2JJ8A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
184
Chain Sequence
b'TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERCVPLKYLQELHELHEDWLIHPQSCKVLVLDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 66
structure length 184
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jj8A00
1CEEA 3SR0A 5FL3A 3QPUA 1S96A 1OH7A 3FKSA 2Z0MA 4IDQA 2F7SA 4ZV4A 1OE0A 1N2CE 1EFHA 1OT3A 5FOUA 2D7CA 3TSZA 4JT2A 2AK3A 2B6HA 2PJRA 4DCTA 3KUDA 3WNBA 3KQNA 4IRUB 2QAGB 3NTUA 2GJAA 1YU9A 4A0RA 2ZUBA 4EDHA 4QM6A 1VG0B 2AFIE 4PO1A 1SQ5A 3CBQA 2XNDD 2OHFA 4NH0A 3WYAA 4NP6A 4IOMA 4FCVA 3WP1B 1N5JA 2GZDA 4HLDA 4DZZA 5DYGA 3QIAA 1G9XA 3TR0A 1AGRA 5CLQA 2WJYA 4LBZA 2YC4C 2OLJA 3K0FA 3AKDA 2V55B 3I8SA 3ZIAD 4B3GA 5FL7D 2FSHA 4QBHA 3CF6R 4JIMA 5AJZA 1VIYA 2L0XA 5TXGA 4XTRA 2FZ4A 4Q4AA 2PMKA 1RJ9B 3LDAA 1KZ7B 3W9YA 3T34A 1T5IA 1OJLA 3SJAA 2GJSA 1DELA 3CNOA 4OJQA 1XPUA 3I1FA 3QXJA 5SZKB 2IXGA 3T12A 5KUTA 4NBSA 1CJTC 4D4JA 3IIMA 2BBTA 3DDCA 1X8JA 4RY2A 1Z6TA 4NCIA 4AI6A 2NPFA 4F92B 3DOEA 1SVKA 1E4VA 1D2MA 1KJYA 2Q6TA 4L15A 3T5GA 1U0HC 2UZ3A 4RD4A 5FI1B 4Z51A 2FDCA 5HKKA 1HTWA 1ZMXA 1YVDA 4EQ6B 3CH4B 3A8TA 2FEOA 1E2FA 5EXPA 1H65A 3T1QA 1MKYA 3AEZA 3ZZTA 3QNUA 3QKRB 1EFCA 3ZJYA 3B6EA 3PITA 2NGRA 3I62A 2PT5A 2FE4A 5TDHA 4HAYA 1MABB 1DBSA 2N1BA 3K9LA 5LD2C 2CNWD 2RKOA 2X8AA 4C0JA 1YZLA 2WM9B 3TK1A 3W6OA 4E07A 5D3MB 2FPMA 1T4GA 4MDFA 2WPDD 2XTNA 2W2XA 2DWPA 3BGWA 2ANCA 1XMVA 2IUSA 1IXZA 3GLHA 4IFBA 1J2JA 3EPHA 2KBEA 3A1VA 4F7WA 1Q44A 2ZJZA 3A1TA 1RYFA 1TADA 1KO7A 2J7PA 2QGNA 2XSZD 3EARA 2O8CA 1E9BA 3LO5A 1N3BA 1GG2A 4V0KA 2ZEJA 3OEHD 4DLZA 1C9KA 3E5HA 2ZUDA 2FWRA 3W8NA 3OZXA 4RFSA 2OFOA 1EX6A 1G7SA 3GMTA 3Q72A 2ZROA 5KSYA 4RD0A 1W49A 4V0NA 2CK3D 1A7JA 1EXMA 1RW4A 1ZBDA 3OE7D 1VYTA 2F9LA 4F4CA 2F3TA 2G88A 1DAEA 2QU8A 3THWB 1UKEA 4LI0A 2NZJA 4DDWA 3CH5A 1RIFA 4QM7A 1VECA 1E96A 1AQUA 1J90A 2GETA 1XTRA 3GLFB 4Q4HB 2J0UA 3DMDA 1GP2A 2BOVA 4JKIA 3RWMB 4ESVA 3KZ1E 1NBMD 4D0NA 3QE0A 5JCPA 1G1MA 2R6AA 4KLZA 3ZS9A 5LDDC 3QKTA 1ZJ6A 2GCNA 2JASA 1T0JB 2ZVQX 3K0CC 4GNKA 1YR6A 1DAMA 4R9UC 1AJEA 2OBMA 2ODNA 2A9KA 3MJRA 2F3RA 4RKFA 1LV7A 5A0FA 3KQLA 5KO2A 1KK2A 4Z8XA 2NO0A 3GFPA 1ZM4A 4NTZA 4PPNA 1E94E 1EWQA 1O87A 2AN9A 4DKXA 1SVSA 3V9PA 4P4SA 1KO1A 4QJ4A 1XTSA 1KMHB 1KKLA 5CJPA 4OYHA 4BWYA 2W0MA 3CF2A 5DE3A 2QM8A 1TX4B 4FMDB 4TQAA 4MRVA 5EZ5A 2QTFA 3CLVA 5FBWB 3I3SR 1F48A 3D3QA 3IKJA 1GL6A 2E1RA 4BZQA 2YNMA 1X1RA 4Z54A 3N2IA 4PHGA 5JS8A 1ZD9A 2QQ0A 1YE8A 1ESMA 2IXFA 5FR1A 3SQXA 1YQTA 3HP1A 3T06B 2VBCA 3UXMA 3B78A 3BORA 4MYUA 2IYTA 1XEXA 1V43A 4KYUA 3AVUA 1Z5ZA 4DRZA 2BJVA 3ADDA 1JPNA 2GXSA 4B44A 2ZRHA 4IDPA 3NHAA 1NVVQ 1XD8A 1OHHA 2FG5A 3GLGA 3L0IB 3BBPA 3VR1A 4I99A 3A6PC 4TYPA 1SVOA 2CL7X 3C15C 5FTKA 2E9SA 2EFDB 1W5TA 2IC5A 2P6UA 2VL7A 4JVLA 1GM5A 5CDFA 2QEQA 4LPKA 5BQ5A 1ZCBA 2WOOA 4NCHA 1OB5A 2HLDA 5KDDA 2VF7A 5FUYA 2FPLA 1PLKA 3SJCA 4D4KA 5JI2E 2WSSD 3RS7A 4DLYA 1UBGA 5UKDA 3BERA 1YZNA 4BPBA 4B34A 4CYMA 2FSIA 5CIWA 3K8YA 4PZYA 4AKEA 1UEIA 3IO3A 3RANA 4IOJA 1IN8A 3MRSA 4YDSA 3TKLA 4HDOB 4KBFA 1P61B 3SC3A 3DO6A 3W8RA 2JJ1A 3EC2A 4OQLA 2VH5R 4B48A 4B74A 1N6IA 4BECA 5AUNB 1UEJA 2ZRCA 4P3YA 2FN4A 2NO1A 3SZRA 1IJEA 4KBGA 3C5CA 3EWSA 4QJ5A 4MQBA 5JJIA 2OAP1 2CEAA 3PVSA 4NCJA 4WA7A 4B43A 1E3MA 1J70A 3UG6A 2HDNB 1VIAA 5KSPA 2C8VA 3ONWA 4BRWA 3HWSA 4Q9KA 2QAGC 2ZRDA 3U3KA 3VKHA 3BB3A 1GKIA 2AFHE 1KI1A 2BEKA 1GITA 1SHKA 4Q7LA 3CKLA 4AKGA 1UBEA 4TQ9A 2FZLA 5FOXA 3SN6A 2O8DA 4LHVA 4Q18A 2DWQA 2GVDC 2ZVPX 2IW3A 4FD2A 3CRW1 4KCGA 5HE8A 4D4LA 4YMVA 1FUKA 5GJVC 3P27A 3KFXA 4KLNA 1R5BA 4D6PA 2HYDA 2MSCB 4B2IA 1NJGA 4LC1A 2BC9A 4PC3A 1WQ1R 3T1TA 3IPYA 2PL3A 4Q9HA 1WDTA 1BH2A 2R6DA 2FEMA 4KAXA 1MH1A 4MYCA 4BUJA 1E9EA 3RRYA 2ZXUA 2A5YB 1VKJA 4PFSA 4QXAA 2GK6A 4URUR 4DC9A 3FKSD 4A2WA 3VTKA 1PVOA 2Z4SA 2RGDA 5CB6A 2QRZA 1G7TA 1SGWA 1R0YA 1Z83A 3TW4A 2B7BA 5JHHB 4D26A 2GAAA 2JLRA 1E2JA 2A7QA 3RRZA 3AVVA 2HCJB 1U90A 5J4KA 2KI5A 2Q9BA 2H92A 2Q3HA 1XMIA 2PEZA 5CIQA 1XEWX 4NZYA 2VP5A 2IXEA 3KJEA 3RAPR 1CP2A 4AYWA 2CHGA 3HPRA 3U4QB 1N5IA 2AXPA 1E6CA 2ONKA 1OLOA 4LGMA 5FTJA 1MV5A 4ZI2A 2WJGA 4BEJA 4AY2A 2C78A 3PV0A 2P67A 2DFNA 2R65A 2CXXA 3GLIB 1CRPA 2B7CA 1OKKD 1ZCAA 2DPXA 2ZE8A 1LS1A 4HUQA 2ATXA 4UJ3A 1KDTA 3K0SA 3B1YA 1RRPA 3H4MA 4KVGA 5CYPA 4B73A 2Q0HA 4AC9A 1KZGB 1M7HA 1UPTA 3EIQA 2JLVA 1SZPA 1P9NA 2OEPA 5F9HA 4OHVA 1DAHA 3B9PA 3D7MA 1EG7A 5DISB 1ZM7A 1I4DD 3UKDA 3GLFA 1T3LA 2HJVA 2YOHA 4HAZA 3ZYCA 6Q21A 2O8BA 3R7WA 2H18A 1CJMA 4WBSA 2F43B 3RC3A 3F5FA 5BN3A 3T5DA 1JEEA 1NY6A 2K5UA 4A1FA 2AWNA 1FZQA 4PC6A 5JRJA 1Q3HA 2OT3B 4LJ8A 1HY3A 4UNRA 1Q20A 1E1RD 2IA5A 3EA5A 2XNSA 8OHMA 2V54A 3T1VA 4JZKA 1E9DA 3OESA 5FPTA 4BQSA 4URXR 1P62B 1YRBA 2EVWX 2QT1A 1AS0A 5FL7A 3ECCA 1SKQA 3WRXC 4LHYA 2IUUA 1WA5A 1AK2A 5F98A 3EAQA 1E32A 2GHIA 1ZVQA 3HR8A 1G291 1AA9A 1FNNA 4LYJA 1FL9A 2PLFA 1R0WA 2BJWA 1BKDR 2J7PD 3U44B 4FCWA 1P9RA 2HEIA 2XJ4A 2XTZA 3GQBA 3PENA 4IHQA 4U02A 3TIFA 4XTCS 1Q0UA 2WV9A 3NBYC 4OHWA 2C2HA 2DWOA 4GZMA 4TMZA 1BMFA 4BFUA 2P6RA 3QG5A 1HQCA 4XIGS 2GBLC 4XVUA 1Z2AA 4FW9A 5EP2A 4GDFA 3PUZA 3VNVA 2OG2A 4KODA 3MWJA 2GNOA 4M1SA 2ZE6A 5EJEA 2DBYA 4TLEA 4LJ5A 2QMHA 4DLVA 2NQ2C 1OXSC 2C96A 5FPSA 3DL0A 3GJ6A 2ZUCA 4S35A 2QT0A 2D74A 2ZI3A 3TSOA 2HF8A 3RNLA 3QOFA 3AV0B 2IUTA 1D9ZA 4BFXA 1H8HD 3GEIA 3ZS8A 4LHWA 2VYFA 1EGAA 1LS6A 2G0TA 3EG5A 4E22A 2LKCA 4OKSA 5L3SA 1G3UA 4L9SA 4GPTA 4UXIA 3ZVMA 1NMXA 4XSHA 2HUPA 3I73A 4ZDKA 4L16A 1D2NA 1SXJD 2OO7A 2OXRA 5GJBA 5J4VA 4A0FA 1P60A 2AHOA 4TMVA 3OEEA 2QAJA 4PQRA 1W0KD 1IY0A 1OSNA 1Z0IA 4DIDA 2CLSA 4Q9JA 1VCIA 1E2EA 4Q9IA 1JALA 4DHEA 3K0FB 1KYIA 4GZLA 1NVVR 3CX7A 1ZIOA 2A78A 2BMJA 3VU9A 3MAAC 4DXAA 1Q22A 4I4LA 3DZ8A 2J41A 4ASUA 1ELOA 4Q4AB 4C2UA 1M34E 1QVRA 2WIBA 3OE7A 5FBRB 1CRQA 4FXPA 1YRAA 1GTVA 2OXCA 5DH9A 4DCVA 2GJ8A 3WMEA 3T1OA 4C30A 3Q9LA 1A2KC 1TAGA 3ND9A 4OQNA 2GAOA 2ZE5A 5DNYB 1VHTA 3GEHA 2VP6A 3SOPA 1OIWA 3AGPA 2KB0A 5HTKA 1S1MA 3WMFA 5IT5A 4OJKA 3P20A 5SZHB 3CB4A 1JR3E 4PO9A 2OILA 5HCNA 4BFYA 1CTQA 3X1YA 1G3MA 2ODWA 4TYQA 1PUIA 4JT4A 5B57C 1E9RA 1QHXA 2J1LA 1L8QA 1GILA 4KYIB 4HB3A 4OK6A 4ZPXA 4BLQA 4RKEA 4Y0AA 1RE0A 4TWZA 1D2EA 1VG1A 1DEKA 4AG6A 4B35A 3ZD6A 1H8EA 3C8UA 3X1ZA 4UNQA 2F6RA 5CYOA 2GZAA 2CHQA 4Q1AA 2HLDD 1W2GA 3HPQA 1XDBA 4LBVA 3QQ5A 1DAGA 5EP3A 5LBIA 2GESA 2BDTA 3H0KA 1NL3A 1N25A 2RCNA 3ZDQA 4CT5A 1X3SA 1IN5A 2ZJYA 4ITRC 4N0EA 5TARA 5JZVA 3Q5DA 3I5XA 3QF4A 3GLHB 3CM0A 3KL4A 3LXRA 5B58C 4BGDA 1WXQA 3GJ5A 3L8YA 4RFVA 2O8CB 3MWKA 1SVLA 2JJ1D 4DCSA 1XTQA 1KI7A 3AF3A 3WXMA 3CO5A 4F38A 3LLUA 3B1WA 2P6NA 2WTUA 3AF1A 4RFSB 2R6GA 3SHFA 2ZRBA 2QROA 3KJIA 4LZZA 5AUOB 4AWXA 2IS1A 2OESA 1G3QA 1JQLB 1KTVA 4FMCB 3U3MA 3ZVRA 2QE7A 4C0AC 2I4IA 2YHSA 3U7EB 3K53A 4LWZA 4Q1CA 3AKEA 3GLIA 4ZKEA 4OI0A 4PC7A 3NDPA 2YJTD 2ZTSA 4IVRA 1NRJB 4OQXA 1OPXA 4EUNA 3U5ZB 1N6NA 1R10A 2VHQA 5KPDA 1NF3A 2IEYA 4KXFB 2CCJA 4XWOA 2J0UB 3TR5A 3G5UA 1UJ2A 2DCUA 3MCAA 4I1SA 2GF9A 2OCAA 3U6KA 5G3ZA 4TMKA 1JQJC 3TJZA 1Z6YA 2XXAA 1G64A 2XAUA 3A4LA 2WSSA 3AKYA 4GP7A 5IRCD 3QBVA 1U0JA 3TW8B 2GF0A 1OXXK 4PSVA 1LF5A 1QHIA 2QY9A 4UXJA 1SXJB 4HB2A 4PQYA 3CPHA 3G0HA 2WKPA 4G3XA 1E9SA 3LX5A 2NIPA 2QI9C 3NEJA 4DLUA 4PAMA 1AGPA 2IF0A 4M22A 1PJRA 2HXYA 1U8YA 1Q1QA 4GI7A 1X8KA 1JNYA 4II7A 4L8GA 4M53A 4Q1EA 4E5UA 4W7SA 1ZM2A 4P4SB 2ZS9A 4EKDA 1YR9A 2I3BA 2IT1A 2AD5A 3TUIC 3ETLA 4TLDA 3SU8A 1Q12A 3A37A 1NBME 1ZNXA 3I92A 1X8LA 2CE2X 2IYZA 4M8NE 5EUQB 5KPJA 1GOTA 1NG1A 1FP7A 2AKYA 1OV4A 2XZPA 3W5JA 4ZCMA 3EW9A 3NWJA 1AM4D 3J81k 1E2GA 1T9HA 4Y0VA 3MUFA 1YR8A 2OBLA 2REBA 3BXZA 3CZPA 4A4DA 3LBNA 4Q1DA 3SFZA 3ZGXA 2V6JA 5D3QA 4JVMA 4HAWA 3TMKA 4NONA 4G1UC 5BXQC 1BIFA 1NN1A 1NVWQ 3O8RA 2KWIA 1J8YF 1GNQA 1G8PA 3FHOA 3ZH9B 3FB4A 4JLJA 4QBIA 4LYAA 4DUGD 3VKGA 2WIAA 2D3WA 5E7IA 3GLGB 4J0QA 4PAQA 5FBVB 1E2PA 3GD7A 1N5KA 1KJWA 4XWKA 4EPWA 1CULC 1KO8A 4RCYA 1Q57A 5K8LA 1S3GA 1GL7A 2JJ2A 4FN5A 3DKPA 1S4QA 3GJ7A 5KNCA 2R8RA 4W5WA 1JI0A 3I5YA 1ZRHA 2VSOA 1FOEB 4FIDA 2Q3MA 4Q48A 4IXNA 3Q8XB 1TNDA 3GJ8A 1ZUHA 1UDWA 3CONA 2A5GA 4MITA 4PC1A 4Q02A 5IHPA 4QGGA 1N6LA 2FH5B 2NO7A 4MRPA 5JSZB 1XPOA 5DHFA 4KFRA 3GEEA 4NYJR 4TL6A 721PA 4KU4A 4Z8YA 3RS5A 1XEWY 4DSOA 3RABA 4TN1A 4C9BA 5BWMA 2GILA 5E7MA 2PMDA 1CIPA 5FTMA 4KSCA 2FGKA 2IYWA 4MDEA 4PZLA 1Y63A 4EPYA 2ZAOA 4MUAA 4JYCA 1J8MF 2DFKB 3RVBA 3KKMA 4Q66C 1I4LD 4C0QC 1IXSB 4CF7A 4HLQB 4MGZR 2WKRA 1A5TA 4JL6A 1GRQA 3OIVA 4F4IA 421PA 3V4FA 2G3YA 2AWOA 2A5DA 1T8TA 1HV8A 1XD2B 1T3HA 4WZ6A 5DN6A 4TL8A 3FTQA 4PSKA 1CR1A 1OKKA 1W46A 1W5SA 1NP6A 5H68A 2PX0A 1F2UA 1GNRA 4NL4H 3ZVNA 1XNJA 2N42A 4PSAA 2QA5A 3NEYA 1IQPA 2C98A 2Z4RA 1S0UA 1OFHA 2ZRIA 1GDDA 3R8CA 3CNNA 3W6PA 5EQTA 1S9DA 3Q7QA 5JLJA 2O8DB 4QGHA 1BMFD 1YJ5A 2J9RA 3AVTA 4YMUA 1TU4A 1Z0JA 4BFVA 3ICQB 2JIZA 4X8LA 2X19A 3LFUA 4BASA 4BLSA 4NYIQ 4PPFA 2GA8A 4MKIA 121PA 4BLTA 4DCUA 3DZDA 2ANBA 3BRWD 4Q7KA 1TF2A 2EW1A 4JYBA 1OH6A 2V4ZA 5TV2A 1R2QA 1HA3A 4B71A 4CEHB 2VIIA 4O0MA 2ZS8A 4F91B 5AWFC 3K70D 1E1RA 1CR0A 1T91A 1Z0FA 2O0JA 2ZJBA 3GP8A 1OXUA 3A1UA 4NMMA 3R9IA 3DOFA 5J47A 1UBCA 4ZO4A 1KAGA 4PHHA 4RD3A 2OFWA 3QXSA 5K8UA 2G1KA 4D0LB 1QG4A 1WF3A 1ZNYA 3OAAA 4U00A 4A9AA 4BLOA 4EPRA 4ZCIA 4XD7A 2BMFA 5IF9A 1Z08A 2WHXA 2YYZA 4XJXA 2C04A 3OEED 4MRSA 3P26A 3TQCA 3WNDA 1FMJA 2ZSBA 3K0AA 2QORA 4HLUA 1NLYA 4QOSA 5EE5B 2VPPA 4R98A 1XF9A 2B21A 2YOFA 3HYTA 3UANA 4ASUD 4HUQB 2QBYB 2WZQA 3RRNA 3KQKA 4TYYA 4M9SA 4IDOA 3BWDD 1JPJA 5BN4A 2VHJA 1W4CA 1KDPA 2B8TA 1KY2A 521PA 3UWKA 1VDZA 4OI4A 2ZR7A 2VP2A 5BYKA 2G9NA 1WB9A 4A0GA 3NBZC 4BFSA 1S1CA 2F55A 1RZ3A 2ZYTX 2XITA 5AUQA 1CLUA 4OHXA 4B3FX 1COWA 2VF8A 2FNAA 4RCZA 2ZYUX 1CF4A 2ZETA 3AVOA 3DM5A 4CEJA 3R7WB 2O8BB 1EK0A 2RGEA 4G5RA 1I2DA 2O8EA 1TU3A 3Q7PA 1H8HA 3I61A 2KSQA 3NXSA 5CLLA 3X1DA 4YMTA 5CITA 2DFLA 4LUCA 4Q1FA 3CNLA 1OH5A 4C7OB 4JLDA 4B6EA 1SXJA 2JDIA 1W36D 1H8ED 5E3HA 4U7DA 2XGJA 1U2RA 2CVHA 4XWAA 3U2QA 1R8QA 3IIKA 4JLVA 2AR7A 4V0ME 5BYJA 5E95A 1W0KA 1ZM9A 2FPKA 2V6IA 2VQSA 3EPJA 2YV5A 2PZEA 5HPYB 2WICA 2EFGA 4DLXA 2LCFA 2AKAB 4GMXA 1DO0A 4L4UA 4B3BA 1NNEA 1F3OA 3N2EA 3IHWA 3BFKA 3LQRA 3TVTA 2Z5FA 1SXJC 4WZBE 4M1YA 4IOKA 3TAHA 3V4RA 2IL1A 3EC1A 5B64A 3KQHA 4TQUS 1N5LA 1OF1A 2O0KA 1E0JA 1NLZA 2G83A 2ZQ5A 3A4NA 3UMFA 3HU1A 3QBTA 1R0XA 3WBJA 1NG9A 2GRJA 2CHVA 4K81B 3TUZC 3RDPA 3JVVA 2P5SA 4UKDA 1XPRA 2ZYVX 2A2ZA 3UK6A 3ZVLA 5KTYA 3LH5A 4CVNA 2QE7D 4PZZA 4R71A 2V7QA 3DEFA 1S9HA 4M9XA 4B76A 1KI3A 1XRJA 2A5FA 2FFBA 3NH6A 4TLBA 4XVQA 2VP9A 1NN0A 1NY5A 3GLHE 1NJFA 2VSXA 2J46A 4KV9A 4LY6A 1KGDA 1VCMA 5K8TA 2JLUA 3K70B 3R8FA 4JSYA 5FUVA 5GJCA 3PXGA 4TLAA 2QPTA 3LRPA 5FBQB 3IIJA 1ZUNB 3BK7A 4JLKA 1I2MA 3NIBA 5L3SB 3KJHA 5DLQC 3FMOB 1XFAA 3KKOA 1CU1A 4DT1A 3GJ3A 1YZTA 4P31A 5HCIA 5JSZA 5L3QA 2G0NA 3FHTA 1AZSC 4CW7A 3SQWA 1FX0A 4LV8B 3IILA 4MRNA 3JZAA 1XMSA 2QSZA 1WBBA 2ZI4A 2IYRA 1RPZA 3VR2A 3VU9B 4POAA 1C1YA 1CJKC 3MD0A 3AP3A 1IHUA 5EXTA 3B9QA 1GWNA 3THYA 5EXSA 4DLSA 2BM1A 3IHLA 5E7JA 4EPXA 2ZRPA 1NIJA 1XZPA 3IGFA 3QENA 5SZJA 3HU3A 4LJ7A 2O5VA 1G3IA 2G6BA 1UBFA 1XD2A 3KXKA 5JEEA 2F1HA 2RMKA 3HR7A 3MMPA 3SJBA 2IK8A 3DMNA 3S1AA 5CK5A 5JEDA 2D2EA 4JMPA 3E1SA 1M74A 1SKYB 2IYXA 3W34A 3FPAA 3ADKA 4WXRA 5C4GB 3U7FB 3BH6A 2GXQA 1KY3A 2ZU0C 3EXAA 4EIWA 1ZC3A 3UMRA 3C7KA 2RGBA 3U61B 4ON9A 4OQFA 2HYIC 1F2TA 1ZINA 4G5OA 2UZIR 4A2PA 1LF0A 4WIAA 1KI6B 3NDBB 1XZQA 3RRMA 4D25A 4RZXA 1FW6A 1W36B 1NVUQ 2DYKA 1XJCA 3PUXA 3AVWA 2MSEB 3UWOA 1J7KA 4NYMQ 3AQ4A 3WY9A 2JJ2D 1YZQA 1SVWA 4KJZA 3NVAA 4LYHA 1BOFA 1BYIA 2WWXA 2OLKA 4OL0A 1QHNA 2R2AA 3FWYA 1TF5A 2ODEA 1HURA 3CR7A 2ZI6A 2WSMA 3NKVA 2ZI9A 5JRZA 1L2TA 3QI2A 3QF4B 4DLTA 3H84A 4JLOA 1KSGA 5KYKA 2PX3A 4I1UA 4QHTA 1NIPA 4CEIA 1P6XA 3VMFA 1HYQA 2C5LA 2JA1A 3VR3A 3GLGE 2VLIA 3IUYA 1PZNA 1GFIA 1FNMA 3KUCA 4FI3C 4DCNA 5G53C 4LOAA 4P33A 4UJ5A 1W47A 2I1QA 5HZHA 3UPUA 2Z6VA 2VA8A 4RSGA 4GOXA 2GXUA 3NBFA 1TEVA 4IVQA 5FOVA 4AG5A 4DEYA 2WMNB 3GJ4A 1XXHA 1NN5A 1Z28A 2LWIA 2YWGA 3D31A 2WWGA 3THXA 3RYTC 2RGXA 3BIFA 5DN6D 4DUGA 4N3NA 4US0R 1KDOA 1GKYA 3K09A 4F93B 5KHOC 1WE2A 1U98A 3L82B 4WXPA 3IQXA 3SS8A 2QBYA 4M1WA 1MO3A 3T61A 2C99A 3QEOA 4G5SA 4HDCA 1OH8A 5FPYA 3IEVA 1LVGA 1EFUA 1FPMA 5C1BA 3LBIA 1CR2A 3WMGA 3L43A 4L5BA 4IDHA 1CXZA 1UKYA 1UFQA 3BH0A 4EJSB 4JLNA 3RS3A 1TQDA 2V3CC 4U5XA 5JHGB 2XXAB 5IDVA 4GOJA 4LBWA 2CJWB 1DVRA 2VHTA 5LPNA 2JIZD 2ZI5A 3K09C 4B3XA 5DSZA 1W4BA 1WP9A 1E2LA 4JBXA 4JJZA 5M04A 1LW7A 2DY1A 2CL0X 5FOTA 2GJKA 5G40A 4ACBA 3LVRE 4B3DA 1M8PA 2ZRKA 3DPUA 4C0KA 4I1VA 3EX7C 4MA4A 3NHBA 2CL6X 3N70A 3L0PA 1AN0A 4PANA 3RS2A 2OV2A 4HSEA 2ZRLA 3FMIA 5IK2A 5FTLA 4C7OA 1YKSA 2VO1A 1VG9B 2RGNA 3PIRA 3QKSB 3B7GA 4D81A 4D0GA 4YONB 4JBWA 2PJZA 3PR1A 1E9FA 2WJHA 4S2EA 4JKYA 3DVLA 2GK7A 2BKUA 3OAAD 3QVVA 5ANRB 4TYWA 4XD7D 1KOFA 4HB4A 3TRFA 4Q03A 5JI3E 4FCTA 2PCJA 3B85A 1U8ZA 3PUWA 4IXMA 3M0EA 1O3YA 3P4XA 3AB3A 5G3YA 1ETUA 2OCYC 2H17A 2R62A 4KO8A 4O3MA 2H57A 3QEJA 4BLRA 1G41A 5DO9A 4ZKDA 3NG1A 2UKDA 2D2FA 1JR3A 5DYIA 5ELXA 2YZ2A 3FKQA 2QMOA 5EE1A 4ACAA 1WBDA 621PA 3SHWA 3O8CA 1ZAKA 3EWAA 4QGFA 1VCNA 4QL3A 2ZJ5A 1P2SA 3BB4A 1UKZA 4NHOA 1II8A 4E03A 3PEYA 4OQMA 4V03A 2H7VA 2W2TA 4RZ3A 5EP1A 3U3OA 4DLRA 4B2LA 2OE2A 5J4LA 3KXIA 2OCPA 3TGPA 1U9IA 4YXWD 1G6OA 3GPLA 1COWD 1Q1ZA 5EP4A 2MMGA 2IF2A 5EZ6B 2ZM5A 5KSOA 1E0AA 4Q1BA 3GJ0A 3TAUA 2VHCA 821PA 3CR8A 3UG7A 2SHKA 1T0HB 3PQCA 1FUUA 2AX4A 3FMPB 1Z47A 2B8WA 3MFYA 3H1TA 1DAFA 3PEVA 1ZU4A 2O8FB 2JDID 1ZW6A 2QL6A 4A36A 2RGGA 2D06A 4B3CA 1Z0DA 4DDTA 3K70C 1G3RA 2ZSEA 3H86A 4LPSA 1N6HA 2ZREA 1CBUA 2XB4A 3EZ9A 3GLFE 4PPGA 4HDQB 1F6BA 3LW7A 4P4UA 3A1WA 2XZOA 1M1YE 2EFEB 1F2UB 2ORIA 2VTKA 4Q4JA 2DB3A 1AZTA 5JFGA 4RD6A 2Q3FA 1BO6A 2A30A 2VP4A 2GCPA 3JZMA 3AUYA 3VKWA 1AS3A 2DHRA 4WW0A 5FH9A 3HYRA 1M7BA 4DLWA 5HR5A 3BB1A 3FGNA 1E69A 1NSTA 2GWHA 3CWZA 4LHXA 2FOLA 5C2JB 1SVMA 2ERYA 2ZR0A 2D62A 3CF0A 3MLEA 2V7QD 2NTYC 2ODBA 1OW3B 1IN7A 3BFXA 3VR6A 1Z2CA 1XX6A 3SYNA 4C0HA 4DEXA 1QDEA 4WZAE 1R7RA 4M0LA 1XMJA 2QPAA 1GL9B 1KI6A 1N6RA 1Z06A 4Q7MB 1XWIA 3TQFA 2GKSA 4BZPA 1JR6A 3W3AA 3AVYA 3TE6A 5H70A 3FYHA 2W6JA 2XJ9A 3LV8A 4LRWA 3CWQA 2ERXA 2HCBA 2WVJA 1X1SA 2OSBA 3OF5A 1LY1A 2FFQA 1RYHA 2VSFA 4LK2A 5J4HA 3CPJB 4D4MA 1DPFA 2J3EA 1IJFA 1T3SA 2WWFA 3RWOA 2QPOA 3LA6A 1W36C 4ZI3A 1JXOA 4PTLA 5C46F 1G19A 1ZUIA 4DIEA 3K0AB 3V00A 1E0SA 2ONJA 4HAVA 1JECA 4A6PA 1RC8A 4LJAA 2ZJOA 4FINA 1KNXA 4YDHB 3ZQ6A 1P9WA 4IEIA 2YWHA 4AKIA 3CX6A 1F5NA 3SE0A 4K46A 1XCMA 3DHWC 1YHNA 4LV6A 4GL2A 4WOPA 1MR3F 3ND8A 5FUWA 1AKEA 4BFZA 2XTMA 3K9GA 4EAQA 2GCOA 3ADBA 1R4AA 2AL7A 5DI3A 5FR2A 2CCGA 4OBEA 1GRNA 2PEYA 4TT3A 4IW3B 2QTHA 1CJVC 1L7VC 2GEDA 3PUVA 4GOKA 2A5JA 3E2IA 5H8WA 1ZM3A 4EJSA 1NLFA 5FPKA 1TF7A 3UMSA 3I72A 1KO5A 4N1AA 1QHHA 4R2IA 5H1YA 3L0SA 2O8EB 3LY5A 2C95A 4GSYA 3I4LA 1QZXA 4MKHA 2CJWA 4Q47A 2P0EA 3PG5A 2EYUA 1ZYUA 3RSLA 2JLXA 4A15A 2IS4A 4A6XA 5L3VA 1A82A 4TTPA 4W9MC 4B47A 1E1QD 2QQEA 4JLBA 2OAQ1 4B6FA 1KIMA 1JBKA 3LVQE 1XU4A 1SKYE 2ZU6A 4MH0R 5GVSA 3W5IA 4HAXA 4M9ZA 1XTIA 1MT0A 1Z07A 4RZ2A 3QKSA 3W6NA 3CRQA 2AK2A 2ASEA 3C14C 1DG3A 4W5HA 1CR4A 3KTAA 3P1JA 1Z8FA 2WJJA 2NZ8A 3VR5A 5GADl 1K5DA 2BMDA 2H5EA 5JS7A 2FA9A 1JAHA 4ESHA 3U3RA 4ZIRA 1N0VC 4EFNA 5KNDA 1WCV1 1E2NA 3SYLA 4JLPA 5L3RA 3RS4A 4Z1MD 4JL8A 1RKBA 1QVAA 2CMKA 4FMBB 4LCBA 2IYYA 2ATVA 4TZ0A 2ZITA 3KB2A 4CEHA 4IKEA 3QVUA 4PPQA 3THOA 3L8ZA 1HT1E 2W58A 3G82C 5KDOA 1TEXA 3R9WA 5CM9C 1US8B 2FSGA 1P5ZB 3I8XA 1Z29A 4ZDWA 1GNPA 1E99A 1GAJA 2JCSA 4DT1B 1EFRD 2WWIA 3BFVA 2CE7A 3D8BA 5L3QB 1U99A 1LTQA 1FX0B 1ZU5A 2W2VA 4GMDA 3GLIE 3AUXA 1E79A 5TMPA 2HJGA 2XEXA 1VMAA 1MO4A 2Q9CA 2O0HA 2WBLC 2RH5A 4MGKR 1M2OB 4MGIR 2BMEA 4PHFA 1OB2A 3Q5EA 4EPTA 5IK2D 2O8FA 4CEJB 5AJXA 1P7CA 2R44A 1ONBA 3THYB 3KKQA 1KDRA 5JBQA 2QMUA 1D8TA 4TMWA 4V0LA 1ZNZA 4D80A 4PO8A 4PHTA 3F8TA 5EXXA 1VYUA 1AIPA 1Z0KA 4YMSA 3B1XA 3S1AB 3AVPA 5LB2A 1Q21A 3QXXA 3VAAA 2TMKA 2YWFA 1C4OA 3KKPA 4C0SA 4AIIA 3IO5A 3RHFA 2VEDA 2J87A 2X2FA 5DHAA 4JL5A 2ZRGA 3K9NA 4G5QA 4E09A 1ZD1A 3VQTA 1QRAA 4BLPA 1JR3D 1YZKA 1F2TB 2YINC 5EE3A 1LFDB 2QZ4A 4M21A 2QENA 1Q1BA 4UXHA 4HB0A 3RS0A 4X8MA 3QPVA 3QY0A 4EPVA 1JJVA 1SHZA 4I81A 4AD8A 1JJ7A 3ZLJA 2G77B 1X6VA 1G5TA 3CUEF 1VHLA 2F1RA 5LB4A 1XD9A 4BE7B 4FWIB 3WRYC 4EFMA 221PA 1UF9A 1HUQA 1FQKA 4V0MA 3Q85A 4URWR 3EIHA 1HT2E 4M1OA 1OYWA 2X1VA 1EFTA 3O47A 2V1UA 3Q3JB 2ZSAA 1DAIA 4CEIB 3AF2A 2QUZA 4TL7A 4CRWB 3W90A 2IWHA 3CW2A 2V9PA 3PCRB 2YWEA 4ILEA 5FTNA 2DR3A 3AVQA 1XCGB 1X86B 4UNNA 3KX2A 1DARA 3M1IA 4DWJA 3U6BA 4TSFA 1N6OA 1JB1A 2BEJA 4UQOA 1XXHB 3OFNA 4LC0A 3THXB 1G17A 3CIOA 4LJ6A 5DIFA 1HEIA 4KI0A 3PEWA 3B1ZA 2X2EA 2RHMA 3ZD7A 5DI9A 4TL9A 2IHBA 4EFLA 3B13B 4XOIA 3BD9A 1DS6A 1II9A 2CBZA 3BOSA 3NH9A 2JLYA 2EFHB 2YKGA 2WJIA 2XOKA 4M1MA 2F1JA 4PAOA 1N6PA 1P2VA 4URZR 4V0OA 1JAIA 3QKUA 3FHCB 2GVZC 3AP1A 1HQYE 4LDJA 1II0A 4M4SA 5JWRA 3AF4A 4HLUC 3ZQJA 4LSGA 4YXWA 4TYNA 3LWNA 1Z6XA 4XVRA 1U94A 3D6TB 2ZS7A 1G18A 4HZUA 2HT6A 1RFLA 3K0CA 2R6FA 2ORWA 1TQ4A 1U0LA 4Q5IA 2WOJA 1G5PA 3QSYA 2OZEA 3OIUA 1HE8B 1PLJA 5A4JA 1TPZA 1E2IA 2IWRA 2W6JD 2BHRA 1E9CA 4DDUA 5A5GA 4ZDJA 4JVSB 2ZIAA 4QFMA 1BYUA 2GXAA 4HEJA 2IYLD 2NPIA 2ZRAA 4BFWA 3BC1A 3IBYA 1VCOA 4BEBA 1GSIA 4KHZA 1TMKA 3WYFA 3TSWA 4KITB 4TZ6A 4DDVA 5AUPB 1P2UA 5CJ2A 1S3SA 2PH1A 3AF0A 4RD1A 2MSDB 4RZUA 3VNUA 1VG8A 4IJMA 3QXCA 4TTRA 2WAYA 2W6IA 4N0DA 1D6JA 3AGQA 3LD9A 4QNRA 3SEAA 4IEEA 3VR4A 1QG2A 3BE4A 3C41J 3NC0C 2C77A 3F3YA 5EE9A 4B2PA 2ZRJA 5FOSA 5DGXA 2ZE7A 1KSHA 1B0UA 1II8B 1ZC4A 4H9GA 4MYTA 3EZ6A 1VTKA 4LHZA 4R2HA 1G4UR 2Q21A 2ZANA 2IX3A 1RRCA 1XJ0A 4A92A 3T15A 4TT3D 5JMTA 2WAXA 3WHKA 1KI4A 5FUXA 3SBDA 5FPHA 1IN6A 1VYVA 1US8A 4A8JB 5L8VA 1QHYA 5JWHA 1GRRA 1OXVA 1XBTA 3C5HA 4URYR 1DO2A 1B23P 3WBKA 3B5JA 4JS0A 4JLMA 3T35A 3CRMA 4LV5B 1NVXQ 1OYYA 4MKGA 4OHYA 1FTNA 4GT1A 4M9QA 1XTJA 3GFOA 4KSBA 1SVIA 2EFCB 2EU8A 2R6CA 3TUJC 1G7RA 4HI0E 2FV8A 3VX4A 3X1XA 3QUSA 1W2HA 5FOWA 2OM2A 3B82A 4F4JA 4X8OA 1W4AA 1IAQA 5KDLA 2PCLA 3HDTA 2CLDX 1E4YA 2YVUA 4Q4JB 5GJWC 2FJUA 2UVQA 2VRWA 3GJXC 4LJYA 4AYTA 3LX8A 5KU1A 3SDZA 1SXJE 1AQYA 3K0EA 1ANKA 2QAGA 1PV4A 4ARZB 1KNQA 4JSTA 4WVFA 3JVUA 4JBYA 4JJKA 3A1SA 2JATA 5CK4A 1UADA 2E87A 5TY0A 2P3SA 2WWHA 2Z83A 2IYQA 1Q3TA 1FTSA 2C9OA 1R8SA 2CCKA 1E2KA 4R7ZA 3FOZA 5B30A 5AK0A 4CT4B 4ZDIA 3FFBA 2GEUA 1VPLA 3FE2A 4NU0A 4UNSA 3AKCA 2BBOA 1G4AE 2W00A 3QJYA 3IPXA 2OUKA 1RJ9A 1IN4A 1CJUC 2EWVA 1E1QA 2QP3A 2YOGA 3E70C 3SBEA 1GVNB 2IYUA 1SULA 4KFSA 1OIVA 2QP4A 3KXLA 1E9AA 1W0JD 3UIEA 4PQFA 3L0OA 1KI2A 2JLQA 3ICEA 1E2QA 1QHGA 2PT7A 2FX3A 1XEFA 2OFXA 4RD2A 2YC2C 1R0ZA 4FMDF 4NDZA 4QG7A 4C3ZA 2PZGA 3VX3A 1E79D 1NMYA 2EWWA 3KB1A 4AYXA 1DTSA 1HE1C 1G8HA 3NBXX 4EQ6A 1V5WA 1Z6AA 3AP2A 1J99A 4O2LA 3NC1C 4YLGA 2J0QA 3C16C 4Q7JB 4XSGA 3QKRA 3TLXA 4HUTA 5CDFE 4NYIR 5SZIA 1MABA 4V02A 1KSFX 3HJNA 3OIWA 2GJ9A 3LQQA 1DE0A 3SI7A 4Z1MA 1YZGA 3EZ2A 5CB8A 3AVXA 2HV8A 2BBSA 3RC8A 5D3MA 5JECA 1U81A 1IY1A 4DVGA 2GCOB 3KJGA 5DI3B 3IQWA 1FFHA 4AURA 4MRRA 2RGAA 2JLSA 3P4YA 4HZIA 2J7KA 4M1TA 3ASZA 4Q01A 2PLRA 2NO9A 3MSXA 5AR1A 1E98A 1XCPA 5AJYA 3R20A 3C4JA 1KK1A 1QHHB 4I1OA 3O8BA 2GDJA 3IDQA 4TTQA 1UAAA 5AJVB 2PZFA 1YZUA 2QMEA 3EIEA 2D7DA 1G6HA 4O25A 5JJKA 3RSOA 1G8FA 2QG6A 1EFRA 4G5GA 2REXB 1A2BA 2F1IA 4PR0A 4Q4LA 2W83A 1KO4A 2BKEA 1K6MA 4DSUA 1AKYA 2KJQA 2ZR9A 1T5LA 4GFDA 4DBLC 3PEUA 4X8HA 3AM1A 3BH7A 4LBYA 1FP6A 3QF7A 2BBWA 2NOAA 1M6NA 4BRUA 2WMOB 4AKHA 2BWJA 3THWA 3MGCA 1L4YA 5C18A 1KKMA 2C9YA 4W5JA 4G0NA 1IOZA 4TLCA 5J4YA 3GFTA 2FF7A 2EQBA 4AK9A 4DSNA 2BCGY 1GKUB 1E2HA 2VHUA 3DKVA 5HKKD 3A36A 2BV3A 4Q4HA 4A82A 1AS2A 3FDIA 3KTAB 4DJTA 3AH8A 4P32A 4LJ9A 1YR7A 3EZ7A 5HZKA 1M7GA 3TBKA 3WP0A 3FVQA 2H16A 1HH4A 1ZNWA 2MMCA 3KQUA 3U7GA 2HT1A 2WWYA 3B2EA 4GBMA 1KK0A 4OK5A 4TSFD 3LBHA 1IBRA 2XNDA 4ZIRB 3BS4A 3OFND 2RGNC 2WJVA 2AXNA 1TUEA 2PBRA 1F60A 4QNMA 2GEVA 1ZP6A 3O8DA 3QPWA 3ZIAA 4H1UA 4US1R 4RVCA 3IEUA 3WNCA 1GZSA 2D4HA 1KMHA 2GBLA 1Q1EA 1ODFA 1S2MA 2V8OA 3TNFA 5KOYA 3EPLA 2ZRFA 4Q19A 1UM8A 4KFTA 2GTPA 2XOKD 2ZSDA 1K8RA 4PXAA 3QG1A 1T8UA 3CX8A 4NYJQ 5FBLB 2QTVB 1DADA 2Z43A 5AJWA 2QSYA 2JLWA 1Z3IX 2O52A 3M4YA 1XXHE 5JJLA 1NMZA 4NKRA 1P72A 4HLCA 2A3RA 4M2LA 4L9WA 4A0HA 1S8FA 1TQ2A 1IY2A 2OBNA 4A8JA 3EPKA 2H8KA 3REFA 1W48A 3EA0A 2JJ8A 1P4SA 4ZCLA 1OIXA 5FI0B 1G8YA 1MOZA 3ZZ0A 2RAPA 2QNRA 2CVFA 2IYVA 4H1VA 3X1WA 1T6NA 2KBFA 2LKDA 1U9IC 1GUAA 3EZFA 2Q9AA 3K1JA 2CNWA 5GVRA 1DG1G 4NCKA 4C0LA 3R9XA 1I4TD 3K9HA 3B8HA 2FSFA 3PUYA 4CDGA 4A8JC 1XP8A 2AD1A 2WPDA 5E4FA 2Y8EA 5FFMA 1W7AA 2QRNA 1G16A 2REOA 1ZD8A 2KE5A 4D82A 4US2R 2WKQA 2R9VA 1TUIA 4ERNA 2FU5C 4PX9A 4QKQA 2NMVA 1RRGA 2QN6A 1UKVY 4Q21A 2W6ID 4ARZA 2QGZA 2XSZA 2ZJAA 4YC7A 4WAUA 1KI9A 4C0BA 3OEHA 4OI1A 3PJRA 1TL7C 4O2RA 1G20E 4GRAA 5BW8A 2ORVA 4YMWA 4QRHA 2QP9X 5F3WB 2QM7A 4MUBA 2J45A 3H2YA 2C9CA 4CZ2A 4KVAA 2W0SA 1N0UA 4MKFA 2P65A 2CK3A 4TMTA 5G41A 4ABYA 2OCBA 3CRVA 4LJ4A 3RLFA 1E0KA 1MO6A 2P5TB 2ZRMA 4DSTA 2NG1A 4JVNA 2XB2A 4FWTA 1ZIPA 1A1VA 3ASYA 1OFTA 3A58B 1QF9A 1EESA 5LD2B 3ADCA 1NKSA 2BVNA 1RRFA 1W1WA 1OFIA 1KAOA 1KK3A 2ZJ8A 2ECKA 3IBGA 4MYHA 1P3JA 1NBMA 1GIAA 4A2QA 5JCZA 1PUJA 2J59A 1UDXA 1OFUX 3HU2A 1XB2A 1U8AA 4IVPA 1OHHD 2BCJQ 2F9MA 2ZSFA 4HATA 3LLMA 5F2EA 4NPHA 3OIYA 4C4PA 5J5CA 1TTTA 1K5GA 4PC2A 1IXRC 3VFDA 3SJZA 1G8GA 3LAWA 2JLZA 1KMQA 4D2IA 2HF9A 4B75A 3BJIC 2JGNA 4Q9LA 2ZYWX 4NCNA 1CS4C 5CM8B 2FFAA 1XTKA 3MG9A 1LB1B 2BM0A 3F0TA 5J40A 3EASA 4NYMR 2JEOA 1NI3A 2IHYA 3KDSE 3FMFA 1P75A 2RGCA 5K8IA 1E2DA 1QBKC 3KFVA 2B92A 4JLAA 4G01B 5BN5A 1WMSA 2IEZA 3QXHA 3X2SA 1FQJA 1R6BX 2J0VA 4OK3A 3GCGA 1OXTA 4LX0A 1Y3AA 2FMXA 5KNBA 3TVDA 2N46A 1D5CA 3WHLA 4P4TA 4M1KA 1W4RA 3N5CA 3U4QA 2NO6A 2RB4A 2ZJ2A 3A4MA 4OHZA 2J0SA 3SYKA 3U3JA 4HZUB 3MWLA 3ZZUA 3LXXA 3B1VA 1N0WA 4P0TA 1Z63A 1E2MA 1QHSA 1RVDA 1WRBA 3KKNA 4URVR 3CRRA 1IONA 4IFEA 3CZQA 4OI2A 5P21A 3L2OB 4CGZA 4MGYR 4HYYA 4QHYA 2FGJA 5TB5A 1Z22A 3LW8A 4LYFA 4NE2A 2CLCX 4QBFA 4TMXA 4EJSC 2CDNA 4BFTA 2IYSA 1LNZA 4QJ3A 1ESNA 4GP6A 2P2LA 1L4UA 1P73A 2ZI7A 4IOLA 1IM2A 1JEDA 4YQFA 5F9FA 3WYGA 3DM9B 2ZAMA 4XH9B 2I1VB 4B33A 2XX3A 2ZRNA 5EUMA 2JAQA 2H1LA 2V1XA 2ZPTX 1KJZA 3P32A 1A4RA 5C4MA 3VHXA 2F43A 3REGA 2FFHA 1N6KA 4UNPA 5B2ZA 1DAKA 2RHDA 5TVKA 4QC2A 5KSZA 1P2TA 3PFIA 2DFTA 1FMLA 1DOAA 1NSFA 4B32A 2BIFA 2EYQA 4BZXA 5JWOA 2XZLA 4KFUA 4DB2A 3OHMA 2IS2A 1EWRA 2GZHA 4Q00A 2WWWA 3W3ZB 1KHTA 3UATA 2J5XA 1MRSA 4K8OA 4C2TA 2VP0A 4HAUA 3SFVA 3MJHA 5EE0A 1Z0AA 3TH5A 4IDNA 4RJLA 1NKTA 1XEXB 1JXMA 1G21E 1KI8A 1Z6GA 3VHLB 3LNCA 5HE9A 3U44A 1W0JA 3FFAA 1G5RA 1PLLA 1R5OA 1NN3A 2G1JA 1XJQA 2HXSA 2IS6A 1D9XA 1EX7A 3I32A 1BS1A 4DB4A 3M6AA 1W44A 3CPEA 1TQ6A 2X77A 4QBGB 1G7CA 1KSJA 1MRNA 3U60B 4QHSA 4QGAA 3B60A 1R5NA 3SNHA 1CKEA 3BAFA 3U7HB 2C03A 3MWYW 4FMCF 1MO5A 2IBMA 4CIDA
chains in the Genus database with same CATH superfamily
1NOIA 3E9ZA 5BUCA 2IQIA 3SR0A 1X77A 3QPUA 4AZTA 4IDQA 2WSYB 3DV2A 1OE0A 4RA9A 2D4AA 4OCZA 2OGSA 4FFOA 4LCJA 2D7CA 3WIDA 3TSZA 4IBOA 4JT2A 4M9RA 5F5NA 1J39A 4YV7A 5BNWA 5CEEA 1DINA 2QAGB 3TZHA 4TVSA 1XC7A 3STWA 1MGOA 3WL8A 1LRKA 4B83A 4IZHA 2ZK7A 4QU0A 4LQDA 5BOVA 3FM9A 4DJJA 3EPPA 2OHFA 2RGRA 3GFFA 1KMIY 1RI5A 3WYAA 4NP6A 5EZSA 1JDBB 5CAEB 2GZDA 3JR3A 4L4SA 5DYGA 4DZZA 3IULA 1AGRA 3ROZA 3PICA 1C9DB 2YC4C 1ZW1A 3KOZA 2O2EA 2V55B 1UK7A 5JDIA 3TLZA 4Q05A 4UAVA 1AX9A 5E8JA 5CVDA 5ADVA 4XTRA 4Q4AA 1RJ9B 5L45A 1KZ7B 3A3PA 1A1SA 5DLDA 4YEDA 3HVRA 2LZ0A 3SJAA 2C4WA 4BJ3A 2GJSA 5I7WA 3B20A 3CNOA 4U63A 1Q1NA 3QXJA 2JI7A 2IXGA 5SZKB 1F0NA 1KBZA 1DT3A 3T12A 4D4JA 1I3CA 4B4UA 2EJTA 1D1TA 3DDCA 1BZYA 2P7IA 1X8JA 4OGGA 2F3QA 4NCIA 2I5PO 4PGAA 2IITA 1JLMA 1SVKA 4JQOA 2Q6TA 2DT5A 1UQUA 2UZ1B 4Z51A 1SZJG 2FWNA 5HKKA 3K9WA 3STUA 1ZMXA 2I78A 3ORRA 3AOEC 4P7KA 1JH9A 4EQ6B 4JEHA 1FDIA 5JPCA 1DJNA 1K4YA 1SO8A 3T1QA 3EK2A 2VXOA 3ZZTA 1LLDA 2RB5A 3HYSA 3E3AA 3JARA 3BHJA 1HKHA 1EX1A 1NBIA 1YWGO 3QKRB 3ZJYA 4B17A 3I62A 4OB6A 2XMRA 3RGWS 4HAYA 1I14A 5JIBA 2JGRA 3EIWA 4E14A 1UBSB 3RC1A 4G0WA 4P3PA 3GFRA 4MB0A 2WM9B 3TOXA 2GYWA 2I65A 2QTCA 4E07A 2OK8A 2IODA 3PHCA 3Q3CA 2WPDD 2HGZA 4ZARA 2XTNA 5DWQA 3DOOA 3INYA 1SA0B 1QS0A 3I2GA 5ECYA 1PR0A 3BGWA 3G0BA 2C94A 2XCIA 3ABOB 3LUDA 3QU5A 5C37A 1BMQA 2XTAA 4K9KA 4MYSA 2EQAA 1IXZA 4B2YA 3JRXA 1HE2A 4LRQA 1J2JA 5IJ9B 2KBEA 3INGA 3E58A 1TADA 2QGNA 2XSZD 5E9WA 3V8PA 5A5DA 3GGSA 1MPXA 3E53A 3SIXA 1C9KA 4HEA1 1V11A 4X95A 1I7NA 2A94A 2ZZKA 2D5CA 1AY0A 3FLEA 4X0EA 1OH6A 4RFSA 1TJ3A 1EX6A 1G7SA 3GMTA 3JWPA 3O8QA 3Q72A 3EDYA 4RD0A 5TC4A 1JU4A 4MEBA 4BNKA 5KSYA 4K9RA 1ZBDA 1RW4A 1LDNA 1SM4A 4IPTA 4UDNA 2VQFB 1VYTA 5B4TA 4F4CA 1B93A 1ZXXA 3AM4A 1DAEA 1WZUA 1UKEA 3B3QA 2B94A 2RJ3A 3SC4A 3ZV3A 3BA1A 1A5SB 5JSFA 1S2LA 3CMMA 4GC5A 2Q99A 4KE9A 4N82A 4QM7A 4HTFA 2VHVA 3KYJB 1E96A 2KM1A 3HBNA 3MWDB 2H00A 1AUVA 2VT7A 4FHZA 1AQUA 1J90A 2XT0A 3WG9A 4ZJZA 4EB6A 2RK6A 1GG5A 4RDHA 1W59A 4YCNA 4G81A 5B55A 3TEMA 2M1ZA 4PLTA 2FEPA 1I3LA 5JCPA 1G1MA 2R6AA 1M34B 4LZPA 4GGPA 3F7MA 4B3JA 3UWMA 2DJ5A 2RCYA 3OMLA 4R9UC 1T6XA 1XMPA 1AJEA 1NR5A 2WR8A 2XXJA 5GIOE 1Y9EA 3O3OB 5TGZA 4BWGA 5JQGA 2C5EA 4HPJB 2BTQB 3BD7A 4DA6A 4ZHQF 3DTVB 3B2QA 5F2KA 3GFPA 4ARUA 1FUEA 2AB0A 1TMOA 2AN9A 2PAAA 3FSJX 3L7NA 3LX6A 3HEBA 4KLAA 3WWOA 4C06A 2QLFA 4QYXA 1RPTA 1I9GA 4AZ0A 1Q83A 2XGOA 4P4SA 1XTSA 5NULA 5MN4A 1MC8A 1KKLA 4FYWA 4OYHA 4BKMA 1IBSA 2W0MA 3C7TA 5ERGB 4BWYA 1RM3A 5BT8A 5CNIA 4RJKA 2X23A 1I2AA 1L5WA 3DPSA 3PU6A 1TX4B 5D01A 4IIJF 4QPDA 4TQAA 2C54A 2B7LA 2HN9A 4U7GA 3JQDA 3N86A 4FW8A 1HDXA 3I3SR 6YASA 2Q8PA 5J2TA 2HHAA 1SOMA 1VMIA 2H5IA 5KTOA 1P1HA 1ZD9A 1YE8A 2QQ0A 1JBQA 2IXFA 1ZXBA 1JX6A 1VMKA 1YQTA 2XYGA 2VNSA 2VBCA 3FPBA 3HP1A 5KVCA 3B78A 4G5HA 3BORA 3M89A 2IYTA 4MYUA 1I4EB 3S2YA 4KYUA 1L5HA 4D9IA 5JS2A 3T5PA 1QGUA 1AKUA 4PLHA 1QIDA 2ZIFA 1D6MA 3ZTWA 4CT0A 4Y7CA 4JELA 3WMWA 4MVJI 2VCEA 4Q1VA 3ZNOA 1XD8A 5FWYB 5JVDF 3GLGA 3L0IB 3RTAA 3TXXA 4YUWA 1T5BA 3VR1A 5HBGA 1RQGA 2ZWVA 4I99A 5IVKA 3D02A 4DZRA 4F12A 5K7SA 2CL7X 5FTKA 1GM5A 1W5TA 2P6UA 3M34A 2CJYA 5GGXA 2WWVD 1RBYA 2ZWIA 1WUIS 5CDFA 1OTYA 1HWYA 3FCYA 5CMLA 1ZCBA 4FOPA 4NCHA 4Q7QA 5I6DA 1R6UA 1RZUA 3JW8A 3UUGA 1D2GA 4AMUA 5FUYA 4EFDA 3T0FA 4II2A 3BQMB 2ZYAA 3JQAB 5JI2E 5PGMA 1TKRA 3F9IA 1UBGA 1DC4A 1TAHA 5UKDA 3JVEA 3BKXA 3OCXA 4NZNA 5TIIA 2WZBA 4LJRA 2H85A 4KGVA 3KM0A 1BQ3A 4AKEA 4IOJA 4YDSA 4Y1EA 1T26A 4MZDA 4J1QA 3MPUA 4BVJA 4XJVA 4LYEA 5E1OA 3W8RA 1PYDA 2OWDA 3EC2A 2I6XA 2NXWA 3RVSA 5MGBA 1AF7A 2VT2A 1IJEA 3WYEA 3C5CA 3EWSA 3ZWYA 2PWBA 5D51S 4W6ZA 4RTMA 5BRJA 1QIEA 3WE7A 1H42A 1T5TA 3L1HA 4C0WA 2PUAA 4XRRA 4L95C 3HMQA 2PBZA 4WH0A 2KS6A 1POWA 1VIAA 2HDNB 2MR6A 2C8VA 2YRWA 3AW9A 3ONWA 3Q9SA 1C4WA 3C4VA 2BM9A 2NYAA 3HWSA 4Q9KA 2CXUA 3AR7A 4HNVA 1ONPA 1OZ0A 3ROPA 5CFRA 3BB3A 4NC9A 4YR7A 2AFHE 1CNMA 2HA4A 1SHKA 2HSDA 4KTVE 4YV1A 2CYBA 5IXSA 3TECE 4UHDA 1LBQA 4EHIA 1R0RE 5TEVA 4CM9D 3LSTA 5B1EA 3ZHTA 5EGNA 2IELA 5FOXA 3QU9A 3WKAA 4E88A 1Z4IA 2DUUA 1QV7A 2R3SA 4H3KB 4LW8A 3SN6A 2GVDC 3TQTA 4K26A 3UK0A 4MXDA 3C48A 1JIIA 2YJ6A 4KVFA 1E62A 1D5WA 1R5BA 2LIPA 5ADHA 3DDUA 4EHAA 4IO1A 2WWTA 2KLBA 3GOQA 3K8OE 2BFDA 3TX2A 3R6GA 2BC9A 2I71A 2X76A 1E1LA 1WQ1R 4U2DA 2PL3A 2YV2A 1WDTA 1K8XB 1BH2A 4MUEA 3DNPA 4BUJA 1WUJS 4MYCA 1TM4E 1TC1A 2E82A 2ZXUA 4UASA 2BHSA 3PXUA 1BGXT 2B4AA 2GK6A 2VUIB 2XA1A 2D1QA 3M1LA 4IY1A 2IV7A 2C00A 2O7VA 2E4AA 3AHGA 5BSVA 3FDZA 1VBKA 2Z4SA 4RX1A 2GMWA 2O14A 1M2JA 5GZ1A 4BO4A 1NUAA 2AF3C 1SGWA 3KOYA 1Z83A 5ICFA 5CB6A 2R1TB 2B7BA 1GR0A 1P91A 2GAAA 1VL1A 3BRCA 3OPXA 4NESA 4WY2A 4M7RA 4CI9A 1U90A 1X7GA 4OMCA 5DWDA 1CUXA 2KI5A 4YQEA 3U9LA 1XMIA 4NZYA 1JT9A 4OXQA 2IXEA 2JHPA 4GQIA 3KJEA 2V03A 3EXHA 5TMEA 5JDCA 3U4QB 1N5IA 5AT1A 4OSOA 4P83A 2AXPA 1E6CA 3ZOKA 5FTJA 4ZI2A 4B6SA 1Q74A 1ISSA 5ENZA 3GHYA 1N57A 3DB2A 4BEJA 2EIHA 5FBHA 1SEVA 1HQKA 1TTHA 2PPVA 2WVGA 2ZE8A 1Z5UA 4DFDA 4HUQA 1J2RA 2ATXA 2FUKA 3LIPA 3B1JA 3S2UA 1KQGA 3K0SA 3JAMA 5DB4A 1YIAA 1D4FA 4CCSA 1IIRA 3WL6A 2CLOB 1WHSB 2HSJA 3FJYA 5IUNC 2NZYA 2I4RA 4B73A 2Q0HA 3DEJA 1KZGB 4N7BA 3I6IA 3O74A 5GINE 4QU9A 3CURA 1BMTA 5F9HA 2FETA 4BQPA 1EFLA 4R2XA 2IW1A 3PPWA 4AQDA 3WDKA 3L7YA 3BGOS 1CW2B 1CJCA 2UXCB 3GLFA 1OAAA 1WMAA 3F5MA 3ZYCA 1M76A 1J9GA 4PYIA 2OQRA 1PS8A 6Q21A 4HQLA 3R7WA 3VHXB 5JPDA 3BSWA 4CKZA 2H18A 2O8BA 3M33A 1WO8A 2F43B 4WBSA 5ARCA 3T3IA 4EVSA 6LDHA 4WPGA 1JEEA 1PQUA 2RGUA 4KB5A 5ELMA 5LN1A 1SOWA 2OOKA 2CMGA 2OT3B 2VDWB 1DQRA 5T64A 1Q20A 3ZDAA 4OQQA 5GGYA 2BFBA 3EA5A 2DUMA 5IAKA 3AETA 4JZKA 2Y1EA 2HCTA 1LDBA 2VDVE 2EBHX 2BELA 1Y1TA 1CFZA 5GPBA 2OZLA 3UBMA 2QT1A 2WZCA 1OLUA 4HGYA 1AMNA 1W4ZA 2R48A 3IEKA 5F98A 2IUUA 1R0LA 4PS0A 2JZCA 3EAQA 2GHIA 2C4MA 4KE7A 4N65A 4NAHA 3FWZA 4IJ6A 3HR8A 5EVCA 4UTNA 3RRJA 4LYJA 3SF8B 1U8TA 5TRTA 1TMYA 1ZD4A 4ZPJA 2GM3A 2BJWA 4PRZA 1UJBA 1T1SA 4NZ9A 4XM1A 2QM0A 1V5IA 4BUCA 3U44B 1D0IA 4YUXA 1NAIA 4K9SA 4DV4B 1V39A 4BP3A 2C1EA 3PENA 4IHQA 4MMZB 1X9IA 2C7VA 4N5IX 4XTCS 1Q0UA 4WLFA 4GWKA 3HWWA 3QPBA 2KLHA 2DTDA 2AZDA 4Y6LA 1BMFA 2GFQA 3MINB 5HF8A 4NPAA 4BNDB 3QLUA 5DBEX 3U17A 5EP2A 4GHWA 4GDFA 2OG2A 2FQYA 1XVLA 3W2IA 5T8KA 3OQNA 3SR3A 4AUNA 4KFCA 4KODA 4OHPA 1TAQA 1CPYA 4YUAA 3M2TA 2QJRA 2W11A 2QAIA 2ZE6A 1CS0A 3BRWA 4IDBA 4NFLA 2DTEA 4CKBB 1W19A 2ZXFA 4YJGA 4TLEA 2EL9A 1JV2B 2QMHA 4I3GA 3DL0A 3GJ6A 4NCXA 4G25A 2A1IA 3ZDCA 1ZK4A 4Q9DA 3TSOA 5G0UA 3RSSA 3B53X 4J2HA 2YIJA 1N5RA 4JI5B 3L6OO 1A9SA 1Z4QA 3D6VA 2YWRA 1IK6A 5HK9A 3VOAA 3OICA 4BFXA 1H8HD 1U1EA 3GEIA 2VYFA 1EGAA 4E22A 3AUSA 4IV8A 3K8QA 3PI6A 1F0KA 4J1NA 4L9SA 4X3CA 4MW9A 4UXIA 1JYEA 5AM0A 4ZWNA 4ENVA 1JB9A 4ADSG 2HUPA 2J3DA 5ALVA 2CJPA 1YFKA 2OO7A 1GJRA 2QLTA 1GCIA 5J4VA 3KT6A 5MN5A 4D9CA 2BJHA 2FQXA 4TMVA 2E4WA 1OBFO 2FRDA 1Y8RA 1W0KD 2QAJA 4GOMD 4PQRA 1DC8A 5CA0A 4C4AA 3KIPA 3BL5A 1VCIA 5AP9A 3ZNNA 4DHEA 5DM4A 4FBMA 2PS1A 2YDYA 3K0FB 4RM3A 1VE6A 4WNAA 4E5YA 3VU9A 2A78A 5CVUA 3GGJA 3PPVA 5F3DA 4ES6A 1GGJA 2FRXA 1M6YA 4HT3B 1YQWA 2FW1A 3E22A 3I45A 1IFXA 3AF5A 5BVGA 4AX4A 3IVCA 5AJTA 4GP9A 5HOEA 1GZDA 1Y9ZA 4GSLA 5KYNA 1K9SA 3M83A 2X4IA 3OE7A 5C52B 1CRQA 1SQ0A 5B1SA 3RYCA 4FXPA 3A3KA 3FOAA 5DH9A 3CEPB 5CJJA 2FY8A 3T1OA 3COSA 4C30A 3W7AA 3WMEA 1BCSB 3CZAA 1TAGA 5AIAA 3W8FA 4UU0A 1QWSA 4OATA 2OV4A 3D0OA 5DNYB 1VHTA 1XZNA 4INOA 4D7AA 3SOPA 3JALB 1CY8A 5EHQA 5HTKA 4BU0A 5IT5A 1PJ2A 1PZXA 4OJKA 5SZHB 3I5AA 5AXDA 2OXEA 1JR3E 2NU6B 2I67A 4JDUA 5HCNA 1F0YA 1VMDA 2FDRA 3X1YA 3RU9A 5DHSA 4PEVA 5DGCA 1VJCA 1M2GA 2ODWA 3I83A 1PUIA 5B57C 1E9RA 2R84A 2J1LA 2ZRQA 1L8QA 4KYIB 4ZPXA 1TKAA 1P7ZA 1QQ5A 4HB3A 3GNSA 3WQQA 4IH9A 3OE1A 1XJWA 3FZYA 1N8KA 4RKEA 4F1WA 2FW6A 4NV0A 4GEGA 4GWLA 4A6DA 4EK9A 4X45A 4EGAA 2L17A 4NJMB 4Q1AA 2I3GA 1BN6A 5K51A 3GDWA 2P0AA 4E5NA 1XDBA 4TL9A 4JA2A 3VR0A 2AZMA 4ZC1A 5JCXA 1IMOA 1ONOA 4CL3A 1DTEA 1NL3A 4UZFA 2RCNA 3USCS 3ZDQA 2HJSA 2E5LB 1X3SA 3PKIA 1ZD3A 4ITRC 5JZVA 3Q5DA 2FPOA 2JGDA 2IVFA 1DIGA 2VXCA 3T41A 6ADHA 3CM0A 5EWLB 1WDMA 1OWPA 2BFPA 3ACBA 3M5PA 4JKOA 4U2KA 3GJ5A 3L8YA 5EG5A 5F73A 5CX1A 2O8CB 2A88A 4I4TA 4D8YA 4DCSA 3PFGA 1XTQA 2QLBA 4RMIA 3AF3A 4IIDA 4CG1A 2CW5A 4PLCA 2MOKA 5AVSA 1ZUD1 3LLUA 2Y0BA 5BVHB 3G9XA 2WTUA 1LX7A 1T25A 4BMYA 2E18A 2OV1A 2R6GA 3NOXA 2ZRBA 2FPXA 2JEZA 3KJIA 3R0ZA 4HN2A 4LZZA 2OESA 4ATNA 3SS7X 4AWXA 1ZIDA 4EG3A 4QQKA 1CZUA 4C7BA 4H0CA 2YHSA 1E3WB 4KLRA 2LVBA 4PC7A 1QR6A 1U3DA 1ZK0A 2D2IA 2FW0A 3JYNA 2R1VA 3TOSA 3ZU4A 1H93A 3P97A 5K0JA 4TKLA 1Z7BA 1RMTA 3FPEA 3OJCA 4DA7A 5LMCA 3U5ZB 1PN3A 2GYVA 2VHQA 3EEIA 2KX7A 1NF3A 1RYYA 2ZT8A 1RWOA 4FGJA 4C07A 5KPDA 4BNHA 2V5AA 2EQ5A 2R6JA 1KZYC 2J9ZB 1XRSB 3MCAA 4I1SA 2Q2WA 4OM8A 3MQ4A 4RUKA 5G3ZA 4MX8A 4TMKA 1JQJC 2Y93A 2ZDGA 3MXTA 4GZ3A 3RYIA 3ZCVA 2XAUA 3FRIA 3S55A 1Y9AA 2WSSA 1PT5A 2O48X 3FUXA 1U0JA 1X38A 3HACA 2GF0A 4TRJA 1OXXK 1QLWA 1R4NB 1E4EB 4WLEA 3NU1A 4MB6A 1NXSA 1LF5A 1QZTA 3I1IA 2C8LA 4Q16A 4UXJA 4WE3A 4CM1A 1HTTA 2M32A 4FTWA 2FHPA 1I7PA 4OHUA 3VH4A 4DLUA 2VDQB 1SR8A 4LZAA 1MAVA 4JK3A 4M22A 1PJRA 1A8SA 4I0WB 1FX1A 4ESEA 3KVYA 2Z57A 1JNYA 5C3UA 5CA1F 3IAM1 5FBKA 1V7PC 5K5EA 3ETLA 1CD5A 2AE2A 3PR2B 1LPPA 4TLDA 3UB4A 3A37A 3OCVA 4QU5A 1FFCA 4LF8B 2CE2X 1ILWA 1CX9B 5CH8A 5EUQB 4X65B 1JDVA 1GOTA 1NG1A 3RFCA 3B9RA 2AKYA 1U7DA 3C70A 3PF9A 4L8LA 4PV7A 4WA8A 4ZCMA 4Q34A 1IG3A 4OBXA 2XNJA 2R2GA 3MUFA 1RBZA 1U7ZA 1TPYA 1EA5A 1PF7E 2A67A 2E6KA 2PZKA 1MCZA 2REBA 3BXZA 3MELA 4NULA 2RC5A 4P84A 4R1OA 1LWNA 4WDQA 1Y3IA 1UJ4A 2ONCA 2V6JA 5F78A 1Y34E 2A0YA 3SR4A 2G63A 4ZOQI 3FMVA 4YP7A 4HPWA 1O8BA 1P18A 3ZJVA 2VZ9A 3ZX4A 2IKSA 1JHQA 2XRYA 4XKJA 5BXQC 4LF4B 2CXSA 1YL5A 2KWIA 4GOND 1GNQA 4EI7A 3ZW7A 3VV3A 3ZH9B 3FB4A 3CYFA 3F4KA 4QBIA 3RKUA 2IHZA 3IDSA 3OOJA 2WIAA 4YWHA 3UQZA 4LZWA 3VKGA 1WU8A 4MR7A 1G5IA 4ZD6A 1NBWB 5IBCA 3LT1A 1MH9A 4I55B 4ZZIA 1E2PA 1M2KA 4KSYA 1KO8A 4RCYA 3I9V1 4LJSA 4NJOA 3HA2A 1S3GA 2B6NA 3L84A 3VZQA 1GL7A 1XQWA 3VA7A 3DKPA 1IN1A 4EKEA 4C87A 3W5VA 5KNCA 2VBFA 3CLTC 3AK4A 4UCFA 5E6SB 1ZRHA 1WTAA 2BP7B 4QPZA 4Q48A 5EUCA 1DTWB 3Q8XB 4MITA 1APBA 3CONA 1UDWA 3RJ5A 1RZRD 5GOTA 1BWQA 2NO7A 1WKVA 3CW8X 3NNNA 5DHFA 4DMMA 4NYJR 1X42A 2H63A 1M1UA 2QV7A 4IMJB 1FFSA 4Q0MA 3TXYA 3HP4A 2ETVA 2GNPA 5AVRA 2XB8A 1ZQ9A 2JFVA 1XL1A 3I3OA 4JMLA 4NVRA 4KSCA 2HZ7A 1NUHA 5AO9A 2FTKE 4YP6A 3VDNB 2R8BA 5AVQA 2Z6AA 2ZT5A 1YT5A 5A4DA 1MIOA 2ETXA 3RTGA 1QAMA 4EPYA 3ZGZA 2GKOA 3OP1A 2NVOA 2PLWA 1RKXA 2VJDA 3LPDA 8LDHA 3C6ZA 4GX5A 1TT7A 4FFWA 3IT2A 1W6UA 1A5TA 3USZA 3ZXIA 4MJ7A 4ND7A 2UYGA 1HZJA 3EE6A 3OLQA 4WKNA 3IT1A 1T8TA 3MRXA 3O9MA 3R3YA 2WKWA 4Z9XA 4QRDA 4TL8A 3FTQA 1OROA 1CR1A 1IVNA 4NFSA 3GEMA 4PFJA 1SC9A 5H68A 2R8OA 2DY0A 3RKRA 3Q7EA 3SQMA 4NL4H 4P4NA 1ILEA 3R5SA 1XNJA 2FVYA 3GBSA 4C5CA 1IQPA 5CVVA 1SUFA 3SEQA 3Q9NA 1COZA 1Q7RA 3CC8A 2CSUA 4OOEA 2P2CA 3UV6A 2XUQA 1LC0A 4E5VA 3JQQA 3ZUGA 3C3KA 4ZU3A 4QGHA 1BMFD 4MNTA 4F04A 1R0SA 5JDIC 4YMUA 1MENA 4FGZA 4BFVA 1MVNA 1XUOA 2B5VA 4F9GA 4BLSA 2X19A 4LRSB 3O4VA 4BASA 5K0FA 3CLSC 4MW2A 4NYIQ 1EDBA 2I2AA 2AKEA 1ZGJA 4YQZA 1YJCA 4TM7A 1GZHB 4MKIA 4RPIA 3H16A 3DZDA 3V5NA 1T5SA 3BRWD 4Q7KA 1GUDA 1TF2A 1KP9A 3BF7A 5FA5A 3GXBA 3QMWA 5F77A 1NYTA 3L77A 1P4AA 3MM4A 2J48A 2B69A 1KH3A 2A0WA 4DZTA 4F91B 4L07A 5TGDA 1H2RS 3ZCRA 1LU9A 1OBHA 2NU9B 2GOYA 3D4IA 2NUAA 4JQYA 5J47A 5FRDA 1RXWA 2ZUVA 3BREA 4NAUA 3IJRA 3GCXA 1ZNYA 1P4JA 3BL8A 1WJGA 4BLOA 3ZDBA 3WKCA 2AN1A 4CHGA 3ZGNA 2BMFA 1ORHA 4G8JA 5B12A 2YYZA 4XJXA 3LFTA 4LOIA 4RV9A 2QVBA 4LFBB 3CCBA 4MRSA 3QWBA 4BQOA 2Y0DA 3V6MA 5C53B 4K1XA 2C2KA 3IP5A 3BUSA 2H2AA 5CCDA 4B45A 3WNDA 1FMJA 5AW2A 5KKCA 3OIDA 2QORA 4QOSA 4BO9A 4BQEA 4LGVA 3R7SA 3NXKA 2O50A 1W8IA 3HYTA 4JEIA 4P9NA 2O4CA 4R98A 1PGNA 4HJXA 3RRNA 1GFZA 3DOHA 4TYYA 3SY8A 4M9SA 3SBOA 3SMQA 4O6VA 4DTIA 3EA4A 3A2KA 3P9ZA 2VHJA 3S2EA 3WLNA 4YAGA 5AW3A 2B8TA 1KDPA 1SIOA 4DADA 2W22A 1NJ2A 2CNOA 1FFWA 4X54A 3DG9A 4B87A 1WL8A 5EEHA 2C42A 4C3VA 3NTXA 1WB9A 4A0GA 1GGFA 1K6JA 4U4AA 2TECE 1O9BA 3HJGA 2F55A 5CLHA 1MUUA 1RZ3A 2QZZA 2BGRA 1IBMB 2XITA 4JB8A 3ROTA 4OHXA 2Q4RA 3OOEA 2VF8A 1AKWA 1EQ2A 3H5IA 5AFSA 4RCZA 1M1YB 4L08A 3OEWA 1TU3A 1GA1A 5BT9A 2EF0A 4LC9A 3I61A 4CKWB 3ZU5A 1VJGA 3LC7O 3OZIA 1TE2A 4Q1FA 1IZ0A 4XYLA 5B6JA 1GQSA 1LEHA 2DBRA 3DHYA 4F60A 4YDQA 2XGJA 2OCGA 2CVHA 4XWAA 5REQB 4L22A 1R8QA 1UPCA 3D7SA 2OGWA 3NJ4A 1BS2A 1XTBA 5E95A 2GPWA 3GXOA 2FPKA 4O1HA 4BLVA 1N7IA 2YV5A 5AW5A 3EPJA 2PZEA 4PZ9A 2ZFUA 3S2ZA 3R09A 1U2GA 2AKAB 4YBZA 3GUHA 4BGIA 2J3JA 3S6JA 1MA0A 2XRFA 3OM1A 3VO8A 4C22A 3RVMA 2PRSA 1XZFA 2HRQA 2JH8A 4TROA 1KJ9A 3S4YA 4IOKA 3TAHA 3CNHA 1G98A 3TS1A 1A0OA 2IL1A 3HB1A 5B64A 4GPBA 3GQBB 1OF1A 3QXGA 4ZTBA 3RIYA 2WFAA 2Y68A 1U0RA 3KBOA 3QBTA 1I6WA 2IYNA 3DL4A 3WL4A 4D9FA 4ARVA 4L3VA 2P5SA 5HVNA 5LVAA 3DMGA 4UKDA 3F4BA 5TE9A 1KJ8A 4B3RB 2ZYVX 4M6WB 2L69A 1C0PA 1EWKA 2BFEA 2OZVA 3HE3A 3KVOA 4NCBA 3LH5A 4CVNA 2V7QA 2XPCA 3DEFA 3LCUA 4R1TA 4B76A 7GPBA 2WG2A 4N8DA 4QFBA 3GJYA 4P93A 2FFBA 2H4FA 3GNTA 2NSHA 2VWHA 2YDXA 3PXEA 2OL4A 4XVQA 2VP9A 1NN0A 1G59A 3GLHE 2FMHA 2VSXA 1E6KA 2J46A 4S1OA 5A4KA 2OCDA 2EERA 3K70B 3EAGA 3TXAA 4P36A 1E7SA 4Y1RA 1GGHA 3LRPA 5FBQB 3M7IA 3U4AA 3IIJA 1BXRB 1QF6A 3BK7A 1I2MA 2BEWA 3KJHA 1YASA 4IV0A 5DLQC 3V4ZA 1NFRA 1XFAA 3KTOA 4DM4A 1CU1A 2WYWA 2CNLA 5G4KB 3L4JA 1Y80A 1YJBA 1YZTA 2WHPB 4PZ0A 4JP5A 5HCIA 2G0NA 2XE4A 4CW7A 5JFTA 3FHTA 1T8RA 4BTEA 1OCEA 2NPOA 3CH6A 1WUYA 3IILA 4MRNA 4ZZ0A 3D7RA 4OHMA 4R6XA 4PCUA 1GZ7A 1RPNA 2PS3A 4HH0A 1XMSA 4Z86A 2QSZA 1QPZA 1P29A 1UFRA 1N7HA 2IUYA 4G4IA 4GR4A 1VRCA 1RPZA 4ZYWA 2VJPA 3BYZA 1MJFA 3H19A 1N2SA 1YVEI 4POAA 1C1YA 1W35A 3TQIA 1IHUA 3R9KA 4YRCA 3RBVA 4O5OA 5JXGA 2BM1A 3IHLA 4EPXA 3NIWA 3NTRA 1N32B 1XZPA 4GZ5A 1OFVA 4TS3A 3HU3A 1UK8A 1VPEA 2ZB7A 2ENUA 3NJ8A 3PGMA 2G6BA 2GPAA 3A0UA 4G0ZA 4QYSA 4I9UA 5JEEA 1NTOA 4I4NA 3SKXA 1ZR4A 2C7GA 1VFNA 2Z1DA 3HR7A 4J16A 2IK8A 1XRNA 2PMWB 4HQ0A 5A7HA 3N3AC 4LDAA 5CK5A 5BW6B 5BSKA 4GVPA 1PR6A 4KDRA 1SKYB 2IYXA 1G8AA 2Q1WA 1U8XX 3FPAA 3W34A 4YRSA 1PNVA 3OZBA 1K3UB 1ZOLA 4GDMA 3PXXA 4FFVA 5ALSA 4C4ZA 1KY3A 1WP4A 3S40A 1ZC3A 1PL8A 3AV3A 3AUJB 4ZHQA 1H4SA 2YXEA 3N0RA 1Z3CA 3EN0A 1KDZA 3FVRA 4PG8A 3R44A 3DMYA 3RLIA 3U7RA 2OKGA 2ZCVA 3EMKA 4FX2A 4G5OA 2UZIR 3R0JA 4BNYA 1DMRA 4D25A 1JDTA 1SKAA 4I8IA 3E9CA 3JYQA 4RZXA 4F45A 1XJCA 5JY1A 4P7FA 1J7KA 2K87A 3QZUA 4KLCA 4J9VA 3LXMA 4QBFA 4KJZA 2KPOA 3L4KA 1UJCA 3NVAA 3PC7A 4LYHA 5FADA 2OLKA 1MG5A 4BB0A 2GZ1A 4LXIA 3CR7A 5P8WA 2IOFA 2WSMA 2FB9A 4BMZA 4BCBA 1A3CA 3U39A 5JRZA 4Q9AA 2GBFA 1KSGA 4JLOA 4E4RA 4F9TA 3HY3A 3T9EA 3CLHA 1P6XA 1WSBA 1R3UA 4J8PA 2HA7A 3VMFA 1I0IA 1LLFA 4FKMA 2VLIA 2FPIA 3IUYA 5EKXA 3RJTA 4L57A 1H0SA 1T9GS 2OXTA 1P7YA 4U6SA 4DJEC 4DCNA 3KV1A 4P33A 4RW0A 3IE1A 5BMVF 1W47A 2OBYA 1KDVA 2Z6VA 3HJBA 3NHLA 3MAJA 4GOXA 4AG5A 4IVQA 1TEVA 1BH6A 3HKBA 2VRBA 1W29A 5EIWA 3GJ4A 1XXHA 5HF5A 5SICE 2PRJA 3G8AA 3AB7A 1GTMA 1J33A 1NZFA 3FTFA 2W37A 3G13A 3L6EA 5BXYA 4FN4A 4FYIA 4G1EB 3NPMA 4US0R 1KDOA 3DWEX 4WACA 3K09A 4QDTA 1Y82A 1WE2A 3SS8A 3CUSA 3KQVA 4P54A 3EAFA 3RSQA 4GPIB 3TQQA 2DP4E 5CVEA 1H9BA 3IEVA 1DCMA 2DPGA 4H77A 5JDCC 1JG7A 5IANA 4XW2A 3EXHC 2ONZA 3AUUA 4L5BA 1CUVA 2D0IA 1RYEA 3HNOA 4JUCA 1IHOA 5JTTA 4YP0A 3BH0A 2C7QA 3CPSA 4NDAA 1G1AA 4FOSA 1YVPA 3B9BA 3CF4G 1F4PA 2XXAB 4MRMA 4JLSA 2JB9A 3I09A 5IDWA 3BJEA 3VJRA 1DVRA 4YRLA 4H7EA 5ED4A 4L4ZA 1UXIA 4CCYB 5DSZA 4DF3A 1ZHFA 5M04A 2BZGA 4KBYA 4YJFB 1LW7A 1GNTA 2W6CX 1E3DA 2GJKA 3AEUA 1FFDA 2QR5A 3QHQA 3H3JA 3LVRE 4HDKA 4N6GA 4JNCA 5DSXA 3TTVA 4R1UA 4DYDA 3TZQA 5DHQA 5BMOA 4LDNA 2QRJA 5DZSA 1KGSA 3L0PA 4PANA 1Z7YA 4RVHA 2ZRLA 4Y6QA 3DLBA 1SK9A 4H7FA 5BPFA 1YKSA 2FPGB 3IR5A 3QU2A 4BNWA 4R8RA 1RRMA 3EUWA 1P1CA 3QKSB 2FN3A 4CODB 5DRYA 4D0GA 3V2IA 4MTCA 4PSUA 4FBGA 1GT91 3GZNA 3V8MA 2QLLA 1G20A 4BLUA 1Y0BA 1E9FA 2WJHA 3ONVA 3PR1A 4S2EA 4WXYB 3F74A 1KMNA 4XCQA 4F6RB 3BD6A 3KOOA 5CLIA 2F00A 3QVVA 5AOAA 1GFWA 4HB4A 5EMLA 5JI3E 4MV9A 1ZI8A 3E5RA 4F8EA 3QU4A 1ODSA 3V55A 4MR9B 1RHRA 5DX1A 5IYZA 1CY0A 5JNSA 2AMLA 2OCYC 3PBKA 1GTG1 5EHXA 1WCYA 5KYTA 2W48A 4FC7A 4Y1FA 2CMFA 1CRZA 1I1OA 1UXGA 3ECSA 3QEJA 4RA6B 1QKIA 1RHUA 1Z8HA 3L7JA 2VZ0A 4QIHA 5IABA 5JAPA 3MMNA 1IHYA 3H04A 5BWOA 4YP9A 2QMOA 4MI9A 5CB4F 4ACAA 4FFBA 3AUTA 3RRXA 2CLHB 6REQA 4MQLA 3FYDA 5HJEA 1ZAKA 3KPJA 4JBNA 4ZOLA 2R6HA 1GGMA 1U3CA 1VA5A 1UKZA 4MW4A 1QDLB 1Z8NA 3WB1A 4UHEA 4E30A 1DQNA 3WIBA 3OKPA 3MTJA 3ND5A 1T3ZA 2VF5X 3HA3A 4V03A 2GHRA 1FDWA 1NV9A 2CNDA 1E5LA 2C3UA 3RK4A 5JO0A 3JRWA 1VGRA 4MS3A 2OE2A 1T2DA 2B4YA 3TD2A 1X1BA 4FEEA 4R0MA 3LUGA 5B7PA 4YXWD 5FX2A 2NV2B 4LZJA 4V3BA 3QYJA 5ALUA 1YB7A 3QTTA 3F9RA 4KVZA 2ZM5A 821PA 4NECA 3QLUC 1VE1A 4EKGA 2SHKA 1T0HB 3ORYA 2AX4A 3DGFC 4IXDA 5T8KC 3H1TA 2WG1A 3PEVA 1V5EA 5C8XA 2A58A 5DEIA 1P7VA 3P9YA 4C1BA 1XNRB 3JYOA 1YDHA 1PZFA 2RGGA 3CZ9A 3KEQA 3HA7A 5LKAA 1OWMA 4IIGA 3WB9A 2P6OA 2CUKA 1YGPA 2GEJA 4RFLA 1JU9A 2X1HA 2FHSA 3H86A 5KMGB 2QX7A 4HC4A 1UDCA 3T38A 1JN0A 2ZREA 2XB4A 1K06A 3A25A 4ZMSA 1DRVA 4PPGA 4HDQB 1F6BA 4KQWA 1SQGA 5AHWA 1X92A 3D6UA 1ABBA 3A1WA 2XZOA 1VI5A 2EFEB 2ORIA 1RLTA 1DV2A 3IURA 5JC1A 5AQEA 3UAOA 4QUDA 1SUPA 2K7FA 5I8ZA 5JD5A 2X5JO 1UOEA 3HVKA 3LPLA 1EZ1A 3VKWA 2Q6OA 1PKXA 2FRDC 1LLUA 2DHRA 4YX9A 4R81A 5FJIA 4Z7NB 4KK3A 2ALJA 4P3XA 3OPYI 5HR5A 1P2BA 2WFLA 1FW8A 2CN1A 2Q0XA 2H1VA 3FGNA 4GUAA 5JASA 5LFAA 1NSTA 3WGTA 4AJOA 4LHXA 1EZ4A 4UE6A 3ZV7A 2IH4A 2OCKA 1V7ZA 2V7QD 2NTYC 2ODBA 3BFXA 2YWXA 3RSGA 3IVAA 5B1DA 1XX6A 1JFSA 1P5HA 3EYAA 4WZAE 2X6TA 1N2IA 1Z06A 2CMDA 3Q87B 1XJ5A 3DNFA 3ESYA 4RK7A 5EIFA 4Q7MB 1PU2A 2B1IA 2VS1A 1S7GA 4W9RA 4BZPA 1Y6QA 3IAAA 2X8JB 4I4IA 4B7UA 3CHYA 4ER0A 1C7JA 1QQBA 3DLIA 2UYOA 2ZYDA 2DSNA 2PU7A 3AU8A 5H70A 3S0JA 4D9EA 2XJ9A 5CB0A 3A6KA 3D8UA 3R0IA 4OXNA 1D3AA 2WVJA 3LVFO 4HVTA 2OSBA 1WDWB 1J2EA 2FFQA 1E5XA 4P58A 4R84A 3TLCA 4EZEA 2PE5A 2BEVB 4NZPA 5AW7A 2AEMA 2P62A 3DV9A 1MF7A 4QXRA 1T3SA 3ZHYA 4L9AA