1LRKA

Crystal structure of escherichia coli udp-galactose 4-epimerase mutant y299c complexed with udp-n-acetylglucosamine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPACWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Y299C mutant of Escherichia coli UDP-galactose 4-epimerase. Teaching an old dog new tricks.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 126
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lrkA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1lrkA01
3UCEA 3HDJA 1DIRA 3NTQA 4BNNA 2YFQA 3DEYX 2JKVA 4NJMB 2V6MA 1YB1A 2I5PO 2CFCA 5FEUA 4U8GA 3ZU4A 5DCWA 1XIVA 2DFVA 3DFUA 1ISHA 3LT1A 3GGPA 4D44A 2EP7A 1UXGA 3ZN2A 1QYCA 3C7DB 1CWUA 3I9JA 4N7RA 4FFRA 3I83A 2I67A 3GDGA 2FP4A 4NK4A 3WMWA 4CLOA 5KKCA 1M75A 3DHEA 1NPDA 4PFJA 4IMRA 2UDPA 3L4BC 1JAXA 4RLSA 3H65A 2NV6A 1IHYA 1TEHA 4E2XA 3DBRA 4II2A 1PZHA 2OGUA 1YJ8A 2AHRA 3HADA 5JY1A 5EQFA 1HSZA 2HJRA 5JCJD 4J91A 3SJUA 5KVVA 3AFNA 2V65A 3S2IA 4DIBA 4EUHA 1H9AA 4LSWA 3LLSA 3D1LA 4BHTA 3AFMA 4BNLA 4MVJF 4HNHA 3GRPA 3AI3A 3K6JA 2AG5A 1NP3A 1TB4A 2WYWA 4NQZA 4Y67A 4B3HA 4M49A 4I8XA 4MVJH 5BNFA 2NVUA 3H9JA 1NAHA 2ZTUA 4XB2A 4EJ0A 3E9MA 4LK3A 3JQCA 1RKXA 1M76A 4ZU3A 4D3DA 3EZYA 2VRCA 1EVJA 3OQ1A 1SBYA 4BNWA 4PRKA 4C7KA 2OBYA 1LLCA 4RPLA 1W4ZA 3BHMA 4I9HA 4DPMA 1I33A 4ZN6A 3GVCA 4MP6A 4BGIA 3PJDA 1B16A 4WEQA 4EEXA 1BXGB 4GLOA 4OGWA 1GUYA 3JQ6A 4BNHA 2B4RO 2HMVA 2D5AA 4FB5A 5CG2A 4GMGA 1JVBA 3H3FA 1EK6A 1TT7A 3F6YA 1AN9A 1NVGA 1YS4A 3ASUA 1I8TA 4L75A 2HAEA 1I3MA 4P4LA 4UREA 3W1VA 5JAZA 2IODA 1GEEA 1U4SA 5CFZA 3LT4A 1MFPA 1PJBA 2Y93A 2YZ7A 3K31A 4WECA 4E5MA 4TVBA 1V3VA 2BMAA 4FBGA 1P31A 4IPTA 5F1KA 3GA0A 1MFZA 1I32A 3RFTA 1XQ6A 4XJTA 1I2ZA 4ONEA 2V6BA 1X14A 3MOGA 1KVUA 4DC0A 3ZI0A 3WQRA 1PQPA 2VHYA 2FSSA 3GPIA 3RJ5A 2YYYA 1C1XA 1YKFA 3ZGYA 1HYGA 1WMBA 1UJMA 2R00C 4BS9A 3IL2A 3SC6A 1HXHA 2D0IA 4J0EA 2PZMA 2J8ZA 4W6ZA 3GDOA 4EDFA 2CVQA 2PWZA 7MDHA 2CF6A 4P8RA 3KYBA 3S8MA 4IUYA 2DPGA 8LDHA 1ONPA 2Y0EA 1K3TA 3MZ0A 5G0TA 5DCUA 4Y8VA 4AJ1A 1JW9B 1OBFO 5FF9A 2HQ1A 1T2CA 2HLPA 3PZBA 3WYBA 1CQIA 4J0FA 4XYEA 2BGKA 5LDGA 3ZZNA 1NPYA 1PL7A 1SZJG 5DP1A 2PR2A 2I99A 4AVYA 4J2OA 1HF3A 1QRRA 5GMOA 3MOIA 4J16A 1GPJA 3OA0A 2W90A 2NU7A 3OH8A 2Z5LA 4LCEA 2VHWA 1ULSA 1K2WA 2J5QA 4R5MA 3WBBA 2NU9A 3V1YA 4OOFA 3RUEA 4J7XA 1MLDA 1VRWA 1FXSA 1G1AA 4YJHA 3DONA 3AWDA 4W9NA 5EPOA 1DLIA 1PSDA 3ZHYA 2EIHA 2DM6A 1WPQA 1B26A 2TMDA 4RZHA 5G0SA 4TZKA 3ETEA 1XWFA 2D5CA 2ILTA 3H9UA 3G1TA 3NDIA 4GKVA 4WLVA 2FPIA 4LMPA 3V2HA 4W99A 3JQGB 3OBBA 3PEFA 5EMHA 4EUFA 1T2DA 4LVUA 1DSSG 1MB4A 1S6YA 3QIVA 1LLUA 4IDBA 4CM9A 4DQXA 4Y6SA 1V35A 1BXZA 4CQLB 3AY6A 1VKNA 4PLGA 2YHIA 1I3NA 2I66A 5HS4A 3RQSA 3GMDA 1O95A 3PWKA 1XU7A 4YRAA 1N9GA 4QECA 4JCOA 2VRBA 4JN6B 2VN8A 4J4HA 4YXFA 1P45A 4R54A 4B3JA 4D45A 5A9SB 3ONEA 5LC1A 4D42A 2DUWA 3B1KA 1P74A 1SPXA 2FY8A 1DIBA 5K0ZA 5KIAA 3WYCA 3FTPA 1KVSA 2HMWA 3QVOA 4RLHA 4O0LA 3EMKA 3DZJA 3GAZA 4MIYA 4J9VA 3C8MA 5EERA 3RJ9A 3ZNNA 1G0OA 2H1SA 2EKQA 3R3SA 1PGOA 1DXYA 4BNIA 4CM4B 4CMCA 3BMNB 4FQ8A 1GYQA 1EUZA 1HT0A 1LRJA 1O5IA 2NU6A 2VUSA 3L9WA 4RPJA 3RU7A 1LDYA 1A5ZA 5JAQA 3P7MA 3PQDA 5DOVA 3WX0A 2BFAA 2PFGA 3C7AA 2ZQYA 3WJ7A 3WWZA 2POQX 4JP2A 5A3JA 2PZKA 3PQEA 3WLFA 4WOJA 4PVCA 2BGMA 2YV2A 1E3SA 4TKMA 4PLHA 4PIVA 3HN7A 4NBWA 3RD5A 1J4AA 2B69A 1B7GO 3DFZA 3DMTC 3S1LA 4MKXA 1PEDA 1KEPA 3GK3A 3H9GA 4NR0A 4Z9FA 2E49A 1RYEA 4RDIA 1ZH8A 4QFCA 2PD4A 4U5QA 1PGQA 5KVSA 3FR8A 4OXYA 3A06A 3CIFA 1BTOA 4R1NA 1CYDA 1LSOA 4E5PA 1E7WA 5JMWA 2EERA 2AW5A 2OUIA 1R0LA 4N5LA 5T8KA 3DBHA 4BO2A 4WNIA 1I24A 3KVOA 4B4WA 4IJVA 3K5PA 3BXXA 3EGOA 4GWKA 5T8KC 4E4YA 2G5CA 4PLPA 2X9VA 1ZXBA 1KC1A 3HSKA 3IUSA 1E1LA 2P2SA 4ID9A 3BMCB 4RORA 2UYYA 1ZEMA 4MVJD 2HRZA 4I5GA 5ICSA 2WDZA 4C4OA 1LEHA 4RF4A 3UICA 1YRLA 3ORFA 1I0ZA 2Q2WA 1T4DA 4LRSB 4UVEA 3DZKA 2Q1SA 5CAEA 3TZCA 4L76A 3NJ8A 1BRMA 2PKRA 4CPDA 2Q46A 4U0KA 3OJLA 4AJJA 2C0CA 2CMDA 2WE8A 2OORA 2NWQA 5JLAA 4BKUA 5DZSA 4ZICA 3PRJA 5KVCA 5JXWA 1UXHA 2J3JA 2D2IA 1IYZA 1WDLA 4O59O 2VTEA 3NKLA 1E7SA 3GY0A 1U5CA 4BO6A 2JCXA 3D4PA 2DC1A 3RKRA 3UOGA 3QSGA 3BMOA 2X5KO 4RDHA 3U4IA 3WIDA 3E1KA 4ESOA 4GH5A 5FI5A 2EJVA 1QG6A 4RO0A 1U7HA 4JJIA 3GEMA 2A92A 3BAZA 3I9NA 1GCUA 4IGEA 3DHNA 3C24A 2WMDA 3FSRA 3H5NA 3CE6A 3OM9A 4E31A 1EQ2A 4JBHA 1UP7A 4XIJA 4BQPA 3TZ6A 1HETA 3SEFA 1ZIDA 1K89A 1IB6A 3GUYA 5B1YA 4KDEA 3TQHA 3RBZA 4NNJA 4R5HA 5I7FA 1XU9A 1P1RA 3HNPA 1K6JA 3Q9UA 4NJMA 4IDGA 1MV8A 4WCFC 3VKUA 3OJ0A 4NBRA 1JQBA 4GVXA 3WS7A 3MJTA 3BTOA 2XXJA 3CEAA 4IQ0A 3RFVA 3WGIA 1LDGA 4UUPA 1E0DA 3R0IA 3INRA 2JFFA 1GZ3A 2WD7B 5IF3A 1OAAA 4U7WA 2JCVA 4AJ4A 1ZMTA 3FPLA 4A26A 4XQGA 1MC4A 2EGGA 1SO8A 2AE2A 4YR9A 1Y5RA 2GN8A 4MDHA 2Z1MA 1DHTA 1PS8A 1I2BA 3NTOA 1O6ZA 2B5WA 1EFLA 2Z95A 4U6QA 1WMAA 4QT0A 4ZQFA 2WWRA 2WD7A 4QXMA 1EZ4A 2W8ZA 4PG8A 3RSHA 1B15A 2YQ4A 1EQUA 1E7RA 1DJQA 3ADPA 3V1TC 4A73A 1YDWA 4INAA 1IY8A 1X7HA 1A4UA 3FRJA 2NVUB 3ZCXA 3ZWBA 4BO8A 1OOEA 4OKIA 3UCFA 4J7UA 3HFSA 2Q4EA 2JHFA 3AOEC 4IDFA 3U0BA 4ILKA 1YWGO 4H16A 4ND5A 1ZSYA 4CJXA 3WFJA 2RHCA 1PS9A 3FWZA 4Z3KA 2VYVA 3K8ZA 4OM8A 1GQYA 1Z6ZA 4FR5A 1PR9A 4D7AA 4OKNA 4BNKA 2B37A 1V9LA 3D64A 5L7WA 4KMSA 5B37A 4YWJA 1CRWG 3GGOA 2FZEA 3R6DA 3ENKA 1T25A 3QWIA 5DBGA 1HRDA 2P68A 4J43A 3TN7A 4DL9A 2DAPA 5BR7A 4NBVA 5JFOA 3M6IA 4IY1A 5HM8A 1NQTA 1UH5A 5IDWA 2J5RA 1C1DB 3I6IA 4I9UA 1H0KA 3A4VA 3AM3A 1E3JA 4IM7A 4WCFB 2PTGA 1F17A 4FOSA 3EVNA 1BGVA 2C20A 2PV7A 4J1QA 5DBFA 2X8LA 1E6EA 1ULUA 2H9IA 5G4LA 5JAMA 1Y8RA 1QYXA 3GN1A 3WMXA 3D4NA 4HXYA 5KJFA 2ZQZA 2GASA 3I52A 2NSDA 4A2CA 2I6TA 2PNFA 3I9KA 1ISJA 5KTKA 3KRTA 1UDAA 3G79A 4WKGA 5C3MA 4YA6A 1OC2A 1U2DA 1XHLA 1R66A 1JKJA 4WJZA 2V7PA 5AXDA 4KWHA 1VKOA 4XWYA 5JMPA 4DYDA 4E12A 3KETA 4YRBA 1HE3A 1YOVB 3DZIA 3EZLA 4FSHA 4OOEA 1RWBA 1RM4A 2VZ0A 1NFFA 1HDRA 3PK0A 4ND4A 2FMUA 2O48X 4ND2A 4RL6A 4PG5A 1MXFA 1JA9A 3ZV4A 5ENDA 2EKPA 3ZNOA 1VPDA 4BNVA 3JTMA 1ZSVA 1K5HA 2C07A 3Q9NA 1PIWA 2FPGA 3JD4A 4KQWA 1Q7BA 1NBOA 4CV0A 1RM5A 2WE7A 4EITA 4RVDA 1Z7BA 2BLLA 4L8VA 3CMCO 5DNAA 1AXEA 4IJKA 4K1LA 3S2GA 4J90A 5EIOA 1LNQA 2VT3A 2B83A 2XPCA 2CUKA 3COSA 4B3IA 2RH4A 1DAPA 2YHUA 2YV3A 3RU9A 3AUAA 3N7UA 3RUFA 5AXBA 3JQFC 3ZWOA 5L53A 5JY6A 2D8AA 3KV3O 5EJ2A 3UGKA 1X0XA 4AL4A 1YL7A 4EBFA 5JCJA 1YONA 4FC7A 4RF3A 3ROPA 4CQMD 5HWSA 1KVRA 3E5MA 4E33A 3O8QB 4H15A 1VSVA 2YDXA 1PJ3A 4OXNA 5AVOA 1TA4A 1O0SA 1AUPA 4ND1A 4JX8A 3OMLA 2ZJ0A 1LRLA 4JP3A 2Q49A 1NWHA 2QW8A 1EVYA 1GPDG 4ALJA 3TOXA 4KP7A 2IYPA 2GRAA 2FHSA 3CTMA 4OAQA 1EDOA 4RPKA 3JQ7A 1TT5A 2GCGA 4ALLA 4BNGA 4CQLA 4A10A 2HMTA 5JNLA 4F3YA 3W4JA 3H5RA 4AJ2A 2EWMA 1LBEA 1PQWA 3ANLA 4Z9YA 5J23A 1W73A 3JV7A 1UUFA 3ITKA 4E5YA 2P5UA 4MIEA 4ZVVA 1T1SA 4CMEC 2EW8A 4DUPA 4J4BA 3TZKA 2QZ9A 4R51A 2IYOA 5C5IA 1R4MB 3DO5A 4FGWA 4MOWA 1S7CA 4CMGA 3BIOA 3JYPA 5ITVA 4PG6A 2DBRA 2JAHA 1ORRA 4KUEA 2Q2QA 2BGLA 1ISMA 5JSFA 3IP1A 4NH4A 1ZUD1 1N92A 4B8WA 1ADFA 2EGHA 4NU6A 3WR5A 4CLRA 1A72A 5MDHA 1ZJZA 1PJTA 4B7XA 1DRWA 4NBUA 3GGGA 4D3SA 3FNHA 2R2GA 3HG7A 1YDEA 3M2PA 4XRRA 2P91A 3O03A 3PLNA 5JYEA 1W8DA 3L9XA 4HY3A 4LW8A 5CHEA 3DB2A 2BHLA 4E2ZA 1KY5A 4GMFA 1H2HA 1CIVA 2DVMA 2X0JA 3B1JA 2DKNA 4Q3EA 3GOHA 4Y98A 3V8BA 2VZ9A 5B4TA 2HCTA 5L4SA 3PYMA 3UAGA 5IN5A 4XB1A 3U5TA 5IZCC 2VHVA 5F5NA 2J3HA 1F8FA 3ICPA 4G81A 2Y1FA 3ST7A 1KC3A 4CMBA 3NGXA 4FPXA 3AU9A 1JAYA 1IUKA 1Q0LA 2C54A 2AQKA 2GF2A 4RQTA 4BNMA 3LLVA 2GO1A 4ND3A 3NT2A 3NDRA 4FD3A 2DTDA 4RZIA 3WB9A 4PLFA 2HMUA 1DC3A 3TOZA 4XYLA 3X2EA 1ZK2A 5DN9A 4AJIA 2X7HA 1A4IA 3D3WA 4GX0A 1MA0A 1F0YA 3W6ZA 3WOHA 2GERA 3W8DA 3DBHB 4FC6A 3IMFA 4UVGA 2YY7A 1HE2A 1XKQA 3QJ5A 3WGTA 2BI8A 2Y99A 3GNTA 3ETGA 3VPHA 4R3NA 1ONNA 2G1UA 3VPFA 1PZFA 3DBRB 3MWDB 3U9LA 3PWSA 3FHLA 3HDYA 1SB9A 1UAYA 3ROMA 1HKUA 3MTJA 3GNSA 4A5OA 1C1XB 2PZJA 3JQ9C 4LMRA 3H9EO 3PDUA 3JQEA 4GBJA 1I5RA 3KEQA 4XGKA 2F1KA 4RGBA 5H81A 3ZU3A 2ZYAA 3V2GA 1H2BA 3OSUA 4A0SA 5AQ1A 4Z0TA 3K9QO 3KSZO 4YPOA 5TNXA 2PA3A 2YJZA 2EHDA 1KEUA 1NTOA 4DQUA 5C37A 4R69A 1R6DA 3WGYA 4B4VA 3RC7A 2B5VA 1V6AA 1E7MA 1I30A 1N5DA 4B7CA 5HBRA 1BW9B 4LSMA 2BKAA 4YQZA 3VH1A 3HHPA 1HDZA 2RHRA 3OETA 3NDJA 4BIIA 3E8XA 4R68A 3BMQB 2Y67A 3UW3A 5A5FA 1ZEJA 4CM8A 1L1FA 4FIZA 3SX2A 3T4XA 2IE0A 5CDUA 3VDRA 1JWAB 4BNZA 1D1SA 3H4VA 4CM3A 4EGFA 4JROA 1LXCA 4ZA2A 1B2LA 3JQ9A 1T1RA 3ULKA 4DMLA 2NNLD 1P0CA 4HWKA 2ZB7A 2G17A 1J5PA 3FF4A 1M6HA 2O4CA 3GN2A 4M1QA 1H6BA 3QQPA 4ZD6A 1UR5A 1FDTA 3DTYA 4JBGA 3M2TA 4NI5A 5TSDA 1OI7A 1GZ6A 3DMTA 4YBZA 1B3RA 3KTDA 3KEOA 1U3VA 4IINA 4N18A 1Y8QA 1EVIA 1L7EA 5BQFA 1LU9A 2AEJA 2A4KA 4EJ6A 1V3TA 3RUAA 3L4BA 4IBOA 1VJ1A 3PHHA 4N5NA 3NRCA 2DBQA 4IS2A 5BSGA 1F06A 4ZGWA 1N8KA 1IPEA 4WNCA 5I7VA 4MINA 4XYGA 1DRUA 1XELA 2X23A 4PLTA 4XX0A 1P33A 2FRDA 3OHSX 4HNGA 1B8PA 3H2ZA 5TQVA 3C7CB 5A03A 4R1UA 1EDZA 2Y05A 3I23A 5A9SA 5ER9A 1BDMA 4KUGA 3W6UA 4IJWA 1WDKA 4DWVA 4MP3A 3T7CA 3INGA 1DAOA 1CETA 3LF1A 4BQRA 1EBFA 5ILOA 5JDIA 2YV1A 5L45A 4I5FA 1FF9A 1K6XA 4XCVA 4IIUA 3GHHA 1F12A 3ETDA 1MP0A 2ZKLA 4PRLA 4BL5A 5IXYA 3NX4A 1P1HA 3NV9A 1GFSA 3CUKA 2NQTA 1PJ4A 4IDDA 5JDCA 4M54A 2XOXA 3L4SO 2D59A 2DQ4A 4IIVA 1VJTA 3BTUA 3D7LA 3C1TA 1Q0HA 4YT8A 3NUGA 3AM5A 4FFLA 4JJGA 2FWMX 4WLOA 3STHA 4CV3A 1DDOA 4R41A 3ZNPA 2ZTVA 1Y6JA 2JL1A 1YBMA 2VUTA 2ZB8A 3RUIA 1A9ZA 4G65A 3PP8A 1IL0A 1LSJA 4CQMA 1Z73A 1NHGA 3ANMA 3PHGA 1LLDA 3ZWAA 4JGBA 2IXBA 2X9GA 4P4NA 4Q9NA 2IEBA 2R00A 3KLPX 5ES3A 3ROKA 4CM1A 4U0JA 1YVEI 5MGBA 2J6IA 4J6FA 2NACA 2RCYA 2X22A 4EI2A 1P1JA 3WDSA 4OIMA 3QY9A 3N58A 5FYDA 3GVHA 3DTTA 3TRIA 1VJ0A 1M66A 1NNUA 4BGEA 4CR6A 1VL6A 1DOHA 2AA3A 1HZJA 4QO7A 2JD1A 2Y1EA 1QYWA 1E7YA 5DP2A 4BV9A 5ER6A 4LCJA 3E82A 1YQXA 5IDYA 1H6DA 1L7DA 1QSGA 2FR1A 1UDBA 2BFPA 4OHUA 1AHIA 5L9AA 1UXKA 3VKVA 2RBEA 1QYVA 1Y81A 1ENYA 5IZCA 4YAKA 1KVTA 4RVGA 3GEDA 2JJYA 4FJ2A 4Z9XA 3WNVA 4M89A 3ADOA 4X54A 3F9IA 1H6AA 3H9QA 2D1YA 1U8XX 3GVPA 3C3XA 3F1LA 3BTSA 3UVEA 4E6PA 4L4SA 3PYXA 2E82A 1QKIA 3TFQA 4BNUA 1SB8A 3FR7A 3KYCB 2PD6A 1LTHR 1O8CA 1PZEA 3UKOA 1HLPA 3WFIA 3WXBA 4BGVA 4F6LA 4ZRMA 5U9CA 3I3OA 5C7IO 3VTZA 1SOVA 4W7HA 3INTA 5B4VA 4RQUA 1UP4A 4EW6A 1WVGA 1LUAA 3QWHA 3BZUA 4IS3A 2PZLA 3BMQA 3IJPA 3IC5A 2AMFA 2TMGA 4JXKA 5EN4A 4WUVA 1DFGA 1E3IA 3MJ4A 3X2FA 1CQJA 3HZZA 3EUWA 4WLEA 1ENOA 4BKPA 3TFOA 5IJZA 5L40A 3Q3CA 4WLNA 3LC2O 1N7GA 4EYEA 3GLQA 4ZQEA 3K96A 5G0UA 3FI9A 3O8QA 3F1KA 4BOYA 2NADA 2VNAA 1KEVA 4YT5A 2NVBA 3PWZA 1VM6A 4XR9A 3JSAA 3PYLA 4CODB 3JQAD 3GG2A 4ALKA 2HK9A 2PKQP 5TGDA 4AICA 4CM5A 2BRUA 3DBLA 3FTNA 3JCZA 4YVFA 4MVJP 2VHZA 4YAGA 2BD0A 2HDHA 3K30A 3TZQA 1LSUA 4MP8A 4Z0HO 3VH4A 4HV4A 1H6CA 2UAGA 2B4QA 3L07A 4B4OA 1AXGA 3HN2A 5C7OO 1N7HA 5EINA 2OL4A 4II3A 3U09A 1HDCA 3HUDA 3AUTA 4S3MA 2HU2A 2ZYDA 4CMIB 3RIHA 2VCYA 1T2AA 1PWZA 4XDYA 4BO3A 2OO5A 1WP4A 1H9BA 2QYTA 3V5NA 3O26A 3HDHA 2PGDA 2Q4BA 3DMYA 2Z1NA 3ENNA 4QUKA 1LC3A 2FSVA 4Z0PA 3F5SA 1J49A 3FPCA 4XEHA 3GUCA 3TL3A 1E6WA 4UAGA 2DUUA 2AG8A 4BMVA 4CL3A 1NAIA 4DRYA 1M6WA 4DLBA 3DDNA 3D4OA 3KSDO 4BB6A 2HSDA 1UAGA 5CEEA 3QLJA 5JCXA 1Q0QA 3W8EA 3VVBA 1VE9A 4FDAA 3HB4X 3DAPA 3FNGA 5L7YA 4EUEA 1FDVA 2ZIZA 5HA5A 1Q7CA 5CDYA 3AJRA 1BVUA 1OFGA 4NFSA 2FR0A 5ICMA 3WLEA 3U62A 4JK3A 1KY4A 1PU2A 5A9RA 1E3EA 3VAZA 1U3TA 1LDBA 2Q99A 1YE3A 5KVQA 3E9QA 2VTDA 1E3WA 1FDSA 2P9CA 5CP8A 1ZMOA 5AXCA 1UZNA 4MVJI 3TSCA 4NJOA 1YB5A 1CEQA 1Y9AA 1YH3A 1NPTO 3MEQA 3GHYA 4TVOA 2EG9A 1Z74A 5I8WA 3WICA 1YBAA 1GL3A 2Q1UA 5A05A 4DPKA 1C3VA 1ADCA 4TQGA 5KJEA 4W9NC 4KQXA 3GH3A 4YJGA 4CMAA 5CDSA 2VWPA 1PX0A 4JQCA 5A06A 1WDMA 1ISGA 3KYDA 4CM6A 4N5MA 2YW9A 1JVSA 4CMEA 2DBZA 1DO8A 1Q7GA 5KJ1A 1O94A 3PQFA 1C0IA 4AJEA 4DC1A 1ML3A 1EK5A 1YL5A 3PDJA 3JD3A 3WNQA 3IKTA 5T5QA 4GAEA 4KTTE 4AJOA 1P1IA 3G0OA 4UUOA 1E6UA 1F14A 2D3TA 4WASA 4NHEA 5F21A 2HO5A 1I2CA 4R9RA 1DFIA 1E5LA 3ZWYA 2P9EA 3DQPA 2C82A 2WD8A 3TWOA 3MJVA 3CZRA 4L74A 2J3KA 4PVDA 4ZJUA 3GFGA 5CDGA 1VLLA 3JD0A 4XA8A 4E32A 5THQA 1MC5A 4D43A 3DBVO 1GQ2A 3UF0A 4E2WA 4Y6RA 2AE1A 4RJTA 5JC8A 2YQ5A 3GRKA 3WGZA 4J1NA 3ZU2A 1UXJA 5A04A 2I76A 1DC6A 2RH8A 1BXKA 3B70A 3I6QA 4NPCA 3AOEA 2VWHA 3PJFA 4HFJA 3JQDA 4FFMA 3MCVA 2BI7A 1VC2A 3FD8A 4TZTA 3ONDA 1D1TA 1MG0A 1NASA 4OYRA 4ZRNA 3IQDB 5C7LO 4CMJA 4DBZA 1I36A 4XDZA 1Z75A 3D5TA 4K26A 3C1OA 4RPHA 3UUWA 2QIOA 4TRJA 2JD0A 3OJFA 4FJ1A 2UV8A 5FWNA 1WLYA 2VOJA 3MJSA 5H82A 3ANNA 3EW7A 3W8FA 3HWRA 3E48A 2Q45A 3F5QA 3PPIA 4BO4A 2R6JA 4L73A 2OP0A 3I9OA 2Y68A 1DIGA 2GZ3A 3PJGA 3DOOA 1HL3A 1B14A 1EE9A 1Q1NA 3G49A 1BSVA 2GD1O 3OJOA 1UZMA 5CEFA 1GUZA 3RC9A 5B4UA 1P77A 1D3AA 1YB4A 5CEJA 3JD1A 1ZZEA 3CMMA 3ZWVA 1J0XO 4FW8A 2IXAA 2B36A 1IZ0A 5IG2A 5F1OA 1UP6A 2ZCVA 2HRBA 4R4JA 1ZSNA 5BNIA 1IOLA 3WGQA 4AJKA 3QHAA 4MIOA 4F6CA 4YAEA 1A9YA 5KCZA 5L4LA 3OIGA 3PTZA 5JC1A 3BMOB 2OZPA 4YQYA 2IEDA 4ZQGA 4DREA 3BMNA 1BG6A 2DTXA 5G4KA 4FGSA 4M86A 1J6UA 1OC4A 4ALNA 1QV7A 2NTJA 1R0SA 1X13A 1ISFA 1NM5A 3B6ZA 4FCCA 2FR8A 4NG5A 3WTBA 4PN3A 5IXSA 2VRCD 1P0FA 2VYNA 5GZ1A 2EEZA 4AJNA 2QYSA 4BUCA 5G0WA 1VSUA 4D3FA 4CUZA 2PKQO 4YEDA 1GD1O 1Q2XA 4Q3CA 4U6SA 2W2KA 4BO5A 3MWEB 3VZSA 4GQAA 5L95A 4Y6PA 3WSWA 4NFHA 3OIDA 5B12A 3HB5X 1LX6A 1N9GB 3OA2A 4IDEA 1XSEA 1QXSA 4M55A 4TSKA 2GGSA 3AY3A 1CERA 3L6EA 2VZ8A 1R4NA 1U4OA 4WK6A 1SOWA 1ZBQA 3V1UA 2GZ1A 1GU7A 1N1EA 1DRVA 2O3TA 4TRRA 1ID1A 2IZ0A 1U28A 4IZIA 4JNKA 2EJWA 3VPGA 1EVZA 2O4UX 3NT5A 3H3JA 3H6KA 3D3WB 3CKYA 1R16A 2ZJ1A 1WWKA 3PXXA 5LCXA 4MO2A 4NDNE 2NM0A 1DLJA 3AUSA 1P9LA 3JQAA 4OJNA 3LT0A 5COBA 3E03A 4RVUA 1D7OA 4WEOA 1O9BA 3SLGA 1R37A 4Q39A 2HK8A 2YUTA 1Z82A 3OP4A 4E5NA 1NHWA 4YT4A 1JTVA 3CZMA 4CLRB 5KWEA 4O1MA 1QV6A 2C2XA 3UCXA 2IZ1A 4DA9A 1U7TA 2E48A 4Q3AA 3KB6A 1H94A 2W2KB 1PJCA 3A9WA 1ZXLA 3IKVA 4PLCA 2BF7A 2I3GA 3DAGA 4WOKA 4MPDA 2C7VA 5H83A 4Z6KA 3HJAA 4FJ0A 1ZK3A 2X5OA 1WAMA 4AFNA 5T57A 3DOJA 3E9NA 3TZHA 1AHHA 1ZNQO 4D41A 2C7GA 1BHSA 4E2YA 3SVTA 4DPLA 1Y5MA 3F47A 3IIEA 3UXYA 3LQFA 3Q2IA 1JU9A 3VZQA 3GDFA 4DTIA 1LA2A 5L51A 3BTVA 2ZB3A 1LDMA 4XKJA 3TL2A 5DULA 4K6CA 1C1DA 3ICCA 1V8BA 4GI2A 2QZZA 1C0KA 1P1KA 4CR7A 1PQUA 4IGFA 2G76A 4GWGA 4QO8A 3F4BA 3ROQA 1FK8A 4GSLA 5EL0A 4B8ZA 4BNJA 1IPFA 4UVDA 4JIGA 5HRUA 1ZK0A 1SNYA 3ZH2A 2ZTMA 1YO6A 2VYVD 4G5HA 4WPGA 3VPXA 3D3EA 2C5EA 3CXRA 2CDBA 3WQQA 3LC1O 3VC7A 3ZHXA 1FDWA 4QFDA 1PJQA 1X7DA 4YCAA 1NQAO 2FOIA 2J3IA 3EYWA 5T64A 1XQ1A 3T7EA 2UUOA 5IFLA 3HE3A 4DQVA 4CUKA 4CM9D 4PLVA 1NVMB 4UEOA 1KEWA 3QWAA 1W0CA 3W4IA 1NYTA 2ZB4A 3RFXA 2LDBA 3G17A 2Y0CA 3I5MA 4QEDA 4RCVA 2OHXA 1ZO8A 4RVFA 5JAIA 3KOUA 3GNQA 4J2HA 3GPDG 3PIDA 4DBVO 4WCDA 3ZV6A 3PGXA 3RUHA 1TXGA 1I3LA 4AJPA 4CLXA 1VL0A 3RKUA 1HDYA 1XLTA 4LN1A 5COAA 4OQYA 3ZWXA 1R15A 1GZ4A 4LRTB 1CF2O 2H6EA 2JCYA 2VHXA 1ZKMA 4PLWA 4XQ9A 2X0IA 3AW9A 1HLDA 1MG5A 1IHXA 2YHIB 1CDOA 3E5RA 3JQ8B 5I9NA 3FNEA 3JQBA 4AG3A 4B79A 4YT2A 3TDKA 3VH2A 3QVTA 4ZQBA 4CMIA 1V3UA 4P4GA 1AE1A 1PR3A 1JWBB 4NK5A 2NTNA 3ZWCA 4D46A 2C59A 1NR1A 3KLMX 3LC7O 2DLDA 2Y1GA 3LSYA 1GR0A 5GZ3A 2X6TA 3H5AA 3KXDA 2EKLA 4YTEA 1X1EA 1TLTA 1B8VA 2W98A 3O9ZA 2ZYGA 3JQ8A 4QX6A 2O7SA 3QWFA 4XR4A 4LISA 2QRKA 4IJUA 4GLLA 4HBGA 1LJ8A 3I9MA 4E3ZA 3OJEA 4HKTA 2I9PA 4BNYA 3GF4A 3FNFA 1PL8A 2X9NA 2NQ8A 2AQIA 3GR6A 2ZATA 4CM4A 4WLFA 1P44A 4BVAA 2JHGA 2CDCA 1R4NB 2OP1A 4J9UE 1A71A 2EXXA 4BNXA 3A14A 1SC6A 4YJHB 3ZWPA 4XD2A 2PGLA 1KBZA 1HE5A 3K92A 1OZAA 3F4LA 1KS9A 4FFOA 3RASA 2ZK7A 4IQ8A 1MGOA 4TROA 4A27A 5ADHA 5K9ZA 2PGJA 4OO3A 2LDXA 3QWBA 5TF4A 1C0LA 4A7PA 3TF5A 1E7QA 5IDQA 1DBVO 4DYVA 4O63O 1XDWA 3Q2KA 4IXTA 4ROSA 1EE2A 1BVRA 3TJRA 4NU5A 1JLLA 5HTOA 3B1FA 4TWRA 1I01A 2DTEA 3Q6IA 3S2FA 1YBVA 4MVJG 4NFYA 3DZBA 3WGHA 1BXGA 2VWGA 3EC7A 4F46A 3OF2A 2WM3A 3HQ4O 4MKRA 1FJHA 4GSKA 4QSMA 5F1PA 3NEPX 5BSEA 3KBOA 2EV9A 1HTBA 3H2SA 1YQDA 4CLHA 2O7QA 1Y9EA 4XQEA 4XYBA 1DC4A 3WQSB 3NJ4A 2Q1WA 2O50A 2AEFA 4XRGA 1WW8A 2QHXA 1WZIA 4NBTA 1NQ5A 5F3RA 2D4AA 4CLOB 3ZWMA 4EZBA 2NUAA 5JS6A 3KHUA 1C0PA 4IXWA 1IE3A 3O4RA 1TVEA 1YOVA 3ASVA 5JDCC 3KYCA 3RI3A 1LQUA 1KVQA 2GN6A 2CNBA 1XA0A 2E6UX 2QG4A 2FPPA 2DBVO 2P9GA 3RUCA 1ZCJA 1TI7A 3GVXA 4J7CA 4DLAA 4BGUA 4YB8A 3IOYA 4DIOA 4DVJA 1PGNA 2G0TA 4HUJA 1NXQA 1KOLA 3EVTA 3A1NA 2ET6A 2JFHA 4K28A 4GKBA 4UVIA 5JW6A 2XAAA 4J4TA 4QQRA 4N54A 4P22A 2QQ5A 1HZZA 1KIFA 2EP5A 2EW2A 1MUUA 3U4HA 4BNFA 3AM4A 4R3WA 1N1GA 5K6AA 1SEVA 4BV8A 4GX2A 3JQFA 3KYDB 3QVXA 4IMPA 1RM3A 4BB5A 4TKLA 1G0NA 4M87A 3S2EA 3GVIA 3P19A 5KJ6A 1VL8A 1ISIA 1ZK1A 1X15A 3BMCA 1DPGA 5DF1A 9LDTA 1QMGA 3DBLB 3FN4A 3DWFA 4IDAA 1PJ2A 2DFDA 3DHYA 3GZNA 2O2YA 3ON5A 4J3FA 2CD9A 3TPCA 1SMKA 3GFBA 2BELA 3MJCA 5L3ZA 1A7AA 3VHRA 1BW9A 3WG9A 5IN4A 1T4BA 3NYWA 5T6BA 1AGNA 5IZ4A 2CDAA 7ADHA 1X1TA 3I1JA 4MVJM 4CMHA 1H5QA 1ZK4A 1B8UA 3GEGA 2Y66A 5DOZA 2E37A 3LU1A 4TRMA 2O3RA 1PTJA 3JQ7B 2JAPA 3WSVA 2BFMA 2J5KA 1XGKA 3JQGA 1HDGO 1GADO 3SBOA 4FFPA 3MTGA 2CY0A 2PH5A 4KOAA 1XG5A 4Z3DA 2PY6A 2Q3EA 3EY4A 3WGGA 1E1NA 5TIIA 1GV1A 1XR3A 3PHIA 3ZW8A 2GPTA 4R1SA 5FFFA 1B3BA 4XZ3A 4RV9A 2HMSA 3W4KA 5LDHA 3GZ4A 4L4XA 4Q3DA 2B0JA 1SAYA 1NR7A 3OFSA 5JPIA 4S1VA 1H93A 1XEAA 2PD3A 4D79A 3JYOA 4G2NA 3QV1A 3AI2A 4DLLA 4CM8B 5DBIA 1U3WA 3T4EA 1MX3A 1TT5B 2CVZA 2IZZA 1D8AA 3FCOA 3P2OA 4XGNA 2GZ2A 2YFHA 3Q1LA 3PHLA 3DR3A 1D4FA 3PJEA 3WYEA 1HDOA 2GSDA 4NMHA 4PCVA 2ZCUA 4XYMA 2X0RA 4XJSA 2SCUA 3F3SA 1BWSA 4CUJA 3GQVA 2P4HX 3ZWNA 4YAIA 1DFHA 2CZCA 3OQBA 5FI3A 4MJLA 5U4QA 3VOSA 3LDHA 1RYDA 4ITUA 3DL2A 2WJPA 3PFFA 1SEPA 2O23A 3I4CA 1Y7TA 1P1FA 4I9NA 5I9MA 1I3KA 4HX5A 3WIEA 3CH6A 1XYGA 3ZU5A 5AXAA 4J49A 1GV0A 5GZ6A 1UXIA 3OIFA 4WLUA 1E77A 2C5AA 4YJFB 3N74A 2G82A 2DT5A 3RBVA 1NX6A 3OEWA 5EQDA 1T24A 4HP8A 1T26A 5ENVA 5U1PA 3WJAA 3L6DA 3RROA 2GNAA 2W2LD 3G3EA 2C29D 2H5LA 3PI7A 1DHRA 4F45A 4BMNA 5L7TA 4I5DA 5JO9A 4CQMB 2UUPA 1KERA 4IQGA 2CF5A 4HFNA 5AOVA 4YJFA 3WBFA 4D0RA 1DEHA 1JDJA 2FZWA 3RC2A 1MXHA 3QRWA 1NQOA 1GCOA 2W2LA 1X0VA 3S55A 1I10A 3IDSA 2X0NA 1DB3A 1Y8RB 1U2GA 3Q0EA 5ITWA 4O6VA 3QW2A 2A94A 4NIMA 1YL6A 3KUXA 4WGGA 3D5QA 1PZGA 1EEHA 2BFOA 3AK4A 3LYLA 3RBXA 3ZV5A 3QVSA 3BHJA 2QX7A 2VOEA 1E1KA 1ENZA 4GPD1 2GN4A 2AQ8A 1OMOA 2O2SA 4K9DA 1CJCA 2JFGA 9LDBA 3R1IA 1U8FO 1YQGA 4PLYA 3HFGA 3B20A 4L4RA 3RWBA 1EFKA 5COQA 4O5OA 3JD2A 1IZ9A 2XF8A 5A4DA 1HYEA 3DOCA 3ITDA 5EESA 1PL6A 1PGPA 2Q50A 4DMMA 1P3DA 4RF5A 3WGOA 2HK7A 4J1TA 1K6IA 5A3VA 1YXMA 1RM0A 2GUGA 1GY8A 2GYYA 4PZEA 1ARZA 3WWYA 4D0SA 3ONFA 1PJLA 2X5JO 3QA9A 3K73O 2Y0DA 4OMUA 2Y1DA 3ZWWA 2VNSA 2NTVA 1ZW1A 3VDQA 1E5QA 1JN0A 4RVHA 5F5LA 1RPNA 4MKZA 3GAFA 1HWYA 1HYHA 1GTMA 4UUNA 3UHAA 4AJLA 4GX5A 3ZW9A 5JO0A 3CINA 4NZ9A 5G2OA 3SLKA 5TT0A 5THKA 5TJHA 3RVDA 4BO7A 3OECA 1Z7EA 2WYUA 3EAGA 3EDMA 1LC0A 4H3VA 4YRDA 2OFPA 3FBGA 4MVJA 2DPHA 4R01A 3JYQA 3ZDFA 1BMDA 3SJ7A 2Y1OA 2CSUA 3P2YA 1KYQA 2VYND 2FN7A 2I3AA 2PK3A 3GC6A 3JQBC 5JE8A 1PGJA 4JBIA 1YGYA 2V6GA 4Q3NA 4EEZA 2Q2VA 1DJNA 4HFRA 1DIAA 2P5YA 3NTRA 4TMFA 4Y9DA 4ZQHA 1GEGA 4XIYA 2IRWA 4XQCA 5TX7A 5JYDA 2WTBA 1U3UA 4I08A 3NAQA 4TRNA 3LT2A 4CL8A 4DXHA 6LDHA 1LRKA 3PLRA 1C14A 1E92A 4YDRA 1QLJA 1W6UA 1G6KA 1NWCA 1ZJYA 3LZ6A 3AU8A 3HDQA 4WE3A 3DAFA 1ZFNA 1SCUA 4BKRA 5KOIA 2AQHA 3RC1A 4E13A 4KUHA 4BKQA 2E4AA 3R3JA 1HE4A 3M1AA 2AEMA 3M1LA 2F00A 3PVZA 4C7JA 1LLQA 4W7IA 2CVOA 5TT1A 4L0QA 5JDIC 3CSDA 3UN1A 2GN9A 3VZRA 4E0BA 2VQ3A 5KJCA 3IS3A 4KWIA 3PHJA 2BH9A 2O3SA 1V0JA 1E3LA 3OEYA 4M8SA 5IDXA 1Z45A 4DGSA 5TLSA 3RCBA 1GQQA 2A35A 3UH1A 3E18A 3F46A 1GUFA 4EJMA 2O3QA 2PLAA 3NGLA 4UEJA 3VH3A 1GDHA 1M2WA 4OSPA 3D0OA 4GL4A 4MVJE 4UVHA 4GVLA 3L6OO 4CLEA 4LGVA 2DU8A 3SC4A 3PGJA 4YYZA 2QRLA 5TC4A 4E5KA 4ZHSA 2NVWA 1VI2A 3BA1A 4HFMA 4RF2A 5CG1A 2VT2A 1R0KA 1N2SA 1T2FA 4LVCA 1PWXA 3AUUA 3LF2A 4YJGB 3IJRA 2UVDA 2EF1A 4GX1A 4P38A 4PG4A 4W82A 4RVSA 4PG7A 5G4KB 1NFRA 3GT0A 5CPBA 3CPSA 4UUMA 2X4GA 2VWQA 4PZCA 1Y1PA 2C2YA 2X86A 3A28A 4IZHA 1GAEO 4W4TA 3L0DA 3QE3A 4YACA 2NU8A 1ADGA 1PJSA 3RAJA 4OL9A 1EUCA 4OQZA 4E21A 4YAJA 4R1TA 3GMSA 3WTCA 4RPGA 1E3WB 4DIFA 1LDEA 1O89A 2RIRA 3KZVA 5JBIA 4L9RA 1B0AA 5DT9A 3G1UA 1QYDA 2Q1TA 3O38A 1DIHA 2A9FA 5TRTA 3K2BA 3VVCA 2Y1CA 5CPFA 2RAFA 2IDZA 2GDZA 1LSSA 2HUNA 5TS3A 3PIIA 1A27A 2YDYA 4KDFA 4YJDA 4BMSA 1F8GA 1U1IA 3BYZA 4HADA 3NT4A 1WNTA 1R4MA 4CLDA 4URFA 4A03A 3AI1A 4BKOA 3I9LA 1EBUA 1U9JA 1WXDA 4PLZA 5A5EA 2WEKA 2HJSA 1HSOA 1QR6A 3QP9A 3KM0A 1T2EA 3BHIA 3LVFO 3U4DA 2B4TO 2WSBA 4CM7A 4BO1A 3FBTA 3V2UA 2O3JA 2WYVA 3H8VA 4KZPA 2OXIA 4UULA 4CV1A 1KETA 5I7EA 3KO8A 2XXBA 3JQAB 2NLOA 5CDTA 4CR8A 1HEUA 3I4FA 4B4UA 2GLXA 3AY7A 1WZEA 4R9SA 1ENPA 3ZNQA 2O3UA 4FN4A 4JLWA 4OH1A 3ZV3A 1U5AA 3ZHZA 2ZTLA 5KKAA 1HDXA 1X7GA 5A9TA 3AOGA 4ALMA 3C85A 3OQ6A 4E30A 3DXFA 1IULA 4GGPA 5BNTA 2OMEA 3PZRA 3DZGA 3Q11A 4UEKA 5DCYA 3U49A 5BSFA 2H63A 1XCBA 3RUDA 1PS0A 4WCFA 3U3XA 3K2EA 5G0VA 3VZPA 3IP3A 1QLHA 4BO0A 1UZLA 2JD2A 4CV2A 3FWNA 1RJWA 4GGOA 1ADBA 2W4QA 3ABIA 2PH3A 3UFXA 6ADHA 3PFWO 4XGIA 4KTVE 4R16A 3L77A 3P5SA 1R12A 5ILGA 1ZVMA 1EMDA 1JKIA 2OOSA 3JYNA 4J1SA 5DDIP 5AYVA 1DC5A 4B7UA 3IAHA 4OXKA 2GR9A 2X1HA 2B35A 4ALIA 4FOOA 1JKFA 5L4NA 5I8ZA 5I9LA 1QP8A 2P4QA 5KNLA 2HKIA 4FFNA 4PGFA 3U4CA 4QTZA 1NVTA 1GYRA 3JYLA 1EUDA 1NFQA 1UDCA 3GG9A 3KSUA 3GZNB 4H7PA 4I1IA 3OICA 3ZHBA 1QORA 5IAAA 1FDUA 4BNTA 5T67A 4AJHA 3EHEA 3DC2A 1K0UA 5TJ9A 3LK7A 3MJEA 5A1TA 2X58A 1BDBA 2V6FA 5I7SA 5K6AC 3VTFA 1E1MA 5HS6A 1FMCA 2OBNA 5BSHA 4JJFA 1LQTA 1A7KA 1GYPA 3DZFA 4OSOA 4PZDA 3E6AA 5GY7A 1LDNA 1ONOA 2QRJA 2I65A 3C1AA 4CMKA 1LI4A 3VPSA 4K6FA 5A02A 3EK2A 2VUUA 5BT9A 3TNLA 4IDCA 1Y8QB 3DZHA 3SXPA 4FS3A 3IUPA 2AXQA 3H7AA 4I5EA 4BO9A 1M67A 3QVWA 4Q3BA 1YJQA 8ADHA
chains in the Genus database with same CATH superfamily
3PFHA 4B87A 4AS3A 2D0DA 3E9RA 3HDJA 3IUYA 3RVSA 3MA0A 1XHFA 2VAXA 1O0BA 1Z4NA 3KAKA 1MPXA 3VR0A 1I3OA 3RLFA 5JH7F 4EYSA 4OKSA 3UPTA 1G5QA 1PSWA 1YB1A 1ZNXA 3QEMA 2IS2A 2WAAA 1V9CA 2WK1A 1JLMA 4U8GA 3R74A 1BE8A 1VSBA 5DCWA 5FUQA 1XIVA 2WIKA 3DFUA 3SZOA 4D44A 2J9ZB 2EP7A 4RVCA 4XH9B 5TDHA 3ZN2A 4ASUA 1N8TA 4QUEA 1KFBB 4KQIA 2DRIA 4BN5A 5B7PA 5KOYA 1LLFA 2I67A 3GDGA 4NK4A 1JMVA 4OP1A 3RVJA 3WMWA 4CLOA 4ND8B 2PX5A 4D4LA 4PFJA 4Q02A 1G2PA 1GG2A 4YP6A 2CCGA 1JAXA 2FFJA 2NXNA 2GBIA 3E4CA 5AM5A 4DLKA 3A6FA 5EQJB 5BOVA 2BM0A 3DBRA 3K05A 4HGQA 1PZHA 2OGUA 1SQ5A 2AHRA 4JB3A 4JUCA 2QORA 5JY1A 5EQFA 1HSZA 2VF5X 3R44A 2VYQA 1JG4A 4DVGA 4EG4A 5I4IA 3VI3B 3AFNA 1WPRA 2V65A 3COYA 1C0EA 3S2IA 3UJPA 2GVNA 4EUHA 1P62B 3GNLA 3LLSA 4HDMB 4TN5A 1DKUA 3CPEA 1X8KA 2RIPA 3HKCA 1VPTA 3DZCA 3KU1A 2GYUA 4FN5A 2P11A 3U17A 3MF4A 3ESQA 3QXGA 4ZK2A 2IIQA 1AHPA 1T5BA 4B3HA 2KBFA 1GO2A 4MVJH 3S2ZA 3A6DA 1SXIA 2LKCA 4LK3A 3G8BA 3JQCA 3UATA 4D3DA 4HUTA 5B2EA 2XCRB 1N6OA 1QM5A 1A5SB 3JARB 4D8UA 2WHPB 2BSQA 1E0SA 1Q19A 3B7GA 1FTNA 1NMQA 3W5IA 4C7KA 3THXB 4RPLA 2CXOA 5GINE 3AKCA 4UEQA 2OY0A 1UFKA 2A4MA 3GVCA 1BS1A 4KMMA 4P7JA 2B5OA 3TDNA 5KHOC 1B16A 1M2FA 2FXVA 5T3YA 2QRPA 4TLMB 1Z7YA 4UNPA 1FYVA 4QPDA 1BXGB 4BNHA 3GA7A 3JQ6A 1R3DA 1CUJA 1UBCA 2HMVA 2ZRIA 3FWPA 4M9QA 1JVBA 4WFJA 4H59A 4FB5A 1E6KA 1JIQA 3F6YA 2OAP1 1NVGA 3HKEA 3PRYA 3DAYA 4JVSB 8ATCA 4P3YA 2IEIA 1I3MA 4UREA 3FMGA 3W1VA 4IDUB 5IK2A 3JS5A 1OAKA 3VQTA 2QYHA 4E09A 4K9LA 1UIRA 4D57A 3LT4A 3TRHA 2HU8A 3WHLA 1MFPA 1N4AA 3X1ZA 1XZBA 1PJBA 2H3EA 4C0SA 4WECA 1PVDA 1OZFA 3K31A 2V4MA 5CRIA 2VDQB 4TVBA 1V3VA 2JAOA 4ZT3A 1L5RA 4X3CA 1D4AA 2VTKA 3E8SA 3FETA 3LHIA 4B31A 4D9EA 1LBQA 1KH2A 4IVNA 4BPRA 1SR8A 4ZYWA 2FWRA 5TVKA 2IPNA 2ZSEA 5F9FA 1ZJ6A 1DMRA 2QX8A 4ONEA 2V6BA 3ZVLA 3BJEA 2FSUA 5C0OE 4KOEC 1JIUA 3IDOA 4B32A 3BWCA 4YMUA 3R5XA 2YYYA 1QOQB 1YKFA 1KJZA 1C7QA 2FJUA 3G8AA 1WMBA 4HLNA 4BQSA 4BS9A 5AUOB 5CTJA 4I99A 4LOHA 3HGQA 2PZMA 2J8ZA 3GZTB 3MVEA 2PT5A 5FL7A 2CVQA 3M5CA 2IELA 2XUIA 4HI0E 2CF6A 1ZI8A 2H00A 2K7ZA 1QHNA 4E51A 2MR5A 7MDHA 2I4MA 5KSYA 1Z6YA 4GUAA 1CY7A 3DFIA 2P9QA 1RBZA 2HQ1A 1T2CA 4MRPA 3PZBA 3IBGA 2FPGB 2OCXA 4XYEA 1BYIA 1YU6A 2NYUA 4JB0A 1RRVA 4JXXA 1V11A 1KSGA 5DP1A 3LDFA 4F56A 3R7WA 3THSA 4AVYA 4LX8A 2Q4TA 1WCIA 4J2OA 4Q6BA 1KJQA 5D01A 1DTEA 4A6DA 2HRCA 4HDCA 3EE6A 3MOIA 1MIHA 3AB7A 5L3QB 2Z5LA 3RWOA 1TMYA 1MNAA 4RSRA 1UBSB 1Q7EA 4LCEA 1ULSA 5KTSA 3WAJA 4L6CA 3ZZTA 3EGEA 1GILA 2XMQA 5IAKA 1H0SA 3RUEA 1PNOA 3C3EA 1L3BA 4J7XA 1YS7A 3C7TA 3TRKA 4KODA 1XN4A 3FZGA 4GPBA 2P1ZA 2A78A 3K71B 3PLAE 5KREA 4UMVA 3BD8A 1WPQA 3GARA 2C1EA 4L5IA 4LHZA 3IURA 4MAAA 4FSDA 4WOBA 3D0RA 2ZVPX 3OCCA 1PI3A 1O08A 2D5CA 2CXNA 4WLVA 4GKVA 4FZ3A 3KVRA 4LMPA 1LFDB 3UHFA 1S02A 2CXSA 3KELA 3JQGB 3KQWA 4LQLA 2CXQA 5EMHA 3ZCSA 2I1VB 5D1NA 1QHFA 1U8YA 1BS9A 4Z1MD 4U2FA 3OM1A 1E69A 4PCUA 2H07A 1CPYA 1DSSG 1QK5A 3MT7A 2XUAA 3N28A 5KAMA 2OFXA 5CX1A 3I53A 3H11B 3GOQA 4CQLB 2J3EA 1JBQA 3AY6A 3BILA 1BIFA 1VKNA 4AN0A 4MH0R 1QVVA 1MB2A 4PZUA 1JMYA 2C61A 3KQMA 4H18A 3H1EA 1O95A 2XAUA 2QLNA 1XU7A 3CEHA 3PWKA 2BGIA 2VRBA 5BSWA 4WUTA 5FI0B 3LY5A 4YXFA 2IQIA 4D45A 4YCLA 1W52X 5BURA 2O2GA 4Q19A 4L5YA 1AKVA 3TLMA 2DUWA 3ZHSA 4NESA 1SPXA 1FMLA 2BFDB 2FY8A 5LD2C 3QE9Y 4WVFA 4TUYF 3FUCA 3FTPA 3RO7A 5AW2A 2WF9A 4YMIA 4G8BA 1NJ2A 4O0LA 3EMKA 3DZJA 3GAZA 5A4MS 1AC5A 1L5OA 1ZNYA 2D2VA 1LVUA 5EERA 3RJ9A 1SQ0A 1W85B 3HP7A 4C3VA 5B6IA 3GCXA 1JG1A 5K0JA 1XZGA 3CKLA 4IF4A 4B0OA 3O2QB 1Y8AA 1PGOA 3ZZUA 4N3NA 4BNIA 4CM4B 3EOZA 2CHEA 4FQ8A 1L5KA 4GNRA 2C4TA 4DJJA 1K7EB 2YNMD 1U8AA 4M8LA 2QUKA 3QTBA 5ADUS 1O5IA 2CLSA 2DWCA 5F78A 2R751 1V5FA 4TSFA 4NU8X 3F5DA 3P7MA 2PANA 4HGPA 4TLDA 3PQDA 3O9VA 1TUBB 1OX4A 4OHKA 2IU0A 5I7OA 5DHFA 1EIWA 4ODIA 2BFAA 2G3YA 2Q6KA 4A82A 3DBIA 2PFGA 1W85A 3G9ZA 3AJ9A 3WJ7A 2L42A 4FKBA 4KO8A 4OLBA 3WWZA 5JCOA 1B41A 3PQEA 3KOYA 4IXNA 5J58A 1D2HA 3Q87B 4B7AA 3BH6A 5IAEA 2BGMA 1IIRA 5HCUA 4QYIB 1NVEA 1VL1A 4D80A 3UKJA 1BCRB 2YKGA 2H4WA 1CP2A 3R7DA 3GLGE 3TZEA 1IZ8A 4B3XA 3P71T 3DFZA 3SS9X 3S1LA 4LE2A 4MKXA 4ZEWA 2IUYA 5CH8A 2CFIA 1X42A 4C88A 4EGQA 3A4YA 1O7JA 1QZUA 3DKPA 4JHXA 3NDPA 1ZH8A 4KFSA 4QFCA 2B7BA 1ONBA 3MK31 3OF3A 1SHKA 3ZY2A 1WCWA 3R2JA 4LOLA 4V02A 4EQZA 4U5QA 1DJMA 4Y30A 2I2AA 1PGQA 2BKEA 4V3BA 4JQZA 5KVSA 3M9XA 1K6MA 2D0PB 3FR8A 4NSNA 4OXYA 3CIFA 1BTOA 4JMLA 4R1NA 1RTKA 1LSOA 3TLGB 4GD3Q 3ZHOA 4BVFA 4K3UA 1H8ED 2EERA 1R0LA 1ESDA 1KA9H 1U2SA 3DBHA 5EIBD 4L15A 4ASUD 3SMVA 1SZCA 3MOSA 2VBFA 4WADA 3KLOA 4WNIA 1HR0B 3U81A 4R9UC 4GI5A 4L7VA 3DLAA 2G5CA 5LM3A 1ZXBA 1M2HA 2DHQA 1E2BA 1RJ9A 1GQOA 2WNHA 3MYYA 1KDOA 3DLIA 4ID9A 3BMCB 2MYNA 3PD0A 5DT2A 2UYYA 2WTXA 3QK7A 2Q5OA 1ZOSA 4X94A 3G2LA 5CT4A 2MDTA 5ALOA 3WRVA 3HY6A 5A6VA 4LXYA 3GYGA 2WDZA 3X3HA 1SHZA 3ZJVA 1A77A 1P3Y1 1QS0B 1NBME 2QMOA 3W34A 1RRGA 2Q2WA 1D7AA 2PRYA 1EH5A 3IEMA 1I5OA 1PK9A 1DTSA 3JR7A 2JHCA 4DJFC 4CRWB 3ZY4A 3P9RA 2FTKE 3NJ8A 2DWQA 3A6LA 1ZGJA 2IPOA 2PKRA 2ZSDA 3ACDA 3QKSB 3O2NA 4F3NA 1HBJA 2E89A 2WF8A 3PQ2A 1KI4A 1V8FA 3HA5A 4CYMA 1RSZA 1WW3A 4PAQA 3M3DA 5K8VA 1MN6A 4LA4A 2WE8A 2OORA 3DT9A 4KAJA 4YJ3B 1EI9A 3IVMA 2RHDA 1L4KA 5JLAA 5EZQA 5K99A 5DZSA 1SIUA 2A5FA 4ZICA 2MR6A 1L5GB 3WY9A 1AGRA 4GC9A 4U2GA 2D2IA 1ORIA 4QDZA 1IYZA 1TCVA 2SBTA 2OM2A 2VTEA 1H42A 3UANA 3ISTA 5JRZA 5AI5A 1XD9A 1E7SA 3F6EX 3B38A 1TO6A 3H1BA 4BO6A 1SXQA 3LQRA 3D4PA 1VJRA 4P3OA 2A84A 2HWYA 4QOSA 1O9GA 1PFGA 2O19A 3DUWA 4MGYR 4TL6A 4E7OA 1C80A 3E1KA 4GH5A 1ZISA 4O0MA 2ZRJA 2EJVA 1QG6A 2VDMB 2QNIA 2AXNA 4TWIA 3I9NA 3MRVA 1FXUA 4TXLA 1RXWA 2I03A 2OLEA 3OM9A 5FXMA 2CMHA 4C0XA 1KDZA 3LQYA 1RYYA 1Y82A 1U98A 3JVVA 1B6GA 1FZQA 1KAHA 2OENG 2XMCA 3HHEA 3HU2A 4YAFA 3L0YA 5SY4A 3SEFA 4UHKA 2JLUA 3GX1A 5CA1A 4BBPA 1F3LA 1M5RA 3TOSA 1P1RA 1RS0A 1K6JA 3DCIA 3HNPA 4L2IA 1MV8A 4UE6A 2ZETA 3IAAA 4QFBA 1JHQA 2ZJ3A 3SQXA 9GPBA 4C4TA 4ER7A 2PWPA 4YCBA 1JLSA 1XN1A 2Q6TA 2WYHA 3EZ7A 3UK6A 3V46A 3KHSA 3PD1A 5T4HA 5HM6A 4HEHA 2Y6UA 4IQ0A 4ARZA 5D3MA 3AETA 1GN8A 2P0EA 3BC1A 5LZ4A 3WGIA 4AMGA 4UUPA 2X8AA 1PT9A 2IIBA 3OZTA 3AIKA 1LS6A 2AR0A 4WNYA 3INRA 1Y1SA 4DSZA 1OAAA 7REQA 2O1XA 5D6NA 3SZLA 4DA4A 2YCLA 3NHRA 1NRJB 1AS0A 4MS4A 1P0PA 1T2VA 2GN8A 2CE2X 4YWHA 1QOPB 4KO4S 1F4LA 5GOZA 2AL7A 1VIDA 1QFJA 1PS8A 2GCOA 2OWDA 4BRWA 4QLBA 1SUPA 5KUTA 4PSDA 5J2UA 1M0EA 4Q1BA 2Z95A 4G8JA 1UJ2A 4HEQA 4TV8B 4QT0A 4ZQFA 3CEJA 1NJGA 2WWRA 3QMWA 3FX2A 4REQB 1VLHA 1Z2PX 4QXMA 3ZZ1A 1UWVA 4IR7A 1OLUB 5JS2A 4PG8A 5AJHA 1ORHA 4P80A 3UWPA 1E7RA 1O95D 3UK0A 3GLGB 4DWJA 3WO1A 2X5XA 3LBHA 2B1IA 6Q21A 2WKQA 3UCFA 1BJKA 1MO2A 4J7UA 5KYGA 3C41J 4X63A 4HDMA 2EIXA 3OZAA 3Q5GA 1YUMA 3V4VB 4JP1A 3AOEC 5GONA 3U0BA 1GG8A 1ZSYA 4ZVUA 3SEAA 2IVFA 2J0VA 1TCAA 3IP8A 1KKMA 2JRCA 5DM4A 2QM3A 4M88A 5IW8A 5C5EA 4V0SA 1IQUA 1V43A 4BNKA 4A0FA 1L4HA 2IUEA 4IICA 1W581 4PWYA 2QRGA 3DM5A 4Q1FA 3FM9A 3UG6A 1X7ZA 2JI9A 3L7KA 3R6DA 1T25A 2BCJQ 2FW0A 1AO0A 1HRDA 2P68A 1CUEA 1NXWA 4DL9A 1IK6A 3A4TA 3AYXB 4R83A 1Z5NA 1EQAA 4E7PA 3B85A 1XCGB 4DLWA 1NDUA 3FSJX 2QAGA 3AP1A 5IAGA 4B84A 5IDWA 5AJZA 3LWDA 2PZGA 3I64A 2QDXA 1E3JA 5JS7A 4MQBA 4WCFB 4G36A 2PTGA 4O2RA 4RZSA 4YJ2F 5EJIA 4FOSA 1BGVA 2WUWE 4IIGA 1C3JA 1C9JA 2PV7A 4CF7A 4M1TA 3BQMB 1RYHA 4XQ0A 3BZBA 4B82A 3JW8A 1EDDA 4PQFA 1YVUA 1YVDA 4RESA 5LZ8A 1VE1A 4LBZA 3IO3A 3T5TA 4XUCA 1QRAA 3NM5A 4GHWA 4BIMA 3GLGA 4GIBA 2HADA 3O8CA 1DQYA 1N2CB 2J0SA 3M5PA 4Z4CA 5IFKA 3I9KA 3A05A 2GA8A 5ARDA 2XGJA 1NJFA 2V7TA 1ISJA 3GZJA 3T6KA 5DX8A 4UHEA 2W6JD 3G0GA 1UDAA 2ZJ6A 3KRTA 5C1IA 5C3MA 3EQZA 3I76A 3FTEA 4TZ0A 3M4NA 2I4LA 3UWKA 3MWKA 1NBAA 1DKOA 2AYZA 2V7PA 5EJ7A 5AXDA 2V03A 4Q16A 2VZLA 4KWHA 5DGHA 3U61B 2EJCA 1GAJA 2UZAA 4HS4A 3NYRA 4DYDA 4DE5A 4E12A 2I4RA 4PINA 3ZIDA 4B76A 4YRIA 3O7WA 4F3KA 4FSHA 2CVPA 1RM4A 1U81A 2BP7A 2ZW9A 2CXHA 1FC0A 1SQFA 3PF8A 2CBGA 3PK0A 4ND4A 3PNPA 4QUDA 4S1OA 4DANA 5M3BA 1XZLA 4PG5A 1JDPA 2RI1A 2YNMC 1P0IA 3IMEA 1QVZA 4L57A 4GP7A 4JDPA 3JTMA 2H9AA 3GV0A 4MUGA 4NX2A 3BWVA 4DLRA 2DPXA 4K6OA 1U94A 3V33A 1ZIXA 3W5CA 3F8WA 5HQJA 2XUZA 4YIHA 1IXZA 1Q6YA 1Y6QA 1DKQA 2UVPB 2WE7A 3EZFA 4EITA 1DCTA 3C5HA 2BLLA 2YWCA 4K8RB 1F7UA 2R6GA 4RD1A 1QO9A 1Q7TA 2QSJA 1UOQA 4RHTA 4Q34A 4LYHA 3LY7A 1BKYA 4J90A 1FUYB 4MROA 3F3YA 3JSXA 5H80A 4UU1A 1UADA 1IBKB 3KQNA 2QRZA 3M0EA 3OE7A 1UMCA 2YV3A 1AMUA 2P90A 5FOXA 4INJA 2C8VA 2GNPA 2HM7A 4LRQA 4ZTBA 1WXFA 5AXBA 3TCKA 3KG2A 1YFZA 4XCQA 4GLBA 4A6XA 4EI7A 4AL4A 3GFTA 2IOFK 3PUVA 4OI4A 4UUBA 4EPVA 4EBFA 4NXMB 4GEKA 2B8TA 4L9AA 5JCJA 5HWSA 4JAVC 1G7RA 3G8DA 2Y77A 4LOJA 4ENSA 1U2GC 2VJYA 3E5HA 2CJFA 1ZVKA 1OLSB 1VFNA 2FUEA 4H15A 2YZKA 4V1CB 1SKMA 3VPCA 3A4LA 1PJ3A 3TXAA 1Z07A 5LXTA 1V2GA 2BKUA 1O0SA 1M2OB 1AUPA 2JB9A 2M6RA 4ND1A 4NZPA 5F7OA 3MWEA 2N1MA 5CT9A 2V74B 3JWIA 3ZQ4A 1V71A 3A9CA 5E1MA 3VPHA 1LRLA 3GJ3A 3RTGA 1R8XA 1WXEA 4ALJA 4UAVA 4R40A 2JIPA 2IYPA 1KYZA 3L7OA 3DHVA 3WAKA 5KYXA 3JVUA 1TT5A 1G7CA 1V1MA 5D86A 3RS0A 3UQZA 4BNGA 1TYAE 1N5LA 2FN3A 4IAOA 4BBZA 1IY0A 4CQLA 3TMAA 3U3OA 1WD7A 3ODPA 3TSZA 2Q6VA 4HNAB 4IFBA 5IJ0B 3LO8A 3QEBZ 1G1MA 1MORA 1S3GA 1IOVA 3GA5A 3ZR4B 1PQWA 7AT1A 2FEPA 3TQSA 2XMSA 1EFTA 1UUFA 3ITKA 3JZMA 3MJHA 3PCXA 2A9OA 1KJWA 5LP6C 3ZKAA 4RSHA 4TX1A 1MC1A 5DYNA 3GIWA 3W5HA 1O58A 4LHVA 4LMAA 4J4BA 3TOVA 3TZKA 3EVBA 1JU4A 5C5IA 3CM0A 1ZC3A 4YRTA 2BLNA 1KU0A 1S7CA 4IOJA 2CCKA 4XB6B 3EPJA 4MZDA 1X8LA 2Q2QA 1ISMA 2YW2A 4DZRA 3EPLA 3HCWA 1UEIA 2XDQA 1ZUD1 2CDRA 4NEQA 1N92A 1GU0A 2QZSA 3EEBA 4B8WA 3X2SA 5L6LB 4Y1EA 3OMXA 5MDHA 5LQDA 2ERXA 2XMRA 3B9RA 1ZJZA 3EA5A 4N01A 1EB9A 5E2IA 4B7XA 4NBUA 3GGGA 1CVIA 2BTQB 1OXVA 4YASA 4AYWA 5KC9A 3DCJA 3I0NA 4FYXA 2R2GA 4J6EA 3KDAA 3UTCA 1P2FA 1RKVA 1MF7A 3M2PA 5IVPA 2C9DA 1TUBA 3NHWA 3VISA 3NUZA 1G8AA 1KH3A 1D0SA 3HB0A 1R8JA 4RKRA 5BUSA 3LWNA 4HY3A 4A3SA 4OPMA 4YAUA 3LFTA 5CHEA 2I2CA 4B73A 3VUEA 5CH5A 4E2ZA 5BVGA 5EUQB 1CX9B 2RHMA 4YLGA 2DKNA 1JV2B 3AG5A 2ZIFA 4EK9A 4P86A 2ZGVA 2R97A 3MWJA 3UJBA 1BDHA 2JVJA 4XVUA 3T95A 2AZXA 3WDKA 2CE7A 1GKKA 3LXUX 3H9CA 5A4AA 3BJRA 3TDMA 4QYMA 3HK2A 5IC6A 1UT8A 5J59A 2J3HA 1JEDA 1F8FA 1XF1A 3HVHA 4CMBA 1U1CA 2EX1A 3AU9A 1IUKA 3ZY3A 4ZHQB 4QGAA 1MJGA 1CDZA 2PVPA 3KUDA 4Y6QA 3ER6A 3OQIA 2PUHA 1N0HA 3HCNA 4M7WA 3NDRA 4FD3A 4HMPA 3CF6R 3MAJA 4PO3X 3CNQS 4ZIRA 4PLFA 2ZR8A 4KPYA 2JDIA 5KJEA 3X2EA 2R6DA 2Q28A 2X7HA 1A4IA 3Q8WA 4O5AA 2ODNA 1NMEA 1K66A 3WOHA 2YIDA 1L5LA 3DKVA 3DKKA 3U6BA 2DX7A 1BE6A 4AIRA 3VC3A 4RY9A 3C98A 1R64A 1XKQA 1CUGA 3EF1A 3R5KA 2Y99A 5ECGC 1QH8B 4R3NA 5KU1A 4L8FA 4BZZA 3AFHA 2W8BB 1PZFA 2BC9A 4FHCA 1C7ZA 4LI0A 3MWDB 1UXOA 1IN6A 1US8A 1G63A 1VFPA 3OTWA 3PWSA 4GW3A 4RGVA 5HZMA 1H23A 1MC8A 5H68A 3JPWA 1MOSA 2OFOA 4WY5A 4DCTA 1ZH6A 1XLWA 5T7BA 3C7KA 3C74A 1CJVC 3JQEA 3KTAB 4RS4A 1I5RA 2E0IA 4ZXPA 2UXCB 1FVHA 3GLIE 1RAGA 2ZYAA 4M0MA 4RTLA 3ADDA 1L8LA 1H2BA 3DQZA 2ZU0C 4FW9A 3I45A 4TMWA 4OAOA 2RGGA 4Z0TA 3NM4A 1WMSA 2YRWA 3JVEA 1EWKA 2DUMA 3KSZO 3P9SA 3Q15C 2PA3A 4YPOA 1KOFA 2EHDA 1E6MA 4IIDA 3K1YA 4O4IB 1KEEB 2JVIA 4R05A 4R69A 1YDMA 4W63A 4PZLA 3WGYA 5C37A 4I8DA 3RC7A 1K68A 2B5VA 4PANA 4RL4A 4M9XA 4OQQA 2LIPA 1NXSA 2GFIA 2ESRA 3GJ5A 5BYJA 4KR2A 4LSMA 4BFTA 4YQZA 4X95A 1YZYA 3HHPA 2RHRA 1ITZA 3OETA 3TW8B 5ALJA 4B83A 4KL8S 1CFZA 1PWHA 4CGYA 3FPEA 4IXDA 4BIIA 3E8XA 4WZAB 1AV6A 5H9VA 3FCYA 3RYFB 5ADWA 1N0WA 3KPUA 4A92A 4G4JA 2A1TR 3IUNA 4FVTA 1L1FA 4QKQA 1NNSA 3NHMA 3T4XA 5B36A 1I5EA 2IE0A 5CDUA 3VDRA 3IKJA 3ZCUA 5JJKA 3H4VA 3OEED 4EGFA 2F6RA 4JROA 2AGVA 1XNJA 1E89A 1FPMA 1OASA 3I2HA 3KKEA 4PCLA 5K09A 4ZA2A 3K0CA 2J6BA 3ULKA 2VRNA 3NH6A 2QQGA 3QM1A 2O5RA 1KZYC 4QASA 2XNJA 4IG9A 5CIQA 3VSCA 5JEDA 3B48A 2AJ8A 1P0CA 3TX2A 1JB1A 2VNJA 2ZB7A 4MW9A 4NH0A 4BMCA 1M6HA 2X8BA 1ST3A 5I45A 3S3TA 1W88B 4HGYA 3K1JA 1SPBS 4TT3A 4ND8A 1FDTA 1GXSB 1L5MA 4E6PA 3PD7A 4NI5A 5AK0A 4YCDA 4AQYB 2J3LA 2HSGA 2QMUA 5D84A 3DNPA 3ZGZA 4AKIA 1U3VA 1M34E 2DF8A 2W2OA 2Y27A 3FSGA 4RHCA 4LQ4A 2EVWX 4YRGA 5BQFA 1PNTA 2NUTA 1FMTA 3VDXA 2ZT6A 3UUGA 4UMFA 3PHHA 4N5NA 1HV8A 2XZPA 3FUTA 3M3HA 4UHFA 4EYQA 5GJBA 2KHZA 4HLCA 2HWWA 2PJUA 3B6JA 4P7BA 1IPEA 1K0FA 1Q57A 4WNCA 3WKDA 2FSFA 1DRUA 1XELA 4XYGA 5ALIA 4EUKA 5I7VA 4TZ6A 1P33A 2GXUA 3OHSX 3KNZA 5B1HA 3V34A 3D7KA 4AY2A 5TQVA 3BM5A 1NC3A 2IHVA 2VPQA 3ER8A 3H04A 3PNSA 4RD0A 3T5AA 2O8CA 2G72A 2LVBA 4GFDA 3RRXA 1T9GS 1XKTA 4NULA 3QFSA 2P8JA 3A4IA 4DWVA 2NXJA 1WDKA 1NQXA 2PIDA 4IW3B 1GFIA 1TK9A 1CETA 3LF1A 1GA1A 3CRNA 5JDIA 1F3OA 3DEHA 1Q21A 1OXKB 3U6KA 4ES6A 3AHEA 3N6VA 2GO7A 3RSSA 5BR4A 1UBGA 1II9A 3GHHA 1TF7A 4HVAA 4LC0A 4MZXA 3E2PA 2IF2A 2P4EA 4L50A 4EO9A 3SWWA 4UOEA 1HOXA 4J3JA 1FE8A 3NX4A 1P1HA 2X3YA 5F76A 3SYKA 1UIMA 3OM8A 2NQTA 1NE2A 3DV2A 3BFVA 4WAUA 3SSNA 1A9TA 4TWZA 3VU3A 3L4SO 5AOBA 1XNHA 4ZQIA 2OHJA 3R3ZA 1V6SA 1VJTA 3NNNA 3H0CA 4TL8A 1Q0HA 3NUGA 2YH2A 3AM5A 3A04A 2FWMX 4LJLA 4CV3A 5BMVF 1DDOA 1ZI6A 2H2GA 4OJYA 3FRIA 4R41A 4OXQA 2ZTVA 2JL1A 2DUNA 3NPAA 3RIMA 2OGTA 2GKSA 5EP2A 5I6DA 4GKJB 5KSOA 2CNNA 4L0DA 4RXMA 3UXMA 4Q4CA 4DV6B 2X9GA 2ZSHA 1QCYA 3NOOA 2HUPA 4FIDA 3H16A 5FULA 4NJEB 2VJMA 4Q9NA 2R00A 1BRTA 3NXKA 1KMCA 3TB6A 3DVQX 4W5HA 2OQRA 5JJBA 3UGTA 1P0MA 4EI8A 3BERA 3C8ZA 4MA0A 3A9SA 4H08A 2ZBUA 5E9QA 4I50F 4DXDA 5FTWA 2RB4A 4JUDX 2FW7A 2OVFA 5JNRA 4XOUA 5CD9A 2ZXUA 4IV5A 2RKBA 5CFNA 2CSXA 3CVVA 4ENRA 1EA5A 2AA3A 4KDCA 5CM2Z 3OUTA 1M6NA 5HK9A 3EYAA 3I2GA 1QYWA 1U9YA 2XIQA 4M6WA 1WHSB 3L7LA 3QOXA 2ETVA 1DEOA 1XNRB 4O2AB 4WZZA 2WPDA 4C89A 1CLEA 4LPKA 1JHDA 5EXEA 2ZFUA 1W29A 2F8LA 2XNDA 4AZ3B 2FR1A 4DY4A 1UDBA 3WWDA 1YK1A 1GPUA 1KWKA 2BM9A 2XLCA 1DQPA 3ZVKA 4RHYA 1I7QB 1U11A 2V5AA 3GEHA 2WQZA 5FA6A 2H2AA 3ZWKA 3DZ8A 3PFBA 1SC4A 1ZI9A 3RRYA 2A5GA 1FXWA 2KSQA 4RVGA 4B0PA 1KK1A 1B0UA 1TQ2A 2JJYA 3QPAA 3DE1X 1WEKA 3TZBA 4B74A 2K7FA 1KRWA 3K5WA 1XTKA 4FINA 3A6PC 1Z4KA 1H6AA 2B20A 1DT3A 5M29A 4JOQA 1H69A 1U1DA 2BY4A 3MMNA 3GVPA 3C3XA 1BX1A 3HI6A 3PXBA 4B40A 3OUZA 3CLTD 3QPCA 4L4SA 2CVHA 1MOQA 3PYXA 1QKIA 3Q6MA 4MWCA 2WIDA 3MYRA 2ZJOA 3FR7A 1BC5A 1FVXA 3LW7A 3MUOA 4BWFB 1O8CA 4DNOA 1FVFA 2XVAA 3B3JA 2D74A 4F6LA 4Z49A 1G8JA 5FADA 5C7IO 1O3YA 2HJHA 2WB4A 3ISJA 2NZ8A 2AI1A 5LUAA 3EZ9A 1M0WA 1UP4A 4EW6A 1Y9JA 1LUAA 4LDAA 4K5QA 1X80B 4AYTA 3BZUA 2FMIA 2PBLA 2PZLA 3RYFA 3W2GA 5AW7A 3H4IA 4CBVA 1IWPB 2LCFA 4MUXA 5HILA 2C0PA 1KGSA 3IUBA 1GOTA 1FQWA 1VYTA 2F43B 3X2FA 1H2AS 4HH1A 3AM1A 2VF2A 3EUWA 1KAQA 1ENOA 3AHGA 1JJAA 1EXDA 1E61A 2G9QA 4KPGA 3Q3CA 4WLNA 5E38A 3LC2O 4Z8XA 2BFEA 4CEIA 4CCAA 5JALA 4GYKA 1Y34E 1Z56C 5G0UA 1IU9A 3THRA 2V4ZA 4BOYA 3D2CA 4JLSA 2VNAA 2BMJA 4FYHA 3SY8A 1AV7A 1HG0A 4YT5A 1JJBA 1K9SA 1QZXA 3TJZA 3PYLA 1QHXA 3W5AA 2VPXA 3OD5A 4OJTA 4U7TB 1PVVA 3E35A 5AHRA 5FOQA 5BQ5A 1Z8FA 4GXQA 1YCDA 3EFBA 2HK9A 4UATA 3LT5A 1YTUA 2IC5A 2XA9A 3H5IA 1D6JA 1QBGA 2B25A 1V9SA 5FJIA 4YVFA 3DEKA 1O2DA 2HDHA 2N1BA 3SZ3A 3TZQA 4Z0HO 2BZ0A 4B6OA 1H6CA 4B4OA 2Z98A 4P6VF 1AXGA 2IHTA 4A9AA 3DLTA 3HM2A 1KTIA 4ETMA 1U7DA 5HFNA 2XMGA 5DIZA 3S2YA 2GPBA 1T3TA 2JDID 3K2QA 2QTZA 3QYPA 5ECDA 2IU3A 3KQQA 3OZCA 3IA7A 4FUTA 1TM2A 3AH8A 1TM4E 1PWZA 2H2WA 3QELB 1WP4A 1H9BA 3G5AA 2R6CA 4NC9A 3V9AA 3FFTA 2P3SA 1ATIA 2P9FA 1RI5A 3V00A 1E63A 1R6VA 1DCFA 3HDHA 3ENNA 2Q4BA 3DMYA 3O26A 3R3HA 4O4LF 1W34A 2VP5A 1MMFB 4AUEA 4DBLC 1LC3A 1MKYA 1ZD8A 1UMBA 1YR7A 3P0FA 3FPCA 2HLHA 5JTUA 3IIKA 3SHFA 4HGZA 3O21A 1X87A 4DQDA 1E6WA 2PGOA 1C1YA 2FRDC 2C4VA 2DUUA 2W43A 4AUMA 3KQLA 4CL3A 3M7IA 1U8EA 3P9KA 4LQCA 1O4VA 3UBMA 1NSTA 2ZE5A 1J5EB 5D3QA 3BVPA 1R2QA 5KPJA 2HSDA 4EARA 4IRMA 3U1BA 5CEEA 2OBXA 3QLJA 4NZNA 2QD2A 3U7HB 5JCXA 3W8EA 3WADA 2XKJE 1F7VA 1GTG1 1N6IA 4R81A 3VVBA 3ENQA 2C9MA 2OV6A 3WGLA 1RPZA 1Z08A 5JD5A 3N8GA 4G5GA 3DAPA 4HMQA 1D4ZA 2ZIAA 3CZ5A 2B82A 3GGCA 1Q7CA 5DI9A 4FLMA 2QSUA 5CDYA 1QE0A 3OD1A 4BCDA 3KUKA 3OOYA 5BPFA 2HREA 1VKRA 4DIMA 1D9ZA 2B7LA 2FMXA 4F3CA 5DU2A 2Q5IA 2CYBA 3LBNA 3PCTA 4JK3A 3RTBA 4BQQA 5A9RA 1EHCA 3AB3A 1E3EA 2WD9A 2CLCX 5FWAA 3C39A 2Q99A 2O5CA 2WUGA 4RXUA 1YE3A 5KVQA 4WXMA 2DE0X 3GYBA 3KXPA 3B6IA 1YUNA 4JC8A 4G5QA 1FDSA 2WAXA 3ORRA 3LHKA 5CP8A 2BFDA 1ZMOA 2ARKA 4G1VA 3T7JA 1UT6A 5CA1F 1F1JA 4MRAA 1L4BA 2F3TA 2YFKA 1YB5A 4OP2A 4WIAA 1YH3A 5HSGA 1IM2A 5FAKA 1NPTO 1NDQA 3PUWA 1EP9A 1P9WA 3MEQA 5LOVA 2NUPB 1OGIA 2Z2JA 3GHYA 4OUDB 4ZCIA 2XD4A 1SUAA 2BGUA 1Z74A 4UNIA 3LK6A 5K3DA 1YBAA 2Q1UA 1L5ZA 3AJAA 4G1BA 2B34A 3GJQA 1C3VA 5EY5B 3VJKA 1G3UA 5FQOA 3ZJ5A 4JX9A 5CDSA 2FEAA 4J0GA 5EUMA 5A06A 3M89A 1PW7A 1WDMA 3TD2A 1ISGA 4CM6A 4RAQA 3RRZA 1JF8A 2OB1A 1K8XB 1SIOA 3R7AA 3RK0A 3ILSA 5LOVF 1M2VA 2BDTA 4URHA 5KJ1A 2VSQA 1R0BA 2HT1A 5I7HA 3PQFA 1NUSA 2O1SA 5EIXA 2GCPA 4KO3S 2FSIA 3S40A 3G7NA 2Q2NA 4DC1A 5IX8A 3L1JA 2DQZA 4ZOQI 3PR2B 3U40A 1QKKA 1I0LA 1NMXA 1SVKA 1UBKS 2XADA 4TWJA 4LJKA 3JWEA 2BHSA 3QFTA 2E1RA 2A59A 3G0OA 2PAAA 2DULA 1T5OA 5GVRA 3QJYA 2P35A 2HO5A 2ACWA 5DJ5A 3T9DA 2D8MA 4QRIA 1JQLB 3GP3A 3TGPA 1USVA 4MYDA 1P5ZB 3DS8A 1E79D 2PSFA 3WQBA 2FZ5A 4JIMA 4H0FA 5IJAA 4TL7A 4G84A 1R5JA 3DBVO 3UMCA 2ONJA 4M9UA 3GJZA 4BQOA 1E99A 5EUCA 5AI8A 4JMPA 2DUJA 4FKMA 1RWQA 2GXAA 2AE1A 2QX4A 1OFVA 2H08A 2P67A 4BFVA 4AULA 1ECJA 3WYAA 2FQQA 4DM4A 4JSRA 1DC6A 1WXGA 2V96A 5H59A 3G6KA 1OE0A 1UJ6A 4B3CA 2PMCA 1DRJA 1LGYA 1RABA 1XTPA 1PFUA 2OHIA 2R6ZA 3KWJA 3PJFA 4HFJA 5JATA 3MCVA 1WXXA 2BI7A 3EISA 4KFTA 4CEHB 3IBTA 2JCGA 5B3JC 1VC2A 3FD8A 1NUHA 3SQWA 4IGKA 1MW8X 3GJ7A 1XKLA 3IAM6 1FRZA 1HO3A 5LA6B 4BC1A 4UM5A 1I36A 5SY9A 1NBWB 1Z75A 2Z56A 4GPAA 4RPHA 3ESYA 2W22A 4TRJA 5FWNA 2I91A 4P9NA 1WLYA 3OTGA 1CZRA 1C7RA 4Z2YA 5EZYA 3J81A 2J0QA 1MVLA 3EW7A 4G24A 4M8KA 4LYAA 4TTPA 3PX2A 3HWRA 4N82A 4BDSA 1W46A 1VMKA 2XT9A 2YWBA 3PPIA 3FI0A 2R6JA 4L73A 2OP0A 4ARZB 4Z54A 3NBYC 4IVPA 2Y68A 1DIGA 1YOBA 3PJGA 4U4AA 5AD1A 4OQLA 1B14A 1N6HA 4EY5A 1T13A 3CX7A 1OWPA 4JLJA 1Q1NA 4HRXA 3WL7A 4ZT6A 1G8KA 1BSVA 5CT8A 2MINB 3OJOA 5SYMA 4DJAA 1KEEA 4O4HB 4NLLA 1D5WA 1RPTA 1YC2A 4MQMA 1GUZA 2RMKA 1IEQA 2CL6X 1D3AA 1OROA 1XDDA 4WA7A 5EVJA 3JD1A 2IEGA 3R5JA 3BFPA 4YHBA 5CEJA 1ZZEA 3CMMA 4O29A 1J0XO 4YREA 3ZWVA 1U4NA 2I2BA 2Y2UA 1BA2A 1IZ0A 3K1ZA 5SY6A 2GM9A 1Y1KE 2NXCA 4D0NA 3G8CA 5E9AA 1TJYA 4JI5B 4UU7A 4ZCMA 2CZGA 2HRBA 1ZSNA 4G89A 1G5FA 4MI9A 4XI9A 1PL0A 4WKBA 2FWNA 1UMKA 1M1UA 3ZHVA 2G9NA 4IDQA 5KNCD 3AFGA 4EY8A 3GLIA 2DLCX 2AJDA 4ZQGA 4KLAA 2PSDA 2CDNA 3FFWA 2X1MA 1Q84A 4A2WA 3WZLA 1UKBA 5MN6A 3FPFA 4EA8A 3ZIAA 4FYJA 2JAWA 4FNGA 2ISCA 2ECOA 3O1JC 4Q7KA 3HCPA 4MYHA 3I5UA 4FGLA 1NVVR 1QV7A 2NTJA 1X13A 3E9ZA 3M6VA 1BKSB 2Q9AA 1IN5A 2BEUB 1TIPA 3QA3E 4HNRA 3D4LA 4MUHA 5CK4A 1P0FA 5EIAA 3L7CA 1WHTA 4RDCA 4MV0A 2EEZA 3DEZA 4HDKA 4Q9LA 1E94E 3KPYA 4TMZA 2PU5A 4TUYA 1B23P 4ZVSA 1VSUA 4D3FA 5LUBA 1LFAA 2QMYA 5AKXA 1M54A 4OU4A 3CW2A 1CUSA 1Q2XA 4U6SA 5JVDA 5GIPE 2FZGA 3VZSA 2XYGA 3LOUA 3V4OA 3OWXA 2JLAA 5B12A 2QAJA 1AZWA 4PSAA 1KPGA 3OA2A 3O90A 1OYYA 1SGWA 1YQTA 1P4RA 3JRXA 1FLAA 4V0KA 2WIFA 4FCWA 4EAQA 1XRNA 5E4TA 4LYFA 3LIIA 1CERA 3L6EA 1ZUNA 3D3JA 4Y2PA 1KZ7B 2AT1A 2Q0XA 1YRYE 4H6PA 3IE1A 4DKJA 4C6TB 4JEIA 3V1UA 4WMLA 4RTQA 4LF7B 1YFJA 1HA3A 1XRLA 2F3RA 3CLTC 1XZFA 4PC3A 3KSAC 4H1VA 1EVZA 3TR6A 4Z1OA 4UHDA 1N3LA 3E18A 1XJ0A 2O2JA 3I9V6 2ZSFA 3TIGA 1R16A 4O1IA 3AL0C 2ZJ1A 4RA9B 3PXXA 4X84A 5LCXA 2YWFA 1ZRSA 1JEJA 3FIJA 1N3YA 1DLJA 4UXHA 3G7SA 1E60A 3F9CA 2P9BA 3JQAA 2OMKA 3E03A 1BROA 2C1XA 1NBHA 3JYHA 3LG2A 4RVUA 5FBWB 1DOAA 3OPYA 3VNUA 1TPZA 3IQFA 4W1SA 4YECA 3OP4A 1Z82A 3UFBA