2G6TA

Crystal structure of an uncharacterized protein from clostridium acetobutylicum
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
MYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYSDIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHNDDYIKFLENMDYYLEQELKVEQEGNVYSCTMPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRINKKNLFVKMLIKDDNEKLVKRFDNLPYKNKVCFHPKPMKYKSVAFFPRYIWRCINYAARTSNSNLEQYTMDMSWLEKSCDILKMLCGEEDFIREKX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Clostridium acetobutylicum
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein, homolog HI1244 from Haemophilus inf
total genus 86
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08942 DUF1919 Domain of unknown function (DUF1919)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12290 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2g6tA01
2G6TA
chains in the Genus database with same CATH superfamily
2C1EA 1PSZA 2RI6A 3ZHOA 1BH2A 2CC2A 3VKVA 1TVMA 4O4IA 1VL0A 4CKXA 4E21A 1MTOA 4EGJA 2ONZA 4CEJB 1NG9A 2R4UA 1G8FA 2F62A 3DDCA 3AKDA 3I42A 4EFMA 1HMPA 2FEOA 3H05A 5LQNA 1QAQA 3M34A 4F6RA 3LW8A 4BV9A 2AR0A 3T4UA 3ZD9A 1A7JA 1QF6A 1M3SA 4MS3A 2Q3BA 4MUAA 1NOIA 4O4HA 1E94E 3K2EA 3ZW7A 5J59A 3DDZX 4C3UA 5B3LA 3M6MD 1XQWA 1Y6QA 2CLKB 4H7KA 1OBVA 2O0MA 3I8SA 4HYTA 5D3QA 2IDZA 2HLPA 4D79A 4DA0A 5K03A 4NSNA 1H4SA 3ZVNA 2V96A 1SQFA 1CHDA 1N25A 3O95A 4S1PA 5AQEA 3RNLA 1DCMA 1D7AA 3IAXA 3JVDA 3A1EA 4TV9F 3CZCA 2ONJA 5BURA 4DSTA 3AM1A 4RULA 5EP2A 3CX8A 4LSZA 2JDID 1E3LA 1VHWA 2X41A 3GEBA 4EHAA 3ELBA 1RI2A 5ELMA 1OV4A 4UDOA 3UUWA 3Q6NA 1B8OA 4FE4A 5L45A 1M74A 2X0IA 1IUOA 2DWUA 2D2VA 1GYQA 1KJWA 1O9BA 3VA7A 1RRCA 2YINC 3AGPA 5IPFA 2AJDA 3B1YA 2PPVA 5GVSA 1DSSG 3UATA 2J41A 4UM8B 5HILA 2A7XA 5TNXA 4ZIRB 5FUMA 1DT5A 3MOGA 1GTZA 3VPXA 4A6EA 3U4IA 2BUBA 4IIXA 5FPYA 1AZWA 2FEAA 2OO7A 3WJ2A 3ZXSA 2BR4A 4FDVA 1BVRA 1M67A 1QH9A 2L42A 3CUVA 4Q9HA 4DLYA 3D6NB 2NP7A 1HYEA 2VYND 4WY2A 4WI1A 4IJMA 4OHBA 5JCJA 5JHHB 1SQ6A 5GIPE 4U7GA 5KYVA 4HQ0A 2HA0A 3ORRA 1Z16A 2I6FA 3II6X 3IKTA 4I7EA 4KH0A 1IK4A 1Q0TA 3K4PA 5CURA 4IJWA 2I9PA 3GLHE 4M60A 2VWPA 3GRPA 4M0PA 1JIXA 2V8OA 4B9AA 4ZZIA 2IYPA 4DKXA 4E51A 3UQYS 1ORTA 1X70A 2G1UA 3E8SA 3IQXA 1A50B 4MHTA 5DP1A 1WY7A 1H6CA 2A5DA 4TMVA 3G0HA 1NJ5A 1T29A 3FI0A 3AILA 4DMHA 1LRJA 1M34B 2PZGA 2VP2A 2VNJA 3P71T 1MC1A 4GAEA 5JUWA 1MRNA 1H6BA 3G7NA 3SQDA 4PZ0A 1MB2A 3FPCA 5JSYA 1R0WA 5DULA 4P3PA 1YDFA 3I2JA 3IE0A 2FPXA 1L6RA 2Q3FA 1ZUIA 3RC1A 4MWBA 1PL6A 1V9CA 3EQ9A 4BIIA 1HETA 3SYRA 2BFFA 3H0EA 2Y4OA 3OWOA 3PR1A 4YDRA 3ENZA 4ZP1A 4O4IB 1CEYA 2JCYA 1FYDA 4PG8A 1MW8X 3L93A 4OXQA 4YT2A 4O2RA 1O6GA 1V8PA 2HU2A 3QTLA 2XUAA 1D3AA 2AUMA 2FB9A 3CHYA 4ZC8A 2RGNC 2A9KA 1LS6A 4K9RA 3RQIA 3RNOA 4YMWA 4DM4A 3ZV6A 4RSRA 4B5LA 3DAGA 1P7WA 4DB4A 1MJFA 1YCHA 3K0BA 1FTNA 1JDVA 2BZ0A 3GK3A 3L4EA 5EC8A 4ZVOA 4XCVA 1UQRA 4LBYA 2HK6A 2CLEB 3HN7A 4JGGA 3B60A 2R5NA 2QTVB 4IIYA 1CJCA 4KFUA 4ND8A 5AHWA 1BKSB 4UM9D 5DN9A 3AINA 1DZ3A 3EQ2A 1FNSA 1SBNE 1J24A 3MLBA 2G09A 1KWKA 2GWHA 3KPWA 4G23A 3QXSA 5FOWA 2OV6A 2DFNA 1LVHA 2Y71A 2ZQYA 3BHMA 3LPDA 4HNAA 3BMXA 3E4DA 3FYDA 2VRCD 4WZAE 2C88A 4RD6A 4WOBA 1W0KD 3UA4A 3ESQA 3AC0A 3IDSA 3OOJA 2ZZKA 3QX9A 4IVPA 3LHKA 4O59O 4AXXA 3UANA 4AKGA 4KXNA 4UFNA 5I4BA 3ZEIA 3PR3A 4YS6A 1VL6A 1M6YA 1SUCA 1T36B 3BWEA 5E38A 3PE6A 5SYAA 2PRJA 3FCCA 1WUKS 2P9CA 5BQPA 1VBNA 4J90A 5DNYB 2WG1A 2D3WA 4NYMR 3RODA 1UINA 3QMPA 2Y1EA 4DXDA 5TQ0A 2Q6KA 1K3UB 1SXJC 1BXRA 4LZPA 4AIIA 2B4TO 1XU4A 1KMCA 3PZRA 3ABSB 1LZKA 1LGYA 2ORIA 5L4LA 4KODA 4K9NA 5BNZA 4N5MA 3DR5A 3P94A 1UFQA 2EGGA 1TZMA 2H8KA 5T5QA 4WLFA 3DO8A 2ZYWX 4UM9B 1B1AA 4IIEA 5LOVB 2E4ZA 4DTCA 3I39X 2TYSB 4DM3A 4KHZA 2YN0A 3OA0A 5A3QA 5KYWB 1BH6A 2OBNA 4P3YA 1K6JA 4IG4A 4J03A 3DVAA 5CGZA 1CUSA 4B7CA 5MDHA 1T43A 1XDSA 2D54A 1JIKA 4GM4A 4HLDA 3H8WA 3M6AA 4UEKA 4PG7A 1TTTA 3FYCA 4IAOA 3E7DA 5JD5A 1UPFA 1TM3E 1CJUC 5F1PA 1N8NA 1RVV1 1WETA 3AL2A 3NOXA 1VRVA 4X6UA 3ZIAD 1LPOA 2WJJA 2CNDA 4MLPA 1II9A 1ZUNA 2DBVO 2A1UB 4OBWA 2GPBA 2ZS7A 5CGQB 2FG7C 4DDTA 2PT5A 1HK7A 5DHSA 2NAFA 4N01A 1VRWA 5B1DA 1T9BA 4L3WA 4GRAA 4ZICA 2CZQA 2ZJZA 1THZA 1WQ4A 1L7VC 1M1ZA 3IIKA 4L78A 2QB5A 4C76A 4BBJA 3BWVA 4XIIA 1NX6A 4G0MA 4JOQA 3TX2A 4K1LA 1ENYA 3E9CA 2FDXA 5IARA 4Z9BA 3TPCA 4ZGBA 5HM8A 5HKAA 5CCDA 2IHYA 2CNNA 1E2HA 3GJYA 5ITZA 3OJWA 1P19A 2JD2A 4A0RA 1XUOA 2PWBA 4WAUA 4CV1A 2NO0A 2PUVA 2HAEA 4TWIA 1S2IA 4I50A 3H65A 4CQMB 3KO8A 3Q3JB 1NW9B 2X8WA 2XMPA 4RQAA 4AKEA 2YV3A 2RJNA 5BYKA 2DHEA 1PYGA 2JGDA 1TMOA 3KZKA 5FUYA 1JW9B 2AI1A 1M1YA 4NPCA 1DINA 5I51A 3RSZA 1QHIA 2J30A 3BBLA 2F2TA 1DBIA 2BT4A 2VXOA 3C0KA 2EX4A 3L7BA 1GNRA 2ZTVA 3RTAA 3DAYA 4GSKA 4UTXA 3ND8A 3LKVA 4XLZA 1V26A 5EPOA 5GINE 4YMTA 5D3MB 1PIWA 2CUTA 3BN3A 4DHEA 4DJAA 1UBNA 4J0HA 1Z06A 3CZRA 4IHJB 1E0SA 1J5PA 3I32A 3HI6A 5CHYA 3E1GA 1TZ2A 5TRTA 4D6PA 2IDKA 3JWGA 1H94A 3THXA 2EXXA 4IIVA 3EXIB 1SN7A 3KCQA 1HOXA 4I19A 5TPWA 3SLRA 4AG6A 1CUUA 4LGCA 2PV0A 4L22A 1Q22A 3MJHA 1PHRA 2O1SA 3LGXA 2QPTA 3SDSA 5GADl 2HNKA 2YV4A 4QC2A 1H3FA 3EW9A 1XXHE 2IEGA 3NXSA 4S12A 5AKJA 4CI0B 1TM1E 4C0AC 2IHZA 1NX9A 1R00A 5BT9A 1WE2A 2JKZA 4B82A 3JVUA 4MR8A 1U0RA 1S2MA 4BEJA 1JDJA 4G1CA 3GHHA 1Y98A 2C2WA 2QLBA 3DVQX 5FX2A 1DAFA 2GK6A 2M6LA 4HBGA 1KBQA 4WLOA 1EMDA 4I99A 3QH4A 3OIGA 4KZKA 4S05A 3I9OA 3E9RA 1JSCA 1CQJA 1DAOA 1OAAA 2Q45A 1MC4A 1Q3KA 1E7YA 1P74A 3MWEA 5EZQA 4E3ZA 1VGVA 3T5BA 3K9CA 1VLZA 3TN7A 2WIJA 3Q3IA 1Y9EA 4DJEC 1JZQA 1OB2A 3COJA 1OWPA 2WF8A 3L8YA 4G0ZA 1SCUB 4I8XA 5GIOE 2GNPA 1RWBA 4R1OA 1QWSA 1G5QA 4XB6B 3L1UA 4NK4A 4RLQA 3RVLA 1Z4OA 2F17A 1YTUA 3CLRD 2ZWMA 4XCXA 1U8CB 1UMBA 1C9YA 2P0YA 1XTVA 1CZKA 2XVZA 3F2IA 3OETA 2PA0A 3IR7A 4HI0E 3ULKA 1PQUA 3UJ8A 3MERA 2V8BA 4QXPA 3R44A 4U02A 3VHXB 1MTZA 1RLTA 4GKBA 1KDYA 4LVOA 3URKA 3SOPA 1YUNA 1V39A 2OAP1 5E9JA 1Q12A 5ITZB 3STUA 3KHSA 4BE4A 3I0NA 1SPBS 2CXSA 1Z0AA 2HWXA 2IFTA 1LSSA 2YXDA 3FLBA 3E4CA 3QHPA 1GZDA 1R9NA 1KI4A 1MO2A 1Y42X 4GPAA 2O3RA 4LRUA 3V4FA 4W5QA 2KPOA 1G21E 2ZQZA 3MQFA 1TM5E 3G0IA 1LBHA 4ISBA 4YYZA 3CX3A 2FFQA 4DLZA 4AI6A 3A7DA 4F6LA 2OG1A 1YZVA 3WK9A 4QRDA 3C8DA 3L01A 4UTVA 4I4TF 3F7TA 1UFOA 1YQUA 1KPIA 2D1RA 5CEJA 1NVAA 1JIIA 5ARBA 3C7AA 2YJ4A 1DAHA 1JDUA 2VHTA 5A0VA 2HEGA 2LZ0A 1ZQ1A 2HDOA 2QN3A 3E9NA 4TPKA 1D09A 1I5OA 5ESDA 2C9YA 1YZLA 2GEUA 2YASA 3B78A 4LJ4A 4UUBA 3VDRA 1OXUA 1U7TA 1FS6A 1OF1A 1SXGA 3DM5A 3TR5A 3SQXA 1BX0A 3RFUA 4RFVA 2Z0MA 3T95A 4G5YA 5TMPA 3ZHVA 2OV8A 1I4LD 4Y2XA 4F2GA 1PWZA 4Q24A 3R7AA 5IAAA 2V58A 2FFBA 4TV8B 3HS3A 1OXSC 2I54A 1GZUA 2JFPA 4L5CA 4GX0A 4YREA 2I7DA 1UDCA 1A0OA 1U3GA 2R1TA 3G85A 3UAOA 4UNNA 1FTWA 1M1NB 3AVXA 4NFHA 2P3OA 3BIFA 4OATA 3F6PA 2PBZA 1ST2A 5E4JA 1RQNA 4LNAA 1C2YA 3UT5A 2PGIA 4YO7A 3TLGA 2AOWA 2BCJQ 1FSZA 3RC3A 5DLPA 4HRXA 4FN4A 5EHIA 1JQ3A 3KKMA 1N0WA 4CMCA 1P2GA 3CPSA 3ISTA 3IURA 4K9MA 1E1LA 3JQBA 2WHEA 3RWMB 3AR7A 3OJOA 4IR7A 1DJQA 5D8DA 1ILEA 4NYJR 1BOFA 3ZWNA 1PGPA 1K7FB 2XUOA 5DXJA 3NWEA 5HYVA 2J46A 3KSZO 2C42A 3X1KA 1EZZA 3CR8A 2OAGA 3W05A 3DSRA 3ZY6A 1BMTA 2Y68A 3KKKA 1E3MA 2PS3A 3LFHA 1QIDA 3LZDA 3BF7A 4IIJF 1XO1A 4WY8A 5K3EA 1FDVA 2I4OA 4I55A 1W87A 3CZ4A 4K28A 1XU7A 2FAXA 3F5MA 3P97A 3BRWA 5EWJB 3E3MA 2OM6A 3P9YA 4R2JA 5KNCH 4DQXA 1GWNA 2GD6A 3ASZA 1H23A 1N6LA 2FOXA 3SXUB 5FFFA 1S2LA 4A6XA 3L6EA 5M2QA 1JGTA 1YK1A 2YFYA 4EI8A 3MWJA 4LYEA 3W06A 2OD9A 5TMEA 4DR6B 2G1PA 1I3NA 2A86A 3N6XA 4FOLA 4ID3A 2X7XA 5CM2Z 1XI2A 1Y1RA 2Y1LA 3C85A 1M1UA 4JJKA 1SXJB 4P38A 1IJBA 4PIMA 4HXFB 1C8KA 4X6YA 3R09A 3H3XA 4CHTA 3OPYB 4XD7D 1Z37A 2PJDA 5CT6A 3AHHA 4LQCA 1MIOA 3DBLB 1YS4A 1FTYA 4LJ9A 1NBOA 1XB2A 4YV7A 2WOOA 4V24A 1G5HA 3DHWC 5BOSB 4I9HA 4PPGA 4EI2A 2EYQA 3HUDA 3OJ0A 3TPZA 4FD2A 5L4SA 2OBXA 2YOGA 1FPQA 1M2JA 3D0QA 3H2IA 3A1FA 4QJ4A 5CW2A 4QTTB 4BNTA 4YMGA 5IVKA 2C83A 3A1CA 5AM3A 3W78A 2RARA 5G2OA 2PX5A 3IXMA 3PC8C 4N3GA 4RSHA 2ZSBA 5I48A 3R4VA 4ZU6X 4CF6A 1I10A 2P1ZA 3TKLA 2XYQA 3TRJA 4EGQA 5FAKA 4TMTA 1HE1C 2VDPB 2KBEA 4JKYA 1JG2A 2B8TA 4ZFNA 1UKYA 3TIXB 3EFOA 5JAOA 1SOWA 2JL1A 1QCZA 2ZDHA 4NENB 1G6OA 4NCAA 1DAMA 4B73A 1OZ0A 1FRNA 1W85B 5K0TA 2FMIA 3V8EA 4PVDA 4HX9A 4RY0A 4AF8A 2QMYA 1WXXA 2SHKA 3UTDA 1D9ZA 2WD8A 3M1YA 3G9UA 3IVMA 4KYIB 4N39A 3P1JA 3KWJA 4TWJA 4DCPA 1TE2A 1ZN8A 3SS9X 4EKDA 2W70A 2LR0A 5M34A 1O95A 1HQKA 1YIOA 4V0RA 1HFJA 1BXGA 1CZHA 4C4XA 3QUTA 4D3FA 1ODIA 2PLRA 4KO4S 2ZI5A 1EKXA 1T3SA 5CVCA 4Z4HA 3L4SO 3SICE 4YJ2A 1UMDB 2G67A 3A9VA 1GADO 5BYAA 1HNNA 1M33A 2W6ID 4M1EA 2E2WA 3O73A 3WAJA 2IYAA 5B1YA 4H3SA 2W43A 1VHTA 3R7SA 2ILTA 3I45A 3IV7A 1T2EA 1CX9B 2PZEA 3CG4A 4M7RA 3NRBA 4XJTA 5U1PA 3RBVA 4YMUA 4CR8A 4ECAA 6ABPA 4CIDA 5EWJA 3AJDA 4F3RA 4WERA 5HQJA 2OCIA 4AIRA 5FIUA 3ICOA 3QPVA 4GZMA 1OI3A 1X0VA 3OFJA 2I22A 1VKZA 1YMQA 1JQAA 5AM0A 4Z0NA 4YP1A 5KU1A 4W8HA 3TJRA 3GZJA 1CY8A 1GZ5A 2WEKA 2NUAB 4GI1A 4PYNA 2ZUWA 4A0QA 2WWWA 3G2MA 2WWFA 1A5TA 1WDMA 4H0FA 1JLHA 2YC4C 2RHOA 2HA7A 2VJQA 3NLLA 3OU6A 5ALGA 3DVRX 1PL7A 3IDAA 5C3UA 3HYCA 4GZLA 3Q0IA 5FYQA 2RG7A 3TFQA 1VLMA 1TIBA 4K3VA 1RRPA 2IHTA 4PU0A 4Q7JB 3RSCA 2PYZA 4NS1A 3QWHA 2ZIWB 1U0OC 2H9AA 5FQNA 3B12A 5FWAA 2VPYA 5BOSA 2JFZA 1WSBA 3GPIA 3JYNA 1IE3A 2O5EA 4GEKA 3LI2A 4O4JA 2B37A 1C7EA 1M34A 4AUNA 5BT8A 1W88A 4JC8A 5JROA 2WYUA 3BCSA 3FWNA 3OCZA 2FSSA 3BBPA 1LPPA 4EJ0A 3UHPA 5HJ7A 3RAPR 4Z54A 3F2VA 3U60B 2JLRA 3RV4A 1S2DA 4OO3A 3NASA 5K6RA 5FA6A 2IH4A 2GM5A 3FM9A 2XB8A 4JLKA 4BE9A 4U0KA 2PL9A 4LZAA 2A1IA 2CJWA 4ZT5A 3U7EB 4GPTA 1WLSA 2HA2A 5AVXA 1XL0A 1OREA 1MORA 5EE0A 4LGYA 4OI4A 3GJ6A 2XECA 3GWGA 1YDHA 1WCIA 3WKDA 3OURA 3VVCA 2H7XA 4BC0A 1P3Y1 2I8LA 1YR6A 3TG2A 1G7RA 5IEBA 2HGSA 4H7EA 1CRPA 3MG9A 5HXAA 1VPEA 1JHRA 1S8FA 2JFFA 4M1KA 5LYJA 1G1MA 4HYEA 4JQOA 1P9OA 2Z4SA 2Q28A 5DDIP 4J3NA 4C6HA 2QN9A 1NXSA 4CM3A 1GQOA 3KEFA 1QRAA 4RW0A 4PBSA 1JKJB 1VDZA 1TJPB 3DTVB 5E0OA 4ZAXA 4CM1A 4AG3A 1XMOB 1M5RA 4YPFA 2GKSA 2H48A 4X8HA 3GV0A 1C9JA 4GICA 5FTJA 1XD2B 2D2IA 2J3EA 2DQKA 2V4ZA 4X44A 2OFFA 4RC9A 3ZY4A 4KQKA 1IZ0A 1KZ6A 1LLDA 4PNEA 3GBVA 4WKNA 3IKVA 4EHBA 1O5OA 2PSSA 5EJFA 1T0UA 2YHBA 1V6AA 2QLJA 4WL0A 3SX0A 1UMCB 3UWKA 3G1WA 3R75A 3PJDA 4BUZA 1O5TA 4AP5A 2CK3A 4WLNA 3WLPA 1R0RE 5AW3A 3DHYA 3N6VA 4JOBA 4RY2A 1VI5A 1Q2UA 1PYOA 2E55A 1SZCA 4YCLA 3A31A 1PFWA 1W1UA 1Z4KA 3PR2B 5AVUA 5JDIC 4IF4A 5HKKA 3A9TA 4MB2A 4O4LF 1W4BA 5HJ5A 2P5YA 2NM0A 5AW8A 1T5HX 3HVUA 4HDKB 3WGUA 2CLOB 3URMA 4YRNA 1VMEA 5FLYA 3EIFA 2O8CB 1HH4A 3TOCA 5GJBA 1TA4A 3QJ5A 3A9WA 1ZW1A 3SR4A 1A88A 3R3YA 4FILA 1J09A 1D1QA 4EJSC 2JFGA 5DIFA 5FPSA 1KFEB 4GKJB 2BSQA 2Q0QA 4FOTA 1VJ0A 3AB8A 1NF9A 2JBWA 3PXDA 2FZGA 2B35A 4F9GA 3CURA 4M88A 4O4JB 5DTIA 5EJ2A 3DMPA 1EUCB 4DMKA 4IQ8A 5KWVA 5DM4A 1PW7A 2O7QA 3NIFB 2X8LA 2NO4A 3E58A 3RT9A 2R87A 1DJMA 3AEKA 5WRFA 3HEMA 1IG3A 3CS3A 1QOZA 1EFVA 3WR5A 1G8KA 3R41A 3IBYA 1ZJWA 5DNAA 2G72A 5IXJA 4QHTA 2QTBA 2J59A 3R77A 2HNAA 3NTLA 4YX9A 1VMDA 1OZFA 3M1IA 3O3MB 2OVBA 1F4LA 3IIJA 3N8GA 2GCGA 4L5YA 3GRYA 3R9KA 4H59A 1IY9A 3PTAA 2DZDA 3CRW1 3C7DB 3GUVA 4E11A 2WHPA 5JV5A 1FW6A 3PEYA 4W63A 3MEQA 4DADA 1JXMA 4EKIA 4B4UA 5EJ6A 1X38A 5I7EA 3F6EX 1TLLA 2A92A 2C77A 3QEMB 5BWLA 4PLZA 3DUFA 3EY9A 1Q44A 2ZSKA 4UVHA 4JV5B 3DOCA 1RBZA 4YXWD 3T5PA 2WB4A 4RMHA 4MRMB 1NN3A 3K7EA 3T4PA 4ODIA 3LPCA 2PBRA 4X3CA 3SSAA 1ZK1A 2Q99A 3CKKA 3F7OA 3L1IA 3FJYA 3UEOA 4F60A 4ZZ0A 4FGSA 4I3GA 3PTZA 1XTTA 1W2WB 4UW9A 1M5TA 1R6XA 5IFKA 4IFIA 3MILA 4I50B 121PA 1UJ4A 5DIZA 5K3CA 3PXGA 4C0LA 4RTLA 5CDSA 3MTGA 1Y6RA 5BVHA 3A7EA 5CFPA 2WE7A 3GJQA 1RHJA 4EG4A 1QOQB 1SXIA 4N03A 3RVPA 4LOAA 2Q07A 2VI5A 3B9RA 4OHXA 2VP6A 3V3KA 4QM7A 1I9CA 2I91A 2VZEA 2COUA 2V4UA 3CH4B 5KOYA 2JAWA 3IVAA 1KERA 2I55A 2YW9A 3OP4A 3PHLA 5H70A 3UW3A 5IWCA 2R0QC 1X19A 3GA5A 4WXYB 1QHHA 3WHPA 3H5TA 3PQCA 3ZVMA 4NZMA 3HY4A 4Q01A 3K20A 2FVYA 3B1VA 1P4AA 4CUJA 2R1VA 4QM6A 4BMPB 1GIAA 2RGDA 2ZBVA 1CVRA 3M4NA 7GPBA 4GLFA 4TYWA 2UUPA 3RVJA 4YRMA 1FRFS 1S3FA 3ZW8A 3Q8KA 1Y8QA 2QMQA 1DKMA 1TK2A 5DYIA 1WWKA 2BEUB 3R5SA 5JG7A 3CLHA 3Q3HA 1Y82A 4N47A 2KB0A 5D87A 2DBRA 3IE1A 1H9CA 1ZOIA 1P91A 3HY3A 5EKDA 4J16C 2DPMA 1WMEA 4WECA 3W5IA 4YMHA 1E60A 5K51A 1DRUA 3JARA 4HQ6A 4OHFA 3UCEA 3U4QB 1XZIA 2AOUB 2L69A 4G37A 5KQSA 5H9VA 5TS2A 2BEVB 1H4TA 1RWNA 1CSEE 1EA7A 4K87A 1CWUA 1IXSB 2FF5A 3GD7A 2WSSD 1L7XA 2GJSA 3BMNA 2YZ2A 4B5KA 4JY7A 4RDIA 1XXHB 4IJ6A 2A4MA 3N7TA 2IY8A 2M6RA 2ECFA 3MXOA 4F9FA 3T06B 2ETXA 3HBAA 3S1AB 1F4VA 1UOEA 2WTEA 1FP4B 3H0CA 3HY6A 1IH8A 4MR9A 4TYPA 2QQFA 4RPCA 1J23A 1NI4B 4W4TA 3A1VA 1ADFA 3PF8A 4DDKA 1G9SA 1V7ZA 1YNOA 3G2PA 4FQ7A 3PX7A 1VL1A 2VJLA 3CE6A 1Y1LA 2FN7A 3OZBA 1C3EA 5AP9A 1MMFB 3RJ9A 1CBUA 3H6GA 4M9CA 1QVZA 2GF0A 2QX8A 3A25A 3E3OA 4OEHA 3CONA 5DYNA 5TARA 1NXWA 4URFA 5B30A 4CKBB 3TQCA 3IEPA 1XJ0A 2PBLA 4ND8B 5I4KA 5K2OA 4O3FA 4A8JA 3C43A 4MVJH 4JA2A 4EHHA 1OFIA 1SK9A 1FFXB 4CN9A 2FFAA 2GPNA 4KE9A 1JSXA 1M83A 1ICIA 1NWCA 2JAHA 1UC5B 3K8ZA 2EBWA 4MQ6A 3ME5A 4REMA 1PO7A 4ESHA 5EIEA 1Z0FA 5JEDA 1QF9A 3TLXA 4LC9A 3IKJA 4GI3A 1EI9A 2A35A 4TYQA 4N5DA 3P0JA 5CFQA 2OXTA 5E6SB 2MYTA 4TSKA 1ZMRA 3EXHC 4IDQA 2IYUA 4YDSA 3TBFA 1T13A 3UK0A 2I6GA 3JALA 3G88A 4YMSA 3ZH9B 5ICSA 4Z9AA 3VZDA 1D6MA 4GMHA 4P81A 5FBRB 5JE8A 3UAXA 3WLQA 4JP8A 1VB3A 3SZUA 4B6JA 3K6SB 1P75A 2YYZA 1WSDA 2NVOA 3MNFA 2WYHA 1PZGA 3EDYA 3IR6A 2PH1A 3F98A 4RJKA 5G0SA 4D9BA 5E9QA 3PB3A 2W37A 5JADA 2ATXA 4NBKA 4PR3A 1IWOA 3QE3A 3RLFA 1MJHA 1J9GA 2CJYA 3DE3X 1FDOA 2Q1XA 1JPNA 4C5BA 1HNZB 4GKVA 4V2IA 4DV6B 3FRHA 3Q9LA 4D44A 4GC5A 5A5GA 4D0LB 3SEFA 2ZBRA 2OHHA 3I92A 5I9BA 3ZLBA 1L5MA 4GPZA 2R1TB 3O91A 3DE2X 2IPXA 2AX3A 1G19A 1WJGA 1GZ7A 3GHYA 4I1IA 3LLVA 3GBSA 3Q15C 4OFZA 4UNSA 3VU3A 3PPIA 5DZSA 1USVA 1ZM2A 1A04A 5LZ5A 1GKYA 4ZDIA 2J5XA 4DSOA 2QTCA 1MAVA 2MT9A 4ND7A 1LDGA 2CBZA 2AJLI 4LHSA 2NUPB 3IPAA 5FTNA 5DYTA 4QDOA 5CJ2A 2P3QA 1POXA 2XNJA 2E89A 3FSJX 2DCUA 1MOZA 3GEHA 4WDQA 5KCMA 4ERXA 4Z5XA 1B42A 1KP3A 3PXEA 3ZK8A 3Q5DA 5ALDA 3ND6A 2FEKA 5SICE 2NZUG 5LJLA 1N2CE 3FDJA 4GYYA 3AUJB 2W6JD 1PS0A 5ETJA 3RQSA 4RCZA 3ZXXA 4P3XA 1Y6GA 1SUFA 1PJRA 4OGWA 3X2EA 3T3HA 1KOFA 1YVDA 3U2QA 3BGVA 3R2JA 4BBPA 2HY7A 4R2MA 5BUZA 4KRFA 5FA5A 2AYXA 3RC9A 5K9ZA 2O2JA 3I34X 5C1DA 5J4YA 2ZIGA 4MRSA 3KHUA 5KTYA 4BXOB 1KO5A 2QM0A 5TE9A 1HXHA 4AYXA 4PICA 4J29A 1XVLA 1ISMA 4C7JA 5F23A 3HJFA 2XQGA 2I3DA 1SPXA 3GLSA 1WSWA 3M6IA 1A76A 1OW3B 2DBYA 4JUBA 5IUJC 1YJCA 3LU1A 1PJ3A 3EMKA 5TR9A 1AHPA 2GMWA 3EMVA 3FPFA 4HYYA 4CFYA 5CLQA 2OCXA 1E1CB 3UHJA 4LSMA 2FWNA 2NSLA 2XQIA 5JJKA 4B6SA 1YULA 4K8RB 1OFHA 2GZHA 3MMSA 4ZHQF 3C1TA 1ZA1A 3P0EA 3R9XB 4M9UA 2VDNB 2F43A 3P2MA 1KQGA 4H6WA 2SECE 5IAKA 3AR6A 5FNVF 1OX6A 3OZUA 3TTWA 3LVFO 3QX3A 2QTAA 3HCWA 2ZAOA 1N6OA 4E5MA 4JBYA 1INLA 2R8ZA 2M6KA 1LDEA 4NYJQ 1SUSA 4R8LA 1I0ZA 5KQRA 3S70A 2XE6A 3BUSA 1CY1A 1PU2A 2X3YA 1LK0A 2O8EA 4L02A 2WKPA 3IVRA 3IXLA 1QQTA 3ZLVA 5FI5A 5TQ2B 3QUSA 4GI7A 4WFIA 5BR1A 5ICGA 3BOSA 5CH3A 1MX3A 1Z88A 3LQKA 3I1FA 5BN4A 4P5EA 5AJZA 4RTOA 1A7AA 1E2LA 1Z4JA 3I2FA 4B43A 5KJFA 4ZRMA 4DCMA 3IRUA 1AQNA 3ZZTA 3L7AA 3ZIUA 3DEJA 1MAAA 1IQRA 2C0CA 4YQFA 4S0XA 3VU0A 2DERA 4AQYB 1U2DA 3KZNA 2QLFA 3OF2A 4J7XA 2WOJA 5AMXA 4F72A 3CJQA 3RSOA 4CDRA 2WVJA 1U6KA 1PG2A 2G70A 3GMIA 2ZE5A 4ZARA 4ASUA 1AQYA 1TPYA 2HO5A 4XIFA 4DLNA 3T1VA 4CQLB 3OIDA 2V6JA 1J0XO 1DEAA 4IPTA 3F9RA 4YEDA 5HZGA 3G9ZA 2H16A 2W2KB 3ILHA 3ZQKA 2WSSA 4CLEA 4MA0A 2DHQA 2JLXA 1SCUA 5GJVC 1DG3A 5A5EA 3LF2A 4HF7A 4N0MA 4FSXA 3NX4A 1AM4D 4BB6A 1JYSA 1X1SA 4EZEA 2IYWA 1BX1A 1OXTA 3AP3A 4HDQB 3CX7A 3CFYA 3QBDA 3WHKA 3SNKA 1N9GA 2BR3A 3KR2A 3ROTA 1G98A 1DAKA 2IEIA 2YJ5A 2Z83A 5D00A 1ZAYA 1SD5A 1WTCA 3JWIA 4LE0A 2G0NA 1ARZA 4IJ5A 3UAVA 1E20A 1FS4A 2REOA 4IMJB 4PYOA 4WK6A 4AWAA 5JPCA 3GFPA 4B3GA 1T10A 2ZGVA 5MN4A 1X8KA 4ESEA 5AW7A 1LBIA 3NT2A 4M9RA 3NWPA 1T5OA 1BA3A 2ZUSA 1U04A 3AVQA 5BW4A 1RI1A 2UVQA 3L5OA 2I2CA 1NMEA 3VV3A 4CEIB 1X1CA 4OI2A 1OU0A 5JS2A 4Z4QA 4RSMA 3J81A 1P5RA 1QH1B 4AJEA 5K1ZA 4QNRA 4H6XA 1EUDA 1GPAA 2X0DA 5I7VA 3C6QA 1TADA 2O2CA 4Y30A 3VR5A 5JY1A 3N39C 2HLHA 5K4AA 2AN1A 5FWXB 4DRXA 2AXNA 3NBUA 3ZBPA 3P0HA 2NNWB 3E7WA 4CLOB 2Q4TA 5C7OO 4FNMA 3W7BA 2ATCA 1OXBB 2YVUA 4L0DA 4AVYA 3A14A 4AQ7A 1DQYA 1W88B 3EIXA 3I6IA 2PYDA 4G07A 3U4DA 2C3MA 1GFIA 1G8YA 2PKXA 1Z75A 3WWCA 4URZR 5F98A 2Q0HA 3ZKAA 4EARA 2VJMB 1PBTA 1S3SA 3MJSA 3LUFA 3N05A 4NJEB 4PAMA 4PSKA 3OX2A 3BFKA 3K4QA 4CM8A 3WNZA 3HABA 2PUAA 1KYQA 1OY1A 1LDMA 1XYYA 1D03A 3E03A 1QBGA 1U5BB 5FHRA 3P45A 4UBJA 1R6VA 2RGRA 2RGGA 5CHEA 1RWQA 4A0HA 5BXQC 2AMJA 3K9FC 4ID9A 3TZBA 1E4YA 1V48A 3V4LA 5ER6A 4DR3B 3FFXA 3OMWA 4EYOA 1JSLA 4X85A 4BY9E 1GP2A 4B2IA 2IX3A 5KSOA 2I2DA 2ZRIA 1UOQA 4RVCA 4Y1GA 3T7KA 4C6SA 5CG2A 3T3EA 2ASVA 3M3DA 2VDOB 4YR7A 4WLUA 1JKJA 3DULA 1GTG1 1TKAA 2P6PA 2VKTA 2JI4A 2AMLA 2NVUA 1Y7LA 1I6MA 3LWZA 4URUR 2PV7A 1HDGO 1XA4A 4OKIA 1MB3A 4Q21A 4PNHA 5KINB 2PUFA 4BRSA 3WLFA 4D3YA 3ROGA 5A1TA 2GARA 1JYEA 3GEGA 4HX5A 1YE5A 5CFZA 3FVTA 4N12A 1PUJA 2IYZA 1AVTA 4UMEA 4FFVA 1P1IA 1ZMOA 4FHGA 2IUSA 3O7MA 1T9CA 1XDBA 1ZXXA 2PVPA 4R68A 4PCAA 5HF9A 4DJDC 3VZQA 1ZC4A 1ZCZA 2D0OB 2VSQA 3N0RA 3OQPA 4GOOD 4ZCTA 1YKFA 4CLRB 1H6AA 5E8JA 3LGAA 3G82C 1W34A 5EZYF 2EKQA 3ZJ5A 3ICWA 4FYWA 2RFLA 2Q3HA 4V39A 2WA1A 4N0PA 2K87A 4RENA 2BFOA 3AZOA 3C5WP 5H3CA 5JLJA 2A78A 2GTIA 1JLKA 1JEQB 1TJNA 2C00A 1QIEA 1V4VA 4IQ0A 3GR6A 4Q3AA 4YP0A 4YP6A 5CLHA 2BKEA 1NQOA 3BICA 1CUAA 1ONNA 1YASA 1U6IA 3EK2A 3D81A 2QTGA 1NVWQ 3EVDA 3F5SA 1F8UA 4UPEA 3DZ8A 3IIEA 3U3DA 1EYZA 1DXOA 1DQRA 4H7IA 3TMAA 3S4YA 4D43A 3WYGA 2LKCA 1AV7A 2QL6A 2ZVQX 4CTNA 5EWMB 2WTAA 4MB0A 1AK9A 1MIOB 2P2ZA 3DBLA 5J5VA 3FFBA 4UAJA 4NS4A 1DDOA 1IEWA 1TIPA 3W5BA 5EJGA 4RE6A 3COYA 4HWRA 5DRYA 4JYAB 5CU7A 1L4KA 2HMTA 2FG5A 3DDUA 2CBGA 5GVRA 8ABPA 2IEYA 1SQSA 4HNHA 2RGWA 2P40A 3C7KA 1VG9B 3QG5A 2F7SA 4MWOA 4ZOAA 1UM9A 5AM4A 4QBKA 1V37A 3ZWKA 4YO8A 4FU0A 4YMIA 1ZNZA 1M2OA 3JQAB 3L6RA 5IANA 3HGTA 4R83A 2I76A 3Q7TA 2FE4A 1SU4A 1AUQA 1UZNA 1VE7A 2OP1A 3RU9A 4MP8A 4BFTA 4DB2A 1KAGA 4UQLA 1W4CA 4F06A 1CP3A 1YL6A 2BTQB 3RVNA 3QXGA 5IZCC 4V02A 5T3YA 4URWR 3G8DA 4QGBA 5A6SB 5JH7B 1I4WA 2G0TA 4JOSA 4W1RA 3MQ2A 1MVNA 4G0UA 1CR6A 3LX5A 2C4HA 2HHCA 2YVQA 3HEAA 4I9GA 3Q4GA 4TL6A 2JGLA 3RLIA 3SLKA 3T3IA 1C9KA 3TLBA 3WIDA 1IB6A 3L8FA 4MRMA 4KR2A 3GOQA 2CKDA 1KVUA 2X14A 3MINA 3PG5A 3L1JA 4X54A 4BWGA 4OJTA 3FPLA 1VJGA 5KQLA 1KEKA 3FVQA 2FOLA 1V4NA 1NOJA 5D7BA 4ZI7F 2WUFA 2C9DA 1UPCA 2C0PA 3LW7A 1KJ9A 2PSDA 1LWOA 4C08A 2BUAA 3EASA 5JI3E 5CITA 1OH7A 1ZH2A 3IPLA 3ANLA 4MKXA 2FPPB 5TQVA 2QTTA 3I37X 3KAQA 4FYKA 3C3WA 3H5LA 1MEJA 5JU6A 1T5SA 1ZVJA 2B7LA 2P9JA 4GMFA 1CT9A 4IGKA 4MITA 3LQQA 1E1YA 1HG1A 5HS6A 2EVWX 5IT9A 4KXYA 1JT2A 1YUMA 4JD5A 3VPCA 3U4MA 1ZL2A 2QA5A 2FUG1 4Z8XA 2MDTA 1QJCA 2R1VB 1KMIY 1CZLA 1ST3A 3HQ4O 3QHQA 4H16A 4Q00A 4B3SB 5TEVA 2FXVA 3BEOA 1U81A 3VC2A 1DO0A 1PDOA 2WQZA 3M33A 3L8ZA 4DQ0A 2QUJA 5EE1A 4I4LA 1RXWA 1Y8QB 1C0EA 2FW9A 1EXWA 5BOVA 1AGYA 3CIOA 4MAFA 1KR5A 1NSYA 4ZTBA 3RC2A 1L7BA 4BJ6A 1EK2A 1EK6A 3DLPX 2H0AA 2YXNA 4XVUA 2DLCX 3KX2A 1N2CA 3A3KA 5HDBB 3ONFA 4QO8A 2IV7A 1OCEA 3GJ0A 1BTOA 4YJGA 4E2XA 3NORA 1SUAA 2XVYA 4TLCA 2J0VA 4EHKA 1U4OA 3FHCB 2I7VA 4IVNA 2ZRMA 1ZO8A 2DU8A 2G9QA 1GCAA 3PUWA 4R9VA 2FETA 4OQZA 3RUFA 3V6LA 5L51A 4CL2A 4X7BA 1YS9A 3LD9A 2BY4A 3HKEA 5G4KB 3JQ6A 5HNKA 4IP0A 2O54A 2AFIA 3CG0A 3PI7A 3O0TA 4IDCA 5LUAA 3EGXA 4RWZA 5BVGA 3NATA 4AKIA 1RM3A 5F7XA 1JALA 3BHIA 2ZBPA 3TB4A 3KEMA 1JN0A 3HO8A 4OIMA 4BNVA 1S2OA 4R4JA 2FMUA 1JQ5A 3H97A 2GK7A 1FE8A 1URPA 1L5HA 4X7PA 4DYVA 1SVMA 1M72A 1NBEA 4PYJA 1T4BA 2R2AA 3TNDA 2C31A 1V6CA 2AG0A 2W6ZA 2ZI4A 2FMHA 3F4KA 3LRPA 4KBFA 4XKJA 3VBCA 4F4JA 3OCUA 1XZ8A 5I6DA 1MG5A 2GILA 2I6QA 3CRNA 4HB4A 1LSOA 4I6EA 4HV4A 2HRCA 3L3BA 5C18A 1SHJA 3P7MA 4LRTB 3CPJB 4M0CA 4M7PA 4X8MA 4ZODA 2GPYA 4IDOA 4RABA 4J3JA 4ABYA 3AUKA 5IDWA 3FCXA 4NBVA 3U7HB 3ZD7A 3KT0A 4LXYA 5CLFA 1ZIDA 1NDHA 1NNUA 2Q5QA 1AX9A 4MV6A 4OQFA 3EMBA 3SXJA 1SVUA 1L5OA 2CK3D 1GKIA 1NYTA 3GLHB 1J8VA 3UICA 3U1TA 3Q7SA 3RHZA 4EGFA 2PUCA 4Q3LA 1PX0A 1W5AA 2ROQA 3BGIA 1WKBA 2YMPA 2V9CA 2ZR8A 3INYA 5F21A 4AJ1A 1JT9A 2C96A 4D9JA 4MUXA 4X3OA 1EBFA 1V1MA 2YVAA 4QUEA 1ZMTA 1F8GA 1RJEA 2C8VA 1KRXA 5TSDA 2VCYA 2H06A 1WBDA 1BDJA 4JL5A 1QO0A 3HUFA 1B74A 2Q1WA 5FFNA 2X6TA 3UGKA 1E3JA 2R68A 2HJVA 5TJ9A 1TU0A 3DEIA 3WRYC 4OJNA 3Q8MA 3FBGA 4E5NA 1U8YA 1VLJA 2NSHA 4ZDJA 3K2QA 5DISB 5EINA 1QGYA 1JEEA 1VJ5A 2XCQA 1E61A 3ENQA 1R4NB 2HRBA 1GGHA 1AKNA 4MS4B 4HDKA 3FUTA 4QU5A 4UQOA 2J67A 1YZQA 3SHTA 2QRJA 4ER6A 4DIUA 1GAXA 2FGJA 3MWDA 2IEDA 3UMFA 2RHMA 1MH1A 3V1NA 1FL9A 3EVCA 2XNSA 3GOHA 3SFZA 1H9AA 1R15A 4M0MA 4HNQA 1Q2XA 1H4VB 4FDTA 1E0DA 1MA0A 2XRFA 3CTMA 4RY8A 5BYJA 4EB6A 4Z7JA 1WCYA 2ILVA 1UKAA 2VSNA 1FNBA 3WK6A 1DC7A 4BV8A 1ZWLA 3AFHA 2HK9A 3ODGA 2GM9A 3R5JA 5KJ1A 3ER8A 4EGCB 4IXWA 1YR1A 2W8BA 3B3JA 2WM9B 4MXDA 3UB4A 4HAXA 1J99A 1NKTA 1PJSA 2NUPA 2QI9F 3A04A 2X4LA 4HSGA 3U39A 1C0PA 3IKMB 1Y89A 2ZRNA 4HQLA 3RI3A 4PTZA 2OHJA 2IZ1A 2XYPA 2GLXA 1VZ2A 4Q4HB 2EAUA 2G25A 5I7OA 2F1JA 3MGCA 3TJZA 3ZNPA 3S1SA 3M3HA 1GG8A 1U7UA 1UJCA 3SMVA 3UNXA 4BVBA 1DV2A 3E7FA 1Z0DA 1C4WA 1Y3DE 2ZSJA 1P8JA 3AYXB 3C6XA 2HR1A 2XYRA 3FLAA 1Q11A 3EGVA 1H8HA 4INOA 3HPQA 5EWLA 1D5CA 2DHCA 5KQPA 5KYUB 1DARA 3GJ3A 1AGRA 3QP9A 4N0QA 4RH1A 3WLSA 1SXPA 4D02A 3OLQA 1F51E 2ZRBA 3F4BA 3ZDAA 3P9KA 2FSVC 1P1RA 2PWZA 4NU8X 1E9VA 4HUQA 4RLFA 4D8WA 2VWQA 1UPTA 4FBMA 3GNSA 1N5MA 5FB3A 2AE2A 1CUHA 4MVJA 2V6GA 4ZD6A 2C5BA 2H31A 1E5VA 5K3FA 4LWPA 2ASEA 3WA7A 2EW1A 3FN4A 2PGLA 4UVEA 1YQEA 3PLRA 3JASB 3RUIA 4G81A 2A33A 1TMKA 4LI0A 1UDAA 3K5HA 1EX7A 3OOWA 3KUUA 4TN1A 5DNWA 4A2PA 3CVYA 1LQUA 2Q5EA 3WYNA 1XTBA 2BEWA 3IMCA 3C3YA 4UXHA 2B5WA 3E27A 1IZ8A 4X7RA 3I5YA 3RTDA 3UJ7A 2GZ3A 3EUWA 1X2BA 2HDHA 3H9GA 2VQEB 4GWLA 3BREA 3ZU2A 3T5CA 2YVLA 1II8A 3P9SA 4BLWA 5JQGF 3RD5A 1AMNA 1JJAA 4R9SA 5CCBA 4OLAA 3ANTA 1OIXA 1ZIPA 4RF4A 5K2MA 3I9FA 3L7JA 3GGCA 5TQ0B 3M81A 4F6CA 4L9RA 1P9NA 2P7IA 4MCJA 3RC7A 2QVCA 2MU1A 3QBVA 4G0PA 1WQ3A 1JRLA 4H4CA 4B7UA 2MWMA 4CL0A 1Z6YA 5KOHB 3HB0A 2QMZA 2QSYA 1NFQA 2PKEA 3PNPA 5J43A 1P72A 2C7GA 4EHDA 3LCJA 3O8CA 4XGRA 1LX6A 2RG1A 3EVBA 1ZIOA 3JRXA 5AKKA 3RSHA 4DQVA 2IK8A 2UYGA 3HRKA 3KIPA 1H8ED 3C45A 4Z7NB 3LT1A 3OT1B 2EL7A 2PGXA 3VJKA 2C78A 2EATA 5IM4F 1R9JA 1JXOA 2A9JA 3QVXA 2J5QA 2QTMA 3AM3A 2J3MA 3FOCA 4B7XA 2QL5A 3FKQA 1DIRA 2EF1A 1N36B 1XHFA 3GP3A 3HHEA 3WRXA 2JEYA 4NBUA 2GHRA 1PZFA 3ROQA 1XXHA 3THRA 2BF4A 5AJWA 4OYHA 4MAAA 4CQLA 5DKFA 2N75A 1QM5A 3IV6A 3T5MA 4PLWA 4YRBA 2X3FA 5BY2A 2UYHA 4Q4HA 3PU6A 2FW1A 1VBFA 3H16A 5CG1A 1EWQA 2NQTA 6REQB 1OZAA 3UXHA 2A4KA 4WASA 2J4FA 4CKEA 1YZ3A 3EDMA 4ZN6A 2DT5A 5EZYB 3ZOZA 1E3TA 5I4CA 1ZCFA 4MV7A 4LIPD 1FSPA 1ZJ5A 1UBSB 2G5PA 4CVNA 3ICQB 1C4OA 5JCOC 1DC4A 3QY0A 1N9GB 2HV9A 3QMMA 3PC3A 4YXFA 4QG7A 1NMYA 2Y1DA 4MI6A 5KKCA 1U7WA 1CZUA 4CGZA 1TQ6A 1YE3A 1Z4NA 5AR1A 3RB8A 3L82B 2H1FA 2IP4A 1YA4A 3WL6A 2HLDA 1NC3A 4PPFA 1YC5A 1KSHA 3L79A 4OYYA 1C3JA 3V8NA 2XZPA 1DG9A 3H99A 1RWVA 2NYRA 3CUEF 3IT2A 1GCGA 1H66A 3Q41A 2Q4EA 1VMKA 2HSGA 1M2VA 2C2BA 3RYCB 2JZCA 2BOVA 4BEWA 1LXCA 1KEPA 4GOND 3HCPA 1P3DA 5ABPA 1HI9A 3I61A 2EWMA 1ISGA 1QIGA 3ACCA 3WRXC 4B71A 1GTRA 4EK9A 3FIUA 3ZD6A 1LJLA 3PWZA 1P9RA 1X39A 3OQIB 1NE7A 1XCJA 5LYYA 2XYGA 4F5YA 4JFRA 2XGMA 5CBKA 1QYXA 4KRGA 1UAYA 3KEOA 5DTRA 3GLGB 1F60A 3IAEA 2QAGA 4N76A 2BDUA 4BX8A 1LWNA 3BH7A 3G0CA 4EUKA 3E2IA 4N5HX 4UEOA 3WKCA 3C8HA 1N0IA 5G0TA 3OE7D 3A3YA 2XUPA 3W6NA 4MROA 1PR0A 1WA5A 4QQNA 5HP4A 4QULA 3JU3A 1YDEA 3QA9A 2PUGA 2VP3A 2QVXX 1NZDA 3KYDA 4O2AB 4B2LA 3F9CA 3A1DA 4WUVA 4N1AA 2R6JA 3K1AB 2XRZA 4AROA 4ZK2A 3N2GA 2Q6TA 5EESA 3L8MA 1KOJA 4DC1A 1TMGE 3GUUA 3BCHA 4AO7A 1EGAA 4YC7A 4F3YA 4JYCA 2H1LA 1VPLA 4EYEA 2N1MA 3ZDDA 4FGWA 1JL3A 4KP7A 4OI1A 4BGIA 3GCGA 4RFLA 3WB1A 5FJJA 4N7RA 1P81A 1YR8A 2YWGA 1U3WA 1NE2A 2OGTA 3KQTA 4M76B 2D2XA 3G9QA 5DRTA 1X7ZA 4LJYA 4EG6A 2NO6A 1YDGA 1Y9JA 2O52A 1ZR4A 2HIMA 5JJ5A 1E96A 1Y80A 5GMOA 1E64A 2BMVA 1DT3A 1G6Q1 1V3TA 1YFZA 2OBYA 2X5OA 3OJFA 4YRLA 4N8DA 2IA5A 4P5DA 3MYRA 1C7ZA 1O89A 5FI3A 1ZGGA 4Y2PA 1CS4C 4NCXA 2R8XA 1QQ7A 3HM2A 2NP6A 4JI3B 3STTA 2OKCA 2QRMA 4ZYLA 1KIFA 2G1AA 1QE3A 3DC2A 1E1DA 2XQJA 1TRKA 4RAQA 2H51A 3GLVA 1FDSA 4WZAA 1N2EA 4WCVA 2VF4X 2XVXA 4WVLA 4Z7OB 3D3WB 4AJ9A 2V7EA 2WILA 1R66A 5FV7A 5FV4A 1FU4A 1ZD5A 5EMNA 5JDIA 2AKYA 1JZTA 3EPLA 4PE5B 4J0JA 4RZIA 4C0XA 2PTGA 1LKZA 1W36D 2QAJA 4NCKA 2OYRA 3S27A 2GPSA 3HP1A 1KHHA 3QVJA 4LVNA 2CDRA 2GHTA 1B6SA 4DEXA 4TX1A 2D7CA 1J8QA 3DLAA 5HEKA 1KPHA 2I03A 4BO2A 4I08A 1R27A 3FNEA 1GUFA 2H2IA 1T0JB 4XTCS 3GLGA 1MB9A 3DPIA 1JVSA 1MHTA 3LPLA 2RONA 4MO9A 1VSBA 4QASA 4CTKA 1WXWA 3OICA 3SK0A 3STHA 1WEKA 1RDFA 2BMAA 2P2YA 4CEHB 2WF5A 4M0KA 1L5ZA 4IOMA 2I1QA 5AVWA 4QBTA 2X0FA 1B6TA 3I5MA 3ZHXA 3FOWA 4Z4IA 4NFLA 3THYB 2VRCA 4EA8A 5M29A 3TQQA 1R8QA 3CKMA 5T7BA 3EDRA 4I2VA 2EHJA 1E1MA 2EFHB 2Z5LA 1V2GA 5CFRA 1XNJA 3N75A 5EHGA 2IYNA 2BGWA 2DWOA 1L1EA 3QLUA 1DIAA 4AY4A 1VKHA 1JJVA 4XGIA 2FY8A 1XF1A 2A9FA 1USUA 1F0YA 1DEHA 3IGFA 3O2NA 5IK2A 5J5CA 1N8TA 1D4AA 5FOXA 3L06A 2I4RA 1PUIA 3FWKA 4JGIA 4KBYA 3SIWA 3SOZA 3WMEA 3IUPA 3UFXB 1DWPA 1WCIB 3SYKA 3WNCA 3KV1A 1UEXC 5CYFA 2XOEA 1IZZA 1DU4A 2P0AA 5DLEA 3SZLA 4NPAA 1Z3CA 1W36C 2ESRA 3JVEA 2CHEA 4MUNA 3H9BA 5KU7A 2F3TA 3TLGB 4EL0A 2ZB2A 4FEGA 1I4EB 5I9TA 4EENA 1ZD4A 5E1OA 3CVOA 5LU9A 2J7KA 5IBQA 3G5AA 4GL2A 1Z0JA 3DW1X 4REOA 3K8OE 1UBCA 5AK6A 4XASA 1OMOA 3CNQS 1YBVA 9MHTA 4NCHA 3D3QA 1H4QA 1HDIA 1T8UA 2J0EA 3QVMA 4MGIR 1RQGA 4MWZA 1UAAA 5T8KC 3PLAE 1N1DA 5IYZF 4TT3D 7MDHA 2BCGY 1CUWA 1ZNWA 4QARA 4GP7A 1H0RA 5EUCA 1NLMA 1SBCA 5DPMA 3WA6A 4B80A 2C0QA 4PYLA 3BHJA 4YCJA 1OAKA 1E6EA 1WR8A 3OQ1A 4YJHA 5B58T 4AJKA 1VC2A 5A62A 5H4GA 4LTNA 1ZH4A 1IVNA 3JYHA 4G4IA 5B1IA 3O84A 4MQ5A 4DMGA 1NYLA 2YHAA 3KETA 3HVKA 2AFHB 2PL5A 1UC9A 1T9GR 2X9LA 3F3KA 3IEXA 3K9NA 3MOSA 1IN6A 3V55A 4UNQA 4J1NA 2D5LA 3V4SA 1ZI9A 1NHWA 2YWEA 4JJ7A 5F2OA 4AZSA 1GR1A 3T54A 1OH5A 3VC1A 2DPXA 2BN4A 4MS1A 4WESA 4HDSB 4UBKA 5IRCD 4HAWA 3IUQA 3QEKA 4YFYA 3T3PB 5J4VA 3NHYA 1QQ6A 3D7MA 4NDNE 3DLBA 3GN1A 3REGA 1DZIA 4G4SP 4MVJP 4PONA 5CD9A 2O2ZA 4ZDWA 2IYTA 1FTQA 3CU5A 2YIMA 4WCFA 2B3DA 4A9AA 3KS9A 3R0ZA 1UFVA 3E22B 4DQUA 3C6KA 1WX1A 2FJUA 1U2SA 3IJEB 1MABB 4QLAA 3U3KA 3UK2A 4B34A 1YZYA 1JBKA 4GUDA 4JGBA 2Z9DA 5CM9C 1BA2A 2C82A 3IBCA 2GBGA 3M4JA 1W35A 4OIFA 4DA9A 2PVSA 1N2OA 1ZGBA 3UWPA 4DCUA 3REQA 2AQHA 5LQJA 3NJRA 4YJ3A 4NE2A 5CA0A 4YRZA 1SJ9A 1MPXA 1EWKA 4Q1CA 3B1ZA 2C92A 5LQMA 3O8RA 4BC1A 4UHBA 2Q3LA 3TKYA 3I6QA 1NQTA 2PKWA 1H2FA 5K6AA 1ZM3A 1PZHA 2KI5A 1G3QA 1FTGA 1K68A 1L3CA 4FUTA 1K5HA 4G4SO 3NIGB 5U9CA 1W29A 5EJ8A 1H8HD 3K9LA 4ZVTA 1QB8A 1U5BA 3GA0A 3M2PA 4XI9A 4DY4A 5IN4A 4EHIA 2EZ4A 3G2QA 1GXSB 4MDEA 1HQYE 3NC1C 1NY6A 2CFCA 3HCEA 2X77A 5EIBD 2HK7A 1QORA 4CL3A 3ILYA 3QM1A 3RYHB 3W1VA 4BKMA 4BWYA 1H69A 1OKKD 1P4SA 4PFJA 2AXQA 1PG5A 3RS2A 1I4OA 3INTA 4WKGA 1BWPA 2ZVDA 3ROMA 2HQRA 4XQ9A 3KTOA 3TCNA 4KACA 4ER5A 2MMGA 4CMEC 4XGNA 1JBQA 3ZKWB 1E2KA 5DNUA 4HWGA 4ALIA 3I5UA 2ACWA 4RHYA 4TTRA 4QYXA 4II2A 2IF0A 1G55A 2EF0A 2ZWVA 3K0KA 4HNAB 3WWPA 1VSUA 2G76A 3PEFA 5AI4A 1V41E 3GJRA 3NDRA 3O4GA 4NAVA 5FO1A 2BC9A 1FFHA 1U2QA 5IULC 1YRBA 1R88A 1MX9A 3DXZA 1M8PA 1NVXQ 3R8FA 3V4VB 1RAIA 2ODQA 2GXQA 4DFDA 2NAPA 3ASUA 3H4VA 4DLTA 3MGKA 1K86A 2HPVA 1FBNA 1DQSA 3I2GA 3A06A 3BL5A 5BN5A 1XXLA 2DSTA 2GB4A 4HN9A 5HW0A 1MQ9A 2WZBA 1Y7TA 1ID1A 1Z8DA 2FRVA 2UUOA 3NAGA 5IK2D 5AKIA 3COSA 4ZJZA 5JFGA 5J40A 2CW5A 2MMCA 4G0XA 4QUBA 4RYDA 1RWWA 1TGVA 4ED9A 1LPNA 5KVAA 4LJLA 1E4EA 1BHJA 2IHBA 3S5JA 1M76A 1NUPA 2H17A 2E0IA 3EF3A 3NBYC 1QANA 2XNDA 3HCAA 1MT3A 3WYAA 1D2RA 2R8PA 2PCLA 2YFKA 1KNXA 2W2OA 3GRCA 3NEPX 3OUUA 2NTEA 4K2AA 1JLLA 4HLCA 3ZUGA 1MBZA 2OLJA 1FDUA 4ZI5A 1C7QA 3IULA 5LDHA 3HJTA 3RVMA 1KBZA 4ZO9A 3P9QA 1UR5A 2J3DA 2CHUA 4XX0B 4IMIB 4AMBA 3CBGA 1RRKA 1ORWA 3F6RA 3H4MA 4BMOB 2YYYA 4S1WA 2IXFA 2QTFA 1RBQA 4L9AA 2QNRA 3MTDA 2V9ZA 1NLZA 3PXCX 4GX1A 2RH8A 5FT9A 2A9VA 4X1YA 1QWOA 3DMHA 1QTRA 5CBPA 1YZNA 2H08A 5CA0B 1E2MA 1G42A 1KRHA 2WSMA 4CM9D 2JGJA 1E79D 2PEZA 3RAJA 1DBPA 1X3SA 5GPBA 3UT6A 2QW8A 2CYBA 3RYCA 3QK7A 4Q7QA 2XB2A 1AF4A 1HLDA 3DZBA 5F12A 5LJIA 1TJYA 3DMGA 3MRVA 4MPPA 1HDYA 2OQVA 3ILVA 1R5NA 1ZUNB 2CLCX 2YX1A 3SQOA 1L4UA 4CL8A 4HAYA 4KPYA 1R4AA 4UEJA 1W7AA 3C15C 4O29A 4FM9A 1FFWA 2BHNA 2CGEA 3HJHA 4AU1A 1UM8A 4CNQA 4ARCA 3WL7A 2F1OA 1CS0B 1QX4A 2DECA 2ZB8A 4PFKA 4PSUA 3IJPA 4I66A 2XPCA 4ZIRA 1YS1X 1Z8HA 5B1SA 2G17A 2P11A 5F77A 5LNK6 3ETNA 4C4SA 3B51X 2YVKA 1U94A 1LTHR 2IT1A 3MINB 3QOYA 1MEEA 4LJ5A 5GY7A 3VV2A 4KV7A 1YI8A 1PS9A 5IU6A 3TFOA 3ETGA 3Q72A 5JAMA 4DMUB 2GO1A 1V5IA 3OUTA 3PDIB 3TNFA 3AIKA 4DCNA 4NZZA 1ZUWA 4QXQA 4RF3A 3RRMA 4KAAA 4DIEA 4D0GA 3JATB 3QTTA 2V59A 1SQ5A 1DJOA 3OX3A 4L0MA 1C1XB 1JU4A 1XHLA 3OX1A 2ZIUB 4MQBA 3F0TA 3HCRA 4X20B 3GIDA 2OCKA 1CJKC 3CLSC 2OOSA 3RM3A 1F8XA 4BFWA 4MQUA 4HXYA 3C3KA 4TMYA 2BMFA 3KXIA 4YMLA 2I6UA 3EQZA 3ZZ0A 1ONOA 5B4VA 4L2IB 1TJ4A 2WU1A 3MRTA 1PJ4A 5G3ZA 5J23A 2OLEA 3TOVA 1R5BA 4LNHA 4DV1B 1UT6A 5JARA 1Z8FA 5HRAA 2EFEB 4LMRA 1PV4A 1KBOA 1VJCA 4BDSA 2CF6A 5CB4F 1SVLA 1N6HA 1O1YA 2W48A 3KT6A 3EY4A 1QK4A 1H5NA 3OPYI 4X1OA 4V1CA 1ISJA 1WDLA 1GGEA 2AC2A 3C6BA 3DZFA 1UPAA 1PRYA 2QVLA 4D0RA 4PZCA 4IJUA 3OPNA 4HEA1 1GPYA 2I71A 1AA9A 2IP1A 1XLVA 2G83A 5SYNA 4XM1A 5TF4A 2R60A 2R48A 5JBIA 3SU8A 4E03A 1C0IA 4MDYA 4F7WA 2PSFA 2I2XB 4MUKA 5CB4B 1Z7BA 3AKZA 1MNQA 2VJPA 2C5SA 2OM2A 5HFAA 1S1MA 2E4UA 5JS8A 3T4XA 1SVWA 3NNNA 5A5FA 1W4RA 3JVVA 5JXIA 3P9CA 3IYLW 4PLFA 4DG5A 4MH0R 1GPLA 3DL4A 3IIIA 1U8AA 5FD8A 1WCXA 3OFVA 1WXGA 1KP9A 2H8GA 2AWOA 3DV0A 1Z56C 3F8TA 3MGAA 1WM1A 3NOOA 4W82A 1SCJA 2R7LA 4E2FA 1CUIA 1X1EA 2YQ5A 3O2SB 1WLYA 2LD4A 3EGXB 4RZ2A 4NYIQ 3LUGA 4N18A 3VR4A 1UDXA 4RGQA 3SBDA 1B0PA 4A92A 4C04A 1VE5A 3IO3A 4DBLE 3R8XA 2H3HA 2FN9A 2QLMA 4WNAA 2KHZA 3ANXA 3D8BA 4JHLA 4UTPA 3AVWA 1T1JA 3HV0A 2ZUFA 4DF3A 1GLGA 5IF3A 4MDHA 1JR4A 1BAPA 1CZRA 1J8FA 1O94C 4Y6GB 2CXQA 1FP6A 1KI2A 4CKZA 5FLKA 3OZSA 4DLUA 1EE1A 2TMDA 5D5HA 5TV2A 4BLTA 2C04A 5IKPA 2ZIXA 5IC6A 1Z2NX 4JNKA 1QOPB 4P7KA 3WB0A 4Z3KA 2V7PA 5JS1A 5HUJA 3I8OA 5AI6A 4MSUA 1WPRA 5L7YA 3X3HA 4G1FA 1B26A 2VPXA 3AM4A 1Y1QA 4NEHB 4RHCA 5FEMA 2H63A 2LCQA 5BV1A 1L5YA 4U5XA 2YKGA 1ENPA 1BVHA 5CK4A 2Q2OA 4Z86A 5LD2C 1SFRA 1FRVA 2PZBA 4V3BA 2A14A 3O0DA 4EX7A 2HPZA 4XXHA 3OLYA 2JJ1A 4GXTA 2C2ZA 2BBWA 2Q1TA 2Y1OA 4L07A 5DMHA 4F4IA 4AD8A 3NTUA 1NPYA 2WAOA 5IUNC 3T3OA 4C88A 4CPDA 3PGXA 3TBKA 1K5DA 2F43B 3PL5A 3QI2A 1KRWA 2NOAA 3RT1A 4K1XA 1C3OB 1LX7A 1Q3TA 1ZQ9A 1ZRMA 3FPKA 3I52A 2ZT5A 4FYVA 1KEUA 2QAGB 3KTAA 1PYDA 5A4AA 4OHUA 4U4AA 1TA0A 5LA6A 4Q9DA 3H3FA 3MTBA 4TTTS 5DWQA 1FX1A 3ZWAA 3QU7A 2P4SA 2ZB3A 1Y34E 2YDXA 4Q7LA 2POCA 3TW0A 4BNJA 1SM4A 1KNQA 2ZP1A 1DJLA 1WDKA 1A96A 2PGOA 3TGWA 1KMHB 2NX2A 5EJ4A 2CXXA 4MULA 3WJAA 3E18A 1OXKB 1PFQA 4OQNA 1XTKA 4J91A 2VYFA 2FNAA 4BJ1A 4G1EB 4O4LB 1KQ3A 2XADA 1HSZA 2IHUA 4I9NA 1IAVA 4KQ9A 4ZXFA 2IJGX 3ER9A 1XZQA 2VPQA 5AHRA 1AMUA 1M1XB 1P73A 1V47A 1SU7A 2ZJ7A 2RGXA 4RS4A 4B48A 5AW4A 3GFGA 4EUFA 1E7RA 1TM2A 4EY4A 2D4HA 3EFEA 1RCUA 4LHEA 3STXA 3B7WA 3UMRA 5ERXA 3ZCXA 2IP2A 1YHYA 2E87A 2L2QA 3RBZA 4L5AA 2YWXA 4PS1A 1CJTC 4F86A 4UDXX 3GAMA 3ZCQA 1NJ2A 1I3MA 5J2TB 2GAOA 3B3FA 2AUTA 3C3JA 2CV0A 3MPUA 4AM8A 2JGMA 5JJIA 2B5OA 3OQVA 3W6OA 5D51S 3AGQA 4LDJA 2FLWA 3U62A 5ECWA 3PRHA 4HXGA 4GOKA 3ELYA 2WY2D 1LPAB 5C7IO 5LWQA 4M37A 1BFKA 1T91A 1QFMA 2BH9A 3LMKA 4GOJA 4IXNA 4KFSA 4YPVA 5JAHA 5FOUA 2Q2WA 2PGJA 4CMEA 1FP4A 4MR9B 2XOXA 4YLYA 4KQ1A 3FGZA 1Y4UA 4RGVA 1NU8A 2NXJA 2GAJA 3RREA 2VNHA 2KWIA 3BE5A 1QRUA 3OHMA 4MW9A 4S1NA 1UEJA 3WQBA 1A5AB 2LTAA 5CDFA 4EOGA 5CP8A 3I9V1 1S8NA 4DM7A 5B7GA 2Q3EA 1JJIA 3PIRA 1E4VA 4C5AA 5A9SB 2VYVA 3MWKA 4M1ZA 1OZHA 3UK6A 4B7AA 1CNEA 4EW3A 1BCRA 2DR0A 2X13A 1CF9A 1MDFA 3KJHA 2RHDA 4I1UA 4B44A 2VYCA 3EJ6A 4EX6A 1Y63A 1RJDA 4EQ6A 2ZFUA 5TPWB 4DIFA 1F14A 2Z8YA 3VKWA 4DG9A 5K3FB 1Q0LA 1AQLA 3OTWA 4RZ3A 2VQDA 4M89A 1VM6A 1U6JA 3BFPA 1E6WA 4KDCA 2QPOA 1Q20A 1MUUA 2KYRA 1BMFA 2H4WA 3PDJA 3EUAA 1PLKA 2ERCA 1CR1A 2P2LA 3BH6A 3OY2A 5ALOA 1T8TA 4A6PA 2YUIA 1F17A 4J76A 2DFKB 2H2GA 1FFBA 4DRXB 2BKVA 1QE0A 2UAGA 2VDUE 3CB4A 1LRKA 1VPTA 1CVLA 2PA3A 3B2EA 3D6TB 5FBKA 1AS2A 2QN1A 2ORVA 4YLEA 4CBVA 2I8CA 2V9PA 1CRQA 3QYPA 2CJFA 4JC0A 2ZBDA 4JUCA 4HDRB 1GM5A 2HTEA 3A1SA 2VSFA 4NE7A 4EPVA 2W71A 3FVVA 5DLYA 1V5EA 2VA8A 1R7RA 3BDIA 4LDQA 1E89A 2ARKA 1LA2A 3QBTA 3LZCA 4LXXA 2QN2A 3LVQE 4EWLA 2JFVA 1RLOA 1LNZA 2WTMA 2IIBA 2R00C 3DMNA 3VQTA 2HIGA 1EQUA 3O4RA 4OOFA 4P54A 3GIWA 3CGGA 3AJEA 2JZOA 3FDZB 1G59A 4GHWA 2W6PA 3FTEA 1ZK0A 4PINA 4Q4AA 1TT7A 2HQBA 1YGPA 3MWFA 3UFXA 5IZCA 2GPTA 2MINA 2X0JA 3P2YA 2QR2A 3OIVA 1HY3A 4UU1A 3W5SA 3F6SA 5G40A 4E07A 2PBFA 1E9FA 3IRVA 2GFHA 3IMFA 3N58A 2AVDA 4FFLA 4LC0A 3NMUF 4O4IF 2NO1A 5HE9A 3OG9A 3FNHA 3Q3CA 1U11A 4RHUA 3WBBA 3V1LA 1CJMA 3JAKA 5JO9A 2BWJA 1WHTA 2HGZA 2VHQA 2XTAA 4HSEA 4ALNA 4C7XA 3M9WA 2R00A 1AO3A 4H7DA 3TSYA 1VHQA 1CB0A 3N86A 4JJAA 4QXAA 3ZI0A 2BGLA 4ZPXA 2FPUA 2ZULA 3E53A 4LF6B 5G1OA 1XRPA 1R6TA 1OX5A 1S9HA 2J9GA 4AMYA 3LYAA 1VLLA 4YCCA 5LP6C 4DDUA 3ZGZA 2CFRA 4ALJA 2O2EA 4F46A 3K72B 5ED0A 3NGXA 1XPUA 1XMPA 4M1QA 3CT4A 3ZLJA 3JQ7B 5JNVA 4C2UA 3L49A 3KFXA 1X15A 5B37A 4ECEA 5J47A 1RYDA 1W49A 1YCDA 4NHEA 1FXWA 1QPZA 4QT0A 1HYBA 1UMBB 4KVAA 4OXXA 3QX7A 4F5EA 4R1QA 1BCSB 1RAFA 5L3QB 1YF3A 1XZAA 4YYEA 5CM8B 3KJNA 5AVYA 5CLLA 2LUOA 2TS1A 5AH0A 3CZQA 1KQFA 2DQ4A 2O2GA 5AVKA 3ND5A 1MC5A 3MTAA 2C2KA 1GNVA 3V8VA 4LCBA 4R2LA 1KXZA 4UHJA 2P2DA 2ZG6A 1M1YE 1S7GA 4NESA 5LL6P 3WYCA 4J16A 3OU7A 1YJ8A 2AFIE 3HXPA 4Y1RB 1U0BB 4TTSA 1N5OX 1NULA 3VNAA 4YUXA 2CFOA 4OSEA 2VC2B 3OZTA 3NFYA 2ZSHA 2I9KA 5F7OA 2OAQ1 2V45A 3IP7A 2YXBA 1ORVA 4JYZA 1W47A 3ZV3A 1GN9A 2MR5A 4MUIA 4OREX 4HBZA 5I4IA 3DEFA 4PGHA 1Y48E 1IBCA 3NUZA 4B81A 3I5XA 2BGMA 4Z4EA 4KCGA 4IGAA 2C5LA 2YDYA 2QRLA 3A28A 2XGGA 3BKXA 3EN0A 4HVTA 4OQEA 1Q0ZA 1TF5A 3FDIA 4JLPA 1E3WA 1CU1A 4P53A 4E5YA 1ZCAA 4EFKA 4ZVPA 4ZAZA 1KKMA 2O8NA 1KZ4A 2J4DA 3I9MA 1AQ6A 2ZWOA 2H18A 2QIPA 2V0GA 2R97A 4YJ2F 3NPAA 1NN5A 3O4FA 4FKBA 1GRCA 3VH2A 4DUGA 1MAUA 4K7JA 1QHFA 2P4QA 1KZ1A 3I30X 4MEBA 1ABBA 2JKVA 3CA8A 3BTSA 4JLOA 4Q4AB 1B3RA 1USGA 3FX2A 1KZ9A 3IB3A 1HUQA 2NZXA 3QYJA 3LKBA 4RA9B 4RV9A 1AV6A 5KDOA 2O5VA 2QQ5A 3F6CA 4HZGA 3FNIA 1JYFA 4QEDA 4HGPA 1S7CA 2PDAA 1K98A 1FEZA 1VXOA 2W2MA 3PUIA 1BE6A 3A3PA 3EGEA 1UWVA 1Q1EA 4IINA 3W6PA 4CV2A 5HS4A 1PNTA 2YWBA 1HURA 4G8JA 2BZGA 1M7GA 1PFVA 5AK4A 1MH9A 2G08A 2HWKA 3Q3VA 3N0XA 2IYYA 1U2GA 1RHMA 1ZC3A 3FDXA 4XLTA 3HDQA 3IB6A 3U0VA 4DCOA 3TJMA 3W3AH 3LT2A 4CMIB 2FUCA 3FHLA 1CE8B 3ZHUA 2PWAA 3LT0A 4JYPA 3CZAA 3IODA 5BSKA 1GUDA 1XK6A 1Z82A 4OHOA 1XVAA 3PFGA 4NONA 3HRHA 1Z6GA 1DUVG 3O93A 1QDLB 1D2CA 1Y1SA 2G4LA 4RHXA 5AKEA 4ZRNA 3SMQA 4F9EA 4M87A 4EHJA 3IPYA 3NH9A 4G5OA 1T8PA 1ULBA 4C30A 2EJUA 5L3QA 1NI5A 1XNHA 1G5PA 2DY1A 2QTLA 2VPWA 5J9FA 1F0KA 4N5IX 4QFDA 3VYSB 2H6EA 1NF2A 1XN4A 1BKDR 1EDEA 3KOYA 2ORWA 2DG2A 4H1HA 3TR6A 1Y4SA 1XCGB 2IZOA 4QZVA 5C7LO 1FJXA 2ZTMA 4Q05A 2VQSA 3BD6A 2A5FA 1E5DA 1CVIA 1PQ4A 1SXJA 3R6DA 1L1RA 2CHFA 2I4TA 3DBRA 3EZYA 4TWAA 2G82A 3ZK9A 5DHPA 2I5PO 1JKMA 2Y0DA 1KEEB 4U7WA 5ICCA 1N2CB 4LE2A 4BVKA 1N5IA 1LFAA 2OHIA 3P8ZA 3A4LA 3RFTA 1I6KA 4QOEA 2G9ZA 1JZSA 3FWZA 3V8MA 2TECE 3L04A 2G7MC 1QS0A 3SN6A 2AXEA 1E6LA 5IFLA 1W94A 1QXSA 4OMFG 1TQHA 2QSUA 3P9NA 2VVTA 4FFSA 4C0HA 4KR3A 2C29D 1IHYA 2VP4A 2Y6UA 4NQZA 3UM9A 3VU8A 4JT9A 4Y2GA 3RSQA 1CZOA 4JQCA 3GLIB 3B38A 5AI5A 1W46A 4R2KA 4ETMA 3GLIE 2WJYA 1G8SA 4F4DA 2B5VA 5ENDA 4Q34A 1BE0A 3WLMA 1DAGA 5AW0A 1N1MA 2P3LA 4I1RA 1LK7A 4TKUB 2GCOB 2FZEA 1CTQA 2WTUA 4DIKA 1XEWX 3PUKA 2BISA 3LL7A 4DCTA 4KI0A 3GELA 3NAMA 4RXUA 4EATA 4CNBA 1XFDA 1NMZA 1Y3BE 3LX8A 2AL7A 2H2FA 1N9KA 3DYIA 1KYTA 3I1IA 2VF2A 9LDBA 3DGFC 5NLLA 1GVNB 1U9JA 1RRFA 2XKAA 4RDHA 1RYNA 3CEAA 1C2TA 3FLMA 3I9V6 4RKYA 1UDRA 2VWHA 2EEPA 5ARCA 2XBMA 3RIYA 3GGOA 1XCPA 3PVZA 2B4RO 3A37A 4DWVA 3JYOA 1BKYA 4MJLA 1K7SN 2ORED 4KEAA 4LS3A 1IOZA 4I3FA 4G1MB 2G88A 2J8ZA 1ZGHA 3OM1A 4J0EA 5KNDA 1QUFA 1V1MB 3KPJA 3P27A 4YCSA 2XCTB 1M7BA 4BMDA 5KYWA 1R8XA 2WYVA 5TT1A 3GEDA 2EFYA 2HRRA 3ESRA 3N5CA 5TF0A 3WWZA 3H42B 5A3SA 1KS2A 4ZV9A 4IDHA 3FROA 1EDOA 4OBBA 2A9PA 4KX5A 1IAQA 4MIKA 1LDBA 3DONA 4OYRA 1XRQA 1FDWA 3TQSA 2M6SA 2JFXA 1Q1GA 2X1MA 4B1FA 2YN2A 1BXRB 1E1RA 4Y98A 2OOKA 3AVVA 3RBXA 2LXNA 2CLHB 4DR2B 5CX1A 1Y0BA 2BF7A 1WXIA 4O02B 1TJ5A 3FHJA 2ZJ4A 4IDEA 4A1FA 1MAHA 3RRYA 1XGKA 3W5CA 3MFYA 1UJ6A 1NIJA 1ZVKA 1D2AA 1N32B 5JCPA 4YUZA 2BGJA 3AONB 4EYSA 2QYOA 3K70B 1DB3A 1ZH6A 5ILOA 2H54A 3I9LA 4CMKA 3PA8A 3R0JA 2WJAA 3SCZA 2B8JA 2R47A 3BC1A 5ESRA 1A8HA 1YQQA 1EGHA 2AFHE 1PT9A 4GEGA 4Z3OA 1GGMA 5KYXA 2YMLA 1OKKA 1W59A 2PX4A 5AM5A 5B6JA 2QSZA 2EKDA 1RI3A 2ZE7A 3PFNA 3IHTA 1M2OB 2Q62A 1WVMA 2L19A 4JODA 5CT8A 1RKQA 2QGNA 4KIGA 3PBKA 3WB2A 4AYWA 2ECPA 1NFFA 3DLTA 3V8RA 4CUZA 1Z6XA 5CH5A 3VZPA 1ZICA 2Y05A 1BGVA 1BFDA 3K9GA 2Z58A 2ZSIA 2R84A 1X1BA 2UDPA 1Q21A 2DJIA 4LDPA 1K8QA 1PD1A 2B82A 3L6UA 5DGHA 3VZBA 5LYJB 5E2IA 2O8VA 5GQSA 3U81A 3BAFA 4I5EA 1QG2A 1QHXA 1E7SA 2QXYA 2X8JA 4M46A 3EAGA 1TF2A 3SBEA 2GJAA 3GCZA 1CIVA 2B1RA 4GX2A 3HUUA 3WISA 3BRQA 3N0WA 5KTSA 3RRJA 1Y6FA 4MTCA 3KE8A 3HO1A 4BNKA 3F78A 1RKXA 3D2LA 1LNSA 2ZSEA 3LH5A 2XZOA 4BATA 4QDUA 4A8TA 2B1JA 4BRWA 3ON5A 3FD8A 3PTLA 4WHMA 4CQMA 3K0SA 5B12A 2B3TA 3LXUX 1R74A 2JFQA 3VSEA 3L02A 1Z68A 1PSWA 1KSJA 1OH6A 4ND1A 4G3XA 4E5VA 3SQLA 3EB9A 4IOJA 3KQLA 2VBCA 4UUPA 2VJYA 1NOKA 4UEWA 2JATA 3O1LA 5K8TA 5DASA 3K71B 2Q6LA 3ZQ6A 4BGVA 3BQNB 4YT8A 2I3GA 4O2BF 1WXEA 4Q3EA 2G6TA 4FTWA 5LA6B 3UMGA 3UMVA 1BZYA 3WIOA 3VM6A 4CTJA 1R0CA 1Z6AA 2RGCA 2G07A 2E49A 4D97A 4XDHA 3T7EA 1PKEA 1LDYA 3FMVA 1S8AA 3TZKA 4TKZA 1T26A 5AXDA 3T9BA 2DSNA 1U99A 2OO5C 1AXRA 4WE3A 1B14A 1WDTA 5DHFA 4NBWA 3WBJA 3ENVA 1YL7A 3FCSB 3OJCA 2OD7A 4YAFA 3ZCSA 3THXB 4TYYA 2FMFA 3EYWA 4QJIA 2QRHA 4DQDA 1M73E 3GUHA 4B3TB 3CYFA 5B2ZA 3V4PB 5F2KA 2ZUTA 4OXNA 2NUTA 5LZ4A 5K09A 2XMCA 1P0QA 4Y2TA 3LBNA 4XUDA 4Z1OA 3CSSA 1A72A 1WZIA 1I7SB 1RYYA 1L4FA 3GEEA 1GT91 2V97A 5J63A 5BUQA 2GFIA 1C9DB 1I51A 5TJHA 2I1WA 1OWLA 3D6MA 2ZS9A 4CLDA 4C2TA 4NBRA 4M0EA 2H4FA 2L0XA 4LV5B 3T5GA 3WAKA 3LQ4A 3HKEB 5K3BA 3VAZA 3IA7A 4RLSA 1RBYA 2P6UA 4QQFA 3WO1A 2P6RA 3UWMA 4I1SA 1Q6YA 3PNOA 4LHXA 3DOJA 4QTZA 4DKJA 5HTKA 4L72A 5C8YF 3KOWA 3B1XA 3FCUB 1DTSA 4JC4A 3FWYA 5F33A 2WWYA 4BIMA 1EVYA 4ZT3A 4BLSA 3QJGA 2DPYA 3E9YA 1Y5RA 2Z9BA 1TYZA 3GAZA 1EFRA 3HGMA 3HFJA 3LO8A 2CVZA 4ZO6A 4KE8A 3A3NA 1CFJA 3AH8A 2JFOA 3MA0A 1SCNE 4IIJB 4ZQCB 1RXIA 5FLXA 4J3FA 3LLMA 1NY5A 3BE4A 1NV8A 2VYQA 2FCRA 2VSOA 4B6FA 3PHHA 1J0AA 2BFDA 2FWIA 3TF5A 1XCLA 1PZNA 5F3WB 1JIQA 3H5WA 4O1MA 1RWXA 4WWHA 2GO7A 3U80A 4B6OA 4OX9Y 1IN5A 1Q17A 4QOSA 1FB5A 4B4WA 5DEIA 1X0XA 1BD3A 1VLVA 1U4NA 1SKBA 3QPCA 5LBTA 3AHJA 4GBED 3WIEA 4COOA 2BE7A 2BGRA 3WWOA 4EKGA 4L8VA 3BIOA 1JHUA 3V9PA 1T6XA 1J9EA 4RORA 4BX0A 1BGWA 3RF7A 3L6CA 3D3NA 3JR7A 2NSYA 4CM6A 5AESA 2BAGA 2WM3A 3S40A 4BFLA 1BNCA 4M8IA 4RF2A 3Q88A 4XGQA 1T6BY 2BFAA 1YIAA 4AJ2A 1DPFA 1V5GA 3FWPA 4L6CA 3SD7A 1IYZA 2QX4A 1NUAA 4ZO4A 5EQFA 3S2IA 1GQRA 2AMYA 4JXKA 3L0BA 3TIGA 4D25A 4JK3A 4K46A 1ZM9A 3GGDA 5LB2A 4QVIA 3NZEA 4NBTA 5ALIA 3GLQA 5LXTF 4BO9A 4RPLA 1CQWA 1EE2A 2FLVA 1GSOA 3HDVA 3GP5A 1NI4A 2YBEA 3FE2A 5SV2A 1FMJA 2O59A 1FP7A 4L4SA 4EH1A 1SC6A 4LUCA 2EQBA 3MWDB 3K1AA 1XZPA 1BC5A 1BXZA 3EBLA 3NCTA 1QAOA 2WAMA 3HYLA 3LCVB 4KMOA 4JMLA 4CFZA 4EUHA 4LF7B 4TWBA 2IW3A 1LTQA 2F3RA 2V4MA 4GFDA 4DUGD 2XGOA 1XDWA 2XNCA 4D8UA 3GQVA 4P2GA 2ZT7A 5J1SB 4RSGA 4MGYR 2D7JA 1UBKS 5U4QA 2GZRA 4WACA 3WQSB 3PDCA 3GGGA 4XSGA 2R86A 2WMNB 4JBIA 2FLKA 2C9ZA 1O6CA 1L7QA 3ZXIA 1XAHA 1EJ2A 3W5DA 1TXGA 1TUBB 3U56A 3GA7A 5BNIA 3ZWDA 2BEJA 5FR2A 3CTPA 3ONWA 4LCJA 2ZCJA 2QEQA 4GMKA 4NPHA 3RG2A 1AZTA 3U31A 4DZRA 1HRDA 2ZJ1A 4KE7A 2QUBA 4RK7A 4MPRA 1B6RA 1P1KA 1GQFA 1Y5NA 2UZ3A 5EMHA 4XWWA 2QL7A 1DBRA 3VH4A 4YAUA 2GN6A 2WSIA 1A4IA 1CYDA 1P4RA 3FYUA 2A94A 1CLUA 1MOQA 1E2GA 2PYIA 3JALB 3RRXA 2QRZA 1YQWA 4WIAA 4M53A 1QZXA 3NKLA 1B8PA 1SURA 3AL0C 1TU4A 1KC3A 3ESDA 4JP2A 1QP0A 4GPD1 1HE5A 4YAJA 3ESXA 2REQA 4ZTUB 1A27A 2CDNA 1RZUA 2DFPA 3IT1A 2YMQA 1ZH8A 3T4EA 1H0HA 3ZVLA 1Y3IA 1PEDA 2XW6A 2CNWD 1HO3A 2OC9A 4RPJA 3E7XA 3UJBA 1X7HA 5FBQB 4BNDB 3S99A 3F5QA 3UJNA 2VDLB 1XRLA 3JASA 5C8YA 3TUJC 1HT0A 1R3UA 4GX5A 1JH8A 1FYXA 2VJOA 4M6WA 4PXSA 2E4VA 2NZJA 3X1WA 1WZUA 1SR8A 1I2CA 2Q3MA 3ZE9A 5DM0A 5IJ0B 1KDOA 4L9WA 2XNHA 2GBFA 2BMJA 2CJXA 4NCIA 2GCIA 2C8LA 2JK1A 2X9QA 2EDCA 2Y67A 4BWFB 1X6VA 5DTQA 4UREA 4CCYA 2VDRB 4OF4A 3ZY3A 1JB9A 1E3WB 1SZPA 3W7VA 4JA0A 4DUYB 1Z7YA 5L3SA 1IK6A 2YNMD 1UP7A 2Q49A 4J9UE 4RQBA 1O5IA 3CVWA 1T4CA 2JBAA 1NIPA 2R5WA 2P68A 2VJCA 4W1QA 5ALUA 3DWIA 4I8IA 1ESEA 4O4LA 5EYPB 1U0JA 2IKSA 1Z4QA 5KKAA 1QC5A 1YZGA 2C4WA 3RJMA 1NKVA 3LZ6A 2FG6C 3FMPB 3N2KA 3PKJA 5HMLA 2X19A 2ZYDA 2VK1A 3A6JA 5DLQC 3ROZA 2QUIA 1GO2A 3MIIA 5FRDA 1EM8B 3RVSA 1F38A 2PSEA 3QLVC 5E3JA 2MSKA 5K0LA 3WG9A 3MM4A 1IY8A 1KPGA 2XEDA 3HUTA 1DBWA 5EIOA 1P8AA 3N3AC 3HYSA 1J6UA 5TMDA 4IX1A 4OQDA 4A23A 1QP8A 3KQVA 5AI9A 1ESZA 3DMYA 2ZRKA 1ULSA 5B6IA 5DSZA 5JNSA 2R7KA 1T24A 2AB0A 2WUVA 2ZBFA 2VHCA 3EBPA 4NRDA 5A9RA 1IBKB 1M75A 2NTJA 4K86A 1RQRA 2X86A 3GGJA 3Q87B 2X22A 4IICA 3HL0A 1R0ZA 3DG9A 3KVYA 4P4SA 1B43A 3RVOA 3RW9A 1A69A 4BBZA 1XRRA 2PG3A