1E9FA

Mutant human thymidylate kinase complexed with tmp and adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
211
structure length
202
Chain Sequence
RRGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Potentiating Azt Activation: Structures of Wildtype and Mutant Human Thymidylate Kinase Suggest Reasons for the Mutants' Improved Kinetics with the HIV Prodrug Metabolite Aztmp
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 202
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e9fA00
5HKKA 1YJ5A 5JWHA 3MJRA 1U0JA 4XIGS 1P61B 1KKMA 2UVQA 5G53C 1FTSA 1YKSA 2WWFA 2WSSA 3SN6A 3U7GA 3NXSA 4EIWA 2BEJA 2EW1A 4S35A 3T1TA 1U90A 2A78A 4N0DA 5HKKD 721PA 4O2RA 1YR9A 4URVR 1NJFA 2QAGA 2C2HA 2VF7A 3CRQA 1N6LA 1JPJA 4JJZA 2WSSD 1P5ZB 2PZEA 2RGNC 2PT5A 3EPKA 2HV8A 2GZDA 2N1BA 3IEUA 1GKYA 3K70C 1KYIA 2V6IA 3AP1A 2QNRA 2A5YB 5IRCD 2PT7A 4CYMA 1L2TA 4YDSA 5KU1A 1IHUA 2JLVA 1T0HB 1NSTA 2HF8A 1U0HC 1KNQA 2FH5B 1TUIA 1E2NA 3EASA 3NTUA 4BRUA 5GADl 1PUJA 4LX0A 3KJGA 1OB5A 3C8UA 2ZE6A 4C7OB 3T1VA 5HZHA 5LB4A 3CX8A 1E94E 2FEOA 4Z8YA 1P7CA 4TYNA 2A30A 3K0FA 4PO9A 5B30A 3W8RA 4NZYA 1HH4A 3CM0A 4Q03A 5FOVA 2VRWA 2XB2A 1RFLA 1UKYA 2ZJ8A 1D6JA 4G5GA 2WWHA 4LJ7A 4NTZA 1Z5ZA 1T3LA 1K6MA 5JBQA 1NF3A 3GEEA 3MG9A 1MKYA 2KBEA 2L0XA 4UJ3A 3VR2A 3NKVA 2HT6A 4BLOA 5L3VA 1UEJA 1R6BX 1R5NA 1ZD8A 2QZ4A 4W7SA 3ICQB 4BZPA 5FTMA 4NYIR 4TYWA 2FV8A 4TMTA 1WQ1R 1ZNYA 1HT1E 3BIFA 3QKSB 4KSBA 1A4RA 1CEEA 5DSZA 4PZZA 1LB1B 1WA5A 4N0EA 1HA3A 5K8LA 1Z2CA 2B6HA 1UF9A 3OZXA 3CW2A 3W5JA 1X1SA 2F6RA 4YXWA 1N5LA 2B8TA 3HR7A 2C78A 2YC2C 2NO0A 3QIAA 2ONJA 4UNRA 1II0A 1YE8A 5DYGA 3F3YA 2QPOA 2VP9A 2ZRAA 1NVVR 3NC1C 3BH7A 1E0JA 2AKAB 4II7A 1UAAA 2IT1A 3EC1A 4A6XA 4A8JB 2Q9CA 2V7QA 1P2UA 1KK3A 1P60A 1QBKC 1P75A 4I1UA 5AUNB 1Z0FA 3DPUA 1E2DA 1IXRC 2GCNA 2PX3A 2R6FA 4BECA 1T5IA 5CYPA 3NG1A 1KDRA 1W46A 2O0KA 3CH4B 2JLZA 2QTVB 2V7QD 4RD2A 2GCPA 3U61B 2QAJA 3IO3A 3B60A 1E4YA 3ETLA 1XDBA 1B0UA 3VTKA 3O8CA 4DLVA 2ZJAA 1ZYUA 4Q19A 1BYUA 2QSYA 1SVMA 5JS8A 5F98A 2BBWA 2ZI3A 1XJQA 5H1YA 1KI6B 1AQYA 2RAPA 3ZZUA 4URYR 3FKSD 1T0JB 1W36B 5EE5B 2VO1A 2XSZD 2OCAA 1GUAA 4QXAA 1Z0IA 2DFNA 1BS1A 1RRPA 1E2IA 1LW7A 2BCJQ 2F1IA 3DVLA 4JZKA 4I1SA 4BFTA 4DUGA 2ZI6A 3I61A 3QI2A 3IUYA 3B1XA 4B2LA 1M7HA 4B35A 1P2SA 3K0EA 4PSVA 2A9KA 2G6BA 4X8LA 4JL6A 4DT1B 5ELXA 4TLCA 5CB8A 4LOAA 3CPEA 4ZDKA 2Q9BA 4MKHA 4QNRA 1Z2AA 4YLGA 2REBA 2VYFA 2FEMA 2ZU6A 1JQLB 2YWFA 3QPUA 3AKCA 4PAOA 3LVRE 3GPLA 3THXB 2V8OA 2UZIR 2ZRFA 1VHLA 3QXHA 4PZLA 3GJXC 5CIQA 2JAQA 1L4UA 2QUZA 4PZYA 3AH8A 2OLKA 4JYCA 2ODNA 3M0EA 3GLHE 2B7CA 1A82A 3CRVA 1GP2A 1NI3A 1Z6AA 4C0KA 5EP3A 1W0KA 4TTRA 1V5WA 4OJQA 4XD7A 3TGPA 5AJWA 2REXB 1SXJD 4GL2A 3X2SA 1OFTA 3OIWA 3THWB 1MABB 2P6NA 3SJZA 2XITA 3WMEA 1YZQA 2OHFA 5KHOC 1HUQA 4JT4A 5AUPB 2IX3A 5CJPA 2PH1A 4DLXA 2QP9X 3CNOA 3U3OA 1G16A 5CK5A 2QSZA 4OHWA 3UXMA 4BEBA 5KNCA 2FFAA 3KJIA 3QY0A 4CDGA 4RD6A 1VDZA 2H57A 1XPOA 3GQBA 4CEHA 2NO7A 2ZU0C 4V0LA 3U5ZB 3QKTA 4ZIRA 3AVUA 3IEVA 3OIYA 4C0BA 1W4AA 3WMFA 1E2LA 3AF3A 4CRWB 2ZVQX 2EFDB 4PO8A 3DZ8A 4GZLA 3ADKA 4LHYA 5LD2B 2ZIAA 5DI9A 2ODBA 2XTZA 3TNFA 4PPNA 1DG1G 1QRAA 4Q1EA 1E9AA 3RYTC 2IYYA 2CLCX 4LYJA 5JFGA 4OHXA 3AF2A 3ZVMA 4H1UA 4PHFA 3IQXA 3EPHA 5E95A 3TAHA 3QJYA 4G5SA 4C9BA 1EX7A 1F2TB 3CX7A 4PFSA 4OHVA 1NVXQ 1OH8A 2HT1A 5FOXA 2XTMA 1WBBA 4WZ6A 3V4FA 1FP6A 3ZLJA 2HXSA 5JHGB 1CRPA 3UPUA 3ZZ0A 1ZM3A 4G01B 2WJJA 1EG7A 3LQQA 1NMXA 3A4LA 3Q9LA 1HEIA 2WIBA 1TAGA 1S1MA 2J5XA 2BOVA 3MD0A 1RVDA 1OIVA 4TTPA 2JIZD 4LGMA 1J2JA 2QMOA 2PJRA 3AVVA 2CMKA 4GRAA 4A0FA 2W0SA 3OIUA 4A8JC 3VHLB 4PTLA 3SC3A 1DELA 1COWA 2YKGA 2IW3A 4U7DA 3BWDD 2ZI7A 4JLJA 3IHLA 1NVWQ 3LX5A 3PXGA 2Z4RA 3QUSA 1X8KA 1EX6A 1Z0AA 2HCJB 2R6DA 3B5JA 3NEJA 1COWD 2J9RA 4M1WA 1IY2A 4JJKA 4YMVA 2A5GA 2H5EA 4F4IA 4WXRA 2OAP1 5KUTA 1G9XA 5G3ZA 1D2EA 2RB4A 1UBEA 3UMRA 1ZNZA 4M2LA 3KKPA 4WIAA 4RZUA 3TE6A 3K0FB 2VP2A 4KO8A 1YHNA 4C0HA 1NMYA 1VECA 2CVFA 2G83A 2ZAOA 4LY6A 2KE5A 5SZHB 4MKFA 3RRNA 4JT2A 5L8VA 3I62A 5FL3A 1OV4A 4HAZA 3CZQA 3D7MA 3VU9A 3ZIAA 3AVQA 1ZW6A 4Q7KA 5TV2A 2RGAA 2VBCA 1EFRD 2ZTSA 1E79A 1TU3A 1GL7A 4B3BA 4TL6A 4HSEA 2KJQA 4Q9IA 3SYNA 3RSOA 2DWQA 2RCNA 3REFA 1OHHA 3ZIAD 5BN5A 2ZAMA 3SQXA 3B2EA 4LC1A 4Q1DA 1VG9B 4PQYA 4B47A 2JATA 4BEJA 4UNPA 1GDDA 5KOYA 1E79D 4DJTA 3PEYA 2JLWA 2D2EA 1GFIA 3GEHA 2FFHA 5BYKA 1CJMA 1P4SA 2JJ1A 2P6UA 2QL6A 3U3RA 1FOEB 2X1VA 3TQFA 5FFMA 2BBSA 2R6CA 4ZKDA 4PR0A 2ODWA 4IVRA 2BDTA 3AP2A 4L8GA 4DSUA 2BMJA 4Q02A 2XXAA 2N42A 1G1MA 2WKPA 1Q44A 4DLWA 4FIDA 3I3SR 4FWIB 4Q9HA 1Q57A 4BFXA 3TK1A 1W49A 2IBMA 2ZR0A 1JNYA 5J4VA 1X8JA 4QC2A 3KQUA 3T15A 1R10A 4TQUS 2ZE5A 3K53A 3HYTA 2JDIA 3ZGXA 2HF9A 1IN8A 2Q6TA 4QBIA 3PG5A 3OFND 4EPRA 5FR1A 4HAYA 1YZTA 3X1XA 5DO9A 2F1RA 1Z06A 5E7IA 1NN3A 4IOKA 1QZXA 4B3FX 5LD2C 1I4DD 1T5LA 4A15A 3J81k 4AD8A 1FX0A 2RHMA 3CWQA 1T9HA 1AIPA 1ZD9A 2AK3A 2C04A 2IEZA 2KWIA 5FUYA 3RC3A 3X1DA 1QHGA 2ORIA 2QE7A 2ZJ2A 1QDEA 4BGDA 1E98A 2G77B 3A37A 4A2QA 1W44A 4HB3A 2D3WA 3I32A 3TUJC 3W5IA 4F93B 4UJ5A 2ZS7A 3SFZA 4JLAA 3ADCA 3THYA 4DEXA 4ZDWA 1XEWX 1KMHA 1F48A 2CLSA 1XFAA 2PBRA 3JZAA 5KDOA 1Z63A 3PITA 3O8RA 2GJ8A 3TQCA 3TW8B 1E2JA 2ZS9A 4PC2A 2GWHA 4B76A 3I8XA 3K0AA 4QRHA 5FUVA 4ZDJA 1MH1A 2EYQA 5AJXA 1VYVA 2QAGC 2GXUA 4TQAA 1UEIA 1YZLA 3KQHA 3WXMA 2VSFA 1SVSA 2VL7A 4KSCA 1NBMD 2VTKA 2ZJYA 3N5CA 3OAAD 4LBZA 5G41A 3RS2A 2OM2A 4JMPA 2ASEA 5KSOA 1C9KA 4FD2A 1RRCA 1JR3D 1H8HA 4G5OA 1WDTA 1JECA 2CK3A 3BS4A 4MYUA 2C98A 3EZ6A 2P6RA 2ZRPA 1U98A 1FPMA 5KO2A 1P6XA 2W6ID 3DHWC 3EARA 4GPTA 4P4TA 4OQFA 4QBHA 521PA 4DVGA 1E9FA 1N5KA 4L15A 4PC1A 1H8HD 3U7FB 1KNXA 4E07A 1YU9A 2CK3D 4IDQA 4V03A 1XEWY 3B1YA 1N6RA 4QJ3A 3AF0A 2XEXA 3FYHA 4EAQA 2OO7A 4CEHB 5EP1A 1CR0A 4D25A 1E2HA 1KKLA 4C30A 4ZIRB 5F9FA 4MA4A 3FTQA 3GLGA 3KKNA 1P73A 2NMVA 4I1OA 2YOFA 1HTWA 4WZAE 3TSWA 1R5BA 4Y0VA 2YWGA 2ZRCA 5FL7D 4B32A 1LF0A 3Q85A 3NC0C 1BYIA 4HATA 3FOZA 1NIPA 3OEEA 4I4LA 1G18A 3GCGA 1OT3A 3BRWD 1E2PA 2GDJA 1OXUA 2FU5C 2IYUA 4TMKA 2PJZA 4P33A 1X1RA 1W4CA 3QXXA 3V00A 2DB3A 1GNRA 4US2R 1H8EA 1G3IA 1KI4A 3OEED 4IDNA 4D4MA 1I2DA 1SQ5A 3EC2A 3G82C 4BFUA 4WZBE 1IJEA 1EXMA 2CJWA 3BAFA 1S96A 5JRZA 5E3HA 2G88A 4C0QC 3HR8A 3LO5A 3CZPA 3OEHA 4RZXA 1UADA 4TQ9A 2G1JA 3WBKA 1NN5A 3QNUA 2ZANA 3RS3A 2R6GA 5AK0A 1UPTA 1OKKD 2G0TA 4I1VA 5KPDA 4LBVA 5A4JA 1XX6A 5SZKB 1ZCAA 1CR1A 1G3UA 2GXSA 3CRMA 1FNNA 3OEHD 2CVHA 2CCGA 3A4MA 1OIXA 4ERNA 1JBKA 4Q66C 1A5TA 4WA7A 4LJ6A 3A1WA 3CWZA 2KBFA 3KXKA 4Q48A 3TRFA 3VAAA 4D80A 2WWXA 1JEDA 2IYTA 221PA 2BMDA 4QKQA 3MWYW 4TYPA 2YZ2A 4Q1CA 4A4DA 3A8TA 1W0JD 4RD3A 1L4YA 3BJIC 2NQ2C 2P5SA 5HCIA 2ONKA 3T12A 3QQ5A 4KYIB 1FUUA 2ZRHA 4AK9A 3FHCB 2J87A 3H2YA 2XJ9A 4JL8A 4TLAA 4C3ZA 5CIWA 4TMVA 1GRNA 1GRQA 1CJKC 2J7PA 4G1UC 4MRPA 4OQLA 2AWOA 1SVLA 3CUEF 1XTRA 1SHKA 1NY6A 2Z0MA 2EU8A 1G3RA 1KJWA 1OLOA 2F43A 3EPLA 1II8A 4AURA 2QROA 2XX3A 5IT5A 2J7PD 1P9WA 3AKYA 4NCNA 4DLTA 1KOFA 3KB2A 1FMJA 4DKXA 4JLKA 1KK0A 5CLQA 1SVIA 2NIPA 3I4LA 3SQWA 3GJ5A 4DWJA 4AYWA 4W5JA 1IN4A 2QENA 4DDWA 1F3OA 3KXLA 2G1KA 3P32A 3SI7A 4Q7MB 3DM9B 3SBDA 1ZAKA 5HTKA 4FINA 3KL4A 4Q7LA 5DIFA 1G4UR 3I72A 4JS0A 3EZ9A 4M53A 2JLXA 1FW6A 3NBFA 3IHWA 1NG1A 5KSYA 3RHFA 2MMCA 1KI3A 3BBPA 2FMXA 4TT3A 5AR1A 4KBGA 4A82A 3RWOA 1NJGA 2GETA 1E9BA 2ZYVX 1M74A 4Q9LA 1D9XA 3JVUA 5KSZA 1RRGA 2R62A 5DN6D 1VIYA 2QRNA 2ZJBA 3K8YA 2XXAB 3ND8A 2ZJOA 2H7VA 3CB4A 5EE1A 4LYAA 3IDQA 1XPRA 1XD8A 3C14C 4DDVA 2O8EA 4JYBA 3HJNA 3GJ7A 4OJKA 4DSTA 5KNDA 4O0MA 3U4QA 2GEDA 4LBYA 1L7VC 4AWXA 1EGAA 1U94A 4DDUA 1P9RA 1XB2A 2IXGA 2Q9AA 1E96A 1U99A 2I3BA 2OFWA 2AK2A 4C4PA 1N0UA 5GVSA 4DHEA 4UXHA 1TUEA 3U7EB 4B75A 3AGPA 4Q01A 4HDOB 1QHYA 4OI2A 4TMXA 2WKQA 5J4YA 1F2UA 1FQJA 3N2IA 1Z0JA 5HCNA 1PZNA 1U8AA 4LI0A 2FPKA 3GJ6A 1VG0B 4MYHA 5DGXA 2FGJA 1IN6A 4PSKA 3G5UA 3GJ8A 1Q1BA 4AI6A 2GVDC 1A1VA 3R9WA 4LHXA 4PAQA 3SJAA 2C77A 2CL7X 4A1FA 1VTKA 2C9OA 5L3RA 4AY2A 3ZYCA 2D2FA 5K8TA 4MDFA 4Q00A 5LBIA 3THYB 3U3JA 3IPYA 4LRWA 1GILA 3UMSA 5AUOB 4FMDB 5B2ZA 4ZCMA 5E4FA 3BFKA 2H18A 2WAYA 4M21A 4KJZA 1M8PA 3ONWA 4OKSA 2NTYC 1G7CA 1YR6A 3CH5A 3LBHA 1WBDA 3K0AB 4GOXA 4FW9A 3SOPA 5GJBA 1RYFA 2X19A 3A1UA 5C18A 4KU4A 5JCPA 5F3WB 5EUMA 2GF0A 1CJVC 1TQDA 3VU9B 5FBRB 1J8MF 3WHKA 2O8DA 3RRYA 5BXQC 4Q4JA 4DLYA 3LLUA 2QM7A 4M1MA 3UK6A 4LV8B 4OYHA 1MOZA 5BQ5A 2HYDA 2Z43A 3GMTA 2WKRA 4PHHA 3QF7A 2VP0A 2OBNA 4Z51A 4HYYA 2D06A 3T1QA 5J4KA 2O0HA 2YC4C 4NH0A 3CF6R 1N5JA 2QBYA 4JVNA 4JVLA 1KDTA 2X2EA 1I4LD 2ZYUX 3U44A 2C99A 3AVWA 1KTVA 3EWAA 4CT4B 3RAPR 2OSBA 4TTQA 2J0UA 3GLGB 3LD9A 3QEJA 4BFWA 4WXPA 2OXRA 3NH6A 4G3XA 1AK2A 4OK3A 4GMDA 2IF0A 4BZQA 2ZSBA 4KLZA 2F1JA 4OBEA 4DB4A 3ZQJA 3CR8A 4JVSB 4WBSA 2WICA 3T5DA 1GL9B 4O3MA 1CXZA 5EXTA 2BBOA 1J8YF 4KV9A 1UM8A 3REGA 4B44A 2MSCB 3PVSA 2EFHB 3K9NA 2ZITA 1HY3A 1S1CA 2VSXA 1NMZA 3BFVA 4MYCA 4TYQA 4HDCA 4KFUA 1J7KA 3QBVA 3CNLA 2CJWB 2OILA 2YNMA 4A92A 3UG6A 4GSYA 4NONA 3TUIC 2QMUA 2PX0A 4DCSA 4URZR 4PPFA 2IHBA 5FPSA 5KPJA 4NE2A 2B92A 4TL8A 2RGXA 4Q4HA 3DZDA 1NSFA 3LBIA 1IAQA 2GCOA 3BH0A 2GK6A 3RC8A 2HUPA 3NHBA 3O8BA 4RCYA 3WNDA 1N6IA 4B2PA 2CHVA 3DKVA 5L3QA 4EFLA 2YWEA 4EUNA 2JGNA 1HV8A 2GZHA 2IYQA 1N6KA 2VHQA 4EPXA 4XVUA 3W3AA 2DWPA 4A0RA 4Q1BA 1E9SA 2A3RA 2QORA 3IPXA 3MCAA 1XTKA 4DSOA 3LWNA 5B57C 2QQ0A 3HPRA 4UNSA 2IYRA 1YR7A 4YONB 3TMKA 4DCTA 2W2XA 2NOAA 3QF4A 4M0LA 1Q12A 1AKEA 1DVRA 3FKSA 2CCJA 2BBTA 3LLMA 2YHSA 4OQXA 3AKEA 1J70A 2XSZA 5FTKA 1OH6A 1QVAA 2FSFA 1MO4A 4IW3B 3B6EA 3UATA 3VFDA 1GRRA 1UBFA 3QOFA 3AB3A 5D3MA 3T35A 2WJVA 3NDPA 4ESVA 1NNEA 2WHXA 2RGDA 3EZ2A 4BWYA 2YINC 1II8B 2NO9A 3WNCA 3KFXA 5JEEA 5BW8A 3F8TA 2GEVA 2AD1A 4ITRC 1OF1A 1Y3AA 2FJUA 2ZRNA 4XH9B 3KKOA 3AVTA 4HI0E 4C0AC 3P26A 4NCJA 2P2LA 3ZS9A 4BLSA 1MO5A 1QHSA 1IN7A 4EPTA 3VNVA 1UDWA 3CRRA 5KNBA 1DADA 4G0NA 3NVAA 4P4SA 5JECA 2UZ3A 2C9YA 1ZIOA 1IY1A 4US1R 2NGRA 3WP0A 3FFAA 1F5NA 3IIKA 1W47A 2O52A 4MRVA 1IY0A 4Q9JA 3THOA 4GP6A 1SXJA 2VLIA 1UJ2A 4ASUD 2EWVA 2ZSEA 1Z07A 4RCZA 1XMSA 1VYTA 1OE0A 1TU4A 2GXQA 4ZCIA 3QG5A 3GD7A 1EK0A 3UKDA 1FL9A 3AGQA 4KAXA 2GKSA 4L9SA 1JPNA 4R71A 1OH7A 1HQCA 3WY9A 2FE4A 3MWLA 2FFBA 3MLEA 4C0SA 2I1QA 3BD9A 2BKEA 4BRWA 2PZGA 4UXIA 2O8EB 2YV5A 2ZUCA 4MUAA 3GJ4A 1BMFD 3U4QB 3FMOB 3E2IA 5FTJA 1DAIA 5AJYA 3VR3A 4KYUA 3BXZA 4P31A 3P4XA 1DS6A 1G8GA 8OHMA 3IIMA 1K5DA 2CCKA 1G8YA 2P67A 1G64A 3BERA 2WWWA 2OZEA 5FI0B 1IN5A 4M9XA 5EQTA 2A5JA 1DAMA 3A1TA 1F2UB 3AVOA 4Q9KA 2AKYA 2IS6A 4ACBA 4R2HA 4BPBA 2ZETA 4HAWA 2QU8A 1MO3A 3BH6A 3ZVRA 4DXAA 5JHHB 2P5TB 3VKHA 2BM1A 2Z4SA 1NN0A 4BFZA 2MSEB 5C4GB 1N6PA 1E2GA 1OYWA 4K8OA 4DEYA 4PC3A 3MAAC 3SJBA 2O8CA 4JBXA 1ZU5A 3V9PA 2QGZA 4PQFA 2GRJA 4LCBA 1E4VA 4C2UA 1TQ6A 4CEJA 3W34A 1VCMA 3S1AA 4F92B 2H8KA 2PMKA 5UKDA 1OXVA 4EFMA 2BHRA 1DE0A 1M34E 1M7BA 2JIZA 5KSPA 3RANA 3WNBA 3GJ0A 4MRRA 4E03A 3LDAA 1ELOA 3CF2A 2IL1A 4FMBB 3LQRA 2EVWX 1EFTA 1VCNA 3EPJA 2RGEA 5GVRA 1KSHA 1OSNA 2QAGB 1P2TA 4GDFA 4JIMA 4JLNA 3HP1A 4DDTA 3OE7D 5BWMA 4QBFA 2Z6VA 3PQCA 2O8DB 2QM8A 2QTHA 4Q4JB 4QGGA 3TVTA 1N5IA 2YYZA 4B71A 1PLLA 2F3TA 1F60A 3AQ4A 4MKGA 2HYIC 4JSTA 4TYYA 4YMSA 3PUVA 3B7GA 1OXTA 4FN5A 2N46A 1XP8A 3TSZA 4NHOA 1OIWA 1XCGB 2DCUA 1HE8B 2QBYB 3U2QA 1HYQA 4QG7A 2DFTA 2O0JA 2J7KA 1P9NA 1KI7A 2XOKD 1PLJA 3DO6A 4DRZA 1RYHA 3U44B 2ZROA 2FSIA 2GZAA 1XD2A 2IUTA 2IXEA 4OK6A 5TY0A 3GLIA 5IF9A 1OW3B 5D3QA 2J0UB 1KDOA 4F91B 2J0VA 1UKVY 1GNQA 1EESA 4FCTA 1EFRA 4KXFB 2G9NA 3C15C 1YZKA 3U3KA 4NYMR 4IHQA 1JXOA 3LXXA 4NL4H 2J1LA 4UNQA 4QM6A 1DAHA 1U9IA 3CR7A 3WP1B 3K70D 2QT0A 5JRJA 1C4OA 4AG5A 1J99A 4JKIA 3ZDQA 3C41J 1W2HA 3G0HA 2IF2A 1I2MA 1TMKA 1NBME 5HR5A 1KGDA 4ZKEA 3TIFA 1CKEA 1XNJA 2JLRA 4HLQB 2J41A 2W6JD 1E6CA 2CDNA 4LJ5A 2FX3A 4PX9A 4QFMA 5EP2A 2ZVPX 1XMIA 2JJ2A 1S9HA 1KY3A 4LDJA 4TSFD 1KJYA 2GBLA 1T6NA 1D5CA 3VR5A 1EFCA 2QMHA 3HDTA 1XJ0A 1KO7A 2Q3HA 4CIDA 1E3MA 2WM9B 2ZJ5A 4NBSA 2C9CA 4XVRA 1KO1A 3OESA 3T34A 3DMDA 2JJ2D 1NY5A 3D6TB 1T8TA 3CONA 1XTQA 4MH0R 5L3QB 2IUSA 1YZUA 1OYYA 1RE0A 3CIOA 2IWHA 1JAHA 3OFNA 2F1HA 3RS4A 3VX3A 4OI0A 2EYUA 1LS1A 1LVGA 3B1VA 1VCIA 2QRZA 1S2MA 2O8FA 3R9XA 2G3YA 2BMEA 5CB6A 4XWAA 3X1YA 3NBZC 3GLGE 2J0QA 2IHYA 4OHZA 3E1SA 3QF4B 1YRBA 1NLZA 3UMFA 3PFIA 4HAVA 2GNOA 4KHZA 1XMJA 4Q21A 1UFQA 1DARA 4QHTA 1G19A 4OQNA 3VNUA 2OT3B 2AL7A 4HZIA 5BN3A 3MSXA 1GWNA 5D3MB 1TNDA 4YDHB 4HZUA 4AG6A 4LHWA 1KO5A 1MRNA 1G7TA 3DL0A 4LHVA 1MR3F 4A2WA 5JJIA 1Q22A 2CL0X 3C4JA 2FOLA 4U00A 5SZJA 2QN6A 1GAJA 2OFXA 1E0AA 2TMKA 1S0UA 4MUBA 3W9YA 3A6PC 3ADBA 3LAWA 4GT1A 1R0WA 2OBMA 3SJCA 1TX4B 2ZREA 3H4MA 4V0KA 3W6OA 4JKYA 3RLFA 4YQFA 3QSYA 3CNNA 3A36A 1BIFA 1XMVA 2P0EA 2REOA 4B6FA 2QA5A 3DDCA 1G7RA 1QF9A 4P4SB 4XOIA 1NBMA 3OAAA 1DEKA 1Z28A 1GTVA 1WP9A 2JJ8A 4TMWA 1VCOA 1JR3A 4GZMA 1WB9A 2LCFA 1XD9A 4F7WA 2DHRA 3BK7A 3LBNA 1SXJB 1SVKA 2AHOA 2WPDD 3IILA 5J47A 2I4IA 3DEFA 4EPVA 1LFDB 1PJRA 2W6IA 1HURA 1G3QA 3QENA 4AYTA 4QBGB 4MGIR 3BC1A 1X6VA 1G6HA 5AWFC 1D9ZA 1NL3A 3CKLA 1Q3HA 3PUXA 3WYAA 2WSMA 1KI2A 1Z22A 2OCYC 2KSQA 121PA 5FBWB 3N70A 1S3SA 1XRJA 4ON9A 4LV5B 5KYKA 1GZSA 4M4SA 4POAA 2ZRBA 3BORA 1E69A 1CLUA 1G8FA 2MMGA 3Q8XB 3Q5DA 2Q0HA 4W5HA 4OQMA 2H1LA 1DTSA 2WIAA 5FL7A 1E9RA 4OI1A 1Q0UA 3K9HA 2QT1A 5B64A 3ASYA 3K9LA 4RZ2A 4P3YA 5FI1B 3U6BA 3LW7A 2XNSA 2WZQA 1ZU4A 1E2QA 3Q3JB 3AVPA 4MGYR 3JZMA 5AJVB 5L3SA 3I73A 1YQTA 1PLKA 1AS2A 3EA0A 1N25A 4RY2A 3FGNA 5JZVA 2HDNB 2FPMA 1T3HA 4D6PA 1GG2A 4HUQA 1XEFA 1CP2A 5JSZA 2AN9A 1N0WA 2O8CB 3UANA 1UDXA 4DSNA 2DWOA 3PEUA 3EWSA 5CLLA 1G41A 1CJTC 4S2EA 3IBGA 2F55A 1ONBA 3GFOA 3ZS8A 1OKKA 4FMDF 4CEJB 5TXGA 3S1AB 1TPZA 4OL0A 1JQJC 1ZUIA 3B9QA 2DR3A 3X1WA 3QEOA 4M9ZA 3DOEA 4AKHA 4URXR 3M6AA 1RZ3A 2ANBA 4NP6A 3W90A 2ODEA 3QXJA 1A2BA 4ARZA 4I99A 3EZ7A 3BB3A 3QKUA 4FMCB 4ZPXA 1Z47A 4BFVA 4XWKA 2GTPA 5P21A 1UBGA 1W0JA 3UWKA 1LY1A 3EX7C 2H17A 2ZEJA 1G5TA 4M1TA 4LYHA 4DZZA 2ZE8A 1Q1ZA 4I81A 4PC7A 1XXHA 4LSGA 5E7JA 2XTNA 3CRW1 4NYJR 2VSOA 4D0NA 1IXZA 4TLBA 2ORVA 4M22A 1DAGA 3WRYC 3ZVNA 5LDDC 2CEAA 2FN4A 2ZRMA 4FCVA 1XD2B 5DISB 2D4HA 2IK8A 3L2OB 3MWJA 1PUIA 3PIRA 3QXSA 3GLIB 1YRAA 3ZD6A 4CGZA 1JEEA 5C2JB 3T61A 4E22A 4TL9A 5TMPA 1AM4D 2AD5A 1U2RA 4GBMA 1AZSC 2QPTA 1ZM7A 2NO1A 4O25A 4JLBA 2GVZC 3TKLA 3QG1A 1EFUA 2QGNA 1LV7A 4LZZA 4Q4AA 4HB0A 2IYSA 4BFSA 3BB4A 1QHIA 1VG1A 2A7QA 2V3CC 2JCSA 1N0VC 5FUWA 2XZLA 1NLFA 4RVCA 2W2TA 3KUDA 1CF4A 3IO5A 2V6JA 1GNPA 4QNMA 3FWYA 1KZ7B 1R0YA 2PCLA 4NYMQ 1LNZA 1M6NA 3E70C 3RWMB 3GFTA 4RFVA 3VHXA 4AKGA 2ERXA 3NBYC 2A5DA 1E2MA 4M1SA 4X8MA 4TN1A 3MRSA 1E0SA 2WMNB 2X8AA 5DN6A 1SXJC 3O8DA 1ZVQA 4EJSA 3ADDA 2ORWA 1W36D 4LUCA 2WBLC 1XTSA 2X2FA 3GJ3A 2ATXA 3C7KA 5JWRA 1GITA 5JS7A 2XGJA 4B33A 3H0KA 1J90A 2VP4A 2JEOA 1R7RA 4BUJA 2OESA 4ABYA 1KSGA 1VPLA 1LTQA 2WOOA 1P2VA 5HPYB 1IBRA 3B78A 5CJ2A 3K09C 3L82B 5EXSA 1XCPA 3H84A 3F0TA 1QVRA 1RW4A 5DE3A 3C5CA 2O8FB 3ZVLA 2ZSDA 4WOPA 4F38A 2D7DA 2OE2A 2DPXA 2E1RA 2GXAA 4Z8XA 4ZV4A 3TW4A 2Q3FA 2RKOA 2PCJA 1Z0KA 4RZ3A 3PUZA 1XJCA 5CITA 4DB2A 4LPKA 4JSYA 1VIAA 3ICEA 4HAXA 1G8HA 4TZ6A 5JJKA 4V0MA 1DPFA 4HZUB 4R9UC 1FX0B 3LV8A 1JB1A 1T91A 2V4ZA 4HLUC 3SR0A 2WJHA 1E9EA 4IJMA 2IYXA 2QG6A 2E87A 2BIFA 1NVUQ 3TLXA 3AKDA 1GVNB 1CBUA 3SNHA 1N6HA 2NPIA 3O47A 1KMHB 3QE0A 6Q21A 5M04A 2OXCA 3AF4A 4D0LB 3HU2A 2GJAA 2QPAA 3WBJA 3EG5A 4P32A 4IXNA 1U8YA 4A2PA 5FOTA 1W48A 3VMFA 3K9GA 3T1OA 2BJVA 2OV2A 3CPJB 1FP7A 3GEIA 2ZE7A 3T06B 3BE4A 2ZRDA 4O2LA 5FR2A 4LHZA 2IC5A 2HXYA 4IVQA 4BASA 1OH5A 3VR4A 5FOUA 1E9CA 2FSGA 1Z29A 1DAEA 1ZIPA 3EIEA 2CHGA 1CRQA 3A4NA 1AGPA 1K8RA 2ZRJA 3LH5A 2JLYA 4D2IA 4M9QA 5J5CA 1KK2A 4GOKA 1S4QA 1BH2A 5CM9C 3QXCA 5DHAA 2GJSA 1C1YA 2ZI4A 2XZOA 3K0CA 4N3NA 4NCHA 4ZCLA 4GOJA 3KDSE 4KFRA 1TEXA 3KQKA 2IS1A 1AQUA 2WJYA 3E5HA 4PQRA 3VR6A 4B3DA 3GFPA 3HU3A 3PR1A 3D3QA 2AXPA 1NLYA 4X8OA 1E9DA 4QGHA 2FF7A 2IYWA 2GA8A 3TR5A 1RKBA 5TDHA 1ZM4A 4Q4LA 5FPKA 4EDHA 2VF8A 4B74A 1IONA 5L3SB 1WRBA 1G3MA 3EIHA 2PZFA 1YVDA 3BGWA 1DO2A 1X8LA 1U9IC 2WJGA 4L9WA 5FBVB 1U0LA 3OF5A 2RGCA 2K5UA 2QY9A 2WV9A 3PUYA 3RNLA 4D0GA 4HUQB 1KAGA 5JSZB 3QKRA 2BJWA 2GEUA 4L4UA 2VH5R 4P0TA 2OCBA 5BYJA 1SKYB 2XAUA 1EWQA 3U7HB 2FG5A 3M1IA 1QG2A 4K46A 2ZI5A 1XWIA 2QP4A 4GMXA 1SXJE 1SGWA 1UBCA 1HE1C 2H16A 2ZSFA 3MGCA 4DLUA 1WCV1 3VKGA 3FVQA 3LA6A 2GK7A 2B21A 4LJAA 4UQOA 5J40A 3GLFA 1R4AA 2O8BA 2QI9C 2HCBA 2DFKB 4RFSA 4DC9A 3VR1A 2GBLC 2LKCA 4A0GA 3R8FA 4IOLA 2W58A 4DIEA 1W5TA 4UNNA 1CR4A 3RSLA 4A0HA 4C0LA 2XZPA 4DIDA 4EFNA 2W00A 1DOAA 1Z83A 5E7MA 4DCVA 4ARZB 4BLTA 4DCNA 1P72A 1OFHA 4JLPA 4RKEA 1FQKA 2AFIE 1ZD1A 2YVUA 2BKUA 5FOWA 4TLEA 4AIIA 3IIJA 4JLOA 1NKSA 5JI3E 1KY2A 3KZ1E 2MSDB 5DLQC 3W6PA 5JLJA 1JR6A 3K0SA 1XPUA 2AWNA 5IDVA 1XXHB 2RGBA 2UKDA 4LJ9A 4YMWA 2LWIA 2BC9A 4URWR 4R2IA 1QHHA 5JI2E 2B8WA 5F2EA 1KI9A 2F7SA 4JLMA 2H92A 2FZLA 3V4RA 4LC0A 4QM7A 4KVGA 3ZQ6A 4YXWD 3I8SA 5DI3A 1JJ7A 1VMAA 2OEPA 1KO4A 2FZ4A 1X3SA 5KTYA 3TJZA 1HT2E 4ILEA 1DAFA 3AVXA 4GNKA 1G7SA 1W4BA 4IFBA 1AS0A 4QL3A 4NYJQ 2F43B 2QP3A 2YWHA 5DNYB 4ZO4A 3R7WA 1G17A 3AEZA 4Q4AB 4KLNA 2VP5A 4A9AA 1B23P 3SZRA 4AC9A 5KDDA 2F9LA 3T5GA 1ZINA 3H86A 4RD0A 2IYVA 1A2KC 1AN0A 3KXIA 3IKJA 5LB2A 3B82A 4TL7A 3TH5A 3WYGA 3KFVA 1DBSA 2ATVA 3UG7A 1AZTA 1R8SA 3VX4A 4PSAA 4FXPA 4B3GA 2JLSA 4ASUA 1N2CE 4LWZA 3B85A 1CTQA 3FHOA 3SU8A 1NKTA 4YC7A 3SEAA 2C03A 5HE9A 5TB5A 3OIVA 2SHKA 1RRFA 2IXFA 2PEZA 4HEJA 3RDPA 5K8UA 1G291 1WF3A 2W0MA 4MYTA 4EJSB 4KVAA 1E2EA 1G5PA 5AUQA 3IQWA 4ZDIA 1XCMA 4Z1MA 1ZRHA 2VP6A 1BMFA 1QHXA 1RJ9A 1S9DA 4NMMA 2DFLA 1G20E 3C5HA 3ND9A 3ZZTA 2FDCA 3B1WA 4L16A 4DUGD 2NZJA 1MO6A 3EIQA 2NG1A 1OFIA 2ZQ5A 5FTNA 1ESNA 2HJGA 3KUCA 4D82A 2VHCA 4M8NE 1WMSA 3IGFA 3K09A 3L0PA 5EE3A 4Z1MD 1GKUB 3GLIE 2D74A 5FBLB 1L8QA 2YJTD 2I1VB 3B1ZA 5FBQB 2A5FA 1FUKA 1US8A 1D8TA 5GJVC 4D4LA 3A58B 1MV5A 2PLFA 2JASA 4YMTA 2XJ4A 2WOJA 1Q3TA 3SYLA 3PJRA 2IYLD 4KFSA 3OHMA 4MDEA 2ZI9A 3LW8A 1AA9A 3DMNA 3TR0A 1IQPA 5EE0A 1TF7A 2GILA 4TMZA 1KI8A 1W0KD 4LV6A 4XD7D 5GJWC 4CT5A 5J4LA 3LVQE 2KB0A 4QJ5A 4EPWA 3FE2A 4HLUA 4OI4A 3KJEA 1N3BA 2FWRA 1AKYA 3BFXA 5FOSA 4B43A 2IS4A 3U6KA 1R0ZA 2C95A 3P27A 2GJKA 4URUR 2AFHE 3PEVA 3BOSA 5TVKA 3WYFA 1RIFA 1M2OB 2ZRKA 3LNCA 5FPTA 4DLRA 1OXSC 3L0SA 4M1OA 3CPHA 3KJHA 1YZGA 4K81B 3NDBB 4TZ0A 2YOGA 3X1ZA 2HLDA 4ESHA 2VHTA 2JLUA 3W6NA 5BN4A 3OE7A 1MRSA 4MRNA 4B73A 4EQ6A 2V1UA 3TUZC 2V55B 2ZSAA 2V54A 1YR8A 2G0NA 3LY5A 4BE7B 4D81A 4IKEA 1XTJA 4MGKR 1DG3A 5JCZA 1SKQA 2HLDD 5CDFE 5FPHA 4N1AA 2R65A 5H68A 5FTLA 621PA 1ZCBA 1SZPA 1ZC3A 5AJZA 1NIJA 2ZUBA 1CR2A 4RD1A 2J0SA 2ZR9A 3EAQA 2C96A 3ZJYA 2ZUDA 1FFHA 4GP7A 1JXMA 1UKEA 5CK4A 5EZ6B 5FH9A 1XEXA 2XOKA 4RKFA 1KHTA 2GJ9A 4PHTA 4CW7A 5JWOA 3RRMA 2WAXA 3LRPA 1XBTA 4UXJA 1OFUX 1ZJ6A 4ACAA 3I92A 3SFVA 3FKQA 4C2TA 1CS4C 1DAKA 1E2FA 4PANA 1GSIA 3UWOA 2R2AA 2RGNA 3H1TA 3ASZA 1ETUA 2CBZA 2Y8EA 4PXAA 4LPSA 4DBLC 1H65A 3D8BA 1T8UA 3GLHA 4DCUA 1PV4A 1JI0A 1D2NA 5K8IA 2IYZA 4KODA 2GF9A 3FMPB 5B58C 2J59A 4US0R 5EUQB 3PENA 4IDHA 2GAOA 4IVPA 1II9A 4M1KA 1D2MA 3AUYA 2W6JA 2PMDA 1W7AA 4Q47A 3B8HA 1IOZA 4QGFA 1UKZA 4XWOA 4JBYA 3QKRB 5CYOA 4RD4A 3FHTA 4JVMA 1O87A 1W5SA 4W9MC 5F9HA 3FB4A 2OG2A 1Q1QA 1W1WA 3P20A 4TSFA 3RS7A 1JR3E 1E32A 4CEIA 2BEKA 4IOMA 4JLVA 1W36C 1GOTA 1W4RA 4TWZA 5DHFA 3VQTA 1G4AE 2P65A 3U3MA 1AGRA 1E0KA 3DOFA 3HYRA 3NBXX 4KBFA 5DYIA 3SBEA 4LJ8A 4W5WA 4Q4HB 3GLFB 2O8BB 3QVUA 3QPVA 4EJSC 2F3RA 2GESA 4IXMA 4Q18A 4RFSB 3KKQA 4JLDA 2WWYA 1R5OA 4Z54A 3I5XA 2GCOB 1Q20A 2WJIA 3KX2A 4BQSA 5JMTA 1NP6A 1BKDR 4HUTA 1TF5A 1GIAA 2J46A 3AV0B 4IDPA 4FMCF 4Q1FA 1ZM2A 5EP4A 3LXRA 4BLQA 1ZNWA 1DO0A 4V02A 5CDFA 5IHPA 2IWRA 1BO6A 3UIEA 2J3EA 2ZYWX 1E1QA 2VHJA 4HLCA 3AF1A 1WXQA 1TTTA 4RSGA 1OHHD 3M4YA 2V9PA 3B13B 1TQ4A 1RPZA 4QHYA 1QHHB 2WWGA 3NH9A 1VKJA 2VPPA 3PCRB 1E1QD 1KJZA 1A7JA 2ANCA 2RH5A 1R8QA 2Z5FA 4NCIA 2DY1A 4NYIQ 2JJ1D 2HJVA 4BLPA 3MJHA 3GP8A 1TQ2A 2RHDA 5DI3B 3NHAA 4IEIA 1ZUNB 3IBYA 2ZRIA 1KI1A 1NG9A 1LF5A 2FSHA 2JLQA 1KSFX 1SKYE 3RS0A 2IS2A 2BWJA 1Y63A 3R7WB 2KI5A 4KITB 1P62B 4G5QA 2YOHA 3EZFA 1NVVQ 4C0JA 1AJEA 2EQBA 4MGZR 3KTAA 4AYXA 4U02A 1ZC4A 2CNWA 3TAUA 2OFOA 4GFDA 2IEYA 2JDID 3QBTA 2OLJA 2XNDA 2ZR7A 4U5XA 1OPXA 2GAAA 4LJYA 1KZGB 1VYUA 5DH9A 1WE2A 3AVYA 2WTUA 4M1YA 4FCWA 2D7CA 4LJ4A 2WPDA 2EFGA 3K1JA 1Q1EA 4A36A 4JL5A 3A1SA 2CNWD 1IXSB 2Q21A 2FNAA 1I4TD 2HEIA 1KO8A 2NZ8A 2QEQA 2XNDD 4RJLA 5C1BA 2ZM5A 2IUUA 4XJXA 4BZXA 2OCPA 1BOFA 4Y0AA 2PL3A 5J4HA 3SYKA 1FNMA 3ZH9B 2BM0A 2E9SA 3B9PA 1GL6A 4CZ2A 4F4CA 2ZRGA 3FPAA 3KKMA 2ZPTX 2CLDX 2Q3MA 2QE7D 4LYFA 5LPNA 1K5GA 2WVJA 1RJ9B 1XXHE 2LKDA 2X77A 3L43A 4E09A 5JEDA 4X8HA 4QGAA 4PHGA 3K0CC 4IRUB 1SULA 4Q5IA 3Q7PA 5EXPA 1ZP6A 1Z3IX 3W3ZB 1M1YE 2B7BA 3A1VA 3L0IB 3L8ZA 3F5FA 1R2QA 2FFQA 3CF0A 5A0FA 2VHUA 1US8B 1OXXK 1NRJB 1IM2A 3RABA 3L8YA 1TF2A 1JALA 2ZXUA 3PEWA 5TARA 421PA 4QOSA 5G3YA 1G6OA 1Z6XA 5ANRB 4EPYA 2F9MA 4XSHA 4PPQA 5EZ5A 2CE7A 1U8ZA 4XTRA 5H70A 4KCGA 4MITA 4MKIA 5FUXA 2QMEA 2BV3A 5A5GA 2IA5A 1OB2A 3RRZA 1N6OA 3NWJA 1OJLA 2OAQ1 4J0QA 4D26A 4GI7A 4C7OA 4R98A 2P3SA 3R9IA 4BFYA 1RC8A 4NPHA 1CJUC 3Q5EA 1KSJA 2GHIA 3P4YA 4A6PA 1EFHA 4XVQA 4NCKA 2R8RA 3CX6A 3JVVA 3WHLA 3WRXC 5EJEA 1XZPA 4E5UA 5IK2A 3WMGA 1KIMA 3LX8A 3DM5A 1S3GA 3FMFA 3RS5A 1M7GA 4EQ6B 1Z6TA 2DYKA 5HE8A 4V0NA 1ZMXA 1T3SA 2A2ZA 2Z83A 1XF9A 4B34A 1EWRA 5IK2D 1SVWA 4D4JA 2C5LA 4B3XA 2R44A 2CHQA 1ODFA 4QHSA 4DLSA 1SHZA 4YMUA 4MQBA 3ECCA 5C46F 4CVNA 3QKSA 2V1XA 1XEXB 1H8ED 1KK1A 1JAIA 3NIBA 3I1FA 4NU0A 5GJCA 3AP3A 1FMLA 2OBLA 2WWIA 1CIPA 1HQYE 2BMFA 2WMOB 4UKDA 4PAMA 4P4UA 2PLRA 3HPQA 4KI0A 4WW0A 3CLVA 4HAUA 1Z6YA 3VKWA 1YZNA 2AXNA 1G21E 2QTFA 4V0ME 4Q1AA 4ZI3A 4EKDA 3KB1A 3PUWA 2ERYA 2W2VA 3R20A 4IEEA 4A8JA 3K70B 4Q7JB 4WAUA 2ECKA 2VIIA 3GLHB 3P1JA 821PA 1ZNXA 1PVOA 1GKIA 3DKPA 1P3JA 1XTIA 2ZYTX 4LK2A 3ZD7A 2OUKA 3W8NA 1F6BA 1ZBDA 4D4KA 2NO6A 1G5RA 4L5BA 5SZIA 2NPFA 4PO1A 1LS6A 4B48A 2PEYA 4FWTA 1QG4A 4H1VA 4AKIA 5FPYA 2CXXA 4WVFA 3C16C 3D31A 3HWSA 1KI6A 2VA8A 1G8PA 5G40A 4HDQB 4DLZA 1VG8A 4CEIB 1QHNA 3HU1A 1CU1A 4HB4A 3KQNA 4OHYA 2EFEB 3LFUA 1T4GA 2CL6X 4B6EA 3CO5A 3MWKA 3EA5A 3I5YA 1FZQA 4M9SA 4B3CA 4F4JA 3EW9A 1ANKA 4G5RA 5KDLA 4BLRA 3CBQA 5EE9A 3SHWA 2AX4A 4DT1A 1SVOA 4IOJA 1E1RA 1TEVA 2FPLA 4JBWA 4PC6A 4TLDA 3SE0A 4ZI2A 1ESMA 2EWWA 2R9VA 4PPGA 1Z8FA 3SDZA 1TL7C 3BB1A 2BCGY 3NEYA 2FA9A 1MT0A 3SHFA 3MFYA 4OK5A 1Q21A 1IJFA 2CE2X 3THXA 3TSOA 1XZQA 3QVVA 1E1RD 3AUXA 5HZKA 1Z08A 4XSGA 1N6NA 1R0XA 2R6AA 1E2KA 1TADA 1Z0DA 3FDIA 4IFEA 3U60B 2VQSA 3FFBA 4XTCS 2QQEA 1O3YA 3TVDA 3R8CA 4TT3D 5C4MA 4QJ4A 3KQLA 3THWA 1MABA 2D62A 2C8VA 2FGKA 3AM1A 5JJLA 4HB2A 1NN1A 1KAOA 1Z6GA 2ZJZA 1U81A 3MUFA 1ZM9A 3TBKA 2J45A 1XU4A 4AKEA 3KTAB 1VHTA 2EFCB 2AR7A 3Q72A 1KDPA 2VEDA 3PV0A 3MMPA 2RGGA 3QPWA 4KFTA 3GLFE 4B2IA 5H8WA 1AS3A 1JJVA 1V43A 2W83A 2ZS8A 4CF7A 3Q7QA 1GM5A 5CM8B 2DBYA 1E99A 2O5VA 4H9GA 4IDOA 4NDZA 3L0OA 3RVBA 4V0OA 4LBWA 3SS8A 4FI3C 3EXAA 1W2GA 2BVNA 4MRSA 3FMIA 1X86B 5EXXA 1FTNA 2JA1A 1F2TA 4HLDA 1CULC 1KMQA 2XB4A 2ZRLA 4R7ZA 4NKRA 2RMKA 3N2EA 1S8FA 1ZUHA
chains in the Genus database with same CATH superfamily
2C2MA 4FYHA 5BO5A 4GX1A 1GZ6A 3EMBA 1YJ5A 3EFEA 2XQIA 3P9NA 4HWGA 5HKKA 4IM7A 1P61B 3WV4A 4MHTA 3WFJA 1FTSA 2WD7A 4TKUA 2EJTA 2WWFA 1TD9A 2Y66A 2WSSA 1IZ8A 1JIUA 2X5XA 3C4VA 3HBLA 2AQHA 4WOKA 5DK6A 3BZUA 3SN6A 4EIWA 2BEJA 3NHPA 3EFOA 1U90A 5HBGA 5I7HA 2A78A 1U5CA 4N0DA 5K6TA 1D1QA 4WH0A 3F6RA 1KZHA 2YVQA 5C8VA 2XV1A 2QAGA 2LCQA 5FBZA 3T3NA 4CIXA 2PZEA 3A26A 3WGJA 3DYVA 4IIUA 2Q29A 3WGTA 2DQYA 5ADVA 2N1BA 2RONA 1GKYA 2QW8A 1CHDA 1R15A 2QN7A 2G72A 2Q8PA 2ZZMA 2QVGA 3AP1A 4FYMA 2QNRA 4AIRA 3OZAA 4OXKA 2V6MA 2ZB2A 4M0EA 2DPGA 4O8ZA 2R1UA 4UM8B 3H3XA 5T8KC 2HF8A 1RI1A 2TECE 1U0HC 4XSVA 4BNIA 3L6EA 2FH5B 1TUIA 2HTEA 2KW5A 4G5YA 1TC1A 4FC7A 3QHPA 3EZLA 4GPBA 1PUJA 4RDCA 5F78A 4LX0A 1Y1KE 5H83A 1F4PA 3JYHA 5JMOA 1OB5A 3PBKA 2NO4A 1AGNA 3TOSA 2VYVA 2YFHA 3BPSA 2XZTA 3ENVA 1Y9DA 1YS4A 5HZHA 1IUOA 1C9MA 3SHOA 1QAQA 1SUFA 1U9CA 5I9SA 5JSFA 2CN1A 2J32A 3IPLA 3TNLA 4BXOB 2A30A 3K0FA 1HH4A 3CM0A 4R8MA 4NV3A 3VU0A 4FOPA 2EXXA 3RIXA 2YY5A 4YN3A 3QWBA 1SOWA 1DKRA 1PUXA 3BXPA 3VPGA 1RFLA 4L8VA 2ZJ8A 3RU2A 3NVKI 2V6BA 2YHUA 3FDZB 4G5GA 2WWHA 4BNLA 4LJ7A 1IBMB 1JDPA 2ZWVA 1R0KA 1MJNA 4CV2A 1Y33E 1K6MA 2WSBA 3PGXA 1OXBB 2HCFA 3GEEA 4M49A 5K0LA 2GM5A 1QTQA 1PW7A 2L0XA 3OJCA 1ODIA 1KYYA 3IUMA 5L3VA 1S7GA 2MYUA 4O1IA 4BC0A 4CM7A 3GH1A 4H7IA 5CLJA 4OH1A 5L4SA 1XRQA 3VKUA 5KOHA 4D9FA 4CODB 3R7LA 3KCQA 4S1OA 4TYWA 3HP7A 4TMTA 1WQ1R 1ZNYA 1HT1E 2DTEA 2VSYA 3QKSB 1A4RA 1U65A 4DMHA 1LQUA 1CUDA 1HA3A 3OY7A 3IUSA 1XDDA 1UBLS 1O5TA 1T2NA 1UF9A 4RMIA 3D2AA 4RO0A 3AYZB 5G4LA 4DQDA 2HQ1A 2C78A 1JRLA 1WDMA 2IQ5A 3AESB 2ONJA 1IMOA 1X7ZB 1II0A 4QARA 1YE8A 5DYGA 3D6VA 3RBZA 3VVMA 2IOHA 5KKNB 2QPOA 3UT6A 2V0GA 2ZRAA 1MUUA 3GLQA 3JD1A 1J8QA 3NC1C 1LV8A 3FTCA 5EHZA 2FAXA 2IT1A 2XWJI 3EC1A 4A6XA 4A8JB 1KK3A 1QBKC 1ZITA 2BPOA 4EKYA 3KAKA 4FNAA 1VBNA 4KE8A 3BULA 2CXTA 1NUSA 3DONA 1IXRC 2R6FA 3PQ3A 4E2YA 1W30A 4ZC8A 1TKBA 2KPOA 1YB7A 2QTVB 2V7QD 2VF5X 5IKOA 4UCQA 1XN1A 1NXXA 1E7RA 2O2EA 1KKUA 3A10A 2ZUVA 3BJMA 1ZVKA 1KBZA 3EZGA 2OV8A 5DNCA 1B0UA 4RKRA 2BGGA 3IUPA 3LPLA 3V2UA 4U2BA 1J56A 1LI7A 3BVPA 4G25A 3DE2X 3FKSD 4DSZA 3VPDA 3EEIA 3HRIA 5K45A 1KJ9A 2MU1A 4HX5A 3O9VA 3WQBA 2DFNA 1RRPA 4UMVA 2MIIA 4Q0MA 3CCFA 4R51A 4LF8B 4IGAA 3KIPA 1MDFA 3DVLA 3GLIE 5AM4A 4BNZA 3L8GA 3WHIA 3H9GA 4LF6B 3IUYA 3B1XA 3OURA 3F96A 3M4XA 3E7WA 4NNJA 4CIAA 3K0EA 5FNVF 3ML1A 3DNMA 3RAJA 3TEFA 1BWPA 2ZZKA 4TLCA 2OYRA 4RGQA 3F2VA 4ZDKA 1FA9A 2ET6A 1NUAA 2Q9BA 2ZG6A 2O6LA 1S3FA 5AH0A 3NHMA 2PKQP 1Z2AA 4YLGA 4AS2A 2VYFA 2C2WA 4XDHA 4BP3A 4ZYVA 3QPUA 4TV8A 5IJ9B 2V8OA 1MO2A 1YCHA 4QRIA 1AV6A 3DKKA 1VHLA 3QXHA 3OCXA 5CIQA 2XF8A 3AH8A 3LC7O 4ZRNA 1OQAA 1I5EA 2HPHA 1EBUA 2OLKA 4JYCA 2ODNA 4Y2XA 3F3MA 5EQDA 5EIWA 4FGSA 3CRVA 1NI3A 4C0KA 3OPYI 1LJ8A 5A3VA 3AO0B 3DZHA 4C0XA 1TO6A 4TTVA 4XQ0A 5AJWA 3P9ZA 2GBCA 4O29A 3L0ZA 4WKCA 3O31A 1UT5A 1HYHA 4BQNA 1QU2A 3TRIA 3THWB 3SJZA 2H2DA 4PSUA 1U0FA 2IE0A 3DG9A 5TQ2A 2DH6A 5KHOC 1XROA 2IX3A 3PFFA 4MUYA 3GJSA 3KSUA 1ULUA 2ATEA 2EX0A 4HDRA 1G16A 1ONSA 3GI1A 1O89A 3D3KA 2H54A 3UXMA 1JHDA 1XZDA 4P53A 1ZG3A 2MWMA 4RD6A 2OQRA 1J07A 4UNIA 4F6CA 4V0LA 4MP3A 4X54A 3DUFA 4U39A 1YACA 3U5ZB 4FX5A 2M6LA 3OIYA 1DWPA 2PTGA 4R9SA 1LPNA 1CYDA 4CRWB 1I94B 1T1RA 3DZ8A 4MULA 4DYVA 4LYGA 5ALLA 2NW6A 3ADKA 4LHYA 4LY9A 1CY0A 5DI9A 1Z4OA 2ODBA 3R7BA 1G59A 1EBFA 3WMWA 4W82A 3JWEA 3W4IA 2E6KA 4K9PA 1F14A 1XZBA 2JK0A 3EAFA 5K6AC 3ZVMA 3A9VA 4I1YA 3IQXA 1YB2A 3WYDA 3N87A 3QJYA 4W7HA 1F2TB 3UUGA 4AY5A 2PH7A 1OH8A 4KK4A 1NVXQ 2PXCA 4FOOA 2Q5LA 2A33A 2PUJA 3AILA 4AX8A 2RG1A 5EWJB 5HKOA 1FP6A 3ZLJA 2HXSA 5ES3A 3UPUA 1YC5A 4G37A 1V4VA 3RSQA 3VYRB 3D4BA 3ZCRA 3LCUA 3GV0A 1P1CA 1PZMA 2XUPA 1Z6PA 3FPLA 5CXXA 1H4TA 3TN7A 4CL3A 3A4LA 1B15A 1LX7A 1HEIA 1LZLA 1YBHA 2I0FA 2WIBA 5JSQA 1TAGA 3MD0A 1RVDA 2OGUA 1Y6GA 1GG5A 1GG8A 3LCJA 2JIZD 3AF5A 1B0ZA 1KYWA 3JTMA 2QJFA 2R84A 4J0HA 1I1NA 4GRAA 4X9XA 4BE4A 4MP8A 5AW9A 4LTMA 2PKCA 4MVXA 2WR8A 3N8NA 3LVBA 4RYLA 1FVHA 2PRSA 4K05A 4OQYA 2R8XA 3I0NA 1WV1A 3O73A 2AE2A 2G9UA 4GO1A 5H7XA 4BQFA 3MWDB 1NNUA 2YUTA 4EDFA 2ZI7A 2A9OA 3IHLA 5GAJA 1XHLA 1Y3BE 5GIOE 1Y5RA 2R4QA 1BXKA 3PXGA 4BMNA 6PFKA 2ATCA 4MO9A 4S1NA 4M6WA 3U0VA 2R6DA 3B5JA 3D7NA 1COWD 1VJRA 2V0NA 3NEJA 1BXRA 5GONB 5CPBA 2FW0A 2H65A 1EGMB 1QH8B 4WXRA 3RPEA 3VYWA 4F2WA 4CETA 1E7MA 3VZCA 4KDFA 5G3ZA 4PLZA 4ZO7A 5T41A 3VGPA 3UMRA 4RZUA 1QV7A 4PZUA 3TD9A 2JGLA 4ODIA 1JTVA 2CVFA 4C0HA 3WVNA 1FX1A 2FMUA 4IZHA 5JXIA 2ZAOA 3GDGA 4RV9A 5SZHB 1DTWA 3JQBC 3OQBA 3FA2A 4HAZA 4HK4A 1JSXA 5K5EA 3I52A 2AHRA 1RLTA 1ZGBA 3R9KA 1X70A 4AJOA 1V5EA 2ZTSA 3P7MA 2WQZA 4P86A 2R751 5DHPA 3IEMA 2QTWB 3K2QA 5B4UA 3VZBA 5TS3A 3EVBA 5KX5B 1QS0A 3T7JA 4UEQA 1B93A 3SYNA 4KJXA 1OLXB 1RFGE 3UOWA 1QZUA 4RTOA 1KYQA 3EIWA 3O7WA 1K4KA 1G8MA 2WIFA 2QYHA 3H04A 3IAAA 4BEJA 1GDDA 4P80A 3OOYA 1ORIA 1E79D 3L4BC 2YN4A 2I55A 1J8FA 1XA3A 4PLGA 1QYXA 2VDKB 4ZI7F 2RHHA 2WTNA 2WFLA 1IM8A 4FSHA 3U3RA 1FOEB 1KORA 2X1VA 5AJTA 1WHTA 3TQFA 3AY0A 3V7WA 3QK7A 3TD6A 5H5JA 5ERYA 4IVRA 4IIDA 3ROPA 3AP2A 5DF1A 5G2OA 3KZNA 5JUWA 2OGTA 5IXSA 4DSUA 1EFPA 4WESA 1T2EA 3MRVA 4FIDA 1UBTS 5CUQA 3QX3A 2H7XA 4A73A 4BFXA 4G1VA 2ZR0A 3H8WA 4XUEA 1A5ZA 2A4MA 5EJGA 5A05A 1WF6A 4HFRA 1R10A 5JXHA 1JDUA 2ZE5A 1PF7E 3OC6A 5GZ3A 3ZGXA 1P4JA 2HF9A 2OQIA 3OFSA 3UT5A 1IN8A 3EIFA 5L7TA 1SY7A 4NV1A 3T7SA 4NZ9A 3WOVA 5LU8A 4XEUA 3IP3A 1WVGA 3IVGA 4BNGA 1DBVO 3FY4A 3ZJUA 1T2CA 2WU8A 5CT8A 3T7CA 4DRXB 3CF4G 1GA4A 3M8KA 3U4GA 2ICAA 4E0BA 4F2GA 5IDQA 2A0YA 3FPGA 1NN3A 4TXHA 4B3FX 1QO7A 1HL7A 1I4DD 1GTL1 2AZMA 2EKPA 2QRJA 4M8SA 4A15A 1KARA 1SBCA 4FTWA 2UU9B 3Q6IA 5ELMA 1U2DC 4IX9A 3V6MA 1FX0A 4AD8A 1JG6A 1UMBA 1ZD9A 2KWIA 1KYZA 1GL3A 3RC3A 4OSPA 1GNSA 1W19A 3X1DA 2XE6A 5DXJA 5IAKA 2QE7A 5A6SB 4BGDA 1C8BA 1CY4A 2Y92A 3I28A 5H16A 3T0FA 3G7UA 4HB3A 2NVOA 4D4HA 3JATA 4UJ5A 5FBHA 4AW9A 4CMBA 1YAJA 1A69A 2KHZA 1SURA 1AXGA 1R6DA 3IOEA 3ADCA 2B4YA 2I2FA 4ZAWA 4DEXA 5A9SA 5JAMA 1MQ8B 1KPHA 3NFYA 1KMHA 4JBNA 1F48A 1Y9JA 4WLOA 1V5GA 2I80A 4PG5A 4H3KB 4MARA 5DCLA 5K3BA 4C4YA 3CNQS 1JLKA 3ROKA 3SF8A 4HRAA 4YRIA 2BM8A 2X1LA 1YBMA 3IHKA 3KE8A 3PITA 4AJNA 1W59A 3DO5A 4X24A 5IYZA 4MJ3A 1PDOA 4P5PA 5IFLA 1WSAA 1IJBA 5T7BA 2GWHA 3K0AA 2O2JA 1MH1A 1K3UB 2EYQA 5AJXA 3PC6A 1VYVA 4TQAA 2GXUA 3NPMA 4XGQA 3VDQA 3WGQA 3KQHA 1MX3A 1Z4NA 2BZSA 4U9HS 4KSCA 3OZFA 4RK1A 3OHPA 3PQ8A 4AN1A 3RS2A 2NSJA 5G41A 1P2DA 3ZCSA 1U0SY 2OM2A 3T7EA 2ASEA 4ZYUA 5IDWA 1XL0A 1RRCA 1QRTA 1Y80A 1H8HA 4BVFA 1NMSA 3BQ9A 4WN9A 3B3QA 2CK3A 1SR8A 2ZRQA 3LZCA 1UJ6A 3O2SB 4MYUA 1DDIA 4TLLB 4RZSA 3A6KA 5FA5A 1QR6A 3C45A 2OENG 2XVMA 2W6ID 3DV2A 3EARA 4P5EA 1BGXT 2QZZA 4PYLA 1E7WA 2PSEA 4REOA 3QVOA 4J43A 1N5KA 1DQZA 3RBXA 3KLNA 3LCRA 3DLCA 4E07A 1YU9A 4K9KA 4IDQA 5JO0A 2G63A 2VRNA 5KNBH 5AIBA 1WZ2A 1GT91 2P9EA 4Z0TA 4ME6A 1XEWY 3B1YA 5JTUA 4DNXA 3N7AA 4QJ3A 3F5QA 3B3AA 1A1SA 4BMOB 3CVYA 1CR0A 2B20A 1SUEA 4C30A 4ZIRB 4PRLA 1FUIA 4WI1A 1X14A 2RJNA 2VHZA 5M2QA 1PT9A 1QGDA 1NUTA 2JK1A 3QFFA 4RF3A 5AOBA 1V96A 3PC8C 4WZAE 3QFRA 1HT3A 2WDPA 4Y0VA 3W79A 2ZRCA 4JEHA 1M1NB 1LF0A 1N2ZA 5F3RA 1PJ8A 3N58A 3FOZA 1CUBA 4P3PA 5IZCA 3JD3A 2FOIA 2UDPA 3RRXA 3GCGA 2Z6AA 2B30A 3BRWD 1X15A 1E2PA 1D0SA 2COEA 5CCDA 2BP7A 3ZDBA 4NG4A 1Q0RA 1X1RA 4HN2A 1FUEA 1GNRA 4X1KB 5C7YA 1OCEA 4P7JA 3FYTA 5IEJA 1EP1B 1WZEA 4HGPA 3WYNA 2BD0A 2V96A 3S1SA 1YFLA 8MHTA 3H5WA 5BSEA 3AJEA 3NRJA 3EC2A 1V4NA 1F0KA 4XPZA 2QVLA 4K9DA 1EXMA 2BI4A 3TNDA 5H02A 1XNGA 4OLHA 1CQJA 1J2UA 2IODA 5E3HA 3KTDA 3DBVO 3IXMA 3SGLA 1JFRA 2B4KA 2XWBF 2Y1WA 4ZVKA 3HXMA 2CFSA 5KVCA 3FR7A 3JVIA 2ZANA 4J2TA 1S5PA 3GNLA 3QE2A 5FNZA 1OKKD 2FPUA 3PGA1 3V6LA 3VO8A 1YZHA 3RODA 4LBVA 1BTOA 3GW8A 4MQ5A 4U3JB 3VDXA 3GR6A 2Y1XA 3BSWA 3OP1A 5DCYA 3OOEA 4NZMA 2CCGA 1RPAA 3A4MA 3COVA 3PI6A 1OIXA 5HM8A 4JIGA 2FETA 4WA7A 3ZTTA 4LJ6A 1RAAA 3OTOB 2YHIA 4N8SA 1C1DB 4B8YA 1PFKA 1B6SA 3ODPA 4YAFA 4QDXA 2WWXA 2W6PA 1M2VB 5CAEA 3VVCA 2BMDA 2VVTA 2VZEA 3DV9A 1OT5A 3EBPA 4QAJA 1ODTC 1AKWA 3A8TA 4I8DA 1T6XA 3EB9A 4GC9A 5JTTA 2JIDA 3R0JA 3F7OA 4MVJG 1ODCA 3D81A 3PNVA 2P30A 2HRBA 2RHTA 3PNMA 2ONKA 3QPDA 4JN6B 4O4JA 3IVXA 5HCIA 4QU0A 1LI4A 5KYUB 4GPEA 4GX2A 4Y9TA 4JI0B 4C89A 3VTAA 3D9QX 3H4IA 2FY8A 1G8KA 1M1ZA 2IYNA 5BNZA 1GRNA 2IEIA 2J7PA 3IAS6 1J4AA 4EHKA 4Z2YA 1SO8A 4JR0A 3OPYA 2JAHA 4Y3UA 2AF3C 4OXXA 4EB0A 1NY6A 2VDRB 3V7NA 1JMYA 1H0HA 3V3KA 4C05A 1QIIA 2DR0A 4L8LA 2O2CA 1II8A 2GPYA 3EMKA 4FSDA 4UM5A 4E5MA 3FJOA 5IT5A 4E88A 3E3LA 3OTHA 4NCNA 5BUQA 1KOFA 1RJWA 4LRUA 4O33A 4PG7A 4MVJP 5D5HA 1QQAA 4DKXA 1NQWA 2APJA 2HLPA 5L51A 1ZNQO 4PYQA 3DOJA 3DBRB 4YRGA 3GJ5A 3LOUA 1GGFA 1VGRA 5KC8A 2I7DA 4HBZA 3FSGD 2XIQA 4BV3A 5D1HA 1FP1D 3F8SA 4BNWA 3EUEA 4X94A 4DIKA 1JEYA 3TYXA 3O3CA 2EBFX 1EVIA 1VFNA 3SBDA 1ZAKA 5KVAA 1VLHA 1NXOA 1Y3DE 3GJQA 4Q7LA 1CEYA 1MIHA 3GFGA 3FLAA 3LTEA 3W0LB 5LXTA 3K15A 1AUQA 1NG1A 3FETA 2OQVA 5TQVA 4B83A 1KI3A 2AVDA 1TGVA 1DNPA 5AR1A 3VDMA 4A82A 2WQ6A 3RWOA 1NJGA 1E9BA 1UBMS 3D1LA 4Q9LA 3YASA 1FVFA 3PDHA 1WD7A 5KNLA 1YRHA 1EFVA 3SP1A 4QXMA 2AVNA 3UK0A 2QRNA 2BYTA 1JG3A 3K8YA 2PUAA 2H7VA 2X4IA 2EP8A 3CB4A 3KALA 4GDMA 1L4HA 1C9JA 5DW3A 3TFWA 3U80A 3WKEA 4EO4A 4FYWA 5AVZA 3NXKA 3SVTA 2DE0X 1JLSA 1ZFNA 3C14C 3NOXA 2JBWA 3BILA 4FOTA 3QOXA 1UH5A 3SXUB 2O8EA 1Y6FA 4OJKA 1W9MA 4AP6A 3DE7X 5C51B 4CUJA 1BC5A 3M5PA 4CFYA 4PF1A 3K73O 1L5NA 4FDMA 1BX1A 3GU3A 4DDUA 1CUAA 4W8HA 4P08A 1NZJA 2PV7A 2OFWA 4LKRA 5GVSA 1NRIA 4NNOA 1TM7E 5DFAA 1K9SA 1QIGA 2JD0A 3AGPA 4RETA 3S1LA 1VI2A 3U7EB 4LISA 1QHYA 1N2OA 2WKQA 3KHSA 4YAOA 4RGYA 5JAZA 1PZNA 3ANNA 3CVVA 3GJ6A 3FVWA 1Z5NA 3U7QA 1K4MA 1OBFO 4QVGA 3G5UA 4LF4B 2B4TO 3GJ8A 1Q1BA 4ZMBA 2GVDC 3MGGA 2F64A 5G4KB 3C39A 5C3UA 5A1JA 5I7EA 5HFJA 3GUYA 3O1LA 3QMMA 3EUFA 4YRBA 2C77A 1SU4A 2YHBA 4MV6A 2CL7X 3LO8A 1K97A 3MWEA 1GRVA 2C9OA 3B9RA 4JI5B 4AY2A 2WK1A 1RYBA 3UMBA 2QTRA 3ZYCA 3QVLA 3TFOA 3KYBA 1JWLA 5LBIA 1RWMA 5EJ2A 5ERXA 3U3JA 3TQIA 2IOFA 3O8QB 2AG8A 3OUTA 1THMA 2GJ4A 2C4HA 2AB0A 4ZCMA 3VOAA 2H18A 3O26A 1VRCA 3CIFA 4FHZA 4D3SA 2H1CA 2H07A 4L0CA 4OKSA 2EZ8A 2ZSIA 2JGAA 4DWOA 3KQSA 3R0QA 3P0JA 3LBHA 3NJ8A 2BEVA 1QYIA 4IUYA 1XT6A 3CX4A 5G02A 3D7SA 4FEYA 2AEJA 1DINA 1KFJB 4FW9A 4D7AA 1RYFA 3SQOA 1XV5A 2HQRA 1KQ3A 2X19A 4RJKA 5JCPA 2E4XA 4DQVA 1CUXA 1T9GS 1FE8A 3KWLA 4QYWA 1UL1X 3VU9B 1FTWA 1NW7A 2QRUA 4AXXA 3LUAA 1U2GA 2VXOA 3VSEA 4RK4A 2O8DA 1I24A 2AA3A 3OE4A 3LLUA 4UREA 3MJTA 1KMIY 2PZMA 4M1MA 1ZWKA 2HHLA 3HCEA 4E5SA 4J0IA 1MOZA 3P71T 2H7YA 3VR4D 4C29A 3GMTA 4WA8A 1MW9X 4F6RB 4YA6A 4LS3A 3L1KA 4PHHA 2VP0A 8GPBA 2UZ1B 4HYYA 4JYAB 3G85A 2D06A 4RDIA 1JEQA 5JH7A 4P7BA 2JANA 3CF6R 1L3BA 4A16A 1XZAA 2NU6A 3NCTA 3LUHA 3I1YA 1KDTA 3RFVA 2D5BA 1I4LD 5EZYB 2JRLA 4L1KA 4HUTA 3HBMA 1MMFB 1SU6A 4RSRA 3EWAA 5FEMA 2JFZA 2PA3A 4CT4B 3RAPR 5DLYA 4U4AA 4C78A 3MTQA 2G5TA 3LD9A 3DYBA 1PWZA 5E4TA 3KOXA 1UP6A 5EMMA 4BFWA 5C80A 3VR6D 3FYUC 4Y2HA 4EK9A 1U3CA 2TMDA 2Y71A 4WGGA 3OF2A 5LLSA 3WYCA 3VC1A 1DBQA 2WINI 3IMKA 2F1JA 2ILVA 3MIIA 3NNDA 4GF5A 2L19A 4WNYA 5JDIC 4DB4A 2IEBA 1IEXA 2JLAA 5CT6A 5CW1A 2WP8J 4BEVA 3T5DA 4NBKA 5C53B 1GL9B 4AUEA 3C87A 4MPDA 3SDSA 2V7PA 3IOMA 3L40A 4JJ8A 1FP4A 3E3MA 5G1OA 4IWNA 4ZI5A 4G23A 4HXYA 4KV9A 2BGNA 2NU9A 1JHYA 3LDFA 3U4IA 1R3UA 3ZU4A 1FW8A 4J0EA 1A7UA 3UCFA 2MSCB 3PVSA 1H23A 3K9NA 3RGWS 3QEAZ 3QEKA 5ICEA 2GBFA 1RI2A 3SY8A 5KWSA 4KFUA 5FQOA 1GUDA 1U63A 2YNMA 1L7EA 3CW8X 4E7PA 1E4EB 5FYDA 2X41A 2B92A 3RUEA 1NYRA 2R68A 2RGXA 4C4OA 1HO3A 1NSFA 1USKA 2L69A 5JCOA 1O1YA 3ED5A 3BH0A 3ONDA 1CEXA 1FDVA 3C3XA 4YMGA 4J1QA 2VC2B 2HUPA 3RC8A 2B34A 1Y37A 3HM2A 3O8BA 4TXMA 1IWPB 4G5XA 2CHVA 4P22A 3DKVA 5L3QA 3PPXA 4EFLA 2ZB7A 3C8HA 1YT5A 5YASA 3ZS9A 2IIBA 1U2QA 4XCQA 4K86A 1YQUA 4XVUA 3KC2A 2AOUB 5LZ9A 2B82A 2DWPA 1H9CA 1JPVA 1NVGA 1EUCB 2JHFA 5DYWA 3RB8A 2A3RA 2QORA 1M3SA 3FUCA 2WAOA 3M81A 1XTKA 3BL5A 1RWXA 4W5NA 3LWNA 5T67A 5B57C 2JFHA 5CB4B 3TMKA 3TD2A 5JH7F 2A9PA 4DCTA 1HTBA 2R86A 3CJTA 5FI1B 3USCS 3IA2A 3D5EA 4OX9Y 1HG1A 3W3AD 5GONF 2I9KA 2BBTA 3LLMA 4O5OA 5D3ZA 2Z30A 1CS0B 4CCSA 1NLMA 4D5EA 3LPMA 1QVAA 3E8SA 1PX0A 5KU7A 3E9CA 2GZSA 1GRRA 1F20A 2QV0A 3AB3A 2IHZA 3KU1A 2FHPA 2WJVA 2QXTA 5D3MA 3T35A 4C4RA 1DV2A 4QYSA 5DNDA 2GDZA 1V6AA 3LLCA 4MHOA 2OLEA 5DZSA 1HMYA 2CXNA 3WLFA 1L8OA 2HPZA 2VJCA 3A05A 5EIOA 2Y76A 3A11A 1A5BB 3I42A 1JAZA 1RWOA 3KFXA 3PHCA 2O23A 4L7QA 1JHZA 1Y1TA 2B37A 1S2NA 2OOSA 2VCYA 2W2QA 4N8DA 3PNOA 1LQTA 3TZQA 1INLA 3KSZO 3LHDA 4WZAB 2BGLA 1Y3AA 3MWFA 2ZRNA 3E61A 3KP1A 4HI0E 3ETNA 3P26A 2NU7B 5KX5F 3GGGA 4DARA 2DFPA 4JCOA 2XCRB 1KRHA 3SYMA 3OH8A 1W88B 1IN7A 4YQZA 3D4OA 5DTEA 3VNVA 1LSOA 3B48A 3HKEA 4EQZA 5KNBA 1U0BB 1PJLA 2KM1A 4P4SA 2VAVA 4Z3DA 1PYOA 2QYOA 3H0CA 2C9YA 5JECA 5D84A 4S2UA 1RQRA 3GLUA 3AUJB 3FFAA 2NAPA 2X2OA 3HKBB 2O52A 2UVPB 4MRVA 4Q9JA 1L3IA 3BRQA 3AZOA 4GP6A 4LZPA 4UAJA 3THOA 4C4AA 2ZSEA 1XMSA 1YDGA 1OE0A 2IUYA 5A03A 5H9WA 3OQJA 2X9QA 4CM1A 4ZCIA 2GBIA 1AURA 1Q0LA 2X1MA 4RZQA 3UWDA 1CEQA 2WSLA 1FL9A 1ECPA 1GPAA 2C5GA 1I0IA 3BXFA 3LPDA 1Z34A 4GYJA 4L9SA 4HMOA 1OH7A 4BVHA 3MWLA 4FU0A 4JQYA 5HCUA 4A7PA 1USWA 2YR0A 1N1DA 4LQLA 3WIEA 3AINA 1MP0A 2J6HA 4W1QA 1IH8A 2PZGA 4UXIA 4CMIA 3KR1A 4XX0A 3WGLA 4D9JA 2JVIA 2CD7A 5HIIA 3GJ4A 2X8BA 3U4QB 3E2IA 4Y2YA 1DAIA 1HGXA 2GFQA 4NY1A 3VR3A 3WO1A 5IZ4A 3M9LA 3OIDA 5KYGA 3ZKWB 1X9GA 1LC3A 3MBKA 1G8GA 2GTHA 2XT0A 3PQ2A 1KVTA 2PGDA 3IIMA 2O06A 3OD5A 4NJMB 3QNMA 5LZ4A 4QDUA 1XXLA 3SOZA 2I91A 1R27A 3MPOA 2GEJA 2WWWA 3PC4A 4U8GA 4MTLA 4U7WA 4M9XA 1Y6RA 2H1FA 2XXBA 2VZ8A 2RB5A 5ISMA 3HZHA 2I66A 4XQEA 1U28C 2JAWA 2X6RA 4ACBA 1Q2XA 3WWZA 2ZETA 2Z04A 2QN8A 1HSOA 1P1IA 4XYLA 3U26A 1Z25A 2X14A 5I7FA 2VUUA 3ZWVA 3VKHA 3K1TA 4AO8A 1NN0A 3KLBA 2MSEB 3R5SA 2WJ3A 3RUDA 1W73A 3EG9B 5TC4A 3WNZA 2GKGA 4K1LA 1L7BA 1N2SA 1P39A 4K8OA 4INZA 4DEYA 4PC3A 4XUDA 4EJMA 1SKMA 1BE8A 5DX8A 2O8CA 1H2YA 2B78A 1A9QA 1DSSG 1Y6QA 3H1PA 4QJBA 1CDEA 3WNQA 5IUNC 2WC1A 5AKLA 3ZJTA 3ZBQA 1O96A 2RJ3A 3KB6A 4LRTB 1VCMA 3W34A 3S1AA 1BCRA 3C8MA 4RGBA 5UKDA 2DLDA 3I6YA 3OKPA 3M5WA 1OXVA 3H13A 1K7EB 5D8DA 1TT5A 2FPGB 1M7BA 3RANA 4BB0A 4LYEA 1ELOA 2EKZA 4H1WA 2IL1A 2XQKA 1OY1A 2DUNA 1JHAA 3H5TA 3K0KA 3LQRA 4FMBB 3EPJA 1D2RA 5J59A 1GPYA 1KH1A 1N2CA 1SIBE 1UQRA 2NSYA 2Y1LA 3QITA 2QAGB 4X66B 3D0OA 1P2TA 1R8JA 4JGIA 4EOGA 5ICCA 2C29D 3TTYA 4A0SA 1V7PC 4HCJA 4X63A 3HO6A 4PGGA 1U3TA 3U49A 2D54A 3MJEA 4QBFA 3ZDZB 2PS0A 2WF7A 1QE5A 3AIMA 4CR7A 5GIPE 5LDGA 1GG9A 1M8FA 3U16A 3RH0A 3PWKA 2HYIC 1EK1A 5KMGB 2AG1A 3DULA 1SCAA 1U3GA 3TSAA 1F1JA 1PL0A 4IILA 4CCWA 1NR5A 5A4IS 3ZOZA 5CX1B 1K75A 3Q4GA 3HVRA 1OA0A 2Q6VA 1HFEL 4OHRA 4IJVA 1HE8B 1PV1A 3U2QA 2QBYB 1HT0A 1Y8ZA 2DFTA 4OGWA 1P9NA 4O8CA 2FE1A 1A88A 3EUWA 3OE1A 1RYHA 4XAQA 5ALZA 3DXZA 4A6EA 2FSIA 3WZ2A 2GZAA 4OK6A 4DNQA 5KBYA 3T4EA 4M7OA 4UBOA 3GLIA 3MCTA 3NTLA 1OW3B 1N8SA 4Y7CA 4CIVA 5JZOA 1Z4MA 1SK9A 1KEVA 3FYCA 4Y2RA 4F91B 2YZMA 1UKVY 4ABTA 4FHEA 2CJXA 3RK0A 1GFZA 5BV1A 4KXFB 4OQQA 3U3KA 3TL2A 5A4DA 4GKJB 2A0FA 4IHQA 2BSAA 2W71A 3GWGA 2J1LA 1R37A 3OCJA 4CM8B 1XUOA 1TJYA 2NUBA 2QT0A 3C7DB 2Q1XA 3EVGA 1T4DA 2P79A 1SZCA 4AG5A 2IHTA 2VZ0A 3ONVA 2GK4A 1XVAA 1C9DB 1W2HA 2PGAA 2XEDA 3ER6A 4QUIA 2ZQYA 3VOBA 4DS3A 3WJ1A 4BO3A 2Z9CA 1BVUA 2ZBQA 1K9VF 4HLQB 4N5NA 3B1ZA 1H5NA 3JQRA 4AG3A 2I7CA 3NTRA 4DLAA 2QW0X 2A14A 2XTAA 3ZK9A 4CM9D 2FPRA 1S8AA 3X1KA 4CL2A 3OEWA 3ACBA 3HXOA 2JJ2A 1Z15A 3IT0A 4DR7B 3F4LA 4OP3A 2QVZX 1KS9A 2ZTUA 3AC0A 3NATA 2H48A 2FP4A 1D5CA 4BBPA 4L0MA 1EFCA 1FFXB 4CIDA 1KO7A 2Q3HA 4FLFA 2LP4Y 2ZJ5A 5GINE 4DA0A 1YS1X 2GLXA 3DMDA 5DHSA 1NY5A 5JANA 2FRDC 3P9XA 4IJ6A 1ZL2A 2BHLA 4PG6A 4MEJA 4NBLA 3AY7A 3RS4A 2WTEA 2FZ5A 2XNHA 3G0OA 3WKAA 1S2MA 3ETGA 4ALMA 3R9XA 2O8FA 3H6KA 3OSUA 5JD6A 1U0GA 3E22B 3NBZC 4EB3A 2ECQA 5CFOA 2GEKA 2EL9A 2IHYA 4ZOQI 3CNEA 3C4QA 3E1SA 1DXHA 1HDRA 1RPNA 2AI1A 2NZ2A 3DSRA 3UMFA 4HAVA 1PNOA 2GNOA 3MVEA 1C3EA 3RNOA 3JQ7B 5J58A 1EM6A 1H2RS 2VOJA 4MPJA 1UANA 4XLZA 1ZZGA 1H66A 2OT3B 2BDEA 2XDAA 3FNRA 3JARA 3ZVNA 3GRZA 3HKCB 3DHVA 4UEJA 2PZ8A 1PVDA 4YDHB 4UEKA 4AG6A 4LHWA 1RWKA 1G7TA 4JJ7A 2GFIA 2FQQA 1D0IA 3WK7A 5JJIA 3C4JA 2CL0X 2JFWA 2VN8A 4M9CA 1JA9A 2FOLA 4LXQA 1NM5A 1GAJA 2QN6A 4U00A 4BKMA 3KSRA 4GVPA 1RI3A 3CR3C 5HKBA 3OUZA 3LKVA 3MOGA 1AQ6A 1EFLA 1HYEA 4DQKA 4HQ0A 1O0CA 1R0WA 4F72A 5K7SA 4YJ2A 4V0KA 3PIDA 4CN9A 3RLFA 5JD5A 1MTOA 2EKBA 3O8OB 2YY7A 1H2AS 2P0EA 3PQ7A 2NUTB 4B6FA 1E6EA 1G7RA 1SA0B 3AYXB 3GFBA 3KYDB 2IDMA 4XOIA 3RYIB 1CQIB 1DEKA 3RARA 5A62A 5LMUB 1WP9A 1GTVA 1FRZA 1N3IA 1UCFA 3LDUA 1JR3A 4KAJA 3KWJA 1I2BA 2IYOA 4Y6LA 3C6ZA 4YRDA 1DC4A 3UJNA 4EX7A 2DHRA 3BK7A 1HFJA 4JJIA 1QH9A 5IH7A 3A70A 5DHRA 1RAHA 4C76A 2ZCUA 2AOTA 3FBTA 5J47A 2I4IA 3OMWA 2JZOA 4ZMSA 1TEZA 3NKLA 4J94A 4NMLA 4M3NA 1HURA 4KGZA 4OKIA 3WSTA 1P81A 3K2IA 3OX2A 1SBYA 4HH0A 4EABA 4UQLA 3B2NA 4IS2A 3CKLA 1CUEA 2BLNA 1ECCA 1QFJA 5JROA 4RTNA 1VSBA 1QC5A 1Z22A 2PQ0A 2Z3WA 121PA 2JCGA 5FBWB 1XAGA 3N70A 1KPIA 2JHPA 1XRJA 2J6CA 4UU8A 1A8UA 2OAGA 2QVBA 2MMGA 2NT4A 1P18A 4RKWA 4TRMA 4W1PA 4YWHA 2LZ0A 1CZKA 1E8DA 2AFIB 1NFRA 3I9LA 5HF5A 1V1JA 5F1PA 2WIAA 1TK9A 3LL7A 2X13A 4EB8A 5JQGB 5K0BA 4C7BA 2QT1A 3DE3X 3C98A 1DHTA 3E1GA 4P84A 4ARAA 2ZBDA 4RJ2A 3EVNA 1G98A 3LW7A 4KC0A 3Q3JB 3ZCVA 2JZCA 5EMNA 5J3JA 4MGYR 4WY8A 1PO7A 3EVFA 3P2MA 5B7QA 3D3JA 3MT0A 3ORYA 1GTRA 1H6CA 2ADMA 1N25A 1RVV1 3EA0A 3OA2A 4RY2A 3TTXA 4CQMA 2WWTA 4BNNA 4QELA 5K05A 1JW9B 3L4KA 3ZWBA 1N0WA 4MQFB 3UMVA 1OAAA 1UDXA 2P62A 3TM4A 1KHHA 3PEUA 3FOEC 1Y89A 1KZ4A 2F55A 4DIBA 2C83A 4E51A 4JOCA 4DDKA 3GFOA 3ZS8A 3HY3A 4YT4A 3G2MA 4NBVA 3W2FA 4JU9A 1YNSA 2QZSA 2Y0BA 4JP3A 4KN5A 3I2JA 1A9SA 3B9QA 1EX1A 2XQGA 5C3MA 2WUEA 4WX2B 3GZJA 3DOEA 3MB5A 2Y05A 1D6MA 4JXJA 4AKHA 3WXBA 3M6AA 4GXQA 3MYYA 4DA8A 1QIMA 2BFNA 4ED9A 1UZMA 2P6OA 1X2EA 1A2BA 2DU8A 3AI3A 4O02B 2EL7A 3E9NA 2VPZA 1XTBA 2DXIA 5KNCH 2GTPA 3DEAA 3MAJA 4Y18A 1VSTA 3GY0A 4EG3A 5EG5A 5JO9A 2R48A 3ZBPA 3V1MA 3ZY5A 4AZSA