3R3HA

Crystal structure of o-methyltransferase from legionella pneumophila
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase, SAM-dependent
publication title Crystal structure of O-methyltransferase from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 67
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r3hA00
5EZQA 3EVBA 5C0OE 4DCGA 4ER3A 1YF3A 2YR0A 3KQPA 3LGAA 5E8RA 2PSSA 3TKYA 3LBYA 3A27A 1JTEA 3KQOA 4MWZA 4C4AA 3KQWA 5GWXA 5JR3A 3FUTA 4PWYA 4ISCA 4HGZA 3I9FA 5DWQA 4EQZA 4CXMA 10MHA 3R9XB 4BY9E 4PCAA 4YMGA 1I9GA 3G5TA 3FUXA 2PWYA 3KPWA 2WA2A 1INLA 3CJQA 3M4XA 4OBWA 1JG2A 1NW5A 3NWEA 3FPFA 3LKDA 3UJ8A 4DA4A 2BR3A 3GRYA 4R6XA 1EG2A 2VDVE 5CVJA 3UJAA 5K03A 2ADMA 3NMUF 2EX4A 3KQSA 3KR2A 3HVJA 3M6VA 5K05A 5DSTA 5E1OA 1YFJA 5ICEA 2ZWAA 3LL7A 3TMAA 3ELDA 3OE5A 3E7PA 3EVCA 3FRIA 1EJ0A 3UJBA 3C0KA 3BGIA 5DX8A 1QAOA 5CVEA 3VC1A 4PYKA 1P1CA 1NV8A 4OX9Y 5DRTA 5CCXA 3EGEA 3IHTA 2PT6A 3AXSA 4GBED 3SXJA 3ID6C 4QPNA 3C3YA 5EMKA 5GOZA 3R24A 2EG5A 3U81A 2PXAA 1R00A 1L9KA 2PXCA 3C3PA 5DPMA 4PYJA 2JH9A 2CL5A 5LQCA 1KPIA 5E9WA 4YV0A 5GM2A 4C04A 3UBTA 5LQNA 2AOUA 4CTKA 1RI1A 3GNLA 3KR1A 5CD1A 2PKWA 5EIWA 3HA5A 3EVDA 3AY0A 3DULA 1L3IA 1DCTA 3OPNA 4H0NA 2AVNA 3I58A 3T7TA 3UZUA 5BXYA 4GF5A 4L7VA 3HCBA 3LDFA 3FTFA 4RVGA 3EMBA 3O31A 3DMFA 2ZSUA 1NW3A 1O54A 2LD4A 2P3QA 3L8DA 2ZFUA 3Q87B 4OQDA 5KYGA 4IV0A 3A4TA 4ER6A 4RV9A 2XYVA 3B3JA 3MB5A 1NW6A 3BWMA 3CJTA 2O0LA 4KDCA 2NP6A 3LCCA 2ZTHA 3ANXA 3UJ6A 2ZIGA 3HVHA 2ZBPA 2O06A 1VE3A 3C6MA 4AZVA 5K0GA 3LDGA 3FPGA 4P7KA 3X0DA 4FSXA 4IWNA 4PYNA 3I53A 2EFJA 5CM2Z 1Q0TA 4QTTB 3ERCA 3TFWA 4WVLA 4XCXA 3O7WA 1RJGA 3PS9A 4E70A 3A25A 3TKAA 1P91A 5DTRA 1VP3A 1X19A 1JSXA 1YUBA 1ZGJA 2ZIEA 3G89A 4R8RA 3PVCA 4XUEA 3TRKA 3M6WA 5DM0A 4CWAA 5FWDA 1Y8CA 1I1NA 4KVZA 5EMJA 5K0JA 4V0RA 5DM1A 4EKGA 4UOEA 4PIPA 5F2KA 4P7GA 3E8SA 2N47A 2ZVJA 4JXJA 1TPYA 5E9JA 2UZ4A 2ONYA 2P3LA 2Q41A 2UYOA 3SM3A 3KU1A 4DM3A 3GRUA 4M36A 1KPGA 2WA1A 5K0BA 4HTFB 3A26A 4CKCA 3THRA 5K09A 2IH2A 3T0IA 4IKPA 5EHGA 2ZZNA 5C1IA 1R8XA 1WY7A 4RVHA 7MHTA 4C07A 1R74A 1BOOA 2QY6A 4AZTA 1EQAA 2CWWA 3P8ZA 4KIFA 4BP3A 3GXOA 4PGGA 3G8BA 4WXHA 2C7RA 4CTJA 5K0NA 3NVKI 3G2QA 1QYRA 5FCDA 2ZZMA 3DMGA 2P7HA 3K6RA 2OO3A 5FUBA 2VDWA 4RTRA 4E31A 1WZNA 4EKIA 5FTWA 3BUSA 3MGGA 3B7PA 3KPVA 2HWKA 5DSXA 4BLVA 1D2HA 2B3TA 2I62A 5DRYA 3PTAA 2AOUB 1NW7A 4RVFA 4YMHA 1WXXA 5FWAA 5K0FA 5FA8A 5LQRA 3ELYA 3B5IA 4YUWA 5GIOE 2BZGA 2CMHA 5GINE 2XBMA 1G6Q1 2HTEA 5B1SA 2NXCA 1ZKDA 2XVMA 4CKEA 2DPMA 2IGTA 5ICFA 4YV2A 2I6GA 4PIMA 1Q0SA 1ZGAA 1X1BA 2AOVA 1G8AA 3BKXA 1EJ6A 1SVUA 3VC2A 3OZTA 2IDKA 1DUSA 3NJRA 3UJDA 3PLAE 2KW5A 3UJ7A 1R6AA 3PFGA 3DP7A 3GRRA 1G8SA 3M70A 4RSRA 5FQOA 4PYIA 4DF3A 3T7SA 5FHRA 1MJFA 2IBTA 2ONZA 2NP7A 4O29A 2VZ9A 5CCBA 2BH2A 3JWGA 4RVDA 5ICGA 2GS9A 3EGIA 3HCEA 5EVJA 4GOND 4HG2A 3P9CA 3DUWA 2YVLA 3V97A 5EEHA 5T6BA 4RWZA 4PYLA 5BP7A 4AX8A 2ZW9A 4HSGA 4QDJA 3CCFA 2PT9A 3EVGA 3GU3A 3KQYA 2G1PA 3E23A 3BWYA 5KQSA 3BKWA 3ELWA 1XCJA 2P35A 1IM8A 5HIJA 1N7JA 1JQ3A 2JHAA 1FJXA 4X63A 4P7JA 4BLUA 1RI4A 3EVEA 3LSTA 3V8VA 3GGDA 4HH4A 3MERA 2FYTA 2B9EA 3P71T 4FT4A 5FADA 3CC8A 3TLJA 3TOSA 1P39A 1BC5A 2G8NA 1SUIA 4G56A 3TR6A 5CVUA 1AQIA 3ER9A 5KQRA 3AXTA 5E2BA 2ZLBA 2NXNA 2P41A 3MHTA 5CIYA 2PVCA 2FK8A 3VYWA 4RX1A 2GPYA 4OBXA 5D1NA 3O4FA 3NW9A 2YTZA 4FSDA 1RI2A 5M5BA 4RTSA 4RTLA 1D2GA 2EJTA 3BXOA 3PB3A 5K01A 1V39A 2AS0A 2O07A 3KPUA 2HNKA 1TW2A 1EAMA 4LWPA 5T64A 1MHTA 3UJ9A 4GOOD 3KKZA 3FUVA 3MCTA 4LWOA 3ME5A 4ZTBA 1XVAA 4FP9A 3FTDA 2FK7A 4QQNA 3SVZA 4ATNA 4C05A 2IIPA 1XDSA 3R6TA 8MHTA 4Y2HA 5IH3A 2BM8A 4EVIA 5DLYA 1F38A 1FP1D 3LHDA 4E2ZA 3NWBA 2GA9A 5CUQA 4U7TB 3DMHA 5LR6A 1N2XA 4YUZA 2AOTA 2AOXA 4U7PB 4PNEA 5FULA 3UFBA 4BP1A 1WS6A 1UIRA 2PLWA 2B25A 2IP2A 1SQFA 3EGVA 3H2BA 3OU7A 3QOXA 5E2AA 3DR5A 3QOWA 2K4MA 4K6MA 2NXEA 4MIKA 4P58A 4Y30A 3CBGA 3KPYA 5HIKA 1SUSA 3DLIA 1KPHA 5KS2A 2B2CA 1XJ5A 4X1OA 5LQAA 3G2OA 4QTUB 5DX1A 2ORED 2OB1A 2P7IA 3OFKA 4MTLA 4DCMA 1IXKA 3FYDA 3KQQA 4HGYA 4DKJA 5LSAA 5CVVA 4ER7A 1SG9A 3UA4A 1HNNA 3KQMA 3P9IA 2OY0A 2P1DA 3NVMB 3SX0A 1AV6A 3HCAA 3HCCA 3OU2A 4E33A 4ER0A 4C08A 3G88A 2XYQA 2H11A 2YQZA 2OB2A 5DXJA 3MAGA 3CVOA 1TW3A 3I5UA 4AUKA 4PGHA 3MTEA 2OZVA 4X41A 1KXZA 4DQ0A 2I9KA 3G2MA 5DXAA 3VSEA 4X61A 4R05A 1ZHFA 2AN5A 2AOWA 4PYOA 1IY9A 2FRXA 4QDKA 3B89A 3M6XA 3OCJA 3FRHA 3HVKA 3UJCA 3T7RA 3TM4A 3B3FA 3BWBA 3HA3A 2QE6A 5GIPE 2F8LA 4A6DA 4RTKA 3LECA 4KIGA 5EQJB 4OA8A 5HILA 5LQUA 3P9NA 2PY6A 4CKBA 5E1MA 3FPHA 2G70A 5EOVA 1RI3A 1T43A 2JHPA 4F86A 1XTPA 1EIZA 4OA5A 4YV1A 3P2IA 1X1DA 3PX3A 4GQBA 3IYLW 5EMLA 4C03A 5BW4A 1L3BA 4PINA 3NTVA 5E1BA 3RODA 4GC5A 4GOLD 3FTCA 3LPMA 3NDJA 3B3GA 5GP1A 4P7FA 3M6UA 1FP2A 2Y1XA 5E9QA 3TQSA 2AVDA 3HP7A 2B78A 3OZSA 2ESRA 3G5LA 4QQKA 1NKVA 1B42A 5DTMA 2AR0A 2R3SA 4F85A 2NXJA 1YZHA 5EG5A 3TM5A 4EK9A 2IDJA 2A14A 3EPPA 3GJYA 3HA7A 2G71A 1FPQA 2AOTB 3BT7A 3LCVB 2OXTA 3TPZA 3THSA 1R8YA 4V0QA 2P40A 1WG8A 2ZULA 3JWHA 4FR0A 4LECA 1JTFA 3UWPA 2PXXA 2JJQA 4E2WA 3P97A 2IH5A 2BM9A 2H1RA 1D2CA 1RJFA 4GEKA 3UA3A 2C7PA 2R6ZA 4LG1A 4PCLA 2ZZKA 5HIMA 2I7CA 3R3HA 4C06A 3CKKA 1RI5A 1VQ1A 2YXLA 5F2NA 5K0EA 1O9GA 5DTQA 3FPEA 3FPJA 2EJUA 3SMQA 5C9ZA 9MHTA 2G72A 2CKDA 2Z6UA 5DM4A 3IEIA 1O9HA 2GLUA 3LDUA 3QV2A 3ER8A 3GO4A 3GRVA 5JUWA 4KDRA 1OR8A 5K0LA 3G8AA 3LBFA 1ORHA 1VP9A 3OU6A 1BHJA 3DXXA 5HIIA 3RIEA 2YXEA 5HZMA 5K0CA 3DLCA 3DTNA 1M6YA 1L1EA 3HM2A 2OKCA 4KRGA 3REOA 1JG1A 3HEMA 2QRVA 2C7OA 4R6WA 2JH8A 1SKMA 3KQVA 5IKMA 3DOUA 1AF7A 3KHKA 4OQEA 4FT2A 3BGDA 3MCZA 2ZBQA 1NW8A 2YUIA 2ZBRA 3SGLA 4YUVA 2PX4A 1NBHA 1XCLA 3EEYA 5T67A 5KVAA 1QAMA 4RTNA 4MHTA 1KIAA 4HTFA 1U2ZA 4AZSA 4Z2YA 1VLMA 3G2PA 5G02A 4RTMA 2ERCA 2P8JA 3P2KA 3CGGA 1ZG3A 4XUCA 1M0EA 3EVZA 1XXLA 1YFLA 3HNRA 3KQTA 3BGVA 3RW9A 4RTQA 3MTIA 4B17A 3IV6A 2CMGA 2UYHA 2JG3A 4R8SA 2UYQA 3GIWA 2VP3A 3FTEA 5D1HA 1NV9A 4KWCA 5EMMA 1XDUA 3EMDA 3EVAA 2HV9A 1AQJA 5EPEA 5EZSA 2IBSA 2WK1A 5GM1A 1XDZA 4MQ4A 4A6EA 3KR9A 3I64A 1JQDA 2NNWB 5LQJA 3WSTA 3KR0A 1Z3CA 1VBFA 3FUUA 4E2XA 2QYOA 1X1AA 1KHHA 1R18A 3FYCA 4RTJA 2YX1A 1JSZA 1QZZA 1VPTA 3EEOA 2HMYB 5DX0A 1KR5A 1JR4A 3ELUA 3GRZA 3A7DA 1RJEA 3OE4A 1KYWA 1VIDA 4HRAA 3S68A 3AWIA 3ORHA 4IV8A 2AZTA 1PJZA 2VS1A 2E5WA 4XUDA 2Y1WA 4AZWA 1P1BA 5MHTA 3NDIA 4M37A 2PBFA 5EIFA 1QAQA 3SSOA 3E05A 3PFHA 1VL5A 4FZVA 5EEGA 2BR4A 1FBNA 2ZWVA 3HVIA 2XYRA 3MQ2A 2PX8A 5U4XA 1G60A 4YUYA 4RYLA 3Q7EA 1PRYA 5HFJA 5P8WA 5BW5A 1QANA 3FUWA 1X1CA 4BLWA 5HEKA 3PX2A 3KPJA 1ZQ9A 2OBFA 3OZRA 2PWPA 2PJDA 4PONA 5DT2A 5F2OA 3DXZA 3SSNA 5EGSA 2IH4A 2OYRA 4RTPA 3HCDA 1JG3A 3BZBA 3P2EA 4HC4A 3AJDA 2UYCA 5FHQA 4FS8A 5EC8A 2QRVB 5EKXA 3HTXA 2GH1A 2PX2A 4QVKA 3CJRA 1G55A 2QM3A 3R0QA 3LCUA 4GOMD 3F4KA 4NECA 4ER5A 2ZCJA 4E32A 3LX6A 3LKZA 4GC9A 3C6KA 1F3LA 3GCZA 1JQEA 3OFJA 5ERGB 3SSMA 1L3CA 2JHCA 5CVDA 2GB4A 3P9KA 3JWIA 2OPBA 2ZIFA 5FA5A 2NYUA 4EMSA 2C7QA 2DULA 4QVGA 2XVAA 3D2LA 4YUXA 3M33A 4FGZA 3EVFA 5HOQA 1N7IA 2PV0A 5K8VA 4DMGA 2FPOA 5ICCA 5EKUA 2IFTA 5FQNA 2Z6AA 1KYZA 2O05A 1BKYA 4DZRA 3JWJA 5E8JA 2PX5A 2GAFA 2AN4A 2V74B 3PT9A 2P3OA 3FZGA 1KP9A 1NE2A 4E2YA 3BWCA 2O57A 1NBIA 1HMYA 2FCAA 2YXDA 3A7EA 4QPPA 4E30A 5H02A 4GUAA 4M38A 4M7RA 3GWZA 1UFKA 4PYMA 1YB2A 5EHIA 1WXWA 5E1DA 2PGXA 1RJDA 1YZ3A 2V7EA 3DH0A 1I4WA 3HCFA 4PYQA 1M6EX 1ORIA 4F84A 4POOA 1JG4A 2H00A 4KW7A 3GDHA 4RTOA 2VDUE 2HR1A 1SQGA 2FHPA 4X60A 1H1DA 1DL5A 2IPXA 1UWVA 2Z6QA 3K0BA 5LQKA 3G7UA 2BR5A 2AN3A 3SR4A 1G38A 3DXYA 1NT2A 5DM2A
chains in the Genus database with same CATH superfamily
2QQ0A 1G21A 4LXIA 2B8TA 4U2EA 3DLBA 3FROA 5IHPA 4Z86A 4LBYA 4XM0A 5E8RA 2AJLI 5HYVA 1NVKA 4LTMA 3TXXA 2DTDA 1WXQA 3WXBA 1IRIA 1FDVA 3KCNA 2UUCB 1MRZA 3ICPA 1AU9A 3BXFA 2UV8A 5IAJA 4V2UA 3W2FA 5TT0A 4DDTA 3SYMA 3WIBA 2H8KA 3ND6A 1BCSB 4K9NA 4G5XA 4QEDA 4RVCA 4Y0AA 4BNNA 2A86A 4C1BA 5H5JA 3F6YA 3UJAA 3EXFB 3BMNA 4CBVA 5BUCA 5C4MA 5K03A 3DNPA 2GXQA 2G88A 2V7GA 5DSTA 4LQ4A 4OY3A 1KVUA 5LB2A 4CT0A 2ASEA 3DVLA 4Z3KA 5K8CA 1Y8ZA 1MXHA 5CFNA 1ISRA 3BMQB 4PPYA 1F0YA 4NH4A 5AKJA 4W8GA 1N8KA 1QAOA 2QNRA 1TYCA 1EVQA 4K6GA 1EDBA 1GTZA 3GFOA 3IELA 1GGKA 1SAYA 1QTRA 1WDWB 3R2JA 3S44A 2IZ0A 2LCIA 4PLFA 4V0ME 2PK3A 3MLAA 4KRYA 5EMKA 3ZWBA 2SHKA 2QTWB 4YMWA 3D8RA 1F7VA 2EARA 3IRUA 3OAAD 4D0SA 1ADBA 3OI7A 4INOA 3TOVA 3NHKA 1ZXXA 2JGRA 3OQBA 1E2EA 4JEUA 4G3XA 3PF9A 3W1WA 2AOUA 5THXA 1BWPA 4FYHA 1KU6A 4M88A 1JQJC 3TW4A 3IL2A 1LPOA 1W76A 1ZQ1A 4JI2B 1RWPA 4DV1B 3OCVA 2ZJBA 2QTHA 5KX5A 4BASA 3EXIA 3ZXIA 2QT0A 3U6BA 3OOJA 4GVPA 5EJ2A 2BD0A 3U4IA 1S3SA 1QHYA 4CM8B 1A3CA 3FLEA 5LYJA 1U0FA 2AYYA 2ERYA 1GYQA 3C97A 3FLMA 5KTPA 5L4SA 1T4CB 4QEKA 1O6BA 3UKJA 4F06A 3D3WB 1U1IA 5DVZA 5AW9A 4TLBA 5IAKA 2H2IA 3GUYA 4NBSA 4Y2SA 1OXSC 4CNQA 1ZNYA 2XUPA 1ZVQA 2NPFA 2VT7A 5I51A 3EW9A 2IQIA 4A8JB 2QZJA 3E0XA 4N6NA 5CM2Z 1O6GA 3M5CA 3AP2A 1IM2A 1OHHD 4XCXA 5JDCC 4LISA 1SH7A 2QYSA 3IQGX 3JQ7A 5G0VA 3ZHRA 3ISTA 2A5YB 2Y1GA 2ZB8A 2AJCA 5KDLA 1ZK4A 4DMHA 1DLJA 2ZIEA 3ZCXA 3T0GA 4QO8A 3ANNA 3M6WA 3VU9B 4Q0MA 5KREA 4H3SA 3C3AA 2A0UA 2QPOA 2ODNA 1UPXA 4R51A 3UOWA 1IH8A 5JD4A 2D06A 2J5KA 2O1WA 2PZFA 4UOEA 3U26A 5F2KA 2IU0A 2PUGA 2Y93A 2ZVJA 1Y9AA 3BQMB 4YRIA 4NE7A 1NVEA 5LU9A 2HU5A 3NTXA 3WLIA 3ZBTA 2J7PA 4RQTA 3RIHA 1RKVA 1XEWX 2RHWA 3CNHA 4LC0A 1Z88A 2V3CC 4QTZA 3UPDA 1R74A 2DWUA 3CQ9A 4EJSC 3L77A 4B4UA 1E60A 1KETA 4KB5A 1BQ4A 2X3FA 2WU4A 2CLMB 3DFZA 3RM3A 1MAHA 3ZY3A 3FKJA 3PEFA 4O0MA 4TGLA 5CG2A 2PJRA 2PIDA 1CP3A 3I9OA 4YDHB 4EJ0A 2P7HA 4A16A 4RPLA 4MR7B 3MOSA 2GZDA 3V4RA 4HUJA 2NVBA 1RRFA 2R8ZA 3G0DA 5G1OA 5THQA 1V7PC 4YAGA 1MC1A 4DR2B 1P9OA 2KPOA 2QORA 1KORA 1UFQA 1PWEA 1NW7A 3L4EA 4UKDA 1QVWA 2E85A 5TF4A 1T24A 2X4DA 1WUIS 3DTVA 1K7FB 1QCYA 3NHLA 4FYVA 4IMIB 3CWZA 4RIFA 2A1TR 4ILKA 1G7RA 1LXCA 5EWMB 2YFHA 3VSBA 3ASZA 2PUHA 4FYIA 1ZK1A 1SOMA 2EW1A 1SM4A 3DV0A 4QSMA 3CNEA 3ROGA 2AOVA 2JA1A 4KV7A 3IP9A 3TWOA 3ZJ4A 2NV0A 5JEEA 2EFYA 3RVBA 1QCDA 4MP3A 1RIIA 2R85A 4RETA 4MJ7A 2QRJA 3RVMA 1FNBA 2IYOA 4KQEA 1V95A 4MVWA 3ZI4A 4CIYA 3CVVA 3IAS1 1MJFA 5FHRA 3BIXA 3AVUA 5KPJA 1BXGA 3ADCA 4KXUA 5BQPA 1TAUA 3EGIA 5H83A 3FN4A 3P2MA 1TJ3A 2GASA 4L75A 4WOKA 2HDHA 2HH9A 3RS2A 1TMKA 1QPGA 2J9FB 3F2IA 2IXGA 5H3HA 4GXTA 5CJPA 2WJWA 1AV7A 1P74A 4KTVE 5JTTA 3N2ZB 4QGGA 1YCGA 1ZK0A 4QXOA 3E18A 5HIJA 1IM8A 3BICA 1Z45A 1ZOSA 4FCTA 5F2EA 4P7JA 1CR4A 5AKIA 2QQ5A 1BMTA 1V2HE 4HH4A 5BPHA 5KOIA 5A3RA 1VGVA 3A1NA 3I2FA 4FT4A 3F5SA 3PPXA 5ERXA 1DKRA 1QVRA 4AJJA 3I6IA 1X13A 1J23A 1DADA 3ER9A 2WYHA 1ULSA 3HUEA 3SIPA 3U7JA 1W4BA 5DXFA 3VOAA 3ZE2B 5A4DA 2MR5A 4R9NA 3NCHA 1YQGA 1GKIA 3TZKA 2G1AA 1T9CA 4M8SA 3CG4A 3ZWYA 4IJMA 1JXQA 4I81A 2W9XA 4UUQA 1DXOA 1LLFA 2QVZX 4QGBA 1I13A 1YK0A 4LE0A 1C2YA 1M73E 5B1YA 4GI2A 5B58T 2VUUA 3WNDA 1I4DD 1C9YA 1SHLA 1UOQA 1VJGA 1MJGM 3C5EA 3KKZA 4I5IA 5D01A 4ZTBA 2IUYA 3QE2A 4TTRA 5FORA 2FK7A 4C05A 3E9RA 4JVNA 5I45A 1L5SA 2UKDA 1FQKA 1Q12A 1E2DA 2R1TB 4YH1A 2XKKA 4PR3A 1K6XA 2FWRA 3QBTA 4QATA 1TU0A 2RC5A 1XQVA 4COOA 2XIQA 1WLSA 1I5RA 3VKUA 4WSOA 1UXJA 5EE3A 3VZCA 3HGTA 2G5GX 2XR1A 3T4EA 4F5EA 4XFDA 4BVKA 4P58A 1KOFA 3G0IA 2PUBA 3K35A 1WCIB 3VH3A 4YYZA 1O3YA 2JIZD 2V1XA 4C7OB 4L4UA 2F17A 3VR0A 3W06A 3SY8A 4ALMA 3IFSA 2IUEA 2VYND 3OFKA 3PXGA 4AY3A 4ZDJA 5CXUA 5DW3A 5EJ6A 3R3XA 1G9XA 2EOAA 1T6YA 3C74A 1C1HA 3HBMA 1ZFNA 4K1LA 3PNVA 1SG9A 2JJ1D 3UA4A 2E0IA 3EA0A 4OQXA 3G0HA 2PTHA 5HSGA 1T2AA 1XMJA 3ICCA 1G20E 4FYYA 1ZM2A 4EHIA 4Z4FA 4C08A 1BX3A 5JJKA 2AK2A 2CMFA 4PX5A 2EDAA 2EXXA 4O4IF 5GJWC 5HZHA 1N5MA 2IY8A 3OJLA 1AB5A 3VZBA 4ZVOA 1LLUA 4AUKA 4OBBA 3HY4A 2FW0A 3HJUA 4QQ8A 4ID9A 2QMOA 3QG1A 3G2MA 2PT5A 3OOSA 4ITVA 4BFYA 1DC5A 5DF1A 4BXOA 4UBNA 2ES4A 2NGRA 2XDQA 2AOWA 4W1RA 4E5UA 1NBMA 1WZ2A 1DAGA 3GJRA 1A95A 2DHEA 4I4TB 2ZKLA 1ZR2A 1RYHA 3BG5A 3LSYA 3DV9A 3A9WA 1CBUA 2R8XA 4N03A 3FETA 3QUQA 2FG6C 3GX1A 4XKJA 4ZQGA 5L8VA 3P9NA 4RGVA 4OI0A 2BEUB 2LW7A 2R68A 5EOVA 5HBGA 5HJ5A 3BAZA 1P5RA 4CEIA 4C03A 3JV7A 5AM0A 4N6GA 3ZGZA 4U2KA 4MQLA 2BFMA 4OI2A 3EZFA 4V1CB 4XDYA 4KWTA 3X1WA 2XF2A 3RFUA 3G2IA 1JIXA 4EQ6A 1GR1A 2DQKA 2EW8A 3FVQA 3JASA 3KJEA 4R83A 3D6FA 5JS2A 3VPDA 4B6FA 4DNXA 2TYSB 5DTMA 4UBLA 1DFGA 2H48A 2IYRA 2FI1A 1RJ9B 1BIFA 1QRRA 4NZPA 4YJFA 1J70A 4ZPJA 1JJAA 2YWDA 1FMFA 1BMFD 5LP1A 4FOSA 3HE3A 2BFDB 2IXTA 3L1VA 3Q7TA 1XRSB 3MIIA 1EE1A 2FPXA 3JTMA 1T4MA 3MTDA 2X4GA 1GADO 4BWVA 4WCDA 3X2FA 1WG8A 4MVJE 1NXOA 1T5BA 1F2TB 3ITKA 3JZAA 4YNBA 2IYEA 2WNHA 4RFSA 2QN8A 2H1IA 3FKSD 2C2MA 3W7BA 3VR4D 3QEMB 4NABA 2YBEA 2QPLA 4PTYA 2QMUA 5JCJA 1WL8A 1BE0A 5PNTA 1JIIA 4WZ6A 1CY1A 1OAAA 4TVSA 1A7AA 2ADFA 1WMEA 3N0TA 2H4HA 1VPVA 3UT6A 2VL7A 2PZMA 3CYFA 4KFSA 3GLSA 2GLUA 1PGPA 5FLEX 5K0CA 5A7GA 4W5TA 4DZTA 2VDRB 1UMBB 1IVNA 3A6KA 3QYFA 2G09A 3HM2A 2WDPA 1A2BA 1NKSA 1ZH4A 4UMEA 1BAPA 1Q5PA 1YULA 3WK5A 1SKMA 2EZ4A 3FFAA 2D1RA 3DOUA 4NMXB 3PNBA 1CHDA 2AKYA 2Q50A 4ADSG 4UPEA 1NBEA 1UXKA 2BBTA 1I7SB 1Y6FA 2CNOA 5B1DA 1MAVA 3JYQA 4I5FA 4KXMA 4P8RA 3ACDA 2FSVA 3TNYA 4KREA 1AH2A 2V59A 3MS7A 1C8BA 5ELXA 2VDNB 3OJOA 4B5KA 4OAOA 3IQXA 221PA 4R8VA 1XRQA 3RS7A 1ZG3A 2BFEB 5A9TA 1EZZA 1YFLA 3KYDA 2AQIA 2R00A 4PICA 4CFYA 1XEFA 3LWNA 1WDMA 1DQPA 3M83A 2W22A 1CQPA 2W6PA 5L3SB 3EPJA 4P92A 4YRJA 4WESB 5JCPA 3AEUB 5K0TA 2GN9A 1OXXK 1E4YA 4IHQA 1W36D 1TPZA 2ZDHA 4G5YA 4CMEC 2IBSA 1IDN1 3QE3A 1XDZA 3CH6A 5J5CA 1VBNA 1K75A 3V55A 2GYWA 4AY5A 4L4ZA 1Y1QA 5C8DA 2QW0X 4P1ZA 4DWWA 1T2EA 5IYZB 3WDMA 4EA6A 2JBHA 4KBFA 1B4DA 4GKAA 3T5PA 1LK5A 4W1QA 5IFKA 5CITA 3C16C 3OY7A 2G9NA 3KB2A 1GL7A 5DX0A 2AE2A 1G6KA 1SHZA 1RS0A 2QXYA 3A7DA 4ZU6X 4YUAA 1JR3D 1IN5A 1LVGA 5J4YA 2POQX 3R5HA 2VNJA 1S2DA 4CHGA 4X1YA 3PFFA 2OFOA 2IHVA 2VS1A 1SD2A 4RWEA 3TX2A 2A67A 4QOSA 1TXGA 4NZMA 4RIHA 3GLFB 2RBKA 2PBFA 1UBGA 2P6NA 3GUCA 2WWGA 4P4SB 3C43A 3PFCA 4H7EA 3E05A 4U00A 1IHPA 4R2LA 3U44A 1OREA 2ZRKA 5DISB 1SZJG 2Q28A 2XRYA 2XYRA 2YZ2A 1TM1E 4OTZA 4CIVA 2WJHA 4BQQA 3TEFA 2SKDA 3TRFA 4EPTA 2PEYA 4Q4HA 2O5RA 3KJFA 1BDMA 1OAOC 2IXAA 3Q5DA 4ZICA 3A8TA 1UBTS 3DAOA 1GVNB 3HCPA 4BLWA 4UQOA 1ZI8A 2OBFA 2WYVA 3AUUA 4FYJA 1PW7A 3EUEA 4P4TA 4HRXA 2OOSA 2VK1A 3BZBA 4HC4A 4C0WA 4G24A 2AX3A 2CNDA 2YYSA 3ZWKA 1HA3A 3PHJA 1WTCA 3DAGA 1I6WA 3LX6A 1FS6A 1UQUA 1WM1A 1THZA 2H8GA 4IXWA 4BTLA 2PLRA 3RC8A 4W5OA 1VBMA 4HAVA 4NBNA 5HWSA 2GB4A 3DT9A 1MC8A 4JLVA 3OQ1A 1PQUA 1GPUA 4N8DA 3PUJA 2VOJA 4WGFA 5K2OA 3OC0A 3T8YA 2PRKA 1ZMXA 4MCHA 4PZCA 5EPUA 4CF6A 1WB9A 2C1XA 1YQWA 4G0YA 4WXEA 4AG3A 3ROMA 1JDSA 5ICCA 1NOJA 2IOHA 3NHUA 1KYZA 5KNCA 3Q1KA 4M0EA 1MEOA 3KSMA 1ZONA 1GGVA 5I9NA 2FQYA 1JQAA 3OQHA 1V9LA 3MMSA 3GLHE 1KEUA 3S8EA 3EGXA 1Z08A 3ZUGA 5JSFA 3KU4A 5LMUB 1EXDA 5AUOB 2PGXA 3DH0A 1Z4NA 2G8LA 1XNGA 2QEQA 3CH4B 1VECA 3ROXA 1PNOA 1H1DA 2IPXA 1Z7EA 3HPQA 1RACA 3B52X 4V2IA 1NF8A 3HKEB 4HY3A 5J58A 3SR4A 1XELA 5DOZA 3TBFA 1PVOA 4LOJA 4D3DA 4QM7A 4IWYA 1AKMA 1K5GA 1NXWA 1U0RA 1ORTA 3G9TA 1AUOA 3HY6A 2CLHB 2M6SA 3K0HA 3PT5A 4URHA 4ISCA 10MHA 4CCSA 3MTAA 4GL2A 1RTTA 3G5TA 4GPAA 3NALA 3S2EA 4A8HA 4BGIA 4BV8A 1K8XB 1JG2A 1T0IA 2HMUA 5T8KA 3O91A 2O3SA 2W5UA 1N5LA 3KR2A 2BKVA 1KI9A 4C3OB 2IOFK 3N5CA 4YB8A 5AK5A 1EQUA 4B85A 4BGEA 4FGSA 3A6HA 1XQ6A 4RAOA 4IJQA 2ZAIA 3K5HA 2HQBA 4XX0B 4CR6A 2ZI6A 4NTZA 5I7VA 2Q49A 3SM9A 1CUBA 4FWIB 1UL1X 1YFZA 2EFGA 3R41A 1CY2A 3IJRA 1EB9A 2PQ0A 5BRJA 1EX1A 4QL3A 2WAOA 1JALA 2C31A 1YA8A 3U62A 2OCDA 3GI1A 4WKCA 2I87A 3U81A 5JROA 1GPBA 3OIUA 3ASUA 4EA8A 1FVFA 2C5BA 3L0IB 1F5NA 4JODA 1LY1A 1EU1A 1KQOA 2CL5A 2MYPA 4H6VA 5A7HA 5J43A 2D00A 1ISFA 2IEAA 4DV4B 4J1QA 3K20A 1AM4D 1FXUA 3N07A 3MUOA 2DQ4A 3IR6A 1DX4A 2VA8A 5FBWB 1AMUA 4KXFB 5ALGA 1P0MA 4Y1EA 5JBIA 2HCFA 2WSSD 1L3IA 2ODWA 3BMOA 4TT8A 3HZOA 3ZHSA 5KNLA 1Z5WA 2BUAA 3GDOA 1YDEA 1O96A 4GF5A 4XUGB 3Q3GE 2HHCA 3QWBA 3LZ6A 2MCFA 2V1UA 2NUTB 4JKOA 4R9RA 4WCFB 3Q87B 3GRKA 3QF7A 2V3VA 3AOEC 3U3KA 4X7BA 5JAPA 2R1VA 3GFTA 1CUXA 3GN2A 3OEEA 5DGIA 1VSQA 5JPIA 4D45A 4C4OA 1DMRA 1U6IA 2HJ9A 3A1CA 3K5PA 4EH1A 2QG4A 4TYQA 3GT3A 3E9ZA 3PQCA 4R3UC 2HA2A 4MAAA 5IN4A 3KOMA 3NWJA 3T3GA 2FZLA 1FYFA 3UAOA 4I99A 4QTTB 1PK7A 4NJEB 2AI2A 4WFKA 5KNDH 1NUUA 2O2EA 1HDZA 4D6XA 2O0MA 4CR8A 4ZOCA 1UJ6A 1ZMOA 1VP3A 4R8RA 1YUBA 2PGOA 4XUEA 3PFKA 1ISHA 1WSDA 2FF7A 2XUJA 2ZQZA 4MXDA 2Y76A 4WKBA 4XSHA 4CWAA 4NP6A 1C8VB 2XDWA 4B7XA 1FRVA 1BFDA 3BB1A 3TAHA 2QAGA 3V1TC 3EAFA 1Y8RA 3ZTWA 1B6SA 1WV0A 2HCRA 1SGWA 3OLXA 4MI9A 4ONEA 4QBIA 5AHOA 4L8YA 1E3LA 4P3KA 3WBKA 3ZZTA 2R0QC 2YFQA 3RARA 1A97A 1KGDA 4K46A 2L0XA 3DMYA 3Q7RA 3W2HA 4JKIA 2C84A 2J45A 2XSZA 1PHRA 5DFAA 1GG5A 1O5IA 1CWUA 1GCUA 2UVPA 1NNI1 4B74A 4BEBA 2QY6A 5IDWA 2CWWA 3F90A 5KC9A 4R01A 3DWEX 3EFOB 5G4KB 5LBTA 3UWKA 3ZWNA 3ZDAA 4YECA 1SCBA 3Q7IA 4Q3NA 4ZJYA 1PNRA 3BERA 3D4LA 3G2QA 4YV7A 3TB6A 2GKSA 5T3YA 1I6MA 2I4RA 2E87A 3MS2A 1NMSA 1QQAA 1KIFA 5FPQA 2IW3A 1BKDR 3VNBA 3GMDA 3JZDA 4GP7A 4J1TA 2FOIA 4Y1FA 5LJIA 4KC0A 3SDSA 3B7PA 4MB0A 3ZVRA 4EG7A 3ET5A 2B3TA 3RV3A 2V5VA 3DPUA 4KQJA 5C8YB 1CQJB 5HQ3A 2C0CA 2WW8A 3NJ4A 3MPUA 3KETA 3V32A 5SY4A 2P6MA 2X0IA 1E1LA 3SXUB 3WTCA 1GRQA 1H2BA 4X65B 1Y5RA 3BWDD 3MINB 4L08A 4CG3A 2OL4A 4IJWA 3MJHA 5ICFA 2A1UB 4ZOLA 1EZ4A 4AQYB 1BDBA 1K2WA 1WXIA 2VLIA 4R2MA 3UENA 4ALIA 3ZGXA 1PR4A 1FUUA 1M0SA 2FHSA 2XMDA 3L6BA 4Z3DA 1DS6A 5AXDA 1GKKA 3DP7A 2GM5A 1UAAA 1PO7A 1VZ3A 3T7SA 1GUBA 3GJZA 5CCBA 1R88A 4JHXA 4YLYA 4J3JA 3TOZA 1W5TA 3FNBA 4E5NA 4AK9A 3IE2A 4YRKA 2PR7A 3OY2A 4NKRA 4UEQA 3OHMA 3REQB 4ZO9A 2ATVA 2V6BA 4PYLA 3FSRA 1N1DA 3B7GA 3CCCA 1K3FA 3AVVA 5DB4A 3KZVA 3W9SA 2GEJA 3WP0A 2JHFA 2YWGA 3Q41A 4D9GA 2GVZC 4B2PA 5K5EA 1X80B 3TQTA 3R8FA 5ARDA 1L1QA 2CXHA 1XHFA 4PG6A 4Y9RA 3QHAA 2QMZA 5F4ZA 1RZRA 1FXWA 3LSTA 1UK9A 3LIPA 3AETB 2BFPA 2J48A 4YROA 1A2KC 2PS0A 3TOSA 3WIEA 1OA0A 3G8YA 2Q1TA 1U2GA 2BHRA 2PSEA 3VPFA 3ZXSA 4G56A 4INJA 3TR6A 4ZO4A 2FQWA 4TKUA 5E2BA 5TSDA 4IOMA 5AM5A 2BFCA 2F90A 3KCQA 3BD7A 1W8IA 2FWBA 2PVCA 5ES4B 3T7DA 2NTEA 3WQRA 5JSQA 3SX4A 3EUAA 1H6AA 3SC2A 1G1AA 3BULA 4NDZA 4OHOA 4X95A 5KKAA 1ZJWA 1TMGE 3TTXA 3KHSA 1QH0A 2NSHA 2REQB 4Z1MD 3E53A 3OBBA 4L9RA 2ZE7A 3OMLA 2JLYA 1LDGA 2GCPA 3OZDA 4AY2A 1SWVA 2ZTVA 1U5BA 2NSYA 4EGAA 1Z22A 1JPVA 5C80A 3FUVA 3TI9A 4Y98A 4E51A 1NMEA 3A1VA 3FTDA 5JAQA 3SVZA 1OXVA 1DWUA 4J0EA 5FPTA 4GVLA 5IH3A 1KS9A 5KTNA 2VSNA 4ZI2A 2WF9A 1II8B 3EF1A 2YWJA 3L9WA 4MV0A 2W2LD 2AOTA 4IIEA 2X7HA 3DHEA 3I6BA 4ZO7A 5FULA 3PC8C 3S99A 1BS2A 4BQOA 2P4UA 2O4UX 2J1LA 3GCWA 1RPJA 1SQFA 2A9RA 3RU3A 1EUDB 4QXMA 1J2UA 3JARA 4XWGA 4W7IA 4C88A 2XWQA 1SUSA 2B7LA 4RFVA 4NV1A 3EF0A 1KPHA 2I2XB 2P68A 2GTIA 4LQCA 4QOIA 2GESA 3GJ0A 3WL4A 4IEFB 4KHPB 4V38A 3U7QB 4PSAA 4I3FA 2I6QA 3I3OA 1ESCA 1PJBA 1VIVA 3IUNA 3I2YX 3KUCA 1RWVA 1U7HA 1QP0A 2C2GA 2OY0A 4RHEA 2YMLA 5CNIA 4EG6A 1SN7A 1Z07A 1M2OA 4IWXA 2C5FA 2VZ0A 5HUQA 5LKAA 3CVXA 1G8YA 3IUYA 1KY3A 2J0UB 2RE8A 4D92A 5DXJA 421PA 2PR2A 3CVOA 5J5VA 1XPJA 1XZGA 2IYFA 5AK3A 4EGFA 1Q7GA 3FRJA 2BKEA 3IH5A 5J2TB 5LM3A 1Z0JA 3QXXA 1Z2PX 1Y3FE 4ZQBA 2GCEA 4ZMBA 3EEQA 4OLJA 4LZJA 1RLMA 3AP3A 1CR6A 1MIHA 1PUJA 4URVR 5LA6F 4JXXA 1XGKA 3OEWA 3BIWA 1NXPA 2C96A 3BMCA 4FZ3A 5B1HA 4BE7B 2V96A 3IBYA 4EYQA 3RWBA 2GRJA 1RRGA 3D3KA 4LDZA 4AJ2A 3RO7A 1R4ZA 2YOGA 3CRVA 1IU9A 5EQJB 4HNSA 2DFDA 4IDEA 1OYOA 4RJ2A 5E1MA 5JOQA 3ENVA 4KQMA 1ESZA 1P1IA 4W5RA 4OA5A 1X8JA 3S1LA 2HMVA 2P9EA 4GQBA 4QAJA 1RWBA 3C7KA 4F56A 3CT6A 3QYAA 2O3QA 4RA6B 5GVRA 2ANBA 1QB8A 3LBNA 3F5MA 3L0BA 1F60A 4P7FA 1WETA 2YIJA 5T41A 1NY5A 3IV9A 4X6YA 3VSAA 1C80A 3EK2A 2CCGA 3F47A 4YK7A 4IVPA 3FF1A 1K63A 4PQEA 3CRRA 4LE2A 5M2QA 1IXRC 5EG5A 1VIMA 3TD6A 3HADA 3NBQA 1OV6A 3G82C 1HM5A 4GW3A 1OYYA 5BORA 1JFTA 1VE1A 2OXTA 2ILTA 3VO8A 4KYVA 1QZXA 3W8FA 3ZK7A 1J6UA 5K3AA 3ORYA 3RC7A 3TG8A 3UA3A 2R6ZA 3KXIA 3G68A 1TL7C 1AY0A 1GGMA 2IY7A 1DPFA 1TIPA 2ATXA 2H1CA 2IEDA 2Z04A 3I2KA 3L1IA 1LDMA 2QJTA 4X00A 3OP1A 3G1UA 2HREA 5EJEA 8OHMA 3HKCA 4IXNA 3F6CA 1YRQA 4GR9A 4GPBA 4QJ3A 5A6VA 1L5WA 1N0HA 2PU7A 2MSEB 2Y1FA 1DBRA 5CP8A 3BHMA 5DM4A 1DHTA 2VTEA 5F21A 2J3IA 2QUKA 1SKYE 9GPBA 1BO6A 3NHBA 2GCNA 4EUFA 1M2EA 5HZMA 4QXQA 3USCS 3D6NB 5JIBA 4M3NA 5H3LA 1QYXA 2OKCA 2X9VA 3RF6A 4B3MB 1RABA 1Z18A 2JDID 2VUHB 1ESMA 4MMYB 5IUKC 4HV4A 5DTEA 3TQOA 3GRCA 3MWYW 3DZIA 4JGGA 1EM8A 1BVUA 4OQEA 4FDVA 4PGAA 4HNTA 3AR8A 5LBUA 2ZB4A 3QSYA 5AJVB 2YHIA 5T67A 5KVAA 3U09A 5HVNA 5JSUA 5AKKA 5L3QB 1O5TA 2PGLA 3MJDA 4XYMA 2C4HA 4A6PA 4D41A 1TX4B 5K3OA 3LNTA 4ARIA 2NWQA 1EP3B 1YDGA 1Z4LA 4U7JA 4F6RA 2OHGA 2R5NA 2WF7A 2X4IA 4WMLA 3V7FA 1K7EB 5LBIA 1EFHA 5BUQA 2X1LA 5FBVB 2W6CX 3I1YA 3O5AA 1R5JA 1R4MB 3WQBA 4EVSA 3TLCA 5BV1A 1HYBA 3KSAC 1E2QA 4J90A 4Q9AA 1YS7A 2NSDA 3K9QO 5J47A 1I4LD 1UF9A 1V5EA 4KWCA 2IXDA 3Q12A 3VMMA 4NI5A 5A5EA 4CFSA 3DDZX 3O93A 1GGEA 5CH5A 4CQMB 1V8PA 3HKDA 3I72A 4DA8A 5COAA 4UUAA 4PC2A 4B3CA 3RC3A 3K1TA 1VDZA 2AN1A 2NU9A 1PD1A 3PGKA 4FYPA 2F55A 1KQ3A 3EQ2A 2YRXA 3FWPA 3WSTA 3QX3A 4MUGA 2P9GA 1M8KA 4YRSA 5AVUA 2QYOA 1X1AA 4B7ZA 3R3JA 2JKZA 4RTJA 1WBBA 3NOVA 3WLQA 3JQFC 2XITA 4I1YA 4ZQHA 3VU3A 4CTMA 1EFVB 3DOEA 1A5BB 4M9QA 2ZSJA 2Z5LA 4QDZA 3ICEA 5EFOA 5CAEB 3C98A 3P0RA 3L05A 3PXEA 5KNBA 2ZUTA 1T8RA 4EY3A 5CMLA 1KVTA 2JGNA 4BUCA 1F2VA 3FCCA 4C6SA 4DZZA 4E15A 3GMTA 2XECA 5MHTA 2HI0A 1NG1A 3KDPA 2Y05A 3A3NA 4TV8F 2VWHA 4MQBA 2XNSA 1M1YB 2YVAA 3D9QX 5DTJA 5FUYA 5CNMA 3UT5B 4DXHA 1XEWY 1QG0A 1ZJJA 1NTOA 4REQB 3RFVA 3USES 1R6BX 4NBKA 4JEIA 4AZ0B 5P8WA 2CE2X 2YY5A 4RXMA 1AIPA 2QTRA 2QI9F 1PFGA 1O58A 1SZDA 3RTEA 1ZQ9A 4AVYA 4DILA 4GE3A 4S1TA 1VGRA 2D2IA 4HDQB 1OI2A 3BWEA 2HCTA 2PVSA 4P4LA 4UCQA 4CI9A 4KGDA 3R1IA 4L51A 2L69A 2FX5A 1R3DA 1RHJA 1XZAA 1GKLA 1X42A 1Z35A 4OMDA 1CDOA 1AT1A 2OAGA 4ZP1A 1Y5LA 2WOOA 3F4KA 1VKZA 2ZCJA 1E2FA 4E32A 3LKZA 1R27A 5LZ7A 2XUQA 2CK3D 2QM8A 5MFPA 1JXOA 4E7PA 4JQOA 2GHRA 2FP4B 5CVDA 4E1AA 1PSDA 4TRRA 5HKKD 4LX0A 2Q3BA 5FA5A 3TJZA 4CKXA 4GXQA 1IIBA 4QVGA 5AM2A 3A36A 3K0EA 5CFRA 5KO2A 4OFZA 3T61A 4HZUB 2CW5A 4YRBA 1I7LA 1FY2A 1UMCB 3EQ8A 5K8VA 1DGQA 2NTJA 4H08A 4DCTA 1EXMA 2P5SA 2X77A 3I09A 3CBQA 4D0RA 5ADVA 3BOSA 1KP9A 2BH9A 5KQMA 2NYVA 1GPYA 3L0DA 3OCYA 4YAJA 5FKJA 3VYRB 1MABB 1KZGB 4DLYA 3LUPA 2ZITA 4DT1A 4B3RB 2DZDA 2WF6A 3OT4A 3L3BA 5EZYF 1YJAA 1L5HA 4AIRA 1B14A 1DU4A 1BNCA 3THYA 2PV7A 5IFLA 3QPWA 2JJYA 3HN2A 2WZDA 4H3HB 2CF6A 3L7NA 4M1KA 4HXEB 3WHPA 4Y3UA 1FFWA 2WP8J 4YO7A 5C0OE 1JH8A 2W0SA 3K5WA 2AUTA 1QG4A 3VGJA 1UEXC 2ECPA 3BIFA 2MT9A 3U4QA 1SU8A 3KQOA 4HJRA 1U0EA 5H59A 2GCOA 4HWKA 4ZI7A 5C7OO 5FX2A 4HWSA 3ZDCA 4MUMA 1Y34E 1UK8A 1JT2A 1KO8A 1DOAA 3AGQA 3LVFO 2I6UA 1DBSA 2DQYA 3KYCB 2Z6VA 3FUXA 4UD2A 1OXTA 4WLFA 5CXXA 5FUQA 2PMFA 2G7MC 1AK1A 3SBEA 3JRWA 3FY4A 5IDXA 1OWPA 2PL5A 3IR5A 1SC3A 2AIRA 2BR3A 1Z6PA 3F9RA 3D7RA 2GSWA 1NMXA 1NJ8A 3FPBA 4GDMA 4AKIA 2C5HA 2EX4A 3HVJA 3CZMA 3VFDA 3DE7X 3AL3A 3EXHC 2QN6A 2HO4A 3FG9A 4K5QA 3GOHA 3OE5A 1EVZA 5TC4A 3TMAA 2ZBGA 4Y6LA 4CEHB 4G09A 1J0EA 1VXOA 3BGIA 5KAPA 3NYIA 5T4FA 1TYAE 1JEEA 4FZRA 4RF3A 1CLEA 1PEDA 5CVEA 1X8KA 3WLJA 3PKJA 4OXQA 4AICA 5DRTA 5IVPA 4BO9A 3HJFA 4W1SA 2F3PA 4BN5A 1Y7HA 2VF8A 5ESWA 4JU8A 4GP9A 5FI3A 4HUQA 3ES9A 2WQZA 4D1YA 1X1RA 4PRLA 2OOKA 3IP8A 5JCOA 1BH6A 5IJZA 3GJ5A 3O2QB 4B80A 4FYXA 3G9UA 4XWTA 3H0KA 4X3CA 3TJMA 2VJQA 1M2FA 1WQ3A 4OHFA 1KPIA 5LQCA 1BRTA 4Q4DA 3OIFA 5IULC 1SXPA 2H0AA 1J5EB 4HO1X 2VAVA 3ETNA 5TB5A 3RREA 4UZSA 3BXEA 1BOFA 3QMWA 1BA2A 5CD1A 2QMEA 4E1VA 1FU7A 3A37A 2P11A 4NXMB 2D5CA 4W7HA 1DCTA 2O8BA 3H5WA 2DR2A 3G0OA 3WI7A 2X9LA 3GGOA 1T29A 1AG9A 1NQWA 2LRHA 1IQPA 3V1YA 1C3OB 4A8JC 4WN9B 2G5TA 2LD4A 2RH8A 3NCTA 4RVUA 2AFIA 3I01M 4Y9TA 4FFSA 5CW2A 5KYGA 3IVAA 2HJRA 3VR6D 2F3SA 1T36A 2OUKA 4IG9A 1KWKA 1LI4A 2RGAA 4C30A 1KYXA 1EUCA 2OBBA 2JRCA 1X0XA 4L28A 2JEOA 3WICA 2IHJA 2YJNA 4BAZA 4C0SA 4E94A 1W48A 1NNEA 4IWNA 3OKFA 4ZOAA 4BLSA 1YR7A 4E12A 4WVLA 1EHYA 4EMUA 2FRDC 3OZIA 1CIVA 2C0QA 1MXFA 2ZR8A 3CFYA 2ZXUA 1FX1A 4XYEA 4B9EA 1SCUA 1ZGJA 4GM4A 2NO1A 3UMCA 4Z6KA 5SYMA 1NI4A 1C1YA 4BEWA 1U3GA 2P1ZA 1OIVA 2WE8A 5K3FA 2INGX 2R7LA 4MWTA 2BI8A 4KVZA 1AN9A 4ARCA 2O9JA 3CZ4A 4EO9A 1NOKA 2B9VA 3E5HA 3FYUC 1OLXB 2NG1A 1YVRA 2OBNA 2R9VA 1DB3A 2G67A 3EGCA 1KBQA 2BCEA 1LW6E 5FUXA 3SEAA 1J42A 2ONYA 1DIGA 4MP6A 1ZUIA 2ZTUA 4QRDA 5WRFA 3ZLUA 2DEUA 1J1UA 1QVAA 3REFA 1ICIA 4ZT6A 3WG9A 2KI5A 3K9CA 2PKRA 1MX3A 4CLOB 2D2EA 2XT0A 1D4OA 2WPDD 3KJQA 4BATA 3TTYA 3GB9A 4I3GA 4QO7A 3HFJA 4J3FA 3L8FA 4V0MA 4ND8B 4ZC1A 4ZZ1A 1GDHA 3W34A 1MO5A 1Z29A 4G4SP 521PA 3NVKI 1QYRA 1SG0A 1OE0A 4BMDA 2D74A 3EGDB 3KDAA 3TD9A 3JAKB 5IK2A 1PX0A 3M2PA 5LOVF 3AEYA 4LXYA 3KPVA 1PR1A 4FI3F 1QQ5A 4FS3A 4NEGA 2O3JA 4UHCA 3OF2A 4ENTA 1DC8A 3HH8A 4YMHA 3ZS9A 2IBMA 3DEAA 2JIRA 1HE2A 1EFTA 4NV0A 1L4FA 3ZKWA 2RKBA 4UQPA 4ZPXA 3MWEA 3BDIA 5EFZA 4FDMA 2AFRA 3KTAB 4GU5A 4LE1A 4UCXA 3SQOA 1GZ3A 1D03A 1ORDA 2DUNA 1GO2A 2FUEA 2Z3ZA 3RYHA 3GEHA 3VC2A 1EJ6A 1TT5B 3OZTA 3KD2A 1DUSA 3N3BC 2JPDA 1SRQA 2QAIA 3STVA 3IP3A 4H9GA 1V3VA 3UB4A 5FQOA 4A6EA 3VVMA 2P9YA 2OP1A 4R2XA 4RGQA 3GRAA 4J7CA 4XYLA 1PFWA 3TGLA 1E7MA 1NDUA 4PZUA 4ALNA 2LKDA 4ZIRB 4B2LA 4DBZA 5AWFC 4RWZA 3N59A 4AX8A 3BXZA 3U3ZA 3HJTA 1QRSA 3VV3A 1QYVA 2WKPA 2GHTA 1N2CB 3RVKA 4OJQA 1G8KA 3K0AB 2BEVA 5AOVA 4W9NA 4F38A 4G0PA 4N9QA 3KKMA 4J43A 2CB0A 2V97A 1N7JA 1JQ3A 2C54A 4Q7JB 3E3NA 3TF5A 4I50A 1PDVA 2IPMA 3NU1A 3Q6MA 3EJ6A 2B9EA 1OUMA 1UINA 3KVYA 4MRMA 3RRZA 2J0SA 1PFYA 5DT9A 4AXXA 2VQSA 5A0TA 5DV9A 3F3SA 1PEYA 4FILA 2IC5A 1UPUA 1HK7A 4GGMX 4LZAA 3DOCA 3FVWA 2G9VA 4A5OA 2PX3A 3NBMA 4JLNA 3RQIA 3D2AA 2ORIA 1DSSG 3THXA 1UDBA 1QIKA 3A6FA 3WGZA 5AVOA 4HGOA 1R6DA 3PSAA 1NP3A 4TYWA 4YLEA 3H5LA 1DEAA 4LF7B 1OY1A 3S8YA 2GSDA 3U0VA 2WMOB 5AKZA 5CLJA 3UJPA 2FMTA 5FWXB 1C3VA 5IDVA 4E4TA 4LHYA 2PD6A 3EBPA 3FMPB 4HQFA 4PO8A 1ZJ5A 2VDWB 4LJ9A 3A2NA 3EEFA 1PAUA 3EDYA 3F5QA 3RYIA 2A94A 2GOYA 1IJEA 5C5IA 2GDZA 2C03A 2XVYA 4QRIA 5AICA 5EQTA 2XOKD 1GQ2A 3TTTA 2WZQA 1NM5C 2JLVA 3PUWA 1N2XA 4WWHA 1PT7A 4RVOA 5F7XA 1K6IA 3K1YA 1MT3A 1DG3A 2D3TA 4JUDX 4L4RA 2MTBA 1ILEA 3GCXA 1C30A 3CMMA 2JJ2D 5KYYB 4EZEA 3SZOA 3T94A 1X87A 1U3UA 2ZVDA 4GX2A 3FDZA 2GPSA 3TVYA 3GFBA 2HY7A 2WM8A 3B1VA 3STHA 4D8XA 3L7LA 1A8QA 2BWJA 3T3HA 4JJKA 1JBKA 2XUAA 2XKJE 1R0WA 2AMLA 1ORWA 2LCFA 3CUEF 3G0GA 3JS5A 3C4VA 3KEFA 4P0TA 4DVJA 3LYUA 4EDFA 1ST3A 5B30A 1OASA 1DLIA 3PEUA 4NATA 1USGA 2XUFA 1H8EA 1BXZA 3KQMA 3L7YA 4LNAA 4QIHA 1B93A 3WP1B 4A2CA 3ND7A 3AUXA 1DFHA 4RELA 5LC1A 4WD3A 4QPCA 1AX9A 2BDTA 1OLUB 2QGZA 2P77A 2V7BA 3JALB 3T7KA 4F92B 4AN1A 3EOAI 4FYWA 3E7DA 3FLBA 1B15A 2BRUC 3C1UA 2RD2A 1QNLA 1RYDA 1V16B 1XVIA 1RRPA 3ORRA 3RR2A 2OZVA 4U8HA 3ZW9A 1C7RA 3K71B 4DQ0A 4OU5A 1AHPA 1NYLA 3EIQA 3EIWA 1HE1C 1RHRA 3MD9A 4EOGA 4DV0B 1USKA 1Q1QA 2A1TS 2VYFA 1TAHA 4RUKA 3ABZA 4FHZA 3ZYZA 4BKOA 1F48A 2X22A 4XZ3A 2CNLA 4ZN6A 1W4CA 2VJNA 1DCKA 1G4HA 3DKIA 3UIEA 2P65A 3RYFA 1P80A 1PT5A 3JAWB 1V37A 2GAAA 2VHXA 4WDRA 5HILA 4WK6A 3LW7A 5CEJA 4JLBA 2CDRA 3SZ3A 2G70A 4YBRA 5IMSA 3JRXA 1RI3A 2QE7D 3MOGA 3AIKA 4FMDB 1HYEA 1GZHB 2PMEA 1YU9A 3FD8A 2JANA 3QQ5A 3IYLW 1GNLA 4PINA 5D85A 3RODA 3N58A 1JEQA 4CV0A 5T3UA 5KNBH 2FF5A 3NDJA 4PPNA 5KWVA 3B6KA 1F4LA 2FWJA 5AJUA 2PRSA 1IL0A 1S8AA 3EDRA 1Y3AA 3FUCA 1GD1O 3PNOA 4IJ6A 1G3MA 1CDDA 2YFYA 4EENA 3SC6A 2AVDA 1EFDN 1NJ6A 2M1ZA 1FMTA 2QXUA 4O3FA 4PZYA 3TIFA 2QSYA 4AJ4A 4QXRA 3EIEA 3PPVA 2XBUA 3E1KA 4W63A 5HXAA 5CVVA 4UFNA 5GZ6A 2RCNA 4LOAA 4NBRA 3ZWCA 3NHFA 1M6VB 2Y2UA 3RVDA 1WF6A 3RYTC 3OZ7A 2WJPA 2BFBA 2FPPA 1DBIA 2DBRA 1R16A 4FN4A 5JY1A 4ABTA 2CLEB 1U9IC 1QJ4A 2OMKA 1UOPA 3UWPA 1IXYA 5C34B 3V7YA 1UBSB 4R0NA 4X94A 3S8MA 1ETHA 1WLYA 3HC7A 3LPCA 4NU5A 4HDMB 4PM4A 1IOVA 2YXLA 1ZUD1 2C7GA 2FGJA 3A9RA 3OZUA 1UEIA 4FKZA 4ZAVA 2YKGA 4OF4A 4NENA 5DSZA 4BC0A 4Z53A 4V3BA 4P54A 1YJXA 3ZZMA 1KBOA 1VLZA 1M2VA 4LDPA 1SCNE 1THMA 1CE8B 2CF5A 1PGQA 3KB1A 3BD6A 5K3SA 3TIVA 4JVMA 2RJ3A 5E7QA 3SYRA 3G8AA 3OU6A 4FFBA 3DXXA 2R47A 4PZAA 1SK9A 4LRWA 1E5XA 3S1AB 3I23A 5KHAA 2V4UA 1HEYA 3QUSA 3DUFA 4K26A 4EGQA 3DBRB 1Y9EA 2XCOA 4RENA 1TA9A 3PD7A 5FYDA 1TLLA 1RAGA 5COQA 3DZGA 5EIAA 2HFKA 4HX5A 3EWSA 1W59A 1ZUWA 2ZPTX 4G8BA 4JVSB 4L5IA 4D9MA 1H8HA 5CA1B 4DCPA 4JB2A 4LRYA 5CX4A 4CG1A 3SGLA 1NHGA 3KE8A 4DCNA 3E8MA 2J67A 4Q6BA 4UC0A 1CUIA 1IIRA 2HLDD 3EPRA 5G02A 4DABA 1QIIA 3I04A 3HA2A 3LNCA 4TSFA 5JZ9A 2GFHA 4XFJA 3EVZA 3TIXB 5G2OA 1AQNA 3HNRA 3NAZA 3BGVA 1R5BA 3RW9A 1TZMA 3ZU6A 2D5LA 1T8SA 2IS1A 1GXSB 1GR0A 3UICA 1PVVA 1HE8B 3C3DA 3AJAA 4LI3X 2FN9A 2PA3A 2Y3IA 4QGFA 4HEA1 3W0LB 1P2BA 3NV7A 4R2HA 4AXBA 3Q8XB 1GA4A 5JRZA 1Q2UA 3HDYA 3EMDA 1U6KA 3AV0B 3ZG6A 5HKBA 1H0HA 3WNQA 2ZIZA 5IZCA 4MQ4A 2ZJ0A 3RTAA 3NHAA 2X8JB 2H85A 3M49A 2ZRHA 2EERA 2L19A 1FDSA 2AW5A 3R23A 4GI5A 4BX9A 3FVTA 4Q47A 4BO3A 3AUSA 4FE4A 4E2XA 5CVTA 1XCGB 2QN3A 2WT4A 2QVXX 2W90A 2J4CA 3AFGA 3FZEA 4YI5A 4ENUA 2YX1A 2SNIE 3MVEA 1QDUA 3CG0A 2Q5OA 3IKTA 1N33B 2OVFA 4NZOA 4D0GA 2OCAA 5CNJA 1BFUA 1W49A 4AAYA 4JUAA 3QVGB 2X3YA 1OFUX 3RVLA 3F7TA 2VNIA 3OPYA 3PPWA 4BVGA 2GN0A 2FDRA 3PNLA 1WB5A 1YRWA 3O4IA 4OKNA 2Y4NA 3OX1A 3REGA 2WMYA 3JR7A 4M4SA 2IXBA 5ECYA 3R0ZA 1V4NA 5ALNA 3RS9A 3WB0A 1J97A 2BR4A 1FBNA 3I52A 1G60A 1HC7A 1DEOA 3IAHA 1P44A 3V9PA 4C4TA 4EJ2A 3SZRA 5HEKA 4EO7A 4PONA 1YBMA 1X7YA 7REQB 4JJ7A 4A0FA 1SRRA 4MMXB 3J7AC 4D4JA 3UMVA 4UAGA 5TNXA 3ROKA 1JKFA 2ZIXB 3G8CA 3RSZA 2N1BA 2E89A 3I9KA 5FV4A 3WWZA 1G2QA 4WIAA 1PR5A 1M8FA 3LCUA 4LOLA 1E7QA 5E7MA 2WT8A 3CU5A 1KK3A 2A5LA 3GCZA 4BZQA 2PZLA 5ECWA 1M72A 3LG2A 5BW8A 3UWSA 1XWFA 4MH0R 2D59A 5LQMA 4M1MA 2YZGA 2X58A 3AH8A 4M7WA 4ZVLA 1T25A 1Z0DA 3NBUA 1GQRA 1OFHA 4FGZA 4MYSA 4MPRA 4DANA 4OAQA 3Q0TA 1LKZA 2BKAA 2F1JA 1U4SA 3GHHA 1UJNA 5JSZB 2DY0A 2FPOA 5EQFA 2PL1A 5FFFA 5FWYB 3E82A 3T7EA 2OAQ1 2Z6AA 2OQRA 3AFNA 4G25A 4MDYA 3J81k 1B6RA 5E8JA 5BNWA 4W8OA 3ZJ5A 4EEXA 2C98A 4KPEC 3FFXA 2ECQA 2H7CA 2F67A 5ALYA 1YR9A 3VHLB 5E6UA 5B3KA 1U7XA 4Q3CA 1ACMA 5BSFA 1AXEA 3UK7A 4X20B 5E1DA 3RAGA 1CERA 1L6RA 2XUKA 1M67A 1HSZA 1SXIA 2C9DA 2A0XA 2GDJA 5EJIA 4LVNA 3JQQA 1JG4A 1TECE 5DBHX 3AEXA 4R1OA 3DVSX 1L5GB 5IVHA 1GWNA 4NIMA 2H1VA 4D9BA 4DG9A 3PYMA 1MF7A 2DH6A 3LPDA 1KO4A 4DCGA 1YF3A 3QOYA 1PP4A 3A0RB 4WKPA 1E4EA 2JD1A 2PSSA 1MNQA 1N2OA 5IUJC 4PZ0A 2Z57A 2GD0A 2PGDA 3G13A 4DEYA 4CXMA 4EQZA 1JAYA 2FG5A 1DDGA 3DVAA 4GPZA 4M53A 1W5FA 3KUXA 2VUTA 3R0XA 2Q4EA 4KKVA 3V1MA 1JMYA 4YMGA 1EP2B 1JN0A 5JD3A 4MLPA 1EKXA 4B7CA 2CV1A 4GKJB 1LSJA 5TPZD 3Q9SA 4OXXA 3E48A 1CVRA 1B23P 5JVDB 4QUBA 2AT1A 3DAYA 1JRLA 1ZSVA 1NZFA 2DMRA 1F8XA 4G9BA 1N8SA 2ZRDA 3UXHA 4ENQA 1JIJA 3NHRA 4HNVA 4M7PA 4OU4A 4ZAXA 3EVCA 4YMLA 1QQ7A 3UJBA 3DG9A 5HP4A 3IR7A 1FZTA 1YBFA 3DDHA 1T3ZA 3H5AA 4XLTA 2JC3A 2OTCA 3LJKA 5DN9A 4AP5A 4CKBB 3D4OA 3VC1A 1P1CA 1XKQA 2NOAA 1E63A 1ECPA 4H7DA 3ZBPA 1CJMA 3R9WA 5C3UA 5JO9A 3AXSA 4R71A 1JXMA 1P2SA 2FWIA 4OLHA 5GY7A 1QLWA 3EZNA 2MYNA 2H1WA 3ID6C 4IFTA 1KVRA 2FEKA 1QIMA 4IZIA 5AUNB 4Y2XA 4DV5B 4KUHA 3H2GA 1E3WB 4XFKA 2VZEA 5BV8A 1DAEA 2YN2A 3JD3A 3DAFA 2QRPA 1IN4A 1FB5A 2GAJA 2OHIA 3MLEA 1EQ2A 1HRDA 4WCFC 5KOHB 3MCVA 3E9MA 3W9BA 4H1UA 2R96A 1EPUA 4TQUS 4OQYA 5A0FA 1ZLYA 3AINA 3DHNA 4DLTA 3F96A 3T38A 4AMBA 3AY0A 4UJ3A 1KI3A 2XQFA 4JOCA 1N5RA 3PPYA 1GSOA 1P4JA 3I92A 4H0NA 2AVNA 2ODAA 3FYSA 1NXTA 3D8TA 3HU1A 3KYBA 3LRTA 4PBRA 4L9AA 3S5JA 3T7TA 4DLKA 5BXYA 4OLAA 3CX6A 3HL4A 2A3NA 2MU1A 3QKUA 4OM7A 4YP7A 3O31A 4BECA 2ZSUA 3UB3A 5CLHA 4MYUA 4O59O 1ISPA 1PWZA 1WZIA 1NDQA 2JAPA 3PDWA 2F64A 3A4TA 4TT3A 5THKA 4B75A 4Z7NB 4NCJA 4W8HA 3B3JA 3PNMA 4FD2A 4ZT5A 5J40A 1Z38A 1PR9A 4KVFA 2O0LA 1CSEE 3LVBA 3QELB 2E4YA 4KDCA 4UDOA 1LK7A 1JYEA 4WFQA 4IVRA 5G40A 4D3ZA 2I7TA 3TLEA 4YAUA 1F7UA 1MMFB 1JR2A 4LCEA 4J6EA 1XAHA 1JKIA 2AE1A 2WF8A 3WZMA 2QRZA 2VHUA 1YJCA 4CQNA 1COZA 1RMTA 4TTAA 3N70A 1EHIA 3PS9A 1TTHA 3UV6A 4D56A 4Q9HA 3AFIA 2PCJA 3MBOA 1WVMA 4NMHA 1ZOOA 1YZNA 3QMVA 1F20A 2R65A 1G18A 2ST1A 3RC1A 1LWNA 5CT5A 1TD9A 1DIRA 3UJ9A 4MV3A 2VYVA 5IM4F 1US8A 1Y8AA 4B87A 2HNAA 5IC5A 1E8NA 4B4DA 4A0RA 1Z0SA 2RIPA 3TTUA 5EMJA 1IBLB 4EKGA 4OEHA 3ZWPA 2XNDA 5DK4A 3IVCA 5CURA 721PA 3O4JA 2OZEA 4K9KA 2QN9A 5FPSA 3M82A 2OQVA 4A5SA 1MKYA 5TJ9A 1NRJB 2UYOA 1CZKA 3KZKA 4JP1A 1IBSA 4US1R 1E3IA 1JSRA 1J24A 5IW8A 4FZ5A 4M46A 2HU2A 4ETMA 3WYAA 1T3SA 2BHSA 4H7KA 4B3TB 1E6EA 5BWCA 4O5AA 4G86A 3GH3A 4ZOEA 1W8DA 3PC2A 3N7UA 2QR5A 5ADHA 1RQGA 3CONA 4PGGA 4F1WA 3VHXA 2JS7A 1LV8A 1WW2A 5BSMA 1PDOA 3JR3A 4FBMA 4BFWA 3GUVA 3DMGA 4FVTA 1J0XO 3R6DA 4UCWA 3FHCB 5KSYA 1QHEA 3EZXA 2ZSKA 3DFUA 4KQ9A 3TRJA 1DOZA 4ZGGA 1L4KA 1DZ3A 1QPBA 1KJWA 3AM3A 3LHIA 4QUHA 2NO6A 2C9CA 3T0FA 1MG0A 1WD7A 1WEKA 2HWKA 4XD2A 3KTFA 3QX7A 3HN7A 2AOUB 1A7KA 5HTOA 2EZ9A 3I73A 4IF6A 3QITA 5TARA 5NLLA 4YRCA 2FRVA 5IARA 3TO5A 4BKMA 1ZYUA 4HVCA 5BMOA 2XXJA 4I0WB 4KNYA 3H5IA 2AEFA 2HTEA 3EXIB 2DWCA 5KTMA 5CFOA 4H0CA 2CXQA 2XLBA 2O8CA 3EW7A 3PQ4A 3OJ0A 4OJMX 4Q1BA 4I5DA 4X8HA 1JR3E 1U3WA 2AJ8A 1XN1A 4MI3A 2FP3A 4NDAA 2ZBUA 3NJRA 4D6PA 4D9FA 1H2AS 3D2BA 5DHAA 3K0SA 4L9SA 1X2EA 3HBNA 4NZZA 1FRFS 4RHFA 4E88A 1JLLA 4XWAA 3IILA 4S24A 3UHPA 5REQB 4XIJA 5ALSA 1M6NA 3OMXA 2F8SA 2IGBA 4CG2A 4I9FA 2VK4A 3ANYB 4QVIA 2ZT7A 5ER9A 3JQ7B 4EX7A 2GGSA 2JFOA 1ZN2A 3FYTA 2O5CA 4HDCA 3DOHA 3BWYA 1T0PA 3BKWA 5FP0A 4DNFA 1ZL0A 2X9GA 4X63A 1RPZA 4BP8A 1NLZA 1IZYA 2B6HA 3GGDA 4Q9IA 2P9BA 1KI7A 4EYGA 4BS9A 3Q7SA 5KOJA 1SC4A 1VRVA 1N75A 1XFAA 3IKLA 4RDCA 5AVTA 2WTUA 5DCYA 1A04A 1YRHA 4OUDA 5CGZA 4Q37A 1ZW1A 1XJCA 3FCAA 3TSWA 1GT6A 2G17A 3F97A 4MUAA 3UW1A 2BFFA 1QRAA 4JIGA 3KAJA 4KG7A 5AW0A 4PF1A 2AUMA 2BY4A 4RW0A 4EATA 4EHBA 2D3WA 3I2IA 3OCXA 3JATA 1E0AA 4PV7A 2E37A 4C78A 2PUJA 1HV8A 2QQGA 1Q44A 2VA9A 2CGEA 1NN0A 4PE5B 2RHCA 1YB4A 3AVWA 4L7QA 4QICA 4E21A 1EINA 1MC5A 3BRSA 4JBIA 2MMGA 1G5QA 3GVIA 3PGXA 4ZCIA 1JEOA 2WWTA 1QFSA 4WQMA 1JEAA 5JFGA 1P0FA 1YZKA 3KLMX 4C5AA 5KSPA 4YCCA 1OZHA 4H16A 4GT1A 2JIBA 4DYDA 1Y1LA 1L7AA 1FP1D 1O94A 1ANKA 4HFRA 4Y2YA 5D5PA 5F76A 4MKRA 3QW2A 5G1NA 3RF7A 5LR6A 1KFEB 2OENG 2CBZA 3NRCA 5CB4F 3LXUX 1O0BA 3STXA 1G7CA 4D80A 2B0CA 3HNPA 2PLWA 3E5MA 3O3NB 5KNDA 3RIXA 2VQ6A 3DV0B 1EVLA 2H5LA 4YJ2A 5J4HA 1J2TA 3IQZA 1E1YA 1YDFA 3Q5EA 2MOKA 1PJ8A 2CXUA 4G0QA 4GR4A 4MTLA 2P7IA 1P1JA 2RGXA 1TCVA 4HADA 1FFYA 5LB4A 1BEZA 2FSHA 3QBEA 3CEMA 1P3Y1 1BXGB 2P3SA 3P9IA 2C2HA 3I6ZA 3U7FB 4Y6SA 3C3CA 1X2BA 3MJVA 4DGSA 3SSAA 1FQOA 4Z7JA 3U6KA 1C4WA 2R86A 1ES9A 3EYAA 3WRYA 1FQWA 5DW0A 3X1KA 4MW2A 1W5EA 1VG9B 4JWKA 3RSLA 2VRCA 2GBLA 4NPHA 5I7HA 1BCSA 1E2MA 2DBQA 5F33A 1VJRA 2GLTA 1UPAA 1QIGA 2YNMD 5K7SA 2PRJA 3RFTA 3C7DB 3SQXA 1UH5A 4IICA 3LO8A 1GDTA 4B2YA 1SFRA 3HA3A 1FSPA 5DIZA 5A0VA 2OZPA 1YTLA 2HWYA 3BMQA 1EZ1A 1WKCA 3K09A 5EP1A 1JKXA 4C7JA 2BEJA 1M34E 4JBWA 4C0KA 3INYA 1X9IA 1NKTA 2C88A 4FSHA 4OK5A 5D00A 2ZRJA 5DBIA 1X3LA 2VNHA 4JA2A 3NQ41 2NYAA 2P9TA 4MMZB 4D4HA 1SXJD 4ND5A 4JJ4A 4CIDA 3UATA 1RZUA 2ZWIA 1AA6A 2O5EA 2WRZA 3N0XA 2XWJI 3TUIC 4M1QA 5CA0A 2WFZA 4H3KB 2DCUA 2J6HA 1NNLA 3T9FA 1PI3A 4RZIA 2Q2WA 1GTVA 1ZRSA 3SEZA 2VWPA 2VDOB 4KAXA 4QQKA 3PNYA 1B42A 2F2TA 2OHOA 1Y5NA 3W7VA 1C4XA 3JQDA 1MQ9A 1QTIA 5AM3A 4JH0A 1A4XA 1NLUA 4X5OA 4P0QB 3GJYA 4NRDA 2WWFA 2HWUA 2IPAB 3RS4A 1VG8A 4JBLA 3JYPA 2XUIA 5JMWA 3DO8A 1NMQA 3NGXA 5CNKA 3TPZA 1QYWA 2VJOA 2ZULA 4LECA 5LNK6 1XU7A 4N5IX 4YT4A 4S2EA 1PWXA 4D9KA 3NBZC 3FMGA 2I9PA 4IY1A 4ICIA 5HIMA 4IUYA 1ZD2P 4GO1A 3TW6A 1UJ4A 3NLLA 4GYKA 2PGAA 4RE6A 5FD8A 5K0EA 1CPYA 5EUMA 1ODLA 4PFQA 3VNQA 2M32A 1DQSA 3PGJA 2H5EA 4DS3A 4F4IA 2Z6UA 1EUQA 1VJTA 1S2OA 1M8PA 5IG2A 1EA7A 1A76A 4G65A 4MLCA 4JK3A 3D6HA 1SOVA 3LBFA 4BFXA 1WUJS 3NYQA 3DA8A 1XRRA 3ZIUA 3E81A 3VU9A 4RCYA 2GPTA 3ZBUA 5J5AA 3KL4A 1BX1A 3N75A 5HKLA 2VNKA 1J8YF 5FFMA 2JLXA 4GPD1 2JH8A 4TWJA 2RGGA 4LFCB 1WA5A 3EISA 4O0LA 1JB9A 1XJWA 3K4QA 4DJFC 4BXOB 5KWEA 2XDQB 2XTJA 2QHXA 3EEYA 4HB0A 4UMVA 3CLRC 3FNRA 3B1ZA 1QAMA 1PV1A 3ZDZB 2B36A 1KIAA 2HUPA 3ZIDA 1A9YA 2AUNA 1GFSA 4V3CA 4ARVA 4C01A 2GWHA 4C7BA 4DLZA 4O3MA 2E48A 3P2KA 4H31A 3AEQA 1Y8QA 1P7CA 1ZH8A 1FS5A 2CMKA 3H4IA 3O1LA 2NUBA 1A2QA 1XXLA 4YT8A 2IHTA 4EY6A 4RTQA 1H5NA 2V98A 1C0IA 3A1WA 3QK7A 2QB5A 1T34A 4HAOA 1AGNA 3RASA 2VP3A 1E2IA 4CEIB 3LY8A 3V2UA 5BPFA 4D3YA 4E7OA 1XYGA 3GT4A 1ZU4A 4D4GA 2W37A 2ZE8A 1ZCZA 2HV9A 2JCGA 4DDVA 1EVKA 3GRPA 3SK0A 5JCXA 3MTQA 4RH0A 1N3IA 2RHRA 2YV1A 3ESZA 2J8ZA 1M2WA 1B74A 2E1PA 1ITZA 3DV2A 4KAAA 2O59A 2PT7A 2QJRA 3LYLA 5F77A 5LQJA 3WB1A 3WK8A 2KM1A 3C3KA 4KVAA 4MWDA 4OH1A 1U90A 2H7YA 3IUEA 2O1SA 4YJFB 4B46A 4BRUA 4DA9A 4EF4A 4K2AA 2I22A 5BN5A 1VRWA 2WJYA 2JFPA 5TJHA 2VPQA 1DBQA 4ZO8A 3ITNA 2AQKA 2HSDA 3ELUA 2ZWOA 4HEHA 4ZO6A 4BFLA 4N0PA 3QMMA 4ID3A 3ECCA 2J9YB 1L4BA 1QGZA 4OLBA 5BYKA 2IE0A 4I5EA 3S2IA 3WAKA 3EMKA 3SS8A 4EVRA 2A9OA 2XOEA 2VN8A 4C3VA 1OYWA 4F5ZA 2OHFA 1U6JA 3TCKA 2IV7A 4AECA 2H0QA 3OLVA 1AKYA 4IRMA 2P2YA 5HE9A 1P33A 1YRLA 1LLQA 2EW2A 4IIJF 4NNPA 2YW2A 2GN1A 3OF3A 2HGSA 1N0VC 2J9FA 1HETA 2DBVO 5DYNA 3C85A 1L4UA 2GR9A 4OMFG 3AEZA 3BD9A 3OPMA 4CETA 3KJGA 2VQ3A 2FW8A 4QJBA 5LD2B 4G4IA 1X7ZB 4BCDA 2WWXA 1QMGA 4Q7EA 4CKWB 4CQLA 4GAEA 3WGQA 1WXHA 4DMLA 2I3ZA 4KGXA 4XQ9A 5MFZA 4RTPA 4YIKA 4ZVUA 3WJAA 1CW2B 3M6FA 5JAMA 1T91A 2P90A 5EA2A 1AO3A 3OQIB 1JHUA 2R66A 3WKCA 5JQWA 1UXGA 1IVYA 1ZK3A 3IHWA 3QU5A 3VKFA 1M3SA 2BJHA 3R0QA 1OILA 4M54A 5AW5A 2GEUA 3FMIA 5SZHB 4A1OA 1Z6YA 2EL9A 1FRQA 3OHPA 4QUGA 3SSMA 2VCYA 4NXNB 1LQTA 1HX7A 3K9HA 3WAJA 3VR2A 1AQLA 3NP9A 4RK4A 2CLDX 3OPVA 2C4NA 1W0JA 3OLCX 2XVAA 3KYDB 5K1ZA 1J06A 4MQ5A 1D3AA 1L5MA 1P4GA 1HZZA 2G1KA 2OXRA 2P5YA 2WBLC 3KKPA 2B83A 3TMYA 1AMOA 4RGYA 4HR7A 5E2IA 4QUDA 1M33A 1PNVA 3NTUA 3ESDA 2Y2VA 3RUIA 1NUHA 2AN4A 4Q9KA 1J8VA 5JV5A 3G7NA 1PS0A 3TTSA 3OWXA 4G4JA 4OFXA 2LXNA 3AUYA 3ROZA 3SHOA 2P62A 4M38A 2P9QA 2R1TA 4M7RA 3IBTA 3UANA 4J0DA 4PYQA 4F84A 2BJWA 1FU8A 2PKQO 1QE0A 1K0UA 3V2GA 3Q8KA 3N2LA 1SXGA 3GUUA 3N8IA 4CG0A 2PZ8A 3T4PA 4JI7B 4JITA 2HR1A 1GPWB 2HT1A 4GICA 3ORSA 1ECCA 1AVTA 1N2IA 3T99A 5IT5A 1W85A 1E9FA 3KR1A 4CHTA 3Q8LA 2AZ4A 1F12A 4X1YB 2BP7B 2XAUA 1PGJA 1ZICA 3GPBA 2PMKA 1EGVB 1ZM3A 3A6ZA 3G0BA 2GKGA 5ILQA 2FR0A 3NOQA 3OTQA 1IJKA 2PHZA 1ZMTA 1ESNA 3FWNA 3RTCA 4CL0A 5A4MS 5IWCA 5JYCA 1TMOA 4GIBA 3R7FA 4PCAA 4C4YA 1I9GA 2YNMC 1TDJA 2Q2VA 3LUKA 4RY0A 3FNHA 2ZB2A 3WX0A 3MELA 2X2OA 4YJKA 2AKEA 1QMPA 5B2ZA 2V4ZA 2E9SA 4RABA 3DEKA 1VYUA 1V1JA 4DCCA 1U3VA 2IYSA 3M4JA 2JIQA 1XLTC 5MGNA 2VQDA 4Y2TA 1A7UA 1Q1ZA 1F14A 2ZJ7A 3DC7A 1TZCA 1MB0A 2ONCA 1EJ0A 2BBOA 3TZHA 3TAXA 4QTYA 4BWGA 1WV1A 2N0SA 1TRKA 2J32A 4G9EA 4LYYA 3PTLA 4LJLA 1VMIA 5G1PA 3PXBA 2C4TA 2FZ4A 2ZBEA 3QUCA 1DKQA 2H5JA 3W05A 1JA9A 4X3OA 4DIKA 2UUAB 1FMJA 3BREA 3IHTA 1PCXA 3SXJA 2Z2ZA 3TGWA 3ZLBA 2A58A 3EPKA 2GPBA 4TKZA 2VDQB 4TTVA 3ZCTA 3QMPA 4F96A 2OLJA 1CQIA 1N1MA 1OT5A 3AKDA 4UNQA 4J7XA 5C31A 2FCRA 2IOQA 3D1VA 3ZZ1A 1BXRA 3ZNNA 1BMQA 4F12A 4JVOA 2XVXA 4K9RA 3BIJA 1UOEA 2WZCA 2Z9BA 4TOIA 3E35A 4YHBA 3PBKA 2Y92A 4G8JA 1H1LB 1HDIA 3JQPA 3NHMA 4HBZA 2OGTA 4C6RA 4CLHA 4V1CA 3D8BA 1MV5A 3B60A 4YN3A 1J25A 5IAOA 2VKTA 1LBTA 3HJNA 1DWOA 2F1IA 3JQ9C 5F7ZA 3I58A 1ZGGA 1ZXLA 1YNSA 2C78A 3RVRA 1ABEA 1GKYA 3CH7A 3UPTA 1FFGA 3OUTA 2F3UA 3DMFA 3TZBA 4J94A 4XARA 5HOEA 5KTSA 4JOQA 2YS7A 4IV0A 4OI4A 5KJEA 2A5GA 5BV0A 4BN4A 1PSZA 5HM6A 1GPLA 1WR8A 2WICA 4ZHSA 4NYJR 4O2BF 1QHHA 1EH5A 1MA3A 1RR6A 3ANXA 4OQFA 1F2TA 4ND3A 1YA6A 5ALTA 1ZX1A 1T6NA 3GLIE 1K8RA 1JKJA 1U8AA 5HE8A 4DQLA 4GZ5A 3ABRB 4M86A 3QVKA 3ERCA 2FJ0A 3TFWA 3IOMA 3O4HA 4HWPA 4E70A 4BKPA 4MKZA 3UMBA 1X19A 1O95D 2IXEA 3PVCA 3QVWA 4DKXA 3ND9A 1YOVA 3RRFA 1V26A 1HL7A 3PUYA 1RYBA 4F4CA 1E6MA 3RU2A 1LTHR 1DIAA 2FSUA 4IYRA 5KEIA 1N0WA 4P7GA 2BLLA 1VMKA 2W98A 3E8SA 3O26A 4HQ0A 1FSGA 3UJHA 5AKLA 2B5VA 3V7UA 1GJRA 2Q3FA 5IJ9B 1GZ7A 2UZ4A 4AY4A 2CY0A 3RJZA 3WMWA 4AIIA 1XU9A 5H0IA 3ICVA 3A1FA 3GAZA 3THRA 5BQFA 1HRKA 4D9EA 1CTQA 2I2BA 1MJGA 2PLFA 4B6JA 3RI3A 4REOA 2KLHA 2G80A 1HNWB 2HN9A 1UM8A 4ZU3A 3HRIA 1EJBA 3MJTA 5SYAA 4DARA 3ESQA 3EZ9A 1RCUA 4QU0A 4KIFA 4ZEVA 2EKDA 4X9XA 1B1AA 5TGZA 5AQEA 4PG4A 4Q39A 2Q5JA 4BRWA 1QUEA 2BFEA 3SN6A 4KLRA 1U0BB 1BVHA 1QYIA 4KDFA 5H70A 2ZZMA 1Y4SA 3ILVA 4AKGA 5BN4A 2TRSB 1MA0A 2BJVA 2J6CA 3C8ZA 4N49A 2BFNA 4ZDWA 5L3SA 1F0NA 3E15A 3JU3A 3PGVA 4WESA 3Q6IA 1P0CA 5DSXA 5B4TA 1R8SA 2A9FA 2OXEA 2YHUA 2GYVA 3QH4A 2MIIA 4O4IA 3RJ9A 5FH9A 3VA7A 1OTXA 1L2TA 2E55A 2JFGA 5CFLA 1JJBA 3QWFA 5AI4A 2GNOA 2GN4A 2HLNA 3CZ5A 2CMHA 4IRXA 3UB2A 5C5DA 3BMOB 4XD7D 5AHXA 5DN6D 3JQ8B 5IVKA 1SG6A 3K3PA 5IYZA 4HGNA 2B8EA 3DMTC 4NE2A 2D2XA 1V11B 4L4YA 4XIFA 5K8JB 3Q88A 1E66A 1E9BA 1UWCA 2CXOA 5K3BA 5BSEA 1ARZA 3Q3VA 4HOYA 1GN9A 1RZ3A 2KW5A 1XN4A 4KWHA 1WQ1R 2R1VB 1G8SA 3KWLA 4L0DA 5TS3A 4CMBA 4P4UA 2Q5EA 2FQXA 2ABWA 3ZVLA 1L8XA 1OX6A 2GI4A 6ABPA 4GR5A 3QFSA 3GLFA 1JDJA 2VLBA 4FINA 2YVLA 3V97A 5KZMB 2FETA 3M7IA 1RP7A 4NG4A 4J0FA 3BK1A 2PT9A 3CCFA 4A2PA 3BORA 1JNXX 2JFNA 3K0CA 1H0RA 2E1RA 4Q02A 1FS4A 3RK1A 1FJXA 1ZEMA 1BDJA 1XMIA 2GLXA 2ODPA 3UV7A 5A1TA 1A8SA 1VMEA 3B2QA 5J2UF 3H9CA 4PGFA 1S2GA