2JJ8A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
184
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERCVPLKYLQELHELHEDWLIHPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 66
structure length 184
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jj8A00
5JMTA 3MWKA 1SVOA 3RABA 1KY2A 3N5CA 5J4HA 1JJ7A 3GLGB 4AG6A 2EFDB 3AB3A 1W5TA 2NQ2C 3EWAA 4L4UA 4M1OA 4URYR 3R7WA 4DSTA 1SVIA 2KBFA 4MGYR 3UATA 4DB2A 1XZQA 3GLHB 1OSNA 1FOEB 3MWJA 4GOKA 1NJGA 2G0NA 3RS2A 1G8YA 1VYVA 3KQHA 3ONWA 3GJ8A 2F6RA 1KY3A 4Q5IA 2FN4A 3JZMA 1S3GA 3U2QA 4A8JB 4KAXA 2AKYA 4U00A 3IO3A 2ZITA 1IJEA 3IUYA 3M4YA 5IF9A 4W5JA 2NO7A 2J7PA 3THXB 1GKUB 3A1WA 2P6UA 1FMJA 2Q9AA 3QBVA 4HB4A 2BEKA 5E3HA 4M9XA 1NVUQ 1II0A 4IOMA 1FTNA 3VHLB 1IN4A 2G77B 1OFHA 2AN9A 2XAUA 1RFLA 1MO6A 3CPHA 1KTVA 1W0JA 1OPXA 4EPXA 4UNSA 4LGMA 3SNHA 1M7BA 1TMKA 1N6OA 4P33A 5GVSA 4JT2A 1N5LA 1Q1QA 1Q3TA 2DYKA 2LCFA 4TQAA 4F93B 3VR5A 2R65A 2O0KA 4HLUA 3GLIA 3PEYA 2BJVA 2ZE6A 4PAMA 4LWZA 1JEDA 4IOLA 3QF4B 3GEIA 4JJKA 2XNDD 4L16A 4BQSA 5IK2A 3BRWD 2GJAA 2O8FA 3SJZA 1E2QA 3KB1A 4D0GA 1LFDB 3QOFA 3H84A 4US2R 3RLFA 2XZPA 4EJSB 2IHBA 2HEIA 2A5JA 4LV5B 3DKPA 1WB9A 1E2MA 1Y3AA 3QPUA 3VKHA 1NMXA 3G0HA 3EPLA 4P4TA 4CEHB 2QP3A 5HKKD 1XB2A 5FOTA 3U5ZB 3W5JA 1RRGA 3S1AA 3WYAA 2E9SA 4MRPA 1BOFA 2H7VA 1YZLA 4NBSA 4TLBA 2WWYA 4V0KA 2HCJB 5AUOB 3CR7A 4GBMA 2HF9A 3P4XA 3FHCB 1GKIA 1DARA 1DE0A 1N0UA 1MKYA 8OHMA 1W4RA 5EP4A 5B2ZA 2BBWA 1XEFA 2OESA 2WJVA 2I1VB 4F4JA 3MSXA 3QKSB 1LNZA 4OBEA 3K9LA 4KYIB 4FWTA 3BWDD 1U8YA 2OT3B 4UJ5A 2WTUA 5GADl 2QGZA 2GBLA 2AXNA 1ZM2A 5DN6D 1YR8A 5ELXA 2IF0A 1HT2E 3AVVA 2VHTA 2ZRHA 2XNDA 4BZXA 3WNCA 1JPNA 2J0UB 2ODBA 3GJXC 4Q4AB 4XWAA 5AUQA 3QBTA 3SS8A 2ZAOA 3ADCA 3FE2A 5JWRA 1Q3HA 4UNRA 4POAA 5SZIA 3WNBA 4IOJA 4D0LB 4GSYA 4DXAA 3EIHA 4D25A 1EG7A 1X8LA 2VRWA 2QZ4A 2BDTA 1XFAA 3D31A 3Q7QA 4LV8B 3REGA 3K9GA 3IHLA 5HKKA 4X8OA 5DI3A 4KSCA 4KLNA 1UPTA 1J70A 2RGXA 3L8YA 2A5GA 3CNNA 4ILEA 3AV0B 1BS1A 3EW9A 1KK1A 4M9SA 1UEJA 2DY1A 4N3NA 4MGZR 2ZSDA 4C2UA 2HXSA 1T5LA 3NH9A 4G5GA 4Q9LA 3A1UA 2NO9A 4MKIA 3P20A 1OIWA 1QRAA 1S1MA 2QRZA 3B85A 4M22A 2QE7D 3X1XA 5CM8B 5IDVA 3K1JA 5HZKA 2IYZA 3I4LA 1J8MF 1Z28A 2Q3FA 4E03A 4CVNA 2FE4A 4QC2A 4E22A 4BEBA 1XTKA 4Z1MD 4R98A 1R5NA 1RRFA 4ITRC 3ADDA 2H1LA 5F9FA 3W5IA 2JDIA 5DN6A 4BLTA 4M0LA 4PSKA 3WY9A 2IEYA 1XRJA 4JYCA 1R5BA 2FEMA 1S8FA 2RAPA 2XSZD 3RWMB 2H92A 5A4JA 2WMOB 3KKNA 1QHIA 4DB4A 1CR0A 2ANBA 2GXQA 3CWZA 621PA 3SQXA 2VF8A 2G3YA 1N5IA 1OIXA 5H1YA 4GDFA 1KHTA 4Q01A 1Z2CA 1OXXK 3B13B 3K0SA 1XXHA 1TF5A 2C2HA 3WYGA 1YZGA 4DSUA 5KU1A 2OCPA 4HYYA 1XTQA 4DLYA 3OFND 1OXSC 1KAGA 2ZPTX 2IYXA 4JYBA 1NIJA 4QRHA 3KQUA 5CB8A 1Z0JA 4G5RA 2YWHA 1R0ZA 1DOAA 4P4SA 1JR6A 4NCIA 4LHXA 5KNDA 3MAAC 2FG5A 5EQTA 5EXSA 2H16A 2XTMA 3K9NA 1KMHB 3P27A 4A8JC 1E2FA 2YC4C 5DHFA 2XGJA 1K8RA 3N2EA 2VA8A 5JCZA 1E99A 3SYKA 2XTNA 1T3HA 4UXHA 3SU8A 3IIKA 1OW3B 1OXTA 3U3JA 3CF6R 4OQNA 2ZJAA 5FFMA 3T5DA 4FIDA 2E87A 4Z1MA 3EC2A 4L9WA 5DI9A 3AF2A 3FMIA 4LHWA 3PR1A 1IN5A 2Q3HA 3GLFA 4KV9A 4XJXA 1WF3A 4NCNA 3SQWA 2Q21A 1L7VC 1SVWA 3CRRA 1P2TA 2FF7A 2FPKA 3PUWA 4FINA 3IDQA 2AL7A 3RDPA 2ZS8A 1VECA 5DGXA 2UZIR 2ZREA 2GAAA 5DYGA 1ETUA 1I4LD 5E95A 1I2MA 2H5EA 1YRBA 2VP0A 3L0PA 2O52A 4JSYA 3VQTA 3F5FA 3MLEA 5TVKA 5GJBA 3TVTA 2ORVA 3KJGA 1U90A 3CPJB 3GD7A 1FW6A 2ZRIA 4HZUB 3OFNA 2IYUA 1UBCA 1P2UA 4WVFA 4EJSC 1TU3A 2VLIA 2VEDA 4OI1A 4ERNA 1W2HA 4PPQA 4KVGA 2IUTA 1W1WA 3HYRA 3I32A 1II8B 4O25A 1D5CA 4BLPA 5G3ZA 4NYIQ 1S9HA 3TBKA 2DWOA 3X1ZA 2GEUA 4BUJA 2OM2A 3QF7A 4FI3C 1YRAA 2YINC 4C0HA 2Z83A 3GFTA 2QAGC 1Z6XA 2XB4A 4OJKA 1G6OA 1IAQA 1RIFA 1UM8A 5FUYA 3LW8A 5E7IA 4DKXA 3SJBA 5L3QB 1PLJA 5F9HA 2ZI4A 2Z6VA 1ZUNB 3L82B 1W49A 2WKRA 4AKIA 1TTTA 4D0NA 1AA9A 4WXRA 1CULC 3AVUA 2BMJA 1DAHA 2KB0A 4LYAA 2EU8A 1U8AA 2VH5R 1R8QA 4QGAA 4BZPA 1WDTA 5LD2B 3U4QA 2UZ3A 2P3SA 821PA 4Q9KA 3A58B 3NEYA 1VG8A 3AUYA 2BHRA 4TYQA 4Q9JA 4F4IA 1G1MA 3CM0A 4DLXA 5CITA 2P6RA 4Q7MB 2NTYC 1HY3A 3FVQA 1E2HA 4GOJA 1T8TA 3SE0A 1L4YA 3DKVA 3WMFA 1TL7C 2ERXA 3GLIB 1M7HA 4YDSA 4Q19A 1KJZA 3KDSE 2DFNA 1N6LA 2GEDA 1ELOA 1E0AA 4KFRA 2G1JA 5J5CA 3TMKA 3REFA 4C0BA 1E0KA 1KJWA 1U0HC 3KXKA 4ACAA 2JA1A 4RD2A 1Q1BA 1S0UA 3RS0A 3RSLA 3PUZA 2K5UA 5C4GB 5LB2A 2ZRBA 1UBGA 4RSGA 3CX8A 4US0R 5J4LA 4XH9B 1KIMA 2C78A 5FBRB 2WWWA 2YKGA 1P9NA 5J40A 1T3SA 2CK3D 1W4BA 2ZROA 1AQUA 3W6PA 3GLGA 2DFKB 1F48A 2IYLD 2KJQA 3EZFA 4KJZA 1DG3A 1KKLA 1XXHE 1KO4A 4OJQA 4QBIA 3T06B 2CLSA 2WSSD 3GLHA 3WBKA 4B2IA 1SQ5A 2XJ9A 3LXRA 2BCJQ 1ZJ6A 3W3ZB 1R0WA 1XD8A 2QG6A 2EW1A 4ZDKA 1AZTA 4A8JA 4URUR 4HUTA 1HYQA 2WWXA 2WPDD 5JI2E 1OIVA 5HCIA 3C5HA 2JIZD 1R7RA 1Z6GA 2GA8A 5E4FA 2RB4A 1UKVY 3THXA 5D3QA 1IY1A 3OEHD 3RYTC 1U81A 4ZCLA 1JJVA 2VHQA 2WZQA 3IEUA 1G8FA 1Q57A 4LX0A 5CJ2A 1V43A 1GNPA 3FPAA 2ZS7A 1HUQA 3T5GA 3N2IA 3Q8XB 2PMDA 1U8ZA 4NZYA 3TGPA 4MUBA 2JJ8A 5FTMA 2XZOA 4BFSA 5F2EA 1NMZA 5CM9C 3T1OA 2ECKA 1TUEA 1SKYE 4M1WA 1E2EA 1MV5A 3GLFE 5JJIA 2JLVA 5FI1B 4HEJA 4P3YA 4A0HA 4YMWA 5FPYA 4CEJB 2W2VA 3EPJA 2WKQA 1HT1E 1GNRA 4Q03A 4Q1EA 1E2IA 3G5UA 2ZQ5A 3QF4A 3KQKA 3NBFA 1QHHB 1X3SA 4ESHA 2ZJOA 5DI3B 5JHHB 1NLZA 3F0TA 2QGNA 3VU9B 2IA5A 4TZ6A 1E2JA 4KODA 1OH5A 1WMSA 1CF4A 1CS4C 2F43B 2QAJA 3BOSA 4NONA 1M7GA 1KO7A 4AY2A 3F3YA 3TKLA 2CCJA 3EX7C 2F1HA 3MD0A 4LSGA 4WAUA 1G5PA 2WSSA 2GEVA 3B8HA 2WJHA 1QBKC 1DBSA 3C4JA 4Q7KA 2Y8EA 3B7GA 2V7QD 2QU8A 2BWJA 4L5BA 4B3DA 4CEHA 2GVZC 4PPNA 4UJ3A 5FPTA 3RAPR 5KTYA 2Z4RA 2O8EB 1CKEA 4PSAA 5HPYB 3QVVA 2KI5A 2JIZA 1T4GA 1KDOA 4OHVA 4EKDA 4LJ4A 4TTPA 1SVLA 3VHXA 3OEHA 5GJWC 4Z51A 5JFGA 2X77A 1YR6A 1QHXA 3GEHA 2X8AA 2OLJA 2GCPA 1FL9A 2W6ID 4PQFA 2D3WA 2VPPA 1TEXA 1TAGA 1W4AA 2V6IA 3QE0A 5EXTA 4DIDA 1FQJA 3LX8A 4TLAA 1Q0UA 1G3UA 2ZRJA 2FSFA 1CP2A 4GMXA 4WZAE 4KLZA 3M0EA 2V9PA 3QKSA 5EE9A 2ONJA 3NWJA 4MITA 3SYNA 4B34A 1IONA 2ZI6A 5JCPA 3CUEF 3K9HA 4FCWA 3AVWA 1HE1C 4TL6A 1NSTA 3I1FA 3W8RA 3ZZ0A 1N6NA 4AD8A 3RHFA 4Q7JB 2V1XA 1HEIA 1P5ZB 2E1RA 4X8LA 5B64A 3BH0A 5AK0A 2V54A 2J0UA 4Z54A 4Q4AA 2B7BA 1UDWA 1CEEA 4UXIA 3ZVMA 3KTAA 2R2AA 1E79A 2W2XA 1CRQA 1J7KA 2J87A 1R8SA 3KKMA 2ZRFA 2RGAA 2REXB 4F92B 3H1TA 4HUQB 2V7QA 1J2JA 1G7RA 3CF2A 4LV6A 5DH9A 1NLYA 4YMUA 1E98A 3VX3A 3VMFA 4W5WA 5KPDA 3AKCA 1SGWA 5C4MA 3KQLA 4B3GA 1US8B 3CH4B 3SN6A 4NU0A 3PVSA 4JLDA 3CRQA 4RZ2A 4C0LA 1P60A 1GTVA 2VL7A 5DLQC 2VIIA 1ZU5A 2VHJA 5L3SA 1DS6A 4JLKA 2W6IA 2ZUDA 4LYFA 2QTFA 2H57A 2WOJA 3AEZA 5GJCA 3SHWA 1FPMA 3GLGE 1NKSA 1P73A 2WV9A 3A37A 5JBQA 1IN7A 2XTZA 1RRPA 2JLWA 3ZS9A 4OYHA 1TQDA 2OLKA 3EPKA 1ZNXA 4M21A 2XXAB 4HLUC 3GLHE 1FQKA 4EUNA 3J81k 1KDTA 4KBFA 3KXIA 2ZRNA 2I3BA 4LDJA 5TARA 1GILA 2CLDX 4M53A 5TV2A 3CZPA 2P5SA 1FNMA 4LY6A 1CJUC 3FDIA 5DE3A 1I4DD 2PBRA 1B0UA 1E6CA 3EIQA 1HA3A 4BFXA 2I4IA 2Z5FA 4QGHA 2ZXUA 1L2TA 4AI6A 3VKWA 1OLOA 4FW9A 3NTUA 2J5XA 5JEEA 4BRWA 4MGIR 1E1QD 2HF8A 2VP5A 3O8BA 3U6BA 3NG1A 5AJWA 4M4SA 4PSVA 3ZS8A 1YJ5A 2R9VA 3OEED 2GRJA 3RS7A 2JLXA 3BB1A 2NGRA 5KO2A 1G3MA 2GXUA 6Q21A 1MT0A 5JSZA 2GZHA 5FUXA 2J1LA 3SHFA 1AS2A 3QEOA 3BAFA 4N1AA 2CVFA 2OE2A 4F91B 1GIAA 4TTQA 5KDDA 3EZ9A 2OUKA 3UG6A 3B1VA 2OSBA 3BD9A 5C18A 1M6NA 1IQPA 1G41A 2IS1A 1KMHA 2EWWA 2GKSA 2ZSAA 1Z5ZA 2D7DA 4D81A 4A9AA 2EFCB 2EYUA 3CWQA 3OAAD 2A3RA 2HYDA 1GP2A 3B82A 3E5HA 1AKYA 4CDGA 1GAJA 5BQ5A 4EPYA 4W9MC 1P62B 5TDHA 3QXSA 2FA9A 3T61A 3C7KA 1W7AA 2CHVA 1NF3A 2PT7A 4XVRA 3UMRA 4TMXA 4NCJA 4RZ3A 1Z3IX 3BB4A 5KUTA 1IM2A 2ZUBA 3AP2A 4PZZA 4TTRA 2X1VA 3GJ0A 4Q4HB 2ZE7A 4AWXA 1P61B 3V4FA 5CIQA 1F6BA 1G3QA 1SVSA 2GHIA 3BFXA 4RVCA 4FD2A 3OEEA 1NMYA 3RWOA 4AKHA 5AUPB 2O8CB 3KXLA 3CX6A 2OG2A 3PJRA 4JLNA 3LA6A 4CF7A 1PJRA 2VF7A 2AFHE 1FTSA 2P5TB 4HZUA 3VX4A 2ZIAA 4MRVA 2ZETA 2VHCA 2MSCB 1G18A 2V6JA 2IS2A 1Z6AA 1YR7A 2GCOB 1CJTC 1II8A 4KHZA 1Z0KA 1E0SA 3BH7A 4FWIB 3FYHA 3NVAA 2WKPA 2JLRA 4URZR 3PUYA 5J47A 3C8UA 1E3MA 2FU5C 4G5OA 3QNUA 2WOOA 3OAAA 4ZV4A 3E2IA 4MH0R 1VYTA 2REBA 2QPTA 3HJNA 2A9KA 1NN3A 4LJ5A 5L3QA 4GNKA 2Q6TA 2F7SA 1SHKA 2P6NA 5BW8A 5JS7A 2B6HA 5DSZA 3BS4A 4URWR 1E1RD 4A4DA 4JLBA 4MKHA 5FOWA 1NG1A 3MJHA 2W58A 3X1WA 2NO1A 3M6AA 1N0VC 2C98A 4Q21A 1Q1EA 4O2LA 1YVDA 4A1FA 1UJ2A 2H17A 2OCAA 1V5WA 3LV8A 1ONBA 2HT1A 1BKDR 3NHAA 3R20A 2CCGA 1QHSA 4YMSA 1WE2A 5EUQB 3UKDA 4MRSA 4ZKDA 1LB1B 2ZR7A 1G20E 3BBPA 3I3SR 1ZM7A 2GZDA 1NRJB 1GRNA 4B44A 4Q7LA 2GF0A 2NZJA 1F2TB 4TMVA 3CH5A 3IO5A 4LJ7A 4M1YA 1JB1A 4DT1A 4YC7A 1KSHA 3EA5A 1R6BX 2OZEA 4PPFA 3CRW1 4JL6A 2EQBA 4JJZA 2R6GA 3OF5A 1N2CE 2DFTA 4DVGA 1NN0A 3B9PA 3ETLA 3OIVA 4PO1A 2QBYB 4A2WA 5F98A 1E0JA 1GDDA 1QF9A 2A30A 4JLPA 4TL9A 5KOYA 3TUZC 1FP6A 2Z4SA 2B21A 1LTQA 4FMDB 1E1RA 3JVUA 3PG5A 1Z6YA 4I1VA 3L2OB 3ZLJA 4LBZA 4PHTA 4MA4A 2CHGA 2CXXA 4D4KA 1ZBDA 4MYHA 3B6EA 4FXPA 2G9NA 1M1YE 1NL3A 3WYFA 3QKRB 3K0FA 3BORA 4TYWA 1GFIA 4B2PA 2IWRA 3WRYC 1COWD 1YZQA 2ZJZA 4TYNA 1FUUA 4OKSA 1BIFA 1EFUA 3GJ6A 3LBNA 2H18A 2ZI5A 2J3EA 4DCNA 4BEJA 4HLQB 3AM1A 3EZ6A 1AGPA 2HDNB 3CW2A 4Z8XA 3VR1A 4RD3A 2JDID 1KSJA 2CCKA 1FMLA 1VG0B 2R8RA 3HPRA 4OQMA 2RGDA 4QXAA 2IEZA 1XEWX 4XTCS 3QG1A 4LYHA 3U7HB 1TPZA 2RGNC 2WWFA 1H8HD 3KTAB 1GITA 4CEJA 4IVQA 4AG5A 1IY2A 4I81A 4V0MA 1GM5A 3IIJA 1YU9A 1Z22A 1W4CA 3CKLA 2QRNA 3KKOA 4U5XA 3CRVA 4YLGA 4RD6A 4Q1AA 3VR6A 5FPSA 1QHHA 5KDLA 1J8YF 3HR8A 1X8KA 2FX3A 3ADKA 1DO0A 3VU9A 4DCTA 2YVUA 4MDEA 5AJZA 2F43A 1G8PA 5K8IA 2V4ZA 1XMIA 4XOIA 3B1XA 2UVQA 4ON9A 3VNUA 3IQXA 1ZM4A 2GXSA 4PXAA 5L3SB 1R4AA 2ZSBA 5BYJA 4BLRA 2J45A 3A36A 1ZP6A 4QBFA 4Y0AA 4YMVA 2VBCA 1A4RA 3TNFA 2O8EA 1COWA 4RKEA 3I5YA 3TSOA 3EZ7A 5AJVB 4J0QA 3K09A 4PC1A 4W5HA 3OZXA 2CJWB 3TR5A 3VFDA 3IHWA 3I62A 1MRSA 2WJGA 5CYPA 1E9CA 1ZINA 5IHPA 5JJKA 3ZZUA 3EWSA 2OCBA 2LKCA 1T9HA 3CNLA 1F3OA 3FMFA 3B1ZA 1Z6TA 4DLZA 1F60A 1P6XA 3D8BA 3NC1C 4DSNA 1KI6B 1JBKA 2J9RA 1QHNA 1H8HA 3LBIA 1EWQA 2MMCA 4LJYA 4LPSA 3MUFA 1DG1G 2PLRA 4FMCB 1QHYA 1S1CA 4F4CA 2JEOA 1PV4A 2X2FA 4IVPA 2FGJA 3NDBB 3R9IA 2WICA 3QIAA 1KKMA 4BFWA 3W9YA 2GESA 5KPJA 1NN1A 1S96A 4WZ6A 1TEVA 2FFQA 1N6IA 2R6DA 2VHUA 2CMKA 4LC0A 4LBWA 5JSZB 1ZCBA 2JLZA 2HYIC 3QQ5A 1XPUA 5EP2A 3GLIE 2JLUA 3AF0A 2HXYA 1ZD8A 2FJUA 2BJWA 4W7SA 3SZRA 1EGAA 3BK7A 4FCVA 4NYJQ 1G6HA 1G16A 3U3MA 3PEUA 4PQYA 1KAOA 3KJIA 1Z0DA 3NH6A 2LWIA 4UNPA 1QVAA 4UNNA 5UKDA 121PA 3TH5A 2FSGA 4QGFA 4HUQA 1P2VA 4KXFB 3A8TA 4AYXA 2GVDC 4MYTA 3AVOA 4NKRA 3K0CC 3IILA 3P26A 4GP7A 4CZ2A 4TN1A 2BVNA 5FOSA 3LWNA 3LLMA 2ZJYA 1US8A 1QG4A 2QTVB 3EAQA 2FDCA 2AWNA 4JZKA 4OQXA 4PPGA 3FHOA 3TUJC 4IEEA 2AR7A 2BM1A 3WMGA 1LS6A 2FWRA 1ZC4A 3T1TA 1FNNA 1D2EA 1OV4A 1T91A 4HLCA 1YZUA 4Q47A 3QJYA 1Z0FA 5CDFA 1CBUA 2XXAA 1D9XA 4NE2A 2QP4A 5EE3A 1XJQA 2FNAA 2RGEA 2ZRCA 4LHVA 4PZYA 4D2IA 2PZEA 4QBHA 3CB4A 4YXWD 2JLSA 1RPZA 4IJMA 1OH7A 1KI2A 1OYWA 4JMPA 2HT6A 5IRCD 4GP6A 1KDRA 4A15A 1ZCAA 1T6NA 4DEXA 1Z47A 1RZ3A 2ZSEA 2ZS9A 2W83A 5J4VA 2AFIE 1JAIA 3BB3A 4II7A 1Q44A 3KJEA 1GUAA 3RRYA 5FTKA 4KI0A 2A78A 1NIPA 4R9UC 2GXAA 4PTLA 3LY5A 1ODFA 2IT1A 1E9EA 4HDCA 4JL8A 4TLCA 5EXXA 2ZR0A 2A5FA 3T1VA 3THOA 1OHHD 2RGNA 2EWVA 2YOHA 2ZE5A 3VNVA 4LOAA 2A7QA 5DYIA 3U7FB 1VCNA 2ZRPA 1N6PA 3AVYA 2AXPA 5C2JB 1NVVQ 2ZEJA 3KKPA 2B7CA 1NP6A 4V0ME 1VYUA 4JVLA 2QM8A 1NN5A 2VP4A 1AIPA 2DHRA 1U9IA 1DVRA 1R0YA 1W44A 1ZUIA 1C4OA 4JLJA 2WJYA 3CO5A 3BH6A 5EE1A 1DAKA 1AS3A 2WMNB 5C46F 5CIWA 1G4UR 1MRNA 3UANA 1Z83A 1ZD1A 1KZGB 2RMKA 3PFIA 5D3MA 3UWKA 4B76A 2ATXA 1G21E 3OIUA 1G4AE 4K46A 4ZI3A 4YXWA 2WHXA 4ZPXA 2OXRA 4QHTA 4A36A 1L4UA 1XD2A 3PXGA 4JIMA 5KSOA 3GPLA 4ASUD 1VTKA 3FOZA 3DM9B 1OXUA 1LVGA 2BBTA 3K0EA 3HR7A 1OYYA 3BERA 1PZNA 3MG9A 2JCSA 3QUSA 2A5YB 5GVRA 3A6PC 2O8BB 1AM4D 3FKQA 4PHHA 1DO2A 5CYOA 4TYPA 4F7WA 1XZPA 2IYRA 1E4YA 4Q4HA 5A5GA 3RRMA 5HR5A 1Z07A 4DT1B 4MYUA 2RGCA 1OHHA 4K81B 3W8NA 1DPFA 2VP6A 2O8CA 3HYTA 1CR2A 4MYCA 1MH1A 3ZQJA 4DCSA 5JEDA 1FX0B 3W6NA 4GT1A 4IDHA 1MR3F 4QG7A 3VR2A 4JVSB 2A2ZA 2FV8A 1W36B 1NLFA 3NC0C 1P2SA 3FFAA 3K8YA 2BKEA 3ZDQA 4Q4JB 2NIPA 4EFLA 2GCOA 2ZRKA 4PHGA 2Z0MA 4UKDA 2O5VA 1OE0A 1MABB 4FMCF 4JS0A 4ZCIA 1T3LA 4HI0E 1JPJA 5CJPA 1MO3A 4V0OA 4BFZA 1GNQA 3DL0A 2JGNA 4OQLA 1YZTA 3FMOB 3WXMA 3K0FB 3QG5A 4EFMA 4BLOA 4NCHA 4WA7A 1E94E 1O3YA 5H70A 5P21A 2QP9X 3K0CA 4MDFA 4EQ6B 3HU1A 3R8FA 1G8GA 4B6FA 4ASUA 2G1KA 1XU4A 4NYJR 2YYZA 3HU3A 3PV0A 4GFDA 3OE7D 2QPOA 1AS0A 2EYQA 3Q7PA 3U3OA 1G3IA 3CF0A 2ZI3A 2ZYTX 2QMHA 2XOKD 5M04A 3FWYA 4TZ0A 4LJ9A 4TMWA 2CNWA 4B43A 3A4LA 3C14C 1SKQA 4M1TA 4PC3A 2WAXA 5FBVB 4BFUA 1Q20A 2IYYA 2J59A 3B1YA 2F1IA 4HDOB 3U3KA 3WHLA 1NY5A 2BKUA 1DELA 1OKKD 5BYKA 3GJ3A 1TQ2A 2GZAA 3CNOA 1A82A 1EX7A 3C5CA 2V8OA 3AUXA 4I1UA 1A2BA 1KNQA 2Q3MA 2QT1A 1F2TA 1TADA 3ICEA 2IYWA 4BASA 3U6KA 5CK4A 1E79D 1NI3A 1G5TA 4EAQA 3MFYA 1I2DA 2PZGA 4LHZA 1II9A 3QPWA 3O8DA 1E2KA 2ODNA 1U0JA 1ZC3A 2HUPA 4HB3A 2IF2A 4TMZA 1G7CA 4A2QA 2D06A 2B8TA 1WBBA 2QBYA 3EA0A 1R10A 4QM6A 3CIOA 5E7JA 1W0KD 4IDNA 5FOVA 1YE8A 2YOGA 3GMTA 1GOTA 1AZSC 4Q9IA 1XCMA 2XB2A 3P1JA 3ZZTA 1D2MA 1ESNA 5A0FA 4DBLC 4D4MA 2FZLA 3SC3A 4E07A 3OE7A 1VKJA 3MWLA 2TMKA 3IBGA 2H8KA 3QKRA 3LVRE 1RW4A 2XOKA 2GETA 3I72A 4AKGA 2ASEA 4US1R 5E7MA 3LAWA 1AK2A 1UBEA 2JASA 3THWB 3X2SA 2NG1A 2DB3A 2QENA 1E9SA 1NVVR 3IGFA 4EPVA 4ZKEA 3RRNA 4RCZA 3U60B 3X1YA 1W5SA 5BXQC 3H2YA 5TMPA 2OILA 4C2TA 3FB4A 2V55B 2AD5A 2CBZA 1IY0A 1OKKA 3QKTA 2DBYA 3RNLA 4DC9A 1UFQA 3RS5A 5AWFC 4AURA 2BV3A 3UMFA 721PA 1BH2A 4Z8YA 4C0KA 3WP0A 2PMKA 4LZZA 4GPTA 1CU1A 4TLEA 4HZIA 1AGRA 3ZVRA 3L43A 4TYYA 2YWFA 1UADA 2WWHA 1HURA 1BO6A 1GL6A 1ZMXA 2QNRA 4A92A 2VO1A 3H4MA 1S9DA 3PCRB 3QXJA 4OI0A 1D9ZA 3H0KA 3X1DA 2ZANA 1NNEA 4K8OA 4YDHB 2D2FA 1E9AA 3MJRA 2FSIA 4ESVA 3G82C 4PX9A 3SOPA 1CJKC 2F1JA 3HP1A 1W0KA 1TF7A 3LD9A 1IBRA 1KJYA 3SEAA 4BFYA 5L8VA 2BM0A 3LW7A 5FOUA 2IS6A 2P0EA 1NBMA 3DPUA 4V02A 1TNDA 1XCGB 1NSFA 5JRJA 4DDWA 1W2GA 1NY6A 2QTHA 5B57C 5BN4A 1SVKA 5LD2C 1W48A 2V1UA 1Q21A 3HDTA 4P0TA 4P4UA 4LK2A 5GJVC 3W3AA 2F3TA 4ZO4A 1KYIA 3PQCA 2FFBA 3TE6A 3QXHA 3WP1B 3OIWA 5LDDC 1UKEA 3TQCA 1O87A 1PUIA 1E2NA 2YHSA 1WCV1 3BGWA 3QXXA 1GSIA 2CJWA 3Q5EA 5FTLA 1P9WA 2PL3A 1N5JA 4OL0A 3KX2A 1NVWQ 4D6PA 4CEIB 4B6EA 1JXOA 5AUNB 2OBNA 3RVBA 2VP2A 1UKZA 2AK2A 2D7CA 5JZVA 2IUUA 4FN5A 1UAAA 1KI6A 3LH5A 1SXJB 4P31A 2D4HA 1KI3A 4F38A 1G9XA 4IVRA 5BWMA 1A2KC 1IXRC 1GKYA 3HPQA 1U94A 2QN6A 1GRQA 2GCNA 4V0NA 2AHOA 1W36C 1D2NA 3FHTA 2IC5A 4CYMA 4HLDA 2JJ1D 4LJAA 2PZFA 3JZAA 1IHUA 3NXSA 4XD7A 3TR0A 3T12A 4GMDA 1BYUA 4GI7A 5CLLA 3TIFA 4B75A 2J7KA 4DLSA 1FP7A 2N46A 4BFTA 3IKJA 1C1YA 1LF0A 3B78A 1G8HA 2CDNA 2FEOA 2J0SA 4G1UC 1U0LA 2OAQ1 1ANKA 5FUWA 4Q1CA 1XJCA 3ZJYA 3RC3A 2WM9B 4H1VA 1N3BA 1E2GA 2D74A 5D3MB 3R9XA 3QSYA 1JR3D 2BIFA 4JLOA 2C95A 4KU4A 1XEXB 4XSHA 5FBQB 5JLJA 3LX5A 4IXMA 3I8SA 1P75A 1SVMA 2QL6A 1FZQA 1XD2B 2IWHA 2FSHA 3GQBA 5KSYA 1UDXA 4XSGA 2ZUCA 3QXCA 4IDPA 1PLLA 4PQRA 3RC8A 3NBXX 3AKYA 4B32A 1WA5A 3I61A 2X2EA 2ERYA 5K8UA 2J46A 2QMUA 4ZIRA 4Q4LA 1G5RA 2Z43A 5FR1A 1CJMA 4QHSA 4JSTA 1T8UA 3D7MA 2ZRMA 2JJ1A 5EP1A 1G19A 2IL1A 2QQ0A 1G64A 1Q12A 4WXPA 2GF9A 2QORA 2WVJA 3IPYA 4X8HA 1OB2A 1P7CA 2XEXA 1YHNA 2C99A 1OH8A 4LJ6A 2G0TA 3UMSA 3B2EA 2RHMA 3FTQA 2P2LA 2ZJ8A 2CLCX 2WAYA 4IEIA 4IFEA 5L3RA 2QMEA 1IN6A 1G3RA 2O0HA 3I5XA 1XPOA 3AGPA 5K8TA 1YZKA 2HV8A 4PC6A 1W36D 3K09C 5KYKA 4EDHA 4NYMR 1Z06A 1JR3A 2F55A 1JEEA 2PLFA 3K53A 1M8PA 2C5LA 3RS3A 3ZQ6A 2PCJA 4JKIA 3ND8A 1AKEA 3Q5DA 5G40A 1LS1A 2IXFA 2C04A 4D82A 3IQWA 4ABYA 4ZI2A 1KGDA 1OFIA 1IXSB 2YWGA 5KHOC 1PUJA 1CRPA 1NBME 1FFHA 2QPAA 2J0QA 1DADA 3OESA 5EZ5A 2F3RA 3IBYA 1IXZA 4ZDJA 2CL0X 1Z29A 4B33A 1JQJC 4OHWA 4BPBA 1SHZA 2Q9BA 3LRPA 3TAUA 1AQYA 2VTKA 2WWGA 4IRUB 2AWOA 1E2DA 4B74A 2O8BA 3ZVLA 4A0RA 1E32A 2FFAA 3FKSA 2GJSA 3GFPA 2YNMA 1G17A 4JL5A 3SDZA 3UXMA 2ZYUX 1GWNA 3TLXA 2X19A 2JATA 3BFVA 5HCNA 4OI4A 4LBVA 5DO9A 3K70B 3ZH9B 2IYQA 2B92A 4AYWA 2AD1A 4CT5A 4RY2A 2OBLA 1FX0A 3R9WA 3U7GA 5ANRB 4MGKR 4L9SA 3TSZA 3ZD7A 4IKEA 1DAFA 1LV7A 1QHGA 3O8RA 4OHYA 3DEFA 5H68A 2IXEA 1XNJA 3MMPA 2I1QA 4Q4JA 4R2HA 5EJEA 3U61B 2GDJA 1VPLA 2EFHB 4HDQB 4UQOA 2GK6A 1AJEA 1KK0A 1MABA 3VR4A 4M8NE 4PHFA 3CPEA 1XX6A 2JLYA 221PA 1D8TA 1ZD9A 2PEZA 1BMFD 1AN0A 3AF3A 2WWIA 4KITB 4RZUA 4HATA 3TQFA 4DLRA 2R62A 4DDUA 2A5DA 1ZU4A 5FPKA 4A0GA 2L0XA 5SZJA 4URXR 1CTQA 1X1RA 3DO6A 4EQ6A 1LY1A 2GJKA 4QJ5A 1M34E 2J41A 1EX6A 3FGNA 1NVXQ 2LKDA 1SULA 2QAGB 5FR2A 3NHBA 4GL2A 2RCNA 3KJHA 2XITA 1DAIA 3FMPB 1JECA 3SJCA 5CB6A 2QROA 1SXJC 1ZUHA 1M2OB 1RYFA 3KUCA 4GOXA 4ZCMA 2GK7A 3E70C 2WJIA 1H65A 5KSZA 3QI2A 3UK6A 1SZPA 1U98A 2QM7A 2GAOA 1KK3A 3PUVA 3VAAA 2RGBA 3I92A 4C0JA 3U44B 2REOA 2ZVQX 3RSOA 3SFVA 4TWZA 2NO0A 3KUDA 5HTKA 3T35A 3ASYA 3AGQA 5G41A 1E2LA 2W2TA 1VMAA 2YOFA 3GJ4A 5FPHA 3K0AB 4B35A 4B71A 3O8CA 1KI7A 1EFHA 2KE5A 3DDCA 4JVMA 1KSFX 4IDOA 4BECA 2ZRLA 5B58C 2IW3A 1CJVC 2R6AA 5JJLA 1YQTA 2P67A 1K6MA 1U9IC 3W6OA 5EE5B 2BEJA 4ACBA 1OJLA 4PZLA 1XMSA 3CR8A 1UF9A 2JAQA 2XNSA 5FI0B 2O8DB 1M74A 3AH8A 3VKGA 1F2UB 1BMFA 1E69A 2GWHA 3W34A 1XTIA 4D26A 4EPWA 2C9OA 3A1VA 4KSBA 1P3JA 2ZI9A 3SI7A 4R71A 2FGKA 4HAYA 2NPIA 2EFGA 5TB5A 1YZNA 5J4KA 1H8ED 5L3VA 1B23P 2DPXA 3ASZA 4G01B 3A1SA 2R6FA 3ZIAD 2ZE8A 5EZ6B 1J99A 4JLVA 4DUGD 2WIBA 3ICQB 1XMVA 1JR3E 1GVNB 1KDPA 1N0WA 2DFLA 4PR0A 4WW0A 2RGGA 4PAQA 5FTJA 1T0JB 1IN8A 3GFOA 1Z2AA 2GTPA 1G7SA 1KSGA 2G88A 1ZM3A 2QSYA 1XEWY 2VYFA 4KVAA 5AJYA 3THWA 4G5SA 1VIAA 1XDBA 2BC9A 4KO8A 4PAOA 4KYUA 1P72A 1OFTA 4FCTA 2VSOA 5FBLB 3DVLA 2DWQA 1G291 4O3MA 2W6JD 2QQEA 4DRZA 3BIFA 2NZ8A 1ZVQA 2KSQA 4C7OA 1EK0A 4WBSA 4QGGA 1Z0AA 4C3ZA 1X86B 4XTRA 3I8XA 1SXJD 1N25A 2PCLA 4LC1A 3LQQA 2J0VA 4C30A 1VCMA 2D2EA 4C9BA 2MSEB 2QT0A 1ZW6A 2F9MA 3EASA 3PUXA 4PC7A 5FTNA 4NPHA 4JBYA 4RFVA 5BN5A 2BCGY 4P32A 4RFSB 1Z0IA 3AP3A 3NBYC 4HAWA 4KFSA 5AJXA 3IEVA 4RCYA 4B3XA 2ZU6A 2GILA 5LB4A 1KZ7B 1H8EA 2OCYC 3B1WA 3TUIC 3ZIAA 4DUGA 5KDOA 3THYB 1HTWA 4LPKA 1YR9A 3WHKA 4BFVA 3UWOA 2BBOA 4MKFA 4NMMA 1WXQA 4KBGA 2HLDD 3MCAA 1XTJA 4N0EA 4AYTA 5EXPA 5DIFA 4DLTA 1R2QA 3QY0A 3KZ1E 1E9FA 4ARZB 4XVQA 1RJ9B 4FMDF 2QE7A 1LF5A 2XX3A 2RHDA 3GEEA 4ZIRB 1KK2A 1EXMA 1Q1ZA 4Q1FA 2ZSFA 2MMGA 4LJ8A 1GRRA 3DMDA 4BRUA 3KL4A 1KNXA 4TQ9A 2FOLA 1GG2A 2W6JA 5AR1A 4MRNA 1D6JA 3NEJA 4BWYA 4G0NA 4CEIA 1EFRD 1S2MA 2OAP1 4JLMA 2EVWX 3K70C 4TL8A 3CBQA 1SXJA 2VQSA 4HAUA 3EPHA 3B5JA 1X8JA 2XSZA 4QHYA 4NH0A 4MKGA 2F9LA 5FOXA 3TVDA 2GJ8A 2ZI7A 2WIAA 5JWHA 3TAHA 3ECCA 4ZDWA 4QFMA 5C1BA 1RRCA 4DLWA 1JQLB 1TQ4A 2IYSA 3T15A 2CL6X 3NIBA 4BZQA 1HQYE 2PX3A 2QI9C 2VSXA 5FUVA 2PJRA 3LVQE 2ZM5A 4AKEA 2CEAA 2XJ4A 2Q0HA 1LW7A 2C03A 4DCUA 4DWJA 3V9PA 4PC2A 5J4YA 1TU4A 3R7WB 2HLDA 4TT3D 2SHKA 3TK1A 3CRMA 2IX3A 3DOEA 1PVOA 4G5QA 1CIPA 2PEYA 2NMVA 4QBGB 2KWIA 3LDAA 1XEXA 3M1IA 3WRXC 4CT4B 4XVUA 2ZYVX 1RYHA 1X6VA 3CLVA 1WRBA 4E09A 1A5TA 3I73A 3U7EB 4EFNA 2ODEA 3AF1A 3DZ8A 3PIRA 4TMTA 1EFRA 4Q1BA 1TUIA 4RD1A 5FH9A 5B30A 4MRRA 4JT4A 4DCVA 1EESA 4X8MA 1F5NA 3HU2A 3IPXA 5CK5A 1CLUA 2CNWD 4XWOA 3P32A 1Z08A 2AK3A 4A82A 4DIEA 3C15C 5EE0A 4B2LA 2FZ4A 5G53C 1KO5A 4DLVA 2V3CC 2C9CA 2IHYA 4KFTA 2GNOA 3DHWC 3EC1A 3LO5A 4IW3B 1MO4A 5HE8A 2HCBA 5BN3A 1PLKA 3GP8A 4C4PA 3KQNA 1X1SA 5F3WB 2ZRDA 3KB2A 1Z63A 3WBJA 1ZRHA 2CE2X 1ESMA 2OO7A 4EPRA 2O8FB 5KNCA 4DLUA 4S2EA 3K70D 5SZKB 3MGCA 4NTZA 4AK9A 4AIIA 4U7DA 1VHTA 1VHLA 3CX7A 4TT3A 1RKBA 2WJJA 4D80A 1DAGA 1T5IA 2RH5A 5DISB 4Y0VA 3AQ4A 2IXGA 4DHEA 3QENA 4S35A 3FFBA 3W90A 1YKSA 4C0AC 4DDTA 4JBWA 4L8GA 1XD9A 4GZLA 4EPTA 2PJZA 4GRAA 3S1AB 4UNQA 2JJ2D 2YWEA 5TXGA 4HAXA 4Q66C 1RC8A 5EUMA 2HJVA 4A6PA 1N6KA 1CR1A 3T34A 4URVR 3NBZC 1ZNZA 4IHQA 3SYLA 2IS4A 1S3SA 3E1SA 1UEIA 4I1OA 3Q3JB 1Z8FA 2PH1A 1NG9A 3BJIC 1VCOA 4I4LA 5DHAA 3SBDA 1G7TA 1OF1A 2IYVA 3B60A 1R5OA 2NO6A 5JWOA 3PENA 4Q1DA 521PA 1KI9A 1W47A 4RKFA 1QDEA 2NOAA 4Q48A 1E9BA 2HJGA 4OK6A 2VSFA 5JHGB 1E9RA 4OI2A 4QL3A 3SJAA 1VDZA 3LFUA 4HSEA 5CDFE 1Y63A 3EG5A 2YZ2A 4GZMA 4LBYA 2G6BA 3AKEA 2ANCA 2C77A 1OXVA 2UKDA 3ZVNA 2QY9A 2N1BA 3DZDA 4TLDA 3L0OA 3RRZA 3DMNA 3D6TB 1XTSA 4G3XA 2DWPA 1E4VA 1W46A 3CZQA 4FMBB 1XCPA 2C96A 4OQFA 1NJFA 4CIDA 2MSDB 4DZZA 3AKDA 1L8QA 4JKYA 2D62A 4LI0A 2ZR9A 1SXJE 1HV8A 3KFXA 4WZBE 421PA 4QJ4A 4OHZA 3GJ5A 4RZXA 4NP6A 5K8LA 2QMOA 4V03A 3DOFA 1ZM9A 4WOPA 2PT5A 1DAMA 4LHYA 4DDVA 4CGZA 2CK3A 1S4QA 2JJ2A 4KCGA 1HH4A 2FMXA 2OFOA 2OHFA 2ZTSA 1NBMD 3UIEA 1KI4A 3CONA 4EJSA 1JI0A 1A1VA 4Q02A 2FFHA 2R44A 4HAVA 2YC2C 5FL7D 5LBIA 5G3YA 2ZJ2A 3RANA 1E9DA 1N6HA 2F1RA 2N42A 2P65A 3IIMA 3PEVA 4CRWB 4KFUA 4BE7B 3HWSA 1NKTA 2G83A 3ZD6A 3LLUA 2W0MA 2WPDA 1VIYA 5H8WA 4QNRA 1QVRA 1Q22A 3SR0A 2ORWA 3A1TA 3PITA 2QAGA 1CR4A 3BE4A 4JBXA 4RJLA 1CXZA 4LUCA 3WMEA 1JAHA 5KNBA 4NYMQ 1UBFA 2BBSA 3F8TA 3LQRA 2NPFA 2YJTD 4QJ3A 4NL4H 4NYIR 4QM7A 1GL7A 4C7OB 5HE9A 3BC1A 4MQBA 1U99A 4B3FX 2OBMA 2QUZA 1HQCA 3U44A 3RS4A 4H1UA 3VTKA 3Q72A 4NHOA 4O0MA 1KO1A 1XWIA 3AVPA 1T0HB 2W0SA 1K5GA 1IJFA 5FL3A 2ATVA 3K0AA 1TQ6A 3QEJA 1XBTA 2BMEA 2OXCA 4MUAA 3C41J 4BLSA 4XWKA 2OFWA 4TSFD 2BMDA 3DM5A 4JVNA 4ZDIA 4M9ZA 4XD7D 3EZ2A 4DSOA 1XXHB 4PFSA 3Q85A 1XJ0A 2O0JA 5FBWB 1OFUX 1P9RA 4D4LA 3NKVA 4I99A 1QG2A 4PO9A 4QOSA 1TX4B 3QVUA 3GJ7A 2O8DA 5JI3E 1F2UA 1WP9A 3V00A 1OB5A 2DR3A 1VG1A 4Q00A 3KKQA 3AVTA 4P4SB 5LPNA 3L0IB 2VP9A 5FL7A 1OH6A 4B47A 4YQFA 3A4NA 3EXAA 1IOZA 1ZNYA 2YV5A 3QPVA 1EFTA 2CHQA 3LXXA 2RKOA 2BMFA 3TW4A 2ZYWX 1VCIA 2JLQA 3WNDA 4A0FA 3LNCA 4HAZA 2IBMA 1OT3A 1KI1A 2BOVA 4DJTA 1SKYB 2FH5B 3EARA 4IFBA 1I4TD 3GLFB 2PX0A 1XPRA 3ND9A 1KO8A 5SZHB 2KBEA 1EFCA 2ORIA 4TL7A 1GL9B 2ONKA 4WIAA 2DCUA 2CE7A 3R8CA 4BLQA 3TJZA 3GCGA 1KMQA 4R7ZA 3TW8B 4B73A 4PO8A 3BXZA 2W00A 1N5KA 4IOKA 4O2RA 1VG9B 3ADBA 4B3CA 1R0XA 1GZSA 2ZRAA 3L8ZA 4TSFA 3QKUA 2EFEB 2OFXA 3AP1A 4Q18A 3MRSA 3OIYA 4NDZA 3TRFA 4OK5A 4E5UA 2XZLA 3OHMA 3UPUA 3ZYCA 1DEKA 1QZXA 3T1QA 2ZJBA 3KFVA 1DTSA 3N70A 4LYJA 4TMKA 4CW7A 4L15A 3H86A 3AF4A 1XTRA 3MWYW 3JVVA 2ZVPX 4R2IA 4M2LA 1KI8A 1RE0A 4D4JA 4RFSA 4RD4A 4A6XA 4V0LA 1EWRA 1XP8A 4M1KA 3AVXA 2ZRGA 2ODWA 1ZIPA 3VR3A 4JLAA 4U02A 1P4SA 1KOFA 3P4YA 2WSMA 4XIGS 1FUKA 4Q9HA 2GJ9A 2IYTA 3THYA 4QKQA 1BYIA 3U3RA 1J90A 2ZJ5A 4YONB 5JS8A 1RVDA 1WQ1R 1XMJA 2Q9CA 1MO5A 4B48A 4C0QC 3Q9LA 3B9QA 1JALA 3TSWA 4OK3A 4B3BA 4OHXA 4NCKA 1JNYA 4M1MA 2IK8A 4UXJA 4ARZA 5DNYB 1RJ9A 2QA5A 3A4MA 3U4QB 1N6RA 4N0DA 2CL7X 4M1SA 1E2PA 3LBHA 2AKAB 1ZYUA 1HE8B 2ZU0C 2WBLC 5HZHA 2GBLC 4RD0A 3O47A 2J7PD 1C9KA 5IT5A 3L0SA 2QSZA 4EIWA 4DEYA 3NDPA 2QEQA 3UG7A 1TF2A 5KSPA 3BFKA 3D3QA 4YMTA 4LRWA 4TQUS 4A2PA 4AC9A 1DAEA 2C9YA 4BGDA 3FKSD 2IUSA 1ZNWA 1MOZA 1XF9A 1ZAKA 4LCBA 5JRZA 1UKYA 1W0JD 1JXMA 5CLQA 2FPLA 3AVQA 3PEWA 2R6CA 1ZIOA 2OV2A 3ZGXA 3SFZA 1A7JA 1E1QA 2C8VA 5TY0A 4PANA 1U2RA 3C16C 2OEPA 4M9QA 3SBEA 4C0SA 2AX4A 1WBDA 5JECA 3V4RA 4H9GA 4QNMA 4HB2A 4IXNA 1E96A 2B8WA 2ZAMA 4I1SA 5EP3A 3EIEA 1K5DA 4HB0A 4IDQA 2FPMA 2CVHA 5IK2D
chains in the Genus database with same CATH superfamily
5JMTA 3MWKA 2C4TA 1R3DA 3FGZA 4FNAA 5AKGA 2A9VA 2FG7C 1JH9A 1FQWA 3I23A 4ILKA 3A14A 4KWEA 1U9ZA 5F51A 4DB2A 1CUVA 1SBYA 5EIHA 1SVIA 1UDRA 2KBFA 2REQA 4MGYR 1JQ5A 3DCYA 1DL5A 1KC3A 5FB3A 1CZHA 4R8VA 1BJKA 3AUTA 1NV9A 4QEDA 1GAWA 1HI9A 1DKPA 2IYNA 4FBGA 4CDNA 2F6RA 2Q8NA 5I7WA 1AY0A 4KAXA 4E5SA 4YT8A 3IO3A 2BZGA 1XTBA 1GCGA 3LK7A 4QO8A 1XZFA 5FV4A 5IF9A 3THXB 1O77A 1UXJA 3RVMA 2P6UA 4CUZA 4OJMX 5E3HA 4M9XA 4R1SA 5FQOA 2ADFA 2H2HA 2WUGA 1IH8A 3TQOA 2XAUA 4KO4S 1FDSA 2C61A 4WKBA 5EJ7A 1BGWA 3MTIA 2C5HA 1MO6A 1P7PA 4HH0A 2QTRA 2CSXA 3QLVA 1XZEA 1OPXA 1QV7A 4AX4A 4NC9A 3TLEA 3ROPA 4P33A 1I24A 5A3VA 2ATCA 3R5SA 3MJEA 3OZSA 4DA0A 1Q1QA 4IO0A 5DNDA 2LCFA 4F93B 3UGJA 4COOA 4R0VA 4TMFA 4CIAA 4HLUA 3GLIA 2HSWA 2YV4A 4KXVA 1Z4QA 2BJVA 2ZE6A 4Y9DA 3HABA 5CLFA 4LWZA 1JEDA 1EWYA 4OLHA 4R41A 4G9GA 4YJ3A 1VKZA 3WS7A 5MN4A 1E3SA 3BHNA 4Z9AA 1YDHA 3MTJA 4JJKA 1XAIA 2XNDD 2V7UA 3HQ4O 1ZNQO 4L16A 4ZT3A 3R7LA 2ZJFA 2JIDA 3A9TA 2P9ZA 4IIDA 1I6LA 3SJZA 1XWFA 1JAXA 1GAQA 3JAWA 1LFDB 3LP8A 2VJOA 3QOFA 2DPGA 4FHCA 4L08A 3RLFA 1WNTA 3GDHA 2CZQA 4ZTBA 2O1EA 2IHBA 4MV6A 1EVKA 1C3JA 1I32A 1U6IA 3DKPA 2I22A 4LV5B 3WZ2A 1WB9A 3QPUA 3ZWMA 3AUFA 1L8LA 3BD8A 4D98A 3O93A 3G0HA 3L6EA 3EPLA 3CGWA 4RHXA 1T36A 2QP3A 2PIDA 1GEEA 3KZNA 4UUMA 1WG8A 3P71T 3U4MA 3TTUA 4IGEA 3W5JA 1RRGA 2QGFA 1WLSA 3TN7A 3I01A 4BKMA 1HFEL 3S7TA 2H7VA 4UVIA 4LSZA 1A1SA 1PJZA 1X7XA 5ALZA 3UJHA 4DADA 4Y2HA 4E6PA 4KE8A 4MUEA 5E6RA 4MV7A 3QWFA 3BMCA 4QU5A 4XX0B 1QRDA 3P4XA 4GBMA 1PQUA 2HRCA 4BQOA 1GKIA 5A4FS 2EX4A 3CVJA 1DE0A 1N0UA 1WV0A 3AWIA 3OTQA 1MKYA 1W4RA 4HEHA 4FYHA 1FC0A 2OESA 1ZK1A 1QFSA 1RVV1 1M1NA 2I1WA 2WJVA 3D8NA 1F5SA 2QLMA 4TRRA 1APBA 1XCBA 1AZLA 1KBZA 4YK7A 3AHGA 4REQA 1UJ4A 4FWTA 4U4AA 2J0EA 1U9YA 3BWDD 3D4NA 3NHZA 1U8YA 3PZRA 1E7MA 3KOUA 4K9QA 4M88A 5DP1A 3QQPA 4DA4A 1E64A 5BQ3A 1U3FA 2V8BA 1HE2A 1N2GA 1U0NA 2X5KO 1QOZA 3KJFA 2VZ9A 4BC0A 1JQ3A 3DBLA 3HVHA 3RYFB 3M6FA 4FCCA 4BL5A 2CXTA 1BN7A 1JPNA 2C42A 2ODBA 3FPCA 4XWAA 3ZWNA 5F9MA 3QBTA 5AUQA 4D6YA 5BW5A 2ZAOA 5IT5A 2AG0A 1ODTC 4PAWA 2VBIA 5IKEA 4U0JA 3IMEA 4O4LA 1M66A 1IUPA 1OLXB 4POAA 5SZIA 4DOMA 4BS9A 2HUNA 3ORSA 1ADGA 4J1TC 2J5BA 3KZMA 5DX0A 1HLGA 4RHUA 5LBTA 1BX1A 2WG1A 3EIHA 3LUHA 1X8LA 4RORA 4YJHB 2Z5GA 3UOGA 3WISA 2BDTA 1WMBA 1TQHA 5KHAA 6ABPA 1XVLA 4LV8B 3TLJA 3V42A 1DRUA 1LTKA 3TDMA 4UCFA 1O5IA 1THZA 4KSCA 4Q4CA 4M7OA 5JCOA 2RGXA 4Y30A 2FHSA 4LNHA 1EZ1A 4H6VA 2O06A 3AV0B 4C08A 4L6CA 3RUEA 4NICA 4M9SA 3WV5A 3JQFA 2DY1A 5HNKA 5C52B 4OLAA 4QQFA 4KXYA 5FX2A 2VJBA 3TS1A 2QRLA 3A9VA 1EAMA 4RJKA 2XY4A 5J1SB 1T5LA 1H0HA 1JPUA 3D1VA 4G5GA 3HI4A 4C4SA 1HZZA 2GF2A 1M6VA 2GHQA 2V7TA 3A1UA 3T7EA 2PUGA 2Z9CA 3P20A 1OIWA 1UPUA 1J2EA 3LP5A 4OJTA 4F2HA 2Y67A 5L6MB 2QRZA 1OLUA 1K0FA 2QZ9A 4Q82A 4RULA 3KPVA 4M22A 1ZL2A 2UUPA 1P91A 1VHDA 2W9XA 6REQA 1R4NA 2Q3FA 4HG2A 4CVNA 1FFYA 1XZBA 1YAJA 1R5NA 3CNHA 3V55A 1UMCB 1YR3A 2XZDA 2YJGA 3OZGA 1GNSA 4C76A 1BDJA 2H1LA 5I7FA 3KB8A 3GUHA 5DN6A 3C0KA 3RM3A 1HNZB 3N87A 4PYNA 2DUWA 1TD1A 3D6NB 4TS9A 3WL7A 3FYDA 4AO8A 1U80A 4IXWA 3WAGA 2J08A 4FFOA 1DRVA 1OZ0A 3SDSA 2RAPA 2R7NA 2XSZD 3KT3A 2AEJA 2CDCA 1PJ4A 4L4RA 5A4JA 2AZ4A 3KKNA 3ZWKA 5JJCA 5LOVB 3Q98A 4OD0A 3KT0A 1U2DC 3OQNA 1UBMS 4MIYA 3IEIA 1P77A 5H1YA 3F2VA 2F3SA 1MXHA 1JRLA 1SIBE 2ZIXA 3CLTC 3L4BA 1JHXA 1CUJA 1MJHA 3LO8A 4Q01A 2LBPA 3B13B 3QPDA 1NQWA 4DSUA 2OCPA 2XVZA 5B6JA 1U4SA 2FR8C 3LUCA 1R88A 3OFND 3AUJB 2WF5A 2SCUB 4CG0A 1J2RA 4HS4A 3UAWA 5CB8A 3M9XA 5EAIA 1WCXA 1UFKA 2O4UX 4NCIA 2BHSA 4LHXA 2G80A 2QR3A 1AMNA 1C4XA 4AY3A 4ER5A 4CKXA 2MSWA 2OQ2A 4B8YA 1KMHB 2O9JA 4ARVA 1QE3A 1EFKA 1JF8A 1X15A 4UM9D 3C1AA 2XUOA 4X94A 4S1PA 5DHFA 5AM0A 3N2EA 3RADC 2O2ZA 1P18A 2VA8A 1PW7A 3HCEA 2RHRA 5DNUA 2XTNA 3F78A 5DCWA 2QI9F 2ZT7A 3D1JA 4MAFA 1GR1A 1X14A 5I8PA 1JWLA 2NU7B 3O2NA 4F7DA 4WBNF 1E6UA 4L9WA 4OB6A 2VC2B 1N5DA 3D5EA 3L0YA 4XR9A 5BUQA 1VE9A 3QW4B 1WXDA 4R0NA 2Q21A 2HX1A 1MFZA 1L7VC 3CRRA 2PGLA 5FUBA 1WXHA 2FF7A 2FPKA 4HDMA 3KHUA 3TOSA 1IHYA 1YAHA 2VJLA 3CZ4A 5GZ1A 2QN9A 5DGXA 4OXYA 2UZIR 4GWLA 5F21A 3UMGA 2CNOA 1I2MA 3H13A 1YRBA 3G5LA 2JGIA 2VQEB 3VOBA 1I8TA 4O8CA 1QO7A 2RC6A 5JVDB 4DRXB 1YFJA 5GJBA 1JQDA 3O90A 4M0FA 4U7TB 1U90A 2H7XA 3CPJB 4FYIA 1QP4A 1P9OA 1J8FA 2V7WA 3PDHA 2ZRIA 2AFVA 1FLAA 3K8QA 1GZVA 1P2UA 4CL3A 4B6GA 1TU3A 4OJNA 2X2PA 3FTDA 4QYWA 3FRHA 3HH8A 1T2EA 4Q3DA 4UAUA 1JQKA 1V5EA 5IT9A 2YZKA 1YCGA 4O25A 2Q7DA 3BCRA 4BLPA 4LF8B 3DEKA 4LEIA 1GQYA 2SKEA 4ARSA 2DUUA 1RZRA 2VXOA 3X1ZA 5F7ZA 2JIOA 2XPCA 1QZZA 5FJJA 1XT6A 4KQGA 1EFVA 3L6BA 2FSPA 1I7QB 3GFTA 2VBFA 2J5RA 2QAGC 2XB4A 1Y6ZA 4OJKA 1VL1A 2DLDA 1G6OA 4GM4A 3F74A 2RKWA 3NIFB 4OQEA 4DKXA 4J16C 3D4LA 5F9HA 3MAJA 3LUBA 4V1CA 4AQDA 2ZI4A 2Z6VA 1ZUNB 2PLAA 1W49A 4PFJA 1L9KA 3THRA 2CXUA 4UCQA 4D0NA 1AA6A 1GPKA 2ZAIA 3FDZB 5ER9A 5J9FA 1PK7A 2IZZA 3NBMA 1PP4A 3IOBA 4Y2QA 3DR3A 4CM8A 3AVUA 1B8OA 2EU8A 2VH5R 2EL9A 2EEPA 1R8QA 3HB0A 4RLHA 4BZPA 2Y2UA 4XM0A 3CE9A 4A3SA 5AIBA 1DMRA 3U4QA 2P3SA 4YCSA 4MROA 2FDRA 1QC5A 1VG8A 2E48A 3AUYA 4J1SA 4TYQA 4F4IA 4DLXA 1NM5A 1ISFA 3AB8A 2P6RA 1HY3A 3SE0A 4QQRA 1D2CA 3WMFA 3ZE8A 1K89A 1F8FA 4V38A 1VMEA 4DA7A 2B5WA 4YDSA 3O2JA 1G5FA 1DJLA 4Q19A 1NQAO 3ONDA 4OQ4A 1KJZA 3KDSE 3P45A 5E9WA 1N6LA 5T57A 4QT4A 2GEDA 1V0JA 1QQBA 5IUKC 2JKVA 1MVNA 2Z58A 4JJIA 5KQGA 3FR8A 1E0KA 1CCWA 1TM2A 2P9GA 3BJMA 3LDUA 2G5PA 4GQIA 1WR8A 4XRRA 5SYMA 3KXKA 3PVZA 5EMKA 3TPCA 3NDJA 4ACAA 2FW9A 2AKEA 4FU0A 2WT8A 2X1MA 4AN4A 5AVXA 3C45A 4G97A 1Q1BA 1P1HA 3FJOA 4FM9A 4GVXA 3ITDA 1SK9A 4JQYA 3P2OA 3RS0A 3R41A 4PRYA 2K5UA 5C4GB 3ZQUA 2GM3A 1U2DA 1PYGA 5JTUA 2WHPA 3MCZA 1I7DA 2C78A 2C84A 3L1KA 3ZK8A 5FBRB 4ZOAA 4NWIA 5LLDA 2QS9A 2V59A 2WWWA 1Y8RB 3MTDA 3PTZA 4UVEA 4FUTA 3I9V6 5JPDA 4FP9A 3RVOA 3INYA 1XDZA 1F1BA 3DVRX 4DV1B 1Z6ZA 4RK7A 1F48A 1HOXA 3JVDA 3UFXB 4KJZA 3P0HA 1KO4A 2QR2A 3EXHA 4JYZA 2IQ5A 2WSSD 3GAZA 5JH7B 3NBQA 3GNLA 4BLWA 1C1DA 2PGJA 3P0EA 2C92A 3QOYA 4FR5A 4K05A 1SQ5A 1VIMA 1P3DA 2WU1A 3L46A 4K6FA 2BCJQ 2J6IA 1T35A 2SKDA 4X54A 1QZTA 2P62A 4RHEA 1XD8A 2ZBPA 4XCXA 4YRQA 5K3DA 5CU7A 4PTZA 5H5JA 4WV3A 4C7MA 2ZCJA 1AZTA 4HUTA 2R4UA 5ER6A 2WD7A 2WWXA 4FGUA 2WPDD 5T41A 3C5HA 1JU4A 4KXWA 1Q0RA 1R7RA 5E4FA 2AN1A 2RB4A 3OFVA 4TT8A 2ZDHA 1LFAA 2OVFA 3JQ8A 4ZCLA 2R47A 4G81A 2VHQA 2WZQA 4XDZA 1NJ8A 1Y33E 4YWHA 4LX0A 5CJ2A 1V43A 5F76A 1TKCA 4F3CA 1HUQA 3UBTA 3Q8XB 3ND6A 3OLXA 4MUBA 3RU2A 2NUTB 1M75A 4BTVA 3TCNA 1B00A 3HSKA 5F2EA 2XMZA 2DQYA 3BUSA 3G0GA 3MFQA 4NXMB 1Q15A 1KZYC 1VKNA 2VDKB 4Z1OA 1L5WA 3ONFA 2GFQA 2HV9A 5FPYA 3U7QB 4CEJB 2HK9A 3NB0A 4Q1VA 4WOCA 1ZJYA 2WWVD 4E5PA 2R8EA 1SR8A 2G4CA 1Q17A 3B3QA 4U7PB 4L4XA 3QF4A 3NBFA 5LQAA 4R1OA 3NZEA 1LK5A 1X3SA 3GT0A 3E3LA 1JTFA 5JHHB 1NLZA 2QMQA 3A06A 4E0BA 5IMBA 4Q34A 2QGNA 1XTUA 1YB6A 2AZMA 2OVBA 5LZ4A 1IQUA 4MJ7A 3B6MA 2O2XA 1HDYA 4MPTA 5AOVA 3BOSA 4ED9A 9ABPA 2O48X 3F3YA 3WKEA 3BREA 2IELA 4LSGA 2B4AA 2H1WA 1C81A 4E4RA 5DLPA 4YRCA 1QBKC 1DBSA 1G1AA 1JZSA 2A0XA 4Q7KA 2Y8EA 4GYWA 3HKDA 1XV5A 4L5BA 2BWJA 5HWSA 2GVZC 3RF7A 1XZMA 4PPNA 5A0VA 3X1MA 5JAMA 1SO8A 5KTYA 4CQNA 4YDRA 2P8JA 4AJ9A 4GICA 3I2YX 1V95A 2PLWA 4R8KA 4OHVA 3HTXA 3N2GA 4BNJA 4LJ4A 4M8KA 2FQQA 5GJWC 3VPFA 4Z51A 2X77A 4N65A 3HZZA 2C3MA 1QHXA 5H4HA 1ULSA 2PSJA 4J16A 2X8AA 3PYLA 5AKKA 5JARA 5MFPA 1PNRA 1P7ZA 4O1MA 2W6ID 5EINA 1ETHA 3F5SA 2VPPA 4IGAA 1L4EA 1RQXA 2R79A 3BGSA 4WFJA 3IT2A 2ECQA 3B1FA 2BFEA 4O2BA 1T2AA 1Q0UA 1XLWA 1MGPA 2ZRJA 1GPMA 2H2AA 1S2OA 4TLAA 3UUWA 3J7TA 4YI3A 2JW5A 1KKUA 5I7HA 4KLZA 2AFHA 2FG6C 5EE9A 2ZW9A 1IONA 2AZTA 5JCPA 3QNWA 2HPHA 5AI9A 4F4UA 4TL6A 1GDHA 1NSTA 4PPYA 2X4GA 3TGLA 2OGSA 4AD8A 2J9FA 5CXQA 2MWMA 1P5ZB 3GGJA 3HVIA 2RARA 4M89A 1MZVA 1FMFA 5B64A 3O4HA 3MPOA 4NBWA 3D2AA 4Q4AA 2BGNA 4EB3A 3IELA 5DMXA 1N1EA 3ZE1B 1RWBA 4UXIA 1I5OA 2GUGA 1Q2UA 2W2XA 1E79A 1MQ9A 1TE2A 4Q16A 1BCSA 2VFAA 2VQ3A 4OU4A 3ZWOA 1CRQA 5D86A 3UJDA 1BWRA 1N7JA 1ZXBA 4FDVA 4RETA 4CMAA 3KKMA 3FNHA 3W5HA 1XQWA 3ZHTA 5JY6A 2B99A 3MB8A 4RXMA 3M7IA 5FJIA 4F92B 4XJVA 3BQNB 3H1TA 2V7QA 2XCQA 3H3FA 2M1ZA 3ZQKA 4CMIA 3OWOA 2OK8A 3C48A 4YMUA 1E98A 3VMFA 3I0NA 4FEGA 1FLVA 1R4ZA 4YUVA 5F1YA 1FSGA 4F4FA 1RI3A 2PWYA 5FWYA 3KQLA 4B3GA 4ZVSA 4P8RA 2CYBA 3CH4B 3SY8A 2R8PA 5BXYA 3KEQA 5KKNB 2VRCA 3M6WA 3JD2A 2V45A 1WJGA 1GTVA 3IVGA 5NLLA 3BJRA 2VIIA 5A6VA 1OROA 4CETA 4EHDA 1VJ5A 3BIWA 3G2IA 2ZUDA 2A94A 2QTFA 2H57A 3SHWA 2EL7A 3GXOA 1E7WA 1J5PA 3F5MA 3K5WA 1P73A 3E7FA 3KQWA 4C3VA 1H0SA 4BWGA 2OLKA 3RYCA 3NOVA 1ZNXA 3HKCB 3QHAA 4P3OA 4JLSA 4C20A 5JT1A 5K01A 3GLHE 1SQSA 3H17A 1U5AA 2Y1CA 3N0VA 3OEYA 5KWEA 1E5VA 4ZAWA 1CZUA 5U4XA 3RU7A 5IAAA 2YXPX 2P5SA 1GN8A 5DE3A 4QPZA 4CM6A 5AYVA 1E6CA 3I1JA 3LUKA 5KYWB 3PPXA 1U8TA 4M60A 4BFXA 4R1PA 1RKUA 2AA3A 1EUDB 3FDXA 4L5JA 2ZXUA 1L2TA 3K73O 2O3RA 3OMWA 1FTQA 4FW9A 4MCAA 4XLTA 5LU8A 1N2CA 3DAGA 2SBTA 5F12A 5CVTA 3GLSA 4BRWA 2HGSA 1E1QD 3CKKA 4II3A 3O8BA 4F97A 4M4SA 4WK6A 4ZN6A 1J33A 1SOAA 4LN1A 3SDBA 1R64A 3ACBA 3UGTA 2E0IA 1SVNA 1SOMA 3FYTA 3RS7A 1JJBA 1LPAB 3BB1A 3CUKA 3EUFA 1G3MA 4EGSA 4YUWA 4GPD1 1MT0A 4S04A 2J1LA 1RYMA 3IJ5A 1JA9A 2COUA 3KLOA 3QEOA 3RYIA 3E81A 4P93A 2I6QA 4CFZA 1M1YA 4TTQA 3RYIB 5BN1A 2P3OA 2H1CA 1L3CA 4XUDA 4RQUA 3UG6A 2JA2A 1JJAA 3B1VA 1H3FA 4CHGA 3O8OA 2OSBA 1MIHA 3BD9A 5BQXA 2AMVA 1M6NA 1IQPA 1TD9A 2ZSAA 4PRZA 4B31A 2EYUA 4XQ9A 3OAAD 5IJ0A 3WKAA 1T10A 3ZGZA 1GP2A 2FMIA 4WPGA 3FF4A 3AUAA 4TTVA 2XNHA 1P8JA 1S5PA 1NXQA 3R3JA 3VZBA 5BQ5A 1E6MA 2GI4A 2ZTMA 2FA9A 3WL8A 2G25A 1DAOA 1TT5B 1W7AA 3IE2A 2GZMA 4XVRA 3UMRA 1OTYA 4LYYA 4WN9B 4RZ3A 1MO2A 1BDHA 3BB4A 3U9SA 2IDZA 3I2KA 3OUZA 4LTMA 4V3CA 1U4NA 4ALMA 3AFGA 4EG7A 3CJRA 3HXOA 5ES3A 2PZAA 3DQPA 4OSPA 4TTRA 4DBVO 1QRTA 3PPYA 5HFNA 3HP7A 1M5UA 1I2AA 2HJHA 4TV8A 4QSHA 1PV2A 4JJFA 4Q4HB 3OTHA 1T2NA 1ZZEA 2GHIA 4MQFB 4ZVQA 5I01A 4FD2A 1NFRA 5COAA 1TAHA 4UBJA 5EIBD 4G8CA 3F2IA 3KR0A 3TLMA 5AUPB 1ULZA 5B1SA 2HTEA 2OG2A 5FUQA 4ENUA 4LDRA 3PJRA 4JJGA 2PMFA 2DZDA 4IP0A 4FYPA 2G36A 1CUUA 1OILA 4M0EA 1YB7A 4OXNA 1EU1A 4Y2SA 2HADA 3WLAA 3T5PA 2Q1XA 1OTXA 4C88A 2J8ZA 3UZUA 2IP1A 2XWQA 3AXSA 3HC7A 5IBRA 5KAMA 4BCCA 1KYQA 1E3DA 4ZJUA 2QVGA 1O94D 1OWLA 5A3SA 1QUFA 1Z0KA 1UDCA 2G9ZA 2QLBA 4PZPA 1K2WA 1D09A 2ARKA 3PNMA 2R1TB 2R66A 5LNK6 1PT8A 4YV0A 2JLRA 3IR7A 3WE7A 4H7DA 3AUSA 4PXYA 4KPUA 1FZTA 4XVCA 1PR5A 5BNIA 4B45A 1VYTA 5ILQA 2QPTA 4ARUA 4BNZA 1NN3A 2PWZA 3JWIA 1JT9A 2H1VA 2HD4A 4GNKA 1SHKA 2P6NA 4GX1A 3GY0A 1NQOA 3NLLA 4PCUA 5BW8A 4B8WA 5CBKA 5JQGF 5DSZA 3S8MA 3BIXA 3PFCA 3SZUA 4FDAA 4LZNA 5KOHB 1T26A 4P7KA 4A4DA 5JPCA 2IUFA 5JANA 1QTIA 1YBFA 5FOWA 4FR0A 2BYTA 2NZXA 2WU4A 1NG1A 3DEJA 2EQ5A 3T4UA 3ZWDA 2P68A 2YWXA 1KXZA 5CT5A 1C80A 3MJHA 1QTRA 4E2FA 4CUJA 3M6AA 3QYJA 1J1UA 2C8LA 3RJMA 1KC1A 2P75A 2C2OA 2C98A 2WZBA 3DE7X 1NURA 4E5MA 3DLCA 2PWAA 1Q1EA 3RUCA 4O2LA 1L7BA 4XLLA 4BNMA 2PUAA 3HNPA 1T1JA 1VSTA 4G24A 2HT1A 4LVOA 1QHSA 4OQQA 1WE2A 2JFOA 1XMXA 4YV2A 5IASA 2PQ0A 3PD0A 4UVDA 2EX1A 1KH2A 1Z68A 1GSHA 2DT8A 2TS1A 5J43A 2O7VA 2JCGA 1SOUA 2FPPB 1NRJB 1D2RA 1QE5A 1UIRA 4GBJA 4KWHA 2QUJA 1CERA 3HUTA 3PC8C 2GF0A 2EKZA 4P58A 3N6RA 4ER7A 2OXTA 5JXJA 4TMVA 4M1YA 1GA4A 4LJ7A 1JB1A 4ZQEA 5C5DA 2XUHA 5D84A 4C06A 3CNBA 4RKQA 3EA5A 1R6BX 2HEGA 2E4ZA 1Z36A 2QL5A 3NALA 3Q3VA 3Q9SA 4G67A 1EFPB 2DKOA 4YJFB 4JL6A 3VC7A 4C3UA 2J4FA 3MRVA 2GCIA 2R6GA 3EOZA 1VPTA 3BA1A 1V7CA 2X41A 3IBTA 5L7WA 1THMA 2YHUA 4PO1A 4RY8A 4UDNA 3NIWA 2KS6A 2A30A 3QVKA 4RQAA 3DS8A 3OZDA 3TUZC 2Z4SA 1ESCA 1LTQA 2XKBA 3VHXB 5CB4B 2VK8A 4L8VA 2JFNA 3VV3A 1QH1B 3D81A 4I1VA 1ZA1A 4LBZA 4PHTA 3CRZA 1ZBDA 1LGYA 1RLJA 4AUKA 3SQLA 4L27A 4M83A 3WYFA 1V3UA 4B2PA 2OBXA 2IWRA 4JC4A 3S2SA 3RJ9A 1QIDA 2MSNA 1I0IA 2AFIA 3EZLA 3RIEA 1T2UA 4OKSA 4PG8A 1BIFA 3JVIA 3GJ6A 2J3EA 3IESA 3B53X 3H2ZA 5GY7A 1RFGE 1CJSA 4HYQA 4LXUA 4OY3A 4PYQA 3LVFO 4RD3A 4YFYA 1CUYA 3DBRA 4BMXA 4U3JB 5HZMA 1QKIA 4ZMRA 1KAHA 2R8RA 1TCBA 5EJAA 2F4VB 1PR6A 1T24A 5REQB 2PX5A 1HYBA 5ALIA 4F12A 3QG1A 2DEUA 1TJPB 2WWFA 3G8DA 4DR3B 2X9GA 2QRVA 3KTAB 1KEEB 2VKTA 3COVA 4KKVA 2YBEA 4XB6B 4N0MA 4DSTA 1VLZA 5L51A 5EPUA 2WJAA 4V0MA 5H81A 3WGIA 5ITSA 2MT9A 3G59A 4GXRA 1XNGA 3GJQA 3JYOA 1GSOA 2PMBA 4RMHA 4U5XA 3SHTA 5ICGA 1BXRA 2HWUA 1JG2A 1VPEA 2YMMA 5CBPA 3MTQA 2HHAA 1R16A 1CY2A 3N0TA 1IB6A 2BKXA 1ORVA 4I6EA 3UHJA 2PE5A 2XNJA 1NXTA 4JOBA 2ZBVA 3WQRA 3REQB 2VNSA 4DCTA 4WY8A 4BIMA 1EBFA 2F43A 2V4ZA 2PZ8A 2GK4A 1XU7A 1KQPA 1YOBA 3H5IA 4KACA 1NVGA 3JZDA 4FHGA 2ST1A 2PX6A 2UVQA 5IJ9A 3IQXA 1G21A 2UAGA 2VJMA 1CE8A 3O5AA 5HRAA 2BR5A 2TECE 2XZTA 4PXAA 3H3JA 3AM3A 3ZDZB 4HVLA 5L3SB 4PIPA 1CRLA 4BLRA 1VJRA 5EWLA 4JBNA 5KSYA 4Y0AA 4MW5A 4AJHA 3TNFA 5IAEA 4R8MA 5ALWA 2B34A 3IJRA 2EZUA 3GRYA 3JD3A 5ENDA 3ZDEA 1QYRA 2IE0A 3TSOA 2AE2A 3EZ7A 3UV7A 2CEKA 4EITA 3OPQA 4W5HA 4PC1A 5JDIC 3OZXA 2RB5A 4KI7A 4QU8A 3VFDA 1S2GA 2ENWA 4K26A 3VC1A 3I62A 1YQGA 5CYPA 1OX4B 2Y71A 2ZSJA 4MB6A 5IHPA 4TUYB 1OUMA 2OCBA 2OZKA 2LKCA 1T9HA 2WF6A 3FMFA 3U0BA 3ZZUA 4EG0A 4UCXA 3SSNA 4ATNA 5D01A 2WW8A 2Z5LA 4DYDA 4PYRA 3NC1C 3VPXA 2BGJA 5BV1A 4HP8A 1JBKA 3AR3A 2PVPA 1QHNA 2JZOA 1H8HA 1IY9A 1LDGA 1MNQA 3GFVA 3VH2A 3UC9A 3MK31 2PLRA 2AMJA 3C6MA 3ID6C 2JEOA 4IWNA 3I04M 4M8IA 5CHYA 3P2JA 4IVPA 5AVUA 1WXEA 3B89A 4W1RA 3U26A 3AEKA 4C5AA 2C3PA 2BEWA 1HF3A 4N5NA 2GESA 2K2QB 4ZQGA 5SZHB 4WL0A 1GGHA 1N6IA 2VHUA 3EFEA 4XWYA 4QXPA 4P81A 3WSWA 1ZCBA 2FAXA 1N78A 3OTWA 2G08A 2VUHB 2H00A 3QQ5A 4LNUA 3KVNA 3IUPA 5IC5A 3UB4A 1EZZA 1NYTA 5F23A 2Q3JA 2HXYA 4DILA 3SZRA 3SQDA 2KQUA 1PJSA 1A88A 1WAMA 1JLKA 1G16A 3PC8A 4PM4A 3U3MA 4D96A 1FRFS 3NH6A 2LWIA 3T7SA 4UNNA 4DG8A 1JDVA 3ONVA 2H9AA 4QGFA 4HUQA 3A1EA 5BVHB 4MYTA 3NEAA 1OMOA 1Z5GA 2QD5A 4FPXA 1XG5A 3GUVA 4NKRA 3K0CC 4L8LA 4RMIA 5L7TA 4CZ2A 2VJYA 4TN1A 3R9XB 2WTNA 3LWNA 1V1MA 3T0FA 1VJGA 2DXIA 5JV5A 1US8A 2IJGX 2X76A 3EAQA 2AWNA 3EQ6A 4JUCA 5DBOA 3PKJA 4GYJA 3TUJC 1IFXA 5DGTA 1Q91A 2AR7A 2BM1A 1N8NA 2EBUA 3GVCA 4X3CA 5I5GA 3T5AA 3P8ZA 1L5HB 2VCHA 2XEDA 1N2JA 2HIGA 3GJZA 5B6PA 1E6KA 3L9WA 4NRDA 2JRLA 4NG5A 4EAAA 3T0IA 1OFVA 1T91A 4WVLA 1Z0FA 4YUAA 1A5BB 1OR8A 1E20A 5I9BA 1FMCA 1P3Y1 2G8NA 2QP4A 1OCEA 3FWPA 4JGBA 1XQ6A 4R1UA 3TQQA 4QBHA 4HXEB 4FHZA 3LDGA 3WLPA 1MC1A 3D4PA 4JMPA 1GXSB 1QYXA 5LA6F 1KDRA 3ROTA 1AGXA 1LA2A 1TZBA 1AT1A 4Y9SA 4I2NA 5ITWA 1Y8ZA 5CVCA 1BVYF 1X7ZB 4I4TF 4U2FA 3HKEA 1ICIA 3PFKA 1NXXA 3CX3A 5BYAA 3A6FA 2O5CA 5CRIA 3R0ZA 2UUCB 1TGYA 2RH4A 4LXXA 4Y2XA 3RRYA 2WHQA 4IMPA 5FTKA 2A78A 3OLQA 1H05A 4BY9E 2PRJA 3FOEC 3LY5A 4FOLA 1LSSA 2P79A 4TLCA 3EMKA 3HB7A 1XRLA 3KD2A 1OHHD 2YOHA 1E3WB 3A6EA 2I33A 4YPFA 2EDAA 4I5GA 2QIOA 4DCCA 1EJ2A 2I80A 2FZEA 5K0CA 4D42A 4Q24A 3AVYA 2OLEA 2AXPA 4QAQA 5C2JB 4H0FA 1NVVQ 1USVA 2FFRA 2JBWA 2PBZA 4DYVA 4D0SA 1U7PA 1ML4A 1NP6A 1L7AA 2VPTA 3H16A 4HC4A 2AC2A 4UTPA 5JO0A 1NN5A 4PYOA 3KAKA 2P90A 1J0AA 1N2HA 1DVRA 1U9IA 1BHQ1 1R0YA 3IVXA 2BM8A 3N7AA 3IA2A 1YVUA 3WQQA 4HSGA 2HMSA 2WJYA 3TW0A 4NF2A 2O2DA 4FONA 1DAKA 1JHZA 4PLCA 4FSHA 5CIWA 4CCAA 1MRNA 3MS7A 3AIKA 4H60A 3OE1A 3PFIA 5B4TA 3PNSA 3ZX4A 3MILA 1M72A 2WHXA 1RWKA 4ZPXA 3E0QA 4ER0A 1EUYA 2GEFA 4HQOA 2GT1A 3FPHA 3OM1A 1RXYA 5DN9A 1DKNA 2JH8A 3S68A 4MQUA 5KYGA 2WJ4A 4M37A 1E1NA 4ASUD 2OSVA 3OZAA 3RPEA 3MT7A 5JDIA 1OXUA 5AKIA 3MG9A 1QCDA 2YZGA 2PO7A 1PZNA 1VXRA 3M8KA 4R8RA 2HHCA 2RH9B 2W8BA 3HG7A 4PHHA 3DEHA 4TXHA 4PYKA 4TYPA 1IZZA 5CYOA 2IPLA 1H5QA 5CUQA 2QRQA 5JAZA 4CKYA 5KREA 5KVSA 1EDBA 1Z07A 1ZI6A 3BILA 3P9NA 5IUNC 1GVHA 4TGLA 2ADOA 1BAPA 4K6OA 3RV4A 5K3EA 2QT9A 2O8CA 2VP6A 5EZYA 3FOBA 3QITA 1WPXA 4H77A 4DCSA 4KHPB 5CW1A 2CJFA 3UTCA 4F6RA 3TRIA 3L1IA 1WPGA 1MR3F 4L4YA 3UFBA 1QDUA 4QG7A 3I6YA 3BG5A 3EH2A 4B83A 3P7MA 4FS3A 1YT5A 2FV8A 1NLFA 4WERA 1P2SA 2ZJ7A 2XYPA 4Q4JB 1FNCA 1GV1A 1XAHA 2ETXA 4S1WA 3ECAA 4UHJA 1HFKA 1OE0A 4FMCF 4JS0A 1ZAYA 4TVBA 3NWEA 1XRRA 3TZHA 2GM5A 2EJCA 2ZUWA 4GGOA 2AW3A 4RPKA 4U6NA 4D4IA 3U0VA 1JQEA 1GNQA 5KKAA 2ONYA 2PFSA 2PJUA 1THTA 1YZTA 1E3JA 4ZZIA 2IIBA 1LK7A 1B8UA 3C2QA 4TKUA 4EFMA 3JARA 3KYDB 3HCFA 5K6AA 4X63A 4WSOA 4WKGA 3K0CA 4MDFA 4EQ6B 1SKUA 3HU1A 3LS2A 3LC0A 3NVMB 4N47A 4EO4A 1D4AA 4QTYA 1RWMA 1G8GA 3OF2A 3EB9A 1O9HA 3QUTA 1DTWA 3CEAA 4JCOA 3FYSA 5BRNA 3HCDA 5JAOA 4O2AA 3HU3A 4EDFA 2YTZA 4JSRA 3RKUA 2QPOA 3V8PA 1AS0A 2V65A 4H6PA 4NMHA 4BEWA 3TTWA 5KX5B 2ZI3A 2ZYTX 3M5CA 2QMHA 4QICA 2QHXA 3FWYA 3PGMA 2R751 3LX6A 3MJVA 3ZGNA 5BWBA 3C14C 2G8LA 1P6UA 4PC3A 1WHSA 1F0PA 2WAXA 3I2GA 2IHZA 3T9FA 4F3YA 4RDXA 4GQAA 3ZLVA 1L5SA 2DKNA 4MO2A 4E7PA 1Q20A 2VH2A 2IYYA 4PZAA 2F1IA 4HDOB 3U3KA 2X1HA 3NOQA 4ZO8A 2BKUA 2EGUA 1GTG1 1EIZA 3GRVA 1H0KA 2GPYA 2I03A 3CNOA 1A82A 2CY0A 1EX7A 2DU8A 2PKCA 2QM0A 4ALLA 4BKOA 2RKBA 1IYZA 1A2BA 4EO7A 2ZYSA 1AKTA 1URPA 1EXVA 4IIEA 1E2BA 1TADA 4DUPA 3ICEA 3VUFA 3WOVA 4BASA 1IPEA 4HDKB 1DQPA 1KEZA 1ZIXA 3B3JA 4RCVA 2HBZA 1VRVA 1MJFA 1YTLA 1G5TA 3AXTA 2RI1A 4EAQA 3B2QA 1II9A 1VJDA 2EF1A 4ND8B 2ODNA 3ZBPA 4C87A 4YUYA 3ETHA 2HUPA 3HCBA 2IKQA 4HB3A 4CGYA 1ACJA 1KVRA 1P1KA 3CS3A 3EA0A 2X6QA 5BOSA 1FS6A 1QVWA 3QLUA 5P8WA 8GPBA 2HW8A 2C3YA 3H8VA 4R5MA 1U7XA 3BQ9A 5JZ9A 4N40A 3GMTA 3ZHRA 5KYNA 5LWQA 4RJIA 1LNQA 1XCMA 2MR5A 3ZZTA 1D2MA 1ESNA 2XB2A 1HETA 2XVYA 5EMJA 2G06A 3OP1A 3OE7A 1QV9A 2F64A 2TMKA 5ENZA 3RVJA 4B4VA 3IBGA 2NV2B 3QKRA 4I50A 4F4DA 1JEJA 1EVQA 1YO6A 2XOKA 1L5RA 1MORA 2C7GA 3E6AA 4WECA 5IS2A 3S1SA 4AKGA 3W9UA 5JOQA 1EFLA 3U56A 5D1HA 4W99A 2H07A 4N03A 2JASA 2MR6A 3TEMA 3THWB 5CNMA 3R2JA 3VI4B 2RD2A 4EPVA 3D5TA 4ZKEA 1E1CA 1QO0A 3X1YA 2DMRA 2XE8A 1J7JA 2CWDA 1NJ6A 4B0PA 4C2TA 3I5MA 3VYTB 2BUBA 2AD5A 2EFYA 1IY0A 1OKKA 2AR0A 2Y99A 1UFQA 4G4JA 4TXLA 1TECE 1GRCA 4AURA 2NU8B 1UBOS 4CF6A 1EEHA 4C0KA 4GPTA 1T3GA 1BWPA 2WLSA 3L43A 1T0IA 1A8SA 4IJ6A 4MWSA 4FW8A 2YWFA 3RTDA 3IAAA 4GP9A 1DX6A 1GNTA 1Y98A 1ZMXA 4MI3A 5EY5B 1ZOSA 3USES 1QIKA 2ZYHA 3H4MA 1SC1A 5F5LA 4RMNA 2HQBA 2PKQO 4FFPA 1Q84A 3C5VA 4QQNA 1Y3DE 1NNEA 1LBSA 5BN5B 1WMEA 1DIOB 2FSIA 4NV3A 3H3XA 1E0DA 3G82C 5D1NA