1LRKA

Crystal structure of escherichia coli udp-galactose 4-epimerase mutant y299c complexed with udp-n-acetylglucosamine
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDNPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPACWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the Y299C mutant of Escherichia coli UDP-galactose 4-epimerase. Teaching an old dog new tricks.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords UDP-glucose 4-epimerase
total genus 126
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 2002-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lrkA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1lrkA01
3NX4A 1XDWA 3AJRA 4CLEA 2YHUA 2HCTA 2J6IA 3BAZA 3PDJA 3HSKA 2C5AA 3MEQA 2UAGA 4RF4A 1LSOA 3D3WB 1A5ZA 2YQ4A 3GK3A 4J9UE 4OL9A 1CQJA 5KTKA 4G5HA 2YHIB 1KYQA 3TWOA 3V5NA 4BV8A 3DBRB 4I08A 1FF9A 5BSGA 3L4BC 5TIIA 1LRJA 2UUOA 3JQ7B 2BH9A 3FD8A 1HKUA 1BGVA 4FFLA 1H9BA 2Y68A 3D0OA 3WGZA 1Q7GA 1C0PA 3I9MA 3LT2A 4YXFA 2Y67A 4KZPA 5ES3A 2G1UA 4TZTA 1PSDA 1EE2A 2CVZA 1E7MA 1DAOA 1MFPA 1AE1A 2FR0A 4D3FA 1J4AA 4PZEA 3M2TA 3RIHA 1JAXA 4H3VA 4XIJA 5GY7A 3EZYA 6LDHA 4ZQFA 4E0BA 4PLWA 3RCBA 3GLQA 1V0JA 4CV2A 3GEGA 3NGXA 1QYCA 2VT3A 4IBOA 4BGUA 1SNYA 5LC1A 2D8AA 5ER9A 4YT2A 2IEBA 4L4SA 1R0KA 5LDGA 2FOIA 1P44A 3ADOA 1DJQA 3GF4A 4H15A 4IXTA 5JYDA 3RC7A 1TI7A 3PLRA 4E2ZA 1PS0A 4OMUA 2JD1A 3GPIA 1F12A 1E77A 3QSGA 4YAEA 2VUSA 5DULA 2E82A 3EAGA 4XCVA 1EVJA 1VM6A 1MC4A 3DBVO 2VYVA 3CMMA 3JQGA 4Q9NA 3M1LA 1XG5A 2AE1A 3SC4A 4RZIA 5K9ZA 2BGKA 3PGXA 4A03A 1GCOA 1VSUA 1UXJA 1JU9A 4R3NA 2P4HX 2NVUB 4NJMA 1NVTA 3UICA 4DGSA 1UAYA 4NFYA 2IZ0A 3L77A 3AUTA 4OXKA 2X6TA 4L4XA 1ZK2A 2RAFA 1ZK3A 4IXWA 2JHGA 4RGBA 3QWBA 2RH4A 4ZQEA 5BR7A 1P3DA 1OC4A 1DHTA 3OH8A 2GN4A 3DO5A 1UR5A 1U4SA 4IIVA 2VCYA 4KP7A 4YAGA 2G5CA 4DUPA 1Z74A 1N2SA 5L3ZA 2NQTA 1DIHA 1YONA 1IPEA 3SLGA 3H9GA 5JAQA 3UCXA 3VDQA 4AJPA 4N5NA 5L7WA 1NR7A 3H3FA 4J91A 3TZCA 5IFLA 5MGBA 3WNVA 1DHRA 2EGGA 4HFRA 1KVUA 1QYVA 4Z9FA 4R5HA 3G49A 4PG6A 4MO2A 4I1IA 2AEJA 1KS9A 4HNHA 3E9MA 4A2CA 1LTHR 1BXGB 1XLTA 1VKNA 4YT8A 3RU7A 5JE8A 4N18A 3ROMA 3PWSA 1FDVA 1G0NA 3GNTA 1ZSYA 2F1KA 2X86A 3G0OA 4PVCA 4Z3DA 1M67A 1LC0A 2QW8A 2WE8A 3BZUA 1V3UA 4W7HA 5H83A 2CFCA 4BNLA 4Z6KA 2YDXA 5ENDA 1ONOA 3DC2A 2UDPA 1P0CA 4YAJA 2HDHA 4TQGA 3ANNA 3PRJA 2QIOA 4O59O 4Z0HO 5IZCC 3DZJA 4CQMA 2OL4A 3IUSA 4X54A 2P9EA 3K73O 4E32A 4CLOB 3IAHA 1R0LA 3PQFA 4OQZA 1K6XA 3RU9A 3RSHA 1DRVA 2NU9A 3DFUA 2VYND 3IMFA 4P4GA 4NU5A 4NDNE 5IJZA 4ID9A 3H2ZA 1VJTA 2Y1OA 1QR6A 1RWBA 3O26A 1GZ6A 2RBEA 2CUKA 2Q4BA 4GGPA 3SX2A 4ZVVA 1I2BA 4YAIA 1K3TA 5HRUA 3KTDA 3C24A 2BRUA 4WE3A 3RFTA 2FSSA 1IB6A 4EDFA 3JQ8B 4GSLA 3JQFA 2DQ4A 2PNFA 1SCUA 2JFGA 2OXIA 2ZIZA 3G3EA 3O38A 4RF2A 1S7CA 4AJ1A 5JSFA 3UHAA 5TS3A 2YYYA 3ASUA 1EZ4A 4UVIA 3I9OA 1M76A 4YJGB 2OMEA 3QWIA 1F8GA 2HU2A 1MP0A 4YJHB 1IZ0A 4WUVA 3GG9A 1LA2A 3IDSA 1BVUA 1NFFA 3PWZA 2JAHA 4IDGA 4R01A 4YDRA 1DOHA 3M6IA 1QV7A 2WTBA 3E9QA 2PD4A 3GVPA 3I9KA 3JTMA 2DC1A 4WECA 5A9TA 3UCEA 1HDRA 1ZO8A 3FCOA 4HP8A 4XYBA 2GSDA 2QYSA 4IPTA 5JCJA 5ICSA 5DZSA 3ULKA 4CM7A 2PZMA 3WLFA 1GYRA 3MTGA 4UUOA 4OQYA 5L4LA 4MP8A 1NAHA 2VWGA 1DRWA 4J1SA 2OZPA 5DBGA 1ZZEA 2GZ3A 2BGLA 3TZKA 1PQUA 1V6AA 1D1SA 3TL3A 1FK8A 2AW5A 3L4BA 4AICA 1P1IA 3I1JA 4MOWA 2TMDA 3GVCA 2ZB4A 4RQUA 3TPCA 1OAAA 1LDGA 4XQCA 1KEPA 5IDXA 2YV2A 3QVXA 1EUZA 3GQVA 1JKJA 1UZLA 2Y0CA 3RBVA 3ZHXA 3K96A 3V8BA 4GSKA 2F00A 3ZNQA 3PZBA 4JXKA 4BNJA 2BELA 4IS3A 3HG7A 3AI1A 3ZHBA 3ZHYA 1ZBQA 1YB1A 2YQ5A 1M6HA 5B37A 3ZCXA 3H9QA 5JCXA 3U5TA 4CL8A 3CPSA 1TT5A 1ZSVA 1P1FA 1NQOA 3W8DA 3VTZA 3WGQA 3RFVA 1NHGA 1EK5A 1A72A 5T8KA 1ID1A 2HQ1A 4CLXA 1YBAA 4YTEA 3OHSX 5IN5A 4ZRMA 4YACA 4D46A 4DPKA 2AQ8A 4MPDA 1Q0QA 1PL8A 1T2DA 1I2CA 1GAEO 2Y1GA 4BO4A 3NJ4A 4A10A 2D4AA 4HNGA 3BMOA 3TQHA 4BNKA 5FYDA 3WTBA 5H81A 2ZATA 4RQTA 3G79A 3QJ5A 5DN9A 3GR6A 3P19A 3S2GA 1VPDA 3NT5A 4J0FA 2IEDA 2YW9A 1Z6ZA 1ZJYA 5EMHA 4E31A 2QYTA 3EGOA 3F4LA 1RM5A 4XB1A 3OP4A 3NTRA 4WASA 1KVSA 2LDXA 1SC6A 1UP6A 4M1QA 3MJEA 1MXHA 4BNFA 4P4LA 4IJKA 3L9WA 3K30A 2AXQA 3BIOA 1ONNA 4AVYA 4BNZA 5A03A 2I67A 3BHIA 3FNHA 4ND3A 1Y8QB 3RQSA 3RUCA 5AXCA 4G65A 4ZICA 3HJAA 2ET6A 2UV8A 3QA9A 3WFJA 4PLGA 2WD7B 3FF4A 3GHYA 5HM8A 1EEHA 4MJLA 2DLDA 2HMWA 5BNFA 2EHDA 3JQBA 2X23A 2HUNA 1IUKA 4Y6RA 3QVSA 1W6UA 3GAZA 4FFRA 3LLSA 2FPGA 3R3SA 2HK8A 1AGNA 4DTIA 3V1UA 5G4KA 1I2ZA 3ZU4A 3ZDFA 3P2YA 2I66A 3W4JA 3EW7A 5B4TA 4PRLA 2EKPA 5J23A 1X7HA 3BTUA 3FTPA 3INRA 3OMLA 3QVOA 1GTMA 4M89A 1HSZA 3JSAA 4WLEA 1L7EA 4FCCA 4MVJM 1PJTA 4DREA 1EDZA 1I24A 4IDDA 3JQDA 3WGHA 1TA4A 2X22A 4NPCA 4RVGA 2PD6A 1D1TA 3EZLA 3HDQA 2P9CA 1SB9A 4LSWA 5IZCA 1DRUA 4IZHA 1J6UA 3L4SO 4CM9A 3WG9A 1E1KA 1E1LA 1Y81A 3WOHA 1UXHA 2PV7A 2I76A 3V1TC 1FXSA 4ALKA 4JK3A 2C29D 2OBYA 1FDSA 3EHEA 2W4QA 4IDCA 5IDWA 3ZWNA 1EUCA 3TNLA 3UUWA 1XYGA 3VKUA 3WGOA 3ICPA 3MJTA 1W4ZA 2G76A 4R1SA 3UF0A 4NJMB 1AUPA 1WDKA 3HQ4O 4IS2A 4S1VA 4BV9A 3IUPA 1D4FA 1DFIA 4WLOA 3ON5A 4WLVA 2IE0A 3DHYA 1MLDA 3AW9A 4EZBA 1LSUA 2PA3A 2Z5LA 2O4UX 2O3JA 4AJ2A 3S8MA 2D0IA 4U7WA 5EL0A 5ITWA 4AJOA 4JN6B 5IXYA 3DZHA 3RD5A 4QUKA 2PLAA 1LSJA 3MJ4A 4FFPA 5KJFA 2P68A 3Q1LA 2ZTMA 5B4UA 1QG6A 3WFIA 5DBFA 1PJSA 4YT4A 5F1OA 1H5QA 4U6SA 5GZ1A 5TGDA 3AUUA 4FOSA 3E1KA 2X0IA 3QP9A 3E82A 4XRRA 1MG0A 3C8MA 1ZMOA 4HFMA 5BT9A 3JQ6A 4CM3A 5I8WA 4JQCA 3E5RA 4RCVA 5JMWA 3H2SA 5A5FA 4WLNA 1HE3A 2Y66A 4R9SA 7ADHA 2NUAA 1LI4A 2R00C 3IC5A 4J1NA 3VVCA 3ENKA 4XYEA 1YOVB 1PJ3A 1EQUA 1RKXA 4LSMA 3I4CA 3TJRA 4B3HA 4E5KA 3A4VA 3S1LA 4EYEA 3BTVA 3GGPA 4BMVA 2I9PA 4OIMA 1Y8RB 3VH3A 2WM3A 4IMRA 3HFSA 2FP4A 2G0TA 4J4TA 2EP7A 4XQ9A 4R16A 1PL7A 4ALNA 1T2EA 3E6AA 1X1TA 4YJHA 1KBZA 3WDSA 2DPHA 2FZWA 1H9AA 4N7RA 1UJMA 2WEKA 3GEMA 2VOJA 3PPIA 4BKPA 5JO0A 1MGOA 2B4RO 1OI7A 4PG5A 4XZ3A 1NQ5A 3DOJA 2C07A 4AJNA 1LQTA 4BGVA 1GD1O 4XWYA 4EGFA 2E48A 3H7AA 1ZMTA 2QZZA 2GZ2A 3PIDA 4MVJF 4XGIA 3IKTA 4WKGA 4L74A 4NBUA 4PLHA 4I9HA 4PFJA 4MVJP 1QV6A 4F46A 2NWQA 1E3WA 2VHZA 1LDNA 2NTVA 1ULSA 3KYBA 1XWFA 3VPHA 4RPHA 3O8QB 3UGKA 3CEAA 5K0ZA 2GZ1A 3CH6A 4O5OA 4Q3DA 1WDLA 2NVUA 3D5TA 3M2PA 1D8AA 4DMMA 4DLAA 4YWJA 4CR8A 2Q2QA 3EMKA 4BMNA 1I3MA 1QYDA 3WQQA 3RKRA 2E37A 2DT5A 3GC6A 5L4NA 4Q3BA 1ZSNA 3HN2A 3NDIA 4INAA 2CD9A 4J16A 3ZWCA 3AFMA 4TVBA 2Y05A 2ZYDA 3AI2A 4KDFA 4CM8A 1B8PA 1UAGA 2H1SA 3CXRA 4WEQA 1PWZA 5CP8A 3RC2A 1FDUA 3OQ6A 4NBRA 4XDYA 2A9FA 4ND1A 3L6DA 3DBHB 1B3BA 3JD4A 5JDIA 5G0WA 3KHUA 4JX8A 4RVFA 2WDZA 4RDIA 1M2WA 5BSFA 3JQFC 3WB9A 3Q2IA 2XF8A 3S2EA 5IG2A 4ZQHA 2B5VA 2QG4A 3S2IA 2EF1A 4E5PA 4ND4A 3CIFA 2CDBA 3RFXA 3ANMA 1VL0A 1PR9A 4ND2A 3D64A 4ZJUA 2GCGA 3W8FA 3WX0A 3I9JA 3LSYA 1HT0A 2NADA 4NIMA 3CZRA 1E3LA 3MOGA 5JS6A 1PZFA 1BMDA 5DT9A 4CLHA 1C1DA 4YBZA 3JQGB 3UW3A 2X58A 4FR5A 3ZWVA 5DOVA 3DOCA 2RCYA 3Q11A 3SXPA 1R15A 1B26A 3PJEA 4PLPA 3QWAA 3TRIA 2E49A 1YDEA 1JA9A 3D5QA 4I5GA 2DUWA 3GGOA 4ZU3A 1GEEA 1EBUA 3HFGA 2NTNA 3N58A 1ZVMA 1YB5A 4JIGA 2ZTLA 3OICA 3KSDO 1D3AA 1DSSG 1ONPA 3GFGA 3KM0A 4PLFA 1I3NA 2EXXA 3DZKA 4HX5A 1U3UA 5DCWA 3RVDA 2YFQA 3GNQA 1T24A 2HJSA 4AL4A 5JXWA 2A92A 1HDGO 5EPOA 2B37A 5I7EA 4M87A 3INGA 3EDMA 3WQSB 4CMCA 4UVGA 4DBZA 2D59A 1PJLA 2VYVD 2YFHA 3B20A 1GCUA 4L4RA 3K5PA 4FPXA 4J6FA 2J3IA 5ENVA 5T57A 1R12A 1DB3A 4AJIA 2J3HA 1E3IA 1YBMA 4XGKA 1HE5A 3W4IA 8ADHA 4OM8A 3LDHA 2ZJ0A 1HRDA 4J9VA 3F9IA 4LGVA 3H5AA 4YJGA 4FGSA 1JVSA 2C82A 3WXBA 5JO9A 1J5PA 4GKBA 3DMYA 3WBFA 3T4EA 4YPOA 2O3UA 3O4RA 1MFZA 4XDZA 5JYEA 1P74A 1N8KA 2PR2A 2JCVA 4NNJA 1KC1A 1I01A 4MIOA 1VLLA 2GN9A 1HWYA 1R66A 4MVJD 4N54A 2OO5A 4U0JA 4BNWA 3VC7A 4E6PA 5EJ2A 3W6UA 3IJRA 4FC6A 3W6ZA 1DC5A 1YVEI 1RJWA 1C1DB 3FTNA 4FSHA 1YWGO 4LK3A 1GADO 2BI7A 4RO0A 4DIFA 1WMAA 4IGEA 4XYLA 4DQUA 4TKLA 4I5FA 3BMQB 5G4LA 1Z73A 3JQAA 5A06A 1B8VA 3RC1A 3JQCA 3GNSA 2R00A 4UAGA 3OBBA 3NDRA 1NYTA 3Q2KA 5TLSA 2V6MA 1W73A 1K5HA 3IJPA 4OKNA 2ZQZA 2PD3A 1I30A 5FI3A 3WYBA 3RUAA 5A02A 1PGQA 1XR3A 4KDEA 4GLLA 4LN1A 2IODA 2H5LA 3D4NA 1J49A 1HXHA 3FWZA 4YCAA 3VTFA 5GZ3A 3U09A 3LYLA 1VE9A 1CETA 1YQDA 2VHYA 5KJ6A 2NTJA 4LRTB 3RC9A 5DNAA 1ZCJA 3H6KA 4KTTE 4D3SA 4TRMA 1I3LA 4QO8A 3ZNOA 2PZJA 1CF2O 2J5RA 4PIVA 1KEWA 4YJFA 5A4DA 4JBHA 2VZ0A 5KKCA 4BS9A 1KEVA 1GUYA 4BNYA 3ZU3A 1E1NA 1QXSA 3DMTC 4PCVA 4B7CA 2PWZA 4RL6A 1IZ9A 3OJOA 5CDUA 4J43A 3IL2A 1SEVA 1A4IA 1PJCA 3DBLA 3NYWA 4TWRA 3DQPA 5CAEA 4JCOA 3U0BA 1JWBB 3FWNA 3JD2A 4J1QA 5EINA 4J49A 4BUCA 2BGMA 3VPGA 3L0DA 1DEHA 2B69A 4CLRB 4CMJA 2HRZA 3H8VA 1LDYA 4XJSA 4XA8A 4AJKA 4BNIA 3GOHA 2VTDA 4GBJA 1DO8A 1ISIA 3D4OA 3DR3A 5GZ6A 1NFQA 2B5WA 2V6BA 2RH8A 3U4CA 2BHLA 4IJVA 1ISMA 3HDYA 3ZGYA 1R4MA 5F5LA 4E5NA 4II2A 3F6YA 1IHXA 2C2XA 4N5MA 4GKVA 3GY0A 3AM4A 4Z3KA 2Y1CA 5TQVA 3UVEA 1U2DA 4BGEA 1Y9EA 3GPDG 1ZJZA 5TT1A 3ZNNA 2J3KA 1R0SA 3OJLA 2OP0A 4EJMA 5G0TA 1H2HA 1VC2A 1AHIA 2NU8A 3WICA 3U4IA 4GLOA 1G6KA 2YY7A 4BNTA 1I5RA 1OOEA 2VNAA 4I8XA 4WPGA 3PLNA 4LRSB 1YL6A 4GI2A 1KVTA 2Y0DA 4CM8B 4ZD6A 2XOXA 2HMVA 3UKOA 2DU8A 4OYRA 1JW9B 4R1TA 3OETA 1WZIA 2GGSA 1ZEJA 3I52A 4DA9A 2DUUA 3NDJA 4R1NA 4OAQA 4EUFA 1PS8A 1BVRA 1YXMA 4XGNA 2I99A 1LRKA 3AFNA 4MIEA 3IIEA 2IXAA 1C3VA 1L1FA 4NI5A 5T6BA 4CV0A 2D5AA 3A06A 3S2FA 2FMUA 5JFOA 4DXHA 3B1FA 4YRBA 5L51A 3KBOA 1UDCA 2OUIA 4NMHA 1LQUA 4MKRA 3RASA 2G82A 3PHJA 4GX2A 2C20A 4CR7A 4FJ1A 2B35A 2PH3A 4BO8A 3GDFA 4BKUA 1X14A 4GH5A 2BD0A 1WW8A 1Y7TA 3E03A 3U49A 3WBBA 1T25A 3OSUA 4NU6A 3WR5A 4RVUA 1NXQA 4GGOA 4MKXA 4C7KA 3GZNA 4ESOA 3PP8A 4QSMA 4CM9D 2X0JA 4P8RA 4QTZA 2GD1O 2CF6A 3JYLA 1G0OA 4RF3A 4YEDA 2LDBA 4YYZA 1KY4A 4DL9A 1XHLA 4TROA 2I5PO 1D7OA 3CTMA 5T8KC 3WMWA 5IZ4A 1ENZA 5B4VA 3OJEA 1NR1A 3KZVA 4DWVA 3DZFA 3WYCA 2QX7A 1AXEA 4D79A 1T2FA 4YQZA 3GUCA 2Q46A 1XIVA 3JYPA 4L9RA 3QIVA 2FPPA 1NAIA 5JDCA 3F46A 2AG5A 3AY3A 1DBVO 5I7FA 4WCDA 3TSCA 3V2UA 4JJIA 1SAYA 2CZCA 1DFGA 1JAYA 4RLSA 1IY8A 3N7UA 2Q4EA 4BQPA 4XR9A 1GV0A 1XSEA 1ZKMA 3I83A 4BKQA 2VN8A 5K6AA 1U8FO 5JC1A 1U5CA 3ROKA 4DMLA 2NV6A 4I9NA 4CMEC 5ICMA 3OIFA 2WYVA 3FHLA 3E8XA 4PLTA 3H9EO 1YO6A 3EVNA 5G0VA 4BO5A 3TZ6A 2QRLA 1P1HA 5IXSA 4TVOA 5TRTA 4YVFA 5I9NA 1ISHA 1V3TA 3F5QA 2FHSA 4BIIA 3W1VA 5JAZA 3MJVA 5CEJA 1U3VA 3MJCA 5KCZA 4AJEA 5CDTA 5GMOA 1F14A 1P9LA 1ADBA 3PHIA 4Z9YA 1JDJA 1U9JA 4JP3A 4FDAA 2A4KA 4MVJG 2Q1SA 3HADA 4J7UA 5DF1A 5EQDA 4NZ9A 3OJFA 4D43A 4GPD1 4H7PA 2X9GA 3G1UA 1B8UA 4BNHA 2H63A 3RUFA 4OSPA 3WGTA 4R69A 3OQ1A 1O6ZA 4ITUA 2CSUA 3RAJA 2JHFA 1EVZA 3IOYA 4RV9A 4DBVO 2GERA 3DZGA 1I32A 2DFDA 5TC4A 3SVTA 2GLXA 4I9UA 1DIRA 3B1KA 4IINA 2FY8A 1H6AA 4RPLA 4W82A 3HHPA 1NHWA 3AOGA 3OIGA 1XCBA 3DTTA 4URFA 1UZNA 1SZJG 1A4UA 4ZGWA 1VJ0A 2UYYA 4IY1A 4FJ0A 4ALJA 3A1NA 1SMKA 3JYOA 4U5QA 5L45A 3NTOA 4ONEA 4DQXA 1QSGA 1H6CA 3QVTA 1NASA 5A3JA 1VI2A 4HADA 4J7CA 2FSVA 2DM6A 1LLCA 4A0SA 2IZZA 4YJDA 3UH1A 5CG1A 1Q7CA 4R41A 3KYCB 3NT2A 3CSDA 4HY3A 4CQLA 4XYGA 4IQ8A 2CVQA 1U2GA 1V3VA 4BNUA 4J90A 1XU9A 5JY6A 1NPYA 3KV3O 5A9SA 5KWEA 1BSVA 1PQPA 2Q99A 2ZB3A 5JCJD 4K6FA 1LLUA 2J5QA 5A1TA 9LDBA 2QRJA 1ORRA 1WXDA 3WGYA 3KYDB 5ER6A 5TF4A 1WDMA 4D0RA 3EUWA 3VH1A 1OMOA 4XQEA 4MKZA 1U7HA 2WYWA 3R6DA 5C7OO 1N1EA 2P5UA 1LSSA 5F1KA 4C4OA 2Q1WA 3LQFA 1LC3A 5HS4A 1AXGA 3LF1A 3V2HA 2HAEA 3WMXA 2C5EA 3D1LA 2CF5A 4CM4A 4QO7A 3QV1A 4BO7A 1ISGA 4PRKA 1ISJA 2O3TA 2Y1DA 1GYQA 4QEDA 3K8ZA 5JBIA 1YL5A 3BHJA 1PWXA 1U7TA 3BA1A 2NLOA 3LT1A 4KUHA 4W9NC 4WCFB 2ZCUA 2AHRA 5I8ZA 2PFGA 3ZU2A 2WD8A 4GQAA 1HDCA 1ZIDA 3NUGA 1NP3A 3F1KA 2HK9A 1ZFNA 1DC6A 4BOYA 2XXBA 1PGOA 3ZWAA 1TB4A 2G17A 1NBOA 4XR4A 4BQRA 4DQVA 5G0SA 3ASVA 2GUGA 1C14A 4F45A 4XJTA 2DTEA 4WCFA 4QT0A 4A7PA 4P4NA 4E3ZA 3JD0A 2YHIA 4IM7A 1CQIA 2PK3A 4NG5A 3EYWA 1B7GO 3ZV6A 1BHSA 2DBQA 3H9JA 4B8WA 3JQ8A 4AJ4A 4OSOA 4IJWA 3FRJA 4F6CA 3ZU5A 2PZKA 3R1IA 4K26A 1ENYA 5EN4A 4LISA 1GZ4A 3ZV4A 3QY9A 3COSA 4M86A 4A27A 3GDOA 3PQEA 4R1UA 4CUJA 4XB2A 1KERA 1PTJA 1E3SA 1XKQA 4AJJA 2Y0EA 3OEYA 1PZGA 3ETEA 1NVMB 4F6LA 5I9LA 7MDHA 3MCVA 1F0YA 1HYEA 2BKAA 4FW8A 4OHUA 3IP1A 2JFHA 4QXMA 1R37A 3AM5A 3BYZA 2JFFA 1E6WA 1LX6A 2GYYA 4WLFA 4CMGA 2Q1UA 1BXGA 1EE9A 1PGJA 5I7VA 5TJ9A 5FEUA 4PG7A 2GNAA 4IMPA 4R51A 2D3TA 2DBRA 5DCUA 4YRDA 3WSVA 3ZW8A 1O95A 4E2XA 1ADGA 2VTEA 3F5SA 4HFJA 3CE6A 3GH3A 3JD1A 3VVBA 2PH5A 1O9BA 1UXKA 1X7DA 1N9GB 3KXDA 4GWGA 5CG2A 3ZWOA 2AQHA 4EUEA 1LDMA 3MWDB 4BB5A 1H6BA 3GGGA 2CMDA 4Q3AA 3VPXA 3GFBA 3VZPA 5BSEA 1L7DA 3E9NA 4TSKA 2Y1EA 4IQ0A 4WLUA 1IOLA 4KWIA 1PGNA 5KKAA 1PGPA 1B16A 2PKQP 4IDFA 3ROQA 4A73A 2H6EA 3QW2A 2W90A 1LXCA 2EV9A 1BXZA 5T67A 4J4HA 1P0FA 2AEFA 2EGHA 3PWKA 3K6JA 2C2YA 4KWHA 4MVJA 4FFMA 3JQ9A 2IYOA 4FB5A 6ADHA 3D4PA 2D2IA 2IXBA 4JROA 3L07A 4JJGA 3OEWA 4K28A 4DPMA 1R4MB 4MVJH 3UN1A 3LF2A 2IZ1A 4E5YA 5HA5A 3U3XA 1E6EA 3AU9A 4B3IA 1JTVA 1HZZA 1PZHA 1NVGA 2NQ8A 3LZ6A 3D3EA 1GUFA 3WJ7A 3BTSA 3HE3A 1PU2A 1YRLA 3RJ9A 3KYDA 4MP6A 4O63O 1I3KA 3GDGA 3LT0A 1MA0A 3PGJA 4JBGA 2ZYGA 4KQXA 4MVJI 3WJAA 1T4DA 4E5MA 1HF3A 1Y8QA 2BLLA 2GF2A 2V6FA 1LDBA 1QLHA 2D1YA 3O8QA 2W2KB 3VH4A 4E30A 3JQAD 2VZ8A 1CIVA 3NEPX 3ICCA 4CJXA 1U3WA 3ZNPA 5DCYA 4BGIA 3RUIA 3PIIA 4PN3A 2VUTA 2Q1TA 4M49A 4NK4A 4PVDA 3MZ0A 4DYVA 1WWKA 1RM3A 3P5SA 4BHTA 4JNKA 3FPCA 4LW8A 1LRLA 3ZWXA 1E7SA 4YAKA 3AWDA 3DDNA 2YZ7A 3ROPA 2BFOA 3WWZA 4EBFA 3FR7A 1XGKA 4E12A 2VRCA 2YJZA 3L6OO 4GMFA 4WOKA 4WOJA 4WGGA 4DC1A 1M75A 4CODB 4E13A 1YB4A 3KEOA 5U9CA 3KB6A 1A9ZA 2VZ9A 1MUUA 3D3WA 1I10A 3DWFA 4D44A 4NBVA 1GPJA 3ZWWA 2DBVO 4M8SA 3C7DB 2WE7A 4Z9XA 3PTZA 2GRAA 5A9RA 1GZ3A 2HRBA 2O23A 3W8EA 3ZWMA 2AA3A 3HB4X 1VKOA 2W2LA 4QECA 4UEJA 2O3RA 4L76A 1JN0A 1NWCA 5CDSA 1YOVA 2NU7A 2WSBA 1IPFA 3FBTA 3TFQA 3PDUA 1I33A 3HZZA 5T64A 2VWPA 4GMGA 1X15A 3I6IA 2DKNA 2TMGA 1M6WA 4J2HA 1Z45A 4OOFA 1GQQA 3NGLA 3QRWA 4TZKA 5JW6A 2C7GA 3AY6A 4YB8A 1P1KA 3SLKA 4CMBA 1A9YA 2PY6A 5KVSA 1HYHA 1T2CA 1EFKA 3K31A 3WIDA 5KNLA 1BW9A 2NM0A 1RPNA 1PX0A 5IDQA 2I65A 1ML3A 3MWEB 3GRPA 5COAA 1SPXA 5EIOA 2IDZA 1NPDA 2FR1A 3GN2A 1ZK0A 3FNFA 1E6UA 3A28A 2OHXA 3AM3A 2EKLA 3O03A 3NT4A 3ANLA 1RM0A 1U8XX 4CMIA 3NV9A 3G17A 4CQMD 4G2NA 3ETGA 4UEKA 5K6AC 3KSZO 5AYVA 1T4BA 4CM5A 4R3WA 5ADHA 1HZJA 5CFZA 2O3SA 5AXAA 2PKRA 4DPLA 2VYNA 3GUYA 3DFZA 4ILKA 3I9LA 4CQLB 5U1PA 4FS3A 5CHEA 4ZRNA 5COQA 3RROA 5JNLA 1YGYA 3QQPA 1LEHA 1YJQA 1QYWA 2HO5A 3NRCA 1XELA 2VWHA 3RJ5A 3FR8A 1X7GA 1ZEMA 1FMCA 3HN7A 1PJ4A 3Q6IA 5AOVA 1QMGA 1DC4A 1C1XA 1Z7BA 3G1TA 1YJ8A 4HBGA 5L53A 3I23A 2Z1NA 1IE3A 2XPCA 3ETDA 1YQGA 4J7XA 1PJ2A 4BKOA 4RVSA 4FOOA 1LLDA 1GPDG 1ZH8A 5JAIA 1PJBA 2QQ5A 4II3A 4R4JA 1GR0A 1O0SA 2NVBA 5TJHA 1U4OA 3GVXA 3LC2O 3WGGA 1EVYA 2PKQO 3QWHA 3JYNA 3EC7A 5IAAA 3ZWYA 2FN7A 3KO8A 4XRGA 1B0AA 4YA6A 1K89A 1X0XA 2R6JA 1KETA 3A9WA 3M1AA 4ALIA 1DJNA 1EUDA 3U62A 1E7QA 3ONDA 5KVQA 4BMSA 2AQIA 5JPIA 5AQ1A 2W2LD 4B4WA 4CLRA 8LDHA 2AQKA 5B1YA 3SEFA 1EMDA 1ZNQO 3FNGA 4CQMB 1JKIA 1X13A 1R6DA 1PQWA 2Y1FA 3INTA 4FFNA 4YJFB 4CL3A 4CMKA 1LBEA 3RBZA 4F3YA 5A9SB 4DIOA 3UAGA 1YBVA 4I5EA 4EJ0A 2O7SA 1H0KA 3AUSA 3PQDA 2HK7A 4BKRA 1P1JA 3DXFA 1C0KA 2YV3A 5AXDA 1BTOA 5DBIA 4D0SA 1MB4A 3H5NA 1E3WB 4HWKA 1MXFA 2P91A 1VSVA 4W99A 1HE4A 1P77A 1T1SA 5IDYA 4A5OA 2J3JA 1MC5A 3DAPA 4EEZA 1F8FA 5L7TA 4RPGA 1O94A 5IF3A 1UUFA 4PLZA 1GU7A 1M66A 4UUNA 1YS4A 2NACA 2HMSA 1BRMA 4I5DA 1ADCA 2FZEA 3OA0A 4Q39A 3TZQA 4Y9DA 1TT7A 1Y5MA 4PG8A 3DEYX 2BMAA 3VZSA 3TFOA 1N1GA 3BMOB 3KLMX 5ILOA 1I8TA 2H9IA 1DIAA 3GN1A 5L7YA 1XQ6A 4Y8VA 4BVAA 5FFFA 1HTBA 3GMDA 4GVLA 4CM1A 4FBGA 5ITVA 3QWFA 1A7KA 1K6JA 2OFPA 3PJGA 4DRYA 3C85A 2VUUA 1WP4A 3VPSA 3DTYA 4H16A 3U4HA 1PR3A 1BDBA 1Y5RA 1JVBA 1S6YA 1QLJA 2VHVA 1EQ2A 3SBOA 5THKA 1Q1NA 5KJCA 2JCYA 4CMHA 4FD3A 4EW6A 5CEEA 2X8LA 1OBFO 2WMDA 3C1TA 1CEQA 2ZB8A 3AI3A 3H3JA 4GVXA 2X7HA 2B4TO 3VAZA 4GAEA 4A26A 1UXIA 3ORFA 1YKFA 3T7CA 5KJEA 2V6GA 3KEQA 4IZIA 1PZEA 1KOLA 3GRKA 1IL0A 3PHLA 2JCXA 4ALMA 1I36A 1UP4A 3AOEC 4BO1A 3I5MA 3JQAB 1U1IA 2OGUA 4B8ZA 2BI8A 4R54A 1NNUA 3KVOA 2YV1A 5I7SA 2W2KA 4IGFA 3K9QO 4N5LA 4R5MA 4Y67A 4ALLA 4UVEA 5L95A 2I3GA 3FN4A 3P2OA 5COBA 5BNIA 4DIBA 2ZCVA 2ZYAA 3FPLA 2CDCA 1I0ZA 1IULA 3JQ9C 3MOIA 3KLPX 3A14A 4ZQGA 4IDEA 3B6ZA 1Q0HA 5KIAA 1JLLA 2QZ9A 1NM5A 4D41A 4M54A 4HKTA 1XQ1A 3DZIA 1H93A 5EERA 1OC2A 3OJ0A 3SJ7A 1V9LA 3UXYA 4E2YA 1R4NB 5C5IA 2XXJA 4DYDA 4QQRA 2AG8A 4OXNA 2GDZA 4K1LA 3PJFA 4S3MA 3WWYA 2AEMA 4PLYA 3RUHA 3ZWPA 4NBWA 5TSDA 2R2GA 3FI9A 3ADPA 4BL5A 4DLBA 2ZKLA 1AHHA 3F3SA 4OXYA 3TOZA 3VHRA 2GASA 2Q50A 4IQGA 4TRRA 4ZHSA 2SCUA 4GX5A 5G0UA 3LVFO 2B4QA 3HNPA 1DIBA 1O8CA 1E3EA 1ENOA 3E5MA 1SOWA 2EG9A 3LT4A 3R0IA 1VL8A 4XD2A 4LCJA 2I3AA 2WD7A 2RIRA 3PEFA 1DXYA 3DBLB 3TDKA 1VRWA 3BHMA 1B3RA 1H2BA 1Q0LA 4U0KA 2IYPA 2O48X 3DOOA 4DLLA 4U8GA 3F47A 5LDHA 2AMFA 1NQAO 2VHXA 1V8BA 4D42A 4W6ZA 5CPFA 2X0NA 4HV4A 2X5KO 4BO2A 3I4FA 2GPTA 4JLWA 5G4KB 2BFMA 2W8ZA 3KOUA 1DPGA 2OOSA 4PZDA 4MP3A 2EIHA 2JKVA 4PG4A 4UULA 5C3MA 1DIGA 1E7WA 1HETA 4LCEA 1E0DA 1NQTA 3AUAA 1IHYA 2B36A 2X5JO 1K2WA 3QHAA 2X9NA 4LVUA 3KETA 3ONEA 3B1JA 4UVDA 4D7AA 4RDHA 4YRAA 2DVMA 1YQXA 4KTVE 3X2EA 2VRCD 1N7HA 3DAGA 4BO6A 1HE2A 1R4NA 4FIZA 3H5RA 2EP5A 4B4UA 1ULUA 5FWNA 1FDWA 1FDTA 2EWMA 4PGFA 5JY1A 5JDIC 1Y1PA 1T2AA 5KOIA 1DDOA 3X2FA 3I9NA 1F17A 1SOVA 2ZQYA 1J0XO 4XIYA 3OFSA 1XA0A 3DZBA 4E21A 2C7VA 2FRDA 4W4TA 1O89A 4C7JA 4TMFA 2ZTVA 1NTOA 4JGBA 4P22A 1C1XB 2O4CA 2Z1MA 1UP7A 3GG2A 1WVGA 4FJ2A 4BNVA 1PIWA 1N9GA 3NTQA 5A05A 4FFOA 5TNXA 4RF5A 1DAPA 3OQBA 2O50A 1WMBA 4L8VA 3VDRA 4J1TA 2EERA 2J8ZA 4B79A 3AU8A 4O0LA 1HL3A 2WYUA 5I9MA 3JV7A 1K6IA 3C7AA 4Y98A 4RJTA 1TVEA 3UOGA 4AJHA 5DDIP 4KUGA 2HSDA 1P45A 4E2WA 4B7UA 4XEHA 1ZXLA 3AY7A 3TN7A 4L73A 1F06A 2UVDA 5MDHA 1LUAA 2JAPA 3NAQA 3JQEA 2POQX 4LVCA 1XEAA 3WGIA 4CV1A 3EVTA 4ROSA 3BMQA 2PGDA 5F5NA 4NBTA 2VRBA 3I3OA 4U6QA 1K0UA 2JD2A 4R68A 5L9AA 4CLDA 3E18A 3WIEA 4BO0A 1SBYA 1CWUA 5JC8A 3BMCA 4Y6PA 3H65A 2OP1A 2C0CA 3IQDB 4OGWA 4JBIA 4NQZA 2P4QA 4FQ8A 1EK6A 1OFGA 2IRWA 4PLVA 3WYEA 3CUKA 2X1HA 3C7CB 1HDXA 3PHGA 4L75A 3VH2A 1B2LA 4ZQBA 1UXGA 3BMCB 1H94A 1E1MA 1GQYA 2DAPA 2OORA 2NU6A 3RI3A 3K2EA 5F3RA 4KOAA 1P33A 1Z82A 5H82A 1X0VA 4Q3CA 1MV8A 5BNTA 3DL2A 3GZNB 1X1EA 1HSOA 1MG5A 1SO8A 2BFAA 4J3FA 4O6VA 1N92A 1A7AA 5TT0A 1KVRA 1YH3A 1NPTO 4UREA 2ILTA 4B4OA 3IKVA 2HLPA 1V35A 3WSWA 2O7QA 2GN6A 3VZQA 4CM4B 3DMTA 1WAMA 5CDYA 3DBHA 1E5QA 4QX6A 1N7GA 3E48A 1YL7A 4JJFA 1T26A 5JDCC 4BNMA 1BDMA 1HDYA 5AVOA 3O9ZA 2E4AA 2HMTA 1U28A 2C54A 3CINA 1QP8A 2O3QA 5C37A 1UDBA 2JD0A 3K2BA 5AXBA 4WNCA 4NK5A 1LNQA 4M55A 3ZH2A 3HWRA 4JP2A 4RVHA 3AOEA 3BTOA 1A71A 3V1YA 3HUDA 2P5YA 4CLOA 3QE3A 5JMPA 3OIDA 5CDGA 4NFSA 1Y6JA 9LDTA 1SEPA 3GZ4A 2B83A 1HDZA 3L9XA 2DPGA 1TXGA 2E6UX 3K92A 2C59A 3ZW9A 4BNNA 1DC3A 1GDHA 3KYCA 3PFFA 4AFNA 4WK6A 1P31A 1WZEA 4B7XA 2FR8A 3Q9NA 2ZK7A 3HB5X 2NSDA 1EBFA 2YUTA 3CMCO 3EY4A 1N5DA 1SB8A 1BG6A 3ONFA 3FNEA 3OM9A 3ST7A 4IDBA 1HDOA 3ZWBA 2EEZA 1TLTA 2Y93A 1E7YA 2FPIA 4DVJA 1VL6A 1PL6A 3JYQA 4BNGA 4J4BA 3WQRA 2X4GA 1ADFA 3GEDA 4Q3NA 1MX3A 3FBGA 1H6DA 4K9DA 4UUMA 3T4XA 3JQBC 1ZUD1 3L6EA 4B3JA 4NHEA 1CYDA 2HKIA 3H9UA 5HTOA 1YDWA 3LLVA 5F1PA 1WLYA 3DHEA 2QRKA 3VKVA 3DHNA 2OBNA 4GX0A 4XKJA 2O2SA 1PEDA 3ABIA 1HEUA 4IJUA 1GFSA 5A04A 4RPKA 3HDJA 4WEOA 1P1RA 1Y9AA 5HBRA 5CPBA 1TT5B 1Q2XA 5BSHA 1RYEA 1DLJA 1JQBA 3TL2A 4NFHA 5C7LO 4OO3A 1ZK4A 4RORA 2UUPA 4O1MA 3RKUA 2PZLA 4ND5A 4GL4A 1NX6A 5C7IO 1LU9A 2Q2VA 1RM4A 2X5OA 5KVCA 2DBZA 3LK7A 4GWKA 4WNIA 3RUEA 1E3JA 4CMIB 4XX0A 1CDOA 2Q45A 5L4SA 2WJPA 3WTCA 3WLEA 3D7LA 4FGWA 2JJYA 3VOSA 4UVHA 4CUZA 1ZXBA 2A94A 2Z95A 3JCZA 2Q2WA 1Z7EA 3RBXA 5THQA 4KUEA 4G81A 5JAMA 3DAFA 1QYXA 2JL1A 3IP3A 5HS6A 2W98A 2CVOA 2GN8A 2FWMX 2PTGA 4ZA2A 3R3JA 4RZHA 4L0QA 3C1AA 1UH5A 3GVIA 2GR9A 1QRRA 4GX1A 5EQFA 2XAAA 4D45A 3C3XA 4OH1A 4KQWA 4CV3A 3JQ7A 3ITKA 2ZB7A 4P38A 1CJCA 4WCFC 4UUPA 2V7PA 4E33A 1KVQA 1B14A 1TEHA 1BXKA 4Z0TA 3WS7A 1C0LA 3LC1O 3H4VA 4EITA 3T7EA 1XU7A 4WJZA 1A27A 4FC7A 4IIUA 2D5CA 4J0EA 3BMNA 1R16A 4YQYA 1GL3A 1E92A 1CERA 2AE2A 3BMNB 2X0RA 5FI5A 5T5QA 2VT2A 1HYGA 3HDHA 3ZHZA 1QORA 4AG3A 3PHHA 4XQGA 3U9LA 4RPJA 4B4VA 2EKQA 4AJLA 1KEUA 3KSUA 2EW2A 2VOEA 3OF2A 1EVIA 2O2YA 1LLQA 1NFRA 3TZHA 3TF5A 4D3DA 2DTDA 2RHCA 4LMPA 4MVJE 3TOXA 1FJHA 4HFNA 4Z0PA 2ZTUA 4EJ6A 3Q3CA 3ZN2A 3CZMA 3SC6A 3Q0EA 2QHXA 4Q3EA 1PS9A 2PGJA 1Z75A 1C0IA 2ZJ1A 3FSRA 5BQFA 2EW8A 5KVVA 2NVWA 1OZAA 2VHWA 2X9VA 5G2OA 3UCFA 2PGLA 2EJWA 4QFCA 4E4YA 3PFWO 4MINA 4HXYA 3F4BA 1JKFA 5IN4A 3N74A 5EESA 5A3VA 1Q7BA 4KMSA 3PJDA 4PLCA 1ENPA 3C1OA 3SJUA 1DFHA 3PYLA 3GHHA 1HLDA 3NKLA 1YE3A 3PXXA 4LMRA 5ILGA 3VPFA 4FN4A 2EJVA 1EFLA 1GUZA 1GY8A 3EK2A 1EDOA 3NJ8A 1LDEA 1KIFA 3AK4A 2DFVA 4NR0A 4BNXA 4CMAA 3PVZA 2RHRA 3QVWA 5F21A 3GT0A 4PZCA 3S55A 3KRTA 4QFDA 4BB6A 1G1AA 3GVHA 3VZRA 2A35A 3MJSA 4MIYA 5LCXA 2CDAA 1BWSA 2VWQA 2BF7A 2B0JA 3ZV3A 2NNLD 4HUJA 4DC0A 4CPDA 3GMSA 3V2GA 5A5EA 1GYPA 2HMUA 1KC3A 3U4DA 1T1RA 1DLIA 3OECA 3I6QA 4Y6SA 3DONA 4IUYA 3PK0A 1WNTA 4EUHA 3BXXA 4IDAA 1U3TA 4EEXA 4W9NA 3STHA 5FF9A 1ZW1A 2CY0A 3OA2A 3P7MA 4BO9A 5TX7A 2GO1A 4BO3A 3ITDA 5L40A 2V65A 3QLJA 2J5KA 1W8DA 2DTXA 2VQ3A 5HWSA 1NWHA 3PI7A 3GAFA 4CR6A 4NH4A 4TRNA 1O5IA 1VJ1A 1RYDA 1W0CA 3LC7O 1UZMA 2P2SA 1WPQA 3PZRA 1GQ2A 1Y8RA 3ZZNA 3B70A 1AN9A 2CNBA 4MDHA 1B15A 1ZK1A 2BFPA 3PYXA 3KUXA 5DOZA 3RWBA 3PYMA 4OOEA 2Q3EA 1LJ8A 1GEGA 5KJ1A 1UDAA 3CKYA 4NJOA 4CM6A 4EI2A 1IYZA 4K6CA 3RUDA 4J2OA 1PJQA 1QKIA 4RLHA 5B12A 1BW9B 2P9GA 1ISFA 3ENNA 3WNQA 4XYMA 4R9RA 3ZV5A 3ZI0A 4CUKA 5DP1A 1E7RA 3JD3A 4W7IA 5JLAA 3Q9UA 2Q49A 1HLPA 5U4QA 1GV1A 2Y99A 3LU1A 4UEOA 2HJRA 3IS3A 4TKMA 3UFXA 2I6TA 4ZN6A 4TRJA 3MTJA 4RVDA 1E5LA 1KY5A 1CRWG 3GA0A 2YDYA 4YT5A 3DB2A 4YR9A 3F1LA 4OJNA 4OKIA 2VNSA 1ARZA 3W4KA 5CEFA 1JWAB 1U5AA 2WWRA 4CMEA 5DP2A 3DBRA
chains in the Genus database with same CATH superfamily
3ANTA 5HE8A 1IHOA 2GUWA 1JR2A 2I7TA 2HLDA 2HCTA 2V8BA 2XZDA 2JLWA 1L4HA 1XN4A 3R6LA 2IS4A 5B1SA 3JVIA 4ABYA 3HSKA 2F3UA 4IIJA 3RYTC 3R75A 2UAGA 1VXOA 2PZBA 1LSOA 1N2CE 3D3WB 3QW4B 4XX1A 1JS1X 4CFYA 2XE7A 3A10A 1CQJA 4G09A 1YUBA 1X94A 2RMKA 3H5VA 2GQ0A 1G9XA 1FF9A 1NBAA 3CLUC 1C9JA 1KJNA 5EZQA 1JHRA 1SKMA 2YJNA 4I19A 1JIQA 1BGVA 3RU2A 3OE4A 3T7TA 1QQBA 3HZHA 2Y68A 4MS3B 3E7FA 5D3KA 2PBZA 1UL1X 1DQRA 1W94A 2RJOA 2Y67A 4KZPA 4L0DA 5CT9A 4Q9HA 5ES3A 4TZTA 5JSZA 1E69A 4HH1A 2WHEA 1RLJA 3EG9B 4EX7A 2CVZA 1E7MA 2XJ4A 3K70C 1DAOA 1E18A 1AE1A 1MFPA 1SD2A 3O0TA 1KAQA 5IMBA 1YA6A 4H3VA 4O2RA 1S8OA 3EZYA 3LY5A 4G23A 4ZVPA 4ZQFA 4WV3A 3TKAA 5CFLA 4EABA 3AZPA 4PLWA 5EHIA 2V03A 1W5BA 3G2PA 3ITNA 4CV2A 1F2TA 2C3OA 5AKIA 2VT3A 4PRYA 5TMBA 3B89A 4UUQA 5SYAA 4YT2A 4LTMA 4NABA 4O5AA 2EBWA 2C0PA 3AG6A 5JTUA 3P2MA 3SSMA 3VU0A 4IXTA 5K2OA 3RO7A 1PS0A 3MFYA 1YJBA 3WKAA 3GPIA 5BR8B 2CXOA 1E77A 1EFDN 3C5WP 3HDTA 2QRUA 1WW2A 2VZEA 4YAEA 1JQJC 5DO9A 3HR8A 1KY2A 5DULA 1EE1A 4NOKA 3SDSA 4MJXA 5C8YF 1V8OA 1A3CA 1I4TD 4GZMA 4A6DA 1VM6A 2H65A 5AW1A 2V45A 3I3SR 3JQGA 3M1LA 1E2KA 1DO0A 3M6FA 4G1UC 1KEKA 4IWYA 2HBRA 4RZIA 3TQOA 4Q21A 4HWSA 3FE2A 5K9ZA 3WLQA 1UQUA 3PGXA 1Z5NA 2JPDA 1L7OA 4LXQA 5KQLA 3G1WA 1KDPA 2LP4Y 1QIFA 3PRHA 2Y27A 4Q1DA 2DHEA 1D5WA 3GAMA 3OQHA 5LA6A 5AJXA 5AKXA 1B73A 4M9QA 4W5OA 5CB6A 2VLBA 3CZ9A 1VJGA 4OQQA 4OX9Y 3C3CA 3TLKA 1FPMA 3NR2A 1EB8A 4OGLA 4OP1A 3ZS8A 3WI7A 5MFPA 1TYZA 2IYTA 2X6TA 4L4XA 1TX4B 2RAFA 1AMNA 1N7IA 1X80A 1P4HA 3QWBA 4RGBA 5BR7A 3W8NA 3ZOZA 2W8BB 1DHTA 2IZ6A 4CE6A 3NC0C 5I3CA 2JLZA 3DO5A 1UR5A 4KP7A 2FUEA 2VCYA 3PNSA 4IIVA 5KPJA 4KW7A 2WK1A 5FORA 1GPNA 2QY6A 5AW6A 2GFQA 2NQTA 2QUHA 2X8JB 1KI3A 1YONA 2G88A 3JTEA 3W7BA 4AJPA 4CQNA 3VDQA 5MGBA 5L7WA 1GAQA 3G7UA 3V4SA 5IFLA 4RY2A 3BKWA 1P7WA 5FNVF 2FCAA 1D09A 2EGGA 5BW6B 1VRVA 1X86B 3W7VA 4YUXA 4UM8B 2AZMA 1FYVA 3AJAA 4Z9FA 1GNPA 3G49A 5FBWB 3UM9A 3WRXC 4BFZA 5LB2A 4I1IA 2OO7A 4ESHA 4BWYA 3U4QB 4B3RB 4P7BA 1E5TA 5JFTA 2DLCX 1XVAA 3E9MA 4Z4GA 4A2CA 5HX7A 1LTHR 3BRSA 1XZKA 1BXGB 1XLTA 3CLSC 4O8CA 4TYMA 1FP6A 4YT8A 5IU6A 5JE8A 2A5DA 4GZ5A 1B6SA 1AKQA 5BW4A 5LKAA 5TB5A 2KSQA 1UK9A 2F1KA 4PVCA 1XNHA 4DS3A 1W2GA 2QW8A 1LC0A 2WE8A 1V3UA 1CJTC 5H83A 5TEVA 1PNQA 4EG7A 4CIDA 1H66A 4Z6KA 2R84A 16PKA 1ONOA 1U7WA 3JZAA 1P0CA 3QZUA 5IZCC 2FKNA 3PRJA 2QAJA 2WNHA 3QEMB 4INOA 4O59O 4Z0HO 2GM9A 4CQMA 2PBLA 3P32A 1SUPA 3DOUA 4X54A 2VDRB 4QSHA 5EJFA 4BVJA 4E32A 3V33A 1EWTA 3KCQA 1V1RA 4CLOB 3IAHA 3PQFA 3VNSA 4ZMBA 5BP7A 4BATA 1NMSA 4ZI7B 5EJ8A 3S8YA 1V71A 3M1YA 3RSHA 4BLPA 2YIVX 2CGEA 3JWGA 4MWCA 4X3CA 4WY5A 2VYND 4AX4A 2V9CA 4WBNF 5A5GA 4NDNE 2BFEB 3ZW7A 1BXRA 2Q5JA 1JEDA 1QR6A 2Y1OA 1M1NA 1BNCA 5AVQA 1WSDA 5KX5F 4TLEA 2CUKA 3FVVA 1TUGA 3CVYA 4GGPA 3PHCA 1DCMA 2CMFA 1I2BA 4HDOB 1K3TA 4MQUA 5ARBA 1SBQA 5EWMA 2OV6A 2QMUA 4LOJA 5HYVA 4FGLA 5ERGB 1YMUA 1FOEB 1D8TA 2ISCA 3EQ7A 1S8AA 3KR9A 3PNPA 4E94A 2A86A 3K9NA 4QXAA 1ECPA 1DKPA 3JQ8B 3KU1A 1GPBA 4WKBA 3MCZA 1GZ5A 3PX2A 5F2OA 5C53B 1SCUA 1IUPA 3JAWB 4HDMA 3FDFA 5CCDA 5D7BA 2ZIZA 2ZGVA 4C3UA 4YV7A 3L05A 4NCBA 3G3EA 5JQGF 1WKBA 2C8VA 4YGXB 3ZU6A 4JEIA 3R4VA 5E4YA 1QDUA 2ZVQX 1JB1A 2QI9C 1BH6A 2OMEA 4LWPA 2O8NA 4MMZB 3IULA 4BX9A 4UUBA 5BQXA 1P0QA 2DQYA 4BLQA 1MP0A 4B0OA 5DT2A 1FUUA 4IUBS 4KAFA 3VGPA 5B30A 1RJEA 4LC0A 1XI2A 4QXQA 1NFFA 5CJJA 3S70A 1E1YA 1X7YB 3M6IA 3TVDA 1I6KA 1PFUA 3I9KA 3K4HA 2DC1A 5DN6A 4WECA 3OT1B 3MLAA 4ARZA 1PNOA 3UCEA 1ECLA 2FK7A 1C7EA 3IP8A 1WPRA 4AYXA 3W9UA 5JH7B 4RENA 5FUVA 4HP8A 2ZRBA 5JCJA 5ICSA 3BDAA 2YW2A 3DJFA 3FX2A 1NOIA 3NBZC 4PZUA 4UHCA 3WLFA 2H57A 5L4LA 4MQFB 1T36A 2GEKA 1RAIA 4LKOA 1NAHA 3OE7D 2BEVB 2Z2YA 4HMOA 4RZXA 4WFIA 4YI3A 2OZPA 2XVXA 4XQ0A 3U80A 2IS1A 3H8SA 1OH8A 5I5EA 2WAMA 2GZ3A 1WB9A 3PQ5A 1UJCA 3KXKA 5LJLA 1Z28A 1D1SA 1Z22A 2WSYB 1MEOA 3AUXA 3F5FA 3L4BA 4G5RA 5KDDA 1JAIA 1P1IA 2EX4A 2JI6A 2TMDA 2AV6A 3ZE8A 3SOPA 1XQ9A 1MC1A 3DZDA 4MB6A 2WZCA 3PX3A 4MEBA 4RZUA 1CQWA 4LDRA 3TQCA 3TPCA 4B6FA 2R1VA 4EA6A 1QP4A 3V8NA 4QBKA 1UZLA 2HA5A 2VJAA 3A1SA 3M5CA 3NAMA 4XE5A 5KI6A 3WYFA 3NHLA 1Y8CA 3K96A 3TTVA 4LZAA 5KPDA 4GSKA 1OZFA 1SU6A 2H7VA 4WKCA 3ZNQA 3PZBA 4R1PA 3FMIA 1KSFX 1E62A 4EDHA 5ADUS 2FW7A 4GDMA 4JXKA 3AH8A 2WWTA 1DDGA 2BELA 4A8JC 2X42A 3AP2A 2WUFA 4DARA 3AI1A 3ZHBA 1R74A 2P9JA 1ZL2A 4WX2B 3ZHYA 1Q0PA 4JS0A 3U5TA 1QDEA 3CPSA 2GA8A 3EQ9A 2DY0A 1TT5A 2QLMA 4C0QC 1NVAA 1KI9A 1WF6A 1QHHA 3FRIA 3TW8B 4FYWA 3VTZA 5CDHA 1FYFA 2XYQA 5H16A 4MQ6A 5CJ2A 1ID1A 4BRZA 1BA3A 4K46A 2QW1A 4CLXA 2W7TA 3SQOA 3VTKA 3KPUA 5C18A 2O8DB 4ECAA 1X7WA 1LI5A 1QYRA 1Q0QA 2Q6IA 1PL8A 1T2DA 1FNNA 1KMCA 3FI0A 4MPDA 4QU9A 1GQRA 1SU7A 3CLHA 4Q00A 2AFVA 3SY8A 4BO4A 4DR6B 3NJ4A 5FD8A 4L4UA 1G4UR 3O4FA 1P9OA 4M1SA 1C3XA 1OT3A 5H9VA 3EASA 1O97D 1EXMA 3W2HA 5DN9A 4MHOA 3GR6A 5AW7A 1IK4A 4QRDA 4ARAA 2ORVA 4DLUA 3IGFA 4WK2B 5AW4A 5EMHA 1FTQA 5JXHA 2OE2A 2MR6A 3F4LA 3WB1A 1RM5A 4MI6A 4ZPXA 3NTRA 3NATA 1KVSA 4IJSA 3OX1A 1Z0KA 3SZOA 4M1QA 4B3DA 3ECSA 1VHDA 3K30A 3BFVA 3EZGA 3BIOA 1ONNA 1N9ZA 4BNZA 2FF7A 2FPIB 4IF4A 1RT9A 3KDSE 1XZIA 1NVVQ 3RQSA 4F86A 4N6NA 5AXCA 1ESNA 2ETVA 3RUCA 1P81A 2BR3A 1M2GA 3HJAA 3OCVA 1IM5A 2AWOA 4GPBA 1AQYA 3WFJA 4ENVA 4ZEVA 3OFVA 1U63A 2WD7B 1UJ5A 5E1OA 4MJLA 4DWJA 1K4YA 3DV2A 2HMWA 4H6VA 2X23A 4QGGA 5E7JA 1IUKA 1LX7A 2W6JD 3D8NA 3I64A 1QIEA 1Q0TA 4DTIA 1G98A 3WWPA 2EGUA 2ENWA 4MXDA 3THYB 2BH2A 3G2OA 3EW7A 4BJ5A 5LP6A 1N5MA 4PRLA 2EKPA 3LHSA 3FTPA 3INRA 1RAGA 5HF8A 4E5DA 2JKYA 4FWIB 3H83A 4FDLA 4FP9A 5IDVA 3HB9A 2IXGA 4LZWA 3VOAA 1H4VB 4GPIB 1PJTA 1JYSA 4DREA 4RC9A 5HCUA 2HQRA 4C06A 3PUZA 3WL8A 4AMZA 3AVPA 4NPCA 2IPLA 2VPIA 1FMTA 4OBBA 5JANA 2PD6A 5J3JA 1EWRA 3ECCA 3LA6A 4QG7A 1RCUA 1UJ2A 4LDNA 3DEAA 4L85A 4C5CA 4DCPA 1PO7A 1Z2EA 1RZRA 3PXBA 4LSWA 2OEPA 5CVEA 5TQ2A 2KB0A 1J6UA 1V48A 4IZHA 4M0LA 1MKYA 3WG9A 1J39A 3WOHA 2YVKA 1UXHA 4QOFA 1U2PA 5FWYA 3OCYA 3GRZA 2I76A 2IPOA 1FXSA 1R00A 4JK3A 3DDZX 1U0NA 1P0PA 1VPLA 2CCGA 1M8FA 3A27A 4AN1A 1UEJA 2W4QA 3DDCA 1EUCA 2Q41A 1G4HA 3WLMA 2ZSBA 3ZWNA 4Z7NB 1XYGA 2NYUA 2J6CA 3P0FA 3GLGE 4UCWA 4JLJA 2G76A 1YIOA 1BDHA 4R1SA 5AK4A 2GRUA 1DWUA 1YFLA 1H5NA 3H75A 4ZU1X 4JUIA 4WVFA 2K7FA 5I7HA 421PA 4OYYA 4F8YA 5A0VA 3LXRA 2GN1A 1QHEA 3ON5A 4MV7A 3JXEA 4OCZA 5TF0A 3DHYA 1J8FA 2DSTA 3IQGX 3MGBA 3OIUA 2PA3A 3P9RA 2Z5LA 1YZGA 3SFVA 3UKDA 4MS4B 4TKVB 3S8MA 3WYNA 4AJ2A 1QRAA 2WU4A 3FGOA 5EL0A 5ITWA 4YJ2A 3SMQA 1SC9A 1PYGA 2PLAA 4H4CA 1C7QA 1YZTA 2EBHX 2H92A 1SVOA 4GRDA 5KJFA 1CY1A 3Q1LA 2ZTMA 1RPJA 1Z15A 3P4YA 3PXDA 5D3QA 1QG6A 5C1PA 1NDHA 3DWIA 1IEVA 4YT4A 2FFHA 5DFAA 1FVXA 4CF3A 5F51A 3E1KA 4U7FA 1ZRSA 1MG0A 1ZNXA 2OHVA 4AMYA 4B46A 3OU7A 2JFNA 1AGPA 1V6SA 2BEVA 4C04A 4CM3A 2JNWA 3CE9A 3E3AA 3E5RA 1W0KA 4RCVA 5AFSA 1RIIA 1HE3A 3E2IA 2Y66A 5LWHA 4MCIA 4O33A 2YNMC 7ADHA 1TM2A 3PQ7A 2NUAA 2R9VA 4E6EA 1ZI9A 1VZ3A 2IQ5A 3GD5A 4QA9A 4QWWA 1AQUA 4ON9A 1NJSA 1DINA 1EA5A 2C9ZA 2D1QA 4FHEA 4M9CA 3RVNA 4H0CA 4HYEA 3NBUA 4AS1A 4IEFB 4EKIA 4EELA 3QLUC 5IK2A 2A3NA 2OPBA 3VH3A 4LYDA 5DMHA 1FFEA 1H0HA 4EJSA 3PPWA 1TDJA 2FP4A 1TZ2A 3N75A 5K05A 5BMOA 2R3SA 8AT1A 2BKVA 4ALNA 1PL7A 3E6AA 4RABA 1KBZA 2XTNA 2ZUUA 5LYJF 1JE1A 3CR8A 4URUR 4KC0A 3U40A 3ZCSA 3GEMA 4HT3B 3RANA 4IYJA 4BKPA 5IH7A 4US2R 1GJRA 1OI7A 2B4RO 2HA2A 2BTQA 2IJGX 3BB1A 4PG5A 4E22A 3AB3A 1NQ5A 1GA6A 3GYGA 1CD5A 1E2NA 2C3MA 4LXUA 2ZXEA 4MWTA 2OQRA 3SCZA 3B6IA 3CLKA 2A0XA 4XWYA 1RWXA 1U0OC 1IK6A 1CIJA 2WWHA 1NI5A 3ORQA 1P2DA 4L74A 1NMQA 3NP7A 1LS1A 4OBWA 4ZJPA 3IILA 4PLHA 4I9HA 4PFJA 4WD3A 2FSPA 2PVCA 2UZ3A 3TVTA 1HDEA 1QV6A 3CF4G 3VR2D 4F46A 2J0UA 3K1TA 1DGQA 1A82A 1XROA 1M0TA 3D1VA 2VHZA 5KYYA 1LDNA 2BWJA 1C3LA 1ULSA 1XWFA 2XCIA 4RPHA 2BGRA 2A6PA 4HB3A 4O5OA 3HI6A 1QG4A 4Q3DA 1XF1A 2IYFA 3S4YA 3MRTA 3GDWA 4HAVA 2HLDD 3VRHA 1DAGA 4QBHA 3E8SA 1I3MA 2PRSA 1M0SA 1QYDA 1UBSB 4M37A 2VG8A 5D85A 4K9LA 1ZP6A 1QR2A 2E4VA 3BILA 1X3SA 2CCJA 2KJQA 3CEJA 4Y2RA 2VNJA 4TN5A 4HAIA 3ZE2B 4TYYA 1ZSNA 1MO4A 1NE7A 4INAA 1Q1ZA 2Q5FA 4JLMA 1PNVA 1JV2B 2CD9A 1HT3A 1YVPA 1EFPA 2Y05A 5GP1A 3OZTA 3HJTA 3I8SA 4KDFA 5BUQA 2FP3A 1W0KD 4LY6A 2GKOA 1BN6A 1B8PA 1DQSA 1RHUA 4OREX 5LLSA 1OWLA 3DKVA 3ETLA 4DCOA 3U7HB 3NAZA 4OGGA 4TWIA 2GK3A 3KKZA 3RC2A 2F4NA 1QJCA 1KI8A 5ELMA 4XDYA 1UKCA 1G66A 1U28C 3TNYA 1E2HA 5JDIA 3AFHA 2BE7A 3KHUA 5IM5A 2OZKA 3IVMA 1QQAA 1II0A 4A91A 3CLVA 4MV4A 4YRNA 4JBNA 1I94B 3G2LA 1M2WA 1VL1A 3AHHA 4RDIA 3VSAA 3QF7A 1A95A 5ALLA 2QD3A 2QG4A 3BSSA 1XZQA 1KFEB 3S2IA 1HDIA 3HEBA 4E5PA 4V24A 4M0FA 3MB8A 3CIFA 2CDBA 1VL0A 4ND2A 1E79A 3QYPA 3WKCA 1AMUA 1C9YA 1RYMA 3G7NA 3W8FA 2ZB2A 3EXEA 5JEDA 4KXUA 3SHOA 3IX7A 4NIMA 3CZRA 3X1DA 5CTAA 1E3LA 1SQSA 3MOGA 5JS6A 1RE0A 5K8JB 3GAAA 3TB4A 5DT9A 3A6GA 1IXKA 1Q15A 4CLHA 3SR0A 3PQ6A 2GPSA 4MUMA 3PDIA 3OE1A 4FR5A 1U94A 4HSGA 2HC9A 4PCLA 3DOCA 2RCYA 3K2IA 1Q57A 3QFTA 4KE8A 1O6FA 1R15A 3FFAA 4OLHA 4TT8A 3PJEA 3LPLA 2PMWB 4IX9A 1XNQB 2GF9A 2JFOA 4MLCA 2ONZA 4DIEA 2XUHA 1ATZA 2XYGA 4F7WA 1JA9A 2JA1A 5EA2A 4ZU3A 3A36A 1XA4A 1GEEA 1EBUA 2NTNA 3B9QA 3THOA 1YB5A 4EUSA 3PGLA 4RHCA 3ENZA 1K5DA 2ZTLA 1F3LA 1FRFS 1V4BA 2O2IA 2WB4A 3OICA 1US8A 3TG2A 1VIMA 5HFAA 1Q1AA 4QARA 3DCYA 1TTQB 1T9ZA 2ADMA 3FCYA 3LPMA 2AGVA 4PLFA 5DHUA 1L7NA 5DGDA 4HX5A 4D80A 4BP3A 1YQEA 4EG1A 3GNQA 3E5HA 2Q3FA 1Q3KA 3CXUA 5A5VA 1BE0A 2Q5QA 4LX0A 3LLUA 4IICA 4DCJA 5EPOA 5EWJB 2A1UA 1LPMA 1UMBA 1UT5A 1UDWA 3FWPA 1GKLA 5I7EA 1DEXA 4M87A 4B35A 3KJNA 1Y7PA 4UVGA 2ZUVA 3IVXA 2AJDA 1NKSA 2D59A 3WHIA 3QE0A 3BSWA 2VYVD 2HGSA 1JSRA 5EJAA 3A9VA 1YBFA 4G1EB 5EC8A 2H54A 4FEAA 5C3UA 1MBZA 3K5PA 3N70A 5DPMA 3W78A 4QEKA 1MF7A 3OPYI 4RA9B 1T4CA 4FDUA 5ENVA 5T57A 1GSHA 2CEAA 3S5JA 1LJUA 5HUJA 4KHPB 4ARVA 4FX5A 5KU7A 5HGJA 5BQ5A 1BVHA 2Y6UA 5THXA 3HJFA 1U8ZA 3NFRA 4H31A 3L92A 2DH5A 3LDHA 4FLEA 4HLDA 3EVFA 2W6QA 4MRMB 4NZMA 5HF6A 2JIOA 5LMCA 3ZZTA 1MX9A 2GZHA 4ZC8A 2D5LA 2GN2A 4HWPA 2C82A 2PZFA 5JO9A 2F4VB 1PR6A 1J5PA 3DE5X 3DMYA 2OBMA 3WBFA 4YO7A 1N6KA 4ZT7A 5I9BA 1MFZA 3ZDCA 2F8LA 3U7GA 4P3KA 1P74A 3ZV7A 4AKSA 3DE1X 5FBRB 3SF0A 1KK1A 4N3NA 2JCVA 1SC3A 1KOFA 3AP3A 3FHJA 2IFTA 3EF3A 3IVRA 2CZQA 1J8VA 5B3JA 3L7OA 5ALMA 4ISCA 1UPTA 2OHOA 4MVJD 4PTLA 2HDOA 2UZ1B 4U0JA 4BNWA 1G60A 4JLUA 5K3CA 821PA 2NZXA 4DIKA 1Y42X 3M82A 3LP6A 1VXRA 4FC6A 4LZLA 3MMSA 1TQHA 2QS9A 3TMAA 4G37A 3KVVA 1CE8B 4LK3A 5A3SA 4RO0A 5K0GA 4DIFA 4IGEA 2PXCA 3OT4A 1YS7A 1YGPA 3BMQB 4RM2A 4WJLA 1X8LA 4RW0A 1KO8A 2YCBA 2FWPA 1UWLA 3M6LA 1F2UB 1NYTA 1JNYA 1YQ9A 2EIXA 3I5XA 1TRKA 3N8GA 1W73A 1VBKA 3FLEA 4TX1A 4WW0A 5DYTA 4BRSA 4JXZA 1M9NA 1YFKA 2OGTA 5ALHA 4W8OA 3WLKX 4D3XA 4ZEXA 1SQGA 1TO6A 5A02A 5ABPA 1P5RA 2HRCA 4I8IA 4C30A 3ZLBA 3JAMA 2C3PA 2H5LA 3ZJVA 3DMRA 1J49A 3FWZA 4YCAA 5AH0A 5C8DA 2W6IA 3P2IA 3E1GA 3VR5D 1IBCA 1KJZA 4NF2A 3MB5A 3RC9A 1W76A 4XUGB 4NP6A 1UPAA 4MX8A 2MJLA 1LVGA 2LUOA 4OXQA 3X2SA 2MT9A 3UJ6A 1BMQA 4PIVA 4YJFA 4DQDA 3TBKA 4JBHA 4Q1EA 4JL6A 2CFIA 1KEVA 1GUYA 2ICAA 2MSWA 1NN1A 2AJTA 4NBSA 3T7JA 3ZU3A 1G38A 3V6LA 2HF7A 4NMXB 1CJSA 1S2IA 5FTKA 4X66B 3QEJA 4QYIA 4Z54A 2P6OA 4PE5B 3CUYA 4ZV4A 5C35A 3LBHA 4C22A 3OJOA 1Z0JA 4PX2A 1CUXA 1NMEA 2H7CA 1XALA 3EZXA 3K0AB 4YAWA 1I4LD 4KU4A 3LQ2A 1M7BA 4UU0A 4CKZA 3A7DA 2C1EA 2QA5A 3DQPA 4DSUA 1H2XA 2PQMA 3U9SA 4C03A 3U0BA 1E98A 5E3JA 3KFXA 5LBTA 4DIUA 2C9BA 3L7YA 4JHXA 4DUZB 1I1NA 4YMIA 1H3EA 1C50A 2JLRA 1IJFA 5HZMA 1LDYA 1QAOA 2EFCB 1PD1A 3OE5A 1Y5LA 2VTDA 3GOHA 1ECGA 2ZRJA 1ISIA 2CJYA 2ORIA 2WHXA 4GBJA 2WAAA 2NZJA 5CB4F 3DVLA 2HIGA 3D4OA 4K8RB 4EYKA 1NFQA 4ARIA 2RH8A 1PR2A 4YP6A 2BHLA 5G3ZA 1D04A 1VMIA 4BCCA 1WSBA 1M7HA 2I2XB 4E5NA 2VK8A 1RWKA 2VDNB 2C2XA 3LBAA 3IAXA 1M1YA 3L18A 3LI2A 3GY0A 3NHAA 1W46A 3ZIAA 3AM4A 5ARCA 3JSXA 2Y1CA 2ZRFA 4Z99A 4LF8B 3BRWD 4DNOA 1Y9EA 2XDAA 3LYAA 2YYAA 5A6SA 5ICEA 3WGVA 1GGHA 3IO3A 3HY3A 4MYHA 4BFLA 1ZGCA 3OJLA 4PX3A 2OP0A 3N6VA 1H2HA 2JJ1D 2NU8A 1JIXA 1H2ZA 3WICA 1HG1A 3QYFA 1R27A 5EKUA 3I6MA 1CT9A 1I5RA 1OHHD 1OOEA 1T9DA 4G8JA 4TTSA 4BVLA 2PIAA 2VNIA 1YQUA 3IIKA 1Q3TA 1ZN7A 1MX5A 3FTCA 1KVTA 4LYEA 4RH0A 5EMJA 4UOZA 4ZD6A 4M6WA 2XOXA 4U6NA 3LPDA 1UJNA 4BAZA 3PKJA 1KJ8A 1JW9B 4IJ5A 4R1TA 1ZJWA 3TIXB 4DA9A 3NDJA 2Y9PB 2ZYRA 1SVKA 3WK7A 4MEJA 4XGNA 4YRCA 3F6BX 3L0OA 4MPRA 3VO2A 2XWBF 4KMMA 3VJMA 4GECA 3AF2A 2HSZA 3DKIA 1VLHA 2WJYA 4YROA 3ZQJA 1MA3A 3S2FA 1SXJB 4D9KA 5GJCA 2XMSA 5EJ5A 3WNDA 3PGVA 4PICA 3KBOA 4QBTA 1YHYA 2O6HA 5FA8A 4NMHA 2R4TA 1JSCA 1DAIA 1G8FA 3RGWS 3PHJA 4GX2A 4QVKA 1XQVA 3QKWA 1L1RA 4OP3A 2B4YA 4UU1A 1LPSA 4TXLA 4UTNA 2R6AA 2B35A 4NYIQ 2FQQA 5DM1A 4BO8A 1CULC 1UDXA 3EXG1 1OZHA 4GH5A 4FBMA 2VA9A 5AKHA 3U49A 4LE2A 4BKUA 1T25A 3NHZA 3OSUA 2WVGA 4OHOA 4Y2PA 3IBTA 4RVUA 4DR1B 1NXQA 4M8KA 2GEDA 4GGOA 2K2WA 3GZNA 2X7XA 3PR3A 2YJ6A 3E9CA 2JFQA 4OIFA 1KE1A 4ESOA 3WB0A 5B57C 3C6MA 1XAGA 2BUCA 1LI7A 2CNNA 3ZWQA 1VYVA 4GWLA 5M34A 4RY0A 4JA2A 5LQSA 1JDNA 3D43A 3PTAA 1G0OA 1YU9A 4BLWA 4MYTA 3IKMB 3DG9A 3ANXA 4ISBA 2VHEA 5BN3B 4CKBB 2NU6B 1JZQA 1V1MA 2OLKA 5K0FA 4LTNA 1JE0A 1ZDMA 3DZFA 1PJRA 3PDWA 4G41A 5FWYB 4I4LA 4Q34A 1BH2A 5ALKA 3ADCA 1CRZA 1T2FA 2NU8B 2VHCA 5SICE 2SICE 2YJTD 2I9KA 4JSYA 3G8BA 1R8QA 1O4VA 3DFIA 3UJHA 2A9PA 2QMEA 3K0HA 4ARSA 4AUEA 5FO0A 1L5QA 3DB1A 3UY4A 1WOYA 2FWRA 2P3SA 4WCDA 3N76A 3TSCA 5FQNA 4JJIA 2IDMA 3HA7A 1SAYA 1NIJA 4UHHA 5LMZA 2D7DA 4ER6A 1FA9A 2R8OA 4FCWA 2Z30A 5KSPA 2N0SA 1P9RA 1U7PA 4BQPA 1A2OA 3QFFA 2YASA 4RHEA 3CPEA 2WTUA 2II6A 4KL8S 4P7FA 5J2UB 1OX5A 3ZXYA 2WG2A 1E2FA 5JJLA 5K6AA 2Z2JA 4R2MA 1TMKA 7REQB 3LQRA 4J1JA 3IO5A 2REXB 2QAGC 5EI5A 1E9VA 3NANA 4JWKA 3EPPA 5ICMA 4ENPA 3P2KA 4HTAA 4O4HB 4BO5A 5G0VA 3VKWA 4BIMA 4Y9UA 4K6OA 5IXSA 4EMUA 4TVOA 1U3DA 1VSQA 2NSHA 4QJ4A 2EZ9A 4YVFA 5TRTA 1ZVQA 1WETA 1P2TA 5JAZA 2F7SA 5CEJA 1VGQA 4B33A 4BMYA 5GMOA 3UH0A 4EHDA 4U3JA 4IQ4A 5FTLA 1NUAA 1W4CA 3B6EA 1I2MA 1U9JA 4FR2A 1EUDB 2YIJA 2GYWA 2ZJ6A 3LECA 1QOZA 2NPFA 2Q1SA 1QC5A 3HADA 4ZYZA 2CYAA 5CVUA 3HJUA 4NZ9A 3OJFA 6GPBA 4KVFA 1AIPA 2XVAA 3H13A 3VDXA 3QQ5A 2JJQA 3A26A 1B8UA 4OQMA 4P4TA 3RUFA 1M74A 4A2PA 1EHIA 4BNHA 3VC3A 3ZE0B 1L8XA 3TSYA 2VTBB 2FB9A 1S3GA 1TGVA 5CA0F 3IOYA 1QZZA 3PQCA 2DFDA 3GEIA 5BQ3A 5TC4A 3AIKA 4I9UA 2W58A 5M3BA 2XADA 1X8XA 2FLKA 2VVTA 2FY8A 1T5BA 3GJZA 4RPLA 5SV2A 3HHPA 1TU0A 2PUFA 2GHIA 3ADBA 5EOVA 1N5IA 1X7WB 1CDZA 1O96B 1GT6A 1JXMA 2PT6A 3OFKA 2QM7A 3A3YA 3O8LA 5KX5A 1SZJG 4ZDIA 1EH5A 4L4YA 2BEUA 4K2AA 4IY1A 1V5GA 1EAMA 2F59A 1T0UA 3UYKA 4UHBA 2ZT8A 3O9VA 4FJ0A 3N2KA 1CZOA 2PNJA 1SMKA 4ENQA 3TRJA 4Y6QA 2FVXA 3JYOA 5C7YA 3LKDA 4ZI7A 1KGSA 1VA5A 3R24A 3FG9A 4PHFA 3JVDA 4XFDA 5A3JA 4L27A 2ARKA 2IZ7A 3CW9A 3PUJA 1P0IA 2FSVA 2MINB 3DXYA 2HPHA 4FS8A 4AU1A 2FSIA 2B20A 2Y1WA 3ITEA 1KO4A 2AFIE 3NTUA 3AESB 2ES4A 4B6PA 2ZR9A 5CG1A 2ODTX 4CL2A 3EISA 3NT2A 4KIFA 2ZIVB 4XYGA 3X1XA 1K88A 5AW8A 1V3VA 3C4QA 1NPYA 3KV3O 2RG7A 2PQ0A 1BSVA 1NVVR 4KJZA 5ALYA 1FFCA 4TQUS 1L7BA 3MRSA 3ZI7A 5JCJD 2FWAA 2J5QA 2P7HA 3SE0A 4EI7A 2QRJA 3FVRA 1H42A 9LDBA 4GU5A 1XKXA 1WDMA 5TF4A 2DWQA 3AVTA 3EMVA 2HW8A 1G21B 3G8DA 5B1YA 2PLRA 1USKA 2C88A 2VJMA 3LRTA 4HYQA 3JWEA 3H16A 1U7HA 2CFRA 3PNOA 1Y5IA 1NE2A 3DEZA 5JHHB 2PKXA 1HFKA 4YRZA 5EJ4A 3FY4A 4UD6A 3V1MA 3R6DA 5EMNA 1T3ZA 5DYGA 1C1YA 1RU3A 4DMRA 5DNVA 5DTRA 2P4EA 3WNZA 1QP7A 3V2HA 3WMXA 3HCEA 3LQYA 1V8DA 2OILA 3D1LA 2O6LA 4GO1A 5KYUA 5BMVB 1QE5A 3I5AA 2JARA 4YCJA 4GUAA 5IYZB 4P5DA 4EYGA 2ZSHA 1E32A 1ISJA 2O3TA 3P20A 5DHRA 1GYQA 2QZJA 4I4NA 4EECA 4EL0A 3K8ZA 4OI1A 5JBIA 4L02A 3KZ1E 4H7DA 4F1JA 5KSOA 1XCLA 2D00A 1PWXA 4B2LA 1P9NA 1GFIA 2HLHA 3MD9A 4DXDA 4KUHA 1M72A 1DBPA 3RS7A 2PFGA 3S68A 2AB0A 2CYBA 1EHYA 3C8ZA 3HJNA 3KWFA 4WXMA 2RK6A 2WLSA 1ZFNA 3F1KA 3OQVA 1PGOA 2OMKA 1A1SA 3QUSA 4FTWA 1J2JA 2B61A 2PWAA 1TB4A 2BHRA 4AS3A 5CXSA 4AUNA 1NBOA 2BBOA 4DQVA 5I3ZA 1QPZA 5KNCD 4MGKR 4MROA 5G0SA 2P0EA 3CVUA 3QPVA 2FWBA 1S2LA 3H0EA 5B53A 2XY4A 4FVTA 4E3ZA 1CUCA 1BFDA 1C9EA 2XDYA 2ZDGA 3EYWA 5AM1A 5ULLA 2SBTA 1NVEA 4HATA 5BSTA 3H9JA 5GWXA 3JQ8A 4B8WA 3DUFB 4HWGA 4OSOA 3UJ3X 5I7OA 1JLMA 2B30A 3ER9A 4F6CA 2NUAB 1D6SA 3W77A 4MUKA 1W1WA 2QUKA 3EXEB 1ENYA 5EN4A 3F97A 5ELXA 4L78A 4TWAA 2PT9A 4OF4A 2AR7A 2QV0A 4Y1RA 1T8UA 1ATIA 2GK6A 2G9QA 2IHUA 2HO4A 3P27A 4BX0A 2AOTB 5B6IA 4LTDA 2CWDA 4JR1A 3VHXA 4AZVA 1DT5A 5D1HA 2B1QA 3OEYA 2VDUE 2VSFA 5I9LA 2YVLA 3Q3IA 1TA0A 1BX1A 1SR8A 3S7ZA 4JGGA 5F7OA 5EJEA 1V25A 2XNCA 2QZSA 1T5LA 1YI1A 3FWKA 1WOMA 3TTYA 4OQPA 1E6WA 1LX6A 2V9PA 4L16A 3VHLB 3MHTA 2N46A 1YR2A 2O2DA 2UZAA 2WYIA 3N87A 5LDDC 1N2JA 2B2CA 3LKBA 4NZZA 2QTLA 3H2YA 3LBIA 1E1RD 4LOLA 4DJTA 1A2BA 2PU5A 4YRDA 1QM5A 3ICEA 4PR3A 1NN3A 3F5SA 4PZLA 4RAOA 1S89A 3HVKA 5F77A 3VVBA 2XMZA 5AVWA 1O9BA 1SUEA 2PMDA 3L5KA 5KSWB 4S05A 1X7DA 5EVCA 2UYQA 4GWGA 3GWZA 1L5VA 4N8SA 2DLNA 2ID8A 5CG2A 2VJBA 5JNUA 1WP9A 4JBXA 3RTAA 1NI4B 4ML3A 3I0MA 1LDMA 3MWDB 2GZDA 3UB2A 4EHFA 1MOPA 4I66A 5BSEA 1CZUA 3GFBA 3VPXA 1N6RA 1OQAA 3E4DA 3E9NA 1GDDA 3EIQA 3IT3A 3MTEA 4LWQA 4ZXPA 4IKEA 3T5CA 3EDOA 1UK8A 4GEKA 2PKQP 2OM2A 3RJTA 1N75A 2WVJA 3DTNA 4CKWB 4EMBA 1OXSC 2H9YA 4HXEB 3B1WA 1BXZA 1Q7TA 1TMGE 1V16B 1Y9ZA 2ZVJA 5KWSA 2AEFA 4WZ6A 3K6JA 3BQMB 4GW3A 1D9ZA 5EE0A 1AKNA 4FFMA 3ZX5A 1ZXXA 2IYOA 4IH4A 1MW9X 1QFMA 3TS1A 1IFXA 1USWA 2W6CX 3AEUA 3D4PA 3HZRA 3KOWA 4QDTA 5EIBC 1T0HB 4JROA 2ZLBA 3QFRA 3L07A 4FYIA 2OQ2A 4K9KA 5FUMA 4WN9A 4Z4HA 2YWHA 1PR5A 2Q07A 4M0EA 3SX0A 3TEFA 2QN8A 5GM2A 2IZ1A 3IYLW 1O94C 3U3XA 2W22A 1E6EA 4J94A 2PMEA 4GXQA 3E7PA 2A33A 1JMKC 1GT91 2FF5A 3BWCA 3CRVA 4MLZA 5AJWA 3CRQA 4D4JA 1CJUC 3P0IA 1GUFA 2FOLA 3BTSA 3OEHD 5HOEA 1C5KA 2DE0X 2FWIA 2I1VB 3CY6A 1NBMD 3O82A 3R7BA 1VKJA 1MB2A 2R1ZA 1KMIY 3EIOA 3KYDA 3LLCA 4J1TC 4RHFA 1RC8A 4RE6A 2LKCA 1MA0A 3WRVA 2ZYGA 1JG1A 3X43A 4JLNA 2AUTA 1ULAA 4KQXA 4L4ZA 2FPGB 4ETMA 2WWYA 2I2CA 5CCBA 1T4DA 1Z4KA 3VUEA 1BMFA 1HPLA 3EOZA 2NO5A 1U9IC 1Y8QA 4IIEA 4AWBA 5JRZA 4KPUB 5K0EA 1F2TB 4TMYA 3T1OA 3Q8KA 5J59A 4MITA 4ZOQI 3CISA 2VZ8A 1CIVA 3NEPX 4MZDA 4TSFA 1LTQA 2H29A 2JJ2D 4EG4A 3AINA 4M49A 4PVDA 1F48A 4DYVA 4RTQA 2VQEB 1RM3A 4B32A 1VG1A 3NPMA 3D6FA 4KMRA 4C0AC 4EW1A 2AFHE 1TRHA 4KPFC 3DMNA 3NP9A 4LW8A 4QJ3A 3AEZA 1IEQA 1E7SA 2NSYA 3EGWA 4HQ0A 4UHFA 3AWDA 4HZUB 1EX1A 2HBQA 3PICA 5DNDA 2YZ7A 4AYWA 4ZCLA 1P2GA 5DWVA 2BFOA 2PGIA 3WWZA 4RTOA 4WOBA 1UBRS 2G5GX 1QZUA 3L6OO 4WOJA 4DYHA 2ZDQA 4RHUA 4G0OA 5AHWA 3ZG6A 4E13A 3TL6A 1YB4A 5LOVA 3IEVA 5U9CA 2C98A 4QEZA 2FJUA 2R97A 3D3WA 3IDQA 4AQDA 1B00A 4X0EA 1YTLA 4EQ6A 2XA1A 2C9YA 2V96A 3PRYA 3C7DB 1MMFB 3OZRA 4LWZA 1IY1A 2G67A 1F2VA 4EY7A 2WQ6A 1MD9A 4K87A 2GCPA 2RC6A 5KTSA 1ILWA 1VBMA 5AP9A 2QGZA 3ZD6A 3MIIA 1JDZA 2AA3A 1UBUS 3HB4X 1SK9A 2W2LA 1C7FA 2DFNA 2NUBA 4UEJA 4OGKA 3H2BA 2VDPB 1HG0A 2A0YA 4HVAA 4L76A 3HR4A 4OFZA 4ZVTA 3HYNA 4NNPA 1GG9A 1TZCA 2B92A 4EQ6B 3BWEA 1YOVA 4A36A 1IPFA 1CRLA 4BWFB 1NLYA 3PDUA 3AVYA 3HZZA 1Z83A 1KQGA 1CB7A 3CCFA 2AD1A 1ZUNB 3VYWA 1KOGA 2DWUA 3AF1A 3HYTA 3HCRA 3RTDA 2TMGA 2XB4A 4UBIA 3VR3D 4CKXA 1Z4JA 5EHXA 5DGIA 3NGLA 3QRWA 4TZKA 5DCLA 1GQOA 2C7GA 1T1GA 2AN9A 5KTPA 3K8OE 1U9YA 2PY6A 4OJKA 1ZD9A 1NSFA 1T15A 4WA8A 5IM4F 1BJTA 3L06A 1T2CA 2FX2A 1EFKA 5IDXA 3K31A 5HZGA 1P91A 4BJ6A 1N2IA 5KNLA 1LK7A 4C4SA 1WXWA 2IKSA 5D2CA 3TAUA 5JV5A 1T4GA 2AOWA 3NOVA 1NLUA 2GKGA 5JBNA 3CHYA 3Q10A 4EI9A 3ONWA 2IDZA 2JJ1A 4RDCA 5IAKA 3E35A 1EJ0A 1ZK0A 2ECQA 3FNFA 2F17A 3A28A 5BOVA 4GD3Q 1TCAA 5A7GA 2DWPA 3WWCA 1EGMB 2WTEA 1HE8B 2FE4A 1U8XX 3ANLA 3MBKA 2F64A