3R3HA

Crystal structure of o-methyltransferase from legionella pneumophila
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
217
structure length
217
Chain Sequence
b'KHLSLTPELYKYLLDISLREHPALAALRKETSTMELANMQVAPEQAQFMQMLIRLTRAKKVLELGTFTGYSALAMSLALPDDGQVITCDINEGWTKHAHPYWREAKQEHKIKLRLGPALDTLHSLLNEGGEHQFDFIFIDADKTNYLNYYELALKLVTPKGLIAIDNIFWDGKVIDPNDTSGQTREIKKLNQVIKNDSRVFVSLLAIADGMFLVQPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords O-methyltransferase, SAM-dependent
publication title Crystal structure of O-methyltransferase from Legionella pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 67
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2011-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3r3hA00
1JSXA 1F3LA 2ZVJA 3G8AA 2NXJA 4HRAA 5E9QA 2XBMA 5EKXA 2CKDA 2IBSA 2PWYA 1H1DA 5E1MA 3KPUA 3O31A 1ZQ9A 5DLYA 5E1BA 1WXWA 2YUIA 3E23A 2ZSUA 3ELUA 4ER6A 5F2NA 2JH8A 2WK1A 3GU3A 3MCZA 3C0KA 3ELDA 4RX1A 2AOTB 3M6XA 3TQSA 3KQTA 1TW2A 1NW6A 3EVEA 1SUIA 3HVJA 1QAOA 3P71T 1L3IA 1VE3A 1KR5A 4WVLA 5CM2Z 4YMGA 1ZGAA 5D1HA 5BXYA 5KS2A 4PYNA 3EVCA 2ONZA 2ZIEA 3BWMA 3GGDA 4YUVA 3DLIA 2IH2A 3OU2A 3KQPA 4FSXA 3KQQA 5T64A 5DSXA 3I53A 3FUTA 5BP7A 4C05A 1D2HA 3MCTA 5E2AA 5EEHA 2ORED 3BGVA 5E9JA 1AQJA 3M6VA 2DPMA 3FUXA 5FWAA 3FTEA 1OR8A 3AXTA 2EG5A 3HCAA 5CVEA 3DXXA 3IYLW 3O4FA 2NXCA 4HSGA 3RW9A 3EPPA 4DZRA 1G8SA 4BLUA 1KIAA 1UFKA 2OB2A 5EOVA 1FPQA 4PWYA 1M6YA 4AZWA 3UBTA 2G1PA 5ERGB 2WA1A 4HC4A 4CXMA 1YZ3A 5HILA 1G60A 3KQWA 2VDVE 5DPMA 4C07A 4KW7A 1NW8A 5CCBA 2ONYA 2UYCA 3TR6A 3I58A 3OZRA 3R6TA 2G70A 3QV2A 3TM4A 5DTRA 4C06A 2BZGA 2CWWA 2PLWA 1AF7A 3EVGA 4X61A 1MHTA 3DP7A 3TMAA 3BWBA 1WXXA 3FRHA 3P9IA 4GOND 2ZFUA 2VDWA 4QVGA 1N7IA 1ZHFA 2IPXA 3GJYA 1IXKA 3R9XB 3MGGA 4PCAA 2C7QA 4M38A 2I62A 4KIFA 3T7TA 3ANXA 3K0BA 4RTPA 4MHTA 2YXLA 4CTJA 2AZTA 2NYUA 1YZHA 3RIEA 4ER0A 4X1OA 5GM1A 4NECA 3KPVA 2HMYB 2YTZA 4YV1A 1SQFA 3PFGA 5KYGA 5LQCA 3A27A 4KIGA 2ZLBA 3C6KA 5KQSA 3AWIA 2E5WA 1P1BA 4LG1A 1UWVA 3A26A 5FQOA 5DTQA 3B89A 3DMGA 4GOMD 4PYJA 3GCZA 4V0QA 2N47A 3JWJA 3VYWA 1RI1A 3HCDA 3LPMA 2OBFA 3OE4A 2PGXA 2OPBA 1I1NA 3Q87B 3ER9A 1SKMA 2AOTA 4HH4A 5EHIA 3SMQA 1Z3CA 4LWPA 1L3CA 3LCUA 3TM5A 2PX5A 5M5BA 1R00A 2K4MA 2PBFA 2H00A 4FT4A 3NMUF 1KYZA 1RJEA 2P7IA 5EGSA 3UJ8A 8MHTA 5EQJB 2CMHA 3LX6A 4HGZA 2JHCA 2O06A 4MQ4A 2P41A 4Y30A 4FP9A 5LQRA 3OCJA 1VBFA 1X1CA 3FUVA 4M36A 5FUBA 4BY9E 5EZQA 3BGIA 5MHTA 4POOA 5DM0A 4RTLA 5EC8A 1KPIA 4FGZA 1B42A 2IDKA 1G38A 3UJ9A 3SXJA 3VC1A 4RSRA 1NBHA 1WZNA 4OX9Y 2Y1WA 4QTTB 3VSEA 1EQAA 3FPGA 1TW3A 5EEGA 5HIJA 4C08A 3LKDA 2PT6A 5K01A 3CC8A 1IY9A 1WS6A 4FT2A 4KDCA 5DX0A 5K0FA 3FTCA 5E2BA 3M33A 2FCAA 5EKUA 4UOEA 1MJFA 1ZKDA 5E8RA 1G8AA 3DLCA 2ZZKA 3KQYA 5E9WA 5GM2A 1XXLA 4CKBA 2I9KA 2HTEA 4PONA 4QDKA 3V8VA 4E70A 3PB3A 1P1CA 2KW5A 2OZVA 2NNWB 3OFKA 4E31A 3DMFA 4EKGA 4MTLA 2ZZMA 2EJUA 2YXDA 5LSAA 2Z6UA 3CJQA 3HNRA 4PIPA 1NBIA 2ZBQA 4E30A 3M6UA 1QANA 2V7EA 3IEIA 1I9GA 3KQVA 5DSTA 3T7RA 3TRKA 5IKMA 4JXJA 2BH2A 1NV9A 1YFJA 3EVZA 2QM3A 2GB4A 5EMLA 1Q0SA 3BWYA 1QZZA 3CBGA 3GRRA 4V0RA 3SM3A 5DRTA 1KP9A 3MAGA 3G5LA 3BWCA 1JQDA 3G5TA 1O54A 1SQGA 3HEMA 2IBTA 4F86A 4C4AA 2F8LA 3P97A 5EMKA 3HVIA 3GRVA 1YFLA 2GA9A 1VQ1A 4L7VA 5GIPE 5CCXA 4IKPA 3ME5A 3GNLA 3AXSA 1JTFA 5ICGA 1XVAA 5HEKA 2BR4A 3AJDA 5E1DA 3AY0A 2Z6QA 4EK9A 1SUSA 3JWHA 4QPNA 2EX4A 2XVMA 3OZSA 4OQDA 5LR6A 3G7UA 1ORHA 3A7EA 3FPEA 1NW5A 4RTKA 5K0LA 1XTPA 1L3BA 3I9FA 3FZGA 5FCDA 2PX8A 3FPHA 3GIWA 3NW9A 3UWPA 1EJ0A 2AOUB 1WG8A 3GRYA 1SVUA 1L1EA 4P7FA 2Z6AA 5FULA 3VC2A 4PYIA 2B78A 2G71A 4PGHA 4QPPA 3PX3A 2EFJA 2IIPA 4QQKA 1P91A 5FA5A 5F2OA 1RJFA 3EVBA 4M7RA 2PXAA 5DTMA 5T67A 1RI5A 3P2EA 4BP3A 2C7PA 3G8BA 2QYOA 3THRA 2ZBPA 5C9ZA 3ELWA 3FUUA 1BKYA 4FS8A 5K0GA 3P2IA 1KPHA 4PNEA 3LDUA 1WY7A 4GQBA 4RV9A 4Y2HA 4IV0A 3V97A 2P40A 2ZWVA 1M0EA 4DKJA 2UYOA 3M4XA 1XCJA 4H0NA 3RODA 3UJDA 3P2KA 2PJDA 2PSSA 10MHA 1FJXA 1FP1D 3EVDA 5DM1A 2CMGA 3P8ZA 3LSTA 4OBWA 1VPTA 4K6MA 4PYLA 4ATNA 1RI3A 2BR5A 3B3GA 3MB5A 3T0IA 3U81A 4AZTA 2PVCA 4ER5A 4YUZA 5EMMA 1KXZA 1JG2A 2XYVA 3M6WA 3O7WA 1X1BA 3PFHA 3B7PA 4PINA 4CKCA 5EMJA 2ZWAA 4PYQA 4OA5A 3EEOA 5FHRA 5F2KA 5D1NA 1HNNA 4E2XA 1XDUA 4X60A 3LECA 3C3YA 4XUCA 3REOA 1I4WA 3GXOA 3PVCA 5U4XA 4QDJA 4A6EA 5E8JA 4OBXA 2I6GA 3KU1A 1PJZA 2GLUA 2VS1A 5LQUA 3KPYA 4AZVA 4YUWA 1DL5A 4PYMA 2P3LA 3HA7A 3LCCA 3E7PA 1VIDA 2VZ9A 4RTQA 5EIFA 4RTMA 1O9HA 1VLMA 5KQRA 1ZGJA 2AS0A 3GRZA 3NVKI 3IHTA 2QRVB 3G88A 4KVZA 3PTAA 4GC9A 3DUWA 4R8SA 4U7TB 2C7OA 2B2CA 3FUWA 2ZCJA 3LDFA 3TPZA 2FRXA 4HTFB 3ELYA 3I5UA 2AOUA 5H02A 5HFJA 5LQAA 1QAQA 3MQ2A 4X63A 3DTNA 4P7JA 4C04A 4E2YA 2EJTA 2XVAA 3BKWA 3L8DA 2PX2A 4YUXA 1JR4A 3EVFA 3UJ6A 5IH3A 2C7RA 1AV6A 3OE5A 2PV0A 5FQNA 2B9EA 2WA2A 3ID6C 1RJGA 3OU7A 5EG5A 5FTWA 1X19A 3THSA 2ZBRA 2ZTHA 5DM4A 3GDHA 5HOQA 4PCLA 3OZTA 3UA3A 3TKYA 2YX1A 2DULA 3TLJA 5C0OE 3BUSA 2FHPA 4AX8A 3KQSA 4BLWA 1N2XA 1XJ5A 2FPOA 3JWGA 4E33A 2YVLA 1NT2A 1NW7A 3H2BA 3C6MA 2OY0A 4XCXA 2AOVA 2UYQA 2GPYA 4KDRA 5K0NA 2UZ4A 3G89A 5K09A 3HA5A 2IFTA 4PGGA 5E1OA 5LQNA 4RTSA 3DR5A 3LKZA 4Z2YA 3EVAA 4DCGA 5P8WA 2NXNA 3E8SA 2P3QA 3QOWA 3UJCA 2YR0A 1NKVA 1QAMA 2HWKA 2FK7A 5LQJA 1DUSA 1R6AA 2AOXA 3CJRA 2IDJA 4LWOA 5K03A 1JQEA 1N7JA 4YV0A 5KVAA 3FPJA 1F38A 1ZG3A 4RVHA 5EPEA 1M6EX 2UYHA 2R3SA 1JG1A 2ERCA 1IM8A 3A25A 4R05A 5GWXA 1JQ3A 3NVMB 1P39A 5ICFA 2HNKA 4R6XA 5K0EA 4IV8A 5T6BA 3FTFA 2P7HA 3EGVA 3ERCA 3UZUA 1KPGA 2R6ZA 4E32A 4KWCA 5GINE 4FSDA 1R8XA 3SX0A 1BHJA 2VP3A 1JSZA 2XYQA 2IGTA 4RYLA 3KQOA 3KHKA 3GWZA 3P9NA 3P9CA 2OYRA 3UJ7A 5FADA 3TOSA 2AN4A 2GAFA 1BC5A 3NDIA 4GOLD 4OA8A 2NXEA 1QYRA 3KR1A 3PT9A 3B5IA 3DMHA 2PT9A 4ER7A 2ZIFA 2QRVA 2OXTA 2G72A 3SGLA 3PLAE 1RI4A 4HTFA 2AOWA 4WXHA 2JHAA 3NWBA 3EGIA 3X0DA 3BGDA 5DXAA 5DWQA 1O9GA 1NE2A 1R8YA 3HCBA 1VP9A 5K0CA 5HZMA 4XUEA 4GF5A 4X41A 5DX8A 1NV8A 2FK8A 3DOUA 5K0BA 5CVVA 5CVUA 5C1IA 1YUBA 1Q0TA 1G6Q1 3T7SA 2ZULA 2BR3A 2PXXA 5BW4A 2YXEA 1EJ6A 3G2PA 4GBED 3DXZA 3KPWA 3WSTA 4RWZA 3I64A 4XUDA 1XDSA 3FPFA 5BW5A 3KR9A 2BM9A 4QVKA 3CGGA 3A7DA 3UFBA 2ZIGA 2QE6A 4DMGA 5CUQA 1UIRA 5EVJA 5K0JA 2IP2A 2HR1A 1D2CA 5LQKA 1KYWA 2A14A 2PWPA 3MERA 5GOZA 4PYOA 2YQZA 3OPNA 4DCMA 5ICCA 1XDZA 4AUKA 2O05A 3IV6A 4RVFA 2OO3A 4QQNA 2GH1A 3BXOA 5CVDA 3PX2A 3GO4A 3MHTA 1PRYA 5EZSA 1JG4A 3SVZA 4DM3A 4MIKA 4AZSA 3EGEA 3BKXA 5GP1A 4ER3A 5FWDA 3LL7A 1G55A 4YUYA 1XCLA 4PYKA 3SR4A 5JR3A 5GIOE 3ORHA 2ZW9A 3R3HA 4F84A 3DULA 4R8RA 3HTXA 5HIMA 1AQIA 3P9KA 1NW3A 4DQ0A 1EG2A 3KKZA 5CIYA 4RTJA 1EAMA 3LCVB 3BT7A 3SSOA 3B3JA 5DRYA 3HCEA 2V74B 2PKWA 5EIWA 4DF3A 4EVIA 2NP6A 3KR0A 3ER8A 4RVDA 1YF3A 3HCCA 4PIMA 2BM8A 4O29A 2QY6A 4YV2A 2P8JA 4MWZA 3EMBA 1YB2A 3MTIA 2JH9A 2H11A 3KQMA 3GRUA 3NDJA 3G2QA 3E05A 3F4KA 3LDGA 3MTEA 1EIZA 1VL5A 4M37A 5K8VA 4RTNA 2IH5A 4P58A 3UJAA 4P7KA 3FYCA 5FA8A 3KPJA 2Q41A 3CKKA 3HP7A 2ESRA 4KRGA 2B25A 5DM2A 3JWIA 2PXCA 4BP1A 1FP2A 4GC5A 1U2ZA 2OKCA 2PX4A 2OB1A 3FTDA 4IWNA 1HMYA 3KR2A 3R24A 1VP3A 3M70A 1X1AA 1ORIA 5G02A 3CJTA 2HV9A 2O57A 3CVOA 4EQZA 1KHHA 2LD4A 4HGYA 4F85A 1BOOA 3D2LA 5HIKA 3QOXA 2AR0A 2P35A 1X1DA 1D2GA 3DXYA 1Y8CA 3NWEA 3R0QA 2B3TA 3LHDA 3BZBA 3PS9A 2AN3A 5DXJA 5CVJA 4RTRA 3HA3A 4DA4A 3OU6A 2H1RA 4E2WA 4BLVA 2JG3A 1L9KA 4R6WA 4CKEA 5JUWA 2I7CA 3Q7EA 3DH0A 3FYDA 4G56A 1RI2A 4QTUB 4ZTBA 3HCFA 3NJRA 1TPYA 5DX1A 3EEYA 3G2OA 3HM2A 4OQEA 3TFWA 2JJQA 3FRIA 2P3OA 2O0LA 4EKIA 4EMSA 3B3FA 4ISCA 5B1SA 4E2ZA 3CCFA 2NP7A 5CD1A 2G8NA 1V39A 3OFJA 2O07A 3UJBA 5FHQA 4GOOD 4GEKA 5EHGA 1RJDA 1DCTA 3HVHA 4RVGA 2PY6A 1FBNA 2P1DA 4HG2A 4YMHA 1R18A 3HVKA 3SSNA 1JTEA 4RTOA 3LBFA 3UA4A 3LGAA 1T43A 2CL5A 4P7GA 3SSMA 2VDUE 1INLA 2AVDA 2FYTA 1R74A 2GS9A 2XYRA 5DT2A 4C03A 1JG3A 1SG9A 3NTVA 5ICEA 2IH4A 4U7PB 3TKAA 2AN5A 4FR0A 3EMDA 3G2MA 3K6RA 4B17A 3C3PA 2ADMA 4FZVA 4GUAA 7MHTA 9MHTA 2AVNA 4CWAA 3LBYA 4CTKA 2Y1XA 2ZZNA 5K05A 4LECA 4A6DA 3S68A 2JHPA 3A4TA 5HIIA
chains in the Genus database with same CATH superfamily
5SY4A 5K1ZA 1J42A 2GYVA 5H3LA 4MVJF 4AG5A 5BSKA 4NBWA 4BV3A 1N2BA 1BFDA 3AUTA 4OK6A 1NRWA 5AW2A 3E2PA 2VJOA 2VHUA 3L0DA 3LWDA 3PUXA 2VDLB 4FYMA 3OQHA 4E4RA 5K8TA 5ALHA 3TJRA 3SN6A 3KCQA 3BIOA 3QI7A 4ZN6A 1DIHA 4EG7A 2YHUA 4CQMA 3THOA 2FLKA 1B76A 3QIVA 4GDFA 5J5AA 3PU6A 1YS1X 3AFHA 3NATA 1TO2E 4RK6A 2QL5A 3CEHA 4A0GA 4GICA 3WHKA 2VZEA 3VDQA 3BWEA 4BC0A 1T0IA 2F1JA 5K8JB 1Z15A 1G7TA 2VNKA 2CD7A 4MOWA 1XZGA 1T2UA 4GWLA 4ZYVA 1BVYF 1K1EA 2Q5QA 5FWAA 1W0JD 1NUPA 3LF2A 4CM4A 3F78A 1EXWA 3DTVD 1O08A 2BH9A 3IYLW 4GG1A 2AHOA 4R3WA 3UMRA 1X9GA 4DA7A 1JHXA 5LB4A 1XRPA 4JC0A 3QVUA 4O2AA 4DT1A 4OFXA 5AESA 5EOVA 4F4JA 2ZT8A 3DKIA 3C7DB 3IB3A 4PWYA 5JSZA 3KQKA 3FBWA 1RTKA 1Z5GA 4CXMA 1EXMA 5CLQA 2O1WA 1JKXA 1KMHA 1ZK0A 3PL1A 5A7GA 4CCSA 3AUAA 2H29A 3CM0A 3IPYA 4HNSA 3CVXA 1J9GA 3WIDA 3C3EA 4OQNA 3QUQA 4IP0A 3AFNA 5KUTA 1XMXA 5TIIA 1EWVA 5EUBA 1XLUA 3TL2A 4RF3A 4CCWA 1FVFA 4HXGA 1ODCA 1KBOA 3PEVA 3DE3X 3KLMX 3QWAA 4FGUA 4QBGB 5B1HA 3F6BX 4X65B 4PCAA 2C7QA 4QULA 4C22A 1T0JB 4J0FA 3T7TA 2Z58A 1CK4A 3TG8A 2V54A 3BMOB 4U3JA 1KI7A 1PJTA 4TOIA 2ZRMA 1BNCA 3RADC 1H0RA 1G64A 1V5GA 5KNLA 1U0BB 1YR3A 5J2UF 4I8DA 1OREA 1X7GA 1PR1A 1BMQA 2QZ4A 4IXWA 5DWDA 1ZD4A 4YDSA 1NSFA 4LG1A 3UYKA 4QYIA 5AI9A 4ROTA 5A2GA 5D6OA 2VUIB 3C5WP 3PK0A 4N5HX 1XAHA 3JALB 1HG1A 2QG9A 2VPPA 4J43A 4L5AA 3TLCA 2K7FA 3INYA 3VH1A 2C2OA 2DR3A 3KJHA 1RPZA 1V2GA 2BPOA 1RT9A 2IHYA 4GO1A 3BRQA 1BQ4A 4ENQA 3UOAB 1Z2AA 2EDAA 4DR3B 1GNVA 1Y0BA 3OUUA 4GL2A 1C1DA 1CJVC 1T10A 1RE1A 2ROQA 1C7IA 2JCSA 3GLFA 2WSMA 1KEWA 1WPXA 5ALYA 1N3BA 4O59O 1YXMA 2L2QA 4HFRA 2CCJA 1GDTA 3UHPA 1J97A 3ACCA 3PD7A 2GPAA 4QT0A 1POWA 4EMBA 4M8KA 1RBMA 3ZDBA 1YQEA 2NIPA 1S6YA 2O0MA 2ZRIA 4MK4A 4OI4A 3EYWA 1OTHA 1MEJA 5F3RA 3V4PB 4F2WA 1I2MA 3QE9Y 2JLWA 4Q39A 5KYXA 2FZKA 2GHTA 3KJNA 2GTIA 1QWSA 3NB0A 4ZVNA 1CUCA 3X1MA 2HA3A 3GY0A 4K9SA 1EYZA 3VR6D 4KVGA 2O4UX 4WFKA 1YE3A 5BNIA 3QVJA 2JIZD 1ZEJA 1C4OA 2D4HA 3GNTA 3BK2A 3GZTB 1RABA 4KOEC 1UK6A 3OA2A 3W2FA 5DGIA 4Y2SA 4HNUA 1AC5A 2HOQA 4PO1A 2IW1A 4H77A 3RQSA 5FNZA 4B6EA 1WPQA 5HP4A 1FFXB 4N8SA 1C4WA 4TXMA 5BYKA 1FNCA 3WIBA 4BQFA 1WB4A 4X3OA 3T7CA 4DLNA 4LJ4A 1GDDA 4TV9B 2HCFA 3K9LA 4CKBA 4R0NA 1GA6A 4GLLA 4YUAA 1NIJA 4GPEA 1NBMD 1KH2A 1SXJC 4WKBA 2IQ5A 2O7RA 3IIMA 3S1SA 4R2JA 1FRQA 5FLKA 5KHLB 1T5HX 2VYNA 1YZVA 4J49A 3CZ9A 3L7IA 1WBBA 3E22B 3DUFA 3M6UA 3QTBA 2WFMA 1I9GA 2D1SA 3KEGA 2II6A 3O26A 4LJSA 4G0MA 1F7VA 1QHFA 3QEMA 3KV3O 4ICIA 5NLLA 4OXNA 1DWPA 2YRXA 3RI3A 3R5FA 4ZVVA 4PZEA 4XR4A 2IVFA 3LUAA 2LPMA 1H1LB 3CZMA 3E82A 8ATCA 1EE2A 4H7HA 3I8OA 3NU1A 1N32B 2J5BA 3B1WA 1JIKA 4WL0A 4TLBA 3EZGA 3ZWMA 5AM2A 1BEZA 2A84A 2D7JA 3MQ4A 5IHPA 3BRCA 2COEA 2R4QA 4BWYA 2QD4A 4Z4CA 2Q3CA 3T9DA 3AY0A 1LQUA 3K0HA 1XRSB 4AC9A 4DUPA 3NANA 2VTVA 5JS1A 3CRQA 1K5HA 3INNA 1GV1A 1W88B 3G2LA 4KLAA 4AZ0B 3FAKA 1RYZA 4RTKA 5JFGA 3U4GA 4PF1A 5EQTA 2WTAA 2AKAB 4G24A 5T6MA 4TTVA 4YCDA 3AM5A 5LUAA 4RKRA 2OHJA 1ZJ6A 4RA9B 3DE4X 3GIWA 4Z1MA 1S1CA 1NT4A 4BFWA 2EZTA 2V6FA 4NJEA 5AO9A 5FBWB 3ZKWA 4PPYA 5A3RA 2QP9X 1QZUA 1ZBQA 2HMWA 3ZKAA 1W75A 1YFKA 4AKSA 4JDPA 1EZZA 1WDKA 4WGGA 3A2KA 4V3BA 3C7AA 4KP7A 3C3JA 1JXAA 3PLNA 2MCFA 2EGHA 3DKPA 1KNXA 2G25A 1Y7IA 4PSDA 1U7WA 1SCIA 4X6XA 1LFAA 1TK2A 2YV4A 3N2GB 4I50A 5DGHA 4DMGA 2YJ3A 3PNQA 4IRXA 1T8SA 3MWDB 3K0SA 1VJRA 1NUQA 3HKDB 1D4AA 3CSDA 3R3XA 3VPDA 3TSAA 1M0EA 3I6ZA 4F2PA 1XN1A 1XQXA 2PJDA 1AMUA 2VKTA 4K2HA 10MHA 2J07A 1SD5A 3PE3A 4CRWB 4EFKA 4TUYB 4E13A 1VPTA 3R4VA 4RAQA 1DTWB 2BR5A 1ONPA 5JQGF 5K6AC 2PZAA 3MT8A 1C0LA 1F6DA 1WRBA 5AK5A 4YUZA 1KXZA 1N2CB 1Y7PA 2WHPA 1ZNWA 3S2ZA 1FXWF 1DJPA 3PDCA 2CE7A 1RP1A 2ZTVA 1G6KA 4Y2YA 5A5GA 1SIWA 4PAQA 4P7BA 4LRXA 3ZZNA 5CA1F 2IYQA 1M5TA 2LRHA 2Z56A 4MV4A 1GG5A 1O4VA 1UJ5A 5JAQA 2WUVA 2FP3A 5EINA 2B6NA 1K63A 3RSCA 3OJFA 5JSFA 3QXXA 4CEJA 3IT3A 1TYEB 3BREA 1WEKA 4NU0A 4Y2GA 1DTEA 3VDMA 4OM7A 2E49A 5ADUS 4OLAA 1WSWA 3B9RA 4EPWA 1FJHA 2NZXA 4XVCA 4J3FA 1DUVG 3KCNA 3RRJA 3GFFA 4AECA 5LVAA 5MGBA 4JUAA 1XTVA 5E7IA 4RIGA 4ZREA 2XECA 1SBZA 4C6TA 1PW7A 1ZIDA 4O4IB 4JJIA 3LK6A 4RY0A 3W1VA 4BFUA 1RRKA 3QX7A 2W6OA 4JU8A 1MX5A 4I36A 2ZUVA 3FUWA 3TPZA 1UZNA 3DEFA 3JQ7A 3I5UA 2QX8A 4I1SA 3MQ2A 2B5VA 4J1TC 3DOJA 3DTNA 3X3HA 1T0BA 1VKHA 3QVLA 5HJ7A 5BMVB 2OECA 4O2BB 5ESXA 4B34A 3WZLA 3A6LA 3ACDA 2W58A 3TF5A 3THSA 1XRMA 5JPDA 2AFIA 5AJTA 3D4BA 4FFVA 1BMFA 1PU2A 4OLJA 1I3LA 3BMCA 5IKOA 3TIXB 3W3AD 3ZBTA 4ESHA 3QU9A 4US1R 1OBFO 1Y5LA 4GRIA 3CT4A 4YI5A 3SZOA 1G17A 4KN6A 5B55A 5AHWA 4N3NA 2WJIA 4CUJA 1QYVA 1MDBA 4BP8A 4AX8A 1EB9A 3LLVA 1A8QA 1M2VB 3OOEA 4G0ZA 5IVIA 2B92A 3O90A 4W7SA 4U2CA 1S2GA 3MF4A 1UFVA 2VNAA 4ZAYA 3G89A 2UZ4A 1DMRA 2VF5X 3KEQA 2PRSA 3HG7A 3Q3EA 5ALIA 5IC6A 3W4IA 1P4SA 1QHHA 1GAWA 3STWA 1PR4A 3C15C 3AY3A 1YQWA 4MW5A 4UM8B 1B41A 4KKXB 3RUPA 3LVBA 2QX9A 2NUPA 4DPMA 2PRIA 4BVKA 2FK7A 5CXXA 5LQJA 2XVZA 2C59A 1WZ2A 4Y2PA 3W2IA 2FY8A 1T1SA 1A77A 3SQXA 1CC1S 3PQ8A 1SO8A 4ZKDA 5EWLB 1R4MA 5K0SA 1TNDA 4C3VA 1G18A 4OXQA 2E2WA 4AJEA 1DKOA 5AW4A 3DC2A 2XUFA 1II8B 3L79A 3QELA 3L0YA 1XRJA 4H3SA 4D3ZA 4DWWA 1ECPA 1GA1A 2JIBA 2BFDA 2H06A 3ERCA 4AG3A 4II7A 5L3QB 2C4HA 1NXWA 1M7HA 1XD2A 1ZIYA 4UXHA 1XEXB 3M1LA 4YJHB 5AVZA 4RYLA 3KQOA 2DP4E 2VHYA 3GWZA 5HDBB 5BQOA 2H2IA 4H4CA 1TVKB 3R75A 3EHEA 4PSVA 4I2VA 1BC5A 4DDVA 4PVCA 3B1KA 2HNBA 4D56A 3E61A 4YAOA 3IA7A 3NDPA 1I3OA 3PLAE 3NBKA 3TLAA 1PNVA 2ECQA 3W9YA 4EABA 1VSBA 1JYSA 2AOWA 1A4XA 2SECE 4JVSB 5DNVA 5C8YB 3LX8A 5KWEA 4DB2A 4UMVA 1IUNA 1C9EA 3GZNA 1KDVA 3WGJA 1L5LA 2YWRA 4I1RA 5DXAA 2IF0A 4DG8A 3EAFA 4AUMA 2QNBA 4JVNA 2PPVA 2QZSA 2F48A 1ZCZA 3GDWA 1DRVA 1T5SA 3BIXA 1K0UA 4TVKA 2AK2A 5C35A 3O91A 1L4NA 3SZUA 5ELXA 5C1DA 2YXEA 1YZYA 5TMEA 3ZHZA 1IZ8A 4NKRA 3GMSA 3ZD7A 3ROEA 2PO7A 4R0MA 3WSTA 4RWZA 3Q5EA 2QU8A 4OF4A 4OGGA 4J1SA 2EWVA 1IPEA 1OZFA 1YC5A 3WL5A 4W8HA 4MLPA 1GRNA 2ZE5A 4GI5A 4OGKA 3WGZA 3R4CA 2DQKA 1JF8A 1WWKA 4BO9A 3T7KA 4AJNA 4KR2A 1XVVA 1NVVR 5AHOA 1XJCA 5I7RA 3CNLA 4QQNA 1OH5A 2NVUA 2XB6A 3CFYA 1ONNA 5G4KB 1JHUA 4O1HA 3BKXA 5GP1A 1ENZA 4BEWA 3U5ZB 5EP2A 1KMNA 3VNAA 2H8KA 2WJ6A 4UULA 1M1YA 1UBCA 5IEJA 1T5DX 3GV0A 3ETGA 4HYTA 4OQLA 4MCHA 4KO3S 1GILA 3A1FA 2X8WA 4G5FA 5AK6A 3OETA 2OLKA 1FDOA 3H5WA 4FVTA 2CEKA 3M3HA 5LLDA 4Q3CA 1TYAE 1XK7A 4O4HA 1DAGA 2PG3A 1FRNA 3GK3A 1U11A 2GT1A 3P0HA 3HCCA 4HAZA 2FEWB 1TL7C 3EZ7A 1SCJA 2AFHB 4R68A 3EMBA 2XUQA 4GZ6A 2YVQA 4ALMA 3G2QA 1D2MA 2AX3A 4MAMA 4WDRA 3S40A 4EAAA 3U48A 3CXUA 1BFKA 3V8NA 4IDCA 4MB6A 1E1LA 1WCYA 1CB0A 2C77A 3UPTA 4PYRA 3KQUA 4D57A 1K86A 1E77A 3F7MA 4JIGA 1JVBA 4W1SA 3AYZB 5D7NA 4GC5A 1Q1GA 5BSUA 1XMVA 3FTDA 3VAAA 3IDSA 5L8VA 1KTIA 5LP1A 2IVZA 2QWXA 1COZA 1MZVA 1WQ3A 2XVYA 3TQQA 1QF9A 5CYFA 4AB1A 4B47A 1U3UA 5KAPA 5L4LA 3P9RA 5K0ZA 4GVXA 3ZGLA 2X0EA 1KHHA 3HU1A 4FLMA 2Q1WA 4MWDA 3L7NA 4HGYA 5F1YA 3O3OB 1BOOA 3SS8A 2QUZA 3K6KA 2AR0A 3FWYA 1CQPA 1D2GA 2A78A 4FYWA 2WDZA 4B0OA 3KJQA 3KDPA 4NZNA 4EM6A 1BJRE 4TZ0A 2QVXX 3PIIA 4EYOA 1RFGE 1X74A 3PS9A 5EJMA 1Z37A 1QMPA 2D3WA 2NNLD 3OU6A 3HRIA 1P62B 4Q93A 6Q21A 5CH5A 2YFYA 1TYBE 3O4HA 4GP7A 4LJ9A 4Q5IA 1Z45A 3WJ2A 1D0SA 4EW2A 5KKCA 1QU3A 4DNFA 3D6TB 3OCXA 3S4YA 4G56A 3GEIA 3RFVA 3SKVA 5BUZA 4P33A 3W7VA 3WK7A 1LPOA 3E48A 3LTEA 4KH0A 4RSMA 5CD9A 3M49A 4XIGS 3QWIA 4EKIA 4EMSA 2C29D 1CF9A 1NMQA 3CZ5A 3DL2A 4KMOA 3I73A 4M7PA 1JEJA 1VKRA 1XZBA 2CF5A 4YRIA 1DGQA 4B6PA 2GZAA 1EUDB 1NYLA 4DILA 4ZYXA 3GLIB 1TC1A 5FHQA 3FOEC 4NXMB 1SOUA 4WI1A 3RRYA 1EXDA 5JNUA 2Z04A 2UXCB 5IF3A 3F8TA 4G5OA 2FN4A 2BUBA 5D3KA 1XEWX 1ZS9A 1N5RA 1IQPA 2CB0A 3CWQA 2RGDA 4EJSB 5L7YA 4DC1A 5IAEA 2CV2A 4XQEA 4YXWA 1XZ8A 2IPOA 1WXGA 3Q40A 1F12A 2PKCA 3TSOA 4KXFB 5K3BA 5C7LO 1SC4A 2FFRA 2VJBA 3PP8A 2J9ZB 3ZBUA 4B17A 1B1CA 4YRSA 3AVTA 4C2AA 1NVTA 1XWWA 3MT0A 2HRDA 4RXUA 4S3MA 2WLSA 4TKUB 5MN4A 1FBTA 1J1IA 2XCRB 1E5LA 3BL5A 3KKLA 1U0OC 1GUAA 4JL5A 1XPUA 2V7PA 3G8AA 1N0VC 4UU1A 3NHMA 3FCEA 3KKMA 5I7AA 2YBDA 3BTSA 4DJDC 3KPUA 4DV5B 3THYB 5IANA 5AK4A 3JTMA 3PPIA 4JHXA 2R6DA 5DLYA 4ZCRA 4JP3A 4MUYA 1E1NA 3L1UA 4LE0A 2JIDA 3C0KA 4PWZA 4QL3A 4BNVA 5C4MA 4FHEA 5LZ9A 4YIHA 1O5OA 2XA2A 3ZI7A 2JI8A 1JP7A 1U3TA 5CBKA 1LGYA 4OSEA 1Q0LA 2XOXA 1YUNA 2D2IA 1R0XA 1Z35A 4KTTE 5I9MA 4ZHSA 3OU2A 4LUCA 2V3CC 2FH5B 3H6HA 2H9IA 3L6CA 5E2IA 3RLFA 1XMJA 1UPXA 1HA3A 2PSJA 1T4CA 2F1RA 1T1JA 4FCCA 1F8YA 5PNTA 3S2SA 1I7SB 3EXHC 2DBYA 1FYWA 5FPKA 5E7JA 1NIPA 3TW4A 4EW1A 2TECE 2YVUA 1DFIA 2P9EA 1DG9A 3LRPA 1ZGHA 1XG5A 4A23A 2PU5A 2AKYA 3VR4H 2E9SA 4DLAA 4PXSA 2FEAA 2Q1XA 3BDAA 3HWWA 2J9XB 4MB0A 1Z4MA 3RW9A 1YRYE 2GHQA 4EENA 4NCAA 4H7JA 1T1EA 3WWZA 1FPQA 2HUPA 3UK6A 3KE8A 4D42A 1OAKA 4MVJH 3A9TA 2QPTA 5F9HA 3QP9A 2JBWA 4FYHA 3DBVO 1OD6A 2N42A 1FUUA 2O2EA 1L5YA 3NTOA 4FDMA 1W1WA 1XL1A 4A3SA 2F1HA 4AD8A 3F97A 2HA0A 2J31A 1G98A 1RQNA 3E70C 3I58A 3JYPA 2G70A 1QGUB 1KZGB 2RI6A 2ZBGA 4OHFA 3WJ7A 4EOGA 4IBOA 1L4EA 1DKRA 4L08A 5BN5A 1U1EA 3EY9A 1MHTA 1PTJA 4EPTA 2FDCA 4QVGA 1NZJA 4RHFA 2GAIA 3TGWA 2JHFA 2OBBA 4RZIA 4Q1DA 2Y6VA 1CBUA 3RYFB 4YHBA 4RTPA 4RPCA 3K0BA 3ZBPA 3PUIA 2PRZA 1UBRS 2QYTA 3LRXA 5EUMA 4LZLA 1IQUA 4Y2JA 3LLUA 4YT5A 2HMYB 3SYNA 4RO0A 1U8YA 3PFGA 1CUIA 1WP9A 3CHYA 2WG0A 3KEFA 4YFYA 4PC2A 5AJUA 3NCTA 4L0QA 4BQNA 1GN9A 1SOWA 3RREA 5MFZA 1KC3A 2C5HA 3GGOA 3MFYA 1QQBA 1N8SA 3DXFA 4XIFA 2UZ1B 4GYYA 2PRYA 1QYXA 3HYNA 3N87A 2Y99A 1RI1A 3RWOA 3F7NA 4BB6A 5LOVB 5AUNB 4NZOA 1VDZA 1ORDA 2GLXA 1JDTA 2AX4A 3ABZA 1HTWA 3DE2X 4ZKEA 4WOPA 3VYTB 3FTPA 4TMZA 3ZW9A 2EFCB 4L16A 1VMDA 2WYWA 3TSZA 4EH1A 1K5DA 1NVGA 2Q0SA 3QNWA 2F4NA 4MPJA 4CT4B 4WBNA 1IQ0A 4Y30A 3M1YA 2B3DA 1J0AA 1WUKS 3H5TA 3F98A 3NR2A 5CJ2A 3RJ9A 3WVNA 3GPLA 5C80A 3KQHA 3LF1A 3ONNA 4FGZA 4LDJA 4NU8X 1XNHA 3QFCA 1RLTA 2QQFA 3ZWCA 5EP4A 1NBHA 1WX1A 1YJAA 2JNWA 1ZA2A 2K7ZA 5ENZA 4L73A 1U04A 2GAAA 2ZBEA 1MB4A 1L5HA 1YZGA 2PZFA 4B4WA 1NULA 2X0NA 4EBFA 4ND1A 1Z4JA 5DIZA 5JQGB 2VC2B 4ZI2A 2ZIZA 1SU6A 4YRDA 2NG1A 5KSZA 4LF6B 3CKMA 3FF1A 4DKXA 4YCMA 3Q6IA 4J91A 1RZUA 1W94A 2PMDA 1R9JA 5CMLA 3RSHA 2O54A 1Z8HA 1E4OA 3FCSB 3WL8A 3AV3A 2W6NA 2RB4A 4PFQA 3ZGNA 1XDDA 1UBLS 1XXLA 4OGLA 1BU5A 3AHCA 1OZAA 1VRVA 3RS4A 4IDQA 5IBRA 3AR9A 1TZBA 3PPVA 3Q3JB 2AR7A 1VA5A 3QYAA 2AJ8A 3VUEA 4ZK6A 2RH4A 2P9QA 4K0KB 4EG1A 2CXNA 3FMFA 4ID9A 3KQVA 4GX1A 4ZI5A 2W71A 5A5DA 1MQ8B 1YIAA 2W8BB 2AXEA 1P44A 2B4QA 2G9QA 1FE8A 2NZYA 2Z5FA 3AKCA 3BSSA 3CF2A 3ENNA 4E5DA 2ISCA 3K70D 2JFNA 1ISJA 1YB6A 2PO5A 1CZUA 2XDQB 3IERA 3SM3A 4CKXA 4LJRA 3A6PC 2AE1A 3MIZA 4ND8A 1V16B 3QKUA 1VGRA 1ITZA 1DCKA 4MCAA 2PQ0A 1A4RA 1R0YA 3M5PA 5SYNA 2BKAA 1BWSA 1H2HA 2C4WA 3O38A 4DA0A 3PA8A 2Z2JA 2Q1YA 4CLRA 3WMEA 1IC6A 2GA9A 4EUNA 4E07A 3UANA 1QORA 3IJPA 3QUCA 1M2FA 2GERA 4B2LA 1BW9B 2D8MA 3NC0C 1ZRNA 1FTWA 5E1DA 2B8JA 5FFFA 2BC9A 4YRFA 1YL6A 3GW8A 4BO0A 2YWJA 3DYIA 4I4TF 1E0AA 3FYTA 4L6IA 3RTDA 1JSRA 5IT9A 3DZDA 1OJLA 4CEIA 1LLCA 3LYHA 4KO1S 4KXXA 1U8CB 4ZVPA 1KO8A 3I9OA 5LD2B 1ISGA 3S1AA 2AOUB 1A1SA 2KPOA 2ZM6B 3NIGB 1Z6YA 5AKGA 3VX4A 3SK0A 4EY7A 5DW3A 1ZN7A 5MN5A 3I5AA 3UKJA 2ODWA 2IIBA 2YJZA 2A3RA 4BTEA 3IHWA 2JFVA 2EIXA 1BQ3A 3KYCB 1E20A 4M7RA 1B6GA 4D8XA 4WWHA 3B7GA 3E3LA 2J87A 5K3OA 3FETA 1HLDA 4ARSA 1CE8B 2MWMA 4CQLA 5CLLA 3R0ZA 1U8XX 3W1EA 2Z43A 3UHFA 3V97A 2D1TA 4MICA 2UYOA 1TTQB 4YAGA 3C8DA 1ZJZA 3I2JA 2HO4A 4QQFA 2W8ZA 1TYCA 4BNZA 3A6ZA 3C3AA 1LZKA 2MHCA 2V45A 2Q2NA 4RM3A 4DNXA 2PLRA 1G9XA 3QW4B 3ZDRA 4XWOA 3K0AB 5AK0A 3GLVA 1TUEA 5DOVA 5J59A 1VG8A 4KV9A 3EQ2A 5JRZA 3SY8A 2P9FA 2Q5CA 4IZHA 1ZU5A 1U7TA 2HTFA 2VQFB 3HMQA 4L6AA 3NV7A 1YT5A 3H04A 2VQDA 1AGXA 2CUTA 1JSCA 4IX1A 4WD3A 1T6YA 3TQIA 1JV2B 1NQOA 3F9IA 3NWPA 3OZVA 3IVXA 4QOGA 5KTOA 3KQNA 2C5AA 4FHDA 1L5GB 1YDHA 3L0BA 4IDGA 4MAFA 3OTIA 3NDBB 2G6TA 1K9VF 2ID8A 3U4CA 2DG2A 3BB3A 4EWLA 2O2IA 3TX2A 1BHSA 4IHAA 4XWGA 4BB5A 2LCIA 3HA7A 5KNDD 2GHRA 4WASA 5E7MA 4ZJYA 1NVXQ 1VHDA 4KQXA 3ZW7A 4RD3A 3KSBC 1AGRA 1GPNA 4FNOA 3QU7A 4RD6A 2FP4A 2W42A 2DH5A 2IYPA 3H2GA 3QU4A 4R8SA 2B1QA 1XEWY 1ZUWA 4U7TB 3RVKA 3U4AA 1UFRA 3OJXA 2BP7B 4JJZA 3GN1A 4XWKA 1U2DA 2CXOA 1SUEA 3EAQA 4R7TA 4XDHA 2ZT5A 2XI4A 1M7GA 3GFQA 3B6IA 3I37X 2I4TA 5CG2A 1XZNA 2QS9A 3R3YA 2DCUA 3ROZA 1Z07A 4LHYA 4D8TA 4XSVA 3AC0A 2WA2A 3D4NA 3HJRA 4NESA 4BQIA 3ZGXA 2WB4A 4D0SA 4MRRA 2G8LA 4TYNA 2WY2D 1EVEA 3FW1A 3HVUA 3HUFA 3OZTA 1D7AA 4PANA 1W46A 3HP1A 1DAEA 5TMBA 3WBFA 3IUPA 3HUDA 1J0BA 1N2XA 2FPOA 1NP3A 4D8WA 1KBZA 1WAMA 4ZDIA 2G28A 1F1JA 1PTJC 1R0WA 4G4JA 3OE7A 1RZVA 2GWRA 2ZJ0A 4JIMA 5I7UA 2GMWA 2P2LA 1BXGA 3DOHA 1GT91 1LRLA 1J7KA 4LOJA 4UDYX 5E1OA 5EJIA 4G0UA 2IDMA 2ATCA 3K9NA 5HE8A 4Z2YA 2B1IA 4QBFA 1E6MA 1YWGO 1T29A 1ODSA 4N6NA 3H6GA 1OFGA 2JLRA 1XZCA 1WVMA 3NBXX 1E3QA 4CM6A 4GP9A 1R6AA 3SKYA 3C43A 2IDJA 2Q4EA 2ZGVA 4CLXA 2P2SA 4AURA 4XEHA 2YMMA 4U63A 5HKOA 1XZJA 3GGGA 5KVCA 3ND7A 2HLHA 3QXCA 2I4MA 4JJ8A 3IMCA 2WHRA 4H0CA 1Y80A 2PBZA 4E15A 4B3GA 3T95A 3EA4A 2XUJA 3EGVA 5HK8A 1NVEA 3RS2A 2EBUA 1G4UR 3IAXA 1FOEB 1E0KA 3VTAA 2LR0A 3A6JA 1TJ4A 1W6RA 2IGTA 2NO9A 1SY7A 1DC7A 2Q3FA 3H0KA 1QCZA 2CXTA 3PXGA 1QE5A 1JNYA 2YJ5A 4JJ7A 1R37A 1UL1X 4FYYA 1RFLA 4ILKA 4MQEA 4K2AA 4CU2A 5BW8A 5JFOA 1V5FA 3KR1A 1P9OA 2PNJA 3O0TA 3VH4A 2FI1A 2V7XA 3EIWA 3P9PA 2HWYA 1L7RA 4N9WA 3S55A 2APJA 2G72A 4X1IB 2ZBVA 4OH7A 4DQDA 1KFKB 3WLPA 4BMPB 2GLTA 2JHAA 3EGIA 2R68A 2XOKA 3IKMB 1DC6A 3NRBA 3LOQA 5EGNA 3TNDA 3FYSA 2YOFA 5NULA 1VP9A 1A04A 3CBQA 1N2JA 1Q2UA 1GRCA 2MOKA 3GP5A 3HB7A 3HEBA 1IZ7A 3VYUB 1GRQA 5CLFA 3R6WA 1YQUA 2WU0A 4C0BA 4RMHA 1U2QA 1C14A 1SGWA 2A9VA 1SCAA 4FGWA 3K4QA 2OG2A 4JLAA 1EJ6A 1WCIB 4WT7A 2PS0A 2R84A 2YS7A 1KBQA 3P5SA 3OZBA 4YP7A 4WGFA 4A26A 3S0JA 3S29A 5KTNA 2Q7OE 4LC9A 2XMBA 1DHRA 2DBZA 4MUAA 4JVMA 3RVRA 4YLEA 3O7MA 2YQZA 2P5SA 3W4JA 2X8JB 4GWGA 3AJRA 5AI4A 2YZGA 2VPZA 1BEUB 4HPJB 2OGWA 2V6IA 1WPGA 4LXTA 3ECAA 4M9ZA 4MIKA 3SBOA 3TXYA 2W48A 5FBVB 4JT9A 1Z7GA 4GBMA 2W4MA 3T34A 2QTHA 1TZCA 2MT9A 1M34B 2LCQA 3V4LA 5JNRA 1KK0A 4JLDA 1Z26A 2QQEA 4IVPA 3OQNA 3LBNA 1PP4A 4WNCA 1EG2A 1MPXA 3MLBA 2B4YA 3J81k 1E9CA 4FMDF 3WTCA 2UZ3A 3HCEA 4BGVA 2O59A 4J4HA 3T5BA 1HY3A 4M99A 1X2EA 5KI6A 4GSLA 1FMCA 1Y1KE 1KE1A 4CL2A 2WIAA 2FQ1A 3UT5B 3IKVA 2QLJA 2XUGA 2DFTA 4M0CA 1A5ZA 2WV7A 1RACA 1HE3A 1E92A 1MB3A 1ICIA 2Q2OA 5GJWC 5AUOB 2RE8A 4NULA 5LXTF 3LUHA 1GVHA 1P18A 3N59A 4AJ9A 4KGDA 1WZUA 5CW2A 1VM6A 5EMNA 6REQB 5LZ2A 3NEAA 2J0SA 1ZCBA 2V6GA 3DM5A 2PVPA 1FP2A 5CTJA 1U2ZA 4RXMA 1QYWA 3ENVA 2DJIA 1Z2NX 5B5SA 3ESBA 3N86A 3YASA 3C6XA 1MT0A 1ZH0A 5A9SB 4MP8A 4EI9A 2FXIA 3KSZO 5G02A 2FAXA 4R83A 2XDAA 4GU5A 1JUDA 2ETVA 4D9JA 3D2LA 3OF3A 1QGYA 1CHNA 2WUGA 4RK7A 1KDRA 4OVKA 4NOLA 1M1ZA 1RYYA 3AJAA 3OIUA 2QIOA 4TS3A 1HFKA 4JLUA 1ZONA 5IRCD 5CYGA 5DXJA 1G8MA 3HA3A 4D96A 3H13A 2AZDA 4LE2A 4RJ2A 4X64B 1OXMA 3DNFA 5MF6A 4Q9KA 1CQWA 3OZUA 3TPFA 2QTLA 3EEBA 3IR5A 4C2BA 5IFLA 4RCYA 3RGWS 1PR9A 1PX2A 2Q3JA 3CCCA 5DW0A 2CJFA 1COWD 2BUAA 2ZVQX 3GB9A 4DFDA 2AH5A 3A58B 3AF3A 5HHTA 1K9SA 3VU3A 1DX6A 1F2DA 3G7NA 2HU7A 3NXSA 3KAPA 4IS2A 5ADHA 2A9OA 4GEGA 1KRHA 3LAWA 1I1HA 2G8NA 3CEPB 1SN7A 2KM1A 3QEJA 4EQ6B 4AJIA 1X86B 1UDCA 2ZJOA 1DCTA 2WWWA 4L02A 3SSNA 3UA4A 1ZHOA 3LGAA 4F1KA 4PIVA 1ACMA 2VEDA 4HRXA 3MMXA 3PWTA 3OC0A 1SUWA 5HX7A 1CDEA 3IOMA 3WNQA 3KYDB 4FR0A 4MGEA 2Q9UA 3JAKA 3DZFA 3SHWA 4C0AC 3DE7X 9MHTA 3C74A 3PCXA 5FOQA 4DSTA 2C54A 1NYQA 1PG5A 3PUHA 1RNLA 4HVTA 4A6DA 5EXTA 2ZDQA 1K7SN 5B1IA 3A9WA 4RJIA 3I3SR 3W77A 1MGPA 4B4DA 1Z4QA 4OKNA 1L5WA 5EKXA 4GUDA 2R6JA 1H1DA 2R5FA 1U2DC 3JALA 3N2IA 4JS0A 4HMQA 1RHJA 2VEOA 2VYVA 1E8MA 4R4JA 2OO7A 4B6JA 1Q14A 2H7CA 5E1BA 2I3BA 5HM6A 3W3ZB 5A9RA 1I2AA 1W4ZA 2A9PA 1GY8A 3WNDA 3M6XA 4U7FA 5LZ5A 2IX3A 1FB5A 2AA3A 1SUIA 3EBOA 1H2XA 2YW9A 1P0PA 4O5AA 4WVLA 1ZITA 5CM2Z 1W4LA 4D9KA 4N54A 2ZXFA 3WFZA 4B6OA 1EXNA 4URUR 5K3FA 4L4YA 4BAGA 1R5NA 2PUEA 1JDZA 5D85A 3KKEA 2Z2IA 4JH0A 4CM9A 3V8EA 3GUZA 2AEFA 2MDTA 2XZTA 3DVSX 3M6LA 8AT1A 5LQMA 4CGZA 3K8QA 1UBHS 2HI0A 2ZEJA 4K6HA 4RAOA 5EYPA 1FDVA 5CK5A 3Q4GA 4C0LA 3V4FA 2DUMA 1HF3A 3JQ8B 2GVNA 1SCQA 1YJ8A 4OXXA 5DNUA 3ANNA 3G0CA 2QRPA 3RK4A 5JNWA 1IFXA 2H3HA 1DJOA 2DKNA 1HG0A 4HC4A 4OHBA 3IXMA 2JPDA 4L75A 1XPOA 1L8AA 4OAPA 1FFXA 1G60A 2VDVE 1GZ6A 3V4ZA 1OH8A 4DWOA 4DNOA 2REQB 1ISRA 3JSAA 5CDTA 2VQEB 3PRHA 3OZRA 4YR7A 1U0GA 3QV2A 4F91B 2JGKA 4TV9A 1OT5A 4JC4A 3C45A 4WEOA 1PS8A 3EX7C 1WJGA 5F52A 1M6HA 4AJOA 4C14A 1Q1NA 3D0OA 4IPTA 1DADA 3ANSA 3W78A 1GN8A 1IXKA 5BWLA 4B3CA 1AXRA 1DELA 2PGDA 5BQ5A 5FF9A 4EATA 1GPAA 1X1TA 2GEBA 2AK3A 4F7DA 2WBLC 4YV1A 5C7YA 2HWWA 5IASA 2H31A 4H0FA 1SQFA 2X3FA 2N1MA 1UEXC 3QX9A 5CG1A 1UC8A 3EC7A 3NHKA 4G8BA 4UBMA 3LZDA 4DSUA 1H05A 1UXIA 1B6TA 1V95A 5LIRA 3DMGA 3JARB 3WLFA 3VO9A 2Y1FA 4ENPA 3CUVA 3C6ZA 3GG9A 5L45A 2DPGA 2C0QA 3GMDA 4QU8A 5DASA 4U5QA 4WNAB 5DNEA 4AF7A 3TTSA 4PBTA 3QPDA 1HX7A 4ZPXA 1W0KD 4EO4A 4BPBA 2FJPA 2PX5A 1DHTA 2PBFA 5LC1A 2XSZA 3B6KA 1KZ6A 1KYZA 5BSGA 4Y6LA 5HA5A 1J22A 1I13A 1LTQA 4N6GA 4AZ0A 2X76A 3PJDA 4HGZA 4PN3A 5HZGA 3K70C 3HQ4O 5LQRA 1RRFA 3OCJA 4JITA 5AKYA 5T4HA 1NHGA 2FJ0A 1FFBA 2TRSB 4X8LA 5FTLA 3EEQA 4HKTA 4B48A 3KXDA 4RA9A 3R44A 2C83A 5DM60 4AKGA 5JJ5A 5JJLA 3EVTA 3H4IA 5ILQA 3VKUA 4KH1A 3WZMA 1VE1A 1UC5B 3JZDA 3PA6A 5T4BA 3RS3A 1UDWA 4HLUA 3MJVA 2B7CA 5FO1A 1Y9EA 1IN7A 3IBCA 1IZ0A 1TW3A 3DFUA 3IMGA 5HIJA 3ZWQA 1VJCA 4LVNA 4BVGA 5L51A 1UWKA 4MA0A 1AV7A 2W2VA 1S8NA 5DHQA 2O8EA 2G9RA 3C4JA 3TQRA 1CY7A 1TEHA 3MSCA 4C7BA 2C9YA 3EG9B 1G8AA 2FCRA 2PIAA 5FT9A 3V42A 5IBQA 4AKHA 1Y34E 4MKFA 3CA8A 3IPXA 1BN7A 4LJ8A 3U3KA 3WLJA 2Q4RA 1P1CA 1GTZA 2HDNB 3IA2A 4CHGA 5DHUA 4BXOB 1EGMB 1LBTA 2V6JA 2PL3A 4KKVA 4Q24A 1L8QA 4XX0B 4TUYA 3JD0A 1PAUA 2XZLA 1ORTA 1QTIA 3U56A 3LM8A 1DTWA 3ZDEA 4UHDA 4B83A 2VTKA 1XA4A 4JHLA 3T94A 4E30A 3OKAA 4M7OA 3QNUA 3HFSA 4UQLA 5JYDA 3PTZA 4FMCF 1CVIA 4DA6A 1IATA 1QV7A 1XTQA 2DLDA 2IL1A 2IU0A 5JJBA 2B7BA 1S9DA 4Q1CA 4QGHA 3RJ5A 2PE5A 4IQGA 1VC2A 2Q2QA 3T9BA 4DADA 4RK4A 1UZAA 3L6UA 1CRQA 1A8HA 5ALTA 3NTXA 1DIRA 1XLWA 5COAA 4IUDS 5I5GA 1G41A 1LPAB 2K87A 3QFSA 5CIQA 3FJOA 3GAAA 1JTFA 4ZI7B 2J6CA 1Z06A 2H4FA 1XF9A 2AFIE 1PL7A 4O1IA 1XU9A 4FEAA 4RY9A 3G7UA 3U5TA 2YIDA 3BHMA 2R8ZA 5K0LA 4PG4A 5HGXA 5FYDA 2HO5A 1JDPA 2I67A 3O5AA 1FLVA 3K0FB 2GCIA 3FDZB 2B20A 2KE5A 3C6YA 2JFUA 5FCDA 3RS8A 1I7PA 1KHTA 3S3TA 1XRRA 4HWOA 2NSYA 1W85B 4WQMA 3V1KA 4TM8A 1WG8A 5ALRA 4PGMA 5BMVA 3QKRB 5FULA 3PWSA 3L7CA 1MRNA 1XDGA 4H6VA 1E62A 4PYIA 2B78A 5CVCA 4B45A 2CXPA 2JCVA 2GZSA 1P74A 3AKDA 3FSGA 4B1FA 4QQKA 1TJ5A 2PL9A 2QUIA 2FV8A 3OWXA 1RXIA 2G5CA 1R10A 4UOZA 3ZIUA 4PZ0A 1IHOA 2R66A 5H0IA 4D4MA 1TTHA 1V43A 3N8GA 1CUWA 2H59A 2HQSA 3DB2A 3UV7A 4J7CA 1SFRA 3T3NA 1YAJA 3EMVA 5F12A 3P1JA 1FJXA 2HCTA 1RAFA 4RKQA 3MJTA 1LA2A 1EK5A 1SXPA 4OBWA 3EFBA 4C0HA 1LPSA 3SLGA 1GGJA 3WGVA 1XNQB 2XRZA 2J3LA 2FUEA 4OEHA 3OJCA 2RAUA 1LDEA 4ER5A 2Z1DA 4JKIA 1FYDA 1SCUA 1T9AA 3WO0A 1NQAO 3IBTA 4P36A 1MH9A 2M32A 2C31A 3ZQ4A 3L06A 5DGDA 1GU1A 4RHUA 1M8FA 4YK7A 1UT5A 3U6KA 1JG6A 1EFVB 1IVSA 3FDXA 1EUZA 1II8A 1XLTA 4INOA 2C5FA 4QYTA 2AG8A 4EF4A 5B58T 2YWEA 2W2QA 2AG5A 4QJBA 1I32A 2BHSA 2FSVA 4RH0A 5ELLA 3TO5A 4DA9A 5IBCA 5LJIA 5DBHX 1IZYA 4IXMA 1KEVA 4CM1A 3DZKA 1W5AA 4N7BA 4Y98A 4F3YA 2AG6A 1TVKA 1IB6A 4UPVA 3SHTA 4PXAA 3NTRA 1YKFA 4PZDA 4GI3A 4UUNA 4C0SA 4Z51A 4WCFB 4D92A 1N0UA 1OXTA 1VGQA 3IMKA 4J03A 1QM5A 5A6VA 5FOXA 2KBEA 1U1GA 4EY8A 3ZNOA 1MQAA 3WGNA 1O4WA 3SU8A 4TMKA 3IT0A 3EJ6A 1XMIA 5KSYA 3V4RA 5C8YA 1E9SA 4TXJA 1PEKE 1MJGM 1W7AA 3AG5A 3ETHA 3D1VA 1IJFA 3FR8A 3Q6MA 2R6CA 2EJTA 2XVAA 3WGLA 3QUSA 4TMYA 3QBVA 4P53A 1I33A 1W59A 3OE5A 3P4UA 2Y8EA 3NTUA 3ORQA 2UVDA 1AHPA 2JEZA 3HB1A 5JBQA 1WHSB 2ZXEA 1F0YA 1Q2XA 3EDYA 4IIUA 4JT4A 4NCKA 4ZCLA 5KKAA 3HJUA 3RBXA 1XQYA 4Y2VA 2NT3A 4B79A 2VJDA 2DULA 2HNAA 2H5IA 2JGIA 3VDRA 5C5IA 4PPNA 2BKLA 2X15A 5IULC 4ND6A 1I5RA 1XJ5A 2ZYHA 4MKGA 1Z5VA 3RT9A 4DDHA 1NT2A 4DXDA 1T2VA 5JZOA 3VR6H 3UT0A 1D0IA 1FFGA 1KOFA 2PFSA 2FFJA 5K09A 3UY4A 1X13A 1THTA 3LKZA 3O4GA 3OPYB 5JZBA 2HF2A 1KWGA 4NHOA 1IXSB 5J40A 5DBGA 1NG1A 3C4QA 3D3KA 5AR1A 3MJSA 4M0LA 3E8MA 5G4KA 2VA8A 3QOWA 4MUFA 2RH8A 3QU2A 2GCGA 2HA2A 4Y8VA 3VR4A 1ZMOA 4K6OA 3L6OO 3JYNA 4HPWA 5DV9A 1DUSA 1XGKA 2AOXA 3IODA 3T5DA 1M73E 4Y6OA 1XJQA 2ZYVX 2VWGA 2RHWA 3E7DA 3OWOA 3P20A 4MVJA 4P2BA 4RVHA 3ZYZA 3P96A 1G2IA 3BD7A 4GKVA 2ERCA 5HQTA 4OUDA 1R0LA 5CDGA 1Q84A 2YJ4A 3OX3A 2Q0XA 1E1MA 3PUVA 1HZZC 1WF6A 3KZOA 1NKSA 1PWXA 3MGCA 5DTIA 1OC4A 2I29A 4J6FA 1QTRA 2V8OA 1NC3A 1U9ZA 4KK4A 4E32A 4J7AA 1K5PA 1NDUA 4D5GA 5J4KA 1JSZA 4XQ9A 1AQUA 3DDWA 2P2CA 1RHRA 3KHKA 1YVPA 4FJ1A 4IV8A 3MN1A 1TCVA 4L9AA 4QAQA 1WBDA 4QGGA 2RONA 1E1RD 3O0DA 3MJFA 3MTDA 1GRRA 3QV1A 5EJ4A 5JYCA 3ESCA 3QLVA 3ROQA 5JVDF 1C30B 3A1NA 2Y1GA 2YQ4A 1FY2A 1QO0A 1WMAA 3GFBA 1RJWA 3K5WA 3GFGA 3QFHA 3NWBA 2N3ZA 4HTFA 2QIPA 1GPH1 2C5LA 2LXNA 4LWQA 4PPQA 5DP2A 2ZSAA 4ANFA 4HLUC 2I6FA 4Q19A 1T9ZA 2R8OA 5ER9A 4ZT6A 2O8FA 3BF8A 3DSRA 3PUWA 2AYXA 1KS2A 3CIOA 4X41A 3DO5A 3V7UA 5K0BA 2PQMA 2CBZA 1T9GR 3AUYA 1AKWA 1KI8A 1P2GA 1Z68A 2AN1A 3IOBA 4Y1RA 1ODIA 1M2WA 4DCVA 2ZULA 4ZPJA 2B4TO 3AB3A 1DIOB 3GZJA 3NM4A 4CG0A 5HQ3B 1Z12A 1AKTA 1XMPA 3GLHB 4A1OA 4PZZA 4X1KB 3Q8WA 13PKA 4G4SP 1J99A 5G3YA 4B87A 2ZYSA 1OAOA 1Y3BE 4RQUA 2RJNA 4MDFA 4ZHQB 2PUAA 1VFPA 2DWQA 2VNJA 3EASA 4EHBA 3R7AA 4QASA 1OCEA 5CU7A 3MERA 1FQOA 1W48A 2C2WA 1IB0A 2ORWA 4EGFA 2F3UA 2C9ZA 1OVMA 3FWNA 2ZPAA 1CWUA 5AKEA 3X1KA 4NOJA 1O96A 1G2QA 1QH8B 5B2EA 2GCNA 1QRUA 2ID9A 4DM3A 3E58A 2JAHA 3EGEA 3DDOA 5J2UA 4REQB 3K8ZA 4W6QA 3ZVNA 3DBLB 3TD2A 3TRJA 4LJYA 3TRHA 4QFMA 1EUDA 4R41A 3VH2A 1OHHD 3I6QA 4QTYA 1DX4A 2D4AA 2NLOA 2VOEA 3DULA 3CH7A 4FLEA 4Z7OB 2X9VA 3GOHA 3H4VA 3PYXA 2RBKA 4OQZA 1BGXT 3DMYA 3I83A 1EAMA 1OX4B 1VBMA 1QHSA 2B61A 2VK2A 3ZV4A 4EJSA 4Z4FA 4HCJA 4J4TA 3SSOA 3JQ9A 1RWOA 4CLHA 1KO1A 1ZUIA 2BMFA 5EIWA 4EG6A 3IV9A 1ISSA 2FW8A 2BRUC 2ZJ7A 1MVNA 4LMRA 1HBJA 4BNLA 5AVXA 3CVUA 4NZZA 4BJ5A 1XRQA 2V7VA 1ZX1A 2GJAA 1P4JA 2P8JA 2PWZA 3HSSA 4E7OA 3CRMA 2F55A 5AICA 1U0SY 3ZWAA 3VR2D 4KQ9A 4M21A 4U39A 1QXSA 3FE2A 4IVNA 5JZMA 4V2IA 4YAJA 5TDHA 3WQBA 4W5NA 3MJEA 3ICPA 4JYCA 2CHEA 4NMXB 3L9WA 3VDNB 3HJCA 1DQPA 2KLBA 1ZMBA 5CHYA 2JGDA 4CKWA 5KU7A 4L78A 1D1QA 5T41A 1E4YA 1Z74A 1BH2A 3ORSA 1I4TD 5JXGA 3LJKA 3L8GA 4MMZB 3MTBA 3R24A 2NUTB 4COOA 5B12A 1VP3A 1H2YA 4ARIA 2A5GA 1LXCA 1EDDA 3DHEA 3F9CA 3RKUA 1G3IA 1T4GA 1VZ2A 4MR7B 4E21A 4NBTA 1NPYA 2H5JA 4KGXA 3ZCVA 3GT7A 4G1UC 1P1IA 3B52X 1RRGA 2HFJA 1SWWA 3CUKA 4HH3C 4O0MA 4P9NA 3IJ5A 4CLOA 4BOYA 2OHGA 1JR6A 4F38A 1E66A 3P45A 1W44A 1MB9A 3NC1C 2I99A 2EATA 4M76B 2WB2A 2I9PA 1V3QE 3G59A 3MBOA 4AUEA 2HSWA 1V48A 5JARA 5J4LA 2DWPA 2A9RA 2V98A 3DH0A 3FYDA 1NFFA 2WD8A 1IHUA 1GQRA 5DF1A 4L6CA 4Q7KA 1TPYA 3W3AH 1A9XB 4WW0A 1Q0HA 1HDXA 4XE5A 1KQOA 1JFFA 1XE3A 2J7PD 2IS2A 4XM0A 5BXQC 4AUNA 1DEXA 3TQOA 1Y98A 3H16A 1QGUA 3D8TA 4WA8A 3UJBA 2V9CA 5FXMA 5KVSA 3Q5DA 1ZXBA 1ZMRA 1XLTC 3RRZA 3HVHA 4GNKA 2CVZA 521PA 3HVKA 3T12A 2FSVC 2IYVA 2CBGA 2PSDA 4Q4JA 3TLYA 1KDOA 4I6JA 3T3OA 4S1PA 3B5JA 3SSMA 2FYTA 4AU1A 1CUFA 1BWRA 1SG9A 1AUQA 4X20A 4LF4B 2O7SA 3MXOA 4ZC8A 1Q20A 4JBLA 2FF7A 4CF6A 1CCWA 3OIDA 3H19A 3NETA 2I4RA 2W6JD 1E5VA 3UCFA 5A3QA 2F8SA 2QM8A 4N48A 3ESXA 2WUFA 1FDSA 5LNK6 4LECA 2O7NA 4WBXC 1OFUX 1Z47A 1Y7TA 4WVFA 5BWOA 2DT8A 2PGAA 3FDFA 1JILA 1Q57A 3IP7A 4JR2A 3KYBA 1I2DA 2CKDA 3J80A 3P9XA 4I9UA 2WJHA 4KUGA 4TVBA 2D54A 3L46A 5KWSA 2ZSUA 1RXEA 4Q01A 3OO1A 4WZBE 1EFAA 1G8FA 3EIUA 4WX2B 1H3EA 4NS4A 1QKJA 2WJPA 5FUVA 1JW9B 1R6BX 2SKDA 3SJ7A 1PHPA 2WVAA 5CEFA 1I4DD 4RVUA 5IK2A 4DJEC 4LF9B 2BBOA 3N8KA 3U6BA 4JT2A 1RLJA 4FD2A 3TLMA 1DQZA 3Q1KA 1ONSA 1O1YA 2GDZA 1DXHA 3EMKA 1OGIA 1P31A 1Z08A 3AFOA 2D2VA 4HUQA 3AEZA 3D7LA 1K7YA 3ZV6A 2NO4A 4FHZA 5EA2A 1TA4A 2VO1A 3RB8A 2GHIA 4TMWA 5JQGA 3G0HA 2YHIA 1GCUA 4M1ZA 1PK9A 4NRDA 1AK1A 1FXWA 1ZCJA 1E61A 2JFHA 2EQBA 1Q11A 3ZQ6A 1D2NA 3GFSA 1BROA 3RABA 1F6WA 4GR9A 1KEZA 5CA1A 4XWWA 1ZOPA 4L4SA 3D8SA 1E2IA 2YC4C 3TAXA 2YWDA 2RGWA 3TM4A 1OYOA 4ONEA 1K6EA 2I8CA 1QNFA 4GLOA 3VR0A 3AJ9A 3OQIB 2O2ZA 1WQ1R 1Z9BA 4NJMA 2BHTA 5DN9A 4UZFA 2OMEA 5TV2A 4M0MA 4RHEA 4UBLA 1DC4A 4LN1A 3ASVA 2BN4A 3FM9A 1JLRA 1B7GO 1OYWA 1Z6PA 2D06A 2NSJA 2QK4A 2CJPA 2W8BA 4LXGA 2YTZA 3NEYA 4NENB 1S9HA 5IFKA 4UMDA 4JGBA 3VMFA 1YHYA 4I4LA 2A0UA 1YBVA 1B0AA 3A27A 1LNSA 3QLVC 4PSKA 3O94A 3AEXA 4FMPA 5AVOA 4AY3A 4Q7QA 2CNWD 3FFWA 2VTBB 2VRCD 3LZ6A 1Y8ZA 1JE1A 1TMOA 4GOMD 1NM5A 2QVCA 3A6FA 4MV0A 3ROKA 4QHTA 3ZY3A 4CN9A 4NVRA 4RS3A 3EGCA 1PZMA 3ZUGA 2PGXA 3NGMA 4RA6B 4OJQA 2AMYA 2H7XA 1L7AA 4PLTA 3SZ3A 3UJ8A 4KFCA 1VG1A 2INGX 2ASEA 4AZ3B 4DQVA 3NHUA 1U3DA 4IMIB 2OQVA 3WB2A 1MO6A 4NHEA 4EECA 4GM4A 3VOTA 4HFMA 4BN5A 2EFGA 3BE5A 4KAJA 4M49A 5F23A 3TB4A 3LC0A 4C3ZA 4KQFA 3PZBA 4KIUA 4BRWA 1E89A 4F8EA 2P69A 2A86A 1ETHA 3FLAA 4QBTA 1MLDA 1EDBA 5I4IA 2HZBA 2JBAB 4OGFA 2YXBA 3GRKA 1OY1A 2Z1MA 4QOEA 2V6BA 3V3TA 1EQAA 2PCLA 4C08A 3KYCA 2GEVA 1GEGA 2Q5IA 1ZI9A 4IMPA 4QOFA 1XEAA 5IM5A 4KRFA 1ZLYA 3FTCA 4CIBA 3G6KA 4PG8A 3FHTA 4OP2A 3U7HB 3UAXA 2JHGA 3PRKE 1E6WA 3IC5A 1Q15A 1QFMA 4ZD6A 2XKAA 5U1PA 3IUQA 1V41E 1ZH4A 3OEYA 4QDKA 4EJSC 5TF4A 4R9VA 2QN3A 3TTVA 3JQ9C 3IE2A 1EBBA 3B85A 4MTLA 4LEIA 2IWRA 1K2WA 3ZWBA 4K8RB 2YXDA 2YKGA 2I4NA 4UOQA 1NVBA 2WILA 1RWQA 2IUSA 4LY0A 2A7XA 1XZKA 1CU1A 1LBEA 4AN1A 2FX5A 3N8IA 2ZYRA 3LI2A 4LRWA 1KFBB 2NN3C 2HA4A 4FFMA 4DMCA 3GRRA 1E2JA 3W6NA 5IC4A 1OSNA 3RU9A 1T5BA 1Q0PA 4B4VA 1PSZA 2ZSDA 4G89A 1KIMA 3O2SB 1TCCA 1FSFA 2IU3A 3VKHA 1V45E 3M3DA 4Q02A 2IHKA 4BEBA 4QUHA 1ZXXA 3PYMA 1ZIPA 3VPSA 3DBOB 4CPDA 3AVWA 1BMFD 1YTLA 2WJGA 3IOYA 821PA 1WU8A 1YRLA 2J59A 2EX4A 2XVMA 4ESVA 1JIQA 3SI7A 1NZFA 2FPGA 3MA0A 5ALMA 2O3QA 4BE4A 1NW5A 1GADO 2CXHA 3EZLA 1UPBA 4DEVA 1MPTA 3O95A 1AO0A 1A2KC 2OGZA 4C29A 1G42A 1MP0A 4R1LA 4KMMA 3UWPA 3WOVA 4GHWA 2LKDA 4LBVA 4B46A 2Z6AA 3C7KA 1KAMA 1JTVA 4ZQFA 4MA4A 3P0IA 4TM7A 1E3JA 1KMIY 1O0BA 4IO1A 5IXYA 3PPYA 3D59A 1PE0A 1XFAA 4S0XA 1GNPA 4UNIA 4YBZA 2QAJA 3N5KA 3PC6A 4BP3A 5A5FA 1PVDA 2C7PA 3N2YA 2NO6A 2ONKA 2ZU6A 3PQCA 4P82A 3EWNA 4N47A 3SZGA 1JHZA 4PG6A 1UMKA 1RXCA 1TT5A 2FKNA 4UC0A 2KLHA 3HKCA 4WLFA 5DP1A 2WZCA 3O2NA 2JJ2A 2VPTA 3M4XA 3QPAA 4H0NA 3W06A 4ZK2A 4WLVA 1UKCA 1MRZA 2QNRA 3GJ3A 3OTWA 4O33A 3DTTA 4OXRA 5AM1A 2QTZA 1U0EA 2PR7A 1MVOA 1AZSC 5D87A 1FEZA 2VYFA 1G7SA 2AI3A 2QPAA 4PX9A 3CO0S 5JS2A 4UUPA 5DB4A 1KZ1A 3T0IA 3U81A 2YJGA 4Y2TA 2VF8A 4YRZA 4OHWA 4O3MA 4EY6A 4AKIA 2UDPA 2J41A 4AP6A 1H8HA 1J9EA 3C41J 4KJXA 5D7BA 5JVDB 3ZN2A 1KEKA 3L4SO 2AJLI 4QYSA 1L2TA 2EEZA 4HD8A 1QFYA 1U6IA 1QZTA 2ANBA 4KL8S 4OA5A 2I87A 4E2XA 1F48A 2H65A 5TF0A 3ZVRA 1SU8A 3BTOA 3IP9A 2Z2KA 3GXOA 5CH8A 1PVVA 4BGUA 2L82A 2P4HX 2PD4A 4OBXA 1N5IA 4IDEA 4BX8A 1QFJA 1WMFA 4XJTA 3ZIAD 5HQJA 2GLUA 4FFNA 3AEQB 4WA7A 2SICE 2RHCA 1G5HA 1UBUS 4YUWA 5JD4A 3ROFA 4PYMA 3JX9A 1R0RE 1RKVA 2XAUA 3TQHA 5JEDA 3FN4A 1JEYA 3OJEA 4PGAA 4KXLA 3W9BA 1RWWA 3ZNPA 1V9CA 3ESYA 3AKZA 1L5FA 1DPFA 3KJZA 1LDMA 1TGVA 3GGPA 3HA2A 3PFKA 3ZDDA 4GC9A 3DUWA 3ONEA 4X1IA 2XXBA 4UNSA 3CMMA 1UR5A 2B2CA 1VI6A 2R9VA 3LDFA 2VCHA 1P7CA 2Y66A 4FQ5A 4U0JA 4EUSA 4RPKA 4YCJA 3AGQA 5HFJA 1IE3A 1L7BA 4DMMA 1EDEA 4DV7B 2HF9A 2IIVA 3CNHA 3DV9A 3IAM6 3FYUB 1UBGA 3KWJA 3QXHA 4QREA 1QP4A 5IMBA 2G80A 2V7QD 1S7GA 5DHSA 1JZTA 3Q9NA 4HRYA 2ZJBA 5J5VA 3UC9A 3R20A 2PNFA 2RB5A 2UVPB 3A6GA 4FBMA 1E2PA 4FONA 4I99A 4BO8A 1P33A 1SM4A 1S8AA 1JDBB 1XO1A 5TGTA 1P61B 1PEYA 3F4BA 3TLJA 2XXJA 3NBZC 4GOKA 1NW7A 3D7RA 2WVJA 1SURA 1L6RA 1TKAA 4EHLA 1AOXA 1US8B 4WLNA 2WZBA 1A9PA 2C2HA 4JJ4A 3WGGA 4RTSA 2D0OB 4HB3A 2QT0A 1W5FA 4NDAA 1KQNA 4BQQA 1Y82A 3T1NA 3BGSA 1N9GB 4YQZA 2PUGA 1HLGA 1F4LA 1NKVA 2R8RA 4YVFA 4BFTA 4G84A 5J2TA 1FXSA 4IRUB 3GEGA 3GLQA 3PFIA 2PBLA 3CLTD 3LQQA 5AVUA 2OWEA 3NFYA 3D7KA 3WDMA 2XUZA 4ZQBA 2E82A 4CDGA 2JS7A 2VWQA 4AM8A 4P0TA 4BN4A 1H3NA 3L8CA 4CODB 2GFQA 3ZDQA 5IUNC 3A36A 3O93A 1JQ3A 1WMDA 5ICFA 5KX5B 1U1FA 4FUTA 1LSUA 1B14A 2EYUA 1QG2A 1E9FA 1UFOA 5KOHB 2WYVA 3FG9A 1JA9A 5KVVA 2PGIA 1USVA 4UVDA 5ECWA 4BX9A 2WT8A 2ZXUA 3LQ2A 1VRWA 1YASA 3DMTC 3UT5A 4H7IA 3UJ7A 1UH5A 5FADA 4BC1A 2YJTD 1EVJA 3T0FA 4DQLA 4MRAA 1B8NA 2GA8A 4MVJG 5INTA 3CEMA 5ALWA 4L0MA 5LD2C 2A1UA 4X84A 1U6KA 4D9HA 2OGUA 3GGSA 3FCOA 2PX3A 4XWAA 4CDRA 3W5AA 5ELMA 5MGNA 3N8HA 4EG4A 4QUGA 1NFQA 2XTJA 2DVMA 3UV6A 1E9BA 3QZUA 3VC7A 2F3RA 2FUCA 4F3KA 2XX3A 3O4IA 4MB2A 5DX8A 1QFZA 5A9SA 3LY7A 2XV1A 1A82A 1ZO8A 3H1TA 3OCVA 4Q3OA 5C1IA 1OB5A 4D9MA 2W2PA 1CKEA 1WMEA 2A1IA 3DEAA 4MGKR 1UUFA 3VZQA 1CJTC 2IOFA 4KDFA 4Z4HA 3I8SA 4PC1A 5FLYA 1GL6A 2W11A 1N5LA 2ZBDA 3KR9A 4O4LB 2DFVA 1AK2A 2B69A 1ZOOA 3AIMA 3UO8B 3DF7A 1PJLA 1KR2A 5EKSA 4OHUA 3W4KA 3DKKA 3JR3A 4UFOA 5ICCA 1MAUA 3ASYA 1LVGA 1RAEA 1PGPA 3CG4A 2HEGA 1ZY2A 4Q1EA 1XP5A 1F2UB 5DYWA 4MJ3A 4WK4B 3PX2A 4JN6B 3ZTTA 4C1BA 4CI0B 4ESEA 1DXQA 5EZSA 4XA8A 1SOMA 5CM9C 3PIRA 3H97A 4ZOEA 1JXQA 3PKIA 4UPEA 1L1FA 2XR1A 4YRRA 4ECEA 3RVSA 4L72A 3LU1A 2DB3A 4EQ6A 1FJ2A 3AESA 3HTXA 1Q83A 4K1XA 1G21A 5CDSA 1ZOIA 2JCGA 3CR3C 3NG1A 3CLRC 3NHBA 4MROA 3RSGA 3UAGA 3IPLA 2PH5A 3KKZA 5CIYA 3LA8A 4G07A 1YBFA 1ANKA 1JBQA 3OMWA 3NOVA 1N6HA 4PHHA 3E2IA 5JI2E 1XZAA 1G9TA 4O8CA 1WP4A 3JQDA 3Q12A 4DOMA 1QCYA 3KYDA 4RKFA 1FP7A 2Y0DA 1JHAA 1JIVA 2PMWB 5J47A 1CP3A 2QUKA 3HCOA 5F33A 3LS2A 1ZICA 1CUSA 3EGOA 3TMYA 1V1RA 2HPHA 3NEJA 1RPAA 2I7XA 3FYCA 3G0OA 5AOCA 4AI6A 1I3NA 2YHBA 1W36D 4TN1A 1IYZA 5FFNA 2Q4DA 2YN2A 5ANRB 5HIAA 2IS4A 3MLEA 1KK3A 2LUOA 4TMVA 1EWRA 4BQSA 1R2QA 3LA6A 2OQ2A 4PSAA 5ALNA 2LV8A 5C5CA 1SQ5A 4K9QA 5HJ2A 4ZEOA 1QO7A 3AUJB 3KR2A 1K7FB 4I4CA 4KSCA 5KNDH 2D5BA 2CNBA 2Q46A 3CH6A 2X5OA 3H1EA 3BFXA 3DD5A 4LIPD 5DBFA 3SOZA 4KX3A 1AXEA 3OQVA 4X0EA 1OA1A 5IJXA 1ZGGA 1L7VC 2G06A 5AIAA 3GLGB 4LRSB 2GN2A 4GKAA 2QM0A 3DXYA 4US0R 4ZCTA 4NCHA 5E0KB 4ZCPA 1XAGA 3NWEA 3Q41A 4X1YB 3GH3A 4S05A 4OSPA 3GVPA 1SBHA 3HYSA 3REQB 4OYHA 3TGLA 3G6WA 2HDHA 1F2VA 2BM0A 4HGPA 4ND2A 5CDUA 1M2HA 1OLUA 3HHEA 1RS0A 1E7WA 1II9A 2OXRA 2ZTMA 5JATA 5L4NA 2IUUA 1YDMA 2GYUA 4KK3A 2B1GA 2R1ZA 1T5LA 4RELA 4YAFA 2ZTUA 4OQEA 4UBKA 3F5MA 3MEQA 3NNSA 4PLPA 5EIBC 1XZPA 4G41A 5A06A 4UHBA 2HC9A 4ES6A 2H52A 2REQA 1XT6A 2BDUA 1GCIA 3D6AA 1E64A 1YVUA 1S2LA 4G81A 2FWIA 3B82A 4NAUA 4MV8A 1C3OB 2QQ5A 3LC1O 1E96A 4P3XA 4UHHA 3VSBA 4URXR 3FVVA 4WY8A 1YCDA 3EC2A 1GR1A 4IDHA 1W0JA 2VDWB 4LMBA 1FRZA 3WBBA 1TFUA 3EFOB 3DTVA 5ICSA 2AJTA 4AKTA 1POXA 1EVIA 4GX0A 4CR8A 4ZOLF 1VJTA 2Z4SA 1TLFA 3OZCA 2XY4A 3H3FA 4I4TA 3K53A 3DQQA 3H7AA 2IT1A 3TEFA 1EI9A 4C0KA 2HXSA 1E2MA 4RKWA 1RRCA 5HZKA 3MVEA 5AVJA 2R48A 3L7DA 2IBSA 1XF1A 4Z9BA 1K6MA 3STHA 1CY1A 1TMGE 2RKBA 4XJVA 5F2NA 4XB2A 1WXWA 5BV0A 4WNAA 2WWIA 5JI3E 2WK1A 1TVEA 4ZRMA 4JWTA 2HU2A 1TW2A 2OKGA 3NAQA 5EE3A 2NU8A 4OLBA 1P77A 2BTOA 2H1CA 3QHPA 4KWIA 4OD0A 3W04A 3U9LA 2VF4X 4CV2A 4AYWA 4QLOA 3AF0A 3HXLA 2OM6A 4S2EA 1G5RA 4MQ5A 5KQMA 3U4QB 3ZJYA 2IHNA 1KARA 4V0KA 4TKVA 4KAFA 1J0DA 2DTEA 2G1JA 3KQQA 3GFTA 1QOZA 3I53A 4L5IA 4OXIA 4WE3A 4DANA 3CH5A 4IFTA 1MAVA 1P3Y1 2YOGA 2PAFA 3MCTA 3PBKA 5JSKA 3T5CA 4PU0A 3T3IA 1IPHA 3HXKA 3UATA 2EKDA 2FJUA 5JG7A 3DDNA 1ADGA 4BJHB 5K6TA 1OTYA 4WH0A 5CVEA 2DFKB 1LSSA 1Y4AE 1H5NA 2EQ5A 2ZVDA 1QHXA 4YONB 4DPKA 2QRNA 1NF8A 1KJJA 1QS0A 1Z7YA 2J45A 3EOAI 3S28A 2GK3A 4R2KA 4KVAA 1CUDA 1M6YA 4ZZ3A 4Y6RA 4XI9A 3RC9A 4MVCA 4PQGA 2JDID 2ZCVA 5IDYA 1N1EA 5B7NA 5CFNA 3JR7A 3OFND 5H7XA 2OP0A 3EG9A 3DGFC 2A88A 3VPBA 1YQ9A 5L6MB 2HBQA 3R6TA 5EWJB 1XELA 5K3SA 4AJPA 3MYYA 5DTRA 3D8RA 1VKNA 3HKEA 2IHVA 2B7LA 2HYDA 3MUNA 3TIGA 2DWOA 5JS6A 4LJAA 3GUHA 3ADKA 4I14A 5BRAA 4W7HA 2MSKA 3VR6A 1G66A 2JIZA 5IAKA 3LOPA 3USES 3KFXA 5BQ3A 5AUPB 2WOOA 1A7JA 621PA 5KJ6A 4O2AF 4NECA 2CHQA 4JBYA 1ESNA 1X7ZA 2HSJA 3QJGA 5KYGA 1X94A 4OLFA 4ZXPA 3WQSB 2BFNA 1ZXLA 3EXG2 2OPHA 5IEBA 2UUCB 1OLSA 4D0RA 4EI8A 2HJSA 3NNDA 4MRMB 1EQUA 1O8CA 5DT9A 3UJNA 1LI4A 1UBOS 5AUQA 4OQFA 2AEEA 4G9BA 5AYVA 4NI5A 2IYFA 5FPTA 1FUIA 2ODQA 4HH4A 1JPNA 3ASUA 3L7MA 3U16A 1NQTA 2VHVA 4FT4A 1WCV1 3QF4A 3TBHA 2XE7A 1XQ9A 3GUVA 2FFBA 2YUTA 3IKLA 3J7AC 5FNVF 1W29A 1YU6A 3DOFA 1Z2DA 2G83A 2ATIA 2P9GA 2VUSA 3A6EA 4G86A 4GMHA 3KU4A 2FVYA 2OWDA 1KPIA 1B42A 2IDKA 1VMKA 1W85A 2WVGA 3LY8A 5EKTA 1FSGA 3WIEA 1C7RA 3CB4A 2B1RA 3IULA 1GNQA 2ZRDA 3LDAA 5JD3A 4EF6A 3VSEA 1V8ZA 1QJCA 4AK9A 2I5PO 4ZAZA 2HN9A 5M2QA 1TADA 4C0JA 2BGJA 3FZNA 3T7IA 1WS6A 2JLSA 3N2ZB 2JFPA 4G26A 3DDSA 4MKHA 4PTZA 2FPUA 5AM3A 1KEEA 4YECA 1QQ6A 2JIQA 1LWOA 1U02A 3I9NA 3LW7A 3SEQA 1JU9A 4I1IA 3GGCA 3KWFA 4MULA 1DAPA 3GMIA 3IQHX 4A73A 3ZLVA 5AW8A 1I01A 3V8VA 1JWBB 3PB3A 4D80A 2NNWB 3OFKA 1E7QA 4GOXA 1CZRA 4JR0A 1GQYA 2I8AA 2PYZA 5BRJA 1R0BA 3QVGB 4CMIA 1K6XA 3MMZA 3ICVA 1X8JA 4QUAA 4NH0A 4TTQA 4Q16A 3Q7QA 4CYMA 1JH9A 1P73A 3BRWD 3HXPA 1D2AA 2O9JA 3OPXA 4EA8A 4JXJA 2BFWA 5CFPA 1SXGA 4TQ9A 2QM3A 1AA9A 2RDMA 5EKDA 1HNWB 2EIHA 1IJEA 3SHFA 1ZIXA 1CZKA 2ZAIA 4WRRA 2OENG 1PL8A 3AIOA 3HEMA 4AP5A 3QVVA 1O54A 1SQGA 1ZCFA 5AVKA 3WTBA 1RVV1 3A4LA 4IRMA 2IPAB 5LP6F 5KNCD 1JPJA 2M1ZA 3PHGA 3RVDA 3ZG6A 3LPAA 4L7VA 2AG0A 1E18A 1Z0JA 3K31A 2IYWA 3WL6A 4D3SA 2DTDA 1HE2A 3WJ1A 5ALGA 3COVA 3WRYA 4WFJA 5B3KA 3E18A 1A5BB 3O92A 4TKLA 4AFNA 1NMSA 5ITVA 3OTOB 4G5QA 2QUAA 3K05A 3K4HA 5JT1A 2W0SA 3O8CA 1P7WA 3USZA 3NVAA 3ORFA 1NUSA 4YMVA 2BMWA 2EBFX 4X62B 3DZCA 2PX8A 3QPVA 4CIVA 3I9JA 2XRFA 2WIJA 5CHEA 4FB4A 2YRWA