3R3HA

Crystal structure of o-methyltransferase from legionella pneumophila
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords O-methyltransferase, SAM-dependent
publication title Crystal structure of O-methyltransferase from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 67
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r3hA00
2IH4A 2C7QA 4OBWA 4ER7A 4FP9A 3HVJA 4YUWA 3E7PA 1R8XA 3OCJA 3PVCA 5HZMA 3BKWA 1T43A 3G5TA 4L7VA 5BP7A 5HIKA 5K0EA 3LL7A 3NTVA 5HIMA 3LPMA 4M37A 2NYUA 2LD4A 5HILA 2PX8A 2NP6A 4BLVA 4A6DA 4YUXA 1FPQA 3UJ9A 5HEKA 5F2OA 1XCLA 3DULA 5HIIA 1NW7A 3HCDA 1KPHA 2OY0A 4HH4A 4MIKA 5ICEA 4MHTA 1P1CA 2AN5A 5MHTA 5K03A 3L8DA 4GEKA 1YUBA 1XCJA 2HWKA 3LKZA 1ORHA 2IPXA 3BKXA 3UJCA 2UYQA 2QRVA 2BM8A 3HVHA 3GRYA 3FUXA 3FUVA 8MHTA 1JQDA 1O9GA 2ZBQA 5P8WA 5K0FA 3M6UA 4QQKA 5CVUA 5H02A 2PVCA 3G2PA 3LCUA 3PT9A 1RI3A 5K05A 1YFLA 3ID6C 4BP3A 4PCLA 5JR3A 5KYGA 4FT4A 1VP3A 4FT2A 1UIRA 1SUIA 2ZLBA 5E1MA 1WY7A 2P3QA 4BP1A 3KPWA 2PBFA 4U7TB 2YQZA 3OFJA 4HGYA 5C1IA 4PIPA 3TQSA 4E2WA 3A7DA 2PX4A 4RX1A 3C0KA 4XUCA 3HEMA 2JHPA 2C7RA 4F85A 5FTWA 4M36A 4QVGA 2A14A 1YF3A 3BZBA 5E8JA 5KQRA 2VDUE 3NW9A 3CJRA 5E9WA 2JHCA 2YXDA 1G38A 1P91A 2ZBPA 3A25A 4R6WA 3R24A 4RV9A 3ELWA 5FQNA 3EVBA 1TPYA 1BKYA 4C06A 3HVKA 4POOA 4V0QA 4C4AA 3VC1A 5LQRA 4A6EA 3R3HA 5CIYA 2IIPA 3T7RA 3NDIA 1ZKDA 3M6XA 1WZNA 4E31A 2UYHA 2IGTA 3KQMA 4V0RA 4HGZA 5EKUA 2GH1A 5IH3A 5EIWA 5K8VA 4QPPA 1WG8A 3FZGA 4IWNA 2Z6QA 4EVIA 4PYMA 4KVZA 1V39A 3ELDA 5KVAA 3EGEA 1UFKA 1WS6A 3M6WA 2YTZA 4PONA 1KPGA 1AV6A 4R05A 3HCEA 1XDSA 3BGDA 4B17A 4UOEA 5BXYA 3BGVA 2NP7A 3O7WA 3TFWA 1B42A 3KQVA 2ZSUA 4PINA 3M6VA 3KQSA 3FPEA 2EG5A 1VQ1A 2FHPA 2PGXA 3GRRA 3LECA 4BLWA 5K09A 3EVDA 1ZGJA 5DX8A 1QAMA 4MTLA 2NNWB 3V8VA 5DX1A 2IH2A 4RTSA 3EEYA 2ERCA 1R8YA 1VBFA 3AJDA 2P3OA 1JG3A 1VLMA 4RSRA 1VL5A 3LDUA 3OE5A 3A27A 2AOXA 2JH8A 1FBNA 1KR5A 1U2ZA 2UYOA 2VDWA 3MCTA 2IH5A 4FSDA 2PT9A 3ELUA 4EKGA 4GF5A 5LR6A 3UJ7A 1ZGAA 3TLJA 3DH0A 5EZQA 1VP9A 5GWXA 5LQCA 3DXXA 4E2YA 3B5IA 3NVKI 3MTIA 2EJTA 1F38A 5E8RA 3DP7A 1YZHA 1JR4A 2G1PA 2FPOA 3B3FA 3SR4A 5DWQA 3SSMA 2FRXA 2ONZA 2PXXA 2OZVA 5EG5A 1JSZA 2BR3A 2ZZMA 3TM5A 1PRYA 5DM0A 4E2ZA 1Q0TA 1X19A 3F4KA 2CMGA 2OKCA 4PYKA 5E9QA 3PLAE 3IV6A 4YMHA 3R0QA 3HA7A 3SVZA 3E8SA 2IBTA 4QDJA 9MHTA 1SG9A 2PLWA 3JWHA 2PKWA 4DCGA 2PY6A 2ZULA 5F2KA 3BT7A 2JHAA 4DM3A 2GPYA 1NBHA 1JG4A 1SVUA 2QRVB 2UZ4A 3Q87B 5M5BA 4P7FA 2VDVE 1EJ0A 3BGIA 1NW6A 5C0OE 2ADMA 4RTMA 3NDJA 3THSA 1Q0SA 2V7EA 3IYLW 3MTEA 3GU3A 5D1HA 3UA3A 2P1DA 3EVFA 2B2CA 3MCZA 1ORIA 2O06A 3S68A 3VC2A 2P8JA 3MAGA 2AVNA 2AZTA 4QQNA 5FWAA 4E70A 4K6MA 3OFKA 3SM3A 3KR0A 5CVEA 4CKEA 4AZTA 3OZSA 4X60A 3DLCA 2F8LA 3G8AA 4XCXA 1RJFA 3UJDA 4AZVA 2AS0A 1R00A 1ZG3A 2XYRA 3FUWA 4RWZA 1JG1A 2ZZKA 3LBFA 3R6TA 1XJ5A 4U7PB 3HTXA 5FHRA 5FCDA 4EK9A 3G2QA 3SMQA 3U81A 1X1BA 5CVDA 4AZSA 5FULA 5K0GA 3EVEA 2BH2A 3MB5A 2XBMA 2YVLA 4WXHA 3BXOA 2CMHA 3DOUA 3QOWA 4X41A 4DF3A 3MHTA 2ORED 1NW5A 5ICCA 1N7JA 3A26A 2PXAA 3B3GA 3CC8A 1KXZA 1F3LA 5BW5A 4GQBA 5DXAA 2AOWA 3P9CA 3LBYA 2HR1A 3CJTA 1JSXA 2E5WA 3E05A 4GBED 4PYQA 4AX8A 4YV1A 3KPYA 3I53A 5FA8A 1XDZA 2ZFUA 5FWDA 3K0BA 3PFGA 3RODA 1DCTA 1TW2A 5EMKA 1L3CA 1NW3A 1XXLA 2HMYB 1EAMA 4P7GA 3G89A 1N2XA 1RI1A 1JTFA 4PCAA 1JTEA 5EMJA 5DTRA 3UJ8A 5K0BA 5U4XA 5FQOA 2XVAA 5FADA 4OA8A 7MHTA 3BUSA 5EZSA 3FPGA 2PV0A 4R8SA 5CCBA 1R18A 1L1EA 3KU1A 4IV0A 2CKDA 5EEGA 1YFJA 2CWWA 1XVAA 1X1CA 3PX3A 4WVLA 3CKKA 3T7TA 2P41A 4HG2A 4X1OA 3I64A 1UWVA 2ZW9A 2C7PA 5BW4A 4PWYA 3T7SA 3GRZA 3O31A 1L3BA 1P1BA 2H1RA 5DLYA 2OYRA 2AN4A 5EMMA 1D2CA 3KHKA 4BY9E 3P2EA 3HM2A 2XVMA 4RTPA 2YR0A 2QY6A 2GS9A 4FGZA 3OU7A 4LG1A 5GOZA 1P39A 2O0LA 3OZTA 3DLIA 3TPZA 1VE3A 3G88A 3LX6A 3NWBA 4PYLA 2FCAA 5EGSA 1EJ6A 1RJDA 2QE6A 4AUKA 4RVHA 4R6XA 5JUWA 5LSAA 3ER9A 3UJBA 5DRYA 2NXCA 3LSTA 1FJXA 3CJQA 2G71A 2ZIGA 2P40A 3OU6A 3BWBA 5KQSA 2NXJA 1M6EX 4LWOA 3TR6A 3EGVA 2B9EA 3KQPA 1ZHFA 5CVVA 3UZUA 4RTJA 5EC8A 4EQZA 4XUEA 2OXTA 3G2MA 5T67A 4RVDA 2I62A 3LHDA 2H00A 3DR5A 2EFJA 1KHHA 3P8ZA 3PTAA 2Z6UA 4X63A 5EQJB 3SX0A 1NV9A 4F86A 2P7IA 2PX5A 2YXLA 2IDKA 4RTKA 2CL5A 1KYWA 3OE4A 4FZVA 1RJEA 5EPEA 3Q7EA 4DZRA 1JG2A 4E33A 4FSXA 4KDRA 3FPJA 3D2LA 2B78A 3REOA 3TKAA 5F2NA 2ESRA 4RVFA 5CVJA 2IFTA 1I9GA 1G55A 1SQFA 2ZBRA 5LQJA 3T0IA 5DT2A 3THRA 3MQ2A 1NKVA 2R6ZA 1AQJA 4ER5A 4RTNA 4KDCA 3GDHA 3P2IA 3KR2A 3DUWA 3PFHA 4HTFB 3UJ6A 4KIGA 5HIJA 5CM2Z 4ER6A 4QPNA 5LQUA 2IBSA 4PIMA 4ATNA 3SSNA 3MGGA 5GM1A 4GOMD 4P7JA 1RI4A 4ZTBA 3M4XA 5EKXA 1EQAA 1QAQA 3G2OA 4RVGA 2OB2A 5ICFA 3E23A 4EMSA 2VP3A 4OA5A 3GXOA 3ORHA 5GP1A 1JQEA 2BR4A 3UJAA 4CTKA 1INLA 1IM8A 2GAFA 3VYWA 3MERA 2AVDA 4RYLA 3EMDA 4OBXA 2PWPA 3A7EA 4YV2A 3AXTA 1ZQ9A 2YXEA 1X1AA 4JXJA 1NBIA 4M7RA 1L3IA 2ZIEA 4QTUB 5DSXA 2WK1A 4GC9A 2O05A 4H0NA 5T6BA 1FP2A 3DXZA 3LCCA 4DMGA 2EJUA 1G8AA 3GO4A 3C3YA 3KQYA 5EVJA 5K0JA 3HCCA 3X0DA 2BZGA 1I1NA 4R8RA 1IXKA 3HNRA 3FUUA 2UYCA 2IP2A 2HNKA 4HTFA 2P3LA 2WA1A 3CVOA 3FUTA 2PX2A 5C9ZA 3DTNA 1XTPA 4Y30A 5T64A 3V97A 2Z6AA 1RI5A 3KPVA 5ERGB 4IKPA 4NECA 2I7CA 2Y1WA 3DXYA 2HV9A 3FYDA 5DX0A 5E1BA 5DSTA 1BHJA 1OR8A 3FRHA 4KWCA 5LQKA 2PT6A 1H1DA 4X61A 4QDKA 3OU2A 2BR5A 3NMUF 2PJDA 5D1NA 4E30A 4RTRA 3CCFA 3HVIA 4HRAA 1SKMA 2JH9A 2G72A 5E1OA 4BLUA 5LQAA 1IY9A 1KPIA 4PYJA 3ELYA 5DTQA 3TKYA 5KS2A 3GNLA 4GUAA 1Z3CA 4KIFA 1YB2A 3C6KA 2K4MA 2P7HA 4C04A 4CKBA 5K01A 3SXJA 4YMGA 2I9KA 3UFBA 3NWEA 4FS8A 2R3SA 3TRKA 1KP9A 2FYTA 2ZWAA 4RTQA 2AOTB 1MJFA 4HSGA 2FK8A 1JQ3A 4DCMA 4E2XA 3HCAA 4OQDA 3JWIA 4DKJA 3KPJA 3B3JA 5DPMA 2PWYA 3EEOA 2JG3A 2DPMA 2QM3A 4FR0A 3B89A 4XUDA 1TW3A 3OPNA 3I9FA 4HC4A 3DMHA 5DXJA 2YUIA 3LGAA 1VIDA 3VSEA 3GGDA 4MWZA 5E9JA 3HP7A 1G60A 2ZWVA 3FYCA 5EMLA 1AQIA 3FPFA 4YUYA 3CGGA 2NXEA 3P2KA 4M38A 3ME5A 5FUBA 1RI2A 3C3PA 3GRUA 5GM2A 3I5UA 2O07A 2B3TA 4G56A 1NE2A 4YUVA 5G02A 1EG2A 3JWGA 3JWJA 3M33A 3KQOA 3HA3A 3FTDA 3HCFA 4LECA 3GJYA 2YX1A 4PGGA 3QV2A 3RIEA 2I6GA 1L9KA 3EVZA 3GIWA 3FRIA 4RTLA 3P71T 4PYOA 1X1DA 2AOTA 4C03A 3B7PA 3G5LA 5HFJA 4GOLD 3FTCA 3EVAA 3ER8A 2IDJA 3C6MA 4YV0A 2OB1A 1QYRA 3IHTA 4O29A 3UA4A 2ZIFA 2PSSA 1VPTA 4F84A 3A4TA 5K0LA 2ZVJA 2B25A 4EKIA 2OO3A 2ONYA 1BC5A 3KPUA 3NVMB 5K0CA 1NT2A 3TOSA 3M70A 4KRGA 1N7IA 3KR1A 4PYNA 3GCZA 5EIFA 2VS1A 10MHA 5E2BA 3I58A 1KYZA 1R74A 3LDGA 3TM4A 3KR9A 4P58A 2VZ9A 3FTFA 4OX9Y 3FPHA 4OQEA 3QOXA 1WXXA 2P35A 1M0EA 2ZZNA 5CUQA 3RW9A 5ICGA 2GB4A 3P9IA 3HA5A 3P9NA 2OBFA 4PYIA 3KQQA 3WSTA 4YUZA 1RJGA 3UWPA 5DM2A 3IEIA 4IV8A 3AXSA 2N47A 4KW7A 4P7KA 5E2AA 4DQ0A 3R9XB 4CTJA 4C08A 2AN3A 3BWYA 1QANA 3EVGA 2ZCJA 2GLUA 3EMBA 3G8BA 1FP1D 1HNNA 1NV8A 1O54A 3DMGA 3EVCA 2O57A 1EIZA 2EX4A 3BWCA 2XYQA 3CBGA 5FHQA 4QVKA 5EOVA 2H11A 4CKCA 4E32A 5K0NA 3AY0A 3OZRA 5CD1A 3LDFA 5GIPE 1G8SA 2AR0A 4GOND 5DRTA 5EHIA 4DA4A 4PNEA 3LCVB 4GOOD 1D2GA 1XDUA 1D2HA 1QZZA 1DUSA 1O9HA 1SUSA 1M6YA 2PXCA 2ZTHA 3GWZA 4LWPA 2AOUB 2NXNA 3UBTA 1Y8CA 1WXWA 2QYOA 3SGLA 3HCBA 5E1DA 4ER0A 3LKDA 2AOVA 5IKMA 2DULA 1SQGA 4C05A 4ER3A 4Z2YA 1PJZA 2GA9A 2OPBA 3NJRA 4GC5A 3BWMA 2V74B 4QTTB 3PX2A 3DMFA 3G7UA 1G6Q1 1DL5A 2BM9A 5FA5A 5GINE 3ANXA 1YZ3A 3EGIA 1KIAA 3P9KA 5EEHA 2FK7A 1HMYA 2HTEA 4AZWA 2WA2A 1BOOA 2Q41A 3O4FA 3H2BA 3GRVA 5DTMA 1MHTA 1R6AA 2G70A 3KQTA 3KKZA 5GIOE 2G8NA 5DM1A 2KW5A 2AOUA 2Y1XA 3AWIA 3PB3A 3ERCA 5LQNA 3TMAA 5DM4A 1NW8A 3EPPA 4PGHA 1I4WA 2JJQA 3SSOA 4ISCA 4CWAA 3K6RA 3KQWA 3FTEA 1AF7A 3PS9A 5HOQA 2C7OA 1QAOA 3P97A 5EHGA 4Y2HA 4RTOA 5B1SA 4C07A 5CCXA 4CXMA 4MQ4A 2XYVA
chains in the Genus database with same CATH superfamily
2Z3ZA 4TV8A 1KQGA 3HDVA 2YASA 5JVDB 1FPMA 1YZKA 1ORDA 1E18A 3E61A 3G5TA 4WNCA 2WJGA 3QTBA 3RPEA 1NXTA 4DUYB 3LPMA 4M37A 3SHVA 5D5QA 1YZTA 1H2FA 3UJ9A 5HEKA 4CEJB 1U1FA 4HRXA 2H85A 3G0OA 3NNSA 4XEUA 3DE5X 5CNJA 4IUDS 4ZWNA 2HX1A 1Y42X 2GZMA 5M04A 1UOEA 4Y9SA 3ENQA 3AIKA 1Q1AA 4UVDA 3RRBA 2V9PA 4I4TB 4BMNA 5SZKB 3DJFA 3FUVA 1WF3A 3B8EA 3K9BA 3KYJB 4EUEA 2W2VA 4HDMA 3O4JA 3UB4A 4YCMA 2HA0A 4C1NA 1A8UA 2NUAA 3LCUA 3MAJA 4RHCA 4ZDWA 5C1PA 3OZCA 5EPOA 2XQKA 2YBEA 2JCBA 4ZD6A 2IEZA 2JGNA 4R1SA 3PA8A 4CG2A 1EX7A 2IHBA 2RHWA 5EJEA 4KN8A 4FT2A 3QG1A 1IZ9A 4U7TB 4KQKA 4BNGA 1RLUA 3K70D 1QIHA 1A7AA 1KY3A 3T3DA 3TD6A 4DA8A 1PD1A 2GKSA 1MV5A 4E46A 5JMWA 1GNTA 3T9CA 4BO3A 1GQSA 2ZXFA 2ZRHA 3U1TA 5IF3A 3QBDA 4TLDA 2Q5HA 1TCBA 1ZKMA 2YCLA 2ZIXB 4GI3A 2M1XA 3H9EO 1RC8A 3AOEA 4Q3OA 3UGJA 4DLAA 4I55F 1ZXLA 1F2UA 5HMLA 5CIYA 4E6PA 1I2CA 1CUDA 1V1RA 1B3RA 1V25A 3IVAA 1JU4A 5ALHA 2DE0X 1SFRA 4Y2UA 2UYHA 5F76A 2I4OA 4MKHA 2GH1A 3DV0B 1SKYB 4CF7A 3U26A 2JJ2D 4M88A 4XLLA 1SWWA 4AYTA 3QXCA 3JYQA 5L7YA 2E1RA 4BE9A 2V96A 4HGOA 5BMVF 2WAXA 3FHCB 3CINA 1W96A 2GNPA 1I0ZA 4L08A 2YH2A 4CM3A 4TMXA 2ZSFA 1IIBA 1NVWQ 2W2QA 2PDAA 4PONA 3CVVA 1CS0A 3P0JA 2DLCX 1CUXA 1E2FA 1WMDA 2H0AA 3HN2A 3KVRA 4GD3Q 3ZIAD 3TSAA 1RXVA 3KQSA 4O4LB 4WZAB 2QXTA 2WDPA 3VU0A 1UBKS 1N3BA 1YI1A 3RVLA 1Q74A 5K09A 2NACA 4O5OA 2WF8A 4FFDA 4BEWA 1DTWA 3VKHA 2ODWA 2ETXA 3C6QA 3I2KA 2QQFA 2Y4NA 5BV2P 2I80A 4HEQA 1M2HA 2GM5A 1NQUA 2NGRA 4DRYA 4PNZA 3ZJYA 4C43A 2FMTA 5EN4A 1J00A 1X7ZA 4NRDA 2C92A 1K3FA 2Z5LA 3LXMA 2VDOB 4XIYA 5CLLA 4BRUA 5LBTA 2AZMA 1QIEA 2DFPA 1T5OA 5CGZA 3EBOA 4IY1A 3AHCA 4DZTA 1GJRA 1RDFA 1AN0A 4GF5A 2QLJA 3FCXA 1MB2A 1X0VA 3I0ZA 3HWX1 1EHCA 3B36A 3DE3X 4NBLA 2AX4A 4QBIA 3G9ZA 5LNK1 1YSCA 3MTIA 1EFVB 3RS2A 2EJTA 4XLTA 2SBTA 4R2LA 5FBHA 1G5RA 2AYXA 2EP7A 4FFWA 1E77A 3NKVA 2ET6A 1IUKA 1XVTA 1E7WA 1VMDA 2OCKA 2QTWB 4G0PA 1RYNA 4H7DA 4YMWA 4F2WA 1FSPA 3TE6A 3LIPA 1EBFA 4G36A 2YRFA 4CNBA 1QJ4A 4Q4AA 4R2WA 3Q98A 3TNDA 3T5DA 3FCYA 1YL5A 1ZSVA 1XEWX 2N1BA 3NGXA 4GE0A 3KE9A 4QODA 1AZSC 3JWHA 3RARA 4GS5A 4R1QA 3T4XA 3LK6A 3GUHA 4ZJYA 4G84A 3E9EA 4XJXA 1RBZA 2H65A 1M8GA 2HWXA 4Q4JB 4XW2A 3ZQ4A 4B3MB 4ARIA 2M2IA 4OHKA 3F1LA 2GWHA 1MIHA 2H08A 4Q3EA 2K7ZA 2Q6IA 3VDQA 4XAQA 4R1LA 4F04A 3RREA 1UXOA 5EQTA 2FXVA 1NVTA 2J0EA 1VL2A 4PSCA 3S68A 5IM4A 4EI7A 2UZ3A 5ILQA 2P8JA 3EE6A 4PGAA 3HO1A 3NYRA 4TLAA 1M1YA 1Z62A 1UJCA 5BSKA 2JZCA 1K8XB 1ICIA 3ESXA 1II8A 1QYWA 4Q15A 2BDUA 1L7QA 2IYTA 1MOZA 4V0KA 1JJFA 1G4UR 1KAEA 4RWZA 1JG1A 5H3HA 1MGPA 4GWKA 1SOVA 3EMKA 1Z5PA 2PGOA 2X4DA 3COVA 4AZSA 3CH7A 4KIJA 1LRJA 3NTQA 3IVXA 3OEHD 2XBMA 1E7QA 1H6AA 1LDBA 3E22A 2ZI9A 3EYWA 3SZGA 4EJSA 1DAFA 1LBEA 1VB3A 4D5GA 1VZ2A 3Q4GA 2YWXA 2PLFA 4B83A 5ENZA 4DIBA 1RAEA 3A6HA 4PLVA 3ZCQA 1MORA 3LBYA 5JZOA 5B1HA 4M0CA 4Z1MA 4DG9A 2ALJA 1PWEA 3DTVA 1UBHS 3ZHRA 5JY6A 1R3DA 5GADl 1FXWF 1UM8A 2KWIA 3QTLA 4TZKA 2J33A 1M8PA 2IKQA 4JLSA 5KVCA 1I7DA 3T3MB 1CR6A 4FDAA 4F71A 5EMKA 4LRYA 2VQEB 4W7IA 2Y27A 1JDSA 5IT5A 2O3SA 1GA1A 4HXEB 1EK0A 3A4LA 4ARSA 2OXCA 2IU3A 4H6PA 2WMOB 2YHSA 5G3YA 3O3MB 4REQA 2JAQA 3VHQA 1CTQA 3T15A 3G1WA 4OXQA 3OOSA 5JANA 4ZTUB 4GICA 2I6FA 1DWQA 3F0TA 4MQEB 4R7TA 3K1JA 4R8SA 3W6UA 3D5TA 2D0OB 4WADA 1HETA 4YAUA 3IVRA 4XSVA 4QBHA 4HUJA 1O95C 2GBFA 3AEQA 1XXHB 2K2WA 4ZVRA 1IU9A 4GZ6A 4X1OA 3WL3A 1WAMA 4XLZA 2C7PA 1VDMA 2EL9A 5FXMA 3OOHA 3O31A 4KN6A 5F5LA 3Q3CA 1Y6QA 5DLYA 2PG3A 5EMMA 1VHLA 4LYYA 1I9CA 4QNRA 2ONJA 3O3CA 4B6EA 4BY9E 3OECA 2GS9A 2P4HX 1GUZA 2Q0HA 2SKEA 1S01A 4ZV7A 4LS3A 4OP3A 2YZKA 4KVFA 3LZCA 5CFQA 4GBGA 1E58A 3DW1X 1YCGA 1GNQA 2JFPA 2VCHA 4Z6KA 1IDN1 5ITSA 2JFXA 3LUBA 4AUKA 2HWWA 3EXFB 3U49A 4ZFNA 2DT5A 3QYFA 4KZPA 3EZNA 3WLTA 2YOFA 2Z30A 3VM6A 5BXQC 3RWMB 4DV2B 2EZTA 3ED5A 2IUUA 4FX2A 1P1HA 3SR3A 3HM9A 3RTGA 2YNMA 1TC2A 3JQ8B 5F3RA 4H17A 5EWLB 2JL1A 4X1YB 1L7EA 1QUFA 4EAQA 1S2LA 3K1YA 5FLKA 4OQMA 3G2MA 1QGAA 2VZ0A 1XLUA 4JY7A 4Y3UA 1F0KA 2Y67A 3SDZA 1MDBA 1PD0A 4G23A 4F86A 4BDSA 3H1FA 3G2IA 4MRMB 4DIOA 4LHZA 4KR6A 4NZMA 4AU1A 3EDOA 3ZWKA 1XMXA 4G0ZA 4DL9A 1XFAA 2H1CA 2DBZA 3FLBA 2BUBA 4EW6A 1HG1A 2WAOA 3LHFA 1AKTA 4CR6A 4P3KA 5F2NA 3U61B 1A1SA 1VGVA 2A30A 2IZZA 1UBOS 3O03A 4P5DA 4YDQA 5F2EA 4FK8A 2XCRB 1E3DA 1QIMA 1C8LA 1T2UA 2VJMB 3ZK8A 3GCWA 2ACVA 5K4GA 4RCVA 4AF8A 1UFQA 5B57C 3VBEA 1FFYA 4MHOA 4CKEB 3TW6A 4YYZA 3EDCA 2VPZA 3JVUA 5I6DA 3DM5A 5KYXA 1ZESA 3F7MA 1GQFA 1L7PA 3HP1A 4P7JA 4J0QA 4BU0A 1QAQA 4RVGA 1IN7A 4KVGA 4MS1A 1NUSA 2QRNA 2QTRA 1RQ2A 2RJOA 3GXOA 1TZKA 3CONA 3H13A 2BR4A 4J3NA 4EYEA 3VZRA 1C50A 4F4DA 4JI4B 3QF4B 3V1MA 4P92A 5EUCA 2JLRA 2I6QA 3TR0A 3C7TA 3KFVA 4F1JA 3L79A 2ILVA 3LVQE 5FX2A 3KC2A 3STVA 1GPNA 2EQBA 1L1RA 4FHCA 4CN8A 2DPYA 2ZIEA 4GX0A 1KERA 2OLEA 1OXMA 1QYDA 2YHIA 2ZYDA 1JR2A 1TCAA 3KQYA 3WGHA 3ANYB 4ZVVA 4IBOA 2WILA 1OVMA 5KYYB 3CNLA 3CLUD 4JJ7A 4R84A 2OA0A 4N3GA 5JRJA 1XD9A 1Z5ZA 1OXBB 2O0HA 1NR1A 5FPPA 1F6WA 4ID3A 4RJKA 4D57A 2PWBA 5JSZB 4C29A 5L4NA 3B70A 9LDBA 2Y93A 4XOUA 3ZYCA 1JIJA 1U9YA 2XDQA 1U9ZA 2Y1WA 1MQ8B 3OMWA 4FYWA 2QVBA 1QHSA 3DC7A 1YQGA 2EKBA 2GSWA 1NAIA 3O1IC 2OC4A 2IXGA 3CR3C 2BFBA 2QHXA 4FI3C 3CH4B 4IXWA 3GRFA 4F4HA 2V98A 4XCQA 2IHNA 1MG0A 2FG6C 1U8YA 1Y37A 1ZOLA 3CCFA 3HDYA 3I92A 2JH9A 3N0WA 4RFLA 2G72A 5L3QA 1KH3A 1Z22A 2JANA 1IH8A 2POQX 3IKVA 4FIDA 5AXCA 1TK9A 4PYJA 3TUZC 1HOTA 3IOYA 3LGSA 1NJGA 2Z57A 2EX0A 3IUPA 1Y82A 2A1TR 3DDUA 3NWOA 4EGSA 5FBZA 1RE0A 1VL1A 1HA3A 1UP4A 2Q9BA 3I73A 4W5OA 3GPLA 2VT3A 5L4SA 4YCSA 4B81A 3L4EA 4GSKA 2G5GX 4D6YA 3WQQA 3V00A 3EEOA 5AM3A 4X95A 3K35A 4DT1B 4ZZ2A 1R0YA 3JAKA 4RE6A 4AD8A 1Y8RB 2PUDA 1YCFA 4UTZA 1DOZA 2DTDA 5E9AA 1ZK3A 1A71A 4GXNA 4PZCA 3WIVA 4AQYB 1THMA 3JWEA 3BM5A 4QT0A 1FTGA 4XDYA 3K0AA 3HBLA 2PBRA 4GOXA 4TT3D 4QXMA 2O8NA 4G1BA 3O73A 1DBPA 2DUNA 3H4TA 4X8MA 1FK8A 2G9UA 3SIRA 1N34B 1I7NA 5AHRA 1BDBA 4II2A 2J9FA 3NEPX 4C0KA 1DXQA 1OXTA 4QBTA 1I5EA 5TLSA 1T9AA 1CUSA 3IURA 4DA7A 3CVUA 1YTLA 2YW2A 4DEYA 5T4HA 1PIWA 2EWVA 2ZBEA 1ZH4A 2DBYA 1XB2A 1KARA 1DDGA 1E9CA 1DRJA 3LG2A 2PVPA 2XMGA 4BQSA 1T2NA 3PVSA 1E99A 2C4TA 2PAFA 2XITA 2Z58A 2AMYA 2J4FA 3PHHA 2E4ZA 2HEGA 3CF0A 3GEDA 5B30A 5JDIC 1P73A 3HBFA 3QFFA 3C3MA 3BJEA 3ZJUA 2GEKA 3VTAA 1KYZA 1R74A 4IF4A 3LP5A 3VUEA 1W36D 2QQGA 2XMRA 4OQEA 4PSVA 4FYIA 1QXSA 1BMDA 2XOKA 2BGRA 1XCBA 2NLOA 4MHSA 2WJAA 4HH3C 4X7BA 5CUQA 5HS6A 1RSZA 4TTSA 4W8GA 5ER6A 2ZYGA 3C74A 3ANSA 2FI1A 3QU2A 1ORVA 3RYFA 3CKLA 1JEEA 5B6JA 3OZDA 3D43A 3TX6A 4N3AA 5IVPA 3ZZMA 3T7IA 4CF6A 5ED0A 1U9JA 3UV6A 5HZKA 1N2SA 4DANA 4H1VA 5IUKC 1FA9A 1J56A 3IOMA 3AM4A 3DOOA 3O9ZA 4U7FA 1ZD5A 3TIFA 4L6IA 3LLUA 2Q5FA 4Q18A 1WCWA 2FEMA 5A9SB 4TSFA 5CLQA 2AMFA 1TX4B 2ROQA 1HT1E 2NU8B 1OI3A 3IQEA 1DIGA 1FS6A 4EG3A 3IT2A 3DL2A 1QP4A 4GKKB 5E3JA 1YR1A 5TQVA 4KXNA 3T5BA 1CDZA 1DUSA 5EFZA 3GWZA 4YJ2B 1XZIA 2C61A 2P2SA 3GP5A 2QP4A 2YXBA 4GNKA 4OJYA 1LPMA 3P5BA 5EJ2A 3NDRA 2Q4EA 5AW4A 3T94A 4WXPA 3GZTB 1BFKA 4X65B 3W8DA 3S2SA 3QLTA 2WSBA 3OUUA 5DGDA 3ZR4B 3PL5A 3SY8A 3EFOA 3BCUA 3OIYA 4D9EA 2BHRA 2ZAYA 3W7VA 5CCEA 2TS1A 4QTTB 4OXKA 2IX3A 1PJBA 1YOVB 1AKQA 1YDWA 5EIAA 3K16A 3MJRA 4B46A 2ON6A 4M98A 2REOA 4IGEA 4HI0E 1CUFA 1XO1A 1LBSA 1M2VB 5FEUA 1CF4A 1M8KA 3KQTA 4IIJF 1G8KA 3KKZA 1M75A 1VL8A 3ZQUA 4ITUA 1H2RS 1TJ5A 5ALUA 5BN4A 1M1NB 2AOUA 3U4QA 1AGPA 4IFBA 2UUPA 1HUQA 2IIBA 4R9SA 3VTKA 2QPLA 3LO8A 1HDEA 2BHLA 3W05A 3ZHZA 1QH1A 4JYZA 5LOVB 1G8GA 1IMJA 1QHHB 1ZINA 3NHWA 3TVTA 5CT9A 2QX7A 1JEAA 3A9SA 4NFHA 1PFVA 2A5FA 2OAGA 1FUYB 1VHQA 3GA7A 4UAGA 4Y2HA 3BZUA 5KAMA 3T5CA 3UAXA 2ZUSA 3K3PA 1LLQA 2FP3A 4ZCIA 5K6AC 9GPBA 2GZHA 2Q5QA 4NZYA 4Z4CA 4YY3B 5JALA 2HSZA 4WBXC 4FC6A 3VHLB 1EUDB 2JA1A 3VYRB 1TTTA 1UM9B 2AJTA 3GFQA 3RK0A 2VYND 4O8ZA 4IL5A 3K15A 3H8JA 3KS9A 2Q1TA 3L7MA 5SYMA 3UAOA 3WWOA 5AW7A 2PH3A 1EA7A 5EUQB 2NW6A 2VPPA 4LEIA 4KMRA 4RL6A 1LW6E 1O77A 1CRWG 2XTMA 4YIKA 3T7KA 2PYIA 1TQDA 3TRDA 1KBOA 3I42A 4OSOA 4EARA 5HIIA 5A04A 3S2YA 5AVOA 3R8FA 1O97D 1QVVA 4IIEA 5TGDA 2QD2A 4YXWA 2PGAA 3Q6IA 2AN5A 3P0RA 1PLJA 2WUDA 1IHUA 1XCJA 3OWOA 4IJWA 1PS0A 1WNTA 1LVGA 5T41A 3EZYA 4AF7A 3D54D 3UTDA 3WDLA 1EGAA 4R41A 2MMGA 5P8WA 4CHGA 3VO2A 2YWBA 3DE6X 4QWWA 2E7ZA 4G41A 3MRXA 2GTPA 4IQ0A 2Q1SA 4EGAA 2D1TA 2Q27A 2VZEA 1L7NA 4Q01A 5ANRB 3KYDB 5L6LB 4IDAA 2FFBA 3QWIA 4ECAA 4BP1A 5CDGA 1PUXA 4GWLA 5KDOA 2CDAA 1YNOA 3K31A 1Z08A 4QRIA 1OWPA 4G4GA 5DMXA 3AB8A 3TQSA 3V4RA 1CX9B 2GZRA 5EWJA 4RX1A 1U4SA 4XUCA 4A0RA 3AJ9A 2JI4A 3EA4A 4H4CA 4R9RA 4Y2SA 4QGSA 2C7RA 4EHLA 5BR7A 3FMFA 4NOJA 1UXGA 5BN1A 1S7GA 4ZZ0A 2GNAA 2KHZA 3IQXA 1O6FA 4CCWA 4IHJF 5IVDA 4RGQA 4Q9DA 2GJKA 1TI7A 3A25A 3H3JA 4TZTA 3OPQA 2QZPA 4ME6A 3CCCA 5KJEA 4M0EA 3LE8A 3GBSA 5FPHA 4I9FA 4WXYB 3OESA 4YLEA 5DK6A 3SAJA 2ZWPA 3OKAA 5BOSA 5J1SB 1B93A 1KEPA 3A1FA 5FWXB 1FNMA 5DTIA 2EFEB 1BKSB 3U48A 1L5RA 4Q82A 3Q10A 4Z7QB 2HRRA 2VOJA 2A59A 4Z9XA 4B2YA 3IDAA 3BA6A 1WZ2A 1G21E 1IG0A 1KDPA 4Q48A 1ZNWA 4JLMA 3OPMA 3QVLA 4C9BA 1H93A 2ZWOA 4LJ8A 1V9SA 2JRCA 2P2ZA 3EGEA 4O4HB 1PFKA 4PCUA 1DKPA 4E5YA 3N86A 1JG6A 4RKRA 5KNBH 3KT3A 2B6NA 3EK2A 3O7WA 3TFWA 3WK5A 4RA9A 1E7YA 1KQNA 1MH1A 5AKZA 3CUVA 4Q7MB 2GHQA 1C8KA 1JPUA 4MS4B 3LWBA 3CEJA 1ONSA 3CTMA 3JPYA 3TDNA 4I5IA 1TAQA 3GYBA 4BN0A 5C52B 2ZAIA 5DX1A 4WHMA 2BBOA 1M5UA 3EEYA 4EITA 1Z4PX 2XZTA 4X6LA 4BNFA 4DLPA 1JR3A 2QMOA 1WNFA 4Y2QA 3EF1A 3TQHA 4KRYA 4Z1OA 1YI0A 4IDDA 3GRPA 3OE5A 3I1YA 4QQRA 2GM4A 2INGX 4OFBA 1JECA 1NURA 3F8SA 3MCTA 4EYQA 3S1AB 1APBA 1EHYA 4GPD1 1HTTA 2ZIUB 5F4BA 1C7JA 4RZQA 2ZQZA 1Z37A 1YB1A 4V0OA 2VJLA 2BWJA 1Q0PA 1VP9A 4DC1A 4PHCA 2DKOA 4WKCA 5JYBA 3B5IA 3BSWA 1D7AA 4MITA 4TV8B 3FROA 2X2PA 5CDFA 3VNQA 3DP7A 4KLAA 1QCZA 5I45A 3OO0A 4UBLA 1WDKA 1UODA 4HEHA 1NBWB 3O2NA 3KDAA 2IEDA 2RGEA 1HT2E 2BR3A 2XRFA 4G3XA 4L95C 2PQMA 4X3PA 4MW2A 3WLJA 1OU0A 4L4XA 2GMWA 4EL0A 3AC0A 3UOAB 1MAUA 1FOEB 1BX3A 3F4KA 2EKLA 3H11A 1PTJC 3QWBA 2Q7OE 1GYPA 2CHQA 3IV6A 1CNEA 1UOOA 2O3RA 3PXGA 2Y1GA 2WWVD 4IDPA 2J08A 5I9TA 3HN7A 3ZN2A 3NHLA 1XJ0A 3H19A 4HQ6A 4JR2A 2Y76A 3ZVNA 2C9YA 1VE5A 1J7JA 3PA6A 1DEHA 1UBSB 1UWCA 2CL6X 4R9NA 1O58A 4KEAA 4B8ZA 1ZWKA 4YRFA 1HORA 3SZUA 5DGIA 5JZBA 2BJHA 2HA6A 2KM1A 3PWKA 3FFXA 1CJCA 5C0OE 2X0DA 3IYLW 4JKIA 4Z51A 2X40A 2LR0A 1S2MA 3DDZX 4QJ5A 5DB4A 4B7XA 3KZKA 2AXNA 4CLXA 1CLEA 3NJ8A 4EJ0A 1U9CA 5CEFA 1ZVJA 2Q29A 2HIHA 1KRHA 4N47A 1MCZA 1UDBA 1US8B 1HYHA 3BWXA 2OPHA 4CQMD 3SF8A 5IZ4A 4HRYA 4HQLA 1AQNA 4FMDF 1NMXA 5FPTA 1L7AA 4P2GA 1K6JA 1M34A 1J0DA 3NC1C 4DB2A 4YS6A 4Y18A 1VA4A 3RSSA 1X1BA 2CY0A 2I4IA 4CMBA 2G3YA 3GUCA 2HH9A 4RMJA 4C6TA 2HJSA 4X41A 4EYKA 4L2IB 1ZHHA 2FPMA 3WYFA 3DLHA 3WGMA 5LUBA 3OLZA 3VR5A 2KBFA 3L1VA 4GQBA 1WXEA 3BD7A 3SS7X 4PIVA 1J22A 1JSXA 3GJXC 1SBZA 1WPXA 2CZGA 3WMGA 3VR1A 3INNA 5DM60 4FYVA 1VDZA 4PAWA 3T35A 1DOAA 3R2JA 4HQKA 5KOJB 4BMCA 3NRCA 5FWDA 1N57A 1T91A 1XF9A 3KFXA 4IH4A 2UVQA 1ISSA 2IKSA 3S2FA 5AJVB 4G5GA 5FR2A 3I8OA 5IEJA 1ISRA 1Y1RA 4JQOA 3ACDA 3U3JA 1NUPA 2QRKA 3DZKA 1N6PA 3HO8A 3B51X 5K0BA 1MUUA 1T5IA 2ZT7A 1CS0B 3GZJA 3JQQA 5HR5A 421PA 1IULA 1HZJA 2Q21A 3OQBA 4DHEA 5FNVA 2B92A 3OQIA 5KVVA 5IWCA 2W9XA 1C4OA 1YOBA 2VF7A 3NOOA 1TAGA 3TZHA 1KSHA 1OBOA 1G9XA 4OXXA 2D54A 3KXIA 4ZO6A 4LF6B 1IM2A 4B5LA 3TXAA 4B3RB 3HFJA 1DTWB 3MEQA 4E7OA 4GLOA 1SCAA 1TZCA 5HOEA 2CNLA 5K3FA 2ZKIA 2LGJA 1ZUIA 3GMTA 4QFDA 3TAHA 4PO9A 2EG9A 2XEDA 3L4SO 2FGJA 4EUFA 1D2CA 2KMLA 3EC7A 3F49S 3KUDA 4L9SA 4W82A 1X7ZB 4HFRA 2XVMA 2WKSA 4G0QA 1ZMBA 4BVFA 3Q3HA 5ITZB 4UASA 2XMBA 3K1AB 4RKWA 3WQRA 1FQWA 3JPWA 3NQ41 4JBIA 3FX2A 3BTOA 4KQWA 3TLZA 2ZM6B 5JO9A 1RJDA 3ESDA 4I9GA 721PA 2HJWA 2QE6A 3AUFA 1NYQA 1WU7A 1EJ2A 1BJRE 1WPRA 2PSEA 3KJEA 5EY5B 4ENTA 4CT5A 2AE2A 5JUWA 4Z9YA 1E2HA 3OCWA 1QFYA 4ZDIA 3DV2A 1B41A 5DRYA 1CFJA 1F4PA 3K9GA 5AVTA 3H83A 4OU5A 1W4ZA 1PR0A 2JA2A 4RS3A 3TR6A 3U5TA 2JLSA 3ZY3A 1FFAA 2YL2A 4PZDA 4ZCMA 5T67A 1KKLA 2LXNA 4FQ8A 1DC7A 4KR2A 3OLQA 1B14A 4L8VA 4BNZA 4BDTA 2X77A 1W4AA 4BVEA 4LFCB 1K63A 4L57A 2PRZA 3QVKA 4RIGA 1I4DD 2QYHA 4F4FA 1ZU5A 1XWIA 5FKJA 4OLBA 3ZI7A 4CCYA 2E6UX 3EEQA 4FMBB 4KDRA 1GA6A 1XD8A 2PD4A 2R6DA 5C34B 1WTAA 3DT6A 1UJ2A 1NI5A 1N6RA 2C82A 1KY4A 1ZCZA 1VI5A 2P9CA 3KSRA 1U0EA 1EHIA 4IDHA 4KMMA 3SHFA 4NZ9A 1ZWLA 5IDXA 3M2TA 2VHVA 4LMAA 1TA0A 2EBWA 4FGUA 4CMJA 3EWSA 2CBZA 1D6NA 5FUXA 1G20E 2W2PA 3PFHA 4KPUB 1AS3A 1UJBA 3PNMA 2RB5A 4EW1A 3G13A 2QW8A 4TQ9A 1M1YB 3RSLA 3QSYA 1BRMA 4N18A 3ZVMA 4DDKA 3R5FA 1H9CA 4ZTBA 1U0RA 2P69A 1TADA 2C8VA 3FCAA 3QELA 4BUJA 3WZMA 1N6IA 3NHYA 4N39A 4OHWA 4GZMA 3GAFA 4KQIA 2WMNB 1NAHA 3KXLA 3IBGA 3I62A 4OQZA 1K4MA 4ETNA 4XWKA 3GFSA 3WIUA 5C46F 2IUEA 1FJGB 3X1ZA 8ADHA 2Q9CA 3LF2A 5HPYB 2YC4C 4D6XA 2CBXA 4GI7A 5T6BA 3I61A 4J0DA 1TIPA 2I66A 2I87A 3DTVB 3UOGA 3WWCA 2QUBA 5FAKA 5B7GA 3RKRA 4P80A 4R0MA 2C5GA 2QV0A 3FSGA 3QU7A 4I3FA 3X0DA 2NZXA 4DMKA 4K6OA 1OILA 3CF2A 4EFNA 3IBTA 2C4HA 3GLIE 4P4TA 2PX2A 3ZV5A 5PGMA 2YS6A 2V3CC 4BLSA 2GEBA 3D3NA 2YW9A 3NT2A 4DNQA 2RK6A 1VSQA 2DYKA 1V7PC 1AIPA 3AW8A 2QN9A 4GOKA 3A1VA 5A5EA 5BSWA 5BSEA 4D4MA 4B7UA 3CPEA 4HWPA 3AEQB 2X23A 3BJMA 2H52A 4M54A 1PNOA 3PFWO 4ZOAA 1X6VA 1LY1A 2C04A 3Q0IA 3BHJA 5DTQA 5EIHA 2MU1A 1RQLA 3UYLA 2AFHE 2RGYA 3MRTA 1VA5A 1IVNA 3SXJA 4EDFA 5CR9A 1DHRA 1POWA 3TOZA 3A36A 1KJ8A 2HA2A 2NIPA 2WV7A 3GC6A 3NIFB 3VYVA 4URVR 4H27A 4ZXPA 2XNDD 2B20A 2CXPA 2Y05A 3FPCA 1KE1A 5IN4A 3AYXB 3L92A 4FR0A 4LJYA 1U7XA 1P18A 1NPTO 1LFAA 2ST1A 4WXMA 2NU7B 1Z6PA 5AOAA 5FPSA 3GGDA 3O74A 1W49A 4DSOA 3TYXA 4DAEA 2ZJ3A 3HFGA 4B32A 4RZXA 1JHMA 4DMLA 4OOFA 3C3PA 1MA3A 3RYHB 2K7FA 3ZK9A 4CEHA 1OX4A 5F3DA 2R6AA 1T4DA 3JVVA 5HIAA 5DV9A 4YFYA 3REQA 3AL0C 3CUYA 3Q11A 2QXYA 3LKBA 1NOJA 2ZANA 1C29B 1L9KA 1TKCA 2JJ1A 4HWRA 3RAGA 4BWVA 4DLVA 4LXHA 1L5MA 1Q0RA 3L6UA 4O08A 3GFFA 4HYTA 1N2GA 4YONB 1F48A 2HKIA 3MJSA 1DXHA 2QB5A 4Z4EA 2G6BA 1AA9A 1VPTA 1U5CA 3LD9A 3INGA 4F84A 5ADVA 5K0LA 2F43A 2CLMB 1UDAA 2FU5C 4JLKA 4C89A 4C3ZA 5JNTA 1H8ED 4JLNA 4AM8A 1T1GA 2DBVO 3C3BA 2CV0A 4BFXA 1XAHA 1ZPDA 2Z2IA 3OLVA 4MYUA 5AKIA 5A3SA 1HZZC 3WKEA 3ND6A 3FR7A 4MIYA 2VO1A 5A4AA 1W35A 4J7CA 4DV6B 4NSNA 2WY2D 3I58A 1E5LA 4L8FA 3Q2OA 1X9GA 3LDGA 3KR9A 2GYWA 4JC4A 3V7FA 3PUWA 4IJ5A 2EW2A 1K8RA 4H15A 1SOWA 1QIDA 1ZISA 1HZZA 1NBEA 3BMOA 1O6GA 1MOSA 3MJDA 4R1UA 1ZGCA 1P0PA 1TFUA 3TW8A 3P9IA 4LXTA 1F5SA 5EXXA 2VJYA 4UHFA 4LAFA 4GLBA 4MS1B 1RACA 2XYHA 1X8XA 2D8AA 4L85A 2H4XA 4XQEA 5IDVA 4LCBA 2N47A 1WRBA 3D6MA 5JV5A 1FNSA 4G0NA 1Z06A 3EVGA 3QE2A 1QIIA 4INJA 4MROA 1RPNA 2J3LA 4FMCF 1CZHA 4UKDA 5CPBA 3HP4A 4JJAA 4CMKA 4J4BA 4DDTA 2RE8A 3A6KA 2Z2KA 4UTOA 4LJSA 3ICOA 3M4ZA 4WASA 1P0MA 1RYMA 1V8FA 3AR7A 3QMMA 1VJ0A 1CNFA 1W2HA 4J16C 1T2VA 2VLIA 6AT1A 1WXQA 1DAHA 1MP0A 1DJOA 3ZXIA 2FSHA 3AFOA 4RL4A 3L1KA 5EFOA 2QE7A 3WJ2A 1AX9A 2J59A 2C4VA 2DFKB 3FY4A 3HUUA 4RFVA 5J40A 4EFLA 5K20A 4JODA 1DJPA 3FJYA 3KE8A 3AHFA 1PJZA 4GMKA 1SBTA 3OJFA 3W04A 3EBPA 2BFBB 2VHJA 4CETA 5K5EA 3CZCA 1D04A 4E6EA 5ITWA 4RGYA 4WDQA 4HBZA 1OZGA 3BOSA 3MN1A 2BTQB 2OHHA 3K0FA 4N8DA 1TD9A 2VG8A 3EAQA 3KV1A 3W9BA 1NUQA 4H3KB 2VUUA 3HWWA 2JLVA 1RS0A 2QQEA 4P4LA 3DO5A 4RAOA 4YRLA 4S24A 1OH7A 2QBYB 3OWXA 4LXYA 4JI0B 2YBDA 3F3KA 3PFBA 5JDCA 1FU8A 3HDGA 3QNMA 4MV4A 4EZIA 1JH8A 1W87A 2PZEA 3PB3A 2ZIZA 3ZZUA 2ZRGA 4PQFA 3RUCA 3HY6A 4TS1A 1PE0A 1C7QA 4Z4HA 3QWFA 2M6RA 3I6YA 4U9IS 3B1XA 1WE2A 2ZB7A 5EHGA 4ZV9A 2Q5CA 1YQDA 2QQ0A 3ONDA 1E9VA 4WZ6A 4B6SA 5FH9A 3PDWA 1RXCA 4JLPA 3URMA 2FR8C 4FP9A 5AR1A 4ZT3A 3V4VB 4YQYA 4YUWA 3IMEA 1Q83A 3K0AB 4IFTA 3OCJA 3PVCA 4KQ1A 4UFNA 1MQ9A 3PI6A 4CMIA 1N2ZA 3TB6A 2ISCA 1RWMA 3BIXA 3IP3A 3PGJA 4MR8A 2VT2A 4Z9AA 2PX8A 2JIPA 2GYUA 2J9FB 2PQ0A 4G0XA 3RG2A 2OCAA 2FR8A 2I4LA 4C6RA 3E1KA 3VR0A 1NW7A 1HLDA 3NKLA 3TLYA 3W2TA 1FVFA 1KPHA 2RARA 4MIKA 1WULS 5K8CA 2J9YB 4LSZA 2OD7A 1U8CB 4YAGA 1YRAA 1W30A 2HPVA 3LAWA 3DDHA 1YBMA 1UDWA 1F2TA 4DCVA 4IUBS 3C5VA 2QUJA 4NARA 2FW6A 3ETEA 3A1TA 3M5WA 3FVRA 5T3YA 4V1CA 1Y7PA 4PYRA 3DWIA 2ONKA 1VKOA 5AH0A 5BSTA 1TQ2A 1RR6A 1RI3A 1EM6A 5CBKA 2ZR8A 4E21A 2QMQA 4ABTA 1EM8B 3PC2A 3PP8A 1CZKA 3B1JA 4TKMA 3FF1A 5B2EA 3EPJA 4LZAA 2ZYUX 1QBKC 3KXDA 5T4BA 3HKDA 4M8IA 5JSHA 2JK0A 2JLZA 3HB4X 2JHPA 3KDPA 2D7CA 2BKAA 4F85A 1A8IA 2GO7A 1TMOA 1YJCA 2FFAA 1Z13A 3D2CA 4LHYA 4A0HA 4Y1FA 4KMOA 1UMBA 2QRZA 2V0NA 2PTGA 2ZSAA 3AI3A 1QONA 4LTMA 4EKYA 1B8OA 4P38A 2YZNA 2L17A 4QDZA 3N39C 1BKYA 2Q1XA 2Y6UA 3TIXB 4YPVA 3VPXA 4RK5A 4M83A 3TLEA 1EFHA 2IVZA 3NDIA 5I5GA 4FUQA 4GEGA 1KTVA 4NE2A 4ESEA 4DLBA 2Y0EA 2LVBA 2WKPA 2W2XA 3ZW8A 2JFGA 4QPPA 1EBUA 4MGHA 1WG8A 4BX9A 1W0JD 1NASA 6YASA 1KOGA 2CZCA 2CL0X 4L15A 4PYMA 4KVZA 1NP6A 1Q2XA 3PJDA 1X77A 2C9CA 3KTFA 2YTZA 4M0UA 4EEZA 1C7IA 5ESDA 5CLGA 3RU2A 4D1YA 4EL5A 2H4WA 3EFOB 3KQVA 3OY7A 5IBPA 4X1KA 3PXBA 3UQZA 2W48A 4OK3A 1SO8A 3R74A 3CVWA 1BS1A 4B47A 3DHVA 2VAVA 5FPYA 9LDTA 1KY2A 1JXAA 4WUVA 1Q0HA 3WNVA 3WY9A 4BP8A 1YR3A 1GL9B 3L8GA 1YA8A 2NTJA 2NNWB 4IFEA 4N5MA 1E5VA 3FI9A 4RACA 3ZJTA 3A9CA 4AW9A 1A9OA 4RAQA 3COZA 2HZ7A 3EF3A 1WZCA 1YDFA 2D4HA 5BN4B 5LYJA 2VXOA 3IA2A 3RQSA 4EG0A 5JD5A 3KLPX 3LDUA 4FEEA 4JC5A 1KDVA 1YKGA 3AVXA 2HGZA 2P2YA 1EJBA 3QHPA 3QK7A 3DGEC 3I04M 3QNWA 3W34A 4DS3A 2G77B 1A98A 1K2WA 1ZD2P 4EYSA 5F5NA 4DNPA 3MOIA 2XZLA 1X7YA 3ROGA 2BUCA 3VOAA 3WVNA 3WL4A 4EJ6A 1ZRHA 1SIBE 2R8XA 1ELOA 1C7FA 4Q1VA 3RUAA 2J0VA 4MPRA 4D8TA 4DQKA 3OE7D 2X0IA 4KVAA 5DGTA 4FNMA 3CN7A 4E2YA 1Z28A 4RELA 2XEXA 1U0SY 3MWLA 4F2PA 5B3LA 3E2MA 3C1TA 3VH2A 1TMGE 1J5PA 1X7XA 4H08A 5AI6A 3N8IA 1IHXA 1TF5A 4TWRA 3N76A 3N2EA 3OH8A 3P9PA 2WWHA 4R2XA 1ZNZA 1C1DA 2P68A 2FW1A 2OESA 1DVRA 5JNUA 5J2TA 3GJTA 5I5EA 5KYNA 1C81A 1UMDA 1Y7IA 1KVUA 1Q0TA 1X19A 4OHPA 3ZD8A 5HJEA 4C2BA 5KEIA 1FU4A 4QFMA 4MDYA 2CB0A 1DWUA 4GYKA 4TKLA 3RR2A 3B6ZA 3GYGA 1ZL2A 4KLNA 3JASA 4C14A 2CLEB 2O7QA 2YMMA 4OIFA 2B5WA 4I4LA 2XHEA 4BMXA 1QU3A 1RKQA 4IWYA 5F2KA 3BT7A 3Q9LA 2VJQA 3PQFA 1SVKA 4FQ7A 5EL0A 3WAKA 2GRAA 3G9TA 3RVRA 1UKEA 3RC9A 3CFYA 4S2EA 3EX7C 4K26A 1UBTS 4G8DA 3JZMA 3TB4A 2O06A 1T35A 1NX9A 5FWAA 5AK5A 4JZYA 1EIWA 4AZTA 2F8LA 4KYUA 3J81k 5TS2A 2DR0A 1F8YA 1HLFA 5EWJB 4B75A 4R3UC 3PC7A 3UK2A 4DCPA 1KETA 3HTXA 2XQJA 3OBIA 3JVIA 2G88A 3IAAA 1N5LA 1JEQA 4L0CA 4EJSC 2JKYA 3E8MA 1SZDA 2PFKA 5GONB 5LJIA 4I7EA 1UZLA 1GZ3A 1UFOA 3HS3A 3C41J 5IS2A 3M1AA 1LI7A 4WW0A 2JGDA 1CE8A 1SAYA 2JI6A 5BW5A 3U4MA 1RAHA 1N5DA 3D6UA 1RYEA 5FIUA 3O2JA 1GRVA 2WFLA 1TM3E 4J1TA 1YWGO 5JJKA 1UJ4A 3W5IA 3DGFC 5DHPA 2GF9A 2MT9A 2ZFUA 3C4JA 3OT1A 1FUEA 1RFGE 4LRWA 5H3CA 1BVUA 3NEYA 5AT1A 1Z35A 2P9QA 1DNPA 1SU6A 3T7JA 2C4UA 3G17A 3VQTA 2IA5A 3NP9A 4P7GA 7MDHA 2PUAA 2OOKA 3HBMA 1DUVG 5AW6A 2JAHA 3VPGA 2Y1FA 1XZCA 1YUNA 2DTXA 5G1PA 2D0IA 3N5CA 4OA8A 2G5TA 5LZ7A 2WKQA 3ZVKA 1FXSA 5AW0A 2J9ZB 5LKAA 2XB2A 1VKJA 2DCUA 1RFLA 4KK4A 5EEGA 4CHTA 1RHMA 2RAPA 5K3CA 1LWOA 2E18A 4HXYA 3STWA 4AK9A 1IIRA 1F20A 4ZT4A 3SKXA 1UDRA 4I3HA 5C5EA 5KYWA 3K05A 2Q6OA 3E84A 5DP2A 1ZH8A 1J49A 2JCGA 1BWSA 5IKEA 5BSMA 3T9DA 2P62A 2GKOA 3GJSA 2WU3A 4DTCA 4J75A 1QGYA 4F4IA 1FDUA 1B0UA 1Z6ZA 3G88A 1MJHA 1YS2X 5EGSA 2F8SA 4F2HA 1K88A 3L7CA 2A0WA 4TS4A 4MW9A 3PFFA 1NC3A 5B1EA 1WL8A 5L45A 4XQ9A 4LDZA 2C5LA 4DA9A 2EATA 4B3HA 1QX3A 2G4LA 4XUGB 3WGGA 5KNDH 4YROA 1JFRA 3OG9A 4ZU6X 2RHGB 3BEOA 1OE0A 1I3MA 2ZJBA 3CJQA 3LVRE 1QDUA 4HX5A 4UXHA 5ALDA 1B8NA 3T5TA 4ZZ1A 5BUSA 2EAUA 4TROA 3GNSA 4TTJA 4EHBA 3JX9A 3U4CA 1DBVO 1XQWA 2W4IA 4MRSA 5CVVA 5FLYA 4BE7B 4G0UA 1ESMA 2VNIA 4DBLE 3NETA 3MMXA 1EVJA 3QITA 2I99A 2I62A 2O2ZA 4MR9B 3Q7RA 4IDCA 3JY6A 2FZLA 5F23A 2FOXA 4M1YA 3CRQA 3OIUA 2C2GA 4X63A 4D9JA 2BM1A 5EP4A 1A8HA 3EGXA 4BCBA 5BUCA 4RK7A 1YT5A 2FA9A 2FUG1 1RRVA 3H3XA 1W59A 3COYA 3OAAD 2RH9B 4GPBA 1BCSA 1KZHA 3QENA 3A1SA 2ASEA 4Q66C 4FWIB 4ZCLA 3NB0A 4B9AA 3THRA 3I01A 3KQKA 3VNVA 2I3DA 1BHSA 1WUTA 5K3BA 4AVYA 3GDHA 2IRWA 3P4XA 3LX4A 2ZSJA 3CUUA 2P4QA 3QXSA 1J9EA 4BN5A 1LV8A 3SYLA 2C7VA 3E4DA 3KVYA 1MDFA 4JBHA 4WEQA 3LLSA 2P67A 5GM1A 3H0KA 1XU4A 3RRNA 3WV4A 1F2VA 3G2OA 3X1MA 1FQOA 5ICFA 3VYTB 4X66B 3T9AA 1ENZA 2OK8A 4EMSA 2XMPA 2VBFA 4E88A 2B1GA 3M0EA 2FG7C 1KQ3A 2NOAA 2QP9X 3EPHA 4KPEC 3MXOA 4EHHA 4IIXA 3TRFA 2WJJA 2X1LA 4I2NA 4TLCA 1MT0A 1I7SB 1NBMA 3B1FA 3LUFA 2VBIA 4I08A 2XWJI 4PR3A 1A97A 1AO0A 2IEGA 5I47A 1FJ2A 1E2NA 1GRNA 2WK1A 3C43A 1XD2B 3I1JA 3M34A 4HMPA 5ECGC 2P1RA 3VX3A 4ZOCA 1QG2A 3GO4A 4FYHA 2G08A 2XNKA 1T15A 4WK0B 4YMVA 3GRCA 2BZGA 4IKEA 1QE0A 1XCGB 3OTQA 1M5TA 4WJZA 4EMBA 4BFCA 3PQ5A 3R75A 4HTFA 1DEXA 1DLJA 3NVDA 2GCIA 1NFRA 4EHAA 1W6UA 3DFZA 3F78A 3IUQA 3GVHA 4QSHA 4IKPA 1IATA 2FETA 3FYDA 1Z07A 4OMCA 1X38A 1XBTA 3AWDA 2HMVA 3FRHA 4PICA 4QPZA 3W77A 1NBOA 3N6RA 5FNVB 4YAIA 2PANA 3CUTA 3CCBA 1B6RA 2DSNA 2D2EA 2XZPA 3BL8A 3R76A 3NMUF 2V6MA 6ABPA 2V03A 1NJ8A 4QYSA 5FI0B 5E1OA 3NCTA 5TQ0A 2EVWX 5AMXA 4GYJA 1PTKA 2FWMX 5K3FB 4GUAA 4OXYA 2O8BB 3FYSA 4D0LB 1PSZA 2HAEA 4URYR 4EQ6B 1NF2A 3R44A 3GLFA 4MVCA 3BHMA 3IEXA 4BVGA 2JEYA 1M0TA 1PDWA 2L69A 1E64A 2FYTA 2OZLA 2DJ5A 2IC5A 1OB2A 4INZA 3X1DA 4UC0A 1L5ZA 4E2XA 3ZE8A 4JVSB 4U8GA 5E4YA 2AGVA 2ICAA 2J5RA 2Q99A 2GHTA 2QD5A 4GVXA 4MVJI 4E4TA 5A6VA 2PL1A 2SKDA 4CL0A 3BXZA 4XUDA 3IDSA 4YTEA 3I9FA 3GJRA 1G3UA 2RMKA 4Q24A 3O0TA 2WM9B 4WKOA 1Z7YA 2XVXA 6LDHA 3D4LA 3NANA 1UKYA 3EG5A 5JAIA 4M38A 5HKAA 1E3JA 1AM4D 3R6WA 4B9EA 1MJNA 3CW9A 1SIWA 2PHZA 3QYPA 4KXQA 4IZIA 3F5DA 2W6ID 2BFDA 1W46A 4XQCA 2Q3MA 2FF5A 3FTDA 4WEOA 1H6BA 4PGGA 2BFEB 2BLNA 3BB4A 3HRIA 2P9GA 3FRIA 4ZU1X 1YB5A 3PZBA 2PL5A 4UEQA 2JIMA 3FTCA 3HPRA 1YMQA 4XFKA 3PGVA 2F1KA 3WRXA 1Q1ZA 3LDAA 1JW9B 4RV5A 2GK7A 1WW3A 2QJFA 2ONYA 3L7LA 2WB4A 2ILTA 3KSUA 3DMYA 2E4VA 5D86A 3M70A 2G04A 4C7MA 5KX5A 1DIHA 2G63A 2C31A 4IIFA 1DAPA 4GXQA 1OXVA 1BMQA 4FE3A 4HJXA 4LDNA 3EUAA 1QVRA 4MUKA 3L0DA 1KO1A 1NMYA 3QFRA 4RHFA 3ZE7A 1NSFA 3AF4A 3FTFA 2N9UA 4E4RA 1EWTA 3KVNA 3H6KA 3SPXA 3M49A 2ZU0C 5CB4F 1P33A 5B36A 5EQDA 5ICGA 4IM7A 3UMJA 1K8ZB 1Z15A 1DCKA 1RWNA 3QELB 1PFWA 4JOCA 4P22A 5BRAA 3ZDAA 1JIIA 2I4RA 3WSTA 1HQYE 2FW9A 3AXSA 5E2AA 3RBZA 2WZCA 4C78A 4CDMA 1KO4A 4KRFA 3AX6A 2JNWA 1P9OA 3NC0C 2ZCJA 2ZR9A 3G8BA 4QGBA 4X1IA 3JQ7B 2JJ2A 4EB6B 5CCBA 1GR0A 1U0HC 2GUWA 2I4MA 1VCNA 2W43A 1JHPA 2XYQA 2FUCA 3JQFA 2NV2B 2PZLA 4UEWA 4TYMA 2C2KA 2AR0A 4UM9B 5DRTA 4HK4A 3A0UA 4HZIA 4MVJP 3PEYA 1FUUA 1SXJE 5CXXA 3ZIAA 2ZTHA 1Q77A 4LWPA 1M6YA 4PLFA 4YP1A 1R8JA 2QL6A 2IS2A 2C3YA 2G09A 3OZGA 4ROSA 1LPSA 2V7TA 3LKDA 2J30A 1E1YA 2P9FA 3QEMB 1PYOA 1ULUA 2IXEA 2R4UA 3A0RB 3DNPA 3PJGA 2DHEA 4WN9A 5F1OA 5FJIA 2J5BA 2EP5A 2YWRA 1XZFA 2ZPTX 3K5WA 3RBVA 3V4LA 1LB1B 1GAWA 1VLLA 1IZ7A 4B2LA 1NMQA 4EPRA 3BEDA 1Y4ZA 3CF4G 3RAEC 1G6Q1 3RRXA 5FA5A 4DG8A 1C5KA 1E1MA 1VHWA 1KIAA 3EGIA 2BSQA 1Q7TA 3ZY5A 2FCRA 1C9NA 3PEUA 4J0JA 1ECLA 1BOOA 1VYUA 2D1QA 3R6LA 5IW8A 1XJWA 4B3IA 1KC1A 1R6AA 3R7WB 1VHJA 1EDEA 4F5DA 4MUFA 5DM1A 2AQKA 4IDNA 1W4CA 4RW0A 2O23A 5FPQA 1DKNA 1C2YA 3UHJA 3WHLA 3SQWA 5BSRA 3FSRA 1P72A 3HR7A 4BJ3A 1K5HA 2OD9A 1RPZA 4BLQA 3DEYX 3FTEA 2C2XA 1OT3A 3PPXA 4QO8A 2G1KA 5HFNA 3I6MA 4BNIA 5GJVC 5AW9A 5HKKD 4PPQA 4D42A 5JNLA 2Q4OA 4D3ZA 1ILEA 3RIYA 5DLEA 2W70A 4L28A 3COWA 4RDIA 1XA3A 3OZIA 2LDBA 1Y81A 4MYTA 3T5PA 4MUMA 3DLTA 1NXPA 2IY7A 1R66A 3AUUA 4OBWA 2CVOA 1W9MA 1YHNA 3NU1A 4HDRA 4YJHA 4D8WA 3KT0A 4CEHB 1T9ZA 1JI3A 2X7HA 3IAUA 4ALJA 3REQB 5HZMA 2XX3A 5IUJC 2J07A 2PGNA 3NTVA 1L8XA 2LD4A 4DCJA 2XGOA 4I0WB 4KO3S 2NU9A 3D0KA 4QNNA 1PJ8A 4GKAA 4QFBA 3VFDA 1LNSA 2V7GA 2IV3A 1LPOA 1U4OA 2ZCVA 1U6IA 3G2LA 4JXZA 4MUIA 1BJKA 2ZT5A 4GEKA 4MLZA 4N5IX 4U8HA 3TLXA 4NF2A 4DY4A 4EM6A 2XUAA 3BERA 2D1SA 2QRVA 4WERA 5KIAA 1WB9A 8MHTA 3ILHA 3MZ0A 4NK5A 5BYAA 3C5CA 5K0FA 1WEHA 3W06A 1B1AA 4D3DA 5EHNA 3EZFA 2PQ6A 3DFUA 3LIIA 4RE5A 5ALMA 3OEHA 3RUEA 5CYGA 5I51A 3ID6C 1PT9A 4DCNA 2HO4A 4ZARA 2ZRNA 5J9FA 1ABBA 1ZX1A 2W71A 4QM7A 4TL9A 3F67A 4XSHA 3RVNA 3AHIA 3T38A 3AVYA 2ISSD 4JGIA 1NYLA 4BC1A 3HEMA 1TU3A 2BFFB 3AIOA 1V16B 2BP7A 2CHUA 1H2AS 1XZKA 4QVGA 4KOEC 5IXJA 3LYAA 3U56A 1VCOA 2NO6A 1ONPA 3O8LA 5E95A 1FDSA 1DKRA 1QBGA 2WU0A 1U8XX 4Y2YA 5B5SA 5HQ3B 5EXSA 2P8SA 2ZBPA 3KKNA 1J2TA 3ZU4A 3QWAA 3BSSA 4POOA 3LT1A 2IEYA 1XN1A 2OOSA 4YAEA 5JTUA 3TK1A 3TL3A 1G1MA 1Y9ZA 3T34A 1LDYA 1E5DA 1NF3A 2G6TA 3L7DA 4OFXA 4TKVB 2H29A 4XVUA 4WCVA 3RYCA 3D81A 2Z6VA 1RWKA 3MM4A 3KLOA 3VOBA 2FE4A 4QPJC 2D00A 3OMLA 4JR0A 4F91B 3ULKA 3ZXSA 1ZGZA 3E9CA 2ZRAA 4BECA 3UMMA 1N3YA 2IE8A 4NTZA 1NZJA 5G2OA 3U0BA 4TT3A 4K9RA 5BVGA 3RVQA 3I34X 4ZI3A 3G5UA 4HEA1 1JBEA 2QT0A 1RADA 3FTNA 3EZ7A 5H9VA 3L9WA 3ENWA 4UJ5A 4RQAA 2WUVA 2FXIA 3FJ1A 1N3LA 3VSBA 3AZPA 2FNAA 4DJDC 3FUCA 4E12A 1C0PA 2QT9A 2FSUA 3AJDA 4PY2A 4Z0HO 5KC9A 5KQGA 1Q3TA 4KPYA 3DFIA 3ED1A 1VG9B 3QMWA 4Q00A 3OCYA 4EWLA 2CNBA 5D6OA 1FFSA 3U44B 4MJLA 1JV2B 1F9EA 1SK9A 2A9OA 3BCRA 1Q1BA 5INTA 4ES6A 2IHTA 3BF8A 4M8KA 1KQPA 3MJCA 4QGFA 4PTYA 3HXMA 4O6VA 1UBGA 2AH5A 3D7MA 4UNRA 1HYBA 3IXQA 1VKNA 1DX4A 4LV6A 5E4TA 3Q8LA 3PEFA 1FLVA 1T8WA 1SD2A 2FPOA 3AI7A 4WJKB 5H59A 4EHFA 4J0IA 2COUA 3F71A 3EZGA 4F0JA 4F92B 3DJYA 2Z1NA 1SB9A 5ADWA 3D9QX 5IX8A 1IBLB 1IMOA 1RM3A 4MR8B 2F62A 5LMCA 3HY4A 4JAVC 4Y2TA 4BTLA 4FWTA 2Q62A 5IDWA 2IBTA 4YRIA 4RXUA 1I33A 5ECYA 3IOBA 4BJ1A 3C7DB 4CV0A 2HWUA 1FDOA 3QI2A 2R00C 3BRCA 1NVDA 5CB6A 5G4LA 1H3EA 4TXHA 1U4NA 3MFYA 3ZBPA 2B7CA 3A4VA 5AK4A 5H82A 3R3WA 1QPGA 2OCGA 4PFQA 1TMYA 4EHKA 5LQMA 2H3HA 3QQPA 4NH0A 5CG2A 4V1CB 3Q3IA 1RPJA 4OQYA 5IYZA 2O1WA 3A6PC 1Q0SA 5KOHB 2WJVA 3KAKA 1XNHA 3MTEA 3X1JA 4G9BA 2P2NA 4QWMA 4BLUA 3NBYC 5LUAA 1Q0ZA 2DBQA 1C9DB 3B53X 2IZ6A 2Q49A 3MAGA 1XQYA 5CVEA 3IP8A 1J99A 4MW4A 4XJTA 1MD9A 5EMNA 3VSDA 4XCXA 1RJFA 2HJHA 3W0LB 1KI9A 2W37A 4YR9A 2IYOA 3AF6A 4YT5A 2W7TA 2JGIA 4G24A 3T9EA 4V2IA 2XYRA 2HLNA 3MF4A 3SIXA 3LBFA 2IHVA 1NNUA 1X94A 1W48A 3MMPA 4M99A 4YAJA 4ECEA 1A9XA 2R7AA 1AUQA 1JQLB 3LW7A 3P94A 1VPLA 2J8ZA 2O20A 3DWEX 2AUMA 3EVEA 2H57A 3PNKA 3RWBA 4WXHA 3QOWA 4IO1A 4NL4H 4OJTA 3P9SA 3AUSA 2HQSA 4TRNA 3QWHA 2WE8A 4O4IA 1KYYA 1N1MA 2HR1A 3EAFA 1ZCFA 2B4YA 1WF6A 1PL6A 2V59A 1CPYA 4IR7A 4REOA 4JLOA 1SQ5A 5B64A 5K3EA 4R71A 1YC2A 3KPYA 3TVYA 4KIWA 3MJEA 1PZFA 3TNJA 4JBWA 3F6YA 1UDXA 5FYQA 1HOXA 3KKOA 1MZPA 4UHBA 3RVBA 1FX1A 1WLSA 3RUFA 1NVVR 3H4VA 5KNBD 3GFPA 3LY7A 1LKZA 3DQQA 1ZGBA 4FFLA 4RD2A 3VNAA 1E59A 4S3MA 2HL6A 3BK2A 3NBKA 4OLJA 1SBNE 4A9AA 4PHTA 1PG0A 4Z9BA 1A96A 3BTUA 4X1KB 1UOQA 2ZAOA 5JCXA 1YFJA 1P8JA 4W1SA 3PX3A 2RCYA 3B8HA 1Y6GA 3OIVA 1W73A 1PLKA 4HQOA 1VIVA 2JAXA 2BMVA 3U3XA 3F6RA 3EXHC 4BVJA 1EE1A 4HAZA 5KMGB 4TYPA 4O4HF 4HDSB 3BXGA 1FUIA 5EKSA 1PZMA 3UGTA 2PV7A 4QXOA 1WXFA 3L1HA 3KHKA 5KSWB 2PJZA 4CQJA 4PBTA 5KNLA 1T8YA 1KVQA 2XTZA 1M8JA 1P74A 1Z47A 2ZJ6A 2YHAA 2GTIA 3WL7A 4KQJA 2PZJA 1OC2A 3RRFA 4I1RA 3LX6A 1IOWA 1EFUA 2EFCB 2W98A 3EXG2 4QYIB 4E5DA 7REQA 5MFZA 3HPQA 2FPGA 2B0CA 2O0MA 4U2EA 3FPBA 5K45A 5AK3A 1DIBA 4Q3KA 3KEMA 1E69A 1A8QA 1AO3A 2IW3A 3DC2A 3FNIA 4QUEA 3UJBA 4WQMA 1E3LA 1GNVA 1FJXA 3I8SA 1BDJA 2RI0A 3HZOA 4I81A 3WICA 2X5OA 5BNWA 1UXIA 3TTSA 1GV1A 2AF4C 4K2AA 2PU7A 1E1QD 1P1RA 3AILA 3IP9A 3L0BA 5I9IA 5J58A 1A3CA 3FFTA 4YASA 1S4MA 5LWQA 5J2TB 4KCGA 4RTJA 1JHDA 2OXTA 4TV9A 1AMUA 2HQRA 5L53A 1UZUA 3IT1A 1QLWA 1JSCA 2GYVA 4ZA2A 4AY3A 3PTAA 3JASB 3FAZA 1YB6A 2ID8A 2OBMA 3VAYA 4LI0A 1E4OA 2R85A 3Q40A 3QW2A 1O6BA 1P1KA 3RI3A 3V1KA 4YBRA 3O4GA 5ERYA 1N6LA 2JKZA 4Q9AA 3ADKA 4CM4A 2PKQP 3TKAA 5A5GA 2JCYA 1QORA 2WIBA 4OATA 3CYFA 5IP5A 4UBOA 4PM4A 5LJLA 3WGUA 1JIQA 1YONA 1NPDA 3QPBA 3D1LA 4LV5B 4MCAA 3SICE 1NKVA 1FRFS 2ZIAA 4AF6A 4RUKA 4C4XA 2NUTA 3D2AA 3DUWA 2MSKA 2YN4A 3JQRA 5AKJA 4EUKA 5CW1A 3ZGOA 4X91A 5LQUA 1FXUA 2OORA 4UM5A 3ZVLA 1LV7A 4QTXA 3LLVA 3FHJA 1EQAA 3H97A 4PLCA 4U4AA 4XXHA 1TQ8A 3LWDA 3WMXA 1D4FA 4EPYA 5EZYB 3TQRA 3DDNA 5TNXA 2OC9A 2EKDA 4U6NA 4XDZA 4Z8XA 1CB7A 1A72A 3CLSC 4ZT7A 5K3AA 2RAUA 4QOJA 4HZGA 3D6FA 1N8KA 2AVDA 3KRTA 3RLFA 4J0FA 2UZIR 4JBGA 5L7TA 1U04A 2FSIA 1CE8B 2JGDB 3FOCA 3RVMA 3CPSA 4XM2A 1PQ4A 2GCGA 3FZQA 4QTUB 4RZHA 5EZQA 1HGXA 4G4SP 1RXUA 2JCSA 4IMJB 5IKOA 1JH9A 4FFOA 3OM8A 2GD2A 4UCFA 1FNDA 4M1MA 3OT1B 1ZK0A 4KTVE 5TQ2A 3TWOA 1C9MA 1YK1A 3IKMB 3GBPA 5I9BA 2HNKA 3IEPA 1WHSB 2BEJA 3MT0A 4ODIA 3T1VA 3ILVA 1U2RA 2WNHA 1EG7A 1CHDA 2L0XA 3B2EA 1ZW1A 3HU3A 4WA7A 4S04A 4G5QA 2FRDC 4NS1A 1LW7A 2J5KA 3WO0A 1VRWA 2FSGA 3H7AA 3ZTYA 3ZS9A 4DIFA 4ENVA 4RS4A 1KQFA 2B3DA 1J90A 3PLRA 3OCVA 1ESZA 2B8NA 1MKYA 3TDMA 1WSWA 2HJRA 2O6HA 2O1XA 3GBVA 2R7MA 2XCTB 3FKSD 4HRAA 1X2BA 4MV7A 1SKMA 3X2EA 3QE0A 3L8FA 4QG3A 5KS2A 4MPJA 2WJHA 4A26A 2WDZA 5L3QB 3A10A 4ZVMA 1ZSYA 1Z74A 1F6BA 1NUUA 2C4KA 3IB6A 4L8YA 2ISQA 3MT9A 2WYUA 4KRXA 4W9MC 2H59A 4US2R 4WLUA 4GI5A 5B3KA 5KX5F 3IL2A 1DINA 5TF0A 2CLSA 3HXKA 4AULA 2X76A 3ZK7A 5JRDS 3FPAA 1PJ3A 2BEWA 4RHUA 1EUCA 2HYDA 1DWOA 4R54A 4RLSA 2EF1A 1TW3A 3HB5X 1IOZA 3G1UA 1XWFA 3DBOB 4PQRA 3TAUA 4DADA 1LNQA 1NJFA 2NSHA 1V6CA 5I3CA 2QSYA 2ZEJA 5JADA 1N75A 1V7ZA 3GROA 1RYYA 3U3KA 1EFDN 1IQRA 1Q20A 2V7WA 1LK0A 3DWFA 2O8FA 1PL0A 3ITDA 1G2PA 2CDRA 2XGMA 2XMCA 3GRUA 3O94A 4RPGA 4BX3A 1KI3A 5FNZA 5LP6C 4PZAA 4YUVA 4DA6A 4DMRA 1C9JA 1I6LA 1YR7A 3AO0B 3C4VA 4YRJA 2HB6A 2HUNA 2PKXA 1T5HX 3RIEA 3U31A 3U7QA 3GDGA 4C21A 4N0PA 1NE7A 2AOTA 3BMNB 3QVGA 1UH5A 4UXJA 3EGXB 5IJWA 5LP6A 2GJSA 3N8GA 1C7RA 3ETNA 3QLUC 2ZIFA 1J8YF 4GL2A 2FKAA 4H6XA 2B25A 4JWTA 3KCQA 4B4DA 1GCUA 2BKVA 2LIPA 2V7BA 3R3SA 2BKLA 5AJHA 5FI1B 4M6WA 4ADSG 2VAMA 2AV6A 1RW4A 4QFCA 4ZT6A 4HNAB 2X8JA 4NX2A 5FO0A 3SHQA 3ZXYA 3TM4A 5CHYA 3WL6A 4EUNA 2MCFA 2VZ9A 3MWYW 2G9NA 3RASA 5C5IA 4AJKA 2AZ4A 1E6KA 3SYNA 1ZSNA 4LSWA 1GTSA 2PZFA 2G4VA 3QUTA 1R6TA 2C3OA 3ZGNA 4ZI2A 1VPWA 2IPNA 4ALKA 3WNCA 3IOEA 3MGAA 3TJMA 5GVSA 2IXAA 2B9VA 2VWQA 1CIJA 1XE3A 2JAOA 4LYEA 3OPVA 4MVJH 4DLLA 3FB1A 3BWYA 3HZZA 3T06B 5JO0A 2H06A 5JHGB 5FHQA 3BWCA 4KSYA 5G4KA 4QVKA 1WSDA 2PD6A 1O08A 3R40A 1ESNA 3BK1A 1FFHA 1N4AA 5JPCA 3ONVA 1YA4A 2X9NA 1B16A 4TRRA 3QBJA 4OHFA 1O0BA 1SCUA 3VOTA 1V8BA 3W5JA 4J6FA 4KWTA 3G0DA 5FRDA 3CUKA 1GZ5A 3CB2A 2TRSB 5IXSA 2JLUA 2DULA 1G21A 3DZIA 4MARA 1DIOB 3PFKA 4B5KA 5TPWA 4O1IA 1PGNA 1R0ZA 2VF8A 4K2HA 4PLZA 5CA1A 3OJCA 4IJ6A 4Q7QA 2BMFA 3LOUA 1CERA 1XAIA 1CY4A 2CSUA 3AY3A 1QOZA 1K5DA 1CQZA 3DMFA 4OJNA 1U0OC 5TQ0B 4AP9A 2FEKA 2J0UA 4B6OA 2POCA 3Q88A 4ZXFA 3UUEA 4G0WA 3EA0A 3EDRA 4EHJA 1J2JA 2ZAGA 2ZRPA 3ABZA 1RYHA 3V4ZA 3DHNA 4BMVA 2Q4BA 4Q3NA 2G8NA 3A3OA 4OIMA 1DQNA 4TM8A 2ZR0A 3HNPA 2QZ4A 2FX3A 4EIWA 1NRWA 2BGJA 3K8QA 2ZS8A 1IVYA 5AVRA 2BJWA 2Y1OA 4J03A 3DZHA 5JH7A 4XQGA 4PG5A 2MHCA 2W42A 3K6RA 1CUIA 2VEOA 4GXTA 1UBJS 2PKRA 5CK5A 2JARA 1ULAA 2CHEA 3NHKA 3PS9A 2OBYA 1AKWA 3GD7A 3KBOA 2YMPA 2WFAA 4HN4B 3W5VA 4WI1A 5FFMA 1NDQA 2XA2A 2ID4A 1OJLA 3WGJA 3JU3A 2Q3JA 1OPRA 4RCYA 3HJNA 1G291 3IMCA 2C7QA 2A67A 1JDVA 1TZBA 2XWPA 1F8FA 4UMEA 4POAA 2VPYA 6NULA 4NESA 3W4KA 1A27A 1IUPA 1R8XA 1WXIA 2BFDB 2CUZA 3NGMA 1O6CA 3O82A 1VECA 4B44A 5BP7A 3H1GA 3QX3A 2E6KA 4LVUA 5L95A 1RRCA 4QHSA 5ICSA 1EWRA 1PR5A 5J4KA 1CLUA 2IY8A 4A16A 4OH1A 1E2GA 1PFQA 3LCRA 4U00A 3RAPR 2IXTA 3VZQA 3NAQA 4I4NA 5HUHA 1NG1A 2ATCA 2CJWA 2RCNA 3EG9A 3VDRA 5ALJA 1O0SA 4P0TA 1QG4A 4Q34A 4CQMA 1U3DA 1NRIA 1FSSA 1AXGA 3BE5A 4ETIA 2WSIA 1Q7CA 3NHSA 5DASA 3V9PA 1ZEMA 3L6OO 5DBEX 2JFBA 3I9V6 5L6MB 3SXUA 4JASB 4JI8B 3PKIA 4LJ6A 5GV8A 3AEXA 1F9AA 2V7PA 1ZICA 1U2PA 3C5EA 3EA5A 1AKMA 1ODSA 2ZVDA 3NHZA 3CVYA 5E1MA 4NIMA 1A9TA 2VA8A 4LJ7A 4NAHA 2LPMA 4B3BA 3A32A 2YQZA 3COPA 3OFJA 5TPZA 5AW1A 1RLOA 1KORA 4UMDA 1V8ZA 2GNOA 2WIFA 4EDHA 3ZBUA 2XW6A 1JKIA 3TI9A 1R12A 3W8NA 3ZV6A 3A28A 4BMZA 5JI2E 3OZEA 4UJ3A 1YF3A 1HFKA 3P0FA 1EINA 3FIUA 3MMZA 1AT1A 1V0JA 5C51B 2X3UA 2YXDA 1H8HD 2PWAA 4W9NC 3HVKA 2PT5A 3AVWA 3GXBA 3R3HA 3FHTA 1IN6A 1THTA 3IERA 4QJ4A 2WZQA 4XGRA 4Z4GA 4AJ2A 4B3XA 1H4QA 2IGTA 3FYUC 4EJMA 4HGZA 1KJ9A 1WOMA 3ZU3A 4AQDA 4CUJA 4EECA 1V26A 3SE0A 4QUBA 2JD0A 2BLLA 1E5TA 4G01B 2W4MA 4J49A 4QNMA 4RKQA 3DKIA 3X1XA 3E5HA 4F7WA 1R5BA 1V39A 4C4SA 2AR9A 1QX4A 3IQGX 4WN9B 3EIQA 4EA7A 1VCIA 3F6PA 4DPLA 5FYDA 1YBAA 5AJZA 3FMPB 1REQB 4PXYA 2GBIA 3FPEA 5EGNA 1COWA 2FJ0A 2LNDA 1I4EB 2RKOA 1Z12A 5AVYA 2P5UA 2VSNA 4RH3A 3OTOB 4P8RA 4GL4A 4DV0B 1IBCA 1F8UA 1LC3A 2GPTA 3IALA 4KQ6A 3BQMB 1FLAA 3C85A 3ZHYA 3UWKA 3WKDA 4Q9NA 5DWDA 3DEKA 2QZJA 3VR4H 2I6UA 3AJAA 4EUHA 1VL5A 5IJ9A 5IYZF 4YRMA 1P7ZA 3I2FA 3BH7A 3NO4A 2EDCA 3RJ5A 1W88A 3S1SA 1SURA 3GJ3A 1DKOA 1DX6A 1V5EA 3QY9A 4P3YA 1YQWA 2QQ5A 3PSAA 1U99A 5IULC 1YJ5A 1HE3A 3ITKA 4CIYA 1C3XA 1EDZA 3H1AA 4V2UA 5ALLA 1CRQA 1DXYA 3OJWA 3IHLA 2VBGA 3QV1A 1SQ6A 4HUQA 5CBPA 5CXSA 1LC0A 3MT7A 1JR4A 1PI3A 1XLWA 1T9GS 1Z5NA 3G9QA 4FHFA 3EZ2A 3RE1A 4HDRB 5DWQA 4NCAA 3NUGA 1PAUA 2B30A 2R8YA 2BRUC 5H4HA 5ECWA 3BGWA 3PRYA 1XRNA 3WB0A 1P17A 4R3WA 1X42A 4ANFA 1FDWA 1DDOA 2O2HA 4FC7A 4O4IF 2NU9B 1QR2A 1W94A 5COAA 2M6LA 4MDEA 1Y80A 3G9XA 1S1CA 2DZDA 2Q2WA 4QYXA 3RFTA 1L4YA 2BRUA 2XXBA 4WOKA 3TLGB 5AVVA 5HP4A 1E2EA 5C18A 4C4OA 1HK7A 5GAJA 2IHKA 1YAHA 3F8TA 3A6ZA 2X0FA 2NPFA 4RJLA 5KNCH 3EASA 1ZK4A 2C9MA 2ES4A 4BPBA 2QRVB 3VYSB 1J0BA 2Q4TA 5D01A 2UZ4A 3E6AA 2BKEA 3N0TA 2EHJA 4TKZA 2M9MA 3LT5A 4U1RA 1GPDG 5D1HA 4ZRDA 5DOZA 4CM5A 7ADHA 3ZZTA 5AUQA 3D0QA 2WJ4A 3G0BA 4YFVA 1MW9X 4ZANA 4Y0NA 2Y1LA 2BI8A 2LCFA 3BWEA 4HSEA 4AZVA 3G2NA 1G20A 5ALYA 2HGSA 5IM5A 2JFVA 1JL3A 3NONA 1ZNXA 4K6GA 3UYKA 4BFSA 3K7EA 2AR7A 3IBSA 4P4SB 2F1JA 3G85A 5EI5A 4CEIA 3WLOA 3CHYA