4V3CA

The structure of alpha2,3-sialyltransferase variant 2 from pasteurella dagmatis in complex with the donor product cmp
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
388
structure length
388
Chain Sequence
SKTITIYLDHASLPTLNQLMHFTKESEDKETARIFGFSRFKLPEKITEQYNNIHFVEIKNNRPTEDIFTILDQYPEKLELDLHLNIAHSIQLFHPILQYRFKHPDRISIKSLNLYDDGTAEYVDLEKEENKDIKSAIKKAEKQLSDYLLTGKINFDNPTLARYVWQSQYPVKYHFLSTEYFEKAEFLQPLKTYLAGKYQKMDWSAYEKLSPEQQTFYLKLVGFSDETKQLFHTEQTKFIFTGTTTWEGNTDIREYYAKQQLNLLKHFTHSEGDLFIGDQYKIYFKGHPRGGDINDYILKHAKDITNIPANISFEILMMTGLLPDKVGGVASSLYFSLPKEKISHIIFTSNKKIKNKEDALNDPYVRVMLRLGMIDKSQIIFWDSLKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SIALYLTRANSFERASE
publication title Complete Switch from Alpha2,3- to Alpha2,6-Regioselectivity in Pasteurella Dagmatis Beta-D-Galactoside Sialyltransferase by Active-Site Redesign
pubmed doi rcsb
source organism Pasteurella dagmatis
total genus 135
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2014-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v3cA02
3.40.50.11120 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4v3cA01
4V3BA 2IHKA 2IHZA 4R83A 2ILVA 2C83A 2Z4TA 2IY8A 2C84A 4R9VA 4V38A 4V2UA 4V39A 2EX0A 2IY7A 4V3CA 4R84A 3S44A 2IIQA 2ZWIA 2IHJA 2EX1A 2II6A 2IIBA
chains in the Genus database with same CATH superfamily
1IK6A 4P84A 3ZIAA 4K6CA 5ARDA 2N47A 1X87A 1K0UA 2PD4A 4P7JA 3OSZA 3K0KA 5T8KA 4TKUA 4L0CA 2QT0A 3GRCA 5FO0A 2FPWA 1P5JA 3KOWA 1J6UA 2J31A 1QVVA 4YJHB 1GQSA 4FE3A 4N47A 3AF0A 1ZH8A 3L93A 3MWDA 5DX1A 5CYGA 3UXMA 5A02A 4BMCA 4HVAA 2C2MA 3HP1A 4E51A 2YN4A 1GAQA 3EXIA 3O6VA 4JU9A 2FSUA 2AJLI 4DLBA 1FTQA 3AMVA 1DOHA 4MAAA 4QDOA 2VWHA 3PYXA 3TGLA 2YHAA 4DR2B 1CZLA 2FZ5A 2I65A 4MDFA 1IONA 1D2EA 2HHLA 2CJFA 5EXXA 2FETA 3GMIA 5EZ6B 1QC5B 4B83A 4BS9A 2YHSA 4TZ6A 8LDHA 3DP9A 2BJWA 2E48A 3KT6A 1F8GA 3NYQA 3EJ6A 3SZOA 1NPYA 1A97A 2HJHA 2J6CA 4Q4HA 2PU5A 1PR5A 5DMHA 2ODNA 4HPWA 5E6SB 1NVXQ 4FNMA 1BH6A 1WXGA 1MT3A 3L6EA 1ADCA 3RSZA 3QBDA 2AS0A 4TQ9A 1EH5A 1FMJA 3ZYZA 4OGLA 4HDKB 3ZGLA 2IHBA 3PYMA 5E8JA 4HWRA 1ZOSA 5JXHA 1A8UA 4ZOQI 4PLFA 3IE1A 4KFCA 1NXPA 3UT6A 1L4NA 4ZHQF 1KEVA 1DZ3A 1T34A 2CBXA 3MLBA 2ZJ0A 3AEYA 3QLVC 3SS8A 1O0SA 3QOXA 3SQLA 4EYGA 5L51A 4R8LA 3L7BA 4D92A 4MDEA 4BQNA 4QU8A 1W9MA 4Y6RA 4HDSB 1OCEA 3O4VA 4I50B 4MYUA 3RABA 2L17A 4HC4A 1SCIA 1UMCA 5CA1B 5JSQA 2Q6VA 4BHTA 1BCRB 5IW8A 4KN9S 1H1DA 1TK3A 1A77A 1PZGA 1VYHA 4ND4A 1JJAA 2HWKA 4OFZA 2FH5B 4JROA 4QQFA 1O8BA 2CVOA 3HDTA 4UDYX 5B7GA 1N5JA 4MULA 2XQFA 1UDRA 3B51X 1GNVA 4IH1A 1KGSA 1R16A 1XJCA 2VA9A 2B6HA 1ZCFA 2DVMA 3G7UA 3R40A 4G0MA 5FUBA 1T6XA 1JQAA 2FXVA 3AUFA 3H1BA 3I9LA 3L1HA 1FCJA 4G89A 4H4DA 1C7RA 1X8LA 5D84A 4YI3A 1JDSA 3JQ6A 2F4VB 1EK0A 3B1ZA 4LI0A 5CURA 1PO7A 1XAJA 2I76A 1U8ZA 1Z5UA 3DFZA 3VYUB 3C3WA 3TRJA 2ZBFA 1VIYA 1W25A 1YB1A 3PVZA 1Y6QA 4HUTA 5FI3A 4Z2AA 1WQ1R 1A98A 5EZSA 3QGMA 1A5TA 3K1AA 1AHNA 1LRJA 3AHIA 4NOKA 4PHCA 3B9RA 4JJKA 4TWZA 5F2NA 3IEVA 4ZZ1A 5DM1A 3MB8A 4XX0B 2UZAA 2E18A 2IUSA 3ROZA 2JI6A 1SHJA 1E9EA 1E79A 1KC3A 3E4CA 4P4NA 3VPCA 4BGUA 4V0ME 1KYWA 1HMPA 2FQQA 2I7TA 3QUTA 5I8WA 2FZGA 2CZCA 1QSGA 4MMXB 4UQOA 2I62A 1KEEB 5AW0A 4R1LA 2W6ID 3PITA 3EIFA 3OIDA 2JD2A 2WSSA 5IUKC 4MWTA 4YP0A 4NS4A 2Q7OE 2NVWA 3HVIA 2W6MA 1P72A 2VYNA 1BEEA 3GVHA 4UULA 5KYUB 4Y2QA 2XCUA 5ALRA 1XPOA 1T6NA 2H2DA 2I8CA 2O2EA 3MINA 3N8NA 3GP5A 4R2JA 3ZCRA 5KYYA 2G88A 1ZR2A 2XY4A 1Z26A 1AK2A 3CLUC 2QVGA 3FFBA 4TWAA 1SU6A 5FOTA 4O3MA 2BI7A 1U65A 3TH5A 5BW5A 2VF5X 1M2EA 2AEJA 3G9TA 3RQIA 1MHTA 3RYCB 3JAMA 4QYTA 3VVBA 1E0DA 2CBGA 4YASA 1FP4A 3CH5A 1B0AA 1Y8AA 2HI0A 4XDHA 1JSLA 1T4BA 4J0DA 4LBVA 4UDXX 2IV3A 3R7LA 3T99A 2A5YB 3RSFA 1CZHA 2QYSA 3DNFA 3BFVA 3A9SA 4OFXA 2EJVA 2PGXA 3ZJVA 4B3IA 4HNGA 1UKYA 1UCFA 5F9FA 3SZUA 3V1KA 2AG8A 4ZYWA 2FNAA 3PHJA 3A9TA 3TKLA 5BYBA 4D1YA 5JAPA 1DDOA 2CLDX 3K92A 3KHKA 1U0RA 2PL3A 1XHFA 5PNTA 3UGTA 1SXJA 3B48A 1DQNA 3VR6A 4YRZA 1WB4A 2PGJA 2A9FA 4F6LA 1T1IA 1XTRA 3IPXA 2C8KA 3K09C 4M9RA 4UPEA 2FPMA 1CEYA 1CIJA 1P2TA 2FSHA 3DMDA 4GI1A 4N7BA 5HIKA 1BXRA 3H11A 3E9EA 4G23A 5JSZB 2HEGA 4Y2GA 5E0KB 4KPEC 2YUTA 4PX9A 1P2DA 4FBGA 3HC7A 4JUIA 3NG1A 5D5QA 1YQQA 4KI7A 2BISA 4NE7A 1OX4B 3ZW9A 4ZK2A 1J2TA 1UIRA 2ZWMA 1ESMA 4KPYA 2Q1XA 3K09A 3K30A 3P9CA 3ZUGA 2W4QA 1M10A 4JEMA 1QHHA 4GZ3A 3SMQA 4AY5A 1RP7A 1I5OA 4X95A 1UZLA 1XZNA 1ZX1A 2NN3C 4OHBA 4CFZA 5KSOA 4RTOA 1OWNA 2A7XA 3ZQJA 1MAUA 3HYNA 2DQSA 1WXDA 4R7TA 1K9SA 2PJUA 2KLHA 3LY9A 3TW8A 3NEAA 3ZNOA 1QTQA 3RLFA 2GDJA 1JVNA 5DNCA 5ECWA 1G9TA 2QLLA 3WNDA 1YDMA 4WNYA 3U13A 3IERA 4QGHA 1NVWQ 1ZXBA 1Y5LA 2W71A 3OEHD 1K8ZB 3O91A 2FA9A 3L7OA 4JXJA 4MQUA 4XIFA 5DFAA 3V80A 5C8YF 1UJ5A 4OP1A 3DD1A 3WBKA 2VYCA 4YALA 5CFMA 1QWSA 3TEFA 5JQGF 3GQBA 4OHYA 3RHFA 1KU6A 1WRBA 3O9VA 4QNRA 4ZCQA 2O8EB 1U2TA 1GN8A 3O95A 1EM8A 2R8OA 5JSYA 2OSVA 3RIXA 3OIWA 2ZJBA 3O1LA 2V9ZA 4ZO9A 1F8UA 5KJ1A 3BWVA 1I4OA 1LRKA 5JCPA 2RE8A 1UL1X 5ICEA 1ULHA 1X7XB 4EL5A 3KJGA 1LPOA 3OPYB 3SD7A 3UK2A 4QOEA 3ZCVA 4L7QA 1YA6A 3HUDA 3ES9A 3DKRA 4MGZR 2XPCA 1WCIA 1FMTA 3G9UA 4G5YA 3R7WB 1XTTA 3Q7EA 1Q44A 4MNTA 1WV1A 3E84A 4D4GA 1GPAA 2G4VA 5JH7F 5LZ7A 1TEVA 4UM7A 3BRWD 1MDFA 4NABA 2X7XA 1RXUA 4XEUA 2VCHA 4ZVVA 1JYSA 4W82A 4O2AF 3ORYA 4HQNA 1JEYB 3CLRC 1OU4A 4ZWNA 1NJFA 2FDXA 1GY8A 1JAXA 1PS8A 2PS0A 3JQ8A 4BV8A 1OHHA 1WKCA 1L9XA 3WSTA 2HDOA 4F5EA 1VSQA 1K7YA 1OKKD 4HRYA 2Y0BA 1YAJA 4U7WA 1T9DA 4RIEA 3U62A 3ZJUA 3ADKA 3IMKA 4B6RA 1J2JA 1KK0A 2IUTA 2FWBA 3GUYA 5DCWA 4CIXA 1TM3E 3L49A 2AZXA 1YR2A 1NY6A 3OLWA 1X94A 1CJSA 1LD3A 3H9UA 3LWNA 3ANXA 1XTBA 4F56A 3NDPA 3U49A 1DKOA 2BVNA 4IVNA 5LFAA 4X54A 5ESWA 1NMQA 4RTPA 5FPKA 4BXOB 1UBLS 4BO6A 1T2DA 2AMJA 3KQPA 5AUPB 2PU7A 2ZB8A 1TPZA 1T29A 2UYGA 3DO5A 4IV5A 2J9FA 3DZFA 4A8PA 2GYUA 2ASVA 3A6PC 3TE7A 1R7RA 1Q1QA 2BR5A 2PUJA 3JSAA 3L7LA 1E3WB 5REQB 5JW6A 3PK0A 3OFVA 4UHHA 5AJWA 2DTXA 3NTQA 3HS3A 1W47A 1TIBA 1VZ3A 1IVYA 1GZ3A 1QFXA 1TMGE 2GVDC 1N6HA 5CDGA 5GINE 1OH8A 2Q5JA 4DIMA 3LUAA 1IRXA 2E1PA 2OGWA 4ZO6A 5CB6A 3ERCA 4RGBA 1VLLA 3U4AA 3WOHA 3O8LA 3NKVA 1R74A 5IJ9B 1DKLA 4Q4JA 1Q19A 3T7IA 4LDNA 4IH9A 2CWWA 4YCJA 5JBNA 5JWRA 2GPYA 2G5PA 4G5XA 3WVNA 1RTKA 4YXWD 1LFDB 3TW6A 4RDCA 4JODA 4X8OA 2BMDA 2QN3A 1P1KA 2HKIA 4US2R 1KMIY 1V3VA 5T5QA 1ZBQA 3CBGA 5HOQA 2E4AA 2XTAA 4I4NA 3UCFA 3HKBB 4I08A 3JWPA 5CUQA 4CQJA 5KU7A 3OT4A 4PYNA 2JBAA 3ICPA 5BN5B 2D54A 2ZIXA 4W8GA 3T0GA 3K6JA 4OKSA 2XGGA 2LGJA 5EXTA 2HF8A 3NALA 3QFRA 3SBOA 3RS8A 1VLJA 2HMWA 4AVYA 4ZVPA 5I4IA 5HILA 2PNJA 8ATCA 2R4TA 2F8SA 4Q0MA 4Q48A 1QLWA 3C5WP 3ZLTA 2XV1A 3R5TA 4CTOA 1G3IA 1ZD1A 4LJKA 3PGJA 2KB0A 2R6CA 3KPUA 3C2QA 2YWRA 3G49A 2I1QA 2QRJA 5LKAA 3RYHB 5J4KA 4LF5B 5KNCH 3ANLA 3OC6A 4QDJA 3IV6A 3GROA 1UP6A 4XDYA 5BW6B 2QGFA 3WSWA 2CHFA 4R8MA 3BZWA 2E4ZA 3OZDA 2MWMA 1WQ3A 2CHQA 3LHKA 3A4TA 5GZ6A 2H3EA 1E7YA 2IITA 4PZ0A 3HRIA 1SEPA 4H3HB 5LP6F 3UY4A 1EWKA 1U7UA 1WB5A 2QRVB 3DAOA 5T64A 3RC3A 5I47A 4EX6A 2VG8A 1TGYA 1IY2A 4HP8A 3DEZA 3GLSA 1IUPA 1UK8A 5ALUA 3ZQUA 1LI5A 3S1SA 3MCTA 2QUJA 4MTLA 2V58A 4YDQA 1J06A 1ULZA 1E2KA 3SLKA 4BNHA 2B0CA 1YJQA 3KUUA 3IULA 2V65A 1Z4IA 3IE2A 4KTVE 3WGIA 3UGKA 4BFSA 3O3NB 1EHYA 1NAHA 1WZIA 1YRYE 2JFOA 2V6MA 3L0BA 5A5VA 2P6UA 1FW6A 2XUAA 1B8PA 1FU8A 1M0WA 4HDNB 5ECYA 3UJ9A 1X1DA 2A9VA 2JZNA 2L2QA 3A10A 1YU9A 1XMJA 3C16C 2FZWA 1N8TA 3E05A 3LPNA 1E1CB 4FUQA 4RSRA 3KOMA 1WB6A 3BYZA 4FOOA 3W5SA 4JYAB 3BAZA 2QZJA 2R86A 3C3PA 5H0IA 4KNYA 1Z62A 2IXTA 1V8DA 1MN6A 3EUEA 3CNQS 1JALA 2DTEA 2G04A 5C9ZA 1JIIA 1T24A 2DUJA 2XOEA 2LIPA 4ZCLA 3ZJ4A 3OF2A 4RPKA 5C8XA 5BUZA 5EIBD 5LYJF 2IHNA 4WGFA 3R9KA 4D45A 5JVDF 1H2FA 2D0OB 2SICE 5LJLA 1V37A 1GOTA 3S2EA 3ROEA 4DNPA 2XVAA 1ADGA 2QDXA 3TM4A 4JVMA 2ZCJA 1XP8A 2R2GA 2J67A 4XJTA 4FOSA 3BCUA 5K3DA 2X0RA 3PHLA 2GTHA 3VH2A 3A36A 1U0HC 2ONYA 3HJUA 4QTZA 3AM3A 1BJTA 3GT4A 5JFGA 4OX9Y 1N2GA 4OYHA 3A6DA 2GBPA 5AVYA 3OX2A 4NULA 2Q6IA 3DNMA 3U3JA 5B6JA 4QYIA 1VLZA 3KUXA 4DLXA 1JE1A 5BQ3A 3G0OA 2AUMA 3N2KB 2ZVQX 5ITWA 1L8OA 1YF3A 2IKQA 3UB4A 2GZMA 2E3JA 3WGHA 4EUFA 2J8ZA 3W6OA 1Q7TA 1Z7YA 1T5IA 3C8HA 3FOWA 2WNHA 5EXEA 1QQ7A 4DANA 2JDID 4FGSA 1OLXA 1PQ4A 3C3BA 3GRAA 3V00A 1TKRA 4A5SA 4AULA 1E63A 4MIOA 2GPAA 1JAYA 5FPSA 1O96A 1Q7RA 2XYVA 5HF6A 4D98A 2PR2A 2WAXA 1ZXXA 4F12A 2OBLA 4L6CA 4R0VA 3NC4A 5JS2A 2CW5A 3WMWA 1GD1O 2CMHA 2G82A 1KRXA 1NFRA 2Z08A 3F71A 3RUAA 1KYTA 2INGX 5HYVA 1XNRB 3GD5A 5IVKA 1SVSA 3MTQA 4KR3A 2IGTA 5IKPA 4X91A 5L4NA 1Z2AA 3R77A 2GK3A 3PWTA 1POWA 2EHJA 4EP1A 5DYNA 3FNGA 3VHLB 1KF0A 2I4RA 3OY7A 1G66A 1RAIA 3OH8A 3OMWA 2MJLA 3TUIC 1ODIA 2EL7A 1POXA 4DAEA 1P0MA 4EG5A 2W93A 5LL6P 5G53C 3PIRA 3ZPXA 1K5GA 3I5YA 1B14A 1ZI9A 3AB7A 4RM2A 2HQRA 4LVOA 4JUBA 5AHWA 5A5FA 2ECOA 5DWQA 1AMNA 4IV8A 2ZRGA 4C01A 2Q4OA 1X6VA 3G68A 5B3JA 3T7SA 1ECFA 2GN0A 3M8KA 3P7MA 4RZXA 2ZE6A 2VDRB 3RHSA 4YQFA 1DIHA 2VP2A 3KSZO 1VBNA 5LDGA 4EQ6B 3UK1A 3K96A 1Z2NX 3LX6A 5LXTF 3WWCA 2ZVDA 4X1YA 3GJ3A 5ALOA 3GN1A 1QIJA 1L4KA 1WPRA 1WD5A 1WM1A 1YSCA 1N5KA 1LZLA 2QV7A 3QW2A 3RHTA 4ZI2A 1DEHA 5I7SA 1QM5A 1P18A 2HPHA 5HZKA 3RS5A 1V0JA 4IDAA 1GAXA 5CXQA 4D4JA 1R3UA 5BVHB 1LPPA 4U0KA 4D3SA 2F3PA 4B82A 3ONEA 4MWSA 3SCZA 1LU9A 2BGIA 2PTGA 2FSGA 4YROA 1BU5A 4YUZA 4YI5A 4DC1A 2BE9A 4KI0A 1SELA 2GSDA 3L7YA 1ZVMA 3MGCA 4HCJA 3A6ZA 1QE3A 3VDXA 4E0BA 4G9BA 5IN5A 3GZNA 3GJ8A 5FJIA 3V55A 1K08A 2AN9A 4NZMA 2XXAA 3EQ2A 3I6MA 3MT7A 1E7RA 4AJKA 1OWOA 3UMYA 5J47A 2ZJ8A 1TDJA 5CVTA 2ISQA 4AJIA 1AQLA 1DBSA 1I4WA 4RIHA 2D1QA 3O21A 5FPTA 2QI9C 5E1OA 1IJFA 3O7WA 1C9JA 3DFUA 1H1TA 3OFNA 2AD5A 4LOKA 4EG8A 2QW0X 2YMQA 2IS6A 2C2YA 2OC4A 3HA5A 3AINA 1GG5A 1QIGA 3IB6A 3K70B 3D54D 4QOJA 3JALB 3U4QA 1E6KA 1YZTA 4K9MA 1RXWA 4QULA 3TINA 3GLIA 4QQNA 1P0QA 5CLHA 3A1UA 3NZEA 4N40A 3ZTYA 5CCBA 1M76A 5A3RA 3ZVLA 4BX0A 3BOSA 3L77A 4I36A 4LYDA 3LCJA 2WUGA 3TIIA 3EA4A 3ZK9A 1GTSA 2AWOA 4M1OA 3UV6A 1DU4A 1DADA 1NW5A 4Y3UA 4ZARA 3WGKA 3MS7A 3V4SA 1SUEA 4B8ZA 1X2EA 2BFCB 3KZVA 4HGZA 1A8QA 3MMNA 4RLHA 3W9SA 3K53A 3LTNC 1B1AA 1LC0A 5IBRA 2J9XB 3IVCA 3P26A 3S68A 1ONOA 4F4DA 2YR0A 3UT5B 2JGRA 4Q05A 4PYOA 2HTFA 4FFVA 3PDUA 2P91A 1KO5A 3HO8A 1SOVA 3C4QA 3RJ9A 4AZ0B 3TF5A 3NXKA 4AQDA 5B6PA 4DCGA 3EVFA 4OGWA 2RD2A 2EJCA 4BCDA 2WD7B 1XVIA 3EVNA 4D0RA 2I2CA 3KR9A 2YOHA 1TUBB 1JQKA 2QUAA 1EQ2A 3IS3A 2P0YA 3GLHB 4KN8A 1EDZA 5HGJA 2G1AA 2K4MA 4MKHA 4BVFA 2IPLA 1T4CB 3PQ6A 4HEA6 1YHYA 3K73O 4WGGA 1JG7A 4BU1A 5M7EA 4PLZA 4RCZA 4UC0A 4LHYA 1KZYC 2IPNA 3HCBA 4ZYVA 3AUXA 3J81A 2Q1SA 2NTNA 5EZQA 5DLPA 1DC4A 2FHSA 4ETWA 1AF7A 4MUYA 1P3JA 2YXBA 4BNYA 1NQTA 4QNMA 1DL5A 5JS6A 3NKFA 5FEUA 4KH0A 1QHNA 4XIIA 4EPXA 1QTNA 4HAOA 1CRZA 3FF1A 4IMRA 4GGOA 3DB1A 1HT0A 1COWD 4C0QC 4CDNA 2I2DA 1BMFA 3KT3A 1X8JA 3QMMA 3T7RA 5LMUB 5LM3A 2Q0HA 3AKYA 3B5IA 5THXA 5BPFA 1T1SA 2X58A 3THYB 1U98A 1ILWA 1N2XA 4KEAA 4B71A 1E4EA 2OCAA 3RTEA 4DR7B 4EL0A 1R0WA 5KDOA 5CFRA 2PUTA 5DX0A 4H6PA 5KWSA 3JWIA 4ID9A 3DLTA 3Q87B 2PSHA 2Q1WA 4JR1A 3C4VA 4R1SA 5IVDA 1YZYA 4GR9A 3I6QA 1U9IC 4HGOA 1GKLA 2BGNA 5FNVF 4FYWA 3R8XA 2B3DA 3STXA 3WKAA 4BQIA 1JDJA 5KPDA 2JLYA 1AUPA 4NCNA 1HDEA 4X97A 5A6SA 4ZIRA 1HG0A 1ESCA 1K63A 3M1AA 1Q17A 3CB4A 3PRYA 4H7EA 1ZR4A 4TVOA 5JJLA 1DCKA 4WXHA 5DTEA 1U9IA 4CM6A 2AC7A 2ZRNA 3QW4B 1TVCA 2HLDA 2PA0A 1QOZA 3C8DA 1V8FA 3MCVA 4FR0A 2VF7A 1KC1A 3HM2A 3HB7A 5CXSA 2H52A 4TLLB 4YP5A 4D41A 1ECPA 1AGYA 5E38A 2VHVA 3ZE0B 4PZUA 3ILHA 4RLSA 2HA3A 1K1EA 3KJZA 1ZD3A 4JC5A 3KNZA 3OIFA 4IWNA 2ZUSA 4JEIA 1N5IA 5MGNA 1W59A 1ZD5A 2A30A 1HO3A 5C18A 5KNDH 2DBYA 1S6YA 3MS2A 4IDBA 3I30X 3EXHB 4AG5A 5DYIA 1UM8A 1QHYA 2RGGA 4M89A 5JI2E 1GZUA 4X3OA 3SC6A 2XJ9A 2Z30A 3PEEA 4ASUD 1ZUHA 4IO0A 4NBRA 1O4WA 2NU6A 2Q4TA 3DYBA 2Z5GA 3FIUA 2EKPA 2RK6A 1P0CA 1VA5A 3A04A 1GN9A 2W7TA 1J09A 1JB9A 1IB6A 2NAPA 3C7CB 1JG4A 3GB9A 4ND8A 4RTMA 1P9NA 1MTZA 1YR9A 2O50A 2HLHA 3AVOA 1H3NA 4QELA 1W1UA 3H0KA 1R12A 1QOPB 3FI0A 1N2SA 1WUKS 4IF4A 5CT8A 1B26A 3WGQA 1SULA 4CLXA 1RI5A 5AK3A 1LLFA 5KOJA 1Z5WA 2WLSA 1TFRA 2JAUA 5A3JA 4L2IB 3OEEA 4MGIR 3AK4A 4EI9A 1GCIA 2X0IA 5ICSA 4DSZA 2NUBA 2YHIB 2FN3A 2O2JA 2CZGA 4OJKA 5B3AA 4TLEA 2F43A 3R7AA 1NKSA 3PWZA 4PFQA 4U39A 2A78A 3FTFA 1Z17A 2C7VA 3MJFA 2E7ZA 1HRKA 1NJ1A 4NMWA 2LNDA 1RJDA 3KFVA 1E2BA 3DTNA 1H6BA 2FEKA 1EUDB 2I0FA 3N07A 4H7KA 5HIJA 4L51A 4WASA 2C7BA 4X90A 4ARVA 1QGYA 4PX2A 4ZMBA 3ZHZA 3BD7A 3A1EA 1TKAA 3F5SA 3PDCA 1OU0A 1T15A 2WZDA 4HNSA 1OI3A 2PGAA 2NUAB 4B3XA 5DGTA 3OEWA 2WABA 1Q15A 1L3CA 2HNAA 2C2OA 4JLVA 1A7KA 1WLYA 2ZPAA 4ZGBA 1TIPA 2VRNA 3GCGA 2JJ1D 3FCUB 3L9WA 4DUGD 5EHIA 2EZUA 2C07A 2YW9A 2H18A 1KOLA 4NEQA 4UM8B 3OZSA 4U2KA 5ULLA 1SPBS 2HWWA 2WSYB 2VDUE 3ENKA 4OLFA 2XNSA 4L9RA 2NVUB 1QQBA 4JA0A 4C2AA 3PDJA 2GD1O 2XMRA 2YWXA 3GI1A 2CLEB 5L7WA 5A3SA 1B93A 5E6RA 4MIYA 1KDYA 1I7DA 2ZWOA 1OFVA 2R8ZA 4J43A 3I04A 1KS9A 1JS1X 4LDPA 5YASA 4L74A 2NSHA 4AU1A 4BNWA 2FXIA 2H1RA 2X5NA 5A1TA 3B89A 2CNWD 5A5GA 1M5RA 4ND2A 1MC1A 4NAUA 1RM5A 1QR2A 4XJXA 3LXUX 1FFXA 1AB5A 3V4LA 4J9VA 3GJRA 3IXMA 3T7DA 4JXKA 1C30A 3BXXA 4QT0A 1C7IA 2CUZA 4AMUA 1IHXA 1QYDA 3QF4A 4NMHA 3GR6A 3S7ZA 3WJ7A 4DMMA 3ONWA 1E2PA 1JLMA 1Y8QB 1CNFA 1M73E 2VJDA 3C3XA 1E2FA 3EEQA 2HOQA 2H2IA 3HRHA 4TXJA 5BORA 3TVDA 1M3SA 4HX5A 3HJAA 1RWOA 1XZCA 1DAPA 3HA3A 4C30A 1HC7A 3JZMA 4IJ5A 4IOLA 3WYEA 1Z39A 1Z83A 1UP4A 1Q5PA 3INTA 4MW1A 2G8LA 4WCFB 4HEQA 4HWPA 2V7UA 2Z4RA 4YMLA 5I9BA 3FJ1A 2HK9A 2PQ6A 2P3QA 1WXXA 2ACVA 1XLUA 4REMA 1JZTA 2CXHA 1T9BA 2IHUA 3INRA 2E1RA 4EKYA 2NUPA 1EX7A 1RMYA 5FPYA 3BA6A 3IOYA 1LA2A 1VYVA 1LPMA 2Y1XA 2YXNA 2XMSA 3HO6A 4ER0A 2BE7A 2H2AA 2ZU0C 1T9HA 5JALA 3WTCA 1PYOA 1ZOIA 1W0CA 3C7TA 3NPMA 3X1WA 1DO8A 1GA6A 5TMBA 5JD5A 3CT4A 1ORTA 1CBUA 2DYKA 1ULAA 1JP7A 2JAOA 5EP3A 3L1KA 4W5WA 3RU9A 2FVYA 3DL2A 2RHGB 3M89A 4DJFC 4Y9DA 1OUMA 3VTKA 2QX8A 1EFUA 4AO7A 4QUEA 4S0ZA 1ICEA 1VCIA 2D1FA 3Q85A 3H19A 3BS4A 1ZONA 4KRGA 2ZR7A 3S8EA 5HJ5A 3I76A 1C3VA 2Q5CA 5IMSA 5FYQA 4QD3A 2YDXA 4GBJA 1X8KA 1SM4A 3AJEA 1IZ8A 1W52X 1W5SA 2FMHA 3GPCA 4NZYA 3PXCX 3U7EB 1CUZA 5C7IO 4GPEA 1ZJ4A 1I7LA 1ULBA 4FE7A 3LCVB 1XKXA 3GHYA 4H4EA 1SCBA 1M0TA 2Q5IA 1U0OC 4GECA 3OVMA 5DM2A 3MWEB 5EMKA 1JHRA 4YXWA 3HY6A 4CODB 4M87A 3VNSA 1CNEA 4BMOB 2G71A 5CDUA 2JLWA 2ACWA 2DBZA 5EP4A 5FA8A 3DV0A 3H17A 5DLEA 3ZCPA 4M1TA 5DYGA 4AECA 4RY9A 4LFCB 2B8WA 1QZUA 4Q7MB 3IYLW 2BFAA 2JGFA 3BIWA 5A62A 1KI7A 1PKEA 1VL6A 4BNTA 5F5LA 3PFGA 4M53A 1KBZA 1PV4A 1QX4A 2OMKA 3RANA 4GI5A 2ECFA 2WG2A 1TO6A 3BSFA 4FOTA 4F2HA 2BSQA 4W1PA 3QWAA 2PPVA 3IAM6 1Y1RA 2XQGA 3QJ5A 1IQPA 4I0WB 4OXIA 4HY3A 3GNSA 3S1LA 5CNIA 2XVXA 3RRJA 1ORIA 3TAUA 5J2TA 1T8TA 1AXEA 3R6DA 3RKSA 4JEHA 2W90A 4INZA 3WGLA 4BJ5A 4Q7QA 1E3LA 2FX2A 5ALZA 1JFTA 3DG9A 2JJ2A 4OJTA 4GVLA 3N59A 3A6HA 4BFLA 4JMPA 3ETDA 4FDMA 3V6LA 1R4AA 3S2SA 2V4ZA 1XA0A 3QVVA 5BMVA 2E82A 1TF2A 2GERA 4FW9A 4BO3A 2C31A 1KKMA 1BA2A 2EJBA 1NSFA 3F6CA 1TE2A 4BAZA 3GPBA 4AROA 4ZAYA 4EBFA 2FGKA 3H1EA 5JCXA 5CDFE 1GUYA 4BLWA 1HOXA 3BJEA 1NZFA 1E1RD 1VE1A 2D06A 2PH3A 4X6YA 1L7AA 5FA5A 3TLZA 3MYRA 4KJZA 1G8YA 4UNSA 3OHPA 3WNCA 4AY2A 1CG6A 3IR7A 1M7BA 1EG2A 3WKCA 1Z25A 3HYTA 2YASA 4EYKA 1TLTA 4Y67A 4B0OA 2I91A 1L4HA 2CXXA 3I4LA 4U2DA 4F4HA 2BCJQ 2V03A 4I9GA 2ID4A 4H7HA 5E1BA 1ZD9A 4E09A 1E32A 1PNVA 3T0FA 1E0KA 3CUSA 4M46A 2P9ZA 4JB8A 3H2YA 2ERXA 5K0LA 1ZK0A 1H6AA 3QFTA 2AQIA 2HB6A 2WWTA 1UFQA 3D81A 1ZMOA 4LSGA 3UMBA 3R6GA 4L50A 5IDWA 2WW8A 4Z1OA 2W6PA 3PFHA 1NURA 1FL9A 3WTBA 2PS9A 4HK4A 1WVMA 3PV0A 2QTHA 5C35A 8GPBA 3B78A 5I5GA 1IZYA 2X0NA 4TMXA 3SR3A 4JLJA 1YRAA 3PC8C 4Y2XA 3GDOA 1BVHA 3GAAA 2B7CA 3OICA 3CVVA 1KVQA 1BHJA 3PLNA 1FNBA 2BI8A 5F21A 3EZYA 2V7BA 1SG9A 6NULA 1QYVA 2HSWA 3D6FA 2QLNA 5IWAB 4NG4A 4UAJA 4QX6A 4GEKA 1EESA 2K6GA 1XQ1A 3PC8A 2A0YA 4NDNE 4UD6A 4PTYA 2O14A 2CLLB 4QTUB 1KOFA 1MKYA 2NLOA 5A05A 3VZRA 3D0OA 3WL4A 5JJCA 1W2GA 3JQFA 1JDPA 3LDHA 2GZRA 4EG4A 1QHEA 3B82A 2X4LA 3PUXA 1B8NA 3Q98A 1B73A 2WHPB 4QYIB 3TQTA 2IJGX 1G0NA 4HLQB 3UQZA 3HZZA 1Z6AA 4FGKA 2DY0A 3DKVA 3RRZA 2DUWA 5DBOA 1BXGB 3LPMA 3RAGA 1PT9A 5HDBB 5ALGA 1BFDA 3NAZA 4KXNA 1YNSA 1YS4A 4BFXA 1HXHA 1EFPB 3JQGB 5FR2A 5K8LA 3PEVA 3GX1A 4KXFB 5CDHA 3IKTA 4U2FA 2IYTA 3JQAB 1MQAA 2WZBA 2JIOA 5K1ZA 2AFIA 5FUMA 2HJVA 4WLFA 2IEZA 1RVDA 1VI5A 4YCAA 2CVQA 4K46A 4XOIA 4RQUA 5B58T 1B8UA 3T3IA 3UJAA 3GQVA 1TLFA 1XDBA 5JJIA 4L5BA 1E5XA 4D97A 3E22B 2C83A 3DDWA 3AFNA 2D00A 3NFYA 3NHWA 1W30A 4QGAA 3R7BA 4BDTA 1QH8A 3RPEA 1EUZA 1RWBA 2H1WA 4YR9A 2AI1A 4Z0PA 4A1OA 2G1JA 1WMFA 1FTYA 1X80A 1P7ZA 2PZGA 1Y1LA 1XQ6A 3ROKA 5KNDD 2ARKA 4R31A 3LDGA 3TS1A 2FMKA 1P73A 4LE2A 4EMBA 4W6ZA 4CR6A 1CU1A 3FPSA 1VRCA 1P1IA 3QQPA 3R3JA 3K5IA 3NHUA 4DLYA 4RK4A 1RYNA 6YASA 2VR1A 1GIAA 4GYWA 3ZWXA 4YRKA 2COEA 1B8VA 1D6MA 2Q6KA 3EK2A 3JAWA 5HWSA 2BM0A 1Y3DE 3FBGA 2QORA 4RH3A 5JXGA 3QWFA 2PUDA 3ROXA 2FPSA 4DJJA 1JTVA 5KNCA 1FZTA 5ANRB 5FOQA 4EMSA 2KM1A 3TMKA 1K7FB 4MEAA 4QUDA 4E15A 5ALEA 4ENSA 3WA6A 1O2DA 1QYXA 4LXHA 1L5KA 1BO6A 1EBUA 2D2VA 3FMPB 1PWHA 5FQOA 3U7QA 3DZIA 2FW7A 4QARA 4R2LA 1C29B 2DFPA 2YH2A 4PFKA 2I03A 1UJCA 1YBVA 1GPKA 4WZBB 1L5OA 1AXGA 1ZSVA 4N0QA 4MW7A 2O48X 3BE5A 3KEGA 4TV9F 1WSAA 2H5IA 1GCUA 4B1FA 2ZYVX 4E2ZA 5JY6A 4YBZA 4M8NE 2P3LA 4MXDA 4A2WA 3CEHA 3KLBA 2VNIA 1G8JA 3ZZ0A 2YVUA 5EMNA 4F7WA 4E5NA 3K05A 4FC7A 5GJCA 2V55B 3L6BA 3LLUA 5CGZA 2ZJ7A 1ADYA 2PZMA 3ZVRA 4KR9A 3OUUA 5TQ2B 1HYGA 4B3BA 1PD1A 3AETA 1N2EA 3B5JA 4KUEA 2CXNA 3ZY2A 5KS2A 5F7OA 1D4AA 4CI0B 3EX7C 3G9QA 5G1OA 2M6KA 5A4JA 1U8AA 4ZVKA 2C4WA 3VV2A 4JENA 1E66A 3CINA 2CDAA 2NQTA 3PNVA 4GMGA 2QPLA 1AD2A 1B6TA 4U63A 3CXUA 2ZTUA 1B6GA 5TPWB 5LVAA 2YMPA 2A59A 2OG1A 4A5OA 4BVKA 1BQ4A 3W3AH 1QB8A 3MJEA 1YR3A 4GOXA 4HQFA 4WEOA 1II8B 1ZM7A 2C3PA 2HLNA 2JI7A 2PFSA 4GBMA 2EWMA 4IGAA 4EENA 5HZMA 4Q1VA 2ZYAA 1Q57A 4JI6B 4UEOA 3SEFA 1GGVA 1CUYA 2I5PO 2V7XA 4MQMA 4HZUB 5EI5A 2I3AA 2CXOA 2YFQA 1NPTO 4IYRA 4ZVNA 1LDNA 4Q16A 1Z8HA 2ZJYA 1G8AA 4QEZA 4PF1A 3VGPA 5CEEA 1KI8A 2P27A 3D8BA 5LQKA 3WRVA 5K05A 4JLPA 1UKCA 2UZ1A 4RD0A 3RFFA 1O6FA 2GXUA 3KVOA 2WFLB 2Q3MA 3MMXA 2UYHA 2Y0EA 4QFDA 4GYJA 5I3CA 1DGQA 2OK8A 2XNHA 1VG1A 3LQ4A 3QH4A 4LX8A 4Y1FA 4F5ZA 4P0PB 5DNYB 1W49A 3GJTA 3NBXX 1FXSA 1XJQA 2QX7A 4JJZA 4Q19A 1J07A 4ZFNA 2WT4A 5HF5A 4C2TA 1E1LA 1R6TA 1TQ4A 3KKZA 1JAIA 4O63O 2YXDA 1N2CB 4BUZA 4E5UA 4AKEA 4F4IA 4UTPA 1IWPB 4LDAA 2VJPA 2R96A 4YY3B 4DPMA 1G7RA 2X9VA 2XCLA 3ULKA 1Q92A 4BO1A 2FEXA 2G9RA 2O20A 4L15A 1HE2A 1NGSA 5IVIA 4MK4A 5HKAA 1IPFA 1CK4A 3FLAA 4J76A 4PZZA 3UQYS 3UW1A 2V8OA 4QSMA 4Y7DA 3ZWBA 1SD1A 1TUEA 1O8CA 2ZRJA 4LOHA 2B2XA 3SP1A 1LFAA 2I3ZA 4G4GA 1EFLA 4XVRA 4DCSA 2Y1WA 3SC3A 5EIWA 2O8BA 4AKGA 2PRYA 1W8IA 5AW9A 1GPYA 5C7YA 2YZ2A 1I13A 2XNCA 1XC7A 1OD6A 4FCWA 5G3ZA 2B82A 2R6HA 2RGYA 2DFVA 2II6A 2X1MA 2Q3FA 3HI6A 1YMUA 4CT5A 3R3VA 1YI8A 4Q3BA 1YE8A 3QE3A 1TQDA 4HNUA 1UXJA 3JQ7B 3W9YA 1XD8A 5IABA 4C21A 2YY7A 3NV7A 3UJNA 1GP2A 2ZANA 4CM9D 1GR0A 1ISGA 1DB3A 4IDQA 4N0EA 4WESA 3T06B 1ZJ5A 4OYYA 3SKVA 2WWXA 1R10A 4LYHA 4AUEA 1DC6A 1WO8A 2JIQA 2LKDA 4TS4A 3DR5A 3CURA 3W8EA 3ICQB 3FTEA 3A3OA 4FFPA 3CLTD 5A4IS 4RFSA 4K87A 2I34A 4FHZA 4Q47A 3EDRA 3ZZ1A 4O59O 2A5FA 2ZI7A 4G2NA 3REOA 5U4QA 1A50B 3IO3A 2GETA 4PPGA 4WKCA 3Q6MA 2WHRA 1XN1A 3X1JA 4BVBA 3AR9A 2ZT7A 1W46A 1EJ2A 4UNNA 1ZL2A 1ZPDA 2OP1A 4B74A 4EAAA 5DN6D 1M2OB 3ZHBA 4KX3A 4NXMB 3WBFA 3ZZNA 1E3JA 5EQFA 3SEQA 1DAKA 2E21A 3RHZA 3PVSA 2C95A 3KOZA 1AH2A 1LVHA 1ZHFA 1GFWA 3DLAA 1PVOA 4PHTA 1WBBA 4KQ6A 1GPLA 2JI9A 3N6RA 3WLAA 3UOWA 5TQ0A 1QKJA 3C1OA 1YDEA 4KJXA 1E9FA 5CB0A 2J7KA 4NS1A 4X6LA 2I6TA 3DZBA 2AV6A 3TRIA 2W00A 3RV3A 2MTBA 4FHGA 2CE7A 1R5NA 4GW3A 3U3RA 2B92A 4UOQA 3HCFA 4QDKA 2XJ4A 3GBPA 3JXEA 2VSYA 3R6TA 1RQNA 3RJMA 4CETA 4D8XA 3JQEA 3I1JA 3GLFB 1FVHA 1TECE 4KO2S 1VC2A 3DCIA 1KETA 4CR7A 3PI6A 1PJBA 4QO7A 5I9NA 1UAGA 1RRPA 1Y37A 3NETA 2J41A 1PLLA 4RZIA 3FDZB 4KRFA 4Z7JA 1NT4A 2Y68A 1HFWA 3GMDA 4CYMA 4DT1B 4EA7A 2WQ7A 1OXUA 3ND8A 4L78A 1AQ6A 4HQRA 4KQCA 5E9WA 1FYXA 5FAXA 4BFWA 1DXYA 4LRQA 2D0PB 4A91A 3M6LA 3VYRB 3I9V1 2NSJA 3OUZA 3G2PA 1TTPB 4A27A 1DS6A 2QTFA 3EVBA 3JW8A 4UTZA 3HGQA 2F43B 4EDHA 2QM0A 4WXEA 2G67A 3GRYA 1EFRD 2QMHA 3MAGA 4L27A 4LC1A 5ERGB 4EUNA 2QXYA 2GCOB 3CCFA 4IBOA 5LQUA 1JJVA 3IJ5A 2QN2A 2QRHA 3PRHA 5I3ZA 4H7FA 1SMKA 3LUKA 4MA4A 4EYOA 3KM0A 2DB3A 2GAJA 3GJ6A 3NTRA 1ENZA 2ZRDA 2ZUVA 4D6PA 1W8DA 4RLFA 1QRRA 4F97A 1YOVA 4QLAA 3DUFB 4RVSA 3RVJA 4AX4A 3NHZA 4N54A 5H5JA 5H9VA 4FYJA 2A0WA 4AMBA 4KK3A 2QLJA 4O8CA 5ERXA 4C89A 2JLBA 1HTTA 3F6YA 5CLGA 3PPXA 3SDBA 4ZYYA 2IH4A 4KYUA 2JDIA 1QQ5A 2WHQA 1OB2A 4LJSA 3VR4H 3B3GA 2ATIA 2X0KA 3GFPA 4C2BA 4F2GA 5K4HA 1X92A 3KUCA 2QQ5A 3SKXA 4A26A 5HQJA 4YXFA 1WBJB 1USVA 3AR2A 1E9RA 3W1VA 1N78A 3FVWA 2FJ0A 3Q8LA 4IH4A 1PGQA 4C4RA 1XP5A 4C7BA 3OQIB 1MB0A 3T52A 1PZMA 3D0RA 1FFWA 3DM5A 3UZUA 4Y8VA 5SY4A 4D9MA 4MINA 1P4SA 2WR8A 2SECE 2Q2VA 4IPTA 4LKRA 3E1SA 4RORA 1SGWA 1PJ4A 4NEHB 1J7JA 1ZM4A 1KR5A 1XCOA 2QA5A 3LQ2A 4QAQA 4UREA 4QXOA 4LISA 3QWHA 3TQIA 1EFVB 2WTUA 3L4EA 1ZUWA 3GLTA 3EA5A 3P9XA 4GKKB 3PA6A 2XUOA 3Q7RA 1NJSA 2G76A 3KQLA 2FEAA 2I1VB 2X5XA 4FNAA 2YRXA 1CQJB 3FYUB 3CWCA 1YL7A 4LVNA 4YJGB 5CCXA 5JOQA 2B98A 4ZOEA 2X0EA 1K66A 3ZXYA 4BQFA 3AIIA 4EDFA 3U6KA 3W9BA 2GT1A 4LUCA 4P83A 3WWOA 2IYRA 2HR1A 3AG5A 3D1LA 1HQYE 2GKOA 2TRSB 1EFHA 4C43A 3UHAA 4EUSA 2HHAA 3M4NA 2XNDD 3R0ZA 4L22A 4MV7A 1M9NA 2J4DA 2A35A 3X0DA 1V5IA 2XQKA 4AKIA 2QZ4A 1M2VA 3G2MA 3GFRA 1KA9H 1I2CA 3B5EA 3ZOKA 4UMVA 4XFKA 1ZIPA 1GPUA 4MDHA 4QATA 3HCOA 4HDAA 4BMXA 1IDOA 4BVLA 5IU6A 2OESA 5C46F 5EJIA 4RA6A 3BGVA 5DU2A 4E32A 4CCYA 1WHSA 3KAQA 2NADA 4NBLA 3A6GA 5HMMA 5HHTA 3MVEA 2PQ0A 4I9NA 4IGFA 4W9NC 3RREA 1YGYA 4RDIA 4UNQA 2POQX 2SCUB 3PF9A 1G5FA 5DTMA 1GPH1 3DW3X 1Q12A 1E7QA 3E9DA 3QE4A 3TYXA 3M2TA 4X0EA 1BJRE 3A1TA 2JFZA 3FXAA 5I7AA 1G5RA 2I4LA 1Z4LA 4CDRA 1TT5A 5IDXA 4X94A 2EX0A 3KEOA 4KXXA 1E9SA 4RS3A 1AUVA 4FNOA 4RAOA 4LDQA 3TTVA 4YFYA 5TGDA 4DG8A 4GMFA 3N2GB 3M6WA 4FKZA 3ETCA 1G98A 1VKRA 1M33A 1SU8A 1NP6A 3OPVA 2F1OA 3M34A 3NHJA 4RKRA 5FWYB 4UQPA 2JGEA 4UU0A 5FH9A 5IBCA 3CUVA 3W6PA 1JPJA 1XCJA 3SHQA 2GX6A 3V7NA 1A1VA 3NT4A 1LBQA 3HBAA 3I28A 1XWIA 3A4MA 2H7YA 4WDQA 2QE6A 4R2KA 1QR6A 3AJDA 4D3DA 3VJMA 3V2IA 1NUSA 4ABTA 4KOEC 4WN9A 3U40A 2JJYA 3BH0A 1Z5NA 1YBHA 2DOKA 3THOA 1L7DA 3O2NA 4I4TF 4DDVA 2G77B 3UIEA 4XX1A 1CQPA 4XVQA 1SVWA 2GK4A 4QXPA 4I3HA 3DAYA 5AKJA 2JCXA 3H3FA 2NVBA 4YC7A 1XJ5A 1KOJA 3SLRA 3C7KA 3B6ZA 4RACA 3VAYA 2HXYA 5L3QB 3WIOA 4Y98A 4FZ5A 2Y66A 4DMRA 5THKA 4ZZIA 2OYCA 2O6HA 2O1EA 2VHEA 3NGXA 5U9CA 4LXUA 3C1AA 4MLPA 3W3AD 3PJFA 1T9CA 1OA0A 1SVNA 3B36A 5AKXA 1UBJS 3AP3A 3BRCA 4LQDA 4UVHA 1QFZA 4U1RA 5BMVB 1H6DA 4XGRA 4QQRA 4PQRA 1CR1A 4QFCA 4ENUA 4WERA 4QOSA 1D0VA 1AZTA 1NT2A 1O5OA 1RPJA 1U0EA 2BIFA 2VYQA 4IZHA 4ZZ2A 2ZOSA 2ZZMA 2VT6A 5FV4A 4QJIA 2O3RA 1S8AA 3WKBA 1QKIA 1GL6A 3JR7A 3THWA 1FSSA 4YNBA 3A25A 2C04A 2FSSA 1EBBA 1CIVA 2HYDA 3R9XB 1XXHB 3OWHA 1MU0A 3ZWNA 4ZZ3A 2ZTMA 1UBNA 4WBNA 2PZEA 4FP9A 3I39X 4CKWA 4HLDA 4Y6GB 3GN2A 3L05A 5A7GA 3PGVA 4O5OA 2FN9A 3FFWA 2Z09A 1COWA 1JR3A 3GCZA 1IZ7A 1O97D 1W88A 2A0UA 3PTLA 3CE6A 3CNLA 4D8YA 3F67A 4L8VA 4H7JA 1QTIA 2AC4A 3A0RB 5EQTA 4GDFA 4QAJA 5I7HA 3MLEA 3O90A 2P30A 1N9GA 5TNXA 3BWDD 4TUYF 1YB4A 1B15A 5CNKA 2GZ1A 1X1EA 1KYZA 5K09A 3MD0A 1NXXA 1SOAA 4LXGA 1W9HA 2VDWA 1N2IA 3ENQA 1WMAA 5KSPA 4L3OA 3EXHC 2RBKA 4DM3A 1Y8RA 3ER9A 5GGXA 2QGZA 1M6WA 4NRDA 1GZ4A 1XRLA 2Z4TA 1H1LA 1TCVA 4O4JF 1SCUA 1KP2A 2QBYB 3R3UA 2SNIE 3DOOA 4FPXA 1K7EB 4BJ6A 2HJGA 5AUQA 4YA6A 1FRVA 2O5VA 4LNUB 4HVLA 5LA6A 2BD0A 4DXDA 5HJEA 5C8VA 5AI6A 2J9ZB 1UT6A 1SUIA 4LWOA 4ZYTA 4R7ZA 2WVJA 4IINA 1EFAA 2REQB 1AK9A 3X1DA 3SX4A 2IXBA 1M67A 4HNVA 1YFLA 1GTMA 2PVCA 2ZR8A 2OGTA 4FYHA 4PG5A 5L9AA 4AO6A 2GXAA 5K3EA 5BQ5A 1VSUA 1AGXA 3PWSA 1A69A 1CFJA 2GM5A 4GX2A 4PNHA 4EZEA 5KQSA 4RD1A 2VPIA 3H05A 3ISJA 4IIJB 3KWJA 3O3MB 4NZNA 5H1YA 1RYBA 5J4HA 4G5OA 4CEJB 1DLIA 4L4YA 1GTJ1 4KLRA 5EXSA 4ZMSA 2VRWA 3PEYA 1CUBA 1FFHA 3L6UA 1Q0RA 1KOGA 1IHOA 2FQYA 3P2EA 3DPUA 1SN7A 5AD1A 1A2OA 4NP6A 3NEJA 6ABPA 4ZCSA 4MW2A 3QUAA 4ASUA 1QP8A 5T3UA 2EBWA 4YRPA 4A4DA 4YRLA 4M49A 4UHCA 2CLIB 2ORYA 1T5BA 1OASA 5K6TA 2C7RA 5CJJA 4ZVRA 3KLNA 4M99A 3HCNA 4D99A 1KARA 4NWIA 3A3PA 3TLJA 1ZY2A 1H9CA 1YR1A 1V3TA 4E12A 1RCUA 2A0KA 3WAJA 3NRCA 3NV9A 3BL8A 1WP4A 3KTAB 1KRHA 1E7MA 1I1HA 1G16A 1O58A 3AF1A 2QJWA 2ZWAA 3AEUB 3CLVA 3EVGA 4NECA 4X45A 2QTWB 1MVLA 3GCWA 3P5BA 1CHDA 1QCZA 1KU0A 3R0VA 4D0NA 5KWVA 2P2ZA 3DQQA 5BNTA 3HGMA 2QL9A 2QRPA 3R0XA 4OM7A 5I9TA 1JQJC 2PJRA 1E62A 2GOYA 2VTBB 3EFBA 3U60B 1OBFO 3H9QA 2VK1A 1G291 4DR3B 3M1IA 3FBWA 5KOHA 2TMYA 3UH0A 3ENWA 4ZOLF 1E9BA 1VYTA 2DKNA 2TYSB 4QG3A 2NV6A 4OHZA 5AM2A 3ITDA 4IIXA 4YUWA 2NAFA 1SCKA 1NY5A 1Z15A 1QG6A 1PYGA 1WMEA 2HGZA 4KRXA 4KVGA 3LF2A 4DS3A 5HUQA 4R1MA 3TXAA 1FRFS 3EVDA 3MOGA 3CF0A 3MTAA 2B4QA 4ZVSA 2BHRA 3WLKX 3M3HA 4Q82A 4YPOA 5CDTA 3W5IA 5IZ4A 4JI7B 2FPUA 1TZMA 2JJ1A 2FPLA 2XE7A 3AF2A 2VUIB 2HGSA 3TJZA 3U3DA 4DUGA 1WPGA 5EY5B 4EI7A 5CD9A 3GJXC 3BMCA 1A1SA 1MEOA 3CUTA 3DV2A 4UFNA 3U7IA 4C7VA 3QRWA 1AURA 3O1IC 4HS4A 3EVAA 1IY0A 1UOEA 4MV8A 1TM1E 1H4TA 4OI1A 3JQRA 3LH5A 2VFAA 3KO8A 4ZANA 3R7NA 4F96A 2P2DA 3DTVB 2H1VA 1E60A 1ZGAA 2GZ2A 3A14A 2JHCA 3SM9A 4DC0A 3E5NA 2CNWA 1B16A 2GLTA 2HU5A 3PR3A 4HNRA 4AZ3A 2I1WA 1AHHA 2WFZA 4EPTA 4ZPXA 3C70A 1SUDA 2QMQA 1L5WA 1WNFA 1A0OA 2Q21A 3ECCA 3UATA 1G5TA 1C9DB 2XVMA 2ZI4A 2K5UA 1PAUA 3OOEA 2GXSA 3SMVA 4A0FA 3RC2A 2VT2A 3N76A 3VJKA 4AMZA 3UPUA 1TAUA 3B7PA 4JAVC 1L4BA 3G17A 4Z99A 1UZAA 1YCGA 4HYTA 2Z5FA 3DCYA 4DBLC 2Q9UA 2ZU6A 5JD4A 1KP3A 3U7GA 3G0GA 4FDLA 2D1YA 3U9TA 5BN3B 3KELA 3PUHA 2IE0A 3DVQX 2PZ8A 1E3SA 2HRQA 5KDDA 4E5SA 2XCOA 1SRQA 3IMCA 3ZLUA 3PPVA 4G8DA 4MZDA 2RBEA 1KP9A 4QGBA 4F9EA 5JATA 1H5QA 5SY6A 5TQJA 2G0NA 3JD3A 1NLYA 2Q2OA 1P1HA 2XMGA 1RMQA 3A9WA 2UZ1B 4QDXA 1UFVA 3Q7PA 1A9XA 1MMFB 3FZYA 2XUZA 3LKZA 1G3QA 3NBYC 4GX5A 1GT6A 4O02B 4MB0A 1Q6YA 2M32A 4R9SA 4Y0NA 1YDWA 3CNHA 2JGKA 1JU4A 1TT7A 5ALDA 4G2TA 3QVGA 5JV5A 3ZE1B 5HSGA 3ITNA 3ST7A 2ZSBA 2CV1A 1US8A 5EKTA 3Q4GA 1HQKA 4ZRDA 5EYPA 2P69A 4KIFA 1BROA 1GZHB 2Z2KA 4R98A 2X22A 4D74A 1E8NA 1SY7A 4O0MA 3FPKA 2I8LA 1XRNA 5BQXA 4PY2A 2WKQA 5EMLA 1K89A 5TQVA 1NX6A 4LV5B 4LC9A 3LFUA 4CM7A 4YUYA 1CC1S 3S3TA 2RFLA 4RMIA 4FHDA 4FFNA 2Q5HA 4KE8A 1EJ0A 1J7KA 3QEJA 2OD7A 4MV3A 3C74A 4B3RB 3IODA 1XEWY 1AZLA 2HPZA 1AKVA 2VOJA 2VZ0A 1XRPA 2XA9A 2XWSA 3FIJA 4I8DA 2DCMA 1NWHA 1IEXA 3O92A 3KOOA 2VWPA 5ALYA 4BQOA 3WGJA 2I29A 2VEOA 4FBMA 1Q22A 1XEXB 1QQTA 5CFNA 1JJFA 1YHNA 3QFHA 3RC1A 4UU1A 2W6OA 4EHBA 2DQKA 3WFIA 1P2BA 2WWYA 1LEHA 1N4AA 1C4KA 5EJ9A 1B0ZA 3EDQA 3AW8A 1UJ4A 4JJFA 4XSVA 3TZQA 1RQRA 1N3YA 2PUWA 5AKHA 3M3PA 3MGBA 4QJ4A 5IXYA 4LN1A 4BB6A 3SSNA 1ZCAA 2JF0A 2OM6A 3VHXA 5DP2A 5C5DA 1LJUA 3A2KA 1GRCA 1L3BA 1BS1A 2WUFA 1P8JA 1LDYA 1EVQA 2QRLA 4HDQB 4KAXA 3RKRA 1E64A 4JJGA 1ZKDA 3EPRA 1RI4A 2DHDA 3P2YA 4BDSA 2JAHA 5WRFA 2JAWA 3PQ7A 4C6HA 2GO7A 4M8IA 1VRWA 3O8OA 4YWJA 4F1WA 3DLHA 3RS2A 4JWKA 1AHIA 3GXBA 1M1YE 2XQJA 1W2HA 4XJVA 1Q3KA 5JCJD 4REQB 4XZ3A 4QC2A 2WYUA 4OHPA 1X9IA 2J3MA 1XPJA 1RRMA 1FEZA 4YMGA 1VIMA 4PIPA 3PX2A 4PCVA 5J2UB 3SHTA 4DV5B 3SXJA 4ACAA 3EG5A 4HNTA 3ZE8A 1L5HA 1UXKA 2XZLA 1YRHA 2G6TA 2HPVA 5BV8A 5KMGA 1AQNA 1E99A 4U3JA 1R64A 4Z9YA 4H6XA 4L6IA 1UFKA 4MS3A 4GEGA 3R3HA 4YMWA 3N58A 3K0CC 4TL9A 2P90A 2ISSD 5A4DA 3DEHA 5LD2B 4P7BA 2EXXA 1GARA 3ZBTA 1LI4A 4YRQA 1DOAA 1W75A 3FLEA 3NP9A 3WLJA 4HAUA 3SX2A 1PTKA 1QIMA 5T4HA 2O0HA 4XWYA 1LUAA 3K1JA 4ZEMA 1M6VA 2CMFA 5EHXA 2LUOA 1DTWA 1OILA 4YR7A 3NGMA 4F06A 3HR8A 3FVQA 3K0CA 3IBFA 1JRLA 2NU8A 1V1JA 2PA3A 5FB3A 5L8VA 1VOTA 1PUJA 2FSVA 3AHFA 2WJ4A 4XCVA 1A9PA 2QN6A 5L3RA 4EX7A 2OC9A 1CUHA 4N5LA 3JU3A 4FZRA 4QBGB 1A9TA 4FT2A 2M6SA 1A9RA 2X5JO 4WMLA 1JDZA 2CLFB 3NB0A 4JNKA 3F4BA 4WKOA 2FTKE 1EA7A 1MX5A 2WFMA 2YN0A 1RXYA 4K8OA 1XEFA 1X0XA 4RCVA 1SUSA 3SXPA 4DQ0A 2NP6A 3D7RA 1JQ5A 2EGGA 3GDFA 4Z7QB 3GOQA 3P1JA 1AY0A 1NZDA 3H84A 4WZ6A 1IUOA 1XU4A 2PYIA 4ZVQA 4EJSC 3GBSA 4EA9A 3IR5A 4ARUA 5CPBA 4JELA 4D9JA 2FDRA 2QPTA 3EGVA 3TX2A 3DZDA 4ZGWA 2NQ2C 1KI6B 3CRNA 5CG2A 5F2OA 4RA9A 1DRVA 1Y4DE 2ZP1A 4V0MA 1E2IA 5GJBA 2JNWA 3MJDA 1SKQA 5JZVA 2LBPA 2X41A 3E2MA 1RLUA 1XSEA 1GGHA 1GQYA 1TYAE 1U8UA 3B2QA 4EJSA 1GYRA 3JASB 3LPAA 2VJMB 2DHRA 2WSBA 3OCVA 4G56A 1XQXA 4MRSA 4WH0A 5CB4F 2OHJA 1EM6A 3B9QA 3CRRA 2RAFA 5EN4A 4P22A 5K0CA 1CHNA 1HT1E 2BDUA 1NXOA 2VHWA 4J6FA 4G0WA 4PE5B 1CVRA 1T2VA 1UFRA 4XPZA 5SY9A 3ESDA 4LMBA 5C8YA 2WY2D 2VUSA 1RZRD 4W9MC 3ZHVA 1YBFA 3QLUC 3QNWA 5A3VA 2PMWB 5JQGA 4D46A 2Z3WA 3QU9A 3FKJA 1JECA 2R1VA 3Q2KA 2J3JA 4NIMA 3QELA 2SKCA 1SKYE 4BO7A 3RBVA 4JUDX 4LJ6A 2AXQA 2HCTA 3IDAA 4KQKA 4UJ5A 3AJAA 3T5AA 3KQSA 1SFRA 3FR7A 2PVSA 2WKWA 2YOFA 3QLUA 1Q95A 3CVUA 1ZJYA 1MV8A 3KWLA 5K2MA 4BLVA 1OLUB 2L19A 2VDLB 3ZUPA 2W37A 2C00A 2HRDA 3IDSA 3M1YA 4NFHA 4WOPA 4C7JA 2WUWE 1CZKA 5E7QA 1T1EA 2ZBPA 4RENA 3CCBA 4RNCA 4ESEA 1L4YA 3OOSA 1B42A 3BWYA 5JH7A 5BR1A 2CYBA 4O33A 2VTEA 3N0TA 1CUWA 4UPDA 3SZRA 4E4RA 4MW9A 4ROSA 3G2KA 2FZLA 2IYZA 5JS8A 4JH0A 1KZ6A 2UYYA 5IP5A 4O3FA 4BQQA 1SIWA 5JADA 3AEKB 2E2WA 1XZQA 3IQEA 1R9MA 4G0OA 1O94A 4I19A 4P82A 4WVLA 5IG2A 2P8JA 1MIHA 1OFUX 1LS1A 4DR4B 1ZUNB 1ONPA 2ZB2A 4F46A 3CZRA 1IOWA 1P1CA 5DO9A 3AR8A 1U3FA 1TYBE 4L28A 4M54A 1XR3A 3A6EA 2VXYA 4MRMA 1GAWA 5HDQA 1QV6A 4GKJB 4KREA 3GVPA 4G5GA 3W4IA 1IN8A 4PAMA 2WQ6A 3ZKAA 6PFKA 3GU3A 5KPJA 2AEEA 4YTEA 4J94A 1EXNA 1XA4A 3V4PB 2AF3C 3TFOA 4O4LB 3QV2A 2PH1A 5AKKA 3NT2A 1CD5A 1LSJA 4GR5A 2IUYA 3LZDA 2I4IA 3CLKA 1WDLA 1UPFA 2R4UA 3BQNB 3N2IA 3PTAA 2HFKA 3LC2O 4PCUA 4YCMA 3T5GA 3DMHA 1I9CA 1HZZC 2VAWA 5ALSA 3BERA 6AT1A 1XT6A 4K6OA 5CITA 3IDFA 4LX0A 3PUYA 1PHRA 3AUUA 3RYFA 3SC2B 1NVAA 2C77A 2IP2A 1L7EA 3QVKA 4QUKA 4BL5A 2JAPA 1NMYA 3I72A 3TCKA 3CW2A 3FH0A 3N53A 1F2TA 5MGBA 1AU9A 5BPHA 2BN4A 4HOYA 4E5YA 1DAMA 4N7MA 3THXB 1ZVJA 1YRQA 3BBLA 3JQPA 1NG1A 2J4CA 4HGNA 3ZIDA 3ZQ6A 5B7QA 1MOZA 5KQRA 4I9UA 3KQKA 3F5FA 1OYWA 1WTCA 1C4WA 3RWOA 3O9ZA 2B4AA 2HDNB 4HQOA 4A73A 3VTZA 2QUBA 3PD0A 3VZDA 3IHKA 4EFNA 3LBNA 4IV0A 3T9CA 2QN8A 5IKOA 2VDQB 1FBNA 1VJTA 2QD5A 4PS0A 1M6NA 3IX7A 5B1YA 2DEUA 3DYIA 2GPNA 1Z29A 1KTIA 3QXXA 1HNXB 4HDMA 3QXJA 4BYMA 4OH1A 4IP0A 1OZ0A 3TVTA 2O52A 4K6HA 4AAYA 3IAXA 4FQ5A 3LAWA 2HU2A 3PL5A 3PENA 2PGDA 3LJKA 1JR4A 1PWEA 2AUNA 1EHCA 2J3QA 3GJ0A 1DRWA 2ZTHA 3KCNA 4BGVA 4Y7CA 2IOQA 2BZ0A 1PJ2A 3IPCA 3VNVA 4HQ0A 4PXSA 1FX0A 3M5CA 3VH4A 1GNRA 1IAQA 1IEVA 4WCDA 1HE3A 5T4FA 1UM9B 4DXAA 1KDZA 1WZ2A 1R0CA 2H85A 4XM1A 5BWCA 5CBPB 1EK6A 3O8BA 3PCRB 3H1GA 3VPSA 5I7RA 1NMEA 4CF6A 2BFNA 3S28A 1GWNA 3KBOA 2WTMA 1S3GA 3V33A 4YMVA 4ML3A 3VOTA 5BV7A 1P3Y1 1Z0IA 4EHIA 2Y4NA 1K6IA 4PGFA 2UUPA 3DOCA 3GFSA 3K4QA 4I4CA 2P5SA 1MAAA 2ZE7A 2QMZA 3F5DA 4I55F 1B00A 4FR5A 4Q1DA 2GPBA 4BKPA 2FFBA 1D1TA 3ZU6A 4FMCB 3Q0EA 1XJWA 4DWOA 2QTTA 3WX0A 3B1WA 4P3OA 1J49A 2GCGA 5C2JB 3O5AA 2BMFA 4RV5A 5AJTA 2F1RA 3OZRA 4BAGA 4JYZA 2D62A 4BNFA 2JH9A 4EGCB 4XM0A 5JRZA 3BB3A 1USKA 1D4OA 2JAQA 3X43A 3I6BA 4MJLA 2HF9A 2HWYA 1B3BA 4MMZB 3KB2A 2KHZA 4EGAA 2BHTA 1OWPA 1XK7A 2DCUA 2QRGA 1VFPA 3CLTC 5AM0A 3IESA 5IAEA 2OEPA 1QZ3A 3TLMA 4BRSA 2B9VA 3AHJA 3VU9B 3MJTA 4BFTA 1EXMA 1U8TA 2Q3LA 4R8KA 1YTLA 2YJ3A 2WU3A 4OG2A 4AP9A 2P4QA 1ZUIA 3VNAA 3A2LA 3I92A 2HT1A 2C97A 2ZWPA 3BUSA 3FZEA 2OA0A 4U9UA 1T2UA 3MRSA 3BD9A 2WIGA 2R11A 3NOOA 4LEIA 1ABFA 2PUVA 3ZXSA 2JRLA 4CKYA 4PSKA 3EZ7A 1E92A 2UVPA 1EFTA 4KXQA 3UWPA 4AKTA 3O0DA 2XBMA 1SZJG 4P8RA 4W1RA 4WXRA 2Z3ZA 5HM8A 5MN6A 1SUWA 1U1FA 5CLLA 4LGYA 5CW1A 1Y9ZA 2ZM5A 1CUUA 2YKGA 1W85A 2DUMA 5EP2A 1DUSA 2HEIA 3L7JA 5E1DA 1W44A 2OHGA 2DBVO 3HVJA 2QENA 2QJOA 3KJHA 2WWRA 1W73A 2FWPA 5KCZA 2WRZA 1NOKA 5IYZA 5K6RA 5KNBH 1KO4A 1XROA 4HGPA 3D7LA 1VHDA 1M75A 1PJQA 3PQCA 4YJ3B 4PSVA 2FZKA 1U7HA 3C14C 5GQSA 3G8CA 4GPAA 4N7RA 3D5EA 1T8WA 4JB3A 3HB4X 1E58A 3LBYA 3OHMA 3ROTA 4TWBA 2V54A 2W6QA 4AMGA 1R37A 3X1MA 3SI7A 3HL4A 5DJ5A 5IS2A 2CXQA 2J0EA 4KYTA 3ECSA 4BNVA 2G1PA 3K94A 2ZAMA 2RB5A 4JSTA 3RFVA 2VATA 2NZUG 3I4FA 3RC9A 1ML3A 4H1TA 4XW2A 4CQMD 4Z53A 4QBTA 5K3OA 3EE6A 1BOFA 1KGDA 2VYVD 3C3EA 1W29A 3CM0A 2X4DA 1Z6TA 5CX1A 2IV7A 1JT9A 3CFYA 2NPFA 4CIBA 4AC9A 2XW6A 3P19A 2Z9BA 1NN0A 3NRBA 3D8SA 2I8AA 3OJ0A 4ZTUB 3BC1A 3SSOA 2XXBA 3ASVA 3U4DA 1QUEA 2X7JA 3GPIA 3I6YA 1BE6A 3QX8A 1D2MA 2OPBA 5LOVF 1LDMA 3IQHX 4NOLA 2AN4A 2OXEA 2YUIA 4FFLA 2K2WA 4P7GA 4CQMB 1Y8CA 1DJPA 1LTHR 2IODA 4P2BA 2X8AA 3TLAA 5JEEA 3HA7A 3A4YA 4JLAA 1QONA 3QYFA 3NP7A 5AVKA 4MPRA 3I9JA 1EFRA 1Z0DA 5KKNB 1OY1A 4RDHA 2BV3A 4GLOA 2AR9A 4JSYA 4N3GA 5CIQA 5L3SB 3WAGA 1AG9A 1TOAA 3RVMA 3ED5A 2K2QB 3TRHA 1OT5A 3HSSA 4LXYA 5LXTA 2ZJ4A 4FWBA 5EWLB 3AIKA 1TKBA 3RQSA 4ZT7A 1R4NB 2YZGA 2HV9A 3A4LA 2E5FA 4FFOA 2HK7A 1I4EB 4UAVA 1GPNA 1THZA 4X1IB 3WY9A 1P9OA 1Q7CA 3Q3IA 1GUDA 2XDQB 4MR7B 1OLOA 4RTSA 4JOBA 1GTRA 3TLYA 3GGGA 1VXOA 1TQ8A 1YCHA 4G6ZA 4PZ9A 3RJZA 4JJEA 2JG3A 3DT6A 1R9GA 1ZMTA 2DQZA 4ZVLA 2QRNA 4RXMA 4E6EA 4AF6A 1ADBA 1T8UA 3JD1A 3KWMA 2Z2IA 3A1CA 4ENTA 4BN4A 5KC9A 1H2EA 2FF5A 4W4TA 4WINA 5KYWB 5G4KB 1D1SA 3M1LA 3QG5A 3SE0A 1H4SA 4F4UA 1NU6A 2PJDA 1NVVQ 5FTJA 1UMDB 4U8HA 4UW9A 3VR5D 1Y5MA 1REQA 3ELWA 3VC7A 4AN4A 3TN7A 3HDYA 4FQ7A 1YJXA 4G07A 4PG8A 1G5QA 2ZSIA 4ZD6A 5C1DA 4Z7OB 4Z3KA 4KPFC 4HX2A 1I3NA 3BIFA 1P4RA 1Y7LA 3D31A 3VH1A 1E2DA 2JI8A 2KS6A 3EUWA 3NEPX 2VHTA 4AQYB 1E5VA 3GWZA 4MRNA 2H65A 3CNNA 3HXLA 1WW3A 2P9GA 4CG0A 2CVZA 1E2LA 4PZDA 2B61A 1J0CA 2JLUA 3T41A 2HAEA 2PWBA 4DILA 4YB8A 6REQB 3NCTA 5G0WA 3K4HA 2BGKA 4R1UA 4ESHA 4HEA1 2QWXA 2X5KO 3KYDB 4R2IA 3EMBA 4D9IA 4ZK6A 5JEDA 1NJ6A 3H8JA 5DSTA 2ZUUA 3H5LA 4D26A 1XOIA 5JFOA 1QE0A 1RHKA 2A88A 3BFJA 4ODIA 3UFXB 2XNDA 5JO0A 5ED4A 1N8SA 4O8ZA 3O8CA 2R2AA 4JP2A 5EPOA 2WOJA 1SCNE 2I3GA 2Q0QA 4DSOA 2Z4SA 1Q1ZA 4A6DA 1E2JA 3ZBPA 4XB6B 5BR8B 2O1XA 3GA5A 2H06A 2Y77A 3F47A 2AT1A 6Q21A 2B34A 2C03A 2IIBA 1PFQA 4LI3X 1BX1A 1HFKA 1KXZA 1MQSA 3KPYA 2HSZA 1XZEA 2WILA 4H9GA 1Y9AA 3VR3D 4DDHA 3GFQA 2A94A 2R68A 4EGFA 5KQPA 4C7OA 2VYFA 4IGIA 1ZK2A 3UANA 3MJVA 4TKLA 2LIVA 3PXGA 3U4MA 4K2AA 2WF6A 1Q1BA 2O3TA 1D6JA 4EEXA 3OM1A 4ZHQB 2BTQA 3QM1A 2YL2A 4QFBA 5FP0A 3I2GA 1MXHA 1KH2A 1YZKA 3SSAA 4QRDA 3EGDB 2J9GA 2ESRA 1A4UA 4HXEB 3LL4A 1G3RA 1U9ZA 2OFOA 1V25A 4LOIA 3W2EA 1QS0A 5MFZA 3LY7A 4G67A 3ZV3A 4TXLA 1BDMA 4WY2A 4E3WA 5JARA 4QM6A 2I4OA 1PG0A 3FWNA 2VJQA 1GADO 4Q9NA 4QZVA 2ANBA 1LF0A 4EY3A 1QP4A 3UGQA 2C4UA 2EERA 2Z2JA 4D4HA 4AXBA 4CNQA 4DGSA 1WLSA 1J2YA 1L6IA 2BR3A 4XYMA 2EWVA 4XUCA 3HDGA 1H0RA 1YULA 1U5BA 2QMYA 3OQVA 4K03A 2J5KA 2VH2A 4LOJA 4U2BA 3SYNA 4AF8A 4IIVA 1CEXA 3SR0A 4AP6A 5HZGA 4I8IA 4B6FA 1OH5A 1DIOB 3U16A 3OLYA 2CUKA 2XYHA 3ZWQA 1KSFX 1Z2EA 1JLLA 2R7LA 2Y8EA 3G8AA 2C9BA 1C41A 4UMDA 5IMBA 1RDFA 1HLFA 2OHOA 4TYWA 3IHWA 1CDOA 5EEHA 4DHWA 1NV9A 3FUWA 3GLQA 3L0IB 2AXNA 5LQAA 2XUKA 3WLOA 3EEBA 2OYSA 3KR1A 1JIXA 1OFIA 4WFIA 4IUDS 2JFWA 1NPDA 1HG1A 4YP6A 1HF3A 1QAQA 4MQFA 1ZC4A 2A5JA 2JGAA 3QENA 2JFBA 3PEFA 4N48A 2NT4A 2AN3A 2HCFA 5GGYA 5IAJA 2H8KA 3EXEA 1N1DA 4IICA 3UAVA 3WDLA 5KSWB 1UDAA 3HK2A 5DI9A 2FUCA 2BEVA 1ZD2P 3VX4A 1DEKA 1NNSA 3UA4A 2YW2A 1PJRA 4L76A 2AOTB 2ZBEA 4V03A 1AOXA 1I0LA 2Q0SA 1YHZA 2H16A 1BDBA 1KI3A 3CN7A 3COVA 2I71A 2AG5A 1GRQA 1JQLB 1XLTC 2XAUA 3LMKA 4PIVA 4AF7A 5FDFA 3GFFA 1O97C 1ZZGA 5L53A 1M8JA 1RI2A 1IOZA 2EJUA 2QROA 3E1KA 3N75A 4FXPA 4KQJA 1R9JA 4DMKA 2C0CA 1Q2UA 2ADMA 4BCBA 4WHMA 5DKFA 2C88A 3F1KA 3UCEA 1I2AA 2R9VA 1KRWA 4HN9A 2KSQA 1F8XA 2XUPA 1XLTA 5CDYA 4WBSA 4RPIA 2RBGA 5M3BA 3HI4A 3ZV4A 5FOWA 1HE8B 1R6XA 2AYXA 2HADA 3TO5A 4DSTA 1CY0A 1J2EA 4DSNA 2HA6A 3F1LA 2WHEA 3M9WA 1G20B 2IOFA 4PBTA 1YVUA 4B33A 3KTFA 5JY1A 5LZ9A 1QK4A 3PDWA 3QV1A 4NJEB 3SNHA 2ZBDA 4Y9UA 3AR6A 2EQBA 2G36A 3MRVA 1OFHA 3HXPA 3HXQA 2KQUA 2PY6A 5HKKA 4HBGA 3L4JA 2BYTA 4H6WA 3TPFA 4YV2A 4KYIB 4W1QA 1O6CA 2CLSA 4AJPA 1EVZA 1QH9A 2GO1A 2WLTA 3FZQA 1FB5A 4UVEA 5I51A 3RU7A 1V1RA 1JBKA 1XAHA 3LT5A 4LAFA 1YDGA 10MHA 4IQ4A 2NTYC 1P7YA 5B2ZA 4UBIA 2WJ6A 3RVQA 4H2DA 1FW8A 4KO1S 3WK9A 4F5YA 2C4TA 5JMTA 2R5FA 2YWBA 1I1OA 2R84A 3I34X 3V1UA 3VU0A 1NFFA 1DG3A 2WMOB 2BGTA 2VXBA 2O7SA 5HXAA 5KVCA 3NUQA 3AWIA 1KJWA 3C5HA 4N5DA 4JL6A 3D4NA 3KB8A 2FRDC 5F7ZA 1ZNZA 2ZAYA 1FE8A 2C4VA 4JT8A 3ZJ5A 4I2VA 3I5UA 2QIOA 2QW1A 3R44A 2ZRLA 1Z7GA 2GZ3A 3HP7A 4P33A 4QHYA 4Q5IA 4R8SA 3E0QA 2HJSA 9LDBA 2B8JA 1MOQA 2ZYIA 3E61A 2HIAA 3HKCB 4B17A 4ETNA 4AMYA 4YP7A 1YZVA 2A1TR 4HXGA 3HVHA 4KXMA 3VNBA 4AZTA 3W79A 2FRDA 2DWUA 2O3SA 2WJVA 4ALNA 4EVIA 5JYCA 1SG6A 3AERA 2BLLA 2WWHA 1WEKA 2FSPA 3NHYA 9GPBA 1WCV1 4O4LA 2ZSJA 4UM9D 4B7UA 3U44A 3HACA 5BN1A 3AZOA 5KNBD 2IYYA 2C0PA 3B7GA 4OHFA 3SPXA 5K8TA 5EKSA 4LZAA 2OQVA 1BEZA 2EFJA 2QRKA 3CCCA 3TLEA 1A9OA 4UXIA 3MT8A 2GPTA 1N3LA 4CKXA 1CDZA 1RWQA 1C1XB 3OIUA 2QI9F 3HVKA 4B40A 5L4LA 4QL3A 3EPLA 2MSDB 1RI1A 1BGWA 5ICGA 3DTTA 3NAQA 4TSKA 5GAJA 1U4NA 1KDOA 3CG4A 5CJPA 3SHOA 3H8VA 2X0DA 2O8FA 3HQ4O 3SHWA 2PBFA 2BKEA 3C98A 3K6SB 1O87A 3C24A 2ETVA 2O4UX 4O1MA 1JA1A 1GQ2A 4WZAE 4EVQA 5BNZA 1X3LA 2LV8A 2GEJA 2ODWA 3OO1A 1XEWX 4O2AB 5AOAA 3SNKA 2WB2A 1CPYA 1PWZA 4KTTE 3NDIA 3L0YA 3DDHA 2CFIA 3FWHA 3TR0A 4HNAA 2I6SA 1S9HA 3RVKA 4MLDA 2WIKA 1ZIXA 3VR0A 1IIRA 2F9FA 2QTVA 4BMDA 4DV2B 1U2DC 1O89A 1KFBB 1DHTA 3B70A 3C6XA 2X8LA 1VQ1A 1ZVKA 3OURA 1SVLA 2O0MA 2FYTA 4GWLA 4MRMB 5EOVA 4CMAA 4S0XA 3NUGA 5HTOA 3Q9SA 1N92A 1VG9B 1TYEB 1E98A 2JH3A 3BSSA 3IQXA 5FBLB 2ZRBA 3DVAA 3PLRA 5D1NA 1BWRA 4ANFA 2OOSA 3MQFA 4QDUA 1RQXA 3KZXA 4JQZA 1BFUA 5FLYA 2Y0DA 1YKSA 3SFZA 5IKMA 1U2DA 2NZWA 3I0MA 4XPIB 4E70A 2RJOA 1NI4B 1RRCA 4RIIA 5HFNA 2A7QA 4KWEA 4UUBA 4RIFA 2JLXA 3AEQA 2JVJA 3HY4A 3ZTTA 3BT7A 4RD3A 4GRDA 2C4MA 2W43A 2WYIA 3L7AA 1G18A 4QTYA 1WUIS 1BX0A 4R2WA 5T6BA 3L3BA 3RO7A 3JPWA 5JRDS 1HE1C 1JW9B 2R87A 3IAM1 2QP4A 1ZISA 1J2UA 1ZLYA 1IN7A 4C6TA 4E5MA 1AGRA 3W5DA 4LZNA 1LSOA 5GV8A 2W70A 4EWLA 3IJRA 1Z7BA 1CS0B 5DASA 1I14A 3VTAA 1KJYA 1W96A 3OHSX 4Y2VA 5G0UA 4ZC1A 2XB2A 3TTYA 1AKNA 1Z3CA 2AOUA 2VL7A 1C7FA 1OYVA 2E4WA 4S1VA 5DF1A 2WK1A 4ZAVA 2CSUA 4AURA 3O3OB 3L7DA 4DLUA 4LKOA 2JA1A 2R1TA 2Q3HA 3B3AA 1JIUA 5CR9A 4BVJA 1T26A 5FHRA 4HLUC 1W36D 4A7PA 3PDIB 3LYHA 4LDZA 4OUKX 4PSUA 2Q46A 3ODGA 2NXEA 4RF5A 1ZQ1A 3H13A 4MICA 4Q9HA 4ZOAA 4G0ZA 1RE0A 3HPRA 3OZVA 1ZI6A 5TXGA 4AO8A 3JR3A 5DEOA 4IJUA 4LK3A 3TTTA 4BE9A 2W2TA 1OAAA 2HDWA 2WU0A 4Z1MA 1J8DA 2IDMA 1WHTB 1YO6A 2ACEA 3HHPA 2AX3A 4RJJA 1SA0A 4I4LA 4Q3KA 5IJAA 1XLWA 3RTAA 1HQCA 5FFNA 3WL8A 3WLSA 5I01A 2LWIA 4KQ2A 1W36B 4HVCA 5J40A 3PGLA 3OM0A 4WKPA 3TOVA 2C78A 3ZDDA 1QZXA 5G2OA 4L5IA 1FSGA 1FDUA 1R3DA 4FS3A 1HNZB 2XDYA 3EZFA 1W4AA 1KXJA 3P52A 4HDOB 2XBLA 2OSBA 4ARZB 1U2PA 2J0QA 4V1CI 4F6RA 2FQXA 2ZUDA 3D8TA 4URFA 2D1TA 4EKDA 4N5IX 4QYWA 5F3RA 2H08A 5HIMA 1CJVC 5J9FA 4C3OB 4K9RA 3KQVA 4RDXA 4J0QA 2A5DA 1ZC3A 3W1WA 4LHWA 2FW8A 4B84A 4EVSA 3UB2A 2P6PA 2NU7B 4R8VA 5LP6B 3FWZA 5DYYA 4FEYA 1KVUA 1BHO1 4RD6A 5KSZA 3LZ6A 1ZD8A 2I54A 3OJEA 1YB6A 2PSDA 4Z8YA 1DIGA 1QIFA 4CW7A 4IDOA 4Y2RA 1IWOA 1K06A 1MV5A 1RPNA 3BH6A 4H3VA 2TMDA 2CMGA 3OX1A 5F1OA 3JS5A 2L42A 4Q3NA 5KHOC 4GM4A 3FOFC 3GT0A 3P71T 4N82A 1NNUA 4UMEA 3NWPA 1NBHA 1XZFA 3NTVA 3PQDA 4FYXA 4HYEA 1QH1B 1O57A 1FVFA 3DF9A 4JC0A 4Q7KA 2G5GX 3V7WA 3CEJA 4Q21A 1JV2B 3EULA 4D4MA 3F5MA 4C3UA 4O08A 2JASA 4POOA 5JIBA 2E55A 4D9FA 1PFYA 3R23A 3LFHA 2CVPA 3TQHA 4CLOA 1VBKA 3LFTA 1QG2A 3LCRA 4NZOA 5LD2C 1T9ZA 4RUKA 2GBIA 5FUVA 1X42A 3E3LA 221PA 5LYJB 1WUYA 3I42A 3M6UA 1W34A 4QBKA 4CG2A 3I9KA 2XGJA 4XGKA 3CB2A 5JVDB 4DY4A 4V1CA 1KYVA 1UT5A 4LOLA 1NJ8A 5H4GA 4PCAA 1Q3TA 5JCJA 3VR2D 1DBQA 3T5DA 4COOA 4A8JC 2H2WA 3VDRA 3WGTA 3FNHA 3C7AA 1DMSA 5G41A 2VXOA 3WRYC 1GTZA 4REOA 3NYWA 3IFSA 4BO5A 4EIWA 3FR8A 3CUKA 3OFSA 1QDLB 8AT1A 2QLBA 5CT9A 3HVRA 4KC0A 3RAFC 2YINC 4TTAA 4TZ0A 2O07A 2H59A 4OBBA 3UHPA 2IBMA 1KJIA 1FK8A 1S7CA 1VJ1A 1XTZA 2AX4A 3AOEC 3AV3A 1XU7A 3GT3A 4JJ6A 3E35A 4A8JA 3ZR4B 1PUIA 5DYWA 3FSGA 3WRYA 4JHLA 1SVKA 2VBFA 3LIPA 3IBGA 3FNIA 5LYYA 2Z2YA 4RSHA 4ND6A 5B3LA 1Q3HA 3O74A 4ZV7A 2ZEJA 4FEEA 3J81k 2WWWA 3CJRA 1ONSA 1SUBA 1G60A 4KAFA 4LYJA 2FWAA 5CLQA 1HA3A 4CMIB 5FWAA 4U8GA 5BO5A 3OQPA 2AQHA 2AMFA 2HCRA 2PKEA 5C37A 4YT2A 4YK7A 1Z9BA 1B2RA 2C8JA 3CF2A 3Q1LA 1XD2B 3QZUA 1VGQA 1XO1A 2G80A 1FY2A 4NBSA 3RVDA 3TKAA 1UR5A 2XGMA 4DN6A 2OHIA 1SVMA 2NPOA 4EG0A 1QF7A 4MI1A 3BL6A 1RKUA 2GAOA 2CUNA 2RHTA 4B4DA 5CJ2A 5FOXA 4DSUA 5B4TA 4OL9A 3H5TA 1X3SA 4Q93A 5EMHA 1NWCA 2CNBA 5FEMA 5JAMA 4PG7A 3DOIA 1O03A 1BGXT 4CDMA 2G40A 1BD4A 1T2EA 3BHIA 1W5AA 2ZJAA 4Q3CA 2V97A 3RS3A 3MJHA 5T3YA 1ECBA 1R6BX 3VYVA 3BGSA 3ZX4A 1A8PA 2BFDA 2XVYA 3Q3EA 4Q4AB 1TEZA 4KSYA 5CIYA 1KIFA 2P4UA 2YWEA 4XUGB 4LPKA 4RS4A 3TDMA 1AUQA 2BGGA 2UVQA 4ZU3A 4G0QA 2PKCA 2W8ZA 4Z0HO 3AUJB 4F1JA 4ZJPA 2AOXA 2Y92A 3W5VA 4CN9A 1RQ2A 4FT4A 4C20A 1GNTA 1E6EA 2B4YA 2CJPA 2VO1A 4LPSA 5LLTA 2AYZA 2CD7A 2W0SA 3LXXA 4AJOA 5BURA 3NHFA 5EWMA 4LRWA 1WPQA 4UEKA 4RO0A 1VSTA 1SD5A 3EN0A 4NJMA 5HS6A 3NHPA 4B31A 3GGOA 3MWJA 3ORRA 4QGFA 2YY6A 1IN5A 2RG7A 2XZOA 2JGNA 4KWHA 1CSEE 3R5JA 5EL0A 1C7JA 4OU4A 5BYAA 1T2CA 4ZALA 3SYLA 4IX1A 4TV9A 4PHFA 1BD3A 4OQXA 3WP1B 1MX9A 3V48A 1KO1A 3M6IA 1I5RA 4OB8A 4XFDA 2FPPA 3CZMA 3G1WA 5GADl 5LP6A 2H5JA 1Z38A 3NPAA 4WJLA 2J07A 1MIOA 2E5WA 1M2GA 3NC1C 4ZC8A 2HQ1A 3WB0A 3U5ZB 4HR7A 4B44A 2V74B 4TTSA 2IPAB 4RJ2A 3CSUA 1OYOA 1Y5NA 4QYMA 2A3NA 1Y9DA 1NSTA 2P9HA 3EMDA 5CAEA 1UBHS 4C0XA 4QM7A 3ANMA 2BBOA 1NVGA 3GJQA 4B8WA 2HLPA 3FSRA 5A71A 3NWOA 1VHJA 3ZD9A 3LRPA 5E8RA 3OZIA 1E6CA 4Y6OA 5LUAA 4EYEA 2QE7D 1QV9A 3M5PA 5AKYA 3THRA 3G0IA 5IKXA 3WG9A 1P0PA 5EIXA 3V8EA 3B38A 4HDCA 4RY2A 1JHVA 1P2FA 1MRZA 4JASB 3BQ9A 4MVJE 4U4AA 4DE5A 5KOYA 4ZRMA 4B3CA 5AM3A 4UPVA 1ZN2A 2WJAA 3X2FA 1ZNWA 3ISVA 4TMTA <