3R3HA

Crystal structure of o-methyltransferase from legionella pneumophila
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of O-methyltransferase from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
molecule keywords O-methyltransferase, SAM-dependent
total genus 67
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r3hA00
3MERA 4EVIA 1Q0TA 2IDKA 2PWYA 3T0IA 5DX8A 1D2CA 2JHAA 3R6TA 2VDUE 2ZZNA 5E9WA 5K8VA 1YUBA 2NXNA 2OO3A 5K0EA 3DXXA 4YV2A 5EKXA 3GO4A 5K01A 5EIWA 1RI4A 1WY7A 3GIWA 2GA9A 3KQVA 5DXAA 4E32A 1HMYA 2DPMA 1ZQ9A 5GIPE 3A7EA 3LBFA 2AN4A 1N7JA 2PVCA 1XCLA 5FQNA 3T7RA 4C05A 4AZTA 4RTLA 3KR1A 2FCAA 1KYZA 1TPYA 4DA4A 2JG3A 1UIRA 5BW4A 3E7PA 3NDJA 1PRYA 3NTVA 2H1RA 2GLUA 3C6MA 5GM1A 4QDKA 4PCLA 1B42A 3SVZA 4WXHA 1D2HA 5LQNA 4ER0A 3G88A 4QDJA 3LX6A 5DSXA 3EVDA 3GDHA 3AXSA 3PX2A 3CJRA 2FPOA 2R6ZA 3KQWA 4B17A 1AV6A 1JG2A 3GU3A 1WXXA 4V0QA 5EC8A 3EVAA 4BY9E 3B3GA 1RJFA 1RJDA 2UYHA 1FBNA 3LDGA 2WA1A 3M6UA 1F3LA 1TW3A 5HIIA 3EPPA 4RTOA 4PYNA 1EQAA 4DKJA 4GOND 5E2BA 4CTJA 5LQUA 1R18A 1INLA 3UJ8A 3FPEA 4GUAA 2ZZMA 1NW5A 3FYDA 3G7UA 5FQOA 4KIGA 5HOQA 2P3QA 4C4AA 3NWBA 4YUVA 2LD4A 4ER6A 3JWGA 3KQPA 1EJ0A 2PV0A 4FSXA 4F86A 4RTNA 2YQZA 2EJTA 2ZIEA 1RI1A 3MB5A 4A6EA 2O0LA 4FT2A 1KP9A 4PONA 2I62A 1JG4A 1D2GA 3BUSA 2OZVA 3FTEA 1OR8A 3HCCA 4Y30A 2B2CA 3KHKA 4RWZA 3DR5A 4KDRA 1H1DA 2AVNA 2EG5A 1ORHA 1UWVA 4WVLA 5EHIA 3S68A 5T64A 1VL5A 2OBFA 2VZ9A 3RW9A 3AJDA 1Y8CA 5HIKA 2PJDA 3SR4A 2ADMA 1M0EA 3NWEA 3FYCA 3SSMA 2PXAA 3E05A 3SSNA 2R3SA 1N2XA 3KQMA 3SMQA 4MHTA 4E30A 4EMSA 3LDFA 2I7CA 5LR6A 1YFLA 2PBFA 3ELUA 1JQDA 1L3IA 1P1BA 2I9KA 1JTEA 2BH2A 2IFTA 1NV9A 4DQ0A 2B78A 2PT6A 3G2OA 5DSTA 1NW3A 4YV0A 4DZRA 2QYOA 2H00A 5EPEA 3LSTA 4KIFA 4U7TB 3RIEA 3HNRA 4RTQA 5D1HA 4RVHA 5K0FA 5ICEA 1O9HA 2GPYA 4RYLA 3R0QA 2N47A 4FP9A 1QZZA 5F2OA 2ZLBA 3SSOA 1JSZA 4RSRA 3KQYA 5C1IA 3FTFA 5DM0A 1AF7A 2O05A 2V7EA 2NXJA 2QM3A 3NDIA 3I53A 3T7TA 3G5TA 9MHTA 1KHHA 2AOTB 4PIPA 3C6KA 5DX0A 1FP1D 3OU6A 4E70A 5CVJA 1NKVA 5E2AA 2DULA 3LKZA 1EIZA 3KPVA 4GOOD 1JR4A 1R8YA 4HC4A 5DTQA 3P9KA 1L1EA 4QVGA 5K03A 4IV8A 4IKPA 2P1DA 3MTEA 1I9GA 3TOSA 2XYRA 3BKXA 1X1CA 5GIOE 4RTPA 4IV0A 4PYOA 1QANA 2G72A 3VYWA 2V74B 3DMFA 5DTMA 4KWCA 5T67A 3B3FA 3UZUA 1P1CA 3FRHA 2IH2A 4CWAA 5K0LA 1R8XA 2C7PA 4H0NA 4HTFB 5HIJA 2YR0A 3EGIA 5CVDA 3TM5A 4PGHA 3FPGA 2C7QA 3FUVA 1ZKDA 2AVDA 5D1NA 5P8WA 2ZBPA 3SM3A 4FSDA 4XUCA 1BC5A 1XDSA 3CJQA 3P9NA 3EVEA 4DCMA 2FK8A 5K0BA 4ZTBA 2YUIA 5HIMA 5FA8A 5DM1A 2PX2A 4BP1A 3G2PA 3HVJA 3VSEA 2HNKA 5EVJA 3NMUF 3A4TA 3UFBA 4C06A 1RJEA 4PNEA 2AN3A 5K0CA 1VE3A 4LECA 5EQJB 3TPZA 3UJDA 2JHPA 2G71A 3GGDA 1RJGA 3KPWA 3PFGA 1Z3CA 2PX4A 4PYJA 3KQOA 4RV9A 2G70A 4P7FA 1QYRA 4KVZA 2AOUB 3BWMA 5G02A 3P2IA 4DMGA 2NP7A 1RI5A 2ONYA 3SXJA 1VIDA 1X1AA 1R74A 3DTNA 3HCAA 4M37A 5CVEA 5CIYA 3CBGA 4XUEA 4XUDA 2QRVB 3O31A 1R6AA 1XJ5A 2NXEA 3EGVA 5FWAA 2AR0A 1YFJA 3ER9A 3BT7A 4E2YA 1V39A 5BW5A 4MWZA 1MHTA 3I58A 3UJ9A 1NW8A 2IGTA 2ZTHA 3MCTA 1TW2A 4BP3A 3LBYA 2XBMA 1SG9A 5GOZA 3R3HA 2VP3A 3Q7EA 5KS2A 2PGXA 4P7KA 2Y1XA 3JWJA 3GRZA 2YXLA 4HGYA 2YXDA 1XDUA 3KQQA 3LGAA 2H11A 3C3PA 1O54A 2Q41A 1KPHA 3B89A 3CKKA 5IH3A 3THSA 2UYCA 4PYIA 4K6MA 4RTSA 5K0JA 3EMDA 3G2MA 2GS9A 3HM2A 3P8ZA 5E1DA 5E9QA 3UJ6A 1R00A 1EG2A 2GH1A 2O07A 3DUWA 4AZSA 1MJFA 3PS9A 4OBWA 2Z6UA 3MHTA 3DOUA 1JQEA 3DH0A 3RODA 4OQEA 3BWYA 3M4XA 5CVVA 3GRYA 3HEMA 5DXJA 1JG1A 4YUZA 3UA4A 3A7DA 2OB1A 5M5BA 3VC2A 3IYLW 1T43A 2ERCA 1BKYA 3ELDA 2XYQA 3UWPA 3V8VA 2YXEA 4CKCA 4PCAA 5EMJA 4AX8A 1EAMA 1VLMA 3IHTA 2NP6A 4E31A 3FUUA 2YTZA 3OPNA 4KDCA 4R6XA 3GJYA 5LQAA 4RTKA 3P2EA 4QVKA 4PWYA 1F38A 3G5LA 2XVMA 5DM4A 3EVFA 3K0BA 3OE5A 1FPQA 3BKWA 2FYTA 2P7IA 4FT4A 4CXMA 4GOLD 3LECA 3V97A 2UYQA 3MGGA 5JR3A 4RTRA 2KW5A 1VP3A 4E2XA 4NECA 2ZW9A 1SQFA 1NW6A 2GB4A 3H2BA 2IIPA 4DM3A 1AQIA 1EJ6A 5HZMA 3BWCA 3D2LA 4EKIA 1Q0SA 5GP1A 5CCXA 5CUQA 5GWXA 5EIFA 5E9JA 2AOTA 1I4WA 2JHCA 1NE2A 3EVZA 1L3BA 3C0KA 2YX1A 4MQ4A 1WG8A 3LKDA 1WZNA 4OQDA 4P7JA 4Y2HA 3EMBA 1IY9A 1BHJA 1QAQA 2Y1WA 3TKYA 1YZ3A 4C03A 2PLWA 2P40A 5CD1A 1NW7A 3O7WA 5DT2A 2ZBQA 2AZTA 1XXLA 4U7PB 2B25A 4F84A 3TFWA 2WK1A 3P71T 1O9GA 4CKBA 2JH9A 5K09A 1KPIA 2FHPA 2AOWA 4DF3A 2BR4A 3UJAA 1QAOA 5EG5A 7MHTA 3A27A 3NVMB 2JJQA 5LQJA 2C7RA 2P41A 2ZZKA 3DMGA 2AS0A 4CTKA 1JSXA 5FA5A 1G6Q1 3QOWA 2HV9A 4PGGA 3KU1A 3LDUA 4E2WA 8MHTA 3ELYA 4GBED 1DUSA 4BLUA 5KYGA 4LG1A 1YB2A 2IH5A 2VDVE 2AN5A 4O29A 2NXCA 4C08A 1ZGAA 3TQSA 1VBFA 3KPJA 3BGIA 3LCVB 5C9ZA 4POOA 5CCBA 4YMGA 5ICGA 5FHQA 2XYVA 3G2QA 3MAGA 3T7SA 5E8RA 2F8LA 3LCCA 1YF3A 4E2ZA 2P3LA 4FR0A 4M36A 3GRVA 4HG2A 4GOMD 5EEGA 3UA3A 1FJXA 2FK7A 2PT9A 5DRYA 2OY0A 4RTMA 1NV8A 3FPHA 3GRRA 2ZCJA 3KR0A 5EEHA 3M6VA 4GEKA 3AXTA 3PB3A 4P58A 5F2KA 4C07A 4ER5A 1G38A 4L7VA 3HCDA 2P7HA 5ICFA 3HCFA 3ORHA 2OB2A 3CVOA 5BP7A 3ANXA 3DULA 2ZULA 4HSGA 3LPMA 1P91A 2CL5A 4C04A 2IBTA 3TLJA 3L8DA 3DP7A 2P8JA 3R9XB 1QAMA 3I9FA 3KR9A 3UJCA 4HH4A 4AUKA 5GM2A 3G8AA 4RVGA 4X41A 2PY6A 3BWBA 4BLWA 4PINA 3JWHA 3NW9A 5E1OA 4X1OA 3TM4A 2Z6AA 2VS1A 3B7PA 1NT2A 3P97A 2ZWVA 4PYKA 4R8RA 5EOVA 1IM8A 4IWNA 1KPGA 2OYRA 1NBIA 3UJ7A 3UJBA 4AZVA 5HILA 2C7OA 1HNNA 3GCZA 4UOEA 2B9EA 4QQKA 2P3OA 5FHRA 3GXOA 1ZGJA 1WXWA 5EZSA 3P2KA 3BXOA 3THRA 3EVCA 1N7IA 3KQSA 3DLCA 3KPUA 1XDZA 5CM2Z 3TKAA 3ELWA 3MTIA 4KW7A 3HCBA 4M38A 2A14A 2PKWA 2BM8A 4EKGA 2HR1A 2CMGA 2CMHA 2ONZA 2ESRA 5DX1A 3WSTA 4GF5A 1P39A 5IKMA 3FRIA 5HFJA 4R6WA 3FTCA 4V0RA 5FCDA 1M6YA 4OA5A 1SQGA 3E8SA 2HTEA 2BR5A 2XVAA 2PWPA 1XVAA 2I6GA 3SX0A 1RI3A 3FZGA 3OU7A 2BZGA 5KQSA 4GC9A 3KKZA 2ZSUA 1WS6A 1KR5A 3MQ2A 4GQBA 5HEKA 2OPBA 3PX3A 3U81A 1M6EX 4QPNA 3I64A 3TRKA 2HMYB 4OX9Y 3ME5A 3Q87B 5ERGB 3QV2A 3PT9A 3OFKA 2BR3A 5K0NA 4LWPA 2NYUA 3HP7A 4ER7A 3FUTA 3PFHA 3M6XA 1YZHA 3FUXA 4HRAA 5B1SA 5T6BA 3PLAE 3LHDA 2IPXA 1VPTA 2P35A 2ZFUA 5K0GA 1ZHFA 3HVKA 5BXYA 1X1BA 5E1BA 4PYQA 5EZQA 1AQJA 1DL5A 3FTDA 3ID6C 3SGLA 4ISCA 4ER3A 4YUXA 4R05A 4YMHA 4HTFA 2QE6A 5JUWA 1KYWA 2FRXA 4A6DA 3B3JA 3M6WA 3MCZA 3O4FA 5DRTA 4G56A 3FPFA 3OZTA 2G1PA 3A25A 1XTPA 3A26A 3CJTA 4JXJA 5FULA 3HA7A 1BOOA 2AOUA 3CGGA 3GRUA 4AZWA 3PTAA 2BM9A 4MIKA 3DLIA 4HGZA 5EGSA 2AOVA 5FADA 5LQCA 2E5WA 2GAFA 2QRVA 3BZBA 5FUBA 3HVHA 2EJUA 1SKMA 10MHA 4PIMA 5EKUA 4EK9A 2K4MA 1L3CA 3DXYA 3OU2A 3EVBA 1NBHA 3F4KA 2O57A 2NNWB 2PXCA 3NJRA 5E1MA 4QTTB 1SUIA 5EMKA 5CVUA 2OXTA 4DCGA 1U2ZA 3BGVA 4X60A 1JQ3A 4FS8A 5U4XA 3OE4A 3GNLA 3JWIA 5EHGA 4LWOA 5DLYA 5ICCA 2PX8A 1G8AA 4X63A 5KVAA 1JG3A 3K6RA 1ORIA 4QQNA 3HA3A 1UFKA 3I5UA 5FTWA 4YV1A 2ZWAA 4RVDA 5K05A 2OKCA 4FGZA 2ZBRA 3FPJA 2UZ4A 2AOXA 2B3TA 3PVCA 3ERCA 3AY0A 3M33A 2WA2A 4PYMA 5LQRA 3QOXA 4M7RA 2ORED 1L9KA 3NVKI 4MTLA 4OBXA 4E33A 4FZVA 3LCUA 2ZVJA 4OA8A 1KIAA 3HCEA 4R8SA 1G55A 3B5IA 2IH4A 2UYOA 3ER8A 5E8JA 1G8SA 3C3YA 2YVLA 1PJZA 4P7GA 2EX4A 3G89A 3KQTA 4QPPA 3GWZA 3HA5A 1FP2A 1SUSA 1VQ1A 2G8NA 3G8BA 1IXKA 3DXZA 2PSSA 4RTJA 1ZG3A 3DMHA 3EEYA 5H02A 3LL7A 5C0OE 3KR2A 3IEIA 2PXXA 3HVIA 3OCJA 5FWDA 4QTUB 2IBSA 5GINE 3EVGA 3M70A 4Z2YA 3R24A 3REOA 4XCXA 4RVFA 3FUWA 5DPMA 3TMAA 3UBTA 2IP2A 1DCTA 3TR6A 3X0DA 5KQRA 1JTFA 2QY6A 1X1DA 1G60A 1X19A 5EMMA 4CKEA 1KXZA 5LSAA 2ZIFA 3OZRA 3OZSA 3EGEA 3OFJA 5DM2A 2IDJA 2JH8A 2PX5A 3P9CA 4ATNA 1SVUA 3P9IA 5EMLA 3IV6A 4YUWA 5F2NA 5MHTA 4X61A 4KRGA 4BLVA 3EEOA 1RI2A 1I1NA 3CC8A 3E23A 4PYLA 2ZIGA 5DWQA 4F85A 2CWWA 2O06A 4EQZA 3HTXA 3AWIA 5DTRA 2EFJA 4RX1A 5LQKA 3CCFA 1VP9A 3BGDA 2VDWA 2HWKA 2CKDA 3KPYA 4YUYA 2Z6QA 1XCJA 4GC5A 3VC1A
chains in the Genus database with same CATH superfamily
3H5WA 1RQRA 2I0FA 3B8HA 3WLIA 1LLCA 4ZTZB 1G20E 4HDNB 4UBKA 1WB6A 2ZZNA 3IEXA 4O6VA 3AEUA 1L8LA 5HPYB 2KYRA 2W98A 2YN0A 1TCVA 1I5RA 2GNPA 1GZ6A 5K0EA 1PSZA 3DXXA 5EJ7A 4CQMA 5I8WA 5IKOA 3L4BA 3TNFA 1P5ZB 1XTUA 5DHAA 4ZI3A 1EQUA 1VJDA 1I3MA 1HT0A 2M6LA 1LSUA 2J3QA 1GGNA 4M1WA 4UM9B 5KJEA 1SG6A 5CB6A 4C7JA 4W1SA 2F9MA 2LNDA 4DA4A 1WUHS 4ARAA 5AVKA 5BW4A 4NCKA 2W11A 1NQWA 4RNDB 1ZI8A 1LLQA 4WESA 3C2QA 1GTL1 3NWJA 5LN1A 1XLVA 4YRNA 3GP8A 4BVAA 4EO4A 4TKLA 2XA9A 5GV8A 8AT1A 5J2UA 2C8LA 3EVAA 4PAOA 4QUGA 4Z3OA 4UU8A 3TTUA 3ABOB 2DE0X 1OC2A 3KOZA 4ZT3A 2WA1A 3OC0A 4DUGD 4AC9A 5JQGB 1MO4A 3G9ZA 4C0QC 1ID8A 4RTOA 1RWBA 2FPGA 3MT0A 1EQAA 2EYQA 5IAGA 3PYXA 4K9RA 1BJTA 2PAAA 4MS4A 4M9RA 4XB1A 2CSXA 1AN9A 1NW5A 1DCFA 2CDNA 2HMVA 2ONKA 3W5HA 4AUEA 1CZRA 4DREA 3KKQA 521PA 1WZCA 2AZXA 3DBRA 1U2GA 1XAIA 2HU7A 4R7TA 4LYJA 2OQVA 1XJQA 1H8HA 1QH1A 2VYVA 1BOFA 4E3WA 1ODSA 2YQZA 3H1AA 1F0PA 5COBA 3COYA 4KRXA 4X6YA 2SKCA 5TARA 2I62A 1CUJA 1AD2A 2AFHB 2O8BA 2C4WA 2IYWA 3EVNA 1GNSA 2HJGA 4BYGA 4JP8A 3OZAA 3QWFA 1NYTA 3L4BC 4LRQA 5JPCA 4RF3A 5HIKA 2AKAB 4HMOA 2O54A 1JLSA 1OY1A 2F1HA 3N3AC 3PXGA 3ROXA 4EPYA 2AXPA 2AX3A 3FYUC 3PK0A 2WE8A 4DRYA 5F3WB 2TMYA 5IUKC 1IY8A 2XW6A 4E30A 3GLHA 2BONA 2WG0A 4QPDA 1T2UA 2G1UA 2I9KA 1VG9B 3OHMA 4AO7A 2D13A 3ZZNA 4WNYA 1FFXB 2P5TB 4JMPA 5AWFC 2F1KA 4QUBA 2LDBA 1Z2AA 2MWMA 2WZBA 3BIJA 4JELA 1IBCA 1JU4A 4YGXB 4JI0B 1HG1A 2P5YA 2ZUUA 2Q6KA 2NUPA 1GVNB 1VXRA 4OB6A 1I5OA 2GPYA 1U1GA 2JI4A 3E5MA 3JRXA 3EF0A 3OKFA 4N8DA 4MUFA 4DY4A 5T41A 3TD9A 2I2CA 1T4MA 3GLSA 2V6IA 5C18A 5CX1B 3WDLA 4L7QA 1LK7A 2WVHA 2O5CA 4XFJA 4CBVA 3OE7D 3FSRA 1NJ5A 2XA1A 4ZJUA 4PZLA 3P0HA 4FEAA 2P4UA 4ZI7F 4BVBA 1FJGB 3RHSA 1QS0A 3QUBA 5YASA 1J0DA 4QGFA 3R9IA 3N39C 2FPPA 2GR9A 1D4ZA 1YS7A 2WAOA 1SUPA 3WWCA 1CUDA 3ROTA 1PK9A 1F5SA 4WLEA 3KZOA 4HQNA 4OH7A 4DCVA 1O89A 4E1BA 2AFRA 1KYVA 2H5LA 2XXAA 4KBYA 1EXMA 2ZIVB 2IH2A 4MR9A 3VHXA 3L5KA 5B3JA 3S8EA 1R8XA 4JB3A 4BGDA 1K6XA 2WJPA 2VG8A 1MFZA 4IIYA 4IEEA 4PGHA 4YRIA 1N9KA 2P6PA 4EI7A 2ZBPA 3UMCA 1ZHOA 2QBYA 2HQSA 4XUCA 5A4KA 2FWAA 4Q1AA 3U44B 4W82A 1HWYA 3TIFA 1GA1A 4I50F 3WWOA 1IWBB 3O26A 3SE7A 2REQB 2XUHA 3DMYA 4ND6A 1JP7A 3UBMA 4TYPA 1DAKA 2YMMA 3ITEA 1CS0B 4L15A 1GPBA 1GNTA 1W48A 1Q44A 4XARA 2I33A 2D6FA 3FNBA 3OWXA 1UP4A 1Z7GA 4JLKA 4B46A 2IYZA 4A6PA 3EARA 1I7DA 4N5DA 3SR0A 4I4TB 3UQZA 621PA 2VXYA 1O9BA 3ESAA 5EZYF 4WCFB 3TRFA 4B75A 2ZSEA 4EQ6A 1W1IA 4FFRA 4P84A 1C9YA 4N3BA 1D2EA 4EY5A 2RGRA 3INNA 5G02A 3P2IA 3AW8A 3RRNA 5ARBA 2BHLA 2NN3C 1UEJA 2JLCA 2XMZA 4F71A 3M6LA 2UKDA 4HX2A 3O31A 1I5EA 1SNYA 3NR2A 2P9ZA 4KMMA 1DX6A 1Z0SA 2GAIA 2WIKA 4KZKA 5FTKA 3CLRD 4F93B 1YB5A 2I2AA 2I2XB 3EC2A 2JEYA 5DM70 3V8EA 4BNUA 4WZAE 1CJTC 3H2JA 1KH2A 3LPLA 4U4AA 3ZW8A 1S5PA 1EX9A 1SG9A 5LXTA 2W6JA 1NJFA 4IFBA 4DTCA 1CW2B 3CYFA 1TM2A 1A5TA 2HHHB 2B6HA 3GRZA 5BR1A 1C0LA 5ELXA 1ZBDA 1M73E 4MQMA 3A58B 3GRKA 4G1UC 5E3JA 4HVCA 1N5DA 4HPXB 3TI7A 2FUG1 3C6QA 3WE7A 1EVIA 4DPMA 4E46A 5K0JA 1HE3A 2OM6A 1E1CB 3REGA 2YVAA 4JJEA 4UBNA 3SJUA 2JH3A 2ZTVA 2P4SA 2JVKA 3OLXA 4X1KB 2AK2A 4KUGA 5E2IA 4L07A 1I6KA 4CKCB 2PD4A 4V1CB 4R2KA 1G5HA 2MU1A 4H08A 4OJTA 5M3BA 2NO4A 2F3QA 2QIPA 2JB9A 3HV2A 2O2SA 4XFKA 3RRBA 4IEFB 2O2HA 2CLLB 2XYQA 4KXLA 3HDJA 3P19A 1PT7A 3IHTA 3EIWA 1B4DA 2WYIA 4E31A 4EAAA 1TMOA 2GDZA 2GX6A 4G4SP 4I19A 1GTSA 4OHYA 1YMQA 4IILA 1Z0AA 4PBRA 4OAPA 1PFUA 4TKVB 3TJRA 5B6PA 2JHGA 2Z9DA 2C5HA 5ALTA 1YR6A 4RTRA 1RKXA 1E8DA 3OTWA 3FD8A 3IQWA 3RI3A 1C5KA 2ZW9A 3DNFA 1GTJ1 4DFDA 4G23A 4CLEA 3M1AA 3N07A 3NYIA 1WUJS 3CRNA 4AIIA 2PKQP 4PN3A 1OIXA 5A4DA 5H9WA 1JECA 4PHCA 2WIJA 4GRIA 3LUHA 2I5PO 5AI6A 1V47A 1V1RA 4AZ3A 3ZIAD 1R5JA 1N5MA 2QI9F 3ECSA 4QATA 3S2EA 4DLAA 5BPHA 4L8YA 2P8SA 3G0HA 3P0JA 4LVNA 1Z5GA 4E5UA 3FFAA 3ZGYA 1WPQA 2EF0A 5BV7A 1XVUA 5LDGA 1SJ9A 4OQNA 3O7WA 4LBYA 1NN3A 4UVGA 4TMYA 1TPZA 3W2IA 3NBXX 2OBYA 4UHKA 4MCIA 4YJ3F 2W8BA 3UT6A 3DBLB 5ALJA 1KPIA 1UXGA 4LHWA 5JS1A 4UM9D 1C0IA 1G7SA 2QEQA 2PZGA 4B3GA 1D0VA 1E3DA 1FRVA 3AHEA 2WVGA 4O4LB 3S2SA 1U8CB 1VCNA 2ZIZA 3PCRB 2M98A 3PXBA 8MHTA 2ERXA 3X1YA 3NVDA 1V3VA 1I4EB 3AIIA 3VI4B 1M75A 2XNJA 2FVYA 3BWDD 4LG1A 3ZWPA 5ALYA 5IEBA 5FTMA 4RD3A 3HR4A 3CTPA 1ZGAA 2FN3A 4TSKA 4F2HA 1WSWA 2ZE6A 1YQGA 2H18A 5DASA 4IEIA 3GUVA 3W79A 3FJOA 1P0IA 5AR1A 3KKPA 1IZ0A 5ECGC 1ZA2A 1BWQA 3FA2A 4GOMD 4TLCA 2ZIUB 1RBYA 1MJHA 4KI7A 5DRYA 1HEIA 4J9UE 3W5UA 1XALA 1PT9A 4F46A 2CYCA 2PUDA 3M6VA 1MDBA 1ULSA 1ZNYA 1ZC4A 2B8WA 3LQQA 5JFGA 1G38A 1T1IA 3KVVA 2RHMA 4UDOA 4UNPA 3SZ3A 2P7HA 5EWLA 1T10A 2VJNA 4ARBA 4TROA 3IMCA 3HY3A 4F72A 5BWNA 2PO5A 4CL8A 4MVXA 4MOWA 1YU9A 2DT5A 3I3SR 3PFNA 3VVCA 1KYYA 1Y6FA 2F1RA 3STTA 1U0BB 3KR9A 4MWTA 4DSZA 3FGOA 1RLUA 4OUDB 1ZM7A 1D2AA 5JISA 2YZGA 1OJ7A 4IGFA 1GFIA 4RVGA 4NCIA 4YI5A 1EFRD 4HF7A 1J24A 2J6CA 2HA3A 4QOFA 4XIYA 4EWLA 4R0NA 4CIAA 1NBIA 5ERXA 3W9SA 1OHHA 4XRRA 4DR1B 1GU0A 3GCZA 2WFZA 4HTAA 4Q48A 4TZ0A 4D0RA 1NRXA 1OTHA 4Y9RA 1K0UA 1MC4A 1ZESA 4JUBA 1FFBA 1IL0A 1RWKA 2G5TA 4ZCSA 4BLSA 5CYGA 1TQ6A 2YOFA 1GUFA 1G9SA 1JKMA 2PX6A 1BGWA 4GUDA 3LUAA 3ORRA 2FPIB 5G1OA 4ODIA 3UB3A 1NIJA 2B2XA 2DH6A 2PKWA 2ZAGA 2XF8A 3A0UA 1L4LA 3IALA 4PZCA 2AMYA 3QUCA 1OFIA 3GG2A 3HDVA 3FDFA 2XKKA 4XFDA 1KETA 3I6QA 4Z4HA 1OILA 1M6YA 2QVGA 5I7FA 4C87A 5GV7A 1RXEA 4CKXA 4ED9A 4BP9A 1LK0A 4BNDB 3T4XA 3PA8A 1CR4A 4GPEA 1I3CA 2A92A 2WUEA 4IJVA 4RGYA 3A1VA 4KSBA 4AY6A 3SX0A 1RAIA 1B7GO 3P9RA 2OC9A 3QLEA 4H7DA 4I1VA 5G3YA 5HUQA 4FWTA 3WO0A 3L0IB 4IFEA 3F3KA 4WCFC 3TRKA 3VUFA 1VHWA 3QH4A 1XQWA 3GQVA 2LV8A 3K9CA 2LR0A 3KT0A 4OQZA 4WL0A 1H5NA 3OFKA 3B9PA 4XYMA 5K0NA 1PSWA 1KIFA 1YFZA 3PFHA 4V24A 5D3QA 1YZHA 1PW7A 4L16A 2QX7A 3PGJA 4P5EA 2V3CC 2IPXA 4YP5A 3P4XA 4GPIB 5B36A 5CPBA 1CFZA 5BR8B 4YCAA 1PK7A 3TSAA 1AM4D 4D99A 2WM3A 4BC0A 1I13A 2UZ0A 1ANKA 3N9IA 2H5JA 3H2IA 1HYQA 1PJSA 2EL9A 4G89A 4HB4A 5CT8A 2FSGA 4H4DA 3A10A 1QVZA 5LXTF 3UAXA 5JXGA 1LJUA 1UBMS 5B6JA 1T8PA 1DTWB 1WO8A 3OZTA 2WJGA 3VR2D 2ECPA 1VC2A 4YXFA 5CM9C 2A0UA 3T7EA 3WL7A 4C0BA 2R7MA 4JNCA 4TZ6A 2EFDB 1C0PA 1SXJE 1ORWA 1UC4B 5CB4F 2AOVA 2GNAA 3B38A 2WHRA 4XGIA 3CLUC 1I4LD 3DTVD 5K1ZA 1JDPA 1E1LA 3OP1A 1ISRA 1FF9A 1LJLA 1MA3A 4H7IA 1KI6B 4X62B 4BB0A 4UHJA 2DFPA 1T9HA 1Y9EA 3PIRA 1YIAA 3NG1A 4PPQA 5FPQA 1N92A 4ARSA 1K0FA 3GFQA 4FQ5A 4PTYA 1ZA1A 4LJLA 4BQNA 2I54A 1DKPA 2DFKB 3H6KA 4HWPA 1KDVA 1E3MA 2PLFA 1LRLA 4ZCRA 2C9OA 4CM4B 1QC5B 3WFZA 1ORIA 3KQKA 1RQGA 2V6BA 2BFEA 1JKXA 3FAKA 3TL2A 2DBRA 4EJ6A 1HE4A 3SN6A 2P11A 2AK3A 4BMXA 2AOXA 2OR3A 2FR1A 3EISA 3NRCA 2FTKE 2UUPA 3HKEB 3WOHA 4AWBA 4DNFA 2OGWA 1C9DB 2WA2A 1DIHA 3B85A 5TDHA 4ENSA 4Z6KA 5BYAA 3I12A 2BBSA 3JVVA 4GP9A 2HXYA 2HB6A 4FGSA 2B5VA 2IHBA 2NU6A 1MN6A 3HCEA 4Q02A 4Q16A 4U7HA 1QK3A 2IH4A 2VSXA 1PQYA 2RI1A 2BMAA 2WZQA 3MTBA 1M1NB 2O3JA 2ZAYA 3TPCA 3IQDB 1R0CA 1YBAA 4CR8A 2PSSA 5G4KA 1JJFA 1ZG3A 3O3CA 1V25A 1R12A 2XX3A 1M54A 2ZPUA 3DDOA 3QKUA 2D7JA 3DE3X 3ZWMA 4MKRA 3EVGA 4EHJA 1AKMA 1X77A 1BD4A 5H83A 1ZIXA 4INAA 4QHSA 3VSAA 4JK3A 4O2AB 2G1AA 2H4YA 5AI4A 3AQIA 3CO0S 4MV4A 1D7AA 3BEOA 4H31A 3OFSA 4ITRC 3DDCA 4M8LA 5LSAA 1XQYA 3AI7A 2OFWA 4AJOA 3OZSA 3WWPA 3GJSA 2HHCA 3VH1A 2H29A 3QLVC 1UFRA 3LP5A 3ILYA 1XCMA 1FDIA 1SVUA 4Y1GA 4HWSA 4DA6A 1QO0D 2FWBA 4L8WB 3CC8A 4RGBA 3FOZA 3JQGB 3ZWVA 2P4HX 1GJRA 1WCYA 5I7RA 1MUUA 3KJNA 3LF1A 4HDAA 1DHRA 4ZGWA 2O8CA 1GRCA 3WTCA 3H6GA 4MK4A 3RFCA 3X1KA 4G0OA 2EQ5A 3CCFA 4P6VF 1QC5A 1N6KA 4RZIA 3BGDA 5KSYA 5LP6F 1AKWA 2ZUSA 3DL4A 2GM9A 2IY7A 4BWYA 1JVSA 2VTDA 2JFFA 2MINA 1OGJA 2XMQA 4PTLA 1AKNA 4XD7D 5HFNA 1OE0A 4C76A 3A3KA 4IGKA 3VPXA 1H2WA 1TAHA 3R7WB 5BN4B 4E5DA 4FHDA 4OU4A 1G3UA 1P4GA 1JX6A 3SVTA 2IYXA 3GY0A 1UFOA 2JFYA 3L7MA 4JQZA 1XYVA 2FW0A 1YVRA 4X93A 5DZSA 5GQSA 2ECKA 4BNZA 4EPVA 1MOPA 4MPJA 1B0ZA 2XD4A 2NTJA 4R8LA 4JEHA 3RUPA 3VZSA 3Q2IA 1Z5NA 2C2ZA 3A7EA 3HGMA 4UUAA 3OY7A 4F8JA 2BGNA 5EPOA 3EUFA 1GOTA 1ZGCA 1MORA 4KDFA 2PT5A 3UHAA 3I6BA 5JZOA 2V6MA 3O8QA 2GLUA 3TD2A 1A76A 1VTKA 2BI4A 2WILA 3EGWA 1XTZA 3SK0A 4XYLA 2WV9A 4O2LA 2BF4A 1IIBA 3NHJA 1RQLA 2FPOA 3AMVA 2I65A 3RC3A 2WJJA 3WP0A 1DEXA 5GJVC 3DKPA 1G7TA 1SY7A 4AI6A 1FBNA 3QXXA 4Z0HO 3F74A 4II7A 5JAHA 4NJOA 3EPPA 1BCSA 2NU7A 4OMUA 5HSGA 1BVRA 1HURA 2OYSA 4PYNA 4BXOA 5LQSA 5DYTA 4WX2B 1S1CA 4C0LA 1KYQA 3RVBA 4QOSA 5JQGA 5JYDA 1FFDA 2EP8A 1HYHA 4HJXA 4KVFA 3U9TA 2A9OA 3FPEA 4GYKA 1KQOA 4WBNF 2JLXA 3QX8A 3DCIA 3S2UA 2Z2ZA 4ZPXA 1ZY2A 1IBKB 2F43B 2GZ1A 3DOFA 4KPGA 5CFLA 4H7HA 1EJ0A 1NLFA 1P0CA 1Y4SA 2EJTA 3MB5A 1I10A 3L5OA 4NMWA 2I67A 2P68A 4G81A 2X8WA 4LSGA 2WMNB 5C8ZA 2OGSA 5ADWA 1NWCA 3PWZA 1WMAA 2QUKA 5BR7A 2AHOA 2QKYA 1GUYA 2H0QA 2WIFA 2ZR0A 2ENWA 3VHXB 1M0EA 3C4JA 2J5QA 1MAVA 4CUZA 1NSFA 2Y77A 4YTEA 4UZSA 2R3SA 3QKTA 5H5JA 4LXYA 3R5KA 3J7TA 3QLJA 2XNCA 3DKVA 1U3GA 4P54A 4JYPA 4EQ6B 2PBFA 1KFKB 3ZYZA 1IN1A 1Z74A 1K3UB 1LSSA 3V7WA 5KNBA 2PKCA 3ZWBA 1GP2A 3K1AB 4LNAA 2JZOA 1NBAA 3GLHB 4JVSB 3RSCA 1OX6A 4U9HS 1JYFA 1JKJA 1Z7WA 3CUTA 2JKVA 2OV1A 4KMRA 4B4KA 4YV0A 2QYOA 5EXEA 2ZOSA 2Q46A 1DDOA 1E4EB 3U7QA 4K86A 1N2SA 1SHUX 5JARA 1B1AA 2HBRA 1JEYA 2DG2A 1D4FA 3SYKA 5AKJA 1UDXA 3UJHA 2VJQA 5ALUA 3UOAB 1FFHA 1LVGA 1RC0A 4MZXA 2P6UA 1PGQA 2PUBA 1LX6A 9MHTA 4INOA 2QXTA 5GJCA 5DX0A 1HT3A 1NI4A 2RGNA 4HFNA 5IKXA 2XAUA 1IBSA 2FETA 3LKZA 5DT9A 5E1OA 1NLUA 1SC1A 1UL1X 4LXUA 4CF6A 4JQCA 3MWFA 4TKUB 5BN1A 1D07A 1OPRA 1OQAA 3LDHA 4D1YA 1L0BA 2GBPA 5LDHA 4L2IA 3FNGA 1T9KA 4V1CI 3L40A 5FOXA 5CFOA 4CGYA 3I2HA 4J1QA 4EHFA 4RNCA 3HR7A 2A59A 1D6SA 1G5RA 4HUQA 4LNHA 3V55A 4BFLA 2K7FA 3I4FA 3KEOA 4K1LA 1TIBA 3OVMA 1Z45A 4G2TA 2PKEA 3TM5A 4KR6A 3BMQA 1U0HC 4BDTA 1UT6A 3AUSA 4WUTA 3EF3A 4V0LA 1DG9A 1CCWA 2PMFA 3TZKA 4TLLB 4C7XA 3SNHA 2GEBA 3IKTA 3VU9B 2GERA 2OBLA 3HUDA 4C29A 3JARA 2YUIA 4NENA 1THZA 3HJBA 3LBAA 1ND6A 2WJWA 1CVIA 4I1UA 5AKEA 2PUCA 1C7QA 2OAEA 3WNQA 4PZDA 4RHTA 4K5QA 3RS8A 5F52A 2VJMB 3ENZA 1RJEA 4QYMA 3I2GA 1Z15A 2YY7A 2YFQA 4FOSA 3SY8A 1TMKA 5ALRA 4LECA 2YVKA 2CV2A 3TPZA 2KBFA 2XI4A 3I9V6 4FI3F 1V8ZA 5AQ1A 3B70A 1Z0DA 2JFBA 3E9NA 3LS2A 1C4KA 1F6WA 1SG0A 1Z3CA 2HU2A 3G0CA 2GILA 3KPWA 4XI9A 1PT6A 3CIOA 4P7FA 3MIZA 1DSSG 2BTEA 1JQJC 3MRXA 5JXIA 1WSAA 3DCJA 4HDQB 1N1MA 3EIQA 1XLWA 3K9NA 1Z5WA 2QD4A 4M37A 3OQ6A 4EJSB 4QKQA 1V5GA 2BGTA 1AKQA 1T26A 2A78A 5EI5A 5BSTA 1TC1A 2D62A 2HBZA 3EW7A 4G9GA 4HXFB 2J9YB 4LWZA 4MQ5A 5HZKA 5BW5A 4EY8A 3QPVA 1RYMA 3CNHA 1MHTA 1BFKA 1W52X 4MLDA 2P9BA 3L46A 4MW7A 4TMKA 2RCYA 1ZUD1 4QUEA 4OSOA 1TEHA 2XGMA 2PANA 3R3XA 5CXUA 3WXBA 5ELMA 4BP3A 4H6VA 3IE1A 3BBPA 4HFMA 5CGQB 3ZHSA 1CF9A 1V6AA 3GMSA 2VBIA 3NAMA 3NC1C 2O48X 1W29A 1VSTA 3CONA 3DF9A 3K3PA 4OHZA 2Y1XA 3WKCA 1VE6A 1AS3A 2HI0A 4QLAA 1Q3HA 1J33A 1EYZA 4QTZA 3GGCA 3VNQA 2EKDA 4IDNA 2GWRA 2Q41A 1T5LA 1C3LA 2ZBFA 1LSOA 1ZIYA 2X1MA 1SXGA 3LUFA 3JZMA 4BDSA 5E9QA 3BGWA 2VKQA 3WHIA 5KREA 2W6CX 3IBGA 3NHSA 3DM5A 1MJFA 4OHCA 5AVJA 2F3TA 3ORSA 4UAUA 3WGVA 3MJRA 5GPBA 3EOZA 3NRBA 1LC3A 1RYHA 1CRLA 3A7DA 1UBLS 1Y7TA 2OB1A 3DBHA 2PZKA 4Q4CA 1J5EB 1PQPA 1T43A 1Z2PX 2OG1A 2XNDD 1W30A 3F6CA 4GPAA 4H7EA 1QFYA 1ZCJA 2ZJBA 3RJ5A 2QZZA 2IS1A 4AX8A 3L8YA 2GHRA 4KNYA 2WWRA 3PGLA 2J7KA 3ZHZA 3LXRA 1JAZA 1X1RA 1HT1E 1CJUC 3MWYW 4C7MA 5CX4A 5JWOA 4G4JA 1SBZA 3PTZA 3K0BA 4WECA 4TMXA 5AI0A 3WGMA 4JXXA 5IMBA 4W8HA 4CXMA 4K88A 1DC4A 5GGYA 1PG2A 1WXDA 2DQ4A 1P3JA 2ST1A 2CHQA 8ABPA 3VJKA 3N2KA 4N3CA 4KX3A 1WCIA 5EJEA 4A15A 1AQUA 3NJ8A 1ZR4A 2GCIA 5DJ5A 2ATVA 2PJRA 5GADl 3RV4A 3FSGA 3UW1A 5GWXA 1SVOA 3D5EA 1E3JA 4Q4LA 1ZD9A 2XCRB 2I8CA 2IF0A 3MMSA 1RLOA 3F2IA 5EL0A 1Q83A 4DYDA 3K0SA 3CR7A 1R0SA 1F17A 4OBEA 3AY3A 1PL7A 3I8SA 3EMBA 4U6SA 4YJHB 5F1YA 4W5TA 3CVJA 1FMFA 5FO0A 4UEQA 1YZ3A 5EIEA 3KV1A 2XDAA 1PZHA 2QPOA 1W46A 1C3OA 2AN1A 3IAEA 4HKTA 3AB8A 2GAAA 4Z0TA 1NKSA 3BB4A 2R96A 4KAXA 5LJLA 5CXXA 1TZBA 4D8YA 1GL9B 1D1PA 5HBRA 3PHHA 4XVHA 3BGSA 3A27A 2JNWA 4UKDA 1OBVA 5I7UA 3SX2A 3KU1A 1NA5A 4EKEA 3Q41A 4ZYWA 2O14A 1EEHA 4HH0A 5BW6B 1CY4A 4YROA 4RJIA 3O6VA 3K0FA 1K9SA 2F2TA 2AN5A 1EK5A 1NR7A 2PMDA 4JUAA 1GV1A 1A1VA 3PJRA 4GHWA 5P21A 5ALVA 2GEVA 1BFDA 1QHIA 1KEEB 3AEKA 2KS6A 3AP3A 1FU7A 3A3NA 3AR4A 3LC0A 3M5PA 2FDXA 3G2QA 3ON5A 4I5EA 1XA3A 2AF3C 3WAJA 3PRJA 2X2EA 4B4WA 3NU1A 4RV5A 4RORA 5EY5B 4KR7A 1H23A 1NPTO 1YZLA 3WV4A 5BQPA 2IUYA 3DAGA 2ZCJA 1ZUWA 5EESA 4P9NA 4PO8A 2C2YA 5F2KA 4W9MC 3FB1A 2JANA 3CZMA 4IW3B 5CDSA 2WIBA 2XGJA 1WDMA 1O97C 4K8RB 5A0VA 1FU8A 1M76A 2XEXA 2Q5FA 4QBIA 3UAGA 1LZKA 2ADOA 3ANXA 3O2NA 1VHDA 1NUQA 1RKVA 3L4SO 1L5KA 4BASA 4JI3B 3PQDA 1ZOSA 1CUEA 2J33A 2FCRA 3NONA 3GLFE 2P6RA 1Z9BA 1QCDA 2GHIA 3L8DA 4Q6WA 3ZWWA 1NC1A 1WUKS 1QYVA 4S1VA 1J5PA 2OCKA 2ZUVA 5E4JA 5F1KA 1IUPA 4CDRA 1OZHA 1TZJA 5J5AA 4NIMA 4C4XA 3B5JA 2NSHA 1YULA 4J29A 1Y3CE 3D0RA 3JY6A 3WB1A 4FFWA 2HH9A 4OB7A 4E22A 5ITVA 3B7PA 3UJPA 2GCPA 1SWVA 2I9PA 4LRYA 4DG9A 4DV1B 1PGJA 3S5UA 4RK5A 3U7JA 1D2NA 1C3OB 4CCWA 1DCKA 1Y5MA 1LDGA 3K4HA 4GICA 1Z8HA 5EZSA 4D79A 2E9SA 3VZCA 1DBSA 2VJAA 1X0XA 2WYHA 3ROKA 2XLBA 4D7AA 4D4LA 1NJ6A 3IELA 2CHVA 2D54A 4Y9TA 1C1XA 1AF4A 1T9DA 4A1FA 2R6DA 3IEMA 5KJCA 3DAOA 1P7CA 4UD6A 4EY6A 1AUPA 4WINA 2B98A 1Q5PA 4GGMX 2AI2A 4PAMA 3T3OA 2CVFA 3TTTA 5T4BA 2IOFA 3GI1A 1Z0UA 2Y1KA 3GLQA 4G5HA 1SBNE 3I9V1 3KZVA 4JT4A 3JPWA 2A3NA 4DILA 4M0LA 4QDZA 4LQCA 1V7ZA 1RI3A 3O2QB 1RHMA 1AXEA 4DR7B 4LC1A 1D1QA 4V1CA 3KKZA 6AT1A 4HZGA 4MYCA 1WSBA 1XMXA 2OPBA 4G5QA 2XJ4A 4QDTA 4QPNA 2WWHA 1CUXA 3IBCA 3PFBA 3IAS1 4M1QA 5CMLA 3QV2A 3LRTA 4Q3OA 4CKZA 5L45A 3CZ4A 4REQA 1XQVA 2B4TO 1ZGHA 2P2SA 3VR3D 4YCDA 4CUJA 4IXNA 3PVSA 3KQNA 5BVHA 4I5FA 2VRNA 2ATXA 6YASA 4CMKA 3GEEA 1Y4AE 2WHQA 1S2GA 1S2DA 2QRNA 4L0QA 4MITA 4X1IA 5FX2A 2YW9A 3OLYA 1R2QA 2XRFA 1X7WB 2VK8A 4YMWA 3UKDA 5B30A 1U9YA 4MQBA 1LLFA 1P33A 4R1QA 5EINA 2ATCA 3S55A 5JCPA 4RULA 3GBVA 1L7OA 3BHNA 3RSOA 2HIHA 3TSWA 4A6DA 1I2ZA 2OOSA 4PGMA 2BH9A 1PG5A 4Q3BA 4JGGA 2QGZA 4YJGB 3CX6A 2WINI 4JXJA 2W4IA 4CQLB 2GRAA 2CVHA 3D6MA 3ONNA 3SOZA 3ROPA 5F73A 3KFVA 4X91A 1E9AA 3ZHQA 2KI5A 4DC1A 3MSXA 3VPBA 2UVPB 2GAFA 4XOUA 4BGEA 1M2HA 5AFSA 2JGDA 3KT3A 2XITA 2D2EA 3E1SA 4EK9A 4AJKA 3KC2A 3F98A 4HLCA 5ICEA 1P6XA 4EEXA 4N3GA 3TUZC 1V45E 5DMHA 3ZTTA 4F12A 4DCCA 2I91A 1N6PA 4LEIA 4W5QA 2ZYTX 3ZGLA 4ISBA 3KKOA 2IGBA 4NHEA 5EWMB 1DC7A 1RRCA 2W4MA 4ZQFA 1HXHA 2HLNA 3MC1A 4JSYA 3OTOB 1TCUA 1WDLA 2W2QA 2OENG 5FO1A 3VZQA 4RVDA 2ZRMA 1VHTA 2QSUA 4TSRA 4WE3A 3K1TA 1J7KA 1QCZA 1SU7A 4WXEA 5IASA 4F96A 4MP6A 2O3QA 4GDMA 1W88B 2IEGA 2QN9A 1LH0A 1V35A 1E1RD 3NTUA 3L7LA 4IF6A 4HNUA 5KYVA 2ONCA 1TUIA 2PLNA 3AGQA 3NUGA 4E08A 1E6MA 2I4RA 3ZCPA 3ZDBA 4RELA 1G55A 1UM8A 2XNHA 3NCTA 4TQUS 5D87A 1RWOA 4JCCA 3SDSA 1H6CA 2Z9BA 3QJ5A 5AKZA 3GGOA 4A36A 3HSKA 1R9GA 1Z0FA 2EJBA 1S9HA 4KBFA 2Z4TA 3FYSA 4TVKA 2X5XA 2O7NA 4K2AA 4N8EA 1QHNA 1Y4ZA 4MVJP 3V3TA 3SZLA 4CLDA 1VPDA 2EFHB 3HVIA 3GA0A 2HBYA 3GDWA 2DF8A 1G7CA 2EFCB 3JYQA 4B47A 3CLRC 3GNQA 2QE7D 1TO6A 5L3QB 4A8JA 5KQRA 1T6BY 1DO8A 3DP9A 4JDUA 3Q3EA 4K9PA 5ESXA 2O50A 4G25A 5I6DA 5AW8A 3ZHYA 2XV1A 2BGRA 4ATNA 2ES4A 1CY2A 4MQUA 3WGJA 1PD1A 4BO9A 1KQ3A 4JP1A 1LS1A 4FCTA 2QR5A 5FAXA 3BRWD 3CY6A 1HR0B 4UUQA 4BQPA 2ZIGA 2VF7A 4GYYA 1E1QD 3E9ZA 3HSSA 1Z6QA 1QP7A 1DBWA 4KBGA 2JK0A 5ITZB 1E0JA 2XODA 3CUKA 2IJGX 4NARA 2Q0SA 4Q00A 3EH1A 2VAPA 4HDNA 3V4SA 1REQA 2GTHA 5L4LA 1TLFA 1OYYA 1TM1E 1ECGA 2FR8A 2Q5IA 3FAZA 3O90A 4O2RA 4WFJA 4E5PA 4EVIA 2J7PD 1GCAA 3LC1O 5HF8A 2FEAA 2YYYA 3H8VA 4HAYA 3OIDA 4FDLA 4R9UC 1DB3A 1YB4A 2RAPA 2VTVA 2YHBA 1JEQB 4CQMD 3GW8A 3AVXA 2DLNA 4Q3AA 4RHUA 3GD7A 5GIPE 1KP3A 1P7YA 3K2QA 2W90A 2VHWA 2RBEA 5TXGA 1UBCA 2E4YA 3DEJA 2Y1EA 2VDPB 3CXUA 5FQNA 1XCLA 2YY5A 1PU2A 4B4OA 2PA0A 4BX8A 3AJAA 4M4SA 4MS3A 3TLGB 3QUSA 3U5ZB 1ELOA 1N0IA 1PRYA 3IUMA 4PYJA 1Q77A 4MMXB 5EE0A 5LCXA 1P9NA 5BNIA 1Q91A 4MW9A 1AV6A 4BUCA 4FJ2A 2R6ZA 2WT4A 4BY9E 3JAWB 3B9BA 4OGFA 1M8PA 4N1AA 3OWHA 4I1PA 2BEUB 4BEVA 5HIIA 4YJ2F 4MROA 2O2CA 5DN9A 1FYFA 5DGDA 3GOHA 4AJHA 4D3DA 1Q2UA 3PXAA 5E2BA 2ZE7A 5EFZA 3VR5D 1I94B 4HADA 3DVQX 1NAIA 3JWPA 3KEGA 1XQXA 3LLMA 4ZVMA 1KQFA 3OHSX 4OUDA 4QNMA 3TTVA 1PCXA 1E1QA 1K6IA 1SA0B 1E9EA 3FYDA 4KIGA 2IUUA 4Z99A 3RV3A 4F4IA 3RIMA 4HX5A 3ZLUA 5IWAB 1H8HD 2C3OA 2VYVD 3GMTA 1F3OA 1F4LA 1EQ2A 4NP6A 1WNTA 5FNVB 4KAAA 4RF2A 3BUSA 1OR8A 2RIPA 3UAOA 5C5CA 2WE7A 4LY9A 1XD9A 4TTTS 4CMAA 5KTKA 4AKIA 1L7NA 4IIFA 1I0ZA 3JAKA 5LP6A 3Q6NA 1QSGA 1VL5A 4OVKA 4AP6A 4IAOA 4E13A 3N2LA 3TRDA 4US0R 1ID1A 1PAUA 2QGFA 3SSMA 1T2CA 1RFLA 5JBQA 4MHTA 1YBMA 1DJNA 2NZ8A 3QNWA 2P9GA 1VKHA 4F9TA 5L51A 2B8TA 2J6IA 1N1DA 2R7NA 1UDCA 3HL4A 2Q29A 4RMIA 5FBWB 1NW3A 3W04A 4NSNA 2E5LB 3JQAB 1N77A 4GM1A 4FWBA 1ZJJA 4M1TA 4CM9A 2CV0A 4TPKA 5L7TA 2SCUB 4U7TB 4O2AF 1FYWA 4RTQA 2BJVA 1YH3A 3HNRA 4H9GA 4ARZA 1H4VB 1XAJA 3CH6A 2B7CA 5TF0A 4JFRA 4RSRA 4GZ6A 1KDTA 2Q07A 3DEZA 3PE3A 4LZOA 1NVVR 2BCGY 4FZ5A 3T9DA 3VOSA 3W9UA 4EFKA 1P77A 3L6UA 1R0ZA 3L7DA 1J5XA 1P2DA 4NNPA 2BEUA 3I9MA 1UFQA 4KSCA 4EB0A 4CIWA 4OHXA 4MPTA 4L9RA 1OF1A 3N2ZB 1SCAA 2WHPB 1UBHS 4FFBB 1JTVA 2C1XA 1BG6A 3EQ7A 1MJNA 3C5VA 3OJLA 3AO0B 1KIMA 4QXPA 5E38A 5AM3A 1BE8A 2CHUA 1I9GA 1KXJA 3BVPA 9ATCA 1X1CA 2OAP1 2X9VA 1WJGA 2V74B 4WBNA 1IQ0A 5T67A 3B3FA 4KQXA 4TXLA 5FNZA 3T3GA 3HK2A 1P1CA 5HKAA 1EVEA 5DULA 2JLZA 1BAPA 2AD1A 4GM4A 1ZM4A 2QJOA 3E9QA 4KQCA 2VUTA 2YYZA 2O2YA 2AJTA 5CVDA 3ZVMA 1QV6A 4EJMA 1T0IA 2C7QA 1E58A 5EE5B 1ZKDA 4HI0E 4REOA 5K0ZA 5LYJA 4Q34A 5I01A 4MQFB 4OGGA 1YFKA 2BFFB 3U4QA 1GKUB 5D3ZA 2FLWA 2ZG6A 4JQSA 4RKYA 4K9NA 4US1R 4D3XA 1DU4A 1GT91 3G79A 4RKQA 3FPKA 3H65A 2C9BA 3PTLA 3SHVA 3LUJA 3VSEA 5CXQA 5KVSA 2H2GA 4FLFA 4O63O 1IU9A 5IUNC 4DVJA 3GLRA 3W5IA 4A5OA 4UAVA 5T7BA 2I2WA 2EKLA 2EQBA 1O03A 3ABQB 2BGMA 5JDCC 3EXEB 3GVCA 4PS0A 3P9SA 5J9FA 2O4CA 3H1GA 1O5OA 1AE1A 4KXYA 1M1YE 1MW9X 3M82A 4N6NA 2REXB 4DLRA 1M2VB 1GSAA 2H63A 1KAEA 1Y4DE 3LYHA 4DB2A 3I1JA 4QYTA 2P5SA 2ZSFA 4LZLA 4EO9A 1JIUA 1BGVA 4AYWA 3R7DA 2JLYA 4QFCA 5CVEA 5DNEA 1Q14A 5J58A 4I4NA 4CM8B 2FE4A 2B0CA 4JJGA 2RJOA 4JLNA 3T7KA 1XJ5A 1OXVA 2WDPA 2Y68A 1FFGA 3KTAA 3DL2A 4C9BA 4K9KA 4BN4A 2A9JA 3M2TA 4BB9A 1TX4B 3KTOA 1W4LA 2IGTA 3KYCA 1Z8NA 3DMTA 4GP6A 4KR9A 3SJAA 2VHVA 2BMEA 1AS2A 5FUWA 1QGZA 4FWIB 1BJRE 3CN9A 4Y9UA 3AUJB 2B82A 2M6SA 3OE1A 4TXMA 1I2BA 1I7QB 3A8TA 3R3VA 2ZS8A 3I34X 3R3HA 4RZ3A 5NULA 3X43A 3RR2A 4XDGA 1XZPA 2OMEA 1ZH0A 1JAIA 3CHYA 3GELA 4KE8A 2QR3A 2A58A 1CY6A 4Q19A 3B2EA 5DLEA 1RQXA 2IODA 3AFOA 3HBJA 3LVFO 1T4GA 4J7CA 3CN7A 1Z12A 4QOHA 5HRUA 1HNWB 1IRIA 1CUYA 2HJHA 5IUJC 1ZEJA 3OCWA 2I87A 5AI8A 4PFKA 2XVZA 4M86A 1JBKA 3F8TA 4RO0A 3LU1A 3C1AA 1U6IA 3PS9A 3VNUA 2Z2YA 3P9ZA 4UTNA 2WTUA 3HEMA 2VVTA 5FLYA 3TQTA 4YUZA 2VJOA 5EN4A 4Y8VA 4DDTA 3O8LA 4HDKA 3UUEA 2ERCA 2QBYB 4B6PA 2O5RA 1BRTA 3WY9A 4RHFA 1IONA 4DLBA 2WWXA 4IDGA 4PCAA 4XUGB 5LLSA 4V0SA 3K9HA 1NYLA 4PGAA 5BWOA 2R87A 4D5EA 4WGFA 4YCCA 3P2EA 2PQ0A 4IH9A 1V2GA 1R66A 1MIOA 1K4KA 1JS1X 1WETA 3IVAA 1QX4A 3V7FA 3HKDA 1RWNA 3F8WA 2J4DA 4LOJA 1HE1C 1RAEA 1TUBA 1Y80A 4LPSA 3KIPA 2RBGA 2CCGA 3W0LB 4LCJA 1Z34A 4KQ9A 3E48A 1SK8A 2WOOA 1VDZA 2QUHA 1C7FA 1PWHA 3ABIA 4IVNA 5BNFA 1WV0A 3K8YA 3WFIA 3ZZMA 2X8JA 2X5JO 1L4HA 1Q3KA 4JJ4A 1H94A 4KC0A 1B6TA 4ETWA 4C6RA 3DUFA 2BFBA 1HI9A 1SEPA 3JTMA 2IUEA 2OM2A 4NAUA 4ZQGA 5LQDA 2JIMA 1Y48E 4MUJA 1FDTA 2ZAIA 1WZNA 4ASUA 5T3UA 3VR4H 3VV3A 3NDPA 3EXHB 3TNLA 1R8JA 2PEYA 3CW2A 2JAWA 3U3RA 1APBA 1E2EA 1U1FA 2W8BB 4OXNA 1PGPA 5HKBA 1BFUA 5IHXA 3M7IA 1DJMA 3H1PA 3WNCA 1LVHA 1VIVA 3PCTA 1U3CA 5ALQA 3BSFA 3GB9A 2JH9A 2HQ1A 5T6MA 3PQ4A 4EBBA 1JGTA 2ZRCA 1G5PA 1QAOA 3NIFB 3QUTA 1HSOA 2V6JA 5MN5A 1NQ5A 1USGA 3OO1A 1ATIA 3QU7A 4PGGA 5G0UA 3OT4A 1H85A 3WYFA 4BMSA 5A2GA 3BL8A 3VAZA 3OF2A 3C4QA 2X4LA 1CZLA 2PIDA 2R7AA 2ZI4A 1FTYA 1HV8A 4HS4A 4BLUA 1YK0A 5IC5A 5FWNA 3PHCA 3ZDEA 2VATA 3L0BA 3EGOA 4OP1A 2AYYA 1YDMA 4FW9A 3NWPA 4DLPA 4F3KA 1AKVA 2QF7A 4POOA 5CCBA 2UZ3A 1ORDA 4D8XA 5ICGA 2FLVA 5F64A 2XYVA 4LGVA 4WZAB 4C1NA 5E8RA 4HDRA 1YF3A 1JYEA 1M7HA 5EEGA 3DGEC 2FK7A 5HQJA 4HFJA 3DMDA 1YNOA 3WJ7A 1F8FA 1ZL2A 3B6EA 3QKWA 3A70A 3L8EA 2X58A 4G5RA 1F2TA 2VPQA 4LKOA 3PB3A 5EEHA 4ZZ2A 1IBLB 2VTBB 2Y66A 4MCHA 5FPYA 4IM7A 2ZDHA 3NX4A 4L73A 2A1IA 2R65A 2VBCA 4BN5A 1QIDA 1S2OA 4DR6B 4MI1A 3NM4A 1B6RA 4D46A 1MB0A 1K7SN 4DJFC 2H06A 3TOZA 4ROSA 3OESA 4CG0A 3ESQA 3GWGA 4L1KA 3VR6H 3B2NA 2I2DA 3FVRA 3NT4A 3ENWA 1MH1A 4IDDA 5THKA 4BNTA 3QENA 1Z4PX 4N39A 4HOYA 4PLFA 4UNRA 1PR5A 5EKTA 3CEPB 3S8YA 5J4HA 3DC2A 4TN5A 3B9RA 2R47A 3PG5A 4FB5A 2QTNA 3J7AC 5FOUA 4MWSA 3P97A 2ZWVA 4R8RA 2GPWA 1COWA 2NPOA 3IQIX 4KCGA 5FWYB 4A73A 1OCEA 1GCIA 4G5FA 4QUDA 3SI7A 2FPMA 1BYIA 2ZP1A 3CZ5A 4P83A 3DEHA 2C61A 1D09A 1N7IA 3M1YA 4MJ7A 4HRXA 4D4MA 4PNZA 3IKVA 4PZEA 1GCGA 1XKLA 2WC1A 4RIGA 3GAMA 1RRGA 4JLSA 1YONA 3H84A 4JASB 4ETIA 2HIGA 2Q2VA 4QGGA 1KJ9A 1ZBQA 5JLAA 3RUEA 4DCOA 5JMWA 1HA3A 4LS3A 4BCDA 5H4GA 5FTNA 3D0OA 3AG5A 5TGTA 3RBZA 3TVYA 3GH1A 3OIFA 2UZ1A 4R3NA 4DBLC 1IOZA 2D3TA 1OX5A 1ZIOA 1LI5A 4OSPA 1BROA 1NRJB 3CLUD 2C00A 3C8HA 3H5OA 3Q6IA 2HLPA 4GC9A 1VBKA 1JYSA 3F47A 1DINA 3I64A 5C35A 2QN6A 3Q87B 4YT4A 2WD8A 3DAFA 8OHMA 2A33A 3UMFA 4GO1A 4M3NA 4DXHA 1Q1QA 1Z25A 3FKQA 3OZBA 2OO7A 1GUBA 3F4BA 1ISSA 1JJBA 1V3QE 3W2HA 4QJ4A 1W0KA 1YGYA 2XUFA 4GGOA 1AMNA 3AOEA 5LYJB 2D5BA 2OV4A 2ZXFA 3PNQA 3ST7A 1FMLA 1FY2A 1Z6AA 4GVXA 4NF2A 1KRXA 4HL6A 4CLRB 4ZXFA 3CLVA 3FI0A 3OD1A 1OFHA 1SPXA 1Y1QA 2V9ZA 1L6IA 1T8TA 2FRXA 4RPJA 2C9YA 5EHZA 1AK1A 3G0BA 4JJ8A 1CRQA 2IIVA 2QXUA 3ABRB 2UVDA 1U7HA 2FG6C 2X0JA 4FR5A 4G24A 2YS7A 4UEWA 5T57A 2GM3A 4MVJI 1KDOA 2FUG6 2PJZA 4UDYX 1K5PA 3UK1A 5LKAA 3ZXSA 1PFVA 3Q5EA 4EOGA 4K9SA 1FNNA 4A0SA 2DETA 4N4AA 2EJUA 2JJ8A 1YL5A 4Y6SA 3ZHVA 5CDHA 3SQMA 3A1FA 5JU6A 5IT5A 4RD2A 1L3CA 3H1BA 4FGJA 4BFYA 1GYRA 3E18A 3PR1A 3VYVA 3EA5A 5DTIA 3WQSB 1DFHA 1U9CA 2AJDA 1OH5A 4B71A 1TJ4A 1U8TA 3N8DA 1Z4OA 1XZAA 3LPNA 1R0YA 1QS0B 2OCBA 4ZODA 1Z0KA 3DS8A 4RY0A 1A3CA 3Q1LA 4D3FA 5TJ9A 1JI3A 1JXAA 3CX7A 2G40A 4PFJA 4YQYA 5BN5B 1JG3A 1JH9A 1LDEA 3C98A 5LM3A 2F1OA 2WT9A 1UR5A 2CJYA 4UXHA 1Q1BA 2ZWAA 1YA8A 3BJMA 4X66B 4GOJA 4IWYA 5HK9A 1KAQA 4FGZA 1PVVA 1T3TA 3FWKA 4KGVA 4R16A 1NNI1 1FVHA 1SQ0A 3M33A 4HNRA 4HNAB 2Q0QA 2I1QA 2IY8A 5EMNA 4DC9A 4EABA 2GBLC 5EJGA 3H2GA 5F76A 4MW2A 3TQIA 5IT4A 4E33A 3VUEA 5F4BA 2HIAA 2FQXA 4OA8A 5ESWA 3G2IA 3HZHA 4R1NA 2UYOA 2V98A 4P0QB 1U7XA 4NZYA 3O3OB 4JWTA 1EK0A 4PBSA 3NTRA 1LPBB 1SMKA 2RHWA 4LY0A 1L5HB 1G98A 1QVAA 2OD2A 3GEIA 1Q1GA 4DJTA 1OLUB 4RTJA 3PQ3A 5DNYB 1SEVA 3JYLA 1OLXB 2GCOA 2J0VA 2LTAA 1YS9A 2ILVA 4MCJA 4KWIA 3SXPA 5LWHA 5DEIA 2PUHA 2R84A 4QECA 3TR6A 1OA1A 1YWGO 2PH1A 4MWDA 3SKVA 1BTOA 2AI1A 2FWRA 3VKUA 5C1OA 2H54A 5B1EA 4CDNA 1GGMA 4KHPB 3H8WA 3ND6A 4CKEA 2QSZA 5LWQA 1K08A 4MYSA 2HF9A 1Z4IA 4MQFA 3SHWA 1ODJA 2IHZA 3UHFA 2IDJA 3OKPA 3VR3A 1L5FA 2UZIR 3MF4A 7YASA 1GZ7A 2YIVX 4YMGA 2GWHA 1UMKA 3IV6A 3KD3A 1OREA 5K3SA 4OH1A 5JCXA 2ZXEA 4PZ9A 4GX5A 4L28A 4PYLA 5E4YA 2GKGA 2H16A 3NBKA 4AXBA 4QREA 5DNDA 3AUAA 3GD5A 3SBXA 4QPJC 1TCAA 221PA 2E4XA 4LYYA 3PEWA 4CDMA 1QRDA 1NZDA 2JIBA 5LQKA 1EFUA 3O95A 5K4HA 2EKZA 2PH7A 2BFBB 1XVIA 1ILEA 1KRHA 4BKUA 2VDWA 1KWGA 4M87A 3AVWA 4HVLA 1K75A 3LUPA 4BPBA 1MEEA 1QNFA 1JLLA 3AM1A 2O2XA 3DZJA 2VUHB 1CUVA 2BFMA 2X40A 5E4TA 5K8VA 2NO6A 4KQ1A 4LE2A 1H6BA 1NDQA 1WB4A 2PN1A 5IVIA 1JFFB 1CUCA 2W58A 4OXRA 4UBOA 1ZX1A 3A6EA 2OLJA 3KJQA 1YT5A 4WZ6A 4X7RA 4DMKA 2PRIA 3I5AA 4P4SA 5FOTA 3AEKB 3W8FA 5JQGF 3N74A 2CUZA 4ZEVA 2B3DA 3CH5A 4BFXA 4NFSA 1BE1A 1II9A 2ASEA 2FN4A 3IIEA 5IZ4A 1OLXA 2GCOB 1WE2A 3IJ5A 3WZMA 2VQDA 2HT6A 3WIVA 4ZVTA 1UPAA 1JA0A 1RJFA 3MEQA 4FM9A 2CLCX 4MHSA 3OQ1A 3H0KA 3WGOA 3U44A 2JIOA 3CXRA 5B4TA 1H2ZA 2UVQA 1THTA 3K9LA 4I4CA 2DM6A 5ICMA 2R1ZA 2WWFA 4RJLA 3FBWA 1Z2OX 3MAJA 4QXRA 5PGMA 1KVUA 1INLA 1ODKA 2WUFA 2R00C 3H7IA 1XTQA 4Q5IA 4UFNA 2PNFA 1UAAA 5DHPA 5IAEA 5KJ1A 1SOMA 1YJAA 2PSJA 4BO3A 4H3HB 3VSBA 1HT2E 4C4AA 2O1EA 3OLVA 4F86A 3M83A 2HRRA 2I4IA 2QXYA 2PS0A 2VDKB 1GPNA 2Z58A 3INYA 3PU6A 1TMGE 2FMHA 3FYUB 1SU8A 4W1RA 4EZIA 2GSWA 2OGUA 1UINA 4YRAA 4QRHA 1GQOA 3HCCA 5IVKA 1DXHA 2B4RO 4IO1A 4R2IA 3NKLA 2DECA 1L5VA 3EGXB 4BMDA 4YRDA 3OLWA 3DNPA 5L4NA 1OYVA 3TX2A 1M6NA 2W2PA 1OAOA 4EVRA 5FWYA 2C8VA 2VBFA 1YOBA 4D9NA 3IC5A 3V2HA 4GP7A 4YP1A 3QVVA 2IBMA 5EUMA 3WGKA 1DIBA 3RJZA 3IP5A 3GA5A 2MINB 3IXQA 1JQDA 3D7KA 5JO9A 2BH2A 5M04A 1QV9A 1XROA 3IUEA 1N57A 2JFZA 4OCZA 2HUPA 3HMQA 5B3AA 5JNUA 4FE7A 3MZ0A 3GEGA 4Y2QA 1R9JA 1Q1AA 3ZR4B 3A1DA 2Y8EA 2WYWA 2VCHA 3TCXB 3GK3A 4RVHA 4YBZA 3C3XA 1U1EA 1O9HA 4LFBB 2GFQA 2Q5JA 2Y1LA 2SCUA 2W42A 1ECPA 1L4EA 3B52X 1K9VF 4IG9A 2XQJA 5C1IA 1NI4B 1AF7A 3P9XA 2EEPA 4AYXA 2QM3A 3T7TA 3E7XA 1LLUA 4D41A 3IERA 1SRQA 1G20A 4G0WA 4J0FA 3PF8A 2JFXA 2IYEA 4N0EA 4D9MA 4XXHA 2O8DB 2C84A 1RXUA 1OT5A 4OI4A 3V4VB 1XYYA 1R6VA 1U9IA 1UPTA 3AIMA 4QAQA 2EZUA 4F6LA 4NZMA 3WL8A 4A8PA 3OJEA 5KHAA 1X8KA 5JC8A 2YJ4A 3GROA 1C7JA 1WIWA 2EBWA 2Q5QA 4U1RA 2WG2A 2V6GA 3JRWA 2X77A 3LC7O 2HMTA 2YNMC 3LCRA 3KDPA 4GXTA 3Q40A 4URZR 5A9TA 3HCWA 4KXWA 4ETMA 4F0JA 1WHSB 3K20A 2C7PA 3GGSA 2DHCA 1JKIA 1AO0A 2VI5A 3ZU3A 1N0VC 4MP3A 3AEQB 2B1IA 3MSCA 5KYYA 2JEOA 3CJQA 1V7QA 3LLUA 1UOOA 3ZWKA 3PHGA 5JD4A 2A5JA 2C2GA 3QHPA 4AQDA 3HV0A 4ZC8A 3NXSA 3V2UA 1Z56C 1LDMA 3AKDA 1NVKA 4HUJA 3RUAA 3ZWAA 1XXHE 1P3DA 1FPMA 4RVNA 1QGUA 4HP8A 1NONA 1P4AA 4HXYA 1CR1A 3WGYA 3TSZA 4AT1A 3CKMA 5JYEA 3BMNB 1PI3A 5CYFA 1JPVA 3MOGA 4MJLA 2W6OA 5AVWA 3T6KA 4RLQA 2Z2XA 5HKOA 4RMHA 3ZWCA 3ETCA 1ZWLA 1RTTA 5E6SB 3HRIA 3TH5A 2GK4A 3CVUA 3LQRA 4YO7A 1RI5A 1QFSA 3IRUA 3VBEA 2XNSA 4UBLA 5JWRA 4JWKA 4XUDA 1BZYA 4WK6A 4E4RA 5ES4B 4Y67A 4GKAA 4QEKA 1YFJA 1IG0A 4Q6BA 3FN4A 3NTLA 1YAJA 4MICA 1XQ1A 2EV9A 4DV0B 3N8NA 3EDOA 1FE8A 1YJQA 3JQ7A 1PV4A 3SLKA 2VQ3A 4JJZA 2IYYA 3S1LA 2LRHA 3CVYA 3WADA 1P0PA 4BNYA 4B3XA 1M5TA 3EUWA 2XT0A 2ETXA 2J0QA 3E5NA 4Y0AA 1GG2A 3QXSA 3G02A 1P75A 1P2GA 2Q6VA 4FMPA 4YNBA 2XUJA 2Z5LA 4DYHA 4LF4B 4YS6A 3OA0A 4P7KA 1ZI9A 4DCJA 4FFSA 2G8LA 4D97A 2C9ZA 4CFZA 2AXNA 5D7NA 4BGVA 3B7WA 4JOBA 5HFAA 2GJ9A 2PBRA 1W25A 5TT0A 1QLJA 2EGUA 4EA8A 1R00A 3D3NA 3DUWA 4Z4QA 2FFJA 3EXFB 2Z6UA 1EAYA 2ILTA 4PHTA 4OQEA 3WMEA 2QP9X 1UKAA 3N1UA 2ZJ3A 4M9ZA 5DXJA 2WKSA 3PVZA 4BS9A 2GYUA 4GPBA 3P9YA 1C30A 2QUJA 1S89A 3IYLW 3UWPA 4UARA 4U63A 3UIEA 3D3WB 5ALLA 3CVVA 1DO2A 1T8WA 2Q50A 1DNPA 2W2KB 2HDNB 2BP7A 2PNJA 5DK4A 4NENB 3S2FA 3JCZA 2VLBA 2VH1A 2Y4OA 1UBTS 1DV1A 2NVUA 2VAWA 3DVLA 3ONWA 4FCCA 4INJA 4LIPD 5AW5A 1DEOA 4LZNA 1T0BA 2P7IA 4WN9A 4X71A 3U4GA 1USVA 3QE9Y 1P5JA 3SJ7A 3H1EA 4LV5B 1O6GA 3NC0C 2BRUA 3X1JA 5IM4F 3UN1A 1B26A 2GN0A 1NNSA 1C81A 2JJMA 1Y5RA 2HKIA 3ORFA 2C04A 2Q7DA 1US8B 3N59A 2I1WA 1N8KA 1WQ3A 3D2LA 2L69A 3H99A 3QG5A 4C89A 4A0FA 3IAHA 4P2GA 1BNCA 2WJ6A 2HT1A 2QW8A 1EK2A 5FV7A 1K8QA 4J2OA 4R4JA 5BNTA 2AJBA 2D1SA 4JVMA 4Z8YA 1WCXA 3QBVA 3L2OB 2AKYA 4HEHA 2LW7A 5G4KB 4D0GA 3JYNA 3KVYA 1NQTA 1RADA 1XV5A 4DR4B 1SKYE 2IOFK 3RYIB 1JEYB 4MUBA 1JVNA 3D81A 3HI6A 4RFVA 5I4IA 5EERA 3QVXA 4J4BA 1R6XA 1G8MA 2ZB2A 1T4CA 3BN3A 4LJ9A 1O9GA 3LQ2A 1C2TA 1HO3A 3O82A 3U4CA 4DOMA 5EG5A 2B8EA 1ESZA 4FMDF 4JVNA 1M1YB 2AGVA 2IYPA 2V0NA 5DBEX 2AS0A 4DMLA 2VJCA 1T4BA 1IEVA 3QOWA 4U39A 5AK0A 3LDUA 4CIBA 5KBYA 1RVV1 2ZPAA 3W5CA 1N2EA 3WGZA 3EG9B 1YHNA 1EZ4A 1DUSA 3GDOA 4V2UA 3DHWC 3HXPA 3W9BA 1VMIA 2AC7A 4NATA 1N3YA 3PPXA 2PS9A 5CU7A 1XEWX 5INTA 3HO6A 4LDAA 2Q5HA 4FFNA 3KYIB 4HY3A 3D0KA 2O1XA 4BNFA 3MAGA 3COPA 3ETEA 5JJCA 3A1NA 2FMUA 2M2IA 5DIZA 3P2OA 3T9CA 3T3EA 2H65A 7REQB 1N6NA 4ZAVA 3KDAA 3R5JA 3UA3A 2GSDA 2ZRFA 2RI6A 5JYCA 4JI4B 4UEOA 2W70A 1W87A 2H52A 1O4WA 1NBWB 2QVLA 4OO3A 4U3JA 3SYTA 4UBJA 5HBGA 3C8ZA 2R1VB 3HJAA 4PPGA 2APJA 3KFXA 3TEMA 1QF7A 3EPJA 3FMVA 4UTOA 1UBSB 1V43A 3JARB 2OB2A 3W3AA 2VXBA 1ZVMA 1SXIA 2HCBA 2XWJI 2V5VA 3AB7A 3DZFA 3L9WA 2ZULA 1AA6A 1H6AA 2OD9A 3C3KA 1PFGA 3GZJA 4RXTA 4TWAA 4W5HA 2SBTA 1QTRA 3AESA 4AECA 1XFDA 1A9XB 4DDVA 2AG1A 2RHBA 1RLMA 2YV3A 3VNRA 2PSHA 3H11B 1E59A 1K92A 3CEHA 3EOAI 4D3ZA 5K0TA 1GZ5A 4CCSA 1PQUA 2Y0BA 4YIHA 3AL0C 1DO0A 1XJ0A 3THYB 2C2BA 1R37A 4X1OA 2IZ1A 2ISCA 4IZOA 1B8UA 4MUGA 1O8CA 2FW7A 3QA3E 4FXPA 4D96A 1KE1A 4KPYA 4IIHA 1QIHA 2XY4A 3HYCA 3EZ7A 1P7VA 4HNSA 3UH1A 3KQSA 2PS1A 4DRXA 4NDNE 3UF0A 1D6NA 1HDGO 3AEZA 4WKBA 4AICA 4PSUA 5JNWA 4ZOAA 3GXBA 3U9LA 5K8LA 1BCSB 2BM8A 2NU7B 2BHTA 1SZCA 4HN2A 4D25A 1RSZA 1HTWA 4DIMA 3TAXA 4URVR 1PJQA 3JQQA 1K1EA 3ED5A 3QKRA 4J94A 1JR3E 4AJLA 4ZYUA 1U8YA 1TVCA 2ACKA 4BKPA 1KS2A 3UPUA 1XF1A 2XQIA 3A6HA 4GS5A 4V3BA 2VL7A 4B73A 4FFVA 1G66A 5AK6A 3KQLA 3K6SA 3QGMA 1BGXT 1I6LA 2I6GA 5FH9A 2J3KA 1CUAA 4UC0A 3QKSB 3I28A 4K9LA 2OWEA 1TM3E 2JRCA 4GQBA 3V4FA 1J0XO 1MFPA 2OHVA 2FVXA 2OBXA 1V5FA 4UNSA 1PHRA 4Q3DA 1U7PA 2CVOA 1NVVQ 1VBMA 3BTSA 3C6BA 5BQOA 3W7AA 4D6PA 4ESEA 5BVHB 2WU3A 1WW2A 2I4TA 2PK3A 3HJHA 4OGLA 1SVWA 2LDXA 3VTKA 3QVUA 3WDMA 3ZE0B 1GKKA 4C4SA 3CB4A 4Q7EA 3U7IA 4RGVA 3NTOA 5B1SA 5H68A 3W4IA 1CJMA 5T6BA 4CQJA 2WMYA 4F8YA 5BY2A 1Y1TA 2A0XA 1G4UR 1KJIA 4CPDA 4RACA 3M5DA 1GG5A 2Y6VA 3ESYA 5E7JA 4YQZA 1WWKA 1U0LA 2QE6A 1R4MB 1M2OA 2WMDA 3D8BA 1JDJA 4ARVA 2RD2A 1FYEA 2UDPA 5JZMA 2DXIA 1RRKA 2Y3IA 4PZYA 1DTSA 5LOVB 4D42A 3LH5A 3LHKA 3OJCA 3PKIA 4Q21A 3RVNA 4DDMA 3ZV3A 3S28A 3QM1A 3R0IA 3ZG6A 2VDOB 2Q9AA 2YJ5A 1DADA 3DLIA 1OLSB 5EGSA 3VM6A 2FQ1A 1P6QA 3P45A 2ZATA 5TLSA 4S35A 3OBIA 3K35A 3FOFC 4LOAA 5KIAA 3QBDA 3IA7A 3RYCA 4QOGA 3JQAA 3GVXA 5EKUA 4HBGA 4NCBA 8LDHA 1MU0A 4G37A 1YMUA 2NACA 3F5MA 4IR7A 1KQGA 2B2NA 5B1HA 3BGVA 5JNTA 2AI3A 5LNK1 2OVFA 4WKNA 5EHGA 3PGA1 4OAOA 1JZQA 4WZBA 5JALA 5FRDA 2K2WA 3AZPA 4XH9B 5G0WA 1AUVA 3HA3A 4QD3A 3U26A 4WSOA 3I5UA 4BB5A 1B76A 2JJ2A 2VJDA 4PYRA 1S7CA 5K05A 1L6RA 4MUAA 3JZDA 1JFVA 4JLBA 3M5WA 3ENNA 1GNQA 5BYBA 4A0GA 2BOVA 5ENDA 3PVCA 1AMUA 2V5AA 1EGMB 2BZSA 3AY0A 3TTWA 4F2DA 4ZREA 2B61A 1R7RA 2G06A 4NXMB 4XJTA 3WA6A 4WMLA 3JD1A 1JDSA 1OLOA 5KVVA 3EG5A 3P20A 4PSKA 1AY0A 1PVOA 2Q3DA 5CCDA 1T5OA 1SD1A 4GRDA 4KFUA 2YVLA 4IHAA 4BMYA 4E5SA 3G8BA 2VP9A 1RBQA 3S8MA 3DMHA 3F71A 2QMYA 3L7IA 4HAOA 1XTKA 4Y6PA 2DB3A 1U1IA 2VJMA 3PC8A 4UREA 5LA6B 3U13A 4EECA 4JYZA 4R0VA 4A8HA 4EHAA 5DNVA 3RLFA 1JG6A 3JD4A 2JIQA 2QTLA 2Q8QA 4YRTA 4DGSA 3R3ZA 2B8NA 2WZDA 4X3OA 3K15A 3U4AA 1X1DA 2V9PA 2VQSA 3LBHA 3ZLTA 2MYTA 3U7EB 4CF3A 3RFUA 1A7AA 4I1OA 1AT1A 2PX5A 4LJ8A 4MUEA 2B69A 3A32A 2WQ6A 4KQFA 3E8MA 1BEUB 4A8TA 4XSVA 4Z9YA 3UV7A 3DT9A 2ZETA 1GA4A 2B4YA 2FOLA 5ABPA 3CLSC 5C1BA 3E23A 3R0ZA 1XGKA 4IXDA 1VJ1A 3L0CA 4BV3A 2FW1A 2VNSA 1FUYB 4DA7A 4HEQA 4Q37A 2WLTA 3X1MA 1NTOA 2SKDA 4TYNA 3Q8LA 1TKBA 1NG9A 3EY4A 1AB5A 4G5SA 1CD5A 3FOCA 3CSDA 4K9DA 4AKEA 4Q82A 3QIAA 4WGGA 3JQFC 2W2LA 4HAWA 2ZBGA 3JWEA 5J1TB 2JC3A 3T0IA 2OZLA 4CT0A 1PO7A 4HPJB 5ED0A 5E9WA 5A5DA 1KKUA 4EW2A 5LBTA 3EPLA 2L19A 3I62A 1Y8AA 3OURA 4TT3D 1ZW6A 4EG6A 4C30A 1YZFA 4JX8A 3W2GA 4P34A 2BTOA 3RBVA 2JZNA 1E1MA 3R4VA 2RKBA 4EGSA 5JDIA 3HXQA 4ES6A 1Q1ZA 3P32A 1VB3A 1L1QA 1LTKA 2V59A 5ECWA 3ZUPA 4F4HA 5I5EA 1AH2A 1UDBA 2I3DA 2BMFA 3ZPXA 2C3UA 1BSVA 1G4AE 3T35A 1YR8A 3AF5A 3IO3A 3UXEA 3AXSA 4KLCA 4ILKA 4GI2A 2H0AA 2HJRA 3DTVA 3GU3A 4V0QA 2UYHA 4P82A 1OA0A 1HX7A 2YIJA 3SNKA 1ZNXA 2ZB3A 3GFBA 4EHKA 2XUGA 3DB2A 1EINA 5F1OA 5F4ZA 4PLGA 1J1ZA 2BGWA 1H1LB 1N0HA 3WBJA 4BEWA 1T36A 2IF2A 1A7JA 4YMTA 1P7WA 1KJQA 4RDXA 1BO6A 2L42A 2V4ZA 3F46A 2C5BA 4E15A 1OYOA 3NNDA 2BISA 4R7ZA 2Y76A 4EPWA 5L4SA 2BMVA 4XWYA 2X4DA 1UMCA 5B64A 1FTQA 5BSVA 4YAWA 3ZQUA 1QLWA 3HKDB 3OMLA 1H5UA 1BN6A 4LMAA 4EMBA 3QVMA 4E1VA 1CYDA 1YQ9A 1DEAA 2CDBA 4CLOA 4BNMA 1LFAA 4Z2AA 4KDRA 1CDDA 2ZUDA 3S68A 5EHIA 4LZWA 2OQ2A 2FZWA 2UVPA 1S02A 4L4XA 3CPEA 2AYZA 4BIIA 2JD2A 3C4VA 4GI1A 1OSNA 1JAHA 3T7IA 1KR2A 2YINC 1TL7C 3FIJA 1GFZA 4YJ3B 1CR2A 4NC9A 1J8MF 4JLAA 1XI2A 2C96A 3UFXA 4EAQA 3U4MA 2PWBA 1LBIA 1E6LA 1TJYA 4WJLA 1KJJA 4PW0A 1Z0JA 2Q21A 2Q4TA 3K4PA 1HNZB 1JDNA 1NN0A 1IXSB 3MOIA 4XEUA 1AVTA 3IB6A 2YHSA 1LSJA 4L9WA 1JEJA 2O20A 2ZSIA 1YS1X 1NQVA 3PQFA 5EIAA 3RSLA 1KRWA 1GTZA 1VPVA 2HHAA 3BJEA 4NFHA 3G7SA 1Y34E 3ZNPA 4R51A 3C43A 2J7PA 1EVQA 3AL2A 1ECCA 3NHFA 5JSFA 1RP7A 2VNAA 4BNDA 2YZKA 3KCNA 4FP9A 4IDBA 1R4NA 1CZUA 1JSZA 4TGLA 5F7JA 2WIGA 2O05A 3W3AD 4WY8A 3AVYA 2O1WA 2WV7A 1T6XA 1FP1D 2JLRA 3TRIA 3FLEA 1P8JA 2JLQA 1W0JD 1I51A 2PMWB 3D6FA 3EHEA 5KYWA 1A95A 1MQ9A 5EXPA 4A7PA 5AKHA 1DKLA 5D00A 4Q9LA 2OO5A 4L4ZA 1XCPA 4PXAA 2JARA 3U0VA 2DFVA 4ZT4A 1D4OA 4NYJR 2PUWA 3ILVA 3W9YA 3WLKX 2F43A 3DHEA 2N9UA 5U9CA 2EF1A 7REQA 2I99A 4JC8A 1QG0A 2G04A 5HMLA 3U6KA 5CEFA 1RWVA 2TSYB 1UBUS 3AFNA 1R0KA 1I2AA 1ITZA 1FRFS 2YR0A 3Q9SA 1NJ1A 4YP7A 3X3HA 3NORA 3MXTA 1UKCA 5P8WA 1OXBB 5D1NA 4TTAA 1QTIA 3R23A 4JU8A 3N86A 4FSDA 2P2LA 4L50A 3MGCA 3TIVA 1SIOA 2E18A 3QU4A 1MV5A 3ESDA 1UM9A 3PZBA 3CIFA 5CFRA 1MB9A 2E4VA 3SC2B 5CA1F 1U8FO 2P2ZA 4ZCLA 3BF7A 4KVGA 2E6KA 1DUIA 2QD5A 4AZ0B 4C7VA 1YHZA 4JB0A 1A9XA 1B6SA 2G1KA 4XWTA 5ESRA 3G8YA 2ZJ7A 3PHLA 1JIXA 3WSWA 3DT8A 2O8FB 1YK1A 3OZCA 5CH3A 3ZIAA 1Z5OA 1XRLA 5AM5A 4EHIA 4V39A 4LMBA 3RVSA 1NVBA 2CXNA 3BH6A 1MC8A 2JFNA 3HPRA 1QG2A 3PFGA 4RYDA 5JVDB 4D8UA 5IU6A 4PZZA 1OWPA 4KVZA 1X94A 5KOYA 1XC7A 1UQRA 2ONYA 1XRPA 1COWD 2GEDA 3CWQA 1XX6A 3FCSB 3OCVA 3PUJA 4M89A 1VCHA 4YYEA 4D4GA 4D9FA 4Z4GA 5LZ5A 1SU6A 1IZ9A 3AZOA 1PZGA 2E49A 3NAZA 2ZYHA 4XJXA 5GOTA 1P9OA 5IDVA 1KI7A 4GWKA 5J2UB 2I2FA 3ER9A 1QPGA