3R3HA

Crystal structure of o-methyltransferase from legionella pneumophila
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase, SAM-dependent
publication title Crystal structure of O-methyltransferase from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 67
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r3hA00
3FRIA 4BLUA 2N47A 3CVOA 5EMLA 2AR0A 1M6YA 3P9CA 1RJDA 5CVDA 5P8WA 3TOSA 4C03A 4RTPA 3PX3A 3DH0A 1R8XA 2ZIFA 3P9NA 4E33A 1INLA 1JQ3A 2O0LA 3BWMA 3C3PA 3DUWA 3FYCA 5HILA 2IH4A 2B78A 2ZCJA 2P7IA 1XDUA 3HCCA 3KPVA 5HIMA 3NW9A 2P1DA 3GJYA 4MHTA 2GA9A 2OXTA 4L7VA 4RVDA 3BGIA 2BR5A 3C6MA 3DP7A 3I53A 3JWIA 3NDIA 5E9WA 2DULA 4X41A 5DLYA 1VIDA 2P3QA 2Z6AA 4FT2A 4QVKA 3FUVA 3HCAA 4YUYA 3HM2A 3PB3A 3BWYA 3FPFA 1P1CA 3DULA 2F8LA 2YX1A 3BGDA 3LCCA 5DM0A 5K0FA 3G5LA 2C7OA 3EVGA 4PYOA 5FQNA 2VDUE 4ER3A 3H2BA 1O9HA 3OZRA 2GLUA 2OPBA 2G72A 3AWIA 3KR2A 3R0QA 1AQIA 1OR8A 1EG2A 1HMYA 2B2CA 4ISCA 1KYWA 2AS0A 3UJBA 4CTJA 4KIGA 3WSTA 1R74A 1WXWA 3B3FA 4HG2A 1SQGA 4ER5A 1D2CA 3EGIA 5HIIA 4PGHA 3OU2A 5D1NA 1VQ1A 5GINE 1G8AA 3EGEA 5FADA 2UZ4A 2HR1A 3MCTA 2G1PA 3P2IA 2PY6A 5CM2Z 4UOEA 3GIWA 4PGGA 3MAGA 3A25A 3A26A 1NE2A 5DPMA 1H1DA 5GM2A 1VPTA 2ZZNA 4XCXA 5K8VA 2AOWA 3B3JA 1X1AA 2AOXA 2GPYA 5EIFA 4C04A 4P7KA 1RJEA 2ZFUA 3SX0A 1KXZA 2JJQA 3M6WA 3KU1A 1T43A 2BM9A 5DSXA 2NXCA 3KPUA 1O9GA 3P71T 4FGZA 5EZSA 3MCZA 1KYZA 1EQAA 4E2YA 3UA4A 3LCVB 5C1IA 4QQKA 5D1HA 4PNEA 1I9GA 3SM3A 1MHTA 4R6WA 4C05A 5LQCA 3T0IA 1EJ0A 3KQYA 5DX0A 3FPEA 3OE5A 4X60A 4QVGA 2B3TA 3G7UA 3OFKA 4AZTA 1R00A 2P3OA 1XDSA 2GS9A 2PJDA 2PWPA 2P8JA 3MB5A 2ZZKA 3OCJA 1XXLA 2HTEA 5E1MA 2A14A 1JR4A 1QAOA 5E2BA 4YV1A 2B25A 3NWBA 5K0CA 4Y30A 2PXXA 2QRVB 5EMKA 3I5UA 4GOOD 2CWWA 2PGXA 1M6EX 1QAMA 2ZTHA 1XVAA 4AZWA 4X63A 4OX9Y 3LDUA 2XBMA 4PCLA 3S68A 3HA5A 4RTRA 4DZRA 3HCBA 3IYLW 3EPPA 4MWZA 3BT7A 9MHTA 4HGYA 10MHA 5EHIA 5HIJA 1RI1A 3BKWA 3EMDA 1JG4A 2G71A 5KQRA 2IBSA 1XJ5A 2P3LA 5LR6A 2BR3A 4KRGA 4OA8A 4DCMA 1SQFA 3ELYA 4RSRA 2GAFA 3ORHA 2FHPA 4WVLA 1XCLA 1UIRA 4GOMD 3RW9A 4AUKA 7MHTA 2ERCA 4U7TB 5EEHA 5DT2A 2HMYB 1YF3A 3M6VA 2EFJA 4KDCA 2Z6QA 1PJZA 3IHTA 5KQSA 1WXXA 4BY9E 5GP1A 3FTDA 3I9FA 3SMQA 3UJDA 1YB2A 4ER7A 3HVJA 2AOTB 3UJ8A 2YR0A 5C9ZA 3LDGA 5DXJA 2FRXA 2R3SA 1YZHA 1HNNA 3AY0A 1X1BA 3EVFA 4HSGA 5K0BA 1R8YA 1KPGA 3HEMA 4YMGA 5K0JA 1JG3A 1VLMA 3FTFA 4DKJA 5BXYA 1JQEA 4EKIA 3NVKI 1AF7A 1YFLA 2OB1A 3LCUA 2O07A 2NP6A 1ZG3A 3I64A 5DTRA 1ZGJA 4PYNA 2JHPA 2XYRA 3NWEA 5EGSA 1ZKDA 2ZBPA 3UJCA 3OZSA 1ORHA 3HA7A 3OU6A 3GNLA 2PX2A 5EQJB 3SGLA 1L3IA 2PBFA 2O05A 2ZSUA 4CXMA 3EVCA 3R9XB 2UYQA 4C06A 3VC2A 4RTNA 3CKKA 1ZHFA 3A7EA 1B42A 2G8NA 2OBFA 5T67A 2QE6A 3ME5A 3NDJA 4WXHA 5CVUA 2AZTA 3MQ2A 3TLJA 4GQBA 5K09A 5FUBA 5CVJA 1IY9A 1D2GA 1L3BA 1TPYA 2FCAA 5EZQA 5KYGA 4A6DA 3E7PA 2V74B 5LQKA 5CD1A 3MGGA 3B3GA 4BP3A 3SSOA 1AV6A 3LSTA 4JXJA 4G56A 3VYWA 1WS6A 3G89A 2YTZA 3GWZA 1NBIA 4R6XA 5K0LA 1NT2A 3CGGA 3GGDA 1N7IA 3KQOA 3M6UA 4CTKA 4RTOA 4XUCA 4GC5A 4F86A 4LECA 3JWHA 4C08A 3GRRA 5LQAA 1QYRA 5F2KA 1IM8A 5T64A 2IP2A 3G88A 4RTLA 4YUWA 3T7RA 4KIFA 2HV9A 1R6AA 3EVDA 3LX6A 3OU7A 4RTJA 1DCTA 2ZULA 1FBNA 2GB4A 5DRTA 4KVZA 2FPOA 1X1CA 3NJRA 3SXJA 4ER6A 1KHHA 4U7PB 5BP7A 4RX1A 2H1RA 5EKXA 3VC1A 5HFJA 2BH2A 2XYVA 5E9JA 4ZTBA 4MTLA 4FT4A 2Y1XA 3DXZA 2H11A 2YVLA 2ZWVA 4PCAA 4E31A 3UWPA 2Y1WA 4YUZA 3E05A 1F3LA 3HNRA 3Q7EA 5CCBA 5E1DA 5FHQA 1I1NA 5MHTA 2IGTA 1Z3CA 2JH9A 1BOOA 2ZIGA 3LGAA 3OE4A 4HH4A 4DCGA 1MJFA 3PVCA 3MERA 5GOZA 2P41A 2XYQA 3G2MA 3Q87B 5HIKA 1YZ3A 4PYJA 2VZ9A 1V39A 1UWVA 4YUXA 5JUWA 3G2OA 1EJ6A 2AN5A 3ID6C 3EEYA 2OKCA 4PYLA 2EG5A 3PS9A 3PLAE 3E8SA 2I7CA 1P1BA 4K6MA 1NW3A 2JH8A 2YUIA 5K01A 1KIAA 4Z2YA 3EEOA 1SVUA 5ICFA 3NVMB 4FSXA 5ICGA 4RTMA 3GXOA 5LQNA 5ICCA 2CL5A 1BC5A 3K0BA 5H02A 1ORIA 2NP7A 3KR0A 4LG1A 4E70A 3BWCA 3NTVA 3A27A 5JR3A 4PIPA 4QTTB 5LSAA 3O4FA 4CKEA 2ORED 5E9QA 2PXCA 5EIWA 5T6BA 3DLCA 2AOUB 3FTCA 4FP9A 1G8SA 2IDJA 3P9KA 1SUIA 4BLVA 5DSTA 4ER0A 4V0QA 5U4XA 2UYCA 3P2EA 3MTIA 1BHJA 4HGZA 2Z6UA 5DM2A 1Q0TA 1QANA 4HTFB 4PYQA 3EMBA 4EMSA 3GDHA 4RTQA 3CJRA 4GUAA 3THSA 4GC9A 5EEGA 3UZUA 4EQZA 4X61A 5EKUA 2PKWA 3FTEA 4Y2HA 2QRVA 4OA5A 4A6EA 2B9EA 3F4KA 4DF3A 4IV0A 4P7FA 2XVAA 3FRHA 4QTUB 2AVDA 1N2XA 2EX4A 1VP9A 2GH1A 4RVGA 3G8BA 4FR0A 3MHTA 5CVVA 3THRA 4B17A 2NXJA 1KPIA 2Q41A 1PRYA 2LD4A 3DMHA 3CJQA 4IWNA 5CUQA 5FULA 2HNKA 5DTMA 1RJGA 5CCXA 1Q0SA 5LQJA 3R6TA 3KPYA 3GCZA 3DXYA 4PWYA 4BLWA 1RI3A 1I4WA 4YV0A 1G6Q1 3C6KA 5DM1A 2AOVA 1ZGAA 1RI4A 4PONA 3KQPA 1JG1A 3GRYA 4MQ4A 2CMGA 4E2WA 4M7RA 5CVEA 1Y8CA 5ICEA 4PINA 4R05A 4POOA 5FWAA 5FWDA 2I6GA 2P40A 4RWZA 2ZLBA 4GEKA 4P58A 3FPGA 2PWYA 2ZBQA 3AJDA 3CC8A 1FJXA 2AOTA 4RVHA 5FA5A 5BW5A 1WY7A 3QOXA 4PYMA 5B1SA 1M0EA 4PYKA 5E8RA 4AZVA 3M70A 1JSZA 5DRYA 2NNWB 2PX4A 5K0NA 3P97A 1WG8A 2ONYA 2UYOA 3KHKA 3KQMA 4C4AA 2IH5A 3TQSA 2ZZMA 1JSXA 4RTKA 3EVAA 3G5TA 3P9IA 3X0DA 3NMUF 2V7EA 2YXEA 5DTQA 1O54A 3B5IA 3M6XA 1NW6A 3UBTA 2IH2A 1IXKA 3A4TA 2O57A 3BKXA 3BWBA 3GU3A 3KR9A 4HRAA 3HCDA 3PX2A 4OQEA 1KPHA 5LQRA 1F38A 1TW3A 4GOLD 5KS2A 2CKDA 3CCFA 3E23A 3I58A 3HTXA 2XVMA 2QY6A 3BGVA 4GOND 4QPPA 3UJ7A 3G8AA 3KKZA 3LHDA 3B89A 1DL5A 5DXAA 1QZZA 4EVIA 1L3CA 3R24A 1X1DA 1NW5A 3K6RA 4LWPA 3V97A 4LWOA 4PIMA 4OBXA 3EGVA 3DLIA 2NYUA 2PX5A 3LKDA 2PT9A 2WA2A 3FPHA 3SSNA 1BKYA 3P8ZA 3U81A 3ELDA 5CIYA 1NW7A 1SUSA 2YXDA 5DX8A 4RTSA 3O31A 3GRUA 4F85A 3HA3A 3L8DA 3SVZA 3UJ6A 4AZSA 3ER9A 4ATNA 5FTWA 3RODA 4RV9A 5IH3A 1RI2A 2AN3A 2NXNA 3FUTA 4P7JA 2IDKA 4CWAA 3ANXA 3O7WA 3OFJA 4KDRA 5EPEA 1D2HA 1RI5A 1U2ZA 5G02A 3LBFA 4QDJA 3EVZA 4BP1A 2EJTA 3KQWA 3FPJA 3FYDA 3DR5A 5EHGA 3TR6A 2NXEA 1XDZA 2DPMA 3KQSA 3DMGA 5FA8A 3C3YA 4O29A 2R6ZA 5GIOE 2IPXA 5K0GA 3P2KA 4KW7A 2OZVA 4EKGA 5LQUA 1NBHA 5DX1A 4E32A 2ZBRA 3T7TA 1NV8A 1JTFA 5IKMA 4XUEA 4AX8A 3ELUA 4V0RA 1UFKA 3GRZA 1VL5A 1P91A 2P35A 2VS1A 5DM4A 5EMMA 2HWKA 4F84A 1JQDA 4R8RA 1VE3A 3FUWA 2WA1A 4FSDA 3G2PA 4MIKA 3ER8A 2JG3A 1G55A 2H00A 1JTEA 2G70A 5FHRA 3FZGA 2VDWA 1RJFA 1TW2A 3KQQA 3QV2A 4E2ZA 3IEIA 3JWJA 5C0OE 3D2LA 3M33A 3SSMA 4P7GA 3GO4A 5EMJA 3B7PA 3MTEA 4DMGA 1YFJA 3TKAA 8MHTA 3UJ9A 3TPZA 1XCJA 5GWXA 1SG9A 4RYLA 5E2AA 4HC4A 5FQOA 1EAMA 4QDKA 4EK9A 3REOA 1R18A 4CKBA 2BM8A 2ZVJA 2UYHA 2PXAA 1G38A 3HP7A 1FPQA 4FZVA 5EC8A 3FUXA 2I9KA 5KVAA 1QAQA 1YUBA 3BUSA 3CBGA 3IV6A 3LPMA 3PFGA 4R8SA 4IKPA 3QOWA 3EVEA 3UFBA 3HVKA 3UA3A 3KPJA 4QQNA 3OPNA 2QM3A 2C7RA 3ERCA 3KPWA 2ADMA 2QYOA 3LECA 2PV0A 3AXSA 2I62A 2KW5A 1DUSA 1KP9A 2ONZA 1NW8A 3LBYA 4RVFA 2AOUA 3PFHA 3DTNA 3HVIA 1X19A 3TM4A 5E1OA 1P39A 3LKZA 1KR5A 3OZTA 2K4MA 3DOUA 4DA4A 3G2QA 2CMHA 5M5BA 1L9KA 4HTFA 2E5WA 1XTPA 4GF5A 1JG2A 3BXOA 2FK8A 3C0KA 4XUDA 4M36A 3TRKA 4M37A 5HOQA 2C7PA 2AVNA 4H0NA 5DWQA 3T7SA 2OYRA 4IV8A 4PYIA 3TFWA 1NV9A 5GIPE 2OY0A 3RIEA 1VP3A 2JHCA 1NKVA 2PSSA 2PLWA 1ZQ9A 3ELWA 3FUUA 4KWCA 1FP2A 3EVBA 3R3HA 3SR4A 5F2NA 3A7DA 4DQ0A 4OQDA 3LL7A 3KQTA 3PTAA 2VDVE 1VBFA 2YXLA 2PVCA 4M38A 5BW4A 2PT6A 3TMAA 3V8VA 4E30A 3GRVA 3UJAA 2OO3A 2IIPA 4GBED 5EOVA 5K0EA 4OBWA 2ESRA 2IBTA 3AXTA 5E8JA 2ZWAA 4FS8A 3HCFA 3LDFA 4NECA 5EG5A 2JHAA 2ZIEA 2BZGA 2FYTA 3DXXA 3TM5A 2OB2A 5K05A 3M4XA 3PT9A 5EVJA 1G60A 4YV2A 2FK7A 4QPNA 5HEKA 2BR4A 3TKYA 1AQJA 1L1EA 2P7HA 1FP1D 2PX8A 4C07A 5GM1A 1SKMA 2ZW9A 3KR1A 5ERGB 2AN4A 4X1OA 5E1BA 4YUVA 1N7JA 2WK1A 3KQVA 3VSEA 3CJTA 1EIZA 2IFTA 2VP3A 4YMHA 2C7QA 2EJUA 3DMFA 1WZNA 5F2OA 5FCDA 2O06A 3BZBA 5K03A 5HZMA 4E2XA 4DM3A 3HVHA 3HCEA 2YQZA 3JWGA 4CKCA
chains in the Genus database with same CATH superfamily
3BHJA 3C3JA 4HX9A 1SH7A 1AB6A 4XZ3A 2YDXA 1VLHA 1RU3A 1XDBA 3KT0A 2A9JA 2V6MA 4J3NA 5EKSA 3GLGA 1OHHD 3VO1A 4EECA 3B70A 3ZGNA 1T26A 4EX6A 2XUDA 3SQWA 4HDRB 4L78A 5A5GA 4UVDA 4JJZA 1P5RA 2QU7A 4G2TA 4JX8A 4MJLA 2OXTA 3STTA 3SZMA 1PT8A 1PL8A 2KE5A 1NVUQ 2ODWA 3DF9A 5HTKA 1PO7A 4B7UA 5AKIA 3EZXA 3CB2A 3PEVA 2CSUA 4KO8A 1ADBA 2GWRA 4QVKA 5ESXA 3TSYA 4JLUA 3LCCA 4ZCTA 3PDJA 2PZEA 5IMBA 1PNRA 2A1TR 1JFSA 3K9WA 4AZ0A 3H5IA 4YCSA 2G72A 3I39X 2NZYA 5CCDA 1C1XB 2OHGA 4FHFA 1QH1B 3QIVA 2FW9A 2HIMA 4LRXA 3ICQB 4D4MA 4B3MB 3FYUA 4IMPA 3GN2A 2KM1A 2PQMA 3RABA 3NHBA 3UF0A 1PJTA 1UANA 5ITZB 3NP9A 4BX2A 2G1PA 1CUJA 3GIWA 2C4HA 5EKTA 2FMKA 4WZAE 1R9JA 2BFBB 5CURA 5TQ2B 4HNUA 4DR4B 1U6IA 4M4SA 1XT6A 2YY5A 3L7AA 1XTKA 4FB5A 4HK4A 1E2HA 1N0HA 2AOWA 1TZCA 3GFQA 4MWTA 2VZ0A 1X74A 4C6RA 5KNBA 3MCUA 1NW9B 4JP1A 2P9EA 2A33A 2HW8A 2JIZD 2DSTA 4Y0VA 5AVJA 3ORSA 1EKXA 4FN4A 4GO1A 4NH0A 3WNVA 3BDAA 1SUAA 5GADl 5CFRA 4A8JA 4NZ9A 1WMAA 1A7UA 1WXGA 1ORVA 2GYWA 4GXRA 4JUBA 4LDNA 1HKHA 2BFEB 4JQOA 5D1HA 4HV4A 5AVTA 3FNFA 4Q7KA 1PZEA 4E4YA 3C3CA 3RASA 1XDWA 3IX7A 2D0DA 1GNVA 4UUPA 1IWPB 3PPXA 2LIVA 4J03A 3VGPA 1HSOA 1XVLA 2ENWA 4R9SA 1RP1A 3O84A 2J87A 4MRMB 5FOUA 4EF4A 4ZJPA 4URXR 1MA3A 3P9ZA 4NF2A 4KFTA 4NFYA 5KTPA 3BTSA 5A0VA 1II8B 5E4JA 5ECWA 3CX3A 3CLKA 3OP1A 4OXYA 5TNXA 1XVAA 1O0CA 1XA0A 5A04A 1C3OA 3HCBA 4MWZA 4PTYA 4AKTA 3AFOA 4HGYA 3AQIA 1RWKA 5DP1A 3JQQA 5CLLA 1QPZA 3OEHD 3MFYA 1UWLA 3OZFA 5KQRA 2ZYDA 1MJ5A 4N1AA 1KJYA 3BQMB 4LSGA 4NSNA 1SQFA 1YRLA 1LXCA 4WZBE 3EGWA 1J97A 1BFUA 1UMCA 2NZJA 3AU8A 3ORHA 4EO9A 5IJ0B 5JAMA 3KFLA 1Z6XA 1I30A 3FWKA 3HDQA 3QJYA 4TVKA 4V02A 4E4TA 4CEIB 3C1OA 5JCOA 1UOOA 2HRBA 3TAHA 1YVUA 1J6UA 2ACWA 3BDVA 5KYWA 1YQTA 1XL0A 1BMTA 3GVXA 2Q4BA 1CUZA 4BNTA 4D6XA 4G3XA 2PWZA 2X6TA 3V1MA 1VG8A 5I01A 1L7XA 4D92A 4JEHA 4ZN6A 1FS4A 1AHPA 1CZLA 4BYMA 5KVVA 4EPWA 2LRHA 5AOVA 5KPDA 3UATA 3PXDA 4KZPA 1AC5A 1U99A 3E9MA 1X7DA 4EL5A 1W1UA 3FE2A 2GASA 3GYBA 1CJCA 4ZPXA 1RM5A 4C7OB 1RM0A 2IYYA 3HEMA 1EHYA 1N2OA 1VL0A 4M86A 2FSHA 1XQVA 1E3EA 4FEYA 1T3ZA 3QVMA 5GTDA 2BF4A 2NP6A 4HDSB 1ZIOA 3RVJA 1UADA 1VLLA 5CNKA 1EFRA 1J5XA 1ZKDA 2XUPA 4PC6A 2DFVA 4CUJA 4RPCA 2VHCA 3KYBA 4EHHA 2FMHA 4OPMA 1DRJA 1XTTA 3IR6A 4DCUA 1NUUA 2DPXA 2FPUA 3O8DA 2DHQA 1BG6A 4HNAB 4CXMA 1VBKA 1VOTA 1FP4A 4QU0A 1Y6FA 5T6MA 3R75A 5CA1A 4CT4B 2G8NA 1MT0A 2WNHA 4EABA 2JAXA 1QC5B 1HTWA 3L4KA 1EP1B 4KAAA 3TLJA 1WCWA 2VF8A 4CNBA 3IAEA 3RT7A 4IBOA 1T9DA 4DIFA 1XMQB 1SUEA 4ZQFA 2HXSA 1TPYA 3HGTA 3CLTD 1BIFA 4I4NA 5LQKA 5ES3A 5CD1A 1P7ZA 2AH5A 4QUBA 1YCGA 3VYWA 4L8VA 1Y63A 4BJ3A 1EQUA 2BMJA 3I5AA 5GZ6A 2F67A 1WUHS 1XNJA 2EFYA 1OCEA 2IUFA 3MJTA 5KYXB 4HDMA 4NOMA 1N75A 1T2EA 3GGDA 1TIKA 1O5IA 1L0BA 6AT1A 1QZ3A 4HVCA 1ECLA 3G7NA 4C0SA 3JWHA 1WA5A 1IM8A 5T64A 1L7DA 3CLTC 3N76A 3C3EA 1FTWA 1ZSVA 4P3YA 4S3MA 2XRMA 4XARA 4KIFA 3EVDA 4URUR 2QGZA 4TTAA 2H57A 2IOQA 3EDMA 4OMCA 1Z4IA 3PHHA 5DRTA 1UZMA 3IQFA 3JRXA 3ACCA 3QVLA 4NU0A 5BYBA 3WS7A 4HDRA 5BT8A 4F1WA 1EDBA 4ZP1A 3PVZA 4RLHA 3VU9B 4RU1A 2OHJA 5D3KA 4LZOA 2AZ4A 3FOEC 3H65A 1SN7A 5TMBA 1PEAA 4PCAA 1MVNA 2ZSFA 4HFJA 4QFMA 2JFBA 1YJBA 2KJQA 4E22A 5L40A 3RSHA 2Y1LA 3GR6A 4GAEA 2Y0CA 3JS5A 1I1NA 1HT1E 1AKEA 1OXSC 4A82A 3DAHA 3R6WA 3PDHA 4OVKA 1C1XA 5JZ9A 3VKWA 1QH1A 2BF7A 4GOXA 4DVGA 2Z98A 3AUUA 3RDPA 1NY5A 2GZSA 3DOOA 2ZKLA 2IOFK 3Q1KA 4QO7A 3K71B 1NVEA 4RDCA 3C6XA 4RNDB 3WADA 1NASA 2VYND 4JJ8A 4B7ZA 3DZJA 2IS4A 1A4IA 4EHJA 2OCYC 3NU1A 3Q7IA 4PTLA 5ITZA 2OAGA 4W4TA 3RIMA 1M2WA 2K87A 4WV3A 3ZWVA 2QN8A 3OICA 3F78A 5LC1A 2BFBA 1NOIA 2VVTA 4NZOA 5K01A 5LIPA 1GSAA 2PL3A 1MTZA 2Q3EA 2XCOA 2YVAA 5F5XA 1QK4A 1UBFA 3H87A 1ATIA 1I2ZA 2J46A 3M2PA 4GI3A 4HLQB 4D0GA 5CFNA 4K40A 4MIYA 4XSGA 1I01A 5HBGA 3IP1A 4L57A 2EKZA 3R7NA 5I7EA 1N36B 5HRCA 1YCDA 2G4CA 1JW9B 2VK2A 1NUHA 1WVGA 2C4WA 2JCYA 2BFEA 2HZ7A 4LC1A 2C54A 1QCYA 5B6JA 3DLAA 4BLVA 4LVNA 3VHRA 2FHSA 1TC2A 4J1QA 1Q3HA 3KXIA 3PNKA 3L0PA 3F7OA 1DC6A 4L4ZA 3W6NA 1NQUA 1LH0A 1MB4A 1QANA 4HTFB 3BD9A 3L07A 1ZCFA 1GRNA 3AG5A 2BRUA 4TWBA 4EMSA 2E4ZA 2DWPA 2PA3A 4HBZA 1A5BB 1PSZA 2EFDB 4MRMA 2HMVA 4QEDA 13PKA 4X61A 4Y2HA 5EKUA 4D42A 5D01A 3W5BA 5YASA 1II8A 4JLOA 4IV0A 5IK2D 1UINA 2O4CA 2V4UA 3QKRB 3G1TA 2FV8A 4LJLA 4G9EA 4LZJA 1W4BA 3PFWO 4GE0A 4U5QA 4NG4A 5MN6A 3F8SA 1ULBA 2W8BB 4DJ5X 3LW7A 1ZM7A 4I1SA 2R62A 4EF5A 1N6OA 1ZS9A 1ICEA 1IFXA 1JT9A 1C0IA 1WNTA 1JIKA 1IU9A 2FSSA 3PWKA 4FW9A 3ZIUA 3UMFA 3OTOB 2WQZA 1KDYA 3SPXA 5LP1A 5L4NA 4IH4A 4D9MA 1S4MA 5C32A 1BGVA 3KLMX 3V7YA 3LXXA 4UTRA 5L7TA 4KN6A 3NUGA 4LBYA 3KZKA 4DLWA 1KEVA 2NYVA 2YC2C 4G4SO 2SCUB 2BGTA 1NLZA 1WB6A 1U94A 2RKWA 4MVJH 2NUAB 1W76A 1K89A 3AI7A 5AOBA 3T3EA 4M98A 3CC8A 4DR1B 1DKOA 4RVHA 3E81A 3WXBA 1KDPA 2R8OA 1L8AA 2XQFA 3MK31 4Y7CA 4OAPA 1L1RA 2WSSD 4KAJA 1B4DA 2CL6X 4GPTA 4LGCA 2V5VA 1PGQA 2H63A 1LPBB 4Q4DA 4OU4A 1QIJA 4IDAA 1WG8A 3HKDB 4PLHA 4PANA 1HZZC 4IJ6A 4QQRA 5IDVA 2P62A 2IH5A 3FDZB 5D84A 4YLGA 2G0NA 1KQ3A 3WLHA 3EFBA 2GYUA 4HDSA 3GGCA 1FDSA 2NTYC 2XB9A 3MOSA 3UBTA 1QFXA 5BWNA 1IXKA 1TVCA 4G0NA 3F7NA 4PFQA 3LX4A 3IS3A 3D8TA 3MCAA 4UJ5A 1EM8B 1DRWA 4RHEA 3O3NB 5IZ4A 1S96A 2EOAA 1W59A 3RCBA 5AVUA 1KFEB 1L3CA 1GPMA 4K05A 1K7CA 3L6OO 4EUHA 4H9GA 1QC5A 5F7JA 3DT6A 1TIBA 2QW8A 3NBKA 3DLIA 3S7ZA 1APBA 2ACEA 2YV1A 5K4HA 3KB6A 2FPWA 1HEIA 3DO6A 3V8EA 4N18A 5EAIA 4ZOQI 4TYNA 1DIGA 5G0VA 1KGSA 4GWGA 3JATB 5IAKA 5HA5A 4AZSA 4AMBA 5KYXA 3HDTA 1BGXT 2X23A 3R7SA 4BVAA 1Q0RA 2ZRCA 4K9PA 2X6RA 5P21A 2NT3A 3MMSA 3ANXA 3BSWA 3PXCX 1NP7A 4L28A 1NT4A 1H9CA 1VXRA 3C5EA 2OXFA 3ZZUA 3HEBA 3H0KA 4BUZA 2Q2VA 1M2HA 1LS6A 1H6CA 2QGFA 3C87A 4D8WA 2QROA 4P4TA 5GGXA 2PJUA 2X4LA 3JZFA 1T24A 5GIOE 1W93A 4E88A 4F92B 3AOEC 4JDUA 1T0HB 5AW2A 1V1MB 4TMWA 1XMOB 3PUHA 3VU9A 3OEYA 1IXYA 1JEYB 4TYPA 4A1OA 3GGGA 4R8RA 2HIGA 3FUWA 4F04A 5EHZA 3CQ9A 2WHPA 3QV1A 3MYYA 4YI5A 1CUUA 1EWTA 2PGAA 1IVSA 1P1RA 3NM6B 4X1YB 3DEZA 1Y3IA 2QRZA 1KYTA 1V47A 4YHHB 1KVSA 2AN1A 4U4AA 4ZT4A 3DW1X 1TC1A 2D5LA 2WICA 4X6LA 4JLNA 2G80A 5K0ZA 1XFDA 2W2LD 4KACA 1XMXA 1RWBA 5D7NA 4DFDA 4FFNA 1ENOA 3A58B 3UB3A 2DWOA 1UXHA 1ZN8A 4HYTA 1CJUC 1JJBA 1QJ4A 2JZNA 2R65A 3A9WA 2UYHA 2JLWA 2XMCA 3D81A 1X87A 1NMYA 1SY7A 1B2RA 3IV6A 4Y2JA 4PHGA 1GPDG 4MRNA 2W70A 4C87A 5KVAA 4MRPA 4I50F 3EVEA 3I2IA 4YFVA 3SHQA 4EVSA 1MUUA 2PSHA 5JXIA 4C7JA 5JCJD 1SCQA 3PYMA 2FP3A 3N74A 2I4LA 5BQFA 4LJ4A 4TXMA 3JAWA 1EPUA 4K88A 4W7HA 4YRFA 3VVMA 1D2RA 4P4LA 3WV4A 3ND9A 2HJVA 2YJ6A 2EGGA 3IKMB 1KC1A 4G41A 2VDOB 3QY9A 5I45A 5IX8A 3H42B 2FETA 4KRXA 1D6MA 4HTFA 4KE8A 4WKCA 2CXNA 5HSGA 5J43A 4UATA 3V1NA 1X70A 5CFPA 1DAIA 4A5SA 3CCBA 2BBTA 3TRKA 4B3IA 1FFEA 2PBZA 3LLCA 2C7PA 2Z5GA 4RS4A 2NADA 1N5RA 3OJWA 4Y2SA 4YMVA 2EBWA 3QKRA 4L5IA 1JA9A 4HNSA 1E8NA 4JBNA 5H4HA 3ZWXA 1CQJB 1VP3A 1TEVA 1W87A 2YRXA 4I6JA 2I54A 3FTPA 1FP2A 1A71A 4M9CA 4ZVMA 2P2DA 2PS3A 1K7YA 5DYWA 4D44A 3KQTA 2DBZA 2I3BA 2W8BA 4KXFB 3JD4A 2Z4SA 1D1QA 2VWPA 2H29A 3EXG1 5K3OA 1N92A 2BGMA 1MF7A 1UQTA 4GI5A 3ZE6A 1IAQA 1F4LA 4CF4A 1U81A 3W04A 1G18A 2F62A 4LYEA 4CV3A 4Q34A 1J0AA 1P1HA 2PX3A 3HFRA 3BB3A 5HCIA 1W36C 4ZI7F 4NECA 1NZFA 3OIWA 1AGNA 2F1KA 3BXZA 2HEGA 2BFDB 2IYLD 4FYKA 4NAUA 3P94A 3ZKWB 4R0MA 1I7QB 1T6ZA 4ENWA 2A0UA 2HX1A 2NUAA 3LIIA 2HK6A 3K1YA 4HWRA 4JOQA 5LZ7A 3PJDA 1R27A 5B6IA 1SKMA 2ZW9A 4NMHA 4P6VF 4BX0A 1Z08A 4EI9A 1SBYA 3DTYA 2IXBA 5TPZA 4Z0PA 1P81A 4JZKA 4R69A 4ZHQF 2AF4C 4TTQA 1K27A 2VSNA 1IQPA 4CMCA 4NCHA 1SC6A 1MW8X 4QOIA 2YIDA 2XR1A 4U7JA 1BS1A 5K6AC 1V6SA 3HKDA 1K3FA 4QU5A 1E4EB 3GZJA 1K5HA 3FDZA 3NAZA 1DSSG 2Z2IA 3QA9A 2C20A 4ND3A 2JI7A 3KV3O 1CX9B 5CVDA 4TL6A 1Y81A 3PA6A 5J9FA 4DMFA 2JLVA 5CB6A 4I6EA 2BFFB 1INLA 1JQ3A 2Z5LA 2X5OA 3NWPA 4LOHA 1EM8A 1M34B 4KQJA 2IH4A 1OPRA 2C9YA 3WLNA 3KPVA 5HIMA 1Y7TA 1M8PA 5EY5B 1KH3A 2XUHA 1M0SA 4FYJA 4F5DA 4IJVA 5TMPA 1H1LB 1X1RA 3REQB 1UM9B 3KEQA 3LUBA 1MPXA 1T8RA 1ONBA 4ZODA 5DLYA 3WLTA 4G8DA 2Y1GA 1XX6A 4YUYA 5IBCA 1EWKA 1R6DA 3ZWQA 2QPAA 4EKEA 2C7OA 4RY2A 1XXHE 3DUFB 2YIJA 2GBCA 3A1VA 2NN3C 4HMOA 3VR4A 2RG1A 2FH5B 3JATA 5K4AA 4S0ZA 1VC2A 3MOGA 2C77A 2ODBA 4ZAGA 1U8FO 4HB2A 2H8KA 2HA7A 1G8FA 2J31A 1IAVA 2QRGA 3PCTA 3UEOA 4DXAA 2P6RA 4F6RB 2J33A 3URKA 1TMYA 1OT5A 3OY7A 4ND8B 1O7JA 2R87A 2P75A 3A1WA 3MJEA 2HR1A 1CDOA 5BSEA 1U2DA 4M22A 4RGQA 1HA3A 3A4VA 3EY9A 3MWFA 1VPTA 3I6BA 3IH5A 4IS2A 1JDZA 4QAQA 4TSKA 3ZTYA 1K7SN 2YV5A 1V1MA 4CUZA 2WWGA 2GJ9A 2ZAOA 3M1LA 4PPGA 4LDZA 3JQ7B 4YN3A 2Q5OA 4YQEA 5CEJA 2XTZA 4HUTA 5IDYA 1OU0A 1XQ1A 3AGQA 3LCMA 5FYDA 4BJ5A 1BXZA 4LV5B 4PCVA 1O6GA 2L18A 2PZMA 3PIDA 1Q84A 1QX3A 1VE6A 3NTUA 4QQKA 4AO6A 2XOKD 1XPOA 2ZAIA 4JZYA 2CN1A 3DAGA 4KYUA 2H51A 4LJAA 4X1YA 4I50B 5A4JA 1CY1A 2D59A 1JPUA 1U04A 3OFKA 4URWR 4ZWNA 1MG5A 1TF5A 2OGSA 3HHEA 4K8RB 4MPRA 1QU3A 3CEPB 3IKTA 3IQIX 1J8YF 4QQFA 2H4YA 5MGNA 1Z5GA 3PWTA 3P4YA 3GVCA 3VC3A 1YKSA 4JT4A 4ZOAA 1D2EA 5I7UA 2YWJA 2JLCA 1OYWA 4D57A 3TNDA 4Q9NA 5IAOA 4CM4B 4JC8A 2XTNA 4WEQA 5L4LA 1KJZA 1KZ7B 4DLAA 3QI2A 2GAAA 4L15A 4OHCA 4PLFA 5F64A 3TCXB 3U3OA 3NIFB 4CCAA 5JADA 4C1NA 3C3BA 5KKCA 1SB8A 2PZBA 1LI7A 4F2HA 3VJRA 2D62A 2EFEB 4P5PA 2VSOA 1FFAA 1SUFA 3ELYA 3FMVA 1Y5LA 3AZQA 4IMJB 5BOVA 5JNWA 1T8TA 1RSZA 1KC3A 2O1WA 5IT5A 1L5RA 4P22A 3WL6A 2JD0A 2QWXA 4AUKA 2X0DA 4IDPA 1TECE 2DJIA 2GN6A 2XPCA 4AJKA 5DT2A 3N6VA 1E3QA 4JLSA 3KKNA 2RARA 4AJ4A 1IZ8A 1RQLA 5JZVA 3SYTA 1IB6A 1JPJA 3B9QA 1J56A 4FTWA 1YB2A 3T61A 3TLXA 2R8ZA 2VJOA 1AU9A 2JCBA 3MTQA 1J4AA 2UVPA 3HADA 5EVCA 2UXCB 3T1TA 5GZ1A 1RQXA 4LRSB 2ZYHA 3EC2A 1JMYA 4OQPA 4ZI7B 1F0KA 3KCQA 3O4RA 1UPTA 4HX2A 1U11A 1ACMA 2VH5R 2IXEA 4AJ9A 2MSEB 3OEED 4LIPD 3SICE 1CQJA 1P44A 2J5QA 3OC0A 4OQNA 3LO8A 1ESZA 1VHLA 2P6NA 2ZJ0A 1NYTA 5HFNA 2AIRA 3WGHA 1B93A 2QMEA 5KYKA 1YFLA 3L5OA 2XB2A 4L9SA 5EGSA 1RXWA 1C7ZA 4JNKA 2G1UA 1NC3A 5CNJA 1D1PA 1NSYA 4J1SA 4B32A 4ZHQB 2D6FA 4B40A 1M75A 2PX2A 5H3CA 1RYFA 1OB5A 4FKMA 2XXJA 1G2PA 2PBFA 2DTDA 3EBOA 5TVGA 2VK1A 2JGJA 2XUKA 5MDHA 1AGXA 4YY3B 1XAGA 3VC2A 1SU4A 3F1KA 4C89A 1TJ4A 1LY1A 3B60A 3R5XA 5TARA 2HMWA 3F0TA 4XR9A 4WXHA 2BFDA 2R2AA 4YRCA 3RPEA 3RQSA 1M0TA 4R2WA 3ZKWA 4DDTA 2HMUA 4PXSA 1AXRA 4G86A 5BV1A 1JKIA 2YHIB 1L4HA 2YC4C 4AP5A 1F7UA 1OLUB 4B7AA 4QNNA 5K8TA 3ROFA 4BNXA 1L6IA 2NV0A 1FMCA 4K6OA 2XNHA 1NVXQ 2VJNA 2ZBUA 4J6FA 3ZI7A 3T3OA 5J4YA 3KCNA 2R8BA 1E4EA 1YS4A 4JEIA 2Y1EA 4GC5A 4KXMA 3DFFA 5C8ZA 1GYRA 2K5UA 1SOWA 2QTLA 2L69A 4HKTA 2NM0A 3REFA 5FUMA 2R751 3PHIA 1EXVA 4GYYA 5JJCA 1WPQA 3G88A 4JJ6A 1TK3A 1YOBA 2OSVA 3MQ4A 5DHAA 5F51A 2BFFA 3D0QA 3LX6A 3QU7A 1NXOA 3PA8A 1M34A 2DX7A 5FTJA 3KAQA 5A03A 3PF8A 3R0ZA 1GTJ1 3GFFA 4QYXA 1W34A 5ELMA 4HGNA 5F9MA 3HXQA 1JV2B 1DKRA 4JLPA 3N59A 1H1LA 2VHJA 3REQA 4CM9D 1UM9A 2WUGA 2B4TO 5AW1A 4ETNA 1ODSA 5LZ2A 3MBKA 1C0KA 1HQCA 2GCOB 4ZALA 3TFOA 3C7CB 1IN5A 4LKOA 5TY0A 3DUFA 5FOWA 3Q6IA 5T7BA 4OJMX 1SOUA 3LRXA 1FDUA 2QTFA 3K1ZA 4Y7DA 4AWXA 4EQ6B 5EJIA 5FKJA 2XMBA 1E79D 1YUMA 2CLIB 3E0QA 1LLQA 3IBFA 2YXPX 3FM9A 1IM5A 2FR0A 3JW8A 3N07A 3PGXA 4Q9HA 2FAXA 4L7QA 4C6TB 1RQ7A 4AP6A 5BNTA 3LQFA 2Q1WA 1H2WA 3IILA 3UANA 2H2IA 3G3EA 5EYPB 4AJOA 4F6RA 1PDWA 1T3GA 4ND8A 1E4YA 4PEVA 3DL0A 3H17A 4DR6B 4J0IA 4KXWA 1FTGA 2ZPTX 4EKDA 4UC0A 3FTQA 1N4AA 4FZJA 2ZBEA 3ZCQA 2VLBA 3U1BA 5DNUA 3CM0A 5H02A 1CJTC 2J9YB 3LWBA 1FJHA 1FSGA 1DQZA 3LC0A 4P53A 5B1HA 1P2TA 4BNWA 2BI8A 1LNZA 2QRMA 1JP7A 3T1QA 1XEAA 3OZDA 5BSVA 4LDJA 1ISJA 3O8BA 3KTDA 2WWIA 3GELA 1JYFA 4P4SB 4I2VA 4Q1FA 1ZOSA 4H15A 4I50A 3TLGB 1S2LA 2W2KB 1UBEA 2ORIA 1PJ3A 3H9EO 4HGZA 4YRRA 3GA0A 1KA9H 4S24A 4W5JA 2DU8A 5JMOA 3DEFA 4WZAB 4DAEA 3UUEA 2QP3A 2I1LA 5HJ7A 2PKWA 2ZDQA 4U1RA 5JNLA 2MSKA 1A8IA 3MCVA 4GSYA 1Z6AA 4BP8A 1WCXA 3PD0A 3WTCA 3ZHZA 2CXOA 1JDPA 2IUYA 5EWJB 1J1ZA 2G5CA 4KPGA 4CM4A 3PGLA 5BWMA 3QUAA 3A2KA 3NYRA 2HLPA 1TGYA 4JMPA 4N65A 1RHUA 4BV9A 1KQPA 2QAGB 4HXEB 4TTPA 2P1RA 4LWZA 1Y4ZA 4BGUA 3WIEA 3MS2A 5CUQA 1RJGA 3R3WA 4L9RA 3AEKB 4TPKA 3GUZA 3CKYA 4TMVA 4UHFA 3DXYA 5EFZA 5IU6A 3KETA 1IC6A 2INGX 5GOTA 3RI3A 3M3PA 2CV0A 4G5FA 3PQ7A 1W6UA 4L8LA 1MB3A 1QRAA 1VBNA 5CR9A 4P7BA 3MJDA 4AO7A 4D6YA 4E5VA 3ODPA 1OXUA 1E98A 2B1GA 3ANLA 5SY6A 4FLMA 5FOQA 2VDPB 5CPFA 4ZVPA 4PINA 4WJKB 2ZXUA 1LI5A 1P75A 2V0CA 2XJ9A 1P2BA 3GJ7A 4FILA 4I9UA 4OAQA 4RWZA 1H22A 2BEVB 3PGJA 5DN6D 2WKPA 2HM7A 1ADFA 3HYCA 4QPZA 5BOSB 1GCIA 4JJKA 2FN8A 4PYMA 1J0BA 1Y3HA 2HHAA 3A0RB 4NDZA 4ZI7A 2CV1A 3AP3A 4I5FA 1GLGA 3L0IB 5DK4A 1GARA 2Q3CA 2ZYRA 2H92A 4OTZA 4WZBB 4CF6A 2X15A 1G16A 3I52A 1DMSA 1PR4A 4I3GA 1LSUA 2CLFB 3AR2A 1XTRA 4XSVA 3G9UA 3I3SR 3A36A 5FNVF 1XMIA 3JARB 4ZHQA 1ZMXA 3IUNA 4GDFA 4ITUA 3V4VB 4IDDA 1RIFA 2VHYA 1YTUA 1TW3A 5HR5A 3K8YA 1KOGA 3WISA 2IHJA 1FDOA 2HHHB 2JFWA 4QYIB 1NVAA 3LNTA 1G0OA 5HDQA 1JHOA 4QPPA 2PWBA 2YJZA 3NUZA 1DL5A 2RAVA 2V97A 3ZQUA 1JSRA 2CE7A 4CZ2A 1SRRA 1LCIA 5ANRB 1R4MB 4RPGA 5L3SA 3RTAA 3LXUX 3ZXYA 5JD6A 1M8GA 2F43B 3HY3A 3IURA 1UC5B 2FEXA 2YHIA 3QVUA 2FSFA 1O6BA 2YKGA 1IDN1 2ATEA 3HLKA 3QNMA 2WSLA 5NULA 1RJWA 3HU3A 4KTVE 3H99A 1NWCA 1YMUA 2IUTA 3ZHYA 5J5AA 4AJEA 3CNEA 2ZUVA 1D2MA 3ZE8A 4DQLA 2J67A 2OECA 2PRIA 4N03A 1X92A 3H9UA 4IRUB 4MW1A 2QEQA 3T7CA 5LZ4A 3T35A 3W8NA 1IRXA 5DNVA 1HH4A 4MVJA 3CRRA 4C01A 4LHWA 2VDQB 5KX5F 1EESA 5C4MA 2P3SA 5G02A 4QDJA 4XIIA 3RHSA 2D2XA 1T15A 2GEVA 2IZZA 2PIAA 3E3NA 3LCJA 2NXEA 4K8OA 3WMEA 3ZLVA 1WB9A 1MTOA 4JI4B 2VDWB 5LYJF 2EQ5A 4LF5B 3BBLA 1YDMA 3D2CA 1NAHA 4OHBA 2J7PD 2D0PB 3D31A 1R9NA 3RSCA 3WYAA 4CMIB 4DEVA 1JTFA 5IKMA 3I4LA 1ZL2A 2EU8A 5JDCC 1E9AA 1YR3A 3TD6A 4TM7A 3NC1C 1VG0B 2P35A 2JRLA 2Q46A 4I5IA 3Q8MA 5A05A 3RVRA 2GCOA 3NDRA 2W6ID 1OC4A 3C3KA 1NE7A 1U4SA 4GZMA 4EKNB 5SYNA 1PAUA 2OT3B 4IDQA 3WQQA 2ZRIA 2O0KA 2BFCB 1GUAA 2I3GA 3BE5A 1DFGA 3NG1A 3QV2A 3CUYA 4Y0NA 4BN0A 1ST2A 1IDOA 4EQ6A 4F4CA 3ZXUB 1VJTA 5CGQB 3DEJA 4LPKA 1T1SA 2VK4A 3B9RA 4C6TA 2OD9A 3ROEA 1ZOLA 4KHPB 4DXDA 3L5KA 5HKKD 5LLDA 4JIGA 3WLRA 1RHMA 1BNCA 2ZUWA 5C1DA 1ZR4A 5JNTA 1XCMA 5KTOA 1RVV1 3TB4A 2FZCA 2WJGA 4OI2A 3WQSB 2YVUA 1GDTA 4OG2A 1IUOA 2AC4A 5ECGC 5ALKA 2P27A 2A30A 1G6OA 2GPJA 1B74A 4HF7A 5HM6A 3CN9A 4Z99A 4YECA 3ICCA 5DTJA 3M9XA 3BFVA 2PE5A 2A6PA 5THKA 3KWFA 1K6IA 5K3SA 4JKIA 1T4GA 3EC7A 3RUPA 1ISFA 1N5OX 3W1EA 4OHOA 5LWQA 2X2FA 4X65B 2C8LA 3HCWA 1YS9A 1XVUA 4I3FA 4YB8A 5DU2A 1E5LA 1UAYA 5JXJA 4P4SA 2JLBA 3W3AH 4GI1A 2HRRA 3ZNNA 1TQ2A 3TLGA 2YZMA 2W2KA 4EG3A 3W8EA 4BQSA 4X7RA 5I7FA 1FDRA 1HRDA 1V3QE 2F48A 2VC2B 1KERA 4M0EA 4C21A 4UPEA 2NUBA 5A5DA 5AW8A 4WZAA 5B7GA 3RWBA 2JASA 2GBFA 2VF2A 2DCMA 2AQIA 4M37A 5ESRA 2R7MA 2ODEA 1CZNA 2W71A 4F1KA 3WXMA 5G3YA 3E4DA 1NV9A 3EZ7A 2OY0A 4LWQA 4P8RA 2PSSA 5ETJA 4KWCA 5EWJA 3RUHA 3WQHA 3ENQA 3R3HA 3OTQA 5BWOA 4EX7A 2QAGA 5HW0A 3DBVO 4ZCPA 4D56A 1NY6A 2WIFA 3VU1A 5JSUA 4QTXA 1FTSA 4BNIA 1VBFA 4X8OA 3QJ5A 2X1VA 6LDHA 2Q1YA 2B3DA 2QTNA 3AEKA 2OHFA 3GRVA 4JI0B 5GAJA 1DKUA 4EFMA 4TN1A 4TTVA 3OLYA 3AF5A 3HGMA 1XP5A 3F3KA 2VDLB 5E8JA 3A9TA 3HDJA 3FWHA 3VJLA 3EXFB 3DXXA 1HC7A 1SIUA 2P5YA 3NQ41 1B0AA 3R3XA 1YJ8A 1ZHHA 4H16A 2V6JA 2BN4A 4BEBA 5C37A 4GX0A 4PRLA 4YV2A 3T38A 1RACA 1QOPB 1T0IA 1KAHA 2XQVA 2Y1KA 2XZOA 4ZQGA 2BEVA 5BPFA 2IU0A 5ER9A 2PX8A 1NJFA 5BOSA 4BRUA 4EHNA 1Y4DE 3I72A 3A3NA 5JISA 4HWPA 3RREA 4NU6A 1H8EA 2EP5A 5AVSA 1RHKA 2DPHA 5SV2A 3ZU6A 4C0WA 5JI2E 3O4HA 1YK1A 3IMGA 3KC2A 2IX3A 2GA8A 5G40A 4WLUA 1U8EA 4WZBA 2YFYA 4D0SA 2HU7A 1VM6A 2JFVA 5ILGA 4JP3A 4GFDA 5I8WA 1HM5A 4TVOA 3KJQA 2N47A 3TTXA 4LOAA 1VCOA 1GA4A 1QIIA 2V98A 3W6UA 1Z35A 4R51A 1ZJZA 1P6QA 3JARA 3JQEA 4LHEA 3NUQA 2NU9B 1NIPA 2O0LA 3SCZA 5IS2A 2GSDA 3SEZA 3ZJTA 4EG6A 1LV7A 3WLMA 2FPKA 3O47A 4QYIA 3O3MB 3T1YB 4V3CA 1XOIA 3UCEA 2GA9A 2HTFA 4RVDA 2I3AA 4N5IX 1FJ2A 5KX5B 1PSDA 2DULA 3PBKA 3TF5A 2VJMB 1DZ3A 1R4MA 2ZP1A 1OYYA 2XMQA 5F52A 4NX2A 2F43A 1KEWA 3PB3A 4BFLA 2O50A 3BGDA 5K0FA 2RDMA 5LYJB 1ZUIA 1JI3A 5CX1A 4WADA 2YOFA 5FQNA 5EN4A 4G5YA 1LLUA 1RBZA 2Y77A 3NGXA 1FBTA 1Z88A 3QVTA 1HMYA 4ZQEA 1XNQB 4EY7A 1BWPA 1KYWA 1UDBA 4TLCA 3U48A 4Y6OA 4C22A 4JYCA 5I7WA 1MAAA 3AF0A 1CDEA 3IB6A 3HCRA 2OVFA 4ZO8A 3C7DB 4UEJA 4EYEA 5DBFA 3HRIA 1IK4A 4PGHA 5TGZA 3X1XA 4UBJA 4DCNA 1AK1A 1BA3A 5GINE 4RD6A 4CMKA 4OGKA 1XZJA 3W8DA 3KQKA 2L19A 3TTTA 2OGWA 2QUAA 4GKVA 3A25A 2WAAA 2M6LA 1AMNA 1TF2A 3U4QB 1O2DA 3G2LA 3O03A 4LE0A 4CNQA 4F2WA 2JB9A 3MWGA 2PV7A 5HOEA 4J7XA 3ZJ4A 3L7JA 2RGAA 2PR7A 2O3RA 2W2OA 1EFHA 4CMIA 1S7GA 2BM9A 3UJ3X 3NORA 2E1RA 5B6PA 2JK1A 2GBPA 5CLIA 5H68A 3P71T 1YRAA 4XPIA 3MCZA 4MAFA 2H1VA 2FVXA 3NPMA 5DTIA 5B3JA 1N9GA 4OBBA 3EXHB 5F7OA 3ELBA 4FD2A 4QICA 4C05A 3NIDB 5DWDA 4TMZA 2BFCA 3OE5A 1BXRB 3EASA 3FLEA 1TFUA 3Q41A 2XWBF 1X1TA 2J3JA 4L0QA 5CYPA 3OCXA 2YZ2A 3IUJA 2PUGA 2PWPA 2RGYA 4LEIA 1E5DA 1QAOA 4OX9B 3SEQA 1P1JA 1QZXA 1WNFA 4DR2B 4BIMA 2WT4A 3SR0A 4D3SA 4AF7A 4GOOD 4MO2A 4L0MA 3RG8A 1QAMA 3H2JA 2QS9A 4XEHA 2J6IA 1PDOA 2R00C 5ALZA 1X13A 2FLWA 2Z4RA 5THXA 4UXIA 4FOOA 4MEBA 2CVQA 4WXMA 2H7VA 3LU1A 1TQDA 5F2EA 1YOVA 3QPCA 4YR9A 3OQMA 5CYOA 3DPSA 4EFNA 1Q0QA 2IEZA 4UARA 1IE3A 4Y1FA 2XYPA 1VFNA 7MHTA 3ESDA 2OZEA 3QENA 2OBMA 1QFZA 4EZEA 2RHWA 1CU1A 2JAWA 1JEAA 1QHXA 2EJWA 2GN8A 5JHGB 1M76A 1YR8A 5A3RA 5GP1A 4NJOA 3NH6A 4BIIA 1KDOA 4L8GA 4RSHA 5AR1A 3PXGA 3SMQA 3KM0A 4AO8A 2C5BA 3I3OA 3HNPA 1U8ZA 1T4CB 5ARBA 3MS7A 3BJEA 3C70A 4I8XA 3IAUA 4S1NA 1LFAA 4ZEMA 2JBAB 1PL7A 3EVFA 3N0RA 5LIRA 1R8YA 2QN7A 2ZRPA 5ARCA 3FTFA 4EVQA 5ALXA 2NYAA 3M7IA 4L3OA 5KOHB 3D4PA 4OK3A 1V7CA 2IHNA 4FLFA 2G5GX 5FPSA 4B9AA 1M8JA 3I64A 5ELLA 4WUTA 1Q21A 4RCZA 2JHPA 2PNFA 4YP5A 2GNOA 1DADA 2QPOA 4U6SA 2LCQA 1UXIA 3FOZA 2M1ZA 3LY9A 1PJ4A 4FYVA 3TLKA 1XP8A 4D45A 2RBKA 2Q8QA 4PO1A 5CM8B 1ZK2A 2ZRBA 2V3CC 3FGZA 1YASA 2NVWA 2ST1A 3OT1B 2ZJZA 1SHJA 3UCXA 4DYDA 3PC7A 3RFCA 4G84A 4C06A 3EF1A 1U7UA 3TZQA 4PHHA 3EXFA 5FIUA 1VDZA 3S2YA 1WBDA 1BKSB 4S0XA 1FRNA 2QE6A 2Y4OA 1JPVA 3USES 5FNVA 2IW1A 1OF1A 1NYLA 5JDIC 4WZZA 1Y80A 3U5ZB 1JR2A 3GLIE 3I34X 1UFRA 2QD3A 2DGDA 2FCAA 3BTOA 3N75A 1K0UA 1UF9A 4DHEA 3CZMA 3HU1A 1RWPA 5BV0A 2QX4A 3NHYA 4FHGA 2IYUA 1A9XB 3SSOA 4IVNA 4JXJA 5BSRA 2CT8A 1VCHA 1P0CA 2I4MA 2HYDA 3AYXB 3GJRA 3RBZA 1WS6A 3N53A 8OHMA 1CUEA 1CK4A 4EVRA 2ZS9A 4ZTUB 1EP2B 1T1RA 1KIMA 4I5DA 3RS9A 1A8HA 2WZCA 2A78A 3VPXA 4HRXA 1SBQA 3WYBA 4RMHA 5D8DA 3CRNA 4N3GA 3QEBZ 4C76A 4C4PA 4I8IA 3TDNA 4AURA 5IBRA 3IP7A 5H83A 2NU9A 4BMYA 3HFJA 2YRWA 5KWVA 2IX9A 3KU4A 4MVJG 1LJLA 4MDHA 4BWGA 2IYEA 1PF7E 3N58A 2VH1A 4ZAVA 4CMEC 3AVYA 1UBLS 2C04A 2F3RA 4ZVKA 1E5VA 4INZA 3GLRA 3D1JA 4X9XA 5KX5A 3B1KA 5A2GA 3IR5A 2VJMA 1A96A 1OXXK 2IA5A 3RUIA 1J8MF 3IA7A 3TCNA 3WBFA 1V43A 3PDUA 4CKWB 4N5DA 3W3AD 4B47A 1G59A 1FYEA 4EATA 4W1QA 3T4EA 1G4HA 2IEIA 2YUTA 5EP4A 5LYJA 2OMEA 4A4DA 1Q7RA 2C31A 5JE8A 3ZIAD 4ACAA 1UOEA 1G2QA 4KJZA 3VR6H 1I1OA 1P0IA 3LGAA 1LSJA 3HWWA 3ENZA 1T9GR 4TTIA 3RC2A 5AJHA 3SQDA 1H5UA 3HPRA 4UEKA 4W1SA 4TQAA 4AKHA 2DPGA 1BCSB 1EUCB 2HIAA 3MTJA 421PA 3ZV7A 4RF2A 4TT3A 1GNTA 1JU3A 1WDKA 3W8RA 1LDMA 2AN5A 3FGPA 4G67A 4ILKA 4ZYZA 3S8EA 1CYDA 1OT3A 2BC9A 2JH8A 4H7FA 3U4QA 5FTNA 4XQCA 1AT1A 1ZFNA 2Z83A 3TSAA 4JV5B 3DVSX 1K9VF 1CTQA 3BHNA 3GCWA 2C42A 3JR3A 2CL5A 1UPCA 5BMVF 2CL0X 1E9VA 3HV0A 1SUPA 4UTVA 1N2EA 2GAOA 2ZPAA 1IZZA 2Q5FA 5JR3A 2B1QA 4GQIA 5JNRA 1PWYE 2Q99A 2R8YA 2O3QA 1QK5A 1HTBA 2FPXA 2H52A 1G8SA 1R8JA 1ZCJA 1BU5A 2WT8A 2ZE8A 3EXHA 4IG4A 4QPDA 1KP2A 3LPDA 1RE0A 2P4EA 3AH8A 1UIMA 3EA4A 4HDAA 4ER0A 2QUZA 2WOOA 1E2GA 2ZUEA 3JZIA 5DNYB 1CS4C 4ALIA 1QBGA 3GDHA 2ACKA 3GW8A 4C0KA 5E95A 4OGLA 2R6R1 2WD8A 1KBQA 2G9NA 1HSZA 1X9IA 3HYNA 2MCFA 2Y1CA 2XNJA 1I2CA 1NATA 2WAOA 4M9ZA 4TWIA 3EUFA 3P2JA 4GE3A 4FOSA 4HEHA 2NZWA 4LXHA 4BRSA 3PWZA 5HQ3B 1FFGA 3QX9A 3OZBA 2PUVA 2AUMA 1PRYA 2OO7A 3NXKA 3U80A 2EBHX 1FW6A 2M6SA 4RGYA 4DNFA 4D4GA 5CDSA 1ZM2A 2FPPB 4KK3A 1U2SA 1GPNA 1II9A 4JL8A 4BLWA 4GMXA 4WN9B 4YDHB 4CM1A 4EJMA 5DB4A 1N6RA 2Z30A 3TYXA 1B6SA 2QDXA 4W5TA 4IIVA 4RV4A 1E2KA 3E9CA 3NT5A 5ALUA 2DHCA 1HT3A 2N46A 3JY6A 2PLRA 4NNJA 1AJEA 2NIPA 2OXRA 4R05A 5C1PA 5I4IA 2OUKA 4GEKA 1G19A 3SP1A 2BTQA 4LOJA 1ZM9A 5IHXA 5TGDA 4M1YA 1GTMA 3IOMA 4TS3A 4CMBA 5A1TA 1T4CA 3KD2A 4IXWA 3D7NA 3DMNA 3V34A 1SCBA 2JBAA 2JGIA 3H8WA 3B6MA 3HG7A 3ZEAA 3L7KA 3A31A 3H11B 3K1JA 4G4IA 4F3YA 3JXEA 4RIIA 1TLTA 2WZBA 3PGA1 5KOHA 4C4AA 4CIXA 2BM0A 3G2IA 4DB4A 1A04A 4QREA 4RTKA 5BUQA 5BNFA 3ZTWA 4MWSA 3KEMA 4DA9A 1CUXA 3V9PA 2JJYA 4GZ6A 1ZP6A 3BJZA 3BF7A 3GU3A 4LAFA 2O57A 4R2KA 4KZKA 2BMDA 4A8TA 1E1YA 4EJ6A 4QM6A 2XZLA 4JT9A 4X85A 2WUWE 3ZE0B 3PUJA 1U3TA 3OT1A 1JFVA 1IWBB 3UWSA 2FEAA 5E6UB 3RTGA 3RADC 3B89A 4AI6A 2G25A 2R1VB 4FKZA 3ETJA 1IOWA 1M67A 1U98A 2AHRA 3GYGA 3OMXA 4GLLA 4D5GA 4YJFB 3KUCA 2F6RA 4RETA 3OPQA 2NPIA 4RPIA 2PKRA 1T34A 4IYJA 4QLAA 4Y18A 3A1TA 3IVCA 3IT1A 3T5PA 1ZD2P 2WG2A 1A9XA 5F3WB 1PJCA 3R9IA 3PXAA 3GRUA 1GGKA 4EUSA 3SJ7A 2NW6A 1OWLA 2FEPA 4LYJA 5KZMB 3RS3A 1IN6A 5IZCC 5DI9A 3WFZA 4JL6A 1AUOA 1JLLB 3JQ9C 3W2HA 5JHHB 5FRDA 4R98A 4LBVA 1TYEB 1JAHA 2GDZA 2NXWA 2JGRA 1XWWA 2W5UA 3O7WA 4LJ6A 3SYNA 4Z6KA 5J4HA 5EHQA 5FLKA 2ALJA 2J0EA 4YT8A 3H2HA 4YALA 1T6NA 2BGLA 3ZK7A 3J80A 2PO5A 3ES9A 3AKEA 3I5YA 1ENZA 2PSEA 1PEYA 3DOEA 3U17A 1XRMA 4BMDA 3O8RA 1V6AA 1BD4A 1A9QA 2G4VA 2O0HA 3RLFA 1WPRA 2DCUA 1TTQB 2IODA 6REQB 5M04A 3SEFA 5DX1A 3AR7A 3JQRA 1WDMA 3IQHX 3I01A 1O89A 3BMOB 3ICVA 3E9NA 1UC8A 4V0RA 5EE3A 4CKWA 1Z7GA 1FFXB 2CNKA 5JJIA 3PFCA 3NP7A 4LQCA 4DDKA 3DCIA 3GGJA 1P0QA 2BDEA 5BVHB 3R40A 1I2BA 4EI7A 2EVWX 2VCYA 1RJFA 1E89A 1S7CA 1EX7A 3SS7X 1YC2A 4Z9YA 4BYGA 3GO4A 2WWYA 1BDIA 3B7PA 4DPLA 2ZRGA 4LZPA 2QPTA 1HRKA 2W2VA 1PJ2A 1BCSA 1EUCA 2YWHA 1XCJA 3H05A 3IAM6 1K6XA 3K1TA 4OBEA 3E2MA 4MV7A 1P74A 4JYZA 2ACVA 5A7HA 4DYHA 2HL6A 1UBNA 2AG0A 2FZKA 4E6EA 5LZ9A 4KMMA 1H4QA 1HV8A 2R85A 1P9NA 3MD9A 1W19A 4B5LA 2BDTA 1FNDA 5JC1A 4MW2A 1W9HA 1A9RA 1XXHA 4J90A 5JBNA 2A0XA 4KRYA 2VCEA 1A2QA 4KGZA 3ZZ1A 3NR2A 3PUXA 1T91A 5FO1A 4AFNA 3WK8A 4KFSA 3CUSA 1N2JA 2OGZA 5H7XA 5IN5A 3U9SA 3AF2A 2P9JA 1H2XA 5CHYA 3TQQA 4HNTA 1USGA 2AV6A 3M4NA 5FV7A 2PGIA 3D8HA 2XUOA 3Q3EA 1TE2A 3VPDA 1SIOA 3DEIA 4GP9A 5TF4A 2OQIA 3GJ8A 4MICA 1JSLA 1HL7A 2VG8A 3UW3A 4HNHA 5FTLA 1K1EA 1L8XA 1AMUA 2E5WA 3FKSA 4R1PA 5IJXA 1SKQA 4EUEA 1U0RA 4Q18A 1BE0A 1J39A 1X15A 2Z3ZA 3RT1A 1Z4MA 2PL1A 3TLBA 1SWVA 2WPNA 2F8SA 4HFNA 4W99A 3SJBA 3NASA 4LF7B 3OZVA 2BHTA 1FJXA 4YQZA 3F6CA 3L7NA 4OJTA 1DAGA 3H7IA 5HQ3A 2IV2X 5EJ8A 4RCVA 3TINA 4B31A 4GXQA 2J45A 2QDKA 1VSVA 2Y71A 3MD0A 5FBLB 3SNHA 1NOJA 5F5NA 3GBVA 3QBEA 5F1KA 3HL4A 1AK9A 2FPPA 4DS3A 1KFJB 2BFPA 2XRFA 2HDNB 1U3DA 4KC0A 1D0IA 4WN9A 3TQFA 4GR5A 1YKGA 1D07A 3LP8A 3W2GA 4OBWA 1L4MA 4K9KA 1L7BA 3FIUA 4YRQA 4GW3A 1MQSA 2GX6A 4JLDA 4JWKA 5KIAA 4KLCA 5AM0A 4MCHA 4YWHA 1XYGA 2JFHA 3EFEA 3OZCA 3LA6A 4XVUA 3I0MA 3WGLA 5EQDA 1R6XA 1KK2A 4DHWA 3H16A 4W8GA 4EPXA 2HJGA 5E0OA 1AQJA 4LTDA 3X1YA 2ZM6B 1CJVC 2DUMA 1VECA 2J08A 2LVBA 3B1VA 3VR6D 3Q2OA 3EGXB 4CI0B 3Q9SA 1MOZA 1OV4A 2FN3A 1HWYA 2QQ0A 2Z5VA 4MS4B 4OOFA 1T8WA 2CLEB 1EHIA 4FQ7A 5U4QA 4AWBA 1BDMA 1FEZA 2VFAA 3DAFA 2IFTA 4J4TA 4KV9A 2HF7A 3H11A 4PSUA 1GZSA 1ULZA 4KWHA 4K3UA 3DDUA 3V6MA 3EYWA 1NGSA 5CDGA 2IKSA 4BVGA 3U3KA 5A5FA 2CSXA 4ALMA 5F3RA 2VBGA 4WFJA 2ZS8A 3R7BA 1AZSC 2H07A 2JI6A 1LWOA 2BGUA 1KI9A 2ASVA 3NIGB 4DREA 2N9UA 1FNNA 1PL0A 1CVIA 3MUEA 4L4UA 3WJ7A 3UK0A 1TJPB 5M34A 1NF2A 1COWA 4NZZA 5ILOA 5E6UA 4EYOA 4KO4S 3LS2A 2BR5A 1B8NA 2R1VA 3NCTA 5A3QA 4H3HB 1RKVA 1DBPA 1YBHA 4YJFA 1P4JA 4XGQA 3WWZA 3ZNQA 5LOVF 2FW7A 4O2AB 1HI9A 2XF8A 1V1JA 3FPFA 4QG3A 4FEAA 1DTEA 1JHYA 1GTZA 4PYOA 3JQAB 1AKUA 4N39A 3RKUA 1IHUA 2C5AA 1H9BA 4EBFA 3GVPA 3HKBB 2EJBA 5K9ZA 4EG0A 1DWOA 4AUEA 3U7QB 2RGBA 2Q6TA 3TZHA 1JLLA 4ER5A 4TQ9A 3LZDA 4PG7A 4FC7A 5EXEA 1LNSA 5HJ2A 5L3SB 2GWHA 1IY1A 1NM5A 4E15A 5BNIA 1PV2A 4F4HA 3KQUA 4BV8A 3G68A 3CZPA 1SZDA 1TUGA 3PEUA 2GM5A 3F7TA 3GCDA 1AHIA 2FSVC 1EK1A 1ESEA 1EWYA 2X14A 3QG5A 3RK4A 3WL5A 5JMTA 4OK5A 1NIJA 1SKYE 3B1WA 2V03A 4IYRA 2C5FA 1KXZA 1UL1X 3MLEA 1R88A 3Q85A 4J2TA 4UZFA 4UU7A 2AG8A 2JFGA 3BMOA 3L1IA 4GVXA 4YAOA 1SIWA 3D6NB 2HQ1A 3SE7A 1FFXA 3EODA 1JTVA 3FPSA 5FBZA 4FFPA 4OHVA 2RFLA 3A6KA 3QLJA 2J5RA 4Q1EA 1H3EA 5BVHA 4TZ0A 1WTAA 5I9LA 4ZICA 1E3WB 1L4GA 3OF5A 1M5UA 2B3TA 2OWEA 1H0SA 2REQB 3RSQA 1UP7A 3ZW9A 1L7OA 5BMVA 2GT1A 2PJDA 2OEPA 1OXMA 3OCVA 1PNTA 2EW1A 4P84A 4R0VA 4R1LA 1JHPA 4EJSC 1XCGB 2ZZKA 3FFBA 4R4JA 2A14A 1B76A 3BEOA 3VKFA 4IUDS 2HRQA 2J3LA 1YDHA 2QY9A 3AFMA 2FNAA 2ZR0A 3RYTC 4EP1A 1YRHA 2I7XA 5JO0A 3E22B 3AVUA 5AJZA 3A1SA 4L1KA 4DC1A 4PPYA 4P3XA 4PCLA 4R3UC 4A0RA 4BN5A 1G6HA 1WPGA 1TYBE 1R0RE 4ENSA 4MKHA 2KB0A 5DYYA 1EP3B 4DV5B 2VUIB 3IO5A 1JR3D 2RB5A 4KVAA 1CRQA 1VMDA 5LR6A 1QWSA 4R8MA 5G0UA 3R5SA 4W82A 2B7BA 3H7AA 4PN3A 4KFRA 5I4CA 4DJEC 4H0FA 5AKYA 5BQ5A 4EFLA 6ABPA 2WF6A 5JQGB 2VXYA 4CTMA 3EYAA 2GOYA 3S2GA 2QX8A 2FTKE 1Z6GA 2MSDB 1QYVA 3IB3A 3SXPA 5AMXA 2CYCA 2YVKA 1M6NA 1QV9A 1Z12A 5MF6A 1NJGA 1JFFB 1TQ4A 4JLBA 2SHKA 3LT5A 5JXWA 2X0JA 3GQVA 3OIDA 5HTOA 5BY2A 2I67A 2IOHA 4BLRA 4WLFA 3EXEB 3DBLA 3PXEA 4KVGA 1MB9A 1G3MA 4FFOA 1HNNA 2FFJA 3C3MA 3OJLA 3DE4X 1KPGA 4LW8A 3FBGA 1XK7A 1Q1EA 4YMGA 2XHZA 4KQGA 3D0OA 3U3RA 1DQNA 2OGTA 4S1OA 1GPH1 3U4AA 4BNDA 3ZPXA 1L4EA 1P4RA 3JWEA 4CETA 2OCDA 2XUZA 1GZ6A 2ZJAA 4TRMA 1IPEA 2G7MC 1XVTA 2FN9A 1PYOA 2F1IA 2H5IA 2HF9A 3QUSA 4MDYA 3SGLA 4OHXA 4YX9A 2ZSUA 3IL2A 5JEEA 1D4OA 3EDYA 1YR9A 2XUIA 5HF5A 3WK5A 4E94A 1G5TA 4Z3DA 5KU7A 4GLJA 1P0FA 3ENNA 3G82C 2CUTA 3A7EA 3E7FA 3I73A 1F06A 5CVUA 1M2EA 3EFOB 4JROA 3FNRA 5KNLA 2NZVG 5HE8A 2V58A 4EI2A 4FR2A 2CCKA 2XMPA 3K0EA 3EGXA 3VTAA 2ODAA 4Q6BA 4DJAA 2HA4A 4BZQA 4MS4A 5FO0A 2VP6A 3DYBA 3LSTA 4EJSB 3AKYA 3RRZA 5ESDA 4AP9A 1M9NA 3TIGA 4F71A 3AKDA 1MQAA 5DBEX 1K97A 3MGCA 4GPD1 5LOVB 1PLKA 2JGFA 4JYMA 2CXSA 8AT1A 1NMSA 3I28A 3NFRA 5DLDA 2PEZA 1M33A 4YGYA 3AGPA 4IDNA 5K4GA 1DNPA 4QD3A 1T8SA 1SBZA 4LI3X 1L9XA 4RTLA 4C5CA 3OTIA 4PSDA 1W29A 2OKGA 3GF4A 3D3KA 3DOCA 1ZK4A 2GAJA 3TQOA 4BB5A 2OFFA 1RZ3A 2VHXA 3GAAA 1FBNA 1JLHA 2Q6IA 1OX6A 2VQEB 2FB9A 3SJCA 1FFHA 5KSPA 4Q4LA 1EMDA 1U28A 5CNIA 4O02B 1QSGA 1CUAA 3Q8LA 3VC1A 4MW9A 1MRSA 1GKKA 3P0IA 5AKLA 1ZM3A 4HZGA 1ID8A 4JCCA 1FUEA 2MR6A 4AJNA 3DXZA 3LI2A 2H11A 3MHPA 4O2AA 1MC8A 1WVMA 4AUNA 2BTEA 3CPEA 2FX5A 2F3SA 5L6MB 2VEDA 4G1CA 1ZD9A 2ZRNA 3TXYA 2YZKA 3JQAA 4B2PA 1BYUA 3RV3A 3OEWA 5DHTA 2ABWA 4JI2B 2WM8A 3ZX4A 4DLXA 4Z1MA 5LYYA 4PZYA 1RRKA 1MJFA 2CUZA 2HMTA 4QBHA 3U7QA 1W46A 3MELA 2FPGB 1GFWA 1GG5A 1W1WA 1Z06A 2AI1A 1S1MA 2EKPA 2JJ2A 3IO3A 2IZ1A 4MKIA 5HIKA 4DA8A 3E3OA 3CS3A 3OPXA 4GH5A 3OPYI 1F3OA 3LUKA 1EFCA 4C0BA 4ND5A 5JUWA 1J06A 1R0WA 3QF7A 2B83A 3RFFA 1KK0A 3KKKA 3N2EA 4IHAA 1MNQA 3OOSA 4XVQA 3AERB 5CEEA 1JIJA 2CWDA 1NW3A 4U7GA 1L4KA 1Q0LA 3JZMA 1E60A 1UBCA 4M1OA 5A9RA 4IUBS 3LVBA 3ITNA 1KY5A 3K0BA 4M9SA 2P4QA 3AKCA 2GILA 3PJRA 1YJCA 3HH8A 1NDQA 3QEKA 3QBJA 4JJ7A 4C3ZA 2H7CA 2W2PA 3DDZX 3DCYA 3NVKI 4Q9IA 5K3BA 2JFOA 3P9KA 3ZG6A 1WKBA 4DV6B 1E3WA 3CXUA 3TUIC 5GPBA 5JCZA 1C9DB 2ASEA 2R86A 4P2GA 1X2BA 4PG4A 4BBZA 2REQA 2COUA 4FNOA 1H42A 4P1ZA 4CLOB 2V65A 3OJFA 5CFMA 3EMBA 1XSEA 3A37A 3IAFA 2EBUA 2GETA 1LK0A 4EQZA 5ALTA 4CMAA 3TTWA 4XD7A 2GZ1A 4U2KA 4U2BA 3AQ4A 2B9EA 2CDRA 4OP3A 4PG8A 1WE2A 2FWJA 4EY6A 3ZHQA 1XKXA 2JJ8A 3AY7A 4KPEC 1IZ0A 2YJGA 4N41A 1TCAA 2VUSA 1Q15A 1XB2A 4UTPA 4RJLA 1FCJA 1FU8A 4HQOA 2HNKA 4B48A 3TL2A 3C8HA 2FFBA 1HURA 1J7KA 2C3MA 3V42A 1L7AA 1JFLA 3BMQB 4UXHA 5SYMA 3WRWA 2BGIA 2R9VA 2WKSA 2NVOA 4FWBA 3SU8A 2C3OA 2QTAA 2AOVA 1C0PA 3KAJA 2BPOA 1YZKA 3KLPX 3L0CA 2LCFA 4MMYB 4GR9A 3NDPA 1SUWA 3DDOA 3B8HA 4PZ9A 1N4DA 2HK7A 4RF5A 4MQ4A 4XFDA 5EXTA 4CE6A 4H6WA 3OZ7A 5JRJA 2AJCA 4MWEA 1AHNA 3HBAA 4JP8A 2ZKIA 5ITSA 4C43A 2VQDA 1IBKB 5FWDA 4B6OA 3IBYA 2YCLA 1K75A 4OSEA 5JJLA 1JFFA 4E51A 1A5AB 2BW0A 3E18A 3EEFA 1W8IA 5ALPA 5ILQA 1W35A 3NHAA 2GD1O 2AEMA 3EXEA 3CW2A 2ZYVX 5DYGA 3TW0A 1KEZA 4W8HA 3GLHE 4COOA 3IUPA 1XPUA 1V41E 1TO2E 1KRXA 3P97A 5CT4A 1T35A 3KQMA 4QBFA 1L5GB 3GD7A 3O2JA 4V39A 1K6JA 4OHMA 4Y9TA 1LEHA 4QTYA 2RCYA 1K06A 1RAGA 4BNNA 4EPYA 3WWYA 2UYYA 3BKXA 3K09C 2NU7B 2EHJA 4OQEA 4OJQA 3QLVA 2JW5A 5LQRA 3LYLA 2D0IA 1QXSA 4FUQA 2UVQA 1SIBE 3LUCA 1OY1A 5F73A 3LHDA 1CDDA 1VFPA 4W5WA 5CM9C 4A8PA 4D6PA 1I4EB 1GZ4A 1C50A 1X1DA 5L7WA 2I5PO 1NW5A 2LKDA 2WWHA 3EFOA 2B69A 4LWPA 1JDNA 4TS1A 3NFYA 1HYGA 2G63A 4UDXX 3ZGZA 2PT9A 5CIYA 1RMTA 4EGFA 4EJSA 3W0LB 2HDOA 4NYIR 2XKKA 1IMJA 3A9SA 3W5SA 1U7DA 1WVIA 3AIMA 4BQNA 3HLTA 4W6QA 3ZHBA 1TQ6A 2QVLA 2Q2WA 5LOVA 5C4GB 1JDBC 2I1QA 2PHZA 3VPGA 1R8QA 4US1R 1JNXX 3RQIA 4B3GA 3CH7A 3O1LA 4CG0A 3UG7A 3CFYA 4NEHB 3GRPA 4J4HA 4CDRA 3ZCUA 4D8YA 4K28A 5FL7A 5FA8A 1K3UB 1TMGE 3P2MA 3BL6A 3KP1A 1VHJA 3B6KA 1TCBA 2F8TA 1SJ9A 1J5PA 4PX3A 1ZBDA 4DQUA 4PRKA 1LUAA 3G8CA 2A9VA 4E21A 1PWHA 1NQTA 2XZDA 3P20A 1C7EA 1EGMB 2B7CA 3UKDA 3K6SB 1XWFA 4EFKA 1P91A 1QE5A 4L5YA 5DM4A 3VTZA 4EI8A 1WAMA 3VPCA 2HRZA 2WA1A 2ZSBA 3GMTA 2BLNA 2JHGA 2VJKA 4EHDA 4Z4FA 1WW3A 2GBGA 1F2UB 4AJIA 2XECA 3HN2A 5FBQB 1I0LA 1J22A 2IPNA 3FNEA 4TL8A 1J33A 1NP6A 1W0JA 2AT1A 2FPGA 4MH0R 4NEGA 2X8BA 1Y8ZA 5KTYA 4GYKA 1LDBA 3GJ5A 3TPZA 4XFKA 1V4NA 1B6TA 5T3YA 1GGFA 1IHOA 2VJBA 1XZGA 4DM7A 2PG3A 4EYQA 3FD8A 4OB8A 3REOA 5EZ6B 1G38A 2HO5A 2N1BA 4GXTA 5EC8A 4R8SA 3ZH9B 3CBGA 3UFBA 3RJ5A 5IAAA 2QL7A 1KQFA 3K4PA 3C43A 1L5NA 3UWMA 5TMDA 1AKQA 1PP4A 4R7TA 4M89A 2GM3A 1I0ZA 3NHFA 2C95A 3PJEA 1DRVA 1NW8A 2XKAA 4J4BA 1TZJA 4S12A 1H69A 2C3YA 1T2VA 3EEQA 2RGWA 1T4BA 3PP8A 1KR5A 1JNYA 4DR5B 3ZHXA 5KNDA 4KSBA 4EY5A 2XTAA 4CLOA 4LX0A 2QJTA 1GR0A 3OM9A 4GF5A 1ZH0A 2WMOB 3D5EA 3KDSE 3SKXA 4BQIA 3AM3A 3QMPA 3QXJA 1CRPA 2AF3C 4M36A 5M7EA 1IVNA 3LKVA 3FNHA 2WLTA 4JQCA 2JJ1D 2X5XA 2IHTA 3AJ9A 3FWPA 4PYIA 4WCFB 4GPIB 3RIEA 2HJWA 3ELWA 4N5HX 3CUVA 3KQLA 3CZ4A 2H4JA 2G09A 3DFKA 1RLJA 1M1XB 1X42A 2BFAA 3JSXA 4LTNA 1HL3A 1K4MA 3R76A 5J3JA 2NSHA 1HY3A 2CFTA 5B1EA 4UASA 4BJHB 3OJ0A 1LDGA 2B61A 4GBED 4YH1A 1G1AA 2AFHE 2OV8A 1A82A 1RYHA 2XA1A 4MGKR 4CMJA 3UAWA 2RHOA 3C8UA 1BKDR 2ZWAA 1VLJA 3N8GA 5EG5A 5HK9A 3OOJA 3RIYA 1VPEA 2BZGA 4KSYA 4YPFA 4BQOA 4JGGA 1QVWA 4RKQA 5EVJA 1WMSA 5B3KA 2QTGA 2FK7A 4H6PA 4V0OA 2IC5A 4IOKA 3SX2A 2NO9A 3L06A 1EWRA 1ICIA 2D06A 4MB6A 4C07A 1RBMA 3R0XA 3FJOA 4X1OA 4IGAA 4L27A 4UMVA 3AO0B 3H4IA 3BTUA 4F97A 3JYLA 2UKDA 4Y2VA 3AIKA 5A9SB 4NU8X 2XEXA 2XMGA 4L8FA 1P2DA 1IG3A 3AZOA 4UREA 3AC0A 1CUGA 4JVSB 3P0JA 2QT0A 2ONCA 1IN7A 3KB2A 2OFWA 1RJ9B 3IVGA 3N0WA 4JH0A 1ZVJA 3Q88A 3R3VA 1Q74A 4DARA 4AQ7A 5IDQA 2NU7A 2YNMD 4L8WB 4QNRA 1PDVA 2FX3A 3T7KA 1ZVVA 3RSSA 4ICIA 2XOEA 3KZVA 4BUCA 3DE2X 1VDMA 4NBTA 2ZWOA 2CXRA 2AJ8A 3B9BA 3HCCA 4Q3EA 4D0RA 2RIPA 4V0KA 1K5PA 1XHEA 3B9PA 3I53A 1BJTA 1DXYA 1EG7A 3D8UA 4GEGA 3H0EA 4C20A 4HWKA 3B38A 2P3QA 1DEXA 1BEZA 1DKMA 2AXEA 1R9MA 1U3CA 4MP6A 4MQBA 5J4VA 4F4UA 2YNMC 2O2YA 3RIHA 1EJBA 2GI4A 3ZUGA 1TPZA 3S2FA 4C3OB 2BSQA 1O9HA 3QKIA 2Q3DA 3VR5H 2WB2A 3CHYA 1OR8A 4WQMA 4LOLA 2IWRA 2HLDD 3UAVA 3V8NA 2NX2A 4LA4A 2E1PA 5FJIA 2R5NA 1KZ4A 1WXWA 2HXGA 1P4GA 1Z6TA 1RHRA 3JR7A 4IV5A 4MVXA 2DFPA 5FPKA 1A1SA 2ZU0C 3GBSA 1ZAKA 1PLJA 1UUFA 3GP5A 1I13A 3D64A 1RRVA 3W7AA 4B6SA 3NBYC 1JH8A 3P9SA 4A6XA 4RZHA 2Z58A 2EC5A 4EAAA 4RJJA 4NRDA 1LGYA 1IL0A 2VPPA 3R0JA 4MIEA 4ERNA 3IJEB 2ID8A 3QLUA 3I45A 1A7JA 1ZWKA 2WHRA 5GJVC 3BJRA 3QQPA 2AXPA 2C8KA 4U6QA 2FJPA 2YW9A 3ROQA 4ZC8A 4HGOA 3KPUA 4BFZA 4DRXB 1MV8A 1F6DA 1P4SA 3EE6A 3T5DA 3TO5A 4B44A 3SG0A 3OQNA 2C4TA 3K6SA 3ZDDA 3SDBA 1MZPA 1M6VA 1DRKA 3ZZMA 4RFSB 3F47A 2H2GA 4Z0TA 3T3IA 1F2UA 5BVGB 3C7KA 3HPQA 5EUBA 3SHWA 5K45A 2REBA 2VAXA 3AVVA 3HJTA 3LHFA 4Z1OA 3UT6A 4D5EA 3BTVA 4URFA 4ENTA 4WBXC 5ALVA 5GONF 2E6KA 1NTRA 3UXYA 4REMA 2A86A 4XXHA 3DMDA 4IDGA 1V3UA 1RYBA 3DFMA 2WIJA 1YZLA 3EPRA 3IYLW 4L5AA 3D4BA 1BXGB 2PS9A 5FH9A 2VYQA 1YB4A 3GD5A 3FDIA 1SGWA 2B5OA 3RM3A 1P2UA 4NE2A 3SZUA 1XJ5A 1Y5IA 1VL2A 2C84A 1T5LA 1GILA 1SBNE 1W75A 2EG9A 3PWSA 1QG6A 4OMUA 1IN1A 1EBBA 4C0QC 3WIBA 3GOHA 1VJ1A 1VSUA 1LBEA 3DKRA 4EARA 4PLWA 3W4JA 1XZCA 1E9BA 1VGQA 2Z6QA 8ABPA 4XQ0A 5AH0A 1S4QA 2VPTA 4X0EA 1DKNA 3BIWA 4CFYA 1C9MA 3NHLA 1ZGCA 1LLFA 1QLHA 3I9FA 1V45E 2X2EA 5EWLB 1U3WA 1F0NA 2NO1A 1DEHA 2Y27A 3O4VA 1B23P 2YR0A 5KC8A 2B4AA 4GP7A 5DXJA 1P0PA 2JC3A 3AF1A 5LB2A 4JSYA 4R1MA 5LXTF 2Q5HA 3UK7A 1NF9A 3TEMA 1KK3A 1R0KA 2R44A 1CVRA 1FSSA 2ZRLA 4LYFA 4WCFA 4HAXA 2BGWA 1R0XA 4GUDA 4Q1DA 1NJ8A 3SZRA 2P5TB 5TIIA 1WL8A 4S04A 4H27A 4PYNA 3D6JA 2PMFA 1JJIA 2VPXA 3LUGA 2E9SA 1GZHB 2P2ZA 2EWWA 2FCRA 1JXOA 3BH6A 1TJYA 4LFCB 4E13A 3F73A 2WG0A 3X1ZA 1GKIA 1G5QA 1O94D 1XRNA 1O4WA 3CIFA 3F6BX 1I51A 2QLJA 4J0DA 3UK6A 3A4YA 4DYVA 4WK0B 3OUUA 1LC3A 3WLAA 3UK1A 1ZHFA 3ME5A 4C7MA 3CVWA 1UKAA 2WV9A 2VHWA 1ZW6A 1JDVA 3HWX1 1E1DA 2QV7A 2PR2A 3I6IA 4Q3OA 2GBLC 4JR2A 1D2GA 4ND7A 4RQTA 1P2SA 5LU9A 4MKGA 1RD4A 1O94C 2PZFA 1KDTA 3VMMA 5FDFA 3GWZA 5A9SA 1P7PA 3DQQA 2F1OA 4HYYA 4W63A 1E3JA 3ZVKA 4L08A 4M0DA 4P98A 1FFYA 4HVAA 4PFJA 3E3LA 4MEJA 1RJ9A 4LXIA 1GJRA 2YWXA 3LQRA 3I9JA 2DYKA 2QN1A 4MV0A 1VLQA 3WNBA 3T7RA 2AFRA 1R6AA 2DXIA 3GEDA 2HPHA 1M1ZA 4BNMA 2HSWA 1HLPA 1RWOA 4Q3BA 2FPOA 3D9QX 5DIFA 1JEJA 3FPAA 1V1RB 4D3ZA 1U0TA 2AUTA 4HQNA 5ALFA 3WNDA 2A84A 1MO3A 4PAOA 4QX6A 5EKXA 1JUDA 3VDNB 4B3JA 2DHEA 1KMIY 1JQJC 821PA 3HBLA 2WBLC 3F5QA 4FK8A 1E9DA 3TI7A 1NMZA 3IAAA 4YUZA 3BOSA 2OOSA 1OZFA 3L7MA 1D03A 4QXPA 2Z1DA 1MXFA 2JH9A 3H5RA