2I22A

Crystal structure of escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
192
structure length
179
Chain Sequence
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDNDIFSRYVEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIHILIQLIEKEMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Sedoheptulose-7-phosphate Isomerase, a Critical Enzyme for Lipopolysaccharide Biosynthesis and a Target for Antibiotic Adjuvants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords Phosphoheptose isomerase
total genus 67
structure length 179
sequence length 192
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2i22A00
5BY2A 3FKJA 1VI6A 1MOSA 2I2WA 4JI4B 3LJKA 1IATA 4M0DA 4K0KB 4YY3B 1MOQA 2Q8NA 2ZJ3A 1DQRA 1X9IA 1IBKB 4GKJB 3KNZA 2UXDB 4DR2B 4LF6B 2UUAB 1HM5A 1VI5A 1X92A 2CXRA 2V4MA 2X3YA 1XNQB 4IVNA 3ETNA 4JI0B 4S1WA 4JV5B 3T1YB 4B3SB 1M3SA 3Q7IA 4DV1B 1JLHA 3T1HB 1HR0B 3I0ZA 4DV2B 1Q50A 4JI3B 4JYAB 4S12A 5A2QA 1NRIA 1HNWB 2PGIA 4OX9B 4LF9B 1X94A 3HJBA 2PUVA 2UUCB 1N33B 5IWAB 1N34B 4NXMB 3TRJA 4TOIA 4JI5B 2UUBB 1N32B 3FJ1A 2POCA 2ZJ4A 1I94B 3J7AC 3CVJA 2DECA 3C3JA 1TZCA 2O2CA 4DV0B 5LL6P 2YVAA 4B3RB 2VF4X 1HOXA 3JAMA 2PUTA 4GKKB 3UJHA 5LMNB 4DR3B 5LMUB 1XTBA 4B3TB 4LFBB 2HHHB 2AMLA 1WIWA 4DUYB 2CVPA 1U0EA 1FJGB 4LZJA 2CXOA 1XMQB 4LF4B 4LF5B 4LF8B 1KOJA 2CXUA 1G98A 1C7RA 2E5FA 4LFCB 2WU8A 4X65B 3FXAA 2DF8A 3PR3A 1B0ZA 1HNZB 4X62B 3OTOB 2XHZA 1IBMB 1N8TA 2VF5X 3JX9A 4DV7B 1J5EB 3Q88A 3QKIA 3BCHA 5I01A 4DV3B 2UXCB 1U0FA 3G68A 1XNRB 2UXBB 1N36B 2O2DA 2E5LB 1U0GA 2A3NA 4DV5B 1T10A 4AQYB 2PUWA 1VIVA 4LF7B 3IFSA 2CXNA 3OOJA 1GZVA 1TZBA 5FLXA 2J6HA 1IBLB 3BJZA 3TBFA 4DR7B 2F4VB 4B3MB 2CXTA 4JI2B 4KHPB 2ZM6B 3EUAA 1C7QA 3ODPA 2CXSA 2CXPA 1J5XA 3HBAA 4JI1B 4NXNB 1JXAA 1MORA 1ZZGA 2I22A 4DV6B 4DV4B 4DR6B 4JI8B 3J80A 3J81A 1VIMA 5IT9A 4LFAB 1XMOB 5BR8B 3FF1A 1JIQA 1NUHA 4JI6B 4DR4B 2CXQA 4YHHB 4X66B 3M5PA 3NBUA 2VQEB 4DR5B 2CB0A 2XBLA 4AMVA 2UU9B 4U6NA 4DUZB 4X64B 1JEOA 3SHOA 1GZDA 1X9HA 1IRIA 4EM6A 1TK9A 2VQFB 4DR1B 1HNXB 4JI7B
chains in the Genus database with same CATH superfamily
2AOVA 3FPCA 3R3ZA 5BY2A 1QRSA 1UR5A 1YWGO 3GUHA 3K8OE 2O8BB 1GCIA 2KE5A 3K35A 4PPYA 4R01A 1T5LA 1U8ZA 2EJTA 3MS7A 3HFRA 4IFTA 1FRNA 1T9AA 2WTBA 4ZZ3A 5BMVB 1N0VC 1JECA 1ILWA 4KAFA 1M1NB 2JBWA 2OTCA 1XZ8A 3KD2A 3TDNA 4C6TA 3A14A 5E7MA 1KXZA 2KQUA 4DM3A 2ISCA 1RPZA 1LWNA 2NNLD 2PT9A 2WM2A 3Q85A 4FOTA 4I4LA 3V55A 3NLLA 4DLLA 3F1LA 1ARZA 3DB2A 1YDHA 4HFRA 4A5OA 2I8LA 4D6PA 3RC3A 1GZ5A 1XNHA 3R40A 5JQWA 1C9YA 1I2ZA 2OENG 1NE2A 2AGVA 3FPKA 5LZ9A 4PO9A 4XRRA 4WKNA 3RSLA 4G0MA 1CUFA 2IYZA 1KR2A 1HNWB 4MYTA 5L9AA 3HPQA 3DDOA 1ZMRA 5F7ZA 2G77B 4N6OA 4A0FA 3RKUA 4RADA 3UGQA 3OZCA 4RD6A 4NEGA 1D07A 1NVFA 4P36A 2QS9A 4L5JA 4UUNA 4AF8A 4ARUA 5HWSA 2QLLA 3QYAA 1XZPA 5B1SA 3KJZA 1XJQA 5H7XA 4BU1A 4AQ7A 5KVSA 4IGEA 2PR7A 2QPAA 5EXTA 1A98A 5IU6A 1UMBB 1AB5A 1ULBA 4JKYA 4MA5A 4B09A 2VRNA 3ZHVA 4B0OA 2ZUWA 3DZJA 3CV3A 3FMGA 2IYAA 2AMLA 5CT6A 5EFOA 1AHNA 2HFKA 2HCFA 1C7IA 3BAZA 4M83A 4LGVA 4LY3A 5AKYA 4EITA 2O4UX 3MSXA 4H6XA 2H92A 3RQSA 3HWX1 1JDTA 3NHKA 4FMBB 1QJCA 4J4BA 4EZEA 1UT5A 3HRKA 4IX1A 4UM9D 3GP3A 3A2NA 2O20A 2QOEA 2RHRA 4R4JA 4W63A 2WUDA 4FKMA 4G37A 4TYQA 1P81A 3FBTA 3SXUB 2AH5A 4MVCA 5CCEA 2PCLA 1KI4A 5KS2A 2UXCB 1J7JA 1C3OA 3U7FB 1RPJA 1AUOA 1JZTA 1VIDA 2F1IA 4BRWA 4CF7A 1T8WA 1IUPA 4E6EA 2C7RA 3B6ZA 2DOKA 2B3TA 2EHJA 2J0VA 2VNSA 2I87A 3E05A 3IBSA 3JPWA 4WH0A 4BNMA 1OLXA 2Q8QA 3BWVA 3QFHA 2PUWA 3ILYA 4PS0A 3UPTA 3NMUF 1S6YA 3TLMA 1VRVA 1YBVA 3OPYB 1XXHE 3BZUA 2H1HA 3RQIA 3BDAA 3ZNQA 5ARDA 1OU0A 2QN3A 2BMDA 3TGPA 2C5BA 4I2NA 5EMMA 3BFPA 2XWSA 3INYA 1TMOA 4YRTA 5GMOA 2BGUA 4J1SA 4IINA 4WACA 1VXRA 4FUTA 2BFNA 4YV0A 1JU4A 4DF3A 1N77A 3PSAA 1R5OA 7MDHA 2O2YA 3VYSB 1IXKA 1MCZA 2ZRKA 6PFKA 1RD4A 4M0CA 2DCMA 2E55A 3MOIA 1UBJS 1YIAA 3TOVA 1XCPA 1VG9B 3PFBA 5LDHA 1Y8RB 3M5PA 1TI7A 1O89A 1O87A 4QXAA 3M4XA 1CR2A 5DTRA 1Y1KE 3RRMA 1U2PA 4ETNA 1VJ1A 1G7RA 3QLUC 4ZCLA 4DJ5X 4ZCSA 5PNTA 1UT6A 3BULA 1AUVA 1U2EA 1AHIA 4JLWA 5EQDA 1YONA 4XB1A 1IB6A 1C81A 1Q21A 2QGFA 2W00A 1MX5A 2HF7A 2V7GA 2YMPA 4HFNA 4XCVA 2RH5A 4QM6A 1CUZA 4KAXA 4E12A 2QL5A 1IDN1 2P7IA 3DC2A 3L49A 5KTNA 1TFUA 2OBLA 1N6HA 2IE8A 5JANA 2F1OA 3E7PA 4XPIA 3EPKA 3LPNA 1ANKA 4QODA 5LLDA 2VQDA 3LH5A 3QTLA 1GU7A 4MVJI 4ESVA 1BMFA 2H3HA 3IIKA 4E11A 2AKEA 4M9ZA 1KF0A 4PGMA 4OQYA 2EEZA 2X3YA 3PJDA 3CWQA 2FF5A 2Y68A 3QLVA 4DCPA 3T5PA 3TSWA 4EELA 1WHTA 5AH0A 3NHYA 3W3AH 4ZI7F 2ZWOA 4Y3UA 3RVOA 3FFTA 3OA2A 1QUFA 1RZRD 5AXDA 3T3HA 1CWUA 5IH7A 2ACWA 3JZAA 2J41A 1NRIA 1K7FB 2ZRNA 2JLAA 3CEPB 2XD9A 3S4YA 4EZIA 1I0ZA 3ORYA 2C5AA 2Y1CA 1DC6A 1KU0A 1L3CA 4OHCA 5C5CA 2VJCA 3DVLA 1F14A 2P2YA 2PGLA 3KZVA 3FFAA 3ZHOA 2ZUEA 1JIVA 1XVTA 2ZK7A 4MKGA 4OTZA 1KWGA 4HPXB 2SKDA 2OBFA 3WWYA 2NZXA 2OV8A 4UMFA 1VHWA 2RHHA 1GVNB 2BSXA 4KQMA 5B1HA 1Q84A 3IP6A 3MB5A 3S81A 4TL9A 2IOQA 2X8JB 1RFGE 2QXTA 1H2BA 1JG7A 3TAXA 2KYRA 3MCWA 5GWXA 2HK9A 3JVDA 2W4QA 4CTOA 3AUKA 2VTDA 2WLSA 3AUTA 4URFA 3TNDA 3RFVA 3FSEA 5HW0A 3M81A 4TVBA 2BCJQ 4L7VA 4TMZA 4RXTA 1Y9ZA 4DLVA 5JQGA 2QW1A 1L8LA 1SGWA 3IP5A 1GNQA 2IL1A 4REQB 1NVWQ 1YUNA 2V6IA 1U3CA 4G1MB 3SHFA 1P19A 5HUHA 1IEWA 1P0CA 3KKPA 4A8JA 4L95C 4HXEB 3C6KA 2O3QA 2FE1A 5C37A 4MTLA 4UD6A 4PLFA 5EIBC 3SS9X 1BS1A 3IUMA 3RVPA 3NHFA 3GLGB 3TLBA 1L7AA 4LHWA 3SZMA 3ANXA 3W90A 4MKIA 3HVUA 4W8GA 2Z4TA 2WSLA 1DAEA 3UYKA 4IVPA 4C87A 4LZNA 1TAQA 1V9SA 2J6BA 4BKPA 1J9EA 2IFTA 3A2MA 4R40A 5FOTA 1II9A 4F4DA 2Q2WA 2QJOA 3NFYA 1JDUA 3R0XA 4YV2A 5HIKA 4LE1A 4UTVA 1W4CA 1JHXA 1V6CA 1KYWA 2D59A 1D6NA 2ZANA 1WPGA 3N28A 3ZV4A 2B9EA 1OIVA 4ZT2A 1B8PA 5I7VA 2Z5LA 1ADGA 1CT9A 4EG8A 1ZJZA 3DOFA 2WJWA 1OA1A 3AXTA 2PD3A 2EX1A 4ZK6A 1DEOA 3WYAA 1ORDA 5E6SA 5KC8A 5LMCA 3RTEA 3BG5A 3NU1A 3PPWA 1NA5A 1O6FA 2C9ZA 2QRVA 2XBLA 2ZSAA 2Z6AA 4H7PA 4UZFA 3F6PA 3G8CA 3SI7A 1KQPA 2VDWB 2F6RA 3TS1A 5F9HA 4M22A 4YXWA 1CUSA 4DMKA 2IF0A 3WZMA 5EJGA 1X14A 3MVEA 1V8DA 3C6YA 4RENA 4CJXA 1I1QB 4LIPD 4OFBA 5D5PA 2IY8A 5A3VA 3E7DA 3DD5A 4FNAA 5JMTA 2HA5A 3N8KA 4INZA 1NJ2A 1ODFA 2IDKA 1TRKA 5FOSA 1B6RA 1NJ8A 1RLIA 3GJXC 2I6FA 5H0IA 1D1QA 3HDTA 1RWMA 3PHLA 3QWIA 2FLKA 3NONA 1KJJA 1P75A 1UEJA 2OCDA 3CSSA 1WZEA 4MLDA 4BNWA 1I01A 4J1QA 4LXHA 1Q92A 2JB9A 4JEIA 4MAMA 2WJIA 1EDZA 3H42B 4OYHA 3S2FA 1DJPA 4RSRA 1WB6A 4B9EA 1XV5A 2CVQA 1R0CA 821PA 2XVYA 2F1HA 3CRQA 3EQ2A 4WZZA 5BXYA 4XFDA 4BZQA 3HZZA 2VDOB 1BWQA 2I9PA 1N2HA 3MGBA 3DQPA 4LZPA 5TDHA 1PYOA 1QHYA 2IHVA 4PBSA 4XD7A 2WVAA 1PS0A 4R1OA 3C6QA 3DFMA 3TRJA 3MWJA 3LA6A 2FRDC 4NFLA 1M8KA 3H75A 2G88A 1QHXA 3UXHA 1Z4QA 3GG2A 2PSDA 4C21A 1XP5A 4Y8VA 2ZPUA 3C1UA 2VF4X 3ZV6A 5BN5A 1Z63A 5A6SB 4IQFA 2XTZA 3O4RA 4B3TB 4H3KB 1L5HB 4TVKA 3TZCA 3K73O 4I36A 1AN9A 4KCGA 4M9XA 3D6HA 3GFOA 2AG1A 5K3FA 2XAAA 4I1PA 1JR3E 1YGYA 5HNKA 3KKOA 4KMRA 1QVRA 4QU8A 1T15A 3KYCB 3ZCTA 2QHXA 4GAEA 5FAXA 2GN2A 4Q34A 2B7CA 1UDBA 3D3QA 2O5VA 1C3XA 2FFAA 5C7OO 4NENA 4QGAA 4GPAA 3WGUA 1VPTA 3KV1A 4DUPA 6AT1A 4IOMA 5J47A 3NGMA 3TRDA 4HXGA 4BNTA 4YRSA 2OLKA 4C4SA 1DAIA 5C8YF 1J4AA 4QFDA 4D56A 1NX9A 3HADA 3IBYA 2QRMA 2EW8A 4DVGA 1J0EA 2VHUA 5JSZB 4UBLA 5JYBA 2WWVD 1JHAA 4CW7A 1V1MA 2UYQA 4B3XA 4RFSA 3BTOA 5FLEX 1FDIA 1NMXA 3AG5A 4PLYA 1OGIA 2RC5A 2CKDA 2TMGA 2VJKA 3EVZA 1MIOA 1A27A 1IZYA 3ELBA 4Y6OA 3S8MA 5FLXA 3R23A 4WKCA 2HA3A 3HCFA 2HXGA 1PQ4A 2XGMA 3NIWA 4Y2GA 3FOZA 5ITZB 4BE7B 2EJWA 4G9GA 5IYZA 1N8SA 3FOEC 1YQGA 2BGKA 1DDGA 3SYKA 2O6LA 3DLPX 2I6XA 4F86A 4CM3A 4Y6LA 5CB4A 2AE1A 5AVSA 1L7PA 1Z6PA 2PO5A 3R6WA 3TLEA 1GILA 1ABEA 5ILQA 3E9CA 5KYUA 1FFEA 2R00A 4DCSA 1OR8A 1U5AA 1E1CA 2VQEB 3BXZA 3RRYA 4DREA 5IP5A 5JBNA 2DUMA 4CMEC 5DNWA 4ZZ0A 1L1FA 5B64A 3TX6A 2QT9A 2GN4A 3EDQA 3DZ8A 3O0TA 4KE8A 4K9DA 4OQQA 7GPBA 4LYJA 1M0SA 1QIDA 4ZYYA 3IOEA 1DEAA 5EMNA 1KDVA 5ARBA 1B8NA 4FP9A 1OWLA 1RRGA 4JLKA 5C81A 2X42A 2EZ9A 4NBRA 4JLDA 4HEA1 3GHYA 1TAUA 1VI6A 3RU9A 2YJGA 2ADMA 3I6YA 2FGJA 2IYWA 4XJSA 4O2AB 4LYAA 4X63A 1SVLA 2IHNA 1RCUA 5C7IO 2HLDA 1CJBA 4LF6B 4RGBA 3VC1A 5H16A 2J45A 4ZEMA 2IPMA 1KEUA 2YC2C 3LQ1A 4ANFA 3HXMA 2YY5A 1AF7A 3PUHA 4HAXA 2PRJA 4Q48A 2E4XA 2ZUTA 2VFAA 2B4YA 3O9VA 3OQMA 3K32A 4M86A 1CULC 1Z5WA 4PHFA 3KTAA 2X6TA 1JX6A 4FZ3A 3RSHA 6CHYA 3QE4A 2VYNA 4UTPA 1Z4OA 2XNKA 1D2NA 3JCZA 4LJSA 4KV7A 1TMKA 5KX5B 1T3HA 1TKAA 2JHGA 2QMUA 1N5JA 2H31A 1H1TA 2ZYRA 3CSUA 3FRJA 3PUWA 2QD5A 4JASB 4ED9A 2QD4A 3G0BA 4DMFA 1QU3A 3SR4A 1DKOA 4WJLA 5CDHA 3A8TA 4R8SA 5NULA 1UJ2A 1Q7EA 3LUPA 3AHCA 1NUPA 3DLTA 3L7DA 5L6MB 3KR0A 1CEEA 2BBSA 4LDNA 1V25A 3I04M 4PICA 1G5HA 2FI1A 1S2IA 3LQFA 4CLXA 1V8OA 1XVUA 1IN6A 1HEIA 1A5BB 3WYDA 1D6JA 1DPGA 3N58A 1IHDA 1I2BA 1YZQA 2X9QA 1Z18A 3ICPA 1P2VA 4LZZA 2ZM5A 3KLOA 2O2JA 4XUCA 1K97A 2WWGA 2LDBA 3WS7A 1UJ6A 3NBAA 4C43A 1G9XA 1JL3A 2HK8A 1A0OA 2JHCA 4WLNA 3S40A 3LZ6A 1QLJA 2EBWA 4ZODA 3TH5A 4DDKA 3VR5D 3KKZA 4X8HA 5JCXA 1C8KA 1KH3A 3S28A 1GCUA 1S9DA 5JNTA 2COKA 5MF6A 2HNAA 4MTCA 3AVQA 5E9QA 1CJTC 4ZAWA 3W0LB 3MILA 3L1UA 3O75A 2QRZA 4P38A 4DCVA 4KE6A 2I7XA 2H1IA 1THZA 5CIYA 1IJBA 5LQJA 2UXBB 1UBKS 1JZQA 3WKAA 3ZJTA 1WEKA 1E6MA 4OOEA 3ZEIA 5DV9A 4AJ1A 3DE1X 2VZ9A 1T10A 4Q18A 4DT1B 2HQOA 3LP6A 1HX7A 3CUVA 3TD6A 1RKXA 3IEXA 4OGWA 3ZI7A 4MVJE 1X1CA 1QHIA 2OV1A 1HT0A 3C1AA 5C8YA 3WYFA 4EH1A 2BKAA 2AN1A 2BKXA 4CF5A 1R00A 5EZSA 4KHPB 5AKGA 4DMHA 1ZIPA 5JZVA 2CXPA 4UNQA 1POXA 1RQ7A 3HUTA 1QIKA 2Y92A 4BNNA 1WUJS 1QKIA 1ISIA 4W6ZA 1G8YA 1GUYA 1OREA 3AH8A 3ZKWB 3A06A 2WIDA 3QFTA 3OF2A 1G60A 1ZINA 2R5FA 3TSZA 3VAZA 4C0KA 4XDYA 2I2XB 1CEQA 2JGJA 4CKZA 1TNDA 5I7HA 2OV4A 1CZKA 4HF7A 4PZAA 1V4VA 1YAHA 3K71B 3WV4A 1XDBA 1Z68A 1U5CA 4H1VA 5G41A 4EVSA 3FNIA 2F8SA 2H16A 3BCSA 1VYTA 4ZRMA 3VPBA 2Q49A 5DULA 2AJLI 2VTKA 3CBGA 4L4YA 4TUYA 2CLSA 5J5AA 3L93A 4HUTA 2GZHA 1DEHA 1DEKA 2OAGA 3SZUA 3PXGA 1SRRA 2NSHA 2EKPA 3EQ6A 1CIVA 1JPUA 2C88A 2X6RA 4KX5A 4XRGA 4Z7QB 1KEKA 1PL6A 2HT1A 1FSFA 3RV4A 5TRTA 1JZSA 3LYAA 3VR1A 4XUGB 4BJ1A 1PZGA 4CR7A 1W1WA 4GKJB 3QW4B 5GJWC 2OO5A 3OM1A 1EWQA 4EMTA 4TSFD 3T3GA 3ZU6A 4GMKA 1KDRA 4ZV9A 4OH7A 4KDRA 3R7NA 2X8WA 3VZRA 3DHYA 1UJMA 1UFRA 3PXDA 5SY6A 4QRIA 2AJTA 4JI3B 5I45A 4QIHA 1P9NA 2QN7A 4KLAA 2I99A 3FPFA 1Z5VA 4Q7QA 4F97A 3V7UA 3VPCA 2H59A 5JPDA 1N33B 4ZU1X 2XW6A 4TVOA 4L4UA 1S7CA 3LBNA 4JHXA 5MN6A 1DAOA 3VU1A 4RK1A 1P29A 4MNTA 4XWYA 3WICA 1SD1A 3U0BA 4IR7A 1M5TA 4Y2JA 1MIOB 3W5HA 1SIOA 3QSYA 3Q72A 3MINA 1E79A 2W98A 4FBLA 3IO3A 1GCGA 3P5BA 4TV9A 2CFTA 4G9EA 2C77A 1NN3A 2Q5FA 4JZKA 4OKNA 421PA 1E2UA 2YCLA 2XODA 4U7DA 4O3MA 1Q12A 2GCOB 3F4BA 3KB2A 3KJIA 3UJDA 2WB2A 3BMCA 2GF2A 3KXDA 3LUAA 4KPUA 4R0NA 5GGYA 1V6SA 4EYOA 1W36C 4Y2UA 3QQ5A 5DHPA 2H9YA 1O9GA 4IWXA 2PGDA 3AZPA 2VDQB 4HFJA 4WVFA 3FNFA 1F0YA 2HBZA 3DFIA 1QGDA 4RVOA 3LWNA 4C0AC 4G8BA 3CWZA 3DMFA 2W6JD 4REMA 4GP6A 4XASA 1DBSA 4C2TA 3SQDA 5B2ZA 1U2ZA 1QCCA 3H11B 1NPYA 1XU7A 2IBTA 4NOJA 2V5AA 3B6KA 1ZOIA 3FTCA 3KIPA 3MAGA 3MQ2A 4OP3A 5FV7A 3V2IA 1KP2A 4C4XA 3DCNA 2I78A 2FR8A 3RR2A 4S1OA 4WZAE 4P7KA 4BZXA 4AQYB 1A9XB 4W1SA 3SQWA 2HREA 2NUAB 4GH5A 4KUEA 2QTCA 3S2GA 2NUTA 3WK9A 1GNTA 4G6ZA 2HADA 5CJJA 3TFOA 4XEHA 1W76A 2CJWA 4PSCA 1G42A 3QUSA 4CT0A 3OECA 3V1KA 3LOPA 3PPVA 3H2SA 4PRLA 3TO5A 4RKEA 3GDGA 3FLBA 1LJLA 1I30A 4CEHA 3QPAA 2QW8A 1D4AA 4NBUA 4WLEA 1AV6A 1PJCA 2ACVA 2VBFA 3FHTA 1UMDB 4B31A 1OFUX 2AC2A 3C3YA 3L7YA 4JXZA 1G6KA 1DKUA 1P17A 4K81B 3T38A 2BGGA 4IHJB 3GEMA 3JQ8A 3WNBA 3T35A 1JQEA 2CCJA 3WLQA 1FFGA 2JPDA 3GRUA 5BQXA 4Z8YA 3T9DA 3PRKE 3OQNA 1Z25A 2ZI9A 2P78A 1TIBA 1UINA 1SCAA 3QUTA 4Q9AA 5JISA 1UF9A 2ZSJA 1EVJA 3AHEA 4R9NA 3SU8A 3S68A 3HCNA 2PANA 4DEVA 2OZPA 1F6BA 3DUWA 4H7HA 2RHTA 3CVUA 1YNSA 4I1OA 3RYIB 2FPMA 1GG8A 1MFPA 1H2HA 3SP1A 3TMYA 4CUJA 4J7UA 4XA8A 3JQGA 1TZ2A 3C48A 4RTSA 4MR7B 1CIJA 1VI5A 2HYDA 4I1RA 4EHIA 1ZU5A 1YRLA 2YJTD 3WV5A 3WLFA 3V00A 3S44A 1D2CA 3ZYCA 4HGYA 2YOGA 4EVRA 5AVTA 1KEWA 3D6UA 1L6IA 3LO5A 4ENWA 3D3EA 2CYCA 5HS4A 4TXNA 4I5DA 2I33A 2DKOA 2XGJA 2CXXA 3PQFA 1ISFA 4QT0A 4V0ME 3G1UA 4S12A 4AG6A 4BVGA 3E2IA 4LBVA 1Y8RA 4D26A 1E3TA 1A50B 1BMTA 2PGAA 2IPAB 1T6XA 1SCBA 2WIGA 1DIHA 5EWJA 3TF5A 2F9MA 3C5WP 3PC6A 4GEKA 3W5JA 4B6GA 3QOWA 1COZA 1QVWA 1XN4A 4MVYA 4Q7EA 4JI5B 4CIYA 1SH7A 5JJBA 1W581 2XGOA 2P6OA 4MMYB 4P22A 4YAGA 2V55B 2J9RA 3L8MA 5JOQA 5AI8A 1OD6A 1YVPA 1O6BA 1W85B 2ONCA 4V0OA 4WEQA 3NVMB 4XX1A 4B3BA 1TFRA 2YUIA 1D7AA 1ID8A 1B8VA 2D2EA 3EDYA 1NW7A 2B8WA 4BYMA 5ICCA 3NDBB 1NDHA 1RADA 3DXFA 3K2QA 4O4HA 5T7BA 4R8MA 3C3BA 4P5PA 5IASA 3WGOA 2W22A 4PGHA 5M04A 1P4RA 1YJBA 3Q7PA 1KARA 2X0IA 4K6MA 1FLDA 1KMQA 1Z7EA 4WZBA 2FZKA 2IWHA 1YFZA 2XMRA 4JL8A 4BTLA 4HZUA 2HLDD 2OFPA 3IEIA 2XF8A 1MQSA 2FFQA 5BSRA 1LS6A 3COJA 1NSFA 1IXSB 1F2UB 3NXSA 3G5UA 3FROA 3LT5A 5AK5A 3T52A 2H11A 3E70C 2FEWB 4K2AA 3EG5A 2XZOA 4PSKA 1KIFA 2QX6A 3L6OO 2GDZA 1XDUA 3CN7A 2I3GA 4D9MA 4HGRA 4P4GA 1DDIA 2EARA 3M3DA 2PR2A 2BN4A 1Y1LA 2H51A 3CWCA 2O0HA 4EA8A 3NHZA 5A03A 1U1DA 3JZMA 4N49A 3JQQA 4QTXA 3U7RA 5L6LB 1VMKA 1NVMB 1LRKA 2BEKA 2A1UA 1L4GA 3HI6A 1RLTA 1IZ9A 2Z57A 1BHO1 4FI3F 4GI1A 3X3HA 1DMSA 1QGUA 1TX4B 4DLTA 1P2SA 1V41E 1YVEI 2J3QA 1OILA 5EXPA 5B55A 4IAOA 4JBGA 4ZHSA 3R5SA 3MRVA 2HUNA 4G5HA 2JFFA 3ICWA 4N3BA 1MA0A 4Q12A 3TNJA 1OXUA 3C2QA 5DHQA 5EN4A 1LBIA 3E1SA 4EECA 3UW3A 4EL5A 2EERA 3PUJA 4QOSA 4UNSA 3WKDA 4BZPA 3L6CA 3OZBA 1R64A 3L41A 5IAGA 3GLGE 2E4ZA 4P9NA 5JJ5A 2P3QA 3EQ9A 4NEQA 4KL8S 4YROA 5JBIA 4RPLA 3P52A 4E5SA 5FUQA 1A04A 4JJIA 4ND3A 3PZRA 4P31A 2FAXA 2D0PB 5JZOA 1X7XA 3U7GA 1HFEL 1QYIA 4X6YA 2ZBPA 1NZJA 2ZXUA 2BHSA 4R2IA 5HCNA 2WD8A 4DCTA 3QRWA 1R9NA 4EJSB 5HM6A 1P0PA 1UBEA 1T36A 3H3JA 3O90A 2HCJB 4I50F 4CV0A 4D5EA 3DHEA 5A06A 1U1FA 3GJ8A 3DM9B 2FPPA 2CUNA 1OLUB 4NP6A 2B7BA 2LIPA 1NR7A 4KI0A 1NTRA 4EY3A 4MUEA 1ZYUA 3NIGB 4Q9DA 2WF6A 1CB0A 3OPYI 3ZK9A 4IV8A 4EAQA 1NQ5A 2ZJ8A 2OR3A 1JDPA 2J5RA 3KC2A 1RXUA 3LFTA 3LSTA 4KIGA 5B3JA 1F7UA 2WWIA 1CUIA 1WVGA 3DP9A 1GPNA 4NAUA 2O14A 4CQLB 2F4NA 4FK8A 4UUPA 4HLQB 4B34A 2G7ZA 5TMPA 3GLIB 3D6JA 4BLVA 5AW3A 1SU7A 4KV9A 1Q83A 2UUBB 4JQCA 4HWPA 1KK1A 2A0FA 2AFIE 1Z35A 3N3BC 1ZGJA 2CBGA 3BQNB 1NX6A 3OKCA 1N5IA 1GZUA 4MW0A 1U7WA 1UCFA 4RV4A 5ELXA 1EPUA 1J2UA 3CRW1 3HHEA 4D80A 1QP0A 1A82A 2ZROA 3QUAA 1S0UA 3ACDA 1QIHA 2AEMA 3ONVA 1KVSA 4MX8A 5C4GB 3WMFA 3ZQKA 4ZCPA 4NKRA 3ZVRA 4BC1A 2XMQA 4KBYA 5AP9A 2HK6A 2NVUA 1KQ3A 2EGGA 3NALA 4GZ3A 2XT9A 2FR8C 4LPSA 4EMBA 5D2CA 1J1IA 2X9GA 1MVNA 2GSDA 3T7JA 4AUMA 2QBYA 1ZVJA 3Q3HA 3BXFA 2DFVA 2J4FA 2YBEA 1R6UA 2OC9A 2PMKA 4M7PA 3IUSA 2QXYA 1UOQA 1PV1A 3FNEA 5IRCD 2INGX 4I8DA 4JP1A 3O92A 3S1AB 4RDIA 4FWTA 3DONA 1FYXA 4BB0A 3T12A 1Y1SA 1LWOA 2J5QA 4JYPA 4IGKA 5EKUA 4EW6A 2O7SA 2XSZD 4B0PA 2B1JA 4R1SA 2A0XA 3RF7A 2VAVA 2WVHA 2WPNA 4KK4A 4CI0B 3JR7A 3EBOA 4ENSA 3F7TA 1M6VA 1RLJA 2JLCA 1CUUA 1U9JA 3AJ8A 1RPNA 3HABA 2VOJA 3NORA 1BD4A 3ADOA 4BBPA 5FOWA 1OC4A 2OQRA 4A03A 3KKLA 2X8LA 4AVYA 1WZNA 5LJLA 2IXFA 1H8HA 2H4JA 3HKCA 1ECFA 5IARA 1JNXX 4OB6A 1C9KA 5DIFA 4DR4B 1E7MA 2QX8A 3PK0A 2V58A 2VP3A 4HNSA 4WXPA 1HI9A 2G09A 3EEYA 3M6LA 5DBEX 5I7SA 2I8CA 3CNLA 4TT3D 1WCIB 4RPCA 4JEHA 2VAMA 3I6BA 4ZOBA 3EA5A 1GV1A 1L0BA 4FS8A 4HNTA 1VE7A 3L1IA 3OFJA 5DH9A 5DHUA 5KJ6A 2BJHA 2GN0A 1DAKA 2CJWB 3VZSA 3K70C 1F0PA 4BVFA 3NBZC 1IM2A 2EJBA 2GARA 4RDCA 3W06A 4H4DA 3CLVA 3GBVA 4O3FA 4W7HA 1G1MA 3TQRA 2EAUA 2BF4A 2XITA 1QHGA 4Z54A 1C1DB 2QTVB 2VTVA 1HDGO 2NZYA 2JD1A 5CH8A 3TW0A 4EB0A 1DO2A 1E60A 3IGFA 1BX0A 3NWOA 4MUMA 4N6GA 1MXFA 3CCFA 4U5QA 2I9KA 4MPRA 1YK0A 3T1QA 4AO8A 4AWAA 4PVCA 4UPVA 2VK1A 4AZVA 4RXUA 1QC5B 2BEUB 1GA4A 4LJKA 2PT5A 2Z1MA 1PJ8A 1ZI6A 2H1OA 2IXBA 3D7KA 3P27A 4UDXX 2B92A 3WGHA 2W9XA 4BO9A 3E9MA 3W9BA 1PTKA 2XKBA 3IXQA 4Q00A 3CNQS 1LH0A 3W6PA 2V6BA 3JAKA 5BT9A 1SC4A 3U9TA 4N8SA 1J2EA 3AI2A 2Y1DA 3FHCB 3MPOA 4A0GA 5AM4A 1VDMA 4MQ6A 4YT4A 1J23A 2WWFA 4CKXA 3AWDA 5CCBA 2WYUA 3FCEA 1QVZA 4ID3A 5JJLA 4UJ3A 3SR3A 3CE9A 1YB4A 4X1YA 3OZ7A 1F2VA 1G8GA 1YACA 2FEPA 2JEYA 3E9NA 3GDWA 1NUTA 1SIUA 1T5IA 3CNHA 4Y0VA 5DI3A 4C3ZA 2L19A 4F56A 3HJFA 5JSUA 1NYRA 1NY5A 3E18A 2BKLA 3ER6A 4MQ4A 2O8DA 4OLBA 3FDZB 3X1XA 2VCYA 2W6MA 4QC2A 4OH1A 3ZQ6A 2NQ8A 1XKTA 4DRYA 3FBWA 4OKIA 4EHBA 5HUJA 1SVMA 5AJZA 1C7JA 5AVVA 4WBNA 1J8DA 4O0LA 3WNQA 1LUAA 3SEAA 4LDPA 1IULA 1UFVA 3QEMA 4HCJA 4G1EB 3FNRA 4WY2A 1UKCA 4AWXA 5DTJA 4H6PA 4CLRA 5DYGA 1EGMB 1G4AE 1LBHA 3EE6A 1Z6XA 2HBQA 2Q6TA 1XALA 2ATVA 3ZHQA 5JAZA 2ZAYA 1ZUD1 2AG8A 4EDFA 1TYZA 3QLVC 4XCXA 3GJRA 3W77A 1P3DA 2ZI3A 4MVJG 1FSSA 5CURA 1JFLA 4H4CA 3USES 3PKIA 1VBKA 2OPHA 1XDGA 4NE2A 3LHSA 1GKYA 4RKQA 1DKRA 4GOND 2OZVA 1H05A 4LNUA 3U3OA 1T9DA 5JNLA 4ALJA 1VCHA 2GEFA 3I0MA 4HYQA 4X7MA 5JXHA 3FW1A 1W75A 1XZMA 4UM8B 1QWOA 1NVVQ 3BJZA 1KQNA 1PGNA 1HLFA 1E7SA 4U2FA 3D4NA 5EE5B 5BYAA 2WUGA 3BTSA 1FJHA 2Z4RA 3GCZA 4R16A 1KJ9A 3DV0A 4HRYA 3RD5A 1L5OA 1KMIY 3P9NA 3WYNA 1IU9A 2E18A 4JUIA 2C0QA 1A2BA 1ENZA 3MELA 1U7XA 4U6SA 2WM8A 4IZHA 3U4MA 3ZE9A 1ZJ4A 1QTIA 1E4VA 3WRXC 5A0FA 6LDHA 3EEQA 3NDIA 3HXOA 2GEJA 4DEXA 5H3CA 3BQMB 4YRIA 3ANMA 4ND7A 4BFXA 1OU4A 4OYYA 4PAWA 1C4KA 3JZDA 2X1MA 4JD5A 3IDFA 4Y9TA 2C29D 1QBKC 1RHKA 1YOVB 1P1RA 4MPJA 5F9MA 3VHLB 2OORA 3V6MA 4HZUB 4WA7A 3A04A 2MCFA 3M2TA 1GD1O 2IBMA 2SKCA 4L5YA 1YDGA 4NYMR 3A6FA 4Q3CA 4XSGA 4A8JC 2IUUA 1WY5A 3T95A 4ZCRA 3U5ZB 3CEMA 1KY4A 4M0DA 1A8PA 4V0LA 1Q0TA 5L3SB 2RG1A 2WZQA 3SFTA 4QAJA 4EUFA 3KEMA 1ODSA 4N0QA 3T7CA 1GEEA 3NEJA 5BW4A 3VAYA 1JKIA 1TCVA 4C76A 2PKQP 2VDVE 2XNHA 3I34X 5A04A 3KL4A 1WCWA 3KPJA 3LOUA 1RXWA 4EGQA 3KJQA 1OZGA 4B3DA 5GV8A 2FA9A 3HKCB 1FFDA 2WSSA 4GBGA 2OUKA 3ZZMA 3HO8A 5C9ZA 2J31A 3BMOA 3C7DB 3LQ4A 1KQGA 2PSFA 1JPJA 1WMEA 1N4DA 4G5FA 3ZWBA 3SM9A 1DADA 3SS7X 2NTEA 3B3AA 4D0RA 4X5OA 3PHCA 3PKZA 2FPXA 4IIFA 2DHRA 5KTOA 3BCRA 1D2HA 1X1AA 1XSEA 4IW3B 2ZJ4A 4QJ4A 3NVDA 3VYVA 1YZKA 3CVJA 3H17A 4E3ZA 4PSVA 3LCJA 4K8OA 4NECA 1FMJA 1VCOA 2C2XA 4FX5A 5KBYA 1IY8A 1UC9A 3REQA 1J97A 1VXOA 2B5WA 5EGNA 1SXJB 1WXHA 1FC0A 5CGZA 5E4TA 1PDOA 5JY1A 3KQNA 4DNQA 1MG5A 5AESA 2EFYA 4KGZA 3RREA 4MW4A 2ZR9A 4TMXA 1GDTA 3FZQA 1AMUA 1FJGB 2ZUVA 5G3ZA 3WAJA 1XRPA 2QYSA 1L4HA 5CVJA 3IERA 1B00A 2FCAA 2VH5R 2J1LA 1FS4A 3WHLA 2HL6A 1YE8A 3R74A 3BIWA 3JAKB 4G84A 3D43A 1NMQA 3RSFA 3BGSA 4AU1A 3PFCA 1WSBA 4AX8A 1K0FA 3QK7A 3KV3O 5LP6A 2W0MA 1DKLA 2CT8A 3B7PA 5EJ8A 3I2GA 4YA6A 1RZRA 3M1YA 1KFEB 1CR6A 2GFIA 1D03A 1UBNA 3EHDA 4G56A 4P98A 2X41A 2AQIA 4LKOA 4TWZA 2GN6A 2O2DA 4QYIB 1EI9A 2ORYA 4XB6B 1DOZA 1L8AA 1RM4A 3F3YA 3QZUA 4DZRA 2CSUA 4PIMA 1PGJA 5EJ5A 2BELA 2VBGA 3ZE0B 3TXXA 3B12A 3ZV7A 3P0RA 1ULSA 1MT3A 1EP1B 3FYTA 3P0HA 1SZDA 1BGXT 1W87A 2YHSA 4XIIA 3HVJA 3MGGA 3RUHA 2AB0A 2DPYA 3NPAA 4J75A 3R76A 1C7QA 1JILA 4BQNA 3KSZO 2F8LA 2DR0A 1K4MA 2SCUA 2VO1A 1ZUHA 2GK7A 1F51E 1CF4A 1P5JA 2YJZA 4FW8A 5EE3A 1F4LA 2FUG6 4M1QA 3VZBA 4PF1A 4J07A 4Q1CA 5DSTA 1ZIOA 1KXJA 4PZYA 5E1DA 4QJ3A 2YY7A 5A9SA 2AK2A 3TLYA 4HQOA 4LHXA 2I65A 4RK6A 2QROA 4QJ5A 3GEIA 3E3MA 4LDZA 3SSOA 2ZU0C 2IYLD 1Q1BA 3KZKA 4IRXA 4QT4A 5JCPA 3KQPA 3DAGA 3LDGA 2CEKA 1VHTA 4WOCA 4KN9S 3MNFA 1MX3A 3T0FA 1BWRA 1GO2A 1YK1A 1ZW6A 3GNSA 2O2HA 1L4BA 3P8ZA 2B83A 3K5PA 4FGWA 4AJJA 3AWIA 4JB2A 3QFFA 1KAQA 3M9XA 3A1UA 1OC2A 5DCUA 3JV7A 2BMEA 4DIKA 1CDEA 2Q41A 1KZ1A 2FVXA 5DVZA 1AMNA 5JC8A 4CKBA 2QJRA 3UWPA 3SMQA 3DBLB 3VH2A 3WLSA 4F6RB 4MROA 3QX8A 4IVRA 1KO1A 1O54A 5K3FB 2GPJA 1LLDA 5KMGA 2VYVD 3C8MA 4WOJA 1GPBA 5IF9A 2QAGB 3U61B 1GTJ1 2B1GA 1NJSA 1YBAA 2VDUE 4DA7A 1E2EA 4PRZA 2FY8A 2NPFA 5BN5B 3B36A 5A5FA 1JDNA 4YQZA 1UM9B 1IG3A 5E8RA 1A9TA 1AS2A 1JF8A 1FX0A 2FQXA 1VYVA 3D64A 2IDJA 2VZ8A 3O4IA 4K6CA 5L3RA 4CCWA 3P0JA 1Y4SA 3M1IA 3RAPR 5AVXA 5AOBA 3CPHA 4EX7A 4EUSA 1DAFA 2WC1A 2ZBRA 3C1TA 3RHFA 1MUUA 5ALDA 4K9PA 3LX6A 3VVLA 3ADDA 4P34A 3I23A 2H00A 3IULA 4AO6A 1LD3A 1G9TA 2JD0A 4WZBB 3X44A 1SHLA 2B35A 2XV1A 1PVVA 5J5VA 1LTKA 5CA0B 3AVVA 1KJZA 2ZS8A 2G08A 4LHYA 3QVVA 5I9SA 4LVCA 2XUIA 1VE6A 4RCVA 5AVUA 1U90A 3H16A 2J0EA 2Q27A 3ETHA 1VHJA 2BI4A 3EVGA 3IALA 3N0RA 1A96A 3TIGA 4MARA 1GXSB 4PNZA 4RVDA 4WGFA 2E49A 3F8SA 4MP6A 3VSCA 4GC5A 2ZB4A 1F4PA 1M1ZA 1OAAA 1ZRNA 1ZH8A 1ZN2A 2HHLA 1UWLA 2LKDA 5E8JA 5JV5A 3H1BA 3P7MA 2BYTA 1UDCA 4FQ8A 3DMTC 2H9IA 3QPDA 1YCHA 4WFIA 1VBNA 3FMVA 1R18A 2FPLA 2XRFA 3LWBA 4LQCA 1XQ9A 2ATIA 4QXQA 3D0KA 4YRNA 1MV8A 3ESZA 1K8RA 4GLJA 2BISA 1P4HA 5TT0A 2BE9A 1Z34A 2RBEA 4ZPJA 1DARA 4MQEA 4BB9A 2A30A 3UKDA 2B4AA 4TS1A 2FMXA 2VHEA 4H31A 5K3BA 3RKSA 1F2TB 4LV8B 4EI8A 1F4VA 2IYNA 1XLUA 2JI6A 3SYRA 3FUXA 3JVVA 1KE1A 3JQDA 2PSJA 3R7BA 3WQRA 4HDMB 2AKYA 5HRAA 3ZC3A 1Y1QA 4ETMA 3F49S 1UAGA 5A0VA 1YL6A 1HO3A 2FZCA 1SCDA 1P0MA 1JFFB 4UPDA 1IWBB 4BNUA 5AI0A 1EQUA 5D5HA 1GQFA 4N3AA 5ECDA 2VPXA 4DLPA 1FFYA 1ZM2A 5JH7B 3GVPA 2H0QA 2PUDA 3CE6A 1U8EA 1QQ5A 4Y2SA 5JPIA 4EKDA 4QGHA 1IEXA 4HVCA 3H1TA 4AYTA 3GG9A 3EZ7A 4E7PA 2XOXA 5FAKA 1AQJA 4UOQA 1AK1A 4HADA 4MV4A 1X1BA 3U37A 3A9CA 2R6GA 3NHPA 3G5LA 3OU2A 4QNRA 3P9CA 3EPHA 5IKEA 1I14A 3AHDA 2ZZMA 3H6HA 1NFQA 3M3HA 1GZ3A 2PY6A 3MRSA 3V33A 4DLXA 4Y6QA 5ITVA 2ETXA 2D4AA 2D4HA 3GLUA 1I6LA 1BH6A 4HSGA 5KU7A 3EC1A 5HILA 4WQMA 1G63A 5AVYA 4NOLA 1OX4A 5HQJA 1H6DA 3MBIA 4IVNA 4ALLA 5AIBA 4Q24A 1Y6QA 4J94A 4X92A 5HGXA 5I4CA 5B36A 3C5HA 3GGCA 3HZOA 4JB3A 5J40A 5SV2A 5TNXA 1YI0A 3K2EA 3EF3A 3RFUA 4C0WA 4E5MA 3HCCA 2GJSA 4O25A 1CU1A 2JFUA 5BSFA 5CNMA 1PR6A 2UYYA 2AN9A 1XRLA 1M1NA 2VNIA 1E9EA 2DT8A 1IB0A 3IDSA 1L5LA 1QIMA 4L8FA 4R1NA 1JYFA 1R0SA 3HJBA 3AB3A 1Z38A 2OKCA 4P82A 3RJTA 2GAAA 3R9KA 3N2LA 1UDXA 3KHTA 1KI7A 4GVXA 4C06A 4DMUB 1EVZA 3HEAA 1X8JA 3WOVA 2C7PA 3QPVA 2TS1A 2HW8A 2PQ2A 2HRRA 2IU4A 5ICEA 3Q4GA 1NKSA 3W8EA 3D7NA 4F04A 1K7XB 1EHIA 2GM5A 2YWJA 1EG2A 2C1ZA 2O7VA 4G86A 5LKRA 2W42A 5G3YA 3ZD6A 2VH2A 3GEBA 1YIDA 1XPOA 3LRPA 1VG8A 5FWYB 2JLRA 1B1AA 3HA5A 4YJ2F 4RANA 3ZDYB 4QM7A 4JP8A 3WNVA 5A3JA 5LNK1 1JAYA 1KBZA 4HGNA 4P54A 4QHSA 4W5JA 5K0EA 3NTQA 4J29A 4LF8B 1GY8A 3CO0S 4C1BA 1B0UA 3FSGA 1QV9A 4M4SA 1CHDA 3FGPA 2FG6C 3NTLA 3AW9A 5I7EA 2I54A 2F64A 2VJBA 1OGYA 1UJBA 3AM3A 3O8NA 4UC0A 4ZT4A 1ZRSA 1P2GA 3IMEA 1ZXXA 2CFIA 5JSKA 4CMIB 5JUWA 3GEDA 1UKYA 2BSAA 2IP2A 4L2IA 3E15A 1U65A 2QG4A 2B9VA 3DKKA 1Y3CE 1NQAO 3W2HA 1L5MA 1QYDA 2CHQA 3RJ5A 3R3VA 3IEMA 1BU5A 1U0RA 1YB1A 1RI1A 2PGXA 3BHIA 1ZJWA 2W4MA 4WCFA 1JXQA 3HA2A 3W8DA 3CC8A 1OQAA 4RKWA 5BRJA 4UQLA 4YRDA 4RS3A 3U7EB 3D5QA 4UHEA 1O0BA 1R16A 5LKAA 1HRDA 3SF8B 2PLAA 2B8NA 3OFKA 1O5TA 1DC3A 1ZJYA 3L7CA 5TQ0A 4CGYA 2VP9A 4DJTA 1AVTA 3EARA 3JS5A 4RH0A 2OHXA 4KXFB 5J9FA 3UXYA 2Q0XA 3W6ZA 1WQ4A 2WG0A 1FYFA 1MORA 3TZ6A 3GELA 3OICA 1KERA 3FFXA 5I5EA 1J6UA 1WKBA 2YZ2A 3RF6A 2C5FA 1OFIA 2CXHA 3REQB 1J0CA 1P44A 2P68A 3DCJA 5T4BA 2G1UA 3NOOA 4HDKB 4CLEA 4DWWA 2CWDA 2O9JA 1TIPA 1Q7BA 4EAAA 2XZLA 4DB2A 1EAMA 3KQOA 5F21A 5THXA 4WI1A 1UK8A 2P9FA 4FWBA 5E2IA 4BGDA 5K0TA 1USUA 3VKWA 4UTZA 4BX9A 4YAKA 3CKLA 3EZ6A 4UDOA 5F5LA 2OOKA 3KHUA 4JJZA 3L7AA 3I37X 4WV3A 2YHIB 1RHUA 3EGEA 3MJFA 4IV0A 4LOAA 4MUBA 3GJYA 4P4UA 4PY2A 2AK3A 3GUVA 5DBOA 2OA0A 1PFKA 2Z30A 3ZGYA 2WNHA 2YV5A 3DUFA 4JR1A 3PA8A 1OTHA 3VV3A 4BFLA 5GIPE 3KQWA 2I4RA 3CG0A 1XA4A 3FCUB 3TTTA 4M76B 5K0CA 4E5PA 1RIFA 4Z5XA 1SXHA 2GD2A 2NV6A 1LKZA 2QY6A 4YUWA 4AURA 4JL5A 1B8OA 3S8YA 4IS3A 1UQUA 3T1NA 3RWOA 3WL3A 2QE7A 3WOHA 1RCFA 2J3JA 2VEDA 4DWVA 4ENVA 4ZYXA 1QDEA 4K87A 5ELMA 1Z0JA 3T1HB 1YUBA 1K75A 5JNWA 5IKXA 3FVVA 4KWCA 3IQZA 3EFBA 4RQBA 3OU6A 3V8QA 4F72A 5BR1A 3X1KA 1I7LA 2F1RA 1FXWA 4IJ5A 3T94A 3ITEA 2OM2A 2WF5A 1EB9A 3DV9A 4IJ6A 1AHHA 4MVJD 1GPH1 5L7TA 3MT8A 3SIPA 1EXNA 4C3OB 3NYRA 1P33A 3EK2A 4JFAA 3I9KA 1P9RA 1ZGGA 2O07A 5DBIA 2R1TA 2HQ1A 2G1PA 2WSIA 4FQ7A 4DV0B 4QBIA 4N40A 3EYAA 3QWFA 2OYRA 1HOXA 4IL5A 2DTDA 4UJ5A 4MIOA 4XDHA 4YJFA 5FT9A 4MCHA 5BW8A 5T64A 2ARKA 5LC1A 4LJAA 3GMDA 1RP7A 1WIWA 2EZ8A 1NN1A 3P2IA 2OHHA 1CR0A 3BKWA 3O8DA 2YWDA 5HK9A 1RI4A 3ZQ4A 4B6PA 3EAFA 1IZ7A 1XE3A 3EXHA 3BKXA 1AKWA 1JN0A 4FTWA 4D9CA 3S7TA 4I6EA 4B4UA 1TMGE 2EBHX 3WLJA 1RHJA 2J3KA 5DBGA 5AM2A 1I32A 1IY1A 1CIPA 5J2TB 4UHFA 4PQGA 3ELDA 5EPEA 4OXNA 4GZ6A 2WJ6A 5GONB 5GZ6A 2K7FA 1YQ9A 4PFQA 3M5CA 1AY0A 1ZMOA 2H29A 1MA3A 3UUEA 1PR0A 4RMNA 3ZHXA 4EY7A 3FRIA 1D2GA 4EMUA 1MZVA 3HYLA 4X91A 1PSDA 5L4NA 2O8EA 2DXIA 4PSDA 5FPSA 3ROFA 3LBYA 5E38A 4JI2B 1T1GA 3NRCA 1XHEA 1NXQA 5JZMA 3RC7A 3HBAA 4Z0HO 2XOEA 4QJBA 2V4UA 3BDVA 4R8VA 3Q3JB 4CQJA 3Q8XB 1FDTA 1CW2B 2H4ZA 2G80A 4N3GA 3KOZA 2WSMA 5EA2A 3FYHA 1VDZA 2BEWA 2D00A 4P81A 2QTHA 3SJCA 1S8NA 1VJ0A 2BGTA 2J30A 4BO7A 1M34B 3X2FA 3OM9A 2G1AA 3JALA 4EJSC 2EIXA 2P2LA 3DEJA 5HF8A 1MEJA 2J48A 1M75A 1V3QE 2J3DA 3D8TA 4DUZB 1GYQA 2FSIA 2C59A 3LK7A 3DZCA 4JS0A 4ZVQA 3U3XA 3ZVLA 1ICEA 5FWNA 3ZW7A 2J3MA 1GQSA 5F7OA 2LVBA 4BMDA 4EUKA 5F9FA 3MS2A 4GR5A 1WWKA 3AKEA 2PUEA 3AJRA 4HATA 1NJGA 4P35A 5FH9A 4ZANA 4A1OA 4BNDB 2QRLA 2Z5VA 3B82A 4ZOAA 5EMHA 1DX6A 1PUXA 1YS1X 3CF6R 5J43A 1W0KA 4PANA 3R3JA 4O1MA 3PUIA 4FYJA 4EPRA 2HA7A 2C97A 2QM0A 3QBVA 2QE6A 4QXMA 4U2CA 4CHTA 2UXDB 5HRCA 3UXEA 1R3UA 3MMPA 4R54A 1SCNE 1Z45A 1WEHA 3MG9A 1IPEA 4L3WA 4L0CA 4BMZA 2PUHA 2PX2A 4BWFB 1XX6A 3PC8C 3DFKA 3EGIA 4OQZA 1K88A 3UUFA 3WGNA 1EQ2A 3D8UA 4B2IA 2RB5A 2O50A 1Q15A 1T6NA 4KGVA 2XT0A 4B87A 1ESNA 1YOBA 1YKFA 3PI7A 4LI0A 5FORA 1J56A 4ER7A 5DYYA 5DLPA 1J1ZA 3NM5A 3V7NA 5C18A 2OK8A 2XJ9A 4BLUA 1M8GA 2LTAA 5DGIA 5HG0A 1Z0IA 4DA0A 4EGAA 4YMVA 5KOHB 4RY0A 4IDDA 5BWNA 1CETA 2Z1NA 1RAGA 3VDNB 1H94A 2JI8A 1M8JA 1OXMA 1K8QA 2FNAA 4I9NA 2FKNA 1E9SA 1LK7A 1RHMA 3KUDA 3RDPA 2C1XA 4OKSA 3GAFA 4B7AA 3OZUA 3TOZA 3AQIA 3U39A 1USGA 1WL8A 2JGIA 2AFHE 2XJ4A 3UA3A 3PL1A 1A8SA 3OJCA 4LNHA 4TTIA 4AN4A 3W8FA 4IDBA 1AURA 3EDMA 3LAWA 4GP9A 1TLLA 2QN9A 5EAIA 4P3PA 3IBGA 4BCDA 1VRCA 4QO7A 1Y4AE 1O9BA 1KVUA 4RL4A 2JH3A 3HB1A 1A1VA 3MUOA 2BKEA 3CT4A 2MHCA 2FW6A 3AY7A 4LYYA 2D0DA 1QGOA 4C6SA 1Z8HA 2WIBA 2D5CA 2WSBA 5IPFA 1G18A 2GKSA 5H59A 2ZBDA 3CH6A 3M2PA 1RRFA 1JMVA 4OF4A 4UVIA 1Z0FA 3VUEA 4D4IA 3OD5A 2ZYAA 1CG6A 2YUTA 3RUIA 1FNBA 1T2NA 1W5AA 2JVIA 3VRHA 4YUXA 1RRMA 3QX7A 1MO3A 1RFLA 5EZQA 4N12A 4OUDA 4ZVOA 3VZCA 2C20A 2XX3A 3PPIA 1WM1A 1DRKA 1G4UR 8MHTA 3BB3A 4JBYA 2VPTA 3EPJA 1PNTA 3BXEA 4JLUA 3PUXA 3INNA 1D9XA 2B1QA 3H2HA 4JBIA 3HLTA 3H2KA 5EKTA 1B15A 3JU3A 4HQ0A 4ESOA 2DGDA 3AUUA 3L07A 3CVWA 3QPCA 4EJ0A 3WMXA 2LW7A 2C7BA 2UZAA 4OHOA 2NZ2A 2AXPA 4HAIA 3MJHA 4PCAA 3CCCA 4KMSA 4X85A 5EINA 4WZAA 3B7GA 3D7RA 5EUCA 2H4HA 4GOOD 3CN9A 2H7VA 3QM1A 5TVKA 2D1QA 4JDPA 4QFBA 4V0RA 1NF2A 3VHXB 4OQDA 5GZ3A 4MPDA 3PUYA 2QENA 1IRIA 2OEPA 2AVNA 3ICOA 3GWGA 1WV1A 3OPYA 2CYBA 3QUCA 4RFVA 2C58A 1LLQA 4JB0A 1YU6A 4C03A 2P2DA 2ILVA 1GKUB 4UMEA 1IJEA 3ZLJA 4PO1A 4WCFC 1XZCA 2HPZA 3EPRA 2QD1A 2DWUA 4DQXA 1VC2A 1TKBA 4FS3A 3RG8A 3ZI0A 4R8LA 1K89A 1M1YB 4A8TA 5B6JA 3FYUB 2ZSHA 3EUFA 1HQDA 4M9QA 2O2XA 3QFRA 4M8KA 1S7GA 1U0TA 4X3CA 2DUJA 3WYGA 4BRUA 4F6RA 2CLFB 1PT6A 3BIFA 4M0MA 4A6DA 1T4DA 2FOIA 4ZI3A 2RGNA 4F9GA 2ZR7A 3IPXA 4HS4A 3F4LA 3C5CA 3KKQA 3M70A 5CYPA 3TCNA 1JA1A 1GNPA 3A9RA 3H9BA 4X7RA 2EP7A 5BSVA 4LRXA 4R9VA 3SC4A 1ONNA 4MLPA 1C9NA 2JHFA 4YQEA 3SM3A 4BB6A 4I5EA 4RJIA 5DSZA 4X90A 5GZ1A 2HZBA 1RACA 2YS7A 3PD7A 3RSQA 4BX2A 1VHLA 1FE8A 2VDLB 1VSVA 3OE4A 1DL5A 2ISQA 3IIMA 4GI5A 4IDFA 4KFCA 1NVKA 4ZOLB 2UVPB 2HH9A 1G5IA 4JYZA 1JYSA 3IUEA 4WINA 1FRZA 1PR5A 1FRVA 3SGLA 4ZRNA 1JDBB 2ZYGA 5K0NA 2AX4A 1T3ZA 1C4WA 2WDZA 4F5DA 3F6CA 4RCYA 4ZQFA 3RRJA 2DQYA 3ROTA 3NHJA 5KYYB 1DBRA 2F8TA 1G5FA 1YOVA 4M9RA 4WK2B 3UM9A 3V7FA 2AFIB 1ZDMA 5LBTA 3R24A 3KO8A 1WJGA 3LX4A 1JSZA 3P2YA 5J3JA 3I61A 4RKRA 3PD1A 4ZOEA 2OESA 4HDRB 5EWMB 4CQMB 2JGMA 5DNEA 2O06A 4AWBA 1EVEA 3OE7A 4RIIA 3HJTA 1DBQA 4IFEA 1HNZB 2W2OA 4C5AA 1Z6GA 1HZZC 3IMFA 3TL3A 3MRTA 4NICA 4YO7A 1N5DA 1DGQA 3A4NA 4NV3A 1XNRB 4IV5A 1L4EA 3KHKA 4NE9A 2PZEA 4QTZA 4XLLA 2QX7A 4BQRA 4YLYA 4MWCA 4OL0A 1UBLS 4D25A 1XUOA 3T5DA 3GLFE 1Z07A 2J0QA 4MP3A 1JP7A 1KMMA 1SXJE 3TKAA 4PR0A 5DBFA 3GD5A 3I3OA 5JAMA 1KZ7B 4PG5A 3I5XA 4A8HA 4BV2A 3IAEA 4LAFA 2J5XA 2CLCX 1C80A 3LWDA 3K9BA 1MOZA 3ONNA 4HAYA 3QKSB 2H5IA 5DLQC 1YE3A 3FA2A 8ABPA 1F06A 1MX9A 2EEPA 1E94E 2A0YA 3P4XA 3PVCA 3OCWA 3OY7A 1PVDA 2IUEA 3T9FA 2QV7A 3A6GA 1DKMA 4GP7A 4KRGA 3WLNA 2YY6A 2CSXA 3E8MA 4JYMA 3L6EA 1QR2A 1E8NA 3L05A 4QUBA 3HMKA 4ZALA 5FTNA 2BZ1A 4B2LA 3NUGA 3OQHA 1G8PA 2QRUA 2NO1A 1YCGA 1KO5A 1JEOA 3KEOA 3RSZA 3VPSA 1R8XA 2AQHA 4A2QA 1QMPA 4FGZA 2H2WA 4LBZA 1AK9A 4NYJR 1ODLA 1B26A 3DKRA 3QELB 3ZVMA 5DXAA 3DVAB 3PQ4A 5HUQA 1GPAA 3H4TA 3G13A 2IIQA 2FN3A 5EUQB 1EUQA 4YY3B 2NYRA 4DCCA 3NEAA 4M8NE 3LHDA 2ACEA 5ENVA 5TXGA 2H2AA 3ES9A 4CKCB 2JLZA 5JJIA 4C07A 2BEVA 3V1YA 4O2LA 4TN1A 3EXHC 2O0JA 2G25A 1P39A 3I9V6 1X7WB 2FEAA 1HDRA 2HRZA 4FYVA 3JZFA 5DF1A 3WGIA 4DV1B 1O97C 4MHOA 1LX6A 4WDQA 4CG3A 4QPCA 1CJUC 2BGMA 2HWWA 2VTEA 2ZI5A 3LO8A 1W4ZA 3T99A 2FHSA 2QXUA 2R84A 1V5FA 2Q5QA 1FX1A 5K8VA 4HLCA 1MVOA 2OMEA 3T1VA 5B4UA 2YN4A 2ODTX 1DVRA 1WRBA 3DS8A 2I4NA 1S2LA 1UBFA 1IN4A 1BD3A 1NBMD 2VS1A 2VYFA 5ECYA 1YJCA 3I2YX 3SJZA 4YCSA 4AY6A 2WB4A 4BO5A 2ZB2A 5CNJA 5JT1A 5DGTA 3GGPA 3QGMA 2PEYA 2GETA 2OVFA 3A1VA 4BQIA 4JWTA 4KYVA 4M0EA 5LUBA 4QBGB 4RIFA 4BFTA 2XLCA 1CP3A 3EB9A 1R0WA 1XCMA 3LDHA 3C45A 1PNOA 2PZMA 3DEKA 2PUAA 4MKRA 1VJTA 1O96B 2PBLA 3KOMA 2EG5A 4RHYA 5CLHA 1SC3A 3T0GA 4HNAA 4AP9A 3AIOA 1B76A 2FWMX 5FBWB 3JQEA 4S0XA 5L7WA 3ZLVA 5DP1A 1T13A 4WWHA 2Q2VA 1BVYF 4F4JA 2DWQA 4J0EA 5F73A 5CLGA 2PA3A 5AW1A 3GXOA 2FG7C 1V0JA 2Q5CA 1IBMB 3PRYA 4LJ9A 4BVAA 4MS4B 4ZAVA 5CK5A 4DGSA 1BQEA 2E4UA 3F4KA 3JVIA 1VPWA 1FIUA 1SFRA 2ZUFA 3C6BA 3CF4G 3L43A 3L6BA 4O2RA 1RJ9A 1IMOA 1R0RE 3MLAA 3OT4A 5F2KA 3BVPA 2A84A 2FP4B 3ODGA 3OTHA 3PX7A 1J70A 2KS6A 3UTCA 2FPUA 3OEEA 3EQ8A 3HXTA 1I3CA 1T1JA 4L85A 4CUKA 3GB9A 3NKFA 3Q8WA 5JH7F 3ORSA 4JKOA 1E7QA 1CUHA 1JB1A 1FXWF 1W49A 2ZE6A 3DFFA 2C2ZA 5C7LO 3MAAC 1XPUA 4E94A 5LQUA 1ML4A 3KU4A 4MWBA 1ZFNA 2LBPA 2I3ZA 1H0KA 1L5RA 4PX9A 1D2MA 2KBFA 2ROQA 1J8MF 3AESA 5AVRA 2FK7A 1FVOA 1JHRA 3GCGA 4A91A 1QIIA 3CUTA 3UJAA 3G2JA 3IJEB 4OXXA 3OOYA 3RBXA 1EFDN 5IBCA 2X4LA 4R1QA 3B89A 4G85A 4FEEA 2AZMA 2GQ0A 2H7YA 4Z8XA 5KIAA 1YFKA 3N53A 5B1DA 5ALZA 2Q1UA 4ND6A 1IEQA 4B85A 2W83A 1Z56C 3NBUA 1ZH6A 1NV8A 1PFQA 3D31A 4D41A 3VTFA 3FAKA 2KSQA 3IBTA 4F6CA 1ZSYA 5LR6A 1OH5A 1DCFA 2FLVA 2R8BA 4KFSA 1G0OA 1GZDA 3DE3X 2IS4A 2Q3JA 1IUOA 1AKEA 4HC4A 4MB2A 3TIIA 2VWPA 2ZYVX 3WKCA 4EJ2A 2IQIA 1UWVA 5BRAA 1SCJA 3QE9Y 2XEXA 3BMOB 3OJLA 4M53A 1DSSG 5DYWA 2GN1A 2O3RA 3R7AA 4LY6A 3RS9A 4JGGA 3NHWA 2ADFA 3ECCA 2W2VA 4D82A 1BE8A 1M33A 2YINC 4NNJA 2PU7A 1UP4A 5B7QA 2GTHA 2JBAA 2QR2A 3EGDB 3II6X 4L08A 4NCHA 4W82A 5E0KB 4F5YA 5EXDA 5JNSA 2I1VB 4LJ4A 4N76A 5ALVA 2FCRA 4R1MA 4OHRA 1Z22A 2PSSA 3TM4A 3UB3A 1YTUA 1E1MA 2AOWA 4G9BA 5DNCA 3CQ9A 1WLYA 3QOYA 5DOZA 4INJA 5BQFA 2XDQB 1WUKS 2H85A 3DEZA 13PKA 4Q1DA 3MRXA 4JLBA 1SKYE 1NFRA 1JQBA 2R96A 3H3XA 3P26A 5EXSA 2YWFA 5CH5A 1T8SA 4B9AA 1R6BX 3F5DA 4NCJA 1D9ZA 2QLTA 2ZYTX 2QMZA 1NLYA 1QTNA 1U0LA 2O2IA 3ELYA 4WN9B 3A1CA 4IHQA 4F4HA 3VC2A 2E87A 2PGIA 2X7JA 3LVBA 5DEOA 2XYQA 2RGBA 1DB3A 2A9VA 4RK4A 3TQOA 2AXEA 1O94D 3DL0A 1MTZA 3UMYA 4GR9A 4F9EA 3PE4A 2VG8A 4G0YA 4US2R 3ETJA 2GF9A 5AJTA 4DLZA 4C89A 1K0UA 1OYWA 5KX5F 1QPGA 3NEYA 1Y7IA 2G9VA 3K0EA 4EATA 1T1EA 2AOUA 1H3FA 4KOEC 1QK3A 1Q5PA 1XXHB 2GPSA 2XYGA 3PKJA 4LI3X 4Q39A 5HKOA 1LI7A 4RVNA 2C94A 3Q7QA 3VR5H 2O3TA 3AP3A 1G0NA 4ZDKA 3HHPA 4FSDA 4KSBA 2QRVB 1CQIA 2IITA 4W7SA 3K0AB 2O2SA 4GI3A 3U7HB 4Q47A 2G5TA 5EUMA 1I0IA 1ESEA 4UDNA 4X7BA 1DAGA 2UZ4A 4P5EA 3DT6A 5DJ5A 3QNWA 5IWCA 1XMXA 3G7NA 4ZDWA 4YXFA 2HHCA 1PZFA 3LG2A 4K05A 5TMBA 3R6GA 1I6MA 3EIUA 4DV3B 1QKKA 4MS1B 2G06A 3V1MA 4FYHA 1LTQA 2AI1A 2H1FA 1A5TA 2QVZX 3KQVA 4LSMA 3L4JA 4DMLA 4F4FA 2OD9A 5C34B 3V1NA 2GZSA 1MJGA 3CZPA 4UU0A 4RU1A 2IIPA 4P84A 3QELA 5G1PA 4TZ0A 1NU8A 2RSLA 4LHEA 2WJ4A 5DTEA 4QEKA 4L75A 4MWSA 2CB9A 2I4LA 2GBLA 1Y0BA 4OJQA 4R6XA 2JGAA 2QRJA 3LI2A 1EIWA 2MR6A 4GM1A 5FQOA 3RUCA 5EHNA 4D7AA 3QWAA 2C4WA 3IAM6 2VIIA 1Y89A 3O6VA 2JCVA 3D9QX 2W43A 3HPRA 3HJNA 5KJCA 1KIAA 4B71A 3J81A 3FDZA 3I58A 4YFVA 1Z33A 4EABA 4IXWA 1CNMA 2QUZA 1FU7A 1E6WA 1LV7A 5DGDA 1BDBA 4HNGA 1WUHS 1VGRA 2Y9PB 2M98A 3PNOA 1I6KA 2PMWB 1Q57A 4IRUB 3R1IA 2R0QC 4QYMA 5CT5A 1HFJA 3DAPA 1G291 1WPXA 4DR1B 2QM8A 1PJZA 4JI7B 1KSHA 1S4MA 4WN9A 1WHSB 1JIIA 4QREA 3TKYA 2X9LA 4I55B 5DM70 4AJEA 1LVGA 1KIMA 3O82A 1JEYB 2VHTA 4G0ZA 2JJ1A 1FYWA 1Z9BA 1H0RA 3EQZA 3JATB 5HHTA 1BKDR 3NVKI 3HXKA 1DQRA 3L7BA 4ENQA 3U1VA 1PJTA 5CYGA 4YIKA 5I4BA 3GEHA 1V5EA 3ETLA 1VA4A 3AB8A 4RE5A 1UQTA 3W5BA 4U7TB 4EUEA 5K0BA 4JI0B 1XLVA 5G1NA 2OY0A 1GGNA 4JBHA 1IUKA 4NLLA 3IBCA 1UPCA 2PGOA 1NZFA 4RGQA 4F5EA 1X3SA 4BWGA 4CEIB 5CK4A 1DXHA 4JBNA 2HX1A 1QR6A 4GG1A 3WRXA 1GUBA 3H5OA 3WBFA 3WKBA 4TT3A 3GQBB 4TTAA 1O8CA 4BO1A 4F84A 2C57A 3LXRA 4B4WA 1ZJ5A 2QJTA 5AW9A 2HIAA 2MDTA 3O1IC 5GJCA 3W5UA 3R20A 3VTKA 4EG0A 1HE2A 1NASA 3HB0A 3KSUA 4JJ8A 3W78A 2R86A 4UE6A 3Q9UA 1AKQA 1DBIA 4JITA 4RSMA 3QY0A 4UTRA 5HZGA 1UEXC 4QFCA 4MQFA 4F7WA 3JARA 1DUVG 1F8GA 5EJ6A 1PZXA 1YZTA 2HDHA 4H77A 4UUAA 3MA0A 5D00A 2JS7A 4JSRA 5L3ZA 4Q03A 3H4IA 3KEFA 3LKZA 2D7JA 3UHFA 3WIOA 3SOZA 5A3RA 3BH7A 5DRYA 1R6AA 3ADCA 3LCUA 4LHSA 2XPCA 3IAHA 4PTLA 1MLDA 1AG9A 3JYLA 3S5JA 4F12A 3H1GA 2GBFA 2B36A 5L3SA 3TSYA 1CS4C 4YMTA 3QNMA 4R68A 4EG7A 2OQVA 4C08A 3DO5A 3ZS8A 1UAAA 1LZKA 2I2BA 1TZKA 3HY6A 5LSAA 1WB4A 2WWHA 4CEJB 1LQTA 1REQB 3FZNA 1DTWA 4EMSA 3TZEA 1VYHA 2CVZA 4BEBA 3RHSA 2FFHA 5K6AC 3IUPA 3KALA 3ZK8A 1XVIA 1OZ0A 3V3TA 4I50A 1BKSB 1JDZA 1A9XA 5D8DA 1Q7RA 4GOJA 5IHPA 1YJXA 3H87A 4OAPA 3TMAA 2DPLA 2XDWA 3ODPA 3IP3A 3KTAB 4KPGA 2ONZA 3B70A 3TRKA 2CF5A 1RI3A 1YCFA 3R0IA 1OIWA 2GBPA 3QI7A 2I22A 4NY1A 1F1BA 2Q4EA 5EE0A 3MOSA 1UPUA 2ZJ2A 4FILA 4G5SA 4UU1A 4JUBA 3FDXA 2CD7A 4OU4A 4PAMA 4RV9A 4CIAA 5JFOA 3GARA 4XD7D 2IGBA 3S55A 4PLZA 1QXSA 1Y5LA 4X66B 3Q8LA 4ZYLA 5EQTA 2XCRB 3M9LA 2H06A 2HA4A 3AEKB 5FIUA 4GSYA 2HF9A 4R2KA 4P0TA 2GM9A 2Q0SA 4OLFA 3DE2X 4RF4A 4TV8F 5IMBA 4WVLA 3FX2A 4DWJA 3RVRA 4M38A 2FSVA 1WBJB 2WV7A 3OCCA 3S1LA 621PA 1HNXB 3DF7A 1KJ8A 3UY4A 4ASUD 1UFOA 2PYDA 2YW9A 4QEZA 4TL6A 4EFDA 4GM4A 1W4AA 2IF2A 1ZLXA 1UP7A 3IS3A 3VISA 2Z56A 4IO0A 4KITB 1C0LA 1IE3A 2ET6A 3KNZA 1PU2A 2GEUA 5GP1A 5IW8A 2AQKA 2JAPA 1PBNA 4G2NA 4FWIB 1ZBQA 5BPHA 1SUEA 1JEJA 2PWPA 3ND7A 3I45A 2ZWPA 4NX2A 4JT2A 5EP4A 3EC2A 4Q5IA 1DOAA 3IC5A 1L4NA 3LPDA 2P5YA 4HMQA 4QRHA 5A4AA 1PJBA 3WK8A 2JAHA 1CLEA 4JLPA 4RZUA 1Z62A 2HCRA 1T8PA 2GXQA 1MH1A 1M1XB 2A7XA 1KDZA 4UFPA 5B1YA 5BWCA 4ZO6A 2FV8A 3ETCA 5HFAA 2X0KA 3PDIB 2ODAA 2VDKB 2YV2A 1D0VA 3OSUA 1KOFA 1RYYA 1V45E 5TJHA 3O8LA 3PYMA 4DS3A 5TMEA 4JXJA 4FC7A 1X8XA 2JJ2D 1UXKA 4EA6A 1S5PA 4ZI5A 5F23A 2ODNA 1C1HA 2E2WA 4G24A 3KWJA 2BDTA 4L5BA 5A4FS 3PQCA 3AU8A 3OZVA 2PMEA 3BMNB 3FFWA 3VU9B 3UV6A 4CEHB 1PDVA 5CVVA 3TQIA 4QUDA 1UJ5A 2X6QA 3QXJA 5KJ1A 3N5KA 2CFOA 1ODTC 4XOIA 3KQUA 2M6KA 5IM5A 1E5VA 1AS3A 2QIOA 1BE1A 2ZSFA 2C3OA 2HY7A 2JBHA 2ZI7A 3I9MA 2Q3HA 5JFTA 4JQYA 1F38A 5K01A 1OTYA 1WZCA 2C95A 3GT7A 3B20A 3VTZA 1K86A 1DIOB 1TVKA 3H2ZA 3RS7A 4RHUA 4KO1S 2YNMC 1TA0A 1V3VA 2DBZA 5JTTA 4D8XA 4RW0A 5FUBA 2H18A 3ABIA 3DAYA 3F71A 1P6XA 4AS3A 1IL0A 4BGEA 1GEGA 2I91A 4WLVA 1GRNA 4JL6A 3PDCA 4C7OB 2QV0A 2Y1GA 1NBOA 3KX2A 1OUMA 1YBHA 1D1SA 1DX4A 1E32A 1XI2A 3F46A 3HLKA 4HX2A 5A7GA 1E2DA 2DKNA 3UOAB 4BATA 3DL4A 1MJ5A 1OBOA 4EA7A 2PUJA 1MABA 1YMQA 1EUCB 5DISB 3EXFB 1U63A 1N1DA 4MR9A 3A9TA 3BTUA 3RVDA 1Y48E 2DT5A 1B14A 1HYQA 1P7CA 2FMFA 4DWOA 2ONKA 4ZC1A 2H4FA 4NNOA 2WG1A 3BE4A 3QKRA 4TKVA 4AZ3B 2CMFA 1N2CB 1E1LA 2WABA 2FQ1A 5HIIA 5KTKA 3MLEA 3A11A 4FDVA 4KQ6A 1MD9A 4OGLA 4OQEA 4N3CA 3O21A 3PWTA 5JO9A 5ES3A 3OVMA 3UAWA 2G5CA 2COEA 1FDSA 4NG4A 1Q7CA 3AUYA 2QUIA 5DX0A 2OM6A 2ZIFA 3RT1A 4ZHQF 1GKKA 3IHLA 2PAAA 4LCEA 2IH2A 2I6TA 4GRAA 4OQLA 4B76A 1WULS 2PQ0A 1UPXA 3LP8A 1SQFA 2X76A 1BE0A 2CNOA 2N3ZA 3NZEA 3TB6A 2O7NA 3DE7X 3LY7A 1AHPA 1BDIA 4IIJB 2A2ZA 2PX5A 3EZYA 4IDEA 4CIVA 3AM5A 2ZBGA 1O4WA 1X9IA 2VPPA 5B7PA 3KZCA 1N6NA 2QRKA 1E1KA 1MPTA 2NGRA 3GW8A 1G20A 1Q14A 4X8MA 2VSXA 4JQZA 4YMSA 3ZE7A 3ROEA 5ICMA 1LXCA 1A8QA 2GAJA 2V4MA 3B8EA 2VT6A 5A9RA 4XQCA 5LMZA 2TSYB 3LLCA 2RBKA 3I0NA 2G9ZA 3PNSA 4XIYA 1GU1A 4ARAA 2IH5A 1UXJA 1KAMA 3JASA 5M7EA 1RYZA 3MWYW 3SVTA 3K6SA 1W2GA 4MS3A 2O19A 3O94A 2CHFA 3OZXA 3O38A 2XUDA 4DZTA 3NQ41 3GZ4A 4IIBA 5I48A 4R8RA 5BSUA 4M0PA 2IWRA 1L7VC 2UUCB 2EATA 2XVAA 1EVLA 4IIHA 1IN8A 1GZ7A 2GKGA 2XYPA 3FTDA 3RUDA 4FXPA 5A62A 3CUEF 2AS0A 3JWHA 1JKJB 1MG0A 3FAZA 5FUXA 5MN5A 3BN3A 2CC2A 221PA 1CUYA 3C3JA 1SULA 1U7OA 3DLBA 1I2AA 5T4EA 1OXXK 5CHEA 1SVSA 4HYTA 1C1YA 3UJ9A 5I8ZA 3STHA 3DW3X 1SPBS 3CS3A 4KQKA 3LC7O 4D6XA 2K87A 3DE5X 5DTMA 5DGCA 2LIVA 3L77A 2XQFA 1Z37A 4Q3OA 3PRJA 4QUJA 4EQZA 1XMQB 3UKOA 2OB1A 4Y30A 3GVCA 4UAGA 1EJ6A 3MN1A 3CEJA 5GONA 4OFWA 4OA5A 1WG8A 3OTOB 2HDOA 4M2LA 1DFIA 3G2MA 4F4UA 1LX7A 3AJEA 3RTBA 4RTRA 3LL4A 4BLSA 1IVSA 3ON5A 2VYND 1KS9A 1UBCA 3AHIA 3G8YA 5LQDA 3V2HA 2HMUA 1VPEA 4O4JA 5B5SA 3OHPA 1WPQA 2NO4A 1I4EB 1UMBA 2A86A 3L7OA 5CA1F 1W35A 2I2DA 3T9BA 1USKA 2BOVA 2QW0X 5FADA 3JQ7B 3TZQA 4ALIA 5C4MA 3K72B 2CGEA 4MAAA 4GLFA 2NAFA 4OHFA 1AV7A 1GZ6A 3A9UA 3QG5A 4DC9A 3CT6A 3TR6A 4KKXB 2WHQA 2HSDA 3JZIA 5JWRA 5G0TA 1R15A 3SHTA 4ARIA 3H5WA 5JBQA 2J7PA 3NM6B 1X38A 4EPXA 2UZ1A 1KO4A 1RNLA 5KSWB 5L45A 1PJ2A 2DBVO 4TRJA 2EW1A 4ZT6A 2DB3A 3JARB 4KQ9A 5HOEA 1XRRA 4JLJA 1O94A 4KO8A 3FPHA 4BQQA 1ABBA 2I71A 1EB8A 3HGTA 3VI3B 4D0GA 1EXVA 4HB3A 4HDQB 4R98A 4DYHA 3ANLA 4JQSA 2R1VB 1MAUA 2PLNA 4YO8A 3QEMB 1FU4A 2NUPB 2GPWA 1NT2A 3KSAC 1A9SA 3BXOA 4G0PA 5IZ4A 1T1IA 4W1QA 4IIEA 4JU8A 5HMMA 1ZCJA 1MQ9A 1XMPA 2QQGA 4IJMA 4ECAA 2PWAA 1SB9A 2HJRA 1U0JA 2WTMA 2C5SA 4JBLA 3PNYA 1Z7YA 4JY7A 3PQ7A 4P83A 1VHQA 2FMIA 4D46A 2XT6A 1W1IA 5DWQA 2Y0BA 1K2VN 3BIXA 4RACA 2WNIA 1T1RA 3AKZA 4N01A 5CDFE 2Z5GA 4UU8A 1V7PC 2XOKD 3R3XA 4R7TA 4URHA 5AK3A 1GL7A 2X86A 4AMUA 1RWQA 2P2CA 4ZVSA 3CF0A 4Q1BA 3WTBA 1E9RA 4BNKA 4O4JF 1QZZA 3AEZA 2G40A 3ZW9A 5B2FA 1DV2A 3FNGA 4X6UA 2VUSA 2YWEA 4BV8A 1G19A 1ZD9A 2B2NA 1IIBA 3GRCA 4BLTA 4TKLA 2O4CA 1XKQA 2F3QA 1IOVA 3OQPA 4KR0A 1XD2A 2ISSD 5FPYA 2ZKIA 3KJFA 4J91A 1HEYA 1RBZA 1ZZEA 3PEFA 4QYTA 4KR7A 4NMWA 4R0VA 2HXYA 1WXWA 1Z6TA 1I5EA 1PG5A 2JAQA 3OPQA 2ZGVA 3CPEA 4GBMA 4UASA 4ALNA 2GHIA 1MC8A 1YULA 1JHMA 1U28A 2P27A 1NMSA 1GUAA 1W4LA 3ZHBA 5JHGB 1SHUX 1Q11A 3STWA 1WSWA 1HWYA 1XJCA 3GROA 2Q4DA 4KYUA 1W8DA 4KMMA 4WE3A 2RGRA 2GEKA 2YZNA 3OLXA 3HCRA 3WLHA 3U40A 1WXQA 2BTQA 3DFZA 3JQBA 1UM9A 1JJ7A 1NF3A 4RTKA 5FLYA 2DG2A 4ER0A 4WNCA 4HY3A 5A5GA 5ESRA 5E1BA 5K6AA 1P5HA 2H1CA 4Z1MD 1ULUA 2Y4NA 5CVUA 3M89A 1W36D 1FTNA 4TSFA 2CHGA 2AEEA 1QE0A 2VPYA 2Y3IA 3PC7A 4J4TA 4NARA 7MHTA 3JYHA 3DD1A 1VMDA 3DO6A 3FWPA 3I1FA 3A1EA 1QHHA 2D1TA 3OLWA 1EK5A 2XUHA 3DE6X 4JJAA 1PR9A 1K63A 3UTDA 5K8UA 4HQKA 2QTMA 2G36A 4NQZA 1RSZA 4RETA 4PFSA 4QSMA 3SHVA 1VI2A 1KE2A 1E1RA 3O9ZA 2NMVA 1XMVA 1DWPA 4I3GA 4FGJA 4ZO8A 3EVBA 3Q5DA 3LBFA 1OBFO 1X7YB 5JRJA 3OMXA 5T57A 2XRMA 4ZC8A 4RA6A 4DLRA 3TLKA 1GL3A 4JEMA 4DR7B 4MMZB 3JTMA 2CXTA 5CW2A 4B33A 1K3UB 2B8EA 1KAEA 3ZCSA 1HC7A 2QTZA 1Z06A 3U3DA 3O84A 3BGWA 4PZCA 5EZ5A 1PS9A 2D06A 4HQRA 4CYMA 3GDOA 4P7FA 2OAEA 4OQMA 1GOTA 2A5FA 3O1JC 5KX5A 4JT9A 1XAGA 2V7QA 4TLAA 3SK0A 1JU9A 2R60A 4RCZA 4PXAA 3TG2A 3IAAA 1U7TA 1V4BA 1O96A 2K4MA 2V7UA 3U7JA 1OXTA 1TEVA 3T3DA 2SICE 5D3KA 1T9HA 2BP7A 1PGQA 2VPWA 1MAVA 1TO6A 3E0QA 3JQAB 2DE0X 4PO8A 3GPLA 1FP1D 4NMHA 1RKQA 2ANBA 2J87A 1CY8A 1JQDA 1WV0A 1K27A 1Y5NA 1SHZA 1ECLA 3PHGA 5FI3A 3SQMA 4PNEA 1S2DA 2G1JA 4XYLA 3UJPA 2A33A 3U4CA 1M8PA 3BS4A 1AM4D 1GSIA 1RIIA 1WCV1 2B1IA 4JSYA 4TT8A 4FX2A 3I9V1 3O93A 4JIMA 2V54A 1MOSA 1CUJA 3N2GA 4OJTA 4JH0A 1O03A 3TNLA 3V32A 5CVTA 3ICQB 1Y8ZA 4J0KA 1E1NA 1U5BA 1D3AA 3R6DA 4D0NA 1KQOA 3W5IA 4ZOLA 5COQA 2XMGA 4KLZA 2G9QA 2PKRA 4TS9A 5DNUA 1EIZA 3A3NA 2XWJI 5IXYA 2BGLA 1E2IA 2AC4A 4CN9A 1BEZA 1M2GA 2P0YA 3ED1A 3RW9A 3QU5A 1M9NA 4J8PA 3ETNA 1GKLA 1OA0A 4V3BA 5JFGA 2CL7X 2PZJA 2VVTA 2MINB 4GYKA 5J1SB 2Q5LA 4XGKA 3SICE 1RE0A 3EHEA 4CF4A 4DQDA 2C3MA 3SSAA 1LVUA 2CCKA 2IYTA 4PU0A 5KNDH 2VZEA 1FFXB 3GCDA 2KX7A 3DPSA 4I99A 1IOLA 2AWOA 3NTUA 4O4JB 2G07A 1K92A 1IVNA 2PFKA 4JJFA 4PQYA 3OLZA 4BQEA 1OZFA 2JCYA 4O4LF 4IOJA 4PO3X 2B5VA 4XVHA 1SD5A 3DLIA 3FWHA 1ZLYA 2G82A 2PBRA 1JI0A 3JAMA 3FTNA 5E0OA 4CT4B 2G76A 1E98A 1L7XA 5IJ0A 3O8OA 4O29A 4RH3A 1YDMA 5E7QA 1I9GA 4D8VA 3GJ3A 1ORWA 3H4MA 4I1UA 1IM8A 1WTCA 4DCJA 5JS1A 2WU8A 4YH1A 5BSMA 4EKGA 5I4KA 1DT5A 1SEPA 4PXSA 1M1YE 2IY7A 2QP3A 3KQLA 1R6DA 4ZJYA 1C5KA 1PLKA 3PA6A 3PFKA 4Q05A 3RJMA 3HVRA 4BVBA 2BLNA 4KG7A 4DBZA 2BHNA 1L4MA 1RYEA 1U99A 6GPBA 3ICEA 4TUYB 1ZGHA 3S27A 4EHJA 1W47A 2RB4A 2OV3A 4INOA 3D1LA 3UO8B 4IMPA 4ZAYA 1ZP6A 5HGJA 4F1JA 2IZOA 2ECKA 1NWHA 1GRQA 1FFWA 2VDRB 2PKEA 2BP7B 2X1LA 3O3CA 3V9AA 3H8VA 4HWOA 3RBZA 3MIZA 3DE0X 3BJRA 2G4CA 4NC9A 5KOJB 1DIGA 4I6JA 5IT9A 3K0BA 4HTAA 3TX2A 1TPYA 1N3LA 2QORA 3IE0A 5I7FA 4RK5A 4Y1GA 3E61A 1HSOA 1NRXA 3ORFA 4RVCA 3EEOA 4KW7A 3B7WA 4I9UA 5JEEA 3OKAA 4BNIA 5IMSA 4F60A 5EWMA 4DUGD 2Y0CA 4BY9E 4E5DA 2B98A 4PYNA 5JYEA 5JD3A 5A5DA 1MFZA 1UZUA 3NOXA 3BJIC 3EJ6A 3O1LA 2PKCA 4TKUB 1E3WA 3N7UA 2CB0A 5AWFC 5BV7A 1NP6A 2B2CA 1X7WA 4MQBA 2ZYWX 1X80A 3QVMA