1E9FA

Mutant human thymidylate kinase complexed with tmp and adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
211
structure length
202
Chain Sequence
RRGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potentiating Azt Activation: Structures of Wildtype and Mutant Human Thymidylate Kinase Suggest Reasons for the Mutants' Improved Kinetics with the HIV Prodrug Metabolite Aztmp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 80
structure length 202
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e9fA00
5FUYA 2J87A 3KUCA 4LYHA 2HJVA 1AKYA 1ZU4A 2DWPA 3CZPA 5G40A 1G8PA 1M1YE 2W2TA 3PXGA 2Z5FA 1V43A 4FCWA 1G7SA 4A8JB 1TUEA 4Q4AA 4DKXA 3QPWA 2P3SA 3NKVA 2V1XA 2D62A 3LWNA 2IS4A 1DAFA 2IYUA 3FFAA 4BGDA 1ZM2A 3T1OA 1N6RA 3M4YA 5KTYA 4A0FA 5CK5A 1IM2A 4XIGS 1AZSC 2YJTD 1JBKA 4RKEA 3UWKA 3AGPA 1X86B 2PJZA 5F9FA 4GMXA 2FN4A 1JQLB 2Q3MA 1G3IA 1E6CA 1G7CA 1A2KC 4TT3D 3QOFA 3L82B 2ZR9A 5IT5A 1HH4A 4QHSA 5JHHB 3ADCA 2QP3A 1W49A 1G3QA 2IL1A 4BFZA 4DT1B 4HYYA 3A4NA 3X1WA 2E9SA 2JIZD 5C1BA 4QNRA 2WIAA 1OJLA 3ZZTA 1GOTA 2FZLA 3BK7A 2JA1A 1KK1A 5F3WB 1GTVA 4DRZA 4GI7A 1ZP6A 3FKSA 3PUVA 2CXXA 3GFTA 4AG5A 2OXRA 4AD8A 1G291 2PX0A 4MRSA 4UJ5A 4DLXA 1DARA 1KDPA 4XSGA 4A9AA 2JLWA 2BBTA 3FMFA 3D31A 2FFQA 4KV9A 4LI0A 4JJZA 4HAXA 4DEYA 2CEAA 1Z63A 1VDZA 2REOA 1EG7A 2HV8A 4JVLA 4JZKA 4ZDIA 1XPOA 2GCOB 3RRNA 5TMPA 2ODNA 4JMPA 2FFHA 5CLLA 5FBWB 5DE3A 4GT1A 1GITA 1CJUC 1Z6GA 4EJSB 421PA 3PV0A 3KTAA 3CF0A 4LC0A 4FCTA 4C0QC 3IDQA 1IHUA 1HYQA 1OE0A 1MO5A 2AK2A 2YZ2A 4JSTA 4NZYA 3TGPA 2JASA 4HUTA 2F3RA 1UM8A 5TXGA 2FSFA 4TN1A 4Z54A 2A7QA 3B5JA 1R0WA 2G0NA 1QHHA 3E1SA 2F55A 3ZYCA 5M04A 1MH1A 5H68A 2AX4A 2QQEA 1KSJA 2JJ2A 3LW8A 2FPMA 3CX6A 1Y63A 1XXHA 1XU4A 4DDUA 3VU9A 2NOAA 3U3JA 1QZXA 4ZI2A 1KOFA 1XX6A 1W47A 1IN6A 2OBLA 2W6ID 2ZS9A 4LPKA 3UMSA 4BFYA 4P4TA 2VQSA 5JWHA 1OLOA 5DI9A 2OUKA 1SHKA 4G5SA 4AKEA 4DUGA 2ODWA 5HE9A 1N5JA 5DN6A 4Q4JB 1D2NA 1VG9B 5FPHA 5FBLB 2XXAA 4LHWA 2UVQA 3KJHA 2HT1A 1G3MA 4JS0A 4GP7A 4WOPA 1CP2A 4FI3C 2ZRBA 4NMMA 1H65A 3C7KA 4Q00A 4HEJA 1XTQA 3CZQA 1HT2E 1EFCA 4QHYA 4BECA 1EX6A 1L2TA 1N0WA 4RJLA 4POAA 1FNMA 1SXJD 3T1QA 3VAAA 1OXXK 2BC9A 4B2LA 4CW7A 3HU3A 3QPVA 1HT1E 2PLRA 5BQ5A 1KI3A 1E9CA 2HT6A 3SE0A 2ZJ2A 4HI0E 5G3ZA 1JPNA 4NYMQ 5JRJA 4JLAA 2ZR0A 4A6PA 1OH6A 2QPOA 1E2FA 3NWJA 3U7GA 1R2QA 2YKGA 1JR3E 4JL5A 3V4RA 4CEJB 4A0RA 3EC2A 1I4DD 4G3XA 4M9XA 5LD2B 3GFOA 3KTAB 1E2GA 4F38A 4B34A 4JSYA 5B57C 1W1WA 2O0KA 2W2VA 2R6FA 5GVSA 1PUIA 5HZHA 3FHTA 3CPJB 4QBIA 3IO5A 3O8BA 3QKRB 2GCOA 1K8RA 4ZV4A 1GILA 4OQLA 4IJMA 3L43A 4BLOA 4I81A 1RRCA 3QXCA 3VTKA 1AGRA 1Z08A 3K0CA 1FQJA 4LJ7A 2GHIA 4BFUA 1L4UA 4LV6A 4LK2A 5TV2A 4LGMA 1Z06A 3GLHB 3VHXA 2CLCX 1Z6TA 3TKLA 1NVVQ 1Q22A 2HUPA 3VHLB 3N2EA 4AKHA 4BRWA 1NY6A 2NQ2C 1W2GA 4XH9B 4WBSA 5FR2A 3L0IB 2JJ2D 1G8HA 5K8UA 4JKIA 4XSHA 5CIQA 1JR3D 4C0AC 5JHGB 1WRBA 4WZBE 1JEDA 2O52A 1JNYA 5IK2A 1RW4A 4URWR 2I1QA 1OSNA 4CIDA 1D8TA 3GQBA 1HV8A 2F9LA 3GPLA 1R0YA 5BN4A 4G5GA 5L3QA 1IJEA 2ZM5A 2VPPA 1FZQA 2J5XA 1II8A 5KUTA 1OXUA 2QORA 2Z4SA 4NCIA 3EZ6A 4JLMA 2VP0A 4NONA 1CBUA 1DADA 2QSYA 3T61A 2CCJA 1CKEA 3KQUA 2DFKB 1UPTA 3QKRA 2ASEA 1HY3A 4IOJA 1E2MA 1JJ7A 4HB0A 4OJKA 3GEHA 1O87A 3WP0A 2QAGB 4Q4AB 3NVAA 3WXMA 1YHNA 1Q1BA 1UBCA 3FMIA 5J4YA 4GMDA 4B48A 1G5TA 4AG6A 2J45A 3FGNA 2CK3A 1DS6A 1E79A 2WSMA 5JWRA 2A5JA 1GUAA 3PG5A 1QBKC 1VECA 3WHKA 1E9DA 4PXAA 4ZPXA 2Z6VA 5FBRB 2DWOA 3B78A 4K8OA 1E0KA 1FPMA 1US8A 1JECA 5HCNA 1W46A 5SZKB 3SYNA 2FWRA 3RAPR 1DTSA 3SEAA 3VR5A 4HUQB 1E96A 4B76A 3IGFA 3DKVA 1H8ED 3OFND 3LY5A 1RC8A 4HLUA 2ZYWX 1RYHA 3PUYA 5JMTA 1T5IA 2WJJA 3RRMA 3ICEA 1VCMA 2JLYA 3KKQA 4LV8B 1KHTA 1TEVA 4PZYA 4BZQA 1YR8A 2AKYA 4WZAE 5JSZB 3X1YA 3JVUA 2OHFA 1UKZA 3B6EA 3CH5A 4TTQA 2GXUA 2ECKA 3EA5A 1X3SA 3VNUA 2ZI6A 3H4MA 4BFXA 2F3TA 4C0HA 5B30A 2JLXA 2BKUA 4ZO4A 1XXHB 2GK6A 4LHYA 4DIEA 2FH5B 1DAGA 1G7TA 4O0MA 2QROA 1OFUX 3I3SR 4FMCB 2XXAB 4N0DA 4OK5A 5L3RA 1D2EA 4Q4HB 2TMKA 2CL6X 4OQMA 3RANA 4B33A 3LXRA 1EX7A 4TLDA 1P4SA 3NC1C 3WRYC 4Q9JA 5C18A 2DY1A 1Z5ZA 2GCNA 2HXSA 1F48A 3U3RA 3LBHA 1I2MA 4IOLA 4RZ2A 3SI7A 1YRAA 2JDID 2WOOA 2DWQA 3AVWA 3TE6A 4JYCA 4MYTA 2O8DA 1Z28A 1LNZA 1W36C 4LYAA 1JB1A 1QHHB 5A4JA 4PAQA 4NYJR 2X19A 4MITA 1Q57A 3DZDA 2V4ZA 3BIFA 4C2TA 1R4AA 2ZR7A 1T4GA 2IWHA 1KNXA 3MMPA 5KSOA 2FGJA 3RSOA 2YWGA 2RGGA 1UDXA 2EW1A 3LQQA 2R6DA 4LCBA 1TF5A 2MSDB 1OIVA 2J7PD 4GP6A 3B1XA 4B3DA 3R8FA 1KI9A 4G5OA 4EQ6B 2MMCA 1VHTA 4AK9A 4BWYA 5UKDA 1E9EA 5C4MA 3GLHE 3Q72A 1XTRA 1IY2A 2R9VA 1F2TA 1CEEA 4EJSC 2DCUA 1ETUA 1XF9A 4PHTA 2IYLD 4XWKA 1KMQA 2HF8A 1FMLA 4M9ZA 4NTZA 5JBQA 4KSCA 2IC5A 2GXQA 4A15A 2O5VA 2CNWA 4FXPA 1WB9A 1UADA 4LY6A 2NPFA 1JXMA 4UXHA 1FX0B 1GSIA 2CDNA 1ZJ6A 2VHJA 3SN6A 2IBMA 4P3YA 5ANRB 1CULC 3R9XA 2JAQA 2NMVA 2BM1A 2PEZA 4M53A 3CF6R 4JVMA 5E7IA 4B3XA 3G82C 3PEWA 2GKSA 3DOEA 1W5TA 1P62B 4OI2A 4TTRA 4W5WA 1N6HA 1MOZA 1QHIA 1EFRA 1JAIA 5BXQC 1SVIA 1IQPA 721PA 2DYKA 2IYTA 3FWYA 1KY3A 2WWIA 1ZIPA 4U02A 5FTMA 1RJ9A 5D3MA 3TSOA 4A0HA 4DLUA 4ZCMA 2IF0A 2IHYA 3BC1A 5C46F 3IBGA 2F6RA 4QM7A 3BFVA 4PQRA 3G5UA 3Q5EA 2QI9C 3CWQA 4Q02A 3QEOA 1R0XA 3PITA 5FOWA 4NYMR 3U4QA 1A2BA 4C7OA 1G41A 3LDAA 1AK2A 4V0OA 3VR4A 3MWLA 2ATVA 4RD2A 1GG2A 1W48A 2WM9B 1UDWA 4PO8A 1RVDA 1R7RA 2FZ4A 1W4BA 3FMPB 5EP1A 2QUZA 4Q5IA 1NSTA 4TYNA 4DSNA 4I1SA 3IKJA 4NYIR 2IYSA 5FR1A 2QQ0A 2FSHA 4LJ9A 4Q1CA 2IF2A 4DIDA 1G21E 2H17A 1J8YF 3KX2A 3RRYA 5EXTA 3AUYA 1W0KD 1FMJA 1XMVA 4JL8A 3CBQA 3RWOA 2OESA 4E07A 4YLGA 3GJ5A 4CRWB 1U0JA 3SZRA 4LX0A 2VHCA 5KSZA 3AF2A 3QKTA 4D4LA 2NO9A 2R65A 1G20E 3TK1A 2V3CC 1VHLA 4BLPA 3Q85A 3HYRA 2C78A 2WWXA 2ZE5A 2QY9A 1EFUA 1W4AA 3QVVA 3R8CA 2JLZA 1YZQA 2H92A 5FPKA 3QY0A 1N3BA 2ZRGA 3TQFA 3O8RA 3FOZA 1NVXQ 2D7CA 3UPUA 1UF9A 3B13B 2ODEA 1EFHA 3CRW1 3W5JA 3FE2A 1L8QA 5JJIA 3E2IA 5AUPB 2QTFA 2W6JD 2PL3A 2ORVA 2XZOA 2EFGA 2QTVB 1YJ5A 3UK6A 1KI8A 3ECCA 1S8FA 3TR0A 2OCBA 1QHXA 3PEUA 4HLUC 1X1SA 4DLVA 1J70A 1OFIA 2EVWX 2CL0X 1KKMA 3I4LA 4NP6A 4R98A 4G01B 5K8LA 3KJEA 4DJTA 3RLFA 4B44A 2O8CB 1OPXA 3QBVA 5EXPA 4W9MC 4LHXA 3TH5A 3SBDA 4KJZA 4KAXA 3CWZA 4V0MA 3REFA 4B35A 3AP2A 1B23P 5JRZA 3I32A 4URZR 5FBQB 1E9SA 3PUZA 4RFSA 1OB5A 3CNOA 5EE9A 2QGNA 4R2IA 4UXJA 4QM6A 3CIOA 3AB3A 1E1QD 2KI5A 1XMIA 2BBOA 4TLAA 3UXMA 3CUEF 4Q1DA 1DOAA 4V0LA 3SJBA 1N5LA 3FVQA 3ZD6A 3TVDA 3M1IA 4M9SA 4LPSA 2VIIA 3ONWA 1VTKA 4XJXA 1FW6A 4Q01A 4PANA 4PC3A 4S2EA 4LJ4A 3FYHA 2V6IA 3B1YA 1QHSA 3KB1A 3W90A 1ODFA 5DN6D 5DIFA 1GKYA 4N3NA 3EPJA 2ZJYA 1GL9B 4R2HA 2OXCA 3KQKA 4XVRA 4LJAA 1NF3A 3H86A 2DPXA 3TMKA 2OV2A 4RCZA 4QG7A 3KQNA 5BN5A 5LD2C 2WWHA 1N2CE 2W0MA 4YQFA 1A4RA 1VCOA 2YINC 4LJ6A 3T5GA 3RYTC 3OESA 1Z07A 3MWKA 5DYIA 1UFQA 2G88A 2ZUBA 2GTPA 1IN4A 1G17A 2JATA 2RCNA 4QGGA 3O8CA 4O25A 1G6OA 4HB4A 2P0EA 1E0AA 4QGFA 1W0JD 1AJEA 2ONJA 1RIFA 1PZNA 3A1UA 3EASA 1U0LA 3PQCA 4UNQA 3K9HA 4AWXA 3DL0A 1LV7A 2FFAA 1WP9A 4GOJA 3ETLA 3AQ4A 3OZXA 4C0LA 2B8WA 3EARA 2QG6A 4MYHA 1F60A 4DSOA 5FOXA 3ZS9A 2R6GA 4P4UA 2JLQA 2CLSA 2OFWA 1KSGA 5KNCA 2OCAA 1GZSA 3EZ9A 4IDPA 4N1AA 1E4YA 4QJ3A 1S3GA 2IYZA 3SU8A 5C4GB 1XMSA 3A6PC 1CS4C 1Z6YA 2IYRA 4GZMA 3Q5DA 3UKDA 4D0GA 1Z0KA 2HDNB 1BS1A 2F7SA 2WPDA 4G1UC 1IN5A 4AKGA 4PAMA 1PJRA 3CX7A 3BB4A 4DB4A 1IN7A 2CE7A 3BORA 2CJWB 3TUIC 4A4DA 4Q47A 1NNEA 5J4LA 4B3GA 2J41A 1M6NA 2Q3FA 4BFTA 1BIFA 2NO0A 5J4HA 1EK0A 4ZDWA 2GDJA 1OYWA 5KNDA 3LLUA 4MGYR 1CRPA 5JJKA 1GRQA 4AURA 3ZZ0A 3U4QB 4KFSA 4PQFA 1E2QA 3C41J 1TNDA 3K0AB 1ZINA 3LW7A 1G64A 1GL6A 4NYJQ 3NHBA 1DPFA 3AVTA 2WWWA 5FBVB 3GLIA 4P31A 3VKGA 4NCHA 3VNVA 2GAAA 2FV8A 3NBXX 1XJQA 4KHZA 2B8TA 3U6KA 4UNRA 5CK4A 2H7VA 3WRXC 4TMKA 1AM4D 3K0AA 4RZUA 3VR3A 3X2SA 3DEFA 1VG1A 4TLBA 2PZFA 4YXWD 4L8GA 1KO5A 4ILEA 4KSBA 3SYLA 3OF5A 5E4FA 1NKTA 5FTKA 4IDOA 4H9GA 2C99A 4BLQA 2WKRA 5JS8A 1IOZA 1YZNA 3AKCA 3IIMA 2IX3A 1JPJA 1U8ZA 1KZGB 1AS3A 4KFRA 3C5CA 4QGHA 4LYFA 2OE2A 4RD3A 1N0UA 1A82A 2HLDA 3HWSA 2GBLA 2R6CA 2KBEA 1FTSA 3FFBA 1COWA 1XP8A 2GEVA 4CYMA 2X77A 2Q9BA 5HZKA 3B2EA 3QF4B 1QHGA 3T34A 3OE7D 3SBEA 2G3YA 2R6AA 3OE7A 4FW9A 4IVRA 1EGAA 2F1IA 4DCTA 1VIAA 1RKBA 2LWIA 2ZAMA 3TW4A 5J4VA 1BMFD 5D3QA 5L8VA 2IXFA 4QHTA 5F98A 1BKDR 4PTLA 4JL6A 2RGDA 2OT3B 1Z8FA 1P7CA 4D2IA 4WZ6A 4B3BA 2VHQA 3BB3A 4BLRA 1GM5A 4O3MA 1G3RA 4G0NA 1ZNXA 4M1TA 1Z22A 1Q3TA 2PCJA 1CR0A 5LBIA 2O8BB 5DLQC 4Q7JB 4HZUB 1Z0JA 2XZPA 1KYIA 3MWYW 4RD0A 2B21A 3R7WB 3SJZA 2AK3A 1XTJA 2VP4A 4JLKA 4LJYA 4JBYA 3U5ZB 3HR8A 5AK0A 4O2RA 4IKEA 3OEED 1M7BA 4PHGA 4WW0A 5SZHB 3RS4A 1KY2A 2ZU6A 4Z1MA 1Z0IA 3AP1A 1E0SA 4B3CA 3W3ZB 1NJGA 1SVKA 2IYYA 4Q7MB 3WMEA 2IW3A 2WTUA 1G6HA 3WNDA 2WSSD 2GF9A 5G3YA 1ZC3A 2ZYUX 3EZ7A 3W3AA 3VKWA 3WNBA 1EWQA 1S3SA 4JLNA 1E1RD 3RSLA 4Q9IA 1TADA 1YU9A 2F43A 1E9AA 5FL7D 1XPUA 1E1QA 2O8BA 5EP3A 1OXTA 1VCNA 3THXA 2OFXA 4XWAA 1XTKA 2NG1A 4M1SA 4B47A 1KDRA 2FF7A 2V8OA 4CF7A 4R9UC 4TL7A 1RPZA 3BD9A 1SVOA 4PQYA 1QF9A 4NPHA 1NIJA 1E99A 2GJ9A 5CITA 1Q12A 2GVDC 3QKSA 2D3WA 2IXGA 1Z83A 3AVYA 2QBYA 2A9KA 1JR6A 2AFHE 2G0TA 4CVNA 2AR7A 4OHVA 5DO9A 1E2HA 5A0FA 2QP9X 2O8EA 4PSVA 1T6NA 1Z0DA 1HQYE 1ZNZA 1X8LA 2IUSA 4UNSA 1N5IA 4DUGD 2IA5A 2PLFA 1NVVR 3CO5A 3FDIA 4ZKEA 5KPJA 4JT2A 1XZPA 4Q1AA 2WBLC 2QN6A 4D4JA 4LBVA 2WWYA 2HCBA 2ZTSA 1FFHA 2RH5A 4WXRA 2QBYB 4NE2A 1AS0A 1LS1A 4US0R 1Z6AA 4YXWA 2ZJ5A 1TQDA 2BM0A 4PPQA 2GNOA 2XNSA 2N1BA 3LBIA 3X1ZA 4HB2A 2P5SA 3RS2A 1RRPA 4DCVA 1W7AA 3B82A 5JCZA 2IS6A 4Q18A 4EPYA 3THWA 2CVHA 1LF0A 1P2VA 5GADl 1NMZA 1PLKA 2MSCB 4E22A 4M8NE 2GEDA 3QXJA 3N2IA 2I4IA 2J9RA 2N42A 2XSZD 3DVLA 4MUAA 4KBFA 1N0VC 3ZH9B 4QBFA 1MO3A 1JAHA 3CW2A 3K70C 3RS3A 1R5NA 3HR7A 4MGZR 4PO9A 4MKHA 5AJWA 1K6MA 6Q21A 1VYUA 4DXAA 2BEJA 2XZLA 2PJRA 1Z3IX 1NMYA 4IVPA 3SQXA 1ZYUA 5FTLA 2ORIA 2GJKA 2SHKA 1WBBA 1II8B 3KUDA 3CR8A 3W6OA 3MAAC 3UG6A 1E9RA 5FTNA 4L15A 1FL9A 3GLFA 1DAMA 1KJWA 2EFEB 4L9SA 2F1RA 3AVXA 3I61A 1FUKA 2BMJA 4H1UA 1CRQA 4UNNA 3KQLA 1VIYA 4M1WA 2DB3A 1SVWA 5EQTA 2JLUA 4DLYA 3TIFA 4ACBA 5AUQA 2GJ8A 4XOIA 4O2LA 4BLTA 5LB2A 1Z2AA 4EQ6A 2AWOA 1U8AA 3F3YA 1VCIA 3HDTA 3DMDA 3I62A 3KB2A 1ZNYA 4TZ0A 4PPGA 1UEJA 2W6IA 2PH1A 2IWRA 1U2RA 3IQWA 2VF7A 3B1VA 1NBMA 3M0EA 3TSZA 3QF4A 2VL7A 4LYJA 4TTPA 3W6NA 1T8UA 2V6JA 3GEIA 1S1MA 4TYYA 3OIYA 4UKDA 2JJ1A 3IQXA 1AGPA 3JVVA 2NO6A 3EG5A 1N6PA 4L4UA 2D74A 4XTCS 2NO1A 3IUYA 3OIVA 4V0KA 1ZD9A 2C95A 4RFVA 5FL3A 2HYIC 1IY0A 4EIWA 4JLDA 5FUVA 1RZ3A 2BVNA 1GL7A 5JI2E 2G77B 3GJ4A 3QF7A 3RS0A 3Q3JB 4G5RA 5CYOA 2OCYC 2BMFA 2V7QA 2ZI7A 3O47A 4QFMA 5CDFE 2CHGA 2J0UA 4ITRC 2XTMA 4BASA 1AQYA 3I5YA 1D5CA 4JYBA 1K5GA 2QTHA 1WBDA 2CE2X 4OQXA 2C9CA 1HQCA 4RZ3A 1D6JA 5HR5A 2YWFA 5J47A 3B85A 4Q7KA 4JLBA 1SKYE 1LB1B 3B1WA 3SS8A 3EWAA 1PV4A 5EXXA 2J7PA 2FMXA 2NTYC 3FTQA 1E0JA 2QGZA 3EZ2A 1CF4A 1ZBDA 3ZQJA 3U44B 3A4LA 1KMHA 1N25A 4KLNA 1IXSB 5HKKA 1Q1QA 1CJKC 5KNBA 5LDDC 2DHRA 2MMGA 2WMOB 5JSZA 1P9NA 4Q7LA 1OB2A 5JEDA 4YONB 4ACAA 3P20A 1E2NA 1RFLA 2GILA 4DLRA 4K46A 4OYHA 4LJ5A 1YR6A 4F93B 3QJYA 3BH0A 2QT1A 1DEKA 4HB3A 3KXKA 2C96A 2O8FB 1NP6A 1F2TB 2A2ZA 2RGAA 3L8YA 2C77A 2WICA 3P4XA 5FFMA 5CJ2A 5DGXA 5HCIA 5SZIA 1CU1A 3TSWA 4D81A 2O8CA 5TY0A 1ESMA 3QEJA 3QENA 5AJXA 4URUR 1N6NA 5KSYA 4Z8XA 2YC2C 1OHHA 3NDPA 1F3OA 1PUJA 2N46A 1XEWX 2EYUA 3IHLA 2VEDA 3K9NA 1SVSA 2VSOA 2GESA 3QQ5A 3PEVA 1KO8A 1M7GA 4C3ZA 2QPTA 2W6JA 2ZI9A 5BW8A 2FG5A 2GXSA 4BLSA 2RGXA 2OLKA 3HP1A 3RABA 2WJHA 1G3UA 1SGWA 2DR3A 2XTNA 1S4QA 5EZ5A 4XTRA 3V9PA 1S1CA 2NZJA 5EZ6B 1P60A 3PVSA 2XSZA 1N6OA 2I3BA 1M34E 3C8UA 4PC1A 1KZ7B 1P2TA 2VP9A 2YYZA 2ZI3A 4DEXA 2ZYVX 2J46A 3ZVMA 4QNMA 3KJGA 1ZU5A 1Q44A 3J81k 4PZLA 2W00A 5J40A 3U6BA 4MYUA 2VHTA 3IPXA 2D4HA 2WJIA 1E4VA 4KITB 5FUXA 1NN1A 2FEMA 1W2HA 1MABB 4HZUA 2RGCA 2D7DA 1YR9A 4GRAA 4TMWA 1A1VA 2OFOA 5AJYA 1LVGA 1R0ZA 1E2PA 3SDZA 4CEIA 3W34A 4JLOA 1GNRA 3NIBA 2P67A 3RWMB 2RMKA 3B8HA 5JFGA 2BBWA 5KDLA 4II7A 5CM9C 4CEHA 2OEPA 2ZJOA 4F7WA 4HUQA 3I1FA 4Q1BA 3K1JA 1OIXA 1HE8B 1NN0A 3K9GA 4C7OB 2ZJZA 1HURA 3ADBA 1RRGA 3RNLA 4M0LA 2REXB 2B6HA 2QMEA 3TUZC 4FINA 4HAUA 3LAWA 3WYAA 4B75A 1XFAA 2QEQA 5IF9A 2CCKA 2ZVQX 4TQUS 4B6FA 2IXEA 1PLJA 1VG8A 1ZUNB 4FMBB 3TAHA 3A1VA 2QSZA 1XTSA 1U0HC 121PA 4Y0AA 4LZZA 2ZI5A 3I8XA 1P61B 2VHUA 3KKMA 1S9HA 3THYB 1U94A 2BV3A 4Q21A 2VLIA 1FX0A 2X1VA 3T5DA 2IK8A 4A6XA 3DDCA 4V03A 1TF2A 2O0HA 3OAAD 5EJEA 1CLUA 4YMVA 2XGJA 2QAJA 2P65A 4DLWA 2AFIE 3DPUA 4U00A 5DH9A 2FPKA 1XD9A 2ZRPA 4IFEA 3THOA 3W8RA 4CGZA 4OK3A 4ESVA 2VTKA 4HLDA 2ZITA 4KU4A 2JLRA 3QI2A 1FOEB 2QT0A 4PHFA 2B7CA 4RZXA 1T3SA 4IRUB 4IHQA 1BYIA 1NN3A 2F1HA 1T9HA 3R20A 4ON9A 1T3HA 3QBTA 3ZIAD 2ZE8A 3TJZA 1W44A 1XD8A 4IEIA 5EP4A 3K70D 3BRWD 2W83A 1FQKA 4MH0R 3DOFA 3KXIA 3VX3A 2ODBA 1CR2A 1WDTA 4P4SB 3C4JA 4C9BA 5JI3E 1NBMD 4N0EA 5EE3A 5L3SA 1SVMA 3VMFA 3AVPA 1GKUB 4LSGA 2ZE7A 4W5JA 4B73A 1P5ZB 2E1RA 3MCAA 3ICQB 2YHSA 1SXJB 2FGKA 1JR3A 2QM7A 4LHVA 3LFUA 2G1JA 4TLCA 5E7MA 1EXMA 3LVQE 3SNHA 5SZJA 5F9HA 5AJVB 3PCRB 4TYWA 3LX8A 2O0JA 5DSZA 3AH8A 1HEIA 2JJ8A 2Z43A 4HDQB 1N5KA 3OFNA 4TMVA 1AS2A 2VP2A 2ZSBA 2CBZA 2ERXA 1G5PA 4OL0A 1WQ1R 1NVUQ 1FP7A 4U7DA 3KKOA 3ZVNA 1BH2A 4JVSB 2CLDX 3GLGB 5FUWA 4URXR 3QG5A 2OO7A 2WHXA 3OEHA 5H1YA 2HYDA 2VF8A 4IEEA 1E69A 4LBWA 3NTUA 1T0JB 4AKIA 4US2R 2C9OA 2OLJA 1P2UA 3IPYA 5FOSA 5FTJA 2ZRFA 3MFYA 2ZYTX 5GJBA 2J59A 3RVBA 4BFVA 2DFLA 2OILA 2Z83A 5J5CA 5B2ZA 2BEKA 3CLVA 3MJHA 1UJ2A 4OI4A 1GRNA 3AF3A 4HSEA 4TL8A 2KBFA 3NBZC 3NC0C 3K0FA 1KO1A 1YVDA 4V02A 3B7GA 1W4CA 2V54A 5FL7A 3GJ8A 1JXOA 3GJ0A 4GPTA 4KBGA 1QVAA 5JS7A 3K8YA 1QHYA 3BB1A 3U7HB 1SQ5A 1W36B 5KO2A 3ASYA 2KB0A 2A5GA 3ZQ6A 1XMJA 5IK2D 1KI6B 1XEFA 3BBPA 4DWJA 1P75A 2QP4A 1LF5A 3K0FB 1J99A 3ZIAA 2YVUA 2QRNA 1UBGA 3A37A 5KOYA 1N6IA 2AD5A 3K09A 2XOKD 3GLGA 4LWZA 2AXNA 4M2LA 3U61B 2CK3D 3HYTA 3QXSA 2VSXA 4HLCA 2CNWD 4PX9A 5TDHA 1OV4A 1KDOA 3MWJA 4A82A 5A5GA 1NG9A 1XD2A 2VRWA 3L8ZA 1GWNA 1YKSA 2WJVA 3BFKA 4RKFA 2W2XA 3BE4A 4A2QA 4BUJA 5E7JA 4AY2A 3OAAA 4TL6A 1SKYB 2QAGA 2W0SA 3LH5A 3RDPA 2QMOA 3OIUA 4JLPA 1A7JA 4JLJA 4A8JA 4DZZA 1XZQA 3O8DA 4M1MA 3VKHA 4DC9A 2WVJA 1MO6A 2JLVA 4X8LA 1TF7A 2HF9A 4OKSA 1OXVA 2GCPA 1ZNWA 1QVRA 1W5SA 3NG1A 2FFBA 4G5QA 1G4AE 1VYTA 1GNPA 4M1OA 3AVQA 3U7FB 3LBNA 1E1RA 2BDTA 3D7MA 2ZVPX 3QG1A 2BOVA 4P4SA 3IHWA 621PA 2I1VB 1BO6A 4V0ME 2GJAA 4A92A 1GAJA 4QOSA 4D25A 3H84A 1TPZA 3MG9A 1H8HA 4MKFA 4LBZA 4UQOA 1V5WA 2HEIA 3D8BA 2ZE6A 5HE8A 4F4CA 1TEXA 2CL7X 3WBKA 1DG3A 5EXSA 1F5NA 4TQAA 5K8TA 5L3QB 1GNQA 2Y8EA 2C03A 5AR1A 4KFUA 4Y0VA 5FOVA 1DE0A 2OCPA 5CB6A 5CB8A 3GD7A 1AKEA 3VQTA 4KO8A 2XOKA 1XCMA 1TL7C 1P3JA 3AKDA 3C5HA 1NN5A 4PC2A 2AKAB 2ZSAA 4A36A 1ZRHA 2QAGC 4DBLC 3EPHA 3R9IA 2ZQ5A 5GJCA 1ZVQA 1IY1A 2QM8A 2WJYA 4MUBA 4OK6A 4YDSA 2XNDA 4OQNA 4A2PA 4C0BA 3BH7A 2WKPA 1G8FA 4TYPA 2FPLA 4QJ5A 4BQSA 1T3LA 1PVOA 1FP6A 5J4KA 4E5UA 3OIWA 1DAKA 4MA4A 1US8B 2IYXA 3T15A 1RE0A 3SOPA 2FX3A 3K0SA 1YZGA 2ZSFA 4LRWA 3SYKA 5FOTA 1XXHE 2RHDA 4ASUD 3RC8A 1IXRC 3KKPA 4IXNA 3CRMA 4YMTA 1M8PA 3L2OB 1OT3A 4LV5B 2WKQA 2XB2A 3E70C 4CEHB 2Q3HA 1E2JA 1Z29A 2O8FA 4B3FX 4CDGA 4ESHA 1NJFA 2ZAOA 3AP3A 4DCSA 4TZ6A 3LXXA 3FKSD 1CXZA 4KVGA 5DHAA 2P2LA 2ZRCA 4F92B 2IYWA 3TVTA 3A1SA 3Q7PA 4GL2A 1Z2CA 3QPUA 1VG0B 3SQWA 2XJ4A 3WP1B 1MT0A 2Q6TA 2FJUA 1ELOA 4D4KA 4EUNA 1ZUHA 4ZCIA 1TU3A 3P1JA 4IDNA 4EFNA 1E2KA 2WOJA 2OG2A 3QKSB 1TQ4A 2JGNA 3REGA 2IYQA 1U9IA 4BRUA 2LCFA 2CHQA 4LJ8A 2BMDA 3WYGA 2ZEJA 2RB4A 1LW7A 4ARZA 3U60B 4C2UA 3CKLA 3LVRE 2UKDA 2OM2A 4US1R 4Q9KA 4Q4JA 2ZUCA 3U7EB 2BMEA 4BFSA 1VKJA 3BWDD 2EFHB 2ZIAA 3BAFA 1X8KA 1KAOA 1P2SA 1P6XA 4YMSA 2D06A 5K8IA 1J90A 3A8TA 3X1DA 4QBGB 2UZ3A 5KYKA 2VYFA 3QXHA 2ZREA 4RD4A 2QMHA 3D3QA 2GEUA 5EE5B 4BZPA 2ZRIA 1C4OA 2HXYA 2ANCA 4X8OA 4IDHA 5CYPA 4BZXA 5JJLA 2EQBA 4BEBA 3IBYA 2Q9AA 2QRZA 3EW9A 4C30A 1J7KA 1II0A 3EAQA 2ZJBA 1CJMA 3AM1A 3ZGXA 1X6VA 1LFDB 2K5UA 1OF1A 2VP5A 2CCGA 4PZZA 3WNCA 4CEJA 1SULA 1XRJA 1ZD8A 4DLTA 2WMNB 2VH5R 1XDBA 5DISB 2PEYA 1XD2B 2GZDA 2AN9A 1VPLA 4JLVA 4ABYA 3RS7A 2WWFA 3BXZA 3NBYC 3EPKA 1U8YA 1E3MA 2C5LA 3S1AB 4DCNA 3AVOA 3KZ1E 1NY5A 4TWZA 1FTNA 4HAYA 1G16A 3VFDA 4JBXA 1YR7A 4DSUA 3AV0B 4NYIQ 3U44A 1P9RA 2H1LA 1M2OB 3P27A 4RD6A 1MV5A 1OXSC 3HU1A 1KI7A 2J0SA 1Q0UA 1R10A 1SHZA 2ZRMA 3LA6A 2ZUDA 4D0LB 1KO4A 1ONBA 4DB2A 4OHWA 1H8HD 1RRFA 5IRCD 2OSBA 3BS4A 1KKLA 4LOAA 3THYA 1QDEA 3ZVRA 2G83A 4UXIA 2J0UB 4Q66C 1Z0FA 4EAQA 3QE0A 4EDHA 5KDOA 3MSXA 1YRBA 2A5DA 2PMKA 4TQ9A 4Q1EA 2AHOA 3T12A 5GJWC 3VU9B 4E03A 1Z6XA 1TU4A 1Q3HA 4P0TA 4XVQA 1TMKA 5JECA 2XB4A 2GXAA 1UEIA 1GKIA 2VBCA 3IILA 1E2IA 8OHMA 5ELXA 4ZI3A 2ZRNA 1XJCA 2FSIA 3TQCA 5IHPA 2E87A 4JKYA 3CNLA 1YQTA 1Q1ZA 2EU8A 3PENA 3KJIA 1KK0A 4Q1FA 5HTKA 2Q0HA 4C0JA 4C0KA 2FNAA 2XAUA 4KVAA 5FPTA 1KGDA 4Q9HA 2XNDD 2H57A 3VX4A 1QG4A 3P4YA 2J7KA 4W7SA 1P9WA 3SC3A 1C1YA 1CIPA 3SHFA 2GJSA 4ZDJA 1NIPA 3C16C 2R62A 5FH9A 3RS5A 3KDSE 2NZ8A 3P32A 1GRRA 2AWNA 2WWGA 2MSEB 1LY1A 2NO7A 4AYXA 3GJ7A 4TMTA 5L3SB 5E95A 1HUQA 1F2UA 1XWIA 3ZLJA 3VR1A 2FDCA 2IUTA 4TSFA 1SVLA 3F0TA 3UATA 2GBLC 2NGRA 3AEZA 1OFHA 2C98A 4ASUA 2X2FA 5EE0A 1COWD 2D2FA 3EIQA 4I1UA 2YV5A 4OHZA 2DBYA 5KSPA 1BMFA 2RGNC 3DZ8A 4NL4H 2REBA 4KI0A 4WIAA 3AF4A 3DM9B 3EC1A 4KYIB 1MABA 1J2JA 5AWFC 1YZTA 5LB4A 3T1VA 4QC2A 1DBSA 3GLIE 3GLHA 1B0UA 1HE1C 2ERYA 4M1KA 4ZIRA 4YMWA 3P26A 5DNYB 5DI3B 5GJVC 2PX3A 2BWJA 1I4TD 4AYTA 1OKKD 4TMXA 1NVWQ 1U90A 3LLMA 4EFLA 2WAXA 3UMRA 1KSFX 2PZEA 2WAYA 3HPRA 4FMDF 2FOLA 3F5FA 1OW3B 4OI1A 5KHOC 1GVNB 2DFTA 1ZIOA 2WSSA 5EP2A 4HDCA 2BIFA 3R7WA 2D2EA 3AGQA 1BYUA 1JEEA 3GFPA 4EPRA 2A78A 1KAGA 2L0XA 1E2EA 2W58A 1FNNA 3GCGA 1XCPA 4MRNA 5EUQB 2JEOA 1UBEA 2H5EA 2R8RA 2A5YB 3AF1A 4B71A 4ZKDA 3FPAA 2WIBA 2ZRAA 1XEXB 1P72A 2QNRA 1S0UA 1WF3A 1KI6A 2FEOA 2GWHA 2A5FA 2FU5C 3C14C 2BHRA 3KKNA 1RYFA 4NH0A 3ZZUA 2X2EA 3N70A 3NDBB 2YC4C 5FOUA 3GJ6A 3B60A 521PA 4QKQA 5AUOB 4JJKA 2YOGA 3OHMA 1L4YA 4LUCA 4PC6A 4CEIB 1DELA 2WPDD 2WZQA 3EXAA 3LX5A 3NH6A 2KJQA 4OHYA 1JQJC 3ZJYA 2IYVA 3DMNA 4YDHB 4Q48A 3DHWC 4Z8YA 2JDIA 4QRHA 4JIMA 2LKDA 2VA8A 4Q03A 2ZSEA 1KJZA 3LNCA 3GP8A 2BBSA 2V55B 4DDWA 2P6RA 2CHVA 2PT7A 3IIKA 4YMUA 2ZJAA 3U3KA 2ZRKA 3CR7A 3U3MA 4EPVA 1KIMA 2IT1A 3IO3A 1NG1A 3BERA 1T5LA 4OBEA 5FPYA 2RHMA 1QG2A 4Q19A 2QMUA 4L9WA 3TNFA 2F1JA 2ZSDA 4RY2A 1A5TA 2ZS7A 3BH6A 4DSTA 3GJ3A 5JCPA 1TUIA 1OHHD 2HJGA 2NIPA 4BFWA 1NLZA 1KK2A 3MD0A 1NLYA 4MGKR 3QSYA 1W0JA 1ZC4A 1E2LA 4D0NA 2WJGA 3SJCA 5HPYB 4MRPA 2CVFA 2YWEA 2ZRJA 4HAZA 4FD2A 3FHCB 2ZROA 3W8NA 5H70A 3WYFA 4EJSA 2GZHA 2V1UA 4MGIR 3RRZA 1T91A 5IDVA 2IHBA 2GETA 4GFDA 3UWOA 5L3VA 4OI0A 1WMSA 2YNMA 3QNUA 3TW8B 3TRFA 1XBTA 4B32A 4BEJA 5JLJA 4NCNA 1SXJA 1G9XA 4B74A 2RGBA 4FMCF 3U2QA 4MDEA 3ADDA 4URYR 1U99A 4UNPA 2QL6A 3GLFB 2IS1A 3E5HA 3QKUA 4A1FA 2ZRDA 2OZEA 3CB4A 4Z1MD 2GZAA 1F6BA 3LQRA 1VMAA 4CZ2A 3L0SA 3FKQA 1GIAA 3OEEA 3TUJC 2RGEA 1S96A 4FCVA 4DHEA 3C15C 1IAQA 2G9NA 4DT1A 2V9PA 3EWSA 1EESA 1KMHB 2V7QD 3A1TA 1AN0A 3UMFA 2JLSA 1MRSA 4TSFD 3UIEA 1AIPA 3HU2A 1ZW6A 2EFCB 1YZUA 2OAP1 2G1KA 5CM8B 3WMGA 3DO6A 1U81A 3WHLA 3ND9A 4IFBA 1N6LA 3CRRA 4I1OA 1KO7A 3WBJA 2Z0MA 4IOMA 3ZDQA 1RJ9B 5D3MB 3H0KA 2C2HA 3VR2A 4IOKA 3BOSA 2EFDB 2IEYA 4AI6A 3K09C 1UBFA 1Q1EA 2YOFA 1JJVA 4TL9A 1H8EA 4HLQB 1T8TA 2QPAA 4HDOB 5BYKA 3NXSA 4J0QA 2OAQ1 3TR5A 2H8KA 2R44A 4PSKA 1X8JA 3F8TA 4GDFA 4I4LA 4A8JC 3GLFE 2CMKA 2ZU0C 4NKRA 1ZAKA 3ZVLA 3L0PA 1K5DA 2FE4A 3W5IA 2BJVA 2IS2A 3FHOA 3SFVA 2ONKA 2A3RA 4GSYA 5TB5A 1I4LD 2KWIA 3QIAA 1KJYA 1XTIA 1W0KA 5HKKD 3LV8A 2YOHA 5AJZA 4NCKA 5CLQA 1QRAA 1IBRA 2F9MA 3D6TB 4WXPA 2ZXUA 4MDFA 1IXZA 2KE5A 3FB4A 4MRRA 4A2WA 2XTZA 2J0QA 1NMXA 4NU0A 3QXXA 4MYCA 2QE7D 4BPBA 3X1XA 1AZTA 2FA9A 4BE7B 4GBMA 4Q4LA 1YE8A 2QU8A 2C04A 2F43B 1DAEA 1MKYA 3I72A 3EX7C 2EWWA 2GA8A 2AD1A 3PUWA 3SR0A 3EPLA 3Q7QA 1ZD1A 4HZIA 3IIJA 3A4MA 1II9A 3I73A 5JEEA 2C8VA 4JT4A 3W9YA 4PR0A 2VSFA 5FI1B 2UZIR 5KPDA 1EWRA 3K0CC 1UKYA 4P33A 4NHOA 1ZMXA 3DM5A 3AVVA 3ZS8A 3SFZA 1G4UR 1R5BA 5DI3A 1AA9A 1EFRD 1G7RA 4ZIRB 1W36D 1Q20A 1R8QA 4PHHA 4AYWA 1MO4A 4HATA 4F91B 3WY9A 3AKYA 1FUUA 4B43A 3CNNA 1N6KA 4NCJA 3THWB 1P73A 4QXAA 3OEHD 4FWTA 4KFTA 1SZPA 1CTQA 4D6PA 5FPSA 4IVQA 3NEJA 3CONA 1WCV1 2BKEA 3KFVA 1DO0A 2IUUA 2B7BA 2OBMA 1XPRA 1ZUIA 4PC7A 1NI3A 3AF0A 2ZPTX 4D26A 1XB2A 1KI2A 5BWMA 1OIWA 5G41A 3NH9A 2BJWA 4EKDA 4ZDKA 4MKGA 1HTWA 2BCJQ 2ORWA 2RAPA 1IJFA 3NBFA 1Q21A 1NBME 2O8EB 3K70B 4TMZA 2OBNA 3RHFA 2H16A 4XD7A 2WV9A 4XVUA 4M4SA 1R8SA 4RSGA 5AUNB 5E3HA 3I8SA 5KU1A 1KDTA 4URVR 1R6BX 3CH4B 4TYQA 1BOFA 3ASZA 4D4MA 3LRPA 5H8WA 1OH8A 2QE7A 3V00A 3K9LA 4CT4B 4RFSB 4JVNA 5DYGA 3TAUA 3R9WA 1DAHA 3IEVA 2ANBA 3THXB 4DVGA 1M74A 5GVRA 4D82A 3I5XA 3T35A 2ZRLA 4A0GA 3LD9A 3GLIB 1EFTA 4LC1A 1ZM3A 5JWOA 4DCUA 1KK3A 4RVCA 1S9DA 3SHWA 4ERNA 1KI4A 4K81B 2J1LA 3HJNA 2PCLA 5CIWA 1YZKA 2DFNA 2ZRHA 4IXMA 1CR1A 221PA 4KODA 1KNQA 4QGAA 2EWVA 4RCYA 2Q9CA 4EPTA 2R2AA 3L0OA 4S35A 4JBWA 1ESNA 5LPNA 3EZFA 2ZJ8A 5JZVA 1T0HB 4CT5A 1DVRA 3B1ZA 3BGWA 2PT5A 4FMDB 4TT3A 1D9ZA 2FSGA 1C9KA 4RD1A 821PA 1NRJB 1G1MA 1I2DA 2P6NA 3SJAA 4R71A 2RGNA 4MQBA 2AL7A 4M9QA 1GDDA 1ZM7A 5FI0B 4XWOA 3GJXC 2QENA 1GFIA 2XEXA 3S1AA 3CRQA 4OJQA 3NHAA 3A58B 3T1TA 4GNKA 1G18A 3CF2A 1ZM9A 3EIEA 4EPWA 4B2PA 1XJ0A 2YWHA 2ZETA 3A1WA 4HAVA 2ZI4A 1WXQA 3MUFA 1GP2A 1Z0AA 4F4IA 1F2UB 5KDDA 3GLGE 4GZLA 5CJPA 4DDTA 4TLEA 5B64A 3PUXA 1UKVY 4I99A 2H18A 3WMFA 1PLLA 1MRNA 4EFMA 2PBRA 1W4RA 4FWIB 5G53C 3CPEA 3LO5A 1JI0A 2JCSA 2B92A 5TARA 4E09A 1OKKA 2A30A 2GF0A 4WA7A 1E94E 4U5XA 4X8MA 4KXFB 4Z51A 1DO2A 4LBYA 1G8GA 4V0NA 3K53A 3CX8A 4UJ3A 5C2JB 1L7VC 1SXJE 2J0VA 3CPHA 5B58C 2ZS8A 3PIRA 1E9FA 3BJIC 3BFXA 3IEUA 1R5OA 1TX4B 2P6UA 1IN8A 1OFTA 4MKIA 1WE2A 4WVFA 1D2MA 2BCGY 2HCJB 3A36A 1TQ2A 1E79D 4PPNA 4Q4HA 5EE1A 2GAOA 4AC9A 4I1VA 5EUMA 4DLSA 1XNJA 4P32A 1KTVA 2J3EA 3MGCA 1LTQA 4FIDA 3QUSA 3H2YA 4QBHA 3U3OA 1MR3F 4PPFA 1NSFA 2QA5A 3B9QA 4GOKA 2P5TB 3FMOB 1S2MA 4KYUA 3CM0A 2ATXA 3ND8A 4H1VA 3GMTA 3RC3A 3EIHA 2CJWA 2XITA 4NDZA 1ANKA 3AKEA 1E2DA 4X8HA 1XCGB 4Q9LA 4ZCLA 4B6EA 1X1RA 2HLDD 3KXLA 4DDVA 2GK7A 3GEEA 1JALA 5BN3A 1E98A 4W5HA 1OYYA 1UKEA 4R7ZA 1U98A 1TQ6A 3K0EA 1SKQA 3KFXA 4B2IA 2VP6A 1CR4A 4L16A 4LDJA 3QVUA 5F2EA 3T06B 1Y3AA 3JZAA 1ZCAA 1WA5A 3M6AA 3MLEA 3HPQA 4GOXA 1ZM4A 1XEXA 1DG1G 1KSHA 1NKSA 3DKPA 1Z47A 5DHFA 1G19A 2VO1A 2EYQA 1LS6A 3W6PA 2LKCA 1O3YA 1OH7A 1U9IC 3JZMA 4KCGA 4DLZA 4KLZA 1UAAA 4IW3B 5P21A 2AXPA 3VR6A 1E9BA 4C4PA 1QHNA 3G0HA 3AVUA 4IDQA 1G8YA 2QZ4A 4QL3A 1TTTA 1CJTC 4YC7A 1HA3A 4PAOA 4LHZA 1CJVC 2XJ9A 3AUXA 1YZLA 3PJRA 1E32A 4PFSA 1SXJC 1D9XA 4FN5A 3PEYA 2O8DB 3Q9LA 3TBKA 2Q21A 3UG7A 4NBSA 3PR1A 2KSQA 4F4JA 3V4FA 3PFIA 4QJ4A 2X8AA 1NL3A 4OQFA 2NPIA 4M21A 2Z4RA 2GVZC 4MRVA 4L5BA 3UANA 4HAWA 1IONA 1G5RA 3N5CA 3Q8XB 3H1TA 1J8MF 1DAIA 2XX3A 3CRVA 1OH5A 4XD7D 2ZANA 1TAGA 1M7HA 3MRSA 3ZD7A 2RKOA 1AQUA 3B9PA 1KI1A 4ARZB 2GRJA 2JJ1D 2JIZA 2IEZA 4WAUA 3I92A 5BYJA 4AIIA 3NEYA 3ADKA 1XEWY 4PO1A 1NLFA 4M1YA 5TVKA 5CDFA 4EPXA 3TLXA 3KQHA 2PMDA 4PSAA 1VYVA 3MJRA 4OHXA 4C0SA 3EA0A 1ZCBA 4D80A 3KL4A 2G6BA 4M22A 2C9YA 2PZGA
chains in the Genus database with same CATH superfamily
5C1OA 2H1WA 3VBEA 1ZCFA 1ZU4A 1W5BA 2HJVA 2MDTA 5G40A 1M1YE 4TSKA 4F8YA 5HQ3A 3WAGA 3O2NA 2WKWA 5HK9A 3O8LA 2W43A 4JIGA 1V16B 3P2MA 2XNKA 4O63O 3KWFA 4R1LA 3OPYI 4RY0A 5EHXA 2FN9A 4FILA 4IIJB 3NKVA 2B0JA 2Q46A 2ZUUA 4YEDA 1Z7GA 5EFOA 2C61A 2DTXA 1DAFA 3WIUA 3FFAA 2RONA 2E5LB 1BVHA 1THMA 1G63A 4PM4A 3RLIA 4B7XA 5JH7B 1EAMA 4ALLA 2QNBA 3D43A 3D7KA 1IM2A 3DT8A 3HI4A 5CK5A 3EDCA 1EP2B 3KLNA 3D3JA 3IALA 1DRVA 1GR0A 2YJTD 5BQFA 4RVNA 1C7EA 3RFFA 1LLFA 3U9TA 1NC3A 1NW4A 2FZWA 1GCIA 3V2IA 3TKYA 3NHZA 5JAPA 1F0NA 2Q3MA 1E6CA 3FBGA 4Q7EA 3L82B 4ZVNA 4UE2A 1U2PA 3F3KA 4ROSA 4K9NA 1G3QA 2I8AA 4BFZA 5F1KA 3X1WA 1DV2A 2E9SA 5HJ7A 5AVVA 3HV0A 2FEKA 4QNRA 4N41A 5KYUB 2XMRA 1VA4A 3EF0A 3OZBA 3Q7SA 3Q6MA 4BZWA 1WEHA 1K6EA 3FKSA 4MV1A 1ISGA 3BG5A 3GFTA 3GUVA 3R3JA 4AG5A 2EBUA 4EUSA 1DJLA 4C6TB 2RI1A 3MA0A 2BF7A 1NJ1A 4OATA 4AD8A 3GU3A 4AS2A 3FA2A 4XSGA 5ITVA 3OZGA 2JLWA 3FMFA 4RUKA 3MB8A 4IUYA 3N3BC 4KV9A 3UJBA 1V7ZA 2ABWA 2HV9A 5LM3A 1QH1B 3MM4A 2I6TA 1XLWA 3EGWA 4EUKA 2XVZA 1M8GA 1XPOA 3FR7A 4FFSA 3SD7A 4EA9A 1SBCA 3RRNA 2ODNA 4CDRA 3HBLA 1Q95A 3ZIDA 5IKEA 2AFHB 2O6LA 3CT6A 1VHQA 1CJUC 1JIKA 4G09A 1JRLA 4FC6A 1DC4A 1BGVA 1XRRA 3KTAA 4LC0A 4YREA 1MGOA 2X4IA 3E8XA 3WO0A 5AKJA 1IB6A 1ZUD1 4C0QC 1X2BA 2WPNA 2VT3A 3IDQA 2YZ2A 1MO5A 3JAKB 5K3AA 4DMGA 1OAAA 3TGPA 3D7SA 1DQPA 3A2MA 1G20A 2VDLB 3I58A 3H6KA 5JG7A 2B7LA 3W7BA 4ZT4A 3ZHZA 4Z54A 5LOVA 3CLTC 2A7QA 3H3JA 4DSAA 3B5JA 5DGTA 2NVUA 3VTFA 1QUFA 1SOAA 4UBLA 3W0LB 3ZYCA 2ZUEA 1MH1A 1KMCA 1MX1A 2AX4A 1KSJA 4HGYA 1RYMA 2ADOA 5H5JA 2FPMA 2HM7A 1QJ4A 2QUHA 4JJ4A 4BVGA 1UBTS 1IHDA 2DPGA 4IG4A 1XU4A 4CE6A 3VU9A 2NOAA 4UOZA 4IBOA 4OBXA 3A7EA 4DDUA 1XX6A 1W47A 2OBLA 1QZUA 1NVFA 2W6ID 3DEAA 4NJEB 3SM3A 4BFYA 5CDGA 2C57A 3ABIA 2BZ1A 4ENWA 1K86A 2QV0A 1HKUA 2IEAA 4ZVOA 1QO0D 2HAEA 3K1TA 4Y2RA 4AKEA 2BJHA 2AV6A 2WA1A 5KB3A 1N5JA 1SXQA 4IQFA 4Q4JB 4BV8A 5FPHA 4G1EB 1BX0A 4G1MB 2XXAA 1S5PA 3H05A 3LCRA 2WFLB 1K3TA 1XA0A 3JQRA 3CISA 3LPCA 4G41A 4KDEA 2HT1A 2BGGA 1CP2A 4NMMA 5LNK6 4Q00A 1NSYA 1FTQA 3BXHA 1DX6A 1EFCA 4PCAA 2QX8A 4BECA 4MWGA 5IAKA 1HZZC 3UOAB 3P2OA 4OREX 3V3TA 4LZLA 3WGOA 5AICA 3WIOA 5A03A 1SXJD 3MFQA 4NMHA 5E1DA 4E2FA 2B2CA 3GRCA 5ER6A 1RMQA 4LXGA 4B2LA 2PH5A 1HT1E 1ZA1A 1VZ2A 2WF8A 3O0TA 1Q50A 2B9VA 2HHAA 4NYMQ 2AOUA 2V59A 3ZZMA 1B6GA 4JLAA 4N7RA 4BO8A 4CKBB 4IILA 3DD5A 5KWIA 3HJFA 3R9XB 1NVKA 2COKA 1VHDA 3NWJA 3U7GA 1R2QA 4JL5A 3LU1A 1YVUA 4P7KA 3AUKA 1I4DD 1JUDA 2VRCD 1UM9B 4G3XA 1GRCA 3NVMB 3G59A 1NU8A 4B34A 4JSYA 2C54A 4RHEA 3CSDA 4G5XA 2R6FA 2J5QA 2QR3A 3W05A 5AOVA 3W2GA 1W9HA 3HABA 2IOQA 4ENTA 3E8SA 2DC1A 3O8BA 5LL6P 2HBZA 4R05A 4WXMA 2LGJA 1AMUA 3M9LA 3SC2B 3K92A 4IJMA 3HG7A 5FDFA 2QI9F 4MS1A 5G1OA 3QXCA 3QPAA 4CL2A 1AGRA 1Z08A 3GN1A 4LJ7A 3OURA 4G1VA 4BFUA 4LV6A 1UWVA 1JYSA 4LGMA 2LCIA 5B6PA 3A04A 1I94B 4O29A 3KSDO 3L9WA 2ZIEA 1ZL0A 1V9LA 1SEVA 1HGXA 5HM6A 2O6HA 2JAHA 3V8EA 1NY6A 2N47A 4H4DA 4XH9B 3AXSA 4O4JA 3BDAA 2JJ2D 3BYZA 4G0ZA 2NZWA 1JQBA 2V0NA 5E38A 5CIQA 5IBRA 2JD2A 1U3UA 2I0FA 5F33A 1K7SN 2Z58A 4IHJA 4ER6A 2O52A 4RJIA 2HA6A 3K5PA 2DM6A 2BY4A 4URWR 2NUTB 4DL9A 5U4XA 1KEEA 2N0SA 1D8TA 1B1CA 3HCOA 2OV6A 3PJEA 2Q2OA 2V58A 2F9LA 4HY3A 5I9MA 3V4SA 4IGEA 2MTBA 2VBIA 4MCIA 4C7KA 1Z4PX 1PNTA 2Q4BA 1L4GA 4H0CA 1VKZA 2VPPA 2HA0A 2J5XA 2YV1A 3WGVA 4S1TA 1QRUA 1TD9A 5KUTA 1QP4A 1RI1A 1WF6A 4NCIA 4JLMA 5IJ9A 1JDUA 1DADA 3V1UA 1CKEA 2AI1A 3KQUA 2DBVO 2CLLB 3KSZO 5ICGA 4M54A 1XQVA 2WTEA 1U0SY 4QQNA 1O96B 3OX4A 2I4MA 3CE9A 4HB0A 4OJKA 1RXWA 1V3UA 4A7PA 1JXQA 4GYWA 3IAUA 3WP0A 1KETA 1I3MA 5AFSA 4I5IA 4TXJA 1ZHHA 1UBCA 3PQ6A 3FMIA 4LAFA 4GMDA 2DTDA 1OXMA 4E6PA 4JJ8A 4AG6A 1XJ5A 3OMWA 3FZYA 3I4FA 3LY8A 5CB4B 2WSMA 5JWRA 1YVRA 5JPIA 3PG5A 3VTZA 3DOIA 1BFUA 1I6LA 4CM5A 4DMMA 5EJ6A 1N8TA 2FR8A 2FUG6 3MTDA 3OJWA 4ROTA 2GVNA 1EVIA 2Y0EA 1YIOA 1E0KA 1SK9A 4K8OA 4MAAA 4MP8A 4QDTA 5SZKB 3SYNA 4NCXA 4WQMA 1DTSA 4COOA 2W6ZA 1XL1A 4HJXA 1RLIA 2VNIA 3L7MA 4HUQB 2ZFUA 1MQ9A 3HUDA 1UQRA 2BKAA 3IGFA 4F21A 2DBZA 3LY5A 1FS5A 3CX3A 4INZA 3IE1A 1RC8A 2XVYA 1HDIA 1RYHA 1Z5OA 3PUYA 2J6CA 5LMUB 1NJ5A 3S70A 3CLUC 5FWYA 2WJJA 3KT0A 3RRMA 1YUMA 3TZBA 2YCBA 4NAHA 4FB4A 1AHIA 4G23A 2ZUTA 4BNDB 5TJ9A 1RQXA 5EIEA 1QTNA 5JSZB 2XQJA 4IJUA 3RFVA 1MUUA 3UMCA 1ID8A 1UKZA 3RTEA 4TTQA 3TJMA 2ECKA 3VNUA 1GSHA 5FUBA 3OY2A 4Y9SA 3WLSA 4RFLA 5KOIA 2JW5A 4O8CA 1TIKA 4U7PB 8ABPA 2CY0A 2OZLB 5B7NA 3HK2A 2FH5B 3O8NA 1ODTC 4O0MA 1TLFA 2B1QA 3KUKA 4FMCB 4OK5A 1U6JA 3PQ8A 4Y67A 1MQAA 3RBZA 2Q6LA 1JKFA 1QB7A 4QEDA 3EVEA 1WXGA 4B33A 5BV0A 2BFOA 1AKNA 1EX7A 9ATCA 2Y1LA 2YTZA 1H2RS 4NJOA 4XQ9A 1YA4A 3OEWA 4D8XA 2ZBFA 1QKIA 4FQ7A 4LTNA 3QYJA 3PPWA 1RZRA 2GPTA 2IH4A 2AN3A 1USWA 1KH2A 4JB2A 4X0EA 1QCZA 5JD6A 4IOLA 3SI7A 3UHAA 4CDMA 4QPJC 1WQ4A 3PLAE 1AQLA 1TVMA 3WSTA 5IEJA 1NT4A 4LRYA 3ZY2A 2SCUB 3K9WA 4EBFA 2R8OA 4UAJA 4O02B 4EY8A 1KOJA 1Z5VA 4RSHA 2ZB2A 1QHHB 3EXHA 3P9RA 1O77A 1T2FA 2WIDA 5DT9A 5IN4A 2HQOA 1B43A 4G0PA 3LQ2A 4ND8B 4RVOA 3UJNA 1E1NA 1L3IA 1NV9A 2X19A 3H9GA 1IIBA 3T9CA 4Q12A 4GLBA 1SRQA 3WO1A 3EGVA 1U3FA 2EJCA 3LP8A 5TMBA 3BIFA 4PN3A 4C2TA 2ZR7A 2DXIA 1SIUA 1XXLA 1S01A 3MMPA 3EUFA 1O89A 2FGJA 4E14A 5KSOA 4HNQA 2OXTA 5LP6C 3RSOA 5BMOA 3EFHA 1T5BA 3PX3A 3LQQA 2HTFA 4LCBA 5THXA 1IMJA 1CUYA 4L85A 4GP6A 3W7VA 2QJOA 5KWJA 1GGJA 1TE2A 4EQ6B 1NGSA 2RH8A 3TCNA 3V7FA 4RQBA 1CQJA 4E30A 5DOVA 4DLNA 1QZZA 1SCIA 4ZK2A 5C4MA 1YRLA 2FTKE 3M8KA 1EMDA 1ZK0A 3BGVA 3TNJA 2AMJA 1K27A 4FSHA 2YJGA 1CEEA 2ZT7A 3L8HA 1PQYA 1NF9A 1N5DA 2AZMA 2FR0A 5JBQA 1VJ0A 2J5KA 2IC5A 2OCDA 2WEKA 3VI3B 2FY8A 4GLFA 4RCVA 4ARSA 4AQDA 3CFYA 3GRUA 5IAAA 2J0SA 2QLTA 1WB9A 2C84A 1TZKA 2VAPA 1JXMA 1Q0HA 1FX0B 1Z7BA 2GNAA 1ZJ6A 2VHJA 3A0UA 2IBMA 3O1LA 3SN6A 2F62A 4BNDA 4YV2A 2P6OA 1C9DB 3R9XA 2JAQA 2BM1A 5JPCA 5E7IA 4CF3A 4U3JA 3L7LA 3C6BA 3G82C 1FDUA 4X3OA 4X91A 1F7VA 3BUSA 1SXHA 2L17A 4B81A 3D1LA 2R6JA 4LFCB 3EJ6A 1MOZA 3LPMA 3IR5A 2VRCA 2I3AA 2NP6A 3Q3GE 2EAUA 4U8GA 4MHTA 2ID8A 1KU6A 1KY3A 2I87A 4K5QA 4U02A 1V8ZA 5D3MA 3TSOA 5I4IA 4HVCA 2VDVE 4IF6A 4MR9A 4ZCMA 1XAHA 5ADUS 2IHYA 2J9ZB 5EQDA 1MB3A 3BC1A 3DFIA 4YRDA 5LZ9A 3K16A 3KZOA 3KZCA 3RUPA 5IVIA 3P9QA 3CWQA 2QQFA 2W2QA 2RH9B 2BUBA 3O4GA 4NYMR 4F2HA 3FSGA 2FMKA 2ZSHA 2ZWAA 1UBMS 5DYWA 4FFWA 1JU4A 4NULA 3L84A 5A9RA 3COYA 4V0OA 3VR4A 1N7HA 2HPHA 3IQZA 3IXMA 1CVLA 2WM9B 4PO8A 2X5XA 4TLLB 3W8FA 2PSSA 1AF7A 1R7RA 1Y6ZA 1W4BA 4X1YA 3UJHA 1ZVVA 4RDCA 3E7XA 3HCDA 4IJ6A 4PBSA 4TYNA 4L08A 5FR1A 2IYSA 3URKA 2XH8A 3G5LA 2CJXA 4BUCA 1E3DA 4XPZA 4TS4A 2MR6A 1Y1PA 4DIDA 2QMZA 4Y7CA 3AOEC 5EXTA 2VPXA 4U9UA 5FAKA 4WH0A 3AUYA 2ZIFA 4CBVA 2YY5A 5JD5A 4MYRA 1D6SA 1W0KD 3CBQA 3GQBB 2AFRA 4AN0A 3I23A 2VOJA 4DMCA 1TGYA 3EMDA 5KSZA 1RPNA 4WEOA 2GEFA 1SB9A 3ELBA 5JISA 2B8EA 3R7AA 1VHLA 5AKGA 4BLPA 1YOVA 1TM5E 4FN4A 4BBJA 2C1XA 2C78A 2WWXA 2ZE5A 2QY9A 3QOXA 1LPPA 3FXAA 3QVVA 5F7OA 2JLZA 4ARBA 4BO5A 3E48A 4KQ6A 4ZFNA 3MXOA 2ZRGA 2VQDA 1ZR4A 3OZUA 1KRXA 3I45A 1AMNA 1LWNA 4DREA 2D54A 3B13B 4J0DA 2ODEA 4K87A 3NDJA 4OAOA 1P1KA 1Z5WA 1C7ZA 4PGHA 2FR8C 1L8QA 4YJHB 5TS2A 3WIVA 2QTFA 2QRGA 2YY7A 3DEHA 2PL3A 3DT9A 4J3NA 2ORVA 4IMIB 3EYWA 1RJWA 1YJ5A 2J31A 2Q8NA 1IZ8A 3RU2A 5A4KA 1JBQA 2R1TB 3BAZA 3PF9A 4CU2A 1GV0A 3ONVA 3PEUA 3T7KA 1JJIA 1YL6A 1X1SA 4BGUA 4NZZA 1E8MA 3QW2A 2EVWX 1I14A 2ZT5A 3PHCA 3R4CA 1EXWA 1JJBA 5DB4A 1V71A 2BRUA 1ZNQO 4NXNB 2O8CB 4RLSA 2ETXA 2XNCA 3OETA 4LHXA 5REQB 1V25A 3X1KA 4CM7A 1COZA 4DV2B 2AJCA 3MBIA 1HM5A 3BEDA 3GG9A 1MNQA 1R18A 2ZJ6A 3CWZA 4XCXA 3R0IA 2QVYX 1NBIA 1JDZA 3AP2A 3HWRA 4GOLD 4ZAZA 3VYRB 3MHTA 4PCUA 2H63A 2Q1UA 3QEMA 5BQ3A 1W5AA 1I7SB 1D7OA 2EKDA 5KYTA 1TO1E 3OM1A 3ACBA 2IEDA 5JNLA 5EE9A 2Q07A 4QVGA 1O9BA 3T7CA 3MRXA 1E7WA 1QTIA 2D00A 2YYAA 3TKAA 4QM6A 1H5QA 1WLYA 2GS9A 4RLQA 3PK0A 2R96A 3FPSA 4DEVA 1THZA 3ZHCA 5K3SA 4PCLA 3NUGA 4DTIA 4YYEA 4Q1DA 3ZQUA 3HTXA 1H3FA 1PKEA 4LNUB 4PYNA 4F97A 4RTQA 2VIIA 1A96A 2YJ6A 1J09A 2XGMA 2YASA 1ULZA 1BJRE 4LJ4A 1BWSA 3B1YA 4GUAA 3BWCA 3KELA 3HKDB 3JQ6A 3CJQA 1ODFA 3KBBA 3HCCA 1ZPDA 3UHFA 1GKYA 5B7PA 3FB1A 4N3NA 4U6QA 2AR0A 1UEXC 2YX1A 3CB2A 3KR1A 3ODGA 1R74A 2X40A 1CERA 2BSAA 1X2EA 4REQB 5DYTA 5JADA 3GMSA 2XWQA 4KDRA 4IG9A 3HO6A 1KYQA 2JRLA 3EVGA 3H86A 3KC2A 1YS2X 3OU7A 4LHSA 3GJZA 4XM1A 1YK0A 5DEIA 3HKBA 8MHTA 4AP9A 1MAHA 4R1PA 5LD2C 2B2NA 1EAYA 2GHQA 3GGJA 1VIDA 2W0MA 4NBLA 1QS0A 2W2NA 2YINC 4YQFA 4U2FA 1U0GA 5JZBA 4G0UA 2VJBA 3NWBA 1Z07A 4N9WA 4MKZA 1VRVA 3ICVA 3NGMA 3HA7A 4BMPB 5IPFA 4JOQA 5CX4A 2C3UA 4KO4S 3NJ4A 4BWFB 4RY9A 3WYDA 3L6EA 2VYNA 4HSGA 3O8CA 3L4EA 5IXJA 3LXUX 3TTYA 1I4EB 4V0RA 4DC0A 1E1YA 3JWPA 2ONJA 4BDSA 2B99A 4O4LA 1PZNA 4WJZA 3PQCA 4J7XA 5IAGA 4BEJA 1QORA 1H0SA 1ADBA 2QRKA 2ZDGA 3DL0A 4EF5A 3GLFB 1XRNA 3L6OO 1QK3A 3QE4A 2QUAA 3GA5A 3JCZA 3AIKA 2FPGA 2JFZA 2O3UA 1YOVB 2B8WA 2Y6UA 1EBFA 3K2QA 3KXPA 3MRTA 1ZOPA 3BDVA 3NI2A 1F60A 3JR3A 4GR4A 2O8NA 3WKDA 4JOBA 2H4JA 2W5UA 1WZCA 1Z9BA 1QGED 1QIGA 3DL7A 3TF5A 2Y2UA 4CG2A 4OP1A 2NUPA 1ZX1A 3IKLA 4D9KA 4GZMA 2XQKA 1ECGA 3K4QA 1Z68A 5TR9A 4D0GA 3ELYA 2WPDA 2XPCA 3W9BA 2OHIA 4BMVA 1JHRA 2A0FA 1UPCA 3W2IA 5KKCA 3L4JA 4DB4A 4PYIA 5F12A 1J6UA 3H5RA 3R3UA 3TUIC 4Q47A 1G38A 2J41A 4FGLA 4J0HA 2AH5A 4PPYA 3OFKA 3VZRA 3ZEAA 2FOXA 2ARKA 1BIFA 4CM4A 3HWWA 4ZDWA 5C3MA 1T1IA 1PHPA 3TRJA 1KTIA 4RH3A 3G23A 2IUFA 4NPCA 4Q0MA 4NYJQ 2GBIA 1DPFA 5GZ1A 2BFWA 3G0IA 1XZLA 3F4LA 3G13A 5JNSA 2FV8A 1PJ3A 3LBYA 3NBXX 4KHZA 4I0WB 4YWJA 4F86A 2GXAA 4IWXA 1RSZA 5CK4A 3WRXC 5CHEA 1AM4D 3T95A 3CCFA 1W6RA 1MNAA 4X1KA 4KQHA 4PQGA 2VOEA 3LVBA 3SYLA 4YV0A 5E4FA 5MFZA 2BFMA 5JS8A 2XZDA 1YK1A 1YZNA 1F06A 4RGYA 5L6LB 4QDXA 1S8AA 3IEMA 4LHWA 1UPXA 4OBBA 1FK8A 2EG5A 3QPCA 2PS0A 1CNMA 3DR3A 1AS3A 3V1MA 1QB8A 4BC1A 1R5JA 3C70A 4K6CA 4RD3A 1JAZA 1N0UA 1GCAA 1TK3A 3HNPA 3HWSA 4J03A 2J9YB 3N0WA 1LNSA 2QW8A 4R2LA 3V8RA 2P68A 2Q3CA 4NEQA 4YRJA 1IVNA 1J22A 4WLOA 3S1SA 3A4IA 1OILA 1CB7A 1XP8A 4DV3B 1A77A 3T34A 1RYEA 4FR5A 4FOSA 4U1RA 1XEAA 3OE7D 3BMNA 2R6AA 4NZMA 4IVRA 1GNTA 3QVXA 2ZJ4A 4LZAA 5CGQB 1VIAA 2XRFA 3M6FA 5J4VA 2UVPA 1BMFD 4FK8A 1P9OA 5BWNA 1BKDR 3G02A 2Y1FA 4PTLA 4UHJA 4EGQA 4EG3A 3GUYA 3P0FA 3JQAD 1UC4B 4MQEA 3EF1A 4QT0A 2HOQA 2XUKA 1FX1A 4D96A 2B6NA 4GWGA 4FFNA 3HUFA 4G0NA 3A3YA 3TFOA 4LF4B 4L02A 1FF9A 3D02A 3UGQA 2O8BB 4NOMA 1Z0JA 4PFKA 3JQ7A 1O5TA 3FZQA 1OXKB 3FIUA 3RU9A 1DIGA 1XTJA 3V4PB 3ZNOA 4GXRA 2EEPA 1OWLA 3A7DA 4HHEA 2C3PA 4OU4A 3THSA 3KQOA 1MPXA 3MIZA 4I6EA 3HSSA 2I65A 4KPUA 4AROA 2UUCB 1C3JA 1Z7EA 2P6PA 1L3BA 3F5DA 2JGAA 4ZZIA 1DV1A 4XFJA 3V8VA 3N07A 3RS4A 1KY2A 2VUHB 1G1AA 2A9QA 5FB3A 4CMKA 3AP1A 4PN7A 1JSLA 2P2ZA 3FETA 3K5WA 3H9UA 5AYVA 3TQQA 1NJGA 4A3SA 3ZHVA 5B55A 1FFWA 1AB5A 1KC1A 1ZC3A 3MBKA 3VKWA 5A06A 3WNBA 1FCJA 4LVNA 5AVRA 1QKKA 1TADA 2Y1OA 4UQPA 3H5LA 2F43A 5DN9A 4XIYA 2H08A 3L1KA 5G0UA 3UXYA 3ZV5A 1I3NA 5H9WA 3INYA 4ALJA 4BIIA 5HKOA 2O8BA 2BEWA 5HVNA 2NU6A 4XWAA 3BE6A 5IFLA 4RWZA 5INTA 1W96A 2V8OA 5MGBA 4R9UC 4LNAA 4OMFG 1RPZA 2X5NA 3ENNA 1SVOA 4MEAA 2PTHA 4F3TA 1ZK4A 4ZU6X 3FHJA 3BQ9A 3V46A 2XWJI 4RPIA 1T4DA 2XCOA 1SBIA 1CSEE 2WHQA 1Q12A 1YIAA 3F9CA 3LDFA 3ZV7A 2IXGA 1A3CA 5DLPA 2MWMA 1Z83A 4PNHA 1QNLA 3IS3A 2Q1SA 4PQEA 4MUYA 1SVUA 2ZYIA 2AFHE 4TVOA 5AM1A 4CVNA 2KM1A 1ZSVA 1QC5A 3FZEA 4KE7A 3WL7A 3Q0EA 1KF0A 2JJQA 4K6KA 2QP9X 4YECA 3Q6NA 3MAGA 2O8EA 4BGIA 3QLTA 2IYFA 4PSVA 5LZ5A 4DUGD 1HQYE 4A23A 1N5IA 5I4BA 4MWEA 3KR9A 3S40A 1WUHS 2Q5LA 1NKVA 5FADA 1EVKA 2HMSA 3BEOA 3FDIA 4X1IA 4P98A 5F73A 5H3LA 3SQMA 5EHQA 3MTQA 1ZSNA 1TZ2A 3RFCA 4YP6A 4CR8A 1NR1A 1IQ0A 2CLOB 1UT8A 2JFBA 1K92A 1P5RA 1A5SB 2FRXA 3BJRA 1AS0A 1UINA 2C8JA 2I71A 4US0R 3WSWA 1WPQA 1ZRNA 2ZJ5A 1TJ5A 4IV5A 3DWIA 4I9GA 3DC7A 4WCFA 2IZ1A 5CA0A 3VGJA 1I9GA 1XNRB 1GU7A 3OM0A 4LMAA 1TKCA 2NU8B 2A88A 4NMLA 4GXNA 2N1BA 4XM2A 1JLKA 3U37A 3X1ZA 4Z3OA 1BX3A 2VNSA 3BIJA 3GFBA 3ZU6A 2IS6A 2BISA 2BEWB 4EHIA 1Q6ZA 4RPKA 4A6EA 5GADl 4E22A 1KMNA 5PGMA 1TCBA 2Z1MA 4M8NE 2X1HA 4DA7A 1NASA 3DVLA 2VDJA 2BEUA 4KBFA 3G88A 5GMOA 1DBIA 1K4MA 3CNBA 1HOXA 3ZH9B 4Z49A 5CDTA 1L5ZA 4UM9D 1KE2A 4CDNA 4X20B 4AJKA 2FETA 4MKHA 1CWUA 1O96A 3HDHA 4OVKA 3WNVA 1XJWA 5AJWA 4F1KA 2PTGA 3ZHUA 2P3OA 2Q0QA 3EOAI 3PJFA 3L4SO 3GLRA 2J4CA 3KQVA 1P1HA 4EELA 1Z3IX 2ST1A 3SQXA 1E6EA 1ZYUA 5FTLA 5DNCA 2J6BA 4I8DA 3GG2A 2OR3A 2SHKA 1WBBA 3ESBA 1FW8A 3CR8A 4QO7A 3WLPA 4GI1A 4RETA 2EARA 3AR4A 3GUZA 2BR4A 3DOCA 3L6RA 5LC1A 1W34A 1DZIA 1Z17A 2AUTA 4ZI5A 4L9SA 4G5FA 4R8SA 5CR9A 1RQNA 2VDNB 2CWDA 1FUKA 2AZ4A 3FHLA 4XX1A 4ZQGA 2FMFA 1Z36A 1UP4A 1FTWA 2O4UX 2E4WA 5TGZA 2ETVA 1YS7A 1Z5UA 4KLRA 1SVWA 4ZREA 2JLUA 3MTGA 4A03A 1W8IA 2G9UA 2OHVA 4EF4A 2GJ8A 3OOYA 4O2LA 2B2XA 1Q6YA 1PL0A 4HOYA 5EWMB 3JAWA 1U8AA 1J42A 3QFRA 1VCIA 2V65A 3SGLA 4B8YA 1OBFO 1K8XB 2SICE 4JLUA 2V0GA 3L4KA 3DNFA 3ESAA 2QPLA 3QVLA 4G9GA 4BO9A 1ZNYA 4LXIA 4C2BA 4HMOA 4Q16A 2P0AA 2RJNA 2W6IA 2Y4NA 4PPGA 1UDBA 1U2RA 4AZTA 2BLNA 1T3TA 1QQAA 3I6YA 1NUQA 2J09A 3VOSA 3QF4A 4OUKX 3UJ9A 4C87A 4EABA 1NPTO 1SRRA 2V6JA 3ACDA 1M8FA 2AG1A 1J39A 2FRDA 1SIBE 1NURA 1Y4ZA 2VAVA 3GEIA 3KETA 4ND5A 4P9NA 2DETA 2JJ1A 3PA8A 4HGZA 4CWAA 3TI7A 3T5BA 4FDVA 3EG5A 4YJ3F 2XUOA 1UWLA 4LA4A 4XTCS 2NO1A 2X8JA 5IC6A 1BW9A 5EJAA 4E13A 2R86A 4RFVA 3IAS6 1IY0A 5D6OA 5JTTA 4E2ZA 2HNBA 1JGTA 2BVNA 4DA6A 4N6OA 3DMTC 2KLBA 3UKJA 1X9HA 4H0NA 4B7CA 2G77B 3H99A 4W6QA 5DV9A 3RS0A 3Q3JB 4G5RA 2WMYA 4UHCA 5CYOA 1URPA 2OCYC 5EPOA 2WM2A 5FT9A 4P3KA 4PAWA 4QFMA 1RRMA 2J0UA 3K30A 2XAAA 2XTMA 4FU0A 4ITRC 5LZ7A 4JYBA 2QTHA 4BQRA 4D3DA 1PG5A 1LC3A 2CYAA 1HQCA 3DHEA 5GQSA 1Z56C 3INGA 1EM8A 5ALJA 5T67A 2PQ0A 5TQVA 5J47A 3PYLA 4JLBA 3B1WA 1LB1B 1PV4A 1MP0A 1CDDA 2I54A 2NTYC 5ERXA 1D09A 3EZ2A 4KE9A 5A3JA 4OUDA 1POXA 2Z2YA 3DL4A 4EL5A 4QTUB 1DO8A 3R3HA 4KLNA 4MVJE 3STHA 4B9AA 8GPBA 1V7CA 3C1AA 1LDMA 4P82A 1Q1QA 1CJKC 1Z7YA 2ZSKA 2RKWA 1ENPA 1QFSA 4HWTA 3WAJA 3II6X 2VRNA 4Q7LA 5EY5B 3WISA 1PU2A 3SNKA 4H4CA 3DYIA 3KOOA 3MGGA 4DLRA 3CVVA 3EWIA 1YR6A 3N8KA 3EXG1 4XGNA 3AR7A 3GJYA 1I6WA 4M89A 5DRYA 3UMYA 2HSDA 2NPOA 4HB3A 1M34B 4YP9A 2JBAA 2IOFA 3UWPA 2CZCA 5FFMA 3LUBA 3ZDDA 2CXRA 2JIQA 3NBMA 5BP7A 5SZIA 5BPHA 4R1OA 4GI2A 1Z2PX 1E77A 4JUCA 3OWOA 1ESMA 2BI4A 2H1HA 3DOJA 3O1HB 3QEJA 1N6NA 2CZGA 5AJXA 1XDGA 2I1LA 3LTNC 2I4LA 1F3OA 1FQWA 4ISBA 1A9PA 2C5EA 1CZHA 2FP4A 3T5PA 2ORED 3E84A 1EFDN 4Z9YA 1W76A 3A4YA 4NBRA 4NBWA 2AYYA 2EATA 3A6KA 4LXUA 4CV3A 1V26A 3D8HA 4BLSA 1MB2A 2RGXA 3T7JA 2UUOA 3F4BA 3U1VA 3ZWCA 1SGWA 5EZ5A 3H19A 1U7PA 3TEJA 2NZJA 3PVSA 2HFJA 2HU5A 4JNKA 1DEHA 2AFHA 3LMKA 3PRJA 3OVMA 4EY4A 5TEVA 4PC1A 4R0NA 1EVEA 1EUDB 4L5CA 5KHAA 4CHGA 2HRCA 3DBRA 4NBVA 4G2TA 4DEXA 3MWGA 3CU5A 3U7JA 4F3KA 3HVUA 5FOQA 3J81k 4G0XA 1S7GA 2W00A 3AEYA 3EZXA 3UB3A 2AG0A 3JYLA 4PLWA 4FT4A 4LGYA 3WGKA 3LP5A 3V33A 3G8AA 3EDRA 4REQA 5DNWA 3KT6A 1UFVA 4FONA 1DQZA 2PWZA 4GP9A 4PGGA 4TMWA 1IJKA 2OFOA 3FLAA 1LVGA 4RENA 3AXTA 3PTLA 1PFKA 2RGRA 1MN6A 2WV7A 2C29D 1GUYA 4MGHA 4P0PB 1PRYA 4ZICA 1QAQA 1QRRA 3ETDA 1C1HA 2CFSA 4HWRA 2P67A 5FLKA 2IPNA 4PLGA 4HV4A 3GZJA 3FUWA 1TLLA 1V1RA 5CM9C 4AZ3A 5AM5A 4HDRB 5TF4A 3H75A 3I1FA 3IBCA 4JA2A 4PZ9A 3OTGA 1HURA 3ADBA 2XA2A 2DT8A 3U7QB 1SD2A 2FPXA 2LV8A 5G4KB 5ALEA 4Q82A 1CZNA 1FSZA 1PT8A 3OOJA 4FW8A 4XYMA 3V4VB 5IXYA 2QTGA 2CMHA 2IYOA 1Y98A 3DDWA 3DCNA 3CLSD 3OBIA 3IULA 3OZRA 4FDTA 4FJ1A 2Q27A 3MAJA 1J8FA 4B75A 4KGDA 3ILYA 2ZVQX 1HEUA 1RAHA 4ZT3A 3JU3A 2P77A 2JCXA 4DNXA 2CFOA 2FQWA 5BUCA 3TBFA 4Q9AA 4O3FA 2FEXA 3G0OA 2Q7DA 2QLJA 1G2OA 2Q29A 2XADA 4B8WA 2R97A 4RJJA 5HWSA 3I8XA 1P61B 2VHUA 4QUKA 1C14A 5EESA 1FEZA 4BP9A 3M9XA 5A4FS 4ESEA 5JASA 4PWZA 2HSGA 2GASA 2QZZA 4UBMA 4V2UA 5GV7A 2IK8A 3DDCA 2H0RA 4MS4B 3G0CA 2O0HA 3HB5X 1CLUA 1JWLA 3KU4A 1WVIA 2QAJA 2AG6A 3HZOA 4R4JA 5FI3A 2AFIE 3T52A 1RADA 3W8RA 4IFEA 6AT1A 2LE0A 1CRWG 3MWDB 2WIKA 3KXDA 3R77A 1G2PA 2A57A 2J9FA 3VNAA 4EWLA 4RE6A 2JLRA 4XPIA 1ZONA 2HIMA 2Z2JA 2QT0A 4O2BB 4QXMA 2XXBA 4PHFA 2B7CA 3AKZA 1QPZA 1T3SA 4B79A 4IRUB 4IHQA 3E5MA 5CM2Z 2GPBA 2F1HA 1NN3A 3K1AB 4QSMA 5JE8A 1PDWA 2TECE 3NDIA 4ON9A 3VPBA 4NIMA 4D3XA 4JAVC 1ZIYA 3QBTA 1C8KA 5AW0A 1NNUA 5JMWA 4LXXA 2ZE8A 4DFDA 1BU5A 1NOKA 3JPWA 3F6EX 4F8JA 3DKRA 2IHKA 3AI1A 3DOFA 3MTAA 3VX3A 1I30A 1NXSA 2XD4A 4D74A 1NYLA 1R3UA 3LQ1A 3MILA 3GLQA 3OT1A 3DLBA 1SVMA 1MVNA 1MPTA 3DA8A 3E23A 2ZE7A 1Z6ZA 4W5JA 2E1RA 1EESA 1JH8A 2G9ZA 2YHSA 3B3FA 1HFEL 1SXJB 2MSKA 3OI7A 3UOWA 5KQGA 2QM7A 4LYYA 3DMTA 4GO1A 4LMPA 2CV0A 3RJ9A 1DIHA 1P18A 3BBLA 3LVQE 4OSPA 5FHQA 4MHOA 5SZJA 3SNHA 3TEMA 5YASA 5F9HA 5B6IA 3R6TA 3NTVA 2OBFA 1JDPA 1H5UA 2O3TA 2PGJA 4ENSA 5L45A 2NQTA 2NUAB 4ZYYA 3ZGOA 2UZ0A 2JJ8A 1XAJA 2P9EA 2DQ4A 2CDAA 3CUTA 3OFNA 4IH9A 3AEUA 3LQYA 2E1PA 5HJEA 2CBZA 4ZGGA 3GI1A 1JEAA 2Y3IA 1WQ1R 4U7DA 1YB7A 2XQFA 1Y9AA 4C4OA 4F6LA 2CLDX 4FKBA 3OEHA 3BK2A 2Q5HA 2HYDA 2WZBA 3TSCA 5MN6A 1IM5A 3FPGA 4QSHA 4JV5B 3CG0A 3PHHA 1O94C 1U2DC 4A1OA 3DOOA 5B3AA 1LK7A 1JB9A 1V8DA 3H4TA 2C9OA 4FYVA 4U5QA 3SSOA 1R00A 4LOIA 3Q3VA 4JGGA 1NDHA 4ZYLA 5BR4A 4J4TA 5BN1A 3RJTA 3DFMA 4ZCSA 3IUMA 4FGUA 5LKAA 1GQ2A 1JEQB 2XGOA 3F1LA 3RVBA 4B7AA 4QUJA 2DFLA 1GCOA 1SBYA 3M5WA 3OPYA 4G86A 4JEMA 2CUKA 3HA5A 3PC8A 3OECA 2BEKA 3CLVA 4IPTA 5B2ZA 1M6VA 5J5CA 3T4UA 5BVHB 5KAMA 2JVIA 3ENVA 3LA8A 1MG0A 1IUNA 3C3JA 4HX5A 2ZPUA 1D3AA 4TL8A 3N8IA 4AUNA 1N2GA 1W88B 2KBFA 2YXEA 1Y1TA 1ZMBA 1IHOA 1J8QA 1KO1A 1YVDA 2PMFA 5AVSA 1LXCA 1UANA 1RI5A 4TM8A 1TCVA 2PJUA 1KJJA 2D5CA 3F78A 1HNZB 4JEIA 2Q7XA 3K8YA 5K3OA 4D57A 5CT4A 2DG2A 4M6WA 4YAJA 3ASYA 3TQRA 5K20A 4B3SB 1DFHA 3DTNA 3L7DA 2WD7A 3P94A 1LH0A 4FGZA 4WKOA 1KI6B 4GEGA 3KQQA 1LF5A 3ZIAA 2NM0A 3USCS 3HB7A 3I34X 1UBGA 4RZIA 5KOYA 1G55A 1N6IA 2AD5A 2GH1A 2XOKD 4V24A 4B7UA 4M2LA 1JFRA 1YJBA 2CK3D 3HI6A 1QV7A 2VSXA 3KJZA 4HLCA 2IPXA 1OV4A 4N3BA 3GRZA 4H59A 3L7NA 2B4KA 2OPBA 3B51X 2PUEA 4RKFA 2D0PB 1D1QA 3BFKA 5B2EA 2UYCA 3MOGA 1MAUA 4GRDA 5F9MA 1OC2A 2OP0A 4NK5A 4IY1A 4RVFA 4TL6A 2QAGA 3RVOA 4EZEA 3EEQA 4N48