4V3CA

The structure of alpha2,3-sialyltransferase variant 2 from pasteurella dagmatis in complex with the donor product cmp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
388
structure length
388
Chain Sequence
b'SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTAEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALYLTRANSFERASE
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
molecule tags Transferase
total genus 135
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v3cA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v3cA01
2IY8A 4V3CA 4V38A 3S44A 2C84A 2IIQA 4R84A 4V39A 4V3BA 2IIBA 4R9VA 2EX1A 2C83A 2IHJA 2IHKA 2IY7A 2Z4TA 4V2UA 2ZWIA 2II6A 2IHZA 2ILVA 2EX0A 4R83A
chains in the Genus database with same CATH superfamily
3U48A 3HWWA 4EBFA 4S1PA 3GLQA 3VR0A 4E88A 3IAHA 3RWBA 4B3TB 3HS3A 1ZN2A 3NIFB 3ZK8A 4Q3AA 1QG0A 2HSEA 2VOEA 3BSSA 4GGMX 4ONEA 5ALEA 3UN1A 4B6JA 4C7BA 3EHEA 5LOVA 3KS9A 3CGWA 4OHPA 4ZRMA 3I2GA 4A0RA 4YMUA 4FQ7A 2PE5A 4CVNA 1G5PA 4F91B 3U81A 3WDMA 2WBLC 3WGZA 4B44A 2P35A 3BXXA 4JCOA 4CKEA 4E46A 3G0IA 3SK0A 4PW0A 1P5ZB 1POXA 3UV6A 1OB2A 4BHTA 2JHAA 3ZE7A 4EI9A 2P6RA 1MAAA 2E55A 4I66A 3V4SA 4XFJA 2GJAA 3V33A 1X19A 3R23A 4BNVA 2Y1XA 1U7XA 2BFNA 1T10A 2FRDA 1USUA 5KNBH 1WLYA 4UU0A 1OU0A 3V6LA 3F7MA 2I65A 2ZPUA 5KTPA 2CDCA 3GJ4A 3TINA 2QU7A 1H3FA 1T9CA 4G36A 1X8XA 1II0A 2QAJA 2IVZA 4TKUB 4NWIA 4JVSB 1MIOB 1GDTA 2FFJA 1PDOA 3GW8A 1MP0A 3CFYA 3I0ZA 5SYAA 3RUDA 5AHKA 3HKEB 2ZVJA 3WYDA 2DBZA 4N6GA 1I9CA 2V65A 5ALYA 3WNVA 4MCIA 3E18A 1P1IA 1QPGA 1SUPA 3PGJA 5AWFC 4M4SA 2D2IA 2YCBA 4JASB 3RC9A 2PWPA 3UAYA 2W98A 4LF7B 2WZQA 3GHYA 4IQ8A 3LC1O 3U7QB 2P78A 4ZO6A 1J42A 4H77A 4PX5A 4BQEA 5TGTA 2AXEA 5SY4A 1HLFA 5BSHA 1H5UA 2XKJE 5KBYA 3G2JA 5L3ZA 4K1XA 1ZVVA 4ND5A 1KAQA 1KMHA 1LBTA 5JEEA 4F2GA 5KYXB 2JGIA 1Z0KA 1EX1A 1X7YB 1XRRA 2EX4A 1S02A 4E6EA 4R9VA 2Z1MA 4WZBB 4RY0A 1ZUIA 3GAFA 5LYJF 3ZGVA 3PDCA 2BVNA 4QAJA 4DF3A 5L53A 3JYPA 3AJDA 4HATA 1GQOA 2SNIE 4MGHA 5JADA 3KX2A 1FP1D 1PGQA 5BRNA 1THMA 2YNMA 1OBOA 5B7NA 3HFSA 4XFKA 4MVJH 4TLCA 4FTWA 1KJYA 2VIIA 5IX8A 4REMA 3THXA 1SR8A 4KHZA 2RCYA 2FEKA 3KR0A 1UZNA 3RS3A 1XD8A 3HKDB 1NBAA 1NC1A 1DXYA 3KB6A 3GEHA 5BN4A 5DTRA 2MDTA 2BKLA 3I6ZA 3ND7A 1PL6A 3QMVA 4WRRA 3U13A 1X1CA 3D6MA 2C8KA 1A4IA 2CNBA 3FWHA 3ADPA 4IOLA 3ZTTA 4DCMA 5TR9A 3T8YA 5B5SA 2PUVA 5BMOA 2Z6UA 1MO6A 5AK4A 3S81A 2NYVA 2XEXA 3MWDB 5C7YA 2AOXA 3RV4A 1U8UA 4EENA 4N9QA 5JBNA 4WFIA 2Q4TA 3V4PB 4LXHA 4FFLA 1OX5A 3D6NB 3E61A 1VI2A 5T3YA 1XRLA 3X1WA 5IUJC 7REQB 2COUA 4YS6A 5FOQA 3EVZA 3W4KA 2VHXA 5AOCA 5EP4A 2P2GA 2JI4A 2TMDA 2X1LA 3EIFA 3GJ3A 4NDAA 3WMRA 2AD1A 3T5BA 3ZDZB 2W00A 4RH3A 2OBLA 3Q72A 5IJ9A 1GRCA 1O03A 3MT7A 1AUXA 1UWVA 3D8SA 1IUNA 3K92A 3EXHC 2FFBA 4HFJA 1OAAA 4OSEA 4D8YA 2WSBA 2YXLA 3IHKA 2Q3MA 4RAQA 1E8MA 3AZOA 2ICAA 5FPPA 3WHPA 3NNDA 3PUIA 1ZXXA 3SC4A 5A3RA 5M04A 4UULA 5MN4A 2ZRGA 3UHAA 3EWSA 5ALTA 1A50B 1N6LA 2MR5A 5A1JA 4ZQGA 1XF9A 4J07A 2BZSA 3STYA 1P4RA 1T0BA 3R5KA 3WLFA 1OY1A 3H3XA 4F4CA 3DOOA 3ZXUB 1JAIA 2R6ZA 1RQ7A 2F59A 4CRWB 2MINA 1CY7A 1PJQA 3I8XA 3ZXSA 3SOPA 1SKQA 2GYYA 2LRHA 5E1OA 1A9TA 5IFKA 2PJRA 4BN4A 3L8FA 4JEMA 4HWRA 4CLOA 1SZPA 2BCJQ 4KACA 2VXCA 3WSTA 3OX1A 1RWPA 4OSOA 1CF4A 2IUFA 4PGMA 4B3DA 3L9WA 5HKAA 5BUQA 2KJQA 3VDMA 4K6HA 2FSVA 4XCQA 4FDUA 3MB5A 4HAXA 3SBXA 5I9SA 4R1QA 1X15A 2WAXA 2XTNA 4GWGA 1G64A 2JD1A 1X7ZB 1W2GA 2J4DA 5LYJA 4ND3A 1GKYA 3EEIA 5EHXA 4L9WA 2VHJA 4EVQA 2H8GA 1Z4PX 2J9XB 2NZ8A 2O2IA 3BJIC 5CW1A 4X3CA 5PNTA 2IBMA 5BV0A 4AP5A 3FB1A 4BY9E 2ZUDA 2XH8A 4KGVA 1M7HA 1NBOA 1NR1A 2RKWA 2BR5A 4GDMA 3ZLBA 3D6AA 4V0QA 3GZNA 1FRFS 1GLGA 4XUEA 5AHXA 2PQMA 4D6YA 1WZNA 5CJPA 3GT7A 1ADFA 2A92A 1ZM3A 4JQSA 4AP9A 3DOCA 1QCYA 1LBSA 1T5HX 3TW0A 1YB1A 4QNNA 3G0HA 1OYWA 1KJIA 1YDHA 5A9SB 2GWHA 2QN1A 4XGIA 1AS2A 1EJ6A 2PL9A 5EMKA 3QHQA 4XCVA 1MJHA 2Q2VA 4Q1DA 4QQRA 2HLPA 4H1WA 3WLOA 3O2JA 5IWCA 1WMDA 4BQNA 1A9XB 1F48A 2H9AA 1ENOA 1IY2A 1JG6A 1KR2A 4FSDA 1IJFA 1Z0JA 2O14A 2B94A 2O8CB 2Y99A 3IV9A 1WUKS 4DJEC 4YXWA 1XMSA 1T8RA 2D5BA 1FLDA 2Y67A 2I9PA 1JEQA 1U0LA 3ADKA 4IGEA 1K2WA 3R6LA 5C3UA 5LZ8A 3SJAA 4DW8A 5EXXA 3K0SA 4IR7A 4BMXA 5HMLA 5EP2A 3C1TA 4E08A 1UPTA 2DBYA 4WERA 3ZQKA 1G21B 4AJEA 4RHXA 3IP7A 4BZWA 4LMPA 1X1AA 3JWPA 3VR4A 2FR8A 2CNWA 3NKFA 1JT2A 1R10A 3GCDA 5JXJA 4JUFA 1NVGA 3CF6R 5CVUA 2ZB2A 3R5JA 1IZ8A 1K4MA 4FIDA 1P0FA 1PJAA 3PFCA 4Q7JB 4P58A 4RCYA 4YO7A 4DS3A 1DXQA 2WIJA 2R47A 1QNFA 3ISVA 4HQFA 2AV6A 1Y9DA 1Y3CE 4PS1A 2SCUB 5LP6C 3OCWA 3SXUB 1QDUA 2WABA 2V7VA 1XCMA 2CXTA 1ECJA 1PW5A 3HSYA 3IC5A 2H4JA 4LDAA 2QWXA 5LBIA 3VPHA 4PN7A 2HHAA 3FFTA 1C0EA 2R66A 4W5NA 2GS9A 2VSQA 2ZE5A 4OYRA 2NLOA 2XE4A 1MH1A 4F71A 3S27A 1RAFA 3KXPA 4C4YA 1Q19A 4IDBA 2J0UB 3LPDA 3TQCA 3FDJA 2CKMA 2YYAA 3GOHA 5IF3A 3F4LA 1MNAA 4DYDA 2LNDA 1OAKA 2A84A 5IJZA 1FYXA 5CCDA 4BVBA 2ZJYA 4XFDA 1JH9A 2ZBFA 4RPHA 3PFHA 4D98A 1DBVO 4EAAA 4BOYA 1G6KA 2AL7A 4DLSA 1JJFA 3LRTA 3D2AA 3DMTA 3BFJA 4J7UA 3DD1A 3PSAA 3Q7TA 4OHOA 4CUKA 3O9ZA 4D8XA 2XD9A 4HPJB 1GCIA 4I1SA 1QVVA 2HBQA 2QTVB 3PRYA 5A0FA 3HYTA 3F96A 4FBLA 1NWCA 2XCTB 3IO5A 4U2GA 2ZATA 2FPPA 1RSZA 1WXQA 4AROA 3CE9A 2FWJA 4F3YA 4X6UA 2GD0A 4ARAA 4DCJA 4WNYA 1OV6A 2O2CA 3V6MA 3WNDA 3M82A 5HA5A 4DIBA 4D5GA 1OU4A 3GAAA 2DRIA 3VA7A 2QE6A 3FOBA 3ILYA 3B60A 3EZFA 3WBFA 3DOUA 1FFCA 3T7DA 1XKXA 4PZEA 2BMEA 4PYQA 2FP3A 3RT7A 3WFZA 2P9TA 4CKYA 1ISHA 3RSCA 1UKCA 3ZLVA 3S68A 2J7PD 3TR0A 3SSNA 4HPXB 2AG0A 2KX7A 1QRDA 2ZJ3A 4MRMB 1V1RB 3MRXA 3DMPA 5EGSA 2AW5A 2XMSA 1PG2A 3WRXA 1ZHOA 1UFQA 3NP9A 4Q39A 4FCTA 3ITKA 1L1RA 3HDYA 4JSYA 1JDBB 3O47A 4LIPD 4DSZA 1V37A 3OVMA 4AJKA 4A5OA 4BB5A 721PA 3QP9A 4OQXA 4HGQA 2X76A 3TSYA 1GA4A 1RYYA 1H22A 3K4HA 3RI3A 2P4QA 3B6KA 2LGJA 1BDJA 1BE1A 3B89A 3E4CA 1JXOA 3QA9A 4UQPA 2YXDA 4BP3A 2BE7A 2AKYA 1P72A 3VI3B 3GLVA 1YRYE 3FNGA 3BIOA 3U0VA 1VP3A 1IHDA 2Q0QA 3N3AC 5T4BA 3VOSA 4PSUA 1FZTA 3SAJA 2XSZD 6LDHA 2XE7A 3NAQA 4G0UA 3JWEA 3NWPA 1F8XA 4RMHA 1VJ1A 3G17A 4GD3Q 1Z37A 2AS0A 2JJ2D 4YT2A 1T2VA 3RD5A 3RYFA 1OBVA 2G1KA 1XLVA 4CIYA 3JQ6A 4MYCA 1CXZA 4NEHB 5TJ9A 4J0GA 5A5FA 1YBHA 2GJ9A 1H2RS 1PYGA 1VL2A 1KQNA 4AMZA 3G2MA 2Q1WA 2F7SA 3RRMA 3WGLA 3RAGA 2Y71A 3UJNA 2J8ZA 1XR3A 1ZU4A 2BELA 3PX2A 4C1NA 4RV5A 3T3OA 2C84A 1TYEB 1R6AA 2UXCB 4ITUA 3DBHA 1R64A 3BC1A 4D8WA 1QVAA 3V8QA 2DQZA 3IIEA 1Z5GA 3HKBB 3JS5A 4GZLA 4LZJA 2W2LD 1S8OA 4Q82A 3V8VA 1Q14A 4DIEA 4ZT5A 4K6KA 3DYBA 4M0KA 1KYYA 2SECE 3HB9A 7AT1A 4CT5A 3J81A 1SXHA 2F55A 2HDWA 3G1WA 3W4IA 4X93A 1WUIS 1LPAB 1OVMA 2VJCA 3O8NA 1P29A 1CLEA 1JWBB 3ZH2A 5CJ2A 3NTOA 5CT5A 3UWSA 2GEBA 1ORHA 2A9JA 3DMFA 3W5SA 5AM0A 2XB4A 3ANXA 4B4VA 2BBSA 4DPLA 4EDHA 4CKWA 4ICIA 4QBGB 4EPRA 1KI4A 1O9HA 1T5BA 3IHWA 3RLIA 1M74A 4NBUA 4F8JA 1OGYA 3P9KA 2PKQO 3ZYZA 4EGAA 1GNTA 2G5CA 4YA6A 2I3AA 9ABPA 1O5IA 5TLSA 1GPAA 2IY9A 3CUEF 2GN6A 3O1HB 3OX3A 1XTVA 5H0IA 3H5RA 4BP8A 4OGKA 1D4AA 3PGA1 3HVRA 2B6HA 3GGCA 3UBTA 4FYHA 4HX2A 1CY2A 3GFSA 4MVJI 1T5SA 2UAGA 4RBNA 3K09C 5COAA 4BUJA 3OCUA 1TJ4A 4BWFB 2CSXA 3G2NA 4OL0A 4R2LA 3EW7A 1KVTA 2C92A 5TV2A 4ARZA 3N2YA 4PXYA 5C1IA 3IULA 1YR3A 1PQYA 4P3NA 3FFAA 4EM6A 2IZ7A 3T1YB 2Z3VA 1IUPA 3SQLA 5KDOA 2EJVA 3JRWA 1R37A 4B3IA 1UQRA 5AM3A 1FZQA 3DG9A 1X7HA 3LDHA 3L7OA 5E4TA 3GELA 5JMPA 3GVPA 4G0ZA 4X95A 2NUPA 1GPNA 2R5FA 4KNVA 4XPZA 3GT4A 2Y76A 3RG8A 2UUPA 5JCXA 2BSXA 1B3RA 4BBZA 3FNFA 1O08A 4Q4JA 4ESHA 2NUTB 3LOQA 4HMQA 1QORA 3ORFA 4H35A 2OO5C 3DL7A 1ZG3A 1B7GO 4LXYA 3EAQA 1URPA 4CEJA 4OB8A 4DNOA 1KVSA 1SBYA 4LYHA 2HF8A 3IQWA 5BR8B 3KK0A 5HOQA 1FQJA 3MWGA 3IXMA 4QDZA 5JE8A 2JK0A 3USES 4ON9A 4AKHA 5DIZA 1DTWA 4CM4B 4IWXA 4MMXB 4INPA 1R18A 4XD7A 4WXRA 1A8SA 1M2OB 2Z2YA 4XUCA 3GRKA 3KWLA 3WI7A 2C2XA 2UZAA 3HABA 3EFEA 4OXXA 3TS1A 1NI3A 3QLTA 2VDNB 3B52X 4Y6PA 1PV4A 2Z2IA 1T5IA 5HZHA 2HHCA 4J3FA 3AI7A 4BNXA 4EO7A 1RP1A 3L01A 2IK8A 4FPXA 4JBXA 4HJRA 1JJAA 5DM70 3U3ZA 4A2QA 2OM6A 2YHSA 1FYWA 5CITA 1OHHA 1EE9A 3GUZA 1KY3A 1WXGA 4RMIA 2NAPA 1WRBA 3LW8A 4TV9B 4UTZA 2JIZA 3I5MA 4X9XA 4Y2XA 3LW7A 1DT3A 3IV7A 2X9NA 3T7TA 2ZIEA 3AHHA 4YLYA 1JDBC 4JXXA 3KQQA 1KORA 2BP7B 2Q2QA 2YZKA 4MUMA 2YICA 4AJ4A 4Z3DA 1TMOA 2ZCUA 1AA6A 3QNWA 1E3MA 1X3LA 4BU0A 3A05A 3I52A 4G84A 4JUBA 3PX3A 1M0EA 3O8OA 3CXUA 5U9CA 3MK31 2W93A 2YRXA 3ECCA 3OZDA 4N6NA 3KR2A 3AUTA 1TECE 1NZDA 1OWPA 4FQ8A 4WY5A 3ZXYA 4PHCA 1KSJA 2GEDA 1VZ3A 2YR0A 2HRQA 3G0OA 2DWQA 2XNDA 2EKBA 3OZIA 4Z6KA 2E0IA 3DGEC 5JAPA 2AZDA 4PFSA 1O6CA 3IP5A 3R6TA 2DPHA 2CVZA 1QB8A 4UM9D 3VU9A 3ZJ5A 5HSGA 1V2HE 4P32A 1R8YA 3N7TA 2GEJA 2GSDA 3VTKA 4OQFA 3NRJA 2JCBA 3HU2A 4IZ6A 1B14A 3BSFA 4Q9KA 5LKRA 1RQPA 1U4OA 4BFVA 2J4CA 3I72A 3NALA 1OA1A 5FP0A 5EP3A 4JK3A 4R1NA 1HQKA 3S8EA 3D0KA 4MVJF 1NSTA 2O8NA 5TGZA 4DV7B 3L07A 4HLCA 3SMQA 3E7PA 1H9AA 2SKCA 3T9BA 3EVEA 2ZIFA 1E4VA 5H16A 2VJPA 2GXSA 2XYHA 4G0YA 3H2JA 7GPBA 4NXNB 2V6JA 2O48X 2CWWA 2BKUA 3CZAA 3UA3A 5TGDA 1OAOC 1MPTA 3EZXA 4NULA 4TL7A 5L4NA 1CX9B 1XU7A 3JAKA 1XWWA 2BMAA 5KVCA 4WACA 2NSJA 1L6RA 3WP1B 3L5OA 2O54A 1YIDA 4XGNA 2PSDA 1P17A 1Z08A 1GIAA 3ISTA 4W1SA 2XE8A 3S7ZA 3PGXA 1YUMA 3TVDA 5ICEA 1IUOA 1EVEA 1POWA 2CNOA 2IQIA 2OBYA 2OL4A 3ENVA 4PX9A 3RIYA 4A36A 4NNJA 4TVKA 4N3CA 1C4OA 4MUHA 4U3JA 2IZ0A 2QY9A 2GWRA 1N25A 1A96A 1W29A 3N2GB 4FX5A 2AQHA 3MAJA 5DNDA 3QVOA 4AUKA 2ZJ4A 4P22A 1TAUA 4EW6A 3QF7A 3AI1A 3H16A 3AI3A 4HDNB 3HXMA 1ESZA 2WD7A 4N82A 3VH1A 4H7JA 3GLSA 3SC3A 4UVIA 4DSUA 4TXMA 1TT7A 4G37A 5FNVB 1VLZA 2J9ZB 1MW8X 4DV1B 3VR5D 1JHMA 1ZCZA 3QYFA 1ZZGA 1O94A 5JDCC 3CLTD 4UMVA 1FP7A 2FAXA 3KZXA 2NWQA 3OPQA 4JLSA 5C7OO 4PZ9A 3FD8A 1XTUA 2H85A 4KW7A 3HB1A 1CUDA 3LWDA 4TLMB 4YAIA 1A2BA 1CZRA 4ENSA 3IDFA 4LF8B 5H59A 3QFSA 2H1FA 3QXJA 1U0HC 3I2KA 3TEFA 2GZAA 3DAFA 4ZJYA 8ABPA 3PJDA 4CMHA 1YBVA 1Y6ZA 1F0KA 1EH5A 2WTXA 1YUBA 3BXPA 4H7EA 1U65A 4G4IA 4LNUA 4RVSA 4UJ5A 4YT5A 3MMSA 3PCRB 3RUPA 4QL3A 4DIOA 2NYRA 1PUXA 4M1QA 4B2PA 1RYEA 1X9IA 4ZK6A 3VQTA 1GXSA 1P9NA 2B8NA 3L49A 3RF6A 4FR2A 4EHLA 3MAAC 1Q5PA 2FMUA 1M8FA 1ZOSA 4UU1A 1APBA 1ZJJA 2I7TA 2R1UA 1G291 4IQFA 4YP7A 1I1NA 5KU7A 3BRSA 1OH5A 1J0XO 4TVBA 5KVSA 1T15A 4EB6B 5B4TA 1T3ZA 3JATA 4QBHA 3LQQA 4MVJA 2IUYA 3HMKA 3PZBA 4A2CA 1YXMA 2V45A 4FMDB 3QG1A 4JB0A 4I5FA 4O2BB 4DLWA 4E5KA 2ZIAA 3VBCA 1VIDA 1OKKA 1OBFO 2BFMA 3B6JA 4HGZA 4WZZA 1QG4A 2XXAB 4YUZA 1Y5MA 1NN3A 1MU0A 4L6CA 3HY4A 2QN6A 4FI3F 4F3RA 3D6HA 3T5DA 5BPHA 4DC1A 2HSGA 3DD5A 1F4PA 2R8YA 2XWQA 4RXMA 1DJOA 1ZD8A 5JXGA 1EU1A 1BGWA 1K7CA 2X4IA 2X7XA 3OY7A 4TYQA 5DPMA 5LQSA 1NN5A 4QARA 3ZZ0A 2IGTA 3GH1A 5LP6B 5KNBD 4EZEA 4LE0A 2JLYA 4HDOB 1R5JA 3F6SA 3RARA 4IIUA 4WECA 2FUEA 2P3LA 2CFRA 3GV0A 3L1UA 4WNCA 3WB1A 4BO7A 1BEEA 3FTPA 4MYTA 1GFIA 1EZ4A 4G26A 1P2DA 2XXBA 5C8ZA 3WMXA 5KTRA 1BGVA 1V26A 1N3YA 2FQYA 3B6ZA 2VQSA 4X5OA 1BCSA 4DBVO 1OYYA 4F4HA 4GKJB 2ZUSA 4EKYA 1GT91 4QYSA 1MGOA 2QL9A 1BA2A 1D5CA 4DREA 1JHQA 2W9XA 4DLPA 4X7MA 4TKMA 5JLAA 2Z8XA 1UKBA 3EQ7A 4QBFA 4Q4AB 1O2DA 1OFHA 3PD1A 4LFAB 3VNVA 2O1SA 2D1SA 2HWUA 4CHTA 3KAQA 3T1HB 5L6LB 4Q5IA 1MBZA 5JXWA 1UMCA 3SZOA 1EA7A 4S04A 1S6YA 3QQPA 1PFYA 1ZD1A 2DUUA 1KKLA 2QJWA 4NS1A 5I7HA 2Q5LA 1GAXA 3F9RA 3ITEA 5ECGC 4GPTA 2AG5A 2EZ9A 4JLBA 1G41A 4ZU6X 1JLKA 5BP7A 2PCJA 1F20A 3AUSA 3MINB 2ODAA 1RRCA 1XVLA 1U1GA 4YMVA 2G70A 4YRFA 2W8BB 3WL7A 1AUQA 1CRLA 3GLUA 4YJFB 4UTNA 5D51S 1PWXA 3AP3A 1U5BA 5KQMA 4WH0A 2R0QC 1EM8A 4X24A 2V55B 3BWCA 2GPWA 3SDBA 1UXKA 1WF3A 4HYTA 1NRIA 2ZQ5A 3LGSA 4JB3A 3ROGA 5KJFA 3OIUA 4U6NA 1F2TA 3IEKA 5CNIA 1UXIA 4MUIA 3BRQA 3DDZX 4I5GA 3U2QA 1VIMA 1NPTO 2E4VA 4R2IA 3UWDA 4OGGA 4CIVA 3KKPA 1V16A 4WZAE 4LSMA 1TKAA 3RAEC 1NDHA 1VLHA 4P80A 2GZHA 1HTBA 4FCCA 4K6GA 5AM4A 3RVKA 4LTNA 4YAEA 2QTNA 3TD9A 1HZZA 1EI9A 2OV8A 3AVWA 1MX3A 3D0OA 2Z5VA 3WRVA 2NU8A 1C0KA 4Q47A 1ZGZA 4QXMA 2FQWA 2Y2VA 3UKJA 3R7WA 2AN9A 3VC7A 4EI7A 1Q3TA 4CUZA 3QBTA 4NR0A 4OHXA 1DL5A 1T26A 4UM5A 2GBFA 1G8AA 5BWNA 3HYCA 4KAJA 1Q7TA 4LC9A 4I5DA 3Q2IA 4CETA 2V0CA 1HFJA 4V0ME 5D6NA 5EHNA 2Q2NA 5IZ4A 4R1MA 4A6XA 2EFJA 4UTVA 3ND8A 1NRJB 1PEKE 4PTZA 2HQRA 5JQGF 2NZ2A 2OZPA 2A4MA 2NPIA 1Z8FA 4GMXA 5FWYA 5H9WA 1AV6A 5DXJA 3TUIC 1ISPA 3WGTA 2C5BA 2Y1KA 3JWHA 1QF6A 1EDZA 4PLPA 3WZMA 1Y3FE 2VJMB 4MRNA 3DTVB 3U9SA 4C78A 3H9JA 4ZEVA 5IJ0B 2CFIA 3PXGA 2MSDB 3F3MA 2PSSA 2J07A 3DZGA 4ALNA 1TZJA 4LKRA 2A9KA 3HCCA 1L7OA 2VDWB 2GD1O 3U0BA 2PAFA 5DX0A 5IDXA 3TGPA 1VL5A 1R0WA 2NADA 3FETA 4QUAA 3G2PA 5FYQA 2YWBA 3DEIA 5BSWA 2C4TA 3FCEA 3IJRA 3KD2A 1D8AA 3OBBA 5G02A 1H93A 2OUKA 4U7PB 1HDZA 4BE4A 1PKEA 1SCNE 2G5TA 5ALWA 3UUEA 4W5HA 2DERA 1JH8A 2IPOA 1IN6A 2V96A 4KFCA 1PX0A 3ZI0A 4WN9A 1FJGB 3G82C 1SD2A 1U8AA 3BWDD 3LCJA 4HNAB 1Q95A 1FB5A 1UDAA 3C6QA 3DAPA 2Z0MA 2QE7D 2C7VA 2QMHA 3MPUA 1L3CA 1CUHA 2C7OA 4X20B 3RK1A 3VGJA 2B2XA 5J4HA 3F49S 3I0NA 4X65B 3NHFA 1TK2A 2SICE 3MS7A 3PEVA 1BW9B 1FFDA 2X3YA 4FK8A 4GG1A 2DP4E 4LE2A 4NTZA 1AKYA 5JAOA 2M6KA 2B1RA 1C5KA 2IQ5A 1B2LA 2Q4OA 1ISIA 4ZVKA 2YVKA 5GQSA 3IE2A 4Q18A 1O6BA 1Q74A 4I9HA 5ICSA 3GLTA 5C8YB 5AVSA 1UC4B 2X8LA 4B7CA 1E0KA 1P61B 1EX9A 1NUTA 2V3WA 2EERA 3V7YA 5B7GA 1CU1A 2J5QA 2WYWA 5EI5A 2GTPA 2GBIA 4FE7A 4X61A 4Z4CA 4F38A 4YO8A 1EVKA 2F3UA 1G16A 3E48A 3GYBA 2WPNA 5DF1A 4V0RA 1AUVA 1CUCA 2G72A 1EKXA 2BGUA 3I6YA 2ZUWA 3JRNA 2HLDA 2B8JA 4IQ0A 4KTVE 3NI2A 3RHSA 2XGMA 2YXNA 4I4CA 1K6MA 1XTZA 2YFQA 4WFJA 3TPZA 3PLAE 4UDYX 2G04A 1XLTA 2DBVO 1AD2A 1M54A 4LVCA 5T67A 3UMJA 2K7FA 1ZNXA 2PZLA 2RAVA 1DI0A 1ODLA 1E2PA 1F6BA 1NNUA 1GPLA 1Z07A 2C57A 2WMDA 3D5EA 3KYDB 3PDJA 4HQLA 4BE7B 2PGOA 4HVLA 3ZDBA 4YBZA 3MNFA 3K53A 3V80A 4RSMA 1N5DA 4F3CA 4EHNA 2QRMA 3DOIA 4JIMA 2PX6A 1JBEA 1U02A 3QUSA 3HJCA 2RBEA 4F5EA 3FWKA 4HNVA 3I73A 2POCA 3ZCUA 2GO7A 4P3PA 3L0DA 3I9NA 3T41A 1MV5A 2ABWA 2YHIB 3TFOA 3W2TA 4CG3A 2CCJA 1KEEA 3A6FA 3I6MA 4HFMA 4QJ4A 4F12A 4PO8A 2XZLA 1KU6A 1Z5VA 2AFVA 3AERB 3ZW9A 4B3XA 3CEMA 4US0R 4PHGA 3V55A 4BO8A 4YR9A 1I3KA 1L7QA 3N2LA 1BVHA 2HBZA 2WA1A 4LSGA 5DH9A 4DOMA 4TWIA 4M0MA 1WX1A 3ZOZA 5I8PA 4CM9D 2OM2A 5G0UA 3BGIA 5K4GA 1HSZA 1SQ0A 4AQYB 3VU0A 1CERA 1QTRA 1SXJA 1RRGA 3AJRA 4D0NA 4BB6A 4ME6A 3TXAA 1MOZA 1V11A 2E4ZA 1HKUA 3GI1A 1VDMA 3V48A 3PDIB 3WS7A 2P0YA 4TMTA 5AJYA 4RK0A 3QKSB 3FIJA 4BU1A 3E1GA 3M6FA 3O7WA 4U9HS 4RTQA 1K6IA 3NTRA 1U8FO 5B6PA 2O5CA 3F78A 1L5GB 1ZJ4A 2D1YA 3HN2A 1PVVA 3LL7A 4K7JA 4ZMBA 4F46A 4LJYA 1D2RA 2WUFA 4DCCA 1S7CA 5BQPA 1CUSA 1RHJA 2KBFA 2VKTA 3AB3A 2YDXA 3GNLA 1E2GA 2ZYAA 5REQA 3SMVA 6AT1A 4HVTA 5FAKA 3I5YA 3B2EA 4LZWA 1WKCA 1L9XA 3CRW1 5EIHA 4BX2A 3JQ7A 4CFYA 3R0QA 1HTTA 3CJTA 4IHJF 3H11A 2ZDQA 4WLUA 1KAEA 4YJ2A 2GZMA 4MO2A 1G2QA 4FXPA 1T29A 3O92A 3PP8A 2QQ5A 2ZSFA 1Z74A 4J1NA 5JRZA 3ZWCA 1XPRA 2ZSHA 4M88A 2B1IA 1SIBE 3UJCA 2IWHA 3QUBA 1VPTA 2BKEA 1N9GB 4RO0A 2B35A 4KSYA 2G5PA 2QGNA 2VSYA 4Q3OA 3VOAA 1E1NA 4F72A 5IK2A 3I4CA 5A4AA 1RI4A 3O8CA 1Z36A 1MOPA 1XJCA 2G82A 1U3VA 1L5LA 4E1BA 3AFOA 2FQXA 1UODA 4AJIA 5ELXA 1NUSA 1OLSB 4D25A 2J3IA 3H5IA 3SCZA 3BTSA 1Q1QA 4R31A 4BIIA 2B7CA 3U5ZB 3BJEA 4A6DA 3WYFA 2F9LA 1KAMA 1SZCA 1DT5A 2I2BA 1EBUA 1ZRNA 3A70A 3OZAA 3EPKA 3HI6A 5CXXA 4BMPB 1I14A 1OTHA 1RI5A 1R6XA 2MYTA 3A9TA 3CRMA 3DNMA 2E2WA 2EW1A 1XHLA 1CEYA 3HRKA 3TSAA 5C7IO 3QYJA 2EL9A 2WW8A 2BZ0A 5FULA 4R4JA 2Z1NA 4M1OA 2BUBA 1OVGA 1E9BA 1KO4A 3HA5A 1WW2A 3QPUA 4WXMA 5IJAA 3RC8A 3KUXA 5ALUA 4M7RA 1Y8ZA 4JB8A 4ZQHA 1ACJA 1SCIA 1CJUC 2JKVA 3BMOB 1DNPA 3BA6A 1BXGA 4GMFA 1UKYA 4HS9A 4B32A 4D2IA 2WILA 5EWJA 2QK4A 1RP7A 2OD2A 4RL4A 4Y30A 1MC1A 4MI3A 1L4GA 2VDOB 4GMGA 2Q9UA 4GX5A 3IPAA 1XTKA 3QFFA 2A6PA 4UMFA 5GONA 3PQ8A 5HIMA 2QM0A 2V6FA 1Q22A 1EEXB 2XZPA 4E22A 5CNKA 3ACBA 3GJYA 1WPXA 2VAPA 1FFSA 3LUHA 4H7IA 4DHEA 1TQ8A 3PC3A 4WNAA 4N54A 5IASA 2BV3A 3A1UA 3C7AA 3CX7A 4FILA 3BMQB 3GLKA 4M83A 3GVCA 5CVCA 5JH7F 4P54A 1RPZA 4LF9B 1H9CA 1KI7A 5H3LA 4MV6A 4UTXA 4MX8A 3ROXA 3WV4A 4B6SA 3TJRA 2BFEA 1KZ4A 2H2DA 2WJVA 3ZTWA 1F6WA 3UOAB 4YJ3B 3WMFA 3QA3E 4FZJA 4HDKB 1TF5A 4MR7A 2AJTA 3DYVA 3NHLA 2X41A 3TPCA 2ZSJA 1FLAA 1EAMA 1SN7A 3I05A 4IHJA 4YJKA 5DISB 4AF8A 3MC1A 1CDZA 1DELA 4Y1RA 5CK4A 4D4JA 1BFDA 4X1YA 2A88A 3O4GA 5EUBA 4E2ZA 5BV7A 1FMTA 5JHGB 5ELMA 3ZHUA 5CUQA 3REOA 5HRAA 1EUZA 4XR4A 3AQIA 3KTFA 1NV8A 3K0EA 1C8VB 4YJHB 4RORA 1IIRA 2ES4A 2QRQA 3P2OA 3C3BA 4WLFA 5JEDA 5L9AA 2JPDA 3MUNA 1AZSC 4KR0A 5A7FA 4LY6A 2ZYIA 4LJ8A 1R8SA 1ISJA 1HOXA 2GEKA 3HDVA 5K8VA 1T43A 4YCMA 2JFYA 1YI0A 2CMFA 5CDGA 2V7EA 1L7MA 1WETA 3ISJA 5TC4A 4TSFA 1MR3F 2GH1A 4B79A 4J6EA 5K6AA 3OWHA 2D7CA 2PUFA 2MJLA 3M6VA 1C1XA 1VJRA 2QZ9A 3UPUA 1PK8A 1J9EA 4REQB 5L3SA 3NZEA 1CEXA 1RRVA 3UUWA 2Y68A 3LHIA 3LSTA 4Z49A 5ED4A 2H18A 4QUEA 5JSZA 4GU5A 2J5RA 5FHRA 3GNSA 1RADA 4GP6A 1U2DC 4AZ0A 5SY9A 2JFVA 1X8KA 3ADDA 3PNBA 4J9VA 4RIIA 1ZK0A 3U4IA 1E4EB 1FQKA 3L79A 4AMGA 4J76A 4NV3A 3SSMA 4TTVA 5TJHA 4C2BA 3IAAA 5LA6A 3V3TA 3W3ZB 3W6UA 5CB4F 1XZAA 2F43B 2GBGA 3NBYC 1UZUA 1W5FA 5LCXA 3PEEA 5TDHA 3SC6A 1GL6A 1ODTC 1W49A 2VXOA 4KAXA 2O8BB 2OY0A 1X92A 1IWPB 2A5DA 3FHCB 3H0EA 3V4FA 1YS1X 1Z0AA 3KOUA 4L02A 3O1LA 3ZE1B 1F0PA 1OLUA 1JZSA 4P4SA 5F1PA 5JYEA 2XZOA 3D6TB 3L7CA 1NNEA 4GXQA 5BN1A 5JSUA 5AVVA 5C8DA 1ADYA 4QPJC 2AOWA 4FNGA 2WWGA 4BNNA 1NA5A 3ER8A 2ZBUA 3GLGE 4U00A 3ZHRA 2QM7A 3B7WA 2PD3A 1BJRE 3CEJA 4IO0A 2NU9B 3PHLA 3HFRA 4NU5A 2ZIUB 2DFTA 3SR3A 4BX9A 3STTA 3WO1A 1HQDA 3SHWA 3FOFC 2HB6A 1JB1A 1SCAA 3WE7A 1ZQ9A 2W6IA 1WQ1R 3LT1A 1EFRD 3H2KA 3J7AC 1KH3A 1TA0A 3Q88A 5BNWA 1E1KA 2C2HA 4MIEA 1YQXA 1BXRB 3WIEA 2GXUA 2O8FB 1SEVA 5J5AA 4QDTA 2QGFA 3THWA 1IB6A 3PLNA 4WKCA 3TTYA 4DBLE 5BW4A 1U1EA 2VF7A 4XM0A 5AVQA 5HR5A 3FNEA 3T61A 3CSSA 3F4BA 4RS3A 4GQIA 4QO8A 2VF4X 2WF5A 4EELA 2CXUA 1GL9B 5LMNB 4LYFA 1VXRA 1MVOA 5DCYA 4WXYB 1HFEL 2HLNA 3UWMA 3NIDB 3LUBA 5K6RA 3E7XA 4NMHA 4TZTA 1PW7A 1I7NA 3OCZA 4DA8A 1PQUA 5KNCH 4YPFA 1AU9A 1V71A 3E8XA 4ZHQF 1SBCA 3Q7RA 1IN7A 3ZH9B 2H2HA 2EC5A 4C04A 3BE4A 3TR5A 4ZYTA 3BXHA 1GP2A 2LCFA 3FMFA 2H1SA 5EZSA 3GDWA 1M5RA 4LJRA 2ZUUA 1OREA 3H8SA 1JG2A 1XRMA 4EQ6A 3E0QA 2WKPA 5TQ2B 2E4UA 3OFVA 4S1OA 1TMGE 3K5HA 4FYKA 1UADA 1OPRA 3TTUA 4E3ZA 1C41A 3JPWA 5KZMB 1P7PA 1JHAA 1YSCA 2RC6A 4URFA 1D4FA 2QG6A 2CXOA 1PYDA 3DF9A 3KYIB 3A1TA 5CTJA 3KSAC 2IHYA 2R6JA 4EG1A 1QV9A 2ESRA 2G80A 4P7GA 5BORA 5JC8A 5EZYA 4EUHA 5F3WB 2ILVA 3WYNA 4A82A 5ITWA 2FN9A 1EGQA 1S2OA 2IITA 3A9UA 5FI5A 5FPTA 4NBTA 4LKOA 4GBMA 4RSRA 1F9EA 5BSKA 1N77A 3CWQA 1NXOA 3KALA 1G8YA 4TL9A 1U7UA 3EAFA 3FZYA 2COKA 2OAGA 1WBBA 1GZ5A 1SXGA 4HNGA 2I6XA 2Z08A 1UK7A 1ISRA 3HBNA 3CNNA 1M1NB 3EWIA 3I83A 3NGXA 3ZDAA 2IS4A 5BNIA 5KJ1A 1RLTA 2VCEA 3ZLJA 3VR6H 1JALA 3ORSA 1YCGA 1PFKA 3G7SA 4HXFB 2QVXX 2GVNA 5C9ZA 3PENA 1E8NA 3GGPA 4JELA 1KSFX 1ZK1A 4MQFB 2EIXA 4EHHA 1MABA 1UXHA 3VYTB 2C5FA 4PCVA 3P32A 3W1EA 3L77A 3N86A 4AICA 1I2MA 2MSKA 1WMAA 4BMYA 2BFFB 2CL5A 2WE7A 1D4OA 2GNAA 3W9BA 3A4TA 4FHEA 1CUJA 4R1UA 4II3A 3MM4A 2P1ZA 3ZD9A 3EA4A 2BRUC 3GPIA 1JR2A 4G4SP 1DDIA 2G77B 2H00A 2ZRKA 3R5SA 3OLYA 1T34A 2XECA 2G71A 2JKZA 3OF3A 1D6SA 4CT4B 4DA4A 5BWOA 1TU0A 2GLUA 3UGQA 2X1MA 3VNBA 2H59A 4HRAA 4KIWA 2Q41A 2IYFA 3CKYA 3ENWA 4JR2A 4K86A 2DFDA 1BE6A 2HRRA 1W88A 1F8YA 2YRWA 4KQ1A 4ODIA 5FAXA 2Q7OE 4AZ3B 2JFUA 2BM1A 1K8QA 2A59A 3DP9A 4JOSA 1B8UA 1AS3A 3ZBUA 5C51B 1G2PA 3TVYA 2IYLD 3MMPA 5FB3A 3WWEA 4CDRA 4MQ4A 1K89A 4U9IS 3VJLA 2JJ8A 3UMVA 1I7PA 1JQKA 4NMWA 6ABPA 4UU8A 2NT3A 3EXHA 4GWKA 1ULZA 3QE2A 2IV7A 3VHQA 4NZZA 1YFJA 3SC2B 4QWMA 4NBVA 4HVCA 1YGYA 4DV4B 3NBZC 1DEHA 1YK0A 5I7RA 3IUEA 1QRAA 2JHGA 3E6AA 2DBRA 3N8KA 1WSAA 3I6IA 2BKVA 3NKLA 1QYRA 4U2KA 4AJLA 3JAWB 3GU3A 1KP2A 4HXGA 4LOLA 1ZA2A 3EGDB 3ZDYB 3UJDA 1J1IA 4J4HA 4M8SA 4W6ZA 5D5QA 4ZN6A 6PFKA 4DR3B 2WNIA 3EG9A 2R84A 4GRDA 3KSRA 4X8LA 3VISA 2B20A 2WM2A 3B3GA 1RM5A 2Z5LA 2EZ8A 3IT2A 3L6DA 2PGNA 3U4DA 1VLQA 5M3BA 5FXMA 3IAXA 2LD4A 1B0ZA 2C7PA 1TGYA 2G9UA 2GKSA 1TYBE 3AF4A 2QUAA 2TMYA 1U5CA 4QGBA 3TW8A 1NGSA 1NW5A 1PP4A 4D3DA 2BGRA 1CW2B 4BNLA 3ENQA 2GT1A 2CLEB 2HO4A 2ZYHA 4H08A 1FDUA 2EKLA 4PPYA 1C1DB 1QM5A 1OFTA 2LV8A 2NGRA 1JLMA 3L18A 1YCHA 1A71A 3KJNA 3G23A 4LW8A 3VKFA 2WHEA 3NYIA 1Y9JA 4YVFA 2DHEA 1XJ5A 5KKCA 4TV8A 3RVPA 3I53A 3KPUA 4ARBA 4ARIA 2VCYA 1WCIB 3PX7A 3I58A 3UKDA 2P7IA 4N3GA 4M0DA 1T1RA 1A95A 1FYEA 3WGUA 3PUZA 5J2UF 3U6BA 1VB5A 2CNNA 4L8FA 4P5DA 1YASA 3ELDA 5E0KB 2JGKA 1XPJA 2QF7A 1SZJG 1QC5B 3GARA 2ZG6A 2QT1A 3F8WA 3CURA 3D1LA 1QDEA 2IW3A 4RW0A 4KLNA 1XCBA 5ETJA 2XTJA 3K2IA 3VYRB 4E2YA 3K1JA 5A3SA 4NV1A 3ZDFA 2W4IA 2HSJA 1XA3A 2OESA 3LXXA 3THRA 1PUIA 4EUFA 1LJUA 5K8JB 1V8PA 2QP4A 5DLQC 3DBOB 1GOTA 4DM3A 4DYVA 2R7MA 4XR9A 4YPVA 5KSWB 1WHSA 2IU3A 2V3CC 2P3QA 5ERGB 1NUUA 1YRQA 2Q8NA 3ZR4B 3HP1A 3TAHA 3DFKA 1MIOA 3P19A 3EC1A 2EBFX 1YZYA 1QHIA 4BS9A 1JNYA 3I6QA 3HKEA 4GC5A 4KBGA 1RRFA 4HR7A 5SZJA 3VPDA 3DONA 4JITA 2GFIA 4RV4A 4QGSA 3A2KA 3A1SA 1NJ8A 3ITDA 4XX0B 3C8ZA 3QVLA 1V5GA 4X3PA 3HUEA 3ABOB 4IY1A 1IBSA 2WYUA 3W6PA 4O1HA 1PK7A 2JH3A 2HT6A 2RHOA 3VNQA 1PNOA 2HQSA 3DVSX 1XCOA 3H1FA 3IYLW 4Y2PA 4ZCLA 3ROMA 1YIAA 3B3QA 3PQDA 3QXXA 4FD2A 2VP9A 1DS6A 2ZEJA 3ND5A 4KBFA 4M0PA 3A9SA 4XOIA 4F9GA 4RZIA 2DHDA 2XBLA 3EVAA 4MR9A 1Y37A 4MWDA 4MCHA 1PJTA 1X7YA 2ZYDA 3VTAA 4ALIA 2C4KA 2ZCVA 2A57A 1R4ZA 1VFNA 2UZ3A 3UM9A 4WZBA 4ZEMA 2IP1A 5FL3A 4LOIA 3JYQA 1HETA 4WOCA 1V3VA 4YUYA 2QW1A 4QPNA 3UFBA 2YZNA 2BDEA 3OEEA 5LP6A 3F3KA 4ZI5A 3RJ9A 3HJRA 4KIJA 1T4CB 1GZ6A 1GPYA 4W4TA 3ICOA 3INGA 4H1VA 2QRVB 4L5AA 4Q9IA 2I3DA 2FLVA 4BVHA 5C80A 4H15A 3VPXA 2ZYVX 5DULA 2EOAA 3I28A 3LT4A 3HKDA 1GSIA 4N7BA 2XDAA 1Y8RA 1WEKA 1XVAA 2A9OA 1CUAA 2NXWA 1J0EA 1EHYA 1S3GA 1W2HA 2Q6VA 5HTKA 4G9BA 3WGHA 3PLRA 16PKA 4HAUA 2FPXA 4MIYA 5A4JA 2QN3A 2IA5A 1PJSA 2NXJA 4KE7A 3VBEA 1XEWY 1WR8A 4JDUA 1IBRA 5BVGA 4EF5A 4LMAA 3A1DA 2PT6A 3ELYA 1QBGA 2W6QA 2C0PA 3EXEB 1FUKA 3SZUA 2ECFA 3THOA 1H85A 3LK7A 4KO8A 1UOEA 5LB4A 4C5AA 2IYSA 1GTSA 2PBRA 4UHKA 3U3XA 5KAPA 2QS9A 4NCXA 3RVRA 4E11A 7REQA 4WZAB 5LSAA 3B6MA 3VSBA 1AN0A 2IUEA 3BJMA 1YR9A 3IDQA 4ND1A 2V5VA 2XUDA 4QXPA 3EDOA 4EJFA 2XGOA 4JHLA 1PVOA 2H3HA 3I37X 3K9WA 4L72A 2CL0X 3DWGA 2H17A 4TT3A 5I9IA 1QQ7A 2BEUB 4FFRA 3CG0A 2CXQA 2JVJA 2NV0A 2PUBA 4J1QA 2MU1A 2WEKA 3MGKA 2A35A 4P35A 1M7BA 1K3FA 5DKFA 5E2BA 4LCEA 1ETHA 5E3IA 1RJEA 1FPQA 2ASVA 5CVEA 4ZAWA 2Q3FA 5KVQA 3RC7A 3VO1A 4BLWA 2XRZA 4PEVA 4JKIA 5CM2Z 5J23A 2XCRB 3GX1A 1FNMA 3WTBA 4YMLA 5FQNA 5K05A 3ZXIA 1U80A 4URYR 3U44B 3BXGA 1OFIA 1RLUA 2VSOA 1JEEA 1UBSB 2F8MA 2GK6A 1ZRHA 1AK1A 1WEHA 1UT6A 5TEVA 3R7DA 4DMGA 4UZEA 1SELA 3D59A 4KYIB 4UXIA 1EP3B 1P62B 4JA2A 4F2WA 1VMIA 1OA0A 3ES9A 4IX9A 4J4TA 3WLJA 1XXHA 1LRJA 3N2ZB 1E1YA 2WJZB 3PNLA 1E96A 1XVVA 1ZJYA 3HJTA 1N4AA 2R4UA 3TOCA 3QEMA 3I61A 1ZHHA 2Q07A 3ODGA 2AN5A 3HXTA 4MKXA 3OA2A 3AC0A 4FYYA 1O87A 2Q1TA 4MTCA 2BHRA 1EFAA 1QYWA 5KC8A 3G8CA 3H86A 5HZGA 4ZI2A 3RQIA 2OMKA 4CIXA 4ZGGA 4KR9A 1GKUB 5AJHA 3T9EA 2XNCA 5HRCA 3BCSA 4UHEA 3GJ6A 3ETNA 4KMOA 2CL7X 2XT6A 2P6OA 4B6PA 4C0XA 1FC0A 2FKAA 4KR7A 4C4RA 4HK4A 3I9LA 2R25B 1BVRA 1NT4A 2GBLC 2HDOA 1QV6A 1T25A 1NIJA 4YT4A 4LPSA 2F1OA 1XD2B 2QENA 4JYCA 1VKOA 2ID7A 5KMGA 1MF7A 1DLJA 1DBQA 2ZS8A 2I76A 3JZIA 1X39A 3EVTA 3ICPA 2RGRA 4JOQA 3KXKA 4DADA 2DECA 2Q7XA 4J0DA 2RKOA 5SZHB 1Z6GA 4M0UA 4PLWA 1N7JA 1A88A 2WU1A 3Q98A 4GOOD 4IOMA 3CLSC 4MUBA 3FUVA 4TXNA 5SYMA 4FUTA 3FM9A 4AZWA 4H3HB 3WL8A 2RONA 3AY7A 1B16A 2V7TA 2WHYA 3WHIA 2FSUA 3MMNA 4I50B 2HWWA 1ZIYA 2G08A 2Y0EA 3L4BA 2P69A 5ALXA 1WO8A 1G21A 2X8JA 4LJKA 4LRYA 3NTLA 3TR6A 1LA2A 4Q7KA 1N0WA 2EXXA 1JJIA 2FUG1 1NVKA 2PLWA 3A9RA 3NAMA 4MYSA 2BJVA 1KDTA 1MMFB 2RI0A 1I3OA 2YS7A 4ZI7B 1IEVA 4B73A 4J94A 4O2AF 5TT0A 3VO8A 3SX0A 3ZD6A 3SVZA 1YRWA 2DFKB 2UZIR 4W5JA 1Z6TA 3GJXC 3OIGA 2IXGA 2YIDA 4DNXA 3LBYA 4Z2YA 1E3EA 3C74A 4R68A 4YDSA 3UJHA 3STWA 1B26A 3FZNA 4U7HA 1DCMA 1P81A 1KKUA 1XWIA 1OXKB 3NRBA 4MLPA 2QTAA 1TKCA 4EMBA 3DT9A 5CD9A 4NNOA 4EPWA 4X1OA 1PQPA 5K3DA 4AZTA 1G59A 2J0UA 3IUPA 4BNMA 4K6OA 1ILWA 1NOKA 3IMKA 3S40A 2YOHA 3ZS8A 4ZWNA 2H1CA 3DSRA 4UMDA 4XRGA 2F17A 1W30A 4BKPA 1CBUA 1ZD3A 1WZCA 2AOUB 3UAZA 2H1VA 2YFKA 2X8BA 3TE6A 2JAHA 4AG5A 4YAJA 4H6WA 4DLTA 3FPLA 2IWRA 4K28A 2RD2A 1CJCA 1U7OA 4ATNA 3WLTA 3FGPA 3Q3CA 4HN9A 4LX8A 5ALPA 3W2HA 2OO5A 2KYRA 3DA8A 4GP9A 3KM0A 5SYNA 4ZVQA 2IH5A 2ZIXA 4FOLA 3NIGB 1ZFNA 4LJ4A 1DOHA 2QTVA 4CEHB 1WXXA 2MYUA 3I5AA 4IZOA 1C14A 4Z9XA 1EVIA 1TM5E 4PBRA 5A7GA 3W5AA 3K94A 1WB9A 3OZWA 2QD4A 2WNHA 1LKZA 3O1JC 4QHYA 1FQWA 2QTTA 3ORQA 3Q40A 2WZDA 4NDNE 3S8MA 4KSCA 4MW2A 3RUFA 5BR1A 1QHXA 2KHZA 3EG5A 3A4IA 4JVMA 1HE3A 1Z4LA 4GP7A 5IVDA 2VRCD 4WJLA 3IB3A 4W9NC 4RLQA 4XSGA 1Y3DE 2XUZA 2OO3A 3GXBA 2VAXA 1FYFA 3CF4G 5H82A 3RW9A 3WLLA 1M2VB 2ZPTX 4XOUA 1YBAA 3IJPA 3Q1KA 1U3CA 1P3Y1 1V1RA 3LHFA 3S1AB 4YGYA 3RJ5A 4QATA 5CLHA 2BHLA 2WJWA 2E82A 5DP1A 2O20A 1U0EA 1N32B 1IPFA 1KZ6A 4KQKA 4FEYA 2PX2A 1XNJA 5IAOA 5LXTB 4QPCA 3EQ2A 1KI9A 1BN7A 1Q92A 1T9GR 1MRNA 2WDZA 5ILOA 1Q44A 5K0EA 2HJRA 3RABA 3PQ7A 5EOVA 4ER7A 4CCYB 5C4GB 4O2AA 3ZGLA 4CQNA 2H16A 3GYGA 1Z2DA 2O05A 3TB6A 4CMGA 1O97C 4QQNA 1FNBA 3FX2A 1KEUA 2AC2A 1KQOA 2WT4A 3FYUB 2CHGA 3OT1B 1JFLA 5IZCC 5DNYB 1RWXA 2Q5FA 3PNKA 3H9UA 3QJ5A 2I3BA 2YJZA 4L73A 3ZHCA 5HOEA 3RS0A 2GBPA 3QWIA 9MHTA 1E7WA 4YYZA 2ZSKA 3F7TA 1K7FB 2AEEA 1OZHA 5COQA 5EJFA 4ROSA 5FOSA 1VCMA 1SA0A 2E49A 1NMXA 2CGEA 3NWOA 3O03A 1QR2A 4OLJA 5ALRA 3DL4A 3RIMA 1GVNB 4N6OA 1CNMA 4LRQA 1ORIA 4GPBA 4DG5A 5TQVA 4F5DA 3NDPA 5A05A 4C6HA 3CNQS 3LY8A 4EO9A 1IG0A 5FLKA 1RRKA 1V8ZA 2DMRA 1OF1A 1EIZA 2FK7A 4OMFG 5G0SA 3SLGA 3BJZA 1VHQA 1PT7A 3IT3A 3NXSA 6NULA 2ZBRA 1J21A 3BMXA 1VHWA 1RHUA 1OAOA 1N1MA 1Z0FA 2NXNA 3FBTA 2YJ4A 4P38A 2IV3A 3RANA 3T7IA 1FJHA 4G3XA 4UQOA 3BXOA 2OSVA 3I2YX 1ZN7A 2X5JO 2A33A 3CPJB 4MW5A 3TOXA 2IE0A 2HAEA 4MGIR 3E7DA 5BT8A 4WESB 4MP8A 2WIKA 3M3PA 2F1HA 4RFSA 3IPLA 2GQ0A 1MQAA 1FW8A 2FY8A 1E2JA 3GLHE 4YDRA 4B3GA 1U3GA 3RUEA 5JO9A 4AM8A 5JS8A 1KYIA 2VZ8A 3ZIUA 4JT8A 3U9TA 4CKBB 4MK4A 4DC9A 5AW4A 4XWWA 1YS2X 1WULS 3DLHA 4MKIA 4CM5A 2R8EA 1AKEA 2C2BA 5JS6A 3ZNOA 1UM8A 5KNCA 3F5MA 3WBJA 5IUNC 1J5EB 2WA2A 4Q34A 2XCLA 4OA8A 1G8SA 3U7IA 5B7QA 3PHCA 4XIGS 4MDEA 3IVAA 1GGNA 1T4DA 1RPJA 4N3NA 1JA0A 2BUAA 3RRYA 5JAZA 3EW9A 2PFSA 2BZGA 5JZOA 4PYKA 1EDOA 2WSIA 4GRAA 3UXYA 1J97A 2ERYA 3SE0A 2XUAA 3WGGA 2JEZA 4IUBS 2PAAA 1NULA 3D9QX 4ZOLB 1MG0A 4HEA1 3CVOA 5AESA 1LI7A 4PSDA 2A8YA 1HE4A 2J9GA 2VWGA 1NU6A 4MMZB 4UUPA 1KC3A 4HX5A 2I8AA 1AQLA 3NM4A 3Q12A 3OX4A 4QYMA 3EUEA 3IXLA 4UUQA 2QROA 4HLUC 1DB3A 4PRZA 2NTNA 2AHRA 1LB1B 1MD9A 2JFPA 1N8SA 2JDID 3ASYA 3K72B 2NZXA 4H16A 3WL3A 1EPUA 1U0GA 5DHPA 4MEBA 2QSYA 3B5JA 3WGNA 1PO7A 3OOHA 5I9NA 2PMFA 3ZWBA 2GXQA 1IRIA 1W8DA 1PSZA 4IDQA 4UQLA 1UT8A 1K8XB 4R9UC 3TSCA 4FE3A 1T4BA 1VE6A 1Q84A 3K6SB 3DV0B 1SFRA 2V7BA 2PGDA 2QN9A 4BMVA 2N9UA 3O74A 1I3LA 2P4UA 4MYRA 2A7XA 1KQPA 1NHGA 4BZQA 3B53X 3EFOB 3EBOA 4N5LA 1QIFA 5EYPB 4Q7MB 4EATA 4ZC8A 1QH1A 2ARKA 3GUYA 1DADA 3ZBQA 1ZO8A 2OHXA 4UW9A 3ZK7A 1GG8A 3L7JA 3ZU3A 2JZCA 2QN8A 2OE2A 3MBOA 5LLSA 5YASA 3W7AA 1RRPA 2GN0A 3GUUA 2CFOA 1FFXB 2ZIWB 3BRWD 1ZLYA 4V0SA 1FF9A 5E9JA 2C2ZA 4MWSA 5L7WA 2CJPA 2NACA 1N4DA 1W4AA 2XMQA 4G63A 4MUGA 1NVWQ 2IXBA 5E9WA 3DO5A 3NJ4A 4LV5B 3GLGB 3M4YA 4Y2QA 2IIQA 1V4NA 4UE3S 3WWDA 2EVWX 4L57A 1G98A 2W71A 1RWOA 2ZRIA 4PZZA 3WGOA 1EE1A 4DMRA 4MB2A 4OGLA 2LVBA 2R87A 3BDVA 2W5UA 5K2MA 5GADl 2OBXA 4TV9A 2FJPA 3I04A 1ZUNA 3MYYA 2ZW9A 2RG1A 1RVDA 3BL8A 5EWLA 1IWOA 1GG2A 1MOQA 1VSBA 2BKAA 4D9FA 5CA0B 4JWKA 3I04M 1DOZA 2WTUA 4PIPA 1P0CA 2AXNA 3OUUA 3IDAA 4IINA 4NQRA 5ESXA 3VAZA 1SHTX 4N49A 3X2EA 4DUGD 1K27A 2I2AA 1UIRA 4FD3A 4UEJA 4B8YA 4BWGA 1VKNA 3ESZA 2XMDA 4BO4A 2HY7A 4C2AA 1XIVA 2GESA 4OQPA 4Q6WA 3H1BA 2AZ4A 1HI9A 4C0SA 2I6UA 4QG3A 1XNGA 1HM5A 4A2PA 3VH2A 1X3SA 4LHWA 1ZIDA 5DIFA 1J8FA 3DDCA 4PLTA 5AHWA 5E6RB 3FYUC 1GGVA 4IJ6A 1E3WA 1ZH0A 3WWYA 3JY6A 4A0HA 2P2NA 3NV9A 3EJ6A 2ZQZA 4OLFA 1N7IA 3ZY4A 3NHSA 4HH4A 1Q16A 3AEZA 4QYIA 5C8VA 3QMMA 2H5EA 2CVQA 3NTQA 4B1FA 3I9FA 4OIMA 1XTQA 3DM9B 4G81A 2QHXA 3DC7A 1VHLA 3GC6A 1NN1A 3P9SA 3T1QA 3TLMA 3PQ2A 3VR6D 4E07A 2GRJA 4FZVA 3LY9A 5AK3A 5NULA 2REQB 1FBNA 1T36A 4CF5A 3AV3A 3AM5A 3A1FA 1GHTA 4Q7LA 4KREA 1NQ5A 1YGPA 3L06A 1TI7A 4EJSB 5JSHA 2B8WA 1S4MA 5ITVA 5CDHA 2AKAB 4OBEA 5B1SA 5J1TB 3URKA 1GGJA 1NATA 2EW2A 4B81A 2FN8A 3DDOA 1P77A 1H9BA 4JC4A 4DLNA 3UMMA 4X97A 1JF8A 1R9JA 5LQKA 1KDZA 2DQYA 2QD5A 1LC3A 3AGQA 3BTUA 3VUEA 4DR1B 1FBTA 1NXTA 4KRFA 3TNDA 5K8LA 5CX1B 5FR1A 2DY0A 1LBIA 2CJFA 3GROA 4TYNA 1D1PA 2V58A 3D2LA 4E4YA 2EARA 3H19A 1W46A 3T3IA 3IELA 3WA6A 4LRSB 4I4TB 3NWBA 4F5YA 5BOSB 3K71B 4FFSA 4O25A 4HDNA 4QEZA 4WOBA 4DMKA 5IBRA 1BOFA 1I7QB 3S2IA 3K4QA 4M2LA 3D2BA 4CI9A 1SU8A 2AX3A 2FEMA 1EDDA 1EG2A 1GILA 4Q7EA 3DH0A 3ASZA 1LNQA 3PR1A 1H2ZA 3NGLA 1M67A 3GZ4A 1UFKA 2ZRAA 4IUDS 5L7TA 4UVHA 2JGJA 5KOHB 3JZDA 3LZ6A 5KTKA 2AE2A 3ZWWA 1SCJA 3W3AH 4UDNA 5HKBA 4G1UC 4UAVA 3ZJTA 4WCFB 1N34B 1L5MA 1ULAA 1U7TA 2G9ZA 2DLNA 3O3NB 4K6CA 3TM4A 4F60A 5MFPA 3F73A 3KZ1E 3EIUA 3WK8A 4MRVA 1OI3A 1SWWA 5LQJA 2MMCA 4LMRA 5CFQA 1TGVA 3KQHA 4QE3A 3H2IA 4W1RA 1J8MF 1N6HA 2HSDA 4DKXA 1OXXK 1YK1A 3OCXA 4CNBA 4JLUA 3UAOA 3DL0A 5K3SA 3DDHA 4JLPA 3R1IA 2VBCA 3PFFA 1KMIY 4PY2A 1MENA 4DIUA 5B2EA 1YC2A 4HV4A 3FKSA 3Q2OA 2QYOA 1AG9A 4DLKA 5JPCA 3IBYA 1KBQA 1E0SA 1TU4A 5J5CA 5LB2A 3E8MA 2W6JD 4JP5A 5A71A 1JR3D 3FTNA 4AX8A 1K92A 3G13A 3A6EA 4MHOA 2QLJA 1G8JA 4YI5A 4E32A 3X1JA 3L43A 1SCDA 2G67A 2P77A 3KEFA 3F71A 1T1JA 1VJTA 2WAAA 2RHGB 2XKBA 1K2VN 3BZWA 3ZZUA 1O8CA 5D1HA 1KTIA 1GNPA 3U7EB 1SVWA 1T24A 1X1RA 1ONOA 5AP9A 2P9FA 1H0RA 2PCLA 2E18A 2IY8A 3O21A 3W90A 4DDHA 1S1CA 3IR5A 4AULA 2WE8A 3HEMA 4LQCA 3IJEB 2QT9A 3X1MA 1QO0D 5B57C 1REQA 2ZJ2A 2B4TO 4AC9A 4OHCA 1CZNA 1ZA1A 4L5CA 3PYMA 5EKSA 4BKOA 3KTOA 3ADBA 2GF2A 2WTAA 2Z30A 3P5BA 1H66A 1AF4A 2P6NA 1R74A 4YUAA 1QHHA 1DKMA 1YQTA 3L02A 1T9GS 4L5BA 3V8BA 3M0EA 5EQDA 1ZK4A 4GICA 1RDFA 1OJLA 3N0XA 4H9GA 4V0NA 1YB4A 2IHTA 3AEXA 3D81A 3Q3VA 3OIYA 3E2IA 2NZWA 4MQLA 1RYNA 4YRDA 3RWOA 3HKCB 2ZROA 3IEXA 4RPKA 4BV3A 3E5HA 4EHFA 3HH8A 4RTJA 5CIQA 3C48A 4YROA 1N0UA 4FR5A 5AO9A 4PZLA 3IUYA 2X6RA 4CLXA 4F2HA 5EJ4A 3CT6A 1ZW1A 4RULA 1UP4A 4Q4AA 4GEGA 1NLYA 5KOIA 2D5AA 1IMOA 1U0NA 3BK7A 4DBLC 1PN3A 4F56A 1CUBA 2GTIA 3UFXB 2C4NA 3O4HA 2ACEA 5EGNA 4EBBA 4G4SO 1G8HA 1VLJA 2NYAA 3KJFA 2QI9C 1W4BA 4HB0A 1NFFA 2DFVA 2C9CA 3KHTA 3QHPA 2K7ZA 4CTJA 1IXYA 4GXRA 1Q17A 4YECA 4MNTA 5JECA 1YNSA 3IGFA 1ZW6A 2GI4A 4EY5A 1FFGA 3OAAD 3CA8A 4JI7B 3ONWA 1CP3A 1I2BA 2X5OA 3CG4A 1LDMA 3R3UA 1I6MA 2HT1A 4YJFA 3WA7A 3H97A 2LPMA 3DXXA 3ZNQA 3OJ0A 4TT8A 3F1LA 1I7DA 3DDUA 1ZXLA 5J2TF 3F4KA 3KV1A 1NE7A 5F3RA 1VYHA 3WLEA 4PC6A 1FNDA 3Q6NA 1H2EA 2VUTA 3BIXA 3VU3A 3KZVA 2I2CA 1S8FA 3IEIA 4B4DA 1S01A 1LFAA 2JBAA 1SUCA 3OLXA 2OXRA 4EJSC 1PJLA 1RTTA 3HV0A 3QRWA 5JAIA 3WGIA 3GA7A 2Q3CA 1HMPA 3BH7A 4KX3A 4ECAA 1EINA 1FMJA 1VI6A 4EP1A 2XOKD 4RHYA 2R96A 4MPTA 3TQQA 3AFGA 3EVFA 4NESA 4ZAXA 1V2GA 4XWGA 1O0CA 1MC4A 3OZCA 4BMSA 4IHAA 3RJMA 5EE1A 2P4HX 5DRYA 2CLCX 4TUYF 5HKKD 4HQ6A 4C03A 5FTNA 4EMTA 3AF1A 1UDWA 3OD5A 1W4CA 3G1UA 3H5OA 4JGIA 3LFUA 4CDMA 3P9QA 3DOFA 3GJQA 1X87A 4XYLA 5JDIC 3TLGB 3D6FA 4E7OA 3F6EX 2A0UA 3JD2A 4P0TA 2C0CA 3CKKA 4QLOA 1DKNA 1QV7A 4G0NA 3B78A 2RBKA 1L1QA 2EBWA 1NP3A 3EH2A 2YXPX 1F2UB 5KTMA 2PWAA 3FYCA 2XQJA 3CNEA 4L74A 4OK5A 1D6MA 4NBNA 1K6EA 3B13B 3DTVA 2Q4EA 3DB1A 3KJQA 1VZ2A 1H0HA 3V4ZA 5IJ0A 2B1JA 2C58A 3R9KA 4N03A 3SU8A 1EK2A 3DAYA 4FFNA 4QUJA 1RAHA 2PLAA 3EOBI 621PA 4EJ2A 1TM2A 5ALQA 1C8BA 1T2CA 2JFZA 3R3XA 4FFBA 2UZ1A 4MIOA 5EP1A 3WAGA 4WMLA 5ADUS 2VDWA 1RABA 4LJ6A 4E21A 4C6RA 4WCFC 4MQBA 1J8DA 4MWTA 4KLRA 1KEKA 2V9ZA 1GAJA 4BFLA 3FG9A 1F9AA 2FH5B 1ADJA 3F6RA 4L0QA 3ZDQA 2LCIA 4JGBA 1E60A 4R8LA 4JQZA 2P6PA 1Z6AA 2AK3A 1X8LA 3A4VA 3GDGA 3F90A 2Q6TA 3MJCA 3R9XB 3QBEA 4F4FA 3C16C 3JQAA 2EIHA 1G7CA 3C4QA 2H06A 3FOCA 4HNAA 4ENWA 2Z6AA 2NUAA 2OGUA 4TZ6A 2H1WA 1HOTA 1CY4A 2D54A 4KFRA 4X20A 1AB6A 1XZFA 2D5CA 5LVAA 1JG4A 1ZEJA 3E05A 5CGZA 5DM4A 1MDBA 1BW9A 3NS7A 5TVGA 3RRZA 4E5UA 1R27A 2AFHE 3TRJA 4DKJA 1E8DA 3AR5A 3NM6B 4J2TA 5ED0A 5HJ2A 1KZYC 2A58A 1F8FA 1Y8CA 4EA8A 1S2NA 2C2WA 3EGVA 3KQKA 3LFTA 4F4UA 3DVAB 4J0KA 3IALA 2PUJA 2GZ3A 1OR8A 3D6UA 3G8BA 3AMVA 4LYYA 3LLCA 5DWDA 2BD0A 3T3PB 5CA1B 4I14A 4R2XA 3V7FA 4QGFA 1M8GA 1DKLA 4GZ3A 3OPNA 1I94B 5FI0B 3MJSA 2IYQA 2AEFA 5U4QA 4IDDA 3YASA 4TUYA 4Q0MA 3OT4A 3ZK9A 4RABA 2P4SA 3G2QA 3TDMA 1JG3A 4HTAA 4O02B 4Z1MA 5C5DA 4E09A 3PC7A 4DA6A 4GW3A 4IUYA 1PCXA 4BKQA 5J43A 1QRUA 1E1QA 1MO3A 1HQCA 1QX3A 3ETCA 5SICE 3IDSA 2WFMA 3L0SA 3LGAA 3KPJA 1QIEA 3CCFA 3KYDA 1G5QA 1B6TA 1E4OA 2RHRA 4UC0A 9GPBA 1PHPA 3VHXA 1FVOA 4M0EA 4TL6A 1ENPA 4XWYA 2Y92A 1I1OA 3AESB 3LZCA 3OZFA 3PKIA 5HCIA 1MAVA 5JOQA 3AHCA 3F5SA 3ZWNA 4QGAA 1PAUA 2HA4A 4RV9A 1A1SA 4CLRB 1MB2A 4FVTA 1GZSA 1QVRA 2J6IA 2QJRA 2PPLA 2V8BA 3LFHA 1MJNA 2YHIA 3K20A 2BIFA 4EX6A 2YTZA 1TXGA 4EQZA 3T4XA 2R86A 4EO4A 1C7JA 5EVCA 3KOMA 4ZHQA 2NTJA 2O0KA 2QUHA 5JSKA 4HX9A 3TSWA 1YS6A 3DE5X 3QVWA 4FGJA 3UATA 2Z9CA 2ZAYA 4CQLB 4CT0A 4FOSA 3MFYA 1FTNA 1G4HA 5E0OA 3LBIA 2WI8A 1YONA 4QSMA 5CB8A 3X1ZA 2FOXA 2F3SA 4J29A 4M55A 3VC3A 1BA3A 4MVJP 5F2KA 2FUKA 3DMDA 4L9AA 3D43A 2YXEA 3DKIA 1N1GA 5IFLA 1SOVA 3VVLA 5K9ZA 2DTDA 1MLDA 1ULHA 3EARA 4OXQA 1U2DA 2VO1A 5FJJA 3UMCA 1W1WA 5CTAA 4FLMA 5M29A 2NZVG 1S0UA 2VHCA 1YZUA 2QSUA 4HN4B 1SC4A 1Q3HA 5DCUA 5I4BA 5F98A 4LJ9A 2A3RA 3DE7X 3PDIA 3VVMA 3DVLA 4ASUA 4PC2A 2C3PA 4IIJB 2A0WA 1I0IA 2A0YA 3QKSA 3CRZA 3LCUA 4ZQIA 2OHGA 1YKFA 1W85B 1TO6A 2VDKB 4JJGA 3SZMA 1UAAA 1ISFA 2PXCA 5GVSA 5FUYA 4DR6B 1KARA 2FZWA 5DM1A 4X54A 1P7YA 1VGVA 2EZUA 3EEQA 4HMOA 3UHJA 3ZE6A 3FBWA 2IXAA 1Q0TA 1FTWA 4QDJA 3T95A 1CETA 1H2YA 4JC0A 3RH0A 1S8AA 5JQWA 3GLIB 2W4MA 5CLQA 3V2IA 3QE0A 3TTVA 3VR2D 2BPOA 3GWGA 2QQGA 3R8XA 1O96A 1XLWA 1ZIOA 4N12A 1DAGA 4PHFA 6REQB 4YRSA 1EESA 3JRXA 3ADOA 4O6VA 1CTQA 2CD7A 5DHRA 5EIAA 4BEBA 5JSYA 3AWDA 1P44A 3LPAA 1HYEA 2L19A 1AF7A 1I7SB 2OB1A 2XXJA 1IH8A 2HN9A 2WF9A 5HQ3B 3AETB 3GMSA 2CLMB 2GFHA 1I24A 1JQDA 2EZ4A 3GPCA 2JCYA 1N9GA 4JJEA 4IIBA 5IW8A 1R4NB 1ZMTA 3OZ7A 1DINA 3D64A 4P3OA 3PDWA 2PMWB 3QEKA 1ZBDA 1S8NA 3QJYA 3W5UA 4MDFA 1GGHA 1DCFA 1DKRA 1P1KA 4O3FA 1YF3A 2W83A 1QO9A 3MCZA 1Y1TA 2PN1A 3KE8A 3TZQA 2RHDA 4KQFA 1WPQA 4JBGA 4O0MA 4P7FA 1K75A 2PZAA 2W8ZA 3OCVA 3ND6A 4LMBA 2ZSBA 4YMSA 3N05A 1S2GA 3ROKA 1TKBA 4U63A 1E9FA 5GPBA 1C3JA 4WOPA 3GAZA 4BQOA 4B34A 4KQXA 2YINC 2FFRA 4MVCA 4G97A 4IDCA 4B5KA 3BZBA 3LUFA 4CNQA 4R71A 3LDGA 5ITSA 1D0SA 5AH0A 4L9RA 4C5CA 4DILA 5AJZA 2A4KA 1ZL0A 4IGAA 2C8LA 1TW2A 4FXOA 1CJVC 3C2QA 4MPJA 3FOAA 3HCRA 3BMOA 3D7LA 3IUBA 4W7SA 2AXPA 4W9MC 5EE5B 4EGFA 3AKYA 3LD9A 2BFBA 4OHWA 1CS0B 4HS4A 4UUBA 3UAVA 4TQAA 2XI4A 4WK6A 3R75A 4FMCF 4C7XA 1AQNA 3ZUPA 1QCDA 3KQWA 5ALIA 1J2RA 1FSSA 3P7MA 3H99A 3MJTA 3MJRA 5HUHA 1LPBB 1Z9BA 1HDIA 1I4OA 1UUFA 1RPAA 2RAPA 3QU9A 2BEWA 4C43A 1KSGA 3DMNA 4FKBA 4J7XA 3B1ZA 3C39A 3T3MB 2V6IA 1M66A 4EPXA 4G67A 3HWSA 2UDPA 1UPUA 3TUJC 3VYWA 4BQSA 3A4LA 1AGPA 4TRMA 1O5TA 4Q3CA 2XB9A 4WZBE 5LU9A 3HBMA 4GBED 1ECBA 1I1HA 4HDSB 1B00A 2II6A 4KMRA 4QC2A 4YJ3A 2PX3A 4HDKA 3Q2KA 3S29A 4ZA2A 3V4RA 3OY2A 4JU8A 1BVYF 3AEUB 1PU2A 4Z9FA 4YV1A 5GIOE 3WXBA 3ZHSA 2V9PA 1RWNA 4Q24A 5JBIA 2FUG6 1PYOA 2XMZA 4JBYA 2JASA 1GEEA 4RPJA 1H5QA 1W4LA 1Y7HA 2Y77A 4MKZA 4V0LA 1R50A 2B37A 2XLCA 4IS3A 2GB4A 2FSPA 3OPVA 2YY5A 3LUCA 2CYBA 1DC8A 3CZMA 3OUTA 3LKDA 1CZOA 1N3BA 2G07A 5AHOA 4CGZA 1E3SA 1WSWA 1M0TA 1C9DB 4MAFA 1E3DA 2Z5GA 5TPZD 2V0GA 1FUYB 5DV9A 2OECA 3JASA 4CDGA 5JJBA 4FDAA 4NBKA 2Q1SA 1N9KA 3ZKWB 4WLEA 1NLMA 1UC8A 5HFNA 1UIMA 2X15A 3K9BA 3UWKA 5J4YA 2VNAA 1K88A 4XW2A 3NAZA 5MFZA 5I9BA 1DRWA 5LBTA 4YAOA 3UQYS 4MS3B 4MH0R 4MLZA 3T5GA 3EASA 3WK9A 2VK2A 3AXTA 3CW8X 1UZAA 4INZA 4XDHA 3LECA 1MAWA 2FPKA 1W76A 2FFAA 1K3TA 1WPRA 3GLHB 1LBEA 3D5QA 1PNTA 4HEJA 1QZXA 2OQVA 1O95D 5A4IS 5K03A 2ZJBA 1NOJA 1E4EA 2EAUA 1K68A 1U8TA 4TQ9A 4XYBA 4O4HB 2PKCA 1DAEA 4BQQA 3VVCA 1YS9A 2F43A 5DGTA 2ZAMA 5EQJB 2HNKA 5MGNA 3DWIA 5C5IA 4G85A 1ZJWA 3K15A 5LWHA 4OBWA 1YRHA 4Z9AA 2YYSA 2O2YA 3T52A 1RAIA 1OJ7A 1SRQA 4JL6A 5KEIA 3CRVA 5BPFA 1NW9B 2YJGA 3M1LA 4BBPA 2O0HA 4CF3A 5GJVC 4AD8A 2AN3A 3TRFA 1OIXA 3U4QA 2GYVA 1L4HA 2O2ZA 3HEBA 2H7VA 2I78A 2NU9A 3MGBA 3COWA 3DDSA 2ZYGA 4M98A 3GJSA 2QXTA 4RQUA 2XVYA 1TEXA 1E92A 4BQFA 3S2YA 1K5HA 2XMPA 3VZRA 4ZAGA 2J3MA 1ONSA 4RAOA 3EGWA 2R48A 4NJMA 2EKQA 4NPCA 2CC2A 2CHFA 4PLHA 1M1UA 3SR0A 2O8FA 5JG7A 2EX0A 5EUCA 4FHCA 5FTMA 2O3TA 4RK6A 3GGSA 1GRNA 3ZDXB 4KFUA 4UBMA 3FTQA 3HB5X 2PSJA 3KT6A 4NS4A 1O1YA 2B2CA 5DCWA 5FA8A 1NURA 2QTRA 3H04A 4WDRA 3IVRA 4Q15A 5C3MA 1L5NA 3IV6A 4WK2B 3I30X 3IE0A 4NARA 1QP0A 1QGUA 1M2KA 3CIFA 3MHPA 3ZGNA 2IPLA 3NC0C 1Z5PA 1GVHA 4S1VA 5KQGA 4X41A 3NONA 5FORA 4ZYXA 2B61A 4WOJA 2GA8A 3KKNA 4FLFA 4LSWA 5FFMA 5AJVB 1UMKA 2XGSA 3IBGA 4Z7NB 2P5UA 1IOVA 3PYLA 4G8DA 2D00A 1O0SA 3AY6A 3VKHA 3KVNA 4QGHA 2BI4A 2D06A 4BMNA 1KQ3A 1QXSA 2IXFA 5AVTA 1E2UA 2GPJA 3W3AA 4XTRA 4RK4A 3CZPA 5IVIA 1EXWA 2FDRA 1WMEA 5JNWA 4U7FA 9LDTA 3KR1A 3RJZA 3TJZA 2WF6A 3PT5A 2G88A 4MVYA 5I7AA 3C41J 1ZEMA 3NHPA 3O8QB 2OFFA 4YXFA 1CUUA 2ZSIA 2XUGA 2G09A 4QT0A 5ALNA 1SAYA 3DKVA 1HYGA 3KTDA 1YA8A 1FP4B 1Z4IA 2CMKA 3CBGA 3CONA 4O4LF 2NPFA 3MS2A 1U0RA 1PD0A 3P9CA 4I55B 4R1PA 4YGXB 1Z6XA 3BD9A 3U4AA 5K6TA 2Y9PB 4JQCA 2OGSA 2WFLB 3IA2A 4PAMA 4I3FA 3N2KB 3TVTA 2HGZA 2D6FA 4EGQA 2X86A 4YBRA 5IDYA 2Q5OA 1ZVKA 2R6CA 4RA9B 1K8ZB 1GADO 3GDHA 3FPFA 4M9SA 3RYHA 1XX6A 1WUTA 2ASEA 1N7GA 3HC7A 4M46A 3WJ2A 4V1CB 3MHTA 4LX0A 5AKEA 5HK9A 1FYDA 3AEKA 3DZ8A 1N6NA 5A2QA 1FK8A 4MQFA 3TX2A 2BTOA 2P2CA 3L7KA 1Z33A 4LK2A 4WCDA 1A7AA 4Q02A 4XDGA 3PWKA 5TIIA 3ABZA 2I99A 5AQ1A 3UGJA 4Q21A 1D2EA 2BFFA 2ECOA 3ZWYA 2X3FA 3D4NA 2AYYA 4DNFA 2L18A 3BH6A 2L2QA 4RVUA 1IHYA 4B7UA 5KOJB 3M70A 4AJOA 2POQX 1LH0A 2I34A 1ZGJA 2XJ4A 2H7YA 3UOGA 4HEA6 2JFOA 4ESOA 3ZLTA 4NMLA 4DR2B 3PEYA 2RCNA 3QZUA 1GQFA 1XTIA 1PZHA 1ZIPA 1FDVA 5F77A 3DZBA 3HCDA 1K5DA 3SBOA 4BJ5A 4EJMA 2BHSA 1KERA 3C1UA 5D5HA 3ZD8A 2VHZA 2JLSA 3QOXA 5GGYA 4KGZA 3ZWMA 4CUJA 6ADHA 2PUEA 1C9NA 2X7JA 1HE5A 2REXB 4UBOA 1H5NA 3E1KA 1CJKC 1K66A 3PITA 3S6JA 2WWRA 3LUAA 1GUDA 4Z4EA 1C0PA 3PJGA 3KDPA 1CQJB 1RQXA 2QXYA 1QKJA 4YJDA 4PE5B 2I7DA 4QJ5A 4RDCA 1Y80A 3G85A 3KQOA 3SC2A 5T57A 1GDHA 2NVWA 2XWPA 3PIRA 4XUGB 3QVTA 1AK9A 1QYXA 1W0KA 1TJNA 2IHUA 2PA0A 1CNFA 4QYWA 4KNYA 2HA0A 2YIVX 3JAWA 1U28A 2PTHA 4C9BA 3EGDA 2XOEA 4LGCA 4JXJA 3A6HA 1BMFA 1SC3A 1SQGA 2Q0XA 1Z35A 1ZAKA 2AMJA 4MPPA 4W5WA 3JQ9C 4PFQA 3RC2A 1DU4A 2G0TA 4RPLA 1L8LA 1ZZEA 2D74A 2HO5A 4IIXA 4LQ4A 3A6GA 2UVPB 3NHWA 4IIVA 5HDQA 4CBVA 1UEXC 2V6MA 3GEIA 3A3NA 3ZC3A 4YUWA 4BB9A 4CMEA 4C1BA 2PGIA 3LG2A 1PJBA 4US1R 1NXXA 3UYLA 4BNZA 5IT9A 2OBFA 2ET6A 2H2IA 3RSGA 4EY4A 5JD6A 3OM8A 1QFXA 1PR3A 3QKRB 1C1DA 2PK3A 2QRLA 4GXNA 2WFAA 2VRBA 4P7BA 4BLSA 3KJGA 2Q6OA 3AL0C 1E62A 4HC4A 2BBTA 3CWZA 1W59A 3JWGA 4L22A 4F2PA 1E79D 4M1EA 3HY3A 4D5EA 1QZTA 1LUAA 2FPSA 3NT2A 3EZLA 1WCIA 1FEZA 4FYWA 4J3NA 2H48A 4DDKA 3AVTA 3FLAA 5DW3A 2OPBA 2SKDA 4GFDA 3CB2A 4C06A 2NTVA 1ESDA 3UGTA 5DMHA 4M36A 1GJRA 3NM5A 1CHDA 1RXUA 2FA9A 1MX9A 1QC5A 1UR5A 2FPLA 3B3AA 5TQ0B 2ZUVA 4DAOA 3H9QA 2PMKA 4A6EA 5E9AA 3KYJB 8LDHA 1NHWA 2Q5QA 2XF2A 1PWHA 3AUYA 3MCUA 4HUQA 4KI7A 4P34A 5CGQB 5JWRA 3CVXA 2F3PA 4EA9A 4R8SA 5IKMA 3AZQA 2ZWPA 4OFWA 3RT1A 5KNLA 3AF3A 1NLUA 4CQJA 5K20A 4EVSA 2QP9X 4FHDA 4FHGA 2GBLA 5B3JA 3T5AA 3LC2O 1DTEA 1QMPA 1A5AB 1WJGA 5IMBA 4RMGA 4Y1FA 3U61B 2F90A 1R66A 4FU0A 3WGKA 1Z17A 1KU0A 1VECA 3GN1A 3RSSA 2DFPA 4NBRA 4UHHA 2P7HA 2R6DA 5DN6A 3V7NA 1NQUA 5JS2A 4AIRA 1UINA 4A2WA 5B58T 2O2GA 4H60A 4IH4A 5EWMA 1TCVA 1ECFA 2W6PA 2DQSA 3MD9A 4RKQA 4DLXA 1C1YA 1O9BA 2LIPA 3EIOA 2P1RA 2IF0A 1PLKA 4AMUA 1DLIA 4KRYA 2PANA 4OI4A 5LYYA 2PR7A 3E22A 4OQ4A 3K16A 1Z22A 5M2QA 2VPWA 4PHTA 3VR1A 2PQ6A 2BGTA 4IICA 2G8LA 1U2SA 4J4BA 3GIWA 5TY0A 1VKJA 2AR9A 1HRKA 1T8WA 2W11A 5C1PA 2CEAA 2OHFA 2RK6A 1M6EX 2WJAA 1AKVA 3NANA 4WJZA 5FOTA 1XMXA 1YZQA 2P8SA 4HZUB 1W75A 5DGHA 2Q3HA 3UMRA 1P6UA 3WWPA 4ZFNA 4RTKA 4MGZR 3ZHVA 3T1NA 3C43A 4L5YA 4PQGA 1XTTA 1HNXB 3V00A 4I9NA 5DNEA 3H6KA 2HJWA 3NHZA 2OYSA 1CR1A 2AT1A 3BK1A 2QRVA 4BPRA 4Z99A 1K9VF 2DKOA 2X9GA 4QPDA 4NMMA 4WE3A 5A9TA 5B2FA 2R6HA 1VLVA 2Z8YM 3AONB 2FLKA 5HDBB 1VE9A 5A5GA 2R8RA 1I3MA 2VR1A 3MOIA 3I39X 3EGIA 4OP3A 1PKXA 4Q9JA 2ZYUX 4XAQA 4RVCA 2F1RA 3ROTA 5FX2A 4NRDA 1S2LA 4IV5A 4K26A 3I0MA 3D3QA 3HLTA 1CQZA 1P1BA 3FAZA 5AIBA 1IAVA 3ESQA 3QE9Y 1OI4A 4Y2GA 4Z0PA 1PSWA 3CY6A 4LA4A 3ERCA 4WNIA 1CZHA 2K87A 1B6SA 2ERCA 2ZIVB 4R8KA 4V2IA 1VYVA 4XSHA 3UG7A 3E27A 4QODA 2KWIA 5JO0A 3FJYA 1WW3A 3MUEA 4GQBA 5CDYA 1YZHA 4LDZA 5CFMA 2VJYA 1CQWA 3HG7A 4C5BA 4TV8F 5FEMA 3BMCB 3ZDRA 1W0JA 3OIFA 1CE8A 3S44A 1NRXA 1T6BY 2IYOA 4DEYA 3OTOB 4G23A 1NBEA 3I2JA 1HDXA 1R8JA 4AKGA 1N5RA 1V45E 3VKUA 4EOGA 3SVTA 4AXXA 1BXKA 2OXTA 5T4HA 3TG8A 3IOBA 3CLSD 1N92A 5T3UA 1WS6A 4W9NA 2J3QA 3R44A 5JCJA 4HWSA 4I50F 1RJFA 3GFBA 5F2OA 3UPDA 2ZRQA 1FTYA 3ADCA 1DQSA 1EM6A 3DCYA 4V0MA 3ULKA 3W8FA 3QXHA 5CP8A 3MGCA 4UE2A 2NU7B 4CF6A 1Z7BA 2PIAA 1BEUB 1U98A 3HM2A 1RKBA 1NF2A 1U2ZA 4MP6A 4CMJA 1II8B 4L2IB 4LHSA 4TQUS 2PXAA 5D3MB 2G0AA 3KZCA 3RIHA