1E9FA

Mutant human thymidylate kinase complexed with tmp and adp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
211
structure length
202
Chain Sequence
b'RRGALIVLEGVDGAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDHSVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIATATEKPLGELWK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Potentiating Azt Activation: Structures of Wildtype and Mutant Human Thymidylate Kinase Suggest Reasons for the Mutants' Improved Kinetics with the HIV Prodrug Metabolite Aztmp
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 80
structure length 202
sequence length 211
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2000-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e9fA00
1DBSA 1KTVA 2FZLA 2GCNA 4W5HA 5TB5A 5EE5B 2NMVA 2ZI7A 5KPJA 4O3MA 2F43A 3F8TA 4LOAA 1JBKA 4GOKA 3WHKA 5DIFA 2BMFA 1G8YA 2NO0A 1U8AA 3ZLJA 1R2QA 2OCPA 1Z6XA 4OI2A 3IO5A 3KXKA 2J41A 4DEXA 3GPLA 4GNKA 1HQCA 4TMVA 1GFIA 3PEWA 1VCMA 2RCNA 2IF0A 1XPUA 1X1RA 3MWJA 2ORWA 2IYRA 3K0CA 2C2HA 2MSCB 1G291 2EWWA 4GT1A 2VH5R 3L8YA 5JWRA 4M53A 1SVSA 4L9SA 3A1UA 4NYJR 3EIEA 3WBJA 4ZDKA 3WHLA 5TARA 5KNDA 3FMOB 2AHOA 2GAAA 3W6OA 1DAKA 2FGKA 3TK1A 3NTUA 1OSNA 4RCZA 1LF5A 4TL7A 2A78A 2WIAA 4H1VA 4JLMA 5CDFA 4JLKA 3LBHA 3QF4B 5HE8A 3VQTA 1PUJA 2XJ4A 3ZS8A 4B44A 1A1VA 1RYFA 3LBNA 2EU8A 3U61B 1CS4C 1G6HA 3I73A 2VP6A 1RYHA 3AGQA 4B2LA 1Q0UA 5BXQC 1COWD 3GEEA 1MO4A 2TMKA 4Q19A 2QPOA 3EIHA 4C0SA 5LD2C 2DFLA 4KYUA 4D25A 2GBLA 5AJWA 2QMUA 3QVVA 2XNSA 4HDCA 4LJ4A 3S1AA 2FG5A 4EAQA 2GZAA 4LBVA 4PFSA 3AVYA 2SHKA 3I72A 4NCKA 2HCJB 5DN6D 2ODBA 4DXAA 2Z43A 3I1FA 4POAA 4B43A 1YU9A 3U3JA 1E9SA 2GEVA 2GKSA 4G01B 3RS3A 621PA 2FE4A 4IRUB 2ZM5A 1CJUC 4K81B 2B8TA 3QXJA 1YE8A 3PUYA 2FH5B 4M1OA 1F2TB 2OXCA 4BWYA 4DB4A 5JHGB 2ERYA 1TADA 2D2FA 2JEOA 2PX3A 3VFDA 2O8CA 1U81A 4PPFA 4TLBA 3IBYA 4NYJQ 1UKVY 3TQFA 5EP4A 5AWFC 1XD2A 4TTPA 5DYIA 3W6NA 3U6BA 1ZC3A 2DCUA 4IEEA 1PVOA 4DT1A 1GL9B 1D6JA 4PPGA 4LYFA 2UKDA 1BMFD 1G3IA 5EZ6B 3CRQA 2C96A 1SVKA 1HURA 2FEOA 2V1UA 4QL3A 1OFIA 4LJ8A 5DISB 4P4SA 1KZGB 4PHGA 4F92B 1E32A 3CM0A 3OE7D 3TAUA 2REBA 3SBDA 3OIYA 1OYYA 1G7SA 2QQ0A 2A7QA 2B92A 4M1TA 1AZSC 4JT4A 4QBIA 4R71A 2DWQA 1Y3AA 2DBYA 2OLKA 1G17A 4NPHA 3AKCA 3KFVA 1A5TA 4D2IA 1NJGA 3AH8A 3BAFA 1OFUX 5DH9A 5DI3A 3A37A 4BRWA 3K09A 2XZLA 1JR6A 1XU4A 4NCIA 3HU3A 3H1TA 2AXNA 1E4VA 4HB4A 4FWIB 1TPZA 1QF9A 3FMFA 3A4MA 4TL8A 3NH9A 3N2IA 5GVSA 1ZBDA 3KKQA 2WSSD 1Z6YA 3B13B 1NVVR 3T1QA 3IIJA 5IK2A 1E0AA 1VHLA 3KQHA 1WCV1 5L8VA 2YWFA 1GAJA 1HV8A 4UNRA 2QP9X 3SJAA 2QQEA 3U3KA 4M1KA 1ZUHA 5SZHB 4OI0A 4XWAA 4HZIA 1GILA 2ZS9A 4DZZA 1JR3A 1II0A 3S1AB 3RRMA 4ABYA 3VU9A 1UDWA 2A30A 4OL0A 2H8KA 1Q3TA 2Z83A 3IIMA 3SQXA 1S1MA 2GHIA 2JLYA 2CL6X 2JLQA 4DVGA 3GLHA 4V02A 4CRWB 1GVNB 3M4YA 1BO6A 4N1AA 2O52A 4F93B 2PEYA 1GG2A 1M34E 3DPUA 2HJVA 3EPLA 1P9NA 4I1SA 4LPSA 4QHTA 2NZJA 2RHMA 1T3LA 5TY0A 2O8CB 2FJUA 2YWGA 1HYQA 5JEDA 2W6JA 4BLPA 1E2IA 2AK3A 2VSOA 2DWPA 3BH0A 5CYOA 2JGNA 4QGAA 4A6PA 3I62A 1TF2A 4OQXA 1AQUA 5CK5A 1XP8A 4DT1B 4MGIR 1VIYA 1ZM4A 3C4JA 4XOIA 1MABA 1QVAA 2C77A 3LDAA 1E9CA 2R65A 3CPJB 1IY0A 3T5DA 3SZRA 4B6EA 2O8FB 1TNDA 4G5GA 2VSFA 1D2NA 1SZPA 1SXJC 1AS3A 1ZM9A 4Q1BA 1FOEB 1NVVQ 3O8RA 1NSTA 3T61A 4FMDF 5FUXA 5JCZA 4LGMA 4DB2A 3PJRA 2AR7A 4TMXA 1FP7A 3LD9A 1KDTA 3SI7A 3SR0A 3AP3A 4GPTA 4O0MA 2H17A 2QI9C 1JQJC 4BPBA 4XTRA 4QGGA 1NLFA 1HTWA 2V6JA 2G77B 2V54A 2VP2A 2XNDA 3Q3JB 4NHOA 3LX5A 3QBVA 4ARZA 1G8PA 4LHWA 1FX0A 1VG9B 3L0IB 2YWHA 1DADA 3CPHA 2IUUA 1X3SA 1Q57A 3NWJA 4Z8XA 2WAXA 3MSXA 4UNSA 5G3YA 3RABA 2P3SA 1CP2A 2Q6TA 4JJZA 4CYMA 2ERXA 1ZD1A 1QHNA 2DFNA 1HE8B 2J3EA 1KI8A 3TIFA 1JPJA 1D5CA 1UKZA 2PLFA 1I2DA 1KO8A 4EPXA 3SC3A 2IXEA 4YDSA 4RFSA 3G5UA 3TUIC 5IDVA 4TWZA 3CWZA 4GMDA 4EJSB 5JWHA 2CBZA 2FSGA 2EQBA 4KLNA 1KI6A 1OXSC 4CEHA 2XB2A 1B0UA 1N6IA 1W46A 2BM0A 2VHCA 4TLCA 3SBEA 2ZS7A 3VHXA 2WPDD 5B58C 1I2MA 1KOFA 2KB0A 3FB4A 4LHYA 1QVRA 3IHWA 3VU9B 4C0AC 3F0TA 2EWVA 3MWLA 1NY6A 4WZBE 1X8KA 4G3XA 2VP9A 1PLJA 1U8ZA 4IKEA 4URZR 4US2R 4L5BA 1ZCAA 3ZVRA 2BM1A 3GMTA 2ORIA 4NTZA 1QHHA 4LC1A 4LJ5A 4TLDA 1JI0A 1G8HA 4DUGA 4KAXA 5HR5A 3B78A 3X1ZA 1R0YA 2YC2C 3IGFA 2HF9A 1GRNA 1AZTA 4XSHA 3VKGA 1T3SA 1M7BA 3H86A 4FXPA 4IEIA 4KVAA 4RY2A 1KO4A 5FPYA 3HP1A 3V00A 1NLZA 1G16A 5C18A 1LNZA 4HLUA 5E4FA 4LV5B 1BS1A 4V0KA 5H70A 1GNQA 3OEHA 2RH5A 1KY3A 1S4QA 1NG1A 3L0PA 1GUAA 4H1UA 1A2BA 2CEAA 2W58A 1Q22A 5TVKA 3I3SR 1OB5A 2ZU6A 5IK2D 5KHOC 1MABB 4LV8B 2FN4A 2ZVQX 4V0MA 5EP2A 3KDSE 1Q20A 3TQCA 1NVXQ 4EFNA 4JYBA 2IYWA 4X8LA 2BEJA 1U0JA 2UVQA 4LJ6A 2C5LA 3TH5A 3TRFA 1OT3A 1ESMA 1JR3D 2P0EA 2ODEA 4B2IA 1PV4A 4PHHA 1P60A 4LPKA 4E22A 3VR6A 4OQMA 1OH7A 1UADA 1Z0FA 2IHYA 2IBMA 5CLQA 2WKQA 1FX0B 1EESA 2WVJA 1N0UA 1OHHA 3A4NA 4QG7A 4OKSA 1E0JA 3HYRA 1FMJA 3RDPA 3ZJYA 1L7VC 1G21E 2B8WA 2R6GA 3THXA 1YR7A 3DZDA 3BB3A 3PR1A 2FDCA 2KSQA 3LVRE 2R6AA 3IPXA 2X8AA 5EUQB 1N3BA 3LO5A 3ZVLA 3MRSA 4EKDA 2D62A 2VO1A 3ZDQA 5FOSA 1Q1QA 2VHJA 3C5HA 4FD2A 1OXTA 1KI6B 3WY9A 2F1JA 1X6VA 4UQOA 2YYZA 2OV2A 1E9BA 4ZO4A 2YZ2A 4M8NE 3HPRA 1T9HA 5JMTA 3AVPA 1F6BA 5GJVC 1XPOA 2JLSA 2O0JA 3WYGA 4BFUA 1BYIA 2ZSFA 3TR5A 2ZIAA 1W1WA 3W90A 3TVDA 3FOZA 1E1QA 1G4AE 4TT3A 4YXWA 3UPUA 1JR3E 2VP4A 4II7A 2WSMA 5JSZA 2LWIA 2CJWA 3ZQ6A 3DMDA 2XNDD 1QHHB 3T15A 5CLLA 1YZGA 3NHAA 1W5TA 1MH1A 3RS2A 4A8JC 4P4UA 4OK3A 3F5FA 4CF7A 3W6PA 5AUPB 2GCOA 4K8OA 1SULA 4HUQA 1B23P 5CJPA 2Q0HA 4D81A 3GFTA 1FQJA 3I4LA 2C98A 1E94E 4KFTA 2PMKA 2H57A 1F60A 2IXFA 1OXVA 4AYXA 3U6KA 2XTMA 2IEZA 3CH5A 4DDTA 2ZRPA 1SQ5A 1E2FA 1TF7A 4M1SA 4O2RA 1F48A 5CJ2A 4JSYA 4EUNA 2IS2A 4JBWA 3L0SA 1P3JA 2F1HA 1CR4A 1P62B 3AVQA 1G7TA 1Z6AA 2JIZA 2CCJA 4NP6A 4WXPA 2VIIA 3I32A 5FBRB 1ZNYA 1N6HA 2FF7A 2OT3B 5BW8A 3ETLA 5KSYA 3KJHA 4IXNA 3TLXA 1JB1A 5F9HA 5GADl 5CK4A 3EZ7A 4TMZA 1FNNA 4C9BA 4Q18A 2GJ9A 4BFYA 3ADCA 3EXAA 2YKGA 4LYAA 1UBFA 2Q9CA 3AKEA 1SVLA 1OPXA 1ZCBA 1R0XA 1QDEA 5TV2A 1PZNA 4KCGA 2HT6A 3CNNA 5KUTA 2KBFA 5HTKA 4A0GA 1AGRA 3JVUA 2NG1A 2JLRA 3IIKA 2BDTA 1CR1A 4MKIA 2VBCA 2G3YA 1S3SA 2N42A 5AUQA 2AKYA 5K8IA 1YZTA 1E2DA 4HZUA 2QMHA 2XB4A 3UMSA 1TL7C 1E2LA 4Q1DA 2CNWA 5EXXA 5E95A 5LPNA 4B32A 4MUAA 1G1MA 2OSBA 3Q5DA 3CZPA 4IXMA 5FUWA 3THXB 3EWAA 1JEDA 5D3QA 2RMKA 3LW7A 1FTSA 4IVRA 3VX4A 3PENA 3W5JA 4JKIA 2QL6A 1Z8FA 3OEHD 5FTLA 1OB2A 2VRWA 3GLGB 4Q7MB 2V6IA 2ZRDA 5G53C 2ZRBA 3HPQA 2CL0X 2PT7A 1XTIA 1TQ4A 2PH1A 4NL4H 1U9IC 1SGWA 2ZRHA 4H9GA 2ZJZA 2PBRA 4IW3B 1GKYA 2FWRA 3QPVA 4KI0A 2F1RA 2ZRLA 1A7JA 2CXXA 2GZDA 1N5IA 3B1VA 4Q5IA 1N5JA 5A4JA 2P65A 2CE2X 1KJZA 2D3WA 1BIFA 3Q9LA 3BS4A 4LCBA 1O87A 1Q1EA 1NY5A 4YMTA 1W49A 4PC6A 4DLSA 5JSZB 1EG7A 3L8ZA 4B3CA 3K70B 1COWA 1ZNZA 1VDZA 2C78A 3OEED 1YRAA 4HLCA 2GESA 4JVNA 2XAUA 2EW1A 4MUBA 5FI0B 2ZR0A 2EFEB 3LQRA 3A4LA 4A6XA 2BMEA 1OHHD 2GCOB 5B2ZA 4C0HA 2XTNA 4D4MA 1EK0A 4F4JA 3BH7A 3FHCB 2XSZA 5FUVA 4KSCA 1SKQA 1GZSA 4LBZA 4M22A 4US0R 2VP0A 3CKLA 2ZANA 3KL4A 5EP1A 3SN6A 3MG9A 2D06A 4FIDA 2WJJA 4HLQB 3THYB 4B47A 1XX6A 2GJ8A 3GEIA 5L3VA 1Z0DA 2NZ8A 5KU1A 1G3QA 1Q12A 1R6BX 4HLDA 5EXPA 2W0SA 4TN1A 5EUMA 1NBME 3CLVA 821PA 1S96A 4AK9A 5SZJA 2ZI9A 5EQTA 3WNDA 3IO3A 4BFSA 3UWKA 1YZQA 4A92A 2P5TB 2IUSA 4DHEA 4QBHA 1HQYE 2GJSA 3AF0A 2ZE6A 3VMFA 4JYCA 3VR3A 4C0LA 2GXUA 4TMKA 4LYJA 2Q3MA 3CF2A 2I4IA 2JLWA 4HATA 3G0HA 4TT3D 5BYJA 1P73A 1Z5ZA 4I4LA 4J0QA 1ZAKA 2BEKA 3I8XA 1BMFA 3RS5A 3G82C 3MAAC 1IXSB 3PV0A 4HZUB 4NYMR 1EGAA 1KK1A 1XCGB 3ND8A 3VR5A 1KO1A 4D4KA 2C99A 2ZSDA 3CF0A 4JKYA 3HR8A 1YZLA 1WB9A 1NSFA 3K9LA 4M1YA 1KK3A 1VKJA 4EIWA 4PPQA 1UAAA 2DB3A 4KVGA 2OBLA 4GBMA 4OQLA 4DIDA 3RYTC 2GNOA 1BH2A 5LD2B 1DAIA 4C2UA 4TYYA 2R8RA 2ZYVX 4W7SA 4AYTA 1E0KA 2JATA 2G1KA 2JIZD 1CR0A 2CE7A 5KO2A 2RGGA 4BZXA 3NBFA 5KSOA 1CJTC 1VECA 4KHZA 4BFXA 1IAQA 3CUEF 4PHFA 3DMNA 4NONA 3GLGE 1TAGA 4AC9A 4JMPA 2BIFA 3RC3A 2A5DA 2WOJA 3CR8A 1E2NA 2ONJA 5AJVB 1LVGA 4BLOA 2WSSA 2BMJA 3U7GA 3U44A 1QHXA 5FOTA 2OO7A 2RB4A 3I61A 4CDGA 4NCHA 1R5BA 2PL3A 3AV0B 4QNMA 1Z3IX 2Z4RA 2ZJOA 3MJHA 3B85A 5A5GA 1LF0A 3BBPA 3UWOA 1VCIA 4IVPA 2ANBA 2CNWD 1J99A 3SEAA 2QAGC 3H0KA 1F3OA 4PXAA 4PSAA 2WWYA 4ZDJA 3NDBB 4WBSA 3SQWA 2N1BA 4N3NA 1KKMA 4P31A 2OFWA 1ZIOA 4NYMQ 1XD9A 3BOSA 3LBIA 1TEVA 2WMNB 2P6UA 1BYUA 4FCWA 3TUJC 2OAQ1 5J4YA 2RGDA 2WWHA 2ZJ5A 4BFWA 2A9KA 4HAUA 1FFHA 1V5WA 1ZW6A 3ASYA 4AYWA 4HAZA 1YR6A 2WWXA 1U99A 4CGZA 1VTKA 1NJFA 3WRYC 5EE1A 3TW4A 4S35A 1Z07A 1DAGA 4GDFA 1XBTA 2QROA 1HEIA 2ZUDA 4MQBA 4X8OA 3Q72A 1SKYE 4DWJA 4Z54A 3IBGA 3QKUA 2QP4A 2R6FA 2HF8A 4CEJA 2RGEA 4DCTA 4UKDA 1I4TD 1UEIA 2PT5A 1O3YA 3RSOA 3IPYA 4CIDA 2GTPA 2MSEB 2QY9A 4B48A 3MFYA 4D0GA 1W4CA 5G3ZA 2QM7A 3KXIA 4HUTA 5DLQC 2ONKA 1OYWA 4MYHA 1OIXA 2NTYC 1X8JA 3CZQA 5JRJA 4A15A 2XSZD 4RSGA 4XTCS 3SNHA 4B3FX 1Z22A 2BV3A 3JVVA 1K5GA 3BORA 4A0FA 4FI3C 1G5TA 3VHLB 2JDIA 2NOAA 3DDCA 2F9LA 3GJXC 4Q9JA 5LDDC 3E70C 1N0WA 2JLVA 2YV5A 3R8CA 4ACAA 4DLUA 4PC2A 1AS0A 3RS0A 4BQSA 3NC1C 4RKFA 3QY0A 1XMVA 2EFCB 5GJWC 4DCUA 2X77A 3PUVA 4HAYA 4LHVA 1VYUA 2H7VA 1XCMA 2GK7A 1IN5A 1T8TA 3GJ5A 4A2QA 3QJYA 4QKQA 4IJMA 4Z8YA 4KBGA 2JJ2A 1MO5A 2ZI4A 2WMOB 4DJTA 1G3MA 1KDOA 3U44B 2R2AA 3AF3A 5J4KA 1N5LA 3ZZTA 4JLDA 4PO1A 2ZRKA 1IOZA 1HE1C 4KLZA 1T8UA 4NDZA 3CW2A 4HAXA 2Q9BA 3FWYA 4A4DA 3R7WB 3AVWA 4D6PA 4E07A 3NKVA 4F91B 2NO6A 2H18A 2WPDA 2O8FA 2A5JA 4PZYA 3LXRA 1UM8A 4GRAA 4TLEA 4ZDWA 2OUKA 3AVTA 1H8HA 3AF2A 3NG1A 1UJ2A 4OI4A 4OQNA 1OFTA 2OLJA 2A2ZA 3A6PC 3KKNA 3SJBA 2XGJA 4UNQA 1WP9A 1U2RA 4Y0VA 3LXXA 3BC1A 1NIJA 2IYYA 4HI0E 3VX3A 1SXJB 2PLRA 1XTSA 2XITA 1AM4D 4JL8A 3HWSA 1NI3A 2WWWA 2DR3A 1IN6A 1T3HA 1UPTA 4IOJA 1T91A 3SJCA 1Q3HA 4MRSA 1S9HA 3RSLA 1WDTA 2XXAA 4KFUA 2B6HA 2QMEA 4B74A 2RGNC 4JLOA 1YZUA 4HDOB 4NMMA 3ZZ0A 4CEJB 1WXQA 3EW9A 4PC3A 1YR8A 4JJKA 4BUJA 3AF1A 3CF6R 3FTQA 4LSGA 1U90A 3O8BA 5IRCD 5JJIA 4UXJA 4EJSA 3A1SA 5FL3A 3VKHA 3KTAA 4ZI3A 2ATVA 1T0JB 4G5OA 4MYUA 2AL7A 3L43A 2AFIE 3NDPA 3TAHA 3THOA 1DO2A 4PO9A 5AJYA 1P9WA 1AIPA 4IFBA 5CIWA 3ZIAA 4AKGA 4IFEA 5SZKB 1OXXK 4NZYA 2HJGA 4P4TA 3B1XA 2ZI5A 2IT1A 5K8UA 3QEJA 4PPNA 2PMDA 3K9NA 3SYKA 4I1OA 1N25A 2DFTA 3U7HB 3UIEA 3KKPA 4URUR 4ASUA 2W2XA 2ZSAA 1VPLA 4OBEA 4P0TA 1OH6A 1P9RA 5FTNA 4MDEA 1N6LA 1SXJD 1ZM7A 5FOWA 4C4PA 3OHMA 2D7DA 3TUZC 3MWYW 3KJEA 1E4YA 2B21A 3HYTA 3QPWA 3NC0C 1EX6A 2EYUA 3BFXA 5D3MB 5EZ5A 5CB8A 3D3QA 3P20A 1HT1E 1WBDA 3HJNA 2O8DA 2VHQA 1MO3A 1XEFA 4KJZA 4RD4A 3U3OA 3RC8A 2BCJQ 4A8JA 1IM2A 1XTKA 3H84A 2YWEA 4C0QC 2I3BA 1FTNA 3E1SA 4B3BA 3TGPA 1QRAA 1CTQA 2PEZA 3PQCA 1NN3A 1E9RA 2JAQA 1XXHE 1Z0KA 4CZ2A 4XVUA 2IYSA 3B1YA 1G8FA 1UF9A 2VLIA 1OE0A 3EASA 1WE2A 1J8MF 4B34A 3U5ZB 4CT4B 3TSWA 1VCOA 2QT1A 3M6AA 1NVWQ 3IKJA 4MYCA 2V55B 3Q85A 4GP7A 2HXYA 4ESHA 4WA7A 2JDID 3OZXA 1AS2A 1Z6TA 2W0MA 5TMPA 1YR9A 2YINC 5JI2E 4D26A 4L9WA 1AA9A 2O8BB 4CW7A 1MO6A 2GDJA 5FBQB 3CX6A 2FPMA 2ZU0C 2WAYA 2L0XA 2WBLC 2WHXA 1ANKA 1D9XA 3B60A 3GCGA 2XXAB 1E2KA 5HKKD 4A0RA 1SXJE 3AVUA 2JJ2D 4DLTA 2Y8EA 4DSTA 3RS4A 4FMCB 1CJVC 2A3RA 5DSZA 1R4AA 1Z28A 2WJVA 2X19A 3SHWA 2OCAA 3VR1A 5KPDA 5F3WB 3R9XA 2IYVA 3WYAA 4Q7LA 1SVIA 3WBKA 3ASZA 1RFLA 3KUCA 3KTAB 3JZAA 2D4HA 4DRZA 3ADDA 4DSUA 4XWOA 4XIGS 1JAHA 1WF3A 2ODWA 2QBYA 3K8YA 3QVUA 5AJXA 2QU8A 5P21A 1RRCA 3A58B 2RKOA 4Q00A 1JJVA 1H8HD 2IK8A 1EFCA 1U9IA 1RRPA 4AKEA 3REGA 2XJ9A 4BZPA 1XNJA 3KUDA 5FBVB 3T06B 3AKYA 1QHSA 3PEYA 3CNOA 4TTRA 1ZJ6A 2IEYA 3U3RA 2ZE5A 2ZSEA 4UXHA 3KKOA 2BBWA 1JPNA 2CLDX 4QNRA 1ZNWA 3C5CA 2W2VA 3N2EA 3VKWA 1M74A 3QKTA 2GAOA 4US1R 1QHIA 3ZYCA 2R6CA 4P3YA 3KB2A 4C3ZA 2KBEA 3PG5A 2OESA 5F98A 2O8DB 1NBMA 1IBRA 5FPSA 2BVNA 3QKRA 2ZYWX 5EP3A 4A8JB 5HE9A 5FI1B 1CF4A 3AEZA 1ZMXA 2JLUA 1CR2A 1X8LA 4MYTA 1OW3B 4L8GA 3FYHA 4M9SA 3LVQE 2QTHA 2BHRA 2OBNA 1EWRA 3DM5A 3HDTA 2FA9A 2VEDA 2ZE7A 2IF2A 5KDDA 3BGWA 1E1RD 4GFDA 1KYIA 4PC7A 3LLMA 4YMWA 5DO9A 5SZIA 2OFOA 3ZIAD 1GRRA 2WICA 5JS8A 4URVR 3R20A 4GZLA 1MV5A 2AKAB 2W2TA 4OHZA 1C9KA 1CLUA 4EQ6A 5AK0A 1IHUA 3B9QA 4MRNA 2IS1A 1TQ6A 3GLFE 2W83A 2X2FA 2ZR7A 4ZCMA 3OEEA 3GLIE 3CIOA 4I1UA 1UKYA 4KSBA 2IS6A 6Q21A 4Q9LA 1CRQA 1R10A 4IOLA 4ASUD 1D9ZA 1U0HC 1KSHA 2WJHA 1IXZA 2GA8A 4MITA 5GVRA 4Q9IA 4BFTA 1IN4A 1J2JA 1OIVA 2QG6A 3GP8A 4DSNA 4XWKA 2FZ4A 4OHWA 4N0DA 5FTJA 4E09A 3LNCA 4LBYA 4LX0A 1SVMA 1P61B 4YC7A 1F5NA 2NGRA 4LHZA 5FOXA 4DCNA 1CJKC 2NIPA 2ZI6A 2J46A 1JAIA 1GWNA 1NNEA 1E9DA 2QSZA 1E98A 1XJQA 3BE4A 3KQLA 5FR2A 2J87A 2FFAA 1XMSA 3GLGA 1NMXA 1W47A 5L3SB 4LHXA 1YHNA 3RNLA 3QUSA 3B8HA 3AP1A 1E2MA 1XEXB 4O25A 1VMAA 2BBSA 4R2IA 4S2EA 2QBYB 3LH5A 2PZFA 1XCPA 3V9PA 3VTKA 3BJIC 4LV6A 1AK2A 4AIIA 1R0WA 2FSIA 1OLOA 5J40A 5EE9A 2IS4A 1ONBA 1KHTA 5FPTA 2LKDA 4UNNA 1M8PA 4G5SA 4LK2A 2DFKB 2OFXA 2QA5A 4RD3A 1IY2A 4QJ4A 3BD9A 1QG2A 3SFVA 3QXXA 4LBWA 1XF9A 5FTKA 5KYKA 1ODFA 5KSZA 1ZYUA 1QBKC 2F7SA 3ZH9B 1RJ9A 1KDPA 1ELOA 1KI9A 4IDHA 3T1OA 2YOGA 3VR2A 1TMKA 2BKEA 3IHLA 3ICEA 3W3AA 4XJXA 1FNMA 2ASEA 2GJAA 1AQYA 4PANA 3SDZA 4HAVA 3FKQA 1YRBA 2ZR9A 3EPHA 4JVSB 1CRPA 2WJGA 3M1IA 2P67A 3T1VA 3REFA 3T34A 1KMQA 2LCFA 4ZI2A 1VCNA 3Q7PA 3AP2A 3I5YA 5K8LA 4BFVA 3ADKA 1N5KA 2LKCA 1FZQA 3QKRB 5BN4A 2Z5FA 4I1VA 4KO8A 4BLSA 3THYA 1KI3A 3FHOA 3GJ0A 1CKEA 2VYFA 4YQFA 2GETA 4QBGB 4C7OA 2X1VA 3WYFA 1FQKA 2RGBA 2PZGA 3T5GA 4B35A 4BEJA 2PCJA 4Q4HA 4WOPA 4M9ZA 5C4GB 1W4RA 2NPFA 2BWJA 521PA 2FPLA 4UJ3A 1G7RA 4WVFA 3B82A 2C95A 1K8RA 1IONA 3EZ2A 4RD2A 1GP2A 4Q48A 2IHBA 1FL9A 4R98A 2VL7A 4BFZA 4EQ6B 3AQ4A 3A36A 1JJ7A 2B7CA 2AFHE 3IEUA 4LZZA 3B6EA 2REOA 5J4VA 3EWSA 4IDPA 3FMIA 3NHBA 3BB1A 3RRYA 4Q1FA 2GK6A 1RIFA 4K46A 1QHYA 1ZU4A 3CB4A 1X1SA 1E99A 2JJ1A 5H1YA 4Q9KA 1K6MA 4U00A 1LTQA 2R6DA 2HYIC 2IWRA 1NBMD 2FV8A 5CIQA 2WTUA 1PLLA 1HH4A 1GKIA 5FL7A 1D8TA 1OIWA 4B3DA 4RD6A 3WMEA 2V3CC 4RZ2A 2J7PA 1L2TA 2VQSA 3RRZA 2P6NA 3B1WA 2AK2A 1KI4A 4LJ7A 4F4CA 2B7BA 3R9IA 4XVRA 1YVDA 3K9GA 4I99A 4TSFA 5DNYB 1W2GA 1CXZA 1QZXA 4DDUA 4RKEA 5KNBA 1IQPA 2ZEJA 5FTMA 1EXMA 2ZTSA 3A1WA 3ZVNA 3PFIA 2ZAOA 4M4SA 2MSDB 4LI0A 3RVBA 1R0ZA 1Z08A 2FPKA 3LAWA 1P2VA 4PC1A 3VNUA 4YLGA 1RJ9B 2ZRGA 4CT5A 2G0TA 2CLCX 1UKEA 1VG0B 1N6OA 4B73A 3QKSA 4MH0R 1KJWA 3LX8A 2F3TA 4D0NA 4RD0A 4WZ6A 2XEXA 5EJEA 1ZUNB 4AKIA 2KJQA 3U2QA 4GOXA 4ESVA 3IQXA 3GJ6A 1NN5A 1YKSA 4Q47A 2YOHA 1R5OA 1XTQA 1PLKA 2H16A 2FNAA 1WMSA 2IXGA 4DLZA 2IYZA 1GRQA 5B30A 1G3RA 1S0UA 4ZPXA 1TEXA 1E96A 2QAGB 1GKUB 4C7OB 3PVSA 3MMPA 1US8A 1Q21A 4Q1AA 1P2TA 3DVLA 3MJRA 2IYTA 1NLYA 3BWDD 3QXSA 4IOMA 1SKYB 3THWA 4Q4HB 3C41J 3HU2A 2ZS8A 2WJIA 3H2YA 3X1DA 1WA5A 4NCNA 4XD7A 1KMHA 2WWGA 2X2EA 2V1XA 5BN3A 1D2EA 4B3XA 2AN9A 2G88A 2VTKA 2C8VA 1ZVQA 2HYDA 1TU4A 3B2EA 3C14C 2K5UA 4LDJA 3U3MA 3UG7A 1XEWY 1I4LD 3GQBA 1KI1A 1E2EA 3QG1A 1QHGA 2FOLA 3EAQA 4ERNA 1N6NA 2NO1A 4NBSA 1YQTA 4G0NA 4HB3A 4PTLA 5JWOA 4YMVA 4FCTA 2QE7A 4RJLA 3AGPA 4FN5A 4ACBA 2RGNA 3W3ZB 1W5SA 4JVMA 2O8EA 1TQDA 5DE3A 4A9AA 5JHHB 1E9AA 2A5FA 3KQKA 5J47A 1LS6A 1LY1A 2QZ4A 4M1MA 1E79A 4YDHB 2GWHA 3B7GA 3OIVA 2QTVB 4AURA 4F4IA 3K0EA 4CEIB 2J59A 3VAAA 2YHSA 3QXCA 1KJYA 1JNYA 3R8FA 3DKVA 5H68A 1MRNA 2RHDA 4DLYA 4PAMA 2E9SA 3PEVA 2CLSA 2ZJYA 5ELXA 2QP3A 4G5QA 4DC9A 4IHQA 2J0VA 2DPXA 2JJ8A 5IHPA 4OHYA 4BLRA 2OILA 4V03A 1SVOA 121PA 1ZINA 4QBFA 1GITA 4D4LA 1Y63A 1FPMA 1W36D 3VNVA 1Q1ZA 3UKDA 3CRRA 1XXHA 2F9MA 4Q02A 421PA 3K1JA 4B3GA 3OIUA 2IL1A 4KV9A 1J70A 4FMBB 1KAGA 1RW4A 3LV8A 2VSXA 4JLJA 2HT1A 5AUNB 1XJCA 4GZMA 1CIPA 1MR3F 3QKSB 1KIMA 2JCSA 2ATXA 1GNPA 3R7WA 2J0QA 4ZCLA 4TMTA 1BOFA 3DHWC 2V7QD 1YZNA 1XMIA 2JA1A 5AJZA 4BLQA 1KDRA 2ZI3A 3OESA 4IOKA 1IN8A 1NVUQ 2YC4C 1MOZA 2EFHB 4FINA 2JJ1D 3NBZC 1Z6GA 2WWIA 1U8YA 4QHSA 3QEOA 2E1RA 4LC0A 1AN0A 4KITB 1ZD9A 5FOVA 1W36C 1KY2A 2R9VA 1ZM3A 1KI7A 3DZ8A 5FL7D 221PA 1US8B 3FKSD 1KSFX 1YZKA 3QOFA 1KK2A 1SXJA 1GNRA 4DLWA 4D0LB 5HZKA 2J7PD 4NCJA 3THWB 3A8TA 2N46A 1J90A 3D7MA 2QTFA 1KMHB 1MKYA 4QM6A 3OIWA 2CDNA 4AI6A 2GXAA 4URYR 2OAP1 4TSFD 5L3QA 4DKXA 1G8GA 1F2UA 1XZPA 1RRGA 4KFSA 5IF9A 4GSYA 1P7CA 4RZ3A 1NF3A 3OF5A 5FPHA 3UANA 5JRZA 1JEEA 5TXGA 1M7HA 2V9PA 4Q7JB 5BQ5A 5EE3A 3GFPA 1SHZA 2YJTD 4B71A 4ITRC 2GILA 3GFOA 1K5DA 1ZC4A 3P4YA 3QXHA 4HYYA 5DHAA 3QE0A 1IXRC 3SE0A 5KTYA 3EX7C 2ZAMA 1U94A 2REXB 1H8EA 5HZHA 1N6RA 2WJYA 3E2IA 1PJRA 3PUWA 4FMDB 2BOVA 1V43A 2OCBA 2P2LA 3ZVMA 2A5YB 2O8EB 4WAUA 4MA4A 2IWHA 1HUQA 4JZKA 3BFKA 5CM8B 2OZEA 4G5RA 2QEQA 4L4UA 2GZHA 4BGDA 1G20E 4MGKR 1N6KA 4U7DA 2FSFA 3MGCA 1L4YA 2FMXA 4PZLA 2ZRNA 2IYUA 2GF0A 5JJLA 1H65A 1KK0A 2Z6VA 3LY5A 2RGXA 1ZM2A 1CULC 4LJ9A 4DBLC 1R5NA 4ILEA 3VR4A 1DAMA 2BBTA 4OQFA 3GJ8A 3W8RA 1DEKA 2QGNA 2BKUA 2ZPTX 4FW9A 3UMRA 1EWQA 2VF7A 3QPUA 2YVUA 2J0UA 5HKKA 4XD7D 1OFHA 2AWNA 3U4QA 1P2SA 3QNUA 5D3MA 3I5XA 3U60B 5BYKA 1XXHB 2FU5C 5B57C 1Z0IA 1N6PA 4AY2A 2HV8A 3MWKA 1TTTA 3X2SA 5DGXA 4BZQA 5H8WA 1C1YA 4TLAA 2O0HA 4GL2A 4PQRA 4A2PA 2C9CA 3K0FA 1WBBA 2ZETA 1IJEA 1W0JD 2HUPA 4DLRA 3OFNA 4M9QA 2QE7D 1XFAA 2QNRA 2IYLD 4Y0AA 4NH0A 1VG1A 3ONWA 5EXSA 2D7CA 4UNPA 4EDHA 1II9A 3GLFA 2ZITA 1E0SA 1M6NA 2CHVA 4JL5A 1G64A 1G3UA 4QOSA 3GLIA 2C04A 3D6TB 2QGZA 4GP6A 4RCYA 2PCLA 2W6ID 4EPYA 1E79D 4NKRA 1DAHA 4AWXA 1TQ2A 2F43B 3V4RA 2CVFA 4B75A 2EFGA 3O8CA 3E5HA 1GL7A 3A1VA 1AJEA 1I4DD 2GCPA 2PJZA 5E7MA 4C0JA 2O8BA 4B6FA 5DHFA 1YJ5A 1OV4A 2P5SA 5DI9A 4A1FA 3TSOA 4PO8A 5L3QB 5GJBA 1EFRD 1F2UB 1NL3A 4HEJA 2CL7X 1OKKA 3QBTA 1W44A 2FX3A 3C8UA 2QENA 5E3HA 1S3GA 2E87A 1DS6A 4U02A 4TL9A 1FP6A 1P4SA 2ZRJA 4WXRA 4TZ0A 4KODA 3ECCA 2QRZA 3KJGA 3RWMB 3B5JA 5KSPA 3K0SA 3ICQB 1Z2CA 3V4FA 1DOAA 4C30A 2AXPA 1CEEA 2NO9A 2WKPA 4JVLA 2BC9A 4TZ6A 4ZKDA 3M0EA 4PSKA 1UEJA 4KU4A 5EE0A 2IA5A 1E1RA 4D82A 3F3YA 1KI2A 4RZXA 2FEMA 1VHTA 1OJLA 2ZJ8A 1E2QA 4Q4JA 2Q3HA 5E7JA 2C9OA 3CRMA 4TYPA 1ZD8A 3SS8A 721PA 1GL6A 4AD8A 3C7KA 3BK7A 3AKDA 2XOKA 4R7ZA 2CK3A 3N5CA 2ZJ2A 5FBLB 4BASA 4P33A 4MGYR 1JALA 3CX8A 2J0UB 2O0KA 4M1WA 4L16A 1A82A 1RVDA 4A0HA 1NKTA 3BERA 3KQNA 3AB3A 4PX9A 2H1LA 3BB4A 3CPEA 3WRXC 3ZS9A 3U4QB 2ZE8A 3K0AA 2R44A 2G83A 2KE5A 4C0BA 2IX3A 4DSOA 3BIFA 3DL0A 3WNCA 1OF1A 3RS7A 3P4XA 3D31A 1KAOA 4URXR 3PCRB 4A36A 3CO5A 1P6XA 3TW8B 2A5GA 2VA8A 5KOYA 1TU3A 1E2JA 3T35A 3TVTA 2DYKA 2H92A 1EFTA 1NIPA 2F6RA 3K0FB 4LUCA 3L2OB 3SU8A 1HA3A 1H8ED 4F7WA 3W8NA 1U98A 4MDFA 1Q44A 5EXTA 2ORVA 3LRPA 4JLNA 3CNLA 3OAAA 3GLFB 2ZUBA 1R8SA 3WNBA 4JSTA 3GLIB 4RFVA 4XH9B 3O47A 1IN7A 2QM8A 1GDDA 1MRSA 1XD2B 4QJ3A 1AKEA 2YNMA 3DO6A 4HDQB 4A2WA 4DCSA 1G7CA 3UATA 5C1BA 3AVOA 4X8MA 2RAPA 1XPRA 3RHFA 2BJVA 1XZQA 2Z0MA 5AR1A 3IILA 5J5CA 2ZRMA 3K0CC 2GF9A 1EFHA 4WIAA 3UK6A 1U0LA 2YOFA 4P4SB 5FR1A 3GEHA 5FBWB 4MGZR 3N70A 4TQ9A 3CONA 5FUYA 2OXRA 8OHMA 4PAOA 3EC1A 3HR7A 1JECA 4ZKEA 1C4OA 4C0KA 5J4HA 4FCVA 4OHXA 1P75A 3P27A 4L15A 2I1VB 2WZQA 4X8HA 2OEPA 2J0SA 1W2HA 3BRWD 1G5PA 1LW7A 2NO7A 1LV7A 3X1XA 4XVQA 3H4MA 4F38A 1G18A 4HAWA 4D80A 4M2LA 5L3SA 5DI3B 2IC5A 1FUUA 5DYGA 3CRW1 1VYVA 3J81k 1XEXA 1Z47A 2ZJBA 3TBKA 3IUYA 3OFND 4MRPA 3NEYA 1DVRA 2F3RA 2GRJA 3FFBA 4XSGA 1OXUA 4Q4JB 2XX3A 2UZ3A 3CH4B 5IT5A 1WQ1R 3X1WA 5JZVA 1XTRA 1CBUA 3RWOA 1Z0AA 1II8A 2GBLC 3TR0A 4RD1A 2CCKA 3GJ3A 1TUIA 4DDWA 3Q5EA 2CVHA 1ZIPA 1XMJA 1AGPA 3P26A 5CDFE 3ZD7A 2GVZC 4U5XA 1CU1A 2PX0A 2EYQA 4JLVA 2Q21A 2WV9A 1RZ3A 1JXMA 1TUEA 4BECA 3I92A 2ANCA 4R2HA 3C15C 3KFXA 3QI2A 5JCPA 5F9FA 4BE7B 1J8YF 3EZ6A 1W0KA 1KO7A 1T0HB 2G0NA 3K0AB 1NN0A 2XZPA 1NG9A 1NRJB 2HLDA 2QN6A 4HB0A 4GI7A 1KO5A 1ETUA 1OKKD 1W4AA 3W34A 2GXSA 3RRNA 4B2PA 4M0LA 3UG6A 5FFMA 4KBFA 2G1JA 5JI3E 1FUKA 3I8SA 5CYPA 3GLHB 4DDVA 1E2PA 3Q7QA 1W4BA 2BMDA 3AUXA 3C16C 2HEIA 4ON9A 4PZZA 3EC2A 1DG1G 4LY6A 3TMKA 4JIMA 4Q1CA 2Z4SA 3W9YA 1DPFA 4TYNA 4Q9HA 4QXAA 4IDNA 1W7AA 1DARA 3TE6A 3A1TA 4LJAA 1S1CA 3CX7A 3EZFA 4LRWA 1X86B 3KJIA 3MD0A 4QRHA 4WZAE 3X1YA 1IY1A 1DAFA 4E03A 4EPWA 3PUXA 1NN1A 3BFVA 2XOKD 1KGDA 3LFUA 5HCIA 5C46F 3ND9A 3PEUA 2CK3D 4Q01A 2G6BA 1S2MA 4JLBA 1GSIA 3EIQA 2AWOA 4Q03A 1EFUA 2ZSBA 5CB6A 4PAQA 4OJKA 3K53A 4V0OA 1DE0A 3PIRA 1Z29A 3UMFA 1CJMA 1N2CE 2EFDB 3K09C 1Q1BA 3AM1A 5ANRB 3AVVA 3WMGA 3P1JA 2QPTA 1S9DA 1GIAA 4ARZB 1T6NA 4AKHA 2FFHA 2OBMA 2VP5A 1E2HA 2CHGA 5E7IA 3NVAA 1E6CA 1Z0JA 4LYHA 2O5VA 3QQ5A 2ZQ5A 5B64A 1L8QA 4EJSC 4DCVA 3LW8A 2DHRA 5G40A 5UKDA 4TYWA 3OAAD 5TDHA 3LWNA 3FE2A 1II8B 2W6JD 3LQQA 4RFSB 2ZVPX 4WW0A 4NU0A 3EG5A 4MRVA 1RPZA 2V4ZA 2QUZA 4A82A 3QF7A 4YONB 5G41A 1D2MA 1L4UA 3CR7A 1KZ7B 5F2EA 2ZRIA 2ZXUA 4CEHB 4YMSA 1UFQA 4C2TA 2WKRA 1ZRHA 3PITA 4IDQA 1HY3A 3LLUA 3W5IA 4BEBA 1Z06A 1P72A 1ZNXA 4JLPA 4Q1EA 1WRBA 4BLTA 3TKLA 2OE2A 1PUIA 2FFQA 2GEUA 1A2KC 3L82B 3RAPR 3JZMA 1ZP6A 1G9XA 4TQUS 2NPIA 4W5WA 4OHVA 2KI5A 1JXOA 4G1UC 1T5IA 1QG4A 4QFMA 1E3MA 2XTZA 5LBIA 3SOPA 2IYXA 3CBQA 2QAJA 1LS1A 3TSZA 4M21A 2DY1A 2QAGA 3CRVA 5C4MA 5CITA 5M04A 1UBGA 5GJCA 3KQUA 4AG6A 3GLHE 4MKHA 3ZQJA 2RGCA 2WWFA 5FPKA 5HPYB 2JLZA 3NBYC 5BN5A 4NYIR 4LWZA 1EX7A 3KXLA 3FMPB 1TX4B 2D74A 4Q66C 1E9FA 1E69A 2GXQA 2F55A 3QSYA 1P2UA 4QHYA 1R8QA 4FMCF 1DAEA 2BBOA 3FVQA 1DELA 1MT0A 4QM7A 4M9XA 1GOTA 4Z1MA 3PUZA 1G4UR 3PXGA 4JS0A 4OK6A 4DLVA 3T1TA 2W00A 4JLAA 2V7QA 4KYIB 2ZRCA 1KSGA 4OK5A 3WP1B 3U7FB 3WXMA 5LB4A 2ZJAA 1NKSA 3WP0A 1W0KD 1N0VC 2CMKA 4Z51A 2C9YA 1ZUIA 3SJZA 3B1ZA 1HT2E 2HLDD 3NBXX 4JT2A 1R7RA 1G19A 3EARA 4EFMA 2QPAA 3QIAA 1VYTA 1NP6A 5AUOB 4CEIA 2GEDA 4EFLA 3FKSA 2J9RA 4TQAA 3UXMA 4N0EA 1XB2A 2VHUA 2Q3FA 4I81A 5BWMA 3EPJA 4NE2A 2OHFA 1IJFA 3WMFA 4YMUA 4DUGD 1AKYA 2QORA 2OCYC 4RZUA 3EPKA 5FOUA 4QC2A 1RKBA 1XDBA 2ODNA 4OJQA 2VF8A 3EA0A 3DKPA 1NMZA 1OH5A 2ZYUX 1Z2AA 2GVDC 4UJ5A 2IUTA 1FMLA 3HU1A 3O8DA 1XEWX 4TL6A 2EVWX 2GJKA 2JASA 4URWR 2VPPA 3U7EB 4JL6A 5KNCA 3EZ9A 4QJ5A 3D8BA 4KFRA 1UBCA 4PQFA 4CVNA 5L3RA 2MMGA 3BH6A 4NYIQ 1S8FA 1ZU5A 3IQWA 1GM5A 3KZ1E 4Q4AA 3MLEA 3T12A 3B9PA 4TYQA 3MUFA 2QRNA 2CCGA 2CHQA 2J5XA 1G41A 5JECA 4FWTA 4ZIRA 4TTQA 2R62A 4JBYA 3IEVA 3LA6A 2FSHA 4PHTA 5A0FA 3SYLA 2AD5A 1KKLA 2P6RA 4HLUC 4IDOA 2ZREA 2CJWB 2OG2A 3NH6A 4DIEA 4GOJA 2C03A 5KDLA 1UBEA 1KSJA 3SHFA 5JS7A 2ZRAA 2KWIA 4QGFA 5JEEA 3SYNA 2AD1A 2HDNB 1VG8A 3QENA 2J1LA 4HUQB 5JJKA 2IYQA 1VIAA 1RC8A 1ESNA 3GD7A 2MMCA 2V8OA 1RE0A 5JBQA 3MCAA 5C2JB 5JLJA 1W36B 1RRFA 1W48A 4MKFA 4V0LA 1G5RA 3FHTA 5DN6A 4HB2A 3FDIA 4LJYA 4MRRA 4ZV4A 3L0OA 2ZYTX 1DG3A 3KKMA 1BKDR 3DEFA 1LB1B 5HCNA 1P5ZB 3KB1A 1DO0A 1SVWA 2H5EA 1E2GA 3QG5A 1NMYA 2J45A 4O2LA 3TJZA 1SHKA 1W0JA 4Q21A 2F1IA 3K9HA 1JQLB 1E9EA 3KX2A 4ZDIA 2OM2A 4Q7KA 4V0ME 4B76A 4TMWA 1XTJA 4OI1A 4P32A 3AUYA 2WOOA 3ZGXA 2FGJA 2Q9AA 2W6IA 3QF4A 1T5LA 3TNFA 4BRUA 1M1YE 1XJ0A 2QSYA 4ZCIA 1TF5A 3SFZA 3NIBA 4PSVA 3IDQA 2VHTA 3DM9B 3P32A 1E1QD 4B33A 4YXWD 2QT0A 3DOFA 2ZUCA 3GJ4A 4DLXA 3R9WA 4DEYA 3FFAA 3EA5A 2PJRA 3K70D 5KDOA 2WM9B 4PR0A 3RLFA 2DWOA 4MKGA 4IVQA 1EFRA 2FFBA 1UDXA 4PQYA 1DTSA 2ECKA 2UZIR 3OE7A 2BJWA 2AX4A 1T4GA 3AF4A 3FPAA 1KNXA 4JBXA 4EPTA 4W9MC 1A4RA 1M7GA 2I1QA 1OH8A 1G6OA 5FH9A 2IW3A 1XD8A 2HXSA 1GTVA 3GJ7A 1XWIA 3BXZA 2QMOA 1M2OB 2RGAA 2PZEA 1LFDB 2JLXA 4V0NA 5J4LA 3DOEA 4KXFB 4D4JA 4EPRA 3FGNA 1FW6A 4GMXA 2ZRFA 3NXSA 3ZZUA 2D2EA 2NQ2C 2XZOA 4R9UC 5JFGA 1Z63A 2HCBA 4RVCA 1J7KA 3NEJA 4UXIA 4Z1MD 2J7KA 4EPVA 3Q8XB 4Q4AB 4OYHA 4W5JA 5K8TA 3ADBA 3ZD6A 1Z83A 4QGHA 1F2TA 2BCGY 1XRJA 3CWQA 3K70C 2WIBA 4Q4LA 4E5UA 2ZROA 1KNQA 4HSEA 4ZIRB 5CM9C 3AVXA 3RANA 5LB2A 4AG5A 2G9NA
chains in the Genus database with same CATH superfamily
1YQ9A 4OYLA 5D8DA 3TTUA 1N7GA 3P52A 4DY6A 4YMGA 1P0MA 3DXXA 4W5HA 3GOQA 4XIJA 4BNWA 2ILTA 3IIIA 3BRSA 3T0FA 4WJLA 1MAAA 4GOKA 5DIFA 2BMFA 2AEJA 2PYIA 3ULKA 2Y0EA 1V1MB 1ECLA 2ZAGA 3A6JA 4FSXA 4K9LA 4RORA 1PR5A 2G9UA 4O02B 4OMUA 1BWSA 2Y1CA 2IEBA 1ARZA 1R2QA 3I42A 1OGJA 3IPCA 2HWUA 4K9OA 4AECA 3THSA 1HORA 2QRVB 1ZBQA 1C9JA 2E7ZA 1GFIA 1KYVA 1W5FA 5HM8A 1VCMA 1FYEA 2BGTA 2C5SA 3OOEA 4K9PA 2P3QA 1CUFA 1X1RA 1Z33A 3P9KA 4EM6A 4PLVA 3O6VA 3K0CA 1A96A 2MSCB 5JCOC 3PLRA 1J33A 1GPLA 4XPIB 4L9SA 3FNRA 5ALHA 3A1UA 3WBJA 3GNLA 3WHLA 1P1KA 2H5JA 3E4CA 1OAKA 2Y4OA 1DAKA 2FKAA 4J16C 4YRZA 4RCZA 3WHIA 1Y33E 4TL7A 3ILSA 2ZSHA 3UF0A 3HBLA 4H1VA 5J63A 4ND8A 2NVUB 3ZS8A 3GUCA 5CVUA 2XJ4A 5FWAA 3PNSA 2NAFA 3QYJA 4ZT7A 2V7VA 1NVDA 2EC5A 2IHNA 1CS4C 1MC4A 1RTKA 3C24A 3O4VA 3OCWA 4LXHA 5FNVF 4AO8A 4BNFA 2A0FA 5BVGA 4LTDA 2HSJA 4LXIA 1R9NA 5BXQC 4EGAA 4EHBA 2PUFA 3D1LA 4GPZA 2GD0A 4U0KA 2AN4A 4Z0TA 1QTIA 2QPOA 3V2IA 2QW0X 5LA6A 2EBHX 4M0UA 1JT9A 2Z5GA 1BFKA 4XASA 3QVVA 1KFEB 3Q0IA 4FLEA 4HDCA 2PMCA 5C5IA 1CPYA 3S1AA 2FG5A 2DBVO 4EAQA 4PFSA 3ICOA 2VVTA 3E9NA 2P2YA 1UZUA 4O6VA 3OQNA 1J2UA 2ODBA 3BRWA 2HBZA 3H3FA 5KYXB 1DIAA 5LC1A 3RRXA 3NTQA 3TW8A 3U39A 3WLIA 4HUJA 4B43A 2Y1GA 3U3JA 3ZC3A 1THTA 1J1UA 3A6GA 1MJGM 3HBNA 3UGKA 4RCVA 4F2DA 1UQUA 3GGCA 2Z2KA 4TKVB 2Z95A 2ZM5A 1BW9A 2I55A 1L0BA 1CJUC 1QNLA 4K81B 1X80A 1YE8A 1E9VA 4M1OA 4HQKA 1U1FA 3KJNA 2A4KA 4HPWA 4BWYA 1ULAA 1QGAA 2QD2A 4HQ0A 2J6BA 3OZWA 1E5QA 3AM3A 2JGIA 1KF0A 4UE2A 3GRAA 4QJBA 2VDVE 1KZ6A 1BDBA 1RJDA 1U81A 5D7BA 4U3JB 4P3KA 4CQMB 1K06A 3JVIA 4NYJQ 5H3HA 2R0QC 5HKLA 3TQFA 4X97A 2X8JB 5EP4A 1XD2A 2YHUA 1T4MA 2DCUA 4IEEA 1IOWA 3VSCA 5HCUA 3EDYA 2P9CA 5LMUB 5KWSA 3BMCB 4MP6A 4PPGA 4MGHA 1L5MA 3D8UA 3KQOA 3J81A 5TT0A 3IQHX 2JVIA 2PGDA 4EG5A 4ENRA 4JKOA 4PZUA 1N4AA 4GOND 2FP4A 4JU8A 1F3LA 5DNWA 3V4ZA 4JBNA 1X9HA 1KZGB 4EL0A 3DF7A 2B1IA 1W4LA 2W2MA 3TAUA 2HSGA 2REBA 3OIYA 2XBUA 3BDIA 3IX7A 1FYVA 2C61A 2Q0QA 3N0RA 5EUBA 5EHQA 4ZXFA 3ZD9A 4TXHA 1RM0A 1R6XA 2W8ZA 3OEYA 2Q7OE 5CFPA 5AW2A 4R71A 2DWQA 4ZHSA 3QEBZ 1JWBB 2HPVA 5CLHA 3UXYA 3WMRA 1P6UA 3LK7A 1ATZA 4HS4A 4LRUA 5I4IA 2PZLA 5B6IA 1A5TA 2IIBA 1NJGA 4RVGA 2E4UA 2YICA 3BAFA 3NYIA 5CT9A 1OFUX 5DH9A 1B00A 4BRWA 3R75A 1I5RA 1U6JA 2FX5A 1WCYA 3QELB 3H1TA 5A5FA 1DCTA 2B61A 3PQ2A 4CL3A 2H6EA 1I4EB 1RWWA 1L5HB 1NNLA 5BOSA 1TPZA 3D7LA 5H83A 3T5BA 2B6NA 4B6QA 3QOWA 4TL8A 1MA0A 2BRUC 5K5EA 3WADA 2C1EA 1ZBDA 2AR0A 2DFVA 2X42A 1RXSA 1NVVR 3AKZA 3G0BA 1NVTA 3UB4A 2YXPX 4CQMD 1DV1A 5IK2A 3KQHA 3IERA 1WCV1 2UXCB 2I4NA 3C6KA 2O6HA 3OMLA 5TMEA 1C1XA 3UAVA 4V1CI 5L8VA 2PUAA 2XTJA 4O2BB 3P97A 4DNPA 1CDEA 1GAJA 4WBNF 1J97A 2YYYA 5KKNB 4XB6B 1BXRB 3SAJA 4F21A 3H3XA 1ENYA 4WFJA 4JJ4A 3ZW9A 2IDKA 1VL0A 3U3KA 3GZNA 3MMSA 4M1KA 1D6SA 2MYPA 4XWAA 4HZIA 4NAVA 1REQA 2ZS9A 3UJ9A 2W42A 3BIWA 3KTFA 4XUGB 1V26A 2EKLA 3KLOA 1WY7A 3MTDA 4OL0A 3CJQA 5AYVA 4MPTA 3VR6H 2WUWE 4INJA 1PR1A 1Q3TA 1GQYA 3A9CA 5A5VA 1S1MA 3A31A 2JLYA 3SQXA 2OY0A 4DVGA 3D4OA 3QLVA 3M1LA 4PSDA 2A94A 4EJ2A 3M4YA 2GNAA 2PFSA 2O52A 4KXVA 3SQLA 4RGYA 1NVGA 2NU8B 3NVDA 3DEIA 2ZYSA 3LF2A 1E1MA 4I1SA 4LPSA 4FHFA 5DTEA 3I58A 4C30A 1WVGA 2I22A 3ZPXA 2XWPA 3QWIA 3TO5A 5KNDD 2Y99A 4QICA 4NAUA 3B3AA 4QHTA 5L95A 1C3EA 3ZV3A 5H82A 5JH7A 4RHFA 1VXOA 1M72A 5A06A 3JTEA 5TY0A 5D5PA 1ISIA 5AKJA 4BLPA 3WL8A 1T1GA 2AK3A 2VSOA 1GNVA 2JGNA 2G7ZA 4A6PA 3JYHA 1AKVA 3SBXA 3ZHVA 1TF2A 2YN2A 4OQXA 3S3TA 3NW9A 5BPFA 1NXOA 5C52B 5IKEA 4N8EA 3C4JA 2G25A 4LS3A 1WNTA 2X4GA 4XOIA 3GPDG 3OP1A 2C77A 3G79A 1E9CA 1N5MA 2NXWA 4I50F 1B6RA 4R7GA 1LRLA 4HXYA 4RTQA 2Y0CA 4ND6A 2VAVA 2XCQA 3WKBA 1TNDA 1NNSA 2VTEA 2XRMA 5E38A 5JATA 5DXFA 1SXJC 1AS3A 3P2OA 1FOEB 4O4JB 3MHTA 1NSTA 3HMQA 1X1AA 1ZJYA 1A9ZA 4FMDF 1VA4A 3IP8A 3LRXA 1OQAA 4U9IS 2AR7A 2JNWA 5I3ZA 3NBQA 3UVEA 1M2WA 2EDCA 1TLTA 1QHFA 1R15A 2GFQA 1A9PA 2VBGA 2ZIWB 4O0MA 5TEVA 3UMYA 1ZGJA 2RHBA 4BPBA 1S2DA 2EW8A 3KT8A 1ZI8A 2R8YA 1K92A 3UGQA 3UAZA 1OR8A 2DPMA 4OGKA 1B3RA 2VP2A 3BWEA 4K6MA 4OFZA 5FPQA 3TFQA 3LX5A 3F3SA 1SBCA 4LHWA 1FX0A 1VG9B 2A1UA 3KB8A 2F8SA 2VCEA 1DADA 4NU8X 2P5YA 1X3SA 2EV9A 3MSXA 4RUKA 2NUTA 3G9XA 1XELA 3TMAA 3BQNB 3TQRA 4YRMA 2G4CA 3B3FA 1FVXA 2NQ8A 2VYVD 1VPEA 4RJ2A 1Z5PA 2B7LA 2EW2A 3RSFA 4CYMA 1MG5A 2XA1A 3HBAA 3ZHTA 5IKMA 1TE2A 3VPHA 3OQOA 3H11A 2NNWB 3A26A 1D5CA 3C87A 1UKZA 3KJXA 2VZEA 1QO0D 3PVCA 1I2DA 3LXUX 4EPXA 3SC3A 5JC8A 4RFSA 4WKPA 2C2GA 3G5UA 4XIFA 3QMWA 4IIFA 2RG7A 1M6VB 4TWZA 3GLUA 5IDVA 3E82A 4Y1RB 4NICA 4LF5B 4I1RA 4JSRA 4EJSB 1U8CB 5JWHA 2JCBA 2CBZA 4EA9A 3ONEA 3EXEA 4YAIA 5BV1A 3ZLUA 1YKFA 2ZJ0A 5EZYB 4CEHA 1MT3A 5IABA 3VTZA 2AFRA 1Y9EA 2BM0A 2HA6A 3Q40A 1IEXA 1QNFA 4B32A 5BRAA 3RVDA 4M0PA 4KO1S 3SBEA 3RTGA 2G36A 3DCNA 3G49A 1KOFA 3HKCB 4F1WA 3TM5A 1QVRA 5SY4A 3EVCA 3DV2A 3UJCA 5FYQA 4CLOA 3F0TA 1WMAA 5DTQA 3UA3A 3COPA 5DM1A 2QUIA 4MPJA 1W25A 2VP9A 1NBEA 3ZI4A 4D43A 4H1TA 4F96A 5E6SB 1U8ZA 3MCZA 4IKEA 4P3OA 1MIOA 1KERA 1ULZA 2V7EA 4XIYA 5E8RA 3TLAA 4E7OA 4L5BA 3AUKA 1SAYA 3GMTA 3PC6A 3PHGA 3V3KA 1TVCA 2QVXX 1R6TA 3KJFA 1JUDA 4KAXA 4X63A 4LKOA 1DEHA 5M29A 5EIEA 3BA1A 2HF9A 1D2RA 1AZTA 1FRQA 1VLLA 1T3SA 2P7IA 3H86A 4HS9A 3SZLA 3VKGA 1LK0A 5K8CA 1DV2A 5FPYA 3N8KA 2JK0A 1G16A 5C18A 4E13A 5DRTA 3AF6A 4ZVKA 1TA9A 1NRXA 3FLBA 1BS1A 2P9ZA 4OKIA 1ESDA 4V0KA 1A71A 1GNQA 1VL1A 2XD4A 3L0PA 3LQYA 5IMSA 5BSHA 4H1UA 3OY7A 1JHOA 2CEAA 3SF0A 2W58A 4RIEA 2PVPA 3RVOA 1W2WB 4FOSA 2ZVQX 1S02A 4QECA 1P1CA 3TQCA 4CCAA 1A50B 2DEUA 2BEJA 2QGFA 3ZUGA 1M0EA 1MAWA 1U0JA 3K5IA 4I3GA 4LJ6A 4TRNA 1C4WA 3N74A 3IUPA 3L1IA 5D00A 3C3XA 1TXGA 3DQZA 5C8DA 4EELA 2WG1A 1PN3A 3FPKA 2E0IA 1JR3D 1POWA 2ODEA 4R01A 3TL3A 4PG5A 4Y8VA 4BMZA 1DT5A 5DOVA 4E22A 2B78A 2I99A 4UMFA 5SY6A 1KPIA 1QYWA 4JR0A 1RHUA 1EA5A 3RKRA 3TQIA 4KRGA 2P30A 2G09A 4RV5A 4BZZA 5IZCA 2Z6QA 4NZNA 1RP1A 4B9AA 1EESA 2CZQA 4P08A 4O33A 4GPAA 3A4NA 4DBZA 4OKSA 2QTBA 1ZMRA 1BNCA 2HUNA 3V2UA 3IAXA 3P2EA 1E1LA 4K3VA 1BSVA 3HYRA 2J3HA 2WYVA 1PJ2A 1ECGA 1MF7A 2V6MA 2PH7A 2VOEA 1G21E 3D2BA 4LRTB 3I0ZA 3ZJYA 5BNTA 1QF6A 2FWIA 3LUJA 2EZUA 5CTJA 3C7TA 3NONA 5BVHB 3PR1A 3VC7A 3CN9A 4FFLA 3PHHA 4YIHA 1JE0A 3R2JA 5CGZA 1Q6ZA 3JAWB 1AN9A 2H08A 2ZAYA 4JENA 3ZDQA 3KZKA 2O2GA 2ZSUA 2VHJA 3BGOS 3L6EA 1KI6B 2YXEA 4UC0A 4KLCA 4AZWA 2J3DA 5K7SA 2WB4A 1SQ6A 1J06A 2C2YA 3FPHA 1Z2NX 3CZ9A 4IIXA 1KY4A 2CGEA 3QWHA 4HQNA 4ZO6A 2MINA 2NXCA 3BK1A 4I9UA 4ZVVA 3IEIA 1IE3A 4IJ5A 3VHXB 5BSFA 4YY3B 2JFFA 4K6FA 3G8AA 5H0IA 1F6BA 2RK6A 3H13A 4GE0A 3RI3A 1JDPA 2JLSA 2CMHA 2O0JA 3RQIA 4NBRA 2XCSB 3EQ9A 1U2ZA 4WUTA 5K0FA 3GY0A 3TR5A 1W1WA 5BMVA 3TVDA 4R5MA 1GHTA 4OMFG 3V2GA 2VTBA 3V9AA 1UAGA 1P77A 3H0EA 3V97A 2VP4A 2WP8J 1QSGA 4JP5A 5FBZA 1QH0A 2CJWA 3W2EA 4AN1A 2NO4A 3DOUA 3H5VA 3HWX1 3NHAA 3WJ1A 3AR6A 5AXDA 3RS2A 3ZWBA 3VGJA 3D7RA 1Z12A 3F2VA 3F5FA 3LC7O 3VYWA 2GCOA 4K8OA 1XTBA 2VRBA 5ULLA 4HDNB 1VI6A 4IJVA 5JMPA 3SR3A 1VSQA 5CAEA 3GFTA 1AE1A 3PDIA 2C98A 3AFOA 4PXYA 2E5LB 4KFTA 2JA2A 1LX7A 2I6XA 2E55A 3TTXA 3QEKA 2VK8A 3U6KA 2XTMA 5GIOE 4QOGA 1E3EA 1E3WA 2Q6OA 2X5OA 5CBPB 3LGSA 1T5SA 4MV0A 4RV9A 2HF7A 4IDCA 4UU8A 4MR7B 4PPYA 4Y0NA 5JCJD 3GT4A 2IW1A 1U6KA 1G7TA 2JIZA 3G8CA 1AURA 3E3OA 3RH0A 4D9GA 1QR2A 3U3RA 1W93A 1E7RA 2CY0A 1R3UA 2OT3B 3I6YA 5BW8A 3KJHA 1E1NA 1KEUA 3TLXA 1SCQA 5F9HA 3IUSA 2BONA 1M2EA 3MJCA 5E7QA 4BO3A 3NHLA 4BFYA 3PE3A 2M6SA 2CVPA 2ZWAA 3K0BA 1MPXA 1U04A 2YKGA 1C4KA 5JCOA 4MW6A 3PHCA 1OPXA 5KU7A 1X1EA 4GYJA 1T0UA 4QWWA 4YRAA 4QAJA 4A91A 1PZNA 4KCGA 2HT6A 4OJNA 1OFVA 1Q0QA 2XUDA 3PCTA 5BSVA 2CV0A 2I7XA 2NG1A 2JLRA 2B3TA 1Y5LA 2QU7A 3IIKA 1WUTA 4I4TA 1EU1A 4CG1A 4DMKA 1S3SA 4J16A 5AUQA 5K8IA 3EVTA 1YZTA 2JGEA 5DTJA 2XB4A 2QD1A 5LL6P 4F4HA 4L5CA 4Q1DA 2YVKA 2CNWA 1OI7A 5TPZD 1U0BB 2C1XA 2ZXFA 3SMQA 5E95A 2PPLA 4P4LA 1JSXA 2G5CA 2GO7A 3GLVA 2OSBA 3OJEA 4IXMA 4MDYA 4MUAA 3WYCA 2VQDA 4ETIA 1XWWA 3ZCSA 3U4IA 1E1DA 1JEDA 4YRJA 2V4MA 1Y3DE 4X1OA 2QXUA 2VUIB 2WZCA 5EA2A 2IPMA 3DE3X 4JKIA 5BORA 7REQB 1D0IA 5KSWB 1SN7A 2VJPA 2ONZA 3SGLA 2NZVG 2VRWA 3R7NA 2V6IA 1O7JA 1YNOA 5G53C 4N40A 3ZGYA 1TIKA 1CY0A 1V41E 4NL4H 1TQ4A 1BE8A 4B6OA 2RJOA 3ABZA 2IZ6A 1GGNA 1SGWA 1K88A 2YYAA 2ZJZA 2Q62A 2PBRA 5FHRA 1GKYA 1IZ9A 4L2IA 2F1RA 2ZRLA 1TQHA 2GZDA 3OCXA 5HIMA 2A84A 3C4VA 2K2WA 2CXQA 4FYXA 1H4TA 1F2VA 2UDPA 2ZB8A 3B1VA 5CB0A 3AL0C 2JD2A 1RU3A 1N7IA 4GBED 3SDBA 5TT1A 5CPBA 3L6RA 2MHCA 4E1BA 2CE2X 2D3WA 3OM8A 3Q9LA 1FFXB 2I8AA 2H65A 3KOYA 1O87A 4J75A 4M1EA 5HIIA 5AVWA 1EE1A 1IPHA 1W49A 1JFFA 2P6PA 3AIOA 4H4EA 1SBTA 1EG7A 4OHCA 5CX1A 4X7RA 3B1KA 1H4SA 1Y1PA 2C78A 5JQGF 1JU9A 1YRAA 4ABTA 1Z38A 3RIMA 1QFXA 3C3WA 1Y6ZA 3FNEA 4FUTA 3L77A 3LQRA 3A4LA 2FMHA 2BMEA 1FDVA 2LV8A 1OHHD 5JANA 4DN6A 4NDAA 2JZNA 2OCDA 3TOCA 4UTNA 3RSHA 3TE7A 4FFWA 3JSAA 3ONNA 3HKBB 1T25A 1D6MA 3AHIA 3M9XA 4KSCA 3NHUA 3ZI7A 2A14A 1GZSA 4LBZA 1PDOA 4P36A 3M6MD 1LBIA 3CKLA 4AZ0A 1UJ6A 4V38A 1T1RA 3MG9A 2D06A 4Q1VA 1V1RA 2YN0A 2IPAB 4F46A 3OHPA 2WJJA 2BM9A 3B89A 3UMVA 4YBZA 5LMNB 4B6PA 3KTDA 1M2FA 2DAPA 3ZTWA 4K6KA 3ZJ4A 3E9ZA 3N7UA 3ZQKA 1Q12A 1R6BX 4DG9A 2IVZA 4C7XA 4TN1A 5EUMA 4CKBB 3IMKA 4E3ZA 4PX5A 2HD4A 2NPOA 4N7BA 5EQTA 3WTCA 4BGEA 2UYCA 3WNDA 1FXUA 1M2HA 5CNKA 1EHIA 1U7HA 2JAHA 4K9SA 4NZ9A 4L6CA 2WAAA 4YPFA 1YB5A 1YZQA 3EIOA 3K2EA 1OD6A 3RIEA 4QBHA 3UOGA 4A92A 4CKXA 1HQYE 2QM0A 4UEKA 1F7VA 3AF0A 3STWA 4QTTB 1DOZA 3E0XA 2XI4A 2PSHA 3WOVA 2GXUA 4LF7B 4JAVC 4LYJA 2Q3MA 3GCZA 1GYQA 2FEWB 2JLWA 5L45A 1NHWA 4JA2A 5IJ0B 4EX7A 3OC0A 1CCWA 2I76A 5BYJA 1A2QA 1P73A 3WDMA 2VPIA 3AXSA 1J9GA 3RS5A 3G82C 3EUWA 1IXSB 1E6MA 4HZUB 5JCXA 2HCTA 1F6DA 1FW8A 3JYQA 1KK1A 4HLNA 4CCSA 5C81A 3ND8A 5K0BA 3VR5A 3J7AC 1KO1A 4D4KA 2C99A 2H7YA 4HRYA 2ONYA 3JRWA 3ZKWB 3WO1A 1M1ZA 4XR4A 4OA5A 2O7VA 4FR0A 4K0RA 4C21A 2YIJA 1KK3A 1D2AA 3OE1A 3VVLA 4GOMD 5KTMA 3AI2A 3LX6A 1N3LA 2B1JA 4PPQA 1UAAA 3M9LA 3N7AA 2F3SA 2DHDA 2VT6A 3AW9A 5M2QA 2G4VA 2XCIA 4DIDA 3RYTC 2IZ0A 3TR6A 3CXRA 3P9NA 3K94A 4KIUA 2H0QA 1BX0A 4HH1A 1NW9B 5LD2B 4C2UA 5TPWB 1FVOA 3CLSC 4J0FA 4AYTA 3COJA 2RJ3A 1N0HA 3KUXA 1RYDA 3FOAA 1GQ2A 3MAJA 2JATA 2WABA 5CT6A 4MUEA 4EB0A 3WAGA 3Q4GA 4KO2S 1YQXA 4MMXB 4BZXA 5KSOA 4XCXA 4I6EA 4BFXA 1IAQA 4PHFA 4NONA 1SHLA 3GLGE 4AC9A 1TLLA 1UZLA 3RC3A 4BU1A 2YZKA 2WOJA 1JPUA 3RV3A 5AJVB 1VI5A 4BLOA 1V16A 4LDZA 5LZ9A 3U44A 3FNBA 2RJNA 3GLSA 2G6TA 3F9IA 3SBOA 3NJ8A 4DTCA 4ZJUA 3UGJA 5C51B 5F3DA 3PNYA 4L0MA 1ZISA 4BNUA 4CDGA 3IEXA 3IALA 1W5EA 2Z4RA 2ZJOA 5GPBA 3B85A 3BBPA 3GU3A 5KJCA 5G4KA 3IL2A 3ODPA 3CUSA 2CNNA 1W85A 2YL2A 2L2QA 2W6QA 4KKVA 2QUHA 3H75A 1LC3A 3WLSA 1RZRD 1KRWA 3GDGA 2IRWA 1T6XA 3CLHA 1I7SB 1DKUA 3LCVB 1F3OA 1FQWA 1TRHA 3AJ8A 4PXAA 1QDLB 4JJ8A 2WE8A 3F4BA 4KK3A 4PSAA 2Y76A 2I8LA 4PRYA 3HDHA 2JHAA 4FLMA 3UV7A 3NDBB 4A3SA 4GNRA 3CGWA 3EVAA 2OFWA 3HG7A 3BOSA 5L7YA 1IZ8A 1RCFA 1TEVA 4EUHA 4IMIB 1FP4B 4TTTS 1BYUA 2ZZNA 4FYHA 2OAQ1 4M37A 2WD9A 4ARUA 2RGDA 3M1AA 2WWHA 3U81A 1P91A 4TVKA 4HAUA 2O0MA 4L5JA 5FI3A 3ASYA 4ZRMA 3O95A 1OMOA 2Z09A 1R12A 5CA1B 1GNLA 1NJFA 1D2GA 3B12A 3ZX5A 1MA3A 2ZB3A 2XUKA 2R1UA 2E6KA 4ZAFA 4TUYF 2J0EA 2M6KA 1OZGA 4XYGA 1HEIA 1J7JA 3LT5A 4YV1A 5T7BA 2CUZA 2B9EA 1H3EA 4V3CA 1V7QA 4BMSA 4OXNA 1JRLA 3D3WA 4M36A 4P1ZA 4ZC8A 4DCTA 1MJ5A 1I4TD 3IESA 2D13A 1O3YA 4EW6A 4Z0PA 2I2BA 2GTPA 4HEA6 2VFAA 2V45A 4G2TA 5LOVF 3E05A 3QTTA 1DWQA 3V8RA 3OUUA 1CUJA 4GVLA 4EO9A 3T7KA 2QM7A 2ONKA 5K3BA 4GKVA 2W8BB 2OP1A 2B30A 1SCIA 1G55A 3WGHA 4RTKA 2NTYC 1HMPA 1UJNA 4XTCS 1UWLA 1EVKA 3SNHA 2QVCA 2BV3A 3I9V1 3JVVA 4NOMA 3S2FA 3AEKB 1PR6A 3LBAA 4FEAA 3BZWA 3RVLA 2XLCA 3DAPA 3DDCA 2GLTA 4GZ3A 4YAJA 2X6TA 2XUIA 2YV5A 1A4XA 4U2GA 3TD9A 2Z04A 3F1KA 3G7NA 3K8OE 3S8MA 4W8GA 1XZEA 3NR2A 3RS0A 4RKFA 1YJBA 4AO7A 2P2CA 1JHRA 2EFCB 1RYYA 5GJWC 4Y1EA 3V8EA 2R87A 4X6UA 3CY6A 3PUVA 4ES6A 3DMGA 2IOHA 4HRXA 2C7VA 4QDTA 2H7VA 4AVYA 1WXHA 2FN3A 4LDPA 2EGUA 3K31A 4P83A 5IMBA 1U5BA 3I0NA 3QJYA 4K9MA 3CCBA 3AF5A 1L5OA 3EXFB 4KL8S 4UD6A 5CCBA 4KBGA 2JJ2A 4RJJA 3T95A 3EDMA 1GGHA 3L8HA 4UHDA 4DUPA 2OMKA 4J0DA 2IXBA 3CB2A 4EF5A 3DFKA 3LGAA 1HF3A 1N5LA 1WMBA 2POQX 4FSDA 4JLDA 2ZRKA 1NOIA 4KQJA 4PNHA 2JGJA 1PG5A 4P5PA 1YS9A 5HSGA 1C0LA 1EZ4A 4I1YA 4NCXA 3ZGOA 1QWSA 1TO6A 3RYFB 1NX9A 2FUNB 2MWMA 5BSRA 1PT7A 5T4FA 1ZXLA 2PHZA 2RGRA 1NI4A 4U4AA 4QJIA 1JDBB 5AP9A 3DD1A 3ZZ1A 3R5JA 3R76A 4F91B 2BI8A 2IYOA 4LZAA 5IXSA 2C2MA 4JH0A 2WPDA 1R4MB 1FJXA 5HQ3A 5JFOA 2QRJA 4J0EA 4LYDA 2Q1TA 4UD2A 1SCKA 3T0IA 5IJ9A 3AZPA 2CWWA 2PUHA 2E85A 2OV1A 4KDCA 4TLEA 3RFFA 2HOQA 3OICA 1HDEA 3R41A 1SCUA 4OQNA 1P18A 4I9HA 1OVMA 2PTGA 3KKNA 1O9GA 3PRYA 4UNQA 1WP9A 4Y2UA 3HRHA 5CA0A 2AGVA 4ER7A 1VHDA 4UAGA 4DXDA 1F0KA 4MR9A 4Z9AA 3D2CA 1PNOA 2C5FA 4ZAWA 5HFNA 3VX3A 2PLRA 2A9VA 2N1MA 3UM9A 2VQ6A 1YDWA 4GKBA 5AM0A 4E15A 3S55A 1AUVA 3TTSA 2DERA 1E4EB 2DR3A 2ORYA 1CJCA 2XB9A 3PDCA 2C5EA 1SXHA 3ET4A 3FFXA 2GYVA 4R8VA 4MRSA 5BQFA 1JJBA 1S9HA 2CLFB 2IUFA 2PZJA 4Z99A 4YWJA 4AMZA 2XXAA 3ROKA 3NHSA 1H9AA 3GN2A 4B74A 3I2GA 3RGWS 4JLOA 2TECE 5TMBA 3R3XA 1L5NA 4CEJB 1VZ2A 1OVGA 2JFZA 3AM5A 3GFBA 5E1BA 1R64A 4JFRA 3WXBA 2BEUB 1PD1A 3FTQA 4CLDA 4QG3A 1TYDE 5JPDA 1V5EA 3F7OA 3H83A 5EEHA 3A6EA 4C4YA 3A1SA 3JYPA 3I52A 3QUCA 1NATA 2EZ8A 5FL3A 3WLFA 1OU0A 1T0JB 1P3DA 4U1RA 4ZI3A 5JE8A 1B3BA 3GVIA 4OMCA 4WZBB 1G2OA 2BEWB 3TAHA 1UT8A 4G1FA 2RC6A 3Q3GE 3M3DA 3THOA 1EIWA 1BD4A 1Z73A 1ZI6A 1ZZEA 3QLUC 1I3KA 1GPJA 1YGPA 3U4AA 4AKGA 4IFEA 4FFVA 4MV3A 2W2LD 1OXXK 3X1JA 2HJGA 4P4TA 1JVNA 2IT1A 1UFVA 4L0DA 3R3JA 4HBGA 4M8SA 3QEJA 4Y9SA 1H4QA 1Q7EA 5F1PA 1OWOA 2VSQA 5AW8A 2DFTA 3U7HB 1F12A 4NFHA 4L28A 3UIEA 2O2YA 2V7PA 3OF3A 4ZYTA 1TIBA 3TLGB 3ZOZA 4IQ0A 2MJLA 2ZSAA 2X5KO 3BF8A 1J1IA 1P9RA 4KNVA 4ZYVA 1N6LA 4BNDA 4JX8A 1KJNA 3IOCA 2LVBA 1KPHA 2FSPA 4NJMA 4UDOA 5AW0A 3HNOA 4IVNA 1UXKA 3PC8C 3QPWA 4KQGA 1Y8AA 5FLEX 2NXNA 2ZIXB 4BO6A 3S6JA 1HT0A 2CVZA 1EX6A 3HHEA 3VNSA 1NDUA 1C14A 1FE8A 4CTMA 2Q2OA 3D3QA 1RYBA 2B2NA 4J3FA 5ERGB 3AFIA 5AIAA 2ECOA 5EL0A 3R7SA 4YASA 3RC8A 1XEFA 4KJZA 1RHRA 9ABPA 4UAVA 3H84A 2IUYA 1JDTA 3IPAA 4RDCA 1QP8A 2EATA 2JHCA 4B3BA 5BWNA 1WUIS 1QRAA 2G06A 5CT5A 1LPPA 3ZDYB 4HX5A 1CNEA 1Y3CE 1XXHE 1C3XA 4HD8A 3SEZA 4MR8A 2XUGA 3WLNA 4CF5A 2VLIA 4Q9NA 2W2NA 1E1KA 1S2NA 2NX2A 5L3ZA 1EE2A 1RQLA 3PNVA 3ST7A 1H3NA 5BSWA 2JL1A 2M1ZA 2VI5A 5GM2A 4B34A 1FLDA 4R4JA 3RKUA 2IODA 5CYGA 4HJXA 2DFPA 3MXTA 2H2GA 4MYCA 2V55B 3ZWYA 2A58A 2Q0XA 3VDNB 4GP7A 1JPVA 3Q8WA 1KMIY 4K26A 4L95C 4TRRA 3AONB 3M9WA 4AULA 2WLSA 1AS2A 4I8XA 1Z6TA 1Q2UA 1ZH8A 2QRLA 1FYXA 3UK0A 3P0EA 3RGGA 1G60A 2YINC 4E6PA 3U80A 3OLCX 2R4UA 3W3AH 2O8BB 2BDUA 1KXZA 1PFVA 4XA8A 1F1JA 1P1JA 3WWPA 1GPNA 1ZESA 1IUPA 3LF1A 1ANKA 1UWVA 3P0HA 1QH1A 4ZQGA 4WA8A 5EIBD 3BXOA 3NNSA 3OA0A 1SXJE 3GEBA 2JGMA 1HRKA 2P2ZA 4GR4A 5DBFA 4B8WA 4YREA 3SHWA 2WJVA 2JIQA 2X19A 5F3WB 2BGRA 4PZPA 2N75A 3MRVA 3WYAA 4WKNA 4KPFC 1U7PA 5T5QA 3AMVA 4Q15A 4DCOA 4ENVA 3OQIA 1RFLA 1I7DA 2PD3A 2C8JA 1F8UA 4L5IA 1SCBA 3H9QA 4MTLA 1T6ZA 1JSZA 3WK8A 1WQ4A 2RGWA 4NV3A 2ID9A 2D4HA 4ATNA 1RAGA 1T9GS 3DB2A 1T35A 1V3UA 4DSUA 4XWOA 4XIGS 4R05A 5F21A 5K9ZA 5LSAA 4GU5A 4JV5B 3GV0A 4ZJZA 5B7NA 3JQBC 3H1AA 1TOAA 3QVUA 3GBVA 5AJXA 4D8WA 3CE6A 3VZBA 4JYMA 5DHTA 4OX9B 4CM7A 3R74A 1KQPA 4HDKA 1VJCA 2IDZA 2RKOA 1JJVA 1G66A 2WU4A 5H59A 1QRSA 3GBSA 1WCIB 5IFKA 3T4UA 1RPAA 5AKIA 1VL2A 1EFCA 4RNDB 3VKFA 1RRPA 5JTTA 1H1DA 2XJ9A 3PZBA 2G9ZA 5FBVB 3B36A 2WTAA 1NQWA 1QRDA 3N39C 1L4NA 3T38A 2GSDA 2FUCA 1QHSA 5IYZB 3CA8A 4Z4EA 3MCWA 3L92A 1RP7A 4JK3A 1LJLA 1RBYA 1MJNA 4TTRA 4WNAB 1Y9JA 3JVDA 5WRFA 2C8KA 3AR9A 2ZSEA 4XKJA 3JARB 1V4NA 3KKOA 4UXHA 5KKAA 3T7DA 4OUKX 3PQ7A 1STOA 2PZMA 3QUAA 1TC1A 1XZKA 1ZNWA 3C5CA 1SBNE 5JARA 2R2GA 5AKGA 2Y9PB 1I0IA 2FN8A 5J4HA 3MGAA 1Y5IA 3QKTA 2GAOA 4IJKA 3QE4A 4US1R 4CI0B 5BNWA 1N36B 3I2JA 1POXA 5C3UA 2R6CA 2F1OA 4P3YA 3KB2A 3P0IA 5ICSA 3PG5A 5JW6A 4R0MA 3QVKA 3QX3A 3HYLA 1PQUA 4IR7A 1KDYA 3VVBA 3NRJA 3F6YA 1CUHA 2C2WA 4IEFB 5EKTA 3PX2A 1YASA 4PVDA 2JJMA 1USGA 1AUQA 1YTUA 5JAMA 3ZXIA 1GL3A 5HK8A 3VC1A 5CBKA 3AG6A 1XTTA 3FYHA 4NX2A 1NHGA 2FXIA 2QTHA 3CE9A 4KQHA 4TSRA 4DW8A 4IGEA 3D2AA 3DM5A 3WFIA 3D3NA 5KDDA 3HCRA 5KNBH 1W87A 3C7AA 1THMA 1QU2A 3JQFC 3H6KA 3LLMA 4J2HA 2HMUA 2Y71A 3E5NA 4QTUB 3D3EA 4J6FA 3PGA1 1UM9B 5JS8A 3MQ2A 2P7HA 1Z37A 4EQ6A 1VGQA 3GA7A 2GF2A 1CLUA 1DXHA 2ISCA 4G5FA 1K4KA 3B9QA 3WIOA 3X3HA 5EJ7A 5AW6A 3I04A 2ZR7A 2EGGA 3IP7A 4ZCMA 3QOXA 4I1UA 2DKOA 2PS0A 3OLXA 4Q9LA 4YRBA 4IOLA 3LMKA 1GEEA 4EF6A 1D9ZA 1FSPA 4BO7A 4L3VA 3E35A 5GVRA 4I66A 1PT9A 4O2BF 3HZHA 3MMXA 4J29A 1J2JA 2PMFA 3FCEA 5EMKA 4BO9A 2FZ4A 4CKWB 4N0DA 2A1TS 5C7OO 3RVMA 3IJEB 4DQXA 4ICIA 1M75A 3LNCA 2YJGA 3S1SA 1P61B 4UTZA 1DDOA 3EODA 1KVTA 4IF4A 2QYHA 1QVVA 2B2CA 1CJKC 1K6JA 3KDPA 2NIPA 2JFYA 5A9RA 3R9XB 1JAIA 5ARCA 1NNEA 2R8EA 2VJNA 4BVBA 2HCFA 1K6IA 2QSZA 1E98A 1XJQA 3BE4A 4RS3A 3KQLA 2J87A 4R0NA 1O8BA 1NU6A 2OZLA 3EVDA 4DM4A 1DP4A 2QMZA 4QVIA 3RNLA 5JXHA 3B8HA 2V98A 3DTVA 3KO8A 1E2MA 1XEXB 2BE9A 4O1MA 4O25A 4OYRA 2BBSA 3TWOA 4RTJA 3N76A 3LPNA 1UDCA 4FJ0A 3LH5A 2PZFA 2PKQO 3LCRA 3V9PA 3ZQUA 2QSUA 2VF2A 3BJIC 3VTKA 3H2IA 1KL7A 1E8MA 1XU9A 5FNVA 4B79A 1ONBA 2GS9A 4MK4A 1OZHA 2H2AA 7MDHA 1BX3A 2DFKB 4LISA 1Z4OA 2XCUA 1IY2A 4PLTA 2IFTA 3T54A 5JXJA 2YNMD 4ZZ1A 3SFVA 1Z7EA 1XOIA 1IFXA 3QEMB 1EUYA 5KTSA 3FN4A 4UUPA 1ZYUA 3DC7A 4TXNA 5FLKA 4XDZA 4XGIA 2YOGA 2YJ5A 3EISA 4J1SA 3FKQA 1D4OA 4ETWA 2WJGA 4MUNA 4YAOA 4ALLA 3FWPA 1C80A 3LKBA 2D54A 1KMQA 5DTMA 4AMUA 1EEHA 3Q7PA 3AP2A 2QN1A 4HRAA 4Q82A 3ROMA 4QTXA 4AY4A 3I5YA 4HQRA 1V35A 4O4JF 3CJTA 1FNSA 1K2VN 4BFVA 5K8LA 2X5NA 3QKRB 4B7CA 1FZQA 4IS2A 5BN4A 4CMIA 1EUCB 3QYAA 4EY3A 4I1VA 3WL3A 4BLWA 3JALA 3CINA 1KI3A 3HCBA 3THYA 1V11B 4J9VA 5JFTA 3O38A 1FRZA 3NVKI 4NBKA 3K16A 4F5ZA 2GETA 2IY8A 4AP9A 4C7OA 2X1VA 1I0LA 1GSHA 3A2NA 2EZ4A 3OJCA 5IF3A 4B35A 1VKRA 2HF2A 4OSPA 3S29A 3UB3A 2WYUA 1SRQA 3X43A 1J42A 5BSMA 3C39A 3EDOA 1W4RA 2NPFA 4YRPA 4DE5A