1E9FA

Mutant human thymidylate kinase complexed with tmp and adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
211
structure length
202
Chain Sequence
RRGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potentiating Azt Activation: Structures of Wildtype and Mutant Human Thymidylate Kinase Suggest Reasons for the Mutants' Improved Kinetics with the HIV Prodrug Metabolite Aztmp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 80
structure length 202
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e9fA00
5LB4A 2QGZA 3THWB 3QBTA 5KDOA 2VTKA 3VR2A 4EJSB 4K8OA 4D6PA 1X8KA 3CX6A 1MT0A 4LBYA 4KFRA 1KO5A 1SVMA 2GXAA 4YQFA 2HT1A 1I2DA 1XCMA 2C9CA 4PC2A 1EFHA 1N6NA 1ZD1A 4GP6A 3MAAC 4PZZA 3KL4A 1XPUA 3GQBA 4M4SA 4N3NA 1KJYA 1UBFA 1G4UR 1GTVA 2CDNA 3F3YA 5CIWA 1VYUA 1OXVA 3PR1A 4X8OA 4EPVA 3GLGB 1E1QD 3EZ2A 3EXAA 1VCIA 1ZC4A 2IYWA 2R8RA 4QHTA 1TNDA 3EC2A 3REGA 2OCBA 3BH6A 2BV3A 5FBWB 3X1ZA 4AG5A 1EWQA 1DAFA 2O0KA 2WWIA 4IDQA 2ZRKA 4PO9A 4V0KA 5E7MA 3NXSA 5EZ5A 3I73A 2VP5A 2V6JA 1OXXK 1W2HA 4V0NA 5C2JB 1DG1G 1W4RA 1WA5A 1R0YA 2CL6X 4PSKA 4LJ9A 1FX0B 1VYVA 1U8AA 5G40A 1KSGA 1RC8A 2P6RA 3NC0C 4P4TA 3LBHA 1OH7A 4Q7KA 1UKYA 1X8JA 4M1WA 1Z2AA 2A5DA 1CR0A 1EFUA 1Q21A 2WJHA 3ZS8A 1ZRHA 3MG9A 3QG1A 1TQ6A 2UKDA 3K9GA 2ZYTX 3AF1A 3QKSA 2JIZA 3CZPA 4NYJR 4D0GA 5HKKD 3K0CC 2C03A 1E0AA 3T5DA 3AEZA 4IOMA 1D5CA 2O8CA 1CTQA 1W46A 1KMHB 5EP2A 2REXB 3OHMA 4LJ4A 4EFNA 3DMNA 2PZFA 1XD8A 1TTTA 3ECCA 1XMIA 2IXFA 2QPTA 2CEAA 4P4SB 5KPJA 1XFAA 3AKYA 3BOSA 4TN1A 2GTPA 4HUQA 4C3ZA 4A36A 3D6TB 2C96A 3GD7A 1EESA 3WYAA 3EW9A 1ZD9A 4ZIRB 2WMOB 2YKGA 1JAHA 2RGAA 1YZUA 4US1R 4B44A 2OG2A 1CJVC 2QTVB 2IBMA 2YC2C 1SXJE 3RANA 2LKCA 1Z2CA 2ZS7A 1W36B 2CLDX 3TVTA 1XTRA 5KO2A 4AWXA 1TX4B 4B32A 2O8DB 1X1SA 2NMVA 5DIFA 4RZ3A 4M1MA 3R9WA 5L3SA 1GNPA 1ESNA 1W4BA 2OO7A 2QPOA 1JJVA 3ZJYA 3AVTA 3UG6A 1P3JA 2OBMA 3O8RA 2GESA 2I3BA 4URUR 4Q66C 4DVGA 1E79A 3ETLA 1W0JA 1XF9A 3D8BA 1OKKA 1RRGA 3FFBA 1XEWX 5ANRB 4QXAA 2EFCB 1UF9A 1RPZA 1US8B 1KO7A 2JGNA 2G9NA 4DEXA 3FMOB 3TSZA 1E2FA 4B3BA 1UDXA 2F6RA 3KZ1E 3UXMA 4HB4A 4TMWA 1NSTA 4MDFA 2ECKA 4C0SA 2HUPA 4US0R 2XNSA 3HR8A 2XB2A 2W0SA 2VPPA 1T91A 3GLIA 1ZIPA 3GJXC 4QGHA 1KO1A 1W1WA 3Q7PA 5F98A 3AVYA 4RKEA 2BBTA 2ZREA 3Q8XB 2AXPA 1ZUIA 4DIEA 4FMCB 3RSOA 4F4IA 1OXSC 721PA 5IT5A 4JSYA 2YV5A 1UADA 4RD3A 2J0UB 4TQAA 5G41A 5GJWC 3W5IA 4FCTA 4HSEA 4C0LA 1UBEA 1NBMD 2VH5R 1S9HA 5B30A 1TF2A 2R6DA 2ORWA 2VHUA 4PXAA 3NVAA 4KJZA 1S8FA 1N3BA 2ZRBA 2P5TB 1KKLA 1N6OA 1VDZA 3L2OB 1RJ9A 1W49A 3PEYA 2KBEA 2FZLA 1KNXA 2BKUA 3RYTC 2AK2A 4NZYA 2XTZA 1OW3B 3QKTA 1F5NA 3IHLA 1KY3A 3UMSA 1E9DA 5AUNB 1ZCBA 1N5IA 3C5CA 3OIVA 4M1TA 2W6JD 1XZPA 1HA3A 2GJ8A 3UMFA 2FX3A 3IDQA 4D4KA 3GFTA 1OV4A 4Q4HB 1NJFA 2Z0MA 3A8TA 4OQFA 1YZGA 4XVUA 2CK3A 4AI6A 3IIMA 2CCGA 1A2BA 1FPMA 1AQYA 2R6GA 1Z63A 1N25A 4C4PA 5ELXA 4KYUA 2ZRJA 4KLZA 5JHGB 5KPDA 2JLYA 1G7TA 3RWOA 1EFCA 1G3IA 4CEIB 3GCGA 4BUJA 2ZRPA 1F2UB 3TSWA 3ZZUA 3NKVA 1S3SA 2ODBA 1XEFA 5CYPA 3SHWA 3KJGA 3ZIAA 4HAYA 1P9RA 5G3ZA 3GJ4A 1U0LA 1BO6A 2HJGA 1YRBA 3UATA 4IOJA 4O25A 1XTKA 4C30A 1JR6A 3DDCA 1OFUX 2A78A 2GHIA 4HLUC 4Q48A 2O8DA 2FPLA 1L4YA 2IL1A 3ZZTA 4F93B 1ODFA 2F7SA 4JLMA 1CJTC 4W5JA 2ZE7A 2RGXA 4TWZA 1CJMA 1K5DA 5BXQC 4JIMA 5DI3B 4GOKA 4MYHA 3RRMA 3DVLA 4TMKA 4DDWA 4I1SA 4JZKA 2IK8A 3WNBA 4LY6A 5H8WA 1VG0B 3QY0A 2QTFA 2DFNA 5H68A 3VU9A 1Z29A 2CNWD 5KSPA 3ZH9B 3LBIA 5KUTA 2IC5A 1U9IA 3RLFA 5FOXA 2ZSFA 1JAIA 1COWD 5JWOA 4DB2A 1N5JA 3KKOA 4MYUA 4B47A 4TYQA 1H8ED 2YJTD 3EA5A 1KI7A 2E1RA 2R6CA 4ZDIA 3TR5A 5FTLA 1CXZA 1U90A 2GDJA 3C16C 4JL8A 5CYOA 1QHNA 4EJSA 3KTAB 1PVOA 3SBEA 2GNOA 1X1RA 4QBGB 3LVQE 1X86B 2JDIA 2ZYWX 4DLTA 1R8SA 4C0JA 3CRW1 3K0SA 3CRMA 1UJ2A 4PPFA 2LCFA 4PC3A 3R7WA 5K8LA 1BKDR 1DELA 1P62B 1UKVY 2VP9A 3ICQB 1Q1ZA 2JLRA 3T61A 1GIAA 3GJ0A 4TYYA 4PO1A 3Q85A 5CK4A 5FL7D 2VSFA 4FD2A 4UXIA 1IBRA 3L82B 1Q3HA 2Q0HA 1KK1A 2XSZD 3DEFA 1L4UA 4Q1CA 4JT4A 5DO9A 3EC1A 3Q5EA 4UNPA 1XPOA 3AUXA 3IQWA 4JLKA 4D82A 4FMCF 5TY0A 2BC9A 4YMUA 3G82C 2QMEA 5E95A 2DWPA 1G3UA 1P61B 2IEZA 2XX3A 1NNEA 4B74A 2KSQA 2WIBA 2OAQ1 1ZINA 1E1RD 4KAXA 1GWNA 3ZQ6A 1A4RA 4GFDA 2BMFA 4LHXA 1MV5A 3KKPA 3WHLA 2PLRA 2J0UA 1E99A 2CCKA 3BAFA 4ZPXA 4BLQA 5L3QA 4DSOA 1CR2A 4TYNA 3MUFA 5J4HA 3WNCA 1S96A 2VF7A 1P72A 1T0JB 4KU4A 1G64A 4IDOA 1E1RA 2JJ8A 2VRWA 4TL6A 2X2FA 1Q1EA 2ZJ5A 4UKDA 3HU3A 2BBOA 4GZMA 2RHDA 4KFUA 3BH7A 2ASEA 1QDEA 1Z0FA 3C14C 1HT2E 4XVRA 3AP1A 2QBYB 2FJUA 4NYMQ 1YHNA 1C1YA 4KFTA 5JI2E 4JVSB 2QNRA 1IAQA 3FB4A 1E6CA 1Q0UA 1D2MA 3THYB 2FEMA 2RMKA 3OIWA 3SYNA 3QUSA 4GZLA 2H5EA 4Q4HA 4YMTA 4A1FA 4EPXA 1PLLA 3OFNA 5DYIA 3AVVA 4IOKA 4TL7A 1VG9B 1BMFD 1NLFA 2ZR0A 3KKQA 2L0XA 3UANA 3L8YA 3I5XA 4QNRA 2QAGA 1F2UA 1KDPA 1T6NA 2NO1A 1ZJ6A 1FQJA 5E7JA 2FGKA 3ZDQA 1GSIA 4XOIA 3W9YA 2J46A 1XEXA 1Q1BA 1Z0DA 2JJ2D 1KJZA 1Z22A 4XWAA 1YR9A 3SYLA 3DKPA 4ITRC 4KO8A 2QT1A 1Z07A 1U2RA 2JATA 5JCPA 4I81A 4HDOB 1MOZA 3CKLA 1FMLA 3DOFA 1ZM9A 2B6HA 3SYKA 4JS0A 2GCOB 3X1DA 4B6EA 1E4YA 1SVSA 2GK7A 2NO9A 2X8AA 2ZM5A 3X1WA 4NYIR 3VKHA 1Z0IA 1G5PA 1WBDA 2PT7A 5SZHB 5J4KA 2F1JA 1LF0A 5JFGA 3L0OA 3ZVNA 4YLGA 2WWYA 3R7WB 4LGMA 4AY2A 2C78A 3JZMA 3M0EA 1MRSA 1QHXA 4B3XA 4R2HA 2CL0X 4TLAA 1NVWQ 4LBWA 4D80A 3WP1B 3GJ6A 2ZSBA 4DKXA 3FE2A 5IHPA 3UMRA 5AUOB 3FDIA 4TLBA 1TUIA 3VKGA 4B2LA 1P2UA 1QHIA 2V7QD 1II0A 2ZRAA 1BYUA 1NVVQ 3LBNA 4OQLA 4X8LA 1E2GA 4F7WA 2R65A 3CONA 3IBGA 3IPYA 3BB4A 3SFVA 1KI6A 4OJKA 4KCGA 4GOJA 3I61A 3AGPA 3E1SA 4L4UA 1YU9A 3G0HA 2AD1A 5JEEA 2EVWX 3F5FA 2FE4A 4LDJA 2BBSA 4EQ6A 2VSOA 1G20E 1Q57A 3U6KA 3THWA 2J3EA 4H1UA 2DBYA 1G8YA 1HV8A 4B35A 5JS7A 1OB2A 4II7A 2WJJA 4YXWD 1ELOA 4M2LA 2YNMA 4FN5A 2NOAA 3B60A 5AUPB 2H17A 1PLKA 1T3SA 2PH1A 1GL6A 4KXFB 3OZXA 3OESA 2QP3A 2DR3A 1QG2A 2BCJQ 3JZAA 3NHAA 4URVR 2QMOA 4BRWA 1AZTA 4JLPA 3LW7A 4M9XA 4QNMA 1GDDA 4MKGA 2HDNB 4TTRA 5FUWA 4LV5B 1G17A 3K9NA 3RABA 4XSGA 2RKOA 2AKYA 1G19A 2IWHA 4DSTA 2BHRA 3A1TA 2NZJA 2G88A 4G5GA 1S3GA 3M6AA 4AIIA 1T8TA 2JIZD 1FX0A 1LV7A 2Q6TA 4U00A 5FI1B 2ZRCA 2MMGA 4G5QA 3N70A 5AJXA 2XB4A 1NY6A 4OL0A 1W4AA 1XEWY 3AH8A 4A8JB 2QQEA 2HLDA 5JMTA 1R2QA 3U44A 4PC7A 4HATA 4Q5IA 4ASUA 2IUUA 5H1YA 1WQ1R 3M4YA 4LJ5A 4NCJA 5F2EA 2R62A 2RH5A 4HDCA 1W5SA 1E2LA 1E2MA 4EJSC 1KGDA 2CCJA 2K5UA 3B1YA 1Z0AA 3Q9LA 5FR1A 3UWOA 1OPXA 4FCVA 3NBYC 5EUQB 2WSMA 3BB1A 3ASZA 3MCAA 4RZ2A 1T3LA 5DSZA 2FFQA 1N0VC 1OH5A 2JDID 5DHAA 1HQYE 4V0LA 4ZDWA 1R5NA 1H8HD 3BBPA 4WAUA 4NKRA 1TU3A 1XXHA 2DHRA 4RD4A 3E2IA 1DPFA 1BH2A 3MLEA 1Z8FA 4B3GA 1E98A 4EDHA 5KSOA 4DHEA 3U4QA 2C5LA 4F92B 4D4JA 4NBSA 5L8VA 2J7KA 4GBMA 2ORVA 4ZCMA 1AGRA 1UM8A 2XXAA 3CO5A 1E2DA 1U99A 3A1SA 1WMSA 1NLZA 1ESMA 1FL9A 4DCSA 1W7AA 2P3SA 2W2TA 2ZYVX 5LB2A 4XTRA 1MH1A 3PV0A 2CJWB 5EP1A 4FW9A 4UQOA 5FPTA 2GJSA 3SDZA 3PG5A 3I5YA 2ZUCA 4BZPA 2IYRA 1E79D 4JLBA 2C8VA 2ZQ5A 2HF8A 2OV2A 4ZCLA 4XWKA 3DHWC 3W8NA 4TSFD 2WV9A 4TL8A 2Q9BA 2A3RA 2O5VA 1KTVA 3U7GA 1TAGA 1R10A 2PZEA 2QL6A 3LLUA 4C7OA 2C04A 1K8RA 2PT5A 3QSYA 1H8HA 3CZQA 3MWJA 2H18A 1G16A 4OKSA 2B8WA 1N6PA 3IO5A 2RAPA 4MGIR 3GLIB 2NIPA 5L3SB 4AKHA 4AKEA 2H16A 3REFA 3QEOA 5JWHA 3U7EB 3R9XA 5DGXA 3W3ZB 1JPJA 3EIQA 1DG3A 3GLFE 2J59A 1E32A 5FPSA 2G0TA 121PA 1HYQA 1U9IC 4KSCA 3B7GA 1WXQA 4EKDA 1M6NA 5LPNA 1JPNA 3PUWA 3I62A 4X8HA 2G1JA 4P0TA 3WNDA 2R44A 1P9WA 1PZNA 3OE7D 3CR7A 1HUQA 1XX6A 1MABA 3HDTA 4OK6A 4P32A 3W90A 4P31A 5JECA 4YMSA 1PUJA 2QT0A 3HYRA 2V4ZA 4Q21A 2JCSA 3TH5A 4QJ5A 2ZSEA 4CEJB 2Q9CA 2QE7A 2ZPTX 4HLUA 2W6JA 2EYQA 4OQNA 2EFGA 2D06A 3V4RA 2ZANA 4KBFA 221PA 4TZ0A 1W44A 2FFHA 1OFIA 4KVGA 1BS1A 4MGYR 4OBEA 4WBSA 4YDHB 1E1QA 4AKGA 3TSOA 3IQXA 1II8A 4BFVA 4Z51A 2XOKD 3GJ8A 3LA6A 1F3OA 3QVUA 2H57A 2IYVA 3K09C 1GILA 3HWSA 3MRSA 2W2XA 3W6PA 2F43B 4FINA 1A2KC 4NP6A 4O2LA 2W00A 2ZRFA 1P7CA 3E5HA 4BASA 5FI0B 2J9RA 3T35A 4ABYA 3W6NA 3R8CA 2VIIA 3MWYW 1E9CA 4AYTA 2NG1A 2BCGY 1G18A 2C9OA 1EG7A 1KI1A 1TU4A 4NH0A 4Q1EA 2J0SA 4ACAA 1CULC 1OJLA 1AS3A 4C2TA 4OI4A 4IDNA 3DMDA 5FOSA 1NLYA 3AF3A 4N0DA 3RS4A 3IEVA 4QBHA 2WBLC 4JBYA 2QGNA 1CR4A 1SXJB 4DLXA 5JSZA 2I4IA 4M22A 4V0MA 4JVMA 3RRNA 3VR5A 3BWDD 1NJGA 4E22A 1FNNA 3RC8A 1DOAA 3BERA 1XXHB 2IEYA 3LO5A 1E2HA 2PCLA 3IILA 421PA 4MRSA 4ZKDA 1GM5A 4I4LA 2F55A 4BZXA 2CHVA 4AYXA 3AF2A 2QMUA 4BFUA 1A7JA 2ANCA 5EP3A 2BMEA 2EU8A 3TUIC 4CZ2A 1T5LA 2BMJA 2XOKA 1LF5A 3U3RA 5FUXA 4K46A 1AM4D 3CX7A 4TYWA 2ZRNA 5BYJA 4DIDA 2X19A 1RRFA 1P6XA 2WICA 1N5KA 1E9AA 1L8QA 2PJRA 4JLNA 4P3YA 4TLDA 1RYHA 3U2QA 2AXNA 2V8OA 4NONA 4B3DA 4HLDA 3FWYA 4G5RA 4JBWA 3QE0A 2YVUA 1DO2A 3T1OA 3U3JA 4HB3A 4NYMR 1G3MA 4NL4H 2WZQA 1CKEA 3K70D 2IF2A 3K0FA 5G3YA 5IF9A 2BOVA 5CDFA 1R0WA 1WB9A 3EPKA 2QU8A 4LUCA 3WYFA 1GKYA 1DARA 3E70C 4R7ZA 1GNQA 4I99A 4RFSB 4YDSA 3B1VA 2OM2A 5B57C 1E0KA 2F3TA 3CPHA 2QSYA 3B82A 5TVKA 5A4JA 1IY0A 4FCWA 1VKJA 1ZNYA 3VR1A 1J7KA 1NY5A 2RGBA 4A0HA 3I72A 4L15A 3O8BA 1D9XA 5FBQB 4EUNA 1I2MA 2XGJA 4PFSA 4BFTA 3QJYA 2WAYA 2ONKA 4XVQA 3V9PA 1YR6A 2W83A 4L9SA 5HPYB 1G6HA 3ZVLA 1II8B 3HJNA 4U02A 1T3HA 2BKEA 3CH5A 1M7GA 1DAHA 4OJQA 2KWIA 4URYR 4A0GA 4C0KA 3QXXA 1R6BX 3H2YA 3T15A 4NYIQ 1NP6A 3QVVA 3QF4B 2FN4A 1HTWA 2XITA 4D4LA 5TARA 5IK2A 4NCKA 3MSXA 3EWSA 1FP6A 1E2PA 1HT1E 3VNVA 3THOA 4TL9A 4UNSA 2Q9AA 2A5YB 2QAGC 2XZPA 2GAAA 2JASA 1R7RA 5JWRA 1D6JA 1LW7A 2EFEB 2IWRA 2E87A 4KITB 1E94E 1YZNA 3LVRE 3EIHA 4B48A 2ZRMA 4RY2A 1XD9A 1YVDA 3NDBB 5P21A 1XJQA 2QEQA 3I4LA 4TZ6A 4RSGA 3TAUA 1W0KA 3JVUA 1FNMA 2ERYA 4ON9A 3U4QB 2ZROA 1AQUA 1NVVR 1PUIA 4IRUB 4RFSA 2GXSA 4F4JA 2DWQA 3L43A 3LAWA 4LHZA 4HDQB 1S1MA 2VL7A 2QAJA 4M9SA 4PQYA 1ZM4A 4M9ZA 1II9A 1N6LA 4ZKEA 4WOPA 4XWOA 4OHWA 1AS2A 2UZ3A 3NBZC 1Z28A 4HUTA 3SNHA 1NKTA 2O8FA 2PBRA 3KFXA 5FPYA 2QQ0A 3H0KA 3LH5A 4CEHB 4FMDB 4MKFA 1E2QA 3B78A 1KIMA 1IN5A 1JBKA 1M2OB 2LKDA 5GJCA 1Y3AA 2EW1A 1JALA 3KUDA 2FWRA 2G1KA 2Z6VA 3L8ZA 2RB4A 5CJ2A 5E3HA 4E5UA 5CIQA 3CNNA 2WJYA 3PUYA 2YWFA 1NVXQ 2OAP1 5GJVC 1N0UA 3ZLJA 3RNLA 1E9EA 4LOAA 2GA8A 2IX3A 4QFMA 1SKYB 2CE2X 1NIPA 5BN4A 1N2CE 1J2JA 2V1XA 4PQFA 4V02A 3W3AA 2IS4A 5C46F 1QHSA 4P4UA 4DLYA 3FFAA 3F0TA 4RD6A 1KDTA 2CNWA 3RS7A 2GBLC 3BFXA 1G7RA 3BS4A 3FTQA 1I4DD 1KK3A 4JMPA 3X2SA 3ASYA 4Q9JA 5D3MA 3BFVA 2IYYA 8OHMA 2GWHA 4JJKA 4RZUA 1G41A 1OYYA 1VIAA 2A30A 2OILA 4IFBA 3SEAA 4B43A 1H8EA 2CVHA 3GJ7A 4L16A 1W36C 1KOFA 2YYZA 1XTIA 5AJZA 4YXWA 1NMYA 1Z06A 3D7MA 1Q1QA 2AD5A 2ZYUX 3SZRA 4JVLA 4ILEA 1I4TD 1QBKC 4XIGS 2ZI9A 1IY1A 4DT1A 1DAMA 1JEDA 1XP8A 3TKLA 1KAGA 3LV8A 4PQRA 1J8YF 1JEEA 3BJIC 3ADBA 1XPRA 1FTSA 2KBFA 4D2IA 2VF8A 2PEYA 1G1MA 2WPDA 2ZRHA 4W5WA 1DEKA 1GRQA 2F43A 5B64A 2QG6A 2JAQA 2P2LA 1NMZA 2ZRLA 3T1TA 1E2KA 1KSFX 4M1KA 3CUEF 1XNJA 3MJHA 2YZ2A 3ZQJA 4ZCIA 1T9HA 3ZZ0A 3PEWA 4Z1MA 3FHTA 3VNUA 3U3KA 1EFRD 3A36A 2IUSA 1XMVA 3TIFA 3VU9B 3KQKA 2FSGA 1AIPA 3IGFA 821PA 3AB3A 4DCTA 1ZUHA 4QM6A 4JLOA 4GMDA 5EXXA 4KVAA 1SXJD 5HE9A 4YMVA 4HZIA 1FTNA 3ZVMA 2RGEA 2GK6A 2PJZA 3DM9B 3LX8A 1GVNB 4M1SA 2QRZA 1LNZA 4IXNA 4LJ7A 4LV8B 4HB2A 2IS2A 2ZUDA 4PAOA 3OFND 4YMWA 2JLWA 4PAMA 4JKYA 4CYMA 1ZVQA 1KY2A 1XTQA 4C2UA 4LYJA 3B6EA 3KUCA 3QKRA 4HZUA 3BE4A 3QEJA 2D3WA 1MKYA 4NU0A 4Q00A 3WXMA 2DFTA 1VIYA 1UPTA 3AV0B 3TW4A 2R2AA 3I8SA 4QG7A 3FGNA 2WWGA 2FPKA 1SHKA 2NZ8A 1GNRA 2Q3HA 1GUAA 3Q3JB 1FMJA 3RDPA 3SU8A 4URXR 1OB5A 4DLWA 1DAKA 1TF5A 2GCNA 3EAQA 1HURA 4D26A 2C2HA 1G3QA 3K53A 3K0AB 4I1UA 5HCNA 1SHZA 3SJZA 1E96A 4QKQA 4QJ4A 3LFUA 2DB3A 1SVKA 2R9VA 2OZEA 4DDVA 1IN4A 4LYAA 4KV9A 5FUYA 1KI9A 4B2IA 2V9PA 4JL6A 5FTNA 1ZM2A 2IYZA 2ZITA 1IJFA 3B5JA 3ADCA 1XU4A 1K5GA 5IDVA 4M8NE 1LTQA 2IUTA 3RS5A 3T5GA 1RKBA 1TL7C 2CJWA 1KAOA 3ADKA 5BQ5A 3HYTA 2GXUA 1KI8A 3B1XA 2ZXUA 4QHYA 2J1LA 5AWFC 1E2IA 1NN3A 2FFBA 1XJ0A 1Z47A 2D2EA 3RHFA 4DT1B 3MJRA 1FFHA 1JNYA 4Q03A 2RGDA 2BM0A 4EPTA 2ZR7A 2GJ9A 3PIRA 1IQPA 3S1AB 3K9LA 4TMZA 4HAUA 2IHYA 3SOPA 2D2FA 4OHVA 3RAPR 3QKRB 4C7OB 1W36D 4BFYA 3ZIAD 5KTYA 2HV8A 1KMHA 2NO7A 1ANKA 4IDHA 4LC1A 4NYJQ 3RSLA 3WRYC 4TT3A 2BMDA 1IOZA 1HQCA 1GG2A 3QKUA 1XTJA 4AURA 4URZR 1DAGA 1Z6GA 4A8JC 4R71A 5KYKA 4PPGA 2WWFA 4BLRA 4LC0A 3KB2A 1G8GA 5LD2B 4MKHA 5A5GA 2ONJA 1J99A 3CPJB 3DOEA 3NTUA 2QROA 2YWEA 2CVFA 4M0LA 3GEHA 1SKQA 2ZRGA 2O52A 2F9LA 3EA0A 2WKPA 1NN1A 1EFTA 1QG4A 2ZRDA 4UJ3A 5B58C 4DZZA 2EWVA 3SC3A 1P9NA 3SJBA 3SI7A 2WJVA 4G0NA 4DUGD 3GP8A 1JQJC 2C99A 2MSDB 2XJ4A 2Z5FA 2O8EA 4EPWA 3UG7A 4PO8A 3WMEA 4A6XA 3I32A 3A37A 2MMCA 1DTSA 3CIOA 4LBZA 1QF9A 2G3YA 3K0FB 1YZTA 1F60A 3NH6A 1E9BA 1SXJC 2WWWA 3CW2A 1JXOA 2G83A 4KLNA 5E7IA 3KFVA 5EE9A 2FNAA 4EPRA 2PEZA 3CRQA 3EARA 3RS2A 5FOTA 3VKWA 3I1FA 4LHYA 4GOXA 5EXTA 2REBA 1IXZA 4BPBA 4W5HA 1KI4A 4HAZA 4IEEA 1M8PA 2AK3A 1DAEA 4A15A 3D3QA 2YWHA 5FTKA 4Z54A 3VR6A 3LX5A 1V43A 1OSNA 3B2EA 3NEYA 4ZI3A 4PHTA 5FPHA 4CEJA 4QBIA 2IYSA 1Z3IX 1R4AA 2QORA 2FMXA 4UNNA 4YONB 1XWIA 2VA8A 5SZKB 5FBRB 1T5IA 3T34A 3CH4B 4Q4LA 3X1XA 4D0NA 4EPYA 1KI6B 2HT6A 1W47A 2D4HA 2YOHA 4DCVA 4ASUD 4KI0A 1L2TA 4B33A 2FDCA 3AKCA 4UJ5A 3THXA 2X77A 1ZYUA 1KI3A 1OF1A 1YQTA 4JYCA 4D0LB 5KHOC 2IS6A 3QNUA 1GL9B 5DH9A 5CB6A 2WSSD 3SBDA 2ORIA 4Q7JB 1HE1C 5CM9C 2NPFA 4C0BA 2GRJA 3QF7A 3AVUA 3IPXA 2D62A 2ZJ2A 4CVNA 3TRFA 2DFLA 1HH4A 1QVAA 3LNCA 2XTNA 1GFIA 2Z43A 1M34E 1UBCA 2BJWA 1GKIA 1N0WA 2JA1A 2QN6A 2JEOA 2ZJZA 1DS6A 3U5ZB 1U0JA 3PXGA 3P26A 1OIWA 1ZU5A 5EXSA 2PMKA 3UKDA 2ZETA 3NIBA 5DYGA 1QZXA 3P27A 1QHHB 2ZU6A 4B75A 4NPHA 2GVZC 1G8PA 5UKDA 1MO5A 1UKZA 2QP9X 2ZSDA 4QGGA 2AX4A 3AVQA 1KI2A 3Q72A 3ZS9A 1AKYA 4ARZB 4D81A 3KDSE 1EFRA 3FVQA 3AVWA 4B3CA 3WBJA 3IIKA 4IW3B 1OFTA 3S1AA 2BEJA 2OLJA 1NN5A 5FFMA 5EE1A 2BEKA 2P6NA 5J4VA 3K1JA 2VHQA 4MKIA 3SJCA 3N5CA 1OXTA 3NBFA 4JYBA 3WMGA 4JBXA 4DLSA 3A58B 4OYHA 2ZI4A 2N46A 1KZGB 3P20A 4DEYA 1E9SA 4TSFA 2HXSA 1Q22A 2ZVPX 1CP2A 4LJAA 1E4VA 4C0QC 3LQRA 1LVGA 5JJKA 5CB8A 4LJ6A 2WIAA 3TNFA 2GF0A 3RRZA 2NQ2C 1XMJA 2MSEB 5CM8B 1WCV1 2G6BA 4MYCA 4TTPA 3ZGXA 1VPLA 2YWGA 3B1ZA 3NBXX 2YOFA 1UEIA 1W0KD 3THYA 2VLIA 4RD1A 3R8FA 2DYKA 3U6BA 1OT3A 2VHCA 3P4XA 4LSGA 4DLVA 1NBME 3VR3A 4Q1AA 4CIDA 3DZ8A 3TBKA 2ZI5A 3B9PA 2FOLA 4GPTA 1GL7A 1KO8A 4O2RA 2XJ9A 1QHHA 3H1TA 1TADA 4E07A 4F4CA 3ONWA 1W5TA 5A0FA 2LWIA 3SS8A 4DRZA 3DM5A 4O0MA 4F38A 4XD7A 1OHHD 5JBQA 4A9AA 2JLXA 4QL3A 3KJEA 4LWZA 1G291 1ZNXA 3TR0A 1CJKC 4GI7A 5TV2A 3VX3A 2C95A 1CU1A 4US2R 5TB5A 3T1QA 4K81B 3O47A 1TQDA 1SQ5A 4WIAA 2OCYC 3P32A 2OCAA 4DCNA 4EAQA 4NHOA 1JJ7A 2PL3A 2OT3B 3I8XA 1G5TA 4X8MA 4HAXA 4MUAA 1JQLB 3BRWD 3C15C 2WMNB 1IN8A 5JLJA 4TMVA 4S2EA 2QM7A 2OEPA 2ZJAA 3CF6R 3DL0A 4OI2A 1UKEA 3KKMA 1E2JA 4IVRA 2I1QA 4JLDA 4WA7A 4DC9A 1U94A 5HE8A 4C9BA 1GKUB 1ZU4A 2ZE5A 1SVIA 3F8TA 5DI9A 3QIAA 5FH9A 1CLUA 3BC1A 4CDGA 4CRWB 3CWZA 3THXB 4LHWA 4Q1DA 4FXPA 4DSUA 2VSXA 1S9DA 1OIVA 4Q47A 2SHKA 3PITA 3LWNA 4R9UC 2NTYC 3CM0A 4KYIB 4MDEA 2D7CA 2X2EA 3KXIA 5KOYA 2RHMA 3VX4A 4JJZA 1ONBA 4IHQA 1DADA 2WAXA 2ZJOA 4BEBA 2ZE8A 4TMTA 2ZS8A 2UVQA 2PX3A 4FWIB 1AN0A 2PMDA 1Q20A 4O3MA 3EASA 2W0MA 1EXMA 3VQTA 4OK3A 2OXRA 1O87A 1D9ZA 4CEIA 1N6KA 1FQKA 1W2GA 2CHQA 2HEIA 1G8HA 3NEJA 3KJHA 4HAVA 1CRQA 2JJ1D 3SR0A 3HPQA 4IFEA 1UFQA 2H1LA 2FSIA 5F9HA 5HR5A 1QHGA 2HCJB 4GDFA 4CGZA 1IN6A 4PX9A 3NC1C 2O8EB 3ZD6A 1RW4A 3CB4A 2GEUA 3BXZA 2N42A 1NBMA 1GP2A 4AKIA 5GVSA 2XZOA 2KJQA 2ODWA 3UIEA 5DN6A 1LB1B 1CBUA 2ATVA 4GNKA 2V55B 1E69A 3DO6A 1OFHA 1KKMA 2QY9A 2J0QA 1ETUA 4WZBE 2ANBA 1J8MF 2CE7A 2OBNA 2JLZA 4PR0A 2XEXA 4RVCA 3K8YA 5KNCA 3B8HA 2ZUBA 4DLUA 2O8BA 2AL7A 4L5BA 4XH9B 3RRYA 3HR7A 4OHYA 1KK0A 2VP4A 3MFYA 1SULA 3A1WA 1RJ9B 4Z8XA 4NMMA 4Q9LA 1YRAA 3CF2A 1Z6YA 1MO6A 3RVBA 1WF3A 2BJVA 1JB1A 3VHXA 4A2QA 1FW6A 3TQFA 2Q21A 1CIPA 3A1VA 1AKEA 3WHKA 1FUKA 1ZD8A 2IW3A 2J0VA 1SXJA 3QG5A 3QXSA 4M1YA 4MYTA 4EFMA 5JSZB 5KNDA 2JLQA 1XMSA 1G8FA 2W58A 4LBVA 4QC2A 1NRJB 3KTAA 2DY1A 5KNBA 1JECA 3AKDA 3GLIE 1P73A 3W8RA 1ZAKA 5EXPA 3SQWA 2C77A 1OYWA 4CT4B 2XZLA 1VECA 1W4CA 1XEXB 1U81A 1QRAA 3MGCA 5EZ6B 1NL3A 2OE2A 5FR2A 5TMPA 2WWHA 3QPWA 2ZAMA 4P33A 4QOSA 1A5TA 4HB0A 3OAAD 3T06B 4ZDJA 5F3WB 2A5FA 4QRHA 3NHBA 4CF7A 3GLHE 2QA5A 1R0XA 3U7FB 4LPSA 3M1IA 5KSYA 3IIJA 1FZQA 4BLOA 2ZE6A 3AUYA 1E2EA 3W34A 1JR3E 3OEEA 1SVWA 1R8QA 5JJIA 5AJYA 1OXUA 1BOFA 2GF9A 2GZHA 2KB0A 4OQMA 2IS1A 5LDDC 4WXRA 5DNYB 2R6FA 3TW8B 2ZU0C 4NCHA 1YR7A 5EUMA 3RC3A 2IYQA 2OFOA 2KE5A 3DPUA 1E9FA 1TUEA 4ERNA 2J41A 1MR3F 2RGCA 2CLCX 4G1UC 4V0OA 3QXJA 2FSHA 1DO0A 1E0JA 3AGQA 2QPAA 1VG8A 1F2TB 4RFVA 3T12A 3GLGE 2Q3MA 2YOGA 2GEVA 4E03A 2OFXA 2A7QA 5SZIA 1ZP6A 3I3SR 3ND8A 4CT5A 3IO3A 4NDZA 5KU1A 3WBKA 2B7BA 3OAAA 2V6IA 4BGDA 1KO4A 4J0QA 4Q1FA 4A2WA 2VQSA 4UNRA 1L7VC 4W7SA 5L3VA 1CR1A 2RGNC 3TJZA 2AKAB 3L0SA 5J4YA 1KMQA 1V5WA 1M74A 3AP2A 4TLEA 1MO3A 5DLQC 2JLUA 2GILA 3IEUA 3ND9A 1KSJA 1E9RA 2KI5A 3BORA 4RCYA 3SFZA 1J70A 2QI9C 2W2VA 4LHVA 3UK6A 1VMAA 1ZNZA 4OQXA 1SVOA 4MRNA 3VFDA 2J5XA 4LRWA 3DKVA 1SKYE 3GJ5A 4RCZA 2O8BB 2GZDA 2AHOA 2BBWA 1HY3A 1Q3TA 1RRCA 3GJ3A 4A4DA 3FKQA 1PLJA 3BIFA 2V7QA 5HCIA 1R5OA 1YR8A 4DDTA 1YJ5A 4I1VA 4PHHA 4EFLA 2MSCB 4NCNA 4BLPA 1UDWA 4DJTA 2VO1A 2AWOA 3C7KA 4Q7MB 3U7HB 4DLZA 1DBSA 2H8KA 5CJPA 4ZI2A 2W6ID 2H7VA 2CXXA 2REOA 2P67A 2ZI3A 4DLRA 3WY9A 3U44B 5HKKA 4TQUS 1GOTA 2AFHE 3UWKA 3HU2A 3EPHA 2Z83A 5TDHA 3CNLA 5AR1A 2BWJA 2D7DA 3EZ6A 4PSAA 2QENA 4JL5A 2FU5C 4TMXA 5CDFE 2QP4A 2VP0A 2OFWA 3OEHA 1GRRA 2ZR9A 5CLLA 4BFWA 2VP6A 1RIFA 2B92A 4KSBA 2F9MA 1S2MA 1VTKA 3RS3A 2GCPA 4UNQA 2ERXA 1YKSA 3LXXA 3CWQA 1P5ZB 4PPNA 3L0PA 1ZM3A 3BK7A 1VHTA 3EG5A 1WP9A 3T1VA 5HZKA 1P60A 4IEIA 1E0SA 1LY1A 2HF9A 5DN6D 4N0EA 3MWLA 2JLVA 4DXAA 5JJLA 3TGPA 3QENA 4DDUA 2A2ZA 1W48A 1G7SA 4R98A 4QJ3A 4B3FX 2EFDB 2C98A 1DVRA 2IYLD 4QGFA 1AK2A 1CRPA 1IHUA 4Q9KA 1G6OA 1N5LA 1N6IA 3FKSA 3KQUA 4JVNA 3GLFB 1E3MA 4LJ8A 3B9QA 3OIUA 3NDPA 2IYTA 5EP4A 1AA9A 1KDOA 3AVOA 4JLVA 4N1AA 3J81k 4QM7A 3A6PC 2VHJA 1Z6XA 1MO4A 4JT2A 4U7DA 2WJIA 2B7CA 1PJRA 1XBTA 5DHFA 1CF4A 3OEHD 3OF5A 3QXCA 1AJEA 4GP7A 2GBLA 4MRVA 5EE3A 3ZVRA 1KJWA 2XTMA 3QOFA 4UXJA 2V3CC 2ZJBA 3QPVA 3B1WA 4D4MA 1Z0JA 2ODNA 5J40A 2NGRA 1AZSC 1F2TA 2GCOA 1Q44A 3LQQA 3ZD7A 4YC7A 1D8TA 4RJLA 4Y0VA 1XRJA 2OESA 4TLCA 1D2EA 3Q5DA 4XJXA 5FBLB 4FWTA 4AC9A 1NIJA 4URWR 1ZUNB 5FPKA 1OKKD 4BZQA 2EYUA 4M21A 4Y0AA 2WHXA 3TMKA 3TVDA 2ODEA 2YC4C 3G5UA 1TPZA 3H86A 2F3RA 4MRPA 2IXEA 1OH8A 1BMFA 4ACBA 2WJGA 3O8DA 1ZIOA 1TEVA 5FOWA 1EX6A 3FMPB 4M1OA 1O3YA 5GVRA 4OK5A 4Q9HA 4ARZA 3OE7A 2GVDC 1FOEB 5AK0A 3FPAA 3C41J 4L9WA 4PC1A 4Q4JA 5C4MA 2WWXA 1IONA 4HYYA 2F1HA 2NO0A 3TLXA 4ZDKA 2QE7D 3A4NA 3KXKA 1B0UA 4IDPA 2IT1A 4PZLA 1G7CA 1NG9A 4LYHA 4BRUA 4LYFA 4IKEA 1ZM7A 1MRNA 2IHBA 3HP1A 3LD9A 5B2ZA 4A6PA 1OHHA 1M7HA 3CRVA 1ZMXA 1YZQA 2VEDA 4LK2A 5EE0A 1G5RA 4S35A 1Z08A 3BGWA 3PUXA 1IM2A 4POAA 2V1UA 4DUGA 1P2SA 4TYPA 4HUQB 3AVXA 5K8TA 4IOLA 4BFZA 4IVQA 1KSHA 4M9QA 3K0AA 1A1VA 2A5GA 3KXLA 4PANA 4BEJA 4BECA 2WKRA 1VCMA 5EQTA 1YZKA 2GAOA 1I4LD 4LI0A 3EPLA 3H4MA 1TMKA 4RD0A 1NF3A 3QKSB 4JKIA 4V03A 1OH6A 2WOOA 5FOUA 1RYFA 4M53A 3U3MA 3I92A 3K9HA 1Z5ZA 2GETA 3TUZC 1R5BA 2G77B 3NG1A 1T8UA 3FMIA 1F6BA 4C0AC 2DCUA 2V54A 4EIWA 4GSYA 3NWJA 4LV6A 5JS8A 1BYIA 4P4SA 4RZXA 4WVFA 1IY2A 2J87A 3PUZA 1Z0KA 4JLAA 3SN6A 3WP0A 2PZGA 3IKJA 5LD2C 3TUJC 4OI1A 4DCUA 2G0NA 4OI0A 1HEIA 5HTKA 2QMHA 2FH5B 1TQ2A 2DFKB 3Q7QA 2P65A 4BFXA 2Z4RA 2W6IA 3U60B 3BD9A 2YINC 3P4YA 4GT1A 5AJWA 1B23P 5C4GB 5JRZA 4H9GA 1E2NA 3K70B 2WSSA 1G4AE 2GKSA 3BB3A 2VHTA 3DZDA 2OCPA 3QBVA 2IYXA 3B85A 2IF0A 4A0FA 5JEDA 3JVVA 5FL7A 2C9YA 3SJAA 4Q18A 1OIXA 1K6MA 2F1RA 4BLTA 5JCZA 3K70C 1Z6AA 3A4LA 4LZZA 1CEEA 2BIFA 1C9KA 1NSFA 5E4FA 1VHLA 5GADl 5FUVA 3VR4A 1US8A 3EZFA 1RZ3A 2HLDD 3PCRB 1T4GA 3AP3A 2ZVQX 1N6HA 5DI3A 4MH0R 4A92A 1U8YA 4BLSA 6Q21A 1M7BA 5J47A 2JLSA 1VG1A 4CW7A 2JJ1A 1RE0A 2I1VB 1W0JD 2ZI7A 3PENA 3FHOA 2FG5A 4AYWA 5FTMA 4NTZA 1EWRA 5SZJA 3GLHB 2BM1A 3CR8A 1XD2B 3EZ7A 4G5OA 3CLVA 3AKEA 2HJVA 3R20A 4FMDF 4HI0E 5G53C 2ZSAA 3SE0A 1IXSB 2IXGA 4IJMA 1AS0A 5LBIA 3PFIA 3ZYCA 3W6OA 5D3MB 3WMFA 4ESHA 4GL2A 4LX0A 3V4FA 3LXRA 2ZIAA 3FHCB 5H70A 2QSZA 1KK2A 1TF7A 1C4OA 1Q12A 2P0EA 1YE8A 1RRPA 4PTLA 5BN3A 2CLSA 1S1CA 2XAUA 3HPRA 4NE2A 2O8FB 1A82A 2RGNA 4ZIRA 4ZV4A 3TQCA 2FEOA 2GXQA 4A8JA 3LW8A 3IUYA 4PHGA 5C18A 2WTUA 2FA9A 3K09A 4GRAA 2NO6A 3AQ4A 3WYGA 5FBVB 5TXGA 3FOZA 1WRBA 1FP7A 2WKQA 4FIDA 3AVPA 1FUUA 4MUBA 5IRCD 4LJYA 5M04A 2FGJA 4KODA 4Q01A 521PA 5JHHB 4BQSA 2VYFA 4OHZA 1BIFA 1XCGB 1MABB 2ZJYA 3GLFA 2Q3FA 2QUZA 1WBBA 4B6FA 4BFSA 2J7PD 2Y8EA 4MITA 4TT3D 2OSBA 2X1VA 4NCIA 1PV4A 4Q9IA 2IA5A 2QBYA 4HZUB 5KSZA 1KZ7B 3LLMA 1GRNA 4XD7D 4Z8YA 3K0CA 4TTQA 2GZAA 1XJCA 1JR3D 1U0HC 3TAHA 4QHSA 1G9XA 3VHLB 3AF0A 2HYDA 1WDTA 3K0EA 2DPXA 2J45A 3VTKA 2F1IA 3C4JA 2HYIC 1QHYA 2AWNA 4U5XA 2XXAB 1T0HB 2CHGA 3FMFA 5L3RA 3CPEA 3KQLA 5L3QB 4DWJA 2FPMA 3FYHA 4PZYA 1GITA 1NKSA 3GEIA 4C0HA 3GFOA 4B2PA 2TMKA 4B34A 4WZAE 2OHFA 4HEJA 3RWMB 2CBZA 4I1OA 1Y63A 3MWKA 4Q7LA 3MD0A 2ZS9A 2QAGB 3KKNA 1VCOA 4JLJA 4E09A 4A0RA 4F91B 5K8IA 1F48A 2GJKA 1SVLA 1CJUC 3QI2A 2A5JA 4V0ME 3WRXC 1M1YE 1COWA 1ZBDA 1VCNA 1ZW6A 4FMBB 3TK1A 5FOVA 3ICEA 1NI3A 3R9IA 2ZEJA 2OLKA 4A2PA 4TQ9A 1IN7A 3QXHA 5AJVB 4PPQA 2Z4SA 3GEEA 4AK9A 3QQ5A 2OUKA 4MQBA 1J90A 2O0JA 4BWYA 3P1JA 1XDBA 2ZAOA 1VYTA 4MA4A 3ADDA 1R0ZA 2EWWA 2P6UA 2DWOA 2QZ4A 1DE0A 4XTCS 1G3RA 2FFAA 1KDRA 5KDDA 4H1VA 4L8GA 3N2IA 1UEJA 4WW0A 3LDAA 4KHZA 1ZC3A 3W5JA 3GPLA 2IYUA 4LCBA 2ZI6A 1AGPA 3NH9A 3RS0A 1SGWA 1IJEA 3PVSA 3AM1A 3EPJA 5EJEA 1XB2A 2PX0A 4OHXA 2EQBA 4AD8A 2P5SA 4Q4AB 2QTHA 1EK0A 1EX7A 5JRJA 1QVRA 4MGZR 2XSZA 4HAWA 2FZ4A 1XD2A 1U98A 1Z83A 4BE7B 2CMKA 4KFSA 1P75A 1HE8B 2ATXA 1NMXA 3CX8A 2RCNA 5CK5A 4ZO4A 4B73A 1S4QA 5KDLA 2AR7A 5JI3E 3KX2A 3C5HA 3KQNA 2N1BA 3V00A 4HLCA 3MMPA 1NN0A 3EZ9A 1CS4C 1KNQA 2WM9B 1P4SA 3CRRA 1NG1A 4FI3C 4AG6A 2GJAA 1H65A 5HZHA 1Z6TA 2B21A 1KYIA 3CF0A 4R2IA 2O0HA 2J7PA 4WZ6A 1UBGA 3KQHA 1XXHE 5IK2D 4Q4AA 3KJIA 3U3OA 3LRPA 2D74A 2VBCA 2WPDD 4LPKA 3AF4A 3L0IB 2HCBA 4PHFA 4B76A 3PQCA 5F9FA 4Q19A 1X8LA 1GZSA 1OE0A 2QRNA 2XNDD 4EQ6B 3UPUA 3CBQA 1XTSA 2OBLA 2R6AA 2ZJ8A 2B8TA 3FKSD 1P2TA 4PSVA 5J4LA 1RVDA 1D2NA 5J5CA 4Q1BA 621PA 4QGAA 4PC6A 1ZNWA 1ZCAA 4D25A 4Z1MD 1IXRC 2O8CB 1X3SA 3QF4A 3B13B 3SHFA 4G01B 2ZTSA 3BH0A 5EE5B 3VMFA 1OLOA 4Q02A 5BN5A 5DE3A 4XSHA 1TEXA 2FV8A 4RD2A 3X1YA 2XNDA 2H92A 3OEED 3HU1A 3D31A 3C8UA 1XCPA 4Q4JB 4DB4A 4ESVA 5BW8A 5FL3A 2UZIR 4MGKR 3GFPA 1G21E 2PCJA 3IBYA 1UAAA 2BDTA 2VP2A 2PLFA 4DBLC 1X6VA 5CITA 4IVPA 1GAJA 4B71A 4PAQA 5FTJA 1TQ4A 1XZQA 2E9SA 2YHSA 3GLGA 3VAAA 1S0UA 2A9KA 3EWAA 3SQXA 4WXPA 2EFHB 5DISB 2BVNA 1LS1A 3A1UA 2GEDA 2FSFA 2JJ2A 1KHTA 1U8ZA 4G5SA 3KB1A 3PUVA 5CLQA 3EIEA 3CNOA 1NVUQ 4A82A 2CL7X 4W9MC 1JI0A 4QBFA 4KBGA 4CEHA 3TE6A 1EGAA 1N6RA 5JZVA 3GLHA 4G3XA 4MRRA 3O8CA 3U61B 1P2VA 1LS6A 2FF7A 2ZRIA 2WOJA 2AN9A 1RFLA 4RKFA 2AFIE 3A4MA 3IHWA 5D3QA 2OXCA 2QM8A 2WVJA 4JSTA 1JR3A 3EX7C 1YZLA 3QPUA 2RGGA 1SZPA 2HXYA 5GJBA 2CK3D 1DAIA 3N2EA 2NPIA 5BYKA 3PJRA 3PEVA 3H84A 5K8UA 1LFDB 3BFKA 4HLQB 4IXMA 4DSNA 4GMXA 1WE2A 5BWMA 5C1BA 3PEUA 4UXHA 5AUQA 1JXMA 3GMTA 3OIYA 3LY5A
chains in the Genus database with same CATH superfamily
3DB1A 4D9GA 5HOEA 3VR2A 4K8OA 1L4BA 1X8KA 4B3GA 4KE6A 1SVMA 2DC1A 1I2DA 1XCMA 2I8LA 2C9CA 3HDYA 4UE2A 1EFHA 1N6NA 1UK6A 3OZDA 3MAAC 1XDGA 4IILA 5ENZA 1NUHA 2VTEA 1UBTS 2WA2A 1Z17A 3WAGA 1G4UR 1T2EA 2CDNA 4PCVA 5G1PA 1T1SA 3PR1A 4EPVA 1EWTA 3W2IA 3EZ2A 3EXAA 1M6YA 1R9MA 3K71B 2IYWA 3TOVA 4HT3B 4BNUA 3I28A 4UD2A 4QNNA 2OCBA 3SC2B 3CINA 5ALVA 1GPLA 1PWEA 1N8NA 2HJ9A 2ZSUA 3CLSD 3F5QA 3DVSX 3TN7A 4IICA 1JFFB 3H9EO 4NY1A 1DAFA 5JYEA 4P2BA 1TYZA 4PO9A 2ETVA 3GRZA 4R1TA 1RE1A 4F5YA 3SIXA 2YXBA 3WWEA 1YTLA 3NXSA 4Z86A 4AJKA 3EMKA 3ESQA 4ZRDA 3RFVA 3FOEC 2Q2QA 3FCUB 3I73A 4IDAA 2X9QA 2V6JA 1OXXK 4R1NA 3WMRA 4PV7A 1ODIA 1FTQA 1W4RA 4B84A 3E7FA 4ID9A 4UMEA 4PSKA 5H4HA 1U8AA 2OZPA 4RACA 1C7RA 1Q1GA 1CUEA 1ISJA 3NC0C 4P4TA 3LBHA 1EXNA 2ID8A 2E3JA 2NXCA 1V4VA 2GYWA 3FLEA 4GI3A 1OH7A 4DARA 4MVJE 4Q16A 1OBHA 3ZS8A 1EFUA 3KE9A 3DPIA 5JMPA 2P4UA 4NYJR 1DCMA 4D0GA 1IZ0A 2QTWB 2C03A 1Z62A 2I1LA 2JG3A 2PJDA 1P0IA 4LZJA 4IOMA 2GQ0A 2R00A 3VJKA 4DJ5X 4NJEA 1J33A 2P91A 3GLSA 3OU7A 3P9RA 5H5JA 5JO0A 5HK9A 5KWJA 2EZ8A 3ECCA 2IXFA 4KE8A 4HNTA 1JU9A 3HQ4O 1NRXA 5KPJA 3ZWAA 1BCRB 4H16A 3GXOA 2BP7A 4O4HA 4D8WA 1JHVA 2BM9A 3ELYA 4RW0A 1SIUA 4PR3A 4C3ZA 3HP4A 3IMCA 3GD7A 5T57A 2B82A 2PUTA 4BNZA 1EESA 3EW9A 4CLOB 4NI5A 2I54A 1FX1A 2NO4A 2JCYA 3R5TA 1JAHA 1LFAA 1QIFA 3S7TA 1YZUA 2B9EA 3KZMA 4ZAWA 4B44A 5IZCA 1A97A 1SXQA 1CJVC 2NSYA 1RI5A 3D0RA 1PG5A 3ANYB 3L18A 3DZBA 4GXNA 3WGTA 1M10A 1W36B 1HPLA 3HEAA 1BW9B 2I4OA 4RPIA 2ZYHA 4HRAA 4MO2A 4O59O 4YWHA 5GP1A 3S2SA 1CE8A 3M8KA 3NUGA 4GVLA 2V7PA 5DBEX 2XA1A 3DVQX 3T9AA 3ZU5A 2VUSA 2GCEA 3B48A 5DTIA 5F76A 4E94A 5L3SA 3ZW9A 1L4MA 3MMSA 4EUHA 1YA4A 1N92A 3N58A 2XOXA 1F4VA 1BZYA 5LLSA 3ZJYA 3AVTA 4OP1A 1J5XA 4JODA 5G4KB 4KYTA 3PGA1 3O8RA 2I3BA 5ERXA 5FBKA 4JKOA 1VKRA 4O4JB 1E60A 1SD5A 3GNTA 2P4SA 2SKCA 5KO2A 1GNTA 1ZOLA 3D7NA 4LJRA 1E79A 3E0QA 3ETLA 4UOEA 1OKKA 5FX2A 3ROZA 4AXXA 3WA7A 1XEWX 5F12A 3B2QA 4Y2PA 4TKLA 1AB5A 1KO7A 4V0QA 4DEXA 4NJEB 4JQZA 4LZAA 1M34B 2F6RA 1ODCA 3P9IA 1Z4QA 4ZVRA 4TMWA 3SF0A 1JB9A 2AQ8A 4L3WA 1PJ8A 4KLCA 1PG2A 3HR8A 3EJ6A 1U0NA 2XB2A 2CJPA 2W0SA 1N78A 4TWIA 4QGHA 3W6ZA 3QZUA 1ZGZA 3D3KA 5A4DA 1UWLA 4UTRA 2BBTA 5ITZB 1H4VB 4DIEA 3DR5A 3WB2A 4F4IA 1K8QA 1L5KA 1UT8A 4RD3A 1O2DA 1PSZA 4ZO7A 4M1ZA 1TZJA 1E66A 2QNBA 2DH5A 4RY8A 3AIKA 3ZGZA 1EWVA 4FCTA 4B3TB 4C0LA 2VH5R 4OJYA 5IABA 4BO6A 5BVHA 3I9FA 1PJBA 3ABIA 1RAHA 3RI3A 2HRCA 4KJZA 3EZLA 4R9RA 4PHCA 4PZEA 5JO9A 1F2DA 4EB0A 1RJ9A 1EB8A 1W49A 3EC7A 4HEQA 4TSRA 4X1IB 4MW4A 3RV4A 2SCUB 3NKFA 4L28A 3A1EA 2PS0A 3F5MA 3FYUA 2JL1A 2H6EA 3SZLA 3TKYA 1E3IA 3GLQA 5F52A 6REQB 5KMGB 1XNHA 4FPXA 3ROGA 2BZ1A 2NUTA 1K68A 1RM5A 2NYRA 4AP9A 3FNBA 3KSZO 3OIVA 4CMHA 2UYOA 4D9BA 2VCEA 3ORRA 4CLXA 5AKKA 4CODB 4EI7A 4ZOLB 3VOAA 3KOOA 1AXRA 4REMA 3VU1A 3R9KA 1LX6A 4ZQHA 4H7HA 3JAMA 1N8TA 2GPBA 3H4TA 4GE0A 3A2NA 3G1UA 5CTAA 5A1JA 3ESDA 1KL7A 3O7WA 1E7RA 1T36B 1XQ6A 3CZAA 4ZAVA 4XVUA 3AR2A 4W1SA 2XVYA 3WL3A 5JH7B 1FPMA 1A5AB 1CUXA 2VF4X 4Z49A 3H1BA 4K9KA 4YMIA 1ZW1A 1KS2A 1SUDA 2PFGA 2YHAA 4BMNA 3MJDA 1D03A 4FEYA 4CF6A 3T7EA 4BUJA 4J9VA 2P1RA 2C61A 2X0RA 3PRYA 4O4HF 4Z2AA 2I4MA 3G13A 3JALA 1NULA 4WQMA 3NDRA 5CYPA 5KNCH 4ALNA 1U3FA 4HDRA 1L0BA 1IHPA 3UM9A 5LOVA 3TG2A 5TIIA 5BP7A 1BO6A 5CXQA 1YRBA 2Q27A 3UATA 4L08A 1XCLA 1Y6GA 3EVFA 1K5PA 1Z34A 4C30A 3DDCA 2WYVA 2GA9A 2A78A 5D5QA 5IULC 4EF4A 3EDQA 3RV3A 1L4YA 2IL1A 1UT6A 3IAS6 3W5BA 2IGTA 3G5AA 2ZE7A 2XIQA 2JFWA 1O9GA 1CJMA 3NPMA 1H1TA 2XWSA 1IBKB 1MU0A 1C9EA 1N1DA 2IEAA 1ID1A 3FYUB 3NB0A 3PQ3A 4JZKA 4KN8A 4LY6A 4WWHA 3ZXSA 3QY0A 5AW1A 1WDLA 2A0KA 4HGPA 4ZOBA 1IL0A 5DEIA 2CNWD 2C5GA 4YH1A 5KSPA 4XVCA 2I34A 4CLOA 5A3JA 1SOMA 2IC5A 4ALLA 4MB0A 4YAKA 1JWBB 3CH6A 4X44A 3DWIA 3WG9A 4P93A 3PICA 3G8YA 3LKDA 3QVGA 4DB2A 1RYZA 1N5JA 1AVTA 4CMIA 3HV2A 4M9CA 2AMVA 1V9CA 2W37A 2YJTD 3H8WA 1H85A 1LJ8A 2E1RA 1Y1LA 3KLMX 4UU8A 2DERA 3HB4X 3C16C 1U90A 1Z0SA 3WZLA 1FJ2A 5HQ3B 2F3QA 1QHNA 1S6YA 3H9UA 3T7RA 4KN5A 5C7OO 1EBBA 1PVOA 4UC0A 3FHLA 2FB9A 2GNOA 1N2CA 3D5QA 1QS0B 3OT1B 3DBVO 4HNSA 3ESXA 3LNTA 4K03A 3LVQE 2XDQA 4UM5A 1GLGA 4DDKA 4EG5A 5DSXA 1THMA 3GROA 3V2HA 4C0JA 1QO9A 4HWSA 4HFNA 5SYNA 1Q14A 1TCUA 2X13A 4B7AA 1XZ8A 3FTFA 3I2IA 1YQ9A 1V5EA 3N1UA 1UMCA 3L7MA 1P1IA 4PC3A 5TNXA 2ENUA 1BKDR 3ICQB 3B51X 2PWPA 3T61A 3GJ0A 3ORHA 3GGCA 1E77A 2FW7A 1IBRA 4EKNB 1Q3HA 5LVAA 5KEIA 4NARA 1J0BA 4C1BA 3IYLW 5DO9A 5HM8A 3B6JA 3EVBA 3ZNQA 4MDHA 3AUXA 5FLEX 3U5TA 2QUKA 4FMCF 1M75A 2BC9A 5CNMA 5E3HA 5E95A 3WWDA 3A6DA 1JJAA 1S7GA 4KQ1A 3ZV6A 4DSAA 1NNEA 3TW6A 4B74A 4MIYA 1SY7A 1GWNA 1QYXA 1A4RA 2YN2A 4Q3LA 4R8SA 4GFDA 1IHXA 5U4QA 4ARBA 1LC3A 4NIMA 3G02A 2BMFA 4O29A 1KZ9A 4QQRA 2IH5A 4Q9AA 3SQOA 3EWNA 3KOYA 3RJZA 3IR7A 4BCDA 2J0UA 3H5LA 2BISA 2CCKA 4ZPXA 1I8TA 2D7JA 4CLDA 1QSGA 1B1CA 2WUDA 3QVXA 4FCCA 5CU7A 1HL7A 2C20A 2D5IA 5J4HA 2AOVA 2NXJA 4HD8A 5CB4F 4KU4A 2V6BA 3HP7A 2JJ8A 3WGOA 4U2FA 1NT2A 4C4XA 4Z0NA 1MX3A 2QN3A 3JRNA 1P3Y1 4YV1A 1AOXA 1Q1EA 3WQRA 3TXYA 2XHZA 2GPYA 3DXYA 4CKBB 1QGZA 1XTTA 5KYUB 3CH7A 4KFUA 3BH7A 3PCXA 2Z2YA 4AJNA 2PUFA 3C14C 1GU7A 3CKYA 4BX9A 1DX6A 4TM7A 4O3FA 2G25A 4L2IA 2F3UA 4JWTA 3WWYA 1IAQA 3Q3HA 4XAQA 3L4BC 2HUNA 2XXJA 1E6CA 5E9JA 2GN1A 1TVCA 2RMKA 3OIWA 1XLUA 4ZYTA 4RDXA 3ET5A 4GZLA 5H9WA 3WIEA 4WKOA 1XZIA 3K2QA 1JEYA 2X9NA 1PLLA 4I1PA 3D3WB 5AJTA 1CDEA 5DYIA 3HVKA 3UT6A 4IOKA 5E9WA 2QW1A 3WGGA 4TL7A 1VG9B 4C21A 3IH5A 1U0FA 4RPHA 4DE5A 4U6QA 4KTTE 4QGSA 4XYBA 3M3PA 1RAEA 1W8DA 3G8AA 4J6FA 3I5XA 4QNRA 1AKUA 1KDPA 1M8GA 1T6NA 1OWNA 3RTGA 1CY8A 3SMVA 3AZPA 1E89A 1MDBA 3MTBA 2WIKA 5CX1A 1IE3A 4XOIA 4BNTA 1XEXA 2VTVA 1Z0DA 1Z7YA 1KJZA 2V58A 4I8IA 2MIIA 2V4UA 4X7MA 2AUMA 2QT1A 5JCPA 3Q87B 1F12A 4I81A 2YHIA 2BZ0A 3GPBA 3ZHQA 4F1WA 3D02A 1OX4A 3CKLA 3PT9A 3DOFA 3RIGA 5JAQA 1FFEA 1U3DA 2HXGA 3DNFA 3FVRA 5IKXA 4H18A 3X1DA 2BGWA 5EJ9A 1UXGA 3IKTA 2NO9A 3H5TA 5K4GA 3LP6A 2DFPA 1YNOA 3V8NA 4KX5A 2AN4A 3K2BA 4PXYA 1G6Q1 1Z0IA 4S05A 4TXJA 5TSDA 2W8ZA 2LGJA 4BO1A 2F1JA 1MNAA 1LF0A 5JFGA 1WULS 3L0OA 3FOWA 1WU8A 2P2ZA 4C7MA 1R0CA 2WWYA 3H99A 2FPXA 1ORDA 4MS3B 3WRVA 2C78A 2ZVJA 1QOZA 2PO7A 1MRSA 1QHXA 5GPBA 2BF7A 2CL0X 3K4QA 5GMOA 1RTKA 1U3UA 3Q7SA 3WP1B 4R2LA 4CNBA 2ZSBA 3FJ1A 2JBWA 4W5OA 4U7JA 4J07A 5AUOB 3FDIA 1GKKA 1TUIA 4AROA 3VKGA 1QHIA 1ZGCA 1II0A 3DBHB 3LBNA 3I05A 2ISCA 4F7WA 3IBGA 2Y67A 3SFVA 4EYKA 4Q4DA 1TI7A 4QUDA 1P9OA 3JQFC 4CV3A 4JR1A 3BMNA 3K1ZA 2BLNA 4KCGA 4UNIA 2MINA 5AVKA 1O58A 5C1PA 4IDBA 4MR7B 4RL4A 3SM3A 3JQBA 1HFJA 3CGGA 1YU9A 4N3BA 4JI4B 2FE4A 4MIKA 3LVBA 1C2YA 4B82A 3NLLA 1N8SA 2VSOA 3CQ9A 5GAJA 2XUAA 4RL6A 1ZH0A 3U6KA 4H1UA 3TZHA 1HV8A 1M0TA 4G1VA 2EP8A 5JS7A 1EP1B 2PBLA 4PRYA 4IZOA 3AR5A 4IIEA 4YP9A 4NXMB 4JBGA 3O2SB 4GLOA 4QQ8A 2I7TA 4OB7A 1NQTA 4DRXA 3HXQA 1BTOA 5THXA 1B0AA 1PLKA 1BCRA 4D4HA 4Z3KA 1W85B 2PH1A 1GL6A 3VYUB 1N2SA 2UYYA 1VL2A 1QG2A 2CYCA 1AGNA 2D1SA 4MXDA 4WSOA 3WFJA 2ACKA 3NHAA 4URVR 5KC8A 1U4OA 1AZTA 1ONPA 3ZCRA 3LW7A 1IIRA 4ZO9A 5FUWA 1JYSA 1GDDA 2PYIA 3QMVA 1DQZA 4FYXA 4TTRA 3ZY6A 4E3ZA 4RTSA 1HDCA 3MHTA 4HN4B 1JEOA 4OUDB 4R3NA 4HRVA 3A0UA 1XYYA 1TEZA 4B2YA 4DSTA 1V96A 2G1PA 1UOEA 1DEHA 4JCOA 1SOAA 2F8MA 5G0UA 2WUVA 2PG3A 1UODA 5F7OA 5ICGA 1U28A 2C8LA 5FI1B 4YK7A 3R3XA 4P35A 5AJXA 4F8EA 3RRJA 1THGA 2XYHA 1NJ5A 3AH8A 3UAVA 1YZHA 3M89A 4CKWA 2ZQZA 3AEQA 2VI5A 3P0RA 4D44A 3ZJUA 3RHSA 5H1YA 1QAQA 1WQ1R 2JGJA 5F2EA 3EIWA 3UJBA 4EJSC 1E2LA 1E2MA 2CCJA 3ESCA 1WZNA 2ZKLA 4GZ3A 1H4TA 2KHZA 5KCZA 4EMUA 1T2AA 4NQRA 2PSHA 5HDBB 3N75A 1AKWA 1QQ6A 3NDIA 3Q8LA 2O57A 3OZFA 2I2AA 3MCAA 3RF7A 2IHUA 1PGNA 4R3WA 4NH4A 4MLZA 3QLEA 5DSZA 4YRGA 1OOEA 2FFQA 4MARA 4DSZA 2QR3A 1OH5A 4K9RA 4ZDWA 5CGQB 4NEHB 5I47A 4LI3X 1J0DA 4M0DA 3ZI0A 4O63O 3IEKA 5GGYA 3O4JA 4DY6A 3SYRA 3UAYA 5I5GA 2DHRA 4HYQA 4DJAA 1H6DA 4FX5A 1LBQA 2CB0A 2VJKA 3CLKA 5K3FB 3GUZA 3JSXA 4YJFB 4YQEA 1FDIA 2QVCA 4U8HA 5KSOA 3IDSA 3HB7A 2OV4A 3WX0A 4OLBA 1P4HA 1ZRSA 2PGDA 1XZCA 3NALA 3MTIA 1Z18A 4Y67A 4ZJUA 7MHTA 4C6RA 4NBUA 2WHYA 3RVSA 4CLHA 5JQGB 2YHIB 3ZDRA 1AGRA 3HNPA 2XXAA 2Q50A 1NBOA 3CO5A 4EA9A 1EJBA 1YRHA 4PU0A 1MQAA 7REQA 4LOLA 2XOEA 3FGPA 5IHXA 2P3SA 2W2TA 3TS1A 4KR6A 2IKSA 4Q7EA 1P7WA 1AURA 3IODA 3FJYA 1YASA 2CJWB 2R1VA 4OL9A 3RYHB 1JFTA 4LA4A 2OD7A 2FVYA 1I6LA 4QEDA 4LK3A 4RLSA 2IYRA 5DNAA 4JLBA 4CQNA 2ZQ5A 4ZCLA 1B6GA 3BD6A 4HN2A 5JD6A 3FF4A 4TSFD 3VV2A 4HDMB 2CFTA 5I3ZA 1AQNA 2PSJA 1NOKA 3IDFA 2A3RA 1J2RA 2QL6A 3LLUA 1NDUA 2SICE 1ACMA 1U3VA 2C04A 5EVJA 2A86A 3G68A 1K8RA 1KY5A 2PT5A 3ZCSA 3QSYA 4HYTA 1H8HA 3MWJA 1G16A 4OKSA 1V47A 2IEIA 3IO5A 2RAPA 2NIPA 3QELA 4AKHA 3D6AA 3KAQA 1TM7E 1QAOA 1PJ3A 2DPGA 2UYQA 1RLTA 4BBJA 1DG3A 3TOCA 1OA0A 1Q5PA 4FYKA 1WY5A 2J59A 1ST3A 4R83A 3UMJA 4BFLA 1E32A 5FPSA 3ZTWA 1K6XA 2EZ4A 1U9IC 4RKRA 4DILA 3C4VA 4EKDA 4O02B 2P77A 4X7BA 3HXOA 3EOZA 2Z8YM 2ZR8A 3I62A 2F67A 4GMKA 4E11A 1NX6A 5EKTA 1XKXA 2W43A 4EW6A 1EM8B 3CR7A 3O95A 2VC2B 5I7UA 5JQGA 3EOBI 2IZZA 2DUWA 1MGOA 3AHDA 1JA1A 3HLTA 2VH2A 3OFSA 4P31A 5T3UA 2LDBA 2QT0A 3QEMA 5SY6A 4O4LB 1O5IA 3ANNA 3BXXA 2V4ZA 4K6KA 5TQ0B 2ZB7A 5BV0A 2Y27A 2Q9CA 1QYIA 1B7GO 3DB2A 2W6JA 1RMYA 1QO0A 2W2PA 4MWDA 3ZLUA 2EFGA 1O6CA 3GCXA 3KLOA 4PN7A 4EUSA 3VYVA 2FW8A 4WE3A 2H00A 2GUGA 3KK0A 4LGVA 1USUA 2FFHA 1OFIA 3T5TA 1YR1A 1HTTA 3IV7A 4KVGA 5AM1A 1G38A 4WBSA 2FXVA 3RK0A 4YDHB 1E1QA 1PV1A 4KSYA 2UZ4A 3WICA 4YV7A 3MHPA 3T4PA 3F71A 2A14A 1Y8QA 3TM5A 1ECCA 1I9GA 1Q0RA 1WXWA 5EQDA 3U7RA 1D4FA 2RI0A 1G21B 2VHWA 2UV8A 2VYVD 2P27A 2V45A 2H57A 1K0UA 1MC5A 2IYVA 2NLOA 1GILA 3BJRA 3HRIA 4LJKA 3TXXA 3UVEA 1W9MA 1WHTA 3ZXYA 1RQGA 4YPFA 3NHUA 4NP6A 4DA4A 2W00A 4BASA 1KAQA 2FFRA 3A4IA 3EVEA 2RE8A 4F9FA 2EF1A 2HK9A 2Q2WA 1K7SN 2HR1A 4XPZA 1ISIA 4J1SA 3LLSA 2LZ0A 5DNDA 1RS0A 1EG7A 2OOKA 3OTWA 3L6UA 1CULC 3I39X 1AS3A 1JU3A 2LTAA 2VRCD 1A9QA 2MSKA 4OI4A 1IEVA 5LLTA 2I03A 4TV9B 4EY4A 3DMDA 4WCVA 3JQ9A 1ISGA 3AF3A 1H5NA 2COEA 3MFQA 2I8CA 3TQTA 2A7XA 3QIVA 3SSAA 1VRWA 4F9TA 2QGNA 4UZEA 5JSZA 4DLXA 2I4IA 3CZCA 3A25A 2JFFA 4WY5A 5FWYB 2BSQA 1J49A 3VR5A 1MB2A 2X1MA 4NS1A 3P2KA 3W9UA 3ZWBA 2R8EA 3IERA 3MD9A 5JNVA 1DOAA 3IJPA 4YV0A 4BMYA 3UPDA 3VKFA 5KTTA 1C7JA 3LO5A 1D2HA 1E2HA 1V26A 4CR6A 4YRNA 2CUNA 5I4IA 4U6SA 2F55A 5B4VA 2GLUA 5IBQA 4BEVA 4BZXA 4FMPA 1PFKA 2ILVA 3DHVA 4HNHA 5A9SB 3MLAA 1XCJA 2QMUA 4XB1A 4BFUA 4DKJA 1A7JA 2ANCA 3TUIC 3JASB 1UMBA 2X41A 1Z82A 2XOKA 1NW3A 4YRRA 1H94A 1K08A 2H07A 2EJWA 2ZRNA 3EUFA 4RUKA 2AMFA 2PBFA 3A10A 2C7VA 4RXTA 1P6XA 4DIDA 2JAHA 4JT8A 4EI9A 5LIRA 2XQGA 3J81A 1UP6A 3RYIA 4G56A 5CA0B 4TLDA 4F45A 5KYTA 4ZCRA 3A3KA 3L3BA 4LTMA 3SVZA 4B3DA 3Q3IA 4FDMA 4HLDA 4ETWA 3K20A 5T8KC 2W4QA 4DTCA 4JBWA 5T7BA 4UAJA 3N0RA 5ALJA 5EXEA 4X3CA 4EW1A 2HB6A 2COUA 3ZE2B 4FYMA 3FBWA 4NL4H 3C3JA 2NAFA 1VLQA 3CLSC 5DBIA 1Y3HA 3FYTA 5K5EA 2VR1A 3O74A 4P54A 3B3FA 3ZIDA 3V1NA 1R0WA 3LOUA 3K31A 3EPKA 3TRKA 3O8OB 5HJEA 4MW1A 2CMGA 3ZWWA 1SKAA 3QUCA 1GKYA 1QGYA 2RCYA 5I9IA 1GTJ1 4MR9B 1GNQA 4R7ZA 3IE0A 5ULLA 2FWJA 2BSXA 1E1LA 5LZ4A 4QUHA 1GZUA 2F3TA 2QSYA 1GGMA 3CPHA 3GYBA 4X1OA 5TVKA 5KX5F 3B6MA 1ZNYA 1VKJA 3VR1A 2NU7B 3ZE7A 3CLUC 3ROTA 4HWTA 2L42A 3ITEA 3QGMA 1P4JA 2B37A 4L15A 2FG7C 2P4EA 4OXNA 4ZEMA 4MVXA 1KP9A 4PYLA 3DV0A 2HDWA 1NVFA 2FN9A 1G9SA 2FR0A 5FULA 2YFQA 3PXDA 2AEFA 3ZVLA 1BHSA 1A2OA 1MPXA 1T3HA 3EQZA 2A0UA 4E5SA 1DSSG 1DAHA 1P0CA 2I0FA 2I4TA 3WGUA 4QT4A 4A0GA 5AVSA 3D64A 1R6BX 1T2VA 5IT4A 4U7FA 5SYMA 3T15A 4KO2S 1RD4A 2A0FA 1B8UA 1HTWA 3BMNB 2BT4A 1WXIA 3JS5A 3L8CA 3KR9A 4GE3A 4BAUA 1X1AA 3G2QA 4D4LA 4ZHQB 1U8EA 2I78A 3MSXA 1XL1A 1FP6A 1HT1E 5EERA 4B85A 4F3NA 4YPVA 3KQOA 4OBXA 5ESRA 4UNSA 3NHYA 5H02A 4NBWA 4FZVA 2GAAA 3DEIA 1R7RA 3KUUA 5B1DA 2JHFA 2BRUC 2E82A 1LQTA 1E94E 1YZNA 2HLNA 4HH3C 3EIHA 3RK4A 2WU8A 1BMQA 3IOBA 2VAXA 1YVDA 4JEUA 4F46A 2IV7A 1XJQA 2KQUA 2QEQA 1JNXX 4M9RA 3T7JA 1W0KA 3T99A 2AS0A 2ERYA 2VP3A 4BNDB 1KMMA 3OLXA 5J2UF 5E4JA 4BOYA 1CW2B 3SZ3A 4Y9TA 2CHUA 2VTBA 4FOOA 3L43A 2ZJ6A 2PT9A 3NETA 2XR1A 2QV0A 5GINE 1RWKA 2EZ9A 4L5AA 5BRJA 4PZPA 1IWPB 1A5BB 1NI4B 1WR8A 3HJCA 4PQYA 1N6LA 3THRA 2R5NA 4XX1A 1JIIA 1V6AA 3UJ3X 4M86A 4OHWA 5H3HA 1Y6QA 1NKTA 3W1WA 1I6KA 2QYTA 3P5BA 4GC9A 2CBGA 5F2NA 3H75A 4OUDA 2PUJA 4PYQA 1JHYA 2II6A 3L4BA 1IN5A 2LKDA 4DV0B 3ZV4A 1ZIDA 3AYXB 1VIMA 4BYMA 5DK4A 1JALA 3HXLA 3KUDA 3W4KA 4DGSA 2FWRA 1G0OA 4ZK2A 2DQYA 3PDJA 2WJYA 5FEMA 3DMYA 1F9AA 3AWIA 2OCDA 4MIOA 2FWNA 1N0UA 3O9ZA 1NV9A 3AEUB 3GPIA 3ZLJA 4Y9DA 1E9EA 2NUAA 1NBIA 2CLEB 2VDNB 1BWQA 3ANSA 4X5OA 5TT0A 3P5SA 1CS0B 1ZCFA 4HFMA 4KZKA 1SKYB 2CE2X 4QATA 4Y2VA 1AHHA 3L4SO 1J2JA 2OORA 3COYA 1PX0A 2VDOB 4UZFA 5DOZA 1F8UA 1OLUA 4IBOA 4P4UA 5E8RA 2PUGA 2UXDB 3M33A 2BHTA 1TIPA 1IHOA 3QLJA 1ABEA 2ONYA 4J90A 2R1TA 3TD2A 1RCUA 3GHYA 4KDEA 4E4YA 2SECE 3I30X 5I7VA 1KQPA 4GF5A 1HDXA 4YFVA 1J4AA 3GCDA 3LDFA 4N41A 3L1HA 1JIKA 4IJ6A 4QU5A 5IC6A 4KUHA 5CVTA 4REQB 4B1FA 4KRGA 2NSLA 2Z1DA 4LJLA 3L9XA 1ZHHA 4C4OA 3BZBA 1H8EA 1UEXC 3GJ7A 1U31A 2WJ3A 4L16A 3K16A 4W1RA 4ZPJA 4QLAA 1MB3A 3PDWA 5T64A 2AH5A 3UT5A 4BNIA 2BR5A 3SZRA 2GTIA 4O4JA 4ILEA 5JJCA 1ZICA 3IT3A 1XRRA 3OI7A 2YCBA 1IY1A 2BKXA 4UPDA 4XIGS 2NU6A 4CMKA 5FQNA 1KAGA 3AU9A 2O2GA 2WZBA 5BN1A 1ORIA 3ADBA 2QK4A 2QWXA 3K0KA 1J6UA 2HHCA 4RJJA 3P0EA 3HBFA 3DAPA 2QG4A 4D2IA 2Y0PA 4ER0A 2WPDA 4W5WA 2F43A 1KBZA 1PO7A 4RWZA 3KAPA 3DYVA 2C2OA 2VWPA 3I9JA 4MVJP 4UZSA 1CG6A 1N2HA 4ENVA 5HPYB 1U1DA 4XIYA 5KYVA 2JAQA 3HMQA 1XTBA 4D8TA 1PR0A 5ES3A 3K4PA 1C7ZA 2ZRLA 3LCCA 4JT9A 4OQDA 4COKA 2BH9A 3T1TA 2NUAB 5K1ZA 1QGDA 3T3OA 3ZQJA 2GPNA 1K8YB 3MTGA 4P34A 1AUVA 3IAUA 5DMXA 4U7GA 1XZDA 5CB4B 4B6JA 4DQDA 3FHTA 4BJ5A 3NTXA 4Q4CA 3U3KA 4DR4B 3VNUA 1N32B 2IUSA 1XMVA 4YNBA 1UXKA 4HZGA 3A7EA 1LPNA 3F46A 3JWPA 3TZBA 4RVUA 4FNAA 4MULA 1SHLA 3KDPA 2PZJA 1QIIA 1A98A 3T3MB 1TA9A 1YS9A 4YMVA 1T9BA 3DGFC 3A3OA 1IQ0A 4ZC1A 4C7JA 2IQ5A 3NGLA 4L1KA 4GGPA 3GP3A 1CZLA 2H5LA 4BVAA 1OASA 3W5DA 1GVNB 4M1SA 3FTDA 3PIDA 2QRZA 2QTMA 4D5GA 4EA7A 3KKEA 4DA7A 4FFDA 7ABPA 1LDGA 3IBTA 1BRTA 1KORA 2XMBA 2EJCA 1FDWA 3OFND 4MR8A 1WPRA 1H2ZA 4ZHQA 3EH2A 5BUSA 3DAHA 2HMVA 4JKYA 4ZOLA 2JLAA 1XTQA 1EFAA 1WIWA 2XMDA 4NENB 2J09A 3KUCA 4HZUA 3T3DA 2DVMA 1UKBA 1W88B 1BX1A 2AXQA 5HQJA 3RVJA 2H1CA 4ZAFA 4HFJA 3WXMA 4C4SA 4BN4A 3NRJA 2HRDA 2AW3A 1BHO1 1HFKA 2JFGA 3AV0B 2AEMA 1XVLA 4B4DA 5JH7A 2R2AA 2PR2A 5A0VA 5D8DA 5EZYF 4G0WA 1E6KA 3GNSA 1KJQA 4CBVA 2Q3HA 4J6EA 6GPBA 1FMJA 4NFHA 1UBUS 1YULA 2TS1A 4QPZA 5HKLA 1OB5A 5JNSA 3QELB 4G67A 3I5MA 4A27A 4WBNF 1P5JA 1NRWA 1EFVB 2E48A 3GRCA 1DKQA 1PFWA 2C2HA 2I66A 3K0AB 2AI3A 4M37A 3A27A 1X1DA 4QJ4A 3LFUA 1SVKA 2GM9A 1ENOA 2OZEA 2R9VA 4DDVA 2F4NA 1VBMA 3PGVA 5EEGA 5FUYA 2GD1O 3TRIA 2QDKA 2O3TA 2OMKA 4IF4A 1ZM2A 2ZITA 3QU2A 2WD8A 3K2IA 3B5JA 1KP2A 3NT4A 4XUGB 2XWJI 4M8NE 1UFRA 1IXYA 4G07A 4H7DA 4CM8A 1E6WA 1RKBA 1X15A 2UZAA 3QUQA 2CJWA 2B4KA 4G5XA 4KP7A 4UVDA 5ALFA 2VK1A 1W5AA 2GXUA 2G70A 4QHYA 3D8TA 3H2GA 5TQ0A 3ZDAA 2NU8B 4HWPA 1Z47A 2DAPA 4IIFA 5EZSA 2CC2A 2DR0A 1XKQA 3RM3A 1CUCA 3TKAA 1FK8A 1FFHA 3LQ2A 4PRKA 3R75A 2ZR7A 3I83A 1J5EB 2IBTA 2GJ9A 3PIRA 1T2NA 4XUEA 3K9LA 1W88A 1U6KA 1USWA 2AOTB 4NBRA 2IHYA 1TRHA 3TL3A 3RAPR 3QKRB 2JIPA 1NM5A 5DX0A 4BFYA 1JEYB 3N0WA 4BCBA 3ZIAD 1PD1A 2VT3A 2WQZA 3LQ1A 2JIMA 1KMHA 1TUBA 3WRYC 3DT9A 4QXRA 1A7AA 5HF6A 3QFSA 2XDQB 3QKUA 3WI7A 2XVZA 3EDRA 2A9FA 4E2FA 4URZR 1DAGA 1PIWA 2Y93A 4TXNA 2DEUA 1QU2A 1Z4OA 1FIUA 2XE8A 1L5YA 4AUEA 2QJTA 1FS6A 4LC0A 2C58A 3ZQ4A 4BVJA 4YP6A 2WILA 2A0YA 1MF7A 5IDWA 4II3A 2VNAA 4MKHA 4XASA 2YMLA 5T6BA 2QROA 3F74A 1EZ4A 3H1FA 3ICCA 1Z2OX 3MWDA 1B2LA 4M0LA 3RT9A 1Y3BE 4CG2A 3I04M 4X62B 3QOYA 1QRTA 2IRWA 3HCFA 2AIRA 4FS3A 4TV9A 3JU3A 3QVJA 1XNQB 4R31A 1JJBA 5JD5A 2NTEA 3SI7A 4P5EA 4YT2A 5CD9A 1RKVA 1Z68A 5IWAB 2MSDB 2Z5FA 3OLCX 2XJ4A 4LXHA 1QIHA 1UJ5A 1YHYA 3FVTA 4NSNA 3VTZA 3L1IA 2AJDA 3RVPA 2QX8A 4AN1A 4B3IA 1GQFA 3QNWA 4DCCA 4FK8A 4I2NA 2IZ7A 4FYWA 3I32A 1NWHA 2AOWA 1HZZC 1XMXA 4BZZA 2G3YA 1TXGA 3VR6D 2CY0A 1FNCA 1YZTA 1VJDA 1E9BA 1MZVA 1NZFA 1VLLA 5E7IA 1YI8A 3A9CA 4PG6A 1TRKA 1JDJA 2VYQA 3KC2A 5EE9A 5GZ3A 2O5EA 4EPRA 2PEZA 3Q3GE 2DQ4A 1EUCA 4N40A 5D3ZA 1T26A 4EG7A 1HLFA 1L5NA 3KXPA 5MHTA 4M8LA 5A2QA 2NTVA 1RM4A 4DN6A 2BEUA 4BPBA 4W5HA 3MCVA 3HXPA 4YVFA 3V8BA 1KI4A 4F5DA 3UTCA 2O7VA 2AK3A 1VRCA 3IUPA 1XKLA 1FXWF 1KETA 4KIGA 1PG0A 3D3QA 5HG0A 3GRYA 5FTKA 4Z54A 4LWPA 4WJKB 3WS7A 3KL2A 4PHTA 3G0IA 4CEJA 1S01A 3NBMA 2QORA 2FMXA 1DHRA 4HUJA 4WUVA 1ZMBA 4AJJA 1KKUA 5SZKB 4DR5B 5FBRB 1JAYA 2YY5A 3CH4B 4CF5A 3UHPA 4R7GA 1KI6B 3G88A 2CFIA 2XUPA 3CEMA 1V6SA 3CUSA 2D4HA 2RG1A 2YOHA 3O94A 3SF8A 2VSQA 3ZE6A 2YZMA 2ZTHA 4FT4A 4YALA 2O7SA 1LNSA 4B33A 4OGWA 3THXA 1M1UA 4KK4A 1YA8A 3QVMA 1ZYUA 4ZA2A 3ZCQA 2YFHA 1AKRA 1LNQA 4MR9A 1HTBA 3I2GA 4JBNA 5EJMA 3WNZA 2WSSD 4L0QA 1ABBA 2FPPB 4B3MB 3M6VA 2EX0A 5CM9C 1HE1C 5TMBA 4M9UA 4CM3A 1T15A 1XQWA 3QF7A 4IV0A 3AVUA 3OZEA 3ENZA 3ZDXB 2P4QA 5LQKA 4Z4FA 1F7VA 4MYDA 2B78A 3TQOA 1UP4A 1EVEA 2HSZA 4YTEA 1XVUA 1GFIA 1JR2A 4ND8B 1E5DA 1M34E 2WNIA 5ARDA 3KALA 4CTNA 1RCFA 3JQDA 1YFJA 3ITKA 5F73A 2YFYA 3EQ7A 2XF2A 4INJA 4J4HA 4WASA 5AMXA 5LA6F 3W1VA 1OIWA 1TT7A 3BPSA 5EXSA 2PMKA 3STXA 3T7CA 4OYYA 2X0KA 2WDZA 1NE7A 4PAGA 3SQDA 4B75A 4D9FA 3LY7A 3WGLA 3DTTA 3LFHA 5UKDA 1QPBA 4ER6A 4LQ4A 3TDKA 3OQMA 4M1EA 2QP9X 2FDXA 2CJXA 1KI2A 3Q72A 1WNTA 1Y9DA 3PPXA 4P3NA 3KDSE 4EKIA 2Z6QA 3NIGB 3WBJA 1HO3A 4YP5A 4D56A 1PNVA 3S1AA 3QV2A 1NN5A 3ELUA 4ISBA 5FFMA 4DR7B 2CXRA 2MHCA 2BEKA 3ZN2A 3OIDA 5J4VA 1NJ1A 4YRJA 4AZ3B 3T4XA 4QDXA 4MKIA 4V2IA 1T6ZA 3NBFA 3FCCA 2RHLA 4QUKA 2EGGA 3CKKA 3PR3A 3E9YA 4WVLA 1Y34E 3W5VA 4DEYA 2N46A 5L6MB 4YJHA 3QHAA 1XDSA 3W2HA 1AUQA 4QIHA 1JT9A 4PYNA 2KW5A 2GN4A 3GWGA 1WL8A 3RF6A 3UENA 5I5EA 4JA0A 3O1JC 2EIHA 5YASA 1LVGA 1MAAA 3RT1A 3IXLA 1FLAA 3V7FA 4A8HA 4WFIA 2QN1A 3W05A 2P1ZA 4YGXB 2OBXA 5B7NA 3RRZA 4Y1RB 3NI2A 4KQ9A 2UVPB 5CM8B 3UJCA 1WCV1 2G6BA 1JHMA 4TTPA 2IXAA 3M4JA 4FDA