2JJ8A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
184
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERCVPLKYLQELHELHEDWLIHPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 66
structure length 184
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jj8A00
4US2R 2QM8A 4TMXA 1TQ6A 5CDFE 5F9FA 5AK0A 5KPJA 2EWVA 3T5GA 4K46A 2HUPA 5DLQC 1KDTA 3O47A 4PQRA 5EP3A 1WB9A 3A1VA 4CGZA 3Q5DA 1IY2A 1OXSC 2JJ1D 4PAQA 2YWFA 1ZU5A 2IS6A 2QAGC 4PC7A 3EX7C 1W0JA 4AKIA 3H84A 1MABA 3QBTA 4C0SA 3QEOA 2QBYA 4I1VA 3AVYA 3HR7A 1ZNXA 1KI6B 5HPYB 2IYWA 2O8FB 1E1RA 1XZQA 3H0KA 5L3RA 3AP1A 3TW4A 3LV8A 1D5CA 3FGNA 3N5CA 4W5WA 4PAOA 4TT3D 2B7CA 3R20A 1CJTC 1E2MA 3KX2A 2G83A 1OFTA 2A5DA 4NYIR 1XCGB 4K8OA 2MMCA 1RJ9A 3TQCA 2WVJA 4F4IA 3CBQA 1CF4A 1ZUIA 5FPTA 2WJVA 3ASZA 1IAQA 3MJRA 5HTKA 2WSMA 2O5VA 1KTVA 3QEJA 3D7MA 1KNXA 2QU8A 2C8VA 4L9SA 4ESHA 5JZVA 4B76A 1U0HC 2FSFA 1EFRA 2CHGA 1UKYA 2Y8EA 5FR2A 3ZDQA 4EPVA 2CL7X 1BIFA 3W90A 4G01B 1U9IA 1RVDA 4IDNA 4OI4A 2NPFA 4AG6A 3I8SA 4IVRA 4G1UC 1ZD1A 1NVUQ 1BS1A 1QBKC 4QXAA 5C4GB 3U7GA 3DHWC 2W0MA 3KUDA 4DLTA 1TUIA 1FQKA 2W6ID 4HZIA 4MRSA 2FE4A 2WWHA 4OKSA 3AH8A 1GL7A 2X8AA 3I32A 4Q66C 4BECA 1U81A 2P2LA 3T34A 2UZIR 3GLGB 2D4HA 5F2EA 3LRPA 3BRWD 1S9HA 1U8AA 4DC9A 2V6JA 1FTNA 2YHSA 1Q22A 3CH5A 1Q44A 1OW3B 3BORA 4Q4LA 4DLYA 4AWXA 1CULC 4CEHB 1G16A 4ZPXA 4DSNA 4C9BA 2EYUA 4D4LA 4LHYA 3L43A 4US0R 4JL6A 1PUJA 5GJVC 3LY5A 4IXMA 1E6CA 2Q3MA 1Z83A 4CDGA 5IHPA 2YOHA 5JLJA 5CYPA 3PEYA 5FL7D 2JJ2D 4UXIA 4A36A 4RCZA 3B13B 3CRRA 2WIBA 1JECA 3HU1A 4RJLA 3A58B 2QMOA 1OXTA 1ZNYA 1XDBA 1O3YA 1QG2A 2XOKA 3EZ2A 1DBSA 1XD2A 5IK2A 2REXB 1P72A 2O8EA 1IXRC 3IQWA 4M1YA 3SJCA 3RSOA 4V0MA 2ZXUA 3K70B 5JWOA 3IEUA 4LGMA 3D8BA 2VHJA 3KTAA 4FN5A 2ZSBA 3GJ5A 2JDIA 2ONJA 3SFVA 1HUQA 1GSIA 1T0JB 5JI2E 2GA8A 2XNSA 3BFKA 1T9HA 3ASYA 1UBEA 3VAAA 1NBME 4G0NA 4PAMA 5CM9C 3U44B 1GVNB 4HDCA 2RGNA 5G3YA 4BFWA 4DT1A 1EK0A 2WSSA 1KMQA 1O87A 1UF9A 5HKKD 1CR1A 2DFTA 3LBIA 1UBCA 3I8XA 1FUKA 3QBVA 5KSPA 1F5NA 1MRSA 5IDVA 3BOSA 2F1HA 3KJHA 4KBFA 5GVRA 2IWRA 2B6HA 2CCJA 5TB5A 2P6UA 2OUKA 3AP2A 4IW3B 4DEYA 3QKSB 1W4RA 1CXZA 2OCPA 4B3BA 1NIPA 3CX6A 2RGEA 4B6EA 1NSFA 1JR3D 3AVQA 5EXXA 2WZQA 1RZ3A 3KUCA 2GXQA 2ZSFA 1D9XA 2R6CA 3OIWA 4F4CA 1ZNZA 3FKSA 4KVGA 4IEEA 1NLZA 1G5PA 5D3MB 4XWOA 1NMZA 3JZMA 2FPKA 1XMSA 2KSQA 2QEQA 4FD2A 3PG5A 1FZQA 4MDEA 3Q9LA 2C9YA 5KPDA 4PO8A 4OL0A 2R6FA 2ZI3A 4Q47A 4GNKA 2WJGA 3ZZUA 1XTIA 2VEDA 4NYIQ 1OE0A 3OAAD 4YXWA 4B74A 5J5CA 4ZIRA 1LF0A 2BMEA 5FFMA 4YDSA 3R8CA 4PC6A 4RZUA 1CKEA 1S0UA 1N6PA 4M9QA 2O8FA 2CE2X 621PA 4KV9A 3T15A 1FP7A 1L4UA 2VA8A 1DG3A 3BB3A 1R5OA 3HJNA 4HLQB 4IOJA 4J0QA 1AQYA 1E98A 3AF0A 4POAA 3THYB 3U3MA 2IHBA 3AKYA 1KSHA 2B8WA 5KNBA 1L7VC 4AKEA 1A5TA 2Q6TA 3SHFA 2DHRA 4HDOB 3KDSE 1SXJD 1WA5A 4BFSA 2QSYA 1R0ZA 3D31A 4I4LA 3SYKA 3NBZC 4M4SA 4XD7D 2GVDC 4CEJA 1KKMA 3WNDA 1HV8A 5KSZA 2HV8A 1GM5A 5HR5A 1U99A 2A5FA 4LC0A 3E5HA 1GP2A 2I3BA 4TMKA 2F43A 3RS4A 1S96A 1TUEA 3FMOB 4AYTA 4PHGA 3ZD7A 1TEVA 2C95A 2XTNA 3CZQA 5DYIA 5J4LA 4MGKR 4BFTA 2F55A 1E9SA 3RRYA 3I4LA 3FTQA 2OAP1 3NEYA 1CEEA 2IWHA 2OZEA 4DHEA 4MKIA 4P4UA 4LBWA 4DLSA 4A2WA 2R62A 1R0WA 4P31A 4TL8A 4P4TA 4NU0A 2RGNC 2XB4A 2QPTA 2L0XA 3GLGA 2ZRLA 3B82A 4R2HA 1GRRA 1N25A 2IYLD 3OFNA 2FZ4A 2CE7A 1OIWA 1XX6A 4CEIA 3NC1C 3L2OB 5E7IA 3RS5A 3LQRA 3ZZ0A 2AWOA 2OBNA 2GESA 1LS1A 4FMBB 4U5XA 4H1UA 2VO1A 4EFLA 4EUNA 1ESMA 4HUQB 2BEJA 3K1JA 4M1TA 3KQLA 4TLAA 3K9HA 2OFOA 5L3QA 4DCVA 4KFTA 4QBGB 4V0ME 1VECA 1G3RA 3WP1B 1KHTA 3NH6A 1US8A 4Q7KA 1EFTA 1BMFD 2CL6X 2J0QA 2NO0A 2IF2A 5JHGB 5DYGA 1E96A 5BN4A 3LA6A 121PA 3SI7A 1E3MA 4NBSA 3KQHA 2JASA 1W4BA 4TTPA 1SVWA 2DWOA 5CB6A 2IS2A 5EQTA 2V8OA 4CIDA 5FOTA 3ICEA 1QZXA 1LTQA 1Q1QA 1TQ2A 3QKUA 2VP6A 2HLDA 3EWSA 4Q4HB 3CZPA 1NNEA 2G9NA 4Q4JB 3X1XA 2E1RA 4JYBA 1YJ5A 2HCJB 2WKPA 2R65A 1P2SA 1J90A 1ZIOA 2IYVA 2FG5A 1K5GA 3EARA 4D4JA 5DI3A 2GCNA 3FVQA 4QHYA 1TX4B 2QSZA 2XITA 3MUFA 3NHAA 3UKDA 4DUGA 1RIFA 2HF8A 5AJZA 4MYUA 1S3SA 4AG5A 1Q20A 5CIWA 1W44A 2ZJ2A 4EPTA 3AVTA 1AGRA 3IILA 2FWRA 2CLCX 5JECA 2GWHA 4GOKA 4BE7B 3H4MA 4EQ6B 5KDDA 2ANBA 4RD1A 2X1VA 3IHWA 3B8HA 1SQ5A 3TLXA 2ZJ5A 2EFCB 4N0DA 4F7WA 1N2CE 3LW8A 4B35A 2Q3FA 5E95A 1X6VA 1U98A 3N2IA 1YE8A 2BCJQ 4OJKA 3X1DA 3BC1A 4NCJA 4B3CA 2IXGA 1R10A 1OXVA 2OBMA 2JIZD 5CK5A 1E99A 2GRJA 5KU1A 4RZXA 3EZ7A 3FMPB 2AK3A 3TSZA 4US1R 1KI1A 4TMWA 3BFVA 3BH0A 1FNMA 1GNQA 1VTKA 4OHVA 4B44A 3LNCA 4L15A 4LJ9A 4TN1A 2QAGB 4OJQA 2ZRMA 4LPSA 4EJSC 1VPLA 1KMHA 4GT1A 2FPLA 1OH7A 4ZCIA 2BMJA 2DBYA 2FSHA 2RGXA 2LKCA 3NBFA 1YZNA 1KO7A 3A4MA 4JVLA 2ZVPX 5KDLA 4QJ4A 2JEOA 3THXA 3X1WA 1OLOA 1PLKA 1JR6A 3P27A 4DCSA 1UBGA 3FB4A 2RGDA 2ZR7A 4A2PA 4PO9A 2O8EB 1Z0IA 2EQBA 1TF5A 2JLQA 3RRNA 3IKJA 1XPRA 1G291 1YKSA 2GETA 1QHSA 4JJKA 4PPNA 3VQTA 3ZIAA 1YR7A 4WBSA 1KGDA 5BQ5A 4KLZA 4B3XA 2QZ4A 2WIAA 1SKQA 2Q9BA 2FX3A 1ZUHA 4TLBA 1E2HA 1TNDA 4HUTA 2BWJA 2VP9A 2ZJYA 4QOSA 4WZBE 3GLGE 2UZ3A 5JI3E 1KI7A 1JJVA 2C78A 4IVPA 4NKRA 4WIAA 3TW8B 3FMIA 3LDAA 1W0KD 2QROA 4Q7JB 3ZVRA 5TARA 3Q7QA 4Q9JA 2MSDB 5KNCA 2JATA 3KQKA 1LF5A 4JBYA 1OSNA 3MRSA 4XTRA 3C4JA 2AKYA 2V6IA 4XH9B 2WPDA 4JLDA 4KHZA 2F3RA 3F5FA 4DKXA 4MUAA 2GCPA 3CUEF 3K0AA 1SXJC 3DDCA 4LSGA 1ZP6A 1EFCA 4NHOA 1IY0A 1R0YA 4B3FX 1IBRA 1PV4A 1JEEA 2QQEA 3M6AA 2VP2A 1L2TA 2ZI5A 4O2RA 1M6NA 2ZE5A 2ZIAA 1K5DA 2WOOA 4HUQA 1ZBDA 1I2DA 2IEYA 3B7GA 2EFGA 4BEJA 4CT5A 2BBOA 4KU4A 2X19A 4B3GA 3CX8A 1CP2A 2QMHA 3DEFA 1Y63A 2ZAOA 3HWSA 2JLWA 4ITRC 1NN3A 4RSGA 2NMVA 4TZ0A 1GNPA 1HA3A 1WCV1 1LY1A 4MRVA 1RW4A 3WRYC 1CRPA 4IXNA 1G17A 1OH5A 1Z0FA 5BXQC 2V54A 2IT1A 4F92B 4PXAA 4IOKA 2HDNB 1Z6AA 5K8IA 2FA9A 2FEMA 2W2VA 2W0SA 3DZ8A 4I1SA 5B30A 3MWKA 2ZYWX 1Q3TA 3ZS8A 1NVVR 1I4TD 1Z07A 2O0JA 2DR3A 4GFDA 1MABB 4S35A 2QBYB 1E1QD 2NO1A 3I62A 1FOEB 2O8BA 3A36A 2W83A 1SKYE 2WMOB 1IM2A 2PLFA 4ASUA 1WQ1R 2C9CA 4MGZR 1XMJA 4IJMA 1DAHA 1YZKA 1N6LA 2JLUA 2ZUBA 2EWWA 2CNWA 3OEED 4AURA 2ZJOA 3A4NA 1Q57A 4E07A 4JJZA 3ZYCA 1RJ9B 2NPIA 3SJAA 1ELOA 4JLOA 4TTQA 1Z6YA 3Q72A 3QUSA 2GILA 4MYTA 4A1FA 2N42A 1N6OA 2QY9A 3CF0A 3IHLA 3IO5A 1W36C 2F3TA 2KB0A 4Q1AA 3N2EA 1X8JA 2ZJBA 1IN7A 2VHUA 1XEWX 2O52A 2PMKA 1E79D 4MUBA 2RGCA 3QENA 2H16A 3HU2A 1N0UA 2ZSDA 3NH9A 1IOZA 3QPVA 3QXSA 1G7CA 2ZANA 4MRNA 4DLWA 3TE6A 4F93B 4ON9A 4G5OA 4FIDA 1KZ7B 4TLEA 1R8SA 5BW8A 2YINC 4UXJA 3P1JA 3RS7A 3W3ZB 3RABA 2IBMA 3OE7A 2CK3A 2Z0MA 3AGPA 1DO2A 3DZDA 3RAPR 4XSHA 3U2QA 1N5KA 2GVZC 4NH0A 5BWMA 1X3SA 4LJ7A 4JT4A 2BEKA 4QNMA 4JLJA 1U94A 4JLVA 3V4FA 3SEAA 3VFDA 3R9WA 2C98A 4IKEA 5JRJA 1ZD8A 4D4KA 2WJYA 2V9PA 1KY3A 3U5ZB 4HB0A 1AA9A 1U2RA 2EW1A 3SC3A 4RFVA 2AXPA 2P0EA 2X2FA 1T91A 3GJ4A 4URXR 4IDPA 4PZLA 3DM9B 1H8EA 1LNZA 5G41A 3RS0A 3I5XA 1SVSA 2J87A 5EE3A 2VF8A 4G5RA 3MFYA 4F38A 3LBNA 3AVXA 2J46A 1S4QA 2YOFA 2YV5A 5HCIA 5CITA 4X8MA 4Q01A 1GKYA 4A6XA 2QGZA 5JHHB 3VU9A 3KQUA 4FWIB 3U7HB 4PPFA 2GHIA 2V7QD 3WHKA 1HE1C 5E3HA 2ZI4A 3CX7A 3KTAB 1OB5A 3SHWA 1KZGB 4JLAA 2WAYA 3NHBA 3BB1A 4W7SA 2WKQA 4BASA 3MD0A 2J7PD 3PR1A 1UDWA 4LHVA 5JJKA 2C77A 3AVUA 2ZU0C 4D80A 1AQUA 3HP1A 4ZI2A 4RD0A 2MSEB 4PC2A 2ZSAA 2N1BA 4Q5IA 5FTLA 3LX8A 4NDZA 4LPKA 3EASA 2ZJAA 1BYIA 1NLFA 2FMXA 1AS2A 4ABYA 2GJSA 4E5UA 2D74A 4LV8B 5EE9A 5FI0B 5KUTA 2CBZA 5E7JA 1GNRA 3IIMA 4BEBA 3EIHA 3FHOA 1IXZA 4FMCF 4D2IA 3B1VA 2G0NA 4D0NA 3TIFA 2JLSA 2P6NA 3Q7PA 4ZO4A 1E2QA 1ZYUA 4JSTA 4R2IA 5EP4A 3SFZA 4D81A 1VG8A 2NGRA 3J81k 1N5LA 4NPHA 3TSOA 3AGQA 1NVVQ 1OH6A 1MT0A 4GOXA 3ECCA 5LB2A 2E9SA 4B2IA 2PEYA 4A6PA 1A7JA 1H65A 4Q1EA 2CLDX 4YQFA 4JLNA 2PMDA 1OKKD 4Q9HA 4CT4B 1ZW6A 4W5JA 4OHWA 4WOPA 3X1YA 4C0JA 1P7CA 2B8TA 4I1OA 4BFXA 5K8UA 1M8PA 3UIEA 1IJEA 3QG1A 4XJXA 4A4DA 4ZIRB 4TWZA 1E2PA 1G8HA 1WXQA 3UPUA 3DVLA 1XPOA 4KI0A 4O25A 5BYJA 3A1WA 1NVWQ 3GFOA 3PQCA 4RD6A 1MO4A 1NKSA 2QTVB 2XZPA 3WMFA 1H8HD 1W5SA 4ZDKA 3MMPA 1XCPA 3O8CA 1P3JA 1VMAA 1E2DA 1OXUA 4JLMA 4TSFA 2PZEA 1Z28A 2FZLA 3EPLA 1HT2E 3CIOA 2HJGA 2EFEB 2IYRA 3GFPA 3U61B 4CEJB 2GJ8A 3M4YA 1J8MF 1ZVQA 5E7MA 3CF6R 4MYHA 2F43B 3PUVA 1COWA 4MA4A 1TF2A 1G5RA 1W1WA 2BBTA 1CJUC 1KJYA 1KJZA 4V0KA 4N3NA 4D4MA 5DN6D 3QF4A 1C9KA 1HY3A 1KSGA 5FPKA 3GP8A 1AZTA 1XU4A 1YU9A 1ZINA 1UKZA 3DPUA 3W8NA 1KDRA 3KKPA 3AF2A 4FMCB 3RC8A 1AK2A 2KE5A 2BC9A 1WP9A 3W6PA 1C4OA 2XX3A 5G3ZA 1JI0A 1VYTA 1Z0AA 3K8YA 3OZXA 3QKTA 3PUXA 2SHKA 5LPNA 4P32A 1BH2A 1OH8A 2IYUA 2NO6A 3TGPA 1R6BX 4OHZA 2IW3A 4FWTA 4CEIB 4XOIA 3VR5A 5J4HA 2XZOA 1Z6GA 2C04A 4FCWA 4QFMA 2Q3HA 3R9XA 1YZTA 2A30A 2NQ2C 1GDDA 2VP5A 2VPPA 4HB2A 1RKBA 3LXXA 4QBFA 2OG2A 3ZH9B 3ZVLA 1QG4A 3VX4A 4OI2A 4B48A 5J40A 5L3QB 2HCBA 4HAXA 3TUJC 3EW9A 3LBHA 1F48A 2QGNA 1US8B 4ERNA 3CRW1 1FUUA 2CVHA 5LDDC 4HYYA 1U90A 3HPRA 1HYQA 3TBKA 3BERA 2JLZA 2FH5B 2WWFA 1KDOA 2ZRBA 2JJ1A 2Z43A 1P73A 4BFZA 1T8TA 3WYGA 1MO3A 4AD8A 2ORWA 4R9UC 4F4JA 3T1OA 5M04A 1KNQA 1TMKA 2VHCA 2ORVA 3FHCB 4WZAE 3V9PA 4CRWB 2HJVA 4PQFA 1OHHD 4L16A 4Q21A 3UWKA 2HT6A 3CNOA 3DOEA 5ELXA 4NP6A 1Z3IX 3AF3A 3AKDA 3B60A 3C15C 1NSTA 1W5TA 1GKIA 4LJAA 3GFTA 4LOAA 2BHRA 1CRQA 1N5JA 3LVRE 3PCRB 2AL7A 4P4SA 4TT3A 2BMFA 4EKDA 2D2EA 3RVBA 1T0HB 2A3RA 2BM1A 1XTSA 3FMFA 5DI3B 2JJ8A 2QG6A 2ZRIA 4PHTA 1GL6A 1A82A 2GXUA 1II8B 3L8ZA 3SYLA 4L9WA 1XXHA 2Q0HA 3IEVA 4U02A 4X8HA 2A78A 4LJ5A 3WMEA 3TR0A 4B32A 1GZSA 4B71A 2W2XA 5CLLA 1ZNWA 1T8UA 5FTMA 2ZVQX 3PVSA 4LX0A 1SKYB 1DADA 3TAUA 1E9EA 4IFEA 1DTSA 1QRAA 4EFMA 4Z8XA 3NDBB 4PSVA 2FSGA 3PEWA 1B23P 1AJEA 1BOFA 2ZRCA 2W6IA 4PX9A 3SJBA 3P26A 3KKOA 1E9BA 2KI5A 1OIVA 2ZRGA 2GCOB 4QHSA 4R98A 1NG1A 5DHFA 2KBFA 5SZJA 2WOJA 2JLRA 4AY2A 4M22A 3ADCA 4QJ3A 2ZQ5A 3NBXX 1Z5ZA 4KAXA 2H18A 4EPYA 2FFQA 1D8TA 2ZYUX 3T35A 1KAOA 3VKHA 2WV9A 3EIEA 2C03A 1PZNA 3VTKA 2ZRJA 2OILA 5SZHB 1KMHB 3VR3A 1KAGA 4S2EA 4TMVA 4A8JA 2EFDB 3IQXA 3QKRB 4RKFA 3BIFA 1J8YF 5GVSA 2J41A 2FJUA 2QAJA 5JFGA 4OHYA 5TY0A 1EWRA 1XEFA 5FOSA 4BPBA 4JLPA 3CB4A 2GZDA 2ZE7A 1XPUA 3THXB 5FL7A 1GOTA 4LHXA 4I81A 3GJ7A 2P6RA 4KFRA 4IDQA 3AVWA 2JJ2A 2Q9CA 1IXSB 4LRWA 3KZ1E 1Z0KA 3H2YA 3AVVA 1HE8B 2IK8A 3SBDA 1ZCAA 2YWEA 3A1SA 1R4AA 3TK1A 3K70D 3BGWA 4JBXA 3ZGXA 5TDHA 1KI4A 4BGDA 1T6NA 2GKSA 3WYAA 1A2BA 1ZM2A 3CLVA 1A1VA 4M53A 4ZCLA 4EIWA 4L8GA 5JJLA 4B2LA 3HPQA 3K0FA 1W36B 2CHVA 1EG7A 2GAOA 3KB2A 3RWMB 1YHNA 1W2GA 3LWNA 4A0FA 1IN6A 1JXOA 5H8WA 3I72A 3VMFA 4TQUS 4O3MA 2O8CA 4UNQA 2OT3B 2QRNA 4A92A 1Q1BA 3ND9A 4TYQA 1OFHA 1QVRA 1NMYA 1DOAA 3QY0A 3WY9A 3GJ6A 4GPTA 5F9HA 5EXPA 4JZKA 1CIPA 4Q7LA 1R5BA 5HKKA 2YYZA 3QE0A 1XEWY 3LW7A 4URZR 3S1AA 2RB4A 3VHXA 3U6BA 1YRBA 2F1IA 3NWJA 2A7QA 3G0HA 1DAMA 1W48A 3K0AB 4IEIA 4EJSA 1DO0A 5FPHA 2OEPA 2IA5A 1G3MA 1AS0A 2FDCA 4DCNA 2PX0A 3RS3A 1P9RA 1DVRA 2WJHA 5A0FA 4HB3A 4OK5A 1MO6A 1HEIA 3L0SA 3CWQA 2HEIA 3TMKA 2WAXA 2CL0X 4P0TA 2PEZA 4BRUA 1JR3A 1UEJA 1KO1A 2KBEA 2BKEA 3DMDA 3C5CA 2QP9X 3NG1A 2ODWA 4WW0A 1G8PA 1LW7A 2C5LA 4DSUA 1ETUA 2JAQA 2G1KA 2XEXA 3SYNA 1EX7A 3ZZTA 3QNUA 4JIMA 2GDJA 3AUYA 3K0EA 3E70C 2OBLA 4YDHB 2ZM5A 3OAAA 4D26A 1NRJB 2R44A 1D2NA 3BD9A 4FXPA 1G8GA 1XXHE 4DDVA 3L8YA 1KK3A 2P67A 5C4MA 4G3XA 1VDZA 4JSYA 4HAYA 1E2KA 4M1OA 3VR4A 4A8JC 2CJWB 2O8BB 1UADA 2VQSA 2JGNA 3B1ZA 1ZM9A 4C0QC 2NG1A 2J0UA 5F98A 3B1XA 2BJVA 3CPHA 1N0VC 1II8A 5DI9A 2OV2A 4UXHA 1SXJA 2ZUCA 5FUVA 3DKVA 2QTHA 4NE2A 1Z47A 1E0JA 5JMTA 2OO7A 1TEXA 4XD7A 3DOFA 4JVMA 4PC3A 4ARZB 1VYVA 1XD8A 4D6PA 4ZDJA 4TL7A 3BWDD 1P2VA 2ZRFA 1D6JA 1XNJA 5J4VA 4DIEA 3IIJA 2DFLA 1CS4C 4TQ9A 4MQBA 4LV6A 1RRGA 4JS0A 1XEXA 3O8BA 1S2MA 1YR6A 2VHTA 3QXHA 4Z1MD 4AC9A 1Z06A 3AEZA 1P2UA 1P9WA 2AFHE 3LLUA 2ZTSA 1DE0A 4Q7MB 2GCOA 1VHLA 4MGYR 4YMSA 4OK6A 3I5YA 221PA 2Q21A 4KFUA 4YLGA 3W6OA 4XWKA 1S3GA 1VG1A 4MRRA 1Q0UA 4LC1A 1KJWA 1RYFA 3MWLA 4A82A 2XAUA 4OQXA 3W8RA 2ZJ8A 4B6FA 3CM0A 4XWAA 1GL9B 4ESVA 4GZLA 3F8TA 4A0GA 2DPXA 5FTKA 1Z0DA 4L5BA 4C2UA 4GP6A 1KOFA 4JMPA 4B43A 5J47A 1S1MA 2QE7D 3V4RA 4FMDF 1T3SA 4Q1BA 2KJQA 2QUZA 2REOA 2GJKA 3QKRA 2OM2A 2RMKA 3T06B 4TLCA 3RNLA 3GLIA 3MGCA 4Q00A 4XVUA 1Z6XA 1ZC4A 2IS1A 1R0XA 3BAFA 2D7DA 1LV7A 2J7KA 1VKJA 1RFLA 3PENA 3CF2A 2HXYA 1ZC3A 4OBEA 1BMFA 2FFBA 2R2AA 5DISB 4BLRA 3P4YA 1OV4A 3KXKA 1NI3A 2ZRHA 5L3SA 2WTUA 2ATXA 3U3KA 3AV0B 4XVQA 1G3QA 2N46A 4UNPA 1YZGA 3ADDA 2JLXA 4NCIA 2YKGA 4DBLC 4DSOA 1DAGA 2YOGA 2CCGA 2CCKA 4Z8YA 2OLKA 4UJ5A 3ND8A 2OFXA 3RDPA 1CR4A 1L8QA 2LCFA 4DLXA 2NTYC 3KKNA 2IUTA 5EE0A 3EPKA 4Q9KA 1S1CA 5F3WB 5AJYA 2J9RA 5HZHA 1IN4A 1G41A 3VU9B 1SVLA 1VCMA 1JQLB 2RAPA 1E2EA 2XNDD 4GOJA 4BFVA 3ADBA 2RHMA 3AKCA 3TQFA 4LYHA 2JA1A 4LJ6A 1TAGA 2HF9A 3U7FB 5FOUA 1PLJA 1GILA 1AIPA 1GFIA 2ZE8A 1Z0JA 2K5UA 4PHHA 2GEUA 4M2LA 2F7SA 3SOPA 2A5YB 4TMZA 3P32A 4JVNA 2VF7A 3PUYA 4Z51A 1S9DA 2XJ9A 3QPWA 2IYQA 3B2EA 1HURA 3F3YA 1JR3E 2IF0A 2LWIA 1XF9A 1HH4A 2OCAA 3K70C 1WDTA 4D25A 2CEAA 2ATVA 2XZLA 3RWOA 5GADl 2OXCA 2P5TB 1QHGA 2BOVA 1M74A 3K53A 4TL6A 5UKDA 4B34A 5DGXA 3SS8A 4LJ4A 3D6TB 3VR6A 3W9YA 5EP2A 2FN4A 3L0IB 4FMDB 1F60A 4E22A 2JIZA 4DVGA 2W2TA 3OEHD 1DG1G 1RYHA 2VSFA 3DO6A 1NKTA 3TNFA 3PFIA 5C46F 1M7HA 4B75A 5FBQB 5C18A 1W4AA 3Q5EA 1FX0B 4II7A 3SNHA 1EWQA 421PA 2C96A 4DLRA 3T61A 5EJEA 3RRMA 3GLFA 3NDPA 4AI6A 1KK0A 2XSZD 2GEVA 1SXJE 5JS7A 3X2SA 4Q9LA 1MH1A 3OF5A 1ZMXA 2FGJA 5SZIA 2CJWA 4RY2A 3LO5A 3X1ZA 4BUJA 2BDTA 4UNSA 3P20A 1FP6A 1JJ7A 1AKYA 5BN3A 1Q12A 3IPXA 4EPXA 2Z4SA 821PA 1VG0B 1XWIA 3ZVMA 1LFDB 4IFBA 1XFAA 2AN9A 3AQ4A 4HZUA 4AYXA 1X8LA 2NOAA 2NIPA 3EC2A 2DFNA 1X86B 2D2FA 3SJZA 2VHQA 4ARZA 2ERXA 5CB8A 1ZJ6A 1X8KA 2RKOA 2VRWA 3T1VA 1G6HA 1E9FA 5HE9A 1TF7A 4LUCA 1G9XA 2FFHA 3GEIA 4O0MA 5AUQA 1E0KA 1TQDA 2GF0A 3L0OA 1XJ0A 5DO9A 4DDTA 5H1YA 1DARA 2I4IA 3ZLJA 1EFHA 1W0KA 1G5TA 1YR9A 3ZS9A 1P9NA 4QL3A 4BWYA 3IPYA 2ZR9A 5TV2A 4AIIA 1SVMA 1OFUX 2J0SA 1KSFX 3QF4B 3TJZA 3KL4A 4RVCA 1E4VA 3KFXA 1K8RA 1YQTA 1EXMA 3GLIE 1G18A 3K09A 4V0NA 1MRNA 4QKQA 3G5UA 5CJPA 1KY2A 3VX3A 3AVOA 5AJVB 4BZQA 3RLFA 2R9VA 1NVXQ 1Z2AA 3GJ3A 4LHWA 4N0EA 1NBMD 1G19A 4WXPA 2WWIA 2C99A 1GG2A 2ZUDA 3W5IA 2ZITA 3D3QA 4JYCA 4PO1A 2IUUA 2HT1A 2XXAA 3W6NA 2ZI9A 4ZKEA 4JL8A 3KKQA 2DWQA 3THWA 3JVVA 2ZI6A 5CYOA 3FOZA 2DB3A 3A6PC 4M1SA 3AVPA 2F9MA 5A4JA 4IOLA 3FDIA 1ESNA 4YC7A 5AJXA 3WRXC 2CDNA 2QN6A 2AHOA 1XBTA 4XTCS 4UNNA 4ZV4A 1E32A 1CTQA 3A1TA 1W0JD 2WBLC 3OIVA 1PJRA 4MKGA 4ACAA 1IN5A 2NZJA 2OXRA 2DCUA 3U3OA 4PFSA 5FPSA 4JVSB 3DL0A 3QI2A 3QXXA 2ZU6A 3U7EB 1E94E 1PLLA 2E87A 4G5QA 5J4KA 1MKYA 5FUXA 1E1RD 2F1JA 4OQMA 1G7SA 2WWGA 4PC1A 5LD2C 1E1QA 1E9CA 1NP6A 3GD7A 2VLIA 4NYJR 4JLBA 2QMEA 1E2FA 4LBZA 1GTVA 2AD1A 2C9OA 2ANCA 4K81B 4M9SA 1KI3A 3N70A 3PJRA 2QL6A 3QPUA 5AUOB 2R6DA 1E2NA 4P4SB 3MCAA 3PIRA 4M21A 3CRMA 2ZEJA 2D06A 3EXAA 3OEEA 5ANRB 1D9ZA 2QP4A 2VBCA 1AZSC 2YC4C 1J99A 4PPQA 3MWYW 4AKGA 4XIGS 3C41J 1GITA 2FEOA 1FL9A 2ORIA 1XXHB 1V43A 3CKLA 5BN5A 3GPLA 3JZAA 3QVVA 1EFRD 5LB4A 1FPMA 4C0BA 3LH5A 2QI9C 2H8KA 1B0UA 2G88A 1EFUA 3UMRA 3W5JA 2TMKA 3M0EA 4LDJA 1JPJA 1E79A 2VH5R 3GLFE 4C7OB 3U6KA 4Q4AA 1CR0A 1SVOA 3GQBA 3GJXC 4FI3C 3ICQB 1NMXA 3IIKA 1MR3F 4QM7A 2XGJA 4AKHA 3F0TA 4NONA 3K9GA 2CVFA 4KLNA 2ERYA 3EZ6A 5KNDA 3WHLA 4NMMA 1FX0A 3MLEA 1T5LA 4Y0VA 4D0LB 2XB2A 4XSGA 2IHYA 3W3AA 4HLUA 2O8DA 3K09C 4CF7A 3SQWA 2NO9A 3FFBA 1FNNA 8OHMA 1BYUA 2ONKA 1ZM4A 4IRUB 3HU3A 4QGHA 4EPRA 3M1IA 2QRZA 3EAQA 4EFNA 1I2MA 2HYIC 1AM4D 1KYIA 2CLSA 4LCBA 1Z6TA 3DKPA 2UVQA 4A8JB 2RH5A 4OQLA 4LJYA 1ONBA 4Q03A 4TMTA 1M1YE 1D2MA 1A2KC 4QM6A 1XTKA 1YZUA 1G8YA 1ZRHA 4QGFA 3SBEA 3VNVA 4URUR 2EU8A 2ZYVX 1U8ZA 1SULA 4Q18A 1RPZA 1NF3A 2XOKD 1JNYA 2ZRNA 4KYUA 1XTRA 5IK2D 5IRCD 2QQ0A 1N0WA 4UNRA 4ZCMA 4DB2A 2XTMA 5DNYB 2AWNA 3NBYC 2V1UA 3PITA 1AKEA 3RS2A 2H92A 2JDID 4C0AC 3ZJYA 1W2HA 1DAIA 1DEKA 2W00A 2YWHA 4G5GA 4HATA 4TLDA 3K0FB 2F6RA 2PL3A 2VYFA 2WICA 5J4YA 1FMJA 1ZM7A 2V7QA 2OESA 3TVDA 3BB4A 3SDZA 4MRPA 4W5HA 1JALA 5AR1A 5LBIA 1OXXK 3KB1A 1EESA 1TQ4A 3QXJA 2WSSD 4C4PA 4PSKA 1WMSA 5JEEA 5JSZA 1OB2A 2O8CB 5B64A 4DXAA 4RFSA 5AUPB 4NL4H 2J7PA 2QENA 2OSBA 1F2UB 3LAWA 3CR7A 1J70A 2YNMA 4LI0A 1NL3A 3I73A 3B1YA 3L82B 3CNNA 1W47A 3U60B 2QP3A 2ZREA 1NG9A 3S1AB 1FTSA 2GBLA 4PHFA 2IXFA 3CRVA 1ZD9A 5EE1A 3R8FA 5TVKA 1CLUA 4TYYA 1PUIA 1VYUA 4M8NE 2A2ZA 4DRZA 2PZGA 2GZHA 1NIJA 4EJSB 5JBQA 4Q1DA 1E2GA 1IONA 3GLHA 1ODFA 4RD2A 2J3EA 4MKHA 3SZRA 2ZAMA 2OHFA 2A5JA 2P65A 2RGAA 1E69A 2UKDA 3ZVNA 5HCNA 4V03A 5JWRA 3BH6A 3QQ5A 4CYMA 2D7CA 2G0TA 2VL7A 3FKSD 4URWR 3R7WA 4Q02A 4EPWA 5B2ZA 2ODEA 1UKVY 3GJ8A 3REGA 2VIIA 1Q1EA 4BLSA 4JLKA 1MO5A 4NYJQ 1FQJA 1WBDA 4ILEA 1OKKA 2IYXA 3CWZA 4HLCA 3EWAA 3O8RA 3U4QA 1ZU4A 3EPJA 1Z8FA 2PBRA 2B92A 3E2IA 3TAHA 4B47A 4YXWD 4TTRA 2ZI7A 3NTUA 4HLUC 1OT3A 2FNAA 3UG7A 2IC5A 3HR8A 4DWJA 4DDWA 1G3IA 4FCTA 3CW2A 3PUZA 1XJQA 4M1MA 1SVKA 2ZR0A 3EZ9A 4LYFA 1Z63A 5TMPA 2JLYA 3Q8XB 1YRAA 3DMNA 4LJ8A 4W9MC 1GWNA 2YWGA 2H17A 2ZRDA 1Q3HA 2RHDA 2GEDA 4H1VA 4DB4A 4M1KA 4BQSA 3BK7A 3PXGA 3RYTC 1N6KA 1H8HA 3SU8A 1HTWA 1II9A 1V5WA 3REFA 2B21A 2J0UB 3B9PA 1IHUA 2PJRA 3CH4B 1SXJB 2BKUA 3ZD6A 5GJCA 3OESA 2ZROA 3B1WA 4LV5B 4B2PA 1HQCA 3NXSA 2H5EA 4LZZA 2DFKB 1P5ZB 5KHOC 1QHHA 4DLVA 4Z54A 1GKUB 4HAUA 1JB1A 2W6JD 3AP3A 3O8DA 4C7OA 2XJ4A 5DN6A 4M9ZA 1QF9A 1XEXB 3QIAA 4BZXA 5C1BA 1DAFA 1U0JA 2G6BA 4URVR 3SQXA 3G82C 3KKMA 2BVNA 4HSEA 1E9AA 1JEDA 4YMUA 1UM8A 3VKGA 1XMVA 1KI8A 4CZ2A 4BZPA 4KFSA 3OFND 2OAQ1 4JKYA 3VR1A 4GMDA 5KTYA 1QHYA 4M9XA 4U00A 5KSYA 1YZQA 1G64A 5FI1B 5HE8A 4HAZA 5EZ6B 2IEZA 5KOYA 4LY6A 4GL2A 1E2JA 4HAWA 1U8YA 2GBLC 4JKIA 5IT5A 3AF1A 5CIQA 3AKEA 2AD5A 3CR8A 2FF7A 1S8FA 2A9KA 4C3ZA 4OK3A 5KSOA 1U9IC 2RCNA 3U3JA 1E9DA 3BBPA 5EXSA 3WNBA 1VCOA 2EFHB 4V0LA 5KO2A 3VNUA 5FOXA 2H57A 3GLIB 3THOA 3B78A 1Z29A 2DWPA 2IXEA 3EA5A 1N3BA 1IQPA 4TYWA 4DJTA 3LVQE 4OQNA 3RHFA 3IDQA 5IF9A 5L3SB 1FFHA 4KYIB 3UMSA 1W4CA 1DAEA 1TADA 2WWWA 4URYR 2IYZA 2ZS9A 1M7GA 1KIMA 1KI6A 3K9LA 1XP8A 2HLDD 2GXAA 2OE2A 3HYRA 3CPEA 4F91B 4NCKA 3U3RA 4OI1A 3KJEA 4DZZA 1OHHA 2PX3A 3K0CA 1G3UA 5TXGA 5FBRB 4Q9IA 3BE4A 4BRWA 2OLJA 1II0A 5FOWA 4QHTA 4RZ2A 5DSZA 4BFUA 4HAVA 4YMTA 4IDOA 4UQOA 2CHQA 3PUWA 1Q1ZA 2O0KA 2XTZA 4ACBA 3GLHE 1UJ2A 4PSAA 4NCHA 4DUGD 1RRPA 1F2UA 3SE0A 1UBFA 2BBSA 5FOVA 1KO5A 3IBYA 1XCMA 3B85A 2J45A 1F2TB 4DIDA 2WMNB 3BFXA 5A5GA 4JL5A 1NY5A 4TQAA 3LQQA 3QXCA 1TPZA 2QMUA 2AX4A 3KJGA 4C0LA 3BH7A 3C7KA 3OIYA 4YONB 3EPHA 1R7RA 4QGGA 4YMVA 4BFYA 2W6JA 4R71A 2FU5C 1E9RA 4MH0R 1NN1A 1G7TA 1KDPA 4QRHA 2G1JA 3PEUA 1TU3A 3TUIC 2NO7A 1EGAA 1FW6A 5DHAA 2V3CC 3NEJA 4IDHA 3Q3JB 2ZPTX 2GK7A 3QSYA 2GAAA 4C0KA 2FPMA 4A2QA 4HLDA 2REBA 3IUYA 4KCGA 2GTPA 5GJWC 1XMIA 1UKEA 3TH5A 2PT5A 4IVQA 3FFAA 4JBWA 3WMGA 1W49A 4D82A 1E2IA 4A0HA 5B58C 4QJ5A 4CEHA 3CPJB 4A0RA 1RE0A 4BLPA 5BYKA 1NJFA 1KI2A 3GLFB 2Z4RA 3UG6A 1JPNA 5FTNA 5K8TA 5GJBA 4B3DA 5LD2B 4A15A 2Z5FA 2Q9AA 3WBJA 2MSCB 3UXMA 4GSYA 4LK2A 1W46A 2CMKA 4NZYA 2WJJA 1X1RA 4DDUA 2GJAA 2QM7A 1R5NA 5DIFA 4HB4A 2ODBA 3DM5A 1J2JA 2QA5A 4BLTA 3LXRA 1KK2A 4QG7A 1SHZA 3ZIAD 3C14C 4DLZA 4I99A 2ASEA 3LD9A 1W36D 4HZUB 5SZKB 3VKWA 1C1YA 4GDFA 6Q21A 2EYQA 4KVAA 3A37A 5B57C 3MSXA 2F9LA 2IL1A 521PA 2BCGY 2FGKA 2ZRAA 1CJMA 1Z2CA 3EA0A 4KSCA 1G21E 2KWIA 2D62A 2JLVA 4G5SA 1UDXA 2QTFA 4TZ6A 3BS4A 4NTZA 4Q1CA 3BXZA 4X8OA 4FCVA 1M7BA 3U44A 3K0CC 1KO4A 3MJHA 1XZPA 4MYCA 5AJWA 4Q48A 3EC1A 4FW9A 2BMDA 5HZKA 2PCLA 4I1UA 4ZKDA 5JCPA 2WPDD 3RC3A 1T4GA 2ECKA 3KJIA 3TSWA 1P4SA 2BJWA 2ZETA 5K8LA 1DPFA 3ETLA 1CU1A 1OPXA 4QBIA 1N6NA 4YMWA 5AWFC 3QKSA 3UK6A 4OYHA 4E03A 5FBLB 4O2LA 1UAAA 1MOZA 1RRFA 4LYJA 4PQYA 2W58A 2WKRA 4KSBA 1TTTA 4P3YA 1J7KA 3H86A 3KFVA 1LVGA 2PCJA 1T5IA 2GK6A 3B6EA 1L4YA 4WAUA 2XXAB 1P6XA 5D3MA 3A1UA 3THWB 3KXLA 3PEVA 1N6IA 3L0PA 4KO8A 4M0LA 4R7ZA 3UMFA 2ODNA 1N6RA 1DELA 4TYNA 2J5XA 5H70A 4Q1FA 2HYDA 4B73A 3LX5A 3I3SR 5KDOA 3RANA 1CJVC 3CO5A 3W34A 4OQFA 2F1RA 3V00A 2BBWA 1DAKA 3R9IA 1LS6A 3JVUA 4HI0E 3K9NA 2R8RA 1W7AA 3P4XA 3C16C 2YVUA 4V02A 1XJCA 3NKVA 2FV8A 2ZS7A 2VSXA 3ONWA 3ADKA 4NCNA 4AK9A 3FPAA 1OYWA 4FINA 3OHMA 1XB2A 4ASUD 1TL7C 4PR0A 1GAJA 3THYA 4GZMA 2FOLA 3A8TA 2YZ2A 1JQJC 4H9GA 1KI9A 2CNWD 4MDFA 1G6OA 1N5IA 4PZZA 2QPAA 3Q85A 4WVFA 2X2EA 1NLYA 2GF9A 1F2TA 2VP0A 1QHIA 5E4FA 1BKDR 1WBBA 2ZRPA 1T3HA 4PZYA 3GCGA 5FTJA 2RGBA 1SVIA 1XTJA 5JRZA 4RD4A 1KKLA 2J59A 5KYKA 2VTKA 3AB3A 3HYTA 1DS6A 1CJKC 5G40A 4LHZA 1IN8A 4GMXA 3FWYA 5H68A 2ZE6A 3WP0A 5AUNB 4AYWA 3ZQJA 1VHTA 4GRAA 1OIXA 5FBWB 1ZM3A 1HQYE 1CR2A 4BLQA 5FH9A 4Z1MA 3AM1A 4GBMA 1AGPA 2H7VA 1NJGA 4Q4AB 4CW7A 1ANKA 4QBHA 2LKDA 2WWXA 4M1WA 4Q19A 3IO3A 4U7DA 2GNOA 5FR1A 1SZPA 4KJZA 4NYMR 1KO8A 2P5SA 2YJTD 3OIUA 3OE7D 2CK3D 1WE2A 1JAHA 1G7RA 4GP7A 2O8DB 3ZQ6A 1QDEA 1FMLA 3UWOA 3NIBA 2ZYTX 1G8FA 1I4DD 2IYTA 2WJIA 4QNRA 5FUWA 3C8UA 1P62B 1OF1A 3TKLA 4KBGA 3GEEA 4KXFB 3SR0A 1QHNA 1JXMA 2QE7A 1VCNA 2ZJZA 1CBUA 1HT1E 1G20E 1I4LD 3I1FA 3QF7A 1TU4A 2IUSA 1D2EA 3QG5A 1G1MA 2GZAA 1EX6A 4DLUA 5JS8A 4LBYA 2RGGA 3WYFA 1NY6A 5CM8B 5EP1A 4DCUA 3PV0A 5CJ2A 1WRBA 4X8LA 3T1QA 2MMGA 1H8ED 3B9QA 2B7BA 1AN0A 3K0SA 3QVUA 1NN5A 4MKFA 1N6HA 5FBVB 2QPOA 4PTLA 3MG9A 1VIYA 4Q4HA 3WBKA 3EIQA 4RD3A 4L4UA 2R6GA 4Q4JA 5FL3A 2PT7A 1PVOA 1BO6A 4E09A 5CDFA 1KK1A 4DEXA 5D3QA 2D3WA 4D0GA 2XNDA 1Q21A 2DY1A 1R8QA 3B5JA 3CRQA 2QORA 1JAIA 4IHQA 2V1XA 3GJ0A 4P33A 4A9AA 2WM9B 4QC2A 2G77B 1NN0A 1VCIA 2PLRA 1RC8A 2OFWA 5JSZB 1RRCA 1GUAA 2BV3A 4RFSB 1XD9A 4ZI3A 2J1LA 4DCTA 5G53C 1R2QA 4EQ6A 5C2JB 2WWYA 3MAAC 1VIAA 3H1TA 1ZIPA 5EUQB 5FPYA 4C0HA 1KSJA 4C2TA 2BIFA 3QOFA 5DH9A 2AFIE 2ZSEA 1ZCBA 3MWJA 2QNRA 5EUMA 3GLHB 3I92A 1OYYA 2H1LA 4B33A 4XVRA 4DSTA 2O0HA 4IOMA 2R6AA 1UPTA 2Z83A 4HEJA 2IYSA 4PANA 1E4YA 2EVWX 3FKQA 3QJYA 4C30A 3R7WB 3OEHA 1GRQA 2QAGA 2FSIA 1IJFA 1XTQA 3RRZA 1GIAA 3AF4A 3E1SA 5CK4A 1IY1A 4RCYA 1YVDA 2AK2A 2A5GA 3U4QB 2V55B 4KODA 4WXRA 2AXNA 1Z22A 4CVNA 2PZFA 1QVAA 5JEDA 3FE2A 3KXIA 2XSZA 3TR5A 2VSOA 3FHTA 4TYPA 3HDTA 4LYAA 1LB1B 1Z08A 2C2HA 2OCYC 3CONA 2OCBA 3NVAA 4MGIR 5JJIA 2IX3A 1YZLA 2AR7A 1P2TA 2JCSA 2HXSA 4EAQA 3TUZC 1SHKA 1Y3AA 2V4ZA 5EZ5A 2P3SA 2DYKA 1G4UR 5DE3A 1U0LA 2ZRKA 2WHXA 4RKEA 4TSFD 1X1SA 4TL9A 3GEHA 1E0SA 1G4AE 1UFQA 4BLOA 3T12A 2IS4A 4Y0AA 3EG5A 1WF3A 4GI7A 2GXSA 4WZ6A 2BM0A 3C5HA 2ZS8A 3TRFA 1A4RA 2QT1A 4UKDA 4HDQB 1XD2B 1E0AA 4KITB 2AKAB 2X77A 2Z6VA 2IYYA 4OHXA 1COWD 5EXTA 4NYMQ 2I1VB 4LWZA 5P21A 3LFUA 4ZDWA 2I1QA 5L3VA 1YR8A 3SN6A 1GRNA 4RZ3A 2GJ9A 4MITA 3UANA 1QHHB 5L8VA 1F3OA 3NC0C 1ZAKA 4QGAA 1OFIA 3UATA 3WNCA 3I61A 1M34E 3KQNA 4JT2A 5JWHA 1K6MA 1P75A 2G3YA 5FUYA 3LLMA 1E2LA 1JBKA 4DT1B 2NZ8A 3GMTA 3FYHA 2QT0A 1QHXA 2VP4A 1P61B 3BJIC 1XRJA 1SGWA 2PH1A 1OJLA 3IBGA 3TVTA 3VHLB 4LBVA 1UEIA 1P60A 1VG9B 3EZFA 1MV5A 4V0OA 5CLQA 1ZUNB 1AS3A 5EE5B 3VR2A 2J0VA 1NBMA 3A4LA 3AUXA 1M2OB 3WXMA 3T5DA 3CNLA 4PPGA 2YC2C 3RSLA 721PA 4ZDIA 4WA7A 2PJZA 4EDHA 2FFAA 5JCZA 4N1AA 3T1TA 1F6BA 2CXXA 4OI0A 1T3LA 4UJ3A 3IGFA
chains in the Genus database with same CATH superfamily
1BD4A 1Q14A 1PWHA 1TQ6A 3A04A 1U1FA 4HTAA 1PTJA 5F9FA 4MZXA 4ZK6A 2O19A 4ZVSA 1FYXA 1J8VA 2R79A 3A2NA 1JG2A 5HBRA 1GRCA 1KDTA 3OFSA 3VNQA 2Q5EA 4CGZA 2LVBA 2JJ1D 5GY7A 2YWFA 4I3GA 1AT1A 2BFEB 3D4NA 3RAFC 4BGIA 3QEOA 4XB6B 3WYNA 2QBYA 1DOZA 1T8SA 2J6IA 1U1CA 3HR7A 1DX4A 1KI6B 2WNSA 5HPYB 4C2AA 4BP9A 3SJUA 5L3RA 1C9MA 2N47A 5B6JA 2D8MA 4PYOA 4YP9A 4W5WA 3N5CA 3A26A 4I36A 4PAOA 2B7CA 3CLRD 4B8YA 2OZLB 4YHBA 2ZXFA 2G83A 5GM1A 4WKPA 4NYIR 2Z5VA 2QWXA 5CVEA 3CJTA 2MMCA 2CWDA 4H1HA 2VSYA 3CBQA 3NETA 3TL2A 4ZOLB 5FPTA 3ZE1B 3OZFA 5CDTA 5JYBA 2BE9A 2G9QA 3MJRA 1IAQA 5B1DA 1I3LA 2WSMA 4P5EA 4JGBA 5ELLA 1KTVA 1QGUA 3STUA 3OZGA 2MIIA 3D7MA 4MA5A 5JNLA 4NMLA 3E9CA 1KNXA 1Z18A 2C8VA 1YR3A 3T3PB 3VV3A 4ESHA 1JPUA 3A10A 3FPKA 3SIRA 2X4GA 3O9ZA 1HG0A 5CPFA 5DHQA 5AD1A 1EFRA 4MUMA 1RMQA 1U28A 2CL7X 4XX0A 1YD7A 2IPAB 1L4BA 5F9MA 1WQ4A 2ADMA 3M33A 1FQOA 4G01B 4JLUA 1U9IA 4PAWA 5I7RA 1LLFA 2Y0PA 2K87A 1L8XA 1ZKMA 4AG6A 1MV8A 4G1UC 5D6NA 5C4GB 4UM9D 3UNXA 4L2IA 1BG6A 3AHIA 4DLTA 1B0ZA 1SOUA 3FPJA 5DT9A 1L5FA 1FQKA 1FSSA 4MRSA 2LP4Y 3O73A 4MUKA 4DUZB 1GL7A 3LM8A 1V8FA 1TEZA 5LA6B 2YZNA 1U81A 3ND6A 3JQ8B 4H18A 4PYIA 3T34A 2EEZA 4RLSA 1XMXA 2ZZKA 1ZJJA 3B51X 3UO8B 1KZ9A 2HMAA 4HWOA 4D3ZA 1MUUA 1PJ2A 1U2DA 3M82A 4YWHA 4C4ZA 3FVTA 3UJHA 4FFRA 2BT4A 4O4LA 5FORA 2O3UA 2PT6A 1ZS9A 1NMEA 4RJ2A 1M1ZA 4DC9A 1WETA 1OW3B 2GPSA 3BHMA 1S89A 1OAAA 3MLAA 3HL0A 2VK4A 3NP7A 4Q4LA 4DLYA 3I2JA 3VR3D 4EM6A 5DW3A 1KQGA 1XVAA 2BGKA 3AERB 3NVDA 4X6UA 4A3SA 5FXMA 1D4FA 1WPXA 3AJ9A 3LG2A 4US0R 5ELMA 3OCWA 4JL6A 3IP1A 4FXOA 3R74A 3NV9A 4IIFA 1B7GO 1Z2EA 1TZCA 4YGXB 4CMCA 1I10A 1YE5A 4IX9A 1TJ3A 1M1XB 3KEFA 4FPXA 1P6UA 4DDHA 1P4AA 2YOHA 3MHPA 4N4AA 5CYPA 5FA5A 2OPBA 2JGLA 1QANA 1A9OA 2G4CA 4I5IA 4WLEA 3R5TA 3GA5A 2O59A 1Y3IA 2IEDA 1JECA 1JPVA 4KMMA 4GW3A 1PTJC 3O38A 1Q83A 1OXTA 1U7PA 3VJKA 2QPLA 3RH0A 1O3YA 2J9FA 2XOKA 4IR7A 3V7FA 3EZ2A 3ZDAA 2VPZA 2REXB 2GCIA 1P72A 2CMFA 3QNMA 1DP4A 4Q93A 3C70A 3RVJA 1L8OA 2BHLA 2R47A 3RSOA 1CCWA 3ZE6A 4ZT3A 8AT1A 3KE8A 2F17A 5TGDA 3K70B 1TDJA 2JFHA 3D8BA 3ZKWA 2VHJA 1OZAA 1F06A 1NLUA 3OMLA 4E14A 1YS7A 3V8BA 2P9QA 4UHEA 5A4KA 2JRLA 3NHUA 4RHFA 1M2FA 5K3SA 2IYNA 2G4LA 3T3EA 4UOEA 3ZJ4A 3VAAA 2IOYA 5DLEA 4PAMA 3UKOA 3PXCX 3V1YA 5JSQA 1MF7A 4BFWA 4DT1A 1EK0A 2CHFA 3ROQA 1H6CA 3LE8A 4HQRA 4DWVA 1UF9A 4UD2A 4HK4A 3FLBA 1Q5PA 2I6UA 1UBCA 3HZHA 3VAYA 4ARIA 3QBVA 4KQKA 5AKZA 3E2MA 2ZUVA 3SFTA 3WMRA 4UULA 1MRSA 5IDVA 1TKAA 2BHTA 4YN3A 2Q3DA 2B6HA 2CCJA 5A3VA 2WKSA 5CAEB 5TB5A 3TO5A 3IC5A 5C7IO 4IW3B 4J7XA 3OM0A 3LQ1A 2GN0A 1VRCA 2PUWA 1CXZA 4DA7A 4BWGA 5JAOA 3AEUA 1R3UA 2M6RA 2JBWA 3S8MA 3FWNA 4B3BA 3ZTWA 1Z4PX 4LZAA 1Y1LA 3T6KA 1PR0A 2X4DA 2R66A 4Y0NA 5F73A 4L73A 1ZI9A 5IW8A 4R41A 1NSFA 1XA4A 2BJHA 2PN1A 2PJRA 1Z73A 3JRXA 1F0NA 3AVQA 3AEQB 3M4ZA 2WZQA 4OF4A 5HQ3A 1W0CA 4M0KA 3CE9A 2XNKA 4O2BB 5AVVA 4TS9A 1D9XA 5CFRA 1M10A 3UBTA 3KQMA 1VHQA 4BJ3A 4XWOA 2XRFA 3CU5A 2CXTA 2Q6KA 2N3ZA 2NYAA 4B4WA 1SG0A 1NOJA 2ZYGA 4TTAA 3J81A 4MDEA 3Q9LA 1N2CA 4DILA 5KPDA 2ISSD 4OL0A 3EA4A 1TYAE 1VB5A 2B0CA 2WJGA 1P80A 1OE0A 2EIXA 2ZBEA 2Y0EA 2WJPA 1U2DC 2X6QA 1U8EA 5HJ2A 4RZUA 3ROPA 4YRRA 3SHVA 3WLRA 2PL9A 3WWZA 1N6PA 4R1TA 3M6XA 4MV8A 1AF4A 2ZPAA 5AJTA 3TIXB 3UENA 4CJXA 2O8FA 1O03A 1RQPA 3I09A 4EKYA 1ILWA 1IOWA 1M2VA 2QTVA 3F9IA 1FP7A 4G5HA 1A96A 4KRGA 4R2KA 4CIYA 1K27A 2QD1A 2WD9A 4IOJA 1SKAA 5CA1A 1AQYA 2BDEA 3C1AA 2NTJA 4BNYA 3EJWA 3VM6A 4HWKA 3C87A 4POAA 2QRQA 3U3MA 2IHBA 4D5EA 3LP5A 3O93A 3HDQA 4AKEA 3I2YX 5IBPA 1U9YA 3GLTA 3FA2A 3KLOA 2QSYA 3RO7A 1R0ZA 4LNUB 3VH1A 4R8MA 4I5EA 5LKAA 4XD7D 1N3IA 2YV2A 5CXUA 2VT6A 3CKMA 5GZ3A 5D7NA 1U99A 2DLNA 1A9QA 4B8ZA 3PXDA 4LC0A 3ZCQA 4RA9B 3LGSA 4QWMA 3RS4A 2BEWA 5A03A 3ZD7A 4UTPA 1X77A 2HGSA 3PNYA 4GC5A 4DE5A 4U4AA 2RHGB 4BFTA 3RVNA 3TRKA 1PZHA 2DUJA 2FKAA 3SEQA 3V8VA 5JH7F 1A98A 3I4LA 1AA6A 3G68A 2OAP1 4YIKA 3WOVA 5KYWA 3WKBA 2AVDA 4V0QA 4YACA 1MNAA 4C08A 1Y7IA 4LBWA 3DBLB 3VOBA 1B42A 2NV0A 5GAJA 4D3SA 2H7XA 1QK4A 4TL8A 2I0FA 5IUNC 4TWJA 2Y05A 3CZ4A 1ISSA 3HCFA 4R2HA 1SCKA 4NBKA 4A73A 1I51A 4NOMA 1OIWA 1EX1A 4ZRNA 1I7QB 5E7IA 1C30B 3LQRA 4BMSA 2GESA 3ZKAA 1LSJA 4JEUA 5DTIA 3DL2A 4BNHA 2HHCA 3CV3A 4XPIA 4CDMA 2RHOA 2XUJA 3RADC 3HKBB 3FOFC 4HUQB 1M1NA 2O2XA 3LUGA 4U63A 2N0SA 4M1TA 5FADA 1FFGA 4X24A 1JA1A 3D8HA 2VDKB 3MUOA 1X38A 2DR0A 4R8SA 4DCVA 5AM2A 3FPLA 3H7IA 4O6VA 1IZYA 2I3ZA 3S7ZA 3CQ9A 1KHTA 1US8A 5HEKA 8MHTA 5FBZA 1EFTA 1MQSA 2B69A 1VI6A 4GLLA 5K0TA 3ZU3A 3KVVA 3DFKA 2QRGA 4DRXA 4P7GA 2JI7A 1SD2A 3F7OA 1X7YB 2HOQA 3FNHA 2I4NA 1KVUA 4NENB 5HKLA 4D9CA 3SI7A 5IMSA 4NBSA 1VJRA 1NA5A 2OCXA 3N2ZB 3OQHA 3ONFA 4C4AA 1E3MA 1SVWA 1Q15A 4EL0A 2IS2A 3EQ8A 1YB7A 4RS4A 5DDIP 1E63A 5JXGA 2PGAA 3DTNA 4ZEMA 5FOTA 4YJFB 1QZXA 4FN4A 1FFSA 3ENNA 2VUIB 4Q4HB 1QFSA 4B31A 1U0NA 1E1YA 3CZPA 4EGJA 3W5CA 1AQIA 3K4HA 1G8KA 2HPVA 2O0MA 4RENA 4M0UA 2CMDA 3GH3A 4DA6A 3QHPA 1HE2A 1LPPA 2N75A 3OQ1A 3CUYA 1P4RA 4QZVA 2BEVB 3PNVA 5HFJA 3OEYA 3RK1A 1XMOB 2Q4OA 4ZZIA 1A5SB 2C2GA 3L6DA 2I54A 5PNTA 5EZSA 3W7AA 1IEVA 1TX4B 3GFVA 3OURA 5JR3A 4ETIA 4DUGA 2WDZA 3EF1A 1H9AA 1QGZA 5JLAA 4AG5A 1YQ9A 1PJ4A 1Q20A 1KEUA 1W44A 5CIWA 4V0SA 5I7AA 1IDOA 2FWRA 3KL2A 4W8GA 1BJTA 4PXSA 1KEZA 4GPAA 2JH3A 1IWBB 4IDDA 5J9FA 4QLBA 4FBMA 1U5BB 3FPSA 5AXCA 4BE7B 2HBZA 4EQ6B 4M1QA 2IFTA 4F85A 1BEUB 3S2EA 1WXEA 4DW8A 5ITVA 1JFVA 1QFZA 2XWQA 3TLXA 2ZJ5A 5ICGA 4F7WA 1AG9A 2ZCUA 4B35A 4BX0A 1Z4QA 2QX8A 3JAMA 3T0GA 4JYMA 1H9BA 1YE8A 3KLMX 2B1RA 1O89A 3WLAA 4FFWA 1HDEA 4RNDB 1SUPA 2OBMA 5CK5A 1IHYA 2JIZD 3VJRA 1E99A 3JQCA 3LHKA 2XD9A 4FR0A 4E15A 5ITWA 3RHTA 3I1IA 2YS6A 1G59A 1ENZA 4LZPA 3ZLVA 3GOQA 5D3MB 1FNMA 4UOZA 1E7RA 1LBQA 5CDYA 1GNQA 1VTKA 5FOQA 1AO0A 3BUSA 2D1SA 4YJKA 2P9HA 3FZGA 4LJ9A 2XBUA 3HR4A 4TN1A 3VDXA 2QAGB 4I0WB 3R6GA 2A57A 1Y3BE 1KMHA 1R4NA 1Y3FE 4Y1RA 3OPQA 4NS1A 1ZW1A 3LYUA 4ZCIA 2YHUA 3KSRA 4UEQA 2WQ7A 4OG2A 1HLDA 3GMDA 1KWKA 3HV0A 4GH5A 3GCDA 4FYXA 5CFQA 4ES6A 1EUYA 2P4UA 2GA9A 5C9ZA 1OFVA 2MSWA 3BULA 4MIEA 1OLOA 5EIBD 3DT6A 1JR6A 2H48A 2VF5X 2K7ZA 4KPYA 4YAJA 4KXNA 3FH0A 3ZCTA 4PNZA 2IYPA 2O2JA 4LZLA 5E7QA 4XEUA 1HETA 3LCCA 2R60A 2JLQA 1DX9A 2HSGA 3I52A 4J91A 4XLTA 3HXQA 3NHLA 2ZIEA 2H5JA 4JJKA 3P2YA 4PPNA 1YR7A 1OWPA 2WIAA 5B7NA 3ISVA 2IELA 1O94D 4KNVA 3I3OA 4QOSA 4WZBE 2ZUTA 1HX7A 2UZ3A 2C29D 5HF6A 5BSHA 1PWEA 4JODA 5JI3E 2C78A 4IVPA 3I28A 4RHEA 4WIAA 4DQ0A 3LDAA 1HL3A 1M83A 3ZE8A 1SCNE 2XB9A 3ZVRA 1JKFA 3HA2A 1D0IA 3Q7QA 2BISA 4OB7A 1Y8QB 1MAUA 4PSUA 4EY3A 2YBEA 3W5DA 5JNSA 3MT8A 3TSAA 1TEHA 3MIIA 1Z36A 4PFJA 2GN9A 4JBYA 3PGJA 1OSNA 3MRSA 4AJHA 1QYRA 2B3TA 4U7JA 4M9RA 4EYKA 3C4JA 4PGAA 3FDZB 4NULA 2PMEA 1PJSA 4K6FA 1X7XA 4GR5A 4JLDA 4DKXA 1FXWA 4UHJA 2DUMA 3FUCA 2WIGA 3I58A 1SXJC 2VK8A 3DDCA 5FO1A 3RTAA 1PCXA 1FUYB 5EQDA 1EG2A 1R0YA 2Z9DA 4NHOA 1J0AA 2OXIA 3JYOA 3ME5A 3GT4A 3H8WA 3M6AA 5DBIA 1L2TA 1CUGA 1HT0A 1QIJA 2EXXA 3A1DA 4CUZA 2RAFA 4CXMA 1XWWA 1QLWA 1N8SA 3WLFA 5TJ9A 2UYOA 1ZK1A 3SYMA 2SCUB 4CT5A 2QTGA 4W1PA 3ZE2B 5JXWA 5K20A 4MWGA 4O63O 3R0ZA 1ICEA 3RARA 2CVZA 4LFBB 4PGFA 1TO6A 3RT7A 2ZB2A 4ITRC 3W1EA 1S2LA 4B46A 1P0FA 2JD1A 2QTMA 1LY1A 3MTQA 1STOA 1RKQA 1T36B 2OHHA 2ZDHA 4KP7A 2EW2A 4B85A 2ECQA 3GLUA 1YGYA 4BU0A 1QS0B 1Z0FA 4B2YA 5BXQC 2ETXA 2V54A 4F92B 4Y2JA 4IOKA 4GLFA 4O1MA 3BSFA 2FA9A 2FEMA 2W2VA 1FRVA 5K8IA 2O7NA 2HO5A 2WB4A 4I1SA 1E3WB 4AY5A 2IPMA 4OQDA 5ALDA 4BN5A 1G60A 2ESRA 4OU5A 5I9TA 2DTXA 1NVVR 1UC8A 3N8DA 3L6OO 1Z07A 3UOAB 4CKYA 2IPOA 3FVWA 1WR8A 1HMPA 2OZKA 1G55A 3BMXA 3V7UA 2PKCA 1YB6A 1YS6A 3I62A 1DRKA 4U7HA 2VT3A 3CH6A 3UH1A 1QFMA 3C6XA 5K2OA 4BGUA 1SKYE 2WMOB 5KYUB 1IM2A 2PLFA 4EG6A 3K7EA 4P4NA 3WLTA 3ZJTA 1DTWA 1EE9A 5LQKA 4AMVA 5A2GA 1PWXA 3KU1A 4QQFA 5AIBA 4TRRA 5C34B 1QTRA 1RQ2A 2NZWA 1DBPA 3GVXA 2BL4A 3OEED 1QRSA 1CV2A 3HP7A 2ZJOA 3A4NA 1Q57A 2H1WA 2Y0CA 5CFOA 7REQA 2WQ6A 4YB8A 3K6KA 4TTQA 1Z6YA 1TAQA 3QUSA 1R4ZA 4MYTA 1D2AA 3VR6H 5JAMA 1OWLA 1XNRB 2ECPA 4BO8A 3IJEB 3HXKA 4R31A 1EU1A 2KB0A 2F9FA 3T9CA 2ZGVA 2ZYHA 3BMCB 3EUFA 1IN7A 1TYBE 4YCCA 2CB0A 5EHZA 1VJ0A 4WLVA 1ATZA 3GH1A 1QX3A 4B79A 1SCDA 1W25A 2XKJE 3OPMA 4WESA 5G0WA 1N0UA 2PS1A 5KYYA 4M89A 5E6UB 3ESQA 1IOZA 1AB6A 3ROGA 2CNKA 1L4GA 1YXMA 1FFBA 4F93B 1NR5A 2HK8A 2NTEA 3UGQA 1CB0A 3EUAA 4P7BA 1P45A 3T4EA 4EWLA 5BYAA 5J2UB 3Q11A 3W3ZB 2ZB7A 4QDUA 4DNXA 2OBBA 4BE4A 3O8OA 4CF3A 3FYCA 5IYZF 1ZQ1A 1H0KA 1N7GA 2CXUA 3DZDA 3IV6A 3U2QA 1Y98A 4EG0A 1N5KA 4IZOA 1Q11A 4MSUA 5BWMA 4L76A 1HZZC 1UXHA 4GM1A 4JT4A 2EJCA 4Q16A 4V3CA 5M2QA 5HVNA 3D8NA 3V4FA 2ID4A 1BRTA 1KXZA 1D2CA 4G9BA 4K88A 1UJBA 1H2RS 1JG1A 2WYVA 4IKEA 4RBNA 3VH3A 4D4KA 3R8XA 4B7AA 2V9PA 5EWJB 1VGRA 1JFFA 1KY3A 5ADVA 3U5ZB 2E4XA 3HDHA 2GNPA 1KE2A 4M98A 5I9NA 1Z5VA 2EW1A 2WZDA 3ZDXB 4RFVA 2PAFA 1FCJA 2AXPA 3EH2A 3R09A 1T91A 1TCUA 1TZMA 3GJ4A 3N75A 4DHWA 4URXR 4IP0A 1EBBA 4J29A 3RRBA 3Q8MA 2XEDA 1IPFA 1WMFA 1DUVG 4AKSA 3I5XA 2NSJA 5EE3A 2CWWA 2GFHA 2VF8A 1U4NA 4Q3AA 2QRHA 5C8YA 3AF6A 2J46A 1S4QA 2YOFA 2VDUE 2YV5A 3HVIA 4I46A 2OOKA 4X54A 5BSWA 1P4GA 1W34A 4ILKA 3VU9A 5JHHB 3M1LA 4HQ0A 2GHIA 1FF9A 4N8EA 1N8TA 3CUTA 2MYNA 4FBGA 5ALWA 4BCDA 1KYXA 2WTAA 3N05A 2BFMA 1IEXA 3MZ0A 2ZI4A 4C07A 2CV0A 3SHWA 1KZGB 2Z1NA 3AW8A 3JQ9A 4ZQGA 3BB1A 1K3FA 3WL5A 5D5QA 3MD0A 4PNHA 1BU8A 4YJHA 3R3ZA 2J7PD 3KYDA 3PR1A 4QU8A 4BNTA 4R84A 1NQVA 3H1FA 5EESA 1GPH1 2WYUA 5KC8A 4RTLA 3T8YA 4HT3B 2XMSA 2IE8A 2NZVG 3E9RA 2YNMD 4D80A 1R16A 5GIPE 3FR8A 3HI4A 4HG2A 2ZSAA 3K4QA 5FTLA 2CW5A 3CVWA 4NDZA 1X39A 5IEJA 2ZJAA 3DOJA 4U1RA 4ZK2A 1ZZEA 4OATA 5JALA 4EVQA 2D74A 5KEIA 3QK7A 3EVDA 4XCXA 3SEZA 2CV2A 1T2VA 1T9BA 2AQKA 1GNRA 5E7JA 2DWUA 5DNVA 4JI0B 3QH4A 1NJ5A 1Q16A 3NS7A 3HN7A 1V8BA 4MQ5A 1JV2B 3OHPA 4IV8A 2HA6A 4NAVA 2P6NA 4NOJA 3UF0A 2GPJA 4OSOA 4BFLA 3IAAA 3TS1A 5EHGA 3HA3A 3LFHA 4UM9B 5BVHA 2OD7A 4GOXA 2E9SA 1ULAA 4TKLA 3WAGA 3ZNPA 4HNAB 4A6PA 1H65A 3QUBA 1JG7A 2WT9A 3N3AC 4JLNA 2X0EA 2IBTA 4Q9HA 4BJ5A 4CT4B 1Y7LA 1ZW6A 3BIJA 1GADO 3K2QA 2ZTMA 3UK2A 4MB2A 2JGEA 5IKOA 3TQHA 5H9WA 5J3JA 4W5JA 4LMBA 2LW7A 4OHWA 3X1YA 1Z5WA 1LLDA 4OJMX 2NUAB 5LZ5A 1BHO1 2BFCA 1P7CA 5TLSA 1TM1E 4JEHA 3TTYA 2XDWA 2LCIA 3DLTA 1ISHA 3G7NA 3T7EA 3I23A 3EXIB 3OCXA 3BXEA 1SA0A 5CFMA 3L6BA 4U9IS 2X5JO 3DVLA 4KEAA 4KI0A 2FUEA 4O25A 4TXHA 2HEGA 3A1WA 3YASA 2GYYA 2HUNA 4R69A 4RD6A 1Y6RA 3USCS 3NHYA 1Z5GA 3HLKA 2QRJA 4PG6A 3IT0A 2Z5GA 4B84A 3BHJA 2LZ0A 1J7JA 2EW8A 3FXAA 1VMAA 1E2DA 3GIWA 4JLMA 3WIUA 1TCCA 2BFDA 4AQ7A 4PE5B 1SMKA 3ZD8A 2HK9A 3PHGA 1HT2E 2FQXA 2NSDA 1JIXA 2DEUA 1N4DA 2H8GA 2IYRA 3MOSA 2BFOA 1OT5A 3DDUA 3IJPA 2EC5A 5IKMA 4CEJB 4C5CA 2DKOA 3QRWA 5T4FA 3FYSA 3M4YA 4RZIA 1ZVQA 2BUBA 1J1ZA 1ZA2A 3CF6R 2JBHA 3WK7A 3ZLTA 2F43B 3PUVA 1OVGA 3BEOA 4EB8A 4LXHA 1M5UA 2RHTA 3HKDA 3P7MA 1PT6A 3NGXA 1RLJA 2DBVO 3OZCA 4FEGA 5CLGA 1GZDA 1L8LA 4C4XA 4BO2A 4YQEA 3QVGA 3JARA 1DCMA 2Z2XA 3W3AH 2YL2A 3GP8A 2QJRA 1DQSA 5JQGA 2BKAA 4MW9A 1KDRA 1TD9A 5HUJA 4UHHA 1JDBB 2BF7A 2KE5A 3JQ9C 3MILA 2V59A 5JZSA 3IDZA 5AYVA 5HHTA 4AP9A 4ZZ0A 1E1NA 2NU7B 4ZT5A 3T7AA 3F3KA 2Z8YM 1C1DB 1N1GA 1OBHA 3QKTA 1SBTA 3DV2A 1ZL2A 5H9VA 4EGCB 3F49S 2ZBPA 2SHKA 3WGYA 2B7LA 2XVYA 3PF8A 1JIIA 2WG0A 3G8CA 4G25A 5LPNA 2HB6A 1RHQA 5MHTA 2NYRA 3G5LA 2PG3A 1V5EA 4MLPA 4J2OA 2H2DA 4R83A 3TECE 1MOPA 4XAQA 4CEIB 4QIHA 3DVAA 3HCRA 1EINA 2QL7A 1JGTA 4O33A 1YZTA 2O5CA 4BV2A 1TU0A 3CEJA 3DO5A 4KE8A 4UBIA 3VYVA 1DJLA 2H1IA 1RKBA 5KX5A 1TKRA 1RI3A 3AFIA 1OAOA 3ZVLA 3VX4A 4ZOEA 4L4XA 4N41A 1F0YA 4WV3A 2IXBA 5L3QB 3MRVA 5IFLA 2GHTA 5AW7A 3F74A 1F48A 4KB5A 3VPFA 3HBLA 3MEQA 5LDDC 2R11A 4RCVA 4XJTA 3PD0A 2JLZA 3BKXA 3L02A 1CZRA 2WWFA 1KDOA 3B6KA 5BN4B 5TGZA 3U09A 1WMAA 4ZWNA 5DYNA 4AUNA 1P73A 1J5PA 3PCTA 1YIAA 4IX1A 2H07A 5A1TA 2H2HA 3U80A 4TWRA 1KNQA 2VHCA 4R0NA 4CRWB 4Q05A 1F6DA 1OHHD 2B83A 2MDTA 2IZ7A 2HT6A 2OB2A 3A6GA 3DOEA 3TFQA 3GUUA 2BGWA 3ZDCA 4NP6A 3TL3A 1Z3IX 1KOGA 3ULKA 4GX5A 5C3UA 1GKIA 2UAGA 3GFTA 1SRQA 1U8UA 3LVRE 1K2VN 3JQBC 1MGOA 2D2EA 4PG5A 3RVBA 5BSKA 1T0HB 2BM1A 3FMFA 1E20A 4JI4B 1BWQA 4HYTA 5DI3B 4I08A 3DF7A 1NMQA 2FPXA 3CG4A 1GL6A 2XYRA 4WKCA 3X43A 4BP8A 1T3ZA 1WCYA 1II8B 1RAEA 4HGRA 4BNDA 2H7YA 2C92A 1OBFO 1VLZA 1MLDA 3D02A 4LJ5A 1SAYA 3IKLA 4U02A 4ZTBA 1RZUA 4QPCA 3WZ2A 3ND5A 4B32A 1GZSA 2FOIA 1LPNA 3IFSA 1HWYA 3DE2X 4PCLA 3KEGA 3QZUA 1C9YA 1LX6A 2BZGA 2FUG6 2HWYA 3PVSA 3ZYZA 2E6KA 4FGWA 1I1QB 2FRXA 1DADA 1FVHA 3IAM1 3DNPA 3KQOA 1RD4A 1H2AS 2J5QA 4FVTA 2VPYA 1FDTA 4IFEA 5EMMA 4KLAA 4EOGA 1J5EB 2GSWA 1H1LA 2CNLA 4PSVA 2FSGA 2HL6A 3QFTA 4L0DA 3BRCA 4BOYA 2WTEA 2FE1A 3PEWA 2VZLA 3IXLA 4E4YA 1GFWA 1GTSA 3RTCA 3VYWA 5FHRA 2J6BA 2A1TR 2ZRCA 3SJBA 4IDAA 3D4OA 2O20A 1V95A 2GCOB 3FWPA 1NG1A 4YXFA 4DDKA 2D59A 1ZRSA 2WOJA 3MTEA 3NATA 3LYHA 3NNDA 4AY2A 1RPAA 3IEPA 1E3JA 2VYVD 3LY8A 2VR1A 1UL1X 3OE4A 4XGQA 3ZZMA 3QEBZ 3ADCA 3NBXX 4QULA 1Z7WA 5C0OE 3JQ7A 3KIPA 4KAXA 1YQEA 1YB2A 3L7DA 2FFQA 3ZCRA 4E11A 1KPHA 4KRXA 4NARA 4UHCA 3L6UA 3VV2A 4CBVA 5FA8A 1ZICA 4EJ2A 2RI6A 2ZYUX 3FTNA 3G9QA 3V4ZA 3ZWVA 3OBBA 4OP1A 1UXJA 1ZK0A 2OD9A 2ZRJA 1AOXA 5SZHB 2AG6A 2A9PA 5C7OO 3BG5A 2QTNA 3K73O 4XYBA 3G1UA 1ITZA 3ZWMA 4KMOA 4H4EA 2EFDB 5GVSA 2P9CA 4RKFA 4UUAA 4DV1B 1P39A 1NI5A 1U3DA 1DKOA 1PK8A 1XEFA 5BW6B 3FD8A 3M1AA 1OXMA 1WXXA 4JLPA 5A6VA 1O95D 1OAOC 1X92A 1FYVA 1ORVA 2UVDA 3L4SO 4LHXA 4K7JA 3STVA 4P4LA 5JE8A 3C1TA 2JLCA 4IDQA 3RGGA 2Q9CA 1JHMA 2ST1A 3NWBA 1JYEA 3Q9NA 5K0EA 2YWEA 4MW0A 5SV2A 1NULA 2F1KA 1R4AA 4I3HA 3RYHB 4KR3A 3BGWA 4JBXA 4LWPA 5TDHA 1KI4A 4H35A 4CG0A 3F5DA 3IEKA 4UPEA 3S70A 4BGDA 1H6AA 1ZM2A 1A1VA 2ISCA 3FOAA 2ZT6A 4M53A 2MJLA 1RJEA 4L3OA 5CT8A 5D84A 4MV3A 4B2LA 3HPQA 1EG7A 3KB2A 1YJQA 2BEUB 1JIJA 5F1PA 2DXIA 1TB4A 5DX1A 4YMIA 3LPCA 5CA0B 4N39A 2XQIA 1JXOA 5H8WA 1TFRA 2XA9A 4MUIA 1PV2A 2VOJA 3LX6A 4R5HA 4TQUS 4UNQA 1IQUA 4H2DA 1I2BA 5B5SA 4CIXA 1OFHA 1QVRA 3BYZA 1DOAA 3MT7A 4R05A 4XQEA 5EPOA 5SYAA 4HDMB 4P7FA 3SLKA 3WY9A 4GPTA 4IUYA 5AESA 4JZKA 3D2BA 1P2GA 1V3TA 2HFJA 2LE0A 4KE6A 4MQFA 4Q7LA 4XXHA 1W581 3LOPA 3FCSB 4DR7B 1YUMA 4URZR 2G28A 1GCIA 3NWJA 3O3NB 1V4NA 3C8DA 2G1AA 1HNNA 5TE9A 4EJSA 5LBTA 3CUWA 1LK7A 4P86A 5FPHA 3EHEA 4W4TA 1POXA 1Q7BA 4MO9A 3IXMA 5HJEA 4YRNA 2IA5A 4YR9A 1ZIDA 2FDCA 4DCNA 2PX0A 3RS3A 2WJHA 3VPGA 3ESAA 3KB8A 1MO6A 3P4UA 2NWQA 4KX5A 3NMUF 2NAPA 2I4OA 2HEIA 1DHTA 4FR2A 1RSZA 5CIYA 4YJ2F 1S3IA 5IJ0A 4IZHA 1JR3A 1EDEA 4G4SP 4JJEA 1ESCA 2XYHA 3KD3A 3IQFA 4JXXA 2BKEA 2JS7A 3OQ6A 4AJOA 2QP9X 3NG1A 3IDOA 3UAYA 3OU6A 4FFMA 3RFCA 3WMWA 3AXSA 4XJSA 2QLJA 4DQLA 4BO3A 2UUOA 1ETUA 2QL9A 4XIYA 3SKVA 2XV1A 3MBKA 4UDXX 1PW5A 3SYNA 3D4PA 3ZXYA 1QYCA 3B3GA 3DE6X 3K0EA 5A3JA 5REQA 2J3QA 2J08A 2OBLA 4YDHB 4XJVA 5ALRA 2ZM5A 4CM8B 2XYVA 3NP9A 4EF6A 2ETVA 1CJSA 3BL5A 4QREA 2DCMA 4U2BA 3L8YA 2P67A 2HSEA 4DDVA 5CEJA 4KQHA 3B7PA 1I3KA 3K8ZA 1J23A 1ZN8A 3U17A 3ZGZA 2Q0SA 2WSLA 4PIVA 2Q7XA 2BGUA 2JGNA 3GPCA 1ZM9A 4ZT2A 4C0QC 2J0UA 1BVHA 4IMPA 1RXIA 3PHIA 2WFAA 3H18A 4R1OA 3MK31 4BMOB 5DI9A 5BN1A 2H4JA 3AI1A 4WPGA 2QTHA 4NE2A 4CNBA 5JMTA 3VRHA 2K6GA 4PC3A 4XUEA 1M0TA 1VYVA 4HFJA 4IHJF 4IIVA 4ROSA 3BWDD 1P2VA 4FE7A 5LNK6 1GUBA 1CVLA 5CGQB 5CX1B 5J4VA 1TJPB 2DFLA 1WLSA 4XZ3A 3U19A 2AG1A 4AMYA 3PE3A 1L7OA 1YDMA 3E8MA 4IIJF 2JZOA 4M46A 1K6XA 4X61A 1KYWA 2G7MC 1E6KA 2PXCA 1UBTS 4I50B 1U7HA 4BAGA 1RAIA 3VYTB 3G7UA 3DLPX 4D42A 5JNVA 3FLAA 2A9OA 2O6LA 3TOZA 4DSAA 1EX9A 1P44A 1DRJA 5KS2A 1K89A 2Z2ZA 1PQ4A 2PV0A 2XY4A 3DB1A 4XWKA 1S3GA 2BGIA 3JAWA 1RYFA 3MYYA 3D3WA 4HNVA 4ZEWA 2HN9A 2XAUA 1NJ8A 1QG0A 3ZW7A 1JVBA 4QT0A 4LK3A 3TDMA 3U37A 4B6FA 4FZVA 3AUTA 5G4KA 3TGLA 1FFEA 4ESVA 1PDWA 3KAKA 3M34A 1NDQA 2ATIA 1PL7A 1KP3A 4HTFB 4TUYF 5CVCA 3Q7EA 2DPXA 5KCMA 3SF8B 3EC7A 1QIEA 4YPVA 2RK4A 2JGRA 3I6ZA 5EMNA 1DIOB 5H83A 1BE6A 4FMDF 1T3SA 2I3AA 2QUZA 2X6TA 3F96A 4Q1BA 3M81A 4R2XA 2Y1XA 4PC1A 5CVJA 1WG8A 3B9BA 4TLCA 3GLIA 4FEYA 3MGCA 4Q00A 3KKKA 4F2GA 1Z6XA 3WAJA 1ZC4A 5C52B 3Q3IA 3R0VA 4D25A 2MINA 5LOVA 1E6WA 4LZOA 4LC9A 1OLSB 1VKJA 1ZY2A 1U3UA 3CF2A 4GVPA 4OBEA 1ULUA 3DWGA 2RJNA 4Y6LA 4DCCA 2R2AA 3KXKA 1NI3A 2EJWA 2ZRHA 5KKNB 3DNFA 2ATXA 1YBAA 1EFKA 4UNPA 1QYVA 4JC8A 5G1PA 4QOFA 4NCIA 4ARBA 4BBAA 2JLXA 1DAGA 1L3BA 1SJ9A 1UPAA 2YOGA 5LUBA 4Z8YA 5CPBA 5BMVB 2J3DA 4REMA 3NDJA 4DLXA 4Z49A 3V1MA 2ODTX 3KKNA 3PNLA 5TF4A 1ISIA 4N03A 5DNDA 3NANA 4QPDA 5CCEA 2YDYA 5GONA 3HWRA 2OC4A 3UWSA 5FWXB 5FV7A 1PNTA 4HWPA 1K7EB 3NTXA 1E2EA 1F8YA 4AWBA 1SELA 4ETNA 2RHMA 3RYFA 4TVSA 3ADBA 3AKCA 6REQB 1RE1A 3BE6A 1PLJA 3MJVA 5JUWA 3BGSA 3L01A 1DEHA 3NWPA 2XGOA 2VCYA 1WZUA 4PHHA 3BXHA 1Z8NA 3RJ5A 1SCJA 2G6TA 2A5YB 4JVNA 3GW8A 2EF0A 1N7HA 4MI1A 4WN9B 5DYWA 1C7IA 5KZMB 3B2EA 1B1CA 1QK5A 2PUBA 2LWIA 4JDUA 4KVFA 2VJYA 1HH4A 3OSZA 2OCAA 3IMGA 3K70C 1XZIA 3VGJA 2P2GA 3DQPA 3MXTA 3VO8A 1HEUA 3R0QA 3ZWBA 1PYDA 4AT1A 1YMVA 1DEOA 2CEAA 4U2CA 4UU7A 2ECOA 4D8UA 2ATVA 2W2LA 2D1TA 5T4EA 5AKJA 3FOEC 3SSAA 2QVXX 4MV0A 3M6WA 4RE6A 1P5HA 2DPGA 4N82A 2ROQA 3B3QA 1TT5A 2BOVA 4TL6A 3SS8A 3PFNA 3U5TA 2C88A 1Y7HA 4CF4A 4C7XA 1ONOA 1V11A 2ID8A 1LDBA 3B53X 5B1SA 3T52A 2CYCA 1NI4B 1T5BA 5CCBA 1WKBA 1L5HA 4DF3A 4OXNA 2Y71A 4DVGA 3RVDA 2R1VA 2X8JA 3E5MA 2W2TA 4H77A 3DO8A 4BVGA 5HKOA 5JFOA 2VSFA 1R50A 1XTVA 5AKIA 3WIVA 3BDVA 1QO0A 1W4AA 1FX0B 1OMOA 2W93A 5LMCA 1N77A 4MKZA 1TQHA 3N7TA 2LPMA 1RHRA 1G1AA 1NNSA 3I9JA 3OX3A 4MVJG 1NAIA 4OD0A 1JDNA 2XSZD 3QVXA 3T1HB 2GCGA 1CK4A 2R96A 1SXJE 1PGJA 5ALKA 3ZI0A 2PH7A 4Q9LA 5BOVA 3GBPA 1QCYA 2EHDA 4EO7A 4R1NA 2NVUA 1ZMXA 1ZQ9A 3E9DA 3KS9A 2FGJA 4U3JA 4UM7A 3T3GA 4CQLB 4Z4HA 4L7VA 3ZU5A 3D1LA 3K72B 2J3IA 4B5LA 1PNVA 3K8QA 3LO5A 1AV6A 3X1ZA 3BEDA 5AO9A 1GGKA 4OFBA 1Q12A 3IPXA 4EPXA 821PA 1OLUB 1VG0B 2JAUA 1UIRA 5FNVA 5JC1A 4PRKA 3MJEA 2JKZA 1XFAA 2AN9A 1COZA 4DMKA 3AILA 2DFNA 1X86B 3QWBA 4OJNA 2Y1WA 4PLTA 3OM1A 4HGZA 4ARZA 4XRGA 1ZJ6A 2VRWA 4E94A 1G6HA 1SOWA 1MB4A 3AUUA 4Z4FA 2E5WA 4BNJA 4CI9A 1TQDA 4E21A 3L0OA 3P2MA 1G6KA 5DO9A 4CM4B 3UMYA 1W52X 4DDTA 1E1CB 1DARA