRA 4EHNA 3PFBA 3G2QA 4BKPA 4X6LA 1GPMA 2BMFA 2HEGA 4HTFB 4P7FA 1DKRA 3RQIA 1B73A 2FDCA 2AMLA 4G0QA 2ZJ1A 2YZNA 1JSRA 2V5AA 1JSZA 5U4XA 1E0SA 4X85A 1KGDA 1X80A 3KV1A 4BL5A 1E63A 3C6YA 2AV6A 4MCHA 1L7AA 1O6ZA 2DUMA 2W2QA 4X1YA 5JMTA 5JWRA 3IEXA 3S8EA 3K8YA 5J4LA 5CYGA 3VHLB 1NGSA 4GQAA 3A6LA 1WKBA 3P2EA 3RGWS 3SYRA 4W7HA 1MVLA 1T9GS 2SBTA 2XR1A 4JB8A 1U3TA 1DWUA 2CMGA 1XL1A 4QOEA 3EPJA 2VJBA 1K89A 3LL4A 1IG3A 2HLNA 2W2LA 3RYIA 3ERCA 2NXNA 4PTZA 1GEGA 2Z8YA 4RHXA 3MJFA 4RTOA 1QV6A 1EIWA 4XWGA 3S3TA 1LFAA 3KYBA 2EVWX 1Y1QA 3KZCA 4ECAA 3JALA 3NUQA 3FZGA 2YC2C 3AXSA 3DAFA 5FKJA 3C6KA 5I3ZA 1KKMA 1KI6B 3DP7A 3S2ZA 4DR7B 4QXOA 3EH2A 1IRIA 1ISMA 5I5EA 4G25A 1E9RA 3U5TA 3NBZC 1HEYA 1H65A 3FZQA 4DMFA 2RE8A 1UFKA 3D3NA 1MX9A 4K6CA 4LG1A 5CT8A 1OZHA 3LP8A 2WILA 5DXJA 3QLUC 5ADHA 3SD7A 1W0JA 2XGJA 5BQ3A 3AR7A 5GV8A 1XN1A 1A9XA 2ZZMA 3RAPR 4RE5A 3R7WA 3WK4A 3LDUA 2FOLA 2NO7A 1I2MA 4BKUA 3OESA 3ZD8A 4ZQEA 2VPYA 2QX8A 2AUMA 5DNEA 4IJ6A 4ZXFA 1I7DA 4L4YA 5AW5A 5BXQC 5AVUA 4OHPA 4D3YA 2HMVA 2IVZA 2GYWA 2O3JA 2Q6VA 3LC1O 5EGSA 3UUGA 4AW9A 3THXA 4J8PA 5ECDA 1FX0B 3D0KA 3JQAA 1MO5A 1TVEA 2V0NA 1GXSB 3QNUA 4B2YA 4DY6A 1VHTA 3JRWA 1EINA 3K4HA 4L5IA 4EI2A 4QLOA 1V8FA 4ITVA 1V1MB 1VJ0A 4HDSB 3OJ0A 3QW4B 4G0VA 2NACA 3I28A 5C35A 2FVYA 3SZMA 5J2UA 2EF1A 3V1YA 3MWEA 3AIKA 5CG1A 1W1IA 1XX6A 2Q2OA 2WWYA 4KHPB 1QU3A 3K5WA 4CQJA 5CW2A 5B58C 1MAAA 2OV2A 1LY1A 1GG2A 1OBOA 1TYBE 2P4EA 1UL1X 4QUIA 4UEWA 5CVCA 2C04A 5IFLA 1DUSA 4ZAWA 4ZYXA 1KTVA 5BWLA 3K8QA 4G07A 3KWLA 1T4BA 2B6HA 3V1NA 4B40A 1KSGA 3PGKA 5KI6A 1F17A 1JQLB 1BRMA 1Z4QA 3PQ4A 1HT1E 4QU8A 5CU7A 3D02A 1TZKA 1XFAA 1SVLA 4TWAA 2IY8A 3K4PA 4K40A 1C1DA 2HHAA 3HVHA 3NBQA 1XU4A 4CQNA 4YAKA 4OX9B 1JZQA 2O0LA 2W58A 5KWVA 3NFRA 4KBGA 2P9BA 1Y1PA 2Q8QA 2A59A 1WB4A 3KJFA 1OH6A 4DDHA 5JSQA 1U2DC 2GBLA 2IQ5A 2CK3A 2UDPA 4ZGGA 4QARA 5HBRA 1ZR2A 2FOXA 1AHHA 3LUPA 1K9SA 1P0CA 4BVFA 1RLUA 5B1YA 1H0SA 5EXPA 4MTCA 5C4MA 2RGRA 3ZDFA 2X15A 4I4IA 4FOPA 1T13A 4GDMA 2JB9A 2JRCA 2WP8J 5K51A 7REQA 3VAAA 1PL7A 4NCNA 2BVNA 2HT6A 1B0PA 2Q5EA 4F5ZA 8ADHA 2F3TA 1EQAA 2OZLA 2QZ4A 5L3QB 5LYJB 1F2TB 1RQPA 1R50A 2HIHA 2HNAA 2Y77A 3TG2A 3K32A 2GVNA 1J0AA 1Q16A 1QRDA 3B3AA 3DAGA 2QMOA 1TK2A 4JC8A 1G7SA 1R7RA 2IHKA 3R3XA 4X1OA 3EDQA 3IE0A 1IAQA 1FJXA 5P8WA 5K20A 2CD7A 5T6BA 1JHQA 3DBLB 4TWRA 2B36A 1WXWA 4P7JA 1G5IA 2AJ8A 1EEXB 2E4WA 1JSLA 1AQUA 4OKIA 3MT8A 4F6CA 4NCXA 5CVTA 1KFCB 1BWPA 1J2JA 4JUBA 4UE2A 5TPWA 1SHLA 4D3XA 2HA3A 4TYNA 5THQA 3TRHA 2CNBA 3O03A 3Q3CA 4LDRA 3UUEA 3HTXA 4HZIA 1ZWLA 2OWDA 3CUSA 3WRVA 1Y5LA 2A5YB 2O52A 1BCSB 4TYQA 3EFBA 5FORA 3QFCA 3ITKA 2XGSA 4MPRA 4Q0MA 1YS7A 2HCRA 5BN5B 3AV3A 1W2GA 4OBEA 4Z5XA 3MB5A 5JZSA 2F4VB 1AQ6A 1EFRA 1CUYA 4LKRA 3J80A 1EE1A 1F0YA 3L8MA 3ABSB 2I6UA 2IPLA 2MDTA 1FIUA 1JHPA 1XDSA 1PLKA 4X92A 3AFMA 3UATA 3WQBA 2UUAB 2ZSUA 1NW6A 4ZVLA 1V8DA 1B00A 1R0RE 2CY0A 2HZ7A 4PRLA 3ZJ5A 5JAHA 1V39A 3QY0A 3IAHA 1GD1O 3RYTC 1Z5GA 3ONVA 4RVNA 4OGFA 4UNNA 5DHQA 4JYAB 3MQ4A 3BF8A 4URXR 1AG9A 1R6DA 2ILVA 4MV6A 4EA8A 2IS6A 2ZT8A 3PF8A 5CMLA 5LNK1 3TG8A 3QY9A 3ESDA 1FLDA 4V3CA 1Z6XA 3MN1A 1YU9A 5F52A 1ISSA 3F8SA 2NZ8A 3GD5A 4PX5A 1KZ7B 1TLLA 2DHQA 3EWAA 3HWRA 3SE7A 3UH1A 4A5OA 4UTRA 3GH3A 4NH0A 5L51A 3ONFA 1ACJA 1NX6A 1QE0A 4FFLA 3VOSA 2EKDA 3FVVA 1FU4A 3H2KA 1MGPA 3PNBA 3E5MA 3N6XA 1X1AA 4KQKA 4D45A 1Y9ZA 4JLMA 4CF4A 1ST3A 3J81A 1HV8A 5DM0A 3IMGA 5IFKA 4GOXA 4LRQA 4UUOA 4A8HA 4HTFA 3R3SA 4LF4B 1ZH6A 5JFGA 1H93A 2QV0A 2C0QA 1H2EA 3OKPA 4R8LA 2IHJA 4WHMA 2RBKA 3EQ2A 3KDSE 1L4YA 3QI7A 4E46A 1JT9A 1KVQA 2H2DA 2VP3A 4J0FA 3W1VA 4EQZA 2C92A 4TMXA 3VSCA 4BQOA 2HH9A 2W2VA 4GOMD 3G0HA 4ZI5A 1H2BA 1NVGA 5E6UB 3MJRA 2PWAA 1J5XA 4IX9A 4WGGA 4WOCA 4WKNA 2ZTUA 3ZH2A 4YMUA 1B1CA 4URZR 3UTDA 4BJ5A 4KL8S 1LPSA 2C1ZA 2AVNA 2JD0A 3EVAA 1KEKA 1UBGA 2V4MA 3F5MA 3HSSA 4C87A 4EPXA 2N0SA 1A2BA 1JIJA 1JVSA 2CXRA 3STUA 2B94A 5AW1A 4DMMA 1HDOA 4DV4B 4RPHA 5EMKA 3NT5A 3DZJA 4JQOA 4AKTA 2TMGA 2WI8A 3IMEA 4P3OA 4YCJA 1HKHA 2H3HA 4BZPA 1K7EB 1PWXA 2JDID 2RK6A 5F12A 5GIPE 4R7TA 4RM2A 4DV2B 2CUTA 2VKQA 1KI6A 3V46A 4QT4A 4IOLA 3COYA 2GBCA 1W4BA 1KAHA 2VDMB 5EXSA 5HM6A 2AZXA 4M0MA 5E4JA 4ZI2A 3K05A 4O5OA 4KLCA 4LSGA 3ICQB 4J9UE 3DWEX 3FKSA 1DIBA 2ZJ5A 3LDHA 1P7WA 2GXQA 3LWDA 4G8BA 3UZUA 3WS7A 5KTMA 3KYDB 5CDHA 3FPJA 1N57A 4MEJA 3UC5A 5B7QA 3VNQA 1NZFA 1W49A 1WO8A 1NP3A 4HV4A 4XD2A 4XEHA 2VJKA 1P61B 2XMDA 1ATIA 1EX7A 2RFLA 4EPYA 5FO1A 4DDVA 3DH0A 1M7GA 3ZW9A 2PX4A 3QEJA 1K1EA 3OKFA 2BF4A 2JHFA 4O0LA 3LVRE 1T25A 3BAFA 3EBPA 4ME6A 3T1YB 1GXSA 1XYGA 1QTQA 3GU3A 4JR0A 5IC6A 1KF0A 4N18A 5KQLA 2NP6A 1YMVA 3R5JA 2XKKA 4GX0A 4PIMA 1UR5A 1QNLA 1V1MA 1M2NA 4HDSA 3DO8A 1H69A 1VCMA 1W9MA 2JK0A 2OKCA 3K8OE 4W7IA 3II6X 2OPHA 5CPBA 4CM7A 4YPVA 1OLOA 2I9PA 5FL3A 3LSTA 1F2UA 4ZZ1A 1KDRA 3KEGA 3Q4GA 4YP7A 1KYIA 3WMRA 1P7VA 3JRXA 3WKDA 4AY2A 3D2CA 1QZ3A 5GINE 1UKBA 2WKQA 3EMKA 1DTWB 1WD7A 4DQXA 4J1SA 4Q3BA 1W6RA 2IXBA 4AMBA 1OD6A 4FDUA 4BRUA 1PUXA 1MLDA 1BWRA 1CY6A 5CD1A 1I3CA 3T4XA 3WKCA 1HA3A 1Y5MA 4YQZA 2XE8A 3GFGA 4ZOLF 4YAGA 3EAGA 1D2GA 2XUIA 4G56A 2H18A 2VPTA 2WYIA 3KTDA 1D2EA 1U1GA 3E18A 4G24A 3QX3A 2CMFA 2YJGA 3VNAA 2CL0X 1DS6A 3LYHA 3HMQA 5ALWA 1PUJA 1NXSA 2NTEA 4M83A 1H8EA 1Y80A 1T9BA 4B73A 1I7NA 2FQ1A 1G16A 3KR2A 5A71A 1J1ZA 1JIXA 3G0GA 4FQ5A 2C2KA 5AWFC 2VCEA 5KYXB 2PSHA 4LSMA 1NM5C 2FXVA 4GUDA 4QOHA 3O1LA 1JNXX 3WYDA 4EW1A 4YR9A 5BYAA 3U1BA 3EEYA 2I55A 4U5XA 3OT5A 3BFXA 1ULUA 3U3RA 3BILA 4L8VA 4R2IA 2Q6KA 1BXGA 3FBWA 4QYTA 1M2GA 3HJBA 3TVYA 1E32A 1DC6A 3IHLA 4Q3DA 1NJ1A 1TF5A 2DYKA 2VBIA 3IA2A 4NYIR 5LYJA 1IEQA 1KBZA 4BLVA 3T3GA 5IX8A 1U9IC 2EWWA 3ND9A 2WUVA 1WW2A 4ND7A 4DPMA 5EVJA 1CCWA 5FNVB 3FOEC 3NHBA 1RWWA 2VATA 2IEAA 2V6IA 1QIFA 2VDOB 2ZJ3A 1HH4A 1X8XA 3C0KA 1Q7GA 3DTVB 2PSSA 3DXYA 3EMBA 1RWBA 3QYAA 1ZJJA 3KLMX 2C29D 3MJVA 4JUAA 3VU3A 1ZSNA 4J1TA 1UZNA 4E5PA 3DBLA 3STXA 1D2CA 1G64A 5M5BA 1KEZA 1DBVO 4MQ5A 1UUFA 2GEKA 2FPIB 2WINI 4YCMA 1R6TA 5IYZB 1K8YB 1VI6A 4ZA2A 2R3SA 1YGPA 4V0NA 2FFHA 2X19A 1ETUA 1J5EB 1K7FB 2DX7A 1K6EA 1TF7A 4QYWA 4J3NA 3FFTA 4IOMA 5JRDS 5HVNA 1ZMBA 4DEYA 1U28C 2PTHA 1HZZA 3CEAA 5JADA 1BCSA 3C24A 2F48A 4Q15A 3WLAA 4F45A 5J4KA 1IN4A 2YBDA 2Y6UA 1VG0B 5F77A 1V4NA 2VHUA 2D2VA 5BN5A 1ONPA 1TYEB 5HDBB 4CQLB 4CM1A 4EKYA 4CEJB 4AJHA 4B6OA 3G1TA 4IIUA 4HDAA 1ZI6A 3G82C 4DA9A 2O7NA 4F38A 1U8EA 1ZGGA 2VNKA 2N42A 2BCEA 3CB2A 3QYFA 1U2GC 2ODPA 3ANLA 5GJWC 2GFHA 2CLFB 1N75A 3PHCA 5E6SB 2ZUTA 1Y7PA 3SSNA 3TBHA 3NWOA 2NYVA 2YMLA 2C2MA 3A4TA 1Q7RA 4IEEA 3KALA 1QAMA 2D4HA 4YGYA 1CK4A 3TOVA 1B76A 5JPCA 3FGZA 3PE6A 4FFPA 5A3VA 5TF0A 2NQ2C 3MQFA 2A9OA 3N8NA 3NG1A 1PZEA 4CMAA 3ZW8A 3H5IA 3OQMA 4B4VA 1KQOA 1XZJA 2AFRA 1TEHA 1XTSA 1KI2A 2H4JA 3H1EA 3NHZA 5FQNA 5IVDA 2X41A 1YFJA 5DNAA 4HP8A 3EOZA 1PQPA 4RVUA 2JD2A 1YOVB 1MX3A 2QN3A 3CJTA 3ZJVA 3B85A 1ZCBA 2ZGVA 2PXAA 3RVMA 3W2IA 1T2UA 3KPJA 5AESA 1JEYB 2OLJA 3AB8A 3P2YA 1SBYA 5HDQA 3DW3X 3ZV5A 4AJEA 4MO9A 3ITNA 1X39A 2B1GA 1MT3A 2XY4A 1SXHA 3EVEA 5AXBA 3R6WA 3NV9A 4YRPA 1WAMA 3D0OA 1HSZA 4LDAA 3IQEA 1HL7A 2WAYA 4D98A 1EU1A 3T5CA 4Z99A 1CEEA 3KVOA 3K1ZA 3G5AA 1OWLA 3MBOA 4YUXA 4IOJA 3T7IA 3PHGA 3Q15C 3ASZA 3VOTA 3N2IA 1M5TA 1UINA 1GQFA 3BD9A 4IQFA 1ICEA 3ER6A 3IV6A 4RPCA 1F2DA 2GPSA 4I6JA 4WERA 3RVPA 5E6RB 5BP7A 4E13A 1T9KA 3L8GA 5DM70 5FV7A 4I4CA 1Z5PA 1C1YA 3UJ3X 3PNOA 3IKMB 1Y6ZA 3EVFA 3T3MB 1GAQA 2GJ4A 1MMFB 3HKCB 2DFDA 2RG7A 2JEYA 4KX3A 4KOAA 4LXIA 1F51E 3PJRA 1P2FA 3ZWXA 1V3UA 1KQPA 1YS4A 3E2MA 3DDWA 4X60A 4H7EA 2I80A 3OZFA 2B1RA 2E6KA 3LQRA 4JA2A 4MUFA 2HIGA 2KWIA 1DAKA 1E0DA 1DRVA 1FMCA 1VSBA 2IW3A 2WPNA 3Q3GE 2JGDB 3C7DB 5CT9A 3RS3A 4EFDA 4Q39A 3M5DA 2IOYA 2PSDA 4WVFA 3JCZA 2MTBA 4IGFA 4J2OA 2FUCA 3AJ8A 2JANA 2C78A 3AZQA 1B8VA 4HQ0A 4ESEA 2UYCA 1U3DA 2FRDA 2HRZA 3KYDA 1P2GA 3PL5A 5FOXA 2D00A 4DCJA 3G0OA 2I62A 5DNVA 3AFNA 5KQPA 2PRKA 2Q6LA 3UANA 3T94A 4FFSA 1QJCA 2DR2A 4EJSC 3EIXA 3TOCA 4B3RB 3TI9A 1Z13A 3RADC 2AJTA 5D86A 2PQMA 3GT7A 2Q6TA 821PA 1LZLA 2D0OB 3JXEA 5DXAA 1FB5A 2EGUA 2AOTB 2BFOA 3QXGA 1BGXT 1NATA 2D2XA 3G79A 1O95C 2Z4SA 1NXOA 3TN7A 4ZVSA 4BGDA 5FOQA 4Z7QB 4NZYA 5IU6A 1CDDA 1X1RA 3E9DA 5FWDA 2J6IA 3FVTA 4MYRA 1RC0A 3ACBA 1VE1A 4G5GA 1DAFA 3BERA 1LWNA 2AMVA 1AS2A 1NMEA 2I3ZA 5F4ZA 4AF6A 4B7UA 2VNHA 1N7GA 1LRJA 1L0BA 2B8JA 2VHQA 1EGVB 2ZJYA 3BSFA 4MLDA 4XTCS 3FMOB 3U17A 2FX3A 3KQLA 2H11A 4JC0A 3DCNA 4BEJA 1ABFA 1VGVA 4MVJA 4F8EA 2EZ8A 3FCUB 1OV6A 3HYRA 3D4BA 1DTWA 3NWEA 3WXMA 2C5EA 3IIJA 1IBKB 1JJBA 4MUJA 1THTA 4H3VA 1SVUA 2WIDA 4RHTA 4WZBE 4DUGA 1ZESA 1N4AA 1W96A 3DC7A 2RCYA 2DT8A 3T5AA 3Q3HA 3UMRA 1B74A 4OL0A 4UUNA 3FN4A 4JUDX 2MYUA 4LDPA 4D02A 4HLCA 3AF6A 2CE2X 3NCHA 1QRSA 1WSWA 4ZCIA 1V6SA 1HGXA 3W2GA 1OH7A 2P9QA 3EY4A 5AW0A 1JR2A 4E30A 1E2UA 3GZNB 1L7VC 1JFSA 1DPFA 1H5QA 1R0ZA 2WIFA 2O23A 4J2TA 2DXIA 3PRHA 1RMQA 3IAUA 2VJQA 4PSVA 3RBAA 1GV0A 1P3JA 2VHXA 4EJFA 1NG9A 4B3TB 5FIUA 4JFAA 4NCHA 3ZZTA 5CFZA 1B3RA 1H3NA 1S2LA 2HQBA 3C6QA 5CEEA 4MA0A 3UMFA 3FHLA 1O87A 3A1VA 4XI9A 4AYXA 5KYXA 3W2FA 2XUKA 1K8XB 1MP0A 4QVIA 4FN4A 2H2HA 3A1UA 1PJ3A 4IX1A 2IJGX 4CDGA 3W5BA 4ZJUA 1Y7HA 2FJUA 3AFOA 1Z83A 3L49A 2H7VA 2A5FA 3ZOZA 4FYXA 4NVRA 1LEHA 4BO4A 4D42A 1R8SA 4G97A 2IGBA 7AT1A 1PHRA 2FSIA 2KM1A 3L9XA 4A26A 4BATA 4KR0A 3O4RA 3NHKA 1L4GA 5FBHA 1VG8A 5J40A 4JKOA 4MIKA 2VUIB 3KUKA 3EMDA 5FNVA 4N0PA 5C51B 1V0JA 1QGAA 2R60A 1F9EA 1RWVA 3ZDQA 3PEUA 3K71B 3FSGA 1MA0A 2FUKA 3PQ7A 4KYVA 5K6AC 2XQIA 4BMOB 2OV3A 2QZJA 3R6TA 4OLJA 3OIDA 4A0SA 1PLJA 2IDJA 2FPIA 2C5HA 4KNWA 4HGOA 5IT5A 3CEMA 4LF7B 1VMIA 1OFTA 2WAOA 3ELDA 5DH9A 3WLEA 2IF0A 3AWIA 1PFKA 3FCCA 3CB4A 2VTVA 1MO2A 1R8JA 2ZSAA 3I92A 4G41A 4IIEA 4RFVA 2GXAA 2E48A 2PV0A 1JAXA 2H54A 3AFHA 4AKGA 2Y9PB 1YKSA 3HU3A 4I3FA 3T5TA 4EY6A 4L9RA 1XPUA 3B9QA 3RT1A 1FC0A 3NCTA 3O2NA 3SCZA 3ULKA 4CQLA 3K2EA 1J0EA 5T7BA 4CEJA 3FOBA 3K1JA 4JUCA 4CIXA 3AL3A 1NR1A 4LHEA 4YRQA 1JG2A 4QLAA 3CS3A 4H1HA 2W7TA 3AY6A 4KN5A 4LMBA 2JLCA 1GV1A 3FF4A 1L5WA 1OTYA 1SCDA 1HYHA 3CW8X 5LZ5A 3QUCA 4D7AA 5L3SB 1JRLA 5H02A 5KSWB 3RVDA 1PD0A 3IQDB 3L0PA 5E6SA 3WGGA 1T3TA 2BHLA 2ZRJA 3NB0A 4V2IA 4YJHB 5AKHA 3R74A 4ZOEA 5HA5A 2WG1A 3ST7A 3ZK9A 2OCBA 4AJJA 2IZ1A 3C85A 4OHRA 3HABA 2XZPA 3IP6A 4PFJA 1R6AA 3H8WA 3RWBA 3QVTA 4DRZA 3PPVA 4JC4A 5C3MA 1T5LA 1QHYA 1ZZEA 4UARA 3WBFA 4XRGA 2WKSA 4V0ME 3E5RA 5DF1A 1EGAA 3NHYA 4S1OA 1JA9A 1KP2A 4V02A 4ZVVA 3M3DA 4I5IA 1T34A 1N5OX 1C3JA 2LVBA 2R62A 4L73A 4WT7A 4BO9A 5CFQA 2O8FB 2H08A 2HWYA 4Y2HA 4KGXA 2W6ZA 3R7SA 1PVVA 2GZ2A 1W5SA 3UKOA 1H5NA 1AM4D 2DHDA 5IPFA 5JC8A 3N2ZB 1NW7A 4QOFA 4C07A 1T5BA 6PFKA 3IS3A 2IYQA 4YACA 4KPUA 1JH8A 2GTPA 3FHCB 4N9QA 1JEYA 1VE5A 3QX9A 1JTVA 1SEVA 3U19A 3GJXC 1S89A 4ZXPA 2XUAA 1GAJA 1RVDA 3IJEB 5EUCA 2PWBA 2WHEA 3E05A 2P6PA 3C3WA 3GD7A 3TDNA 4BFZA 5JXWA 5K5EA 2IH4A 1A7JA 1N9ZA 1SEPA 2BBTA 2Q99A 2IYLD 3A32A 3FYCA 1I0IA 2DFNA 4G0XA 1SOAA 3NC0C 4OPMA 4BV3A 4PN7A 1NDHA 3IDOA 1U7HA 3FWYA 3PC4A 4A6EA 5JALA 1G6Q1 2PUVA 5FBKA 4EY5A 1HKUA 1ZN8A 3F3YA 1LS6A 4D8TA 4HNGA 3U4AA 1JEOA 4RQTA 4KTVE 4ED9A 4F4DA 3FCYA 3UWDA 1NSYA 3ZGZA 3WGLA 3A0RB 1Y1KE 1BS1A 1FDTA 2IYTA 4KX5A 1FTSA 3L7BA 4BDSA 4BVAA 4IIGA 3OBIA 5E6RA 1J2TA 3I6IA 4L2IA 4DDKA 1EDOA 3NHMA 2F7SA 4TKUB 4TKMA 5J2UF 1E66A 2DM6A 3A3OA 3HKCA 4E6PA 2PX5A 3ZGOA 1L7PA 2XOEA 3LYUA 1J2RA 2ORVA 1M72A 2EZ9A 1A95A 3KKKA 4G5XA 4R05A 4RKFA 3VH2A 1KVTA 2LR0A 3PD0A 3RTCA 1J0XO 3GHHA 1N3LA 8LDHA 1RXWA 5DRYA 4C2BA 4NXNB 1YONA 2C5GA 1XU9A 2B9EA 4LJ4A 2ZSJA 1YZVA 2WOJA 4WECA 2H4YA 1U8XX 4BQFA 1QQBA 5D3QA 2JGDA 3LXRA 3OE4A 3A4IA 4X91A 1N1MA 4JR1A 1D6JA 3UK0A 1TZMA 4L57A 2FR8C 2OCDA 3GNTA 3F97A 3GRAA 4ZV9A 4AN4A 3U3XA 1U94A 4M37A 2V65A 4OV6B 4KREA 1LW7A 1CWUA 2WZCA 1PGOA 3WGZA 5CCBA 2MSKA 3UOAB 3ZWCA 2VVTA 1L5KA 1I2CA 4HWGA 3W5UA 3WB1A 3FCAA 3RFTA 1VSUA 1T9DA 2JFQA 2CLCX 3L0YA 4ZPXA 4KIGA 4Q3LA 3VGJA 2HWWA 5HRCA 3VJMA 2AOTA 3ZS9A 4PYOA 3O0TA 4ZYWA 1XROA 4FYHA 4EZIA 1N6HA 4UFPA 2J3HA 5LP1A 4NJOA 1CZRA 3E9QA 2HPVA 2CCKA 3N70A 4WY5A 1Y8QB 1FP6A 2O5EA 5EJGA 2ZJBA 3HYTA 3LUGA 4HXGA 3ZU3A 1CDZA 5C0OE 1R6VA 1EEHA 4WJLA 2ZR7A 2V98A 3TTWA 4J6EA 5HTOA 1IL0A 1UC4B 3M9XA 4PSCA 4RJKA 4TS9A 4W1RA 2BC9A 4YREA 2GUGA 3TLGA 4EEXA 4MKRA 3S7ZA 2NUPA 1VP9A 2ZBFA 4DQDA 4PLZA 4QGGA 1IZZA 1H9CA 1HK7A 1UXHA 2I67A 1E99A 3UHOA 1O5OA 2IC5A 4YT4A 5ALVA 5FBRB 1Z8FA 1CV2A 3LP5A 1OWPA 2FWJA 1APBA 4QNRA 4ZVTA 5B57C 1JDZA 3A9VA 1E3SA 4WLUA 5LFAA 3QLJA 3RRJA 5K0EA 1SKQA 1OLXB 4Z49A 4IGIA 4B35A 2QRLA 5A2GA 3GZNA 3HZRA 1QQ5A 3LCVB 5IP5A 1EHYA 2FNAA 2GZHA 2J09A 4CM4B 1OY1A 3URMA 1P73A 1NW5A 3F6BX 4RX1A 2VZ0A 3ROMA 3HXTA 3G9XA 3AUJB 5LVAA 4JGBA 1T91A 2YJZA 4ZO4A 5LDGA 3SBEA 4PZ9A 1GLNA 4P54A 5TGDA 4L72A 4LXGA 1OPRA 3PVZA 3QJYA 4M6WB 5D3MB 3C5EA 2G0NA 4HX5A 2XYPA 1BA3A 4P3XA 4PYIA 4MI3A 4RHFA 1MOQA 1ZDMA 4BECA 3CWQA 3KT3A 3O2JA 3PCTA 5LQAA 2MYNA 5JVDB 5CTAA 3B51X 4TMFA 3LW8A 3LLSA 2AMFA 4UMEA 3C3AA 1IQUA 2E3JA 3EXHB 4FMPA 4OK5A 1FW8A 4W6ZA 4EDHA 3KVNA 1KPHA 4JC5A 3ELUA 4WZAB 4U7FA 1SMKA 2KMLA 2XH8A 4U0KA 3VR0A 4BB0A 1VGRA 4ZWNA 3H87A 3AVWA 3ZVLA 2P9ZA 4ZOCA 3J7TA 4L07A 1KY5A 1ILWA 1DOZA 3L0BA 5HF9A 2HIAA 4B48A 4XVQA 2ZWPA 1DKUA 3ONDA 3EIHA 1DAOA 2O3TA 3LDGA 1DAEA 1QZUA 2AOUB 3PHHA 4L0MA 1A5TA 3GRZA 3BD7A 2QX6A 4EATA 4MJ3A 4OVKA 3EASA 5IEBA 2BLNA 4CU5A 2NMVA 4H7JA 4EMTA 4EX6A 2V7UA 2FPPA 4Y2JA 3TCKA 3DEIA 1WP4A 4RC9A 4BTVA 3OCYA 4NU0A 2O57A 1JF8A 3OJWA 3KOZA 5K8CA 1ANKA 3CTPA 4GC9A 3RHFA 3GUZA 2VRWA 1ZM7A 3CRZA 2DWPA 2VZEA 1TMGE 3GLHB 1IPHA 4G0ZA 4RJIA 2P9GA 2C0PA 3AW8A 2ON6A 2WC1A 1QRTA 5GTDA 1NHWA 4I6EA 2A67A 4JJ6A 1YRBA 2ZUEA 3LRTA 4YP5A 4ZVNA 1RBMA 2B4AA 2Z57A 3IC5A 1UP4A 1XCJA 3WICA 5ENZA 4ZTBA 4B31A 1ZR4A 3JSXA 3FIUA 3DAHA 3NBAA 2PY6A 1GADO 1I80A 2VRCD 3ZWAA 3PVCA 2G6TA 3TTSA 1IDOA 2ETXA 5GGYA 4R3UC 3DL7A 5EIFA 1E61A 1R0WA 1CJTC 2AL7A 3NYIA 3ZTTA 4QO7A 1C4WA 2QN9A 4P38A 3A7EA 5C8XA 1QK3A 4LXXA 2GBLC 4G8DA 3O8BA 3O83A 1MB0A 1Q22A 1RMTA 2W6ID 3OWHA 3I0ZA 1TVKB 2GXUA 3DW1X 3R44A 4HCJA 4YRMA 2XKBA 1ZL2A 5LQKA 1RBYA 2K5UA 3CJRA 4ITUA 1JV2B 5FUBA 5BQFA 1W94A 2C8VA 4COOA 5JU6A 1XKTA 1G8JA 2HMAA 3C4VA 4MP3A 3UJAA 3KOOA 4YRKA 3VVMA 1IDN1 1H23A 3E9YA 1AZSC 1A5BB 1NSTA 1L1QA 1OX6A 2MYPA 2AOWA 1PDOA 3DR5A 2Z6AA 4G4SP 1M0EA 4AQDA 2ZJFA 4I14A 2Q0HA 5BSVA 1EP1B 1XV5A 5TX7A 4X94A 4RYDA 4OLBA 3AY7A 3M1AA 2GCOB 2WQ7A 2LUOA 4D79A 5FTJA 3K9QO 3LNCA 2A5LA 2CNWA 2J4DA 3ES9A 4TKUA 4DS3A 2Z8ZA 3WV4A 5MHTA 2JHCA 4M0KA 3WNDA 3KTAB 1LDBA 1AQYA 1JHAA 3QE2A 4G63A 4YIKA 1U31A 4AP9A 1I3OA 2ODAA 5TY0A 3FOZA 4G01B 2VPZA 4K2HA 1ECPA 1JG7A 2QVBA 2B69A 4XVHA 4BJ6A 1P0QA 1GVHA 3QX8A 4OAPA 4YI5A 3T5PA 1ECBA 2JFGA 3FKJA 3N7UA 5AD1A 1TL7C 1Q20A 3H9BA 3WRYA 4C21A 1VFPA 3RROA 1T5SA 1QP8A 1JFFB 2P1ZA 2WWTA 5D5PA 3BDVA 3SJ7A 3ZHRA 3LMKA 3W04A 4HNHA 4L28A 1VRVA 4PINA 4TMWA 1Y81A 2FWIA 3P96A 2EHDA 4LHSA 3O1IC 2K87A 1BXRB 1V6AA 2OESA 3I9LA 3MCVA 5DLYA 4H6VA 4YQYA 4GI1A 4G67A 4OATA 4PO9A 3ZCUA 4YJ3A 1G18A 1PL8A 3H1FA 4KYTA 4UBJA 4U7JA 5G0SA 2JIZD 2I78A 1TX4B 2XNCA 4PAOA 1P74A 2CMDA 4EVRA 3AKCA 5IC4A 5LDHA 4YUWA 4BNLA 1XVVA 1YBVA 2ZAYA 4OU5A 5E2BA 3SKXA 2XWPA 4BEWA 1B2LA 5EYPB 2WVGA 2HSEA 2XRMA 4YONB 3NETA 1JPJA 2QE7D 3QMPA 1CC1S 1XDUA 4K9LA 3F47A 4KKXB 4EBFA 5FWYB 1ZNWA 1FLVA 2HHLA 5CPFA 1GRNA 4BCBA 1SCNE 2YV2A 1R74A 3KKOA 4PX3A 3ZNNA 2PS9A 2P11A 2QTGA 1L5OA 3BRWA 5DBHX 5LYJF 3WSTA 3IT0A 5LLSA 3A1EA 4OAOA 1JBKA 3COWA 1BW9B 1RTTA 2GAJA 4NEGA 2PLNA 4DJFC 1YZGA 2OE2A 5ALFA 1N3IA 3VNUA 2ODEA 5A4FS 3F46A 4B9EA 4CN9A 421PA 2XXJA 1UPXA 1OPXA 1YI8A 2HCFA 5AKEA 1RYFA 4EZEA 5FTWA 3D81A 2VS1A 4JKIA 4C0WA 4LBVA 5JXHA 5E1OA 2Z1NA 2JDIA 4C43A 2ONZA 2GXSA 1C8KA 1QGDA 5KQGA 2NN3C 3PSHA 3HC7A 5DHSA 1NQAO 1KYYA 3DZKA 3NC4A 3GDGA 1VBKA 3HS3A 5JO9A 2I76A 1BMDA 3IHTA 4AJ4A 5CG2A 1OLXA 1I3LA 1P19A 3ZDBA 1KI8A 3UWMA 4DIMA 3DWIA 1QG6A 2X86A 2HI0A 1Z7BA 3PCRB 3JWEA 2YNMD 2CHEA 4I1RA 5FL7D 5HNKA 1J4AA 4CM4A 2XF8A 1RQRA 2XRZA 3SWWA 2YKGA 3DEAA 4IVNA 3R4VA 1OXBB 2ZYHA 3PLRA 4P5DA 4AP6A 3IIMA 2YJ6A 2IUYA 1D8AA 3T4PA 4LNUB 5AM3A 1PR9A 3ZI0A 1EVLA 4G2TA 3KJGA 1WMEA 4M6WA 2BGLA 4PW0A 4GBGA 5FLEX 4MUYA 4Y30A 5D3MA 1YDMA 5IH3A 3I1FA 3OOSA 4ZT5A 1NNEA 1VPLA 5C5DA 2PXCA 5AKYA 2BMJA 2DQKA 3CW2A 2DJ5A 2HSGA 3DDOA 3OFNA 3T12A 4CF3A 2P6RA 2R9VA 3QOWA 1MRSA 1L2TA 4Q05A 4LTMA 2WSLA 4RV4A 5JVDA 3QMVA 1W25A 1T2EA 1T8PA 1RP7A 2RARA 3P9YA 1UDWA 3EXHA 2P2YA 4PHGA 4S1PA 3T1VA 4MGYR 3VYTB 2ZE5A 1PTKA 4QASA 2IVFA 2HGZA 4E09A 4MWGA 2BZ0A 4WZAA 5EP4A 3AVVA 3V33A 1YNSA 1E1KA 5DXFA 2X7JA 1GNVA 3C14C 3I01M 4EG5A 1TTPB 4CCSA 2NAFA 2PDAA 1AKWA 2JFUA 3FTNA 2C9DA 2AN5A 4AG5A 2Z30A 2PWPA 2XAAA 3A36A 4NBWA 2FZGA 5HIMA 2CCGA 5GOTA 3V3TA 1Z08A 2GKGA 3TTYA 1IBRA 5B1DA 4L08A 1WKCA 5BSFA 1AUOA 2IY7A 3VR4D 2AOUA 3LC0A 3SDZA 2QGFA 4G6ZA 4HVTA 3MAJA 4PZYA 4V38A 2J3QA 4DRYA 1GGVA 1FJ2A 2PRJA 5LB2A 3ZYCA 1X13A 2B37A 3F7MA 1JIUA 1ZD1A 4IIDA 4H3SA 4UZEA 3OTOB 3H0CA 4RSHA 2IH5A 1PHPA 1QHGA 4I3GA 4DNPA 4YRDA 1VRCA 2HDNB 1HDYA 4FD3A 2NYAA 1B6GA 1M2EA 3W1EA 3NVMB 1A2KC 4UASA 4Y2GA 1XXLA 4RHUA 1T4CB 1P44A 2CVFA 4U7HA 1GZ3A 2NXEA 3FNHA 1UFVA 1ECFA 4BLWA 7GPBA 1ADGA 1N8TA 1VKZA 1JHMA 5IDWA 3GLHA 1LA2A 4PHFA 1AZWA 4K03A 3Q0IA 4P7KA 3F4KA 2F2TA 4W4TA 5A0VA 1CUXA 1KJIA 2AI2A 3PDUA 4FFDA 4ALMA 1P9OA 2G83A 2BFFB 2HB6A 4MCAA 2MCFA 4TN5A 4BRSA 5JCPA 3EDCA 3RS5A 1O7JA 3PEFA 4TT3D 3ANMA 1FEZA 2Y0BA 5LZ8A 1LD3A 2Q2WA 1T43A 1A1SA 1BXKA 1Z4OA 3GT3A 4JWTA 3ZHYA 4UAGA 1PK7A 3C5CA 4B34A 5E7JA 2P4HX 5TXGA 1JYEA 3H99A 3IBCA 3KQMA 1QUEA 1DC4A 1XVLA 4WNYA 2ZROA 4GQBA 5EIHA 3T0IA 2BEVB 2HU2A 2UZAA 1FVOA 4HEA1 2GQ0A 4HJXA 4NU6A 4ALKA 3QF4B 1NUSA 3KPWA 1M8GA 5FHQA 1DADA 2I4OA 1ETHA 1COWD 1TVKA 3P9CA 4NK4A 4YP6A 1KVSA 3I8SA 3H3XA 3LO8A 1WABA 1FRQA 1NT4A 2EJBA 2ZRGA 3EA4A 3EODA 4LHZA 3DL0A 5JRZA 3UW1A 1PKXA 1HYGA 1K8ZB 2KS6A 4ALNA 3QEAZ 4FZRA 5ESDA 4IDCA 1Z4KA 3NBXX 2XI4A 1R18A 1JS1X 3C2QA 4DLPA 2QPLA 4C76A 2FWRA 2B82A 2OCGA 3V7NA 3PPXA 4XARA 3TMAA 1LK7A 5CHEA 1XQ9A 2UXCB 2GCOA 1I6MA 2C8KA 2UVQA 5TVGA 3OZGA 3WIEA 3NBYC 5EVCA 2QAGB 3M7IA 4UM7A 4CF5A 3CPJB 3DMDA 1CJUC 4J1TC 3VO8A 2WTEA 3C15C 4WSOA 4O3FA 4M89A 3TQOA 2I9KA 1TUEA 5I9IA 2FEOA 1NLUA 2ZRQA 4H7HA 4CUJA 2V7QD 1KARA 1U6KA 2LP4Y 3K6SA 4MVJF 2VDRB 1W44A 2MR5A 4KQHA 1U4SA 5D1HA 4YBRA 1UDCA 2OB2A 3DBIA 3L7KA 5CXSA 2QX4A 2PZ8A 4DREA 5D00A 3DTTA 1HZZC 3DOCA 2QXTA 3R3HA 4KPGA 3UG6A 4AI6A 5AK0A 1JFFA 2JI4A 5DJ5A 1I1OA 4RS3A 3SKVA 4GX5A 5AJUA 5EQTA 1KO5A 1QHIA 3U31A 1P2VA 5AW4A 1IEWA 1O5TA 1XBTA 2ZM6B 1QF9A 2VOJA 1XDGA 1JHRA 1N92A 1AC5A 2GCGA 2XMCA 3LY5A 5AJTA 2COEA 3GLSA 3CLTD 2P9YA 4H77A 1Y4DE 1XA0A 5T64A 4EEZA 4ZO6A 4GKJB 3MUFA 1KA9H 1OHHD 3ET5A 3HZOA 4H6PA 3JQCA 1OJ7A 3INYA 5KDDA 1YZKA 5EYPA 1TNDA 4F8JA 1YS2X 2WFZA 2FWAA 3DE6X 4KQFA 3VJKA 3MIIA 4R9SA 5FWYA 2CYAA 3EDMA 4JLJA 5K3BA 1BH6A 1N0VC 4P80A 1N5RA 5C3UA 5IM4A 1Z12A 2WICA 3AG6A 3AF5A 2XNDD 1Y8AA 3QK7A 1YV9A 1R00A 3ZDCA 1BW9A 2R6CA 1BDBA 5GWXA 4HYYA 5FNVF 2O2GA 5HIIA 2A7QA 3P2IA 1JI3A 3CW9A 5ULLA 2CGEA 3AUUA 1BDJA 3KV3O 5A9RA 4I55B 4MRNA 3UAWA 2Q3EA 3UKDA 2G82A 4L6CA 3LWZA 4ODIA 3TE7A 4K6HA 2WD7B 3Q7PA 2VP4A 1N8NA 3C6BA 1BNCA 3NDJA 1XTRA 3JAMA 5IEJA 5CJ2A 5ALYA 1R12A 2PVSA 2GHQA 3PIDA 1QPGA 2WAAA 4DSNA 2WG0A 5C8ZA 2R8ZA 4FXPA 1KR5A 4P36A 1M6VB 2D1RA 2RGUA 1JHVA 3QGMA 1P6QA 3H5WA 3EGCA 4D56A 1VI2A 1TW2A 1YJXA 4Y2YA 1ZUD1 5CNJA 3LE8A 4EARA 3M4NA 2Y1XA 4TXLA 1RYEA 2WTNA 4LC9A 3OOHA 2AG1A 2WU1A 3KPYA 4RABA 4LNUA 5HFAA 1VJGA 2GEFA 4J2HA 4MRMB 1G8YA 3AFIA 3RAFC 3PLAE 2Y67A 2YWRA 3P26A 3SQOA 2F17A 2VZ8A 4A2WA 1V3VA 4W5JA 3RJ5A 1Z9BA 1WF3A 3BG5A 4LVCA 1AY0A 1I0LA 4V0SA 5J23A 1S3IA 1YJ8A 1ZBDA 1DEXA 4FNMA 2PZKA 4G2NA 4HAVA 1BOOA 1I4OA 4IDFA 2OXIA 4TTIA 5DV9A 3T15A 4NE9A 4C4RA 2VXBA 2EGHA 2IPAB 1VLLA 2CHGA 5LZ7A 5K99A 1ZD5A 1ZVJA 4FT4A 4J43A 1E6WA 3SQLA 1F14A 2FRDC 2ET6A 5BRNA 1PK9A 1YR3A 3A6JA 3IMFA 4OGGA 4TQUS 4NPHA 3THRA 4UKDA 5A4IS 4BBPA 1GKIA 3PTLA 4H27A 1XPRA 2H2WA 3EG9B 5EAIA 3RU9A 1UK6A 5EJ8A 3KM0A 1EDZA 2AZMA 3HNRA 3IPLA 4QBGB 4C5CA 1CUWA 1CEQA 3V32A 1U7OA 5EP1A 1CRLA 3WB9A 2W2NA 2QW1A 2XCRB 1P0IA 1E6UA 2PZAA 4OSPA 1IIBA 1YI1A 4I46A 5JEEA 2VBCA 4AZVA 3O8QB 1NUUA 3Q3JB 1W8DA 2DTEA 4PNEA 3ZLVA 4QYIB 1CFJA 1LBEA 4LGVA 4BOYA 1A9PA 5JXIA 4NS4A 4M0FA 3E9CA 4AWXA 1KC1A 5KX5B 2CLOB 1QDUA 1YCDA 4BPBA 1ODSA 1Q84A 1NLYA 4Z3OA 3BC1A 1BJKA 2Z3VA 3U61B 4LZNA 5KVVA 1DAGA 1PDVA 4XIIA 3DBVO 3L7IA 3ORYA 4EVIA 1T4CA 1ZSVA 1DEHA 1BFDA 1MC1A 1UK9A 4HRYA 3T3DA 4X93A 5HIAA 5MN5A 3VPCA 4XYEA 3KB8A 1A5SB 1EX6A 1LBSA 2W11A 3TR0A 2XQGA 3VH4A 4LZAA 4NYJR 2X8WA 4GOND 4YJFA 2JIBA 3CWCA 3MW8A 2CLEB 4LCEA 3RUEA 2QTLA 2BFFA 1AE1A 1UM8A 2WM9B 2NO0A 3LPCA 3NC1C 2A5DA 4ZAVA 4DG9A 1XJ0A 1VPDA 2X1LA 4FSHA 2A94A 1Z07A 1ZIPA 4TRNA 1PDWA 3QKRB 1R88A 1Z4JA 3HEAA 3EUFA 2PMDA 4L3WA 3NWBA 2AMJA 2HDOA 2QUBA 3DCYA 2BEVA 2XB4A 2FZ5A 4QVKA 4HWSA 3MLAA 1J25A 2D62A 4LOHA 1USWA 3RS4A 5IBCA 5JJ5A 4C04A 4FFNA 3MJHA 1KE2A 1ZFNA 5B4VA 2LTAA 3OQVA 2WVAA 4G5YA 3HFSA 1L8OA 2AG6A 3TQTA 3PRKE 3UMYA 1WBBA 5JCZA 1E8NA 1J70A 3QI2A 4UCFA 2O5VA 3GV0A 1C29B 2Z5GA 1E9FA 1NLMA 4UBIA 3PXUA 3L7OA 4Q1AA 1CBUA 1H4SA 3GQBB 4KO4S 4MUGA 1DGQA 2JCBA 6ABPA 4DMRA 3R7DA 2WDPA 2ZJ6A 2JEZA 2FMHA 4QXQA 2E1PA 2GWRA 5EZYA 5H4GA 2EW2A 2IXGA 3CUKA 1QFXA 2QA5A 3E27A 5DGCA 2YYSA 4N3NA 4XX0A 5BYJA 3T5DA 1EBFA 1MZVA 1ORVA 3GLTA 5BSWA 2VTKA 1DOHA 2PS3A 5T4EA 4UHCA 2OFFA 4ZHSA 2QAGA 3PDJA 2G5TA 3M6WA 3QE0A 2XDQA 4G65A 1N7HA 1NBWB 1U80A 1WOYA 2HF7A 2BONA 3ABIA 4LYYA 4UXIA 4RIFA 5JAPA 1GYRA 2FW6A 1H6AA 3DUFB 4F5WA 1U3WA 4DANA 3PPIA 3EQ7A 4ISCA 1ENOA 1AF4A 4KW7A 1XLTA 2V6JA 1JBEA 4EHJA 2ZDGA 3UH0A 3AEYA 4BHTA 2GILA 2C83A 3BFVA 4XDHA 2P90A 4ASUD 4EECA 2OGTA 1O0CA 3IGFA 4LYEA 3E1GA 4PLGA 1MV8A 4L5CA 1HEUA 4IHKA 1QYXA 4U63A 1E5XA 5CA0B 5L3VA 1DB3A 3JAKB 2A57A 3T3NA 1ENPA 1FTNA 1GHTA 5FV4A 2HDWA 3DQPA 3GJTA 2IIVA 1YBHA 5JNVA 1OSNA 4OIMA 5HF6A 1M8FA 3P2JA 4ND8A 1FLAA 1BC5A 1XCOA 4K87A 1FFDA 4M8SA 3A4VA 4NAVA 3QVJA 4RJLA 2GN6A 3CLUD 2V9CA 3ZXUB 3T9CA 1XJWA 4EF5A 3QOXA 3GT0A 5I8ZA 4DCNA 1Z17A 3OAAD 4S3MA 2RGAA 4F21A 3NTUA 1GUBA 3CVUA 1FQJA 3AJDA 1PV4A 2C20A 4OJYA 3DFKA 1L7QA 1W93A 1YTLA 2DMRA 2IT1A 3JTMA 3AGQA 4JVLA 2NXWA 4JP5A 2JH8A 2A9QA 4DR4B 4M88A 1L6IA 4Q6BA 1YQUA 3FMIA 1I14A 4HO1X 5IHPA 5KC8A 3W4JA 3RC7A 2PNJA 4YAFA 2G4CA 2GJAA 1E7YA 2ZRPA 1U6IA 3JY6A 3MD9A 5KO2A 2HLHA 3VH3A 3WX0A 4E08A 4MI6A 1P9RA 4E2YA 4YCCA 2VTBB 3AP1A 2QB5A 3S1LA 1U0EA 4JLUA 1FOEB 4XWAA 2F64A 4DOMA 4ND2A 1P6XA 4RJJA 1G3IA 3LC7O 4M38A 4DILA 1QP0A 2IIBA 3C8ZA 2WD7A 1JALA 2PT7A 2FAXA 3KO8A 3S70A 2OBYA 1IPEA 1DBWA 4AURA 4Q4LA 4DA6A 1H6CA 3JVEA 3I9V1 3IVXA 1GPKA 2EBFX 4PLYA 2YJNA 4IGAA 5FI1B 1GLVA 1K68A 1JQAA 4ZVMA 1C3LA 3P2OA 4WVLA 4CFYA 3MSCA 3TZCA 1MZPA 1M6VA 2GEBA 2OHFA 1SBTA 3TLMA 3PI6A 2DECA 3WWEA 4EI9A 3CNOA 1QIIA 3D7KA 3TOXA 1KXJA 2B4KA 3EZFA 3REQB 2HFJA 2WHQA 3GJQA 2IYWA 2JKYA 5JI3E 3HVUA 4LUCA 3ZIAD 2GEUA 2P6NA 2X9NA 4UOZA 3TSWA 3OE1A 1UJCA 3JPWA 3KDPA 3IUEA 2QN6A 2ZSIA 4KVZA 4MRMA 2P0EA 1PZNA 3HB7A 2AK2A 2Z2KA 4L85A 1T0BA 3WIBA 2R7NA 3K92A 4Q4HA 2PGAA 2C96A 2Q1TA 1E9BA 1M34B 1OZAA 3MGBA 1Z68A 9LDTA 5IBPA 2J4CA 4KFCA 2IS2A 3GDHA 4QG3A 3U4QB 4CGZA 5CGZA 5BQOA 2WE7A 4GR9A 3O9ZA 5FA5A 4MJLA 1SBZA 3IUQA 1GPDG 1VG9B 4HQLA 4TLLB 1G5HA 1OAKA 5BY2A 3H5AA 4XOUA 4ARUA 2UXDB 5BSMA 3I2IA 4O4IB 4Y98A 3JYPA 1OGJA 1MU0A 2WUDA 4NNJA 2PHZA 2GRAA 2B4QA 5KINB 2EIXA 2RAVA 3H9CA 1ZXLA 3EG9A 2OSBA 3QZUA 4EHLA 2LD4A 4II7A 1MFZA 1DAIA 5DYYA 4RE6A 4MW2A 1W5AA 5U4QA 2TECE 4RSRA 1DNPA 1GQSA 1LPNA 2FY8A 1T6BY 2FW8A 1KQNA 5JRJA 5TIIA 1EESA 4CDMA 3QXHA 2JBAA 4XWWA 3K4QA 4QYIA 1R3UA 2I7VA 3PT9A 1NF8A 3KG2A 5JD6A 3I72A 3I83A 2GCIA 3KEFA 1VPVA 2DULA 2G28A 4WXRA 4YCLA 4P0QB 1MEOA 2J85A 2JAOA 4PGGA 4K88A 2XIQA 3I58A 1GSAA 2X23A 5ERXA 1QE5A 2H4ZA 3AO0B 4MW0A 3V7YA 5BR8B 2BM1A 2J6HA 2LKCA 3RK1A 2VQ3A 5CB8A 3R3ZA 1MDBA 2QV7A 3LWNA 2AD5A 2REOA 3PUHA 1ZMXA 2EFGA 4R2LA 2C1EA 5BORA 2O6HA 2B5VA 1YMQA 1P2UA 1IOVA 1FDIA 1A04A 1U8UA 2JFYA 1QORA 4FMDB 1B14A 5DWVA 3ZI7A 1LVHA 1LX7A 3LPDA 4RK5A 4DHWA 5LXTB 2G08A 4NMMA 3S5JA 1ISGA 5FUXA 3M83A 1F06A 1P39A 2B2XA 2BZ1A 4KYIB 5HCNA 3SHOA 2PKQP 3KT0A 3QKRA 4HBZA 4HDCA 3X1JA 2G9QA 1AGXA 3GGOA 3TKAA 4BFXA 2J0QA 2JIRA 1T8RA 1VLQA 3AF2A 1FMJA 1RWXA 3L2OB 3K0SA 4JLSA 2GTHA 4MUHA 4ER7A 2QYHA 4MV7A 2QQ5A 5ILOA 4J76A 3EQ9A 4JQSA 1DX9A 4UC0A 1YHYA 1CIVA 4NBRA 3M89A 1RHKA 3A7DA 2H1RA 2VWHA 3G5UA 4YJ3F 2E6UX 1QKIA 1UBCA 2NV2B 1X1TA 2O3QA 3K0EA 1HETA 3H8SA 3GQBA 3NR2A 2VR1A 4HDQB 4KWCA 3RG8A 3TJZA 3V9AA 5JS1A 2FDXA 2IXEA 3UHJA 1LI5A 2I7TA 1WZCA 2D7CA 3PU6A 2PKXA 4IEIA 4QJBA 5C1IA 1XNGA 3V4LA 1CF4A 2HF9A 4DZRA 1UJ5A 2C4MA 2K2QB 2OHXA 2QZZA 2WWGA 2NVUB 2YFKA 1CY7A 4MXDA 3EBOA 3KK0A 4NHEA 4J0EA 1OFGA 3WDSA 1IZ9A 1BS2A 2G4VA 3KOWA 2ZUFA 5DMHA 3PS9A 2VK4A 3N8KA 2X3UA 1KJNA 1P1JA 2FZWA 1M33A 3CKMA 2M6LA 1QS0B 3T54A 1BDMA 4EGSA 3DUFA 2VHZA 1GPH1 5I7RA 3ONWA 4IQ0A 4RIHA 1ZPDA 1DC8A 4R31A 2GRUA 4E5MA 3BUSA 1TZ2A 4R69A 1WUJS 5FBWB 1LLFA 1KS9A 4HHEA 4JGIA 3EIOA 4N3BA 3KSUA 3OLZA 1JXOA 1NQXA 4J07A 2RMKA 2BTQB 3B1YA 3Q6IA 4I08A 1FMTA 3UB3A 3WJAA 2VJPA 3W5DA 2VRCA 3JAKA 4BS9A 4DJJA 3S4YA 1D6MA 1G21B 3P0JA 3V42A 3S28A 2AWOA 1UKYA 5DX1A 1LB1B 3F4BA 2LRHA 4ZT6A 1EK6A 1JE0A 3S27A 2W6IA 3TNDA 2W90A 2IEYA 1G1AA 1CSEE 5ELMA 5FI3A 1MG5A 1D1QA 4YV7A 3GDFA 1NBAA 2IIQA 2H48A 3D7NA 3I9JA 4JL6A 2FWBA 5EJAA 1N2BA 2CLDX 5CFPA 4ZV7A 4CM8B 1L7OA 1R37A 2CXQA 3K5IA 1S2DA 2IZZA 4MS1B 1J90A 2Y1CA 4XA8A 5JS7A 4W8HA 3I01A 5EJMA 5EESA 4AY3A 1LVGA 2Q9UA 3CKKA 3GIWA 4BXOB 3VYVA 4YXFA 5KB3A 1GGKA 2B99A 1RKXA 3EZ2A 5D5QA 3EZXA 1IK6A 4W9RA 1EDEA 1NPYA 1OROA 1L5HB 1BX1A 1XZIA 2NVOA 1YR6A 2OY0A 2V7GA 4I5FA 4U7GA 5HTKA 5C31A 1ZISA 3IEKA 4UNSA 3VKUA 2V03A 4BUCA 1UXOA 3EPPA 3OLCX 1AUXA 2JAXA 2P6OA 2AJBA 5DYTA 4EFMA 4G86A 2VTBA 1ZUNB 3IP8A 5KKCA 3ZTYA 3AB7A 3S40A 4TLAA 4B85A 2GERA 1Q1QA 3AKZA 1A27A 1ZEMA 3NASA 4GQIA 4MA4A 3O3OB 2NUBA 2O2IA 4QPNA 1GGEA 4QWWA 1G66A 4M1MA 3OUZA 4B43A 4BNXA 4KMOA 5CH5A 5CVUA 3D3WA 3H04A 5A4DA 4DNXA 1CHDA 3ZDZB 1O54A 3TS1A 4K0KB 4JEHA 3OX3A 1KZ6A 5C4GB 1YRLA 1TYZA 1VLVA 4C0HA 1EUZA 1UBRS 1FYFA 1XIVA 5AW9A 3GROA 4WKCA 1XTTA 3A2KA 2H2FA 2RKOA 3KELA 3O2QB 4NBUA 5JIBA 2M2IA 2Z0MA 4WY8A 4JI3B 4P4NA 1ZUIA 3UAOA 4P5PA 1PRYA 1L6RA 3INNA 2JIZA 1VIYA 2W6OA 2DH6A 3K09A 3QIVA 4JD5A 5HF8A 3QPBA 1NFFA 4B3FX 4BNIA 1GZDA 5ADVA 1XZCA 1Z34A 2HJRA 3HLTA 3R3WA 2G88A 2OV8A 1M34A 4F46A 2OA0A 3I42A 2OCKA 4NMLA 2QE6A 2Z2JA 2BUBA 4P2BA 1AXRA 3QUBA 4FMCB 3U0BA 4M9ZA 1SK8A 3MUOA 4R0MA 3U4QA 2QE7A 1GTRA 3HCNA 3WRYC 3ZV7A 3P9IA 5JD4A 2JAWA 3TWOA 1CB7A 3G6WA 2XYVA 3SJUA 3FUTA 4YVFA 1SXQA 2G72A 4M1ZA 1QRRA 5KYUB 4PAWA 3P9RA 4YDQA 1PV1A 1LSJA 2HAEA 2CWDA 2JW5A 1U7XA 2O2ZA 2P9CA 3FUWA 3IDSA 3N28A 4QGFA 4LX0A 2XUZA 4QUKA 3VGPA 1TQDA 5ILQA 4DLNA 3R9WA 4QREA 2ONYA 3P8ZA 1AGPA 2XD4A 3B5IA 4RLQA 5KYWB 1P9WA 2WU8A 1OREA 1RT9A 4KXYA 1V5EA 5G0TA 1CHNA 3TUJC 2PE5A 3BRSA 3MJTA 1Z0AA 2V7BA 3DVLA 4M0CA 3P4YA 3U3OA 3AZPA 1NYTA 1DUVG 1MH9A 4PAGA 1Y9DA 3M6FA 3L8EA 2ZRMA 3EGOA 1JGTA 3WADA 2FEKA 1ADFA 1V7PC 4ENTA 4ABYA 4JLAA 3FCXA 4EBBA 4P31A 2P2SA 2RBGA 4X1KB 4BYGA 4MDFA 3ODGA 4ADSG 1U8ZA 1U99A 2YNMA 2LCIA 1KVRA 1ECJA 5FL7A 3SHTA 4MWBA 1JHYA 1ND5A 2BBOA 5BWNA 2I3BA 3HUFA 4I4TA 1OI4A 3UW3A 5FOWA 5KKNB 2VQDA 4G1CA 3VC7A 1WDMA 2DUNA 3F0TA 4QU9A 2B92A 2MSWA 1ORRA 4Z3KA 5CCDA 3FZEA 3MNFA 2IBSA 2IP4A 4AG3A 5IK2D 3OURA 1X1CA 4ZYZA 4BN4A 4BNTA 5BR7A 2C98A 3AEUB 4Y9UA 3KT8A 3R6LA 1X7DA 5EZ5A 5F4BA 4DABA 2V6FA 3D6AA 2P6UA 4Z2AA 1RLIA 5DTRA 3ZOKA 4AMGA 2UU9B 1A8IA 4MQBA 4CTOA 3SQNA 3FFBA 3D1JA 2AG8A 3TX6A 4DQ0A 5H8WA 3LP6A 4EYQA 5HR5A 4X9XA 4O3MA 4PZAA 4R3WA 1Y3DE 2QVZX 5CDFE 3L6DA 3SYMA 3NMUF 4EB8A 5KJ6A 4KXVA 2ENWA 3IVAA 4LBWA 1UBNA 1RXIA 2FG7C 3NNNA 2V1XA 4YJ2B 3VR4A 5F35A 3QRWA 1N2CB 5B1IA 4MIEA 4EY3A 2R86A 3I9OA 1NW9B 3KZXA 4EB6B 2D5LA 3DDHA 4FWIB 4YNBA 4AK9A 3VV2A 2QMQA 2QTFA 2NVUA 2ZRCA 3EXHC 4D0SA 3L7AA 4ZCLA 1ZW1A 2WUFA 3CH7A 2GBIA 4FYKA 4OQMA 3GFOA 4B3XA 1FRZA 1A69A 2XCLA 4LCBA 5IM4F 5AHWA 2QZ9A 2C7QA 3KPUA 3FWNA 4DC1A 1QS0A 4I5DA 3D8RA 3HXKA 5ALJA 3F71A 4EO4A 2XB9A 1GPYA 1XZ8A 2WJ3A 1PT9A 1PJAA 2X2EA 3ED5A 4FR5A 1GR1A 2FG6C 4GLFA 4HDRB 3RO7A 4BQIA 1W87A 3TTVA 2BM0A 3OY7A 4NZNA 5DM2A 4MQUA 2ZI6A 3GLRA 4TT3A 4CKXA 1WLYA 4HB2A 3ZLJA 5KHAA 1NY6A 1KAEA 3V8EA 2BTQA 3HSKA 2KSQA 3WKBA 1X6VA 1UP6A 4NDNE 4G0WA 4D4JA 4UNIA 4QFMA 2P5YA 5EPEA 1HL3A 2O8EB 2NNWB 2HQSA 3K2BA 1VQ1A 5AK5A 4F2HA 5HQTA 1HNWB 3NT2A 4UQLA 3ECSA 1G21A 3PXGA 3FTEA 2QMHA 4BUJA 2B0JA 2W6MA 3AY3A 3RSQA 4ETIA 4QKQA 1YU6A 4MICA 3A25A 3GARA 1JG3A 3QLEA 5FPPA 1XZFA 1FE8A 5CUQA 4CF7A 3QU2A 3ZZMA 3ZCPA 4HN4B 4HDKB 1RP1A 3L6BA 3RSLA 2FEXA 3MOGA 2OMKA 4N1AA 1FSSA 5K03A 4BLUA 1KERA 3UAVA 4OQPA 1UQRA 1SY7A 2RGDA 5DN6D 2HXYA 1IHXA 2XCQA 3WTBA 4DA8A 1OW3B 1OLUB 3OQNA 3KRTA 3V55A 3WLHA 4MS1A 1J22A 4CM8A 2EWMA 3THYA 1D1TA 1Z0JA 4OK3A 3DPSA 1YD7A 2AXNA 3T9DA 4RQBA 4R1UA 1JKMA 4BYMA 4ZTUB 2HUPA 4J16A 4G5RA 1HORA 3HDQA 4BZXA 1RNLA 2NU6B 3RDPA 3FUCA 2FHSA 2IA5A 1L5HA 4PG6A 2CE7A 1M5RA 2VT7A 3BWCA 3HCOA 4R84A 2HRBA 1OI7A 1PWYE 3L01A 4CMHA 1QMGA 4D5EA 2P41A 4FVTA 1ZUNA 4WH0A 1TM1E 4RORA 1NOKA 3Q6NA 4W8OA 5KSPA 3ZCVA 1TRKA 3A05A 1T8WA 4MUNA 4B71A 3VDXA 8GPBA 5IUNC 5HE9A 5HOEA 1FCJA 2VG8A 2V7QA 2GCEA 4Z4IA 2JAPA 4YP1A 2AFIE 1EK5A 2FW9A 3CO5A 3L5KA 4A7PA 4E4YA 3ANNA 1WJGA 5DT9A 4YAUA 3TAUA 2K7FA 4IIHA 3NRBA 4CWAA 1P8AA 2VFAA 4F5YA 1CQJB 2PA0A 1NVKA 1QDEA 4PG5A 1IZYA 4Y9RA 1NULA 1G7CA 5F1PA 4KQ1A 4DWWA 3BA6A 1SM4A 1IXYA 4BJHB 2HO5A 3TOSA 1ECGA 5E4FA 1QE3A 1SU7A 3LX5A 1UOPA 5KOHB 1DQRA 3EC1A 2WBLC 2Y1WA 5HKKD 5LN1A 2X0FA 1PNOA 5A6SB 4AMYA 4P92A 4NMXB 4XD7D 4YMIA 3GX1A 1OHHA 2F8LA 3HJTA 3QBJA 2VK2A 1Q2XA 2ECQA 2H7YA 2C3UA 4BQRA 2EKBA 1MAWA 4HRAA 4XEUA 5ICFA 4FLEA 1K2WA 4MPDA 5AW8A 1WZUA 3ER9A 1WV0A 3UHPA 1HI9A 1YBAA 4KLAA 1H4VB 4DJEC 3PD1A 2QHXA 1KOGA 4BE7B 1CYEA 3EYWA 4CKCB 3SYTA 2OAEA 2O1XA 3LF2A 4O2AB 1WDLA 1HDEA 4DUPA 3T3IA 5LQUA 1MR3F 4HZGA 5KYUA 5LPNA 5D5HA 2JGLA 1XZNA 2BFMA 4PG4A 2O3RA 2AT1A 1D09A 2XNDA 2Z4TA 5ARDA 4MDYA 3S68A 4MVJG 4Q4JB 3BMNA 1G60A 1ZMTA 2QQFA 3NFYA 4TKZA 3ZWNA 1W5TA 3OJXA 3HCAA 4FQ8A 5TDHA 3H5TA 4N76A 4N41A 5KYWA 1E98A 1J23A 3SAJA 5AVSA 4HYEA 1XRNA 1NW3A 1OASA 4W1SA 4IDHA 1F48A 2CL5A 2FPSA 3IV9A 5BV7A 1QQAA 2XWJI 4E5YA 1YZ3A 2A1UB 5DBOA 3P9XA 2WKPA 3OZTA 4OFBA 3KR9A 3QKWA 2OTCA 4FM9A 1GJRA 1AKEA 2EX1A 4Z2YA 5EHQA 2GN0A 2IL1A 3KE8A 1PJ2A 2VDNB 2XNSA 1WBJB 2NO1A 2WSIA 1KS2A 3AW9A 5KREA 4AUMA 4EKEA 1JNYA 2WVHA 2J0EA 5BNZA 4A36A 5DGXA 4D3DA 3KL2A 2OZVA 5D8DA 4DJDC 1Z2CA 2VDPB 5JZBA 5TSDA 3SZUA 5KPJA 2E9SA 4INPA 1B93A 1M6NA 3MCTA 4JIMA 5EZYF 2NU9B 4BZQA 3PE3A 2WU4A 1NI3A 4ARBA 2XGMA 5FFFA 2NGRA 2G0TA 5CVEA 2YWEA 4U1RA 3UMBA 2ZQ5A 1NKVA 1PG2A 1DDOA 1K5DA 2V6GA 4B6PA 4E5SA 3RYCB 2QZSA 3FDZB 4L9WA 2RH5A 4EGCB 2HLDD 2UYHA 1E9EA 1KPGA 1PT5A 1TA4A 5F3DA 1JUDA 3LBAA 2VSFA 3DVAB 1ZN2A 4YO8A 5HYVA 1TU4A 2PA3A 4JDUA 4WCFB 2YZMA 2Q9AA 5MFZA 1D4FA 2OR3A 1UQUA 4LF5B 4HADA 4NOJA 3AEUA 1HE3A 2P5SA 5LKAA 4AAYA 5LQJA 3M49A 3IYLW 3SLKA 3BJIC 3T7TA 2IP1A 2PYZA 3DMNA 4UTVA 2QDKA 4NXMB 1I3NA 2NT3A 3NANA 4RIEA 4URWR 4CEIB 4KVAA 4JSTA 3O38A 2IW1A 5IT9A 3M81A 1QCYA 2F1IA 1VKOA 4D9JA 1F6DA 1WEHA 1IQPA 1X1EA 3GP3A 5EJ4A 2N3ZA 2WTBA 2PUFA 3DZIA 4KQMA 1SXGA 4ZVKA 1DBQA 3GFVA 3HADA 4QTXA 4ZAZA 5TMDA 3MWKA 3X1MA 4MLCA 4MW9A 3HJNA 1JHXA 3ZCXA 5C8YB 3WYAA 1MQSA 2B0CA 3G49A 1PN3A 1Q0UA 3QLVA 3AL2A 4UJ5A 4K9DA 4EG3A 3FM9A 3T7CA 4EB6A 3Q85A 3QJ5A 4GP9A 3RUCA 3FB4A 2JBWA 5JYCA 2WYOA 3O7MA 3TIGA 4X6XA 2HK9A 4KO3S 5SICE 3N8GA 3ZIUA 5JMOA 2Y1OA 4QQNA 2AX4A 1FS6A 3L9WA 3CZ4A 1JHDA 2GH1A 4TMTA 4QNNA 3A6EA 1TQ2A 5KEIA 3IEVA 3EEIA 3V2GA 4JVMA 4I66A 1R9JA 3EULA 2PZJA 1MW9X 4UHBA 5DHUA 5IJ9B 4HQOA 1IM5A 2HT1A 1JAZA 5AUPB 3ZHXA 5SZIA 4XASA 3G8AA 2X4LA 5EERA 4QTUB 2E18A 3MJSA 2Y0CA 4HDRA 3NGMA 2PT6A 2ADMA 3A3NA 3C3YA 3EX7C 1DTSA 1I32A 5D3ZA 3TW8B 3W34A 5B30A 4QICA 4R2MA 4ZU3A 1YHZA 3LZDA 3IEMA 1SQGA 4ER0A 2C7PA 1J7JA 4MVYA 4X3CA 2WB4A 5C8DA 1I7SB 4HRXA 2HMUA 1SBCA 1TRHA 2GDJA 1KYXA 4ARCA 3CZRA 4XYMA 5FF9A 1IEXA 2RGNA 4GHWA 1WUKS 1NJSA 2VHVA 3PTAA 4B84A 3KKNA 2I7CA 1YZNA 5LM3A 1ZM2A 2YYZA 2GD0A 3WK5A 3DFUA 3ZDRA 1L4MA 1B8OA 2BIFA 3IIEA 3A6ZA 2QPAA 4GO1A 3KUXA 4HDKA 5AXAA 3WL7A 2DFKB 1IY0A 4ZQCB 3ZTWA 1X14A 3V7FA 3ZHTA 3M1YA 5C7LO 1KYTA 1OYVA 3OPXA 4OM7A 3FMVA 5IM5A 3RYHB 5T67A 2C5FA 4BZWA 3T7RA 3BD8A 3O31A 1Y3CE 3LBYA 3AF1A 3W2EA 4HNVA 1PK8A 4KN9S 2IZOA 4NPAA 3JARA 4GGMX 5K2MA 5MFPA 3QV2A 1FU8A 2QJRA 2ATIA 2NU6A 4QULA 4U3JB 2EQBA 4LJ6A 1Y3AA 2YV5A 3VVLA 2WM3A 3E1KA 4JOQA 2PKCA 3TPCA 4OB7A 1UM9B 3VDQA 4EFLA 2OYSA 3ANYB 3NKLA 5U9CA 3RASA 3CY6A 5JFOA 1UF9A 2Z09A 3FHTA 2FPGB 1ND6A 2XCSB 2I5PO 5K0SA 3USCS 3R23A 4RKQA 3VX4A 1NQWA 4LEIA 2O19A 2VTDA 4KRXA 4LMPA 3MIZA 2OHJA 1GRQA 5FLKA 3GZ4A 1UWLA 2COUA 2HR1A 2FZ4A 1P77A 3DE2X 4ASUA 2E4UA 2VL7A 1CQJA 1ZC4A 3HFGA 2JJ2D 1B7GO 4AB1A 5I9BA 1GFZA 1XTBA 1ZAKA 1KYQA 1I4DD 1FU7A 2OORA 1QYDA 1W4ZA 1NJFA 4BVEA 2VDLB 3OFJA 3MGGA 3IP1A 3IXMA 5WRFA 5KOHA 4KR7A 1NC1A 1TC1A 2QAGC 3WKAA 4WLEA 1NVBA 5FR1A 3QKIA 4RK7A 3P2MA 1SG0A 1RLMA 3CVVA 4QAJA 1SOWA 3IAS6 3QVWA 5A6SA 1PJLA 4E5DA 4UTOA 1GNSA 2G70A 1J8QA 1XLTC 4TXNA 5AI5A 4DMCA 4EYOA 3OAAA 2GHTA 5E7IA 4E14A 2ZI5A 3ILYA 4A0QA 2REQA 4ZJPA 1MD9A 4ENVA 2IPOA 2NT4A 2R6HA 1XF9A 3DYBA 4QGBA 2R6FA 4O2AA 2VRNA 1VDMA 4ZI7B 3HNPA 1OFHA 1ZN9A 3LFUA 4C05A 3NH6A 1P5ZB 4X7RA 4ENUA 4DR2B 2XEXA 2W0SA 2EV9A 2VK8A 1QG2A 2Q2QA 4A23A 3PC3A 4Q4JA 1U3CA 1VGQA 1MABA 2BFNA 3T99A 2P9HA 1ESDA 4D4MA 1MB3A 3WNCA 1MC5A 3RJ9A 3SN6A 3ZHVA 3WAJA 5KJFA 3H17A 1QVWA 2CKMA 3MELA 1DAMA 2IQIA 4EPRA 4N7RA 1CD5A 2IYVA 2A1UA 4FDLA 4J0HA 1T9AA 3P7MA 3H11B 4FNOA 4L5JA 4ZPJA 1TU3A 3W8RA 1CYDA 2OXFA 4C4PA 4C7KA 3SOZA 3I5YA 1TCBA 4OH7A 2YJ4A 1JWLA 3HXQA 4Q3NA 1UPAA 3D43A 4YMGA 3K70B 1YGYA 2XLCA 3JQ7A 721PA 4RL6A 1CJKC 1V11B 3VR6H 4ON9A 1Y4SA 3CLKA 4C1NA 3UGJA 4HSGA 3CVYA 1O6FA 1YCFA 5KWSA 5LKRA 2NU9A 1BE6A 2VQFB 3D3JA 4WINA 3QE9Y 1GILA 1KI4A 4X7MA 3PC7A 1JKJB 1M1UA 1T6NA 2LKDA 3LSYA 4KSYA 4OKNA 1XXHB 5CURA 3OWOA 521PA 2NPFA 3D8HA 3ZHOA 3DHVA 3ZIAA 2WM8A 4EGAA 2POCA 1VLHA 2H1CA 3RYCA 4NCJA 1RXUA 1UFQA 3FDZA 3ISJA 1QANA 4M76B 3ETGA 4CI0B 4K0RA 4R1OA 2BGJA 3DVAA 1T1SA 2QT9A 4N6GA 4WCFA 1JYFA 1O5IA 3KT6A 4YWHA 5HZHA 1H0HA 1SUSA 4PNPA 1U9CA 3SNKA 2G1PA 2HD4A 3WFIA 2KPOA 4DMUB 4F4JA 4IDEA 4P7GA 3BWVA 1N6PA 1Z0SA 1HEIA 1JR3E 2OPBA 2BMAA 4INOA 5JAQA 5TMPA 2WSBA 5A5EA 2FP4A 2PVCA 4N8DA 3W1WA 3L4BA 4RSMA 3K0HA 4AIRA 5EY5B 1UMDB 3OICA 3CEHA 4FOSA 4WKBA 3SX2A 1QFYA 1TCCA 4P0TA 4DGSA 1PZFA 3ASYA 5EA2A 5GQSA 3URKA 1O0SA 1YJBA 4UUMA 1YR1A 3SF8B 3BCRA 1RJEA 1PS9A 3FETA 4RK1A 5D3KA 4Z0TA 3ZHQA 3PEWA 3D4IA 5C8YA 1WNTA 2G09A 2QR5A 4D97A 5FBQB 1S3FA 3DSRA 5ALNA 1PFUA 1DV1A 1YQWA 3ZWVA 4XCVA 2GEJA 4UM5A 1IG0A 1G8HA 4FGZA 2AK3A 1HNNA 3AJRA 3K9WA 4B6RA 3MLBA 3EUAA 3I2GA 4PZLA 2YWBA 3W8FA 5FI5A 1J39A 2HRQA 1DXQA 2EERA 2BW0A 3LTEA 2HPHA 3D7MA 5LUBA 1M2VB 2OC4A 2BDUA 1RRGA 4V3BA 4MITA 1FTQA 4W5QA 4N7MA 1JTEA 3PZRA 4NYIQ 2W4MA 4OJMX 3V7WA 3WIVA 5IJ9A 4V0KA 5DM4A 4ROSA 4JOSA 1IN1A 4MMYB 2VJAA 1GLGA 1P1BA 2CJWB 4EG1A 3PR1A 1P2BA 1DTEA 2HXGA 2SCUB 4WLVA 2JJ8A 3TW8A 1YQ9A 4Q24A 5T5QA 2V59A 3AETB 3RTBA 1HURA 4LCJA 5ALGA 4QD3A 3AX6A 2DHRA 4EZBA 4Q1CA 2PL1A 1FRNA 1LSSA 3H9GA 3KJQA 4WJKB 4BMYA 4B5KA 1CVIA 5EJ9A 3S6JA 121PA 1KK3A 5EUBA 2ETVA 2RJNA 1E69A 3L7YA 3IOCA 2C57A 2EX0A 2OMEA 4GSKA 1EFTA 5CM8B 1ZO8A 4XIFA 4GWKA 2FPUA 1I36A 1S3GA 1T6YA 2W0MA 4GXNA 5KZMB 2RK4A 5LP6B 2PKQO 2YOFA 3SYKA 5J3JA 3PGXA 1Y89A 3JR7A 2I65A 3FX2A 1SUIA 2DPXA 1RMYA 2AOVA 1IHOA 2PQ0A 5AVYA 2YJTD 1F38A 3SX0A 5CBPB 3RYHA 1DUIA 3AH8A 2M6SA 4NESA 1WXGA 5IZCA 1Y6GA 1O9HA 1R0XA 1MEJA 3V4OA 4YYZA 1R8YA 4IGEA 5FEMA 2M32A 4DEVA 1MHPA 1FNCA 1XC7A 1E8MA 1E79D 1WIWA 2W2MA 2OLKA 1XUOA 4O63O 5K3OA 1OA1A 4H7KA 2NXJA 4U3JA 2RHJA 3KP1A 1ODCA 3HVKA 4MPPA 1UM9A 2WUGA 3A31A 5AW2A 3LW7A 3K5PA 4AY5A 1AB6A 4DN6A 4IMRA 4Q9AA 2FPGA 2NTYC 4MQLA 2WEKA 4RETA 3LX6A 1LQTA 3EW7A 3EXG1 3L7CA 3WB2A 2AG0A 4IDDA 2PMCA 2I1WA 5IASA 2FKNA 4DGQA 4G5SA 5HOQA 4LWOA 5H70A 3ACCA 5F9MA 1K4MA 3TQQA 2NO9A 3FDIA 2QN7A 4HBGA 3NHJA 5BWOA 2IZ6A 1B6TA 4O29A 3OECA 5KSYA 2OENG 4EJ0A 5L6LB 1LPOA 1POXA 2JFBA 2RHMA 1SO8A 3K0AB 4FB5A 1PFGA 1XCLA 1IAVA 1ULAA 2IHUA 1GAWA 4L8WB 3I9V6 5ADWA 1NVTA 3G0DA 3G8BA 1QGUB 3GOHA 4G9GA 2J3JA 1N4DA 5F3RA 5FOVA 3TGWA 1EQUA 4PPGA 1L8AA 1KL7A 1HFJA 2E89A 1NVMB 2XBUA 3LK6A 1ZEJA 3B1ZA 5A5FA 3NAZA 4LHXA 3ZU5A 3V4VB 3S2FA 1YIOA 3WGQA 1DCTA 4GOJA 3BHNA 3AR8A 2WJIA 3DVRX 4I4TF 5JSHA 2CHUA 2K4MA 4KITB 5CX1B 2K2WA 4X7PA 2D7DA 1CPYA 1MNAA 3N2KB 5IDYA 4BNJA 4BFCA 3ZWYA 5DZSA 4KR9A 1REQB 5BV0A 2FSHA 2QTAA 4NOMA 4FMDF 4WEOA 2XTAA 3SQMA 2IY9A 1TM4E 1EB9A 1G98A 4ML3A 2Q3CA 5HJEA 2ZYWX 2GF9A 2YCLA 3NRJA 1Y48E 5LXTF 3KLNA