2G6TA

Crystal structure of an uncharacterized protein from clostridium acetobutylicum
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
MYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYSDIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHNDDYIKFLENMDYYLEQELKVEQEGNVYSCTMPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRINKKNLFVKMLIKDDNEKLVKRFDNLPYKNKVCFHPKPMKYKSVAFFPRYIWRCINYAARTSNSNLEQYTMDMSWLEKSCDILKMLCGEEDFIREKX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein, homolog HI1244 from Haemophilus inf
publication title Crystal structure of an uncharacterized protein from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
total genus 86
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08942 DUF1919 Domain of unknown function (DUF1919)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12290 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g6tA01
2G6TA
chains in the Genus database with same CATH superfamily
3IODA 3HCEA 4JUDX 2HI0A 1IWBB 1L8AA 2CNBA 1RMQA 4MQ5A 4O2AF 3OM1A 4PRYA 1DEKA 3VPDA 2IITA 3A1TA 4HDQB 5ARDA 1E89A 4XCXA 1K6XA 4L02A 3N0XA 4QDOA 4YFVA 2GT1A 4M0LA 1AU9A 3WB9A 2O1XA 4BNFA 3U16A 5I7HA 4G4IA 1JQKA 3NNNA 3OZUA 3TIIA 4LJ4A 1E79A 4YB8A 1NQ5A 2J85A 2PS0A 1Z5PA 3UKJA 4MS4B 5FNVA 1L4UA 2OHIA 3WWEA 1HI9A 4KSYA 5GGYA 3TQIA 3SOZA 3TDNA 4OJYA 5EQJB 4I14A 1ZI8A 1MJHA 3KVYA 4GPEA 3THYA 1OFVA 3L6UA 2GHIA 1GTZA 1ULAA 2O8VA 4K28A 3HWSA 4I9FA 3RVJA 5IWCA 2J0EA 3PQ2A 4H60A 1Y9JA 5K3BA 1BXZA 3VH3A 4NVRA 4LC9A 4F2WA 4ESVA 1Y37A 4EJSB 3OZDA 3EXG2 2FW1A 1XNGA 3JQ6A 4LDPA 7MHTA 3B9BA 4MKFA 2AR0A 2WPDA 2XV1A 3CR8A 1F2DA 3IQWA 1FDOA 3D5TA 3PGA1 3BMCA 1RQRA 3RH0A 1HDIA 1U1IA 3AX6A 3H7IA 3QJ5A 1P0PA 4EUEA 1VKOA 2PVSA 5EJ2A 5L3QB 1S2IA 3FDXA 3CF0A 3OLVA 3AVTA 2H1WA 3QFFA 3E22A 4LV8B 1F2TA 4CFSA 2IYSA 1DBSA 5IN5A 2Z9BA 4EYQA 3HXOA 2Z6UA 4IS3A 3CNLA 1KOJA 1N6OA 1B6TA 1L5FA 3ZDYB 721PA 3DAGA 5JY1A 1EUQA 4QYMA 1G20E 1E9FA 1CHDA 1IXRC 4OP3A 4XKJA 3WKEA 4Y9TA 1ZZEA 2XWSA 3TNLA 4ETMA 3ERCA 1P8AA 4OMFG 2HNBA 4ZT7A 2OXCA 4YRPA 1JSXA 5JC8A 4L95C 3ZC3A 2M6LA 5LJIA 3R7FA 1KQOA 2PEYA 4R6WA 3TPZA 4RZXA 1ZC4A 4QUDA 3I2YX 4M8IA 4KG7A 2DERA 3GFGA 4N8SA 4B3DA 2DRIA 1IULA 1KJYA 3FM9A 3UTCA 3O8BA 1E20A 2JFXA 3C5EA 1RI5A 1Y1RA 3B2QA 3QBEA 5EHGA 4MKXA 1KMQA 1SG9A 1YR1A 2OHHA 4LQCA 4RM2A 4RYDA 2WYHA 3D0KA 5B58T 4HDRB 4ZQBA 3VMMA 4D4MA 5ITWA 4YI3A 1SQGA 2EQAA 5AMXA 1URPA 2HQOA 1VG9B 2IOFK 4TRMA 3A3KA 1QNLA 1K89A 2JATA 4UULA 2X76A 2Z2ZA 4MGIR 1YBHA 3I2IA 2DPLA 2O2YA 4GMGA 4B74A 2CC2A 4WLVA 4MB2A 1M7HA 1PG0A 1DAIA 3AFHA 3JW8A 3LOPA 3VKUA 4DLYA 5HS4A 1FSSA 4FW8A 3FWPA 4FXOA 4PINA 4EKYA 3EVNA 3IBYA 1D0SA 1FP6A 3EGDA 3WJAA 1JKMA 1M8KA 1XR3A 3AR6A 4BO4A 2Y92A 3OIGA 1SIOA 2ZCVA 1GADO 1E6MA 1E8MA 3PUYA 3WWCA 1DIAA 4FHDA 1NQWA 5LCXA 4KREA 2P2YA 1R0BA 2VK8A 1ENYA 4KO3S 4MVYA 4BRWA 2RHMA 2HIHA 1JDBC 1XTJA 4JI1B 4Z3OA 4AJEA 4NU6A 1R5BA 3SSAA 4IJKA 1V9SA 5A5EA 4ZVNA 3COJA 1NV8A 1KYXA 2Q2NA 5DJ5A 3C7DB 5K3EA 5DM0A 1WXHA 2X2EA 3FHTA 4I4CA 3GEDA 4PEVA 4JBYA 1ZOPA 3O4FA 3W1VA 5CTJA 3JVDA 3TTXA 4AJ9A 2YHUA 4K9KA 4HD8A 4EJMA 1CF2O 1YRAA 4H7KA 5DISB 1DT3A 4DA0A 5C32A 5CYFA 1GYRA 3ZQ4A 3ZNPA 2IQIA 3K9CA 2O2CA 1GR0A 3VR5D 1II0A 3SVTA 4X7RA 1ZM9A 3C5CA 1JBQA 4MB6A 4ARBA 2DEUA 3GVXA 4QOGA 2J0SA 4BLSA 4FE4A 1WDKA 2HSEA 2CKDA 3BEOA 4HR7A 1KARA 2QRHA 2XQJA 3GGGA 2XCIA 4QLOA 4BMCA 2CYBA 2OC4A 1ZJ4A 4YGXB 8OHMA 2QDKA 2WFMA 3FIJA 1RM3A 4N3CA 3RSZA 1Q0PA 3UA3A 4U2FA 3V8PA 3HBAA 3KOMA 1P6QA 2JI4A 2F1RA 3D43A 4EBBA 5BNTA 5CW1A 3ORYA 1M1YB 5F7ZA 3NTVA 3FUVA 2OCIA 4N3NA 2RCYA 2GZ1A 1KQFA 4PQRA 3KHTA 2CLOB 3ABRB 1QIHA 5LUBA 2WM8A 1KC1A 2ZWOA 1IOLA 1ACLA 1PEKE 5MHTA 2OVFA 3P26A 5ED0A 3VPSA 4DVGA 3C1AA 3CE9A 4IGFA 4I50A 4J9VA 1Q6ZA 5GONB 3FDIA 1G6OA 1PYDA 1WVGA 4KR6A 1QDEA 3PK0A 1P18A 3W2TA 1C29B 3H97A 2GN2A 2NO5A 1SCUB 3A9RA 4D0SA 4AJNA 5F12A 4TLEA 1IBLB 1F7UA 3H0EA 2NM0A 6AT1A 3P96A 2QL9A 3MN1A 1KY2A 2PZLA 3EW7A 3OM9A 4R7TA 5IW8A 3AM1A 2QT1A 1U02A 1GR1A 3DTVB 3PC8A 4CEJB 3PQDA 3EY9A 5CT4A 1B6SA 1H23A 5HJEA 4DA4A 2DC1A 1SXPA 1HXHA 1PTJC 1FUIA 1FDTA 4O2BF 3U4IA 3SZMA 3K70D 1G7SA 4PG4A 3FYUC 2Q1UA 3UOAB 2DBZA 5A9RA 4MV1A 1D1QA 4CGYA 1EUCB 1F0PA 3CR7A 4C4XA 2C00A 2FEAA 3P2IA 5AUPB 4UBKA 5BMOA 3N8DA 1PFQA 5KX5F 3ZDRA 2V6FA 1YAJA 2Q6LA 5JO0A 4FUQA 5AJZA 3NNDA 2OWEA 1Y6QA 4RKRA 3WIUA 3T5BA 1SD1A 5IBQA 3H0KA 5B57C 5K0LA 3CT4A 4TS1A 4KO1S 5ALZA 4A2WA 4UBJA 4QU9A 5BW4A 2ECQA 1ZH0A 1P7PA 4MGEA 1VBNA 4RSRA 3CY6A 4L3WA 2WU4A 2D2IA 5EKTA 1HYEA 1W2WB 3OJWA 5EWJB 1PR0A 4IDGA 3W8RA 3UGTA 3HYNA 4BLWA 1U0BB 4Y9SA 1TW2A 2C4NA 2IEAA 4IPTA 4E2WA 1F3LA 1Z56C 6NULA 1YJ8A 5JAMA 4CMBA 3WRYA 1FNNA 1L7DA 5FP0A 4RJIA 1UMDA 4NCXA 2BR4A 1D9ZA 1NP7A 3L4SO 3QF4A 4JJAA 3IE0A 2WSSD 3LQQA 4OXKA 2MR5A 5AOBA 4B6SA 3B1WA 3MCAA 3IEMA 1J0AA 1O6FA 1WM1A 1DVRA 2BZGA 2REQA 4XQCA 5LZ7A 4FNGA 4AJPA 4B32A 2DPGA 2A0YA 2FPMA 3U4HA 2QWXA 1CETA 2ZJAA 3CC8A 3HV0A 3HMQA 4NR0A 4V0KA 4AYXA 3AONB 5BSFA 2BGTA 4G56A 1ZH8A 2XAAA 2OFXA 3K1ZA 1R15A 4DLZA 4PONA 3IQHX 5L3QA 4B82A 3EHDA 4PCAA 1VI5A 3PFNA 5LP6A 4OLJA 1EFHA 2GSWA 4YJFB 1C41A 5E9WA 4IEIA 5EGNA 4L3OA 1ZGAA 2JFGA 4G9BA 1UXKA 2ZATA 1A7JA 1ETUA 5ED4A 3UGJA 4DLVA 2Q3LA 3D81A 4PHGA 3HFSA 4PG5A 3V46A 1YJCA 5EMLA 5LYJF 2O9JA 1CBUA 1PNTA 4IQ0A 4RZ2A 3EZYA 5A3SA 5FBWB 3UC5A 2FVYA 3A8TA 5JXWA 1FFAA 1T2AA 1A27A 3MWLA 3QU2A 1Z5OA 2ZSFA 3O26A 4ZWNA 4L4UA 1N4DA 2C97A 2GM3A 1HE2A 3E5NA 3T4EA 4AQYB 4CV3A 1YJ5A 1MN6A 4ROSA 2IL1A 1EE2A 1NW8A 3X1DA 2XYHA 3FBTA 3LNCA 2FPIA 3S2ZA 4QYIB 3KQVA 1IXYA 2HSGA 1W9HA 1YMVA 1U3WA 2VNKA 1FVHA 2YR0A 3KJEA 2JBAA 1NQUA 4WECA 3IUBA 3HO1A 4HXYA 1SB9A 4TKLA 2GF0A 1TGYA 2X8JB 4YI5A 2WVHA 2ZYDA 1OREA 3PLNA 3VR2A 2H5IA 3QTBA 4B7ZA 2XIJA 3LKZA 4CDGA 5JAUA 5A4MS 1NLYA 3FI9A 5FX2A 4Z4FA 3LO5A 2IF2A 3OO0A 3ZK9A 2ZRLA 4A2QA 4GKVA 1AS0A 4J2HA 4JUFA 1TTTA 4AJ2A 2GBCA 2ZUDA 3HWRA 4FJ2A 2WWIA 2X8BA 3BERA 3W78A 3WMXA 4DPKA 1VL6A 1DTWB 4I55B 4K86A 1T36B 5DNAA 2QXTA 4LFCB 4GQAA 1PHPA 2OCDA 4CT0A 4EQ6B 3OECA 4J0HA 4NLLA 1JT9A 3ONNA 1P8JA 3PWZA 4X94A 4AY3A 4CKYA 1IMJA 3AZOA 1NHGA 1WMFA 1S3IA 1DRJA 1ISGA 1AQUA 1XI2A 2YRWA 5EYPA 4YRKA 1KGDA 3H4IA 1HYQA 3OPYI 4WFJA 5CDFE 5EKSA 4YJ3A 4YECA 3RU3A 5KHOC 4CEHA 1O03A 3KKMA 1IE3A 1RWOA 4PC3A 3R5TA 2AZDA 2INGX 3PC6A 4HN4B 3LF1A 1L2TA 1UC5B 3OQIB 1Q3TA 2JIMA 3VPCA 5F3DA 2CLIB 1SA0A 1ONBA 2OKGA 2WKSA 1P7CA 4B3TB 1MC1A 4Y2TA 1ZU5A 1NW9B 3V4VB 1J0EA 3JQBC 1OH6A 2C59A 5JE8A 1LC0A 2DFVA 2HREA 1XL1A 2QG4A 4FYKA 1UC9A 3UWPA 2OAP1 3W8EA 1IJKA 2V0CA 1EWTA 4Q47A 4MS3A 4DV5B 1V16A 3ZIAD 2PO7A 2Z3WA 3WLJA 1DZIA 4CM8A 3A2KA 3FWZA 2D8AA 1PFUA 5BURA 1P81A 4Y6QA 3VR6H 2BC9A 4B4VA 3KVNA 2OXIA 3QYPA 2PH7A 4GGOA 1OZFA 4JD5A 4M7OA 3WQHA 1MX1A 3RUAA 3RASA 3UKOA 1EWKA 1GTG1 4MVJD 3ENWA 4B7AA 1CB7A 4IKPA 1KAEA 4RTMA 3IEXA 2RGDA 4RHCA 3E9RA 3TLBA 3IMCA 2H1HA 3O31A 4FZVA 1NURA 3PI6A 3QXXA 4KR0A 4OA5A 5GOZA 5AJXA 2Q9AA 2ZI6A 4CR7A 1BEZA 1KPIA 2W4IA 3PKIA 4NJMA 3FFBA 3LWNA 3UAWA 1MG0A 4ZCLA 1K1EA 1XQWA 2ZPTX 5K8JB 2Y0CA 3LL7A 1WMEA 2BTEA 2O3TA 4CMEA 2ZTUA 4H9GA 4PM4A 2GF9A 1GUYA 2FXVA 2HU5A 4TXLA 1OSNA 1R5NA 3F9IA 2YUIA 5KYUB 5CBPB 5DI9A 1SU4A 2IXAA 1V5GA 3N2EA 1UH5A 3RHZA 1H3EA 2QI9F 5J4KA 2ZK7A 1NDUA 2ZDGA 3EIWA 1ATIA 1M76A 5KYWA 4I4TA 1C1XA 1K6MA 2E4YA 2H1CA 3IHKA 3QVKA 3IA7A 4YUYA 1RC8A 4QWWA 3ORQA 4NMWA 4KXNA 1KR5A 5IH3A 2D0PB 5F77A 3RU2A 4BKRA 5L7WA 2GTIA 3O7MA 1YS6A 3WYFA 3G0HA 4IDQA 4G3XA 3ZDXB 1EFAA 2QF7A 1G8JA 4HNGA 3Q9LA 3STHA 1H22A 1IBMB 1AS3A 3CF4G 3JAKA 3KRTA 1W93A 4UUMA 1KVUA 4YCCA 2AOTA 2OQRA 2GVZC 3SMQA 1NKSA 1NSFA 4QXRA 3WGYA 3K8QA 4C22A 2QK4A 4IF6A 1QBGA 2JZNA 2WIGA 1VPEA 3BQMB 3FWNA 4Y67A 1BDJA 2JZOA 2RGGA 1ZIXA 5J2UB 2VJMB 2FZCA 4H08A 2IDZA 2XHEA 5B2EA 2F1OA 1K5DA 3R6TA 3KJQA 4CL0A 4X90A 1E6CA 5CDHA 1L4YA 4A1OA 5IFLA 1Z88A 1C50A 3DR3A 3I37X 3N58A 1YDMA 3CURA 2QYOA 2BUBA 3DZHA 3PTLA 4Q00A 1L4NA 3RFVA 3DMTA 2RH4A 3I34X 4B6GA 4LHWA 3HNRA 5AW1A 3ROMA 1SG6A 1Z4LA 3FR7A 2ZSJA 2VLBA 5IKXA 5JY6A 4W5JA 4J1TC 1E2FA 1YVDA 3I53A 1PJSA 3NXKA 1NVVR 1QOPB 1AQJA 4MUAA 2AC2A 1L5QA 4J0KA 3D7NA 2JGDB 3NDIA 5EWJA 2WUDA 4UTNA 4C2UA 3N2LA 3OU7A 3FBGA 1PIWA 2H1FA 4BP8A 2RIRA 4RTNA 2FWPA 4YEDA 2BCGY 4PHCA 5A0TA 2Y66A 3MGKA 1OTHA 4DBVO 1RYBA 3DCYA 4E2FA 2XQVA 2WD8A 3C48A 3FKSD 4PNHA 1NPTO 3OURA 4RIFA 4KIJA 4US0R 3DBRB 4ABTA 3BQNB 3USZA 4L72A 1ZSYA 1L9XA 2CV2A 4ZOAA 3PEUA 4Y0VA 4IVRA 4AO7A 2FZWA 1UBFA 4UQOA 3M9XA 1O9GA 1U6KA 3WMRA 3GL9A 1IVYA 4K46A 4NZMA 2XUOA 4X1OA 4EY3A 2AN4A 5ILOA 3QVMA 4P3YA 2OMEA 3OQ1A 1ECJA 2H4YA 4RD2A 2JI9A 3H3JA 2GNOA 4BUJA 1GNVA 1U5BA 3TGPA 5AK5A 2R65A 1UBEA 2XSZD 5F76A 3T61A 1ORIA 2A9QA 2EJWA 3LWBA 2CEAA 2HV8A 2P40A 3U31A 1RKVA 4DADA 5AJWA 3PQ4A 1ZD4A 4PCVA 5KNBA 1JL3A 2CXUA 2F8SA 3W6PA 1DU4A 3V4FA 1CY6A 4S1VA 3EVCA 4CTKA 4EA9A 5K8CA 2JHAA 2QD4A 4IFTA 4DRZA 3EPLA 3W5UA 3WL7A 4L4YA 4YV0A 3FNHA 3EWSA 3R2JA 1BWSA 3NBXX 1D2GA 2EW2A 3MTDA 1CEYA 4TLLB 3MCUA 1YI1A 3V3TA 4L5YA 1MD9A 3FMOB 4AMGA 2QQGA 2C82A 2X2FA 4UNSA 1B76A 4NDZA 3TIXB 3MA0A 3NOVA 2C9MA 4LZPA 1SZCA 2B25A 3E03A 4TM8A 5JEDA 3RVPA 1RM0A 2H65A 1O94D 2Z9CA 4QM7A 1XZMA 4UUBA 4EMTA 2BD0A 2H18A 4UJ3A 4BY9E 1TKAA 4DCPA 1NI4A 3IULA 1BHJA 1J7JA 2BUCA 5JDIA 3NPAA 2A57A 4MNTA 3GEPA 3LO8A 2Q6TA 1O95A 4ERXA 1EX7A 1EZ1A 2Z4TA 1XD2A 4CVNA 2QIOA 2ASEA 4ED9A 2WSLA 1S2NA 2YWBA 4C4SA 4JU8A 1U7XA 2A9RA 4GX5A 3A1SA 3QF7A 4B83A 1OTYA 3AI3A 4QPJC 4RZSA 2AG8A 3JYPA 3GEIA 5AXCA 1NNI1 1M6VA 5HP4A 4JYMA 3TTSA 1UKCA 5LQDA 2IV3A 4PWZA 5FPSA 3OX3A 5GV8A 5DV9A 2GGSA 1R0SA 3EAQA 3PF9A 4KIWA 4XB2A 3TLMA 2XQGA 5I3ZA 4UTXA 2G77B 2QP3A 3LBIA 4RZIA 3V2UA 4A10A 4RF5A 4EPVA 3VAAA 4BJ5A 4G5FA 1F51E 1MPXA 4W9RA 3C6BA 3RFCA 3ZUGA 1PJQA 3IJEB 5KQSA 4L4ZA 3GLFE 4ZVKA 2BMWA 2QUAA 4UOQA 4C6SA 1NPYA 3R5XA 1RJ9B 2UZ1B 1L4LA 1M1NA 3L7CA 3P0IA 1R6UA 4U39A 4UU7A 3VYWA 4JEUA 1NLUA 4MPTA 1EAMA 3ZE9A 3S7TA 1VA5A 4Y8VA 3GLVA 5LXTB 3NP7A 3WMWA 1K2WA 1ESEA 1JP7A 4F11A 5DK6A 5K3OA 4BN0A 4NK4A 2CXRA 4LECA 3SIXA 2Q0QA 4EHHA 1EDZA 4R54A 2WWWA 2EQ5A 3JD4A 1SVNA 2GLTA 2BP7A 4UVEA 4K88A 1A88A 3W34A 5DMXA 2HUPA 1GRQA 2MHCA 1SPBS 2A5DA 4X62B 4U7DA 3A4VA 3D6HA 5HE9A 3DT8A 1HRKA 5B7GA 3VR4D 1U8FO 1JWLA 4B73A 2F43B 3PDUA 3OU6A 4X1KA 1RPAA 1MUUA 4IVPA 2P6PA 4KIFA 1WOMA 4IICA 3GRFA 2E89A 1PWXA 1BN6A 5F5LA 3RLIA 1Z0KA 4WKCA 1F2VA 4RPLA 5IXSA 2FNAA 2XGOA 2WF9A 4DMFA 4L5CA 3L4JA 3MGAA 2Q3DA 2Z3ZA 4TMXA 3C39A 4D7AA 1KQNA 2XGMA 5DCUA 4DSZA 2NQ2C 5B4UA 1K63A 3S1LA 1FDSA 5GJWC 3HXKA 4I6EA 1C14A 3V1LA 3LV8A 3NBQA 5KYUA 4GO1A 1AK9A 2YFKA 3A1WA 3B13B 3B1JA 1U0EA 1C3OA 1GPJA 1SIUA 3FAKA 3QKUA 1L8QA 3O8RA 1AGNA 4FI3F 4HNTA 4IRMA 5BN3B 4QPZA 2APJA 1K4KA 1QGUB 4RJLA 3EAFA 4G9GA 3KZOA 1JHAA 3IUJA 1ZSVA 1SVIA 1B8VA 4HN9A 2FV8A 4AUMA 1RRMA 2PX6A 3VU3A 3ZTWA 2I2FA 3COPA 2YRXA 1TADA 5DEIA 2EG9A 4HQRA 5FBVB 2EOAA 4P4TA 4IWNA 3IHLA 1DWUA 4N6OA 5JVDF 1J97A 2FY8A 3CNHA 1ZO8A 2B1JA 1CKEA 2DF8A 1JQDA 1OVMA 3I8OA 3WOVA 1PJ2A 2ACEA 4LOAA 4LY0A 3SEQA 3ZVNA 1U8ZA 1UMCB 1V45E 2BBTA 1FUUA 2QTFA 1IQRA 5E3HA 3N76A 3DPIA 4FINA 1HTTA 3NANA 4HDMB 1QLHA 3DA8A 3TMYA 1LZLA 4L08A 3SK0A 4YCMA 1OXSC 2VNJA 2M32A 3JQ7A 3P4XA 4D97A 3HBFA 1HURA 4H59A 3M4NA 4C7KA 1MDBA 4CEIB 2C8LA 3CLUD 3U7GA 1G8MA 5G41A 1ZHFA 3L7IA 4LSGA 4GX0A 1U99A 2GARA 2Z6AA 4JELA 3OEYA 3CGWA 5HJ2A 1UBRS 2J6CA 3OPYA 2GBIA 3O82A 2FJPA 3DFIA 1XZDA 4JIGA 2W6MA 1K3TA 2AG6A 2DX7A 2W2KB 2AJLI 3DLCA 4W6QA 3CVWA 5E4YA 1IUNA 4IGIA 1RWVA 2ZBQA 4LZAA 4AG6A 3VC3A 2R96A 2V5UA 3ET4A 3ZZMA 3IUNA 4NJEB 5JDCA 2QRZA 1R37A 1LDBA 5IK2A 5AICA 1L7QA 4JJZA 4PC6A 2YNMA 4ZC8A 1D8TA 1JIXA 3WRXA 2VJOA 3WYEA 4AG3A 5IU6A 3KZKA 4K7JA 1RXSA 2AEJA 3KWJA 3CUWA 1HE8B 3DPUA 1WY7A 2LUOA 2QLNA 5UKDA 3RVSA 2J4FA 4X8MA 3WQSB 4GHWA 3ZOZA 4A92A 1H42A 1SIBE 3WLQA 3P19A 4D9FA 2JZCA 3GCGA 4HGZA 1BDHA 1KMHA 2QTHA 4Q1CA 5DM60 2VPWA 3O73A 4WZBB 4M1KA 4JT9A 3JY6A 4BTVA 4Q3DA 4INJA 2ZZMA 1TT5A 3FHLA 4GL2A 1VL2A 1WULS 1HX7A 5LQKA 5CURA 1B0UA 3HA7A 3L41A 4NBTA 1CZKA 3MQ4A 3ESXA 3U3XA 1W76A 1AKUA 1ZL0A 3FX2A 4EGAA 4G86A 3T95A 2YW9A 1I32A 1JR3E 4S1WA 2J9XB 3F2VA 3E1GA 5GPBA 4DNOA 3DOEA 3PBKA 3Q88A 5C7LO 1O0SA 3HH8A 2VSNA 3JCZA 1ND6A 1WABA 1ZJ5A 2JL1A 3O2JA 4IO0A 3S1AB 3ZKWA 3GIDA 1SQFA 1TPZA 1E2JA 3U81A 1CJTC 1XU9A 3CLKA 4EGSA 5FWDA 2J08A 5C9ZA 1U2GC 2VLIA 4FC7A 3W8NA 3KL2A 2K7ZA 5CP8A 1NUUA 3WLRA 9LDTA 4MDEA 2BFEA 3ANNA 5DLQC 1LBTA 2EDCA 1GNPA 2JEYA 5IC6A 1SBNE 2YZKA 3H9GA 2R1ZA 3WGUA 4D81A 2DWUA 3OP4A 2FPKA 1XUOA 2VHEA 4D80A 3U3RA 1Y5LA 5B12A 2W8BA 1V1MA 1K6IA 3DJYA 1KI9A 4RK7A 3NUQA 2ZAIA 4EB6B 4NFYA 3C70A 4ZOCA 4G63A 4QX6A 4EITA 3VZQA 2ETXA 3RFUA 2YY6A 4JR0A 2KPOA 3AR4A 2CZQA 1BW9A 2UUOA 3EZNA 4O4IB 1VPWA 4BX3A 1E3MA 2RGNA 3UH0A 3LUFA 2XD9A 3TZKA 5E1BA 3X1KA 4Y9UA 4CLRB 3SQWA 4H7HA 5LSAA 2QMYA 3WGHA 2HA3A 3BMQA 2VHZA 4HQLA 1RZRA 3AL0C 2AYXA 3ABZA 4JLJA 4UPVA 2R86A 1E4OA 2PKWA 2QD2A 4OMUA 4ZO6A 4BKPA 4EA7A 4H2DA 1T2VA 3BWVA 2TECE 3H2KA 1O97C 2IPLA 2Q21A 4RJ2A 2PMBA 4O33A 3FFWA 1W47A 3WV5A 4NJOA 2J33A 1F48A 2X9NA 5CPFA 1OASA 4XZ3A 5GVSA 2WVGA 1XEWY 1GVNB 3QOFA 2C95A 4KQ1A 2OLJA 2YFHA 1E2HA 2PKQO 4E0BA 4O4LB 1R16A 3QW4B 1W0KD 1QP8A 5TQ0B 3A3NA 3LPCA 5D7NA 3Q8LA 2V1XA 5IP5A 1V41E 1KGSA 5CTAA 3RHTA 1KYYA 3TLJA 4NE2A 3RS8A 2HFKA 3DZBA 3UK6A 4BO1A 1CYDA 4JT4A 1VPDA 3AOEC 3M6AA 4ZQCB 5A02A 2FE4A 3DAYA 2IELA 1DHRA 1P1BA 1X7ZB 1Z73A 3IUYA 4XEHA 5JCJD 2UUBB 3EEIA 2QS9A 1C4OA 5IF3A 5KTOA 1L5OA 2XOXA 3FOBA 3KT8A 4I1UA 2QV0A 1EVEA 4KFTA 3IESA 5K0NA 4YJGA 1FS4A 3QE2A 1KI6B 3HKDB 3B38A 4BNHA 2YMQA 1HKUA 1NVXQ 2RD2A 1T0IA 3CZAA 3HSSA 2IYOA 4NARA 3ADOA 5AW0A 4YK7A 5ITZB 1GZ5A 2A5GA 1EUDB 1ZN9A 4DPMA 4DR3B 3DZ8A 1CULC 3I5UA 4EPRA 4A0RA 5FFNA 1W44A 3PEVA 2I87A 3E2MA 5C3MA 1Z16A 1GM5A 3C3KA 1YCDA 3NYRA 3OHPA 3OF3A 5HIKA 3G7UA 3RUFA 3TAXA 2HRRA 1RLMA 2XNSA 3JASB 3CO5A 4KH1A 4KO2S 4NV3A 1F5NA 4ETWA 2IZ7A 4BLRA 3CZPA 4U1RA 3JD0A 1BIFA 3F98A 1ZUWA 4DXAA 4EO4A 4MGZR 1YTUA 3K6SB 1VKZA 4FFNA 3V1NA 3S7ZA 3X1JA 1O5IA 2I3AA 2YV3A 3FGNA 4Q39A 2ISSD 3BRWA 3LKVA 4ODIA 5CX1B 4CHTA 3OKCA 3T54A 2VHUA 2VUUA 1AY0A 4KBGA 4MK4A 3WGQA 2YN4A 3RVDA 3V8NA 4BGEA 4NWIA 2PD6A 4MW7A 2BTQB 3LHKA 3W3AA 2V96A 4J6FA 4OFWA 2Y76A 3DDWA 3G0IA 1CP2A 1U0SY 2VT7A 2QY6A 3K6KA 4L3VA 4U02A 5CA0F 2M2IA 5GM2A 4EX6A 5LU9A 2P75A 4Q7EA 3K0AA 1YRYE 2J3EA 3JWPA 4XI9A 2J6IA 2AMFA 4Z7NB 1Z26A 3HKEA 1M34B 4MQ6A 5CCDA 4R3NA 1RM4A 5B3KA 2H2HA 5LA6A 1CUVA 4WN3A 1B2LA 3EK2A 1DAMA 1K8ZB 2BE7A 3MCZA 4JU9A 4ZCTA 2P7IA 4XSGA 1RRVA 3LQ4A 4QQ8A 4RABA 1KY4A 2J5RA 1DAHA 4IIUA 1T8RA 4O2AB 3TK1A 4MHSA 3U3MA 1QFSA 3UV7A 2UZ3A 3TSYA 4V39A 5JFGA 4KRFA 4PTZA 1G3RA 2JGRA 5TPZD 2J30A 2H31A 3LGAA 4E03A 5HCIA 2QIPA 3R4VA 3WB1A 4QFCA 1XB2A 3W5SA 5DI3B 1UPBA 2CB9A 4ILKA 1KYVA 4MV8A 4D4KA 1LJUA 2NU6A 4ID9A 4ZCPA 2GZ2A 4DQDA 1OBCA 3PB3A 4P0PB 4DF3A 1ODIA 1R8SA 2OY0A 1P1HA 1XCJA 1N4AA 3T7CA 5EZSA 2CE2X 9GPBA 2AG0A 3EG5A 1Y6ZA 5CB6A 5JARA 2VC2B 1WXWA 1CX9B 2I2WA 2TMDA 2VA9A 1CY7A 4YWJA 2WHEA 1JQBA 4JLAA 1O77A 3LLMA 3T7SA 1ID1A 1JR3D 4EW3A 2PUAA 1RQGA 2RGRA 2J4DA 1EXVA 4YRRA 1H5QA 3HYLA 5AW2A 1PCXA 3I9OA 3SKXA 1XMQB 1CDEA 4AULA 3GDWA 1P9LA 4LA4A 4KCGA 1VP9A 4KSCA 5ENZA 3RC7A 3KLOA 3V3KA 4AVYA 3TRKA 3C2QA 1EWVA 5ER9A 2ZW9A 3PLAE 1K08A 4IR7A 4EHBA 3ST7A 3QWIA 2XUJA 4H6XA 2JRLA 1E2EA 2JA1A 5DTEA 1L8LA 1FBNA 3W90A 4IF4A 1D07A 1T9KA 4DQKA 2QLMA 5JXHA 1TDJA 5KS2A 2BFFB 1T1RA 1C9YA 4KC0A 1EX6A 2GD1O 3SQLA 3VSAA 1OWLA 3GARA 1U0GA 3H13A 5F35A 1Z39A 5FBRB 2O3JA 4CCAA 1QNFA 2D59A 3MXOA 2RDMA 3PGLA 4F2DA 3IMKA 3WO0A 2VT2A 2Q41A 4H4DA 3WYAA 1KVTA 2GLXA 2OCBA 1Q83A 3E5MA 3NUZA 1XMVA 3CRZA 4RF3A 3QEBZ 1PVVA 1IONA 4CDNA 2I71A 1IDOA 1T5TA 3AVOA 5DCLA 1ECCA 2X0JA 5ALXA 4ENVA 4WLNA 3AEXA 5LN1A 3OQOA 4I5EA 1V7PC 2PM8A 4Z9AA 2FRVA 2JGFA 1XD8A 1ZONA 2X0EA 2W2XA 3H1GA 3JQ8A 3SZRA 4FYVA 5CFMA 1R66A 1L8XA 1TNDA 1ZUNB 3NM6B 4YLYA 3S1AA 1RHJA 2WUGA 3NHYA 1NUTA 1PS0A 3RD5A 2Z2YA 1PP4A 2ZULA 3MM4A 4A6XA 4OGKA 1RWKA 1QUFA 2FEWB 2GRJA 2OZEA 2Y0EA 1V1RA 4KIUA 5JMOA 2PAFA 3QMWA 3UBTA 3LY5A 3IMGA 4ATNA 3GRPA 1SCQA 1SO8A 4KE8A 2OGTA 3M4JA 5E6RA 2ESRA 4J3FA 1YB1A 2PX5A 2J3KA 2QE6A 2R8ZA 4M9QA 3STWA 4BNMA 4KP7A 1FQKA 2BFDB 1N33B 2H1LA 1Q1EA 5ALPA 2XR1A 4WJZA 3H4TA 2BY4A 2BEUB 1K0FA 1O9HA 3L0OA 4WKNA 1VQ1A 2PGJA 3G1TA 3ROPA 4BKOA 3VJRA 1X0VA 2BPOA 2EARA 3LVRE 4CF6A 4OH7A 4Q4JA 2JFQA 2DHEA 3A6EA 1KIFA 4YYZA 1RCFA 3EG9A 4GOMD 1Y7LA 2AD1A 2PX3A 4HRYA 1A9TA 1E1LA 1WDLA 2ZWAA 4Y6PA 3KR9A 3X1YA 4BU0A 2J7KA 2F3TA 3Q7IA 2QGFA 2R66A 3BXXA 5T64A 4W5HA 3T0IA 3FBWA 5L95A 1Z25A 2NYVA 1YQUA 2RHOA 3I6ZA 4ZYYA 1UKYA 1CUIA 2VUHB 1ZNZA 3AZPA 4FBMA 4HEHA 1WB6A 4WXYB 3QFRA 4Q18A 1H69A 1UMBB 3MRTA 2RAUA 3FKQA 3N8KA 1QR2A 5TX7A 2ZQZA 4XDGA 1S6YA 4TV8B 1NE7A 3CX8A 4IL5A 5JXJA 3HKCB 1NW5A 5BSHA 3HNPA 4Z7QB 1CC1S 3KAKA 3MTAA 1ZM3A 3ITEA 4YXFA 3BGDA 3OEHD 2EEZA 2MSDB 2BHSA 4XD2A 4UTOA 3PITA 2DPYA 3WADA 4LG1A 1DXQA 2BELA 4J8PA 4F5ZA 1KYZA 3L43A 3LFTA 4W7SA 1W25A 4NNPA 1I3KA 4X20A 5DM2A 3HS3A 3L4EA 5H7XA 3V7YA 2OV2A 3PYXA 1NJ1A 1G4UR 5E9JA 2OWDA 4KEAA 4BO6A 3U9LA 5JYCA 3EHEA 3T3OA 4DC9A 5IJAA 3VVLA 1MA0A 3HGMA 5ALTA 1GAWA 4Q9NA 3JD3A 3L6CA 4MR9A 5CK4A 5E6SB 2ZI3A 5TPWB 1E3JA 5CB4A 4DIMA 3WFZA 5HG0A 4DW8A 4RTOA 1JKFA 3K4PA 3BB1A 2G4LA 1ZD5A 2C99A 2PNJA 5EHQA 2VDWA 4W4TA 4Z8XA 3E7FA 3KTAA 1HDEA 4F8EA 4Q12A 1S9HA 1US8A 1JE1A 2OHGA 1YJXA 3K5HA 2CBZA 1B1CA 2J07A 1ISFA 4KE9A 2IOFA 3DB1A 4BGDA 4LI0A 1E79D 1PJ4A 2ZE7A 1FP4A 2JLXA 1AJEA 4R3UC 4B2YA 1NVDA 3QH4A 3DF7A 3BIOA 2V1UA 3LCVB 3PJDA 4HEQA 4CMIB 1UOEA 4AQ7A 4QPCA 4IHQA 1OJLA 4OIFA 1HV8A 3LYHA 4RF4A 5A5FA 3AKYA 3I5AA 3Q2KA 5AI6A 4AROA 5FQNA 4UAGA 5I7EA 2QAGA 3ZE0B 4FQ5A 4GE3A 4GT1A 3HBLA 2EZ9A 5IBRA 4YO8A 3EXIB 4IIJF 3FPBA 1CF4A 3KR0A 3R3YA 4DOMA 3K6SA 2WPDD 3L7MA 4TS9A 4HUTA 2FQXA 2ZU0C 3KB6A 4IX1A 4RANA 1OROA 5DASA 2YZ7A 5LOVF 1GSAA 1DC4A 1N0VC 3D02A 1SUDA 4XLZA 5EUMA 4WFIA 1YU9A 5IDYA 4EG3A 4FHCA 4DZRA 1ORRA 2B34A 4MUMA 1MR3F 1Y80A 2WM2A 1VIYA 1Y6JA 2XEXA 3U3KA 2CNWD 1J33A 3LPNA 5LZ5A 1O8CA 4CKEA 4TV9A 4MKZA 2GCPA 1SEVA 1YH3A 4BTEA 5L45A 4RPJA 3MJTA 5DLEA 1W48A 3PT5A 4J43A 3ZWCA 1J5EB 2ZYUX 1YNOA 1NT2A 3SBEA 3WLLA 1VM6A 3ZJYA 4PX5A 4LBVA 3DE7X 5CX4A 4DHWA 2JLZA 1YGYA 4E51A 5JHHB 1H8HD 2Q4RA 3SS7X 4B31A 5K5EA 2O8FA 3KU1A 2C77A 2Z5GA 1Q3HA 3ESDA 4LQDA 3GF4A 4O2AA 5EPEA 3Q8KA 3GMIA 4CZ2A 3P94A 1N2CA 4RV4A 3F4LA 1ZGBA 2YH2A 5KJEA 2IYTA 2V7UA 3IDFA 1BMFA 4JLSA 1AZWA 4Y2RA 4L27A 2YJ6A 3CMMA 4J03A 1SK8A 1P80A 4Z7OB 2A5FA 3QYFA 4L9AA 2XCRB 2AW3A 4HTFB 1E5DA 3COSA 3EDMA 1GV1A 1ZRSA 4QJ4A 3TR6A 4B87A 2C2GA 2CNKA 3HACA 2PU7A 2IS4A 3NC1C 4DL9A 5A6SA 1N7JA 1BJKA 3CONA 1KETA 3UHPA 3LUKA 1TEXA 5EIOA 4B6EA 4DVJA 2XUAA 5DHRA 2NTJA 4F7WA 5FOUA 5ALSA 3BZUA 5C4IA 1O4VA 3NDJA 4MWTA 2C1EA 1NBMA 2PKXA 3ZWOA 3DG9A 3FF4A 2FLKA 3QFCA 1QR6A 1V5EA 4UCFA 4HGPA 1UK6A 1VIMA 4WW0A 4ZK2A 1OWOA 2CHUA 3DBVO 4M49A 4AG5A 3H75A 2NU9B 4PYJA 1N2GA 1P62B 5T4FA 3C4QA 4WCVA 4YP6A 5BW5A 5K0EA 3A1FA 3WGJA 4RDIA 4WY2A 3KV1A 4XB1A 3A7DA 1ZR4A 1JMVA 2CNOA 3QXJA 2WQZA 2Z8YA 4ZOLF 3G8BA 1KDVA 2JGMA 4X7BA 4QQFA 3GY0A 4FMDF 5H3LA 4BWYA 4BYMA 2YRFA 2C4TA 1ISHA 4AIIA 4IIHA 3FFAA 3P9IA 4LN1A 5FLYA 5JMPA 2CMGA 3IB3A 3WR5A 1HF3A 4YV1A 1D2NA 4K03A 5INTA 2XB2A 2B1RA 2X8LA 2CJXA 4PSUA 5EAIA 4R8KA 1F0KA 1GD1O 2QDXA 4MW2A 3WXBA 2WT9A 5CH8A 4NYJQ 1LLFA 2YVUA 3CUYA 2R8PA 4AUEA 1LDGA 3V5NA 2XB6A 3MRSA 2BN4A 3WK4A 3GG2A 1EUZA 5C8YF 4EFMA 1Y3BE 3RU7A 4TVSA 4R40A 1TJ3A 3RWMB 1DCFA 1AA9A 2BI8A 4KMOA 5JS2A 3IVXA 2AB0A 2IEZA 3M6FA 2KM1A 4LDRA 4EJ2A 3CINA 3TOXA 2IZ0A 4CMAA 1OFHA 1RI1A 2WFLB 1WUJS 2YYZA 4K6OA 4N9QA 4OH1A 3BFKA 4Y9DA 2JGAA 2P41A 1QDLB 2VP0A 1OXTA 4TSKA 3RYFA 4PZEA 3U4QB 4IHJF 4QRDA 5JD4A 1NL3A 1ZNXA 3VZPA 5EJ9A 2B20A 1CYEA 1T8WA 2VH5R 2WNHA 1I24A 4KZPA 4DV6B 1XNHA 2Q3BA 3BB4A 4JJIA 3ICOA 5EESA 3RGGA 3ZTTA 2DKFA 3DNMA 4IJQA 3TOCA 3ZU5A 4A8JC 1AQNA 4CUJA 3EZLA 5DT9A 1E77A 1AQLA 5DH9A 3X2SA 2CLFB 3I58A 2C7QA 3QE9Y 4MLCA 1UMBA 3CIFA 3MIZA 4KNWA 1Y33E 3NOXA 3BCHA 2ZSBA 2FPPB 1M2FA 3Q5GA 2DKOA 4KQXA 1HSOA 3BOSA 2YYYA 3VBEA 4R2XA 1YZYA 4TKUB 5EMHA 2CMFA 4QAQA 3U7QB 3GW8A 1H6CA 5FUVA 3NRJA 5DNYB 3WLPA 3C16C 3MWEA 4YJ2F 4EKDA 1JVNA 2ONYA 3G68A 3VYRB 4NS4A 3WVNA 4OP1A 4BNTA 2FSFA 2QYHA 2E0IA 3HYTA 2ENUA 1E64A 2HHAA 3DQZA 2H7XA 2G4VA 4EVIA 2EF1A 4LC1A 4BKQA 4MA4A 2AYZA 3ROEA 4LNUA 3BEDA 4Z6KA 3G2HA 1A4IA 3JQAD 3HP1A 4JA0A 2NZWA 1JLKA 1BFUA 1BEEA 1G6Q1 2XMDA 3TJRA 5MDHA 1OBOA 2FW0A 2OO7A 2CD9A 4HAYA 2IVFA 2OAQ1 3KSBC 3EPHA 1DG3A 1P4SA 2GBLC 5BWNA 3TAHA 1K6EA 1VHQA 4DE5A 1NVVQ 4L8YA 4DIOA 1C9JA 4EM6A 1ZOIA 2HBRA 4EEKA 1H2BA 1F38A 5KOYA 3BKWA 4YMSA 1MU0A 5HZKA 5EUQB 4PU0A 4PSDA 4ZOQI 4UE3S 3TSOA 3I28A 4PYKA 1WV0A 1WB4A 1TPYA 4I99A 4YDRA 4MVJG 2WJVA 3RUCA 3O9MA 1OF1A 2R97A 1PJ3A 3U7JA 4FYJA 1Q0LA 1RZVA 4QEKA 1KYIA 4HH3C 4V02A 4PPNA 2OZLA 4C7OB 3MQFA 3M9LA 4CKZA 1XPOA 2PZBA 2IY9A 4O4HB 1Z35A 3ZHVA 1ORWA 1RHKA 5HQ3A 1RWMA 3WLHA 2R4QA 1UXIA 4M8KA 4R5HA 2GCOA 1RRCA 2ZRNA 3CUEF 3UH1A 4US2R 2F3PA 1Y9EA 5EJAA 4V3BA 5HOQA 2J0UB 5IKEA 3P52A 3PG5A 4DDWA 3N2GB 3Q3VA 1T6NA 4BV8A 3MWDA 2CLMB 2XMCA 4NCNA 3A7EA 3G1UA 1FYDA 1G17A 1T5LA 2DT8A 2FH5B 5DWVA 1R6DA 4EF4A 1NGSA 2GD6A 4YRMA 4FOTA 5J58A 1XCMA 1E6LA 1RXCA 4O2BA 3U60B 5JQGA 2CGEA 1NE2A 3L84A 3WNVA 3VGPA 1RAIA 1C0EA 3E7WA 1MOPA 1YGPA 2FF5A 4WDQA 5K05A 5KX5A 3N0WA 1IHDA 2A35A 2GPBA 1EGHA 1KJIA 2B0CA 2OAEA 2X1LA 3E8XA 4JXKA 2PRIA 4KN5A 1FP1D 3SYMA 3OZGA 4RJTA 3ILYA 4HWOA 1P72A 1WXDA 1Y3HA 1P2BA 1UZLA 4KI0A 5KOHB 2MSLA 1VJTA 3ZDDA 3QU7A 4TTJA 4Q7JB 1FE8A 1GG8A 1TU3A 3N05A 4Z4CA 5BN4A 2P9FA 1TCAA 4DS3A 2RMKA 2XYGA 1YRWA 1FSFA 4G9EA 1YZVA 4OL9A 2IYVA 3OUUA 4UHBA 1ZEJA 4Q7MB 3RRJA 1J8VA 3W9SA 1KYWA 3MW8A 1Q44A 4BJ6A 4F4UA 5IM4F 3X1WA 2AX4A 1G5QA 2RI1A 5HUQA 2G8NA 1TC2A 5C5CA 4GMHA 3F2IA 1WUHS 1QPBA 2YOGA 1X94A 5JJBA 2YZ2A 1WF6A 4KSBA 1E1RA 1DJMA 4LOKA 1YJQA 5KVCA 2XOEA 3SX4A 2VNAA 2QQFA 3GNQA 4ZKEA 4F3TA 3E0XA 2LNDA 4DMKA 2QVZX 1EQAA 4YT5A 3X2EA 3R0QA 3F1LA 1W6UA 2V4UA 3FMPB 4WNCA 5DYTA 3OC0A 5JSQA 3PENA 2AV6A 1YKSA 4XRGA 4XCQA 2P5TB 1NN0A 2RFLA 4HNSA 5HTOA 1KFJB 1VYHA 5FPYA 1W75A 1KK0A 4MWCA 2EAUA 5CAEB 4XDZA 4R2LA 3PA6A 4QRHA 5K2MA 2BGIA 3LYUA 3WGMA 1CNFA 3ZV6A 4ZYXA 2REXB 4DXDA 4KWEA 3I9NA 4ZAYA 2WW8A 4IG4A 5D3MB 1FUYB 5CB0A 3H5OA 1V8BA 4I4LA 4HAOA 4E31A 5DOVA 2R00A 3UYLA 1E0DA 2H2FA 4W63A 4C88A 4QLAA 3D4IA 3PFFA 1I1NA 5LYJA 2VSXA 1EE1A 1WUYA 3W2FA 1FFWA 1S2MA 3PE4A 5C5IA 4EAQA 1OXUA 2G6TA 2IYAA 4L7VA 5F1PA 1ZMRA 3T5TA 1TEVA 4B2IA 4AYTA 1SKMA 3R40A 4R2MA 1C30B 2A9KA 2VL7A 4TT3A 3TZBA 3W6ZA 4ZOEA 4RNDB 2D5AA 1ZD3A 2I7CA 4JKIA 4MV5A 3X3HA 4LF9B 1SHKA 4ENSA 1QTQA 3VO9A 1DIOB 1GZVA 1JDVA 4UM8B 1N3YA 1XRLA 2VHXA 2YWJA 3LUAA 5I9SA 1TQ4A 3N3BC 5E8RA 4MX8A 5BYBA 3IUEA 4GAEA 4BMDA 4TRRA 2EJCA 3PXAA 4I19A 1KHHA 2QJFA 1XZEA 2IUYA 3DHVA 3HL4A 3ECCA 4ZAXA 4GS5A 2GB4A 3RIGA 3TSWA 3GCXA 3ZZ1A 3G13A 4U8GA 3FAZA 4JXXA 1MB4A 2QSJA 1DPFA 3ESQA 3I9JA 3SR4A 2A92A 3A6GA 1N2IA 2PBFA 4H27A 2WTXA 2P2ZA 5HZHA 3QVGA 5JT1A 3U4GA 1J22A 1TIBA 1Z8HA 2JD1A 3M6LA 3DULA 3IQXA 6YASA 1MQAA 3LA8A 2OK7A 1DB3A 3AB8A 4O25A 3SJBA 1M0TA 3G23A 4TMFA 4CV0A 4JXZA 3QBVA 1MO2A 2X86A 1B15A 4PLCA 4TYMA 4UDXX 3RIEA 1RPJA 5G0VA 2OCAA 1IIBA 5IPFA 1K7CA 3KU4A 2XVZA 2W9XA 4JC5A 1YHYA 1EB8A 1YZQA 1Q3KA 1HDGO 4QXAA 5T4EA 1C7RA 1WV1A 3CRVA 5DTIA 5JD6A 3HZRA 4ESOA 3HZZA 3AKEA 3BWMA 3H04A 4PHTA 2FW7A 2IA5A 2RK6A 4KXLA 4BLQA 5AHRA 2W71A 5FUQA 4YJHA 1V3TA 4DV3B 1YKFA 2WDZA 2XNHA 4YFYA 2D4AA 2UXCB 4MYCA 1FNSA 1B1AA 3RS2A 1YE8A 4DLPA 1LLDA 4E11A 3W9UA 3T7AA 4MDFA 2W58A 3DTVD 2LDBA 2B78A 4IQ8A 2R6JA 5A9SB 1B8UA 4TS3A 3SLKA 2ZCUA 1ESDA 1AXGA 1Y8QA 5IBCA 1GQQA 3LK7A 4RXTA 1BVHA 2G5CA 2AOVA 2AR9A 1KIMA 3CZRA 3ICWA 3H9UA 4ENPA 4UATA 2B4AA 4FFBA 4N9WA 1QRRA 4REOA 3ZEIA 1PRYA 2ODWA 4ARZB 2XT6A 3W9BA 4WESA 5ALEA 1YASA 5ADWA 1XHLA 3I2FA 3OZEA 4LSWA 4ZPXA 4E3ZA 4XVHA 1D2CA 4G8JA 5HF5A 2HPVA 4PYOA 2AFHB 1L4EA 2J7PD 4AMUA 2VBFA 5BN5A 1E7QA 5I7VA 4RKEA 1TKCA 1F4LA 5HGJA 4GRAA 1R12A 4A8PA 3O21A 1Z5NA 3NVAA 2GHRA 2VAVA 4TXMA 4CUKA 2FSSA 1JQJC 2H2IA 7ADHA 4A16A 1N34B 1TC1A 4D9CA 1RYYA 2GJ8A 5E0OA 4EVSA 2L82A 3GZNA 5ETJA 5FL7A 4D0NA 1KJQA 2J46A 2N1BA 4IDNA 5BSUA 5JANA 5KHAA 4P6VF 3SQOA 3RR2A 2AXPA 2WTEA 2JJYA 3K20A 4M1SA 1FY2A 3ZE2B 3DZGA 5C1DA 4MWZA 1GGVA 4EHKA 4QG7A 1M2HA 1MF7A 1XTBA 1NG1A 1GL9B 3K1AB 1RXUA 1KVSA 3ITKA 4M9XA 4EW1A 1P3Y1 1OXVA 2IHTA 2EZUA 4H7EA 1CUUA 1CLEA 3WKDA 3D2LA 3ADBA 1KORA 1WHSA 4WE3A 1QRAA 2XAUA 3PR2B 4IFEA 4YN3A 2IUEA 2IV7A 4RD1A 5K0FA 1F6WA 1NRXA 1IN4A 3UANA 1KO8A 1X7GA 3EY4A 6LDHA 1SHZA 1THZA 2ZUSA 2ZS9A 3FZEA 1Q7RA 3H9JA 3ZXYA 2WHXA 2J0UA 4DZTA 3I5XA 4KXXA 2H63A 5I9BA 1UXGA 2FP3A 2GFQA 3JQ9A 4ZTUB 4MQEA 3FOAA 3PQ8A 1ZMTA 2R47A 4OI1A 2ZRHA 2VDLB 2G9NA 4ADSG 2W48A 3VR5H 1EJ6A 1FFYA 4KDEA 1RKQA 4FGUA 2BMEA 1LTHR 13PKA 1DAGA 1Y1SA 4V0MA 3CX4A 3AOGA 1J21A 1T1GA 3NWEA 3QEMA 4XM0A 3CG0A 1RI2A 3OUTA 5G4KB 3U44A 2R4UA 4ZU3A 4K2HA 3A4LA 4TWBA 5H3CA 2RAVA 5IM5A 1IVSA 4G4SP 4JC0A 4PSAA 4O1HA 1G0OA 4X54A 4I0WB 4EEXA 1G9TA 1GJRA 2GM5A 3SVLA 2J59A 2WHQA 2P0EA 2ZBUA 3R0IA 4PC7A 2BEVA 3TM5A 3HWWA 1S8NA 2XRFA 2EX0A 4NESA 4C4AA 3H05A 3BHIA 4PPYA 6REQB 3K9FC 2A3NA 1NBOA 3AL3A 2I3DA 4RAOA 4KGXA 3C0KA 4S24A 3L0PA 4MVCA 4C89A 3GP8A 4L8VA 2DUWA 2CJWA 3QITA 4WZ6A 2J87A 3LYAA 1KDZA 3GGSA 2XLBA 4ESHA 3D0QA 1P74A 221PA 4HNQA 3UICA 5BV2P 3OMWA 4Z3KA 3IBTA 4IDPA 3GJRA 4JBGA 5KYVA 2ZREA 4LRTB 1BYIA 2W98A 5A7GA 1E1CA 3PC8C 4XCVA 3SJ7A 5ARCA 2HHHB 4WJLA 4YWHA 5J47A 2ZJ4A 1XEFA 3LQRA 4U00A 3JQRA 1XVLA 2JD0A 4MINA 2I0FA 3F9RA 3Q9SA 1NW6A 4G81A 2A5LA 1EA7A 4M0UA 2GUWA 2WIBA 2O7NA 1M2JA 2AZXA 1IN6A 1FU4A 3WE7A 2GAOA 2CEKA 2NSJA 4Q4HB 1QYRA 2WKPA 4RGYA 4OHKA 1DQSA 1BOFA 4ND5A 1X70A 3SIRA 3X1ZA 4MXDA 4PBTA 2E48A 3L0CA 3V1TC 5CA1F 3ESBA 2BFWA 2XCLA 1GITA 2DHCA 1K97A 4FR5A 4GXNA 3V7NA 3WY9A 3GFPA 1WEKA 2C5BA 1NHWA 1NXSA 4RH3A 3QENA 4RHYA 2RHTA 5AVJA 4JEMA 3F8WA 1RXIA 1IIRA 3DEAA 1NJ2A 1ISSA 1NTRA 1N2XA 4MW5A 1TM3E 5CVTA 4QQKA 5G1OA 1V8OA 1T9HA 2ZSDA 2J9GA 3GRVA 3RS3A 4DLWA 3AVUA 2H92A 4PG7A 1IHUA 2PSHA 3IS3A 5D2CA 2IYZA 4MUYA 4UFNA 4C20A 4EBFA 2BDUA 3KO8A 2NTEA 3KSMA 4LJKA 4E12A 4CF7A 1QZ3A 3DR5A 3N75A 3CZ4A 3VFDA 4PV7A 3WRYC 1ZICA 5EHIA 3JALB 3OFJA 3T6KA 5KJ1A 5EQTA 1X2EA 4W5RA 2HIMA 1NI5A 2I8CA 4DCTA 1QH9A 1Q7TA 1BXGB 2XNDA 4X8LA 1YDFA 5FQOA 2DHRA 1UM8A 2EHDA 2XE4A 2ENWA 2IEGA 1CZLA 3UT5B 3A11A 4C04A 5IH7A 3WRVA 5BSWA 4RVHA 3GELA 4B48A 1UM9A 4JI6B 3NH9A 2YASA 3CLTD 3DO8A 3GFTA 3T4UA 4C76A 5AXBA 4ZYWA 3RT9A 4CM3A 2PN1A 2P69A 1OYVA 4ANFA 4DRYA 3PXCX 5AVOA 3ZS9A 4JKOA 1U9JA 2FGKA 2VI5A 5LP6C 4EYSA 1WBDA 1ML4A 4CFYA 4PTLA 4DLAA 2NGRA 2JFHA 1MNQA 1FTYA 3HYCA 4YCDA 4KLAA 2WY2D 5CR9A 4FLMA 5JJLA 3DOCA 4XVQA 3QHPA 2OUKA 1QQ6A 1T10A 3C3AA 4URWR 2LCQA 3ROZA 1KNQA 4DSNA 1KO4A 1NY5A 2P9QA 2BHRA 2GRUA 2QZPA 3INGA 4S2UA 3ZDFA 1LLQA 2AEFA 2DMRA 1MB3A 4MV3A 3FFXA 3ZDAA 1Q20A 3ITDA 1DAOA 2OHOA 1F8FA 1X1BA 3Q1KA 3IHTA 4KJXA 5DTJA 3OSZA 2FQWA 4AJ4A 5K51A 3ZWDA 3ZD7A 4Q9DA 1SMKA 2I29A 3EVZA 3EUAA 1KMMA 4HF7A 5K45A 2HT1A 2XKAA 5FYQA 4QE3A 2P9GA 1K2VN 2KE5A 4MITA 3HYSA 4C5AA 1G2OA 5F78A 5IF9A 1SD2A 1EFVA 2GPSA 1KRXA 3O74A 4JWKA 4R4JA 2X4LA 4A27A 4XWKA 4O0MA 1LLUA 2YZMA 1Q0UA 2CCGA 4K9SA 5AVSA 3Q7TA 4NAUA 9ABPA 4AKGA 1ZUHA 4IXDA 4A0FA 4BO3A 1RE1A 3MMZA 2PVCA 5THXA 3MTQA 1U3UA 3FETA 3GLKA 4R9RA 3NIGB 1ETHA 1H2RS 1SHTX 3P27A 4PHHA 3S2IA 1Z4KA 1D1TA 1BJTA 2LVBA 3CUVA 4MJ7A 4QYWA 2I67A 3GAAA 3GH3A 1OLOA 2VWGA 2M6RA 2HTEA 4DJFC 1HETA 2RONA 2GSDA 3LDHA 2BJVA 4FMPA 1LPNA 2JI8A 4YV2A 2D62A 2JVJA 2AFVA 2OO5A 1DG9A 1IM8A 1OV6A 1SFRA 2AFHA 3T1YB 1Z0FA 5BWCA 1LCIA 3TQCA 3AUUA 4ZQGA 5FLEX 4F3NA 2QTNA 4E5SA 2KS6A 1SELA 4ZVTA 4TYWA 5I9MA 3AUAA 3NIBA 4K1XA 4KXYA 5DNWA 4BQQA 4ZEWA 1G8YA 4KRGA 1L7MA 4U9HS 5J43A 3CVXA 1GFIA 1RADA 2JJ2A 2YIJA 1YA6A 4LRSB 1JNXX 3PGVA 3OOSA 3A9TA 3D2BA 3IRUA 1DX6A 3AEUB 2OQVA 4CU5A 3OQMA 2ZI4A 2V7VA 1I13A 2P11A 3SIWA 1FA9A 2YNMD 5JBNA 3U19A 1WP9A 3KX2A 3ZI7A 3W5AA 4OUKX 3ENKA 2XZTA 1WVIA 3NAGA 3IYLW 5AKXA 2PQ0A 2VPIA 4HGOA 4CRWB 1D2HA 2IK8A 5DBOA 5BMVF 4GNRA 5J5VA 3HJFA 2H52A 1AURA 3CRQA 1N25A 1BHSA 3SD7A 4Q01A 4GPIB 3Q6MA 4BASA 2QTMA 1ZBQA 2HDHA 4IJMA 1F3OA 4G0OA 1UZNA 2HMSA 5JVDA 3L8HA 1Z6AA 3PNOA 1TK3A 3O47A 1R7RA 4EY7A 4IG9A 1U9ZA 1HEUA 3CVJA 4HDOB 1O6ZA 3DH0A 5TQ2B 2Z56A 5B5SA 3F78A 1LNSA 4NDNE 5K2OA 1N8TA 1DJQA 1GTVA 4ALMA 3BWEA 2H9IA 4CIWA 4GX1A 4TYQA 1LI7A 4PY2A 4CMEC 2NXCA 1TVEA 1JDNA 1FLDA 4L2IA 3KLNA 4OHXA 2IXBA 3CEMA 5HIAA 1JTFA 4K0KB 4OFZA 1O6BA 1PDOA 1AB6A 2VRNA 4E5KA 1U5AA 1XRQA 3AVQA 3WV4A 3IAFA 3U5TA 1N3BA 4O4JF 5DKFA 4CLHA 4LE1A 4RDCA 4MGYR 5LR6A 3R3SA 2VK4A 3PXGA 2ICAA 2PSFA 4IM7A 4W8GA 821PA 3DKKA 1ZXBA 3GJ6A 3OD5A 4DLRA 4DWWA 2MDTA 1GAJA 3ODGA 2FUG1 3HLYA 4JUCA 5EJIA 1PJZA 2XYRA 2F8LA 4DCMA 3LTNC 4XQ9A 1XGKA 1QYXA 1C9MA 4QA9A 3N0VA 2K6GA 3UAZA 3M2TA 1FNCA 4FCWA 3UXYA 2WYVA 4DUZB 4ZQIA 1Y1LA 2O2SA 2V59A 5HE8A 4HDKB 2Z6QA 3TVTA 4NCBA 1C0KA 1CZOA 4DJDC 3G9ZA 4LYGA 3VDRA 2DR2A 2XNJA 4DABA 4K9RA 3R9KA 4LVCA 4M0DA 2FXIA 1QHXA 4KQGA 3UB4A 2JI6A 1W581 1QUEA 3T7DA 1KC3A 4XSVA 4XW2A 1Q19A 4LJSA 4G5OA 1Q92A 3O75A 1P91A 4G5QA 3MUEA 4KH0A 4PLYA 4UEWA 3WL5A 1UPTA 4RD6A 3D4PA 4JJFA 3GT4A 1CR2A 1Q12A 2JDIA 4I1IA 4QREA 1ZP6A 1S3GA 2BF7A 4M7RA 5EZ6B 5GADl 4KDCA 1P6XA 1Z28A 5IBPA 2I1WA 4YRZA 2A0XA 1GUDA 4A91A 4DTIA 3ZVKA 3DMTC 1A9XA 2P2LA 1NOIA 4G97A 1U4OA 3LGXA 4QDKA 5FWAA 2XDQB 3SVZA 4AY6A 2W2MA 5CFRA 4N40A 1VFNA 1YVEI 3CT6A 3GV0A 4JQSA 1KHTA 1YZHA 2P0AA 1XTVA 1DBVO 2PHZA 4K81B 1G7RA 1JG3A 2V6JA 4NQZA 3REFA 3PYMA 4CIBA 4RHTA 3AEQA 1GG2A 4TT8A 5F1YA 4F4IA 1TO2E 2I7TA 1XNJA 4YGYA 5KTRA 2P4UA 4LHYA 1Z8NA 4B84A 4ND7A 3IEKA 4JS0A 1IQPA 2G9QA 1XZLA 3JALA 3VUEA 4QU0A 2FCAA 1RZUA 4IV0A 3VTZA 5IJ9A 3LIPA 4FXPA 4OKNA 4CE6A 1KFBB 4KPYA 4K6KA 4AN4A 1G3UA 1DO8A 1U7OA 3Q98A 4C30A 4EFLA 3CNEA 3MS2A 4FZJA 4M9CA 2ZU6A 3V2HA 4QT4A 4LX8A 4FILA 1XAGA 2UVPB 5EG5A 5JG7A 4LWPA 1LX7A 4HB0A 4PBRA 1P2GA 3RKUA 6GPBA 3AR2A 1JFFB 4LI3X 1C4KA 2UYOA 3L7KA 1HM5A 5EINA 1GKKA 2CL6X 2B5OA 1BHQ1 2VA8A 2LIPA 2AN1A 2HSZA 2WJJA 1PDVA 1U28A 3D8TA 1PKXA 1NWHA 3EXG1 1G98A 3TRHA 2ZSKA 1P0FA 2GCNA 3OWXA 2HV9A 3BFJA 2D1YA 3Q3GE 1PGJA 2XUFA 3ZGYA 4UHFA 1EMDA 1I36A 521PA 3UGKA 5EHZA 3IT2A 2QLFA 3NVDA 4ZIRA 4HLCA 2QN2A 3HC7A 4YAWA 2P6NA 3HB9A 3W5HA 2RI0A 4ZT4A 3L7NA 1HOXA 1T9GS 1Y3FE 2GERA 4LTNA 3KOXA 4EG0A 2FX2A 2Q28A 2QJRA 2AKYA 3BDIA 2JJQA 2B69A 3IDAA 3NKVA 1T13A 3BRWD 2VRWA 4BGIA 4EKEA 1E5TA 8ATCA 5GIPE 4AX4A 3Q72A 5EOVA 3WA7A 1DBPA 3IELA 2H9YA 3L05A 4Y2VA 4Z4EA 2G7ZA 2EIHA 4C4OA 2P3SA 4CPDA 3FYUB 1H5NA 5JS7A 1YF3A 2IP2A 5A4JA 3JWHA 3ED1A 2KSQA 1AUQA 1RXWA 3RABA 4YIKA 3WSVA 3NTUA 2C57A 1DXOA 1KTIA 2WICA 4L8FA 3U37A 1XZIA 2GN9A 3N8IA 4G0YA 4PQYA 3FYTA 2C9YA 4RA9A 3AM4A 4CQMA 3NZEA 3MWGA 4S0XA 4UAVA 3STUA 3SYNA 4Q34A 3T52A 1EJ2A 5JDIC 1QQAA 3PIDA 4YP1A 3Q8MA 1J2RA 1MV5A 3TQRA 1SY7A 5H81A 1M1XB 3BRSA 3ADCA 4OXRA 4CBVA 3HJCA 1B73A 4QHTA 4YH1A 4FGSA 1OA0A 4BNDA 3UK0A 1AKTA 2W6OA 3F73A 2Y68A 4KZKA 2UYHA 5K8IA 4WBNF 1J0BA 1E6UA 4NYIR 4GMKA 1EGMB 2QJTA 4V03A 5GY7A 3MT9A 2C0CA 2JJ1A 2YV2A 3TI9A 1DQPA 3DHWC 1QOQB 3NEJA 1L5LA 3B20A 5ESDA 3B85A 5JWRA 4R71A 3SG0A 1ONSA 2D7JA 1PJRA 1UP7A 4QBGB 4B4KA 4OHYA 4ZODA 4OJKA 1F2UA 4TYNA 1JKXA 1OI2A 5KQPA 1BHO1 4C14A 1GNSA 2WWTA 5ADVA 3V8BA 1B14A 4N8DA 1X13A 2JAPA 4PAOA 4HK4A 4ZICA 1BRMA 2YOFA 3M49A 3OD1A 1T9AA 4OMCA 2XITA 4CT5A 2BMAA 1K7XB 3VAZA 4RDXA 5KJFA 1FJ2A 4PTYA 2X19A 1Y3CE 3LZCA 2D3TA 4LMAA 4WBSA 3SBDA 3B82A 2A4MA 3WG9A 3ZG6A 1NNEA 1UZUA 1YHZA 2PPVA 4MCIA 4W1QA 1GZUA 1NF9A 1IBCA 4MRPA 4TXNA 4ZMSA 1N2CE 3LK6A 5CA0A 3BH6A 1PWEA 1LD3A 2F6RA 3DEYX 5LC1A 3ENVA 1P4JA 5BPFA 3QXCA 1SUFA 1KMNA 4MKHA 1DEXA 3RGWS 3VV3A 4R6XA 2KB0A 1XZBA 3M5DA 1ZH6A 2F00A 5GJBA 1F20A 3LCMA 3URKA 4J7XA 2ECKA 3AJRA 5M2QA 2ZJYA 4CL2A 1N78A 3EH2A 3RRBA 3RRMA 1SGWA 2GEKA 3EXEA 3ONEA 4D92A 4UKDA 4B09A 4YDHB 2BRUA 2P7HA 2EC5A 2XJ4A 1C80A 1TUIA 3IP5A 3WZMA 3ZZ0A 3RFTA 4W7IA 4WH0A 4H3HB 5TQ2A 1DJPA 3TLAA 2I76A 3VR4H 4Y1RA 3TVDA 3TG2A 4TKMA 2G36A 1DRKA 5EEGA 3VPFA 3C3PA 1Y8ZA 3R9IA 2XBMA 1VLLA 3O3OB 2RI6A 3M70A 4IZ6A 3W5BA 4X3CA 5I9LA 1RRGA 1L7AA 3IAM6 1ZKMA 3L8EA 3R75A 4D2IA 1MVNA 1QG2A 2F55A 3C3EA 4JP3A 4NXNB 3UJPA 1NBME 2VPPA 3KKZA 2O59A 1M8FA 1J23A 3HN6A 4C0WA 4P3OA 4RPIA 2HLDA 3JAWA 2PZMA 4PO8A 4D1YA 2W6JA 2B9EA 4HLQB 3G2IA 2TYSB 1KEZA 4QNMA 4CKWB 4JL8A 1H4VB 2FFBA 4FYWA 4P80A 2G04A 3ORFA 1UPCA 1H2WA 5KVVA 2YDXA 5I8WA 2J48A 4LCBA 2NACA 3M7IA 2WI8A 5F5NA 3ADPA 2XCUA 1RSZA 2K87A 3KZ1E 5CNKA 4HDKA 2DLCX 3IKJA 2P5YA 3IEPA 1UJCA 1VE7A 4MUNA 3EWAA 3O8CA 2EFHB 2B9VA 1E2MA 1WXGA 2WKQA 3OIUA 4WZAE 4B6FA 1I3NA 1N5MA 1PEAA 1YB7A 2PCLA 5EJ8A 4OU4A 4BJHB 3GLTA 1IL0A 3DBLA 4LHEA 1WW2A 2OC9A 1KI7A 1VHTA 3L02A 1YS7A 1C3EA 3DWFA 1UJ6A 3H4VA 3Q0TA 1KSJA 4IRUB 2PUEA 3KZCA 3ABQB 1X8JA 3GCDA 4ZOLB 4BVFA 1Y1KE 1GT6A 2WEKA 1KFKB 1T29A 2BI4A 2I3BA 4P7GA 4NBNA 4NC9A 2MTBA 5DXAA 3UXMA 5L3SA 3GOHA 1LDNA 3P4YA 1E2KA 1O6GA 1W59A 2BR5A 2ZRGA 4HEA1 4Q15A 3TDMA 3HXMA 3KDPA 3C4JA 4AF8A 2SNIE 2VOEA 5DHSA 1U3VA 3FPCA 2GZ3A 3FLBA 1TAUA 5JDCC 4YAFA 3I5MA 3VR3A 1F4VA 1GTMA 1XTQA 3HUEA 5I5EA 1L7PA 2NVUA 4ZVPA 3ZJ5A 1GCAA 2YNMC 3R44A 3VH1A 2D1FA 3PIRA 4D45A 5JRDS 1YAHA 3W2EA 1NRIA 2BFCA 1OYOA 5H9WA 4WK2B 1R18A 4WD3A 4Y6SA 4B75A 1RFLA 2GS9A 3P45A 3QY9A 6CHYA 4LZOA 1JAXA 2NVWA 4COKA 3EQ2A 3CB2A 4IHJB 1WG8A 4FKBA 4YUXA 2WSIA 3UMCA 1MTZA 3ELUA 4F6CA 3BH0A 1KL7A 4IYJA 5A5VA 3E7DA 1D2AA 2Q29A 3C4VA 4PZPA 1UEJA 5HEKA 1SCJA 3I4FA 4QUGA 3S70A 1UC4B 5HSGA 3FTDA 1NT4A 2O2EA 2PL5A 4BVAA 1QE3A 2CD7A 1XELA 5BYAA 4R9VA 2IHNA 2CHQA 5JD3A 1X2BA 3SYLA 5B2FA 2VAXA 3R5FA 3ZWWA 3C6QA 4BVHA 3UWKA 1EVQA 3B1YA 3HK2A 2EW1A 3HLTA 2HNAA 3RUIA 3JD1A 2OFOA 2DFDA 4X71A 2CJPA 2XOKA 1ZGHA 4I1OA 5B36A 5BR4A 1HE3A 1HL7A 4AS1A 1FDUA 1PU2A 4HJRA 4KUEA 1BG6A 2VP5A 1ZMOA 3LWZA 3K6JA 4J7UA 4KX3A 3F7NA 2VWHA 1XDWA 3G9QA 1IRXA 2H4JA 4PAGA 5ADUS 1E5LA 1BU8A 1NMEA 2A4KA 1JZSA 2BZ1A 4TSRA 2X2PA 5BQOA 3VPGA 1L5WA 1FNBA 5JOQA 2VRCD 1NYLA 5JH7F 5D8DA 4L74A 3I1FA 4XIGS 5IANA 1UANA 3OEWA 1GPYA 2FZVA 3W4IA 1XE3A 4EHJA 3RKRA 3ZU6A 1P19A 3F5QA 1KBOA 4RACA 1ZA1A 4EF6A 2BSQA 3AERB 4Y2GA 4RTKA 1OILA 4ZYZA 1P7VA 2GN0A 3E0QA 1IB0A 1KTVA 1GN9A 3GFFA 2O8EA 2B4TO 1DKRA 4K3UA 1S89A 4ENQA 1A9SA 1YTLA 4AZVA 3CCBA 4LTDA 3VDXA 3CWCA 1F17A 5DBEX 1LNZA 3E3AA 2WF8A 4HX9A 1L4KA 4L51A 3QA9A 1A2BA 4PR3A 4QTXA 2YUTA 1IHPA 1D6SA 1VBFA 4P53A 4AW9A 4M98A 4LBWA 3N6VA 5C37A 1G19A 2DFPA 2KJQA 3KAQA 3HKBA 3DVRX 4D82A 3KQYA 3T1NA 5JV5A 5LOVA 3DMYA 1DL5A 3P5BA 4MI9A 1ODSA 2YHSA 2WP8J 4BMPB 2ZJ8A 1XDGA 3KQKA 5GQSA 1Z2OX 5FEUA 5AW8A 5CDUA 1PQYA 1R5JA 5F73A 1BDBA 1WQ4A 4Z0TA 2QVYX 5F64A 4G0UA 1U7WA 1ZC3A 1PV1A 2DLNA 2I8AA 2ZGVA 1WTCA 1Z15A 2L2QA 1BEUB 3GLQA 1UXHA 3ZV4A 1FRFS 1QS0B 3QE3A 3WLEA 1NBEA 1OKKD 1UAGA 3I73A 3TSZA 1XDZA 1GHTA 3KB1A 1TJ4A 3K73O 1YQXA 4JHXA 4TTSA 3I52A 4WADA 1UBKS 2DPHA 2HJWA 2P62A 2R68A 2JFVA 3G6KA 2NVOA 3MGGA 3NNSA 4A8HA 1CZNA 3K9LA 4DEYA 4IIJA 2GJ9A 4GZ5A 1VMKA 1UP6A 1R0CA 2HLPA 3OFNA 1NBMD 4CQLB 3X43A 3BZBA 3ECAA 3IAXA 1RQ7A 2CYAA 3DEFA 3DV0A 3P9NA 3BS4A 1KEVA 5DN6A 3QMMA 5AKGA 4AIRA 1M75A 4BLPA 4ZJZA 1L5GB 1D1PA 1Y0BA 4DAEA 3J81A 4I5FA 4JR1A 4GOOD 1WPQA 1Q74A 4P2GA 3R8CA 2Q1XA 4F38A 2AJBA 2JA2A 4DANA 3UCXA 5ES3A 4I4NA 4GI2A 1S4MA 5KO2A 2W6IA 2PRYA 3T4PA 1IN7A 1M8PA 2Z5FA 2PZAA 4BEVA 1F06A 4WZZA 3CH7A 3DW3X 3GVCA 5E3IA 4OSEA 1TYDE 1L5HB 2Q7OE 4BV2A 4EHDA 4AJLA 5BSGA 1NMXA 4LOJA 3QUAA 4PAQA 4BB0A 1L6IA 2DR0A 1KZ6A 1GCIA 2FFJA 1XF1A 3BD9A 1JU9A 3DV2A 4TQGA 5I6DA 3B6MA 4J4TA 1JHYA 1W34A 1E3EA 1IRIA 1M9NA 3OESA 3HU5A 3NBKA 4LDJA 4UOEA 3WYBA 2FPSA 1HZZA 4UCQA 3I92A 3K7EA 1N5IA 1G7CA 4X91A 2A58A 2GLUA 5EUBA 1BMQA 4IDEA 1PLJA 2YWGA 3WICA 4XASA 2Y99A 1JHDA 3WBFA 3CZCA 5E9AA 5G0WA 2BMFA 3ZWNA 1V2GA 3PFIA 3RSQA 4XIJA 4N48A 4A03A 4F8JA 2YBEA 4OX9Y 4MHTA 4PLFA 2CXHA 3PIIA 4YPOA 1VSVA 2EFDB 2QUKA 5TJ9A 3GT0A 5BSTA 3PC2A 1EI9A 4MA5A 4FFMA 5J63A 4RK0A 3K1TA 2QROA 3T3GA 3O8QA 1BDMA 4GPAA 1IH8A 3NHMA 1NFQA 2ZRAA 3QI7A 1G8FA 1YZNA 1Z82A 4DQUA 1U7UA 1E1YA 3GFQA 4AK9A 3CKYA 4CJXA 1GKIA 1N0WA 2HPHA 3H6KA 3SC4A 3V6MA 2C96A 3KQMA 3PDHA 4Z4GA 4MKIA 4TL8A 1S9DA 2VEDA 3HU2A 4JDUA 5E6UB 2HA6A 3RYCB 3AETB 5FA8A 3BHJA 1GPKA 2B30A 1QZXA 4HX2A 2CXNA 4W5QA 3RSHA 4OAQA 2O0MA 4C78A 1GPUA 3QPVA 1S2OA 3AU9A 2ZIGA 1DG1G 4MROA 3RC9A 3NIDB 4O6VA 5A4IS 3U4AA 4E15A 1G20B 5CEFA 1N6HA 4BWFB 1EGAA 3L9WA 4LDZA 5KDDA 4KAXA 5LMUB 5LB4A 4RVGA 1CQZA 2FOXA 3AV3A 2CZGA 2EWVA 3EVEA 5KBYA 2H1RA 3VR6D 1GAXA 4WAUA 2PLNA 2LD4A 4UU0A 5J2TB 1ATZA 1Z4PX 4KOAA 3RAPR 1N1GA 2JCXA 621PA 1PBTA 2GF2A 2FMIA 3I45A 1AHHA 1NQVA 2FR8A 4I08A 3W8DA 5JAOA 4BFCA 1YE3A 1HYGA 2JAQA 2QTVB 4BFWA 4X00A 1U2TA 2VHQA 4J0QA 5BSKA 5ENDA 1YQEA 2IHVA 2QYTA 1SKYE 4QM6A 5KSZA 4PLPA 2EERA 4ZKDA 2BM9A 4BAZA 2GM9A 2YV4A 4K9DA 3AWDA 2ZYAA 4MS1A 1VGVA 1UBSB 4W1SA 3SYTA 3RADC 2HLNA 3I9V1 1ECGA 4HAWA 1KYQA 2ANBA 1ZS9A 2COUA 2WHYA 3MMNA 5C8YA 1HDZA 3U6BA 4LW8A 2PV0A 1Y4DE 1A7UA 1J1ZA 5C46F 1A0OA 1U8YA 3OM0A 5NLLA 2A7QA 3B1KA 3DEIA 3SXUB 2YCLA 4AS2A 2PSJA 3VC7A 1OH7A 1PWZA 3ORRA 1YQ9A 4HFRA 1DKOA 5LBUA 4E30A 1DRWA 1V2HE 5JAZA 1PF7E 3J81k 3DC2A 4UHDA 1B6RA 1Y3IA 3GJ0A 4CNQA 3ZHOA 3WLNA 1S2DA 2WV7A 2FN3A 3DQPA 1KEEB 1BQ4A 3NH6A 4IHJA 3R7WB 5ITSA 1OHHD 4BNVA 4EW6A 5LNK1 3ANLA 1SUAA 3RYIB 2QYSA 3DWGA 3Q7QA 4QGFA 2C98A 2BFBA 1ONPA 2IDMA 3NVKI 4WACA 2XMPA 2AWNA 3K0CA 2LKDA 4IMPA 3LDFA 5KTSA 3FA2A 1Z45A 1C5KA 3R23A 3BSWA 1ZM4A 1BVUA 2HBYA 1YRLA 5DIFA 5MN4A 3HJGA 4DMRA 3L40A 4UMEA 5CCXA 1GRCA 1Z29A 2PQ2A 3PLRA 2JG3A 4QVGA 5HVNA 2OQ2A 1P9RA 1OBFO 2RKOA 1UJ2A 4JVMA 2JHCA 2WV9A 4UAUA 5FR1A 4YQEA 4LSMA 3T06B 3TJMA 1Y4AE 2E21A 2HA0A 5COAA 1Z83A 2RARA 5CIWA 4D02A 5EZYF 4YJ2A 1ADYA 1JG7A 4IIVA 4UD2A 3AG5A 1PUJA 3U1VA 1P3JA 4UNQA 3H0CA 1KP2A 5JASA 1HEIA 1MAVA 5JPIA 4HPWA 3SEZA 1VKHA 5ELMA 2FYTA 1PK8A 4IS2A 3JZDA 2BI7A 1S3SA 3E9DA 4RENA 1QH0A 2I5PO 2JH3A 5CBKA 2HWXA 3T7IA 4CW7A 1EAYA 5FOWA 2CT8A 3C8UA 2L17A 1QG6A 2JHFA 3OCJA 4FR2A 4Y0AA 5DIZA 3T3IA 5CXSA 3FRIA 4OB8A 1GZSA 3RRFA 3DZKA 2HJHA 5FTWA 2JGNA 1F7VA 4Q16A 1YULA 1P0CA 2GPWA 4I8XA 1U9YA 3EOAI 2GTPA 2PKYX 3LE8A 2VCYA 2L19A 2EIXA 3I3SR 4RK5A 4RH1A 1ZJ6A 2CJFA 3PKJA 4H7DA 4XPIB 5ESRA 3I5YA 5DYYA 3FFTA 4BZQA 3V4PB 1UWKA 2OL4A 4E1VA 1ISRA 3K05A 5EWLB 3DQQA 1UXJA 2Q5EA 3DZIA 5FI3A 1TL7C 3RIYA 5HK9A 3OZAA 1IOZA 3IIIA 3L4KA 3FRHA 1GZ4A 4MUJA 2CL7X 2WD9A 1E1RD 3ZD9A 1TU4A 4V0ME 4C0SA 3M1YA 5AM0A 2JIQA 3DLHA 3H5WA 3MINB 1CRWG 1X1EA 1E5XA 2PGAA 4D4LA 2IP1A 1V39A 5AVWA 1LVUA 1Y5NA 1THGA 2HMYB 4M55A 3H2GA 3PQ6A 2EJTA 1BKSB 4PFSA 2BGNA 1RBZA 3LS2A 3R0VA 2HJVA 4CMGA 2QL7A 3RSFA 4ZI7B 5G0TA 2GBPA 2IDJA 3E5RA 5AXAA 1MOSA 1EVKA 5IABA 2FRXA 3GYGA 1FX0A 3Q87B 2BHLA 2IOHA 4HNAB 5IG2A 1OZ0A 2FK8A 1CFJA 1HNXB 2XKJE 1PZFA 1MABB 1NN1A 2NN3C 3HMKA 2GZHA 3WKCA 4X45A 4ZVLA 3T1OA 2MMCA 4IDDA 5BR1A 1YR2A 2BFPA 3IDSA 3T9AA 3KJZA 2J3LA 3P0HA 3U62A 2VCHA 4IMIB 4RMIA 3REOA 4UEKA 3KQNA 1VGRA 2F1HA 1UOQA 3HUDA 1IDN1 1PS9A 3FTQA 3MUOA 1SVMA 3FNFA 3HI4A 1YNSA 2H17A 5KOJA 5JTUA 3IP1A 2O57A 3BAZA 3URMA 2F1KA 2ASVA 5AK0A 3CMCO 3SICE 1JR6A 1GSIA 4OA8A 5JPDA 3MWFA 4TT3D 3WP0A 4CLOB 3FROA 3RIHA 3UJAA 2QAGC 4YRAA 1ZLYA 1QM5A 1KAMA 4ZT6A 1OPRA 5TB5A 5FUXA 3KTFA 4HSGA 1CSEE 1VHLA 1E61A 3KBBA 4OMDA 1QH1A 1X77A 3PNPA 1S4QA 2H7YA 5FNZA 1T2NA 4EI9A 3H17A 1VCOA 4RVUA 1CVRA 4DNQA 4ZN6A 1X3SA 4QXQA 1N6IA 1U2EA 5IM4A 1M6HA 5AT1A 1QVWA 3WLFA 4IDOA 3KYIB 2CSXA 1PJAA 1JLSA 1XZHA 1RLOA 4ER0A 1G5RA 3ED5A 4UXJA 3QV1A 4MUHA 1XKTA 2DLDA 1UKZA 3GVHA 3JPYA 3WS7A 3R76A 3TLGA 2ORED 1BA3A 5FBHA 1T6ZA 4ISCA 4IVNA 5T6BA 5KYTA 2IS6A 4KRYA 1OX6A 1KAHA 4GVLA 1EFPA 4NMHA 1W46A 2N3ZA 3DEHA 5E6UA 4UTRA 5CA1B 5K6AA 2PRZA 2FKAA 2VTDA 3II6X 1ESMA 4NZ9A 2WJWA 4BBPA 2Q6KA 1RC1A 2DWCA 1XZNA 4XIYA 1NNSA 3WLIA 3IQFA 3L07A 4AP6A 2XE8A 2XE6A 3Q9UA 2H5LA 4YRFA 3S29A 1OLUA 1Y4ZA 4ZFNA 4DV1B 4N8EA 4G5YA 2IUFA 2AMJA 4CMCA 1B7GO 2RGYA 3HP4A 2FPLA 1E7WA 2B1QA 3HA3A 3DUFA 1JYEA 1O89A 2DM6A 1PD0A 1ST2A 5ERYA 3L7DA 3PU6A 3R3JA 1MZVA 2GXQA 4XYGA 4C2BA 1QB8A 4JYBA 5HJ7A 2CDCA 2FEXA 2P91A 1QRUA 5A71A 3VC2A 4TRJA 1QYVA 1V96A 5EKUA 2PL9A 5KJCA 5B7QA 3H3XA 4TUYA 1Q1QA 5E4JA 3KEMA 5DE3A 1JGTA 3SC2B 3NAMA 4PPGA 2AZMA 1H4SA 3S27A 4DNPA 2CXPA 1P1KA 3G5TA 4K40A 3G2OA 2H00A 4YJ3F 5KDOA 3AHEA 3NS7A 3OIFA 4ICIA 2R3SA 1QVVA 5AKKA 1HMPA 3B1ZA 3IVCA 4CMJA 4HNHA 5JNLA 1KNXA 2FCRA 3BF7A 3FDZB 4Z2YA 2IHBA 3C1TA 3CNOA 4DCCA 4D79A 3IXQA 1JA9A 4B17A 3C3XA 4HJXA 4DDVA 4RK4A 3W7VA 1U0OC 2IHKA 1MEOA 5GM1A 4MAAA 1BS9A 2VF2A 2GMWA 1XQVA 1NR1A 4U3JB 3JQGA 3RLFA 3VH4A 3EPJA 2DCUA 5HZGA 4EKIA 2IH2A 2DFTA 3IAS6 2EBFX 3HU3A 3OKFA 4X1IB 1FK8A 3UT0A 3VU0A 1A72A 1PW5A 3OLCX 2WWRA 5EWMA 2HGSA 2WJ4A 1ODLA 3EBPA 2IYYA 2WTBA 3T15A 1V5IA 4IMRA 1ENZA 1JJIA 1FFCA 3C1OA 4YHBA 1WF3A 5A04A 5ALUA 5HRAA 4WEOA 5DM70 3CFYA 1UDCA 2QTZA 3P4UA 1M2VA 1MIOA 3OQBA 4BLVA 1TZKA 2VHTA 2VJCA 4E21A 2B8TA 3NVMB 4BBAA 5K01A 1QTIA 5KVSA 4N76A 4BZPA 1ZAKA 4WSOA 5DPMA 5IN4A 1RXVA 2WVJA 3G88A 2IYXA 1TK2A 3R7DA 3K0SA 4E46A 4F56A 1AMNA 1EB9A 2OORA 2OLEA 1A50B 2PBLA 1MKYA 1P75A 3BMOA 3F49S 3EGXA 3HDGA 4EVRA 4OGWA 5C7OO 2EFYA 3S8YA 2FUCA 2RC5A 1X74A 3R7LA 5B55A 4GUDA 5KYGA 1CS0A 2AHOA 1II8A 4PQEA 5HXAA 3LQ2A 3E35A 2IPAB 2BTOA 1E4EA 3PDIA 3VV2A 5BOSA 2VZ9A 4KOEC 4O1IA 4II7A 3UC9A 4BNUA 1KO7A 1ZAYA 4JQCA 2RBKA 1H66A 4YXWA 2BW0A 3RPEA 1YD7A 2AUMA 2LGJA 3H1TA 4AZ3A 4DLKA 3RK0A 3B6JA 5LZ9A 5DLDA 1HG1A 4IGKA 3ZU3A 5IS2A 1UOOA 1VJ0A 3A58B 3LLSA 2I6GA 1L7VC 3LT5A 1Z7GA 3RUPA 4AKTA 1QVZA 1ZYUA