1LRKA

Crystal structure of escherichia coli udp-galactose 4-epimerase mutant y299c complexed with udp-n-acetylglucosamine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPACWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
molecule tags Isomerase
source organism Escherichia coli
publication title Structural analysis of the Y299C mutant of Escherichia coli UDP-galactose 4-epimerase. Teaching an old dog new tricks.
pubmed doi rcsb
total genus 126
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lrkA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1lrkA01
1WWKA 4CQMA 1HETA 3UVEA 5JBIA 5ER6A 2EEZA 3S1LA 2QX7A 4IDGA 4GH5A 3K31A 3GMSA 3K9QO 1B26A 1QP8A 1QKIA 3DFUA 4Y9DA 4YVFA 3X2FA 2R00C 5IAAA 4YBZA 3GUYA 5U4QA 4GAEA 1T2EA 4L76A 4QQRA 1X1EA 1C0KA 1O5IA 2YJZA 4IUYA 4A27A 3VVCA 5JC1A 4X54A 1JN0A 1Y5RA 5DNAA 5FI5A 1GR0A 2R6JA 5GY7A 1AXGA 1VL6A 3RVDA 1ZEJA 4JNKA 1ID1A 3CXRA 1D8AA 1B14A 1V0JA 3PTZA 3O03A 3PWKA 3IUPA 3B1KA 2J6IA 1PS9A 3JQAA 3N58A 2QIOA 5JY6A 5KNLA 1EMDA 1DHRA 3JQAD 4JN6B 1FDUA 1PL8A 3TQHA 3ZWAA 4Q3NA 2RIRA 1E7YA 3GHHA 1F8FA 1W4ZA 1TT5A 4MKZA 1ZVMA 4EJ0A 3FWNA 3KYBA 5C7LO 1GUFA 3PVZA 3ANNA 3BIOA 3O8QB 1HF3A 3TZ6A 3BMCB 4E6PA 1T2DA 5I9MA 4OYRA 3TL2A 1MG0A 1EUCA 3AOEA 3AM5A 2AA3A 4I8XA 1GV1A 3D5QA 4HFJA 1O89A 2O7SA 4L8VA 5DOVA 5JMPA 4CR6A 3BA1A 1LXCA 3U09A 1T24A 2Q2VA 2VYVA 1NBOA 4M49A 4NI5A 2VHYA 1UDBA 2AXQA 2C20A 1JDJA 4ZQFA 2YZ7A 4DLAA 3VDRA 2XF8A 2IZ1A 2GLXA 3H5RA 1ZH8A 4GSLA 5LDHA 1E6UA 4E4YA 3TFOA 2CD9A 4A2CA 1FDTA 3RU9A 3HADA 2Q1WA 2BELA 4BNFA 4LMPA 2I9PA 1PEDA 4J1QA 1SNYA 4OHUA 4U0JA 4XYGA 1DC3A 1KEUA 3SJUA 3ST7A 2PWZA 2DLDA 2CZCA 4J2OA 1YB4A 2GZ1A 3JD3A 1V35A 3QA9A 1DFGA 4RQTA 4R54A 1ZIDA 4BO2A 1Q0QA 2B4RO 2PA3A 1XG5A 5FWNA 2QRLA 4D3FA 1X0VA 5BR7A 3ZI0A 1WDKA 1H2HA 4L75A 2OP0A 2D5AA 3W6ZA 5H82A 1A7AA 4DVJA 1VL0A 2OOSA 4OKNA 3L4BC 4G2NA 5A02A 2AEJA 2ZQYA 4FJ0A 1JQBA 2VZ8A 4P4GA 1GPDG 4BNMA 2XPCA 1E1KA 4ILKA 4D0SA 2XAAA 2DUWA 1JWAB 4LMRA 1I2BA 3DWFA 3N74A 1ZBQA 4DPKA 4EBFA 5TRTA 4LRTB 3ANMA 2X23A 4EUEA 4R69A 1MFZA 4D46A 1N9GB 1M6WA 2P5UA 4OH1A 4E5YA 3ICCA 2PKQO 1U2GA 3E5MA 2B5WA 3GC6A 4B4WA 2HKIA 2FSVA 3AY3A 3KRTA 4Q3CA 1GEEA 1BXGB 4A10A 3QVXA 1T2CA 1Z6ZA 2VOEA 1U5CA 2V6GA 3ZU4A 1F17A 4AJHA 4DTIA 4J43A 4U6SA 1GYRA 4F6CA 3AY7A 2P2SA 4HKTA 3VKVA 4NBTA 2PZMA 1T1RA 2VZ0A 3WBBA 3TZQA 2P4HX 3DZJA 4MVJA 2AQ8A 2IYOA 5G4KB 4TRMA 3SJ7A 4WLNA 2G1UA 2V6MA 4ALJA 5G0UA 3IP1A 1SCUA 2GO1A 3QJ5A 1NR1A 4AJIA 3AJRA 1X14A 3HFGA 4GVXA 4RVUA 2EKLA 3TOXA 2BHLA 1I32A 1KEWA 1JAXA 5COAA 5ADHA 1VI2A 4R1SA 4B3HA 2Y68A 5JAIA 4XGKA 4E2WA 1LRJA 5U9CA 3OECA 1LQTA 1R4MB 1HDXA 3KLPX 3W6UA 3FF4A 4TZKA 3FBGA 4PRLA 4ZGWA 3S8MA 2A94A 5ER9A 1N1EA 2CFCA 2JKVA 4NZ9A 4BB6A 4RCVA 3C3XA 3HE3A 2HUNA 1HE2A 2Y05A 4GL4A 4LW8A 3UGKA 4URFA 4AJ4A 1M75A 1T2FA 4DA9A 4WE3A 1XGKA 5TNXA 4LCJA 1ZK2A 3WSWA 3M1LA 3KYDB 3SX2A 4NU5A 4OO3A 4YAJA 2TMGA 1YL5A 4MOWA 1HRDA 2GCGA 2V6FA 2X9NA 1QYWA 2HMUA 2Y1CA 1YDEA 1FDSA 3LT4A 3EDMA 1VJ1A 5L7WA 4JXKA 3DAGA 1YO6A 1YDWA 3WR5A 2FPIA 3DONA 2Y0DA 4WCFA 1E1MA 1LDNA 1AUPA 1YOVA 2PKQP 4JJIA 4W82A 2O4CA 4JROA 4D45A 2BLLA 5CDSA 3LQFA 3AUSA 2FOIA 3RC7A 3ZNNA 4GKVA 3K92A 4IXWA 3OH8A 3F4LA 5G2OA 3WMWA 5C5IA 3FR7A 3EC7A 4BNTA 4KTTE 4WUVA 5TSDA 3MTJA 2J5QA 3GVHA 1P33A 4NMHA 5EMHA 5THKA 4WLUA 1E77A 3DXFA 3TOZA 1P77A 2OUIA 2FPPA 1WAMA 3L9XA 2AQKA 2XOXA 4XZ3A 4OAQA 1YGYA 4ND3A 1MX3A 4Y8VA 5A03A 1X15A 4Z0TA 2NSDA 1Y8QA 3BMQA 5CEJA 4IDEA 4Z9FA 3Q0EA 3DZBA 4FFNA 1YRLA 3PDJA 2VCYA 3K8ZA 3GHYA 1GD1O 1QYXA 2HMTA 1XHLA 1B8PA 2CSUA 4NBVA 1Z7EA 2IODA 5KVQA 4C7JA 3I23A 3ONFA 3D4OA 3VZQA 5A9SA 2X4GA 1PJSA 4I5DA 5L3ZA 1ML3A 5K0ZA 2X6TA 1PGOA 3AK4A 1R15A 5JXWA 3ULKA 4IDBA 1N5DA 1Q0LA 5CPBA 4Y6SA 1QLHA 1WNTA 4YJGA 1PJ4A 2WD8A 3HHPA 2PD6A 3PHIA 4BV9A 1PJBA 2IRWA 4QUKA 3A14A 5KJCA 4AG3A 1QORA 3E9MA 2C82A 2WYWA 1DJQA 3CEAA 4K9DA 2WE7A 5EIOA 3D3WA 3NTRA 3PHHA 5C7OO 4AJ1A 5T5QA 5EQDA 2DBZA 3ZV4A 4GLLA 4AJKA 4PG8A 2RH8A 3ITKA 4JP2A 1RPNA 1ZZEA 1KC3A 4LN1A 4IJKA 1DDOA 1D1TA 2VUSA 4CQLA 2VHVA 5G0WA 1FXSA 3HSKA 3GZ4A 3L4SO 2WEKA 5DCUA 4IIUA 2UAGA 2JCYA 2O50A 5A5EA 2ZJ1A 2IEBA 1YWGO 5ES3A 4CLDA 3E1KA 1VSVA 2EHDA 3HB5X 3DBRA 1LA2A 4ZN6A 3K5PA 1HLDA 2BF7A 3P5SA 2QRJA 3ENNA 2RH4A 5DBFA 4BL5A 3Q9NA 4AJPA 2B4TO 1L7DA 1EK6A 4PZDA 4YXFA 4DIOA 4FN4A 5A06A 1HKUA 5CG1A 2C2XA 4BGIA 2FMUA 3LC7O 4ROSA 4W99A 1KVQA 2B37A 5F3RA 3PWSA 1H5QA 5TS3A 5G0TA 4XKJA 3I6QA 1JVSA 1Y7TA 1JLLA 1C1XA 1NVGA 2Q99A 1Z73A 3FD8A 1HE3A 4FQ8A 2ZTLA 3L0DA 4UVGA 2D59A 5GMOA 1D4FA 4BNNA 4J0EA 4EJ6A 3UICA 5KVCA 4EUFA 3OJ0A 5DOZA 3C7DB 1U28A 4B79A 3TFQA 3D7LA 4I1IA 3T4XA 4CM5A 5K6AC 4AJJA 2NU9A 5KVVA 4CMHA 3TDKA 3I3OA 3ORFA 3FSRA 3KYCB 3MJEA 3WGOA 1I24A 1X7GA 5DBGA 1Q1NA 3IP3A 4FFMA 3OA0A 2J3IA 4E0BA 1Z82A 1LSOA 2X8LA 2IEDA 3KM0A 4R41A 5CPFA 3QVWA 4IGEA 3V8BA 4BKUA 1V3UA 3GZNA 1AE1A 3QVOA 3INRA 1IZ9A 4EITA 1X1TA 3I9LA 3JCZA 1ADFA 4OKIA 3IUSA 1CYDA 4OSOA 2EW8A 2YHUA 4RZHA 2FN7A 2UYYA 2DBVO 1OFGA 3I52A 3S2EA 3ZWYA 4ZHSA 1G0NA 4QX6A 1SAYA 2O2YA 2DM6A 3SLGA 1BRMA 1N8KA 3ZV3A 2VWPA 3WICA 3AFMA 1U7HA 1FK8A 4RDHA 1LUAA 1IL0A 3PHJA 3WSVA 5IDQA 1I30A 1PSDA 4R51A 2JFFA 4GKBA 2CF6A 4XEHA 4JJGA 1SMKA 2HRBA 4E2YA 2JCVA 3RCBA 3WTBA 1KYQA 2EGHA 3GY0A 3AW9A 3D5TA 3Q6IA 1I01A 1RYEA 1NQ5A 1XA0A 1ISIA 4DL9A 1R66A 1P1FA 1PIWA 1PGNA 5T57A 3UCFA 1TXGA 1WP4A 3AI1A 4YB8A 4DIFA 2A92A 4J4BA 4Z3KA 3AY6A 2CVQA 5HBRA 2YV2A 4IS2A 3CH6A 3WGGA 1BWSA 3GZNB 4PCVA 2ZB8A 4GGOA 2BFOA 4I5EA 1BW9A 4OM8A 4XRGA 2IXAA 3VZSA 5AXDA 3UXYA 5HM8A 5IXSA 4MIYA 1C0LA 2EXXA 2W8ZA 5T8KA 5ICSA 2UDPA 1RM5A 5CP8A 3VPSA 4CM8A 4O63O 3NDRA 2VT3A 4YA6A 3NGLA 4RJTA 3I9OA 4OXYA 5L4SA 2HMSA 4WOKA 1PWXA 4RF5A 5G4KA 1R4NA 4JLWA 4ZQBA 5FYDA 2HU2A 4ZU3A 3DBLA 4F46A 4E30A 4TKMA 2BH9A 4FGSA 4YT8A 1M6HA 4DMMA 3LVFO 4WEOA 3DZGA 4NJMA 2OZPA 4RDIA 2F00A 4LK3A 4E5MA 5JYDA 3MTGA 1I3MA 4XB1A 2X5KO 3STHA 3WGIA 3ON5A 3HDHA 4LGVA 3HDJA 1T2AA 3WLEA 3ICPA 3C85A 3F6YA 4QFCA 3FR8A 1GZ4A 2O3SA 3IQDB 1DIGA 2DC1A 1TI7A 4XQ9A 2Y0CA 3GVXA 1KS9A 1WDMA 4Y67A 4CM3A 3GLQA 1K89A 3AOEC 2PK3A 3ZW9A 2OBYA 2B5VA 3CZRA 3GQVA 4NK5A 1PZGA 1UR5A 4AJEA 5BT9A 1SC6A 3OA2A 4J4TA 5CAEA 2JD1A 4YT2A 1H6CA 1GEGA 2X22A 5B4VA 1LSUA 4CMGA 4N5NA 2C59A 1JKFA 2G82A 2VNAA 4KTVE 3WYCA 4XQGA 3QWAA 1MB4A 3V1UA 2EIHA 1R12A 2FP4A 3P19A 3H9EO 1B3BA 3PQDA 1GY8A 1U2DA 4N18A 5B37A 4PFJA 3P2OA 1MUUA 5DZSA 5CDTA 3PFWO 4J7XA 3EUWA 4CODB 3KEQA 2X0JA 3HQ4O 2VTDA 4YAIA 2NADA 4J6FA 1TT5B 5IJZA 1Y8QB 3BMQB 2GN9A 4PVCA 4B7XA 1ZK3A 2Y1DA 2CVOA 4JGBA 1GCUA 3D3WB 1XKQA 2LDXA 5T64A 4CPDA 2QG4A 4BVAA 1KVUA 4TMFA 4YJGB 4QEDA 1Z7BA 3G49A 4IINA 4D44A 1DPGA 1NFQA 3ANLA 3FTPA 4J1SA 4TRJA 1E3WA 1LJ8A 2NU7A 1ZK1A 2O48X 3L9WA 5JAMA 4BQRA 1Q7GA 2B69A 3ZWWA 4OJNA 4DUPA 4HFMA 2PTGA 2ZATA 1SZJG 3AUAA 1UAGA 1U7TA 4TRRA 5L7TA 1A72A 1NYTA 1K3TA 2WE8A 1E7QA 3VZRA 3JQ7A 3G1TA 1ENPA 2BKAA 1R0KA 1DHTA 3TZHA 2Q1SA 2GN6A 3Q9UA 4E21A 3H8VA 4ND4A 1PZEA 4YDRA 1B16A 4W6ZA 4KDFA 4CV1A 4YJFB 3HWRA 4DGSA 3JQBC 5JNLA 1T4BA 3K6JA 1ADCA 2CF5A 1QYVA 3A1NA 3NT2A 3ZNPA 4L73A 3VTZA 4IS3A 2HMWA 4YYZA 5IDWA 5MGBA 4NFSA 2QZ9A 2DUUA 4CJXA 3JQ9A 4K26A 3NEPX 1LBEA 4MP6A 4CLEA 1B3RA 3WQQA 3FN4A 4L9RA 4XGNA 3NUGA 3N7UA 1EDZA 2B4QA 1NM5A 1N2SA 1I36A 4JP3A 3E6AA 1NASA 4KQWA 4D0RA 4BO5A 1PS0A 2PH5A 3HFSA 5KKCA 1T26A 3NTQA 4R9SA 2P9EA 2ZKLA 2P5YA 3R6DA 4KMSA 1HSOA 3U9LA 2BD0A 3CUKA 3LDHA 3O4RA 4BO3A 3IIEA 5DDIP 2VRCA 1FJHA 3ADPA 2WM3A 2DT5A 2WWRA 3WGYA 3RBXA 1BVRA 1H2BA 4B4OA 3LZ6A 5I8WA 3WX0A 2EKPA 3ADOA 3RUIA 4W7HA 4BNLA 4PZEA 4NFYA 1BDBA 1LRLA 3V2GA 2C2YA 3U49A 2JHFA 5A1TA 2YDYA 1MXFA 4Z9XA 3JD4A 1LDEA 4ITUA 4CM7A 3F1KA 1Y81A 1UXIA 4FFOA 1NQTA 1N92A 1X7HA 2X5JO 4O5OA 1LI4A 2J3HA 4YRDA 2V6BA 2Q1TA 4BO0A 4PRKA 2EWMA 2ZYDA 1W0CA 1L1FA 3RFTA 1U3WA 2W4QA 1P3DA 4M8SA 4Y98A 1KY5A 3HG7A 1O9BA 2YHIA 4ZD6A 1UXGA 4ND5A 4U6QA 2WDZA 3GGPA 2VYND 2AEFA 1CWUA 2D3TA 4PG5A 5A04A 2VYNA 1U1IA 1Y9EA 4PZCA 4Y6PA 3DFZA 4GQAA 4AJOA 4NHEA 1GL3A 4BO1A 4EW6A 1OZAA 1YBMA 2X5OA 1IPFA 4ND2A 4BNGA 1RKXA 1U4OA 3FRJA 3T7EA 4YRBA 1Z45A 1P1RA 4FFRA 4CM4A 1ZNQO 1V9LA 3TN7A 3ROQA 1HDCA 2CDBA 4FJ1A 3WS7A 3ZDFA 2OBNA 4LCEA 4UUPA 5IDXA 5IG2A 3WOHA 5BSEA 3PI7A 4ZA2A 3VAZA 1E3WB 2Y1EA 4R3WA 3WYEA 3LC1O 4M55A 5IZCC 1DB3A 5F1OA 3VTFA 1XU7A 5CDYA 3JYOA 2P9GA 3GEGA 3DAFA 2JL1A 3OJOA 2I5PO 1DLIA 1GV0A 1UXJA 4HBGA 4XIJA 4K28A 3GAZA 1NFFA 5IN4A 1EBUA 6ADHA 3MJSA 4BO6A 4KUHA 2QYSA 4GLOA 3NRCA 4AJNA 3ETEA 4YJDA 2ZYGA 3HZZA 5F1PA 2GPTA 5C37A 3JSAA 3QW2A 4MVJG 4YQYA 1VJ0A 3TRIA 3PYXA 4GGPA 1E7WA 4YCAA 3WGQA 1ADGA 2YFHA 4D3DA 1GQYA 1XELA 1DXYA 4Z3DA 3GK3A 4E2XA 4AJLA 2D4AA 4IJUA 4PIVA 4BNZA 1PL7A 3WLFA 3LT0A 5CHEA 3EYWA 3JV7A 2YUTA 4B4UA 2BFAA 5J23A 2BMAA 3PGXA 2P9CA 2EF1A 4ID9A 4MVJM 4NJMB 3ROMA 1AHIA 1F14A 2GSDA 3RUDA 4DBVO 1BXGA 4RZIA 3AU8A 5DP1A 2EG9A 2XXJA 3D0OA 3QRWA 4PLVA 3H5AA 4HNHA 5COQA 4ZQHA 3ZHXA 2X1HA 3GG9A 2VWGA 1GYQA 2C07A 1Q7BA 2R00A 4MP8A 1HDRA 4DLLA 2HMVA 3FNFA 4TRNA 4B8ZA 1SEPA 2Q46A 3F47A 3R0IA 3PJGA 3DO5A 2O3JA 1HXHA 4R01A 1LLCA 3SLKA 4MVJH 4JIGA 1O6ZA 3ZWPA 3W4KA 4RF2A 4GX5A 1DLJA 4M89A 1GUZA 3B1JA 3WFIA 4KWIA 1GCOA 4MJLA 1JWBB 2GNAA 1EUZA 1TEHA 3PJFA 5B1YA 5L45A 1XU9A 3I9NA 3GOHA 2A35A 3C7CB 4ONEA 3VHRA 1J5PA 5A4DA 3O8QA 4Q3BA 5F5NA 3GVIA 1I33A 5ICMA 3JQFA 1PWZA 4ESOA 2WYVA 2FR0A 1E7MA 1VE9A 1YL6A 3MOGA 3TPCA 3RUAA 5TIIA 4XCVA 3PDUA 4CUKA 2VHXA 1EQUA 2E37A 3ZU5A 3CTMA 4Q3DA 3F5SA 3DAPA 4O0LA 5BNFA 1A5ZA 4Q39A 5L40A 3PEFA 4XIYA 1LDGA 3Q3CA 2GUGA 3E48A 3FTNA 3VOSA 4P38A 1Y5MA 1ADBA 3BHJA 5DF1A 4CMIA 1EUDA 3E82A 4YJHB 3KLMX 4A0SA 1ISMA 2W90A 1DIHA 1HEUA 5DCWA 1MFPA 1VKOA 2GD1O 3B6ZA 3OMLA 4E2ZA 5JDCA 4DXHA 4CMKA 1NXQA 2I6TA 3F4BA 4BOYA 3F3SA 4GMGA 3G1UA 1M67A 4HWKA 3SEFA 3QY9A 4FR5A 3X2EA 2G0TA 4I9HA 1ZKMA 4B3JA 3I83A 2PY6A 3FWZA 1JA9A 1ZSNA 2HRZA 4GX2A 1H6AA 2YY7A 1M66A 1KIFA 4II2A 3ZU3A 5KWEA 1YL7A 3U62A 4M1QA 3W1VA 1J0XO 4BHTA 4UEJA 3ZWNA 1LTHR 4MVJF 4RGBA 1CIVA 1EVIA 1ZMTA 2DBRA 4KDEA 1R16A 3PXXA 1UP7A 4KZPA 3GDOA 4DPMA 1NWHA 5KTKA 2OORA 4E12A 3IMFA 3OP4A 1P44A 2DKNA 2I99A 4OSPA 3RAJA 4FB5A 3GRKA 3AM4A 5IZ4A 1EVZA 4H7PA 5CDUA 2VUTA 7MDHA 1LQUA 3ZZNA 4C4OA 2BFMA 4W9NC 3JQ9C 3VDQA 1YQXA 1F12A 3E9NA 3FCOA 2ZIZA 3GEMA 3OETA 2VWHA 4PG6A 2ILTA 2UV8A 5JW6A 2FPGA 4J2HA 5TJHA 4BKQA 3SVTA 3H2ZA 2GASA 1LNQA 1D7OA 4BO9A 3GR6A 3KV3O 1FDVA 1K6XA 1TT7A 3IAHA 3I4CA 5HS6A 3WDSA 4PG4A 3RC1A 4R1TA 4R5MA 1PJTA 3DC2A 3CMMA 3GPIA 1DFIA 3KXDA 4NPCA 5EINA 1M76A 4FSHA 4EDFA 1GUYA 1QLJA 3JYQA 1PJQA 4BO8A 3GN1A 5A3VA 4CMEA 4A03A 3NTOA 1A9ZA 1X13A 4WNIA 5A3JA 2GRAA 4R68A 1PZFA 2CMDA 3I5MA 1GDHA 1J6UA 1P0CA 3RUHA 3UAGA 1UZNA 3RUCA 2I3GA 1CJCA 5LCXA 1K2WA 2PH3A 4CUJA 4JBIA 2DVMA 5JYEA 3WQRA 3NDJA 2Q1UA 3JQ8A 4WCDA 4H3VA 3S2FA 3QWIA 3H9UA 4IDCA 1FDWA 5G4LA 4C7KA 4YRAA 4ZRNA 4WLFA 1PR3A 1XIVA 3EZYA 4CM9A 2BGKA 2HK9A 2HJRA 4YQZA 3QVSA 3BYZA 3H3JA 2VNSA 4HY3A 4EI2A 1F8GA 2OL4A 3GMDA 1E3LA 4CM4B 5TT0A 3L6EA 3WXBA 3D4PA 3E18A 5L4NA 5HS4A 4XWYA 3OJFA 2CDAA 3DOCA 3GAFA 1LDYA 4UVDA 1U3TA 2WD7A 1IUKA 3C7AA 2ZB7A 1NHGA 1A4UA 1N7HA 4FC7A 3DZIA 1LRKA 4HP8A 1DIRA 3WGHA 3B20A 1HZJA 5B4UA 5T8KC 1PTJA 5BNTA 3JYPA 4KQXA 3QWBA 3WQSB 1GPJA 3DOOA 4BV8A 1HYGA 3EVNA 3ZWOA 2Q2WA 3G17A 1WVGA 2ZTVA 2NVUB 4UUMA 4DYVA 1UXKA 2HAEA 4F3YA 4CR7A 1ZXBA 2ZQZA 4MVJD 4KUEA 1H6DA 4MIEA 4CQMD 3WFJA 1JAYA 1ULUA 5ILGA 1EVYA 2HCTA 3UW3A 2BI7A 5ILOA 4QECA 4Z0HO 3A9WA 1E3IA 1GFSA 4O59O 5JO9A 1UP4A 2ZTUA 3WWYA 3DMTC 1C0PA 3K2BA 3COSA 4NNJA 3AUTA 2BFPA 1B15A 1HL3A 1UDAA 3H9GA 4ZRMA 4ALMA 3OQ1A 1I3LA 2EP7A 1UZLA 4UULA 3WMXA 2Q50A 1QV7A 3KZVA 4I9NA 2FRDA 2F1KA 2NU6A 4N7RA 3QSGA 1F06A 4XDYA 1I10A 1UUFA 3G3EA 1PJ3A 2R2GA 4A5OA 4J90A 3TZCA 4J9UE 3GNSA 2EERA 2O3QA 2Y66A 4DC0A 1E5LA 2IXBA 1B2LA 4FOOA 4DPLA 3LT1A 1BGVA 1HDYA 3DHNA 3PZBA 2NVUA 2O3TA 2GZ3A 4JX8A 2P68A 5JAZA 1NP3A 2W2LD 2C7GA 1I0ZA 4ALIA 1E3EA 3LC2O 2V7PA 4TVOA 3MCVA 2VYVD 1MC4A 1H0KA 4W7IA 4GSKA 3W4JA 3ZWVA 1V8BA 2C29D 4QO7A 5L95A 3WNQA 4DQXA 3RROA 1EBFA 1YKFA 4BGVA 2NVWA 3INTA 3G0OA 5EESA 4BMSA 3EMKA 4IMPA 3OEYA 4FFPA 2H1SA 2QRKA 3ZHYA 3ZU2A 2ET6A 4Z6KA 4RLHA 4LISA 4CQLB 4TQGA 1H93A 2C5EA 1AXEA 2DTDA 4YWJA 3NGXA 3IKTA 4YT5A 2YYYA 5EQFA 3JQ8B 2ZTMA 4BNYA 3BHIA 3OEWA 1LLDA 3DBRB 5JS6A 5IZCA 1VM6A 2LDBA 4FIZA 3HDQA 3WIDA 5LDGA 2Q49A 2JFHA 5A05A 1TA4A 3GUCA 1P0FA 3OM9A 5GZ1A 5CDGA 4PVDA 2VTEA 3A28A 1VC2A 1B7GO 3PPIA 1E3JA 5I8ZA 3INGA 3D3EA 1ENOA 3M1AA 3RFVA 3RFXA 4PGFA 4ZVVA 4DRYA 4DIBA 3NX4A 1E7RA 1MXHA 4J0FA 3FPLA 1O8CA 2EV9A 3L77A 5CEFA 3CKYA 3TNLA 1C1DB 3EY4A 4AFNA 3C1TA 1WXDA 3IOYA 2X0NA 3UCEA 3LK7A 1I8TA 3ENKA 4K6FA 1IZ0A 1R4MA 1ZXLA 3VH3A 4RVDA 1HT0A 4GPD1 3O38A 4R5HA 3T7CA 5DCYA 3H7AA 4YAGA 3Q2KA 2UVDA 2D8AA 3NDIA 3BMCA 5GZ6A 4XR4A 5KVSA 4QT0A 1QRRA 4M87A 1SB8A 3UN1A 4E32A 4ZJUA 1ZK0A 3P7MA 4EEXA 2VHZA 1OAAA 4L4SA 1PJLA 4RV9A 1PJCA 2E49A 3L6DA 4WK6A 3LYLA 1TB4A 1EE2A 2HO5A 3FBTA 1XEAA 4CLRA 4YAKA 2X0IA 3EK2A 5EL0A 1DO8A 4YTEA 4CMJA 2Q4EA 3BMNB 3BMNA 2PGJA 2NTVA 3ZHBA 7ADHA 5L7YA 2ZCVA 1IPEA 4PLWA 4E3ZA 4BMNA 3RWBA 4J16A 1VLLA 4DYDA 5B4TA 1R4NB 4J7UA 1MC5A 2VZ9A 1XLTA 2DBQA 3AI3A 1XQ1A 3M6IA 3W8FA 4YT4A 2Q4BA 3PLRA 1T25A 4B4VA 4CR8A 3BMOB 1PGJA 3KSZO 4H15A 3VPHA 1IY8A 4LSWA 2JHGA 3MEQA 1EQ2A 4J49A 1AN9A 1BW9B 1NVTA 2BGMA 3RUEA 1GTMA 4WJZA 4J3FA 3JYLA 4CLHA 5HA5A 1PQPA 3UF0A 2NM0A 5KJ6A 4GX1A 3GRPA 4XGIA 3DOJA 3E03A 4IDAA 4BO4A 1LLUA 2ZB3A 3KEOA 3U4IA 4II3A 5BQFA 4BNUA 1P1JA 5AVOA 5IN5A 4Z0PA 2I66A 4RPGA 2NNLD 4NR0A 1HSZA 1U8FO 3C1AA 3VH1A 3RSHA 2X9GA 3LT2A 3W8EA 1O95A 3ZWBA 2E4AA 5JDCC 4MIOA 3VH4A 3IJPA 1D1SA 4D43A 3H9QA 5TT1A 1EFKA 2PLAA 1R0SA 2FR1A 5KKAA 3JQAB 2O3RA 8ADHA 1CEQA 1XR3A 3IDSA 3OBBA 4CMBA 4M54A 3KYDA 4RORA 1NHWA 3A4VA 1G6KA 4F45A 4TZTA 3R3SA 4GBJA 3JQ7B 4IXTA 3UHAA 4TWRA 4IQGA 3V5NA 4M86A 3A06A 3ITDA 5I7EA 1NR7A 1JTVA 1YOVB 3NKLA 4BNIA 2TMDA 1XSEA 1GAEO 4MVJP 1S6YA 5BSHA 3WIEA 3DHYA 4CV3A 5CG2A 3WGTA 3RC9A 2P4QA 4E5NA 3MWDB 3B1FA 3AOGA 1JU9A 4JK3A 4IY1A 1QXSA 1LDMA 3QIVA 1HDZA 1BDMA 1QR6A 2Z1NA 4LRSB 3NJ4A 1NTOA 1KC1A 3JQEA 1LX6A 3RI3A 2H63A 5IXYA 1E6EA 5DBIA 4BNHA 5AQ1A 1ORRA 4IJVA 2WD7B 1ZJZA 2E6UX 4NBUA 4FJ2A 2Y0EA 4XDZA 5IF3A 1NPDA 5T6BA 3H2SA 4XYEA 3CZMA 2OFPA 5COBA 3TZKA 4CM6A 3DB2A 2VWQA 1DIAA 1OBFO 1UZMA 3L4BA 1NQOA 2C54A 5F5LA 1MA0A 1Y8RB 1EFLA 3KHUA 3Q11A 4WEQA 4PLZA 4E33A 1P1KA 3JD0A 1SB9A 2C7VA 1ISJA 1PS8A 3ZW8A 4RPKA 2X9VA 4BIIA 5KJ1A 1P1IA 5JC8A 2G17A 1DBVO 3QWFA 2W2LA 4U8GA 4CLOB 5JMWA 3ZWXA 2Z95A 2PKRA 1I5RA 3BXXA 2HQ1A 2DTEA 5KIAA 3I1JA 3S2GA 1C14A 3C24A 3HUDA 4XJTA 1IE3A 5TJ9A 4J1TA 1EZ4A 4CL3A 3DZHA 3MJCA 3LLSA 3Q1LA 3GGOA 1R6DA 4FOSA 3U3XA 1SBYA 2POQX 1I2CA 4IIVA 1LC3A 3F9IA 3MOIA 5JCJD 4FCCA 1LC0A 3PJEA 1V3TA 5AXCA 1VSUA 4ALNA 4GMFA 1ENZA 3PFFA 2DAPA 3UFXA 3JQFC 3T4EA 1JKIA 1PX0A 4PLGA 5AOVA 4EZBA 2HK7A 4IQ8A 4RPLA 2FWMX 2O3UA 2OO5A 2QYTA 4RLSA 4RO0A 1K0UA 1CQJA 1BG6A 1PQUA 1HDGO 1X7DA 2JFGA 2NWQA 3JD1A 3LLVA 3AI2A 1HE5A 1K6IA 3GNTA 3GA0A 1JW9B 4KP7A 3OF2A 3PZRA 1SOVA 3TWOA 5I9NA 1AHHA 3NV9A 4HX5A 2DFVA 3OQ6A 2AQHA 2DTXA 1QMGA 3OICA 3QHAA 5I7FA 3WWZA 3AM3A 1BVUA 3ETGA 4DBZA 4G65A 3F46A 1GU7A 3FNHA 4YJFA 2QZZA 3PRJA 4IBOA 4NFHA 2CVZA 4Q9NA 5TF4A 4RVFA 3WYBA 4HADA 4RVSA 5FFFA 4HFRA 4TVBA 3ZNQA 1YB1A 3NT5A 4NK4A 4NJOA 4PLPA 2C5AA 3PJDA 4P4NA 1O94A 4QFDA 4CMAA 4RPJA 4A7PA 3KBOA 4ALKA 3DMTA 2D0IA 3DQPA 5A5FA 1RM3A 1UH5A 2D1YA 3WG9A 4WNCA 2YQ5A 2O7QA 1QV6A 3UCXA 2V65A 5TQVA 1ZFNA 3NYWA 4B7CA 3K30A 4WASA 3LF1A 4CLXA 1WW8A 3WBFA 2VT2A 3KB6A 3E5RA 1NFRA 3DTTA 4WOJA 5KCZA 2W2KA 2GN8A 3F5QA 1ISGA 2W2KB 2WJPA 5G0VA 1E6WA 1ONNA 3PQEA 3V1TC 4RF3A 1YVEI 3ASVA 2B35A 2H6EA 4IDFA 5U1PA 5THQA 3K73O 4QO8A 1G1AA 3H4VA 5DP2A 1HYEA 1PGPA 1KY4A 3OFSA 4XYBA 5JPIA 3QP9A 4CLRB 4YPOA 4HFNA 3KSDO 4L4RA 3GPDG 4N5LA 1EK5A 2NACA 1GZ3A 1ONOA 3PHLA 3HJAA 4CMIB 1BXZA 3ROKA 1IYZA 5FI3A 1W6UA 1RJWA 4D7AA 2EW2A 3BTOA 2IDZA 1HZZA 4E5KA 1GZ6A 2OGUA 3QLJA 3U4HA 4BGUA 2H5LA 1KOLA 1KETA 3GN2A 4NBRA 5HRUA 4PLTA 5ENDA 2J5KA 2PZJA 4XYMA 4BNXA 4RF4A 1ZK4A 1R37A 1HWYA 1HTBA 4RPHA 5JCJA 1BTOA 3HB4X 2J8ZA 5C3MA 4FFLA 1OC4A 3WTCA 5JDIC 4IJWA 3DR3A 2B36A 3FNGA 1B8UA 4WPGA 2D5CA 3EGOA 1FMCA 3EVTA 4B3IA 5CFZA 4I9UA 4J7CA 1Q0HA 2D2IA 2C0CA 1Q2XA 2CUKA 9LDTA 1E1NA 4IDDA 3IL2A 4U0KA 2B83A 3PHGA 1XCBA 1EE9A 1DAPA 2AMFA 1VJTA 1UXHA 4NDNE 3DZKA 1KBZA 1CDOA 4UVHA 2DU8A 2AE1A 1U3VA 4FS3A 3PIDA 2PZLA 3MZ0A 2JCXA 3S55A 3CE6A 3NT4A 1A71A 2J5RA 5JFOA 1NAIA 3I9KA 4XJSA 1DRUA 1W8DA 5TX7A 1Y9AA 1SO8A 2CDCA 4S1VA 3EZLA 3L07A 4MDHA 4QTZA 4R3NA 4UUNA 4BKRA 1IHYA 2VUUA 1XYGA 1R0LA 1A9YA 1ISFA 3BTUA 3P2YA 2HJSA 2I3AA 4UEKA 4D42A 3IKVA 3D64A 3RC2A 2I65A 1P74A 5TC4A 4G5HA 4FGWA 4WLEA 3K2EA 2NUAA 4L4XA 3DBVO 1XWFA 1DC5A 3OJLA 2PNFA 3JQDA 2JAHA 2NTNA 2RHCA 3RU7A 1DJNA 1NAHA 4XR9A 3NAQA 3JQ6A 4MVJI 3FPCA 3HN2A 2AW5A 5ENVA 1TLTA 4HV4A 4XA8A 5JCXA 1DSSG 9LDBA 1N1GA 3HDYA 4OQYA 4JBHA 2JAPA 2AG5A 3KSUA 1XDWA 4WECA 5JE8A 4L74A 1KVRA 5AXBA 3RKRA 4ZQGA 1GADO 2GERA 1BHSA 1NQAO 1Y1PA 3JQBA 3O26A 4BNJA 5BNIA 5L51A 1H94A 3PK0A 3W4IA 2IYPA 1H9BA 3DTYA 4HXYA 2VQ3A 1OC2A 4I5GA 3RJ5A 1SOWA 4A73A 3GEDA 5I7VA 4W4TA 1PZHA 1DRWA 1YQGA 5H81A 1NVMB 2OXIA 1MGOA 4IZHA 3KVOA 3IC5A 3H6KA 4BB5A 4ZQEA 5EN4A 3JTMA 2RCYA 1K5HA 1ZW1A 4NIMA 2BI8A 4ND1A 3RKUA 4KWHA 5A9TA 3GGGA 1J49A 3WGZA 3PLNA 1NPYA 2O2SA 3VH2A 4HNGA 3GDFA 3LSYA 5KJFA 5AXAA 2PV7A 2EP5A 1H6BA 5G0SA 3MWEB 5ITWA 1P9LA 4LVUA 4BGEA 4D79A 1F0YA 1QYCA 1NWCA 4YJHA 3KTDA 3U4DA 1ISHA 4QXMA 4IZIA 3DBHB 4XD2A 3K96A 3IS3A 1I2ZA 3KYCA 4CM1A 2VRBA 1IHXA 4MP3A 1ULSA 2GYYA 3H9JA 1H9AA 1T4DA 4U7WA 3GFBA 2YHIB 2NVBA 3QE3A 4CMCA 4E13A 1U8XX 3WB9A 3WJ7A 4PLYA 2WYUA 5TLSA 2GDZA 2XXBA 3OHSX 3AFNA 5T67A 4BKOA 1YE3A 3H5NA 4J4HA 4OXNA 2EKQA 2X0RA 4R1UA 3ZHZA 2DPHA 3KETA 1YONA 2PR2A 1YB5A 1YBAA 3U0BA 3AU9A 3ETDA 4L0QA 1X0XA 2J3KA 4IGFA 5JSFA 1BXKA 4KUGA 5FEUA 3NJ8A 2E82A 2Y93A 1RYDA 2Y1FA 1ONPA 2FZEA 4KOAA 3C8MA 3BAZA 3U5TA 2B0JA 2WMDA 2DPGA 3CSDA 4B8WA 4B7UA 4EYEA 3PYLA 1N7GA 3GT0A 1O0SA 1LEHA 4OGWA 3SXPA 4O1MA 2JD2A 3CMCO 2NLOA 3AUUA 4IM7A 3TSCA 4R9RA 1UDCA 5JAQA 4NQZA 5F1KA 3SBOA 4MPDA 4TROA 5LC1A 5MDHA 2CY0A 2AE2A 1A7KA 2DQ4A 3WNVA 3IJRA 2NU8A 4XQCA 5L4LA 4OXKA 1QSGA 5H83A 1HYHA 3CIFA 3RASA 5EERA 3L6OO 4UAGA 2H9IA 5F21A 2YV1A 3Q2IA 2FSSA 2OP1A 2AG8A 5IFLA 4OL9A 3PWZA 1UJMA 4EUHA 5DULA 2VOJA 3C1OA 1WLYA 5GZ3A 2YW9A 1LSSA 1VKNA 1N9GA 4OQZA 4WLVA 1MG5A 4YR9A 4CQMB 3I4FA 2DFDA 1PQWA 3LF2A 2QHXA 4FPXA 5IDYA 1U4SA 4N5MA 2WTBA 4BUCA 4ZICA 3UUWA 1Z75A 4GI2A 4BO7A 4JQCA 2IE0A 2Z5LA 2RBEA 4R16A 3DZFA 1PL6A 2NV6A 1ZO8A 4PLHA 2G76A 4RQUA 2BGLA 3ONDA 1KEPA 1DFHA 4P4LA 5CEEA 1ZSVA 1E3SA 1P45A 4XB2A 2UUOA 3LU1A 4FDAA 4CV0A 4K6CA 4MINA 3RBVA 2FZWA 4UVIA 3DHEA 4OOFA 1PU2A 4YAEA 1MV8A 3I6IA 3ABIA 3M2TA 3O9ZA 1Y8RA 3ONEA 2JJYA 4BMVA 1IOLA 3ZWCA 2I67A 1VRWA 4Q3AA 5TGDA 3FHLA 4Z9YA 4JCOA 3TL3A 4TSKA 4GVLA 1HE4A 5EPOA 4XRRA 3SC4A 2Q2QA 4K1LA 1DOHA 4CLOA 3EAGA 1EEHA 1YS4A 5AYVA 4D3SA 4WCFB 5KJEA 4DMLA 1E92A 4WCFC 3ZNOA 3VPXA 3ZV6A 4ALLA 2IZZA 3D4NA 5BSGA 1Z74A 4DQUA 1JVBA 4E31A 4IPTA 3OIGA 1NX6A 4BQPA 4HUJA 3DBHA 2HSDA 4XQEA 3F1LA 4BS9A 1WMBA 1U9JA 4P22A 5KOIA 2ZYAA 3GDGA 2PD4A 3TF5A 3B70A 1YXMA 2O4UX 2PGLA 2FHSA 3OJEA 4I5FA 4R1NA 2YV3A 3EW7A 1AGNA 5ITVA 3JQCA 5K6AA 3V2HA 1E5QA 2HLPA 3OIFA 5A9SB 3DEYX 1GYPA 1PJ2A 1UP6A 2YDXA 5JDIA 4YACA 4PLFA 3VPFA 2JD0A 4UUOA 5DT9A 2AHRA 1GQQA 2J3JA 2QW8A 2PFGA 1CQIA 3FI9A 4G81A 5L53A 4NH4A 1NNUA 3EHEA 5A9RA 4MO2A 3HNPA 1OMOA 1OOEA 2EGGA 3GNQA 4OIMA 3GF4A 4INAA 2VRCD 5JO0A 1PR9A 3ZN2A 3ZV5A 4OOEA 4CMEC 3FNEA 3QQPA 4IMRA 4DLBA 1WZIA 1YH3A 3S2IA 4CUZA 3PYMA 1GQ2A 1WDLA 3UOGA 4FBGA 3G79A 4GWGA 4CL8A 3SC6A 1NPTO 3DDNA 4GX0A 4QSMA 4BNVA 2GF2A 3E9QA 1LLQA 1U3UA 3RQSA 4EEZA 3PQFA 1S7CA 3H3FA 3KOUA 2VHWA 2ZCUA 3V2UA 4BKPA 2OHXA 1C0IA 4CV2A 4AL4A 3ZWMA 1A4IA 1B0AA 1PGQA 1VL8A 2W98A 1RM0A 1XQ6A 4UREA 3GG2A 3BTSA 4UEOA 1BSVA 2NQTA 2AEMA 4FD3A 2X58A 3UKOA 4D41A 3RUFA 3V1YA 3W8DA 4AICA 3M2PA 4LVCA 1BMDA 4BNWA 1G0OA 3GVCA 1IULA 1DEHA 3ASUA 2EJWA 1MP0A 3I9JA 4PN3A 1EVJA 1IB6A 2YQ4A 4TKLA 1OI7A 3VZPA 2X7HA 1E7SA 3BMOA 5EJ2A 2IZ0A 3DL2A 4J1NA 2HDHA 5B12A 1RM4A 1I3NA 4LSMA 1KVTA 2RHRA 4CM9D 1C3VA 1DC6A 1K6JA 2GGSA 1HDOA 4W9NA 3RIHA 1DC4A 4JJFA 1ENYA 3PP8A 3VC7A 3H65A 4DQVA 4EGFA 8LDHA 2AQIA 3PGJA 2HK8A 3DMYA 3GFGA 4E5PA 1KVSA 3BTVA 1YJ8A 2GN4A 1YBVA 3JD2A 3PIIA 4DWVA 2UUPA 6LDHA 1T1SA 4MKRA 5K9ZA 4R4JA 3KO8A 5HTOA 4RVGA 4NBWA 4H16A 1LSJA 2ZK7A 2O23A 1V6AA 2BRUA 4DC1A 5HWSA 5JY1A 1YJQA 2WSBA 3RD5A 1W73A 2GZ2A 2PD3A 3MJ4A 3BZUA 3U4CA 4WKGA 2CNBA 2X86A 4MKXA 4AJ2A 3KUXA 3QVTA 1L7EA 1CF2O 1SPXA 1YQDA 5C7IO 4AVYA 3GH3A 4Q3EA 3JYNA 1WPQA 4YEDA 4OMUA 4O6VA 1E0DA 4DREA 4PLCA 4J91A 2Q3EA 3JQGA 3R1IA 2RAFA 4N54A 1C1DA 2Y1GA 2FY8A 5BSFA 1DIBA 5L9AA 1C1XB 4NU6A 4UVEA 4IQ0A 3TJRA 2PZKA 1UAYA 3UH1A 1V3VA 1M2WA 1ZUD1 4Y6RA 3QWHA 1KEVA 2EJVA 3E8XA 3WJAA 4A26A 3QV1A 1D3AA 1DAOA 5DN9A 3HN7A 2PGDA 3R3JA 1ARZA 2YFQA 1KERA 1EDOA 3OQBA 4I08A 1I3KA 2NQ8A 1U5AA 2E48A 3AWDA 3ROPA 3VKUA 4RL6A 2Y99A 4U5QA 3JQGB 1HLPA 4S3MA 4RVHA 3OSUA 1ZCJA 2OMEA 2ZJ0A 2Z1MA 1P31A 2A9FA 2G5CA 3MJTA 4P8RA 1CERA 1DRVA 3GVPA 1LU9A 2VN8A 1ZSYA 4FC6A 4XYLA 3D1LA 4PG7A 1MLDA 2I76A 2GR9A 4CM8B 3VPGA 1P1HA 4F6LA 3ZGYA 1ZMOA 3CINA 3BHMA 1ZEMA 4NG5A 1QYDA 2Q45A 3ZCXA 4J9VA 1CRWG 5I7SA 1Q7CA 2Y67A 1QG6A 3RJ9A 4WGGA 2A4KA 3RBZA 3CPSA 3OIDA 1E1LA 1VPDA 1FF9A 4WLOA 1CETA 3VVBA 4FW8A 1Y6JA 4EJMA 2SCUA 3I9MA 2NTJA 4GWKA 2QQ5A 1JKJA 1B8VA 3MJVA 1TVEA 3ZH2A 1WZEA 2FR8A 2ZB4A 4MVJE 4XX0A 5FF9A 4JBGA 5JLAA 1WMAA 2P91A 1J4AA 2Y1OA 4BNKA 1LDBA 1SEVA 3DBLB 1A27A 1RWBA 5I9LA 1ZJYA
chains in the Genus database with same CATH superfamily
3LJKA 5ER6A 4NMMA 1R5OA 4ZU1X 4IDGA 1L7NA 3HYTA 5EJIA 4BJ1A 4TYMA 1RQGA 4R6WA 4TQ9A 1CJVC 4K81B 1HNNA 3G2LA 1QKIA 1TJNA 4Y9DA 3BIXA 4IEEA 1TA9A 1XHEA 4YBZA 1JDUA 2XTJA 1MJHA 2GPBA 2WM9B 3CG0A 4GAEA 1ZMRA 4L76A 3K0CA 4P9NA 4HDNB 4QQRA 2YJZA 4IUYA 3VVCA 5DXAA 4JV5B 3DEJA 5FBHA 2P9YA 4YQFA 4IW3B 1QQAA 1SRRA 1N2IA 1YUNA 1Y5RA 4NWIA 5G3ZA 3ZCSA 2HYIC 1ECFA 3EBLA 5IVKA 3FZYA 2PUAA 1ZMXA 5GY7A 4EHBA 1VL6A 4LQCA 4J2TA 2IUUA 1ID1A 1MB9A 2P7IA 4XOIA 3TRDA 3PUHA 3O03A 1CR1A 2K4MA 2P3LA 3TUJC 5CVTA 4RACA 2JH8A 3N58A 2H0QA 2ZM6B 5DBOA 3K0HA 3VVMA 1OXKB 1PL8A 3TQHA 1JI0A 3AMVA 4Q3NA 2J32A 1G38A 2RIRA 2ZSHA 3JAKB 2NUBA 4GQIA 3PEYA 3GHHA 4DKJA 1PHRA 1ZVMA 3NAMA 1YA8A 4Y2YA 2G07A 3KYBA 5ALHA 1S3IA 3B12A 3UM9A 3ZBQA 5IT9A 1NUAA 3ANNA 5LZ9A 4OU4A 1RCFA 1UFOA 1HF3A 7MHTA 1JFSA 4FYJA 2CZQA 4E6PA 3NUZA 1A76A 2C1EA 3QU4A 3AM5A 4FOLA 5B6PA 4I8XA 2I6XA 2RCNA 4HLCA 2GJ8A 2O7SA 3GLFA 4CR6A 4BFSA 1N3YA 4DJFC 1T24A 2VAXA 2F43B 5K45A 2VYVA 2QTZA 4NI5A 2AHOA 4P3NA 5JBNA 3HZHA 4ZQFA 2FPSA 2FETA 2COEA 1ESDA 2XF8A 5JQGF 4FNOA 2IZ1A 4TSFD 2DQZA 2W6CX 5BVHB 1F2DA 3FFXA 4HD8A 3G9QA 4K8OA 5KWVA 4C2UA 1FDTA 2BAGA 2XKJE 4ZVUA 2ERYA 3RU9A 2PWAA 3W2EA 2HZBA 1X1RA 1AV6A 1XZPA 3JS5A 1Z63A 5LWQA 4LMPA 1FVOA 1PEDA 2I9PA 2J0UA 5GWXA 3RG2A 5CJPA 4MAMA 2PO5A 2CZCA 1K4KA 4J2OA 4B6SA 4IZOA 3OZEA 4HZIA 1X3LA 4ZODA 1CY1A 2VLIA 2FZ5A 1Q0QA 3BUSA 1JE0A 2GTPA 4TVKA 1AKRA 2O8VA 2R3SA 4B6OA 3VYUB 5LYJF 3FDXA 2RB4A 5BR7A 3B78A 1S2LA 1H2HA 1XQYA 2GBLA 2XZPA 4QA9A 3W5IA 2WM2A 3ZI0A 5JZMA 5LNK1 3W6ZA 3TLCA 4DTCA 5KOYA 5H82A 4DVJA 1K8QA 4AKEA 1ICIA 1P9NA 2J7PA 4D4IA 2YMMA 2NZXA 4MNTA 5ALXA 1JX6A 1XTJA 3VR5D 3K9FC 3MPUA 3L4BC 4KQFA 4RLFA 2C7BA 5GONB 1NW5A 4H1WA 1K4YA 2QN2A 3PNYA 2XPCA 2HJGA 1J24A 3RQIA 1VHDA 1E1KA 3UT5A 3OX3A 3LBNA 3NHZA 4OY3A 2XAAA 2WPDA 1JWAB 1MBZA 2IPNA 4LMRA 4LHEA 4DPKA 1XMVA 3D43A 2FFBA 1TZMA 4JA2A 5GJCA 1UPBA 5TRTA 1TO1E 3GH1A 1V1MA 4F8JA 2X23A 3PJRA 1B43A 1FFGA 3H6HA 1N9GB 2QLTA 1M6WA 4OATA 4QYIB 3ORQA 2ZVQX 2DCUA 2BEVA 3PR2B 4J0QA 4OH1A 2PMDA 1A98A 1SBIA 1N5RA 5K51A 2PYIA 3THSA 4GZMA 3GC6A 3ZE9A 1DO2A 2FSVA 5B30A 1Y3IA 1DAKA 2QTHA 2WTXA 3KRTA 1TC2A 3L7BA 1CUZA 2B9VA 3QEOA 3SZUA 3AKDA 2GCOA 3AEYA 1R50A 3FJOA 4UHHA 2YTZA 4DTIA 3ICEA 2A30A 3IE2A 2ZUEA 4JT2A 2BYTA 5EZYB 4YMIA 3VKVA 4ARZA 1BMFD 2R85A 2HGZA 4B33A 1U6KA 3ZU6A 4F9TA 5HFNA 3U7FB 1T1RA 5AMXA 2VBFA 1CP2A 3R44A 2XQIA 5EI5A 3TD2A 2E5WA 4NXMB 4GP7A 3DZJA 1TVKB 1K7CA 4GKJB 1XI2A 1QRSA 1PK7A 2CNWD 1S2DA 4FZVA 4O1IA 3REQB 2PX6A 3UJHA 1AQJA 3Q3GE 1XRSB 2OHHA 2GO1A 4LMBA 1KSJA 1JQAA 4IR7A 1P72A 1XOIA 2EJTA 3L7LA 4YGXB 3WI7A 3JSXA 3WNZA 3B52X 3VNBA 2OK7A 2ABWA 4LECA 3TLEA 4K6KA 1FCJA 4KV7A 5EQJB 4ENSA 4IXMA 3OWXA 3ZHQA 5COAA 1J23A 2JFXA 1FFYA 2Y68A 2UZ1B 4UM9D 3FWPA 2XLCA 4HAYA 4OVKA 4B71A 3SBEA 3RS9A 3P52A 3IT2A 4KXLA 3E7DA 3FBGA 4PRLA 2DUNA 4Q00A 4IFBA 1P62B 2CFCA 2FHPA 2ZYUX 3CUVA 2FI1A 3EF0A 3QLVA 5LQRA 1Z17A 4B2PA 3HE3A 1HE2A 1IATA 2XGMA 5JG7A 5TQ0A 1ZH6A 4KIWA 1X1QA 3G82C 1UM8A 2DOKA 2HTFA 1A5TA 4GO1A 3M1LA 5E3IA 1RVV1 4NU5A 1JFLA 3HCWA 1QIDA 5AO9A 2V0NA 3WY9A 4DQLA 3RVJA 5C8ZA 1Y7PA 2ZBEA 1SXQA 4GIBA 1QBGA 1Y6QA 1G7CA 2Z3WA 2NZWA 2GK3A 2IS4A 5ED0A 1TJ3A 3O2QB 3P1JA 1OFIA 3NIGB 4FZ3A 4BFCA 3EDMA 1XCPA 1YULA 1WZUA 2CDRA 2CL5A 2Q5JA 5H9WA 5AM3A 4N9WA 2FPIB 1W4CA 1YDWA 1ZVKA 2FPIA 4TXMA 5HKOA 5HQTA 1M5RA 4HLUC 4WCFA 1E1MA 3HGTA 4JEHA 1C7IA 4CHGA 1KZ4A 4JROA 2BLLA 1CLUA 1VPLA 2MHCA 3I8SA 2CVFA 4XB6B 2R8ZA 4Y0VA 3VPAA 2FOIA 1JZTA 3ZNNA 2ESRA 1GR1A 1XZCA 3CO0S 2F17A 3DDZX 1VB3A 3NWEA 3AP3A 1X7WB 2A0WA 3KKOA 1X7WA 3QPWA 4ID3A 4MVCA 2GM5A 5TSDA 3IA2A 1EXVA 1JHOA 3SDZA 4BFYA 5FHQA 2BW0A 3QVKA 1Z2PX 1K98A 2W6MA 2PJRA 2RAVA 3D5EA 1XA4A 1F6WA 4PQEA 1Z06A 2CWWA 4BVLA 3I9FA 4YUAA 3QYAA 1P77A 3NHJA 3W7VA 1WTAA 2OUIA 2RARA 3P9KA 2IIVA 3IPLA 4KQ1A 4QGFA 5FXMA 1WAMA 1D6SA 5TQ0B 1FU7A 3VOTA 2WT4A 2MTBA 3Q0IA 5BOSA 1GPNA 3LWBA 1E66A 3B38A 4QYMA 1YGYA 3RRFA 4Y8VA 1SBTA 4FSDA 5JWOA 1NJFA 4Z0TA 2NSDA 3OLZA 4TWZA 3O1JC 1M0WA 3SF8A 1UCFA 2O1WA 3DC7A 4JUBA 5CEJA 4IDEA 4OGFA 2XVMA 3U4MA 2JIMA 4FFNA 2JLBA 1IZYA 2BDUA 4EHLA 2R0QC 1W96A 3GHYA 2VAMA 2XIQA 5M04A 1XHLA 1CUEA 4C7JA 1EEXB 5KVQA 2YRFA 4F5YA 5ILQA 2Y92A 3VZQA 2X4GA 2GXUA 4NABA 5A9SA 2XMPA 2EEPA 3GGCA 2CUZA 5L3ZA 3T7KA 1NZJA 5JH7F 1P91A 3BAFA 1M1NB 1OB2A 4OHXA 3ULKA 1N5DA 4I36A 1VFNA 2RBKA 4J1JA 2PSFA 3BCRA 5CPBA 2PUDA 5EIAA 3FCUB 3B9PA 3FYDA 3NVAA 3TSOA 1RWNA 3E58A 1KAGA 3NETA 3RANA 3MXTA 5JZ9A 5LQAA 2Z09A 4FHZA 3L82B 4LPKA 1POWA 4QUKA 3WL4A 2IXDA 1IG0A 3A14A 3A3KA 3DKKA 1T5BA 4HB4A 4KH0A 1QORA 1RHJA 3FW1A 2Z6UA 1ORHA 3GWZA 1SVIA 5A5VA 2DBYA 1SCIA 1U3CA 3CEAA 3VNVA 3FPSA 4MI6A 3BWEA 2DHQA 2VK2A 1WQ1R 1NJ1A 1JXOA 4E11A 3NTRA 2R48A 3PHHA 1AO3A 4AJ1A 2DR0A 4X66B 2PUBA 5K0BA 2G08A 3ZV4A 1UJ5A 2X42A 4EI9A 1K7EB 4GLLA 4AJKA 1KFEB 3NVMB 5FYQA 2W2MA 4PG8A 1P2GA 1QTIA 1N0WA 2HA6A 2ROQA 3HDVA 3AERB 3B6KA 1E2IA 1DDOA 1U81A 3LUHA 3QFHA 1EXWA 2VUSA 2F3RA 4B31A 4JFRA 1UBSB 3CNQS 4PONA 1MA3A 3QFRA 4L8FA 3QPVA 3RHSA 3OZGA 1S2GA 2JIDA 1SIOA 2OG1A 5DIZA 1G5TA 4HGRA 1JQLB 1KO7A 2IEBA 3A9VA 3NDPA 5ES3A 1CEYA 3P0RA 4WXMA 1M2OB 2EHDA 1M2OA 3ENVA 2QTNA 3DBRA 5FPHA 4L5AA 4LVOA 4IYJA 1JSCA 3SX4A 3K5PA 5JCPA 1F0NA 1U7ZA 1D2NA 1H4SA 2WYIA 3P0FA 4W5WA 1HTTA 4RZQA 3SXUB 3ZOZA 4AJPA 1SC9A 3AWIA 4PZYA 2B4TO 2XQKA 4B7ZA 5BMVB 2ECKA 4H17A 4BE9A 1EK6A 4PZDA 1BFUA 2G9ZA 5A06A 4OQXA 3DZDA 4LHZA 1VJDA 4W5RA 1YMQA 4GOKA 4IOMA 2G1KA 1OYWA 4CKXA 1NOKA 4FFBA 4ROSA 4XWWA 2M6LA 1F5NA 5G0TA 2AJDA 2HI0A 3DTVB 3I6QA 4A0GA 4KPUA 3DXXA 4NJEB 3BDAA 1CUBA 4M1EA 1VI6A 2I4RA 3KOYA 4MMXB 4NQRA 1GNVA 1GXSA 3OLCX 3AIOA 4C7VA 1G8JA 1HE3A 2WWVD 5J2TA 4KR6A 4LKOA 2QR5A 4QPJC 2D59A 4EJ6A 3T3OA 2G1AA 3OU7A 4R2XA 3UICA 1TC1A 1RXSA 4RHUA 2XUDA 5CU7A 4Z4EA 2IUFA 1QE0A 4PGMA 1K0FA 2BSAA 1JS1X 2F59A 3OZTA 2XGGA 2H0AA 3DL4A 4B80A 4KO1S 4C30A 2GYWA 3FPGA 4CMHA 3TDKA 1L4EA 3EQ7A 4BVHA 3ORFA 2R86A 5TY0A 3GUUA 4AZ3A 4TWBA 1X7GA 4UJ3A 3GQBA 4ZQCB 1Q1NA 3RIGA 1QFJA 3HVRA 1Z82A 4B3BA 4B3MB 4U9IS 1RQLA 1CZLA 1K6MA 3CZCA 4MLPA 4ZIRB 3DOFA 1TDJA 2WAAA 3DEFA 4UHBA 4KAFA 5DGIA 4US2R 1MT3A 2PVSA 3UWPA 4XGRA 2H7YA 2O14A 5B53A 5AW0A 1AE1A 3MTQA 3INRA 3Q1KA 1IZ9A 3CJRA 2W2QA 2IEAA 3PEEA 3QVOA 2C96A 3F6EX 3MINB 3FDZB 4IICA 4NPAA 3I9LA 4DA8A 4GOXA 4UNNA 3T4PA 4OSOA 2R4TA 3K4HA 4X71A 4C20A 4HWTA 1VPVA 4UU7A 2O2YA 4UEWA 1BRMA 1OTHA 1DMRA 2WHEA 3AFMA 3NOVA 2FUNB 4JJAA 4QLBA 4Z1MA 1F8YA 1LUAA 3USZA 3O8OB 3PHJA 3T3HA 4S05A 1I30A 2PFSA 1BE8A 4JB2A 4RE5A 5DI9A 2K5UA 2M32A 2CF6A 2P77A 4JJGA 5TQ2B 2CV2A 1H42A 1R8YA 2QE7A 3OJWA 3T7JA 3RVMA 4B8YA 3GFOA 4P0PB 2ISCA 2WSMA 4JLVA 1P8AA 4FNAA 2RKOA 4KFCA 2GJAA 3AW9A 3D5TA 3QOFA 1VA5A 1I01A 4LIPD 2GPSA 6PFKA 2V59A 1NQ5A 4PYJA 1QHYA 4X0EA 1XA0A 4EVQA 4JQYA 2YINC 4RS4A 1X2EA 3F9RA 1FFEA 1R2QA 4YCCA 2IJGX 1PIWA 3N28A 3HZRA 5AVUA 1YZHA 3UCFA 3HUUA 2V7QD 3P2IA 5ALIA 1G1MA 1WP4A 4C08A 4L27A 2VA8A 4AX4A 1V5WA 2VBIA 1X1AA 1TF7A 3CN9A 3ZXIA 3FYUB 4Z3KA 2IOFK 4IH9A 3HXOA 2ZWAA 2YV2A 1L8LA 2QSUA 3A3PA 4PCVA 2Q4RA 2ZB8A 2QLFA 1BW9A 4I5EA 2QVCA 4NEQA 2ZJZA 5EPUA 3UJNA 3N39C 2UYHA 1PYGA 5H7XA 2F8MA 1YOBA 3PC3A 3Q3IA 1C0LA 1P4HA 2EXXA 3DULA 3W5VA 3GCZA 2XNDA 4CM8A 4M8KA 3NDRA 2J4CA 4O63O 1ISRA 5JEDA 4QFBA 1BHO1 4JKIA 3LLMA 5J4LA 1SKAA 3I9OA 3PU6A 1T6XA 3EF3A 3IPXA 4GI3A 4RZ2A 3R7WA 3ZDZB 2CXTA 4NMWA 4WOKA 2CYCA 4NOMA 4BNDB 4JLWA 2PMFA 2VK1A 1I2AA 2IEGA 2OENG 3UH0A 4ZU3A 1OSNA 5ARBA 3I9V6 3JQQA 2BH9A 3EDCA 4G9BA 1JEOA 4DS3A 3QK7A 4XQ0A 4F4JA 3O8CA 2BF4A 1E1RD 1Y80A 1ABFA 3GLVA 3KKLA 3MTGA 4XB1A 2X5KO 4N3BA 1FFBA 3GCGA 4NX2A 5FO1A 3ZE1B 1L4LA 3ON5A 1T3ZA 2JJ2D 3L7NA 3HDHA 4RD1A 3C8DA 4LGVA 4LXYA 4WH0A 1EJ6A 3VR4H 3VKHA 3WLEA 5DHFA 3D9QX 3IGFA 1GT6A 2MMGA 2HU8A 3IIKA 3IT1A 1YVPA 3WB2A 2RK6A 3NNNA 4ZT6A 1GZ4A 4DMUB 3CF6R 3RU3A 4EA6A 3OOSA 4MULA 1DIGA 4AK9A 2FRXA 1XNRB 3R5FA 2Y0CA 2VNHA 3DT8A 1OKKA 1U65A 1U5BA 4O2LA 2ZROA 4FLFA 1Y34E 3ESZA 2AMYA 3BBLA 1DNPA 5FA6A 3UT0A 1JPUA 4Q7JB 3ZK9A 3FKSA 1UR5A 1Y9DA 2XWSA 1VLHA 3TVTA 4OLAA 3ABRB 1H0HA 3HCOA 2QLBA 1SC6A 1V45E 3OA2A 3PXDA 4LDPA 3F6CA 3D8BA 4BDSA 4Z49A 1WEKA 4ESHA 4YPVA 1XZGA 5LZ4A 1V8ZA 2X22A 1IHOA 1B6RA 2HPAA 3GP5A 2C9OA 2QTVB 3HVJA 4JR2A 2HHLA 1H4VB 3LDUA 4HWGA 3HI4A 2ETVA 4O4LA 1OX4B 4Z4QA 1OX4A 1RXCA 3VTAA 3O0TA 4G4IA 3UPDA 2VNAA 4RD0A 1GNSA 3LKVA 1T2UA 3OOEA 4KRGA 3Q9SA 2FE1A 5ERXA 3U7IA 4ZI2A 3IVGA 1A97A 4GZ3A 2EIHA 1Y7IA 3P19A 3OCXA 3QLUA 4MGZR 3H9EO 1B3BA 1XDZA 5A4JA 1GY8A 4MMYB 1KKUA 1MUUA 2DH5A 1CUIA 3CLRD 3OUTA 4KK4A 1QCZA 4AWAA 2WJ6A 3FIJA 3DYVA 3EZ7A 4C6RA 1O0BA 2VHTA 3KEQA 3MOSA 3PFNA 1QO0D 4MTCA 4YAIA 4LX8A 1NR5A 4WOPA 4LHYA 3MJDA 2BP7A 2WR8A 4F60A 1QIEA 4JY7A 5LPNA 4PVCA 5K8LA 1RWMA 2IZ7A 2C57A 2BGRA 3DAHA 3DD1A 521PA 1GCUA 1KMMA 1UFQA 3D8UA 4GXQA 1WF3A 1XKQA 5D3MB 3WRWA 1U11A 4CPDA 3U39A 1NBMD 3BD6A 1KVUA 1MEJA 3R6LA 4QEDA 4TMFA 4ZOLA 5EJ7A 2ATEA 1GL6A 2QMHA 2JH3A 3FTPA 4RL4A 5F5XA 5LU8A 4KO3S 1GQRA 5D6OA 4HL6A 3SIWA 3TCKA 4TRJA 1R0XA 4I50A 3THYB 2QMOA 2E4ZA 2BHRA 4ETIA 4JI8B 2IY7A 4FHEA 3RKSA 1KU0A 1Q7GA 3QFSA 4KL8S 4EHJA 3O4FA 1ANKA 4I2VA 2PTGA 4IRUB 1XVIA 1F2UB 1YZQA 2Y0PA 4ZI3A 2FSVC 4TRRA 3ZV7A 1A72A 5L7TA 2P8JA 4Y30A 1A0OA 1E7QA 1KYYA 1TFRA 5GONA 1BCSA 3JQ7A 2F9FA 3K72B 2QYHA 3U48A 2BKAA 4QE3A 1CZKA 1PJ8A 3UT5B 1YQ9A 1JYSA 2GN6A 2Q1SA 2BFEA 1Y9ZA 4ND4A 3V80A 4A8TA 3WIVA 1C9DB 1PZEA 3VSBA 3BK2A 1Z88A 5K3FA 1T0IA 4CV1A 1Z22A 4YJFB 3ZW7A 3TTXA 3FNRA 4LJ9A 4F72A 5LQNA 3TMKA 1JT9A 1OYOA 3PWTA 2CF5A 1B8OA 1QYVA 1R18A 3NHMA 4OM7A 1GG9A 3KAJA 3OX1A 2P6MA 1LLFA 2VQEB 5MGBA 4OG2A 4GU5A 4CJXA 3JQ9A 4K26A 4B32A 4RIFA 2G63A 4MP6A 2CLCX 4F2HA 1CHNA 5CITA 4BQQA 3ZYZA 4M1TA 1UBLS 4I3GA 3WB0A 4YV1A 4ZV7A 1M0SA 1XMSA 2OSVA 3JWHA 1PWHA 3N7UA 3TLXA 2ACVA 1SELA 1RBZA 3RG8A 2VF5X 5BV1A 5HW0A 2LUOA 1XNHA 1MD9A 5J1SB 3O82A 5B58C 3EXIB 1PQ4A 1FRZA 4DDKA 4BO5A 4G84A 1E79A 1T26A 4M38A 3O7MA 3VR5A 4RIIA 3HXTA 4IDPA 2C2HA 1PKXA 3SQNA 1XA3A 3TJMA 5EIEA 2ZI4A 1SUIA 5BYJA 1Q1BA 3L1HA 2A5LA 2BZSA 4WY2A 1R9GA 2FEWB 3G1WA 5CYGA 3X1KA 3RBXA 2NO1A 1AGRA 1TQ8A 1EH5A 3LZ6A 5AW8A 2BFEB 2C95A 2GETA 4PZEA 3E7FA 1BDBA 1K97A 3ND6A 1I4EB 2Z5FA 1HFKA 2YDYA 4KE6A 4Z9XA 4QUGA 3W5BA 3IR6A 1LDEA 1OWLA 4CM7A 3V4OA 3F1KA 2QNIA 5LJIA 2TSYB 4RTSA 1NQTA 2X5JO 5DTRA 2WG1A 1AIPA 3ZJUA 3ZDDA 1GA6A 2Q1TA 2DB3A 1ZIOA 2ZYDA 1R5BA 4HLUA 1XZ8A 2W4QA 2D13A 3BFXA 3CLSC 3Q7EA 1N6IA 3FFTA 3HG7A 4ZD6A 3WISA 1AK1A 2I1QA 3GJ6A 3G2OA 3GGPA 1OLXA 4AF8A 5JJLA 4MS1B 3RF7A 1OZGA 2D3TA 1KDZA 4PG5A 3CURA 1EK0A 1KAQA 2DFTA 1XFAA 1QRAA 2AK2A 3IBFA 1A8SA 4FCVA 2JG3A 4W5NA 1YBMA 4LFAB 2X7JA 3QVMA 4ND2A 4BAZA 4RTPA 1E2JA 2R66A 3B9RA 5L3RA 4YRBA 2WB2A 3OQNA 4QYSA 5I5EA 1I3CA 1SHTX 1IUOA 2OBNA 1S3GA 3JY6A 1GZ7A 4X7RA 1F6DA 1D9XA 3PI7A 3VU3A 3A3NA 2GA8A 2QL5A 2OZLB 1KP3A 3W5HA 3ABZA 1WUKS 3ZTTA 3A1EA 4KR2A 4HN4B 3GDWA 2WWHA 1XU7A 3W3ZB 5CDYA 4LF7B 3GEGA 3DAFA 2W6ID 4H35A 2JJ2A 4LNHA 4Z5XA 1F9EA 4XIJA 3B60A 3PL5A 5U4XA 1HA3A 1OT3A 2VJKA 3JZAA 4L78A 1T9CA 1JR3D 1UFRA 3R5SA 4F5DA 3UFXB 4C7OA 3GV0A 1EBBA 1GPYA 2HRQA 4BO6A 3UA4A 3NO4A 2IDJA 4Y9RA 4R2HA 3PCTA 2A0FA 3WXMA 1WCV1 3U13A 1KSHA 1NM5C 3RGGA 1EXDA 1HV8A 1WF6A 3ESDA 3QKUA 5JRZA 1I2MA 3QW2A 2WIFA 3O1LA 4HGYA 1VJ0A 4YQYA 3TD9A 3J80A 3TRIA 5IF9A 1Z2EA 3HO1A 4YALA 4BN5A 2C2WA 2QTLA 3PYXA 3Q7SA 2YHSA 4NYJQ 1F48A 2ZZNA 2PIDA 2A3RA 3AZQA 2YYAA 1PT5A 3FPBA 2DFLA 1DXYA 4P3KA 1HFWA 4E2XA 4Y9UA 4D25A 5JSZB 3UPTA 1Z3CA 4PIVA 3WLPA 2QUJA 2ZYVX 3B1WA 3MUOA 5CHEA 1IJBA 3JV7A 3HYNA 5KQSA 2C4TA 3QEAZ 3R4CA 2PQ0A 5A6SA 1RI2A 3H7IA 2BMAA 4QJ4A 4D4HA 2ZEJA 4EGAA 1OWPA 3HXKA 3IMEA 1U90A 1MAUA 3RUDA 2Z1DA 1NVKA 3EXEA 4KFSA 1BXGA 1GFWA 4RZIA 3KZOA 3UC5A 3LPCA 3OM8A 2HC9A 3D0OA 4MUJA 4UBJA 3E81A 4PLVA 4QXQA 4JLJA 1VSTA 4WK0B 3IP5A 1GYQA 1UJ2A 2P9HA 5SZIA 2BONA 5TDHA 4MP8A 2I54A 1VIMA 1SH7A 3HUFA 4DLLA 1UT6A 4BHHB 3K9BA 4MWCA 4TRNA 5J2TF 3OPQA 4QWWA 3VKWA 1FUEA 4F85A 2W4IA 4IFIA 5F23A 2JFUA 2R1TB 3R0IA 5AKHA 1E5XA 1CJMA 1P0MA 1YB2A 1NG1A 1WW3A 3OT4A 4G5QA 1EWYA 1MC8A 2HWXA 5H1YA 1PDVA 2OCBA 2YVLA 1KJIA 1LLCA 2WI8A 4ENQA 3P27A 4AB1A 1L2TA 5C4MA 4MDEA 3QMMA 4JIGA 1ZPDA 4LE2A 3W4KA 3WGMA 1FSSA 1M73E 3K6KA 3AFOA 5CVUA 5GM1A 2IYYA 1GUZA 4CEJB 2CFIA 2TYSB 3QPCA 4KWIA 1HMYA 4MJLA 3NHFA 2GPWA 8OHMA 2CB0A 1CY0A 5L45A 1QVWA 5ALSA 1W9MA 1UPFA 1NXOA 3I9NA 3OHPA 5DHRA 2IYNA 3I6MA 1VL2A 4WOBA 4ONEA 2Z8YM 3JVDA 3VHRA 3ZLUA 1U31A 3GLRA 5DX8A 1ZA1A 4G89A 3GVIA 4AKHA 2IEYA 1G6Q1 2Y6UA 4ESOA 4HDNA 2KLBA 3IPYA 5E7IA 2JI4A 5B3KA 4O3MA 2O1SA 4UUBA 5A2QA 3TPCA 2BM8A 4N0DA 4YJKA 1YSCA 1F38A 2TECE 1MU0A 1XYVA 5EHGA 3SE0A 4U2FA 3JZIA 4L3OA 5AI9A 4EGCB 1UKVY 2ZSEA 2PKWA 3R09A 5CYOA 3VYSB 2FAXA 2VHXA 2IHUA 4Q3DA 4Q19A 4URHA 1R9MA 1CULC 3DAPA 3F49S 1T5DX 2AL7A 3I32A 4O0LA 4ZPJA 1A5ZA 5EKTA 5BNFA 1FUKA 3T5DA 3PX2A 2EATA 5L4LA 1TAQA 2YVKA 2HBYA 1EJBA 1QFYA 4QNRA 3T9CA 3BCSA 2C7OA 4QFMA 1TYZA 3ACCA 4PWYA 4O4LB 5EZYF 1NMSA 1YDGA 5J47A 1Y5MA 1J25A 3BHJA 3EWIA 4MW4A 5DF1A 4C4YA 5J4KA 4DG9A 2IWRA 4LI3X 3QKIA 3TNJA 3G7NA 4JYAB 3DGEC 3E82A 4NVRA 3V34A 4ND6A 3KLMX 1ISMA 4X1YB 2OYRA 3U1BA 3MWLA 5DCWA 2P1DA 1AC5A 1EB9A 3ZZUA 3G2MA 4E2ZA 3VI3B 4CMKA 1NXQA 4XVHA 3AR7A 1JDPA 2NYRA 3VBCA 4BOYA 3GFQA 4JI2B 3A31A 3TQQA 1XVUA 1YIAA 3LZCA 3ZY3A 1M67A 1I4DD 5HGXA 4CKCB 1B0UA 4LXQA 4FR5A 4I9HA 3EH1A 2B78A 3FE2A 4RE6A 3I83A 1MW9X 5GM2A 4GX2A 4X1IB 3ZU3A 1TMOA 1YL7A 3DE7X 3S1SA 4OBBA 4UEJA 3PUJA 2X15A 1CIVA 1MGPA 1EVIA 2ARKA 2GAIA 2ORIA 3ND8A 4OQEA 4TTAA 5KQLA 4CEIB 2PV0A 3GDOA 4HH1A 3UAVA 5DXJA 5IVPA 3IMFA 3OP4A 4WGFA 1RJ9A 2ZJYA 1QTNA 1ZCBA 4HH3C 4MUIA 1B6GA 4H7PA 1Z18A 3NIBA 1FL9A 2V45A 1BD3A 1LQUA 3V33A 3ZZNA 3IDAA 2ECQA 1NULA 2X5XA 3ECCA 2VJMA 4W9NC 5BN4B 2XDYA 2QIPA 2ZIZA 3GEMA 5FWAA 1WUIS 4Z4CA 3KAPA 3R0XA 4LTNA 2D8MA 3CF0A 2UV8A 2XTNA 1FP1D 2VJQA 3KSRA 1U2PA 5TQ2A 3BGWA 2XUAA 2GASA 1LNQA 3A2NA 5C2JB 4DDVA 3IV9A 4URYR 3VA7A 2ANBA 4PIPA 4XM0A 4BU0A 5BMOA 1N6PA 2PH7A 2LTAA 4C4TA 5DIFA 1W0KA 2RH9B 1N0HA 1NATA 2WHPA 3I4CA 4KN8A 3ZGZA 1ZGJA 4PG4A 3RC1A 2GTIA 3O0DA 4OJTA 1D2HA 1PJTA 3EG5A 4QOSA 4Y3UA 4EPWA 2FZGA 1DFIA 3KHTA 3KXDA 4FEYA 2O7VA 1J8DA 2GB4A 1UBRS 2DPXA 2FB9A 4HWRA 5EINA 3TKYA 3TSWA 3ZDBA 4GL2A 1BE0A 1NRWA 1TECE 3IBTA 3R3WA 1L5LA 3NAZA 4ARCA 3GLKA 4OUDB 2RH5A 2VDNB 4NP6A 3G0HA 1NYRA 4I1RA 2JFWA 5F7XA 5HIAA 1N6RA 1PUIA 1SHZA 2J3QA 3GFFA 3BJEA 4FGLA 3GPLA 2AN9A 2GRAA 3VKGA 4PYRA 3TW8A 2BFCB 5K99A 1XRRA 1GDHA 5AVRA 5MN6A 3ZVNA 4LFBB 5BP7A 2JCSA 4IJSA 3BD7A 4O4LF 5KTRA 1CJCA 4DMGA 1N6LA 3F3MA 1JAIA 4MZXA 3WMGA 1HO3A 2PH3A 4M4SA 4JBIA 3EMBA 4BLTA 3DMPA 3ANSA 1ZW6A 4RHTA 4WERA 1IFXA 3NDJA 1LVHA 3RADC 2PBLA 1UC4B 2GLTA 1FDWA 2YIJA 4C7KA 1M83A 1OASA 3TZEA 4KXUA 4X63A 3COZA 4WLFA 3TPFA 1TYAE 2F3UA 3C8HA 4ZKDA 3CEMA 1SHLA 1UBCA 2NO4A 4N82A 2VUIB 3H3JA 4QC2A 1NLFA 1KY3A 1MIHA 2VNSA 1G9XA 3KOMA 2FX5A 4X00A 4BX0A 3GMDA 3LAWA 3PENA 3C97A 3ROXA 5KU1A 2HSEA 1M8PA 1Z5GA 3EDRA 4KI0A 4ZK6A 1PX2A 5TT0A 3E18A 4LKRA 3UXMA 3FPKA 1Z4OA 1XTQA 4XWYA 3OJFA 5KYVA 2CDAA 1LDYA 2IKQA 2PPLA 2VZEA 1P9OA 1QHIA 1JUDA 2GBGA 3DZIA 4NY1A 4F92B 2WAXA 1LRKA 1Q84A 1YUMA 1DKQA 1UEXC 1YR9A 4C78A 1HZJA 3VUFA 2IPMA 1GAQA 2O2IA 3T6KA 4MUBA 3JYPA 4DLNA 4DV5B 2CD7A 2OAP1 1RZVA 1GPJA 4ZOEA 4QQNA 3DOOA 1HYGA 3BORA 4QUDA 4BN4A 3KB8A 4PX9A 4AUEA 1QONA 4G9EA 2ZTVA 3OHMA 1SUFA 3E1GA 1RHUA 1IM2A 1IXSB 2J41A 2QKYA 3CUUA 2DR2A 5SY9A 2A5DA 2OECA 2HAEA 4M99A 4WMLA 1GPWB 2ZQZA 4QUJA 5DISB 4MVJD 1YAJA 2HHAA 2MYPA 2P7HA 4PSDA 3TOSA 1Z8HA 4CQMD 3WFJA 3WZMA 1JAYA 4JVSB 4X65B 1ULUA 3ZLAA 1EVYA 4TTSA 3KSBC 3NC0C 4QECA 4PO8A 1XAJA 4S1NA 1XVAA 2N75A 3LT5A 1R8JA 4RGYA 5M5BA 3NCTA 1MJNA 1D6MA 3R7BA 2ID7A 5ALNA 1V5FA 1C0PA 4MYUA 3TO5A 2HA2A 4NNJA 3WC4A 3HKCB 2G5TA 5M34A 1I3LA 1RP7A 3ASYA 1SOMA 2F55A 2BMWA 1KMIY 3KJGA 1CJSA 3WMXA 4AM8A 2Q50A 1QV7A 4HH4A 2VHCA 3R7FA 1TQ2A 3ZVKA 3RK1A 5CDHA 3AJ9A 3H05A 1ZRMA 3QSGA 1I10A 1NQXA 1UUFA 1PJ3A 1VJRA 3G3EA 2H11A 4A5OA 4J90A 4K9QA 5JCOC 5A7GA 3FROA 3GLUA 3GNSA 3MMXA 1L5KA 1G9TA 2O3QA 2Y66A 4DC0A 2PL1A 4YCDA 1YE5A 1XMPA 2XTAA 3OE7D 1G3QA 1I0LA 4FOOA 4NEGA 4F4CA 2DWQA 3FOEC 5CTAA 2O3TA 1CCWA 1HH4A 2GZ3A 1FYDA 2P68A 3NH9A 2RC5A 2PS9A 3KZCA 2NUPA 4JX8A 4CKEB 4UZEA 1ZAYA 5AJXA 3DVAA 1ZGZA 4KO4S 1E2MA 4MV7A 2B1RA 1E3EA 2NSYA 4ZARA 4QHSA 3FX2A 3MCVA 5KOHA 5BYKA 3OLQA 3R76A 1H0KA 4W7IA 2WIBA 2F62A 3PNKA 2NXJA 4X8OA 4DAOA 3FMIA 3HY6A 4MA5A 4ZVQA 4QO7A 4NAUA 2EX4A 2FW7A 4WZAB 3LNTA 1E18A 3MWYW 5IM4A 2Q3JA 2X3YA 5JZVA 1DAIA 2Y2VA 3WNQA 2IUYA 2P90A 3D6JA 1IN6A 1FQWA 1YKFA 2XUZA 2QEQA 4KHZA 4BGVA 3G5TA 2AJBA 1MOZA 3INTA 1W94A 5K0JA 4BMSA 1R0WA 1A4XA 3M3DA 3OEYA 4FFPA 1XZMA 3FUVA 4F96A 3G0BA 3ZHYA 2IZ5A 3ZU2A 4UCXA 3WYNA 5EUCA 2WU4A 2NPOA 2XV1A 4TM8A 4URWR 5CB4A 4AMBA 1H93A 2QW0X 4EABA 1P2SA 2GVZC 1CY4A 2PX2A 1NJGA 1BYUA 2DUJA 2EKZA 5DLPA 5EA2A 4YWJA 3IKTA 3RS0A 1KWKA 4R1MA 2QL6A 1YI1A 2YYYA 3KEGA 5A7FA 2ZTMA 1PRYA 4C0JA 4F9EA 3ADCA 1JB1A 2A9JA 2RGYA 1K5GA 4HWSA 4NDAA 1VM6A 5IZCA 5J43A 4FIZA 1IDOA 5LDGA 5GZ1A 4F38A 1UMDB 2AJ8A 3HJBA 4IGKA 3EGXA 4PVDA 3O3OB 4M9CA 1G55A 4YCNA 3G6WA 3IODA 3NC4A 4WK2B 3PPIA 1Z4NA 2YYSA 4GMDA 4ZEMA 1RZRD 1WG8A 1T8SA 3KQPA 3MYYA 1SIWA 3DT6A 3KKKA 3QPAA 4I0WB 4DJ5X 2ZZMA 3BOSA 1H4TA 3HJCA 5D8DA 1G20E 3NTUA 3FPLA 5SYAA 3ZCRA 1DBWA 3LO5A 5HUHA 2ZUBA 1JXMA 1O8CA 1D4ZA 2O0KA 5DSTA 3Q5GA 3IRUA 3S28A 1UPUA 4DG8A 2QY6A 2E5FA 1B1CA 2WQZA 3CKYA 3CWQA 3ET4A 3EY4A 4HEA6 3TEJA 3AVYA 1XL1A 5HXAA 4UEQA 1FEZA 4R6XA 2MSWA 1I8TA 3ENKA 4K6FA 1JA0A 5KTSA 3VH3A 4PNHA 3ITNA 1HT0A 2XUGA 4QSHA 1II8A 5JTTA 4R5HA 4V02A 3BMCA 5EJ8A 1W36B 1HEYA 2YH2A 2BWJA 4XR4A 1WEHA 3RYFB 2ZVJA 2LE0A 3KVVA 5KVSA 2VZLA 2NYUA 4TL9A 3BDVA 2AOTA 1NUUA 4IWYA 3ZHUA 4O2AF 1OE0A 5IC4A 5FBQB 2G6BA 2R1VB 1ZK0A 4EEXA 3H75A 4UHEA 1OAAA 2K87A 3SQLA 3UTCA 3IEKA 2O2GA 4QIHA 3FVWA 3NHRA 3OZSA 4V38A 4YP1A 1TB4A 1EE2A 2HO5A 3FBTA 3M33A 4LJRA 1UDRA 4CLRA 2Y3IA 4LJ7A 3ZGXA 5B5SA 1P5FA 4MRPA 1J06A 1PR6A 3S7ZA 2FUG1 3E1SA 5EL0A 2QVXX 4RQBA 3W6NA 1ZP6A 1RFLA 3MCTA 2NZ2A 1UPCA 1VYVA 2NTVA 3B9BA 4EBBA 4E3ZA 1LBSA 3UGTA 1T15A 3DE3X 1X7ZA 4W1SA 4BLPA 4QUHA 1ISSA 1R4NB 2LCFA 2B8EA 4J7UA 5B4TA 2VZ9A 3N2GA 3KAQA 4CKBA 3M6IA 4KN6A 3SBDA 1VE3A 1DXOA 2HJWA 4YT4A 3FB4A 4RGVA 5EEGA 1SXGA 3VYWA 4CR8A 3QHPA 4H15A 1EUQA 4EHNA 4LSWA 3HA5A 3BZBA 2IOFA 2JHGA 4EPRA 3MEQA 1P1CA 1WPRA 5JEEA 1P7WA 1BW9B 5GQSA 1NVTA 4KVZA 1PNRA 2DRIA 4IKEA 1ABBA 1ZJWA 3RUEA 4WJZA 4LQ4A 5EZYA 4H6WA 2GLUA 5K09A 5BWBA 2NM0A 2EF0A 3P9ZA 4B9EA 1HORA 4BO4A 1BHJA 4II3A 1NI4B 1THGA 2ZAYA 4C7BA 5E1MA 1WABA 4PNZA 4Z0PA 3WGJA 3NHLA 3BRQA 3A58B 3H9CA 5C5DA 1U8FO 3AEZA 3C1AA 4GUAA 4M9RA 3VH1A 2X9GA 3LT2A 5B1DA 2QUHA 3ZWBA 4B45A 1RJEA 1SBCA 3EIOA 2C3UA 4MIOA 4R3UC 2F3QA 3EGVA 5JDCC 4EW1A 4D43A 5TT1A 1X1CA 2XHEA 2FR1A 3NH6A 5KKAA 4EJSC 2GD2A 5K03A 1CUUA 1Y37A 4DV7B 2ZJ6A 3ZDXB 2G9VA 3IQXA 4RC9A 2IELA 3PXEA 2OCKA 2P41A 3QFFA 3F2VA 3DZ8A 3KYDA 1TPYA 4QPDA 3T5GA 4GYYA 3WK7A 4JYCA 1ZN2A 2HXYA 3A4VA 1KQNA 2VDPB 1J20A 3HS3A 1A9TA 1GVNB 2P6NA 1RYNA 2WM8A 4IXTA 1WUYA 3RAEC 1K27A 1VYHA 2M6RA 2PUJA 3HYSA 4IQGA 4B84A 3SM9A 4M86A 4C07A 3A06A 2VT6A 3ITDA 1SK9A 5AWFC 1GAEO 2WUDA 5BSHA 3UQZA 4E22A 3WGTA 5CG2A 4HDQB 1V8PA 4G1UC 4E5NA 1QVRA 5L3QA 2JRCA 5C1OA 4OQQA 2QGZA 2O2DA 4UNPA 5HF9A 5J59A 1XPOA 1RCTE 1S8OA 3ZQJA 1BDMA 1QR6A 3VO9A 1EHCA 2JA1A 2OESA 3TLGA 2FW1A 4JENA 4LRSB 3PBKA 2VPWA 4DRXA 2YV5A 2EKDA 2C1ZA 2AI2A 2G9QA 3E22A 3V55A 1KC1A 4X6UA 1VMDA 3M89A