1E9FA

Mutant human thymidylate kinase complexed with tmp and adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
211
structure length
202
Chain Sequence
RRGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Potentiating Azt Activation: Structures of Wildtype and Mutant Human Thymidylate Kinase Suggest Reasons for the Mutants' Improved Kinetics with the HIV Prodrug Metabolite Aztmp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 202
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e9fA00
3TUZC 1G5RA 1E2NA 1BYIA 2CHVA 4JLMA 3TR0A 3EA0A 2O8DB 1VDZA 4TT3A 1CJMA 2BJVA 1VCNA 3O8RA 3W8NA 3GJ8A 3LV8A 1S96A 1YZLA 1MABB 2GCPA 2JLZA 3PFIA 2DBYA 1GZSA 2LWIA 4C9BA 5A5GA 4JLJA 2XTZA 3B1WA 2ZRAA 3B82A 4N0DA 4TQAA 3RYTC 2J0SA 1J99A 2ZYVX 2WWWA 2WZQA 4V02A 4KODA 3FYHA 4EFLA 4CDGA 1IN7A 4B2LA 2P5SA 1MOZA 4HB4A 4PHFA 1E0JA 3EWAA 3LDAA 4GMDA 4Z51A 1XEFA 5CYOA 3SE0A 4EPVA 4LGMA 4PQFA 4KITB 1W36B 3CF2A 2J59A 1W36D 1G3MA 3MUFA 1DTSA 1D2MA 2H7VA 5FPHA 3AVOA 1L2TA 3LY5A 1CU1A 4B3GA 4C0LA 1GNPA 1FQKA 1XXHB 5DHFA 4DLSA 1KSHA 1JI0A 2WM9B 2ZRPA 3RS4A 2QQ0A 3K0AA 1N6IA 2VL7A 1SVWA 1XFAA 2H8KA 5EUMA 3T34A 4DLTA 2QROA 4AKHA 1U9IC 4I1SA 5CK5A 3WBKA 4GDFA 4YMUA 3E5HA 1XZQA 4WZAE 4DKXA 5AUNB 3KJGA 2GJSA 1FTNA 4HLQB 1W49A 2ZR9A 1OSNA 4TSFA 3K70C 4RD1A 2WWGA 2ZR7A 1G7SA 1VPLA 4ARZA 1N0VC 4AKEA 4BGDA 4HZUB 2IXGA 3KB1A 2Q3HA 2A2ZA 3I8SA 2JJ1A 5KTYA 4GFDA 2Q21A 3KQNA 2JLSA 3P4YA 1JB1A 2ERXA 3I72A 3TW4A 4MRPA 3EPKA 4LC0A 1AGPA 1ZUNB 2X8AA 1IAQA 2QT1A 2RCNA 1VMAA 1W4RA 3RRMA 4DWJA 5HCNA 2DB3A 4DDWA 1V5WA 4OI4A 3TR5A 1I2MA 3ASYA 1W2GA 4D0NA 1ZINA 2G88A 2OE2A 4LJ8A 2OLKA 1JR6A 3K9HA 1U0JA 1NVWQ 1Q1ZA 1U0HC 4R2HA 2X2EA 4A6PA 2GILA 4HSEA 4TMVA 4D0GA 5LB4A 5G53C 3NBXX 4DDVA 1G3UA 1Z07A 1Q1BA 3VFDA 2ZVPX 3C8UA 3SYNA 1F48A 3NC1C 1U94A 1VG9B 2JLQA 4Q4AB 2X1VA 4C0HA 1XCGB 4DLWA 1L4UA 1E32A 4I1OA 1YRAA 3GLFA 4TWZA 1KGDA 4I81A 2ZJZA 4NYIQ 3RDPA 5FPTA 2HJVA 5KNDA 4C2TA 2O0HA 1Z6AA 3AF3A 1OKKD 4KV9A 3QKSB 2GXUA 2ZAOA 2PBRA 5K8UA 3GFPA 3L0OA 4MYHA 2ZEJA 1Z63A 1DAFA 3R9XA 1US8B 2OAQ1 5ELXA 3THWB 2IYUA 1XTQA 3VU9A 2ERYA 4TL9A 2FSHA 4PSKA 1QG4A 1P3JA 4AC9A 2WV9A 4CEHB 3TAUA 4LHZA 2O8BA 4NKRA 3QEJA 2ZM5A 2VO1A 2VTKA 4PSAA 1Y3AA 3VR1A 3MD0A 3SU8A 1E9CA 3QXXA 3UIEA 3F5FA 3W3AA 2BDTA 1N6OA 3PITA 5IDVA 1SVIA 1QBKC 2QA5A 3FMPB 4KJZA 2QAGA 4AYXA 1UKZA 1OIVA 1ODFA 3HYTA 3ZIAA 3LNCA 4MGKR 1PVOA 4NMMA 2DWPA 1UEIA 1Z2AA 2IYVA 4TLCA 3A6PC 3H4MA 4NHOA 1FZQA 2XTMA 4Z1MD 1DELA 2D2FA 4OQNA 3V9PA 3ZZTA 1AZTA 3BWDD 1QRAA 3K0SA 1ZC4A 3AF0A 1N6HA 4Q9HA 4B6EA 4CZ2A 5FL3A 5HPYB 2X2FA 4YDSA 1AJEA 3U4QB 3AKEA 3LVQE 4TYQA 3K9LA 3NEJA 5A4JA 1OJLA 4BLOA 2PMDA 4MUBA 2W6JD 4M1WA 1Z83A 4DLVA 2O0KA 3FMFA 4UXIA 4TYNA 1GITA 2WJYA 2GXAA 3RLFA 3SEAA 2OHFA 5FOXA 2JJ2A 2QU8A 3OIVA 2V9PA 1WBBA 4HAYA 3DZDA 4UKDA 5LBIA 3GLGE 2HDNB 4Q47A 1LY1A 5JBQA 3QY0A 4IDQA 4PSVA 2BVNA 4MRVA 1DAHA 1CR0A 2EW1A 4HAZA 5JHGB 1KJWA 4JBWA 3REGA 4CVNA 1ZM7A 1OB2A 2GZAA 4YMSA 4EIWA 1G18A 4NTZA 3PEYA 2OLJA 4PAQA 1OXSC 2J45A 3I73A 2AFIE 4FIDA 2G6BA 1KSJA 1TUEA 3CRQA 1RJ9A 2BC9A 4LJ9A 3UWKA 3G0HA 2JDID 3OEED 5IRCD 1KI9A 4IVQA 1KKLA 1ZNXA 2C96A 2QMHA 2F1RA 4KCGA 1C1YA 1E2JA 121PA 4Q9IA 2X19A 3QIAA 4DCVA 1P2VA 1X8JA 4OQXA 5IT5A 3HPRA 5AUOB 4HATA 3ZH9B 2ODBA 1XP8A 4TQ9A 1QHHA 1JAIA 3IKJA 1CJVC 4Q01A 1HQCA 3IIJA 5KSYA 4DT1B 1W5TA 3GFTA 1NNEA 2IX3A 3O8CA 4AG5A 3CNOA 2NIPA 4XSGA 3TJZA 1P5ZB 2VSOA 3SHFA 4L15A 2OCPA 3TQCA 3WP0A 1DE0A 1F6BA 4MYCA 1LB1B 2ORIA 5FL7A 2CL7X 1VCOA 3LQRA 2TMKA 4TLAA 2J87A 4UXHA 1OW3B 2ZJ8A 1T6NA 4LJ7A 2CK3A 2QG6A 3CH4B 3EZ6A 5DGXA 5JCZA 1VCIA 2P6UA 4URZR 1KI6A 4Q21A 2NO1A 1MO5A 4RY2A 4ZKEA 3ZYCA 5JEEA 1QVAA 3ECCA 4K8OA 3NVAA 4WVFA 1EWQA 2OCAA 721PA 1JAHA 1T4GA 2CJWB 5LDDC 5E95A 2G83A 1W36C 4P3YA 4BASA 3SYLA 3K9NA 2YHSA 3GJXC 1E3MA 3H2YA 2ZROA 5H68A 4JS0A 1S4QA 4QGFA 4P4SA 4KFUA 5C4MA 5FH9A 2BEJA 1IHUA 2MMGA 3THXA 1KO1A 4BLTA 1L4YA 2P0EA 1F2TB 1XEXB 1UKVY 3T35A 4JMPA 3TSOA 2QAJA 3U3MA 1HE1C 2NGRA 2XZOA 2CVHA 4CW7A 2EFGA 1CR2A 3P32A 1G7CA 3W3ZB 1LS6A 4JLPA 3ADKA 1HTWA 4QBFA 2JJ8A 2H1LA 2RKOA 2RGEA 4IFBA 2IT1A 3QPUA 5IK2D 2GCNA 2I1QA 3BB3A 4HUQA 2BM1A 4M9SA 2IK8A 3K0CC 1QHSA 3VKGA 3LXRA 3P4XA 2WAYA 3ZD7A 1P75A 3JZAA 4URVR 4WIAA 4PC2A 1OYYA 4N1AA 5CIWA 4M8NE 3WMGA 3HU3A 3I8XA 2XB2A 1IM2A 2C78A 5B64A 1IXZA 3LW7A 3GLFB 3CRVA 3CBQA 1NBME 4RKEA 3WY9A 1PUIA 2BMDA 4DBLC 1XD2B 2L0XA 2R6DA 1EESA 3KFVA 4EPWA 2ZI7A 3CPHA 1XPRA 4MGYR 3T1TA 3I92A 4HLCA 2GRJA 4CT4B 2XNDD 2CXXA 2ONJA 5F3WB 4FMCB 2W6IA 2PLRA 1J90A 4Q4LA 3VU9B 3EPHA 2WKQA 4NCKA 1NBMD 1FUKA 2OFWA 4ZDWA 1Z29A 4LK2A 3WYFA 1N0UA 2WPDA 1QF9A 1ETUA 3RANA 4YXWA 4E09A 2UKDA 2J0QA 4UNPA 5KYKA 4NYMR 4PPFA 4RKFA 1N6KA 2WBLC 4ZDKA 2QTFA 2J7KA 4KLZA 3KTAA 4HB3A 3DM5A 2FX3A 4BPBA 3L8ZA 5H1YA 2LCFA 4OHVA 4MKGA 4X8OA 5DI3A 2J9RA 4JT4A 1YVDA 4WBSA 3BXZA 3U2QA 2W83A 1N2CE 3I62A 3L0SA 2XITA 4QGHA 4TZ0A 2ECKA 1E69A 4KAXA 2XSZA 5GJBA 2OBMA 3ZD6A 2Q0HA 2QP4A 4FI3C 3QPWA 1W0KA 4H1VA 4XOIA 2XJ4A 4AG6A 1A5TA 1ZMXA 2RGXA 2G9NA 5L3VA 1QZXA 1ZM2A 4MKIA 3K0FA 2IXFA 2J0UB 1BH2A 5B57C 2PX0A 4G01B 4B3BA 3PEUA 4CRWB 2N46A 1OV4A 2AK3A 4M4SA 1TL7C 3PCRB 1IY1A 3GPLA 3IEUA 2A5DA 2YOGA 2OEPA 5JJIA 5EE9A 4DXAA 3D6TB 1NVVR 1MABA 3C14C 4UNNA 3WP1B 1XEWY 2DWQA 4BLSA 2F1IA 2EWWA 4RD3A 3L2OB 4X8LA 2EFEB 3A37A 4C0JA 3NDBB 3B5JA 5HCIA 4IVPA 3RC3A 4C0KA 2G1JA 3UANA 4FMCF 2IHYA 4PQYA 4ERNA 1JPJA 3PV0A 1N6LA 2BM0A 4MUAA 5DIFA 2NO7A 1X1SA 4M9XA 3EW9A 3CNLA 4J0QA 3RSLA 4V03A 1DAIA 1EG7A 2CCJA 4XSHA 5IF9A 1T9HA 4RZUA 3PJRA 2O8EB 4LI0A 4P33A 4AY2A 1KSGA 1HE8B 2DY1A 2JIZD 5BN3A 4D0LB 2YZ2A 5FI1B 3WMEA 4LYHA 4DLXA 2IEYA 2DR3A 2HCBA 2J3EA 1TNDA 3OEHD 1JECA 1X8KA 1XXHA 1KTVA 1YR7A 3R8CA 4M22A 2Q9BA 3S1AA 5AJWA 3VQTA 4MGIR 3RSOA 1R5NA 4P32A 4QJ3A 1QHHB 3A8TA 1R0WA 2YJTD 2OFOA 4G5SA 3T5GA 621PA 1XCMA 3W34A 3LRPA 4KVGA 4PO8A 1E2EA 2GEVA 3K1JA 3RNLA 3VR2A 5JHHB 4PQRA 1KMHB 1YZGA 3QNUA 3ZS8A 1GTVA 2DWOA 2E87A 2R6FA 4ZCLA 4BLQA 1TTTA 4GL2A 2BMFA 2F1JA 2ZYUX 2DFKB 2ZI3A 521PA 1OPXA 1D8TA 1P61B 2QY9A 3EA5A 4HZUA 1P6XA 4DCNA 2IF0A 2GZDA 1E94E 3K0CA 1XMIA 4R9UC 1WXQA 1XTSA 1IJFA 3TNFA 2QP3A 1VHLA 1G8FA 3U3OA 3A1SA 3R8FA 3PXGA 2O0JA 4WXRA 1G4UR 1V43A 2VYFA 1J7KA 2FNAA 2ZE5A 1FQJA 3LW8A 5HKKD 3SFVA 1FL9A 2B8TA 4DCUA 2ZUCA 1NKSA 1N0WA 3WHKA 1OF1A 4RZXA 4BUJA 5A0FA 1MRNA 4PHGA 1ZYUA 3QJYA 2D2EA 4NYMQ 4B3XA 2JAQA 2JLRA 2ZJAA 3ETLA 5E4FA 1NLZA 2CDNA 3EG5A 1JEEA 3OIUA 4JKYA 4URYR 1H8ED 4P4SB 1EGAA 3C5CA 3B9PA 4WAUA 2WMNB 4Q4AA 1IN4A 5EP2A 3W6OA 1B0UA 3CRRA 4NYJR 3SJCA 1G3QA 2ASEA 2WSMA 4PZYA 3UK6A 4FWIB 2NZJA 1G291 4DJTA 2G0NA 1E9BA 2BV3A 421PA 4AK9A 4B34A 4HB2A 4AKGA 4F92B 4BFTA 1E1RD 2V55B 1OKKA 4LPKA 4AYTA 3QKSA 2EFHB 3QOFA 4QM7A 1OHHD 3A1TA 1SVSA 1SXJE 3J81k 3IIKA 1K8RA 3PIRA 4LHYA 4B47A 1US8A 1F60A 2QT0A 1T91A 4GOXA 1XF9A 1RRPA 4HUQB 2NOAA 3AKYA 4CEHA 4TYPA 2JEOA 2OCBA 5H70A 4GZLA 4Y0VA 3LQQA 3AGQA 1WP9A 3RS3A 1NP6A 1SXJD 3N2IA 5TV2A 1KHTA 1DO0A 2J41A 2ZR0A 4NPHA 4Q9KA 3Q72A 1NVVQ 1PLJA 4KSCA 1XZPA 4HAXA 5H8WA 1NLFA 2CBZA 2V8OA 4OQFA 4F7WA 1MR3F 2A9KA 2YWGA 4HEJA 5AJZA 4Z1MA 3SHWA 3V00A 2QPAA 1TEVA 2BWJA 4PPQA 5KU1A 5HTKA 3IIMA 3AEZA 1NN5A 1E9AA 1I4DD 2YC2C 5DHAA 4HDOB 3FKQA 4RFSB 4LHXA 3BB1A 4Q00A 1J8MF 4Q1FA 1FNNA 5EP4A 3FOZA 5GJVC 4EAQA 3U4QA 1E2DA 5KDOA 5BN5A 4OKSA 1W47A 1YKSA 4MDEA 1NKTA 5FOUA 4GPTA 4LYFA 3L82B 2RHMA 3PQCA 1BS1A 4TYYA 4FWTA 2FFAA 2PMKA 2OBNA 2QP9X 2BBTA 5AJXA 1SGWA 5E7MA 5J4YA 4XH9B 2Z4SA 3KQLA 3DVLA 1S8FA 4EFNA 2XEXA 3C5HA 4QL3A 5FPSA 1T5IA 2BJWA 4MKHA 1ZM9A 2W2XA 4B76A 2VF7A 2G3YA 4BRWA 1RKBA 1NY5A 4IOLA 5CLLA 3GLHB 2PX3A 1E2HA 4G5OA 4JKIA 1P7CA 3U3RA 2ZQ5A 3CR8A 4B74A 4ZCMA 1S3GA 4LJAA 4NYIR 2XB4A 4A15A 1R0ZA 2WIBA 4MKFA 3VTKA 4BFZA 2QN6A 5JWOA 2NQ2C 4OK6A 3AVUA 2XXAB 2EU8A 2NO6A 3FGNA 5BW8A 5JMTA 4ZI2A 1Z0KA 2FSIA 2JLUA 1I4LD 1II8B 1IY2A 2JDIA 3I4LA 3OEEA 1PV4A 2AL7A 3K0FB 3NIBA 2VSXA 2A30A 4GRAA 4JBXA 1E6CA 5KPDA 4BECA 5JI3E 1SHZA 3Q85A 3M4YA 3BE4A 4M1KA 3VHXA 3SJZA 5EXPA 5FPKA 1FTSA 1G41A 1X8LA 4AWXA 4M1YA 4R2IA 1SKYE 3KZ1E 4WZBE 4L16A 1WA5A 4EPTA 1EFRD 5JCPA 3I5XA 4DT1A 1Q1QA 4OI2A 2AXNA 2Z5FA 4DSUA 4KHZA 3VKHA 6Q21A 3CW2A 2V3CC 1E2PA 1QHYA 5B2ZA 3L8YA 3L0IB 3UKDA 2CCGA 2KJQA 5DLQC 2BOVA 3PG5A 4NYJQ 4A0RA 3LAWA 4Q5IA 4QHTA 3NC0C 1M6NA 2C9CA 1RRCA 2ZJ5A 2KWIA 2H5EA 2NO9A 1XDBA 3T61A 4NDZA 3T12A 1Q12A 4DIEA 1TQDA 2PLFA 3IPYA 4BFYA 1XPOA 2P2LA 4HI0E 3WRYC 2B6HA 3CF6R 4OK5A 4UJ5A 4DSOA 1LF0A 2ODEA 1AZSC 3S1AB 2OUKA 1ELOA 4BZPA 1D2NA 3O47A 2CJWA 2PCLA 3OIWA 1AS2A 4A4DA 3CLVA 5G40A 2JASA 4PAMA 3H0KA 2FWRA 4YMVA 4LBZA 1KZGB 3IDQA 1R7RA 4XTCS 5DH9A 3GD7A 1T0HB 1ZC3A 5FI0B 3P26A 1YR9A 1GWNA 3NHAA 1T3HA 2ZS8A 1OFIA 1QHXA 2B7BA 2J5XA 3EIEA 4AURA 1T5LA 4F4CA 3HYRA 3H84A 3KXKA 4I99A 2IYTA 3PEWA 3EZ9A 1FPMA 1JPNA 2V4ZA 2EWVA 1F2TA 1MH1A 2ZSAA 4NE2A 1XEXA 3RS2A 3FTQA 3F3YA 3RRNA 1RZ3A 1LV7A 2F3TA 3QI2A 1MO4A 2G1KA 1XNJA 5P21A 4JIMA 2QL6A 3A1VA 1ZCBA 2CE7A 4UNQA 3GLIE 2BBOA 2R2AA 5IK2A 2GF0A 2JCSA 3EZ7A 1H65A 1WB9A 2ZS9A 1JR3E 2GJ8A 2HXYA 3HR8A 3QSYA 3LFUA 2QM8A 5EE5B 4EQ6B 1VTKA 1VECA 1R8QA 1ZD1A 1OIWA 2HLDD 2BKUA 3P27A 3OF5A 3Q8XB 4TLEA 3EC1A 2C9YA 2OM2A 5FUWA 3BFVA 3VR6A 2H16A 2IS4A 4A0GA 3QF7A 2OESA 4NL4H 2GETA 4GZMA 5KSZA 5TVKA 2VF8A 4IDHA 4QG7A 1XD2A 3CKLA 1EX7A 2W2VA 3IBYA 3PEVA 4W5HA 2KBEA 1LVGA 3B7GA 3BH7A 3NDPA 2HYDA 3PR1A 4LZZA 4B3CA 1XTRA 1K5GA 2XNDA 4ESHA 2I3BA 3N5CA 2ZRGA 4LYJA 3VR4A 5JI2E 5KDDA 1I2DA 1KK3A 4MRSA 1E2MA 1E4YA 1L8QA 4A2WA 3VNVA 1HT2E 1P62B 1Q3HA 3EZFA 4DSTA 3AF2A 3NG1A 4JSTA 5DISB 2N1BA 1GKUB 3LBNA 4DLYA 5DNYB 4D80A 4D25A 1A4RA 2IWRA 1JQLB 1OT3A 5FTLA 2R6GA 2VQSA 4PXAA 5F98A 3W6NA 1G4AE 2XNSA 2VP5A 1VIAA 4B3FX 4F4JA 2CHQA 1CLUA 2JA1A 2XZPA 3X2SA 1DBSA 4LRWA 3VMFA 4JSYA 4JLKA 821PA 2Z6VA 3CRMA 3ZDQA 2ZRFA 5HZHA 1XBTA 1XEWX 5KUTA 1QHIA 2FPLA 1M74A 1Z8FA 2NG1A 2AX4A 1DEKA 1W4AA 2EQBA 2C5LA 2VP9A 2Y8EA 4PTLA 4W5JA 1D9XA 4JYCA 4ZKDA 4PFSA 4QOSA 4V0MA 1KI8A 3EX7C 4G5QA 1AQYA 3HR7A 1NN0A 2J0UA 2GVDC 4OHZA 3V4RA 4IOMA 2WOJA 3VNUA 2GA8A 2B8WA 3HU1A 3OHMA 1Z06A 4V0KA 3PUWA 4L9WA 4Q1BA 4LJYA 1E2FA 3SC3A 2OILA 4URXR 5CB8A 4KFSA 1QDEA 3SZRA 1Z3IX 3VX4A 1NSTA 2DFLA 2YWHA 8OHMA 2GEDA 3B13B 2GJAA 2FGKA 2YYZA 1E96A 3OAAD 1S0UA 1Z0IA 1VYUA 1E79D 3U5ZB 2C77A 2HV8A 4C0QC 2R6AA 5JEDA 3GLGB 2C03A 2HUPA 2J7PD 5JECA 2ZJBA 5EJEA 5LD2B 2DFTA 1W5SA 3LD9A 3TQFA 4AI6A 2O8EA 5C46F 4C7OB 1NG9A 2QE7D 2DHRA 4AIIA 1UEJA 3E1SA 2IS1A 1FX0B 3PUYA 3OEHA 1MV5A 4GNKA 1KO5A 2ZRCA 2E1RA 3CX8A 5DE3A 1YZTA 2DFNA 1XRJA 1GKYA 1YJ5A 1QG2A 1KI2A 1Z08A 5E3HA 4MRRA 4HAUA 3VX3A 1SVMA 2GKSA 2Q9CA 4O3MA 3BRWD 3ADDA 4YMTA 1QVRA 2HXSA 3GJ5A 1P2SA 1W46A 1ZUHA 3QKRB 2KSQA 3EASA 3A4NA 1XTJA 4H9GA 4ZIRB 4KXFB 2D3WA 1KMHA 1OYWA 5EUQB 1P2UA 3RWMB 5CLQA 5GJCA 3U3JA 1GRQA 5SZJA 5BXQC 4EDHA 1CIPA 4PPGA 1OFUX 4O0MA 3D31A 3KKMA 1A2BA 1ONBA 3CX7A 1BYUA 3B60A 1NMXA 4TT3D 1GOTA 4RZ3A 1N6NA 1T8UA 3SYKA 4W7SA 4R98A 3BH0A 4N0EA 1ZUIA 2AWOA 4ZI3A 1TEXA 4HLUC 5C4GB 3CR7A 3NH9A 5B58C 3NTUA 2G77B 4LHWA 2ZRBA 4RSGA 2QGZA 1KIMA 5HKKA 1Q3TA 4BFVA 2GVZC 4FCVA 1KI1A 2FG5A 1DOAA 5AWFC 4M2LA 2WWYA 4L8GA 1G9XA 2P5TB 2FFHA 1IJEA 1JBKA 1E0AA 1E9EA 5C2JB 2VP6A 1G8PA 4QXAA 5CM9C 1ZU5A 3AP1A 2D74A 3U7FB 4FCWA 5SZKB 4XVRA 1G8YA 1WE2A 1H8EA 3UMFA 3TSWA 4DB4A 1ZD8A 2FZLA 2PZEA 1VYTA 3CO5A 1YRBA 2WICA 3AQ4A 1KNQA 3DHWC 2A3RA 1AA9A 4PC1A 4Q4JB 3UPUA 1KJZA 3FHCB 5C18A 3AP3A 3KB2A 1NVUQ 3CB4A 3Q7QA 4NBSA 2VIIA 2YNMA 5CIQA 3QXCA 4G5RA 5JWHA 3ZQ6A 4E5UA 3RRYA 2FSFA 1D5CA 5JS8A 4EPXA 2PT5A 4L5BA 4MRNA 1F2UB 4WZ6A 2R65A 1OHHA 2GAOA 2OCYC 5CB6A 2GESA 1DS6A 3TK1A 4OI0A 4CEIA 1UDWA 2SHKA 2ZANA 4TMTA 3AVWA 4NCNA 4A8JB 2REBA 3EIHA 1SVOA 3CUEF 3ZS9A 1UBGA 5J4HA 2NTYC 3DOFA 1W7AA 4BE7B 3DDCA 4L9SA 1P73A 2GTPA 5FR1A 4DLRA 1SXJA 5EE0A 3ICEA 2BCJQ 3SI7A 1U8AA 1FMLA 1KOFA 2OFXA 2A78A 2CMKA 2FEOA 4RD4A 4IVRA 3WYGA 4IEIA 4D6PA 3JVUA 2HYIC 2XOKD 1BMFD 1TQ4A 3GEHA 3IO3A 1PUJA 3RC8A 1GRRA 1IY0A 4LSGA 2BBSA 5CDFA 3EWSA 2O8CB 1RRFA 1GIAA 1KY3A 1RW4A 3EC2A 5GADl 3U7HB 2QSYA 1XB2A 5JZVA 4JVNA 4PHHA 5KPJA 1NL3A 1UBEA 2VHJA 4RFSA 1H8HD 2FE4A 2AXPA 1Z6YA 3LBIA 3LVRE 3U7EB 3FKSD 2ZSFA 1E9SA 2FOLA 1P9NA 3UG6A 2ZRKA 3LBHA 4DDTA 3B2EA 3C41J 3CWZA 1AS0A 4LV6A 1E2LA 3CF0A 3GFOA 4Q7MB 5BQ5A 1M1YE 4LC1A 2B21A 1N25A 1NRJB 4TL8A 1TU3A 4KBGA 3T1OA 4ASUD 1ESNA 1FUUA 4R7ZA 2WWFA 3EIQA 2ZIAA 5EP1A 3M0EA 1NSFA 3GLHA 3GEIA 1G6HA 1VKJA 1Q44A 4KFTA 2H57A 1W4CA 2IS2A 5L3QB 1E9DA 1ZCAA 1G64A 2J46A 4XWAA 4RD0A 3MGCA 5K8IA 1K5DA 3GJ3A 2XXAA 5FOTA 4Q4HB 1KO7A 4E03A 4ZPXA 1UBFA 1XCPA 4I4LA 1CBUA 4B33A 1E2QA 2VP4A 5JWRA 3TW8B 1II8A 1DG1G 2W2TA 4QJ4A 2P3SA 4E07A 3ZZ0A 3PENA 2A5FA 2AKAB 5FBRB 1TQ6A 1ZAKA 2V7QD 4IW3B 4KSBA 4KBFA 1FP6A 1JALA 3EXAA 2WHXA 1UKYA 3THYB 1ZNYA 2JGNA 3IEVA 3EZ2A 4U00A 4XWKA 2WTUA 1T3SA 5L8VA 2V6IA 1S3SA 1EFRA 1SVKA 4XJXA 3MAAC 4MITA 4NZYA 4TMZA 2G0TA 1GL7A 2D06A 5AK0A 5CJPA 4HLUA 1J8YF 2BKEA 4TN1A 4KYIB 4TTPA 1Q0UA 1IONA 1J70A 4G5GA 2ZSBA 3U7GA 5FPYA 3CPJB 4GSYA 1ZRHA 1DPFA 5AUPB 3RABA 4DDUA 1P2TA 5HE8A 4QGAA 4FINA 5F2EA 1EK0A 2CL6X 2FF7A 4TLDA 1EXMA 1CULC 2N42A 5FOSA 1KI7A 3Q9LA 4YLGA 2OSBA 4PZLA 2OO7A 4Z8XA 5BYKA 2PJRA 4R71A 1W48A 4BLRA 3T06B 2V54A 3AH8A 3LX8A 4F4IA 1YR8A 1CP2A 1ZIOA 2R9VA 2ZRNA 5FUYA 3C4JA 4TTRA 3REFA 2IXEA 4IOKA 3ND8A 3E70C 2C04A 2PT7A 3KKQA 3B1XA 1CRQA 221PA 3RAPR 4G0NA 4DRZA 2EVWX 3GJ6A 3AB3A 3ONWA 1RE0A 3SQXA 1E0KA 1DAEA 3BFKA 3TLXA 3IUYA 4XD7D 3R9WA 1YR6A 2CCKA 4GMXA 1HUQA 3K70D 1OH6A 1HURA 1E99A 4RFVA 1KAOA 1DAKA 2VRWA 4Q02A 1IN5A 3ZVRA 2WJHA 4GOKA 1RFLA 1YZUA 3CZQA 3BGWA 3R7WB 3U44B 1G7RA 2HT1A 3MMPA 4QRHA 1EWRA 3SJBA 3WHLA 1U8ZA 4GBMA 4QBHA 2C98A 2GF9A 2YC4C 3UXMA 4C0BA 4WA7A 2ZRDA 1FFHA 1KNXA 3ZVNA 1X1RA 3CPEA 1ZNWA 3ZJYA 3I32A 2ZUDA 5ANRB 3HDTA 4PZZA 1VG1A 1S9HA 3SOPA 4BFUA 1R6BX 1Z0DA 1ZIPA 4ON9A 1HT1E 3WBJA 4EQ6A 2ZRLA 2O5VA 4YMWA 2HLDA 4PO1A 4JLOA 3GLIA 1XPUA 2ZVQX 4LOAA 2FSGA 5EP3A 4O2LA 3X1ZA 3QBVA 3BH6A 4IDOA 3QKTA 1CR4A 1TF2A 4LBYA 2IHBA 3ZGXA 2F55A 2IYXA 2WKRA 2QPTA 1DAMA 4LJ4A 5FTNA 3TMKA 3BAFA 2PEYA 3NBYC 1NF3A 2Q3MA 5KSOA 3O8DA 3GP8A 4CEIB 3BD9A 1UJ2A 2R8RA 1SZPA 4FW9A 4GOJA 4OHXA 2VH5R 3GJ7A 3QKUA 2Z4RA 2CLDX 4Q7KA 1L7VC 3HWSA 4BQSA 4C2UA 2F7SA 1XJCA 1RYHA 4US2R 1G5PA 1EFCA 1SXJB 1U90A 3B1ZA 3OFND 1ANKA 4LPSA 1W4BA 4PC3A 3X1DA 2RHDA 4KLNA 3NKVA 1E1QD 1DARA 4V0NA 2C2HA 3SFZA 5DN6D 2IEZA 4OHWA 3DO6A 4LCBA 5HZKA 3B8HA 4A8JC 5FOWA 3DKVA 3U61B 1Z47A 3SQWA 2GK7A 3BERA 1NMZA 3CIOA 2MMCA 3FPAA 4QNMA 4DCSA 4OHYA 2PZFA 4RCZA 2ZUBA 3LLMA 2J0VA 3B9QA 4FD2A 3TUJC 1EFHA 3F8TA 2H92A 1IN8A 1P9WA 2BHRA 3B78A 3QENA 3FHOA 4MDFA 2UVQA 4OQLA 2FU5C 4RD6A 1DVRA 1GP2A 4ESVA 2O52A 2OBLA 1FP7A 4IXNA 2FFBA 1VYVA 4RCYA 4DLZA 2AD5A 2F3RA 2QORA 2Z83A 4K46A 2QBYB 2W6JA 1U99A 2C8VA 1TUIA 2FMXA 1N6PA 4B2IA 4GT1A 4JBYA 1W0JD 1NMYA 2IYYA 3BK7A 5TY0A 4Q1CA 2J1LA 1E9RA 1KI4A 5CK4A 1XTKA 4B73A 3K09A 5DSZA 4BZQA 3MLEA 3SJAA 5J40A 2HEIA 1QHNA 5FTMA 2QENA 1OE0A 4B3DA 3TAHA 1TMKA 4US1R 3AKCA 3UMRA 2ZREA 4FN5A 2PJZA 4EFMA 3B6EA 1T8TA 4LYAA 3C7KA 1R2QA 3AGPA 1YHNA 2FEMA 1M8PA 1MKYA 2ZYTX 3OAAA 2Z43A 3V4FA 1P4SA 1GM5A 1Z6TA 4NCJA 1E79A 3RS5A 4PC6A 4Q1EA 1YZNA 3GLGA 5FBWB 3D3QA 4M21A 4TZ6A 1W44A 2QSZA 3KKPA 4HDQB 4IDNA 4EJSB 1OH7A 1D2EA 4C7OA 2QE7A 2FJUA 1IXRC 3H1TA 4TL7A 1FX0A 4A92A 1OXUA 4IRUB 4NCHA 3P1JA 1LFDB 2WWIA 3VHLB 2ZE8A 2BCGY 1KDRA 2W00A 1UPTA 3IO5A 2I1VB 1COWD 3IILA 2ZRHA 1WQ1R 3PUZA 3Q5DA 2AN9A 1N5KA 5G3ZA 3DMNA 1XJQA 2XSZD 1Z6XA 2ANCA 4QC2A 4AD8A 4D4JA 2FDCA 2P67A 2K5UA 2QM7A 3QVVA 4DUGD 3QKRA 4NCIA 2AKYA 1KO8A 2REOA 3CZPA 4A9AA 4ZIRA 2MSCB 4A36A 2HT6A 4OBEA 4M1SA 1SKYB 3PUVA 3D8BA 5CJ2A 4HAVA 5JSZB 4QNRA 5FR2A 3SNHA 4PANA 2BBWA 4M9ZA 1U0LA 1WRBA 4QKQA 4IJMA 4OI1A 4B32A 1G21E 1S1CA 4II7A 2RGNC 2KBFA 5EZ6B 1LW7A 2IUTA 2KE5A 4NH0A 4E22A 2F9LA 4XVQA 4IHQA 3BIFA 1MO6A 3TVTA 1CEEA 3OESA 4QJ5A 1G8HA 1FNMA 1G1MA 2OZEA 2IYQA 1X3SA 3HJNA 1A1VA 4YQFA 3KKNA 2VBCA 4JLAA 3H86A 3SN6A 5JFGA 3BBPA 1XXHE 2ZI5A 2ZXUA 2PH1A 2ORVA 1WF3A 4JZKA 3B85A 2AD1A 3RRZA 2RMKA 2ZI6A 4S2EA 3AUYA 3SR0A 3AVYA 1ZU4A 4PC7A 1R0XA 4DLUA 1ZBDA 4KVAA 4JLNA 3FDIA 1Z28A 4RZ2A 1XU4A 3T15A 4US0R 3TUIC 1J2JA 4QHSA 2JLVA 2PZGA 4LJ5A 4Q4JA 3KL4A 5G3YA 1U2RA 3RS0A 2GAAA 3DPUA 1ZVQA 1CJKC 3O8BA 4LHVA 2VLIA 1KK0A 2VSFA 1UFQA 1K6MA 4M53A 5FTJA 4D82A 5KO2A 2FPMA 4ZDJA 4D81A 3AVXA 2KI5A 1F2UA 4TMKA 3OIYA 3MSXA 1C9KA 5J4KA 2RAPA 3UATA 4D2IA 5J5CA 2A5GA 2GZHA 3LX5A 4Q66C 4P0TA 2ZS7A 4P4TA 4A8JA 3U6BA 4B71A 5JRJA 4RD2A 3RHFA 1CRPA 1DO2A 3DZ8A 3KJIA 3QE0A 2ZRJA 4HZIA 3G82C 5GVRA 1CJUC 1KMQA 3JVVA 3GCGA 2JLWA 4UNSA 4A6XA 3GLIB 5FBQB 4IFEA 4NU0A 5SZIA 2CHGA 4KU4A 4XWOA 3GJ4A 1JR3D 2W0SA 2WVJA 1BMFA 2XOKA 2ZSEA 4U7DA 3OE7D 1ZM4A 3ZVLA 1XMVA 2RGGA 3KJEA 1CS4C 2O8CA 1OB5A 2GNOA 1U81A 3Q7PA 4FCTA 4D26A 1JXOA 3WNDA 4JJKA 5M04A 4WW0A 3EPLA 2WWHA 1H8HA 1VHTA 1QHGA 2XX3A 4I1VA 1UM8A 3I61A 3QVUA 2FV8A 3FKSA 2AFHE 3LLUA 1TADA 1NBMA 2IYWA 5KNBA 2QGNA 1R0YA 4P31A 1S2MA 2WOOA 2R44A 3KXIA 3QQ5A 4BWYA 4Q1DA 4BRUA 3AVQA 1G5TA 3A1UA 3I5YA 1BOFA 4ASUA 1JJ7A 4BLPA 2O8FB 5F9FA 4Z54A 4PHTA 3VR5A 4LUCA 2V6JA 1SVLA 4OJQA 2WSSD 3BORA 1O3YA 2WJJA 4Y0AA 1MRSA 4FMBB 2ATXA 1HA3A 2JATA 1GNQA 2JLXA 1NI3A 4AKIA 3K9GA 5L3QA 2GEUA 2IC5A 3TE6A 2ZE7A 3ADCA 1SXJC 4EPYA 4LWZA 1AQUA 2IUSA 1ZW6A 5FBLB 5BWMA 4Q4HA 4ZV4A 1KDOA 4MQBA 2EYQA 3K8YA 3NBFA 1R10A 3BFXA 2ZE6A 4IOJA 3KXLA 4HYYA 4M1OA 3SDZA 2H17A 4TLBA 3X1WA 3NH6A 2V7QA 3NXSA 5HE9A 4LJ6A 3PUXA 1E9FA 4OK3A 1JNYA 1G7TA 1BKDR 2EYUA 1VCMA 3EARA 3THYA 4JVMA 3K0EA 1II0A 4URUR 1XD8A 1GFIA 2CNWD 3T1VA 4V0LA 4RVCA 3T1QA 5KOYA 3KFXA 4KFRA 1KAGA 3ZVMA 2P65A 2RGNA 1GL6A 2VEDA 1GVNB 5LB2A 5B30A 2IW3A 5FUVA 2GCOB 5DYIA 1CJTC 1G20E 1TPZA 3TBKA 1PZNA 4CF7A 2F43B 3DKPA 4JLVA 4CEJB 2OXCA 4JYBA 3W5JA 2AWNA 4BFWA 2BIFA 4N3NA 5BN4A 3W90A 4F93B 3IBGA 1IOZA 2JIZA 2QTVB 1F3OA 4XIGS 2RH5A 4MYTA 2QQEA 2RGDA 1HYQA 1HV8A 3QEOA 1CR1A 2YOHA 4LV8B 3MWYW 3QUSA 1IN6A 5JLJA 4PX9A 4HAWA 3BJIC 4K81B 1GSIA 1KO4A 3KDSE 3THOA 2I4IA 4HLDA 3W8RA 4IDPA 1G8GA 3RS7A 1M7BA 4EJSC 1VIYA 1A82A 2OT3B 3FB4A 1KY2A 2ZYWX 1U9IA 2RGBA 3CH5A 3VR3A 1M7HA 2XJ9A 4Q7LA 1TQ2A 4FMDB 2YOFA 1X6VA 4XD7A 4M1TA 2IWHA 3N70A 5TB5A 3UG7A 4ACBA 1NN3A 4Q48A 4ZDIA 5FBVB 1SQ5A 3WNBA 4EPRA 3QBTA 2OAP1 1DG3A 4B35A 1LS1A 2Q6TA 2V1XA 2IA5A 1OIXA 2D7CA 1E2GA 4P4UA 2QPOA 3A4LA 1XMSA 3R7WA 3U44A 3BC1A 1N5JA 4OJKA 1NIPA 3MWLA 2NMVA 1F5NA 1CXZA 1IXSB 4X8MA 5TDHA 3SBEA 1R5OA 3ASZA 4Q03A 3AVTA 4LY6A 1E4VA 4ZCIA 2RGAA 3X1YA 1UKEA 1I4TD 3KKOA 1G3IA 4PR0A 4B6FA 1CTQA 1UBCA 1C4OA 2ZTSA 3U3KA 2W58A 1S1MA 2OXRA 1G16A 4MA4A 5E7JA 3I3SR 5KDLA 3U6KA 3IHLA 4UJ3A 3BB4A 2B92A 1SHKA 2QEQA 3TSZA 1GRNA 1YU9A 3K0AB 3QF4A 3TRFA 1OXVA 5UKDA 1N6RA 2C99A 4ACAA 4IXMA 4Q18A 4HUTA 1ESMA 1G19A 1JQJC 4ABYA 4DZZA 1E1RA 1XTIA 2CL0X 1N3BA 1GDDA 2R62A 3E2IA 3TH5A 1KZ7B 4M0LA 4GP7A 3QXHA 4JL6A 5E7IA 2VP0A 1Z0JA 2AHOA 3JZMA 2YV5A 2ZSDA 3I1FA 4TSFD 3X1XA 1Z22A 4AYWA 3ADBA 4BZXA 2HJGA 2BMJA 3EAQA 4QBIA 1RYFA 4ARZB 2NZ8A 5GJWC 4PO9A 4BEBA 4WOPA 3KQHA 3IQXA 2XAUA 4B43A 1OXTA 1EFUA 1HY3A 1NY6A 3LO5A 4FMDF 1Z6GA 2ZETA 2JJ1D 3NBZC 4LBVA 3OFNA 2Z0MA 1OH5A 4OYHA 4TTQA 2ZJ2A 1BIFA 1T3LA 1XWIA 3MCAA 4DIDA 5KNCA 1E1QA 4O2RA 5DN6A 1LTQA 2WAXA 2XTNA 5IHPA 1Z5ZA 1S9DA 5K8TA 3K53A 4LV5B 3QXJA 4GI7A 2B7CA 3ZQJA 4D4KA 3QG1A 1T0JB 3IQWA 3GJ0A 5JJKA 4S35A 3GLFE 3AVVA 1G6OA 1P9RA 4LDJA 1B23P 3L43A 1SULA 1WMSA 2QI9C 1FOEB 3SS8A 4ITRC 2IYRA 4JLDA 4MYUA 4Q9LA 1Q20A 2ZJOA 2VHTA 2XGJA 2QBYA 4TMWA 3DMDA 4JJZA 4QGGA 1U8YA 4XTRA 2IBMA 3Q3JB 1W0JA 2P6RA 2KB0A 4POAA 3B1YA 5D3QA 5EXSA 2UZ3A 1O87A 1OXXK 2PCJA 1FW6A 3C16C 1IBRA 2GWHA 3C15C 1AIPA 1D6JA 1GILA 2NPIA 4C4PA 1N5IA 4JLBA 4A2QA 2IF2A 1OFHA 5GVSA 2GXSA 2O8BB 4B75A 2FH5B 3R9IA 3MJRA 2ZRMA 1TAGA 3UWOA 3M1IA 1AKEA 5AUQA 1ZD9A 4WXPA 1KYIA 3TGPA 1D9ZA 3QG5A 3VKWA 4A1FA 1Q1EA 4BFSA 5D3MA 4EJSA 2F9MA 2QAGB 5SZHB 1GAJA 3ZIAD 5KSPA 2W0MA 5BYJA 1NJGA 5J4LA 1GKIA 3IPXA 5L3SA 4V0ME 5JS7A 3IHWA 1RRGA 2DYKA 2IYLD 1COWA 2WKPA 3TVDA 1M7GA 2YWEA 3GQBA 4Q9JA 3KQKA 1JXMA 4YC7A 1EFTA 4YDHB 4TYWA 1TU4A 4CT5A 3CX6A 3ZZUA 5TXGA 2GXQA 3LH5A 4TQUS 1Z2CA 4OQMA 1WDTA 2LKDA 3M6AA 4DUGA 5TARA 2QNRA 1KDPA 3IGFA 4JL8A 4DB2A 3WXMA 2A5YB 4ILEA 4YONB 4BEJA 4FXPA 1UF9A 3MWKA 3K09C 2ANBA 2D7DA 5JSZA 1ZM3A 2O8DA 3SBDA 4DEXA 2CLSA 2ZU0C 3WRXC 5EE1A 1XJ0A 2JJ2D 3FWYA 5DI9A 2HF8A 5EZ5A 4UNRA 3KJHA 5CYPA 5L3RA 4NP6A 3WMFA 3AUXA 3BOSA 2GDJA 4JL5A 1KJYA 2GJKA 5DYGA 3TKLA 4EUNA 2CE2X 2GBLC 4NONA 4XVUA 3MWJA 3WNCA 1R8SA 1II9A 2WJVA 2F1HA 3PVSA 2HCJB 2FGJA 1NLYA 5LD2C 1Z0AA 2ATVA 3AKDA 4A2PA 4G1UC 1ZNZA 2QTHA 2GHIA 1VG8A 1OH8A 4CYMA 2ZJYA 1RJ9B 4V0OA 1OLOA 3CONA 3OZXA 2GJ9A 2E9SA 1W1WA 3A4MA 1G3RA 2WJIA 1UADA 1E2KA 3U60B 3K70B 4DEYA 5AJVB 1AS3A 2QMEA 2CLCX 2RGCA 4C30A 3LXXA 2ZU6A 4QBGB 2D4HA 4DHEA 3CRW1 1JJVA 1M2OB 1WCV1 1XMJA 5HR5A 5EQTA 5J4VA 4X8HA 4KYUA 2FZ4A 1SKQA 5G41A 3CWQA 3KUCA 3KUDA 2YKGA 4O25A 1EX6A 3LWNA 3T5DA 1YQTA 4QM6A 2ODWA 1N5LA 4JVLA 2DPXA 1HEIA 5J47A 4L4UA 1NG1A 5FL7D 1PJRA 1P72A 3FFAA 1YE8A 3NEYA 1YZKA 1R4AA 3UMSA 4A82A 5TMPA 2ZAMA 3A36A 1NVXQ 1AK2A 4U02A 4LBWA 2CK3D 3W5IA 3FVQA 5JJLA 3LA6A 1BO6A 3F0TA 1KI6B 5EXXA 1RPZA 4U5XA 1A2KC 4B44A 1GNRA 1ZP6A 3HP1A 3NHBA 4HDCA 2Q9AA 2ZITA 2FN4A 4Q19A 3RWOA 5CITA 1CF4A 1JR3A 4A0HA 4H1UA 3FFBA 4PPNA 3OE7A 4IEEA 1DADA 3DOEA 3QF4B 2FA9A 3WYAA 4URWR 2FFQA 2REXB 1NJFA 2ZI9A 4QHYA 1W2HA 4W9MC 4UQOA 2Q3FA 5FTKA 1NIJA 2AK2A 3NWJA 5FUXA 4B48A 1E2IA 4M1MA 2IYSA 4TL6A 5AJYA 5FOVA 2CEAA 2ZPTX 3HU2A 1KSFX 3W9YA 5EXTA 1LNZA 4JVSB 4TMXA 3G5UA 4A0FA 3ND9A 1OFTA 3THXB 3KQUA 1U98A 3Q5EA 2ZI4A 4C0AC 4C3ZA 4KO8A 2HF9A 3GMTA 1X86B 2VHCA 3MJHA 4D4MA 3DM9B 2EFCB 2WWXA 2X77A 1GG2A 4Q7JB 2O8FA 2C95A 3R20A 5EE3A 5JRZA 1TX4B 2IUUA 3FHTA 3ICQB 2PL3A 3N2EA 4UXJA 3A1WA 2NPFA 4D4LA 2WSSA 2JLYA 1LF5A 3THWA 2A7QA 4B2PA 1Z0FA 1DAGA 5LPNA 2V1UA 3RVBA 1YZQA 4I1UA 5KHOC 2R6CA 1HQYE 3GEEA 5C1BA 4LX0A 1R5BA 4G3XA 2OG2A 5CDFE 1E98A 2IL1A 2RB4A 3FMOB 3AVPA 1XX6A 2P6NA 1KK2A 3A58B 2GK6A 4EKDA 4OL0A 3VAAA 2YVUA 4ZO4A 5K8LA 1HH4A 4RJLA 1Q22A 3BS4A 1Y63A 1PLLA 1Q21A 2FPKA 4QFMA 1WBDA 1IQPA 3QXSA 2D62A 2YWFA 1FMJA 5DO9A 5F9HA 1UDXA 3W6PA 2VPPA 3HPQA 2CNWA 1AGRA 4DVGA 1KKMA 2ORWA 2VP2A 3KX2A 1PLKA 3AV0B 2PEZA 2QMOA 2UZIR 2W6ID 4MGZR 1AM4D 2BMEA 2IS6A 3CNNA 3DEFA 2VHQA 1G17A 4W5WA 4F38A 4MH0R 3MFYA 2NO0A 2GCOA 3QPVA 4DCTA 3L0PA 1P60A 2MSEB 3AM1A 2WPDD 2GBLA 3GLHE 1MT0A 2DCUA 3AF1A 4CIDA 4PAOA 4YXWD 2ODNA 1UAAA 2VHUA 2F43A 2XZLA 1KI3A 2J7PA 2ZRIA 3TIFA 4CEJA 2C9OA 5CM8B 1A7JA 2IYZA 1XD9A 2QUZA 3CM0A 1JEDA 1ZJ6A 5D3MB 1M34E 2VA8A 4M9QA 3KTAB 2QRNA 2WIAA 1KDTA 1RVDA 1TF7A 4IKEA 4HB0A 3DL0A 2BEKA 2ONKA 2WMOB 4Q1AA 3FE2A 1KK1A 2AR7A 2EFDB 5DI3B 1AKYA 4BFXA 5L3SB 1TF5A 5FFMA 1RIFA 2CVFA 4GP6A 3AF4A 4C0SA 1CKEA 2F6RA 3P20A 1GUAA 2OV2A 2LKCA 2QRZA 1NN1A 1GL9B 2H18A 4F91B 4DSNA 2A5JA 2MSDB 4CGZA 1MO3A 1E0SA 1VG0B 2QAGC 5AR1A 2WJGA 3EPJA 1Q57A 4KI0A 1W0KD 1AN0A 4Z8YA 3AP2A 1RC8A 2QZ4A 3MRSA 3B1VA 3FMIA 3ZLJA 4DC9A 3MG9A 4JT2A 2QMUA 2YINC 3D7MA
chains in the Genus database with same CATH superfamily
5CLFA 4ZCPA 3TUZC 3P9XA 2HMSA 3B6ZA 4BO6A 2WE8A 1E2NA 2I4LA 4P5EA 2M32A 6YASA 1WKCA 2XNHA 2F3SA 2RAUA 3TR0A 3EA0A 1H2YA 1VDZA 3ZE0B 5I7OA 1WSBA 1QORA 4EHBA 1I32A 1P74A 1MAUA 4CGYA 3W8NA 4RJTA 4EEKA 2C07A 3C8MA 4HXFB 4EBBA 3TTXA 1C4WA 2X6RA 1GZSA 1QSGA 3H7AA 3BL8A 3KPUA 4XVQA 3TVTA 2CHEA 1XRQA 1J99A 4R0MA 1N3LA 5ALIA 4G0YA 2WWWA 2WZQA 2UUBB 4CCAA 3JYHA 4CDGA 4B2LA 2QN9A 2F1OA 4FYIA 4KTVE 3OCVA 4RZIA 1TT5B 4CTNA 3ONVA 3EWAA 2ECFA 5CYOA 4EPVA 3BYZA 3OQIB 4ZARA 3CF2A 2J59A 2ZJ7A 2DPYA 2PKXA 3MUFA 3DP9A 4IIJF 1KEPA 1VLVA 3IR6A 3EY4A 1XZCA 1BXGA 4DIUA 3SR4A 3AVOA 1ADYA 1NF9A 3ZHBA 4ZJYA 3R4CA 4IQFA 4C0LA 4ZOLF 5AW0A 5I9NA 4DLSA 3HMKA 2C2KA 5BV0A 3K0AA 4AF6A 1QZZA 2LPMA 2TS1A 5EL0A 1TJ5A 1GQRA 4JJEA 1EQ2A 4DIBA 2QROA 1XHEA 3ISVA 4DA7A 1LX7A 3LYUA 4I1SA 1C29B 1X7WB 5FAKA 1K7CA 2VR1A 1GGEA 2QOEA 1DKUA 2CEKA 2DSNA 3BMNA 3Q0TA 1BGXT 1UJCA 3D8RA 4DKXA 3VYVA 2ZR9A 1OSNA 3I28A 4UCXA 2YY5A 2FB9A 3K2QA 1L5QA 4JT9A 5ADWA 3ROEA 3ZDDA 1JW9B 1M5UA 2EIHA 2ZR7A 4XB1A 1NLUA 2A14A 2EJCA 3JWPA 4HUJA 4ARZA 3BTVA 1N0VC 4B6GA 4ZYVA 7REQB 2DERA 2IXGA 3KB1A 1TCCA 2A2ZA 3VNQA 3AZPA 4EZEA 4BVGA 4GFDA 3FSGA 3H83A 5GWXA 5HOQA 3H3XA 3TLJA 3VSDA 3ZUPA 1BDIA 3TW4A 3GP5A 1SCUA 1ONPA 2JVKA 1ZUNB 1NA5A 3FUTA 4MR7B 2QT1A 1JU4A 3GVCA 1UJNA 4INOA 3RRMA 3NAGA 4G9BA 4PVDA 4ODIA 4DWJA 4HTAA 3L6OO 2D7JA 1Y80A 4LXIA 3ASYA 4D0NA 1YUBA 2H63A 5KCMA 2WHEA 2X0DA 2G88A 1KJJA 3FFXA 1WIWA 2FWIA 3L84A 4ZO8A 3TW0A 3K9HA 3PUKA 1U0JA 1DQNA 5KYVA 5C5EA 1SUPA 1Q1ZA 3B9BA 2R60A 3GLRA 3JWHA 4R2HA 2EX0A 2XA1A 1LD3A 1IM8A 5LB4A 5G53C 3X2FA 3VFDA 1OGIA 1Q1BA 1POXA 2OFPA 2ZVPX 4ZRDA 4JEMA 4KQHA 4M0FA 3NC1C 2M98A 2PS3A 2JAWA 4R1SA 3OLWA 2IY9A 1G98A 1GT91 3OX4A 3DZIA 1YR3A 1XCGB 3W8EA 2XMBA 1GZUA 4YALA 3FCEA 3GLFA 3I39X 3MM4A 3RDPA 5FPTA 4Q39A 1MXHA 3V80A 2BH2A 3KCNA 5KNDA 1H3FA 4QODA 1ULAA 1NZJA 1QO9A 1Z6AA 5LYYA 1SCKA 1OKKD 1HDGO 2R66A 4FEEA 4XWYA 3STHA 2GXUA 4D9MA 1ZK1A 2UUCB 2ZAOA 3HFRA 4TT8A 5LQUA 2OWEA 2QU7A 4DMCA 3NVKI 5BMVA 3C39A 3K9WA 1XA3A 2JI9A 2WG1A 1G5FA 1DAFA 1XK7A 3N2NA 1RNLA 2OAQ1 3MOGA 3MGGA 3JQCA 1XTQA 1J0XO 1YHZA 4KMRA 3UF0A 4GRIA 3V8RA 3T5CA 4UMDA 1C9DB 1GG5A 1QG4A 3CV3A 2WV9A 2OBXA 3BD8A 3F47A 3F7OA 4EVQA 4CEHB 2ZM5A 3QEJA 1ZVVA 4IJUA 2QL5A 2QRVB 2ZSIA 4PSAA 4YFVA 3ET5A 3K05A 3PK0A 1D07A 4DQXA 1AO0A 5DM70 1QIIA 3M81A 4MR8B 2ERCA 4TS3A 2P30A 4IG9A 3AXSA 2JZNA 3NHZA 4JA0A 4ZQIA 5THQA 3WK6A 2MOKA 3F5FA 3H16A 2GA9A 1G59A 1UEXC 3AYZB 3KXPA 3PITA 2BI8A 2Y0BA 4RQAA 4AYXA 2QA5A 3LLSA 4E5SA 2H51A 1OIVA 1ODFA 1U0GA 3QV1A 3QSGA 3PSAA 1V6CA 1I2AA 4MGKR 2DWPA 1PVOA 3B6MA 5K0GA 3FW1A 1FZQA 4BYGA 4YAKA 3V9PA 4JITA 1QWSA 4RGVA 4A1OA 4YAJA 3BWDD 4NBWA 2Z98A 1GADO 3K31A 4M1ZA 4BVAA 2VNIA 1N6HA 1DFIA 1CQWA 1PYGA 3GFFA 3U4CA 1I9GA 3OMLA 4TTJA 4Q9HA 4B6EA 4M87A 4V0QA 3ZLVA 3WWCA 4CZ2A 5FL3A 3AB8A 2DP4E 4FSDA 1N8TA 3D3EA 4TTTS 1VKRA 4BLOA 4IGEA 3M4JA 4BX8A 2IIPA 2W6JD 1HE2A 2B37A 2ZIVB 3C3DA 3EJWA 1HORA 3CZ4A 3OO0A 3CVJA 3H5WA 5DRYA 4LKRA 4EB8A 3F73A 1EFPB 3IAXA 2ZCUA 4KQWA 1GITA 2ESRA 3G7SA 3OTGA 4RIGA 1PKXA 2GASA 3T99A 3VKFA 3UMCA 2WJYA 3RLFA 5GAJA 3UQZA 4JJIA 2OC9A 2V9PA 1FXWA 2YVLA 1ZXXA 3EXHB 4ZHQA 3P0JA 4ND8A 1NPDA 4Q47A 3SXPA 2NM0A 3VH4A 1GR1A 2HPAA 5JBQA 2VWGA 3LC2O 4IDQA 4PYLA 4DMRA 2BVNA 4MRVA 2WB4A 2EW1A 4HAZA 5A05A 5JHGB 4HDKA 3DNFA 1Y4ZA 2CJPA 4MQFA 1ZI9A 1N2JA 3KQQA 1ND5A 1TOAA 4BJ6A 5GIPE 1OB2A 1LK7A 1S2OA 4F3TA 1U7XA 2GSWA 2FZKA 3ICCA 1WF6A 1A76A 3OQPA 2O0LA 3Q3CA 4NTZA 5T4BA 3RYHA 3SLGA 3NAQA 1F0PA 3I73A 5I7AA 5I9TA 2BMAA 4O4JA 1V5EA 2O23A 2H65A 1VKOA 1TUEA 3CRQA 4LJ9A 3G0HA 5DJ5A 5EZYF 2GB4A 1KJNA 4RQBA 1RWMA 2JDID 2WFZA 2ZYIA 2PKQO 1KI9A 1ZNXA 4J0FA 4AN1A 1PU2A 3KSAC 3JVIA 4Q9IA 5TGZA 121PA 1UJBA 4MULA 4H7PA 3RYIB 3BWCA 1G8KA 1QAQA 4QDJA 1OUMA 3IJPA 4UD6A 2UXCB 5AW4A 5JVDF 4QLOA 5IT5A 5AUOB 2AMLA 2V6GA 3E9CA 4TQ9A 3GNQA 1CJVC 2WP0A 1QPGA 1ISHA 3DDNA 3EMDA 2FQXA 1IBCA 3K9FC 4F5EA 4JGBA 1SIUA 2YFQA 4CKBB 1P5ZB 1LDEA 1UC9A 1XQ1A 3I42A 3SHFA 3VZQA 5D1NA 3WP0A 5TNXA 1F6BA 4H7FA 1I1OA 5J2UB 3TPFA 1PEYA 2ORIA 1T8YA 1XTUA 3DLTA 3C6ZA 3NV7A 3S28A 3T3HA 4LK3A 1FDSA 4TLAA 2J87A 4NOJA 3ROKA 3WWPA 3ICOA 2OBFA 3EZ6A 3Q0EA 1WD7A 2QRGA 1VCIA 1DT3A 4KIFA 3AR3A 2VK8A 4OP1A 1HE5A 4ZQHA 4GWGA 4Q21A 4BJHB 4BQIA 1MO5A 4RY2A 4ZKEA 5JEEA 4KYVA 4KPGA 4X84A 4K8OA 1OV6A 2GLUA 1D6SA 1JAHA 5L7TA 4MCAA 1T4GA 2ZYHA 5AM5A 1M0WA 4MZDA 1Q5PA 1GUYA 2FP4B 2FYTA 4KKXB 1HTTA 4E11A 5IWAB 1DTWA 1Z56C 3EVAA 3PGVA 1UBJS 2RJOA 3VKVA 1W36C 4IR7A 4P3YA 3VJLA 1EXNA 4GZ5A 4BASA 2Y76A 3HCOA 3LHIA 4MMXB 3GI1A 3SYTA 3USES 4RX1A 4X1IA 3SIXA 1RHMA 2YHSA 1EINA 2VBFA 4HGOA 5H68A 5CB4A 3KVVA 3DYIA 4JS0A 4P22A 1P33A 3E5MA 4QGFA 1XELA 4YUYA 4LEIA 1WLSA 3BICA 1HWYA 3K6KA 2FCRA 3M4XA 2BEJA 3OLVA 4NWIA 4PM4A 3V8NA 1IXYA 1NX9A 2MMGA 4IJVA 2BEWA 1KOLA 1KO1A 4BKQA 4BLTA 2PS1A 1WXDA 1C8LA 3ZDYB 4OYRA 2P0EA 4YRNA 2H0QA 1WDMA 1LPPA 1Y8ZA 3VGPA 1G0NA 2GKGA 1TJPB 2NGRA 3AR2A 4ZMRA 2B7LA 4CW7A 1H2RS 4XVCA 1NR1A 3P32A 2Q50A 1DJMA 3OEYA 4H59A 5KMGB 4MWCA 3ADKA 1AE1A 1HTWA 2JJ8A 2HXGA 5I5GA 4EKNB 2RKOA 4NARA 2RGEA 2OCGA 3GUVA 4P3XA 4ARSA 3UBTA 4DMUB 3HKBA 2DSTA 3BB3A 3LG2A 4ID9A 4PZCA 1PJBA 3X0DA 2BM1A 2IY7A 3O8QB 4M9SA 2CFCA 1JFVA 5CNMA 3LZCA 2JAHA 3P4XA 4QBTA 1U2TA 5IVIA 3C48A 3D5EA 1P75A 2ORYA 3VO9A 3PYMA 3RT1A 4URVR 3EHEA 4WIAA 2H4FA 3EF1A 4G85A 1GG8A 2C97A 1TYBE 2NXJA 1RQPA 3ILVA 4G4JA 1Y6GA 3UT0A 1NFQA 3RREA 1P80A 3PXEA 4YRCA 3WA6A 4B6FA 3F97A 3PEFA 1IXZA 3LW7A 2BMWA 4GRDA 3LZ6A 5K01A 1TJNA 4H0CA 4X91A 5K6RA 1RXSA 2PUDA 2GM5A 3DW3X 1DEAA 1SCDA 5FB3A 4EABA 1L4MA 3KFVA 4EPWA 3CPHA 4L7VA 3CVOA 3IOEA 3E7WA 4I19A 4IV8A 3QVXA 3EISA 2C7BA 3I92A 4HLCA 4TKUA 4Y2PA 5EIHA 1M8JA 2GRJA 3DZKA 2G09A 2KYRA 4HQOA 4O2BA 4X54A 2ONJA 3VPDA 4JJFA 3R9XB 4C01A 5F3WB 3F7MA 3D8NA 1DIHA 3VU9B 2F4VB 3VOTA 3EIUA 3Q1KA 1Z0SA 4NCKA 4PQGA 5KNBD 4X3CA 3QU2A 4AMUA 5DNCA 3W5VA 4LK2A 5A5VA 3HCWA 1N0UA 2ZUFA 2WPDA 1QF9A 2PD6A 3RANA 2X4IA 5JSYA 1NUTA 2UKDA 4H6XA 4MK4A 2JFGA 3AJ8A 1JHRA 3KAJA 4UNPA 4G0VA 5JZSA 2OM6A 5B58T 1ORDA 5I4CA 4Z3OA 3VHQA 1L7QA 2WBLC 2PQ6A 4ZDKA 4J9VA 3DVRX 4P08A 2ATEA 2ODQA 3A7DA 3H4TA 1IVYA 3DM5A 4LF7B 4BPBA 3L8ZA 5ALKA 3C98A 3I5UA 3N0VA 1WVGA 1JJAA 2O7RA 1L8OA 2R6JA 2WLTA 5F1OA 3VVBA 4F56A 3LGXA 5BSHA 3HI6A 2VJBA 4FFBA 2J9RA 5LIRA 1V4BA 1VB5A 4WBSA 8LDHA 1YASA 1YA6A 4KE8A 10MHA 2AVDA 4TZ0A 3VSBA 1VJCA 5KTMA 2NVUA 3OZEA 3D8SA 3RIGA 5GJBA 1XZDA 1WCYA 3MOIA 5LN1A 4QUBA 2IUEA 5C5IA 3JWEA 2NO5A 3GOHA 1Z4QA 2RGXA 5L3VA 3KALA 1M33A 1U1DA 4ZD6A 1EIZA 3F3MA 1V7QA 1RBMA 1NJ6A 3PFNA 4UTZA 4OG2A 3V1NA 2RHTA 4ZCSA 3G8YA 1OV4A 3P9SA 2VF2A 4WFKA 2AK3A 2WYOA 5ICFA 1TL7C 3IKMB 1IY1A 4XYMA 4QAJA 1XYVA 4EHFA 1XVTA 2PMBA 3IOYA 5IP5A 5DP1A 5EZSA 3TEMA 1FK8A 5AKXA 3SZOA 3K9BA 3D6TB 2YFYA 4DWWA 1XZGA 5DBGA 3H13A 4UNNA 1C1HA 4BLSA 1ZVMA 2KLHA 1NX6A 5LZ7A 4JUDX 2G9RA 4RD3A 3LFTA 4X8LA 3EBOA 2O9JA 3QHPA 3QOYA 4JI8B 4BEWA 1IQ0A 4J3JA 3AESB 3Q9SA 4C0KA 3MZ0A 3R09A 1JPJA 2QIPA 4HNQA 1C8BA 1HBJA 2ZJ3A 1DT5A 1RP1A 1V7PC 3INRA 3QTTA 4I3GA 4M9XA 1X1SA 3EUWA 4Y9RA 4YP6A 5FXMA 1X7DA 1VSQA 7ABPA 1DAIA 1EG7A 4FUTA 1YAJA 5IF9A 1T9HA 4RZUA 5DTQA 3PJRA 1V9SA 5G1OA 1HE8B 5I8ZA 1KSGA 1E7WA 3SG0A 2YZ2A 1TZMA 5BN3A 2FK8A 3G8BA 5TEWA 1ICIA 3U9SA 4YJHA 3MUEA 3AKZA 2B1QA 2HV9A 5AOBA 1XTZA 4FYWA 2Z2XA 4GECA 4L5IA 3S1AA 1I5EA 3T7JA 1JNXX 1YACA 1A2QA 3LWDA 3IXMA 2Q5IA 3RSOA 2EGUA 3IODA 5E1BA 1HDEA 3SD7A 4B9AA 2CD7A 5K3OA 1QHHB 4CM4B 5HKKD 3W34A 1JH8A 1E3IA 1IVNA 1Z5PA 2AXEA 2CB0A 4CNQA 2XMZA 1ZZGA 4PO8A 5FA6A 3TZCA 1O6ZA 1GYPA 5AI9A 4Z9BA 3VR2A 4NV0A 3WQSB 1U80A 1MG5A 4N12A 5DBOA 4AZ0B 3LIPA 1YZGA 3QNUA 1OI3A 1UBMS 2ZT6A 3M6WA 1AZLA 4K8RB 5I9BA 4J1TA 5D5HA 4BLQA 1E5LA 4OM7A 4E14A 1FQWA 2F1JA 4OAOA 5AUNB 2DFKB 2R85A 1I2CA 4X9XA 3V2UA 4D02A 1T4CA 1GTG1 1ENPA 1JIUA 1P6XA 1Q0RA 2B35A 3DFKA 5E6UB 1K98A 4X65B 4FWBA 3BXEA 1UJ4A 1W5FA 1SVUA 1XTSA 3G79A 1SC9A 2QW8A 4OIMA 2GDZA 2QP3A 3R0XA 5J58A 2GSDA 2Q45A 1JDZA 3U3OA 1KYXA 3PJEA 3N2ZB 3PVZA 1HFKA 2I03A 3OPQA 1DQSA 1QH1B 1G4UR 1XNGA 2R4QA 3WLTA 5B1YA 1M67A 1CF9A 1J7KA 4QDZA 2I7DA 2J48A 3MJFA 4IDCA 4TV9A 2QDKA 3UPUA 2B8TA 4UEJA 1O6CA 2ZSHA 5F7ZA 2GRUA 2TMYA 4N3BA 3WHKA 4BN5A 3IJEB 1MRNA 4PHGA 2ECQA 4UBLA 4XLTA 4GW3A 2D2EA 5JTUA 3T4PA 5E4FA 5IWCA 1TT7A 2CDNA 3A2LA 3DCJA 3DEKA 3OMWA 4HH0A 3RUIA 1ZQ9A 1H8ED 1WX1A 3C5CA 2IUFA 1MUUA 2OZPA 3U7JA 5JSQA 4Q4AA 2CKMA 3W6OA 4F1KA 1MEJA 2JAPA 3CRRA 2RONA 4AWAA 4C5AA 3C70A 4CL8A 3TM4A 3UK6A 3NWOA 3QGMA 2Y1GA 2YNMD 4GX0A 2V7BA 1FDUA 2BV3A 1OX4B 5AM0A 4AK9A 4BN0A 1ZK0A 4HB2A 4KN8A 3PUJA 4B34A 4F92B 5K03A 1XR3A 1Z2PX 1ZGZA 2D8AA 3AHEA 5D01A 1Z2DA 1ISPA 1YUMA 2FUG1 3QKSA 3NHSA 5DX1A 2YCBA 2R1UA 2ZPUA 3OMXA 3ZEAA 3A1TA 5MGNA 1SVSA 1QFMA 4MPJA 5GZ6A 1MEOA 1HYBA 1K8RA 4ZO6A 4LHYA 3ZYZA 2QT0A 1NOJA 4Y98A 3ZDAA 4G1CA 4YECA 4FIZA 3WHPA 3DV0B 4XPZA 1WUJS 2IOHA 3MB5A 4B8ZA 1P6QA 2B30A 2ISSD 2OCBA 5H70A 4GZLA 1C14A 3OJCA 4GBED 4IKOA 2EF0A 3B6KA 4MV7A 4AJIA 3RS3A 3RFUA 2WFLB 1SXJD 3D1VA 1ZSYA 5I01A 1Z74A 3H18A 2ZR0A 4Q9KA 2YN4A 4RVHA 5I7VA 1UK6A 3TIVA 1PLJA 1OA0A 1XZPA 2DWUA 4NG4A 1Y8QB 1NLFA 3U9TA 3ITDA 5AOVA 2A9KA 4S05A 1C8KA 1I80A 1YS6A 2M9MA 1O89A 3SOZA 1HFEL 1NXTA 5HTKA 1SB8A 3AEZA 1H1TA 4YCSA 1CC1S 2IKSA 4D57A 1CDEA 3FKQA 2MYUA 3OQJA 4E12A 1JIVA 5AM1A 3C4VA 4KRGA 5KDOA 4PAWA 4D8XA 1NVAA 2K4MA 1C0IA 1SWWA 5C3UA 4EVIA 3P7MA 4MAAA 2XIJA 5LKAA 2L2QA 1NI4A 4GPTA 4YJGA 1I1HA 4L5YA 3MTGA 1A5SB 2PBZA 2VSNA 2QP9X 5AJXA 3LY7A 1CSEE 2FXIA 3K94A 2Z4SA 5AI4A 4JB0A 1FY2A 3VTFA 2NUAB 3H1AA 3DVLA 1T4MA 5FQNA 4EFNA 2XEXA 5FPSA 4J7AA 4QPPA 2C2MA 1W19A 2RHLA 4MKHA 5AOAA 2ZTMA 2WTBA 1O0CA 2P8SA 4FR5A 3HNPA 1NY5A 5JXJA 3RVJA 2Y93A 4EITA 3GLHB 2X0NA 3EQZA 4M38A 1JIXA 2C0PA 4G84A 3CR8A 1FSFA 1NF8A 4B74A 3ZE8A 4GUDA 3L7KA 2QAIA 4I4TF 7MDHA 1NAIA 4JENA 4OHFA 4KXXA 2QN6A 4HWPA 4WESB 3WK9A 1KOJA 4I5FA 3TF5A 2WJZB 3DLPX 2ET6A 4OK6A 3AVUA 2EU8A 4EB0A 4OOEA 3ESDA 4R5HA 1PJCA 1P7WA 1PT6A 1WABA 2JCXA 3AUFA 3FZYA 4KQGA 3V4ZA 3ZHYA 1QGZA 3LPCA 4LZWA 4R9VA 1HLFA 1A8PA 4UD2A 2VZ8A 1NQ5A 3JVEA 2RIPA 3CSUA 1QVVA 3O4RA 4H2DA 1U7WA 1E3DA 4TSRA 4OD0A 1HFJA 4B87A 1X9IA 3L6EA 3ZI0A 3HKEA 3F5DA 4MVJF 1AY0A 3I1JA 1WW2A 3II6X 4G6ZA 4GYKA 2C4TA 4M49A 2M6KA 1FTSA 3VHXA 4R2IA 1QUFA 2VTBA 3UK0A 1GPKA 3GZJA 1WA5A 4RJIA 4QXMA 3SMQA 3I5XA 4M55A 4JI5B 4ARAA 5HFNA 1J1IA 3HDGA 1UL1X 4KHZA 3NYQA 4YT8A 2Y27A 1J9ZA 1GXSA 5JZBA 2H2AA 5B2ZA 4YLYA 5AFSA 2E5LB 2A59A 4RH1A 1EVQA 3U40A 1VBNA 2Q1SA 4PLZA 4MHSA 2KJQA 1Z5UA 3GV0A 3JD3A 5DLQC 3RBZA 1RI3A 5DB4A 5L4SA 3B20A 2NV0A 4QHTA 4YCNA 1SHTX 3VJRA 4JXZA 3VNBA 1WBJB 1AURA 2NTEA 1W85A 3EVNA 2IZ1A 3IHKA 2PUAA 1S4MA 3WYNA 1FLVA 4LDPA 3I76A 3NT5A 2YASA 2A1TR 4DIEA 4EHHA 4PF1A 4WLEA 3V1UA 2V0NA 2JZOA 3DG9A 2VYVD 3M1YA 1CK4A 4HI0E 2C5SA 4BNYA 3KZCA 1LPOA 3CUWA 1YDEA 2ODEA 5IUKC 3IBFA 4CM5A 5CCEA 1VLJA 3U80A 3MELA 1V1MB 4BV3A 2PCLA 2Z56A 3OHPA 3PL1A 2Y9PB 3DMTA 3RVKA 4EGFA 3IJRA 3CLVA 4DQKA 5HP4A 2VJMB 2I78A 4PAMA 2FWRA 2V5AA 4YMVA 4YASA 1JFSA 4LBZA 1PJQA 4UAGA 4E21A 1EU1A 1PL8A 1R7RA 3IDQA 4PE5B 5DH9A 3GA7A 3GD7A 3JQ6A 1UFRA 1UXHA 3EA4A 3PPIA 3QYJA 1HYHA 3P26A 2WZDA 4RK4A 2X42A 3WC4A 1QCDA 2QUAA 2MU1A 2JL1A 2RH8A 2ZS8A 4FMPA 1MBZA 2FPGB 4POOA 4U8GA 5EUBA 4UTRA 4F4CA 1ZD2P 1Q0LA 4BP1A 3OQMA 4R0NA 4PLHA 3KXKA 1U6KA 5G2OA 2BFWA 5F52A 1ZONA 1MV8A 2Y1OA 2M6RA 3OM8A 1W5AA 1MH1A 2EWVA 4MTLA 4NE2A 1XEXA 3RS2A 4ALLA 1XZHA 3OUZA 3KOWA 3M2PA 3RRNA 2P7IA 2ZYGA 3B1FA 1N57A 4KO3S 2QRUA 1UBKS 2G1KA 3LT5A 1LW6E 1S2IA 1PZFA 1XNJA 4GI1A 1LX6A 1AQ6A 2CXNA 2GKOA 3CCCA 4JIMA 5M29A 3CUTA 4M46A 2HREA 1DTEA 2QRPA 5T57A 3UT5B 5IK2A 1NR5A 3H9CA 2HW8A 5A7HA 1Z45A 3IB3A 5E1MA 5ENVA 2L19A 2ZWIA 5H4HA 3TDMA 1CZOA 4EI9A 5JNRA 3VOBA 3LFUA 4O08A 1NBOA 1XSEA 2Y68A 1AF4A 2GMWA 4ZT5A 5EE5B 4EQ6B 4RA6A 4QARA 1YRYE 5CCXA 4UEQA 2CXQA 3UV6A 4EECA 2HLDD 2QMZA 2J07A 3I6BA 3CY6A 3ZWDA 2PUJA 3LOUA 4NNOA 3EC1A 2FXVA 3PP8A 2OZVA 2ZSJA 3BFVA 3VR6A 2H16A 4JODA 1K7XB 2OESA 4DXHA 4YXWD 2GETA 4GZMA 4KGVA 5KQPA 4QG7A 2Q5QA 1RWQA 1GYRA 2B5WA 1T6BY 2XB6A 3PPYA 4IAOA 1MZPA 4L2IA 1MHPA 3IBYA 4W5HA 1LC3A 3R5JA 2KBEA 2YR0A 2I4RA 2R68A 3L6BA 5EKDA 3L1KA 4YEDA 4AY4A 5LJLA 1K5GA 4NU8X 3TFWA 3GEDA 3WVNA 2ILTA 2WJ6A 3M2TA 4MGHA 3T54A 1U9YA 1E18A 4R2KA 1H4QA 3IB6A 5MGBA 3EULA 4MRSA 2XCSB 1E2MA 1E4YA 1V6AA 1J1UA 4A2WA 4NZ9A 4PZ9A 3LP5A 5BQPA 1Q3HA 3KKLA 2BCEA 5L40A 2O2GA 1PS8A 3EZFA 5CD9A 4DSTA 1U8FO 5LXTA 4P83A 5ED4A 5C1OA 2C3MA 1DLIA 2N1BA 3LO8A 4DLYA 1JEQB 2WJWA 4DUYB 3TLBA 3QVWA 4IIHA 1A4RA 3GXBA 1P4HA 4GPD1 1YI1A 5IPFA 4AZWA 5CAEA 4BNJA 1LC0A 2VQSA 3FVWA 2CLOB 3HE3A 2QN7A 4JOQA 3DEIA 4LKOA 4HRVA 4LF5B 5F2NA 4ER6A 3A32A 3DHNA 1NP3A 4LXYA 4PNEA 3Q7SA 4ZCRA 3X2SA 2JA1A 4TTVA 3FDZA 2ZUVA 1H2XA 1XTPA 5IULC 4LMBA 1GPNA 4JSYA 4X00A 5DW0A 5CT4A 2AYXA 4JLKA 5FADA 4DNQA 2Z6VA 4LSMA 4XX1A 3ZDQA 4Z7OB 3NB0A 3W5AA 1XEWX 3FAZA 5ALWA 4AUKA 2TRSB 1ISRA 1Z8FA 1D1QA 3HA7A 3CEJA 4DLAA 1DEKA 1W4AA 2EDCA 2EQBA 3DWFA 4B17A 5JAPA 3ZHXA 5KNCH 1XVVA 1O97C 3NFYA 4EVRA 2OSVA 3BIOA 5A9SB 4GMHA 1PT8A 1KI8A 3EX7C 4G5QA 1AQYA 3HR7A 2HTFA 3OUTA 3DOOA 4WWHA 3FG9A 3V4RA 1JDJA 3D7KA 4FOOA 5LBUA 2ZIEA 1X1AA 3VNUA 3DFMA 5BXYA 3OHMA 1V47A 1OBCA 1GRVA 1UFKA 4K05A 4V0KA 3PUWA 4L9WA 1YQ9A 2AC4A 3KYDB 3GNLA 5J59A 4QU5A 3SC3A 3EC7A 4URXR 3P71T 4GGPA 1PEKE 1CF2O 3LY8A 4RPCA 1I7QB 1NSTA 1QYDA 1V37A 3M6FA 4XFKA 4YJDA 4FHGA 4ENRA 8OHMA 2C3YA 1BMDA 1E96A 1M8FA 4KE6A 1Y5IA 1KFCB 3R7SA 3WRYA 1S0UA 5JBNA 5LDDC 3FDFA 5FBHA 2AOUB 3ABIA 1RDFA 4W8OA 2HZBA 1GQQA 1HL3A 4RTRA 2HUPA 1GJRA 2X8BA 3ENZA 3WYCA 4G86A 3BWYA 3U4GA 1X80A 4OFZA 3DTVA 2CNLA 4L9RA 4ZOQI 1QFXA 1MX1A 2C9BA 2DBZA 5ALZA 1QO0D 1XFDA 3F74A 4AIIA 2YVKA 3MJCA 2C1EA 2CUKA 2OCIA 1QGED 3SYRA 1A7KA 2FWNA 2R8YA 3BHNA 1EBFA 4N82A 4HVTA 4H7JA 4RKYA 2JI7A 2DFNA 4X7RA 4AZ3B 4GKVA 1V16A 3WDKA 3K73O 4DABA 1UQRA 1O4VA 3VPXA 4MRRA 1QK3A 5CT5A 4KLCA 1TZBA 1SVMA 2Q9CA 1E6KA 2EL9A 3DZFA 3JQRA 3BRWD 1AK1A 2FPSA 3L8EA 4TLLB 1I5OA 3V8PA 2HXSA 2NYUA 2Z2IA 5A5EA 1ZUHA 3CO0S 2KSQA 5AT1A 2Z6UA 3VU3A 2DBVO 3F2IA 3LT0A 4H9GA 2D3WA 2BGWA 2GCEA 2JRLA 5JFTA 2BFDB 3RWMB 2OQ2A 1X77A 3KEMA 4CU5A 1IZ9A 1OFUX 5BSFA 1RM0A 1FJ2A 5HBGA 1OZHA 3B60A 4YAGA 3CE9A 1GOTA 3RO7A 3UB2A 3TW6A 2RG7A 3GPCA 1N6NA 3SYKA 2A0KA 2PDAA 3F1LA 3A3OA 3LC7O 4Q05A 3ETEA 3L6RA 3Q7IA 1ZFNA 2AWOA 2FMUA 2YDXA 4FFLA 4IQ0A 5C52B 4RTKA 1C1XB 3NH9A 3ECAA 5C4GB 3WDLA 2VZ0A 3DGFC 1SG9A 1PT7A 2G77B 3FLAA 3KD3A 3MW8A 4QX6A 3HBNA 1N9ZA 3ZOZA 1S7CA 1OI2A 2DHCA 2QGZA 2GAFA 2R97A 2ZT7A 2PYDA 4Z0HO 1FFWA 1H5QA 1YCFA 3OJWA 3PPWA 2GVZC 4FCVA 2FG5A 1YS1X 3QW4B 4JB3A 2XH8A 2ID9A 1RXYA 5JNUA 1E9EA 2G40A 3CUUA 4L3WA 2AN1A 3NALA 3BT7A 3AP1A 1SUIA 3FJ1A 1L7DA 1OBOA 3U7FB 1QIHA 4B4VA 5SZKB 1P1IA 1G8YA 3LPLA 4XVRA 3IQIX 4F4UA 1ZD8A 2FZLA 3CO5A 4PSUA 2FSUA 1YRBA 3AQ4A 4X64B 2A3RA 1TCVA 3IFSA 1F3LA 2FFJA 4YQEA 3L8FA 5F2OA 3ZU4A 4MI6A 1QX3A 4DMGA 3LFHA 2FWMX 1M8KA 5JWHA 1FYXA 3EGXB 3OF3A 2BP7B 3S8YA 3D8HA 3N8KA 1D5CA 1CJCA 3WL7A 3AWIA 4MRNA 4MV4A 3L6UA 1FIUA 1J25A 2GAOA 2OCYC 2Z57A 4G5FA 4C2BA 2W22A 3TQOA 5CB6A 4JI2B 2W8BB 2FPPA 4LX8A 3P5SA 3TK1A 4OI0A 3ORYA 4IG4A 4XFDA 3IVGA 5BNTA 2VRCD 4NCNA 3GFVA 1NSYA 1RWXA 3EIHA 3W1EA 2RI6A 1SEPA 5HK8A 3COYA 4EF4A 3MJTA 5J4HA 4G0QA 1VSTA 2QUKA 4BE7B 4U2GA 3DDCA 1BWQA 2EJTA 4M86A 1DO8A 5L7YA 3UCFA 4YYEA 4RO0A 4CM1A 2OGWA 1FF9A 4AX4A 1CUFA 3EAGA 5LA6F 1DIAA 1GUZA 1MB9A 2A78A 2X9VA 2P3QA 4I6JA 3FFWA 4MV6A 3THRA 3WYGA 4ZEVA 2EP5A 1RM5A 3INNA 3NBMA 1BMFD 4CLDA 2CLKB 2AYZA 2JBWA 3WYEA 4WEOA 1PUJA 1OA1A 3RC8A 2BR4A 1J20A 1J0DA 4LSGA 2BBSA 2XUDA 1RRFA 4K2AA 1KY3A 1RW4A 3DF9A 4N54A 4WH0A 4UM5A 3IAS6 5JRDS 1YXMA 2CLMB 2OD9A 2NU6B 5CEJA 4E4RA 2C7PA 2DB3A 2QSYA 1FXSA 1L7BA 4MUGA 4ZAZA 2X9QA 4DBZA 1L7PA 3ER9A 1YFZA 2VHJA 5ALXA 1PR9A 1RBQA 1ZL2A 2J3KA 2AXPA 2G9UA 1MAWA 3V1LA 5AH0A 4ZU3A 2D2IA 1SXPA 3EHDA 4AVYA 4IIGA 4DR5B 4GM4A 1ATZA 2A57A 2ZRKA 3CLUC 4WHMA 3I9FA 3LBHA 3PI7A 1L9XA 3CWZA 4LV6A 2GZSA 5BQ5A 2WQ6A 1M1YE 4G8JA 2I8AA 1WUHS 2XBLA 3JZDA 3LF1A 4IO0A 4LWOA 4F1JA 1I3MA 1JKIA 4QYIB 3G0OA 3K1AA 4ASUD 3ZY3A 1ESNA 1FUUA 1SD5A 2WWFA 2WHPB 3EIQA 1D7AA 3ICPA 3VR5D 3M0EA 5TLSA 4DQUA 1QS0A 5C4IA 3C1OA 2Y1LA 3QFTA 4IGKA 3QYPA 4BNKA 3FI9A 1JTFA 3MJSA 3L4SO 4IS3A 5D5PA 1VKJA 2Q2OA 4BAGA 2Z6QA 4BXOA 1X1DA 1YZVA 1L5WA 2JGDB 3DTTA 4PFKA 1ZCAA 5GP1A 3ZHCA 4XWAA 4L72A 3K20A 1U1FA 2B4AA 4KXMA 1ZHFA 2Z1NA 1HDCA 2XXAA 3NT2A 5LKRA 5FOTA 4RTNA 4RM3A 2R1VB 4DUPA 4ZPXA 5BRJA 4MHOA 4I4LA 1H6BA 4B33A 1L3CA 2ZFUA 4HT3B 4I50B 2BD0A 1LI5A 2VP4A 3SLKA 3NVMB 5L6MB 1II8A 3TCXB 4U0JA 2YJNA 5IN5A 4E07A 1DQPA 3L4JA 2A5FA 4DLTA 2AKAB 5FBRB 3ZTTA 4BFCA 5IBCA 1BWRA 1N2CB 3OU2A 3VVMA 1I24A 1FP6A 2RD2A 3THYB 1UKYA 4DQ0A 4ER5A 1NFRA 4ENQA 2B1RA 3IEVA 1PI3A 4TS4A 3QEMB 3GAFA 4OGWA 1T9KA 3SXJA 2KX7A 3KYCA 3LUGA 5K0JA 1S3SA 3K1TA 2FPXA 4WV3A 4HFJA 1BE8A 4G9GA 4XJXA 1SJ9A 2JHCA 1W4LA 4DRYA 4N01A 4JOBA 4NZYA 1CZLA 4TMZA 4EX6A 3VAZA 2J9FA 1DEHA 1GL7A 1OGYA 2D06A 4X1OA 5GPBA 2I6TA 2P6RA 4LRUA 2BKEA 4MO2A 3KOOA 3S3TA 4KYIB 4R8MA 4TTPA 1TQHA 1Q0UA 2PGAA 2W4QA 5AI5A 1IONA 3F4KA 4ARIA 4G5GA 1DRVA 1J0BA 2CFIA 1AB5A 3CPJB 4GSYA 3ESQA 4EG6A 1OBVA 2Y1KA 4NMLA 4DDUA 3P0RA 5HE8A 3LGSA 1FB5A 2E37A 2HI0A 5F2EA 3A1EA 4P86A 5BN4B 4TLDA 4XLZA 4KOEC 4CTKA 3P52A 4PRKA 1EVIA 2PL9A 1P0QA 2YIMA 2PTGA 2D1YA 1L5VA 5KTSA 2MINB 3BQMB 4BLRA 1AHNA 5CW1A 1FMCA 2DLCX 2FMIA 3T06B 1ZIOA 4N6GA 2FPIB 2JFFA 3O91A 3VTZA 1G5IA 2IXEA 4C20A 2XRYA 2PT7A 3KKQA 1AVTA 1MIOA 5DK4A 5IBPA 3RAPR 2QDXA 1QGUB 5AMXA 1J2EA 2V96A 5B2FA 4ZVSA 5A3JA 1V1RB 3D3KA 3GJ6A 4LDQA 2GR9A 2V59A 4LQLA 3VR3D 4Y6LA 3VC1A 1E0KA 4CQMB 4CQMD 3ZN2A 3IUYA 4I66A 4XD7D 3W2TA 4BE9A 1XDDA 3D64A 2V0GA 3FJYA 4MW2A 2BEUA 4RFVA 4CI9A 1W2WB 3F8SA 5IKOA 4Q02A 4R9NA 1QFJA 2IXAA 5DLDA 3ZVRA 2DT8A 4H4CA 5TQ2A 1KXJA 1RFLA 2W93A 3KM0A 2QT9A 3TCKA 4CFZA 5BP7A 3D5TA 2BHTA 5K7SA 2PUBA 1G7RA 2GNPA 1MOSA 1IM5A 3VAYA 2G36A 4TUYB 1SBTA 4QBHA 5E3IA 2Z5LA 3PT5A 1MVOA 1M76A 2YC4C