2I22A

Crystal structure of escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
192
structure length
179
Chain Sequence
MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDNDIFSRYVEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVPHFGYADRIQEIHIKVIHILIQLIEKEMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Phosphoheptose isomerase
publication title Structure and Function of Sedoheptulose-7-phosphate Isomerase, a Critical Enzyme for Lipopolysaccharide Biosynthesis and a Target for Antibiotic Adjuvants
pubmed doi rcsb
source organism Escherichia coli
total genus 67
structure length 179
sequence length 192
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.28: D-sedoheptulose 7-phosphate isomerase.
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13580 SIS_2 SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 2i22A00
4B3TB 4DV1B 1X94A 4JI2B 3OTOB 1XMQB 1N32B 3FJ1A 1VI5A 1J5EB 4OX9B 3TBFA 2ZJ3A 2UUAB 2DECA 3C3JA 2CXOA 3KNZA 4TOIA 4AQYB 2HHHB 4DR6B 4LF7B 1HM5A 1IBKB 3M5PA 4JI1B 1DQRA 1HNWB 1HR0B 1N36B 1KOJA 4LFAB 3OOJA 3PR3A 2CVPA 2PUWA 2I22A 5LMNB 3T1YB 1HOXA 3FF1A 4S12A 1VIVA 3TRJA 2CXQA 2PGIA 2AMLA 2UUBB 1NUHA 1XNQB 2ZJ4A 3UJHA 5LMUB 2Q8NA 1JLHA 3ETNA 1C7QA 4JYAB 1TZCA 4JI4B 1WIWA 4DR7B 1G98A 2CXPA 1C7RA 4DV3B 1Q50A 2POCA 2A3NA 2XHZA 3Q88A 2I2WA 1GZVA 1VIMA 4JI8B 1X92A 4X66B 1MOQA 4YY3B 5FLXA 4NXMB 1XNRB 4S1WA 1TK9A 3Q7IA 3FXAA 4JI6B 4DV6B 1FJGB 3J80A 2O2DA 4LFCB 1U0EA 2CXRA 2XBLA 3LJKA 1MORA 2J6HA 1M3SA 2PUTA 3IFSA 2VQFB 4DV0B 4DR2B 4DR1B 1HNZB 4AMVA 4NXNB 4LFBB 5A2QA 4GKJB 4LF8B 4LF5B 3HJBA 2CXSA 3SHOA 1I94B 2UXDB 3BJZA 1B0ZA 2E5FA 4JI3B 2VF4X 1IBMB 4LF9B 3G68A 4DUZB 3CVJA 3BCHA 4X64B 4YHHB 2UU9B 1JXAA 4JV5B 4DR5B 1X9HA 4EM6A 4JI0B 3J81A 4LF6B 5LL6P 2PUVA 1VI6A 4DR4B 2DF8A 1JEOA 3JX9A 2CB0A 4JI7B 3J7AC 4DUYB 2E5LB 4B3SB 2X3YA 3I0ZA 3ODPA 1HNXB 3JAMA 5IT9A 1N33B 4GKKB 2VF5X 4M0DA 1XTBA 4DV7B 4KHPB 3EUAA 4DV5B 1MOSA 5I01A 1U0FA 2UXBB 4DV4B 4LF4B 1N34B 1ZZGA 4U6NA 5BY2A 2VQEB 2UXCB 3HBAA 5IWAB 4K0KB 1GZDA 4DV2B 1U0GA 2O2CA 2CXUA 1X9IA 2WU8A 2V4MA 3QKIA 1IRIA 5BR8B 3T1HB 2ZM6B 1N8TA 2F4VB 4B3MB 4B3RB 1JIQA 1NRIA 1TZBA 2CXTA 4JI5B 4X62B 4X65B 1XMOB 4IVNA 1IBLB 4DR3B 2UUCB 1IATA 3FKJA 1T10A 3NBUA 1J5XA 4LZJA 2YVAA 2CXNA
chains in the Genus database with same CATH superfamily
3QYPA 4XVHA 1IY0A 2JGMA 3BGVA 1VL6A 1KNQA 4ND2A 5H83A 1AZTA 3VU8A 3A3NA 1LZKA 3C1TA 1L8OA 2X8JA 3L6OO 1NQ5A 3AF0A 3PFWO 4RWEA 4CM9A 2JDIA 4RCYA 5JO0A 3JPYA 1KZYC 2HSEA 4I1SA 4PHGA 1MZVA 3S7TA 4BLTA 4ND3A 5JAZA 2XEDA 3VC1A 5L4LA 1SXHA 4PU0A 5AKEA 1EP3B 1Z8NA 1WRBA 2VDRB 3A4NA 5IC5A 1SKYB 4ARIA 2IUFA 2G09A 3ABSB 5K01A 6AT1A 2X9NA 4EHBA 1L1RA 1M1NB 4XQEA 3ONNA 4I55A 5IAKA 3QPBA 3C43A 4LRTB 1M8GA 4KG7A 5DN6D 4MVJD 1U28C 2FQYA 3ZJUA 2W0SA 2HWKA 4QGFA 2XWBF 1NFQA 2AZTA 4U4AA 5CNJA 2IEYA 1VQ1A 3GC6A 4J4TA 3GZJA 3EXEA 1OU4A 3MRVA 2CE7A 2CB9A 2Z5GA 1PX0A 3NHUA 3OOSA 4IV5A 1OH8A 3CEHA 1VZ3A 2XHZA 3DTVA 3Q87B 4QAQA 5JS2A 4F8EA 4QLBA 3BWDD 2PZEA 1PG2A 4WWHA 5C51B 2G7ZA 5AT1A 4QASA 3SDBA 1RWMA 2Y1WA 2XGSA 1WKVA 1PJLA 5GJVC 3R44A 3S7ZA 3RWOA 3WLJA 1XLTA 1E3MA 1FU7A 1CDEA 3BORA 3L0PA 2VAPA 1IEXA 2F3UA 1ZXBA 2O2DA 4EUKA 1C3EA 3U1BA 4QD3A 4CKWB 3FF4A 3TLEA 3EMDA 5FBQB 1DKPA 3FHJA 3U1TA 4EJFA 4DR2B 4CMEC 3E5MA 5ALVA 1B6RA 3ZU5A 3PPXA 2WB4A 2PXXA 4JVNA 3I5UA 2B78A 3EWIA 4FKMA 1CJBA 4Q4HB 5P8WA 1G5TA 5IPFA 3HRHA 1F3OA 1U8EA 3KTOA 5CXSA 2HK6A 2X3FA 1FDIA 2Z8YA 2I3AA 3AH8A 1IXZA 1N3LA 3I4FA 3QTBA 4KGXA 4U5XA 3U1VA 2P0AA 3M6LA 3DE0X 1J06A 5KKNB 3ANMA 5B4TA 1BDIA 4KSBA 4RZ2A 1E4YA 3SSMA 4FZVA 2ONYA 5AK6A 4LXUA 3MA0A 1QKKA 4AZ0A 5CX1A 4Z1OA 2C3YA 4MVCA 2R6R1 2XRYA 3FOCA 1T36A 3TI7A 2F7SA 5A4JA 2OUIA 2H1VA 4M1WA 5I4BA 2EBWA 3A2LA 3EWSA 4J16C 4QDTA 1Q16A 2OXCA 2JFQA 3OTQA 4OU5A 4RHFA 4TZ0A 5K4HA 1WCYA 1D7OA 4ZOEA 2ATCA 4DIBA 2XUPA 1JXOA 3D4IA 4UULA 5D1NA 5G41A 4EEZA 2K87A 2ZWVA 2CVHA 2VP6A 4YBRA 2IXDA 2XJ4A 4PRYA 3HR7A 2FOIA 1CQPA 1DDOA 3O8DA 2WKPA 4AICA 1PWYE 2CDAA 2FEXA 3OLCX 2RGBA 4L51A 1A69A 3OIWA 1A5TA 5DKFA 4IG9A 1BFKA 2A9QA 3EVGA 3GDOA 3PGXA 4MVWA 3SC2B 3TW4A 1R6VA 5CNKA 4ARZA 1NYQA 4IJVA 3K9FC 2BAGA 2IYNA 1A1SA 1KAHA 1NRIA 4D4HA 1AHNA 4IJ5A 1SVLA 3DV0A 4X1YA 1VJ1A 1ZA2A 4LRSB 4I4IA 1J9ZA 4BKOA 4KSCA 2R6JA 3WK7A 1Y33E 1SC6A 3QFTA 3F3KA 3UV3A 1MEJA 4LEIA 4NBNA 2K7FA 1SBYA 2QMZA 1D2RA 1G6HA 1PQWA 1WVGA 2AJTA 1XVLA 2DVMA 1IUKA 1PD0A 3CUKA 2IPNA 3KG2A 4Q9IA 2QTWB 1U2GC 1QWOA 4YAWA 3ROGA 3RU3A 3ETDA 3OQIB 3SFZA 3TW0A 3HWX1 3TFQA 2I6FA 1L6IA 3TEFA 4DCMA 4MQEB 1PR6A 3NNDA 4CEIA 1PV2A 3C7TA 3ESDA 1WHSA 4KPFC 1A8IA 1BDJA 3G2PA 3TX2A 3Q3CA 1NSYA 3GCDA 8LDHA 1QPZA 4ZU6X 1KDZA 4XWGA 2P2YA 5FB3A 4ENPA 1MQ9A 4IIHA 1VIAA 3W9BA 2PQ6A 1ZMXA 1Z0IA 2PX4A 1TPZA 2Q6LA 3B2QA 3QXCA 3FE2A 2VSQA 4RY9A 4UU7A 3PX2A 5AKKA 3SQWA 3IAFA 1JQ5A 1L1QA 3HN7A 4GX2A 4WKOA 3AHCA 2UZ0A 5CW2A 3OQOA 2WTAA 4GMHA 3I5MA 1Z6QA 3AFOA 2BJWA 3RS2A 3WLLA 2P0YA 3DOFA 2RGGA 4GOOD 1FL9A 2XUAA 1NUSA 4YTEA 2JFPA 4X66B 3VI4B 4B09A 1M66A 3DE7X 3HEMA 3BA6A 4IGAA 3LGSA 4WACA 1X8XA 4J0DA 2NPOA 4GLJA 1IK6A 3OE5A 5SICE 4BQFA 3LF1A 1VE9A 1EWKA 3UMFA 5KTPA 3OJOA 2H4FA 4I6GA 4UMVA 3SJ7A 5IUJC 3BMOA 3EHDA 3H8WA 3OY7A 4M0EA 1DRJA 2VH2A 1EZ4A 2G1JA 4R81A 4TTQA 4TTRA 3IJPA 2XDYA 3CZRA 2X15A 4GGPA 2VNJA 4NOJA 3ZIUA 2JIZD 1L5QA 4BKUA 2NO5A 1L0BA 4KLNA 3VNBA 2ZG6A 3PEVA 2ZSFA 3SF0A 3TMKA 1T8RA 2WPDA 1R8XA 1E4EA 1X77A 2EP8A 2ZT8A 1VJTA 4MR8A 1PDOA 4B35A 1TJ4A 1IY8A 3MWLA 4BVKA 4ZU3A 4R1UA 3P9KA 3ZDAA 3B53X 1CR6A 1SNYA 1CVIA 1HE1C 1T2CA 1T2EA 1W4ZA 2OAEA 3CRVA 4TV9F 3WLNA 1P0FA 4IXNA 4DZZA 2ZI6A 5ADVA 1GTJ1 4HLUC 4RMIA 1AUPA 2AOWA 3I3SR 2I1WA 5D3MB 5H5JA 4QO8A 5JSQA 1JLLB 3FOEC 3KR9A 4ZVRA 1C7IA 1WW8A 4NCIA 2MR6A 4CNBA 4F97A 2ZBRA 2I1QA 3GLTA 4N47A 1MV5A 5KNCD 3GJZA 4IWYA 1MLDA 1U8TA 2P91A 5IKEA 2CE2X 4JYBA 2P4UA 1UADA 5D3KA 1FMCA 1MGOA 5SYAA 3UJPA 1FNBA 1ABFA 3ZHZA 4DCNA 1JIIA 4KEAA 1J6UA 4LOLA 2IRWA 1UINA 4HWPA 5FOWA 4DQ0A 4DV7B 4GIBA 2C04A 2IHTA 4HRXA 4MEJA 3P71T 5E4JA 4RELA 1L4MA 2VUHB 3U81A 5EWLB 4C4RA 2A58A 4D9EA 4PSVA 3NVAA 1ZJYA 2GMWA 1SUFA 1Z6ZA 2PO7A 3BRQA 3ICEA 3ETJA 3D7LA 2VPWA 2QTRA 3EC2A 4G8BA 3VNSA 4JUDX 1DFGA 1FJ2A 3CH6A 1LW6E 3HWRA 3LHFA 4KLZA 1QIDA 1DFHA 3I9NA 4DVGA 1PFVA 3KOMA 4NS4A 5K0TA 5A3RA 1EX1A 1G5HA 4YONB 4YDRA 1LNZA 3IP5A 3V2GA 2V96A 3H1GA 2YRXA 3L7OA 4BN0A 3W1EA 1BVYF 2PEZA 5FWAA 1I7QB 4MP8A 4N3GA 4N5DA 3R5JA 1H3FA 4EK9A 3PRHA 4WJKB 5JQWA 5DOVA 5FO0A 2EFEB 4DV1B 1PDVA 1LLQA 1TT5B 1YA4A 3BHIA 1L1EA 3IT2A 1ZOIA 2G80A 2O6LA 3TCXB 4MQFA 3WBKA 2YHUA 3LX8A 4LHSA 5AI5A 1NJFA 3LDFA 3RVBA 4A9AA 3WKEA 3PC8C 1O8BA 4FCWA 5DT9A 5TJ9A 2R79A 4RZ3A 4C6SA 3QU5A 1VDMA 5BV0A 1G21A 4G4GA 2VPPA 1GZ6A 1X3LA 2DPLA 2Z3VA 2HXYA 3HVUA 4LYFA 1U31A 1M1UA 3VO2A 3OICA 2IYPA 1I6MA 4JENA 4JGGA 4L7VA 4PW0A 2I22A 2VTDA 4UUQA 2V59A 4BDSA 4M36A 4HLCA 4RUKA 2DGDA 5TMEA 1Z34A 1SVKA 1F48A 1SMKA 4EB8A 3WIOA 1WPXA 2OTCA 1V16B 4F3RA 1Z82A 2ESRA 3VDRA 4A10A 1Z17A 5A4KA 1PHRA 4OGLA 1JJIA 3MJDA 5FBLB 5KNBA 2E4XA 1X7XB 4FD2A 2PBRA 4MYTA 3ZHQA 3M2PA 4KIGA 4BY9E 4PHTA 2YWXA 1JZTA 3EGEA 2QVZX 2WUVA 1PNRA 1E62A 4W1RA 3X2FA 4KI7A 4MS3A 3IXLA 2W8BB 3JZDA 3MGAA 4PQFA 3UWOA 1VL5A 3X1DA 2IYAA 2GS9A 5JV5A 4ZGWA 4TMTA 2FG6C 5I9LA 2C5LA 2NXNA 2VSNA 2X4DA 2C58A 3KKMA 5FNVB 3RROA 3J80A 1KHHA 4JOSA 4ER6A 4ZU1X 2O05A 1NUTA 1QE0A 2DJ5A 1BFDA 4D9JA 4AS3A 1YDGA 4A23A 4J07A 3EAFA 4OHKA 3LYAA 4ZI2A 4H60A 1N5RA 1BHJA 4MVJE 1STOA 2GN6A 5LLTA 2J08A 3E61A 3TO5A 1AMUA 4AZ3A 4QBHA 1B93A 1HMPA 1WUTA 2BMDA 1YBVA 1QHEA 1XDDA 2C00A 1K3UB 4QNRA 3ZGNA 1EBFA 3IUYA 3T52A 4CQMA 1VXRA 3CG4A 4DLSA 3AKDA 4BU0A 4DG5A 3EZGA 4PZLA 4B3JA 2YCBA 4HT3B 4E09A 2OVBA 1ZD2P 2DZDA 4H7KA 1T8TA 4WDRA 5LQRA 3GUZA 1WNTA 2B9VA 3KUKA 3PLRA 3H9JA 3C8HA 4C2BA 1N5KA 4HBZA 2IOFA 4D02A 5FO1A 5A05A 2EP5A 3ZCUA 4IHJA 5E6RB 3UA3A 4IJQA 2F90A 1LUAA 2IE8A 1SBIA 2GASA 2XCOA 1PKXA 2Q0SA 3AO0B 1V5EA 2OHVA 4IWNA 4QQRA 4XDGA 4JI7B 4P5DA 1Z6PA 2QAJA 1FSFA 3QFFA 4QBKA 4WXHA 3K8ZA 2Q29A 4MWZA 4ROSA 1QR2A 4BNJA 1IZ9A 3KTDA 4DC9A 1WP9A 3U56A 5CB4A 1CWUA 3U3RA 4BL5A 1HI9A 2VQ6A 3EUFA 3H6GA 3S4YA 1F9AA 1FNMA 1JT9A 1UK7A 5D5HA 5BPHA 1G9XA 1HFKA 2MCFA 4QT4A 1G7TA 3EGXA 4NHEA 4XRGA 2O14A 2RJ3A 3WHPA 1BVUA 2ICAA 4RQTA 1AQLA 3HB7A 2OV4A 4O2RA 1V9CA 4QGGA 2J3MA 1QQAA 3NBQA 1G7CA 1YL5A 2OZPA 4N76A 5JXHA 1E4VA 1YR8A 3I6ZA 2HBZA 4BNWA 4P58A 4EG0A 3I45A 3IPLA 2AD5A 2O50A 3NBYC 3DOCA 1N6PA 4K7JA 2ZUVA 4Q21A 2GVZC 5GY7A 1J2YA 3ZK8A 3ZLBA 2ZB3A 3K92A 2VWHA 3KLBA 5IKMA 4LWOA 3QE9Y 2QJRA 1BGVA 2RKOA 1F6WA 3ADDA 2P5YA 1QTQA 1L5RA 3QJYA 4E88A 4BTEA 1KEZA 1JG2A 1OFUA 3BVPA 3D6FA 3OU2A 5EMJA 2H7CA 3A4YA 5HKKD 5CH3A 1NDQA 2D0IA 3NWOA 4R1QA 4U02A 5FWDA 5AHXA 5C8DA 5AW7A 3HNOA 4I50F 5IRCD 3NHSA 2ZBPA 3I2YX 1X1BA 3FCAA 3ZV7A 3CB2A 2C7QA 4GT1A 4LY6A 2IW3A 2HA0A 2X7HA 1Z3CA 3BE4A 4EX7A 5IANA 3L1VA 1Y4SA 2QRVB 2PNJA 1PW5A 3BSSA 4LMRA 1J0XO 1NA5A 2FPUA 1N1GA 3L7JA 1TT7A 4X1IA 3DMGA 1Y81A 3K9BA 1E77A 1GPDG 1ZY2A 3DPIA 4MRSA 3KR2A 3CS3A 1I5EA 1M2EA 4I9FA 2ETXA 2CNBA 4X71A 4PSUA 1DEXA 1WXQA 3F7MA 4NCXA 4X7BA 4XD2A 4DIMA 1G5PA 1BDBA 1I01A 3RJZA 3PU6A 2EHJA 4LNUB 2E21A 5EUMA 4BKMA 4RTLA 3SZOA 4HNUA 3NT4A 1ZS9A 2DFVA 1MABB 1T3GA 1M72A 5AK3A 3G6KA 1YF3A 1N57A 3UC5A 3EGDB 1RYEA 5EEHA 3L41A 3QPWA 4GVXA 4IZHA 4HO1X 5HDBB 5BQ3A 2BKEA 2QE7D 2XH8A 1BQEA 4I3FA 3UHPA 3F96A 2ANCA 1QORA 4N8DA 2TMDA 3NHFA 5I7SA 3BSYA 1HDCA 2I3GA 1YR6A 3A4MA 1D2EA 2XWJI 3KEOA 3LY8A 1FLAA 1PGJA 1X42A 2D3WA 2H5IA 5F1OA 5IUKC 5JQGA 2DETA 4ND8B 1CVLA 1ZXLA 4GLBA 3GAAA 3WRYC 4QUJA 4XQ0A 3BULA 4BV3A 1WV1A 1CQIA 1XNGA 2E5FA 2SKEA 3LQYA 3PFIA 2OQVA 3D3QA 1KYIA 5B3JC 4G9BA 1CHDA 2XGOA 3FNIA 3JYQA 5M2QA 4YJ2B 5FR2A 1XNHA 3ND8A 1PW7A 4CV3A 2GJAA 2AWNA 3DTTA 5BNFA 1Q1EA 4EJ0A 2OPHA 1AVTA 5JZ9A 3REGA 2WG0A 4Y1GA 1UZUA 3URKA 4BO7A 1KSJA 2JFOA 1XDUA 3TG2A 3ZCRA 3BL6A 3K1ZA 4C7MA 4G1MB 2PXHA 1PJ2A 2P7HA 2VRNA 4JLBA 4YJKA 5JJLA 1DXOA 3I5AA 2NZ8A 5ALQA 1XZJA 3GZNA 4Z1MD 1SXJD 4CT0A 4M0DA 3R5FA 1RMQA 4GZMA 3AYZB 1NN0A 3X3HA 5IAEA 4ZIRA 1QGOA 2BFPA 4UNIA 2AYZA 2P9QA 1OZ0A 1KJNA 4IDQA 2IEGA 3QWAA 2CNNA 3CJRA 4MPDA 4RW0A 4S1NA 1J2JA 1D5WA 1QQ6A 1XZBA 2A5LA 2OC9A 2IHBA 2ZS7A 3D4PA 4TL8A 4WDQA 3V7NA 3REQB 3SYNA 4UDXX 1UPXA 2GN9A 2BMEA 1ES9A 3VR6A 4MVXA 4KMSA 2J4DA 4BKRA 1W93A 2VDLB 4BFLA 1ENOA 5AKLA 4H0FA 3L0YA 4PRZA 1TM1E 2WAMA 2I62A 4BJ5A 4DLYA 3GU3A 2WFMA 3EVDA 4KR0A 2YVLA 3EA5A 3OLVA 4RK4A 4Y9DA 1I51A 2MSCB 4IDAA 2B4QA 4FFOA 4QU9A 1Q0PA 1XU4A 2I99A 2AX3A 3Q7TA 3RAGA 4LZJA 4RK6A 3DL0A 4YMTA 5A9SB 5K0JA 4J8PA 1K8YB 3DCIA 2PT6A 1FYXA 5CPBA 3KXPA 3A9SA 4F91B 4B85A 1E4OA 2ERCA 4ZVUA 6GPBA 3NJ4A 5IDQA 1XA0A 1CW2B 3LECA 4R2JA 1W5SA 1H2YA 1DVRA 2GEDA 1J8VA 4H4EA 721PA 3IC5A 5K0EA 1BDHA 1FVHA 1DO2A 1KRHA 3RC8A 2IX9A 2F62A 2M9MA 1CT9A 1Z37A 1KFKB 4FYVA 4R31A 3V2IA 5JO9A 1YE8A 3PTZA 4XCQA 4Y0VA 2J6CA 1DX9A 1AKTA 5FRDA 2CN1A 1CX9B 1TTHA 1EDOA 5FPSA 1BJRE 3OE7D 1ULBA 2IX3A 4IDPA 2ZIXB 4W5TA 1RCUA 1T6ZA 2B7LA 2HU5A 3CF0A 3LQQA 3NUZA 4N65A 4XSHA 1CERA 2IA5A 4RLSA 4ND7A 1C29B 1IU9A 4KQ9A 4CWAA 1KK0A 3WJ2A 4DM7A 2QLBA 3ETNA 2LCIA 3G2NA 3HKEA 2GETA 3H75A 3SAJA 5JNTA 3IQDB 2BGJA 3RYFB 2VL7A 2CV1A 1K2VN 5EE9A 1UK6A 5I9IA 3ZY5A 2WA1A 2JA1A 1M7HA 4ZJPA 4F9FA 5GVSA 1QHIA 4PX5A 4JLDA 1S4QA 1JSLA 3KCNA 5DNUA 2P6UA 2YHSA 3VJLA 1ZLXA 1LBTA 1QV6A 2JRLA 1RYMA 1JT2A 2AFIE 1HOTA 1RRPA 2FQWA 3EEIA 2PQ0A 4NU8X 3H1BA 1XEWY 1Z5NA 3AG5A 4Z2YA 4RTKA 4RWZA 1W94A 3MJRA 3D1LA 4FN5A 2BE7A 3NIGB 3QHQA 4JY7A 3SY8A 4Z9FA 4QJ3A 4HADA 1WUJS 2GRAA 5CVTA 5ADUS 1T0IA 1NN1A 1VMEA 1WZUA 1XDBA 1ZBDA 3FB4A 4LXQA 2FGKA 1U4NA 3OM1A 2YHAA 2NPFA 2AHRA 3UT5A 5AXDA 2O8DB 1FLVA 1XYVA 1ZEJA 4BBJA 2F1IA 4OB6A 3VVMA 2V6FA 4Z49A 5A5VA 3QKSA 4ZGBA 3NDJA 4LVCA 3DVSX 3U3DA 1SXPA 2MHCA 2OGZA 3B48A 1P2DA 3LLCA 3MGGA 3GEPA 1J5PA 2D4HA 2PS3A 3NXSA 2ORWA 2ZB7A 3ZOKA 4CCSA 2HRDA 2OL4A 3P4YA 3AI3A 4I1RA 2WOJA 2JANA 3FHLA 4V02A 1HYQA 1WSWA 3VPDA 3W3ZB 3TVYA 3MMNA 1LU9A 2QPTA 4I5DA 2XTNA 4Q4LA 4QLAA 3ZG6A 1R4MB 3ENNA 2WFZA 1G7SA 1Z4LA 5HSGA 1GYQA 2P79A 2DKFA 2H2HA 2QM0A 1UJNA 1MFZA 3UJ6A 2N46A 1HA3A 1KZ7B 3R5XA 1UFQA 2WB2A 4BMDA 4LZOA 2W7TA 4U6NA 2DX7A 1E1RA 5DYWA 3M9WA 3COSA 1JHQA 2OORC 3F6SA 2OGWA 4OM8A 3U44A 4IIXA 1TQ2A 3W1WA 2IBSA 1ZCBA 1H1LA 3LXXA 4W5NA 4HTAA 2C4UA 5D3QA 2G82A 1MB0A 4K9OA 4E6PA 3K94A 1P0QA 1QK3A 3R9WA 1GCGA 2WYWA 4J3NA 1MNQA 3FX2A 5E9WA 4Z0NA 5KOHB 2GEJA 4K81B 5HIAA 5LP6F 1AGRA 3C97A 4PZDA 3DWFA 4OB8A 4PYRA 3EDOA 3UEOA 4ZYTA 1TZJA 1H4SA 3IYLW 2BR5A 1UIRA 4KDRA 1CDOA 2PLRA 3UWKA 4YXFA 4GMFA 4WUTA 4M8LA 2QRQA 4NU6A 1N9ZA 2ZQ5A 3BMQA 4F84A 4D82A 1HE3A 2NXEA 1H2BA 3GMDA 3UAWA 4BFWA 3GPDG 2ZAIA 5AM4A 1SBZA 3I83A 3EPLA 1VLLA 1Z3IX 2LGJA 4HRAA 5SZJA 1QE5A 4RIGA 4TS1A 5JSUA 1G5RA 1GARA 2D59A 2LKCA 2ZYVX 1U6IA 2FR8A 4JOBA 4B2IA 4LRYA 1I80A 1Y9DA 2PSJA 3B5EA 3M5PA 3P96A 3WNZA 2CBGA 3QWBA 3N8HA 2YFYA 3E9QA 1W19A 2BTQA 1YNSA 2ENUA 2W22A 3PI6A 1LW7A 1PLJA 3QYAA 4EQZA 2B7CA 3FVRA 3NP7A 4DE5A 1Y3IA 5JXIA 3K9CA 4CM1A 1FU4A 4AMYA 5D00A 13PKA 4OBEA 4HVTA 4PG4A 4ALNA 3KKLA 4MPRA 1D8TA 1B8VA 1GGMA 1O77A 3B36A 3GRPA 1D2GA 1UOPA 3QOFA 2RGRA 5LP1A 4I3HA 2GD0A 3WGHA 5M04A 4BJ6A 3FPGA 1XQWA 4J7AA 4EBBA 4MWOA 4YK7A 1KC1A 2HCFA 1Z0UA 3UBTA 4CTNA 4X1KB 2H4JA 1SO8A 4WBSA 5JNSA 3WLOA 5JCPA 3GCXA 3H2HA 3QVLA 4I7EA 1OC4A 4G2NA 5EQDA 1H0RA 3O4JA 5KU7A 4ZOCA 5AM2A 4OUKX 4Q6BA 1ODJA 5JAHA 3R7DA 2R751 1QF6A 3ROEA 4ER5A 5CXUA 4XARA 1XZQA 4YJFB 5DW3A 2VPQA 5FTJA 3I2FA 1GGKA 3V8QA 4RPLA 3C1AA 3GRUA 1TJ5A 3L6DA 3B1FA 2WHEA 5M7EA 2V4ZA 2OZKA 2FWIA 4E94A 2FFRA 5HKLA 1YE3A 4QUIA 2OHGA 3Q7SA 3LZCA 1TJ3A 5DHUA 1T2AA 3Q10A 1KYWA 1U1EA 2GPNA 3UJ8A 2DPXA 1ZINA 4ZI5A 1WUYA 2PMWB 4INAA 3SC3A 3LIIA 1MJHA 4AX4A 5IVPA 1CRQA 3OG9A 2QZ4A 5AUQA 5KO2A 1NQTA 1RMTA 5FBKA 3F5MA 3IX7A 4A5OA 4EEXA 4C7XA 2AV6A 4YDHB 2ZR8A 3GXOA 3K3PA 1RJWA 2ZT7A 4GL4A 3L1UA 4CI9A 4J75A 3LV8A 2B1JA 4CV2A 3GLFE 4FDMA 2C0CA 1Q0LA 5DHAA 5JRJA 4WLUA 3I0ZA 1TE2A 1VB3A 2XIJA 3KJNA 2NSHA 1I1OA 3BK2A 3FVQA 4RH3A 1KOFA 5F1YA 4E5SA 5EMLA 4GO1A 3GELA 2OZLA 4KK3A 4QYTA 1TYCA 3NNSA 4RETA 4X20B 1P2SA 3AVPA 2RGWA 3M2TA 4EMSA 2VK1A 5DTRA 4D3FA 2QN8A 3KJQA 5CMLA 3AUUA 3N2LA 1Y5NA 3VU3A 3S70A 3BWCA 3RKUA 4GRAA 4FZJA 4QTYA 3ZV5A 4I50A 3DMHA 2IBMA 1JVBA 1YMQA 4HPJB 5TMDA 2NSLA 5JASA 1N8TA 1ZD8A 2ZBDA 5CR9A 2AR7A 1TC2A 4K87A 3AFMA 4YP1A 3VX3A 1UBGA 3V9PA 4YRPA 4LJ7A 3KUDA 1RKUA 5DGHA 2GYWA 5EQJB 2FPXA 1SQGA 3WSVA 3P9YA 4ND6A 4OHMA 5DYIA 1SBQA 1G3IA 5LA6B 4E2WA 1SXJE 1C3LA 2AI2A 2AW3A 5EJ9A 3HFJA 4MRVA 2C9BA 4II2A 1I2CA 3M1IA 1JQEA 4OHZA 1Z62A 3OQPA 4HDMA 2XNDA 1TUBA 2B99A 1Z7EA 1J5EB 2H51A 1N2XA 4GPAA 1NVUQ 1R16A 3L3BA 4ZYYA 1WWKA 4G8JA 4N01A 4HEA6 1AMOA 3FTFA 3L0OA 4L08A 3D0KA 3L7BA 3AHHA 1KI9A 1C8BA 2PUHA 3OX3A 2UVPB 3HABA 2YHIB 2XVYA 3NHJA 3W90A 3HO6A 1W1WA 2QZ9A 4M6WA 4MEAA 4QPZA 2QTGA 2WWYA 4B6SA 2XOEA 4UVDA 4YREA 3T0FA 2AZXA 4XM2A 1KQPA 3JWGA 2IYUA 2JKZA 2R48A 1OD6A 3ELUA 2CT8A 3T8YA 3GW8A 4QBGB 2Q0HA 4GAEA 1P9NA 3FDXA 1NW3A 3DB2A 4REMA 3F97A 4DCUA 1G2PA 3EDYA 1KI6A 1ZR2A 5EKDA 4P98A 4IRUB 2A67A 3IE2A 3O26A 2B20A 1LK5A 2OECA 4XDYA 1O3YA 1Q50A 1TVKA 2O7SA 4YQYA 3RM3A 1YONA 4ZCMA 4B2PA 4I1VA 1G0OA 2GM5A 1KYVA 1E3WB 5C7LO 1BU5A 4ID3A 4JI8B 3RRNA 4U39A 2X0JA 2ZDGA 2OHXA 1FX1A 1OREA 4PCLA 3OFNA 2HRZA 1F8UA 1KIFA 2BCGY 3LNTA 3M4ZA 1WG8A 3O73A 2J0UA 4DB2A 4E31A 5DNEA 4TKMA 1Y1RA 2HF7A 3IFSA 4NBSA 3P4UA 1QYXA 4R9NA 4TV8F 4FPXA 4YYEA 3AM1A 1RI3A 2NOAA 4KO3S 1J0AA 1WCIA 5EN4A 3FWZA 4CU2A 2R6FA 2Q5OA 2A1UA 3AI7A 3VYSB 7YASA 2R7KA 4IUDS 1HO3A 5FTNA 1DQSA 5FUBA 3AG6A 5DV9A 4E4TA 1NM5C 2HLDD 5B1IA 3WLPA 2J3KA 3DBOB 5K3OA 4JLSA 1TTQB 1KMCA 5EGSA 3EASA 1NNSA 2M32A 3LHDA 4JKOA 1TJPB 4WXYB 3ETCA 3RS0A 4CL8A 2O8CB 4URVR 1KDTA 1ADFA 4KAXA 4HAYA 1P9OA 1NJ8A 3OPMA 1PTJC 1RW4A 3BRSA 4H59A 4E32A 5HKAA 2PMKA 1NONA 3HP4A 2VHZA 2WHPA 3AT1A 3UWDA 2LPMA 4BP1A 1SXJC 1X8JA 1ZM3A 3AETB 1VPVA 5ICEA 4HY3A 4RYLA 4UXHA 3SQOA 5DTEA 4BQQA 3X2EA 4WE3A 4MKRA 1I0ZA 1GGVA 2B8EA 2R7MA 1C30B 3K9LA 4J7UA 4MKIA 4I99A 2O57A 3PC4A 1XVUA 3UXYA 5D2CA 1JQBA 1SB8A 1X86B 1QQBA 3NHPA 2VSOA 5IW8A 2FPGA 1T4BA 2G04A 1KYTA 3BZBA 4KKXB 1MG0A 1SWWA 1VLJA 4EYSA 2GDZA 3JU3A 3MC1A 4PPNA 4QRHA 2RGAA 1N2EA 2ZJ1A 3LCMA 5SZHB 2PGAA 1Z26A 1SRQA 2CEKA 3KT0A 4WZAB 3PBKA 3A14A 2Q7DA 1KMHA 5FPQA 4JI5B 3N75A 4AG3A 1D04A 4ZVNA 3MNFA 1OWMA 1VE3A 2ZYWX 4EAAA 1A9XB 3W9SA 1XD2B 3CNOA 1SCKA 2Q4TA 1CJMA 1EFCA 3O1HB 4HYYA 4KQ1A 4BMCA 1NOJA 2WJWA 3LU1A 2GN1A 1KAQA 3H5WA 2B30A 1JMYA 3E4CA 3NVMB 4B6JA 1IY9A 1OFGA 3EFOA 4H3VA 4NU0A 3LQ2A 3ZDRA 3VU9A 3ZYZA 4BUJA 4EMTA 2GXAA 3DDHA 1ATIA 4ETIA 4M1MA 5JAPA 2Q4RA 1HEUA 4B3BA 4CETA 3LBHA 3LX5A 4S04A 1SZCA 4HGYA 4KDEA 4R41A 1CYEA 2AG6A 4AJ1A 1CYDA 1JEYB 3VR5D 4JH0A 3H17A 1K1EA 4R8MA 1D7AA 2IP1A 1XZIA 1YDMA 2G9ZA 3I6YA 3MW8A 5CIYA 1VE1A 4OA8A 3CX4A 5KDOA 2X42A 5C53B 2ERXA 2PS0A 3BH7A 3HJUA 3G5MA 2L19A 1QDLB 2HJVA 1Z6AA 2B3TA 3AKEA 3E70C 5LZ4A 3WWPA 1CF4A 2JEZA 4RSMA 3V42A 4GOLD 1CB7A 1FMTA 4R1PA 5BYJA 4L0DA 4HNVA 5ICMA 1ZLYA 4X7RA 2OY0A 2O8BA 1JAYA 1PR0A 1T8UA 1XWWA 2NADA 2OLEA 4JUIA 4Z4EA 1TXGA 5DP1A 4HWSA 1RKXA 2DR3A 5FL7A 4I81A 1QC5A 2GCOA 3GDHA 5KYTA 1NW4A 4G0YA 5B3KA 1XRPA 4RVCA 3II6X 3UFBA 1GPWB 3MJ4A 5K2MA 4GUDA 1GVHA 2FG5A 2X76A 4RLQA 1OHHA 3OT1B 4DSZA 3U7QA 4PIPA 5KYYA 3DV2A 3KZXA 4LOHA 1JSRA 1IFXA 2QLFA 2QY9A 1LNSA 3CR7A 4NHOA 3ZK9A 2NN3C 3WBJA 4AZWA 3G8CA 1C7ZA 2E18A 3DBHA 4RDHA 5TVKA 2OK8A 3HPRA 4WN9A 3W6ZA 4EA6A 3B9BA 1F7UA 5IT0A 4C0SA 3T5MA 1QFXA 1KVQA 4G41A 3L6BA 4MW9A 4XUEA 4JJ8A 3UB4A 5KOIA 1CUDA 2GBFA 3BFXA 4J0IA 2NU8B 2P41A 3VR4A 1VJGA 3ABOB 5K0CA 5FOVA 3AYXB 4KWIA 4X54A 1ORVA 4KAJA 1E1KA 4MW2A 2DF8A 2VHEA 3ZXXA 3OM9A 2A7XA 3CIOA 4BFZA 4E21A 5KTSA 2CUTA 4QPCA 5IDWA 2P4EA 3F8WA 1VHTA 1JW9B 7MDHA 4DIFA 5LP6A 4B3SB 2KM1A 3SICE 2FW6A 1E9AA 3T7RA 4CKEB 2GPAA 3ESRA 3MB5A 4FSDA 4NBKA 4EA9A 3VBCA 3TF5A 2XT6A 3ZZ0A 2G5TA 1YUNA 3MFQA 3SKYA 5EZ5A 2BEUA 1WABA 2ISSD 3HY6A 3N2NA 4WXEA 5FLKA 1YJXA 3ZWBA 1WMSA 3PHLA 3LUJA 1E8DA 3OCVA 1F38A 3IS3A 3OZEA 3EE6A 4JCCA 1UMBA 3SZGA 2XVXA 5I7VA 5CB0A 1HDRA 2D2XA 2HM7A 4U5QA 2H48A 1T2VA 3TLZA 3KQSA 2I7XA 1USGA 2GF9A 4JUAA 4PC3A 3AKCA 3AU9A 1P75A 3I5XA 5CUQA 3DR3A 5B5SA 1O96B 1AN9A 4CW7A 3CUYA 4LUCA 1PJZA 4JLVA 1E3QA 5GV8A 2P9GA 3NCHA 4TTAA 4BO1A 5DNYB 3QBJA 3AB8A 2CJWB 5LBUA 1E7SA 1GRVA 1OAOA 4PQYA 3AL0C 3VU1A 2ACWA 1N2BA 3NIBA 4QOGA 3AF4A 1R5BA 3L8EA 3CLVA 3LPMA 4FI3C 2GZDA 3AJ8A 3PTLA 3UUWA 4DDUA 2O8NA 2Y0CA 5DASA 3PNMA 1YVDA 1T5OA 5ARCA 4JWKA 2ZUDA 2Q2OA 3R2JA 4EPXA 1GYRA 1VYUA 2DFKB 4O08A 5IF3A 1UWVA 1V5WA 4FDUA 3B6ZA 1H66A 5FOUA 5KKAA 1KOLA 4UHEA 2FA9A 3TUIC 3RUHA 3QE0A 4XVRA 1TQ6A 2QG9A 2YYZA 3QH4A 3AR9A 5BSFA 1QP7A 2ZE5A 2DPHA 5ALSA 3FDZA 4FJ0A 4K6MA 1JF8A 3CCFA 5HIIA 1J9EA 2HMVA 3G23A 3T5BA 2XE7A 4DNQA 3TNJA 1P45A 2P9YA 4BEVA 4GOXA 1ZOPA 3RYIA 1IJBA 2WF7A 3JQBC 1IUOA 5BUZA 3N2KA 3FWKA 5C3UA 2VDVE 4CIYA 1G38A 4HR7A 4YCLA 3HGQA 3B7WA 3O83A 3IAUA 4YRBA 5KQMA 4RABA 2CYCA 4U7GA 5BT8A 5JEDA 1JALA 3IBTA 2NZ2A 4LV8B 3UAYA 1RAFA 1RVDA 4P7FA 3E3OA 3QF7A 4BV2A 5TLSA 1USKA 2DBZA 2E4VA 2GHQA 5F12A 1WQ4A 2ZTSA 3HBNA 3WIEA 4D3DA 4PYQA 1KJQA 3EH1A 1G5QA 3SGLA 1QOZA 1W8DA 3UKOA 3ER8A 3V32A 1VE5A 1MJGA 2C88A 3OH8A 5CIWA 4JP8A 3WS7A 4AP5A 1HNNA 4M9SA 4YR9A 3P2MA 1EUDA 1GN8A 2FRXA 4L4RA 4MLPA 1YZQA 1K4KA 1CEQA 2AX4A 2RI0A 3GBSA 2N1BA 4L8YA 2QSZA 4EMUA 5JADA 2OD9A 1L4EA 2V7UA 1PS9A 1NWCA 4X64B 1V5GA 5JU6A 1HEYA 1MHPA 4H35A 3F0TA 4H1TA 3IV9A 2EZ8A 4TM7A 3RR2A 5CT8A 2IU6A 4NCJA 1P4SA 5MN6A 1MB9A 4ZCRA 3KJIA 5TY0A 2M1ZA 2X5NA 1KEVA 2IK8A 1UBKS 3EXAA 3N7UA 2GARA 3QBDA 2YNMD 4LGYA 1I13A 2C8LA 3T1OA 4P4LA 5AKZA 1TM3E 1FYEA 2JLAA 5AP9A 3S3TA 2VYND 1IXYA 3MCAA 3U4CA 1ODSA 1QVVA 3HB0A 3A6KA 3B78A 1S8NA 2PGJA 1J8YF 4UBIA 1ZISA 1J09A 4CF7A 3QX3A 1UJ5A 2G5PA 3AMVA 3DUFA 4DDKA 5G1NA 3VZSA 4FM9A 2HJRA 3BN3A 2NYVA 3MERA 1KQFA 3MUEA 4TKVA 2ETVA 2VTBA 4QOSA 4EP1A 1W5FA 1U3CA 3G3EA 3DWGA 3LGAA 4G36A 4O3MA 2IS2A 2QLLA 5HJ7A 2BOVA 2GA8A 3NDBB 2ZUWA 4KXVA 1A77A 1HK7A 2O3SA 1SFRA 7REQB 3C3MA 7AT1A 3IKMB 1BE6A 4ZT6A 2JVIA 2AJLI 3AFHA 4FOOA 4PV7A 1IDN1 4FEGA 4Q19A 5B12A 3NT2A 4Q9LA 1SZDA 5DP2A 1NYLA 2W4QA 2VA8A 1UODA 1OIWA 2ODAA 1KDVA 1OH5A 2CLDX 2CHUA 2PGXA 3FFXA 3H4IA 2QUKA 4I6JA 4CF6A 5CPFA 2AXPA 2O3QA 3X44A 2EKDA 3DL7A 2UZ1B 1ZR4A 4U7TB 3U49A 2BRUC 1OX4B 2G06A 1XF9A 3N5KA 4CQLA 5KYNA 4UAJA 4KLRA 2JJ2D 4MVJM 4IILA 1RYBA 3E81A 1RIFA 5AOAA 1FTSA 4G1VA 1KJ8A 1GNTA 1QRRA 2GM3A 1E3JA 1FUEA 2XGMA 2YZ7A 2ZATA 3PNSA 3GEDA 2B69A 4FT2A 4TSRA 5REQB 1L7NA 3KOOA 1QH1A 2NUAA 3IT3A 2BFOA 3ZBQA 4Q1DA 5D5QA 3K53A 1W5AA 4PICA 4RHUA 1ZD1A 4LOIA 3BTSA 4JHXA 1RPTA 1UOOA 4WKCA 2WWTA 3O9MA 3SQXA 1TMYA 4TV8A 1Y6QA 1V1MA 5EJIA 2XE8A 2E37A 1G59A 3MGBA 4QEDA 5C1IA 2AT1A 4ML3A 4JB2A 1D3AA 4ZT5A 1NNUA 2C1EA 4WCFA 4S2EA 1NG1A 4JB0A 4UCWA 1Y3BE 2QR3A 3K96A 3HKCB 2UZIR 1NW8A 1VIMA 1N3BA 3CV3A 4V0RA 5DGTA 4BQPA 2QMOA 3ZCVA 3BH6A 5LOVF 2IKSA 3UPTA 2GJSA 1T6XA 3W04A 3WOVA 3ZU2A 2PXAA 1NW9B 3THOA 4OP3A 1ZM4A 2XZLA 1MJFA 2JFXA 2JEYA 3JPWA 1G41A 3FCEA 1J49A 3LYLA 4R69A 4WOJA 5LNK6 3R9XA 3OEED 2RH5A 3WZ2A 2N42A 3HO8A 2WV7A 4TLAA 4OX9Y 3E7WA 1SVNA 1Y48E 1WD7A 1CJCA 4LCJA 1E99A 1U6JA 4A1FA 4L07A 4AKHA 2QP3A 4WCVA 5E4TA 4CMAA 2JCGA 2V7XA 3SZMA 2IT1A 4C07A 4O8ZA 4IG4A 2Q49A 1K7CA 2C94A 3BREA 4KE8A 1XZMA 2ECKA 3NORA 2CC2A 3EIHA 4OV6B 4CODB 1ZJWA 1IHYA 2EVWX 3OE1A 1P5ZB 4QREA 4W6QA 4BFXA 4JMPA 4F7DA 4ZOBA 2LCFA 2OD2A 2XCIA 3T3IA 1E3IA 1WMAA 3P27A 4LV5B 4N0MA 1OFIA 2JF0A 1BU8A 1WULS 1T9GS 4J0JA 3N0WA 5IJ9A 1Z0SA 1AUVA 2B5WA 1ORTA 4OH1A 1NJ1A 2Q3HA 3KWFA 3DJFA 3RF6A 4BNZA 2XUKA 4YQFA 1EDDA 1NQVA 1U7HA 3CF2A 3DZGA 3GX1A 4L4SA 4TWBA 2G28A 4MDEA 1WB4A 1JP7A 4IWXA 2FP4B 4FS3A 1KWGA 1GXSB 4KQKA 2HF8A 3SPXA 5JRZA 2R2AA 1E7RA 1WPRA 1RWNA 2FX5A 3LUDA 4R8VA 3GP3A 1HZZC 4MQ6A 4QXOA 4U2KA 5EHNA 1II0A 1V6AA 2AFHA 1X7DA 1L4LA 1OX5A 2CXUA 3PICA 1XI2A 2IGBA 5K8IA 4YIHA 3DO8A 1EFPA 4RF5A 3VKUA 4JNCA 1FS6A 2Z5VA 2XUDA 1ZCFA 2YX1A 1NULA 4GBJA 4TKUA 3GLHB 4ZYLA 1BZYA 1SVWA 1BAPA 3LBAA 4ZD6A 3WLIA 2PVPA 4PVCA 2ODWA 4IVNA 1R88A 2GNOA 5CGZA 3PYLA 4YV7A 4B3GA 2O7NA 1N4DA 1HLDA 2VP2A 1RFGE 2V9ZA 4F8JA 2JAWA 4XJXA 2I71A 3MOGA 3K35A 4MR7B 2AN1A 4QQKA 1G66A 1RQNA 3JZFA 3OC0A 3PNYA 2HFJA 4HJRA 4RY0A 4PO8A 4UDNA 3U5ZB 3AWDA 1VHWA 1NVFA 3IRUA 4DFDA 3QY9A 2GZAA 2ZIAA 4R8RA 4X94A 1WOMA 3JQDA 1RYZA 4Z86A 3WB1A 5IMSA 3LG2A 2F3TA 3A58B 2Q5FA 4G8CA 4OQXA 3MTEA 3A06A 5FLEX 2AN4A 3LXMA 5HUQA 1LXCA 1N36B 4G1FA 4GPBA 1SIOA 1PD1A 2X1HA 1C9EA 2XCQA 1F1BA 2V5AA 1R0KA 1P1BA 2ADOA 1V2GA 1BE0A 1HH4A 3DM5A 2COEA 1EX6A 3BFVA 1C7QA 4QYWA 3TTTA 5A9RA 4WNAA 1TKBA 2XD4A 1SOMA 1XD8A 4FFBA 4QUAA 5TC4A 1P2VA 1V39A 2WZBA 4LWZA 3C3XA 2PSSA 5CM2Z 1L5WA 3L7KA 3RKRA 3B2EA 4M0LA 1MO3A 4EYEA 4KUEA 1RLOA 4D25A 3KDPA 4D43A 1I7PA 1O6FA 2QIOA 3Q0TA 4FQ7A 1X39A 3G89A 5AXCA 1UJ4A 1Y1PA 3BJIC 3LQRA 5K3FB 5EP4A 4QPPA 1T4DA 4Q3OA 1UKEA 4UMEA 1MCZA 1QH8A 4ITUA 1LRJA 5E3JA 2O7VA 1RBYA 4F2GA 4GOMD 2FZVA 1QP8A 2A4KA 4C87A 3W3AD 3NFRA 2NTEA 4G97A 2QORA 1M0TA 3S99A 4FMPA 4HX5A 2OBFA 1WXGA 3OUZA 2XYHA 1E69A 4RA9A 3RUAA 4FS8A 4YI3A 1KSHA 3FOZA 2G7MC 4RF4A 1ZOOA 3DFUA 1D6MA 3GJYA 4ZKEA 3PQEA 4AN1A 1L3IA 1P31A 3P9CA 1TM4E 2DBVO 1X0VA 2EW1A 4GSLA 1DBQA 4LF9B 3GNLA 3EULA 3D2LA 1DBSA 1OASA 1QS0A 5CM8B 5IM5A 5DM70 2XA9A 4JLPA 2JLZA 3FR7A 1X9HA 3PNPA 4LF6B 3TS1A 3LT2A 2Q5HA 2HHLA 3I8SA 3OY2A 1DX6A 3LOUA 1SBNE 5CYFA 5K0NA 3T0GA 5J5VA 3EDRA 3ZTTA 2NZVG 1UMCB 4UE3S 1RLIA 5KNDH 2OGTA 1DX4A 3NIWA 3OAAD 1HE8B 3OP1A 1C9YA 3UAXA 2JBAB 4ZVTA 5ARBA 3KJHA 1F20A 4L78A 4IS3A 3VNAA 2WD7A 1G3RA 2OO3A 1A9TA 1JHZA 2ONCA 3QUAA 1D8AA 4FYMA 1RZRA 5CDHA 3R7SA 2F55A 3BKWA 2OYRA 4H7DA 1V5IA 3VU0A 2VHXA 4AYXA 4RPCA 2FZ4A 3AVUA 1SY7A 4C7JA 5JALA 5K6RA 4PPYA 4MULA 4FHEA 3A1EA 5DYNA 4O33A 2NVWA 3G7SA 4ACAA 1GU0A 4BFTA 1RCTE 4D6XA 2B4AA 1F14A 3WK5A 1N8SA 1E92A 2OILA 2X8JB 3HCWA 2C97A 4A15A 4WKNA 3DL4A 2P2ZA 2HMUA 3B12A 5DMHA 1N2HA 1JWBB 1BMDA 5EP2A 3LLUA 2PDAA 1CETA 3GGJA 1EE2A 2X13A 1M8JA 5KYUA 1YXMA 3AZOA 1WDMA 2GHIA 5K3BA 1N7JA 4I55B 3RVDA 2XQKA 3EN0A 4UNSA 4KMMA 4ZEVA 4JEHA 4BX8A 3NBUA 4QQNA 3PGVA 3I30X 2JCVA 2HC9A 3O8QA 3ZU3A 1KL7A 4JI2B 2VZ8A 1ADJA 2I87A 1P8AA 3K9GA 4NYIR 3KYDA 4YN3A 5H80A 1AQJA 1K8XB 3EXEB 2EC5A 1W48A 2X23A 5AWFC 4N6GA 3INNA 4QOHA 3S6JA 4OX9B 3EIEA 1N0UA 4JP5A 1CIVA 4XA8A 5A1JA 1XTTA 1G8MA 1XCBA 3DTVB 3BF7A 4GLOA 4KR9A 5KHAA 4U7WA 3SJZA 2VDWA 4K86A 3WRWA 3U5TA 4MRMA 2YFQA 3HXTA 1SH7A 1RSZA 5B36A 3TQOA 2PUWA 4C3VA 5K4GA 5K8LA 1UPUA 4FFLA 3TZ6A 2Y2UA 4OPMA 1MOPA 2V7QA 1JDUA 2DY1A 3K09A 2AJCA 2BKVA 2I2BA 3MUNA 3H5IA 4NQRA 2ODEA 1GQRA 2VFAA 3JSXA 4KX3A 4LXGA 2QL5A 2VBCA 2WSIA 2JNWA 3BXHA 4RORA 2J48A 3Q9SA 1Y3CE 4EECA 3EJ6A 1MVNA 1U8AA 4EUSA 3PF8A 4LBVA 4QQFA 2L0XA 1FFXA 2JIOA 2VG8A 4UZFA 2CHEA 2QF7A 2XZOA 4GMKA 3T1VA 1ULAA 2IEBA 2PL9A 1RTTA 5EMKA 4C2TA 4NWIA 1E1MA 1Y8CA 5KSOA 1OV6A 1RAIA 4AZ0B 4GLFA 5CAEA 5CX1B 5C1DA 2JJQA 3B85A 3UXMA 3DLTA 1WEKA 1T36B 3MJHA 2DKNA 4DC1A 1G8YA 3FAZA 4QXQA 4LI0A 4N4AA 1O5IA 4R01A 2CXSA 2VEOA 2YXEA 4PZUA 2V97A 2LW7A 1SQFA 3VVBA 4M53A 1S6YA 4GX1A 4B81A 1L7BA 2I7TA 3NHMA 3NEYA 3ZGOA 4DUPA 4MNTA 4YMUA 2J5KA 3Q3JB 3MBKA 4UTRA 4JL8A 2VAVA 4F71A 1SU8A 4UVHA 1HE5A 4W8GA 3AF6A 3LLSA 3UB3A 2ERYA 2YNMC 1W0KA 2PUVA 3R0XA 3JR3A 1Z7GA 4X1OA 1QH0A 1QCYA 1CJSA 3KKEA 3FUXA 3R6GA 2PNFA 1O7JA 1QX3A 1MEEA 4ME6A 1J21A 2KSQA 2X7JA 4MI3A 4ARZB 2GKGA 5I4CA 1P44A 2ID9A 3UWMA 3VUEA 3LC0A 1JJFA 2YMLA 5I7FA 4JQCA 5E3HA 3DV0B 1GSOA 4NCKA 4N6NA 4X1YB 4BWVA 3EQ2A 3N58A 2A9KA 4CMIA 2FN4A 3HNRA 5KJFA 2AEJA 1JE1A 1LI4A 2OUKA 3MELA 2PKQP 1L3BA 2W6NA 1IWBB 4N3AA 3RUIA 2G77B 1IOLA 4OHOA 3VYRB 1FF9A 1XMPA 3NFYA 1Q7TA 4KC0A 4KK4A 1RBZA 1K6IA 3VC7A 4IH1A 4BVEA 4CEIB 3RFVA 3FPAA 4A8JC 2HR1A 1WHSB 4JEIA 3E48A 5B7PA 4J0FA 1Y1QA 4QXAA 4F4JA 1C2YA 4YFVA 1F51E 4IDFA 3KSZO 4I5EA 4RX1A 3PEUA 1WNFA 4OHUA 3D4LA 4ZTUB 4B6FA 3T7IA 1YC2A 3I0MA 4Y2QA 3ZHTA 1YQDA 1PZEA 1IM5A 2Q46A 2OE2A 4EABA 3FPSA 4JHLA 3EZYA 2XLCA 5K0FA 2MWMA 1W46A 4MW0A 5LWQA 3T5GA 3K4QA 4RSRA 4CM5A 4TLDA 2BHTA 4CL0A 1H9BA 1UBEA 2FKAA 2NO0A 2Y1FA 3L8DA 3QEJA 3UXHA 4CG2A 2J3LA 3S2YA 2JHPA 2O48X 1Y8QA 4BLVA 4H7FA 5LOVA 1RWBA 3Q41A 1ZIDA 3QSGA 2Q45A 4UU8A 1AUOA 1WZCA 3R3HA 4LFAB 1NXWA 5I3ZA 3JWIA 4QUHA 3FYSA 5JXJA 2CW5A 4ZJZA 3BMOB 1AG9A 1Y3FE 2ISCA 3FF1A 2C2BA 5JZVA 3GPCA 1XU9A 3OOWA 4TMWA 3DMDA 3D8HA 3ZE9A 2GM9A 4DJEC 1PWZA 2I1LA 4L4UA 5FFFA 2CD9A 2GSDA 2F67A 3VUFA 2WUWE 3A9WA 1OWPA 1E4EB 2H29A 4MR8B 4Q1VA 2NVBA 1R12A 1ZRMA 3AUSA 2EF0A 4J6FA 2O2EA 4HNSA 2I2WA 4MWCA 5DPMA 3PNKA 3PVCA 3WO0A 4DRXA 3TRHA 3UV7A 2HA7A 4A3SA 4BO3A 3KLPX 3UMCA 2X40A 421PA 2NU6A 1XNRB 3V48A 3T99A 4AJ2A 5J5CA 4MK4A 5KQRA 2QROA 4HNHA 2GBGA 3AWIA 4OYHA 4NBLA 3UKJA 1CY8A 2ZSKA 3SFVA 5JHGB 1QV9A 1OTXA 3RSOA 1Z4QA 1N2ZA 4BVJA 1E2JA 1NX6A 4GZ3A 4S24A 1E1YA 1HFWA 2ATEA 3GJRA 3E9EA 2B8TA 2X8AA 1I32A 4KOEC 1QO0D 1CUUA 2PZJA 2EU8A 1DAHA 5JR3A 1VLQA 5LU9A 2QGFA 1XZCA 1DSSG 1CY0A 1G291 2HMAA 3MTDA 1CV2A 2ZE7A 3MM4A 4LZWA 4NYJR 3R76A 2M6KA 2G4VA 1GPYA 1HRKA 3FHOA 4FT4A 4GLLA 1NVDA 3AB7A 3PGLA 4HGZA 1DO8A 4KNWA 4Z4GA 2P4SA 3LXRA 4ZTBA 3P45A 4EG1A 4ZQIA 1F6BA 2NV6A 3WP0A 3L0CA 5IG2A 5EUQB 2PWAA 3IL2A 4PYLA 5B6PA 5FUXA 4ZVLA 2C4TA 2EG9A 3B52X 1UK9A 1XA3A 2FN7A 4JB8A 2RGNC 4R6XA 4EMBA 2JZCA 4C30A 4HUQA 4OK3A 1UWKA 3O6VA 3V8EA 5I9BA 1N92A 3BWVA 4B0OA 3A6PC 2IE0A 4B47A 4BTVA 4LY0A 5J9FA 3WDKA 1OLOA 1U81A 5C2JB 2C03A 4MQFB 4PZAA 1QK5A 4TX1A 3BH0A 2V7BA 5G40A 3VPFA 3V4FA 3YASA 4KR6A 1SVUA 3UK2A 1YB6A 3F4LA 1XJWA 3HCNA 3R0QA 2VP9A 2WABA 5AVWA 3WVNA 3O1IC 4EL5A 1RWQA 3BRWD 4X84A 4IDDA 2BTEA 1G21B 3ZJTA 5D8DA 1VJ0A 1XL0A 3B8HA 3CGGA 3ZCQA 2XQFA 4DUGA 3D54D 2FUCA 3D8NA 3L7LA 1DKMA 1TQHA 3ZWAA 4ZYWA 2JD2A 4I14A 4OY3A 1MC8A 1R8YA 1I5RA 2Z83A 4POAA 4B32A 3PDIA 4UEWA 5AIAA 5GAJA 2F8MA 1VJCA 4YUWA 5K6AC 5JPIA 3OZTA 1VBNA 4LNHA 3HYLA 4RGQA 5F1PA 5F4ZA 1QVZA 1P19A 5FPTA 4WY8A 1GV0A 5J2UF 1DPFA 1EK5A 1GPJA 4XRRA 4COKA 4BKQA 1DE0A 1M5TA 1YQTA 2XUJA 3KSDO 3PPYA 3G2QA 1J23A 1XC7A 4MS3B 1JKJA 3O8LA 3G9ZA 3W2IA 4Q66C 4ND4A 1E1LA 4W5QA 1F8YA 1TB4A 1NI5A 4NBWA 4QATA 4DLKA 2VTKA 4RTPA 1AJEA 2ZU0C 3JYPA 1DHTA 3GFSA 5B53A 3MBIA 2VF7A 2QRPA 4RQUA 4WFQA 3WOHA 4QM7A 3FZEA 1CUXA 5I7AA 5C3MA 2HN9A 2VBGA 2AEFA 1NLMA 2CYAA 2CFSA 5ALYA 3LVRE 1TM5E 3I1JA 1PGOA 2Z5LA 4HEA1 4Y2SA 4YWJA 4AZ3B 2ZRKA 4ISBA 5BSGA 3WGOA 3WGGA 1V8FA 4KYTA 4QHSA 2FPRA 4CG1A 3ZDFA 1MH9A 1N8NA 4Z9BA 4CQMB 4DGSA 4AKIA 5CCXA 4MV1A 2DQKA 3A0RB 2YMQA 4NFYA 4QU5A 5F73A 2UYOA 3B9QA 3UG6A 4NPAA 4AG6A 6CHYA 4GI5A 5EE5B 4ZQGA 3W79A 1YRWA 4UBNA 1UR5A 2E48A 1NGSA 1A2KC 4B46A 3JQGA 1XBTA 4Y2GA 2WWGA 3NRCA 1PT5A 3THXA 4IHJB 2P5TB 3M9XA 4MI6A 3CLSD 1CJKC 4X60A 1OAKA 2E6KA 1ZK3A 3KOYA 3CVOA 1ITZA 3C1UA 2PR7A 3FKSD 1PFQA 3LCJA 4IIJF 4MITA 1E3DA 4BAGA 4J9UE 2JI7A 4GPIB 2P1DA 5K9ZA 1KU6A 3FSJX 3WYEA 5JYBA 1R9GA 2EKQA 3H4MA 4DLRA 3OHMA 5CB4B 1LPBB 4HFNA 2VBFA 4MWBA 4CKBB 3HTXA 1CUZA 3SM9A 2W58A 4UPDA 5ALMA 3EGXB 1JSZA 3DYBA 3Q85A 4IZIA 3UAZA 1VGVA 3QNMA 3COJA 1JPJA 1YBHA 3G82C 4MJLA 4URXR 1W73A 2RONA 3QIVA 4F96A 3AVWA 1RWVA 1EFDN 4JZKA 3P2JA 3ZHXA 2PE5A 1E2BA 1Z08A 4BECA 4OQYA 1P9LA 4WXRA 2VLIA 3K05A 4ZVVA 3RRYA 3TECE 3V4RA 4YUAA 3R41A 4QUEA 5COBA 5JIBA 4RVOA 4BCDA 2HV9A 3G02A 3NVKI 3U17A 5CVDA 1BWPA 3TMYA 2HPVA 4NNPA 1QVWA 2QD3A 3NANA 4OK6A 3CRZA 5J1TB 2UXBB 4W9RA 2VQEB 2O6HA 2I0FA 1G3UA 1JJVA 5EZ6B 5IK2A 4EDFA 1CUYA 3OZXA 4ZVOA 4NK5A 2F9FA 5JCXA 4D9FA 4DNOA 1GGEA 4AJNA 1SD5A 4A8TA 1CZOA 1LBIA 2OQRA 4RNCA 3F9IA 3ZVLA 4Y7CA 2VDOB 1LK0A 3FI9A 5TT1A 4EJSA 2ZM6B 1BCRA 4M1KA 4FINA 4GGMX 1ZUWA 1LBEA 2DJIA 1XOIA 2YYYA 4BFUA 1R4AA 4KL8S 2H3HA 1MW9X 1QF7A 3PQCA 4M9CA 3AEKA 4CEHA 1G8PA 1ZGAA 2A2ZA 1B26A 1F0PA 2OBLA 1T2FA 1B76A 1OKKD 1SCBA 3B6EA 3KXDA 4H4DA 3FUTA 4M7OA 4MJ3A 4WLEA 4X1IB 2ZR9A 3RODA 1MX5A 1TPYA 2R2GA 2WICA 2YC2C 4BVFA 1YS4A 1DZIA 3F2VA 4JLAA 1XMQB 2AQKA 1C7EA 4PBSA 1JH9A 1GL3A 1QX4A 3PPIA 4KBYA 4ZRDA 4DABA 1J8DA 4AQYB 1NUUA 2OCAA 1KSFX 1AK2A 2YQ5A 1AO0A 3AVTA 4AG5A 5EE0A 1XJQA 1OXTA 1RXUA 5AHOA 5B3AA 4KFCA 1NXQA 4G0PA 1WCV1 4ACBA 2CVZA 2XWQA 2ECOA 3KM0A 4R3NA 5KJEA 3ZVRA 2FSSA 1KVRA 3DO6A 1LPNA 3G2IA 4JC5A 4HWGA 3PQ7A 3A31A 4ZYUA 1VIVA 4JD5A 4NV0A 1I1HA 1VOTA 1YKSA 4X85A 5T6MA 4N03A 3OZ7A 4W5RA 3NIDB 3W9UA 3AIOA 3H99A 3KO8A 5CBKA 3C5CA 2XX3A 1PEAA 1RJDA 2C4VA 1KWKA 4HUTA 3KZOA 1O94D 4I1OA 2J9ZB 1YU6A 2X6RA 3T06B 1CQIB 2FDXA 2J33A 3P2IA 2CSUA 4ZEOA 5EIWA 1MA3A 2E6UX 2V7EA 5DNVA 1QMPA 2Q6IA 3ESAA 3NW9A 2ZYHA 5DBFA 4TTTS 3R3SA 4K1LA 1P3JA 4OXNA 3E22A 4GC5A 2GN4A 1FVFA 2BKAA 3UANA 1CJTC 3BD9A 5HNKA 1ZUNA 2J3IA 4OREX 4L74A 5CLIA 1DUIA 1TK3A 4UXJA 4ZQCB 3EQ8A 3WR5A 4JLUA 1TCAA 1W2WB 1XPRA 3QYFA 5CHYA 1R8SA 2DUWA 1RAAA 1TLFA 1XRQA 1PG0A 2JK1A 1VYHA 3EH2A 3O9VA 2HTFA 4UMFA 3GZNB 3HA2A 1QBGA 2VXYA 2X8LA 4FKZA 4M98A 3RS5A 3C3CA 4BAUA 3W8FA 5LJLA 2Y68A 3WNBA 3T7EA 4ZIRB 3WGMA 3ID6C 4DL9A 1ZVKA 3AUXA 1ISSA 2QVCA 1EM8A 3ZBUA 1DEHA 3NWEA 3V97A 3SIRA 1LD3A 2VUSA 3DOUA 1EKXA 2XUHA 4HDOB 1JQAA 3EVNA 4B4UA 1JH8A 2W4MA 4NULA 1DKQA 3RTAA 2FUNB 3IAS6 5EIEA 1PT7A 1JDVA 3M3HA 4CDGA 5AVUA 1KJ9A 1RYDA 4OBWA 4JB3A 2FX3A 3ZWKA 2LV8A 1D03A 2EL9A 2GERA 4RIEA 1GRCA 4CU5A 2X7XA 3NS7A 3HL0A 2NWQA 3UK7A 1NR1A 5DBGA 4R0NA 1DXYA 4D6PA 1QYIA 5HM8A 2XKJE 1VL1A 4RKEA 1KDRA 1OI4A 4B2LA 1P7ZA 1DEKA 5FNZA 1L5VA 4PZ9A 5HQTA 3EGWA 1PGPA 3NYRA 3VMMA 3PUJA 3UBMA 4B48A 5JD5A 4GDFA 3A1CA 1NDHA 4UATA 1J20A 4BB6A 1B14A 4JJ7A 2WWXA 4EYQA 2ZIZA 3FJOA 2PUJA 1VCHA 5CIQA 1YSCA 2R8EA 3USCS 3ILSA 5K05A 1ESZA 2PHZA 4FTWA 1HT3A 1GL6A 2JLYA 4F45A 2HLPA 4FGKA 2RHCA 1AKRA 2QY6A 3E5HA 3CA8A 5A7FA 3X0DA 1E5LA 3EZ6A 3JWHA 3T6KA 2BLNA 2P67A 2FZWA 2XVAA 1D6JA 4QFMA 2CLLB 1FTGA 3HKEB 1RQPA 4J9VA 2WINI 4OD0A 5CYOA 4DA9A 5B37A 5JXGA 3E15A 5L7YA 1GR0A 1G64A 2VK2A 4ZT7A 5H70A 3ANLA 2XRMA 4YRRA 1A7AA 4W4TA 5JFTA 5LQAA 4RBNA 2Q5EA 5LXTA 3K6SA 2MT9A 4UFNA 1BRMA 5AVQA 5KQLA 4U00A 3DAFA 5G0UA 4NCHA 1SCDA 1XQ1A 3QMPA 3H6HA 1EH5A 4RVHA 2B2NA 3CUTA 3HHPA 5IFKA 3U60B 4CMHA 5EPOA 2HQBA 2P27A 2IUYA 1TU4A 3QSYA 3NMUF 2O5RA 5CVVA 4ZA2A 1XTZA 3TVDA 1G20A 4XM1A 3LW7A 4N5NA 3T7DA 4Y2JA 4O4HF 3RNLA 2R00A 4TQAA 3DDZX 3U3MA 1KK3A 1GTL1 1PSWA 2OEPA 3MTBA 1Z6GA 1PVVA 3FBGA 5DM2A 1M74A 4CKYA 2HK9A 3ZGVA 3NETA 4FZ3A 3UT5B 3TTXA 3ZY2A 3WZLA 1P72A 3VC2A 4OFXA 3ZWNA 2O23A 3QKSB 1TK9A 3MOIA 5A5DA 1ZK0A 1FP1D 4DC0A 3CCCA 4PX9A 5AM5A 3NASA 2P8SA 1KAMA 4QYMA 4WZAE 4LFCB 1XVAA 5KSYA 1ZK2A 3PK0A 3A1SA 4EZIA 4ZOQI 1X9GA 2CZCA 2WTMA 1CR0A 1EPUA 5DM60 4G23A 2E9SA 3FRHA 3W1VA 3KOXA 3TOCA 2W6IA 3GQBA 3CVUA 1YH3A 1L5FA 3PG5A 4UM9D 2KMLA 3HYRA 4E7PA 5A5EA 2PH3A 1C4KA 1RPAA 4URFA 3IT1A 4DIDA 1Y9JA 4WX2B 1W36B 4MJXA 5LSAA 2H57A 3I2HA 3GOQA 5FNVF 1ZU5A 4G5GA 1WZ2A 3O8OA 1XQXA 4ZC1A 4EWLA 4BB5A 2NM0A 2HGSA 1IQUA 3ANNA 3U44B 1BXGA 3DLCA 3EEYA 3NHLA 4DQKA 3TYXA 4F4HA 1RP1A 3WYGA 1H1LB 1XHFA 1ZMRA 3HLKA 5T8KA 3T3DA 3V7UA 1XTUA 2AMJA 2BBSA 4KRGA 1ESEA 3Q72A 2PRSA 3W06A 5JSKA 4N5MA 3P9QA 3HNPA 4QTTB 3TDKA 5BNTA 1NVBA 1A5BB 1JA1A 2YTZA 4Y2XA 3WISA 2BSXA 1U11A 3ABZA 4EHFA 2BGRA 3KT6A 1AHHA 1AM4D 2CF5A 4G0VA 3BOSA 4ETWA 4ND1A 4YP7A 5HRCA 1U9JA 1X15A 2A1TR 3EF3A 3PKZA 2MOKA 1F12A 3BMQB 1KXZA 3PX3A 4YIKA 1VKHA 2BGIA 1WVMA 1XELA 2QN3A 4QM6A 1KYQA 2FRVA 5CDGA 4DV2B 2WWWA 1XZDA 1F4LA 2GTPA 1YIAA 1E5TA 2IIVA 3D6NB 3M6VA 4RHCA 4WNCA 4CF5A 4CCAA 1IZ8A 1KK1A 1UBSB 5JAQA 3EPHA 2PY6A 3H2GA 3JQ6A 1L5HA 3ZK7A 2CWWA 1SKBA 5K09A 4Z2AA 4O2BF 3ZWOA 4XKJA 1KFEB 3FN4A 4M1ZA 2BTQB 4BLPA 4LPSA 3R6DA 5L51A 3BZUA 1ESMA 2JI9A 3WGNA 1DC8A 3T3HA 2CLHB 1DRUA 2HIMA 2ZW9A 3UQZA 3EOZA 3DBRA 4CQJA 1UT5A 2YY6A 3NALA 4OKIA 1EUQA 2NO7A 5BWCA 1ONOA 5HFJA 3N7TA 3TOXA 4DLNA 3AFNA 1X1RA 1Z4PX 4BMZA 2AOVA 5JUWA 4FMCF 2H8KA 2XI4A 2DECA 2IHUA 3ONDA 3KYBA 3D8UA 4IFBA 4MLZA 2ZWOA 4K6GA 4MVJP 4RD0A 1RYYA 4DQXA 3O2SB 4X0EA 5I5GA 2BONA 2PKRA 4DW8A 4EHKA 3EZXA 2P69A 4RVUA 1HQDA 4NU5A 4ERNA 3R3XA 1YT5A 1AZLA 1JDTA 3DVAA 3LUFA 4W8OA 1IZ0A 2DMRA 4IIJA 3REOA 1FP7A 1E6KA 2UUBB 3ZU6A 4YO7A 3GYGA 3FNHA 5DSXA 4BQSA 5LLDA 1BNCA 4N8SA 3D7NA 1Z9BA 2RHTA 3EIFA 3QMMA 3VGJA 1KF0A 1AQYA 1GPLA 2P2GA 4NNOA 4OB7A 4XQCA 2IZ1A 3ELDA 2HSJA 3H5TA 5D51S 3OQMA 4NG5A 2PMEA 1YASA 5ALPA 1F5NA 4NXMB 2DUMA 3IHLA 3OU7A 1VL8A 1KY5A 3OQ1A 1PL0A 1XGKA 1Z5VA 2IHVA 3ZUPA 1YFLA 1U2RA 3I0NA 4X00A 3CGWA 3DM9B 2D13A 2PMDA 3ESQA 3Q8WA 3QVXA 4Q4AA 4JOCA 5AJTA 5LQNA 1NV8A 1T9AA 1KARA 1M8PA 5I4KA 2I29A 3TIGA 3UHJA 3GFVA 9ABPA 3JALA 5L9AA 2O4CA 3R0ZA 4MB0A 5EIBD 4CL3A 2VDMB 2VHQA 1T5SA 4C7VA 1YB7A 2GCEA 3A27A 3C4JA 4AQDA 3LX4A 5C18A 3F4BA 1CZRA 2GXSA 3IXQA 3K0AA 2PUGA 2OZLB 1UH5A 1T3SA 2GZSA 1P81A 4Q4CA 2BDEA 3N05A 2C5SA 1EFLA 2RH9B 3OQBA 4WERA 4JV5B 3OQHA 5KTOA 1KAEA 1D0VA 1L7PA 2HPHA 2Z2JA 3H0CA 2I03A 4I50B 5B6JA 2GYUA 4YJ3F 1UM9A 3L77A 4BWYA 1E3EA 3P5SA 4L8FA 5CJJA 1G16A 1LLDA 3LC7O 4PGFA 1X74A 1T3TA 4Z8YA 4YUZA 4LDAA 1JJAA 4PG5A 5AJWA 1KP3A 4KN5A 4X8HA 4RXUA 4EF4A 2QQ0A 1BMTA 1ZGZA 3LK7A 1ESCA 4QELA 3TZEA 5IAGA 1FLNA 1V8PA 3KS9A 1TI7A 1KJWA 1QGZA 4RLHA 4Q01A 3HCDA 1W52X 3WL3A 1TM7E 4IH9A 4BRSA 1B6GA 3OBBA 4P3YA 3V3KA 2P6NA 3RGGA 3OUUA 4GICA 4HDMB 1TUBB 2XT0A 1EDEA 1PYGA 1ZD4A 3FNRA 4RF3A 2BJVA 4NAHA 3WB9A 2AR0A 5LPNA 1LBSA 3S29A 4GZLA 5A4IS 5CLGA 5AJZA 3T95A 1YRAA 4KREA 3L1JA 4D56A 3LLMA 4NATA 1OBOA 2OCLA 4M6WB 3BFPA 2DQ4A 1I5OA 3TGPA 1J1UA 4EGQA 3LPCA 3FKJA 5A3QA 2WA2A 1Y63A 1RLJA 3F2IA 3UCEA 4BTLA 4DLPA 3VNRA 3AQIA 4OU4A 5LIRA 1VLVA 3FSRA 3EHEA 2PIAA 5L7TA 5M34A 3DVQX 5DLYA 5DT2A 1A98A 1KI6B 1ULZA 2Y0DA 3GAZA 2HL6A 8MHTA 3GCWA 4MTLA 2FZEA 4UEKA 4A0QA 2XXAA 2JI6A 1B1AA 4MUKA 1TVKB 2JDID 3NKLA 4O5AA 5EUCA 1T4CA 5LDGA 4C04A 4NEHB 2C8KA 1IL0A 2QLJA 2YY5A 3GEMA 1H8EA 4ZAZA 1Z18A 4P3PA 2JAXA 1U9IC 4G4JA 3HU1A 5ALGA 3L6UA 5A62A 2FEPA 3QP9A 3H9UA 4ZVSA 5JJ5A 2Q1UA 3RVMA 5BYKA 4DA7A 4WFKA 2J0UB 1J24A 2YIDA 1JQDA 4Y2RA 2BMWA 4P3NA 4A0GA 4DARA 4DXHA 1U7WA 5SY6A 4EVQA 1O94C 3RVSA 3UGQA 5JBNA 3D8RA 2A0UA 1WCIB 2RGCA 2H17A 2YCLA 1Y7IA 2QDKA 1YV9A 3P0FA 2A1UB 4GR9A 2AR9A 3AR7A 3GRKA 4BXOA 3DTVD 3QVWA 3I1IA 1P74A 2OG1A 3KQOA 2D1SA 4YAUA 2FJPA 3VTKA 1ZA1A 3S2UA 1P6XA 3T7SA 4RKFA 3H6KA 4I4LA 4KXMA 5H1YA 3I39X 3LJKA 1K7XB 1K68A 1MORA 3CYFA 4J29A 3AF5A 4K9DA 3RQSA 3VR3D 4PGAA 5EJ8A 1P7PA 2I9PA 3OIVA 4KW7A 3TZQA 3JTMA 2WHPB 1RTKA 3NT5A 4F6LA 4AJ9A 2K6GA 4JJFA 3M6AA 2MMGA 1MA0A 3BJRA 4HWKA 1B0ZA 2LIVA 1B6TA 3E82A 1GJRA 1SAYA 1P8JA 5C9ZA 3RSGA 1PO7A 1QU3A 4Y0NA 4H7JA 4E11A 5AW2A 2O5CA 2EGUA 4TLLB 3H8JA 3CRQA 3CF6R 1LDMA 1PL6A 5L40A 2RDMA 2FPGB 4PLVA 1FA9A 3HVJA 3H83A 3VHLB 1YS2X 3V4VB 1SOAA 3QVTA 4OXRA 1FFDA 3C3AA 2OXFA 4MVJF 3W4KA 3D02A 3TOSA 1A27A 3HB1A 4Z0TA 3A1VA 3SQLA 5BW6B 1EXWA 3BM5A 3CB4A 1KMHB 3FROA 4CMEA 2FQ1A 2ZR0A 3BCSA 3VH1A 3EJWA 2IJGX 2GJKA 2J9XB 4LKOA 4NKRA 3DDNA 1PNOA 1BKYA 4JT8A 4IDCA 3OPVA 3D2CA 3VX4A 1FJHA 4FGWA 2C5EA 5I9NA 4HG2A 4L6CA 3GLIE 4DV4B 3A3PA 4XLZA 4XFDA 2BDUA 2Q2QA 2B1GA 2OBNA 3PLNA 4LJ6A 2VJCA 2EG5A 4AC9A 4Y67A 1CUSA 4XCXA 2J5BA 4NYMR 5GMOA 2PL1A 4EO7A 3FNGA 3ZD7A 3CVWA 3EFOB 4DKJA 1MQAA 5IP5A 5TX7A 3UH1A 1GG9A 1SG9A 2ADMA 2Y6UA 3HDQA 3VU9B 1R6TA 4FDLA 5ETJA 1E59A 4ESEA 2GWHA 5G0WA 5JY6A 1LFAA 2ZUSA 1MIOA 2K5UA 4KP7A 3RUDA 3CVVA 2QP4A 2H18A 4I5GA 3IURA 4UVGA 2O9JA 5FWYA 2FUG1 4PRLA 1LTQA 5IJZA 1O9GA 2QUIA 3LC1O 3WQRA 1DKNA 1O97D 2XYRA 2CL0X 4J16A 1FYFA 4KH1A 4D4JA 3U7FB 1KBQA 3FLAA 5JMOA 2XR1A 2Y9MB 3ZX5A 5HPYB 2QHXA 3QVUA 4QVKA 4C0LA 2Z6QA 1NPDA 4P4TA 4O4HA 1Y8AA 3WLQA 3RYHA 1DT3A 1F5SA 4R9SA 2OCYC 4RKQA 4R8KA 5EPEA 1GPAA 1T0JB 2CXOA 3I01M 4C0AC 1BC5A 1SQ5A 4CUKA 2O8BB 1XTIA 2H65A 1H6DA 3CO0S 5I48A 3T7AA 1K8QA 2NNWB 3OPYI 4D57A 2GEUA 4AO7A 1SPXA 1QC5B 2GCOB 5LD2B 3BJMA 4D0RA 2D2EA 3KTFA 1ISJA 2DLNA 1KMIY 2P2DA 2W6JD 3MIIA 3PUXA 3U7QB 5KYYB 1ZJZA 2JATA 1BH6A 2ST1A 3FGNA 4EYKA 2OXEA 3AUTA 1FX0A 4G4SP 1HL3A 1KO1A 4NMWA 4XR9A 1CEXA 2WKQA 3DBHB 1Q7RA 3K0EA 1E1CA 4UTZA 1JQ3A 4WN9B 3G9XA 3GK3A 1FCJA 3VOBA 2Y0BA 4UHBA 3JVDA 4WFJA 1U2GA 1GZVA 2M6SA 4OI4A 3R8XA 3BXGA 4Y0AA 2P3SA 1FDTA 5TSDA 3WKCA 3ITKA 2AF3C 4HXFB 4J3FA 5BWLA 4B4OA 2OFPA 4E46A 4MAMA 3JQAD 3ZNOA 1SU6A 1XALA 2I7VA 2YV1A 1ZICA 3GLHE 3OX2A 3QELA 2H5JA 4Q12A 3E7DA 2W00A 1CD5A 1UFRA 3ESYA 3SKVA 1QQ5A 1J56A 1DJPA 3EB9A 4G0MA 4WTOA 4DA8A 1CUAA 4EHAA 3PLAE 5LP6B 3PCXA 4XTRA 4JT4A 2WPDD 3V8BA 3FR8A 4ENRA 3VKWA 4KLAA 3S68A 2Q4EA 1JEQA 4PS0A 5DBHX 4BC0A 4DUZB 2BEUB 1JR2A 2WD8A 3DZKA 1RQLA 2Y4NA 1YI1A 1F6DA 1NI3A 1S2GA 3M0EA 4FFRA 1ODCA 1UMBB 2JG3A 1NNI1 4WT7A 1JBQA 3C3PA 4RZUA 3ZYCA 4ETNA 5AESA 4UEOA 3BHNA 2EEZA 2PU5A 5BP7A 1YU9A 2O2SA 1YQQA 4FJ1A 2PQ2A 2EW2A 5FPYA 3UWSA 4O2BA 2O59A 2WAAA 3GL9A 4FBMA 3GIDA 3IOBA 2AC2A 3BXFA 1WB9A 1L7EA 2VYVA 4XYEA 1XKLA 2F00A 2QN7A 5DM4A 4Q47A 3G8AA 4H3KB 3N7AA 1KPIA 4MAFA 3B1YA 3RARA 1UKAA 4F0JA 3R9KA 5BY2A 3LDUA 4D44A 2WWIA 4HD8A 1FRNA 3NR2A 1IONA 4KE7A 1ULSA 1XKTA 3RC9A 5AVXA 1DKUA 2ID4A 1GRRA 3FSGA 3IMCA 3DMTC 3PX7A 3CZ4A 3FLEA 3I42A 4CIDA 5F2NA 2P62A 4NABA 4O25A 4IIFA 1WEHA 3OFSA 1QFSA 1QZ3A 2V3VA 3D59A 1XFDA 3OMWA 2ROQA 4MW4A 4S0XA 5DBOA 4H1VA 3ZJYA 1I7DA 2FFQA 2I6SA 1SCNE 4FXPA 4RKRA 4PE5B 1H4TA 1CP3A 3C8ZA 5TE9A 4HP8A 4Y9SA 3KPWA 3AKZA 3FDZB 4LJ5A 4M88A 4BNYA 4WVLA 1DP4A 1L7OA 2FF7A 2DM6A 3RC2A 1U0HC 3T35A 1C1YA 2WJ3A 3MYRA 2QS9A 4OO3A 3ZCSA 3SMQA 3RYIB 5IH7A 3GVIA 1TRKA 1KFJB 3ADPA 5DXFA 5TPZA 4BO4A 2UUAB 1MQ8B 1AF4A 3N2KB 2IHJA 5HOQA 3E2MA 5ALHA 4F7WA 2RG7A 1NOKA 2W8ZA 3E7PA 3WL4A 2G25A 2YZKA 1VYTA 3DB1A 4BJ3A 1WU7A 3UGTA 3R3VA 4U6QA 3K7EA 4EHHA 4RD2A 1P60A 3P9NA 5K0BA 1IYZA 3LBIA 2E0IA 4RPGA 4CLXA 1Q5PA 1I4WA 3AHIA 3NEAA 4QRIA 3HJAA 1R5NA 2Q9UA 5FP0A 4PHFA 1XKXA 4F1JA 5JHHB 5LQUA 1KGDA 1PAUA 2QVBA 4P4GA 4UQLA 2VJKA 2VNAA 1GPH1 3GRVA 4L76A 5ARDA 1EP2B 2K4MA 3F7TA 1EUDB 1GNRA 2V6GA 4YJGA 4OJTA 1BVRA 2QJFA 1L5NA 1ZC4A 2POCA 3H4VA 3JASA 2SCUA 3HVHA 3L8GA 3LOPA 1ZMTA 4P7KA 1J70A 3V9AA 3W77A 3NHWA 1L6RA 1S02A 3BQMB 4G81A 3SSNA 2JCYA 4LQCA 4WOKA 4EHDA 2XMCA 3K6RA 4O4JF 3V3TA 4D0NA 4DIEA 3UTDA 4G65A 1KO4A 3PDHA 3E3LA 4DLXA 1YI8A 3HFRA 2QV0A 1KBOA 1YTLA 4H16A 4A2PA 1V1JA 4YJ3A 1XJ0A 1SURA 1GT6A 4IFIA 5AW3A 1RRVA 1NE2A 1NVVR 3WA6A 1YJ8A 5E6SA 5EIBC 1LWOA 3BWXA 1BYIA 1T8PA 5BOSA 1R0ZA 1UP7A 1ICEA 4G5FA 3TRIA 3W5JA 5FIUA 2A78A 2NUPA 3DUFB 4KV9A 1IIBA 5AOBA 1NW7A 1NVGA 1MX3A 1PJ3A 2ATVA 3UHFA 3L1KA 1JIJA 4CQMD 3VYUB 4TKVB 2VTBB 4R3UC 2MYNA 1FDUA 1FJXA 3A3KA 4HAZA 1SXIA 1Z06A 2DTXA 2F3RA 4GWLA 1HKHA 3VGPA 1PJAA 2XMQA 1PUIA 1KY4A 2R1VA 5JATA 3LTNC 4EO9A 3N3BC 3P19A 1QHSA 1S2LA 2IELA 4HSEA 1L4BA 3MS4A 4MWTA 3PHBE 4EJ6A 2FVYA 1RAEA 1C5KA 2ZU6A 4G0WA 1FNNA 4HX9A 4WADA 2PA3A 3ZLUA 3D6HA 1T9HA 2I6QA 2P6OA 1EB8A 2PANA 3HH8A 2JIRA 4UTXA 4CM3A 2H52A 2JGFA 4QYIA 3GVXA 4F6RA 5CG1A 3ADBA 1PR5A 1ZH6A 3HR8A 3PWKA 4RY8A 1QYRA 1Y34E 2PRJA 1OTHA 4R2LA 5E7QA 3MQ2A 1G4UR 3WGIA 1OFTA 3R7BA 2HRQA 1K0FA 4ESOA 1S96A 3PXDA 4CQLB 5HM6A 2AVDA 3WLEA 4D92A 1I4DD 5LZ9A 3F1LA 2WU8A 4WMLA 4BIIA 5K3DA 1WBJB 1V96A 1CRPA 5F5XA 2G5GX 3MT9A 1N2SA 3H2KA 3QLTA 4H17A 4MUIA 3UJBA 4D8WA 4JLOA 4M87A 1QH1B 2EWMA 2GPJA 3W2EA 2X9LA 2NUAB 2PYZA 1U3TA 3A2MA 3LCCA 1OYVA 4P3KA 5HCUA 1NUQA 3V4ZA 3TI9A 4EI7A 1ZZEA 2BMVA 3UKDA 4BRUA 2OAQ1 2DFNA 3EGVA 3G88A 4K9NA 3FZNA 1U0NA 4TV8B 1I1NA 3A6EA 1V1MB 3GJTA 4NONA 4JLKA 4PGHA 1O2DA 3RRXA 4Y6GB 1UMKA 2HAEA 3DHNA 1NE7A 1SC4A 2Z43A 4I4TF 4MA4A 2DCUA 3VC3A 3C4VA 2GJ4A 4WCFB 2C2XA 2H1LA 3C6BA 1KY2A 1YDHA 4J03A 3H3XA 4XD7A 4D99A 3LTEA 5A4MS 3I09A 3V1MA 2A5DA 3O0DA 3KKQA