1LRKA

Crystal structure of escherichia coli udp-galactose 4-epimerase mutant y299c complexed with udp-n-acetylglucosamine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPACWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
publication title Structural analysis of the Y299C mutant of Escherichia coli UDP-galactose 4-epimerase. Teaching an old dog new tricks.
pubmed doi rcsb
source organism Escherichia coli
total genus 126
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lrkA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1lrkA01
2Q1SA 1HLPA 3W8DA 4CL3A 4ND2A 2FPPA 5A3JA 4BNTA 3GZNA 2VHWA 1LRLA 1U8FO 4CM6A 2I3GA 3DMTC 4U0JA 4CMAA 4D42A 1HDZA 2CDAA 4R1UA 3U4CA 4N18A 3K30A 3WGTA 2FY8A 2NQ8A 3ZWAA 2B36A 3NRCA 4LISA 5COBA 3E9QA 4PZCA 4EBFA 4DUPA 1C0IA 4J0EA 2O3QA 3VHRA 4I1IA 3G49A 1ORRA 4A0SA 3D64A 4RV9A 3MJVA 3RBZA 3PYMA 2UV8A 4MVJG 3IKTA 1ZK0A 2CDBA 2JCVA 1C3VA 3GEMA 1T2DA 3N58A 3V5NA 1T26A 3WWZA 4A03A 4YJHA 1T4BA 1EDZA 2O7QA 5TT0A 4FJ0A 3HWRA 3GZ4A 3AY3A 2EJVA 2A35A 2IODA 1U3WA 4DTIA 2H5LA 2YUTA 3ZWBA 2O3TA 4IXTA 4RLSA 2E6UX 2O3SA 4XRGA 1A27A 1WDLA 4IS2A 1BXGA 3M6IA 3FR8A 2J3KA 1FDTA 4CV3A 3HNPA 2FN7A 5BR7A 1IHXA 1H0KA 3Q1LA 3VPHA 2ZYDA 3GVIA 3GGPA 3IAHA 4E13A 2HQ1A 4CR8A 4MP6A 3PLRA 5EIOA 1KBZA 4HKTA 4YT8A 4XDYA 4ALNA 7MDHA 1H2BA 2YHIA 3PJEA 3KTDA 5I7VA 4KDEA 1ISJA 4K6CA 3F5SA 4E5NA 3MWDB 2RCYA 4NZ9A 3UCEA 1D8AA 3LT2A 2NU8A 3PK0A 1NFRA 1Y7TA 4Q3DA 2YDYA 1XU9A 3NTRA 3OECA 5IN4A 1BSVA 1EDOA 4G5HA 2Q2WA 4K9DA 1FDVA 4HNHA 1DBVO 4J9UE 2PD3A 1PTJA 4MP8A 3V1TC 1EBFA 3GNTA 4R01A 4BNZA 1N1EA 1N1GA 1KVTA 1N2SA 4ILKA 1EE9A 3MOGA 4PLYA 1P1IA 4IXWA 5B37A 4CQLB 2AE1A 1U3TA 3DZGA 3O03A 4JJGA 3DTYA 1QXSA 4OXYA 3BYZA 3X2FA 3WGHA 3ASUA 4RVFA 1DDOA 3F4BA 3AI1A 3T7EA 4IJWA 1AE1A 4CM8B 1WMBA 4RZHA 3SXPA 4Y6SA 3GAFA 3UXYA 5AXAA 4PG8A 1LNQA 3B6ZA 2ZCVA 2FZEA 4QO7A 1W73A 3E5RA 4WGGA 3O4RA 4A10A 3KYBA 1KVRA 1M6WA 1UUFA 2DBVO 3ICPA 3KHUA 5G4KA 3VPGA 1B15A 1HF3A 2BD0A 4OGWA 3HN2A 5JBIA 3GUCA 3BMNA 1HRDA 2ZB3A 5T57A 2BFOA 3DFZA 1NM5A 5LCXA 1XYGA 3HFSA 1SEPA 4YAGA 3U09A 4FR5A 3OJEA 1KVUA 1YB5A 1H6CA 3T4XA 1B0AA 4XQEA 4EUFA 1VM6A 1HE5A 4PZDA 4MKXA 4OIMA 3ZWPA 1ZBQA 1QV6A 4E5MA 5J23A 3FNGA 3OP4A 4CM9A 3CPSA 1U5AA 4Y8VA 2EHDA 4OO3A 3E1KA 5DCYA 2ZTUA 3QSGA 4UEJA 1F8FA 3GEDA 5IF3A 3H2ZA 1ULUA 5L95A 4D3FA 1AHIA 4J2HA 1YWGO 1VSVA 5IDYA 4WCFA 3R3JA 4M87A 2Z95A 2I76A 2PH3A 2CNBA 4W82A 2FWMX 1PQPA 4PLWA 3WGOA 2YFHA 3QE3A 1JWAB 1IE3A 1PGQA 5C7LO 3K92A 2Y1DA 3VDQA 4HV4A 2NU7A 1X0XA 4Q3EA 4BNYA 4ESOA 2X9NA 2YFQA 3F6YA 2V6MA 4EITA 1BDBA 2Q45A 1U1IA 4UULA 2RBEA 3W4KA 1Y1PA 4S1VA 4BMVA 1Y8QB 1V0JA 3ST7A 4NQZA 1QYWA 4IQ8A 2FMUA 4RQUA 2P5UA 4B4WA 4GQAA 4YAIA 3CMMA 4CQMA 5JC8A 4YJFA 5FYDA 1YQGA 2V65A 1JA9A 1GQYA 4R51A 2QHXA 2A94A 2E49A 5HTOA 1DIGA 1LDGA 2PNFA 1VL0A 4DVJA 1I3KA 1E3SA 3VPXA 5A5EA 3W1VA 5A04A 3ZN2A 3PHLA 3AY7A 4OKNA 2NLOA 2VZ8A 5HBRA 4HADA 2R00A 2ZQZA 3OICA 1M2WA 3KSDO 2WE7A 3BIOA 2WYUA 3BMOB 1DJQA 3JQ9C 4XYGA 1YBVA 4LGVA 2VRBA 4U5QA 2NU6A 5T6BA 2VOJA 4FOSA 4IDEA 4FIZA 4CLOB 5A9SB 1E1NA 5HA5A 8ADHA 2EERA 3I9KA 2GGSA 3AY6A 3I6IA 3AM5A 4BNUA 4E30A 1A7KA 2FRDA 3O8QA 4N7RA 1I30A 1HDOA 3QRWA 4Y6PA 3A9WA 4J90A 3WGIA 2DPHA 3E8XA 3GGGA 5TX7A 3UOGA 3UCFA 4YJGA 3ZHYA 2EP5A 2VRCD 1V3TA 2FP4A 4BNNA 3PZBA 4B8WA 3PP8A 1UAYA 2AW5A 1JQBA 2CF6A 2ZK7A 2VHVA 3GFBA 3HE3A 1IY8A 3HN7A 5JDIC 3BMQA 1I24A 3N7UA 2C2YA 5HS4A 2HMVA 2YZ7A 3LDHA 3MJEA 3AUTA 4D44A 3H9UA 1NFQA 3PDUA 1R4NA 1VLLA 3H2SA 1OI7A 3PQFA 3FHLA 1ONNA 2ILTA 4RPLA 3VZQA 1T2FA 4HFMA 1E77A 3WWYA 1UDBA 2AHRA 3VC7A 4H16A 3B1FA 1SAYA 1LQTA 1YKFA 1VL6A 3PPIA 4BGIA 1XR3A 3OA0A 4Z3DA 2NQTA 2Y68A 3DHYA 3LZ6A 1CERA 3G1TA 2OORA 4PRLA 3S55A 1ZSNA 2B4RO 2DAPA 3V2GA 3BHIA 2J3JA 3JD1A 5JCXA 4AJ2A 5JDCC 3INRA 1AHHA 4BB5A 3GH3A 1K6IA 2OOSA 4XD2A 1TLTA 1O9BA 2GSDA 3LC1O 3GQVA 1OC2A 1KEVA 2H63A 3SEFA 4EI2A 3H9GA 4IGFA 3WNVA 1KVSA 4HXYA 1V6AA 4XYMA 1KEWA 3WYEA 1LLUA 1IL0A 3KYDB 1GYRA 2JD2A 4JBHA 1H9BA 4K6FA 3F4LA 3ENKA 4FGWA 5ITWA 1UZMA 1A4IA 4W9NC 3ZHZA 4CLRB 5JCJD 3IQDB 4LW8A 3ON5A 1R0LA 3PI7A 4OM8A 1Y8RB 4EJ6A 5IDXA 1DIBA 3RUEA 1OZAA 3OETA 3QWIA 3ZWOA 4IMPA 4M1QA 1QG6A 1BTOA 2B0JA 3MEQA 2C5AA 4XGKA 1Y5RA 2B5WA 1ZJZA 1GR0A 3QA9A 4OH1A 3ZWVA 4AJPA 3UICA 1UZNA 4JIGA 1SMKA 5G2OA 1NAIA 1KEUA 5GZ6A 5JYDA 3DBHA 1UXKA 4R9RA 3WNQA 3GG2A 1ZCJA 4FS3A 2EV9A 3DBLA 4M49A 3RKRA 3WQRA 2C82A 4BGUA 1WXDA 2JFFA 4QFCA 3RFXA 3WTCA 3PJDA 5FFFA 5ENVA 2HCTA 3GT0A 4NK5A 1PGPA 5KJFA 1I2ZA 1O6ZA 4JLWA 4R4JA 1W8DA 3C1AA 4RQTA 2OZPA 4WOKA 3PLNA 1ZK1A 2W2KA 3DONA 5G0SA 1SPXA 4J43A 4ND4A 5THQA 3BHJA 1F8GA 1MFPA 4WLFA 2Q1WA 4YDRA 2Z5LA 3RFVA 3DBVO 2X86A 2Y0EA 4NH4A 1I3NA 5DCUA 4RLHA 4U6SA 1SBYA 3DMTA 3TOZA 3VKUA 2O50A 3WGQA 3PXXA 1E7SA 4YEDA 2JFHA 3HDYA 3Q2IA 4CV2A 9LDBA 1FK8A 1WP4A 1XGKA 4YQYA 2VRCA 2PV7A 2X8LA 2PZMA 3WR5A 3ZV5A 1LI4A 5L51A 1SZJG 3HADA 4B4OA 5JXWA 1ZEJA 2B83A 4R1NA 1KC1A 2VQ3A 4YA6A 4CR6A 4QX6A 5KVSA 5L4LA 2YV1A 4O6VA 1PWXA 1YL7A 5HS6A 3VPSA 1T25A 5IDQA 1J4AA 1FDWA 4BNMA 2HO5A 4MVJP 2YQ5A 1WDMA 4OQZA 1C1XB 2EJWA 4YXFA 1ZH8A 4YAJA 4AL4A 1X15A 3B70A 4TVBA 1DC3A 1KYQA 2HJRA 5K6AC 5LDHA 2BLLA 1N5DA 4EDFA 5JYEA 4R9SA 4TQGA 4RVGA 4PLPA 4ND5A 2D2IA 1ENYA 3U9LA 4O63O 1XEAA 1B3BA 4BO9A 3MTGA 3H3FA 4PG7A 3VDRA 1OAAA 3GEGA 3G1UA 5CDUA 2ZTMA 1YJ8A 4C4OA 2D4AA 3FD8A 3PWSA 4FC6A 2PK3A 1A72A 3NDRA 3RBXA 4GSLA 2RH4A 1TEHA 1LEHA 5L7WA 1QYXA 2UDPA 4XYBA 1GDHA 2BRUA 1HDCA 3QWHA 3QW2A 5DULA 3TZ6A 3ZNPA 3G3EA 4LSWA 4OJNA 4O59O 4BNVA 1QR6A 3WYBA 4CMKA 2QX7A 1ZK3A 2FR1A 1T1RA 3KUXA 5C5IA 6ADHA 3V2HA 3DFUA 3LQFA 3S2FA 3FRJA 5H81A 1ZNQO 2B4TO 4WLEA 2EXXA 3PWKA 1K3TA 3NYWA 1LDYA 4NBTA 2UUPA 1MB4A 2FOIA 4B79A 4IZIA 1PS8A 2Q1TA 4W6ZA 1PJSA 1QYCA 2I67A 1PJ2A 2FSSA 1NWCA 2VWQA 3DAFA 2D1YA 4CLEA 2DVMA 1KETA 3SBOA 1RWBA 1M66A 2B69A 3EW7A 2IYPA 5JS6A 5TGDA 3LU1A 2VN8A 2R6JA 2X0JA 3I83A 3RBVA 2I5PO 4BKOA 5COQA 1U4OA 4H7PA 4IIUA 1JWBB 1NHGA 1WWKA 2NWQA 2IDZA 1E3EA 1HE2A 5DZSA 1A7AA 2JD1A 1P44A 2WTBA 4GGOA 4CMIA 5GMOA 4GI2A 5ILGA 3EDMA 3RD5A 4BNJA 5IXYA 2UUOA 4D45A 3U5TA 3GDFA 3D3WA 5CG2A 3NUGA 4YT2A 4BMSA 2GCGA 2HRZA 4D43A 3FI9A 2G5CA 2X9VA 4FGSA 5CEFA 4IJVA 3B20A 3RU9A 4CR7A 1HYEA 4GMFA 1I10A 3K6JA 2VHXA 2ZB7A 4CM4A 3QWBA 2TMGA 3IP3A 3JYPA 2VT3A 3PFFA 4TKMA 4DLBA 4UUOA 4DREA 1B26A 2D8AA 4NK4A 3RC9A 3GVHA 3TFOA 1MGOA 3U49A 2QYTA 3GVPA 3QP9A 1ISIA 4FDAA 3QIVA 4BO2A 5CEEA 3JQ6A 2O3JA 4RPGA 5AVOA 2WWRA 3H4VA 3TF5A 4BGVA 1BGVA 3K73O 3LLVA 3OH8A 4J16A 1BHSA 2EP7A 4BHTA 1KY5A 2ZYAA 1I2CA 1K6XA 1SB8A 3DEYX 3MOIA 1YONA 4WNCA 3AW9A 4Q3CA 1GL3A 3H7AA 2ZIZA 4JP2A 3IJRA 4LCJA 5G0UA 4R5MA 3UF0A 1HETA 2GZ3A 5AOVA 3Q6IA 1ULSA 2AQHA 1AUPA 5A06A 1DFIA 2PKQP 4BO4A 1MG0A 3OMLA 5H83A 2HLPA 4RO0A 4YRBA 1ADGA 4RORA 1Y5MA 3OHSX 5BSFA 2GZ1A 2RIRA 5K9ZA 1U7HA 3ABIA 1HWYA 3K2EA 3JYLA 3WG9A 4GWKA 2BFMA 2J3HA 4IDCA 1LDBA 2GERA 4J0FA 3AUUA 3GHYA 3ZU5A 4A26A 4H3VA 3PYLA 3UW3A 1FDSA 3NAQA 3QVOA 4CMEA 2PZJA 1X14A 3OEWA 2H1SA 1IZ0A 5JPIA 3S8MA 1K89A 5CDTA 3KRTA 4EJ0A 5T8KC 3L0DA 4A73A 1DHTA 2X4GA 4DMMA 4BNLA 4BO5A 1H5QA 4N5LA 1U3UA 2ET6A 4IDBA 1MA0A 4WASA 4OQYA 3GAZA 3OJ0A 4X54A 3WTBA 4KUGA 1Q7GA 1KOLA 2P2SA 1P33A 3BTOA 5AXBA 1O95A 2Y67A 1PJCA 2EKQA 2Y99A 3ASVA 3ZW8A 1E7YA 2EW8A 4ZGWA 4AJKA 4Z9FA 4CUZA 1DRWA 2PY6A 4BVAA 5AYVA 4WNIA 3DXFA 1F17A 1NP3A 1CWUA 4Z3KA 1PS9A 4J6FA 5T64A 2NVBA 3DZKA 1Q0LA 1XHLA 2X5JO 3OM9A 3TJRA 3ZH2A 4XKJA 1EFKA 4MIEA 5IZ4A 3M2TA 5EPOA 4E5PA 3JD2A 5A02A 1AN9A 5EINA 3GRPA 2YHUA 3L07A 4JN6B 2QRLA 4NBRA 4E0BA 3IMFA 3UHAA 3GHHA 3H5RA 5F21A 1GAEO 5B4UA 3IL2A 3RASA 4YQZA 3I52A 3QQPA 4D3SA 4ZQHA 4MVJH 3C3XA 3JQ8B 3RKUA 1HYHA 3DHNA 1E1LA 1IPEA 5TSDA 4E2XA 2BFPA 3KLMX 3I9JA 1LLQA 4GX0A 2Y0CA 2CDCA 4GSKA 4RF2A 3TN7A 1PZHA 2QIOA 3A28A 3I9LA 2I65A 5AXCA 3RI3A 3G17A 2PA3A 3ETDA 3SC4A 1P1RA 4B4UA 4CM9D 2FZWA 4ZICA 3AK4A 3OQBA 1EK5A 2A9FA 4JJFA 3BMCA 4FQ8A 4B4VA 1HDGO 3JSAA 3NV9A 1WW8A 1IPFA 1LX6A 4XIYA 4YAEA 5DF1A 4W99A 1X1TA 3F5QA 4IDDA 5F3RA 2WYVA 3UN1A 3R3SA 5A9RA 1ZO8A 2DPGA 3VZSA 4DGSA 1B8VA 2NVUB 4HUJA 4BNXA 1GADO 2VYVD 2GDZA 2VZ9A 2WD7A 1GUFA 4UVGA 3GNSA 4YTEA 3GRKA 2J5QA 1M67A 3E9NA 3MJ4A 2VWPA 3I5MA 4RDHA 3F47A 4KUEA 1TB4A 4DC0A 2LDBA 3GDOA 3NTOA 3FNEA 3GN1A 4WJZA 3JQFC 3CMCO 1ZK4A 1C1DA 2GF2A 3LT1A 4EUEA 2O3RA 3JD0A 1ZSYA 3D3EA 4BNIA 5EESA 4GLOA 5H82A 1F06A 1PWZA 2PGLA 3L6DA 3E18A 4CQMD 2BGMA 2DU8A 1EZ4A 3DWFA 4YVFA 2JAHA 2Y0DA 1YDWA 4XQCA 5I9MA 4A2CA 4BUCA 4R5HA 1PX0A 2OP1A 5BQFA 3JQAD 4IMRA 4MP3A 2JFGA 2OO5A 3JCZA 1H6BA 2D59A 4G65A 4CV0A 3PHIA 4EW6A 3CKYA 5BNIA 4HFJA 3CXRA 3TNLA 5CDGA 2AE2A 3IUPA 3WYCA 4DXHA 2EGGA 1ZMOA 3C7AA 3LYLA 1E7MA 4IGEA 1U3VA 4A7PA 3QLJA 3JQEA 2FSVA 1BVRA 2EKPA 2JL1A 3EUWA 3JTMA 4LRTB 5K0ZA 4XYLA 5IZCA 2PKQO 4F3YA 1FDUA 2HKIA 3W6ZA 4FJ1A 1F12A 4IS3A 3GVXA 2PD4A 2BFAA 1H94A 3GPIA 4PLCA 3WGYA 5F5LA 3HDQA 3KEOA 3MCVA 2J3IA 4J7XA 4YJDA 4INAA 4Q3AA 1DLIA 5L53A 4Z0TA 1HSZA 1B2LA 1Q0QA 3KLPX 4CM3A 1BVUA 1VJ0A 5CDYA 2C59A 4U0KA 1NQOA 1B14A 5A05A 1L1FA 3FBGA 2D3TA 2C20A 1U5CA 1UXHA 1GD1O 1UXJA 3PYXA 2HMUA 3AJRA 3PWZA 1GY8A 4RPKA 1E7QA 3WJ7A 1KVQA 3JQGA 1EQ2A 1GCOA 3WFIA 1BW9A 5BSGA 3ZI0A 2PD6A 3ANLA 1I3MA 4URFA 1NPTO 4MIYA 4FFOA 1WNTA 2J6IA 4HP8A 4I9HA 2PLAA 3IOYA 4J4HA 5DBFA 4F6LA 1L7EA 4L75A 1BMDA 1H6AA 2HMSA 3W8FA 3TWOA 2B4QA 2X58A 1ISGA 3O9ZA 5EL0A 3ZU3A 2AEJA 1ZMTA 1ZXBA 3WQQA 1PR3A 2W98A 1PQWA 1BXZA 3KV3O 1Y81A 3PRJA 1R4MA 3CUKA 1GUZA 1LSOA 1HZZA 4NIMA 4KP7A 1YRLA 4AJOA 3SLGA 3UAGA 2DFDA 3ITDA 4J4TA 5KJ1A 2IXBA 3R0IA 1ML3A 4GLLA 3AFMA 4XQGA 4AJNA 1P31A 5F1PA 4YT4A 3WBFA 1QLJA 1QMGA 1PJLA 1YDEA 2NVWA 2W2LD 3RUFA 4O5OA 4ROSA 2VYVA 4I5DA 1JU9A 2BI8A 1J6UA 4XDZA 1HE4A 1YQXA 1TT5A 1DC4A 1Z45A 4KOAA 4MKRA 1DIHA 3L6EA 3TZCA 4AVYA 3DZIA 3N74A 4D41A 3UKOA 2CFCA 1DJNA 3NT2A 1I0ZA 5G0TA 4LVCA 4JBIA 4YR9A 2VT2A 1UP4A 4FFNA 5JFOA 4B3IA 2WYWA 3DZBA 1GYPA 1N9GA 1K2WA 3INTA 5CPBA 3LLSA 1ADBA 3ANMA 2PWZA 1GEEA 2P9EA 3ADOA 3ZNOA 1U2DA 3IDSA 3PQEA 3WB9A 1DB3A 3WFJA 3EVTA 4ALKA 2JCXA 1NQTA 3DBRB 3DDNA 3JQAA 2OXIA 3RCBA 3HG7A 2Q4EA 4R1TA 1RKXA 4OAQA 1WZEA 4RVDA 3KOUA 4IBOA 1T2AA 3GZNB 4QFDA 4PRKA 1PGJA 1EK6A 3B1KA 4B8ZA 2YV3A 1NQAO 4OKIA 2EF1A 3QV1A 4KMSA 1PZEA 2RH8A 1Z75A 4I9UA 5TQVA 4NU5A 4BQPA 2OBNA 1LLCA 3H8VA 4NBVA 4D3DA 3ROMA 1N8KA 4LCEA 1MV8A 1YXMA 2CMDA 3V1UA 1HL3A 4ZQGA 3RC7A 4EEZA 4OOFA 4Q9NA 2IEDA 2AXQA 3HDJA 2UAGA 4WLNA 1GZ4A 1N7HA 1BXKA 1YJQA 1ZVMA 4YWJA 4DQVA 5ICMA 5IJZA 3DB2A 3EHEA 3WBBA 4YJHB 1EVYA 1C0LA 1E6WA 4UUMA 3IUSA 1B7GO 3QVXA 1UR5A 2XPCA 1R0KA 4FFPA 3CH6A 5DDIP 3ZWCA 2Y1EA 1B3RA 3NDIA 4R3NA 1R0SA 4J2OA 3FF4A 4GWGA 4PFJA 1SB9A 2IZ0A 1DRVA 1GPJA 4FFMA 1BXGB 7ADHA 4TZTA 2CY0A 4J7UA 4II2A 4P8RA 1MUUA 2HMWA 4MVJF 3I9MA 1GZ3A 1DLJA 3ANNA 1U9JA 1LTHR 2QRKA 3BAZA 2YHIB 4PLHA 1GV0A 1PJ4A 3PZRA 1Z7EA 3P19A 4C7JA 1B16A 4LN1A 3ITKA 2W4QA 3RSHA 4QXMA 3U0BA 3ZWWA 1IZ9A 4GPD1 1ZK2A 3WLFA 3D4PA 1E1KA 3C1TA 1DEHA 5THKA 5DBGA 3ONDA 3PHJA 2Y1CA 5LC1A 3MTJA 5F5NA 3R1IA 5A9TA 1BRMA 3LT0A 3PQDA 4NJMA 2IRWA 1GUYA 2WD8A 3AUSA 1A5ZA 2BHLA 1W0CA 3RC1A 3DC2A 1P0CA 4GAEA 4CUJA 1E0DA 3OA2A 2EG9A 5A1TA 2LDXA 3LK7A 2BI7A 2W2LA 3UCXA 1DAOA 1LSUA 1CF2O 3D1LA 4AFNA 3E6AA 1QRRA 2GN9A 1I5RA 3FTNA 1JKJA 4RF3A 2HAEA 1IHYA 1GQ2A 2GN4A 1T2CA 3DAGA 4NU6A 4YRAA 3ETGA 4B7UA 2NTNA 4CLXA 3WSVA 1HEUA 2GNAA 1PZGA 3CE6A 1UXIA 2AQKA 4XEHA 4W7IA 1HDYA 1PQUA 3H5NA 2DUUA 3PHGA 4WLVA 5G4KB 1CRWG 2P4HX 3OSUA 2ZYGA 3AUAA 3RJ5A 3V8BA 4E5YA 1VPDA 4NPCA 4DA9A 4ALLA 1Z7BA 3BMNB 1BWSA 2ZCUA 5I7EA 3WGZA 1BW9B 4KUHA 3ZHBA 2ZJ0A 4U7WA 4B3JA 3EK2A 1LRKA 2C7GA 4D0SA 3VOSA 3GNQA 2DLDA 2CZCA 2J5KA 3EVNA 3CZMA 1J49A 4ZJUA 3EAGA 3QVTA 4TRRA 3ICCA 1E3WA 1P1HA 1S6YA 3ZWYA 1EFLA 2VCYA 1L7DA 2ZQYA 3PJFA 2IXAA 3SJUA 3ZDFA 1NYTA 3D4OA 4IJUA 3JQ7A 2DBZA 1ENOA 4JCOA 2WEKA 1HXHA 3HSKA 2VOEA 3FCOA 1YOVA 2PGDA 5TS3A 4WCFB 1H6DA 2JHFA 5ENDA 3KSUA 3EYWA 4BOYA 5I7FA 3GVCA 2YDXA 2EW2A 4L4SA 1XU7A 1OC4A 3JYQA 1A9ZA 4FC7A 4LMPA 5U9CA 2DQ4A 1LLDA 3I4FA 4TKLA 3L6OO 5AQ1A 3RUHA 4UVIA 5C7OO 3E9MA 2BF7A 5T5QA 3SJ7A 1EQUA 4NFSA 1RJWA 4DPMA 3RC2A 2ZJ1A 4XA8A 4FPXA 4ZN6A 3AOEC 3ZU4A 2P9GA 4W4TA 8LDHA 1C14A 4II3A 4OXKA 2EWMA 2QZZA 2HK7A 4CQMB 4YAKA 4YJFB 1FXSA 2CVZA 5L7TA 1Q1NA 3JQBC 3JQFA 1QKIA 2BGKA 4QTZA 4HY3A 1LU9A 2X5KO 3EC7A 1I36A 2DC1A 5KJCA 5CP8A 3TSCA 4MVJD 3DHEA 1YS4A 3Q0EA 4ZU3A 2GN6A 3IJPA 3C7DB 1I01A 4BKQA 4NI5A 1R12A 2HUNA 1W6UA 2Q2QA 3TL2A 5TNXA 3KO8A 2Q1UA 1XKQA 1PSDA 1XLTA 2AEFA 3K9QO 1F0YA 1GEGA 2JJYA 1DFHA 2PTGA 4NHEA 1LSSA 1ADCA 1XELA 4XWYA 3VH1A 4RCVA 3ZNQA 1GFSA 4BNGA 3KYCA 3W4IA 4DYVA 3HB4X 3O8QB 4E6PA 4BB6A 3F1LA 3DQPA 4L0QA 1JLLA 1ZJYA 5HWSA 5F1OA 4L9RA 4YJGB 1HT0A 2AA3A 3ZU2A 4U6QA 4BKUA 4EGFA 4YYZA 3DOJA 2YJZA 4XCVA 1P3DA 2O4CA 3BMQB 3QWFA 5TJ9A 5CEJA 1PIWA 1PS0A 2GASA 2RAFA 1SCUA 2Q3EA 2AQIA 3QVSA 5BNTA 3C1OA 4MINA 2VZ0A 1R4NB 4WCDA 1PJ3A 2FPGA 4J1QA 1GV1A 2X5OA 4HNGA 1DHRA 3NGXA 2VHYA 3IC5A 4WOJA 1IULA 1QSGA 3C85A 5L45A 2HJSA 1JW9B 2J5RA 2I6TA 5A03A 1ZW1A 4CM1A 3HUDA 3FTPA 3VZPA 4AJLA 4UVHA 2X1HA 3KVOA 3L4BC 3LT4A 4TROA 5KCZA 1FF9A 1F14A 3GOHA 4WPGA 3C7CB 1T1SA 1I8TA 2GLXA 1VSUA 4WECA 1TXGA 4CMJA 2G82A 1HKUA 1B8UA 2R00C 2CD9A 1U7TA 4IINA 1HTBA 4I5FA 1EUDA 1RYDA 1EBUA 4AJIA 5DP2A 5I8WA 3S2IA 4NBWA 3ZWXA 3WICA 4R41A 9LDTA 1XSEA 1VI2A 4NMHA 4PLFA 5IFLA 4FCCA 2WE8A 5BNFA 2NADA 1P9LA 3RAJA 1GZ6A 4PVDA 5KNLA 1E92A 2Y1GA 2GN8A 2Q50A 2DTDA 2IZ1A 4PLZA 3V1YA 1U4SA 4QEDA 3GG9A 4TMFA 4BO0A 4DBZA 2AMFA 1ONPA 3RUAA 1DXYA 3A14A 2HRBA 5ICSA 1NVMB 4GKVA 4WK6A 3RQSA 4OOEA 1HE3A 4K1LA 1KERA 1M75A 1J5PA 3S2EA 4CQLA 1E5QA 1ZSVA 4DLAA 2OMEA 1H9AA 1NHWA 3OJFA 4E3ZA 3DBHB 5DCWA 4ZA2A 4MVJI 1KY4A 3DBLB 1D1SA 1E3JA 2SCUA 4FJ2A 1O94A 3GK3A 4YT5A 1R66A 2HDHA 3CEAA 4MVJA 4WKGA 5GZ1A 3PIIA 3VVCA 3KETA 3KZVA 1HLDA 4CM8A 1LDMA 1UP7A 3NT5A 4E4YA 4DRYA 5JW6A 4U8GA 2W2KB 4YBZA 1KC3A 1M6HA 1XQ6A 3WLEA 4Q3NA 4NG5A 2ZB4A 3FPCA 3NTQA 1PU2A 3SX2A 3L9WA 5C37A 1X1EA 1NR1A 4TRMA 3TDKA 4QECA 3VZRA 1I33A 4NFYA 3I4CA 4BV8A 3JQ9A 4AJ1A 4XYEA 4IIVA 5KKCA 5JMPA 2V6FA 2C07A 4CMCA 2OBYA 3H9EO 5EN4A 4Q3BA 1QORA 3PVZA 2VTEA 2DUWA 2NUAA 3KBOA 4JGBA 4BO1A 4D79A 1XWFA 1E5LA 4BO7A 3QWAA 4OHUA 1NPDA 4GVXA 2ZB8A 1JVSA 2O4UX 3PTZA 2NNLD 4UEKA 5I7SA 2Y05A 4M55A 2WSBA 1P77A 2G17A 1EMDA 2JAPA 4JNKA 1NNUA 1D4FA 1PGNA 1T24A 1C0KA 1Y9EA 5JAZA 2CF5A 3FNHA 2GUGA 1LDNA 3GN2A 4GMGA 4JP3A 5U4QA 3PGJA 5G0VA 1JKIA 5JDIA 5L40A 2VWHA 5BSHA 3U4IA 5DT9A 3OQ6A 2TMDA 2JCYA 2ZTVA 3KXDA 4KZPA 3EMKA 1G6KA 2CUKA 1E3LA 4RL6A 2I66A 3Q3CA 2P68A 5DN9A 4EJMA 4TSKA 3CSDA 1Y8QA 3DZJA 5U1PA 1X7DA 4HX5A 2Q49A 5COAA 1PL8A 1Z74A 1MXFA 5KTKA 5HM8A 2QW8A 4I08A 4AJHA 1RM4A 4ALMA 4GX2A 5TLSA 3L4SO 5JDCA 4ZQEA 3GA0A 1JDJA 2ZATA 1LC0A 5FEUA 2P5YA 4EUHA 5B4VA 2QYSA 4Z6KA 1P1JA 1CJCA 1MX3A 1VKOA 3BMOA 3BZUA 4R68A 1CQJA 3Q11A 4IPTA 1GYQA 3O38A 5TF4A 1NASA 1A71A 4W9NA 2XF8A 3DOCA 4CLOA 5A9SA 4A27A 3NGLA 1Y9AA 1LDEA 1GQQA 1ENZA 2Y1FA 3ADPA 4UVDA 3F9IA 3F3SA 4GX1A 5FI5A 4CMIB 3E03A 4PG6A 1NVGA 1SOVA 1IUKA 5KWEA 1E6EA 1K0UA 1VJTA 3D3WB 4UEOA 4ZD6A 3RUDA 2CVQA 3IS3A 3HDHA 3JD3A 2PZKA 4WLOA 1QV7A 2Q99A 2VTDA 5EQFA 1N7GA 2H9IA 5JAIA 3H65A 4J7CA 2YY7A 4CMHA 5DOZA 3W4JA 1DIAA 4CV1A 1NVTA 5KVQA 1SC6A 2QRJA 1LRJA 3ZWMA 4LVUA 2X9GA 4WLUA 3TOXA 3ROKA 4XX0A 3ZV3A 1PR9A 3ETEA 3KM0A 5KVVA 4CM4B 4TWRA 4XJTA 5BSEA 3H6KA 4CL8A 3CIFA 6LDHA 2QG4A 4MIOA 1ID1A 2D5AA 5GY7A 1LSJA 5KOIA 4RPJA 3K96A 3Q9NA 4E2WA 4ID9A 4J9VA 3I3OA 2BMAA 4J4BA 1UZLA 2VNAA 4TVOA 2PGJA 1CDOA 1NTOA 4CODB 5IG2A 3ZW9A 2O23A 4QT0A 3RU7A 2H6EA 3HHPA 3Q2KA 3BXXA 3ORFA 4AG3A 4KWHA 5L9AA 3P7MA 1MXHA 1YL6A 3EY4A 2Y66A 3X2EA 5I9NA 2X7HA 4JXKA 3B1JA 4CLDA 5B4TA 1RPNA 2VWGA 3S1LA 1Z82A 4ND1A 2V6GA 2IE0A 2DBQA 2C5EA 3LC2O 1NBOA 1H93A 3KYDA 5TJHA 1IOLA 1T2EA 2POQX 3K5PA 4RDIA 2BELA 4CLRA 5TT1A 4R1SA 2W8ZA 2X0NA 3AOEA 4FOOA 1Y8RA 2VYND 5K6AA 2F00A 4B7XA 1NXQA 4L8VA 3PDJA 4NFHA 1HDRA 2YW9A 2YYYA 1PZFA 3EZYA 5I8ZA 4DIOA 3DTTA 2W90A 3JQBA 5DBIA 3STHA 3ZWNA 3GGOA 3CZRA 1MC5A 1O5IA 3TZQA 4E31A 1MLDA 1UP6A 4ZQBA 3TZKA 4NJOA 5TIIA 4J1TA 3I23A 3ONFA 1W4ZA 4FSHA 4YACA 2GZ2A 3NJ4A 4M8SA 2OHXA 1RM5A 3HFGA 5B1YA 4JQCA 3W6UA 4XJSA 3TQHA 1V35A 2C2XA 4KDFA 5KKAA 3C24A 4G81A 1E1MA 1SEVA 3OEYA 3VH4A 4MPDA 4YRDA 4HFNA 5ITVA 5ER6A 1DFGA 1ISFA 5IN5A 3OF2A 1X0VA 1V8BA 4BV9A 3OQ1A 2FPIA 3OFSA 5KJ6A 3IP1A 3MJSA 4WEQA 2GO1A 3D5TA 4Q39A 3NEPX 3DZFA 4DIFA 2P91A 4LRSB 1TT7A 1Y6JA 3LSYA 4EZBA 2Z1NA 4FFRA 3E5MA 3TRIA 4BNWA 1E7WA 1LA2A 4KTTE 2O48X 1FJHA 1PL7A 1ZUD1 4BNHA 1WLYA 4XB1A 4L4XA 5JNLA 1TVEA 5EERA 2WJPA 4LMRA 3ROPA 4DL9A 2HK9A 1X7GA 3DMYA 4H15A 1EUZA 4FW8A 4KWIA 3VKVA 5EMHA 2X6TA 1ISMA 4UREA 4TRJA 5ADHA 1EVIA 1U2GA 4J49A 5FF9A 4XGNA 3PEFA 3GDGA 4O1MA 1VKNA 5F1KA 5L4SA 5JMWA 4AJ4A 4PGFA 5KIAA 1LUAA 1HSOA 1PGOA 4N5MA 4P22A 5TC4A 3BTUA 3H9QA 1C1XA 1Q7CA 4F6CA 1YB4A 3GFGA 4E32A 3OIGA 1LQUA 3U4DA 5CFZA 2WMDA 3L9XA 4CMEC 5L3ZA 3BMCB 3L4BA 3ZV4A 5A5FA 1CYDA 4ZRNA 3RWBA 1QYDA 2P4QA 3GY0A 3EGOA 1OFGA 4RZIA 3WX0A 1UAGA 3RIHA 2R2GA 4BO6A 3AU9A 5JAMA 4CMBA 1KS9A 1YBAA 3JD4A 4DMLA 1SOWA 2FR8A 5ES3A 1TI7A 1PJTA 5G4LA 3ONEA 3QJ5A 3W8EA 2QQ5A 1V3UA 4DIBA 4BKRA 1OMOA 1YGYA 2G1UA 2WD7B 1DIRA 1ZZEA 4R69A 5JAQA 1OOEA 3BA1A 4AICA 2EIHA 1E7RA 1SO8A 1EE2A 1UDCA 3DAPA 4DWVA 2AEMA 4IDAA 4DQUA 1X7HA 3OJLA 2YV2A 3P2OA 5FWNA 1C1DB 1JAYA 3Q9UA 3H3JA 1NAHA 1ZEMA 3IKVA 4DPLA 3LC7O 2HMTA 2O3UA 3FBTA 3U4HA 1XIVA 1D3AA 3VVBA 4DC1A 4I5GA 3ENNA 2G76A 1WPQA 2NV6A 1XDWA 2VYNA 3DOOA 3HZZA 4N54A 1NPYA 5JY1A 5B12A 4IQGA 3GMDA 3CINA 3UUWA 2X23A 2VUUA 3D5QA 4PVCA 1LXCA 4PN3A 1ENPA 1YE3A 3SVTA 4FBGA 2X22A 3GPDG 2PR2A 3S2GA 1O89A 4R54A 3A06A 4OSPA 3TL3A 5G0WA 1P1FA 3MWEB 1A9YA 4A5OA 2CVOA 1C0PA 4BO3A 4J1NA 2AG8A 3EZLA 3ROQA 4E12A 1AXGA 3RROA 2WM3A 3U62A 2OFPA 4JROA 3RUCA 4IM7A 4FN4A 4GVLA 1T4DA 4IUYA 2Q46A 2FHSA 3JQDA 4I9NA 3WJAA 1GTMA 5L7YA 2Y1OA 3GC6A 4WE3A 1I3LA 5TRTA 4XB2A 1V3VA 2D0IA 5FI3A 1JN0A 5DOVA 4XRRA 5T8KA 1LJ8A 2VUSA 1Z6ZA 4QQRA 2Y93A 4K28A 1YQDA 2RHRA 3LVFO 1VRWA 2B5VA 2I3AA 2UVDA 4HFRA 1ISHA 1K6JA 2DBRA 2GYYA 2O7SA 2CSUA 2DM6A 4LK3A 1EVZA 2D5CA 3RUIA 2C7VA 2HK8A 4N5NA 3AM3A 4Y67A 5JY6A 1HDXA 3P5SA 2DTEA 2OGUA 2XOXA 5JE8A 3M2PA 1DO8A 3BTVA 3IIEA 3OBBA 4P4NA 3H5AA 3HJAA 4L73A 2QZ9A 3ZCXA 2P9CA 2AG5A 4JJIA 4OXNA 2UYYA 3JQGB 4JBGA 1HYGA 5CAEA 3OJOA 3RJ9A 2B35A 5JO0A 2A4KA 5KJEA 4BMNA 1IYZA 4EYEA 2NTJA 4NR0A 4I8XA 4RVHA 2OUIA 2NU9A 1NFFA 4YB8A 3WIEA 2Z1MA 1Q7BA 4GBJA 4F45A 3HB5X 1XCBA 4KQXA 3LF1A 4IY1A 4PLVA 1ARZA 4C7KA 3MJTA 1J0XO 1CEQA 3WMWA 3ZHXA 4D46A 1E3IA 1KEPA 5DP1A 2OP0A 1ADFA 1CIVA 2BGLA 4MO2A 5I9LA 3AFNA 1R4MB 4XGIA 4CJXA 4RF5A 1ZFNA 1NQ5A 1UXGA 4PLGA 4DPKA 4FD3A 4L74A 1XA0A 2DKNA 1DC6A 2WDZA 2X0IA 3UFXA 3I6QA 2DTXA 1DOHA 3GR6A 2Q4BA 2XXJA 4EEXA 3L77A 3HQ4O 2C0CA 3SC6A 1VC2A 1FMCA 3VPFA 1EVJA 3BTSA 2O2SA 2XXBA 3F1KA 5C7IO 1TT5B 2J8ZA 4CM5A 1EEHA 1KIFA 5IZCC 2I99A 4XR9A 5EQDA 1JKFA 1JVBA 2XAAA 1S7CA 1Q0HA 2C29D 3ZZNA 3OIDA 1ZKMA 2AQ8A 1UJMA 2JKVA 5JO9A 4D7AA 4PCVA 3UH1A 1I32A 4ALIA 1N9GB 3DO5A 3WSWA 4XR4A 3INGA 4NNJA 4GH5A 1AXEA 1V9LA 4K26A 2GPTA 1GU7A 4TRNA 3GF4A 3A1NA 2IEBA 1AGNA 3FN4A 3O26A 5KVCA 4HWKA 1ZXLA 1Z73A 4UUPA 3JQAB 2JD0A 1DPGA 4J1SA 4Z0HO 2EEZA 4BL5A 4M54A 1PJQA 5CDSA 3PIDA 4LSMA 4ZQFA 3NKLA 3NX4A 1MP0A 3FWZA 2A92A 4I5EA 4Y98A 3NDJA 4ZRMA 1G1AA 1G0OA 3FWNA 3LF2A 1R16A 4BQRA 3TFQA 4DBVO 5MGBA 1XQ1A 4E2ZA 3K8ZA 5ER9A 4JK3A 4RF4A 4QSMA 3ZNNA 4CLHA 4AJEA 1U28A 1N92A 3JQ8A 4B3HA 1QP8A 3AI3A 3V2UA 1YBMA 1QYVA 2HSDA 2X0RA 4R3WA 4ZHSA 2I9PA 4Y9DA 4WCFC 2EGHA 2E48A 2IZZA 4YCAA 4CUKA 1PEDA 1X13A 4FB5A 3C8MA 2IYOA 1XG5A 4OSOA 1JTVA 3FSRA 3JQCA 3NJ8A 3WIDA 4P4LA 1O0SA 4KTVE 4GKBA 3AM4A 3U3XA 1ONOA 1PJBA 1LBEA 3G79A 4GGPA 5JC1A 4L76A 2BKAA 4RVUA 5JCJA 4R16A 4CM7A 4P38A 4UAGA 3KEQA 1M76A 3FR7A 4E33A 1GPDG 2NVUA 1RM3A 5IDWA 2EKLA 5ILOA 4BIIA 3I9NA 4J91A 3KB6A 1G0NA 4OL9A 4MVJM 3QHAA 1I2BA 4BNFA 4E21A 3T4EA 3A4VA 1NR7A 4DYDA 2O2YA 5LDGA 4S3MA 1MC4A 4RVSA 3SLKA 3UVEA 1P0FA 3JV7A 4YPOA 4MKZA 4Z9XA 4W7HA 5BT9A 1PL6A 2NM0A 4NJMB 4M89A 3WXBA 4E2YA 3DZHA 4L4RA 3DL2A 4QO8A 3D0OA 4QUKA 4FFLA 4ITUA 3QVWA 1WZIA 1EUCA 3COSA 4UVEA 2HU2A 3GLQA 4NDNE 2C54A 3UGKA 2FR0A 4Y6RA 1YO6A 4ONEA 2V7PA 4TZKA 3R6DA 1YVEI 2VNSA 3E48A 1E6UA 4P4GA 2E37A 3DR3A 4JX8A 4CMGA 5C3MA 3AOGA 2JHGA 5DNAA 3OIFA 4PG5A 4BS9A 2ZTLA 1IB6A 2VHZA 4BGEA 2GD1O 3GUYA 4E5KA 1GCUA 2GRAA 1WDKA 2PKRA 3AWDA 1RM0A 1JAXA 3AU8A 3D7LA 4RPHA 5EJ2A 3T7CA 1H2HA 3KSZO 1DC5A 3PFWO 4OYRA 4DLLA 5CG1A 4MDHA 1ZIDA 3QY9A 1A4UA 2E82A 5JLAA 5HRUA 3VH3A 3ZGYA 1E3WB 4XIJA 3WQSB 2NTVA 4D0RA 1R15A 1WAMA 1LC3A 4BO8A 1TA4A 4IQ0A 1SNYA 4DQXA 3M1AA 2PFGA 4GX5A 3WDSA 2GR9A 1D1TA 5CPFA 1NX6A 1NWHA 3JQ7B 4B7CA 4UUNA 3VH2A 3BHMA 4KQWA 2NSDA 1HZJA 3M1LA 1P45A 3VAZA 1YOVB 3WOHA 3NT4A 3PGXA 1D7OA 1VL8A 1YL5A 3MZ0A 4CPDA 2PZLA 5GZ3A 2BH9A 2E4AA 4HBGA 1CETA 2YQ4A 4F46A 3F46A 5L4NA 4ZVVA 1R37A 1YB1A 2Q2VA 3JYOA 1DRUA 3TZHA 4AJJA 1MFZA 4IZHA 4M86A 3RVDA 1WVGA 3FPLA 5AXDA 3VTFA 3D4NA 2DT5A 1WMAA 4RJTA 5A3VA 1OBFO 4J3FA 1O8CA 1UDAA 3RFTA 4MOWA 1DSSG 4O0LA 1CQIA 4RGBA 4OMUA 5CHEA 2DFVA 2V6BA 4PG4A 5IXSA 3VTZA 5T67A 1Q2XA 3H9JA 3E82A 1BDMA 4XZ3A 1MG5A 2G0TA 4NBUA 3ZV6A 4BNKA 4G2NA 3G0OA 4IDGA 1B8PA 3TPCA 2NACA 3I9OA 1K5HA 3FNFA 4PZEA 2B37A 4PIVA 5IAAA 2OL4A 1DAPA 1P1KA 1YH3A 5JSFA 3K2BA 1UH5A 2ZKLA 3AI2A 1U8XX 4Z9YA 1R6DA 3WS7A 4GL4A 4IJKA 4XQ9A 4WEOA 3WMXA 3P2YA 3ULKA 1QLHA 2F1KA 2RHCA 2VUTA 3CTMA 3PHHA 4ND3A 5MDHA 4Z0PA 4IDFA 3JYNA 2PH5A 1BG6A 4MJLA 4ALJA 1VE9A 3K31A 3GMSA 5A4DA 1P74A 4WUVA 3I1JA 3MJCA 3PJGA 4BKPA 3KYCB 1RYEA 1VJ1A 3DBRA 4MVJE 4PLTA 3WGGA
chains in the Genus database with same CATH superfamily
1HLPA 1M1YA 1FUIA 4KQ2A 4BNTA 4EY7A 4ES6A 1U8FO 3K1JA 5KWJA 2B8EA 3DLHA 2I3GA 2PDAA 1A8QA 4TTPA 2VDOB 4F4IA 2CDAA 4TM7A 3U4CA 4BGDA 4P80A 4OI4A 1R6UA 3K30A 2O0JA 4QICA 2VXOA 4JU8A 4TLEA 5SY4A 2NQ8A 2P67A 3DMGA 3FVQA 4U5XA 3SHFA 3ZWAA 3I09A 3NBYC 3Q7EA 4LISA 1A8IA 4ND6A 2Q9AA 1RKBA 3C14C 4J0EA 1DEXA 1FUEA 1M0TA 3K0AA 3T1HB 3VHRA 3G49A 2FPGB 2X4LA 3ENZA 1KI7A 2P40A 3D64A 2FTKE 2G4CA 2WRZA 4OQDA 3R7BA 3Q9LA 3ZE2B 2UUBB 4PAQA 1KU6A 1JYSA 3F0TA 2QGNA 3IKTA 1BDHA 1CRZA 4ZOLA 1KYZA 2A84A 2D4HA 3GEMA 4QG3A 3V5NA 4A03A 2ZRDA 4YHHB 2B4AA 2H0RA 1GARA 3V4VB 1X3LA 3RH0A 5TT0A 3JSXA 1QOZA 5E9AA 4R71A 3HFJA 2GCNA 1SBQA 3AY3A 4YMTA 1W6RA 5KYGA 2OPHA 3DSRA 5C1BA 2IODA 2P11A 3V8PA 5DBHX 2H5LA 2B8WA 5JD5A 1WDLA 4IS2A 3VPCA 3FR8A 2ONCA 3AWIA 2J3KA 1CLEA 4B44A 4CV3A 4D25A 1OWOA 1Y3HA 3N1UA 3NG1A 4F4HA 3JASB 1AKUA 2EKZA 4NZZA 2XTZA 2BMEA 3CE9A 3AC0A 4A2PA 5DYGA 3GVIA 4DKXA 3L6CA 2XUOA 1KBZA 2WF8A 2ZT8A 3EIOA 3PLRA 5EKTA 7MDHA 1EUDB 4MS4A 1NVBA 3PJEA 4L7QA 3RSCA 4Q9KA 4QJ5A 1E2MA 5FORA 3MWDB 1SVUA 2NYUA 2B99A 3SC2B 1XF1A 3LT2A 2NU8A 2H1WA 2BRUC 1H2EA 2AWNA 3EF3A 3O84A 4M53A 4Q7JB 4EB6B 1XQYA 2Z3VA 2YDYA 1XU9A 3O4GA 4JB2A 4EY6A 3NB0A 1BSVA 1Y82A 3A4YA 1BX0A 5EC8A 2MDTA 1RNLA 2ECOA 2JI7A 4R2JA 3UOWA 4HDCA 4TWJA 1T29A 2F62A 1DBVO 2L0XA 3KSMA 4HNHA 2C2OA 1J20A 2I4TA 4R6WA 3HM9A 2R47A 5HQ3A 1QH0A 1TECE 3DDWA 2HADA 2WINI 3KEMA 2J7PD 4H35A 6AT1A 2HHLA 4XVHA 1ZNYA 4PLYA 4N48A 1OUMA 1P1IA 3L8EA 3UB4A 5KNCA 5K09A 2C5SA 1XZKA 1SVKA 3DTYA 1F5SA 2ZUUA 5HW0A 1CW2B 2HDOA 3KFVA 3X2FA 4DHEA 3WGHA 2V7QD 3HNRA 3IBGA 3ASUA 4RVFA 3JRXA 1RQ2A 4OQPA 2A0XA 4I9FA 5M3BA 3RG8A 2AG1A 4WQMA 3ZZ0A 4B45A 2ZM6B 4AI6A 5C80A 2JPDA 3BF7A 5HRCA 4CM8B 1WMBA 4RZHA 2A9RA 4OJMX 3SXPA 3GX1A 1K4YA 5A7GA 3C7KA 2E85A 2J0UB 2A59A 4PG8A 4AX4A 4EHIA 4Y1RB 1UK6A 2FG5A 2FZEA 3OX1A 4QO7A 3TLJA 1W73A 3QI7A 4AUMA 2F3RA 4H6PA 1GQFA 1U2TA 2IT1A 4KXUA 1A82A 4D3ZA 1UUFA 2CNDA 4D9HA 1B15A 1HF3A 3GLFE 4AN4A 4OGWA 1IN7A 1TGYA 4H31A 1FNSA 3IQWA 3BMNA 2QNRA 1NVDA 2UYCA 1W8IA 3NIGB 1ZN8A 1UQTA 3CF0A 2DJIA 5DYYA 2KM1A 4RSGA 1XYGA 1JFRA 2XUKA 2BCEA 5GONA 1Z0JA 4FN5A 4YAGA 3U09A 1JEDA 3OJEA 5LQDA 1CR4A 3OIWA 1B0AA 4QARA 1IMOA 4RFVA 4EUFA 4G8JA 5KBYA 3PFNA 1KSHA 3EZ2A 4TV9A 4OIMA 4EPTA 2Y6UA 1QV6A 2Q7XA 5J23A 3PRYA 5AW4A 2GNOA 3OP4A 4MWTA 4DARA 3LHSA 1GG9A 4UATA 3SZUA 3F5DA 3TUIC 1Q0TA 3IGFA 1H2WA 2EHDA 2Q9BA 4OO3A 5CA1A 4RA9A 3E1KA 5K0FA 4WFQA 3FMPB 2X0DA 4ZQIA 3W1EA 5IVIA 1SU6A 1ZDMA 1CXZA 3Q0IA 2IYZA 2EX1A 3LA6A 4J2HA 4G89A 4K40A 1YWGO 3G0DA 4X1YA 4TSRA 5IDYA 4B6GA 3KZCA 2DLCX 4UMVA 5E1BA 1BMTA 2EL7A 1AC5A 2QTVB 5JSYA 2CNBA 2QU8A 3DUFB 1COZA 1KS2A 3DEFA 2FWMX 4GMXA 4MUXA 2C97A 1IE3A 3O4FA 3BMXA 4U2KA 5F7OA 2FFRA 4C4SA 4Q3EA 1KMHB 2OK7A 2X9NA 2XCOA 4OQNA 2P1ZA 4PSDA 2IPMA 2ATXA 2YFQA 4RGQA 4MKFA 4XUCA 2J31A 4UBLA 4UBMA 4WY8A 3M6WA 4X7RA 4YJ3B 3TCXB 4EITA 4MW2A 1P7ZA 5LZ8A 3T15A 4L5JA 1H05A 3DOUA 3BVPA 2RB5A 3KKLA 4S1VA 1TVMA 3OT1A 5E4YA 3M4YA 2M6LA 3KJGA 4AYWA 1HPLA 1QYWA 2PMEA 2FMUA 3EF0A 4B4WA 3EQ9A 4L5CA 5FI1B 1H66A 3BSSA 4DG9A 4IH4A 3B9QA 3DOFA 3PB3A 1A69A 1W87A 1SIWA 2BFNA 1QHYA 3I6YA 2OD7A 4A92A 2UYOA 2A94A 2HJHA 1DIGA 1LDGA 1FS5A 1QMPA 1M8GA 3TPFA 1WMSA 3IJEB 4YRGA 1VL0A 2XRFA 3C7TA 1I3KA 3HU5A 1XHFA 3VO8A 3VPXA 1UKCA 1ZWKA 1NLUA 3BCHA 4HN4B 5A04A 4M1OA 4PNHA 3ZQKA 4NCXA 5JAPA 1V5FA 2QR5A 3LVBA 5HBRA 3UV6A 5A3SA 4HB3A 1UDWA 1WY5A 4CI9A 4JX9A 2QP3A 3DKPA 3UV3A 3THXB 2EBWA 4Y18A 5BYBA 4JT2A 2HCJB 2E4YA 1CQJB 2H2IA 4KGDA 3RYHA 3TTUA 4YIHA 3HJHA 1ANKA 1VPVA 1YBVA 4XYGA 3PG5A 4IHJA 1RADA 3LCRA 2VRBA 4OV6B 1HDIA 1A9RA 4FYJA 2NP6A 4FOSA 2YXEA 1W85A 4FIZA 4G0ZA 1QDUA 2ERXA 3PNOA 4IDEA 4UKDA 4AZWA 1W52X 2YC4C 2F9MA 3FGPA 5EQJB 2J0EA 5HA5A 6GPBA 1N4DA 5K0EA 3I6IA 3PRHA 4K9SA 1YKSA 4E30A 2IYQA 3F6CA 2D5LA 3GLFB 4YMVA 4NWIA 1ECCA 3LX4A 2IYRA 4B9AA 5BUZA 2YWHA 2NUTB 1I30A 2R5FA 3F97A 2UUCB 3GJQA 3AJEA 3E3NA 3M82A 2DPHA 3KDPA 4UEQA 5HF8A 3E8XA 5TX7A 1MZVA 3ZHYA 2WUDA 4YJGA 3A4IA 1N9ZA 4B8WA 4O02B 2WKRA 5HBGA 1N2OA 2GUWA 3P0FA 2VHVA 2Q28A 1WZ2A 3HN7A 5LBUA 4ERNA 5JDIC 3BMQA 1QQTA 5GJCA 1KYIA 1HYBA 2X3UA 1DU4A 5CBPB 4QUAA 3EN0A 3I3SR 3PGA1 3PDUA 1R4NA 3G0CA 4OF4A 3F6PA 1VG8A 1OI7A 5DYNA 2YQZA 5IBQA 2HYIC 3FHLA 3MTEA 2IH2A 1DKUA 1ONNA 4M9UA 4RANA 4Y6OA 5G53C 3REOA 1RS0A 1T2FA 2ZAGA 3C6ZA 5CW1A 4YONB 1BWQA 1UDBA 3AL3A 4PGGA 4ZIRA 3ZVNA 4US0R 5EJEA 1SAYA 2WMNB 2WT4A 2GEFA 2PL1A 3ILVA 3D7NA 1YKFA 4HUTA 2WV7A 1XR3A 4DNPA 3KLNA 5A4KA 5HUQA 3R23A 4MDFA 2IF2A 1Z6PA 4QQFA 1FIUA 3SQXA 4I3FA 2Z9BA 3DHYA 3RVBA 1CERA 3O1IC 4TTJA 3CNEA 4IKOA 3WIOA 4X97A 1II8B 1RPAA 4B3MB 3G1TA 1U5BB 2AF3C 2O1SA 5ESXA 3K0HA 1KK0A 1ZSNA 3ZHSA 1EPUA 4LJ6A 2CCGA 1P2UA 1Y8AA 2CVFA 2XYRA 1SHUX 1VG9B 3CLHA 4ZT6A 5JDCC 1AHHA 3DS8A 1SCNE 1K6IA 1L5QA 3VXKA 4BMYA 2D0PB 3S81A 3QUBA 1KGSA 1R4ZA 1N7IA 3ZY2A 3NGMA 2IXTA 4KGXA 1H22A 3CWQA 1RI4A 3SEFA 4EI2A 2YN0A 2ICAA 4I36A 4IGFA 3WNVA 4V0LA 3M6UA 1N0UA 3AGPA 1KEWA 2GJSA 3DO8A 4B6JA 2JD2A 3G6WA 3DKKA 1H9BA 5ITWA 1B6SA 2CYCA 3H1PA 1I1OA 3VSAA 3ZHZA 5GJBA 4CLRB 1N0VC 1OWMA 3IQDB 2BEKA 4LW8A 3WKCA 4DSNA 3DD1A 3L7DA 1Y8RB 1RYMA 4LYFA 2RAPA 5EHIA 1R8XA 3D02A 3IBTA 1OZAA 3T99A 2AFIE 1MJFA 1NJGA 2PZEA 3DAHA 1K1EA 2EG5A 3VJLA 1F4VA 4LECA 1QC5A 4XGKA 1SU8A 1U7UA 1NSYA 1XP8A 2P6MA 2PXHA 3KEFA 3QA9A 4KLCA 4OH1A 4ASUA 4L27A 4U7FA 2QPTA 2YOFA 4PNPA 3F6SA 1HOTA 1WU8A 3U60B 1SMKA 5DZSA 1NAIA 4A0HA 5GZ6A 4BPBA 1NMXA 2VR1A 2B1QA 4QAQA 5CHYA 4YFYA 3WNQA 5B53A 3GG2A 4FS3A 3RKRA 2EV9A 3THOA 3ZPXA 2I4LA 1ZMBA 2OGTA 3LZCA 4DMKA 1KYYA 4HT3B 3ZVKA 1QZZA 2WF5A 2JFFA 4S1OA 1JG3A 2ACKA 2GK7A 1JDPA 3NXKA 1ICIA 2GCIA 3PX2A 3TLMA 3WLRA 4X91A 3R9KA 1I2ZA 3EXHC 4G0QA 1JA1A 2FEWB 3FYTA 4R4JA 1J1UA 4U1RA 1RKUA 1ZL0A 4WFIA 3VISA 1Y1RA 2W2KA 2W6QA 1IEVA 4YCBA 3U3KA 3WDLA 3RRNA 1NGSA 5A5DA 1RE1A 3BHJA 3IT1A 1UBHS 2Q1WA 1OJLA 2WY2D 2Z5LA 3RFVA 1NBMD 1N8SA 4ZYUA 5FUBA 3FFXA 4R2IA 4TYPA 2ORVA 4FGUA 1CVRA 1Q21A 4R2XA 4LQLA 1C3OA 3K2QA 5FOVA 4MAAA 3TOZA 1C7QA 1HORA 3OTGA 2WU1A 1E7SA 2PL3A 3RS8A 1N32B 2O19A 2CFSA 2FE1A 4HWTA 5JAUA 2WWFA 1XGKA 1TM5E 1VJDA 1SD1A 4GC5A 3ZJYA 2VDWA 2HBQA 4JLOA 3VA7A 1F7VA 2F3QA 1JLRA 3IMEA 1N0IA 1JPNA 1H4TA 3QKSB 5F64A 2B83A 3UMRA 4D3YA 1KC1A 2VQ3A 4IQ4A 2I3DA 2NT4A 3FRIA 4FT2A 3MIZA 3CEPB 3SSOA 1WMDA 4FKBA 4O8CA 2HX1A 3VPSA 5HS6A 1ZY2A 5C9ZA 2X14A 5BR4A 1J4AA 1FDWA 1S4QA 3OE1A 3QXHA 2C4KA 2YQ5A 4H1UA 4OQZA 3R7FA 1C1XB 2WU8A 1E4EA 3MGKA 3VMMA 4YAJA 4YXFA 4AL4A 1R6AA 4TVBA 2HJRA 1YKGA 5LDHA 2BLLA 3Q4GA 2J4FA 3WK8A 1G3MA 1QIIA 3KT6A 1VJCA 5LPNA 1GKYA 1VBNA 2YVQA 3N0WA 3AG5A 4PLPA 4RVGA 5J5CA 4N82A 1BWRA 4ND5A 1G20E 5DNYB 3IHWA 3K0BA 4O63O 2OWEA 3G68A 4C20A 4QUHA 2CKDA 3HUFA 3MTBA 1NI3A 4RPIA 4BO9A 5KDDA 4L3VA 3ONVA 3CX3A 4LSGA 2VYFA 1AM4D 3E15A 5CDUA 2D4AA 3FD8A 3FUWA 3H8SA 3IUEA 3QLUA 2Q6VA 1XBTA 5LA6F 1EWVA 3TOSA 2PK3A 1GVHA 2DYKA 4B32A 1UK8A 3NDRA 1ZH0A 5EGNA 5BPFA 1CC1S 1BZYA 1DAKA 3BGIA 4BV2A 1NP7A 2J48A 5L7WA 2OC9A 2UDPA 4TKUA 4XYBA 3JZAA 3O6VA 2RCNA 3RK0A 3IP6A 1PUXA 1G5HA 3S3TA 3QWHA 4HCJA 1WF6A 3BH7A 5TF0A 3TZ6A 3ZNPA 4ON9A 1CPYA 2R4QA 2VSQA 2ZVDA 4LSWA 4O25A 4CFYA 3CH7A 2G0AA 3QE2A 4CMKA 4KU4A 1F8XA 3UXMA 5C5IA 3P2IA 3HACA 1RAGA 2QZPA 4YUAA 3F9RA 3ISTA 3QXCA 1CP2A 6REQB 1FQOA 4ER6A 3DOHA 3BL8A 4ZRDA 2Q1TA 3DC7A 4NENB 1U8ZA 2HY7A 2I67A 2NYAA 3DAFA 1NWCA 2VWQA 3KZ1E 4C4PA 5DPMA 5KS2A 2HF8A 2IOFA 1M7BA 2H5JA 1OBVA 2PUHA 1W49A 3HM2A 3DA8A 4N40A 4ZXFA 2IYPA 2OM6A 1N6LA 1WSWA 4HG2A 5JS6A 2VN8A 3BL5A 2PIAA 4HWRA 5IT5A 4LV8B 1EWQA 4BKOA 5COQA 2NV0A 1WXIA 3BKXA 4QU0A 1JWBB 1WWKA 3FJOA 1PW7A 2WTBA 4REMA 2GEJA 1KEZA 3V4ZA 4LDJA 4FMCB 4BNJA 2PR7A 5IXYA 5TPWB 4RK4A 4HD8A 3U5TA 3BDIA 3QIAA 3LDGA 5CG2A 1CUJA 1UOOA 4F1WA 4YT2A 3GLIB 2GCGA 2NPIA 4IJSA 4YAFA 2GTPA 4PC1A 3S68A 3SWWA 3SAJA 3AEKB 2DQYA 5JO0A 4FGSA 3VJRA 4UE3S 4JL8A 1H4QA 2P9FA 3DULA 3WGKA 3ZD9A 3KZMA 2XMDA 5CDFE 5HKKA 1SKYB 3NP7A 2FG6C 1GPYA 1L5HB 4CTNA 5B6IA 2I4NA 2X7XA 3K6JA 1CSEE 2Q0HA 2C84A 1G21B 2H54A 1UFOA 1WXGA 1ZD8A 2WIKA 2HSJA 1H2AS 2TMGA 2ZQ5A 3IP3A 3KT0A 3LFUA 3QWBA 3IT0A 4LXGA 4TKMA 3T8YA 1H1DA 3Q40A 5ALUA 2IEAA 1EHIA 3EEFA 4NK4A 3RC9A 2YVLA 4OHWA 3TFOA 4HNVA 4H9GA 1UBOS 4FDAA 5FADA 4BO2A 4DUGA 1A9XA 1XZLA 5CK4A 1ESMA 3P1JA 2HRQA 5AVOA 3IQXA 2WAMA 4ENSA 2QUJA 4P34A 2WOOA 4BAGA 3WL6A 4J16A 3JAWA 1SVLA 1YUNA 3QJYA 1KY5A 3LBAA 4I0WB 4PEVA 2VUHB 1L5ZA 1EGAA 1Q1BA 4IYJA 3RS0A 2P65A 4GPTA 4Y2SA 4HAXA 5FTWA 1D04A 1W75A 2QN8A 4C88A 5CXQA 1IN4A 1RVV1 4MKHA 1UK9A 1D1QA 3AW9A 3VC2A 1IWPB 4IGAA 5F77A 3PUVA 2FUG6 1HETA 4RFLA 5AOVA 1P39A 1U7XA 3IILA 4P7KA 3IP8A 1SQGA 1ULSA 1AUPA 2GAFA 1DFIA 3OFND 3B2EA 4LQ4A 4BO4A 5A06A 1MG0A 2GFIA 1XDGA 2HLPA 3HEAA 1RRCA 5JD6A 2NG1A 3RODA 1Y5MA 2WOJA 3IT3A 5YASA 3ZK7A 2GZ1A 4DM4A 2A57A 2BEVB 3FYHA 2BZ0A 5K9ZA 3GLGB 4LJ9A 1HWYA 3A6HA 3H0KA 3JYLA 3K2EA 1MB9A 4EFLA 5JH7B 1W4AA 4GS5A 4LZZA 3PTAA 3HVHA 3BULA 1AKNA 2OGWA 4GKAA 1IEQA 1AQNA 1Z33A 2W2TA 3CLRC 3EG9A 3AUUA 4A26A 1E2QA 4HDMA 1S0UA 4ISBA 4B35A 3LQ4A 1GU0A 3EPJA 1XRMA 3QVOA 4YRCA 3HKCA 1X14A 2IQ5A 3MB5A 3ZBTA 3R0ZA 2V4MA 4HLUA 4E46A 4OQLA 3QPBA 2J6CA 3K5WA 4YP5A 5JPIA 1LH0A 2YKGA 2HA7A 1L5NA 3KRTA 3LYUA 3L0DA 1DHTA 3QTTA 2F1HA 2H92A 2OQIA 2VL7A 4N5LA 3F67A 3RQIA 1P7WA 3SHVA 2VQDA 1AO0A 4OQYA 1RLUA 3ADCA 3S70A 1R6TA 4L72A 2GCPA 2ZUWA 3FNIA 1V6CA 2MINB 1PNQA 4XM1A 4NCJA 5SYMA 4FVTA 5E6UA 3WDMA 3W5BA 1RZUA 1THGA 1H9CA 1RJEA 3UYKA 1TJ3A 4DCGA 3ASVA 3H2BA 4HI0E 4C4XA 2EW8A 5M2QA 4ZGWA 1IM2A 2W6NA 4CF6A 1DRWA 1OBCA 1Z4NA 2HPZA 5IAGA 1KK2A 3DXFA 1F17A 1E94E 1G8JA 4DCSA 4Z3KA 4ZYWA 3ELDA 4ECAA 3OM9A 3TJRA 3L49A 2XUDA 3TR5A 1YB2A 3ELBA 3BH0A 3QE4A 3OPYA 3PUIA 4NARA 2CUTA 2F8MA 3I30X 4JT9A 2I71A 1YHNA 5CLJA 4QA9A 3VU3A 1J21A 2P2GA 2QRLA 4JN6B 4NBRA 4O4LF 4PAOA 1J24A 3FF1A 4E0BA 2AOTA 1E66A 2X42A 1U2PA 3LBNA 2HN9A 1UPCA 5DKFA 2B1RA 4C2TA 4G3XA 5B4UA 3ZXYA 4YQZA 3EIXA 4ND7A 2NZ2A 3KXIA 3RWMB 5AKXA 3TIIA 3TQSA 4ZCLA 2HREA 3BERA 1LFDB 4W5WA 1WD5A 1E1LA 4OYLA 3PNBA 4GX0A 4EO4A 2CLIB 4NXNB 4R05A 3C5HA 3KJEA 1UC8A 3A28A 1CVIA 3I9LA 1XJ0A 1UZUA 1FTWA 2AZTA 2HDWA 2OQRA 1GL7A 2PA3A 3C98A 3G17A 4JA2A 1DS6A 3EOAI 3SC4A 1BE6A 3TPZA 4AQDA 4BCCA 1JIQA 4ZICA 1H8EA 2AJDA 3G5LA 3OQBA 1K97A 1Q15A 4N65A 2YASA 4JJFA 4FQ8A 3K1ZA 1UPAA 3OIUA 4B4VA 3T5BA 4RH0A 3WISA 4OI2A 3SQMA 1WW8A 4Q4HB 4EG6A 4MYDA 1LX6A 2ZJ4A 2CW5A 4XIYA 3OCJA 4YAEA 3HC7A 5SZJA 2DZDA 2BEJA 2YZ2A 5DF1A 5EWMB 2AYZA 4Z1MA 3NBQA 5F3RA 2WYVA 3BFVA 1XYYA 1E8DA 2Y77A 1XJQA 1NC1A 3VZSA 4DGSA 1B8VA 3BREA 4NG4A 2C4VA 2PXXA 4B6OA 4W5TA 2DB3A 4BNXA 2XXAB 521PA 4XAQA 4B9EA 2VZ9A 3HYRA 2WD7A 4HAOA 4I3GA 4Q82A 4UZFA 3J81A 2Z8YA 4YTEA 5F98A 3CLTC 3GRKA 4RDHA 2E7ZA 2OCIA 2YOGA 4CKCA 4KUEA 5E7MA 4MJXA 2CVHA 4YLYA 3NTOA 3W78A 4WJZA 4DV1B 1KDTA 3ZEIA 1UOQA 1ZK4A 3TTVA 1YDMA 3LT1A 4EUEA 5KTTA 5D3KA 4LDQA 2O3RA 1XX6A 2LKCA 3AHHA 3JRNA 4Q18A 4CEJA 1ADYA 5EESA 1B8NA 4LF6B 1PWZA 2HBZA 1QWOA 3L6DA 4YCMA 1M83A 3E18A 4LMBA 1G3QA 4DLWA 1OAKA 2ZROA 3HY6A 4PHGA 5KCMA 5DM70 4MW0A 2IKQA 5A62A 2JAHA 2XCUA 1EFAA 2JCBA 5I9IA 3T7IA 3X1KA 4A2CA 3B60A 1PX0A 1Z6TA 2OP1A 2Q5LA 3HVJA 3MTDA 4GEKA 2TMYA 4I55A 4INZA 2LW7A 3IBYA 1NY5A 2JFGA 3B9BA 1ISPA 4KI7A 3HJCA 4MP3A 2C7PA 1FLDA 2ZE6A 3UHPA 3PHIA 3WRXA 3OMXA 4AAYA 2QTLA 4EW6A 3E5NA 1AXRA 4HFJA 2Y27A 1H4SA 1I6LA 5CDGA 2R1VA 1U28C 4TT3D 1R5NA 2W0MA 4C5BA 4EG0A 2R44A 3DF9A 3P71T 1IBRA 1XTVA 2EF0A 3C6XA 1M5RA 1Q7EA 2HIMA 4LV6A 4WRRA 1IFXA 4I1UA 2BFBA 4Q02A 4PZYA 2FSVA 4DMGA 1BVRA 5SY6A 2EKPA 2JL1A 4LRTB 1V11A 1YA6A 3AHJA 4XYLA 4Y2UA 2PKQO 5K5EA 2ONKA 3W6ZA 4XQ0A 4FJ1A 1F12A 3WRVA 3CRZA 4JB0A 2BFAA 1E2IA 2WWHA 1H94A 4WH0A 5GM2A 5JXHA 3ZLJA 5LXTB 2WM8A 2WDPA 2MYTA 4L85A 3UATA 2ZUBA 3M1IA 4HAZA 4J7XA 4P84A 1X2BA 3V7YA 2OYSA 2XNDD 3HCDA 1XTBA 3RYCB 4Z0TA 1HSZA 4DIMA 2PWBA 1Y6QA 1KYWA 3M9LA 4OMCA 2Z9DA 4R7ZA 5CDYA 1QDEA 1RXIA 2ZRCA 1NQOA 1B14A 4YRPA 4MUHA 1KOGA 1IY9A 1ZI8A 5EXDA 1L1FA 4EUKA 1ES9A 1T8WA 2I2BA 2O14A 3FBGA 2D3TA 2M6SA 4RXMA 1D2HA 2C20A 3LUAA 4GT1A 1U5CA 4QE3A 1KDZA 4XWOA 3Q8LA 4PS1A 3WI7A 2FJPA 3RV3A 5D6NA 2YUIA 3QFHA 3WJ7A 2R85A 1ABFA 1NXPA 4JJ8A 3HKBA 4RXTA 1EQ2A 5E7JA 3INYA 3WFIA 4UOEA 5J2TA 2MSKA 3T3EA 4C4ZA 5M34A 1PKXA 2PD6A 3K3PA 5CXUA 1I3MA 1NOKA 2NNWB 2FWRA 5ALFA 3U3OA 2QVXX 2Q5EA 5NLLA 1KEEB 3I12A 4J4HA 2J6BA 5CNKA 5DBFA 1BMDA 2PGXA 2H7VA 3N39C 4RKWA 3TLZA 1ISGA 5EL0A 3ZU3A 3LOUA 5DM4A 5FBRB 4JWKA 1ZXBA 2GHIA 2HDNB 1AQYA 1GCGA 2I78A 3SDZA 2W98A 1NIJA 2R1UA 1BXZA 2AWOA 2XNJA 3EDRA 3UQYS 4AQ7A 3SZLA 5KQGA 1E5VA 1KHTA 4GEGA 3JZFA 1YRLA 1SC9A 5AHWA 4D8WA 1CY8A 5M04A 3CXUA 5KJ1A 5ISMA 4CEIA 1E6KA 2A1TR 1AUXA 1AKYA 3UAOA 1P31A 2G7MC 2QT9A 5BVGB 1YRQA 2H00A 1ND6A 3BIJA 1YDEA 1JQDA 2H3HA 5GGXA 4ROSA 2VYVA 4MW7A 5G1NA 2BI8A 2GN1A 4XDZA 1IVYA 1HE4A 1ZD2P 4KOAA 3D2CA 2VAPA 3NHPA 1RABA 2VK1A 4AVYA 3EIFA 1MD9A 4E1BA 2OK8A 4DR6B 4IL5A 2FN4A 2P6NA 1DCKA 1OPXA 2J0SA 1MU0A 5G0TA 3C97A 2Z5GA 4CKXA 4ZCIA 4F5DA 3THXA 1H1LA 3EEQA 4JBIA 3LOPA 4TTSA 2HTEA 5AP9A 4EENA 5B1EA 4FGZA 2QJWA 2K87A 3TLKA 1K2WA 1O03A 4CG3A 4LFAB 3AUYA 2HEGA 4IFEA 5JJKA 4ASUD 3ANMA 3FOEC 2W42A 1S9HA 3WLOA 3ZNOA 4QJBA 4A6XA 1VHDA 2IEIA 3KS9A 3MBOA 2RFLA 3A9UA 4W7SA 2BJHA 4I50B 3CZ4A 3SPXA 4X64B 2G67A 4QLAA 5EMMA 1ZUHA 3EVTA 3OLVA 9GPBA 3I53A 1TM2A 4TTVA 3Q2OA 1NQTA 4UFOA 4Y9TA 4PCAA 9MHTA 1CG6A 2ETXA 2HJVA 2NO0A 3BE6A 3OM1A 4OAQA 4WZBE 5I9BA 4RMHA 3G02A 3KOUA 3H84A 2I0FA 1AKTA 2W83A 2BMFA 3GZNB 2QZSA 4IBOA 5JJBA 3GYGA 4A16A 2DRIA 3FYDA 3GFVA 1IU9A 1FCJA 4TQUS 5JJCA 1Z75A 3IMGA 4ZAVA 3FZNA 3TINA 3J80A 5TQVA 4NU5A 5ALTA 1E2LA 1GUDA 4EYOA 5F9FA 1U99A 4YLGA 1LLCA 2NZWA 3H8VA 3W77A 4X3PA 2CBGA 4BZWA 5C8XA 2XB6A 3I64A 1OXTA 4L07A 1BYUA 2C83A 4HEA6 4S1WA 5JHHB 3VR6D 4LCEA 4H0NA 4O29A 1R0BA 3VC1A 5DNEA 2J07A 1O87A 3V1UA 8ATCA 5IT0A 2Q2NA 2VTKA 4OOFA 3QE0A 4PPQA 2PJDA 1U8CB 2CMGA 4IAOA 1YFJA 1KAEA 1N7HA 3LT5A 5LOVB 1YJQA 2SKDA 3ENWA 1ZVMA 2VAXA 4YWJA 5FTNA 3WB2A 3DB2A 2CL7X 3TDNA 3AHCA 3RSZA 1C0LA 2AFIA 3BRWA 1PO7A 3GLUA 2A8YA 2GAIA 3DXXA 3IUSA 3NYRA 3PD7A 2W6OA 3LLUA 1FNBA 2B34A 5DLEA 4NZYA 1JG4A 3QUCA 4IDOA 3M34A 1YUBA 2A1TS 3FXAA 1B3RA 2ORED 3QFFA 1TUIA 4MWGA 3X1JA 4B3CA 5CB6A 1VB5A 1MENA 5GWXA 1E1QD 5CVCA 4KJZA 4PZPA 1R0SA 5EJ4A 3NO4A 4PFJA 5ALIA 1DRVA 1GPJA 3IB6A 3CLKA 1BXGB 4PXSA 1E8MA 2CFRA 4TZTA 5TQ0A 4Z8YA 4HRAA 1VG1A 1BMFA 4DS3A 5EJIA 1NVVQ 2BI4A 3EXFA 1Z29A 4KLNA 1Z8FA 4RIHA 1XV5A 3HPRA 3R5HA 3I9MA 1GZ3A 4M99A 2XYVA 3MELA 1U9JA 1N75A 2XUHA 3WRYC 1LTHR 2W71A 4L15A 3T7TA 1OJ7A 1PJ4A 2D74A 4ZZ3A 1N2HA 2FEOA 2H65A 2X8AA 4Q1BA 4DDVA 4P4SA 4BU1A 4QXMA 1IZ9A 4KPEC 1N6HA 1ZK2A 2RJNA 2FPSA 3SIRA 2PBRA 1GUBA 1JZTA 4PIMA 1SUFA 5J3JA 3C1TA 1DEHA 1DBWA 2L18A 3EQ6A 1KDVA 4ER7A 3A3KA 4PHTA 4K9LA 3ONDA 3F8TA 1SCDA 4LJLA 1X8LA 4M0KA 1DGQA 3HO1A 3GEPA 3R1IA 5A9TA 3UPUA 2FETA 4FLEA 3PQDA 3R8XA 2IRWA 2X8JA 3AVOA 3PEVA 3PNQA 3QX9A 2IS1A 5TQJA 3L93A 1QIJA 1Z0SA 4EWLA 4BLUA 5J43A 4CUJA 1D6SA 5FXMA 4AWBA 2EG9A 3TRFA 5KOJB 2BI7A 1NYRA 1PBTA 2GF9A 2NN3C 1DAOA 3ASYA 3ND9A 4YP6A 4CIVA 4ZCMA 1CR1A 1CF2O 4RHCA 1PCXA 4RD2A 1LPSA 1EQAA 2ZZNA 3E6AA 1P75A 2GN9A 1MB3A 4HAWA 3HABA 5JROA 5AK5A 2FXVA 2HAEA 2W8BA 1GNQA 1IHYA 1L6RA 1FNDA 2G40A 4MW6A 1E4YA 4QZVA 1NNI1 4CKYA 2CYAA 4BTVA 1YB7A 4HNSA 4ZCQA 2NTNA 1R3DA 3WSVA 5CBKA 1XNHA 1HEUA 1OFIA 1R4AA 4MRVA 4X1IA 1G8MA 4CETA 5SYAA 2X1MA 2FG7C 5FBWB 1I4TD 2YRFA 4ADSG 4CBVA 4D9BA 1N36B 1IVNA 5JXIA 4O2BF 3SFTA 2NO7A 1UADA 4CEHA 1CRWG 3AKEA 4M6WB 3TRKA 4Q1AA 1G20A 2VDNB 3E23A 1Z7BA 1BWSA 2ZCUA 3BE8A 1BW9B 5EKUA 4KUHA 2PGNA 4ZO9A 3STWA 2CLOB 3ZHBA 5IKPA 4YJ3F 5IARA 2YIDA 1LRKA 4O4HA 3TTYA 5B3AA 1N6OA 3R0XA 1XD2B 5HTKA 1F4PA 4BUZA 2DLDA 1ECPA 1F2VA 2ZYRA 3W3AA 5KQSA 2BM1A 2FWBA 4IFIA 4WESB 2TYSB 4FNGA 3R40A 3TUJC 1XJ5A 3EAGA 1OSNA 4TRRA 3E3AA 1S1CA 3ICCA 3QBJA 4WY2A 1WKVA 1VPEA 2AOVA 2QZJA 2R6FA 5IUNC 1EFLA 2VCYA 2BBOA 2B9VA 2Q6LA 3NUZA 4IGKA 2IXAA 1TQ2A 5HCUA 5FBHA 2BW0A 4TLCA 3SJUA 1TW2A 3RRZA 2Y2UA 3ZDFA 1Y63A 3W6OA 4C22A 2QUBA 4LI0A 4B75A 3P0HA 1BE8A 3L8FA 4EL5A 1HXHA 2XWQA 3DEKA 4HLNA 4IP0A 4K5QA 4ZREA 2FZKA 5HGXA 1R50A 4WCFB 1GKLA 2AMJA 2ZSHA 4PWZA 1UK7A 1YR8A 2QUIA 2ODBA 4U4AA 2JHFA 5CX1A 1NN5A 4Q4LA 3H13A 1ZLYA 4DUGD 1KMNA 1TGVA 1WZCA 1AG9A 2Q5CA 2QTWB 4WVLA 4IRMA 4KREA 2EW2A 3FHJA 4L4SA 2IU0A 1XU7A 2NU7B 4M98A 1OC4A 4BE9A 1TLLA 1E96A 4MROA 3KDAA 3RRXA 4ZTBA 5JSZB 5C7OO 4MPPA 1KDRA 2BF7A 4PR3A 2VPYA 3SJ7A 2CK3D 1RJWA 3LKZA 3NHYA 2B8JA 3HP7A 5AQEA 1U7ZA 4MV6A 3T7RA 3U2QA 4KQ6A 1ZN2A 4GZMA 3AF3A 4W4TA 1C14A 1M0SA 1C9YA 3A36A 1P7VA 2G9UA 4FR0A 2EWMA 4CQMB 1JHXA 2WSLA 3MIIA 3WWEA 1Z8NA 2AC4A 2XHEA 3O75A 3WWDA 4Q7KA 1P61B 3HV0A 1Q1NA 4QTZA 1QKIA 2BY4A 1NXSA 3BWEA 1F2TB 5LZ5A 4EA9A 3PQCA 5JLJA 3EC7A 1I36A 5AVZA 1TOAA 4JVLA 4WBNA 1VZ2A 2PLNA 5CDFA 3KB1A 4DR4B 3KAPA 3NVMB 1L5YA 4IEEA 5H5JA 1K8QA 4UNNA 1NT4A 3Q6MA 1FTYA 3PQ2A 4ZU3A 1FE8A 4BKQA 2OAGA 3ILHA 3OLWA 5IJ9B 2HUNA 1XMPA 5ECGC 5TNXA 1U6KA 3OTWA 4BRUA 3B8EA 2MJLA 3C39A 4N3BA 1NKTA 1RHRA 2JLBA 1HT3A 3S7ZA 4CVNA 4MB6A 3HDTA 1VLMA 2VG8A 4XM0A 3VR2A 1GLGA 2XTNA 4GOXA 1A96A 3MCTA 4FINA 3FIUA 2JA1A 4OU4A 4TMWA 4XWYA 3VH1A 4BNGA 3PGKA 4D56A 1CKEA 2EZTA 1Z37A 4HSEA 4B73A 4E6PA 2YZNA 3HB4X 2EATA 3O8QB 1YCFA 3FIJA 1CYEA 3DQPA 3PDIB 4L0QA 3TVTA 3ZLVA 2QLTA 1BCRB 4UM8B 4KQKA 2R7MA 5JASA 4BZXA 2WUWE 2VDLB 5AM2A 4R1OA 1HT0A 3R75A 2FP4B 3ZU2A 2DXIA 3ESZA 2G8LA 4OHXA 2M1ZA 1M6VB 1LTKA 2FRVA 2YV4A 2N75A 1KYTA 3BWYA 2PRYA 1OV4A 1Z16A 1LQ2A 3CCCA 3IEUA 1O9HA 2O4CA 3QWFA 1CZHA 4EM6A 3AZPA 4O2RA 2GASA 2AKAB 2RAFA 4AROA 4CKWA 1SCUA 3Q12A 2Q3EA 5CM8B 5BNTA 3C1OA 2RKBA 2JJ8A 1QHIA 2Y1LA 3D59A 1W5BA 2MSNA 2R5WA 2C8VA 2VZ0A 3JZDA 4MINA 1RI5A 3MWFA 2CMKA 2FEKA 3AH8A 1CIJA 1JXQA 2X5OA 3QBDA 4J1QA 4GMHA 4CN8A 5KQRA 2ZDQA 4JB8A 2VHYA 3IC5A 2ZRBA 4WKPA 1E4OA 3C70A 2FX2A 4UCWA 1MDBA 2YWGA 5L3VA 5DV9A 1OT5A 2VP9A 1NMSA 4J8PA 1G38A 3NC4A 1NVKA 2J5RA 1W76A 4UD2A 4FHEA 2IGTA 2XKBA 5EZYA 2CHVA 3NPMA 4RETA 2AZ4A 4O2AA 2OCXA 2Y92A 4ZO8A 5F2EA 5JI3E 1JMVA 4WXHA 2W2VA 3GJRA 4LZPA 3KVOA 5C5EA 4TROA 4A2QA 5KCZA 1FF9A 1OI2A 1MO6A 2QM0A 3EWNA 4G4GA 3GOHA 4DMHA 3EEOA 5KNDD 1QOPB 1SCAA 4TM8A 3S40A 1VSUA 4H3SA 2P9YA 3LL4A 4JLSA 4M60A 3ENQA 3FOAA 1YD7A 2IUSA 1W88A 1YU9A 3DV9A 4XSGA 3V1MA 4Z4GA 4GBMA 1SIOA 2IIPA 1NV8A 2IOHA 1H8ED 1WUJS 3JARB 4PYLA 4OB8A 2JS7A 1LVGA 1T6NA 3JY6A 4NBWA 1P5FA 4R41A 4PLFA 1OFUX 3VC3A 5BVHA 2C7RA 1QPBA 3L0BA 2NADA 2G08A 1LY1A 3Q7QA 4ZV9A 4TLMB 3TD6A 4F6RA 2NUPB 2QUAA 4IVQA 4Z1MD 4UBJA 1OWPA 1Y33E 1TEVA 3OWOA 4U9HS 4RMNA 5KSOA 1OU0A 1OT3A 2GN8A 5A6SB 4N0PA 3PHBE 4L5BA 1D03A 4PLZA 1NJ5A 3OTIA 2R6GA 4QEDA 1EFRA 4ZOBA 4DBZA 2NYRA 3RUAA 3HS3A 1JIJA 3I2HA 4BAUA 5ICSA 4G2TA 2ENUA 1DWUA 3VUEA 2JIOA 5JI2E 4N41A 5AW7A 1T8SA 1XEFA 2FRXA 5JVDA 1QQBA 2C42A 3NS7A 1E5QA 1ZSVA 4C08A 3OCYA 3SJAA 1RBZA 3RFUA 1H9AA 1NHWA 3OJFA 1Z17A 2JZCA 2H57A 1KY4A 3IKLA 1OA1A 2J3EA 1JBKA 1RLMA 2XVYA 4KXFB 1TQHA 4R1QA 2ZXFA 5FLKA 4FJ2A 1J07A 1FW8A 1O94A 1Y6RA 3CEAA 1JLKA 3O0TA 4WKGA 2DWPA 5CFNA 4P81A 3VHQA 4TYWA 4DM3A 1LVHA 2P5TB 4OLAA 4I1PA 4WXPA 1FFHA 1LDMA 4QHSA 4AK9A 4MXDA 4DDTA 4XWWA 3R8FA 5CVEA 3F3MA 2JLCA 1UMDB 4HK4A 4YLEA 1PFYA 1Q7TA 3IAS6 1JQ3A 4JODA 4PAGA 4QKQA 5L3SA 3MGCA 3OQNA 3Q3VA 2A5JA 4NYJR 1NN1A 3FPCA 5I7RA 1CR2A 1EFUA 3FAZA 2M6KA 3RNLA 5C37A 3IELA 4TRMA 4FFVA 4R0NA 1K4MA 1GNRA 1I33A 1W2WB 1U2ZA 2Z1DA 3IVGA 3YASA 2PGAA 4IZOA 4G1FA 4GQBA 1RYYA 2REOA 2QLMA 3EZ9A 3B13B 4BV8A 4PXAA 2EFDB 4P3PA 4AJ1A