1LRKA

Crystal structure of escherichia coli udp-galactose 4-epimerase mutant y299c complexed with udp-n-acetylglucosamine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
338
structure length
338
Chain Sequence
b'MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPACWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-glucose 4-epimerase
publication title Structural analysis of the Y299C mutant of Escherichia coli UDP-galactose 4-epimerase. Teaching an old dog new tricks.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 126
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lrkA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1lrkA01
1LXCA 3KYBA 3WIDA 4OL9A 1V3TA 4CLEA 2BRUA 1WDLA 4ROSA 2DPHA 2TMDA 5MGBA 4WLVA 5TRTA 3CIFA 3TOXA 3WGQA 3WYEA 3H5NA 3RU9A 3MTGA 5TT1A 2JFFA 3VVCA 4LCJA 1DIGA 3GVIA 2NQTA 4B4UA 3RQSA 3OP4A 1ISGA 2X22A 4FFOA 3RFTA 5IN4A 2NWQA 1SBYA 3FR8A 3PHGA 4N5MA 3ZWBA 4KUGA 3MWEB 1WAMA 5JDCC 4DQXA 2FPPA 1HDCA 2Y68A 3KSDO 4R41A 2Z95A 4CR6A 3V5NA 2ILTA 4ND2A 1U3TA 5KJ6A 1KEPA 1M6HA 1ZXBA 3ANNA 4MVJG 1ZK1A 3VPFA 2DBQA 4PIVA 3UCXA 2X6TA 4D43A 4JJFA 1XGKA 2PKQO 4J43A 1BMDA 2HK7A 2H1SA 4FS3A 4PG5A 1GD1O 1WWKA 4DMMA 1A71A 2QZ9A 1T2CA 3MEQA 5K9ZA 1RYDA 1WXDA 1U8XX 1GQYA 4JJGA 3C3XA 4ZRMA 1IHXA 3RROA 4KUHA 4CL8A 4YWJA 2O3RA 4J4HA 1EUDA 1V0JA 4OKNA 3JYLA 3W4IA 4ND3A 3ZWVA 3TFOA 5A9RA 1OZAA 4FOSA 3Q9NA 2HAEA 3L6EA 2GN6A 1C1DB 1PJLA 3G17A 5A05A 3H65A 2WEKA 4R9RA 4IPTA 3SJUA 4JN6B 4DBVO 2WD8A 5F3RA 1NYTA 1I5RA 1OFGA 4L9RA 4ALKA 2NQ8A 2R00A 1VM6A 2O48X 1CRWG 3WGHA 3F5SA 3OQ1A 2GNAA 4YRDA 2WD7B 1LDEA 2I99A 5DBFA 4RV9A 2VHWA 3OICA 2F00A 4DUPA 5A9SB 2HO5A 1YQXA 3DR3A 1CJCA 1Q2XA 4L74A 4S3MA 1ENPA 5AXDA 1FDTA 2VWPA 3RFVA 4AL4A 1HDOA 4TQGA 2WYVA 2GZ1A 1NQAO 2VZ8A 3W6UA 3FNEA 1NR1A 3ST7A 4J3FA 4ZICA 3AU9A 3MTJA 1DJNA 2VTDA 2P91A 5AXCA 1BG6A 2IXBA 2YUTA 3L9XA 2EW8A 3GMSA 4BVAA 4D41A 5L53A 4I5FA 5JY6A 3ZWYA 5IDQA 1B14A 1LJ8A 2E6UX 3JD4A 5JC1A 1YXMA 5JYDA 1FF9A 1OC2A 3O8QB 5ICSA 2Q49A 1MP0A 1QYXA 2X9VA 3PEFA 1B7GO 2V7PA 3RBZA 2A35A 3F4BA 4A0SA 2CDCA 5KVSA 1ENZA 4I5GA 1Q1NA 5G4KB 1E7RA 3PTZA 2Y99A 3JD0A 3PHIA 4BGVA 4CMJA 3SBOA 5TLSA 2VYVA 3MJSA 2BLLA 4Z6KA 3I6QA 4NZ9A 2GRAA 3UH1A 2PZJA 2NUAA 3WR5A 4CLDA 1X0XA 3GC6A 4QQRA 1YONA 4U6SA 4CUKA 2EJWA 5HS6A 1ZO8A 2CY0A 3WLEA 1ZJYA 3FWNA 3T4EA 3JQ8B 3MOGA 4RF3A 1R4NA 3DZFA 2VWHA 3WS7A 5IXSA 2GN8A 2DKNA 3GFBA 1M75A 2JKVA 1E3WA 1LC3A 4PZEA 4D7AA 4RZIA 1G1AA 3MJVA 2AHRA 1QR6A 3QQPA 5FEUA 3VH1A 3UUWA 2I66A 5JC8A 4ZQHA 1A7KA 5TQVA 1DOHA 3OEWA 4CMIB 2AA3A 3F1LA 5IZCC 4FGWA 5TS3A 4QTZA 3TFQA 4EZBA 5I7FA 1UP4A 4DTIA 3QW2A 1FDSA 2GN4A 1LDMA 3EYWA 2WE7A 2EKLA 2ZB8A 1JW9B 1A9ZA 1NHGA 4IDGA 5U1PA 2VZ9A 1XEAA 4B3JA 3RSHA 2O2YA 4ITUA 4CM6A 4LRSB 3ETGA 1E3IA 1J5PA 3JTMA 4JNKA 3GK3A 1OAAA 3HG7A 3QRWA 4A5OA 5KIAA 5COQA 1GYPA 3ICCA 4IM7A 2WSBA 3CKYA 1LSUA 1GL3A 3FTNA 4KQXA 3G79A 3PZRA 3VZRA 3DBHB 3ENNA 4RVFA 3WQQA 2O3UA 1XQ6A 1PTJA 2GPTA 4NNJA 2POQX 2FR8A 4LRTB 1NP3A 2JD0A 4BKOA 3WGIA 4MIYA 5JMPA 4N5LA 4JROA 4OSPA 2HUNA 1WDMA 5L51A 1WP4A 1PGPA 5CHEA 2NTVA 1KETA 2A94A 1I33A 4XQCA 5JAMA 4WOKA 3I52A 1Y5RA 4K6CA 3LT0A 3BMCB 3N7UA 4MP6A 3V2HA 3VPSA 4BS9A 2IZ1A 2HU2A 1NASA 4PG8A 4HXYA 3KB6A 1PS8A 3V1TC 4K9DA 3KRTA 3M1LA 4J1NA 2YHIB 3ZGYA 1J49A 1ONOA 4DIOA 2W8ZA 4I5DA 4AJOA 4R1UA 3UXYA 2AQIA 1KIFA 2JD1A 4R3WA 2W2KB 4XEHA 3GHHA 4AFNA 3WQSB 3HFGA 2V6FA 2C82A 4RVDA 1F14A 2O7QA 1XCBA 4YJGA 4FFNA 3ULKA 1KOLA 3BYZA 3WWYA 4YEDA 1K2WA 1YB1A 3K73O 1U3UA 2DLDA 3NT4A 1TXGA 4LMRA 4CJXA 3E03A 3AJRA 1X1TA 4CUJA 4M8SA 4RPHA 4ESOA 2QZZA 2CVQA 4Z9FA 3PXXA 4YVFA 3DEYX 2EKQA 5T57A 2QYSA 2YW9A 4GQAA 4NPCA 5L7TA 5GY7A 3JQ7A 4XYLA 4EEXA 1HE5A 5KKAA 3ADOA 5J23A 3GH3A 3RUDA 4DC1A 1T25A 4KWIA 4YR9A 2V6BA 4A27A 4YPOA 1H6CA 4U5QA 1VL0A 1QYCA 1GPJA 2R6JA 3AW9A 2ZYDA 4BNTA 3E48A 3AY3A 1Y9EA 4B3HA 1E1KA 4R51A 1SEVA 2AQ8A 3DMTA 4HNHA 3DAGA 4MVJP 4XGKA 3OEYA 3DFZA 3HADA 3JQAB 1E3SA 3Q11A 4NDNE 3OMLA 4CMBA 4LW8A 5EINA 5KKCA 2NACA 1U3VA 4TRJA 1QORA 4YJFB 1JWBB 2ZTVA 2OUIA 1EZ4A 4M49A 1PIWA 1KERA 3E6AA 3GZ4A 1IL0A 3FRJA 4NFSA 1LLUA 3W4JA 3LT2A 4KOAA 1W4ZA 4NFYA 4ZA2A 4Y8VA 4DLBA 1CERA 1PGQA 1XELA 3H9UA 1N8KA 4B3IA 4GH5A 5CEEA 4Z0PA 3VZQA 2UUPA 1E7MA 2JCXA 3EK2A 3NRCA 1Y8QA 4P4NA 2O4CA 1QV6A 4AJ4A 3PPIA 2DTEA 4E30A 4QXMA 4CM3A 3QVSA 4F6LA 2AW5A 2PD6A 1EMDA 5JMWA 1ONNA 6LDHA 3WNVA 2B36A 2D59A 4W4TA 1C0LA 3KV3O 4EGFA 2PFGA 4CM5A 2AMFA 5DULA 2GZ2A 1N9GA 4M86A 1CIVA 1SCUA 3Q6IA 4KTTE 3U4DA 4UVIA 3GEMA 3JQGB 4HFJA 1FDVA 1NM5A 3BHJA 3QE3A 3ZWNA 4A10A 2PLAA 5L4LA 3RKRA 5TGDA 3D4OA 3DBRB 3IP1A 4J4BA 3NJ4A 3IOYA 4XD2A 5DF1A 4C4OA 5FWNA 1Y1PA 1I3MA 2DTDA 4RGBA 3GAZA 4LISA 1PSDA 2VHXA 5L95A 1V6AA 3HDQA 4E12A 5IFLA 1A7AA 5LDHA 1RM0A 2OORA 1SOVA 3GN2A 4PLPA 2Y1OA 2WMDA 4IBOA 4II2A 4CMGA 2EGGA 3QWBA 3GLQA 4RJTA 2BHLA 4UULA 3C1AA 1ZSNA 1SO8A 3OIDA 4E31A 2ZTUA 4DL9A 1IYZA 4ZRNA 4BO4A 5ENDA 2X0IA 2D3TA 1A4UA 2X58A 2R00C 3D3EA 3DBLA 5DP2A 4Z3DA 5T5QA 3V1YA 3ZHBA 4CV1A 1RJWA 1A72A 4PRLA 4DMLA 1E6EA 2HRZA 3TNLA 4YAEA 4YCAA 4DPMA 2YQ4A 1I0ZA 4GWKA 4Z9XA 4Y98A 1MV8A 5U4QA 4J6FA 5IG2A 4MINA 1K3TA 1X7DA 4PRKA 5G0TA 4F6CA 1GV1A 1PJCA 2W90A 3DAPA 1E7WA 2OOSA 2PKQP 3PK0A 4RCVA 2NU9A 3GPDG 1DFHA 1SPXA 1A9YA 2ZB4A 5BNFA 3CPSA 5L40A 3IP3A 1CF2O 1YDWA 2I3GA 1DIBA 2OL4A 5FFFA 1P0FA 4E6PA 4EUFA 3WG9A 1B8VA 3U62A 2CF5A 3GGGA 3TL3A 4CM4A 4R16A 2VZ0A 1E3JA 1DFGA 1D3AA 3L0DA 2F1KA 3K8ZA 4W7HA 3AK4A 4R5MA 1T1RA 2HK9A 2J3IA 3GEDA 4YDRA 3SEFA 3ZNPA 2X86A 1PQPA 1M6WA 1J6UA 4BNMA 1BHSA 2UYYA 4RORA 2FWMX 1PJSA 4EI2A 3HZZA 2WE8A 4HWKA 2BI8A 3TWOA 1ZW1A 1Y8RB 1T4DA 4OXKA 4EJMA 3FNGA 3K92A 1LLQA 5F1KA 1PU2A 2FZWA 2J8ZA 3KBOA 4O5OA 4CLOB 2HKIA 1DRWA 3M2PA 1YVEI 3CMCO 2W2LA 4BNNA 1F0YA 3NYWA 3JQ9A 2R2GA 4J1SA 1BXZA 3IKVA 1VJ1A 1GEEA 3EGOA 1DC6A 2P4QA 3OJ0A 3P2YA 4NFHA 3SLKA 2G5CA 1LTHR 5BSHA 1PWXA 3COSA 3MCVA 2ZKLA 3WNQA 4J90A 1UAYA 3SC4A 3H3JA 1I01A 2IXAA 3E18A 1HZZA 3JQEA 4U8GA 5GZ6A 3H2ZA 1DLIA 3GA0A 2W4QA 4D0SA 1MB4A 3NJ8A 4CM8A 1H6DA 3DC2A 1QYWA 3AI2A 5H81A 3ZDFA 2W2LD 4PLGA 3LZ6A 2HMSA 1LX6A 4CV3A 1AGNA 1BDMA 3D5QA 2QHXA 4WCFA 1C14A 3KVOA 4NG5A 4CLRB 4D3FA 2ZTLA 3R0IA 2C29D 1FMCA 3TZCA 3ZNQA 3WWZA 1XLTA 1ULSA 4ZU3A 2RCYA 3UICA 3RBVA 3E9NA 4OIMA 1YDEA 4ALNA 1MUUA 1P33A 4Q3DA 3MZ0A 5JPIA 5LDGA 1P74A 3ONDA 3M2TA 4NMHA 2ZCUA 3BMQB 2PZLA 3KETA 4GPD1 4TWRA 2V6MA 1U28A 2O3SA 3EC7A 4TVOA 4R9SA 1DRVA 4HY3A 1AE1A 5U9CA 3AI3A 2CF6A 1VSVA 1GV0A 2D5AA 2FPGA 4UUMA 4NJOA 1JAXA 4A73A 4G5HA 1ORRA 1NXQA 3TL2A 1YBAA 4IMRA 2FR1A 2Z1NA 1EFKA 1MGOA 3MJCA 4CQLA 3KYCB 5L7YA 5FYDA 4XR4A 4HKTA 2TMGA 5K6AA 3D4NA 3VZSA 2QW8A 4LN1A 4NBVA 2VOJA 1DIRA 4Y6PA 2Y05A 1ADBA 2NTJA 4JBIA 3PQFA 1W6UA 4J7UA 4Q3CA 4MVJA 3ZI0A 3JD1A 3KYDA 1H9BA 3O03A 4M55A 2WYUA 1I10A 2IZZA 3WSWA 3B1FA 3I9KA 1C1XA 3GZNA 2GR9A 2PGLA 3IL2A 1NPTO 2GSDA 1P31A 4R68A 4XRRA 1BDBA 1N1EA 2NU7A 5KJFA 1DBVO 4RO0A 2EF1A 1YOVB 2DUUA 1H6AA 4E3ZA 4Q3EA 4RVGA 4D44A 4XIJA 1LU9A 1HRDA 1ZSVA 4GSLA 1U8FO 3F46A 2GN9A 4MVJD 3WBFA 1NX6A 1E3LA 1EK6A 5DOVA 4BNZA 1ZNQO 4IZHA 3OFSA 1GPDG 2YY7A 1SB8A 2EERA 2EV9A 2O7SA 4CLHA 3ZWWA 1I8TA 4O59O 4IJKA 5LCXA 3IIEA 4M87A 3NGLA 3TDKA 3I3OA 5F21A 1NNUA 3V2UA 1V8BA 3VVBA 1U3WA 2JJYA 2C20A 4XKJA 4D0RA 2DQ4A 4GI2A 1DO8A 1SMKA 2QG4A 3CH6A 1DXYA 3IJRA 3DMTC 1RKXA 4TRRA 2A4KA 3ITDA 1VSUA 4H15A 1JTVA 1PZFA 3BMOA 1O0SA 4FFRA 3VC7A 4KP7A 2BKAA 2VHVA 3GRKA 3UCFA 1B2LA 1G6KA 1GUZA 3HWRA 4FIZA 3LT4A 3H5RA 4N54A 1ULUA 3FN4A 4JCOA 5T8KC 3WTCA 1M2WA 4LMPA 4EITA 2GUGA 1PL8A 1ISFA 1DPGA 4E2YA 5BR7A 1MXHA 5JYEA 1XKQA 4XJTA 4QFCA 4OXNA 2VT3A 1E6UA 3R6DA 2P2SA 1BRMA 3JQFC 1YBVA 1Y81A 3PQEA 3AUTA 1Y7TA 1P77A 5G0VA 1UR5A 2E49A 2NV6A 1PJTA 2CDAA 1UZNA 3A06A 3DWFA 4IS2A 3P2OA 4WNIA 2YV1A 4NI5A 4XYEA 3B20A 5EL0A 5TX7A 4CODB 5GZ3A 3AU8A 1U7TA 3OQBA 5EMHA 5TJ9A 4R1NA 1G0NA 1PJ2A 1QP8A 3A1NA 3C8MA 3WSVA 4JBGA 7ADHA 4IQ0A 3KOUA 2C5EA 5BQFA 4YJHA 2ZYAA 3ETDA 3I5MA 1EFLA 3GDOA 1DAOA 3Q0EA 4PLVA 3WLFA 1NVTA 1WDKA 4MKZA 4O6VA 4PVDA 3WDSA 1U1IA 2OBNA 1LUAA 4NU5A 1LA2A 4W7IA 3ZHZA 1E1LA 2EIHA 3SJ7A 1IY8A 1NHWA 3C24A 4Q9NA 3RC7A 5ITVA 2VOEA 1WNTA 2NADA 2YDXA 3DOOA 1BW9A 2NVBA 4MVJI 1JA9A 4RPKA 4GMFA 1Z75A 2EW2A 1GYRA 3RCBA 1HE3A 2GGSA 2ZB3A 4BNHA 3HQ4O 4I9HA 3DZJA 4AJIA 4XGIA 2NM0A 3RASA 2IDZA 3GVXA 4WLUA 5IDYA 1MA0A 4D79A 1YQDA 3QWAA 5C37A 2OP1A 4D3DA 5CPBA 4BO6A 1YQGA 4WASA 3VTZA 5HTOA 1WLYA 2O50A 9LDBA 2YYYA 1UZMA 2X9NA 2I67A 4YQYA 3VH2A 5TC4A 3GVHA 1R66A 3UW3A 1IZ0A 1I3KA 3C85A 3KZVA 3S2FA 4Q3AA 1YL7A 4RPJA 5IDWA 1V3VA 1VL8A 4BKQA 3I4CA 1TA4A 4FJ0A 2D4AA 2X1HA 3ZHYA 2PD3A 3OJEA 3F3SA 4FC7A 3JQ6A 1ZZEA 1UH5A 4G2NA 4Z9YA 4E5YA 2YZ7A 2YFHA 2NSDA 3IKTA 1VKOA 1T2AA 4XGNA 2XAAA 4RPLA 3U5TA 3L9WA 1XHLA 5JXWA 4YT2A 3HUDA 3I6IA 3UOGA 5JLAA 5H82A 1UXJA 2CVOA 4CMCA 3H3FA 4DQVA 1EEHA 1ZSYA 4JGBA 1JDJA 1Z82A 3ORFA 4U6QA 5A3JA 3FD8A 4YRBA 1HWYA 1GUYA 1I30A 4ZGWA 3IMFA 1ZCJA 2VHYA 2Y0CA 4B4OA 1ZXLA 3DL2A 2HMTA 1K0UA 3LQFA 2I65A 5IXYA 1KVQA 3HDJA 3WJ7A 3E1KA 4MKRA 1Z74A 1GUFA 2LDBA 1S7CA 5JNLA 1ZEJA 1B16A 1P1KA 2FOIA 2ZYGA 4MVJF 1I36A 5I8ZA 1HDXA 4IDDA 4XR9A 5H83A 1QMGA 1B3BA 3WYBA 3PIDA 4O0LA 4MDHA 4XB2A 1WMBA 1DSSG 3I9JA 3T7EA 1X15A 2NVUA 4RLHA 3RWBA 6ADHA 3JQ9C 1KY5A 1LLCA 3I1JA 4MJLA 1C0KA 3MOIA 2D2IA 5CAEA 1FK8A 4HFNA 1BGVA 4WLOA 5EESA 3AFNA 3U9LA 5L9AA 4CR8A 4GVLA 4IDEA 5A5EA 4AJ2A 1I2CA 4YJDA 4MP3A 1VPDA 1FJHA 4OM8A 3S2EA 4XDZA 2P9GA 3ZCXA 2J5KA 3K30A 1H6BA 3HDHA 1SEPA 1VLLA 4RPGA 4WCFC 3QLJA 3H9QA 4L75A 1EDZA 4TVBA 2DU8A 3BTVA 4CUZA 2AE1A 2Q2WA 3E82A 3QVXA 4JP3A 3PP8A 1R4NB 2B37A 3WQRA 4R4JA 2D8AA 1VL6A 2BFAA 3ADPA 4F45A 5I9MA 1E3WB 3IS3A 4NHEA 4OH1A 5IJZA 1LRKA 3SC6A 3FNHA 4WKGA 3C1OA 3RKUA 3KHUA 4E2ZA 3NDJA 4FFMA 4BIIA 3NUGA 1R4MA 3KLPX 2C7VA 4DLAA 5A1TA 1UXHA 3K5PA 3UCEA 5EN4A 1GEGA 4A2CA 3PZBA 4PG4A 3OA0A 3WGGA 3BA1A 4B4VA 3IDSA 3SLGA 3GUCA 3B6ZA 3D1LA 3RAJA 2AQKA 2B5WA 3C7CB 3TJRA 2HLPA 4K28A 4WOJA 2NU6A 4XZ3A 4AJNA 1RYEA 3G1TA 1NAIA 4A26A 5K6AC 4H16A 5BSFA 4YT8A 4RLSA 4WCDA 4J16A 1QLHA 2DBRA 2X0JA 3DZKA 4YA6A 5TSDA 1AHIA 4GX1A 1DC3A 3GRPA 1HDRA 4QSMA 3GGPA 2NU8A 3OQ6A 4DRYA 4ALMA 5B4UA 2AG8A 2OO5A 4DVJA 1E5QA 1H93A 1HYGA 4YAIA 4CMHA 4UVHA 1UP7A 1LI4A 4U0KA 1OBFO 2DBVO 3WFIA 3LLVA 4O1MA 4IDCA 3PHLA 4IDFA 4QO8A 4TRNA 4YT4A 2E37A 3WBBA 4X54A 4CMAA 3D5TA 3NDIA 2YQ5A 1WZIA 4ID9A 3RUAA 4IXTA 2B4QA 1D1SA 1DFIA 1EE2A 4FOOA 5ER9A 4BO1A 2GCGA 4BO9A 4HX5A 5KTKA 4RQTA 1GADO 3EVNA 1U5AA 3RUEA 3SVTA 2EWMA 3PFWO 4Q3BA 2PV7A 3GFGA 1MC5A 2PD4A 3UAGA 1OMOA 1EVIA 2CNBA 1K6IA 4GAEA 1K5HA 3QY9A 2DT5A 1ML3A 4IGEA 1ZK4A 4UEOA 1NFQA 4UUOA 2PKRA 2DVMA 2JHFA 1PL6A 3LT1A 1E7QA 3CMMA 1M67A 1R15A 1F06A 4G81A 3BZUA 1EVZA 1JVBA 1HE4A 5DT9A 4AJJA 4Q3NA 1Z6ZA 4YJGB 3ANLA 1U2DA 1B26A 1ZVMA 4ND4A 3O4RA 4P22A 3BTSA 3TZHA 2C7GA 2FY8A 1DC4A 4CM1A 4ZHSA 5I7VA 1Y6JA 2AQHA 2X7HA 1E6WA 4JXKA 4FFPA 3KSZO 3NKLA 4INAA 2IYOA 5HBRA 5B4VA 1UJMA 3JYNA 2ZTMA 3INTA 4NJMA 5T6BA 4LSMA 3WMXA 5T8KA 1MG5A 4L76A 1T4BA 3PDJA 4B7XA 4EW6A 3JQ7B 4I9UA 4M1QA 2EJVA 2CMDA 2E48A 3F9IA 3I9MA 3F4LA 3OSUA 1PR3A 1HETA 3LYLA 4PLTA 4WEQA 5AVOA 3X2EA 3R1IA 3JQFA 2GYYA 3ASVA 4OO3A 4XQ9A 2YHUA 3NX4A 1LLDA 3TSCA 2C0CA 4RF5A 1LSOA 4MKXA 5ILOA 4ILKA 4WPGA 4MVJH 1XU7A 1CDOA 5HA5A 4GX5A 2VCYA 4QEDA 3ZWXA 4EYEA 1GQ2A 4NIMA 4L4RA 1ISHA 4E4YA 3ETEA 1L7EA 2QRJA 4YRAA 4ZVVA 2D1YA 4M54A 3DOCA 5KCZA 2Q46A 3HN2A 2G17A 1TT5A 5A02A 3F47A 1GU7A 3EY4A 2JCYA 3D3WA 4Y9DA 1U7HA 1H5QA 3BMNA 3ZU3A 2IODA 2XF8A 3ON5A 3ZW8A 5GZ1A 3VH3A 2GASA 4MOWA 4OQYA 1CQJA 3FTPA 4CM9A 1NQ5A 5DBIA 3ROPA 1JKJA 4WEOA 1R6DA 2PH3A 3ICPA 1HKUA 3VPGA 2BGLA 1QXSA 3A14A 5BT9A 2O3JA 4RF4A 5T67A 1PEDA 1QLJA 1KEVA 1NQTA 4GX0A 1RPNA 5ICMA 4MVJM 3GDGA 1GDHA 4E2WA 5JAIA 1DIHA 4RF2A 3WGTA 5DDIP 2UDPA 3AUUA 3ZN2A 3MJTA 1I24A 1CYDA 3H6KA 3JYPA 4JQCA 4CQMA 4I9NA 5F5LA 5JS6A 3RC9A 1Y5MA 4PLWA 1LQTA 4CMEA 2FMUA 3W1VA 5CP8A 3GEGA 4YT5A 3ZHXA 4CM9D 3JSAA 1HXHA 4R3NA 5G4LA 1O8CA 1N9GB 4BMSA 3EHEA 2CDBA 2V6GA 2ZK7A 3QV1A 4OYRA 4PVCA 1ZK2A 3H9GA 4WK6A 3VKVA 1MG0A 1PJBA 4RDHA 1T2DA 2JFGA 3PHHA 4Z3KA 2C5AA 4U0JA 2ZCVA 4PG6A 4N7RA 3OECA 3V2GA 2O4UX 2CD9A 3DDNA 3KXDA 4CQMD 3PWKA 5G0SA 4CPDA 4ALLA 1I2BA 4XA8A 2YJZA 1ZEMA 1VE9A 1TVEA 3PDUA 3U3XA 2ZB7A 1ZUD1 4R1SA 1V3UA 3STHA 1TEHA 4E32A 4UVDA 1DEHA 1LDBA 5F5NA 4BKRA 5DN9A 2RIRA 8LDHA 4QT0A 5KJEA 1KVUA 3IC5A 4FDAA 4BNXA 3DBLB 4W99A 3NEPX 2B5VA 1YB4A 1CETA 2C2XA 3C7AA 3FSRA 3TZ6A 3U09A 5KJ1A 3L07A 3GN1A 1QRRA 5A04A 3W8FA 1PWZA 1PZGA 4DIFA 2PNFA 3DONA 1ZH8A 3PQDA 4L0QA 3D7LA 4Z0TA 3RUCA 3S55A 3GVPA 4LGVA 1UZLA 4GKVA 5JCJA 3AOEA 3DTYA 1X1EA 3GVCA 4BO0A 2Q4BA 3I9OA 4P8RA 2IZ0A 2P5YA 5L4SA 2VHZA 3EMKA 2Y1CA 4DXHA 1VI2A 4FB5A 4DIBA 3TF5A 3RI3A 5CDTA 4CM4B 2NNLD 3FPCA 5JE8A 1I2ZA 1BXGA 3OETA 2DM6A 4MPDA 5COAA 4WLNA 3ZWPA 4B7UA 1P1HA 2X4GA 4MP8A 3CINA 3VPHA 1GAEO 5JCJD 4F46A 3HNPA 3PGJA 1B8UA 3BXXA 3PWSA 1BXKA 1LRLA 4NBTA 1DJQA 1AUPA 2VNSA 4EUEA 2C07A 3EZLA 3ROQA 4DC0A 3EUWA 4AG3A 2VUUA 1LRJA 3RIHA 1DB3A 4E5MA 3PWZA 4LVUA 4PLHA 4PLFA 2G0TA 1DIAA 5B4TA 5JFOA 4RZHA 5KVCA 3W8DA 2EHDA 3PLNA 4CR7A 2Q3EA 3P19A 4W9NA 4FN4A 3PIIA 1YJQA 3INGA 2HJSA 4OOFA 2PGJA 3VZPA 4CL3A 3L6OO 2FN7A 2IE0A 1QSGA 5A03A 1IB6A 2RHCA 4B8ZA 1J0XO 4E13A 1YO6A 2Q1WA 2Q4EA 1A4IA 3RJ5A 1XIVA 1MC4A 2G1UA 2VTEA 2BI7A 2ZJ1A 4ZQGA 5C7LO 2GF2A 3K2EA 4GLLA 4CM8B 4PN3A 3OIGA 3TPCA 3U4IA 3AM3A 2QQ5A 3KSUA 8ADHA 1NAHA 2OZPA 2IEBA 4GLOA 4J1TA 4NBRA 3Q2KA 4BQRA 1P45A 3B1JA 4FJ2A 3GR6A 4WCFB 5KVVA 2PZKA 5TF4A 1D1TA 1HT0A 2IRWA 3CUKA 4BO7A 2B83A 2OGUA 4E5NA 1FDUA 2Y1DA 3BHMA 2HCTA 2VN8A 4IY1A 4O63O 4Q39A 1T1SA 2I3AA 3EAGA 1U2GA 4LVCA 3TN7A 5IAAA 5KOIA 1K6JA 1U4OA 3VPXA 2Y67A 4HV4A 1N7GA 1B0AA 4H3VA 5A4DA 2UV8A 4WGGA 2BFOA 2H5LA 2X8LA 2B0JA 2LDXA 3UFXA 1T2FA 1O9BA 1PGNA 1UDCA 2OMEA 3B70A 1WW8A 3LC1O 5DCWA 3QWFA 5JCXA 3WICA 5G0UA 4DGSA 3ZV4A 2XXBA 4I08A 4WE3A 1OI7A 4P38A 1XSEA 1RM4A 4KQWA 1DAPA 1C3VA 4DLLA 5AXAA 3ZWAA 3M6IA 3WYCA 1BTOA 2JAPA 1DHTA 2EEZA 5HWSA 4EJ6A 2DFVA 4CQLB 3GOHA 3NGXA 2GO1A 2OXIA 3WTBA 4XYGA 4NK5A 3VOSA 1NFRA 1GZ6A 1HYHA 3EVTA 3OJFA 4BV9A 5IF3A 4GKBA 4DREA 1NFFA 1NWCA 1O95A 4P4GA 1HDYA 2Y1GA 5IN5A 2FRDA 1MFZA 2Z5LA 3DZHA 4QFDA 3KM0A 2WDZA 3ITKA 3DHNA 4W6ZA 3KYDB 1U4SA 2GD1O 1H2BA 3ZW9A 4BL5A 1D4FA 4A7PA 3QA9A 1Z7EA 1C1XB 1IULA 3GZNB 4ZQEA 1EQ2A 1QV7A 3QJ5A 5JO0A 3AFMA 5G2OA 2EGHA 2BF7A 2XXJA 1HSOA 3HFSA 3I9NA 5TJHA 5DZSA 4EUHA 2X0RA 3VHRA 1MLDA 4XQEA 4KDFA 4BQPA 4IQGA 3E5MA 5FI3A 4JIGA 3EZYA 1UDBA 2CFCA 4J91A 1EUCA 1YGYA 3OIFA 3OM9A 3NV9A 2J3KA 4YAGA 3GG2A 5T64A 4DQUA 2C59A 3OF2A 5CDYA 3JQCA 3QVTA 1KS9A 1UXKA 3DZIA 5A5FA 1CQIA 2EP7A 1UUFA 1V35A 3DOJA 5F1PA 1A27A 5AOVA 5IDXA 1W73A 3LSYA 3PJFA 2I5PO 4XWYA 5I8WA 4UEJA 3JQBA 2HRBA 4YXFA 5L4NA 4II3A 1I32A 2CVZA 2ZATA 2GERA 1VKNA 3HJAA 4OQZA 2JL1A 5JDIA 4IUYA 2RBEA 2PY6A 3KEOA 3HB4X 1GY8A 4E2XA 2Y66A 3I83A 1UAGA 4R01A 1KC1A 3OBBA 3ROMA 2QRLA 3BIOA 2C2YA 1WPQA 3BMOB 2HDHA 1NTOA 3D4PA 4DWVA 3RFXA 4OAQA 1H2HA 1P1FA 4KTVE 2JD2A 2DFDA 3WFJA 5HS4A 4IZIA 3ONFA 1YBMA 4PZDA 1HF3A 3FI9A 2I9PA 4TRMA 3WGOA 1E1MA 1XDWA 2OFPA 1E77A 1SAYA 1PGJA 3DXFA 3UKOA 5JW6A 4E33A 1EUZA 2HMWA 1C1DA 3WMWA 4FJ1A 3V8BA 1HEUA 3JCZA 4PGFA 4B7CA 2WJPA 3GUYA 3L77A 1G0OA 3DTTA 2PH5A 1JQBA 1HDZA 1E3EA 2WD7A 1Q7BA 2PZMA 2Q45A 2VYNA 5A9SA 3GMDA 1SNYA 3E8XA 1X13A 2CSUA 4CMEC 4L73A 3Q3CA 2CUKA 4QX6A 1YKFA 3A9WA 1ADFA 1ENYA 1N1GA 1NWHA 4RL6A 2AXQA 2B4TO 3GNTA 2B35A 4YJHB 2P9EA 5I9NA 1KEUA 5CEFA 1X14A 1BWSA 5I9LA 2Q2QA 1LDGA 3C1TA 4PFJA 5EQDA 2A92A 4MIOA 2VWGA 3LU1A 2Q1SA 4TKMA 1X7HA 4UVGA 1ADGA 2GLXA 3NAQA 4IDAA 4BMNA 1YS4A 3QVWA 4BO5A 4UUNA 2A9FA 1DHRA 2H63A 3S1LA 1TB4A 1BW9B 7MDHA 2VYND 4BOYA 2Y93A 3ZWCA 1TT7A 3GNSA 4WECA 5HM8A 3AM4A 4UVEA 3BAZA 1NR7A 3O8QA 3RD5A 1ZFNA 3PI7A 1GCUA 1Z45A 3CE6A 5EPOA 1HSZA 4P4LA 4PLYA 1C0IA 5KJCA 2QIOA 4UEKA 4ALIA 4CM7A 5G4KA 4YYZA 5L7WA 1ZIDA 4K1LA 3ZU4A 1PX0A 3GT0A 1IOLA 4YAKA 1EVYA 1DRUA 5C7IO 1YJ8A 4B8WA 3S2GA 4RVUA 3L6DA 4AJHA 2EG9A 1JKFA 2OHXA 3JQ8A 1E5LA 2X23A 1JLLA 3FBTA 4NH4A 4FSHA 4GMGA 1ZBQA 3ZNOA 3AOEC 1Z7BA 4XIYA 3FHLA 4BNFA 4NR0A 1P1JA 3C7DB 4BB6A 1LDNA 3G49A 3PHJA 4TROA 3QWHA 4R69A 3GY0A 3OHSX 5DNAA 1YL6A 1HLDA 2FSSA 5KWEA 2DTXA 2J3JA 4ND5A 4BNKA 4CMIA 3P5SA 3P7MA 4IJUA 1D8AA 1JAYA 3N74A 4XB1A 5CDSA 4OHUA 1E7YA 3BTUA 1VJ0A 2HJRA 3MJEA 4AVYA 1ZMTA 3AOGA 3PYMA 3OJLA 4BNYA 1P9LA 3ZWOA 4BGIA 4BNVA 2Q99A 2IYPA 2NTNA 3DAFA 3AY6A 3U4CA 3PLRA 3FBGA 4N5NA 2J3HA 1JN0A 3VDQA 4C7KA 4BNGA 1TI7A 1X7GA 1YL5A 5ITWA 3ZV5A 1LDYA 1VJTA 2PK3A 3CXRA 3L4BC 5CFZA 3DHYA 2VUTA 2X9GA 1PGOA 2AEJA 1OOEA 3QP9A 3IQDB 4HP8A 3F5QA 4Y67A 3I9LA 2EP5A 3PRJA 3TRIA 4AICA 1ISJA 2BD0A 2VYVD 5A06A 2H9IA 3DBHA 4ZJUA 4XYBA 1KVRA 1U5CA 4J2OA 4YAJA 2D5CA 4XRGA 2NVUB 3PGXA 4I1IA 4W9NC 1R37A 1ID1A 3FPLA 4D42A 2D0IA 5CDGA 2JFHA 2E4AA 2I76A 1A5ZA 1B15A 3WJAA 3K31A 4IJWA 4QUKA 4R1TA 1P44A 3HHPA 5ES3A 1OC4A 2PGDA 2RHRA 5EJ2A 3BMCA 4J49A 2P68A 3LDHA 3NTRA 4KWHA 4WLFA 3D64A 2BH9A 4F3YA 1VRWA 1ADCA 5CG1A 4TSKA 4AJ1A 1AXGA 3ZV3A 1GTMA 4FQ8A 5DP1A 2WYWA 1T26A 2YHIA 3OH8A 4IGFA 5DCUA 3U49A 5THQA 4J0EA 1U9JA 4PCVA 1HL3A 2O3QA 3Q9UA 1WVGA 3DB2A 3KLMX 2W2KA 3RC2A 1F17A 4YTEA 3ANMA 3LF1A 1NPYA 1W0CA 1LNQA 3S2IA 1PL7A 4J0FA 3LF2A 1MFPA 1R4MB 1UXIA 3LVFO 3WGYA 5K0ZA 3AM5A 1J4AA 1BVUA 3G1UA 3H5AA 3ASUA 4CV0A 1E7SA 3QIVA 3PFFA 4JBHA 5FI5A 1Q0LA 3NDRA 4PG7A 4KMSA 1LSJA 5FF9A 4DYDA 3A4VA 1EBFA 3R3SA 1ZK3A 5CG2A 3NTQA 1RM5A 2OBYA 4HBGA 4NK4A 3UN1A 3IUPA 4U7WA 2X5JO 5A9TA 5F1OA 3GAFA 1PR9A 2VRBA 1VC2A 2RH4A 5MDHA 5L3ZA 1NVGA 3ENKA 1KVSA 2YFQA 4RVHA 1KEWA 4D45A 4RVSA 3WOHA 4BO3A 3T7CA 1NPDA 2J5QA 5I7SA 1M76A 2BFMA 2NLOA 2RAFA 4MO2A 3PYLA 4K6FA 4DBZA 5AXBA 1JWAB 4BKUA 1P0CA 3DZBA 3JQAA 4YBZA 4ONEA 3NTOA 2PA3A 3FF4A 4GX2A 2AE2A 5ILGA 4HADA 1SZJG 3V1UA 4YJFA 1MXFA 2BGKA 5ER6A 2YV3A 2VT2A 1KY4A 5C5IA 1ISIA 1W8DA 1EBUA 4XX0A 1IUKA 3QHAA 4GL4A 4FFLA 5HRUA 5EQFA 4GWGA 1HLPA 4LSWA 4DYVA 1QYDA 2Q50A 5TT0A 1AN9A 5EERA 3U4HA 4BKPA 4WNCA 4PLCA 3KTDA 3Q2IA 3CSDA 2G76A 1LC0A 1ENOA 1N5DA 1SOWA 2WTBA 4BMVA 3JQAD 2Y1FA 3HE3A 2V65A 4WLEA 4QO7A 4JP2A 3TQHA 1KVTA 1N2SA 3GPIA 1UP6A 2B69A 3HN7A 1YH3A 4UUPA 3H4VA 1Q7GA 3VKUA 4DPKA 3JQBC 2X0NA 3OA2A 2VNAA 1TLTA 4HFMA 3W6ZA 3KEQA 2VRCA 5I7EA 4XJSA 1EVJA 2P4HX 5JDIC 2FZEA 4XYMA 1O89A 2BMAA 4KDEA 4E5PA 3JQGA 4JLWA 5GMOA 1FDWA 1GZ3A 1H0KA 1EK5A 4UREA 3T4XA 2IEDA 2AG5A 2O2SA 4XCVA 3AY7A 4IQ8A 1N92A 1ZKMA 1QKIA 3K6JA 1LBEA 4IJVA 1SB9A 2FPIA 2BGMA 5C3MA 2Y0EA 3DBRA 2OP0A 3CZMA 1GQQA 4K26A 4NJMB 4RQUA 3K96A 3INRA 1I3LA 4OMUA 3RUFA 3ABIA 1ONPA 1YE3A 1XR3A 2J6IA 5JDCA 2JAHA 2VRCD 2ZJ0A 1GFSA 1F12A 4FBGA 4DA9A 4EJ0A 3DO5A 1XYGA 2P9CA 1R0KA 3I23A 2DPGA 5DOZA 4TMFA 4EBFA 1PZHA 2EKPA 3IAHA 3H9EO 2GDZA 4CMKA 1HTBA 3F6YA 1Y8QB 1PQUA 2O23A 1MX3A 2QRKA 2DC1A 1IZ9A 5COBA 1P3DA 5C7OO 3O38A 3DHEA 3ROKA 4J7XA 4MIEA 4S1VA 1F8FA 5ADHA 2HMVA 1LEHA 5AYVA 1FXSA 4FPXA 3KO8A 3W4KA 4E5KA 3PJEA 4ZN6A 2FHSA 2E82A 1KYQA 5THKA 2HQ1A 4KUEA 3TZQA 3AWDA 2Q1UA 2P5UA 1YRLA 3IJPA 4GGPA 3NT2A 4OGWA 1ARZA 3VAZA 1TT5B 3GQVA 3D3WB 4IDBA 3BMNB 3RJ9A 1PJ4A 3FNFA 4OXYA 2SCUA 3E9QA 2ZQZA 4WJZA 3D0OA 3DZGA 1JVSA 3GNQA 4J9VA 3JD2A 4Y6SA 1PS9A 1CEQA 4J2HA 3K9QO 5JY1A 4YQZA 4LCEA 4D46A 3LK7A 4BGUA 4TKLA 1XG5A 1KBZA 1GR0A 2JCVA 5L45A 1H94A 1NVMB 1Q7CA 1X0VA 2W98A 1K6XA 4E21A 4BNLA 3SXPA 3E5RA 4ND1A 3QWIA 5KVQA 4CQMB 1L1FA 2CZCA 2DBZA 3TZKA 1R0SA 4Z0HO 2XPCA 1PQWA 2NVWA 4QECA 3VTFA 1HYEA 1YWGO 2QX7A 3KUXA 2XOXA 1IPEA 1Y8RA 3DFUA 4CV2A 5IZ4A 1T24A 4BNIA 4FR5A 1NQOA 3AUSA 3G3EA 1I3NA 4CLOA 1DC5A 3RC1A 4BNJA 1EE9A 4FC6A 3WGZA 3W8EA 4EEZA 3O26A 4GGOA 3ZH2A 1XA0A 2EXXA 4BO8A 1IHYA 4AJPA 3FR7A 4IXWA 5BNTA 4OJNA 1RM3A 2JHGA 1E0DA 3H8VA 3H2SA 3RUIA 3AI1A 3B1KA 4OKIA 4FGSA 1IE3A 4NBUA 4ZQBA 5CEJA 1E1NA 4XQGA 2B4RO 1O94A 3E9MA 1CWUA 4NU6A 4TZKA 3LLSA 1E92A 3RBXA 3LC2O 4KZPA 4UAGA 2HK8A 3AUAA 2VWQA 5JSFA 1O5IA 4L4SA 4CLRA 4IINA 4GSKA 1PJQA 1F8GA 2FR0A 5TNXA 3H9JA 3F1KA 1ISMA 4NBWA 4WUVA 4J9UE 1M66A 5KNLA 4B79A 3L4BA 4L8VA 1S6YA 4EDFA 2GZ3A 5AQ1A 5JAZA 3FCOA 3JD3A 1NBOA 2FSVA 4LK3A 3GF4A 2VQ3A 3O9ZA 3HSKA 3UVEA 3VDRA 1H9AA 1ZJZA 2FP4A 2I6TA 3BMQA 3NT5A 3RUHA 4ALJA 4OOEA 4AJEA 1JU9A 1K89A 1WMAA 2QYTA 2Y1EA 4H7PA 1R16A 2BFPA 5DCYA 3VH4A 1N7HA 4URFA 3OJOA 5IZCA 1BXGB 1YB5A 2ET6A 4IS3A 5BSGA 1BVRA 3WX0A 5LC1A 4I5EA 3PYXA 1EDOA 4YB8A 2VUSA 4DPLA 2Z1MA 4W82A 4OSOA 1XQ1A 1DDOA 3KYCA 4BHTA 2HMUA 4M89A 3WIEA 1LSSA 2HSDA 3MWDB 5CPFA 1KC3A 4FD3A 3QSGA 2X5KO 1T2EA 4AJKA 3M1AA 3GDFA 3R3JA 4R5HA 4C7JA 3GGOA 3RVDA 2X5OA 1HDGO 1P1RA 4JK3A 4TZTA 4BNWA 5JAQA 1QG6A 4ZQFA 1Q0QA 4XDYA 1AXEA 4BUCA 4J4TA 5ENVA 3JYOA 1D7OA 5G0WA 1LQUA 4R54A 3IUSA 3PVZA 4YACA 1PS0A 4PZCA 4Y6RA 2J5RA 3GG9A 4BO2A 2DUWA 4J7CA 3UHAA 5TIIA 5JBIA 3I4FA 4G65A 2UUOA 3ZWMA 3HDYA 3DMYA 4FCCA 3JQDA 1YOVA 3WB9A 1ZK0A 1UDAA 3N58A 3DBVO 4IIUA 1XWFA 5A3VA 3U0BA 3DQPA 4I8XA 4IMPA 3H7AA 9LDTA 2AEMA 4BNUA 4MVJE 2RH8A 2H6EA 3EDMA 1B8PA 4HFRA 3UF0A 1O6ZA 2G82A 2UAGA 3JV7A 2BELA 4HNGA 3ZZNA 2PWZA 3LC7O 2Q1TA 1PJ3A 2C54A 1UXGA 3BTOA 3ZNNA 1Z73A 4J1QA 3A28A 1EQUA 4L4XA 1HE2A 4BV8A 1C0PA 2Y0DA 3CTMA 4CLXA 2YDYA 4GVXA 4JJIA 1QYVA 2WM3A 1PZEA 3HB5X 4A03A 3PJGA 2PTGA 1GYQA 2ZQYA 1L7DA 3L4SO 4PLZA 3RU7A 4D3SA 5B12A 1IPFA 1GZ4A 1SC6A 2DAPA 3JYQA 3FWZA 4GBJA 1Y9AA 3BHIA 1ZMOA 3MJ4A 3G0OA 2PR2A 3CEAA 1HZJA 2ZIZA 3ZV6A 2Q2VA 3PJDA 4BGEA 5BSEA 5BNIA 3TOZA 4ZD6A 1R0LA 2WWRA 3UGKA 4FW8A 3SX2A 3ZU5A 4IIVA 3GHYA 2YV2A 1P1IA 3ZU2A 5CDUA 5JO9A 2AEFA 3K2BA 4JX8A 5EIOA 3Q1LA 3CZRA 4B4WA 2O3TA 1Q0HA 1JKIA 3QVOA 1WZEA 4NQZA 1R12A 1XU9A 4E0BA 1GCOA 1BSVA 1V9LA 1DLJA 1RWBA 4BB5A 4HUJA 3ONEA 4AJLA 5DBGA 2UVDA 5B37A 3WXBA 4RDIA 5B1YA 3X2FA 4N18A 1B3RA 3S8MA 1AHHA 3EW7A
chains in the Genus database with same CATH superfamily
1LXCA 4TT8A 2WOOA 3MK31 4A1OA 2CD7A 3OOHA 5B7QA 2QTWB 1V3TA 2VJAA 1G41A 4MLDA 3BL8A 1MJHA 2FQ1A 2DUMA 2JEYA 3RNOA 3T3HA 1JUDA 2DHEA 4G4SP 2ZU0C 2BGTA 3MWYW 4M0LA 1DWQA 3WGQA 3H5NA 3ZCPA 1EGHA 3HNRA 3RU9A 2A1TS 3H1FA 1QVZA 4NJEB 3VVCA 4C6HA 5TGZA 3F6EX 4LCJA 3TTXA 3HEMA 4E51A 3GVIA 1I3OA 4NENB 4B4UA 2WJ6A 2W6CX 2R751 4RX1A 1Z2AA 1OX5A 1ZI6A 1ISGA 2K6GA 3ZZ0A 1RWOA 2Q6KA 2NWQA 3FR8A 1KTVA 3O31A 1ZOLA 4R2HA 3U3MA 1VPWA 1PKXA 2HL6A 2W48A 3MWEB 1P6XA 3IULA 4EJFA 1ZHFA 1HDCA 2P9ZA 4OFZA 1NXVA 1OT5A 1G66A 3QELB 5E0OA 1JYSA 3SFZA 4ADSG 4F4UA 1SGWA 3DL0A 3V5NA 5LA6A 2C9CA 3OO1A 3LCVB 1U3TA 4ND2A 2X0FA 1OT3A 1DEAA 1KEPA 1ZXBA 1U0NA 1UEXC 2R96A 1ZK1A 3LOUA 4PICA 4F97A 2DBQA 4PIVA 3T35A 3UCXA 4HD8A 1CR4A 2X6TA 3GL9A 2XQGA 4CKBB 1BN7A 2JAXA 1V11B 3N0RA 1FX1A 2C4WA 4HWRA 1SVLA 3OQNA 1BMDA 3ZLJA 2HK7A 3UK1A 2XBUA 1NVUQ 2GKGA 4KBYA 3ADDA 3FOZA 1H0HA 4LY3A 1GD1O 5CFOA 3PUHA 4A82A 2QZ9A 3DCYA 4QLAA 3G68A 3CEMA 2R66A 1WXDA 4QQNA 5JJBA 1WXFA 1FA9A 2HXSA 4MRVA 3INNA 3L7NA 2A58A 5BWNA 3IEIA 3N3AC 1PVOA 3U44A 3AJDA 1ZM2A 2Q9BA 4BRZA 1P5FA 1G21E 3TLZA 5LIPA 1EX7A 3FZQA 3GAAA 4F12A 1V0JA 1L4FA 4LMBA 4OKNA 1BH2A 2IYLD 1MIOB 3W4IA 4Z3OA 3W6NA 1EQAA 4BMZA 1OZAA 1N75A 2ZU6A 3Q9NA 3UY4A 1FNCA 3L6EA 2D8MA 2XVAA 1X6VA 1XKLA 1JQDA 2VVTA 5A05A 3TJMA 4BVGA 3CTPA 1TF2A 1ESNA 4IPTA 1Z0UA 4JN6B 2WD8A 1VKJA 2QVXX 1RMQA 4YAWA 1EFPA 1GUAA 4ALKA 4WBNB 2NQ8A 4KRXA 1VPLA 3IPRA 3WRVA 3WGHA 4U2KA 3OQ1A 3TEJA 2BUBA 2GNAA 4YRDA 2WD7B 1EHYA 3D2BA 4M2LA 5DBFA 4RV9A 3OICA 1UKAA 3DV0B 4BCBA 4DUPA 2HO5A 4H0NA 3DR3A 2JH9A 5KYWB 1CJCA 1ZD5A 1GARA 5LB4A 6NULA 1FDTA 1TEXA 2VWPA 4AL4A 4BAUA 4WVFA 2YY6A 3JZMA 1VBKA 1IEVA 1HLFA 2E5FA 2GZ1A 2WYVA 3A1TA 2VZ8A 2VH1A 5DT2A 3FNEA 4Q24A 1W85B 4ZARA 1IPHA 2ZBEA 1DJNA 2WWHA 3OOWA 1JAZA 2IHVA 3K3PA 5FPTA 2UVPA 1SUSA 2ATCA 1NY5A 2EW8A 2PVCA 5AVSA 3KCQA 1GL7A 1Z39A 4V0KA 1QCZA 1R3DA 1MRZA 3M6VA 1P6UA 2HGZA 4UE3S 2AKYA 3OP1A 4RD4A 3T0IA 3IQGX 3FRIA 4DCPA 4BV3A 2PN1A 1UQRA 3R5KA 4OM7A 1LJ8A 3SHWA 5IDQA 5JC1A 3JD4A 1ZMRA 1G5QA 1EWKA 3MPUA 4QNRA 4Q9LA 3I9V6 4LKOA 5JYDA 4XWWA 5JJLA 1TKBA 4OJKA 4O4HB 2PBLA 2VP2A 4LY6A 2X9VA 3ABSB 2G6BA 3WNBA 4IF4A 2HT1A 3VR2A 2CHQA 3AG5A 4KH1A 4D3XA 2CYBA 2R68A 1Z0SA 3A3PA 1J20A 4MWGA 1QH8A 4B3RB 1ENZA 3ZYCA 3QMVA 1EFRA 1Q1NA 3EQ9A 3N53A 2QD5A 3FTFA 3SR4A 4OLFA 1SA0A 4BX0A 3D9QX 3SBOA 3QF7A 2GFQA 2BLLA 3WIOA 2C97A 3I6QA 2X4LA 2NUAA 2VBFA 4M0KA 1EG2A 3S1AB 3CKLA 3LHDA 4IGAA 1JG1A 4CLDA 2W22A 1YONA 3NBFA 3VYWA 1N5IA 1T9KA 2CY0A 3W5JA 1ZJYA 2A7XA 1XXHA 3T4EA 2WJAA 4B6JA 1R4NA 3DZFA 1QHHB 2OVBA 5E1DA 2P7IA 2RHOA 4A8TA 2DKNA 1L5QA 3WLQA 3DTVD 3QKSB 2B7LA 2FETA 2GESA 4PC1A 4RJLA 4YROA 4G8DA 3UBMA 4EDHA 3SE7A 4RZIA 3AR8A 3GOQA 5JARA 1PEAA 4ZAFA 3SSMA 1Z4JA 3VH1A 2P9JA 1PZNA 6CHYA 5JC8A 3IV7A 3EZNA 3FUUA 1GM5A 3M6FA 2EYUA 4M0EA 1AG9A 2ID7A 4QHSA 4F1JA 4GP6A 1DOHA 2P8SA 1A04A 1SKAA 4G1CA 4CMIB 1SQ5A 3U4QA 3BGWA 3EGIA 4FGWA 5TS3A 1QIDA 4QTZA 3TFQA 5FPKA 1WKCA 3SN6A 5KNBA 2GN4A 1YA8A 3I34X 2QUJA 4HAXA 1ECPA 4RK5A 1WQ3A 3A4IA 3QOXA 5U1PA 4IDGA 4B3JA 1RLUA 4MIKA 4YMLA 2IUYA 3IAS1 4DBLE 1KZGB 3A7DA 1N32B 3T7TA 2O2YA 2V7UA 4CM6A 1ESMA 1UOQA 1RKUA 2XODA 3JTMA 3VR1A 2OO3A 1KO5A 3KQVA 1CX9B 4MQMA 3RTGA 2EX1A 2Z6UA 2J5XA 5G40A 3L7MA 4G5FA 4GOND 2G7ZA 2VQEB 1GYPA 5SYMA 4IM7A 1QYIA 3CKYA 4HATA 3RVOA 3VU9A 1AV7A 4PRYA 4CI0B 3FTNA 2IHZA 3MS7A 3G79A 3WI7A 1MAAA 2ZIVB 1U28C 2YHAA 2HSEA 5C4MA 1JNYA 3MMNA 2YMMA 1DZ3A 1DQRA 1N6IA 2Q4OA 4AZVA 2GPTA 5JNVA 2WTMA 4H18A 3ZD7A 3RYCB 4JLJA 1Q50A 1NP3A 1M2FA 1L5YA 4LZAA 4BKOA 1AIPA 1TJNA 3ETHA 1W2GA 2WYOA 2A86A 4N5DA 4OSPA 3G0DA 1WP4A 4OK3A 2M98A 5DGXA 2WFLA 4R8VA 4YRZA 4KXUA 4QYIA 2AVNA 2CUNA 2CXRA 1I33A 2XQVA 4IX1A 2J7KA 2X15A 4HLQB 4OYHA 2OAP1 4KQHA 4K6CA 4PSCA 5ALJA 4CEHA 1KRXA 3LT0A 3WLJA 2XDQA 3FFWA 2QAJA 4HEA1 3BMCB 2XGGA 4RSRA 4EVSA 1UT8A 2OWEA 2J33A 1XLWA 2AC7A 2IZ1A 3OE7D 3ZIDA 1T5DX 2HU2A 2B0CA 3Q41A 4WKNA 2XQFA 5L3SB 4Q4HB 2Q5HA 1TFRA 3H1TA 1PS8A 4X6XA 5FFMA 3V1TC 1Z2CA 1ZA2A 1XEXB 2ANCA 2HNBA 4G1UC 4K9DA 3VKWA 2FX5A 3PC6A 4HPWA 3CPJB 2FGJA 3VR6A 3WMEA 1J49A 2W8ZA 3HGTA 1NSFA 1RLMA 4AJOA 3WAGA 1YI8A 1IU9A 3V4RA 4AMUA 4M0FA 4ODIA 2AQIA 2R4QA 3UXYA 4BLQA 4UNSA 4AFNA 2OSVA 5LYYA 4KQ9A 4EPWA 1RR6A 2BSXA 2VYQA 2Z08A 1DXQA 1QX4A 3T41A 1PLJA 3PUJA 3ULKA 1OPRA 5FPPA 4AO6A 4IL5A 2PEZA 3DVSX 2C4TA 4L50A 2FYTA 3BJMA 3DGEC 3SFVA 4MS1A 2ZWPA 4CF3A 4LMRA 1UWLA 3SJZA 4YMVA 4DLKA 3R7BA 4NCNA 2XLCA 4L3OA 2BF4A 3IAM6 2AFIE 4K3VA 4RPHA 3I2GA 3TQTA 1TMYA 3GBVA 3A4NA 3WXMA 4ESOA 5CA1A 2QYSA 4NPCA 5L7TA 2BLNA 4RPCA 4NE9A 4BATA 3SHVA 3W05A 1UJ5A 4XYLA 5KKAA 2XMBA 2XOKA 4HXFB 1QDLB 3DW3X 1R6BX 4JNCA 2OYCA 2QTCA 3OCUA 4R2IA 3AR7A 4MHSA 4CIWA 4YR9A 2V6BA 1QHSA 4UAUA 1AUXA 2IX9A 2BMFA 1L7BA 2R6GA 4B9AA 4F7WA 5JRDS 1AQJA 1WVIA 4NCHA 1HRKA 3CO5A 2JVKA 1GPJA 1FSGA 3PV0A 5DGIA 2R6JA 3GIWA 3L1KA 4E7OA 2XVMA 2RJOA 4R1LA 3E48A 3AVQA 5AQEA 1E1KA 5EZ5A 1M0TA 4DSTA 3A2MA 3DMTA 3NH6A 2YXLA 2GBIA 4DT1B 5G3YA 3EXAA 4MVJP 4Y6GB 4BLTA 3DEJA 4CKWB 1U0BB 2FW6A 3OEYA 3SOPA 2IXFA 1SU4A 1MU0A 1RQRA 5E6RB 5KMGB 3OEED 3RVLA 1VCMA 4CMBA 2Z43A 2OGWA 3P0HA 4MQFA 3IE2A 4YJFB 1EWRA 1Q7TA 1Q2UA 5HJ5A 3A4LA 3TM4A 1JJAA 1EJ6A 3UT5B 3BFVA 2QRPA 4JOCA 3FRJA 4XLLA 1PT8A 1CY1A 3RS0A 1LLUA 3NEAA 5BPHA 3VKHA 4KOAA 5A4AA 4UQOA 4CIXA 1ZC4A 3AW8A 2XZDA 2JFPA 1Y3BE 3DCJA 2XHEA 3C43A 1O9HA 4DSNA 3H9UA 3ZDYB 4B3IA 4GH5A 1Y63A 4KWEA 3EZ2A 1F5SA 1NF3A 1E7MA 5CEEA 1Y8QA 4V0SA 1BXRB 1G8FA 1HT2E 1MRSA 2BGGA 1QV6A 3CW8X 4TV9F 4RH3A 3GLFA 1Z56C 3KKEA 4WXPA 3ER8A 1R1DA 3QVSA 4X7PA 1EMDA 1ONNA 1SXJE 4D8XA 3WNVA 4IQFA 2PLWA 2YIDA 1XYVA 2PUWA 2Q3DA 4S1TA 1UINA 4W4TA 5C80A 3SMQA 3LXMA 4ITRC 2X8AA 1DC8A 2ZRAA 4KU4A 3B7GA 4WBXC 1WE2A 3CGGA 3CE9A 4B75A 1PF7E 1SCUA 2WA1A 3EASA 4C2AA 2QW1A 3DFKA 2QLFA 2XCIA 2YBDA 2XGJA 3VMFA 1WQ1R 4CTMA 2IPXA 3HFRA 2JI7A 3W5AA 1Z17A 3TOCA 4QDZA 2BEJA 2PLAA 2XT6A 1QANA 3RSCA 2FPIB 4A10A 3B9PA 4ZVTA 1TC1A 5L4LA 3D4OA 3IP1A 2ZUDA 5DXJA 4LWPA 3T3OA 3FFXA 3IOYA 3NJ4A 5DF1A 1X2EA 3ZS8A 2BKEA 1H65A 1Y1PA 3QX9A 4PC3A 1J1ZA 2G77B 5EJMA 4IH1A 2DTDA 2A8YA 4RGBA 2K7ZA 5A4IS 1KFKB 1XRMA 1C9JA 4OQPA 3L8FA 3BWCA 3V4ZA 4MYHA 1H5UA 4Q0MA 3NHMA 4IBOA 4WD3A 5DHAA 4PCAA 4RH1A 4CMGA 2V7QA 1T8WA 3BF7A 2HF9A 3I1YA 4IRUB 3C1AA 1CS0A 4QU5A 1ZSNA 1SO8A 4KVZA 2FN3A 3ZKWA 2WSYB 4E31A 4HH1A 2JI6A 3N7TA 1I4OA 4DL9A 1NMSA 1A9XB 4BO4A 4PCUA 1E63A 2FDRA 5DP2A 2H4JA 5EQJB 5BVGB 4G6ZA 4Z3DA 5E2AA 4DUGA 1MH9A 4NKRA 1OIXA 1SVMA 3ZHBA 5IKXA 1M7HA 1NKTA 2C00A 2HRZA 3ZH9B 5HR5A 4IXMA 3TNLA 5LLDA 2PWAA 4YCAA 4ZODA 4DPMA 5ED4A 2BSAA 4F6RB 5KYUB 2OCBA 2VATA 4GF5A 1HI9A 1UKEA 2EP8A 2JIBA 1VP3A 3DT8A 1FRQA 1JT9A 1ZD2P 2YRXA 3NOOA 1BE8A 1DX9A 1C8KA 1H2ZA 2IVFA 4F6CA 4HB0A 2W90A 4KWCA 5EE9A 3IAAA 5K20A 2JGJA 1Q0RA 1BYIA 5F35A 3MUEA 2A78A 3UPTA 3AM1A 3B52X 2VF4X 4J0HA 2QNRA 3AERB 1YF3A 3VI4B 4ZV4A 3HKEB 1C9EA 1DIBA 1XHFA 2OL4A 3T1VA 1RI5A 3M82A 4DDHA 1II8B 2EAUA 4F9GA 3DDZX 4AB1A 3K70C 2IH2A 1IB0A 3NOQA 1B8VA 1J42A 2CF5A 3SS8A 3PLAE 1K8YB 2F64A 4I1YA 3CS3A 1RZVA 4CUJA 1D3AA 1JPJA 4EWLA 4EF6A 2Y6VA 3L0DA 1N3BA 2ZRHA 1P5ZB 3ZWQA 1MABA 4RXUA 3AK4A 5DNVA 4D4IA 4D1YA 4R5MA 5DM2A 1RFGE 1T1RA 2J3IA 4HN4B 3QOFA 3GEDA 1W5AA 3ZNPA 3RJTA 5KSYA 3B3QA 4TKUB 4AP9A 1M6WA 1JR4A 1U0OC 1BHSA 1FP6A 3MTEA 4RORA 3TQFA 2XGOA 1ETUA 1GZHB 2AL7A 2WE8A 3HA2A 2BI8A 2QXYA 3HBFA 1Y8RB 2MR6A 2ZG6A 5IT0A 1BX3A 3EFBA 1T4DA 3EFOB 4EJMA 1R0CA 2XUKA 3L40A 5EE0A 1LLQA 4P98A 4CLOB 1P81A 1NOIA 1J2UA 1UL1X 2BKXA 3PUIA 4YONB 3N5CA 1EWQA 3M2PA 3CMCO 1H2XA 1Z8DA 4BNNA 3TS1A 2YR0A 4AUEA 4LC1A 2R2GA 4KRFA 4UM9B 4J1SA 1VJ1A 3EGOA 3P2YA 3TAUA 2P4QA 1P2FA 2IHYA 1OE0A 1NKSA 4IWYA 3WGLA 4C29A 5BW8A 2BFCB 3COSA 3MCVA 5HJ2A 3WNQA 3QV2A 4PY2A 1TUEA 4NC9A 2IUTA 3C2QA 3K0KA 4OJMX 2PSDA 3F2VA 3WY9A 1ZVJA 3E18A 4U8GA 1V7PC 5GZ6A 3H2ZA 3ZBPA 1ILEA 2RSLA 2DLNA 3PFGA 5FR2A 4D0SA 3FLAA 5IK2A 2Q2NA 3DE3X 1JJVA 2XMSA 1FQWA 1WSBA 1P0IA 1E2JA 4N47A 1QYWA 2ONJA 1JHAA 4KN6A 1RWXA 3HXOA 3RRJA 1LX6A 2BMWA 2BZGA 2R8BA 3T95A 2JGLA 2ST1A 4YP1A 4D3FA 2JFNA 1MVOA 4WZAA 2ZTLA 4PBSA 1GKLA 1BKYA 3R0IA 3ZD6A 1NATA 3QPAA 4KLNA 3AIMA 2WV7A 2PJDA 2OBFA 1Z7YA 1UDXA 4YJ3B 3D2CA 4ZOCA 2HXYA 3E9NA 1Z3CA 1Q1EA 2W6ZA 4V03A 3OHPA 1SUCA 2BP7A 4JLUA 3IOCA 1P74A 3ONDA 1E6MA 2X8JB 1JBEA 1L9XA 1ISRA 3C39A 4IHAA 4YIKA 5DBOA 5E9WA 5I7UA 4C2UA 2V6MA 1JDPA 3FRHA 3M8KA 1A0OA 1ST2A 3D02A 1ZNWA 1L2TA 3DWGA 3MOSA 4BZQA 4OQDA 1H8ED 4EI7A 1M1UA 1TTQB 1EJ2A 1KDPA 4JVOA 5ALXA 1VL1A 2MYPA 4MRSA 4MO9A 1IHPA 1WX1A 2ZJ7A 3AI3A 4GXRA 1U0FA 4C14A 2CF6A 3EG9B 1GV0A 2FCRA 3L1IA 4Y0NA 1W49A 4NJOA 1JYFA 5ALZA 4ZT4A 3TVTA 1IUPA 5LD2C 5E4FA 4G8CA 4ZI3A 4MA4A 4A73A 1ZR4A 4G5HA 1ORRA 3ZJ5A 2YBEA 2EFEB 3KQKA 2Z4TA 5ICEA 2C2KA 2FR1A 1BHO1 3BFJA 1EFKA 1TUIA 3FBWA 3MJCA 3NU1A 5DISB 1T6XA 3NXKA 5E8JA 4B5KA 4R8RA 1NF8A 4D0GA 3ROGA 2P1RA 1E4EA 4Y2RA 1QFYA 1AK9A 3MIIA 5I48A 2QW8A 4LN1A 5KX5A 2F4VB 5ALVA 1Z2PX 3OG9A 2PT5A 5A4MS 3LW8A 2X7JA 3G9TA 2Y05A 3HXTA 1ADBA 4NBNA 4RAOA 3X1WA 1ZP6A 4OGFA 2QJWA 3KYDA 4I4CA 3O03A 4LZLA 2F1RA 1FFEA 1P80A 1T3ZA 3P96A 2WYUA 1I10A 4TMKA 1RPJA 3B1FA 3RK1A 1TQ8A 3CB2A 4WY2A 3WSWA 4KSBA 5CVUA 3HJNA 5BSTA 2IHKA 1PK9A 4D4GA 2PGLA 2VDQB 3EARA 5J47A 3SKYA 4RY9A 1P31A 1SKMA 3VTAA 2WQ7A 4Y1RB 2OPHA 4RS4A 2XDYA 4BFXA 4F93B 5KJFA 5KBYA 3M34A 4L78A 4BYMA 1YOVB 2CVHA 5KOYA 2HRDA 1JH8A 5IX8A 4LFAB 2ZS9A 1U7WA 1FTGA 4D44A 4XIJA 1LU9A 4AURA 1IY2A 4MVJD 3V8NA 4BNZA 1E3LA 1CZLA 5FDFA 1HPLA 4X6YA 3W34A 1BFKA 3MCTA 4E4RA 3GPLA 2Q27A 2ADOA 1FDIA 2EERA 1RWVA 2FLKA 2FJ0A 1NDQA 2GCEA 2R1VA 3G23A 4R40A 4EB3A 3ICVA 2IOHA 4AP5A 5LCXA 1UJNA 3NGLA 4M87A 1KHTA 3U40A 3N39C 3ZDQA 4FXPA 5F21A 1SULA 3RBAA 3H11A 3SJCA 1SXPA 4AXXA 4RE5A 4ZDWA 1U4NA 1U8YA 2H1HA 3DUWA 1KMCA 1NW3A 1QK3A 2JJYA 4XKJA 2JFZA 4D0RA 2WPDD 4JJ8A 4L5AA 1CVLA 4GI2A 3F96A 4IV5A 2G80A 1L5HB 1O6GA 1C8VB 3DMTC 3IJRA 2QDXA 3GJRA 3IBSA 2DKOA 5IVIA 3OESA 1JTVA 2QA5A 1W30A 4FFRA 2VYCA 4UBJA 3GRKA 3ECCA 5IMBA 2A5JA 2M2IA 2ZRFA 4QU0A 4BBPA 4N54A 1M34B 3GJ3A 1ULUA 3FN4A 3COPA 3DHVA 3CWCA 4JCOA 4DN6A 4HVCA 5A4JA 4AU1A 3BHNA 3WTCA 3NPAA 5BUCA 2Q5QA 1M2WA 2GUGA 2WY2D 2UZ4A 5DK6A 4MVWA 3BWDD 4E2YA 1Z29A 3LRPA 1MXHA 1XKQA 1GG8A 2PFSA 1FP2A 1EUCB 5K5EA 2TMYA 2BM0A 4I6JA 2HA0A 1J22A 2P2SA 3R6DA 1OWNA 4RVOA 5KNCD 1YBVA 3AB8A 3AR9A 3KELA 2ERXA 1L4LA 3DDOA 2ISCA 5IU6A 4UU1A 5I45A 3OZUA 4UNNA 5KTYA 3RWMB 2O20A 5B7NA 5LQKA 2E49A 2LE0A 1AQLA 4M8KA 1KOJA 2QRVB 3AG6A 3QIAA 2CDAA 2P5SA 1UZNA 3VSBA 3A06A 1XTZA 2DPMA 1IWPB 2QN1A 3OOSA 5T6MA 4Q4JB 3P2OA 4IIGA 3C3WA 4WXMA 3FDIA 3AU8A 3I6ZA 4TMYA 5TJ9A 2PGNA 4C2TA 3QUAA 5F64A 1UBMS 2J41A 3IAFA 3IPYA 4MR8A 2B92A 2TS1A 4UPDA 1PJ2A 1QP8A 2WG1A 3TCNA 3WSVA 4B34A 4EJSA 5IBQA 1WOMA 4IQ0A 2ZRNA 3FA2A 4EH1A 5D1NA 1X74A 4OEHA 1NNLA 1Q1AA 1T3LA 3BZBA 3F6RA 1OLOA 2AR0A 2V5AA 4CN9A 1EFLA 1G3UA 1SUWA 3GDOA 1B4DA 3PNYA 4JHXA 3W2TA 5JRZA 1AZWA 4JJEA 4KGDA 1USWA 4G1BA 5JALA 4O6VA 5BMVB 4DCNA 2OBNA 3QE2A 1GPBA 2GK6A 1EAYA 1MX5A 3DPUA 2XAUA 1NHWA 1JIKA 2ZVJA 2VSQA 4BVJA 3RC7A 2E9SA 1EGMB 2VOEA 3CLUC 3PDHA 5ITVA 1S3SA 3RTBA 1P61B 2NVBA 1AQ6A 3VPAA 1JA9A 1XNGA 4RPKA 5FL3A 4F4JA 5JSQA 1IBCA 2G9ZA 4ABTA 3WKDA 3N2KB 1KTIA 2ZB3A 1E18A 2B61A 1MOQA 1OYYA 1XEWX 1MO5A 3LNTA 4RMGA 4X84A 2I1WA 4WGFA 5KTOA 3E5NA 3M6LA 4WLUA 4POOA 3CVWA 1EAMA 2YH2A 5IDYA 1MA0A 2BI4A 5C37A 2OP1A 3UXEA 4GDFA 2Z9DA 4R1PA 1YQGA 4WASA 5CPBA 4BO6A 5HM6A 5HTOA 1G20E 2K7FA 4QDXA 3MYYA 2X9NA 5A62A 4ZHQB 1Y4ZA 3DR5A 3E22A 4N9WA 3LOPA 4X64B 3KZVA 4KGXA 2BGNA 5DWDA 3AHJA 2BCEA 4JL8A 3L1UA 3UJHA 3W9YA 4QTYA 5CA0A 4BKQA 3EXIB 3L7JA 4YV2A 3IQHX 4OXXA 4A8HA 2B4KA 2CJFA 2X1HA 3TE7A 2ZUEA 3F3SA 3JAMA 2A1UB 2HYIC 1W87A 5DW3A 4Z54A 2FI1A 4HAIA 4IICA 1RZRD 1T29A 3HXPA 4RC9A 1M74A 2CJWA 4O02B 2D6FA 4TT3D 5HEKA 5K03A 2FNAA 1UH5A 4PYIA 1Y6ZA 2YN2A 3R5FA 2NSDA 3B3FA 1M6VB 2JRLA 2BFDA 5F73A 1WSDA 2KBEA 2B8EA 1T2AA 5JRJA 3LK6A 3LS2A 3U5TA 4UUAA 5CT6A 4YRJA 2V7TA 5IUKC 4N76A 3IH5A 4KLRA 2O2DA 2AJBA 1L6RA 1DJOA 3K1AB 3UOGA 2H1VA 3K9CA 5CX4A 1UXJA 3E7FA 2CVOA 1DIOB 3JALB 4QNMA 3PNBA 1Z82A 3ORFA 5ICCA 1M0WA 3KQLA 1TNDA 2C0QA 3G2JA 1JJ7A 1HWYA 1I30A 3A4YA 4BTEA 4YCSA 2XA9A 2WUFA 1ZCJA 1DKUA 1FE8A 2OV1A 3LQFA 4IIJA 1QNFA 2I65A 3PE6A 3Q3EA 1X2BA 4JSRA 4JZKA 4PZEA 4I14A 1A5TA 3VR5A 3WJ7A 3IJEB 4XVUA 3WMRA 1S9HA 3AL0C 2DE0X 1C50A 1L5OA 2A0XA 2FWRA 2LDBA 4ZCPA 5EUCA 5JNLA 4OQXA 5LQJA 1DAKA 1F7UA 5H3LA 2ZYGA 4MS3A 4K0RA 1HYBA 2P9YA 1WB9A 1CUWA 3Q15C 2DY1A 2IF2A 4XR9A 1QMGA 2RC5A 1EHCA 2HLHA 3BEOA 3QUTA 4D81A 1RRFA 3I9JA 4X3OA 5GV7A 1LF0A 3JATA 1X15A 3T7EA 3ILHA 3T3PB 3WZMA 4B45A 4PYOA 1A96A 1LLCA 3I1JA 4Q7LA 3ND6A 1L3BA 3PCRB 3GJQA 3Q1KA 2D2IA 4ZTZB 3NH9A 5KHAA 1TX4B 3M5PA 2ZJ6A 3W2IA 1U7PA 5DNUA 4Q02A 1T5TA 3VU3A 5HF9A 5EESA 4F38A 1IZZA 5FXMA 4TN1A 1Y6QA 4NYIQ 5FTWA 3JWIA 3BDAA 2QQEA 1WIWA 3VU0A 3HO6A 1FJHA 3FNQA 4OM8A 2P9GA 2BKUA 1E2QA 1H6BA 2WKQA 3O8CA 2QLLA 1MB2A 3H4IA 2Z9BA 1TKAA 3G9XA 3FLMA 2G4VA 4RK1A 4Y1EA 2C7PA 1Z3IX 2ZWMA 1PL0A 3D5EA 1O2DA 3H9QA 4TVBA 2DU8A 3BTVA 2R84A 4HWSA 2GWHA 1JZSA 2I4NA 2PMKA 2C78A 1P4SA 3LXXA 3TNYA 5C1PA 2Q2WA 3E82A 1DG3A 5LMUB 2JLVA 1SXIA 2B37A 4PZAA 4C4YA 1L5WA 3EBLA 4L2IA 2BFAA 1UZAA 4AI6A 5DNDA 5I9MA 1UC5B 1PNQA 1E3WB 3ZGNA 5JADA 2JIZA 1YK1A 1CUFA 4LC0A 4WSOA 1HO3A 1OXMA 3VR0A 1IVYA 1N34B 4XSGA 3MUOA 2WWIA 4NQRA 4C4ZA 4FZVA 4MQ5A 1EM8A 1UXHA 3IQXA 3K5PA 3L0YA 2Y2VA 4HX9A 4ZC8A 3IEMA 1TEZA 3P32A 3NAZA 1YFKA 5MGNA 3AEUB 2M32A 3CVVA 4HVLA 1N3YA 4CTKA 4AWXA 3BA1A 2HA2A 1G64A 1WZCA 1O77A 4LZJA 1WCV1 5LYJA 2OA0A 3TGPA 3GUCA 3D1LA 1YQWA 2AQKA 4KV9A 4K7JA 1XXLA 1BWRA 2OBBA 1G8SA 3KKNA 2NU6A 3PR2B 3P9SA 3X3HA 2GBCA 5AVTA 4GE0A 5C8YA 3CCBA 1U8UA 3NG1A 3PEVA 4F4DA 3G1TA 1SZPA 1U1FA 3I2JA 5CW1A 2DETA 3H9BA 4G5YA 4YT8A 4KXYA 4YCNA 4LI3X 4ISCA 3TXAA 1E6CA 1AHIA 4LIPD 4GX1A 4IZ6A 2I2WA 4Z4IA 2CLFB 1RQ2A 1OYWA 3FPJA 3D7MA 2G9QA 1WUJS 2R8XA 4XAQA 3RF6A 1ZISA 3IVCA 2P40A 5HIJA 1P2UA 3GLHE 3IDAA 3STTA 2PQ0A 3VHXA 4CHGA 1TIPA 5EJFA 1XALA 1L4KA 1AMUA 2DB3A 5B4UA 3OURA 1HYGA 1H93A 2RJ3A 4YAIA 4G56A 4O4IF 1XRSB 1ITZA 4GZLA 3W5BA 2Z0MA 1LI4A 5CDFA 2QPLA 2ORVA 3ILXA 4N7JA 1K5GA 3I9FA 3TKLA 3CBQA 4QO8A 1GU0A 3K9BA 4O1MA 2GT1A 1FPQA 3RW9A 5LLTA 5AW1A 3E58A 1SXQA 1OXUA 3WBBA 5L3QB 2R44A 3EVFA 3LH5A 5ULLA 4ID9A 3RUAA 4L16A 4KIJA 4D3YA 2B4QA 4PAMA 2PUAA 5A1JA 1EE2A 1JU3A 1MAHA 3PIRA 3QF4A 4K05A 5ER9A 4BO9A 5KTKA 4IOJA 1GADO 1U8TA 2MSKA 2VC2B 2ZXFA 4L8FA 4LDQA 1D2CA 4I50A 1U02A 5EG5A 4TN5A 4TXJA 4KLZA 3CURA 4C0WA 2IYWA 4J6EA 4LYEA 4M8IA 4RE6A 5ITZB 1YS2X 3GDWA 1K6IA 2DT5A 2XB9A 2PUTA 2YHBA 5EXEA 4LDZA 1A2BA 2J09A 4ZT5A 4Q1DA 1OFVA 3SOZA 1M2JA 1ZM9A 3F4KA 5KTPA 2C4HA 1M67A 1R15A 4G81A 1R8YA 1T0PA 1EVZA 1JVBA 1AKTA 1MKYA 2PGIA 3QI7A 1KYYA 4Q3NA 5FV7A 5KQPA 2ZAOA 4O25A 1QM5A 3H6GA 3ANLA 4KHZA 2PO7A 1U2DA 1NVKA 4YJGB 1B26A 4EYQA 5I47A 2AR9A 2E1PA 3O4RA 5HKKA 1RXEA 2Q0HA 3TZHA 1PWYE 4FZJA 1J06A 5EWJB 4ZHSA 3SIRA 1DCMA 3UJ8A 5I7VA 1N2CA 4CF5A 1E6WA 4UNQA 1QF7A 4RTNA 3NKLA 2CL5A 4V3CA 5AVKA 1UJMA 2W6OA 4PNPA 5M7EA 3TUZC 3JYNA 2NXJA 2OKCA 2XKAA 3FPBA 3OKAA 1MG5A 5JUWA 3HYCA 4EO9A 2QZSA 4LRQA 4I9UA 2QLBA 2EJVA 4LWOA 1UMBB 2FW9A 2AG6A 3UG7A 3ZJ4A 3S40A 3ZGXA 4MK4A 1FYDA 4YUXA 1XMSA 4DQKA 5AVOA 5ALRA 4EAQA 2GYYA 3VI3B 4D99A 1QFMA 3DDUA 3R75A 4MX8A 3F7NA 4C6TA 2EJUA 3WLTA 1LPPA 3TSCA 3K0HA 3NWJA 2JKZA 4RF5A 4N6OA 4IIFA 4AP6A 5ILOA 5EFOA 4ILKA 5LXTA 1SBZA 2PYIA 1OKKD 1O6FA 1QF9A 4MVJH 4L6IA 5EC8A 2ZBFA 4DMGA 3L8ZA 2VCYA 4URVR 2F90A 3OO0A 2QUBA 4Q4AB 5JSKA 4NIMA 1G2PA 4GO1A 3BKWA 3N2NA 5ESWA 1GPNA 1L7EA 2HA6A 4LRUA 3TUJC 3AXTA 4EJSC 1RBYA 4ZVVA 4CIDA 4JBNA 3L3BA 1ZJ4A 2W2OA 1GAWA 1KZYC 2Q46A 2QROA 2ACVA 1TT5A 2HBRA 2I33A 3PNQA 4R81A 2I87A 1H8HD 3BMNA 3HYTA 4NCIA 4DCTA 3ZW8A 1EBBA 2R2AA 9ABPA 3LQYA 4MR9B 3L0OA 5GZ1A 4MOWA 1QIIA 2Y0BA 4X00A 3PX2A 3AIOA 1FPMA 2AW3A 4R2XA 4IKOA 1T0UA 3DEIA 1JKJA 3ROPA 3SP1A 3U3DA 2JCSA 2G25A 4MQUA 5EZSA 3T3GA 4QUEA 1XRLA 1JDBC 1SBNE 4HGQA 4L6AA 5BT9A 3O1JC 2O3JA 1J90A 2V5VA 5FCDA 4OHMA 1FNNA 1PEDA 4F60A 2RB5A 3V1MA 4PZUA 2EKZA 2PL5A 4JLNA 2IK8A 4X44A 4E2WA 2PXXA 3EC1A 4LKRA 3LPMA 3G2IA 4OQ4A 1COWA 1XB2A 3H6KA 3JYPA 2OD2A 1KO4A 2AKAB 1XC7A 3KWFA 3N87A 4I9NA 3OWOA 5A7HA 2ZE8A 5J4LA 1LQTA 1PBTA 2FMUA 5B3JA 3O83A 2HJHA 2IOFA 3KBBA 3OQIB 1PE0A 2BT4A 4K9QA 2GPWA 4YAUA 5IWAB 1CHDA 1O8CA 3VOAA 4L5JA 4LPKA 1I6LA 5DRTA 3TSZA 2OENG 2NYVA 2ZK7A 2XTAA 3QV1A 2G36A 4LXXA 1VMIA 1P60A 4N3GA 4E5VA 4RDHA 1T2DA 4P84A 3ZE7A 2JFGA 5A2GA 4HQRA 4EF4A 4U9UA 5DBEX 4Z3KA 2IEAA 4M7PA 1MV5A 4BLSA 4EYSA 5DGTA 3S2UA 3HWWA 4N7RA 1N5LA 1G8JA 1JZTA 2O4UX 3LDUA 2CD9A 5AKZA 4LGMA 4ASUA 3RAEC 3W5CA 5G0SA 4F5YA 3IQEA 1Q84A 3CU5A 4GYWA 4ALLA 4WDQA 3I2KA 2CYCA 1WEHA 5HE8A 2RG1A 3PDUA 2NX2A 3IP5A 4S24A 3H17A 4O33A 3UMJA 1V3UA 5B1EA 1OZHA 5AOBA 1XMPA 2FQWA 4QEZA 3WWPA 1TEHA 3A6HA 3UJPA 2O6HA 5HQ3B 1OASA 4WZBB 4A2WA 1NU8A 3EFHA 4UVDA 3DLIA 4JLSA 2ZIXA 5AO9A 5F5NA 2G04A 2M6SA 5JH7F 2RIRA 1CUZA 3QK7A 4RA9A 8LDHA 4I4LA 3IX7A 4NMWA 5D86A 5K3SA 5AH0A 3FCXA 1A98A 4O3MA 1MHTA 3QMPA 3KV1A 5EE5B 2CCJA 1IQUA 3C5HA 3C7AA 2C2XA 2NAPA 3G0HA 1ORVA 2YVKA 4PAWA 5KQRA 2QTVB 3GN1A 5A04A 3VR3D 1GP2A 3L01A 3PQDA 3L8DA 4KQGA 4L0QA 5T4HA 5FAKA 2ATXA 4OF4A 3D7LA 2O8EB 4FOPA 5ITSA 4Y9TA 3L8HA 4Z0TA 5A0FA 5D3MB 3RUCA 1BS9A 3VU1A 1J8YF 1T13A 2O14A 1WPXA 2LGJA 3LTNC 3AOEA 2O54A 1GFIA 4YLYA 2Y1LA 3DV9A 3W2FA 3ELDA 1OFUX 2IIBA 3I9OA 4BO0A 3MBOA 2RH5A 1LPMA 3G8BA 2IZ7A 1QCCA 2FXVA 4IX9A 1U2PA 3V8QA 5L4SA 2HLNA 3EMKA 1W29A 2Y1CA 4DXHA 1VI2A 2FUCA 5AM5A 2ENWA 2JB9A 2XUDA 3D6HA 3O8DA 5FUXA 4IVQA 4ZAYA 1XMIA 4EHJA 1GPH1 1Y34E 3FPCA 3RF7A 4EX7A 1BXGA 3OETA 2DM6A 4MPDA 2WF8A 3GEIA 4U3JB 4US2R 4BP9A 4B7UA 2POCA 3SSNA 1ISPA 3LYUA 3P97A 4CCYB 4MP8A 3CINA 1EE1A 4JI5B 4F46A 5JCJD 3MJHA 1LZKA 4U9HS 1B8UA 3BXXA 1ORIA 3PWSA 5F77A 1DJQA 2DSTA 2HB6A 1M1NA 4O8ZA 3T06B 1XNRB 5DFAA 4EUEA 1KO1A 2ID8A 4FFBB 3RG2A 1J33A 2VUUA 1HDEA 2ZRIA 4NS4A 3QGMA 1KY3A 1WXHA 1RNLA 3I2IA 3PWZA 4B81A 1NV9A 3QLUC 4ZVSA 5IVPA 2PL1A 3A11A 2ZSBA 4Q93A 4YV0A 3SC3A 5ERYA 2GD6A 2J3LA 1LPAB 2P9QA 4D26A 4TMXA 2Z6VA 5KVCA 4KDCA 4MGIR 4REQB 3KT6A 4Y2HA 3PLNA 1FYEA 1TKCA 1SIWA 3DP7A 4N9QA 5ALNA 4CR7A 5JZMA 4P31A 3MJRA 1NBMD 3S8YA 2MYUA 3T1TA 1XTBA 3B5IA 3PXCX 5GOTA 2VYFA 3FNRA 3PIIA 1K9VF 4LXUA 5AI0A 3IUQA 4Z1OA 5K8UA 2VP9A 3WKEA 1TQ2A 3D1JA 1WV1A 2R47A 3C3AA 3VZPA 4A6PA 3W77A 2IE0A 3I28A 5A03A 2FFHA 2RHCA 1J0XO 3B3AA 3R24A 4V0OA 1XCLA 4FNOA 2Q4EA 3CPHA 3B9BA 5ERGB 4MQEB 1MC4A 1NI4B 2O1XA 5EI5A 5CXQA 4GLLA 4WWHA 2CW5A 4PN3A 1NUHA 2GM5A 3ABZA 4FMDB 4Q16A 2BE9A 2QJOA 3DKVA 5CT8A 1NAHA 3C8UA 3N8KA 3TX6A 1N4DA 4N7BA 4LVNA 4UCFA 1CS4C 2GA8A 3Q2KA 4QELA 4WFIA 1YR9A 3B60A 4P0PB 4FJ2A 2R97A 1GNRA 1E2MA 1PT7A 1QKKA 3B78A 4TTQA 1HT0A 2B83A 2OGUA 1WD5A 2ADFA 3KHSA 2BISA 4CKCB 5I9IA 1WB6A 1EWYA 4O63O 3KU1A 4KXLA 3EAGA 4G4IA 5HRAA 2VNKA 1E5DA 5E2IA 2EQAA 4LQCA 5I7HA 1U4OA 1X7WB 3VPXA 4OPMA 4GL2A 4FX2A 2UV8A 4TV8A 1PSZA 1E9RA 2DPLA 2X8LA 2ZEJA 5DLPA 3SQNA 1JMVA 5WRFA 3OEHA 4ZCQA 2P67A 4HNUA 4EX6A 4LBWA 4E07A 2WMYA 1AOXA 2XMZA 2VI5A 4QQFA 4B35A 5J43A 1Y3FE 4DABA 1U0TA 2JZNA 1IN5A 3RS3A 3UHOA 5JCXA 5JLJA 5JJCA 5FWYA 3LA8A 2EFYA 1Y7LA 4LOIA 3GP5A 5EUMA 2CNWA 5FA5A 2GPSA 2KYRA 3ZQKA 4DLLA 1JWLA 2MINA 1TM4E 5AXAA 5BN3A 1QPZA 1CU1A 3M6IA 3IEVA 2EEZA 3OE5A 3Q7SA 1UFVA 3KXLA 3DMDA 1E2LA 4EJ6A 4HAUA 2OC4A 3BWBA 3P4XA 1HA3A 3PICA 1KDVA 5IJWA 4HWTA 1WHSB 1NFRA 2QR3A 1HYHA