1E9FA

Mutant human thymidylate kinase complexed with tmp and adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
211
structure length
202
Chain Sequence
b'RRGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Potentiating Azt Activation: Structures of Wildtype and Mutant Human Thymidylate Kinase Suggest Reasons for the Mutants' Improved Kinetics with the HIV Prodrug Metabolite Aztmp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 202
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e9fA00
2HYIC 2DYKA 1HE8B 3PENA 3VAAA 3I73A 1T5IA 1I2MA 5FTKA 1ZIOA 1SKYE 1IXSB 1US8A 3BIFA 1N6NA 3OE7A 2VSFA 4Q47A 2ZRGA 4JLVA 1P7CA 3BB1A 3KXIA 1G6HA 5LBIA 1YZKA 4JLKA 3W5IA 2JLXA 1AS3A 3TUIC 4LJ4A 4KLNA 5BN5A 3R8CA 2QMHA 3CF2A 4JBWA 1QG4A 3Q5EA 5AJZA 1TF7A 3A1WA 3AQ4A 1X6VA 4NH0A 4Q4JB 2GJAA 3RS2A 2NO7A 1W4RA 2P5TB 1G3RA 2IYTA 3HP1A 2UZIR 4TTQA 4KI0A 4NHOA 5B2ZA 1J2JA 3DOEA 2QE7A 3U44A 4ZDKA 5J4VA 2WSSD 2GZDA 1JR3D 2VSOA 3LW7A 2RGGA 1ZUNB 3TKLA 4M1TA 3BH7A 3DZ8A 4FMBB 2JA1A 2OLJA 1LF5A 5FUYA 4HZUA 2WOOA 2RGAA 1ZC4A 4LBZA 5LD2C 1VIAA 621PA 4URWR 5L3SB 2YKGA 1GILA 4HZIA 2SHKA 4C0LA 4URZR 2IHBA 1UFQA 2KI5A 5FPKA 3ZVLA 1WXQA 3M6AA 2A5GA 4PPNA 4AYXA 2IHYA 2H92A 1G4AE 4C2TA 2ZJBA 3HR8A 1F2UB 4K81B 5FUXA 1HQYE 2ZRJA 3QKTA 5FTJA 4CRWB 4OHXA 3IBGA 1DE0A 2A78A 2XNSA 3EW9A 1HT2E 4IRUB 4F92B 1E79A 2QENA 4LRWA 2IYYA 3BK7A 2IXFA 5GADl 2IS1A 4M53A 3LXXA 3LXRA 1OIWA 4QFMA 4L15A 2NO6A 3EIHA 5CLLA 3ZQ6A 5LD2B 3KXKA 1YZNA 2ZJ8A 2FJUA 1KGDA 3BBPA 4US1R 4URYR 2W0SA 4NBSA 1D2MA 4Q66C 5UKDA 4PHHA 5DLQC 1NLYA 2C78A 2Q3FA 1FNNA 3K09A 3LDAA 1KI9A 5FTNA 1C4OA 3I8SA 5KSYA 1F3OA 1YR7A 2WM9B 1M6NA 5JEDA 5BXQC 4H1UA 3T34A 5C4MA 1QHGA 3AKCA 2GXUA 4HDQB 2P6NA 4LJ8A 1DARA 2QQEA 1KDRA 5TB5A 4NTZA 3T1VA 4C3ZA 4HLUA 3ZS9A 3LLUA 2OE2A 2GILA 4AG5A 1VIYA 2F9MA 5J5CA 4D6PA 2ZRFA 1FNMA 2GF0A 1JEDA 2CMKA 2WWFA 1Z0DA 2BBSA 4L5BA 4D4LA 4M9SA 1CF4A 1HE1C 3DKPA 4EFMA 1PJRA 1YRAA 2QG6A 2O52A 4JL8A 3H0KA 1HEIA 2ZI3A 1B23P 3IIMA 4A2WA 2VSXA 4D82A 1YZTA 5BWMA 3VNVA 5DHAA 4BFVA 4NPHA 5AJVB 3DMNA 5EP4A 3CZQA 4US0R 2A5YB 3CX6A 1NBMD 3PUYA 4WOPA 4D0LB 3AF1A 1FTSA 1LF0A 2CL7X 2ZI7A 1CS4C 4V0LA 3UATA 1X1SA 1P61B 5JEEA 3TAUA 4F91B 2R6CA 1UADA 3U3RA 4RY2A 3FFBA 3L43A 3SS8A 2QU8A 3LVQE 4V0MA 2GJ9A 2FN4A 3U3JA 1E3MA 2ZRNA 1M74A 1DOAA 4QNRA 3PXGA 2GXQA 2VYFA 1XWIA 2ONKA 5HTKA 2GK7A 4F7WA 4M2LA 1T0HB 4QBFA 1JPNA 5KHOC 5AUQA 3U44B 5GJBA 2D7CA 3A1TA 4DLXA 4IFEA 1L2TA 4CZ2A 2FSHA 1OKKA 2C98A 4LV5B 3MWYW 1XB2A 2C99A 4Q02A 1IM2A 1RRGA 3HU2A 4IOMA 3GLFE 4G01B 5H1YA 5K8LA 3RANA 3SYKA 5IHPA 4ESHA 1NRJB 2ZYTX 1PLLA 1ZM3A 1NN1A 4GPTA 2F1IA 5FI1B 1ZP6A 3QVUA 1JI0A 3L2OB 1NY5A 4MGYR 4B3BA 1HUQA 2ANCA 1NSTA 1E69A 3VU9A 4A9AA 1DEKA 2OUKA 1D2EA 3EZ6A 4HLCA 5AUPB 4NCNA 1AZSC 3AVTA 2XB4A 3K70C 2VTKA 2C04A 1AQYA 1L8QA 2BC9A 4C0JA 2FGJA 1ZBDA 3OIWA 1CR0A 4BFTA 2RGXA 1LW7A 1UKYA 2ZU0C 1I4DD 4IOKA 2WPDA 5KUTA 4HLUC 2GJSA 1Q1QA 3PUZA 2ZS9A 1ZYUA 2JCSA 3L8ZA 4GZLA 1GITA 2H16A 4WXRA 5DIFA 1P2TA 2JLRA 2IS6A 2FH5B 1EFHA 3QG5A 3DPUA 1YR8A 3MWKA 3WRYC 5CM9C 4TMKA 2QPOA 4BRWA 4EPVA 2VP2A 1W0JA 5J4HA 2NPFA 3K70B 1W0KD 2V3CC 4TLDA 1KKMA 3ZGXA 3N2IA 4XD7A 3ASYA 4JLPA 1XTRA 1N6OA 4AKEA 2J5XA 3FMFA 1VTKA 4TQAA 1Z83A 3JVVA 5KTYA 3BB4A 2JATA 4BRUA 5FL7A 2VQSA 2WZQA 4Q48A 3WYAA 4LWZA 5JMTA 1RRCA 2AKYA 3ONWA 3N2EA 1K6MA 1AN0A 2R44A 2XSZD 2KBEA 3OAAA 2IF0A 2IA5A 1BMFD 4NE2A 3R7WA 3B78A 1U0HC 2ZS8A 2FA9A 2GEVA 1YRBA 2QSYA 3DKVA 1IXRC 1W4AA 5FBQB 1YU9A 2N42A 5FI0B 2PZFA 1OXVA 1N5KA 4S2EA 521PA 1R8QA 3RWMB 4TYYA 3A1VA 1YJ5A 1I2DA 1KMHA 3A4LA 4B3FX 3IIJA 4OQXA 1XEXA 4M9XA 1QBKC 2C95A 3TW8B 4Q7MB 1E2GA 1E2MA 5JI2E 5KNCA 1FPMA 1PLJA 3C8UA 5KDOA 3KQLA 2ZANA 5EXTA 1KDPA 2ECKA 2J7KA 3V9PA 2B6HA 4U00A 4L9WA 3WY9A 1UKVY 2YC4C 4KU4A 4DUGA 1WBBA 4QKQA 4OI2A 4IOJA 3K1JA 2RB4A 2XZLA 1E4VA 2IXGA 1K5GA 1Q12A 1KMQA 3G5UA 4J0QA 4LK2A 3IO3A 3VKGA 3PR1A 4GDFA 3F5FA 4MYUA 5SZIA 1HTWA 3E1SA 2O8CA 2IK8A 4MYCA 1W4BA 2YWFA 4DLWA 4JZKA 3A1SA 4JMPA 3FTQA 3ZD6A 2RCNA 1FMLA 3KUDA 4HDOB 5GVRA 3MJHA 4DEXA 2JDID 1UM8A 1P75A 1E1QD 3NH6A 5H68A 4EPRA 2KE5A 1Z3IX 5KNBA 2FFQA 1F48A 3VU9B 4JLAA 1VCIA 3GJ6A 4G5QA 4R2IA 5IK2A 3VMFA 2ATVA 3EAQA 4G1UC 2EU8A 2JIZD 3CPHA 1DAHA 1O3YA 1D9XA 2GCPA 5DE3A 2GJ8A 1Z2AA 3HU3A 3F8TA 4RKFA 2ONJA 4M8NE 2WSSA 4DBLC 3JVUA 2XNDD 4GMXA 2NOAA 1XBTA 3HWSA 4ASUA 1N6PA 5C1BA 3CWQA 3OIVA 1G9XA 4BFUA 2KBFA 1VECA 4MRSA 1UKEA 1GRQA 3BERA 3TH5A 4IDOA 5F9HA 4P32A 4B48A 3B5JA 1NF3A 1CRQA 1XJ0A 4BFYA 2EQBA 2OBNA 4NCHA 1KK2A 4G5SA 4QHYA 3I8XA 4XVRA 3RABA 2ODBA 1LB1B 3QBTA 2OILA 3C4JA 3QIAA 2G88A 4PC7A 3TR5A 4ZCMA 2BHRA 2JASA 3GFPA 2WKQA 2GEUA 5CDFA 3QPUA 2CVHA 1ETUA 4WZAE 1GKIA 1E2PA 4JIMA 2QORA 1YKSA 3Q3JB 1E9SA 4RSGA 3LV8A 5K8UA 3TMKA 4YMVA 3DEFA 3T35A 2ERXA 3R7WB 2R2AA 3WBJA 4URUR 4KHZA 2IEYA 2BCJQ 4IDHA 3WYFA 3KTAB 3EIEA 5DI9A 1KO4A 2V1XA 2XX3A 1W5SA 5CJPA 1KMHB 1ANKA 4FD2A 4JT2A 1J90A 2CHQA 2FEMA 3H4MA 4Q03A 2Z83A 1E9DA 4B3DA 1A4RA 1XEXB 1DO2A 4CGZA 3AF3A 1SVIA 3WHKA 4PZLA 2CE2X 2AKAB 4G0NA 1PLKA 5G3YA 3L0OA 4IVPA 4PPGA 5F2EA 4TMXA 1Z28A 1MRSA 3NXSA 3RNLA 2O0JA 1DPFA 4P4TA 3AGQA 3AUYA 4V02A 2K5UA 3UXMA 1H8HD 2OG2A 3U3MA 1E4YA 1GUAA 5IF9A 5DYGA 2J9RA 2XJ4A 1AS0A 4NONA 4MRNA 3U7HB 1CR4A 3KJIA 3WNCA 2YC2C 1E2LA 1GOTA 1AS2A 4BLOA 1J99A 3PCRB 4QGAA 2O8BB 2OXRA 3KKMA 1ZD8A 2GVZC 4QG7A 3RVBA 4ZCIA 1RKBA 1BO6A 2PJRA 2RGEA 3UWOA 2O8CB 3ZVRA 1KSFX 2I1VB 1G5TA 4KVGA 3KJEA 1NBMA 3Q7QA 3ZDQA 3FHCB 2WMNB 3SFZA 2D3WA 2J0QA 2R6AA 121PA 3IEUA 2QPTA 1KNXA 4LJ5A 3EG5A 3KKQA 1IJFA 3H86A 4AI6A 4XSHA 1YR6A 5F98A 2VHJA 3B8HA 1OIXA 2GTPA 1K5DA 2YJTD 1V43A 2XITA 1U8AA 4O2RA 3A37A 3JZAA 2BCGY 4KFTA 2A30A 1ESMA 1WCV1 2EWWA 4LUCA 4H9GA 4A36A 1GTVA 1VYTA 4B3CA 3BS4A 2ZSEA 1NKSA 4RJLA 2Q9CA 4OI1A 1SXJE 1E2QA 1FP6A 721PA 4QBGB 2YYZA 1SVKA 2ZSFA 2W6ID 2J7PD 1G8YA 4HUQA 1G16A 3O47A 3OIUA 4ZKDA 2BIFA 4DSNA 4KXFB 1KI7A 1WQ1R 1I4TD 2ZQ5A 4MUBA 4URXR 421PA 5EP3A 2RH5A 2F7SA 2ZJAA 4QJ4A 4A15A 3TSWA 3FB4A 4UQOA 2MSDB 3ZLJA 1U94A 1QHXA 1PUJA 4Q5IA 4ZDJA 1EK0A 3CZPA 3CKLA 2MMCA 1ZM7A 3GJ0A 3GLHB 2OM2A 4BECA 1W48A 2QN6A 4D80A 4US2R 1JPJA 2OCAA 1OH7A 1EFRD 1DBSA 3AP3A 5FBRB 4D25A 1EGAA 4UJ3A 3EPKA 2XB2A 1AZTA 1HY3A 4DLZA 2QTFA 2BEKA 4XVUA 3EPHA 3LD9A 3FVQA 4TQUS 2QY9A 2ZRLA 1ZNXA 3CX8A 2LWIA 1OHHD 2HLDA 2CL0X 2E9SA 4PO8A 1IQPA 1XXHE 1JEEA 4FWIB 1OB2A 821PA 1HA3A 2ZIAA 1KDTA 3BH6A 1UDWA 3KZ1E 4DLVA 2C9CA 2VRWA 3QY0A 1CJTC 2NZ8A 4DSUA 5D3QA 1UEJA 4PC6A 4LJ7A 4RD2A 2Q0HA 5JI3E 3EIQA 3GFTA 3QVVA 1P2VA 2V54A 1W0KA 2VP0A 3TUJC 4IDQA 3AKEA 4RD6A 1F6BA 2YOFA 3B60A 3M0EA 4GOJA 3T1TA 4GNKA 1QVAA 5DH9A 3GLIE 1G4UR 1Q22A 2CEAA 4PPQA 4X8HA 3BJIC 2J0VA 2Q21A 3W90A 2DFLA 1IY0A 4KFRA 2AR7A 2VHCA 5JECA 4V0OA 4JSYA 3EPLA 4NYMR 5AWFC 4DDTA 4QC2A 3B1WA 4NL4H 4I1UA 2MSEB 1BMFA 1P72A 4NYIR 5K8TA 5TVKA 1MO5A 4QGHA 1DTSA 5D3MA 3L0SA 3BORA 4YDSA 5CITA 2BMEA 4DT1A 2EW1A 1LTQA 2AK2A 1ZRHA 4TTRA 1G291 3BRWD 4RZ3A 2CK3D 5FBWB 2QNRA 2XTNA 3D31A 1Q1BA 1R8SA 1IONA 5EE5B 3IQXA 2VF7A 4HB3A 3NWJA 5AJYA 3CW2A 3UMFA 4B75A 1II8B 3TW4A 4QBIA 2WJYA 1G3IA 1NMYA 1T3SA 4R98A 2DWPA 2OLKA 1IBRA 3LNCA 4Z8XA 3WBKA 5HE9A 4OI4A 5JFGA 3RSLA 1ZM2A 2C96A 3E2IA 4NDZA 3GPLA 2IXEA 1FOEB 4OJKA 1D6JA 2WKRA 3CR7A 4P4UA 2ZAMA 2ZM5A 4ESVA 4XJXA 4QGFA 1FX0A 3MFYA 5J4YA 1KHTA 3KJGA 4ZDIA 1F2TA 2I4IA 5FOSA 2WOJA 3MG9A 4B33A 1DAKA 5E7IA 2QP3A 3HYTA 2D06A 5C46F 1G64A 4HDCA 1DAIA 2J0UA 1OYYA 4NYMQ 4HUQB 2DFKB 3P26A 3PJRA 3MUFA 1AIPA 1VPLA 3FMOB 1Z22A 1OXUA 3AEZA 2ORWA 2EFEB 5BYJA 1E96A 4NYIQ 1XMVA 4ZIRA 5HCIA 2ZRMA 5TARA 4C0SA 3BD9A 1O87A 1KYIA 4FXPA 4EFNA 4A6XA 5EP2A 4HB4A 1SXJD 2JDIA 1RYHA 4HUTA 2QUZA 1M7HA 1KSGA 1E1QA 3BH0A 2JJ2D 3ICQB 2JLUA 1G8HA 3QKRA 1WF3A 5FFMA 1G7TA 4TLEA 2HV8A 3B2EA 4Q01A 4N0DA 5AR1A 1LNZA 3QJYA 4HLDA 2JIZA 4Q1EA 1VCMA 2P67A 3WMGA 1MOZA 2EFGA 5ANRB 1QHSA 1EX6A 3ZIAD 3O8RA 1KI4A 1M1YE 2C9YA 1UBFA 3U2QA 3GQBA 3VNUA 3B7GA 3K53A 1Q44A 1LS1A 3V4FA 1ZUHA 2AX4A 1RIFA 1XEWX 3X1WA 1TQ2A 3C5CA 5E95A 1SHZA 2RMKA 2BWJA 4JLNA 1E9CA 1Y63A 1P9NA 1KY2A 1XTJA 4M21A 1N0UA 4B2IA 2WBLC 3DM5A 1GIAA 4IDNA 3HPQA 4AC9A 2D62A 4EKDA 3W8NA 3MCAA 3I32A 1JJVA 2VEDA 4ZO4A 2JLYA 1W36D 1TTTA 2ZRHA 3CF0A 3FDIA 1T9HA 2W6JD 4GI7A 3GEIA 4YONB 4JS0A 3ZD7A 3S1AA 1XZPA 2IYWA 2FPMA 3VR4A 2B8TA 1Z6XA 4MH0R 2J3EA 1KNQA 4Q1AA 3SOPA 4KFUA 1A7JA 3FHOA 1X86B 3G82C 4MGKR 1Q3HA 2GZAA 4WA7A 3TSOA 3CBQA 5EJEA 2UZ3A 1YR9A 3TQFA 1PZNA 5D3MB 4IVRA 2BEJA 2BBWA 4TL6A 4UXIA 1G20E 1GG2A 4JLJA 1Z6AA 4TLCA 5EP1A 4CIDA 3HJNA 2R62A 2HT1A 2V7QD 1CU1A 2CLCX 2GCNA 2FWRA 2LKCA 4QOSA 5G41A 4RZ2A 4U02A 5B58C 3R9IA 2ZU6A 2YINC 1A5TA 1IN7A 4Q1CA 2IWRA 4C0HA 1Z8FA 3CX7A 1JJ7A 2P5SA 1RVDA 2ZSDA 2P65A 5DN6A 3VKHA 2BBTA 1ZU4A 2WJGA 2IS2A 2OHFA 2NO1A 1FX0B 1H8HA 3KFXA 5KSOA 1NN0A 4QBHA 4BLQA 1S2MA 3QKSA 4LYJA 1F2TB 1RW4A 4BLSA 4NYJQ 4CF7A 4GP6A 1UAAA 1XPUA 5JWHA 3X2SA 4U7DA 2ZPTX 1HURA 2W0MA 2J0UB 2O0HA 4LSGA 1OT3A 3RS5A 3EA5A 1VCNA 2EFCB 3U7GA 4BLTA 3QBVA 1S8FA 4PAMA 3I1FA 4ZIRB 1JAHA 2Q9AA 1CBUA 2HJVA 2NQ2C 2P2LA 3GEEA 4LC1A 1GKUB 3B82A 1US8B 3AF4A 5LB2A 4PQYA 2OFXA 4P33A 3ZQJA 3KQHA 3WXMA 5G3ZA 3GJ4A 3OIYA 1JNYA 2DB3A 3LA6A 2QBYA 4YLGA 4C2UA 3KKOA 2W2XA 1GFIA 3OF5A 1E9RA 4Q4LA 2A9KA 2P3SA 1XFAA 3QKRB 2AWOA 4B3GA 2ZE6A 4JVNA 4CEJA 1GNQA 2QSZA 1Q0UA 1U0LA 4BGDA 3KXLA 4FCVA 1XTIA 3AKDA 3BB3A 4IFBA 2OBMA 1C9KA 1XD9A 3PV0A 3MJRA 4F93B 3SHWA 4B6EA 2WWIA 1Z0KA 1E32A 2GZHA 2W6IA 4RD0A 2GK6A 1S1CA 2H1LA 5EXPA 2G0NA 4TMZA 4POAA 4HZUB 1G7CA 1EWQA 2ZYWX 2R65A 3QF7A 4PHTA 1FQKA 4PC1A 3EZFA 4TMVA 4A1FA 4DCTA 2OT3B 2VHQA 1VYVA 4OQLA 2ZXUA 3L0IB 4TLBA 3WNBA 5CYOA 3IBYA 1ZM4A 4TTPA 3UMRA 3R20A 4A82A 4BFSA 3VR1A 3D6TB 2EYUA 4OJQA 3I5YA 1YZGA 4OHYA 2QP4A 3I4LA 1UKZA 3K09C 5FTLA 2HF8A 3SI7A 1ZU5A 5J47A 1NVWQ 2OV2A 3S1AB 3VHXA 3AVWA 2WICA 4GMDA 3TR0A 3SFVA 4KFSA 2JJ1A 3QI2A 4OK5A 2VP9A 3TK1A 5CM8B 1OV4A 1OHHA 4AKHA 4HYYA 5KSPA 4YMUA 4OL0A 2FOLA 2PX0A 1XPRA 2JLSA 4DZZA 2QMEA 5H8WA 4IHQA 1IN5A 4L4UA 4B43A 1DELA 1RZ3A 2I1QA 1HYQA 4LCBA 4PXAA 2AXPA 1P5ZB 2IBMA 3AVPA 1W2GA 1Q21A 2B92A 3RDPA 3IIKA 1GKYA 1YHNA 2XOKD 2RGNA 2XTMA 4UKDA 1KK1A 2V1UA 1Y3AA 3WP0A 3A4MA 3CNOA 3AGPA 1YZUA 1RJ9A 3LBHA 2BM0A 2A3RA 3TRFA 4BASA 2HXYA 1KTVA 5LPNA 2FMXA 2ZJ5A 1W5TA 4JVMA 2G6BA 1W46A 3I92A 4JJZA 2QMUA 4NCJA 3KL4A 4AD8A 1MT0A 4DCUA 2Z43A 3TLXA 1KO8A 1TQ6A 2ODEA 4WXPA 4EIWA 1GNPA 2C5LA 4TMWA 3UK6A 3GD7A 3B9PA 3IDQA 3SBEA 5TXGA 2IT1A 1G8FA 1P4SA 4AK9A 1Z08A 1EFTA 1MV5A 2IYRA 2N1BA 4JLDA 5HKKA 5JHGB 1CEEA 2G1JA 3M4YA 4ARZA 1PV4A 1TF2A 3F3YA 3NDBB 1G19A 4Q1DA 221PA 3V00A 3QF4A 1R5OA 3W6OA 4AG6A 1I4LD 3GEHA 1KZ7B 2CK3A 2I3BA 3SU8A 3U7FB 5JJLA 1J70A 1XJCA 3HPRA 1SULA 1J7KA 3UANA 4EPWA 5JS8A 2P6UA 4W5WA 2QBYB 1JXOA 1NI3A 1OXXK 2G9NA 3DDCA 4GL2A 2MMGA 3PUVA 3MLEA 4JSTA 5FPHA 1D8TA 4M4SA 4M0LA 1AA9A 4PTLA 4TYQA 3SJCA 4CEJB 1SZPA 3ND9A 2IYSA 1BYUA 4M9QA 3K0CA 5FOXA 3LAWA 1E0SA 1KI2A 1CJMA 4P31A 1TU3A 2F9LA 1G6OA 3SQXA 2REOA 4HAVA 4LHWA 4C7OA 1Z29A 1WMSA 4I81A 4JKIA 4BZQA 5FOWA 2HCJB 1IY1A 3EARA 4YXWD 4Z1MD 4B6FA 1CJKC 1KZGB 1OPXA 2FF7A 2FU5C 3NHAA 3OFND 4P3YA 4RCYA 1N6KA 3D8BA 1R6BX 4DEYA 2PZGA 4JL5A 1XF9A 5FOTA 4UXHA 5JWRA 4M1SA 2RGBA 3DZDA 1WP9A 1E98A 3GJ7A 3DL0A 4TN1A 1E6CA 2WWGA 3CR8A 1NN3A 1SXJA 3KQUA 2Q6TA 3GJ8A 3ADBA 2W2TA 3WMFA 4LPKA 2JJ2A 1T6NA 2F1RA 1S0UA 2CJWA 1P3JA 1ZC3A 3K9GA 2RGNC 4UNSA 2WKPA 3BE4A 1Q1ZA 3PEVA 4TYNA 5CJ2A 2NO9A 4ZV4A 2DHRA 1NG1A 1N6LA 5FTMA 1KJZA 4A0HA 2ODNA 4DWJA 3WYGA 4MKIA 2ZSAA 5FUVA 3ZIAA 3WMEA 3K0SA 4URVR 2GJKA 4TMTA 2F6RA 5HCNA 1NL3A 1U8ZA 1JR3A 3QKUA 5DYIA 2VHUA 1T8UA 3E5HA 3CWZA 3W8RA 1GL9B 1E2HA 2OAP1 3A1UA 3CRW1 1JQJC 2PMKA 4PQFA 4BFZA 4DB2A 3RHFA 3KUCA 3RWOA 3ZJYA 4GOXA 4GBMA 1CJVC 2J59A 2J1LA 1XCGB 2W83A 1NKTA 4PPFA 4D0NA 1MH1A 3W3ZB 2CCJA 1RJ9B 3P20A 2QE7D 4Q1FA 1FMJA 5KNDA 4Z8YA 2KJQA 2WMOB 1QF9A 4UNNA 3K0AA 4NMMA 1N2CE 2W6JA 1NJFA 1XXHA 3IQWA 3LH5A 3QUSA 1Z6GA 5JCPA 2NMVA 1R0WA 3H1TA 4FCWA 4MGZR 1V5WA 1G7RA 4MKGA 4EPXA 2Z4RA 2BVNA 4QGGA 4PAQA 3X1ZA 3IPXA 5M04A 1G5RA 2NTYC 2ZI9A 2AN9A 3IILA 4ZPXA 5AJXA 3RS4A 1G3UA 3JZMA 4MKHA 4BFXA 4LV6A 3KB1A 2G0TA 4QHTA 4BPBA 3SEAA 4QRHA 2YOHA 2ZETA 1E9AA 2WWYA 4FIDA 1E2IA 3K0CC 3Q7PA 2WJIA 1N6RA 5CK5A 4Y0AA 4KITB 3UMSA 4KLZA 1OIVA 5CK4A 2QTVB 4O0MA 4D0GA 3T5GA 3GLIA 2CHGA 3QF4B 2RAPA 3ECCA 4D4MA 4LPSA 3TE6A 2V7QA 3C14C 1TUEA 1T3HA 2ZREA 4F4CA 3LX5A 3SE0A 1F60A 3CH4B 4AYWA 4BQSA 4GOKA 4JJKA 1JALA 3THOA 3PEWA 4LBWA 1GVNB 4LHVA 4CDGA 2PT7A 4BEBA 3QXHA 4LDJA 3LRPA 4ZCLA 3B9QA 3CUEF 3PFIA 5KYKA 5H70A 2ZROA 2JAQA 4DIDA 1HH4A 3CF6R 1SXJC 2CVFA 1ZD9A 2EVWX 3W6NA 1XD8A 4R71A 4G3XA 4FI3C 2HYDA 1Z0AA 4C7OB 1FTNA 2AL7A 2J0SA 3P1JA 2D74A 1XD2A 3K70D 1VKJA 1DS6A 1M7GA 5TY0A 5A5GA 4M1YA 4MA4A 3I61A 1T3LA 3LBNA 5SZHB 4AURA 3GLGE 2J45A 1G18A 3CNLA 4PC3A 3SZRA 4MDEA 1W44A 2HEIA 1IHUA 3LQQA 4DHEA 5CB8A 1ZINA 3RSOA 3ZZUA 1COWD 1DO0A 3BC1A 2PEYA 4NU0A 4W5JA 2PJZA 1ZIPA 1SXJB 3VTKA 4HAUA 3NVAA 4DLTA 1XPOA 1ZCBA 4S35A 3MGCA 1AGPA 5HR5A 3L0PA 4XSGA 1G3MA 4MITA 5JRJA 4RD4A 2QRZA 5SZKB 2CLDX 3ND8A 1J8YF 5P21A 2WJJA 1QHHA 4JBYA 3FKQA 2XZOA 4MRVA 3W5JA 3R9XA 2REBA 5FL3A 1ZW6A 3DOFA 4ZI2A 2O0KA 1S9HA 1W36C 5GJCA 2NGRA 5FPSA 5BQ5A 4E07A 3RRYA 1NJGA 4PSAA 2OEPA 3AF2A 3TVDA 3T1QA 5IT5A 3VFDA 4AYTA 5JJIA 3D7MA 3THYA 1E2FA 1SVMA 2A5JA 4MUAA 2PT5A 3LBIA 1EX7A 1E9BA 1P2UA 3PIRA 5DHFA 3X1YA 1A1VA 3TIFA 5F9FA 3RS7A 1MRNA 4AIIA 5TV2A 1UBGA 2OFOA 5L3QA 5EUQB 1RE0A 1II0A 3CO5A 3FMPB 1ZAKA 4LBVA 3CRMA 2Z4SA 5KDLA 1PUIA 2IUUA 4EUNA 3GJ3A 3EC2A 2YHSA 1VHTA 4FMCF 4PO1A 1E0KA 2Y8EA 1W36B 4AKGA 2VIIA 3K0AB 4DRZA 5CIWA 5JBQA 3THXA 4LGMA 2IS4A 1CULC 1WDTA 1R0XA 5F3WB 1W4CA 2Z6VA 4G5OA 1XTKA 3TAHA 2F3RA 2OAQ1 3VX3A 4E22A 4C0QC 3RRMA 2GF9A 3UPUA 2F55A 4BZXA 2VL7A 2ZTSA 1EG7A 1E2KA 1AJEA 1AKYA 3DO6A 3PG5A 4ON9A 1PVOA 1W2HA 4C0KA 4PANA 1P62B 3MAAC 2ZRCA 1X1RA 4DLSA 4ACAA 4HSEA 3UIEA 4TZ0A 3LFUA 1H65A 3AH8A 2B21A 3EASA 4DVGA 2XXAA 4DLYA 1OSNA 1R5NA 2YOGA 4FINA 2QT0A 4Q9JA 1FL9A 4BFWA 1JAIA 3A6PC 2XOKA 3ZVMA 2V6JA 1XMJA 2ZRPA 4G5RA 4IOLA 5E4FA 2F43A 4R7ZA 3TSZA 5L3RA 5KO2A 3BFXA 3NIBA 2QRNA 1IJEA 1GZSA 3HR7A 4WBSA 4Q9KA 4A6PA 3EWAA 3DM9B 4DCVA 5EQTA 2WPDD 2C8VA 3O8CA 3P32A 5KPDA 2JLZA 3GLHE 4IEIA 1E2NA 1KJYA 2CNWD 2O8FA 4OBEA 4CW7A 3GJXC 4YC7A 2E87A 4MQBA 1NVVR 3VR2A 4LYFA 1X8JA 3AVQA 3SYLA 1DAGA 4LJAA 5L3SA 3U4QA 2XSZA 2FDCA 1FW6A 5SZJA 4FMDF 1XD2B 4NCIA 4L9SA 3MWLA 3UG7A 4RFVA 3QXCA 1JECA 1UEIA 3PITA 2XTZA 3TBKA 1X3SA 3IEVA 1GRRA 1Z5ZA 4D2IA 1S3SA 3ASZA 2BOVA 1QRAA 4KV9A 2LKDA 2X19A 4RVCA 2FFAA 2AFHE 4DLRA 1OLOA 1P9RA 3AVYA 1JR6A 1SKQA 3ETLA 4H1VA 2YVUA 3IPYA 3FYHA 1DAEA 2PX3A 5DGXA 2BKEA 4W5HA 3OAAD 1TF5A 2D7DA 1TMKA 1FUUA 2RHMA 4BZPA 1GL6A 1OH6A 1DG3A 4G5GA 3OHMA 3ZS8A 4Q9LA 1SVWA 2QTHA 1E2EA 1UBCA 2GRJA 1QHHB 2ZR0A 5C18A 3AB3A 1Z0IA 2L0XA 2ODWA 5HPYB 1KI1A 1T0JB 1GAJA 1SKYB 3BGWA 4RKEA 4A0RA 1WB9A 2IEZA 4GFDA 4TL9A 5ELXA 1NVVQ 5E3HA 1L4YA 3AKYA 3W6PA 1KO7A 4V0NA 4YXWA 3THYB 1E0AA 5EE3A 4R9UC 4HB0A 1BKDR 4Z1MA 3CNNA 4UNRA 3OFNA 3NBZC 4TYWA 5EZ6B 2D2FA 2IW3A 1LS6A 1T8TA 2OBLA 4B2PA 5BW8A 5KOYA 4IXMA 1ZCAA 2P0EA 4EPYA 3GJ5A 1GSIA 4NCKA 1YQTA 5DNYB 2R6GA 1S4QA 4GRAA 3D3QA 1MO4A 3AVUA 1QZXA 4A2PA 1KY3A 1KO5A 5EE0A 4PC2A 2FFBA 1W47A 3THXB 4YDHB 5IRCD 3GLFA 3SJZA 3AVVA 1D5CA 2H17A 1U0JA 4KVAA 3K8YA 1AM4D 2O8DA 3T06B 1OFUX 2DFTA 4PZYA 4PX9A 4GSYA 4TWZA 4PZZA 1U81A 1Z2CA 5C4GB 1XCMA 1JB1A 3AP2A 3U61B 2OXCA 1NIJA 2QZ4A 3SDZA 2O5VA 1S9DA 1VCOA 2GAOA 5EUMA 1N5JA 3LLMA 1M7BA 2PLFA 3MD0A 1OH8A 2XNDA 1H8ED 2OESA 3PEUA 4HB2A 4CVNA 2XXAB 3CRQA 2WSMA 5FPYA 1R10A 2QAGA 4EDHA 1FFHA 2GCOA 4FMCB 5IK2D 1N6HA 2IX3A 1TQDA 1GNRA 1P73A 3ADDA 2F43B 4LOAA 4X8MA 5KU1A 3CONA 1KI8A 2DCUA 4RD1A 1MR3F 1RC8A 5DI3A 4TZ6A 1OJLA 3J81k 4V0KA 3CM0A 4XTRA 2WWHA 5KSZA 3H84A 1A82A 1CKEA 2A2ZA 4IW3B 1E99A 2GEDA 3NBYC 2WV9A 5CYPA 4E09A 1LV7A 2BKUA 2O8FB 2VF8A 4TT3D 3VKWA 1NLZA 4NYJR 4ASUD 1CR1A 1OYWA 1XMIA 4IKEA 4KSBA 4HAXA 5BN4A 2HUPA 1K8RA 3H2YA 3QG1A 2WAYA 3W34A 5JZVA 1NSFA 3C15C 2PL3A 3Q9LA 2VH5R 4TL7A 3U4QB 2CHVA 1QHIA 2QM8A 3T1OA 4D4KA 1M34E 2GAAA 1OW3B 1R7RA 3T15A 4X8OA 3EZ2A 3WNDA 1L7VC 2GETA 1E0JA 3FKSD 3IO5A 2ZRKA 5FR1A 4B3XA 4EPTA 3NG1A 3THWA 4DT1B 1T5LA 3DVLA 2QQ0A 2FX3A 3MWJA 1AKEA 1ZD1A 3CH5A 3KB2A 1ONBA 3TQCA 4OI0A 2ZYVX 3SBDA 3QEOA 4DCNA 5JSZA 2VLIA 2AFIE 3C7KA 3GMTA 3AUXA 2J46A 4I1OA 1E9FA 4IVQA 2W2VA 3K0EA 4Q7KA 3EC1A 1Z0FA 5AUNB 1SVLA 1FZQA 3GFOA 1Q57A 1FUKA 2AWNA 3TVTA 4XTCS 4R2HA 3RAPR 1QHNA 4W9MC 4CEHA 2C9OA 2CL6X 2ZUBA 1CR2A 4FMDB 3K9HA 4B34A 2BJWA 2IYUA 3SQWA 5B30A 1RPZA 2DR3A 3B1VA 2EYQA 3DHWC 3VR6A 3UKDA 3B1XA 4XWKA 2DWOA 1NG9A 1AQUA 2B8WA 3PQCA 4MRPA 1FQJA 5KPJA 3I5XA 4QJ3A 1E2DA 1OXSC 3FWYA 1ZVQA 2ZUDA 2ZJ2A 3HU1A 3IKJA 2VO1A 3NDPA 1E1RD 5FH9A 2PEZA 2IF2A 4X8LA 4FN5A 1RFLA 4IXNA 5JCZA 1N5LA 1YE8A 2D4HA 4Q4HA 2CLSA 4GT1A 4LJ9A 1COWA 5EXXA 2C77A 1XDBA 4JT4A 4LV8B 2QAGC 1QVRA 4OQNA 4C30A 2QMOA 2IC5A 1KJWA 2NG1A 5A0FA 2DY1A 2Q9BA 3GLFB 2G77B 1TPZA 1Q1EA 3NBXX 4D26A 2HDNB 2O8DB 2F1HA 2FSIA 1ODFA 1IN4A 4UJ5A 4PR0A 2Q3HA 1KDOA 1XMSA 2J41A 4XWOA 2GDJA 3FGNA 4BEJA 3EZ7A 2ZI6A 4LYHA 4Q1BA 1SVOA 4B74A 4CT5A 1DG1G 1UJ2A 3QEJA 3Q72A 4NKRA 2J7PA 2C2HA 1ELOA 4RZUA 4TSFD 4WAUA 4B35A 3FOZA 3NEJA 1XTQA 1E2JA 4LHZA 2UKDA 1VYUA 1DAFA 1VDZA 2GBLA 1KKLA 2QPAA 2QAGB 3MRSA 4XWAA 4A8JA 2NO0A 2X8AA 2GCOB 4Q21A 2R6DA 3LX8A 1W1WA 3ZYCA 4UXJA 3QENA 4IEEA 4B73A 3F0TA 4RZXA 5DI3B 4F38A 2ZEJA 1U8YA 2W58A 2HXSA 2ZE5A 3WHLA 2J87A 4Q18A 3G0HA 4MKFA 2FV8A 4DDVA 3FHTA 3RS3A 1ZM9A 2OO7A 1XEWY 1ESNA 2ZJZA 1YZLA 1EFRA 2QI9C 2BDTA 4OKSA 2PZEA 1E9EA 2DBYA 2OCBA 4B32A 3X1XA 5JWOA 3OEED 1U9IA 3U5ZB 4MGIR 1NVUQ 4ITRC 5FOUA 5J40A 3P4XA 1P9WA 2PLRA 4NZYA 2GXAA 4KO8A 2V4ZA 4FW9A 1T91A 4OHZA 3CLVA 4QHSA 4C0BA 2VPPA 1KI3A 3THWB 1UF9A 4EFLA 3PUXA 1UBEA 3R8FA 1KK0A 4GZMA 3U60B 3LO5A 4P4SA 4XIGS 2R6FA 4Q7LA 5G40A 4LHXA 1R0ZA 4BE7B 5JSZB 2PBRA 1KAOA 3ZZTA 3OEHD 3RC3A 1OFHA 4KCGA 3AVOA 5DISB 6Q21A 2HLDD 4PSVA 1QDEA 1UDXA 2QROA 5JLJA 4PHFA 2BMFA 4I4LA 1BIFA 2CNWA 2WHXA 3EA0A 4CEHB 4Q9HA 4UNQA 4W7SA 2A5FA 2GA8A 1G1MA 2JGNA 4LZZA 3QKSB 3T5DA 3FFAA 4LI0A 1TEVA 2VP4A 4JLMA 3R9WA 2FPKA 2RGCA 2YNMA 2IUTA 3SJAA 1P2SA 2IL1A 1G8GA 1KO1A 4TQ9A 4Q4AA 5FBLB 3A8TA 5G53C 2CBZA 3AVXA 1XNJA 5FUWA 2BMDA 3TNFA 2IYLD 1YVDA 3NBFA 2HCBA 4Q4HB 4XVQA 4F4IA 2H8KA 3QQ5A 2QEQA 4A0FA 1S3GA 4M1KA 1A2KC 1XU4A 2HF9A 3U3OA 3BWDD 2X1VA 4OHWA 1R0YA 5L3VA 2ZRIA 3B1YA 5JJKA 1IN6A 1G7SA 1M8PA 2YWEA 2GBLC 2QA5A 4JBXA 2FEOA 3MSXA 4A8JC 2GVDC 2VA8A 1VG0B 4B76A 2XJ9A 4I1SA 4KBGA 4OK6A 2FG5A 3B1ZA 2CCKA 2XZPA 4QL3A 1Z0JA 5AK0A 3KTAA 3QXXA 2QAJA 3GLGA 1SHKA 4LHYA 1G41A 4Y0VA 3AF0A 1CTQA 3IUYA 5BN3A 2V55B 3N70A 3KFVA 4BLRA 1TU4A 4D81A 1LFDB 1SGWA 2H18A 4LBYA 2R8RA 1GWNA 3K0FA 5HE8A 1S1MA 1CIPA 3NKVA 3EZ9A 1ZUIA 3X1DA 4RFSA 4A8JB 1U9IC 1RYFA 3B13B 5AUOB 4Q19A 4Z54A 4HATA 5HZKA 1Z6TA 1ZNYA 2EWVA 2ASEA 3E70C 1VG9B 2JLWA 1N6IA 1HQCA 1NVXQ 2O8BA 1J8MF 4K46A 3ZVNA 4V0ME 4O2LA 4ABYA 3BFKA 1P60A 1VG1A 3PVSA 5EE1A 3IHLA 4PAOA 3OE7D 4RCZA 2OFWA 2H7VA 2X77A 2ZR7A 5CB6A 2IUSA 1JXMA 4GP7A 4M1MA 1JBKA 1Z63A 2VP6A 4AKIA 4KODA 4MRRA 2ZS7A 1R2QA 3BFVA 4E03A 4LJ6A 2QL6A 1X8KA 2PCJA 1XJQA 4M1OA 3RLFA 3ZZ0A 1OH5A 2A7QA 3LWNA 3U3KA 4C4PA 3B6EA 4EJSA 1H8EA 3CPEA 2G1KA 2KWIA 2PH1A 2P6RA 2WAXA 4XOIA 2KSQA 2VP5A 2Z5FA 5DO9A 1KK3A 4O3MA 1CJUC 1TADA 1MO6A 4OK3A 4P4SB 1YZQA 2ANBA 2CCGA 4JL6A 4WIAA 1WBDA 1MABA 2ZI5A 1BS1A 4NP6A 2ZE8A 5B64A 2MSCB 3W9YA 5JHHB 1VMAA 2F3TA 4V03A 1IOZA 4ERNA 4A0GA 3O8DA 4HEJA 3NH9A 3U7EB 3BXZA 4I99A 3NC1C 2CXXA 2NPIA 2B7BA 2UVQA 4CEIA 2FZLA 2TMKA 3RS0A 4TT3A 1OF1A 2A5DA 2OSBA 3T12A 2E1RA 4KYUA 5FPTA 4AY2A 1G21E 3A58B 5FBVB 2JEOA 2AD5A 2Q3MA 3RC8A 2GWHA 4IDPA 3RRZA 3WRXC 3C41J 4IJMA 5DSZA 1TNDA 4WVFA 4DIEA 1KSHA 2IYQA 3FKSA 2QT1A 5BYKA 1XZQA 4Q4AB 4UNPA 4OQFA 1G8PA 1XEFA 4Z51A 4ARZB 4QM7A 3GLHA 3P27A 3U6BA 1TUIA 3HDTA 2G83A 3TJZA 4N0EA 3KQNA 1E79D 1B0UA 2W00A 3QPWA 4N1AA 1WA5A 1CRPA 3CIOA 3GCGA 2FFHA 5GJVC 2ZJYA 2QM7A 3SHFA 3VX4A 3REFA 4YMWA 1MO3A 3N5CA 1OB5A 1CXZA 4L16A 3QSYA 2IYVA 1IY2A 1NLFA 3NTUA 1GP2A 2ZR9A 3LQRA 4DSOA 2V9PA 2DPXA 4FWTA 1F5NA 3GLGB 1ZJ6A 4ZKEA 4HLQB 1JQLB 4M22A 2QGZA 1EESA 5E7JA 2ERYA 1KI6A 2X2FA 8OHMA 4Q00A 4YMSA 1Z07A 3K9LA 3AP1A 3P4YA 1N3BA 4PO9A 2WWXA 2ZUCA 2ZSBA 4LYAA 2JLVA 3QNUA 3SYNA 1GL7A 2LCFA 4B47A 3SR0A 2GNOA 4ZI3A 2REXB 4Q9IA 4CYMA 3QE0A 4ACBA 1Z06A 3KJHA 1WRBA 2OCYC 3K0FB 1GDDA 5JRZA 4DSTA 1XX6A 1E1RA 2GKSA 2AHOA 3QXJA 1R4AA 1Q3TA 3HYRA 5DN6D 2RGDA 4TLAA 4RFSB 2D2EA 4RD3A 5E7MA 1N5IA 3ICEA 2NZJA 2BBOA 2ZRDA 3M1IA 2O8EA 2ZVQX 2XAUA 2VHTA 2BJVA 4JVLA 2RKOA 4CT4B 4EJSC 1TQ4A 2ZVPX 1TL7C 2WWWA 1HV8A 4OQMA 3VHLB 1ZNWA 2ZYUX 3NEYA 4DCSA 4P0TA 5GJWC 3PUWA 1XP8A 2OZEA 3OZXA 1NNEA 3PEYA 2CJWB 2FSFA 5L8VA 1P6XA 1NN5A 5EE9A 2AD1A 2ORVA 4DLUA 2IYXA 1Z47A 1NIPA 1SQ5A 2BM1A 3I3SR 1BYIA 1G5PA 4Q7JB 2F1JA 3T61A 4A92A 4FCTA 4F4JA 2B7CA 2NIPA 3A4NA 1XCPA 4D4JA 4E5UA 3U6KA 3L82B 1II8A 1KOFA 3UWKA 5B57C 4KYIB 4EQ6A 1VG8A 2YWGA 4DDWA 1OE0A 3CB4A 4LX0A 3I62A 3KKPA 4EJSB 1EFCA 4TSFA 3CRVA 4B71A 4HAZA 2EFDB 1T4GA 2ZJOA 4TL8A 2ZRBA 2YWHA 3IGFA 3TUZC 3RYTC 3B85A 1N0WA 4DJTA 3EPJA 5K8IA 4C9BA 1C1YA 1MABB 3LW8A 4BWYA 2Z0MA 1XRJA 2HT6A 2VBCA 3FMIA 3I72A 3RRNA 3MMPA 2ZI4A 1NP6A 3SNHA 4DB4A 1M2OB 1IN8A 3LY5A 1CP2A 2G3YA 2CDNA 4LY6A 5A4JA 3QOFA 3NC0C 1X8LA 1OKKD 1XTSA 2ATXA 4II7A 1N25A 1XXHB 4HI0E 2AK3A 2R9VA 1NMZA 1RRPA 2AXNA 1KAGA 2X2EA 3EWSA 1U90A 4MDFA 4CEIB 1TEXA 2DFNA 5J4LA 4LJYA 2PMDA 3C16C 4QXAA 2ORIA 4OHVA 4BLPA 1Q20A 2JJ8A 1MKYA 3REGA 2DWQA 4TYPA 1BH2A 3OEEA 2WJHA 4KBFA 4ZDWA 3QPVA 3VR5A 1II9A 1EXMA 4MYHA 3EXAA 2EFHB 1OFIA 2V6IA 1OXTA 4HAYA 4WZ6A 1JR3E 4A2QA 2N46A 4JKYA 2WJVA 4AWXA 3C5HA 4WW0A 2HJGA 2GESA 4QJ5A 2FSGA 3L8YA 3GLIB 5HZHA 1TAGA 1AK2A 1IXZA 1RRFA 4LC0A 1FP7A 4Q4JA 2V8OA 1WE2A 3W3AA 1NMXA 2GXSA 4BUJA 1NY6A 2YV5A 3O8BA 2QP9X 1U98A 2FNAA 1OFTA 2JJ1D 4I1VA 1DAMA 3AV0B 4U5XA 2YZ2A 3LVRE 3OEHA 4YQFA 2H57A 4XH9B 4JVSB 5TDHA 1TX4B 4A4DA 1U99A 3UG6A 4KJZA 1LY1A 1U2RA 2C03A 5J4KA 3KX2A 3EX7C 3QXSA 2BV3A 5CDFE 2XEXA 1BOFA 3OESA 1KI6B 3Q5DA 2OCPA 3VQTA 3VR3A 2ZAOA 1S96A 1LVGA 4KAXA 3ADCA 3SC3A 1SVSA 2PCLA 3FPAA 2QGNA 4WZBE 1W0JD 4L8GA 2WTUA 3AM1A 3FE2A 1DVRA 3NHBA 1KIMA 1F2UA 2ZITA 4N3NA 4XD7D 2BMJA 2H5EA 1HT1E 3BOSA 4DXAA 1E94E 4JLBA 2KB0A 5GVSA 2O8EB 4DKXA 4QM6A 1R5BA 5FL7D 3K9NA 5JS7A 3V4RA 5EZ5A 1G17A 4M9ZA 2JLQA 2FE4A 4M1WA 1IAQA 3SJBA 3A36A 2FGKA 5LB4A 1D9ZA 3WP1B 2XGJA 2CE7A 1N0VC 2WVJA 1EWRA 2RHDA 3TGPA 4ILEA 5HKKD 3IHWA 1A2BA 1ZNZA 4YMTA 5C2JB 3ADKA 1UPTA 5CLQA 1L4UA 1KSJA 4HAWA 4C0AC 3GP8A 3SN6A 1W7AA 1QHYA 5IDVA 3ZH9B 2GHIA 4B44A 4EQ6B 4PHGA 1GRNA 3KDSE 4K8OA 4PQRA 2IWHA 5FOVA 4PFSA 1GM5A 4B2LA 1G3QA 1VHLA 3CRRA 4PSKA 5FR2A 2ZE7A 2FPLA 3Q85A 4MYTA 3Q8XB 4JYBA 1AGRA 5LDDC 4DDUA 4EAQA 3BAFA 4DC9A 5L3QB 5KDDA 1NBME 4DUGD 1ZMXA 1DADA 3KKNA 4JLOA 3DMDA 5AJWA 2ZRAA 1D2NA 2WIAA 1CLUA 5TMPA 3CPJB 4QNMA 2FZ4A 1W49A 2IYZA 5EXSA 3KQKA 4OYHA 1QG2A 1EFUA 1Z6YA 4KSCA 5CIQA 4O25A 2WIBA 4JYCA
chains in the Genus database with same CATH superfamily
2PSHA 1HE8B 3VAAA 1JEYA 4AS1A 4LQLA 1IN1A 3BXFA 2YUTA 1V1RB 4CL3A 4Y7DA 1WD5A 3AEUA 1SAYA 1I2MA 1T5IA 4YT8A 2H2DA 2H9AA 1N6NA 3AZQA 3BTSA 3A4TA 2VSFA 3MT9A 1PSWA 2VXBA 1CZRA 2ZRGA 5FQNA 4FBLA 1ISSA 3KFLA 3LIPA 3QE9Y 3EDRA 5J2UA 2AKEA 5BSKA 1XR3A 1G6HA 1YJXA 1YH3A 3WLMA 3FN4A 1YZKA 1Z37A 2OHOA 2WF5A 4GM0A 5CLGA 3TUIC 3R0JA 3W5IA 1I2AA 5JNRA 1LQUA 2V5VA 4LJ4A 4KLNA 1NDHA 4X1IA 1Y5MA 1OBFO 3GMDA 3HXTA 3JCZA 4TMYA 1BZYA 3LO8A 4JBWA 1Z34A 3SSOA 3ZI4A 5BN5A 5T3UA 4KE8A 2I65A 3TEMA 1L7NA 2XA2A 4NV1A 1ZI6A 3OJWA 3AETA 2NO7A 4GE0A 3SD7A 1W4RA 2P5TB 2IYTA 4E3WA 2VZLA 1ZQ1A 5CFNA 4X94A 3ZU5A 1QLJA 1VLQA 4KI0A 2D54A 3T5BA 4RAOA 1J2JA 5DNDA 4X62B 1Y8ZA 1I3CA 3A2MA 3DEIA 1HO3A 3LPCA 4X7PA 4MQMA 1S8AA 4Z5XA 3QV2A 5DFAA 3DVAB 3Q1KA 3O3MB 1EGHA 4TS1A 4ZZ3A 2ZBVA 2UXCB 5L8VA 2GCIA 4HZUA 4D8YA 1ENYA 1XCOA 4KOAA 5JLAA 2BI7A 2RGAA 3ZWMA 3HJRA 1ZC4A 4LBZA 4PRKA 1VIAA 3ZE7A 2GN1A 4HZIA 2SHKA 4G8JA 4DJDC 4J3NA 1UFQA 3DE5X 4HXYA 4JT9A 3ZVLA 2R86A 5C32A 2Z3ZA 4I4CA 4L0DA 3DEHA 4AYXA 1UXHA 1PWEA 1C41A 2IHYA 3A14A 2XMRA 4UDNA 3E9RA 3HR8A 5IULC 1KQOA 4JDUA 5J2TA 3IODA 5DRYA 2OENG 4RULA 4J2TA 1LQ2A 3EXHC 1EHIA 1DE0A 2XNSA 1HT2E 1BWPA 1O57A 2H51A 3OQIA 5KQSA 2ZYDA 5M34A 4YUZA 5CGQB 1MOQA 2UYQA 3ESYA 3UPDA 1CJBA 10MHA 1M6VA 4NJEB 3UUGA 4AMYA 3ZQUA 3BK7A 2WFAA 1V8DA 2IYEA 3G8DA 2QRGA 3WLKX 5GADl 2PD3A 1O0SA 1ECPA 2QVGA 3IBCA 3LXXA 4RCVA 1PZEA 4H2DA 3UNXA 5KJFA 3EIHA 1YBHA 3N5KA 3OPYI 1B8OA 3JQAA 3FYTA 2ZJ8A 1LRKA 2HHHB 1GKLA 4PYOA 4RZQA 3BBPA 2VSNA 4B4WA 2O5RA 2W0SA 4BWGA 2YWCA 3ZY4A 1WOMA 2FPRA 4PHHA 1V7ZA 3K3PA 2QUHA 3ACBA 1A9XB 4K03A 1P31A 2C5HA 2Q3FA 3LP5A 3EXHB 4BU0A 2JEZA 1F3OA 1YR7A 5BW6B 2WM9B 1M6NA 4FHFA 2AUTA 1EE9A 2X5KO 4O4JB 3OX4A 4FT2A 2XEDA 2VS1A 1ZZGA 3NJRA 4F4UA 1QHGA 2GXUA 3B36A 3EOZA 4QATA 4IIYA 5TB5A 3A1CA 3L4BA 2QU7A 4OUDA 4HLUA 3UJ3X 1U7XA 2OE2A 4IF4A 5J5CA 4DZRA 4IZHA 4FEAA 1ZIYA 1NATA 2ORED 5IJZA 4L5BA 4TV8A 2CMDA 1B8VA 2RG7A 3VPDA 1JKMA 2IX9A 1E4EA 2O3TA 2XCQA 1NUSA 3IXQA 4X95A 2DQSA 2HHAA 5KYUA 3FCAA 1PR2A 2H5JA 2WYOA 1YRAA 4EHKA 3P9CA 1NSYA 3HKEB 3ZHQA 4BMDA 4LF9B 5JJLA 2Y0PA 3D7KA 2Z58A 1VGVA 3QK7A 5EMKA 5F1YA 3STVA 4DA0A 1B23P 5BWMA 1SBCA 1KA9H 4HWSA 5CTJA 1OZAA 1KRHA 1QR6A 1Y9JA 4AJEA 4B40A 4YAFA 4CU5A 4I5DA 5AJVB 5EP4A 3P9RA 4Z0TA 3EJ6A 4US0R 2I78A 1VYHA 2IYPA 3CX6A 3PKIA 4B83A 1Z0SA 4ZOCA 5K0ZA 3AF1A 1UMBA 3R7NA 4P84A 3D6VA 1CS4C 4AWBA 5GZ6A 3VI4B 3QGMA 4FEYA 3UATA 4BMOB 1P61B 4DJAA 2A5LA 3SHQA 1QIDA 3F9RA 1CNMA 5F33A 3SQOA 4Z4CA 1RXUA 3PUKA 1ISPA 3DV0A 1EJ2A 4JZYA 2B4KA 4RY2A 2XR1A 3R0XA 1A2QA 2FPGB 2QU8A 4DTIA 1M2KA 2B30A 2VF2A 2PM8A 3LVQE 4M9CA 4PG6A 3BMXA 2VUSA 4PQEA 1JQ3A 3I1IA 5EFOA 1SU8A 3DEZA 4KXNA 3PL1A 3A3KA 2HU8A 5NLLA 2ONKA 2X0EA 1XZLA 2G9RA 2WEKA 4RLHA 5GPBA 1T0HB 4I1RA 1M6WA 3FRIA 2H4ZA 3EY9A 4C7MA 2W22A 5EHXA 3U44B 1CUDA 5GJBA 3DE1X 2ZIVB 2XV1A 2EJUA 5K3OA 4GL4A 1SHLA 1UBTS 1XB2A 2QSJA 3DL2A 4XWTA 3KHSA 4D5EA 1IM2A 3IHTA 4WERA 3GLFE 1O6FA 4I7EA 1PL0A 5I7AA 1RAIA 3SYKA 3EIFA 5IHPA 3I6QA 4K0KB 4EI9A 1NRJB 1U04A 5K0EA 1NYRA 2E89A 1IRXA 4OXKA 1BJRE 2LUOA 4X1KB 2XUPA 1ZM3A 3R3VA 3WB2A 4RABA 3WAGA 4EG7A 1NI4B 3ACDA 1XZIA 4RZHA 3IA7A 5FI1B 1EE2A 1ZP6A 2VBIA 5DCWA 2YIVX 3N2GA 3C3CA 3DFZA 4MJXA 4MGYR 3GN1A 2IYNA 2HA5A 1F4VA 1HUQA 5H3LA 4FZVA 1O97C 1E7YA 4HDNA 3RRJA 1ODIA 2OUKA 2VHXA 3EZ6A 3NXKA 4MUHA 1FQOA 4M76B 5TS3A 4A9AA 4OX9Y 1IZYA 1JHVA 1F8XA 4PRLA 3FVVA 4R8RA 2JFNA 3FCYA 3P97A 4PFJA 2OVBA 2WM2A 3BL8A 2LXNA 4BZZA 1MC5A 4UM7A 4EG8A 2C04A 5DW3A 5BNFA 3K70C 1QNFA 3JYQA 4HWOA 4A5SA 4DIOA 1XZ8A 4M38A 1U5BA 1DEHA 5EQJB 3WGTA 4B3JA 4EB8A 2RGXA 5CD1A 2XA1A 1VDMA 3L7NA 1X14A 3AG6A 1Q1QA 2W6OA 3PUZA 3EXFB 3KDPA 4H35A 4LVOA 4AXXA 5KVAA 1ZYUA 2R8OA 4LRQA 1FSGA 1N32B 3L8ZA 1N9KA 3LCUA 4R84A 4TXMA 3B6JA 4IQ4A 4MW9A 1PGQA 4TRMA 3ZHBA 4K9SA 4BCBA 2HPVA 4LKOA 1P2TA 1UWKA 1P4GA 2AYXA 3QG5A 1JG6A 3VZSA 3DPUA 2AN5A 1XLWA 2H1HA 2J30A 2QLJA 3PJGA 4N5IX 5E6SB 1GTRA 2CXUA 2XYGA 2FUG6 1RABA 2RDMA 4BRWA 2J3DA 2VP2A 3K70B 3T5AA 2V3CC 2POCA 1TJ4A 3I9NA 3G2JA 1KKMA 4QFBA 4Y8VA 4BL5A 2BGUA 1H85A 3MGAA 4P4LA 2HQRA 3BDAA 1VZ2A 4J0GA 3I05A 4EJ0A 1CJSA 3HRKA 5K2OA 3B1FA 2NWQA 1GD1O 4MTCA 1Z83A 2B61A 2A0FA 4E1BA 3BB4A 1XK7A 5FL7A 3P9ZA 4Q48A 4GOOD 4LWZA 2X5JO 4CQLB 1RRCA 4KR0A 3QUCA 5IUKC 4YV1A 2H1FA 4B31A 4EG4A 1EZZA 5CW1A 3MTIA 4H59A 3TG8A 2ECPA 2ZBDA 3B78A 1GGHA 3R3XA 4DCCA 3BICA 2ZS8A 4JI3B 2GEVA 3BZUA 4X45A 1C0EA 2QSYA 4R5MA 4RE6A 2H2IA 1IXRC 1W4AA 3G85A 5DX0A 1YU9A 2QL9A 1O5TA 1X8XA 3RUCA 2YYSA 4P9NA 3BQ9A 4U7PB 1X7ZB 1N5KA 2KQUA 3WWPA 4XFJA 4DE5A 521PA 3RVOA 4TYYA 2Y27A 4H7DA 5E9QA 2V98A 3AMVA 2JI7A 3BWEA 3DD5A 4PYIA 1Y7HA 4K87A 3URMA 5EHNA 4CN8A 1YFLA 1U2GA 1ZXXA 3TW8B 1L4LA 1WXDA 2C95A 3FROA 4PAGA 4Q7MB 4Q9NA 5KNCA 1UDAA 2VDWA 4M87A 3RG8A 5DTQA 5KDOA 2GZSA 3KQLA 3T3GA 4U2FA 1QZTA 3FDZA 3H5WA 2ECKA 1KPHA 2O8NA 1B74A 1M2VA 1GARA 4DIKA 4U00A 4RXMA 4OGGA 2Z08A 4NXNB 3ZIDA 1UKVY 1YT5A 1FU8A 4KU4A 5GV7A 3U48A 1WBBA 2WQ6A 4DJJA 4DRYA 5F5XA 1N1EA 3JU3A 4HNHA 1NVAA 1ICEA 1TO1E 4IOJA 5I9LA 2Q4BA 3OIFA 2PUTA 1Z2NX 3ELDA 4IJVA 2BUBA 3UB4A 5AI4A 1KMQA 2WHQA 1NW7A 2H29A 2W8BA 3H11B 3BIJA 3QEAZ 1TLLA 4J0QA 1YB2A 4UHJA 4C01A 3IO3A 5CB0A 1T6XA 1I94B 3H0CA 2PVSA 2YXEA 3V46A 4BNGA 1E62A 2O8CA 2K4MA 1IHDA 2IK8A 1MB3A 3AINA 3UXEA 4MYCA 2YFQA 3CCCA 3GT3A 3HM2A 5JARA 1L5QA 2V97A 1ABBA 5JZMA 1FMLA 4ZAWA 3KUDA 1J24A 4J94A 2H9YA 4Y2TA 4IIJA 4BO0A 1KL7A 4HDOB 2XVXA 3IH5A 3JQBA 3CPSA 3Q9SA 1Z4QA 5IH7A 4UEKA 2JDID 1A8QA 1PV2A 3NH6A 4LXIA 1GXSA 3JPWA 3TMYA 3B5IA 1P5JA 4EPRA 3Q1LA 5CVDA 3GPBA 2I6QA 5KJ6A 3O75A 2P9CA 4Y6LA 4COKA 1VCIA 3PGXA 3GJ6A 4G5QA 1ZONA 4LYDA 4G36A 5DPMA 3EXG1 3RV3A 1AX9A 2C3OA 2EU8A 3MUEA 2JIZD 4L9RA 1WVGA 3OD5A 1G21B 3CPHA 4KXVA 4U6NA 5DE3A 3FBGA 1Z75A 1Z2AA 3EVTA 4H7EA 1A96A 4O63O 4C4RA 3V4LA 3HU3A 3K31A 1VB5A 1R16A 3W4IA 4BV9A 1B76A 4MWOA 5HSGA 1Q95A 4BKRA 1NQVA 2WSSA 1PG5A 1OWPA 1M8GA 3PFBA 4HCJA 4YP9A 3TZLA 5HM6A 4GVPA 3AUKA 3RVLA 4GMXA 4C4XA 1LNSA 4D9KA 1BFDA 1N7GA 4KR2A 1YSCA 2PLAA 3A1EA 5K9ZA 2GPWA 4BWVA 2M1ZA 2Q8NA 1G9XA 4BFUA 3ZU6A 3JQEA 2DH5A 2KBFA 2VQEB 4A7PA 1TKAA 3WK8A 4IDOA 1LSJA 3AR7A 4MUXA 5F9HA 4P32A 5JNLA 3VUEA 3OUZA 4KREA 4D74A 4ZICA 2DPGA 2FR8C 5TE9A 2NLOA 4YJKA 4ED9A 1EIZA 3MTDA 4G5SA 4UM8B 4G9GA 2QTRA 4S24A 5HVNA 3RABA 5JU6A 3B3AA 3QBTA 2D5IA 1L8AA 1FDUA 4CWAA 1G1AA 1Z73A 4N03A 2JASA 1QANA 2PL1A 2G9QA 3KR1A 5EA2A 3X1KA 4B81A 4WZAE 2CWWA 1TT5A 1GKIA 2C82A 2WSLA 4JIMA 1YKSA 3TZEA 2R7NA 4ATNA 3LV8A 1XQVA 1LDNA 2RH8A 3EOBI 4RTPA 3CJTA 2W90A 5GM1A 5K6AA 2BT4A 3O2SB 3T35A 4CQNA 4IHJF 2BW0A 1QK4A 4URUR 4UZFA 1W88B 2ZWMA 4CM7A 1RS0A 4K6MA 2QLBA 1A9TA 1GCOA 3BMNA 3MMZA 4UHHA 1W5SA 4RIGA 3AY3A 2I29A 1NZFA 3CLTC 2PMEA 2Q6IA 4JT2A 3WYNA 3ZDZB 4EAAA 3H4MA 1X2EA 4Q03A 4ZT6A 1UC9A 2Z83A 1DKLA 4NNOA 3WDSA 4B3DA 1QH9A 1K7XB 1Z39A 4EY5A 2WJ3A 3PGVA 1PLKA 1Y5RA 1PJZA 5G3YA 4TV9A 1WXXA 3MWGA 4IJQA 4UAJA 1MIHA 2JA2A 1I80A 1Z28A 4P34A 2KW5A 1KJQA 1MRSA 2J4DA 2Q5FA 3LBFA 4NENA 5EIFA 4P4TA 4K28A 3DXYA 3UXMA 3A3PA 5TX7A 1H8HD 3WRWA 1E4YA 2XA9A 4H6WA 2UVPA 3K2BA 1RYEA 1J20A 1V3QE 2WZBA 3NOQA 5L3ZA 4KOEC 4F6RB 5LJIA 4DY4A 1Q0RA 1EE1A 3N8GA 5LSAA 2Q3BA 4QEDA 4G2NA 2YCLA 1ORWA 2XJ4A 3AC0A 2DKFA 4GVXA 4Q3EA 4MRNA 5F4BA 3O26A 3O8LA 4TRJA 5C51B 3NWBA 2RK3A 1Z2PX 3WNCA 3EGWA 4DM4A 4CETA 4FP9A 2NYUA 4D9BA 1WW8A 4FHCA 3ZCTA 2QRJA 4QGAA 4WLFA 4ZYUA 1G55A 5L53A 1ZD8A 2GVZC 4LNAA 3RVSA 4QG7A 3ANXA 3AERB 1BO6A 1WXGA 2PJRA 1V11B 1IC6A 3TTTA 4HT3B 4KR3A 1FF9A 3RH0A 2I1VB 4RSRA 5CFZA 1OX4B 1V8FA 1X9HA 2XYPA 1FP4B 1ZHOA 3ZDQA 5K4HA 2R6AA 1QFZA 1LPSA 3IEUA 1NDQA 1ZCJA 2D5CA 4CKEB 1PHPA 1UAYA 3KKQA 3P2IA 4I0WB 3U6KA 4XSHA 3JPYA 1YR6A 3CLSD 4ZYXA 1TK3A 2C97A 1U5AA 3D8TA 4IJ6A 4H27A 8AT1A 4I55F 4MVJA 2R1TB 1P81A 1NLUA 1OIXA 3NTXA 3ROPA 5A5EA 4P36A 3V4PB 2E4UA 2XITA 4B6RA 4O2RA 3DO8A 2BCGY 3ZGOA 2EWWA 2L82A 4M36A 4EA8A 3BHMA 1QYXA 4B3CA 2GPSA 3BS4A 2ZSEA 1NKSA 5B6JA 3ZG6A 2Q9CA 4DOMA 1SXJE 5A03A 1J9ZA 4QBGB 4Y2PA 1AUPA 4OB8A 3SF0A 2Q1XA 4OQQA 4QEZA 1M5TA 4YWJA 2FW8A 3ECAA 1PNQA 4GQAA 1EWTA 2AJDA 4HUQA 3NO4A 1FYXA 3FFXA 4HV4A 3BIOA 4YP0A 1G16A 3I9V6 2JJMA 2DHCA 3Q3CA 1WQ4A 2CNKA 2C7BA 4V1CB 4KG7A 2ZKLA 1S01A 4K6FA 1GCGA 5BSHA 1RI5A 1Q7EA 1SHUX 2RK4A 3TSWA 4UQOA 4BQNA 2MSDB 3Q2IA 2GB4A 4LWPA 3W2EA 1U94A 2DBRA 3O0TA 1ESDA 1QHXA 4EHHA 4HOYA 2PTGA 1GFWA 3RWBA 4G8DA 3OWHA 2XMSA 3CKLA 1YI8A 3CW8X 1XO1A 3EDOA 3HZZA 2DUUA 4RUKA 4TUYA 4PW0A 3BMQA 3MAJA 4FUQA 3GLHB 4KMSA 3KV3O 3T7DA 3DLHA 2L42A 1SEVA 4DEVA 2OCAA 3O95A 1OH7A 3A25A 1EFRD 3WK5A 1DBSA 3AP3A 2R8BA 4PZEA 2WB2A 4UQLA 1RT9A 4WBNA 1A27A 4U2EA 4XQ9A 2G8LA 3EPKA 2BTQA 4AS3A 1W5FA 3CVXA 4WK6A 1POXA 4IX1A 1T29A 1W5EA 3FVQA 1IZ8A 3LD9A 4D8XA 1ZNXA 1HNNA 2LWIA 3HVHA 3Q3HA 4CQMB 2HLDA 4J1TA 1GPAA 1OVMA 2Q0XA 1D1SA 3BSFA 3L7LA 3A27A 4RL4A 3TIXB 3IQIX 1XXHE 3ZTYA 4PYMA 1HDCA 5EWMA 4BO4A 3ZDAA 4MV5A 4AWAA 1E60A 5H59A 4YRKA 5KNBH 3N2ZB 4FWIB 4RACA 4HRAA 1CWUA 1KMIY 3D8UA 4DZTA 8LDHA 3BH6A 1C14A 3HBLA 1O95C 5F1PA 3CLHA 3EF0A 3EUWA 3RKSA 2NZ8A 1XRSB 2WF6A 3E5RA 3F7NA 2ZKIA 2H2WA 1BGXT 1O08A 3Q3GE 4BO5A 2AFIA 4ENTA 1ZNQO 3ETEA 3PP8A 4N8EA 4RA9A 3ROGA 5EZQA 3SMVA 3TUJC 3IT2A 4BN4A 4DC1A 4UZEA 2ADOA 1F6BA 2BFBA 3M0EA 3T1TA 3TOSA 4GNKA 4WDQA 3FUCA 3HUDA 4YROA 1VBFA 5B1SA 5KJ1A 3GLIE 3ZE0B 4GYWA 2GN9A 2X2OA 4QDTA 1K8YB 1P2FA 1QGUA 4X8HA 5G4LA 2ZB8A 2J0VA 2ATCA 3O4GA 3PHCA 1MJGM 3W90A 3L6RA 1F0KA 4LA4A 5H7XA 2UZ1B 4E5DA 2GAIA 4V0OA 2BEUA 1Y5NA 4GC5A 4XPIA 1HC7A 4EG3A 5AM3A 4O1MA 3OJFA 2GA9A 1S2IA 1YAJA 3DEAA 1XN1A 3C3DA 4OHCA 5EMMA 5EYPB 1P72A 2HQOA 3MFQA 4I6EA 3VM6A 1CF2O 5HM8A 2Z8XA 5K8TA 5K09A 1KTIA 1MO5A 2P9JA 1KEEB 4BJHB 4U8GA 5CITA 4DT1A 2EW1A 2I7XA 4OQEA 1SCKA 1ZRHA 3OFKA 4G9EA 1PJ4A 3FPFA 4Z9YA 4RZ3A 1Y6ZA 3PHJA 1YDWA 1M8FA 3A28A 3H2JA 4MS3B 5AJYA 2VF7A 4HB3A 3NWJA 3UVEA 4ER5A 3GYBA 3LC2O 3QUTA 4OP1A 3TW4A 2Z6AA 2WJYA 1NMYA 4QBTA 4RIFA 1IBRA 3DHNA 3WBKA 5AI6A 1Q0TA 3R7SA 2CFOA 4RVSA 3I1YA 1ZM2A 3PDWA 1QZZA 2FXIA 2C96A 2XIQA 1BVYF 3E2IA 4IGIA 5B4TA 2XH8A 4HL6A 3OF3A 1T2NA 3G17A 4JJ7A 1D6JA 3WBBA 2VQ3A 1MQ8B 2HA7A 2XMDA 4PLWA 3D4IA 4IS2A 5L4SA 4QGFA 4YQEA 4NRDA 1FX0A 3MFYA 2NU8A 4U7JA 5J4YA 1JGTA 2B98A 2ZAIA 4HDKB 1GR1A 2QLFA 4DYDA 1I9GA 2MSLA 4ZDIA 4RO0A 5HKOA 1OASA 3MG9A 2YV2A 2OXIA 2EGHA 2QP3A 3KRTA 3PNKA 2D06A 4GECA 1IWPB 5BVGA 1G64A 4FS8A 5KYYB 1SY7A 2FUKA 1Z7EA 2J0UA 2O1EA 2V3VA 4QLAA 3T1HB 1L0BA 2B8EA 2DFKB 2IUYA 2P3QA 1U0GA 2Q41A 3AI1A 3P26A 1VPLA 4MSUA 1Z22A 3S2IA 5J1TB 3OC0A 3NVKI 5HHTA 1XMVA 5DP1A 3W5AA 3HSKA 1EM8B 5HCIA 4MJ7A 4JQSA 1FLDA 1OLUA 4FYIA 4R5HA 5TARA 3UJ8A 3BD9A 1O87A 1ZKDA 1WPQA 2V9CA 4FXPA 5EQFA 4MLDA 4I55B 4A6XA 4K9RA 3QTBA 4HB4A 2I62A 4A8HA 2W2KA 1SXPA 2Q2NA 4DG8A 1BQ3A 3BH0A 3F7MA 2JJ2D 5KOJB 2JLUA 1G8HA 1RM5A 3V6MA 4N54A 1SBIA 4BMVA 5FFMA 3ICQB 3OPXA 4FFRA 3UCEA 1W87A 2WWRA 3B2EA 2PBFA 3FZEA 4MR9A 4Q01A 4BNNA 4N0DA 5AR1A 3WV5A 5K3EA 3GGCA 5FLXA 3PEEA 2B7LA 4HLDA 1VCMA 2IEGA 4KH1A 3JQGA 4LISA 1XC7A 1ZG3A 5FORA 2EFGA 3UICA 1U3WA 1UKAA 4MPJA 2LGJA 3LQFA 5LDGA 4FZ3A 1M34B 5FT9A 5BT9A 1KI4A 3IALA 3MRXA 3QA3E 1LDBA 2GARA 1Q44A 2Q62A 3V4FA 3W05A 3M6UA 5JD4A 2G1AA 5EKSA 1AMOA 2ZK7A 3P9NA 1BU8A 3JQDA 1XEWX 4B7XA 5CLFA 1Z8HA 2PR2A 3FCEA 1SHZA 1HKUA 2FP3A 4C6RA 1IIRA 1JDTA 1WO8A 1QVVA 3EWNA 2HRBA 3TBHA 4RC9A 5JANA 1EB9A 3N7AA 4FEGA 1SO8A 1JT2A 3AUTA 4RKRA 3DM5A 4WNAA 4RH3A 3KYCA 1GIAA 1SXQA 4AC9A 5AQEA 3MT8A 5EPOA 1RXYA 1M1NB 5K4AA 5H5JA 1YGYA 2FSUA 4EB3A 1C29B 2VEDA 1TTTA 1W36D 4QQNA 1T9HA 4OHRA 3IL2A 4YYZA 2ZUFA 2G9ZA 3FOEC 1QIHA 1RI2A 4DG5A 1VFPA 4TKUB 1D03A 1JI3A 1UFKA 1XZPA 2NUTB 1GSOA 2HLNA 2IYWA 3S1AA 3IB3A 3UV6A 4X66B 4QVIA 2P2ZA 4C7BA 3N2LA 4PZUA 1KE1A 4ZVVA 1MX1A 3CWCA 3AR6A 1A7JA 3GFFA 1XN4A 3DF7A 4LRXA 5IAGA 3FHOA 4LOHA 3RG2A 1Y4SA 2GZAA 4S05A 4R41A 1RIIA 3BRQA 3PJFA 3TRIA 2WR8A 5JQGF 3HM9A 1N5DA 2WHEA 1GTL1 3PXEA 3UKJA 5D3MB 1P45A 1ZX1A 5A1TA 5FNZA 3QPDA 5C37A 3L49A 5A9RA 2BEJA 5IC4A 2BBWA 2FSSA 1FK8A 2NU7B 3DDHA 1AHNA 1Z6AA 4JLJA 2Y4NA 4C07A 2HAEA 4KUGA 1QYDA 1IUPA 2FSPA 2V7QD 2CLCX 4RTJA 1RWQA 1SQGA 2VJKA 2MOKA 4QOSA 2X14A 4XAQA 4GZ5A 3BVPA 3VTAA 4R1QA 5B58C 2A59A 1M0EA 1CE8B 1UPCA 1UZAA 2JI8A 3SC6A 3V8VA 3DE3X 3AT1A 1WKVA 3G5AA 1TFUA 1IN7A 1H2RS 2BFMA 4I9HA 1Z8FA 2CLHB 4EF6A 1RQLA 2ZSDA 4OSOA 2P65A 4M83A 2HWWA 4G56A 3T4UA 2AUMA 2J6HA 2AZ4A 4DABA 1K9SA 3BJZA 2NO1A 2BFWA 1U0EA 1YFKA 2PKEA 3DBHA 4BLQA 4LIPD 5BV8A 4XD2A 1PK9A 2O1SA 4LYJA 1A8IA 1MV8A 3B8EA 1D04A 3FPEA 4IGAA 4GX2A 4DA6A 4U7DA 2FMUA 4ZQFA 4EVIA 3R6DA 3V1NA 2O0HA 4GXRA 1OTYA 5COQA 3EA5A 4AS2A 4DMCA 3TQIA 4QTYA 2F62A 2EFCB 3ZZUA 5LMZA 3U7GA 5KC8A 3HB0A 4B6OA 4UTXA 4PEVA 3QBVA 3KOYA 1ZVMA 2FF5A 1CBUA 5LB2A 4W5TA 3B82A 3AF4A 3A7EA 4P33A 1JA9A 3ZQJA 3AFOA 4G23A 2HBQA 5HYVA 3OIYA 4WKGA 5GIPE 1E7RA 3A4YA 3ZNNA 3MIZA 3X44A 1W52X 2W2XA 1GFIA 5EJ4A 4Q4LA 3LLCA 2P3SA 4LZAA 5LBUA 1AN9A 2XNKA 1R9GA 3ROKA 4HNUA 2H7YA 5CLIA 2EAUA 1XHEA 3LF1A 1VL2A 4OMUA 1GCIA 4KXQA 2A6PA 5IZCC 4UD6A 3NONA 5JSQA 2IJGX 3QNMA 4LFCB 4TM8A 1O6ZA 1UT5A 4BGDA 3N2KA 3ZGNA 4MOWA 2PUFA 2XXBA 4F6LA 1DPGA 3JQPA 3NHRA 1XD9A 1NA5A 3M6FA 4BB0A 1SUCA 3SHWA 1A2OA 4EYEA 4CQJA 1HKHA 1YVEI 4DHWA 2W6IA 1R12A 1VSBA 2JAXA 1Y7TA 2XDQA 3RU2A 1J1IA 3KCQA 1LTHR 4MI6A 1LDYA 2VPYA 3PQ3A 4WQMA 4YALA 1FS4A 1EWQA 3KKKA 1M76A 3A1FA 2I2XB 2O2SA 4G09A 5IJ0A 4KQJA 3LZDA 3OTOB 5D00A 1HM5A 1VYVA 1WXEA 3A32A 3I0ZA 3KKLA 5AXAA 2GYYA 1Y8RA 5I4KA 8GPBA 4FPXA 2FOXA 4S04A 4Y2RA 4MEBA 4N8DA 1RAEA 2AJLI 3FZQA 3I2HA 3SIWA 2EYUA 2QW8A 2VQDA 3SZLA 4OJQA 2ZWPA 2R3SA 2VDNB 3WA7A 3L8DA 4QUJA 2NSDA 3P45A 4F04A 3WBFA 3VSCA 1UKZA 2DPYA 3K09C 1RM3A 1WDLA 1OQAA 5BUZA 3BMOA 3NC4A 4NIMA 5EWJA 2BJHA 2WICA 1PBTA 1YA8A 1RC0A 1BXKA 1W19A 5DHRA 5DNCA 3WGMA 1DKUA 1E6KA 4OK5A 1C7RA 1U0BB 4X1OA 5M5BA 4IH9A 2O20A 1H0KA 1SVNA 4FYHA 2JKYA 3EG9A 4CMIA 3U56A 1M75A 2BFCA 3AFGA 3EZLA 1YULA 4DZZA 1PKEA 4L3VA 1IN5A 1YOVB 2VN8A 1GZ4A 1DELA 2XVZA 2OCKA 4BU1A 3K8ZA 1P5ZB 1RWWA 2IBMA 4LZNA 3O4FA 1W2GA 4QUIA 2B92A 3RDPA 4D3YA 4IDCA 4LNHA 2QG9A 4B7AA 5K45A 4CKCB 1F9AA 1FC0A 1XALA 2XOKD 2XTMA 2WABA 1DO8A 3OECA 3TCNA 3A4MA 1HTBA 1IDOA 1I32A 1TZKA 2GI4A 2BM0A 2OBFA 3KZCA 2TMGA 4J16A 1AKTA 3RT9A 5HIAA 2CFRA 3LY7A 5I7OA 3GRVA 2I4TA 1JX6A 2OXFA 2F67A 1CY6A 2ISQA 3ROEA 5JHGB 1XRNA 1NVMB 2E82A 4QT0A 4NCJA 3HVRA 2QT9A 3ZCUA 5L4LA 1NWHA 3LDUA 2Q4RA 3BK1A 3C3XA 3VR2D 3URKA 3QEMB 3L8GA 4BFCA 1U2SA 1GNPA 3SQDA 5AI9A 2JCYA 3CLSC 4EIWA 9LDBA 5JSFA 2D1TA 3GD7A 4IO1A 1DUSA 4WN9B 4OOEA 5ALZA 4JP2A 1L3CA 4HVTA 1Y80A 2AHRA 1CQJB 1MV5A 4HDSA 4MV6A 1NW5A 2HDOA 1A71A 1PR1A 1LCIA 2ISSD 2N1BA 3GVCA 3O6VA 4JLDA 3WMXA 5CLJA 1L5YA 2DXIA 2G1PA 3L0YA 3I4CA 4EEKA 2QJFA 4U2KA 3V00A 2AVDA 3AWDA 4CIDA 1R5OA 4JI2B 3TYXA 3GEHA 2UXDB 2CK3A 2I3BA 3KIPA 2GHQA 1YC2A 4X6XA 4WE3A 4DV5B 1U63A 1SULA 1USGA 5JS8A 1T25A 4DQDA 2YIJA 3AHIA 1XJ5A 3LUKA 1FQWA 3RVKA 2DEUA 2JH8A 4BBZA 4QICA 4U7FA 1FYWA 2A4KA 3HGQA 1OA1A 2C7VA 3EPPA 2MMGA 3D3KA 4HGYA 1MAVA 1JE1A 4FXOA 3WWYA 3ZHYA 4PTLA 4H4CA 3VBCA 4CEJB 1SZPA 2E5WA 1G8AA 1L7XA 2W2QA 2X0RA 4K6GA 1KZ1A 4Y67A 1HPLA 1FVHA 1T6ZA 5K4GA 3O4VA 4PLTA 3EGCA 5B5SA 2H1OA 1U2PA 2R5WA 2XE7A 2BONA 1HDXA 1G6OA 4B4VA 3SQXA 4HAVA 3L1JA 3I2IA 1PTJA 3EFHA 5FIUA 2I0FA 3DVRX 4HXGA 4WHMA 4KHPB 2I03A 2PQ6A 4PN3A 1SPXA 4MS4B 3FR7A 1D6MA 4G63A 4Y2GA 2QVZX 4Z1MD 3UJ7A 3S81A 3RPEA 3X3HA 5D01A 1KZGB 2A92A 2BEWA 4P3YA 4IO0A 1XK6A 1R4NB 4UHKA 5KAPA 4YCLA 5EUCA 3JV7A 4MICA 4GBED 1HFJA 4P1ZA 2PZGA 1UK6A 1XF9A 3F5MA 3MCZA 1RAFA 1ZSYA 1SIWA 3MQ2A 4M1SA 3GJ7A 3B9BA 1P4RA 1C1HA 2JH3A 3VZPA 3JY6A 1E6CA 2E21A 3CR8A 3DNMA 2QZ9A 1ZJ5A 5CEFA 1E61A 4LFBB 3II6X 2G06A 1JILA 1X1EA 3ADBA 1P0FA 1GYQA 1P3JA 1WV1A 3H9GA 4M8KA 3VISA 2RGNC 1W25A 5ES3A 2ACEA 1F4LA 4TYNA 4Q9DA 2DHRA 2W7TA 2GUWA 3KV1A 1NLMA 3OQ1A 5B7NA 3QUAA 3ZV5A 4A0HA 2ODNA 4DWJA 5E0OA 3OCVA 5CEEA 1VPWA 1SZDA 4URVR 3QLVA 5B7GA 2VPXA 4UMFA 4J2HA 1P74A 4RIIA 2D0PB 5HCNA 3UJ9A 4RHCA 4B80A 3STWA 2O57A 2F4NA 4IJWA 2ACKA 3HO1A 5AKYA 1K1EA 4ZOLB 2PMKA 4KXMA 3UHAA 4DB2A 1NFQA 1SJ9A 2YFYA 3KJQA 3KUCA 1PS0A 1NUUA 2J3KA 4KIWA 2JAWA 5AJHA 3N76A 4FX5A 3MS7A 4W5OA 3DE6X 4DRXA 2W83A 1QH8B 3OM9A 2XF2A 2X0NA 1AB6A 1AV6A 1TYCA 3ZHSA 2W11A 4AZ0A 2DTDA 5AXBA 5C8XA 5ESDA 5DU2A 1X1CA 3K0AA 5JBNA 1OWLA 2W6JA 1XNRB 2NMVA 2CW5A 3BGVA 3U4CA 5CVUA 4HNAA 4WCDA 4MKGA 2RD2A 2BVNA 3OM8A 3X1ZA 3EEYA 1JVSA 1LJLA 2ZAYA 2ZI9A 2VZ8A 3U26A 1I7PA 3IILA 4GKAA 1JBEA 5BQOA 1XG5A 3SS9X 3AY0A 3RS4A 3JZMA 1C3JA 3GAAA 4P86A 1C3OA 1Q7RA 3IVXA 4L50A 4XOUA 4ZGWA 2BTOA 1JR4A 2OORA 3GPCA 2YOHA 2ZETA 4D46A 3E8SA 3EVEA 3Q7PA 4QFCA 4QYSA 5CK5A 5JFTA 4BX8A 4PX5A 1J9GA 2CUTA 5CK4A 2QTVB 2WA2A 4CLRB 3T5GA 1X7WA 2CHGA 3NT4A 3ECCA 1B1CA 2DJIA 1JDSA 5E9WA 1IHXA 3M4JA 3REQB 4KNVA 4S1WA 2XBUA 3RUAA 3WGOA 3C14C 1TUEA 2WG1A 3JD0A 4YTEA 3WIDA 5ICCA 3I37X 3CH4B 1Z13A 1EBBA 4BQSA 2NTJA 4GOKA 3F8WA 2JIBA 3R5KA 1TCVA 2R1ZA 3ZI7A 4LDJA 4C21A 4UDYX 3K32A 4DCJA 5I7UA 3LRPA 5CYGA 2GLXA 3GAFA 3CUEF 3NQ41 2H4HA 4LC9A 5FP0A 3HL4A 3Q3IA 1HH4A 4IRMA 4CKBA 4JI1B 5EZYA 1UBSB 5DDIP 4W1SA 1XZDA 3W6NA 3ER8A 1I33A 4KGZA 3HI6A 1XYVA 3H7AA 3PVCA 1RZRA 1E18A 1EK5A 5A71A 4G3XA 4MQ5A 5CCBA 4EGCB 4QJ3A 4C7OB 1YDHA 3E3OA 3ZE2B 2D74A 4LOIA 1NBAA 3L3BA 5EVCA 2XCTB 1XU9A 1Y34E 3SS7X 5E8JA 1ZEMA 2LZ0A 3I61A 3GCWA 3FW1A 3WMRA 4MK4A 3LBNA 4RF3A 1JYFA 1VP3A 4JXZA 4U2DA 5KYXB 4MDEA 3IP6A 3DHVA 1AE1A 3K30A 3ZNQA 1J0XO 3EE6A 1KR2A 4OFBA 3BWMA 1PYOA 2HEIA 4U7GA 2IPLA 2HO4A 4X60A 4BXOB 2AN1A 2IXDA 3JRNA 1GA6A 3Q7IA 2CLFB 3WTCA 1COWD 1DO0A 2XMBA 4I5IA 1IPHA 1NI5A 3T4PA 1W75A 2HK7A 2Z09A 3OLZA 4AMBA 1ZIPA 2HGZA 2VA9A 4ZC8A 4YRIA 3NVAA 2QN2A 3MGCA 3ROQA 4F9TA 4L85A 2E5LB 2QNIA 2IBTA 3L0ZA 4B0OA 2LDXA 3VYRB 3LRTA 1CQPA 4HEQA 5EAIA 3EMKA 3TMAA 2QX8A 2QRZA 1ZSVA 2CLDX 4OF4A 1EFLA 1ACLA 1JLMA 4CIWA 1QHHA 4PG7A 3F47A 4ISBA 3SE7A 4NOJA 3FETA 5MN5A 3FOBA 3R75A 1ZW6A 2WU0A 1BCRA 5DXAA 3QELB 4OQZA 5M2QA 1W36C 5CA0F 5EESA 4M8IA 5LA6B 3RRYA