2JJ8A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
184
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERCVPLKYLQELHELHEDWLIHPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords DEOXYNUCLEOSIDE KINASE
total genus 66
structure length 184
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jj8A00
3BB4A 3C4JA 4EPVA 1Z0DA 2HF8A 1JI0A 3LQQA 4TQUS 3WP0A 4B2LA 4EAQA 2ORWA 4PHHA 4ZO4A 4Q19A 1IN6A 4KFSA 4B76A 1ESMA 3IO5A 2OEPA 2GWHA 4QJ5A 1HYQA 2WKRA 2QTFA 1VCNA 4XJXA 4KFUA 1L7VC 5SZJA 4ASUA 5AJVB 2W6JD 1TADA 2V54A 2QBYB 3QEOA 4BFXA 4PSVA 4PZYA 2YWFA 4GRAA 1R5BA 1SHKA 3M6AA 3G5UA 1XXHB 2Q0HA 2WAXA 4PQRA 4JBWA 1M7GA 4EIWA 2IHYA 3U44A 1OKKD 1OIVA 2ODBA 4AG5A 4TZ0A 1QDEA 4GDFA 1E2QA 4CEHB 3T35A 4UNSA 5FBVB 1V5WA 2WIBA 3VNVA 2QT0A 2HF9A 1RRPA 3LWNA 5KNBA 1D8TA 2FEMA 3A1WA 1M34E 5E7IA 3D8BA 1VECA 4BZQA 2RGEA 3ZS8A 4ERNA 1W2GA 4I1OA 1YKSA 2CCJA 1JEEA 4HLCA 3TVTA 2EYQA 4FCWA 5BW8A 1E2MA 3EA0A 4JVMA 2DB3A 4F7WA 1UPTA 4JVSB 3LBNA 3RWOA 4Q5IA 5KOYA 5IF9A 1G41A 3FFBA 1Q57A 1G3RA 3A36A 3BFVA 3LXXA 1NN0A 4OJQA 3WP1B 1LY1A 1QHHA 4RVCA 5CIQA 4BFYA 3KFVA 1MO6A 1OT3A 5FFMA 1QHNA 1XCMA 4UNPA 4NZYA 5DN6A 4V0NA 3N70A 4BFSA 4LDJA 1E98A 4TLEA 4MH0R 4WVFA 2ZR9A 4IOMA 1R0WA 2W6JA 3KJEA 1SVIA 5HPYB 1DADA 3AF3A 2ZJAA 5EE3A 5FOWA 2PT5A 2QBYA 2C9YA 2AFHE 4B3FX 4HB2A 3U7EB 4NYMR 1G8YA 2W58A 2YYZA 2JDID 3VR4A 4NE2A 3U44B 1E2DA 3QPVA 2D2FA 5A0FA 3TR5A 2CVHA 2VF7A 2Z43A 3GJ0A 2BMJA 3K70C 2ZQ5A 3B9PA 1E2FA 3GEEA 1L2TA 3H86A 1R0YA 2O0JA 1E9DA 4DLUA 4M8NE 3X1YA 4CEIA 4JL5A 4OL0A 4GP7A 1E69A 3MWKA 2CVFA 2Q3HA 3CUEF 1NVXQ 4C0BA 3TUIC 4QG7A 4NH0A 4OHWA 3IPXA 3B1XA 3GFTA 2J87A 1H8HA 4HAVA 5FL3A 1JXMA 5JFGA 4E5UA 1ZNXA 3PUWA 3RS5A 1ZW6A 2JLRA 3KQKA 4YMTA 1N5IA 3IUYA 5M04A 4UQOA 4Z51A 5EP3A 1FUUA 2YWHA 4J0QA 3FTQA 1ZM4A 2X8AA 5GJCA 1DS6A 3ETLA 1VHTA 3M0EA 1NVVR 1V43A 5AWFC 4DDVA 5HZKA 4HEJA 2IT1A 4X8OA 2BBOA 1CXZA 1HE8B 2CHQA 5FUWA 1EK0A 4KBFA 1KO1A 1ZD9A 1R6BX 2FSHA 2BM1A 1CKEA 3IDQA 1SKQA 2H1LA 1B23P 5C46F 1G7TA 2Q9AA 1ZVQA 3ADDA 5CYOA 2GILA 2BEJA 1XTQA 2AR7A 3AGPA 1Z0KA 2IYQA 1G7CA 2BMDA 1KO8A 1QVAA 1XTIA 2XNSA 3LW7A 3SJBA 5HR5A 4PC1A 2RGXA 3TRFA 2QQ0A 4OQXA 3R7WB 1W4RA 3NG1A 2FZ4A 4OQFA 2GXAA 4TTQA 4NL4H 1S96A 5KPDA 4CEHA 4HB0A 2IWRA 4A8JC 2GZDA 4XWAA 4O3MA 4LV5B 4Q4JA 3BAFA 1Z6AA 2IS1A 4I99A 3RSOA 4KFTA 2C2HA 1VYUA 2QE7D 1N0VC 4RD4A 3B7GA 1KNXA 2QM8A 1Q1EA 2BOVA 1J8MF 4IKEA 1RKBA 3MRSA 3KTAA 2WOJA 3PXGA 2ORIA 1UKYA 3GCGA 2R6DA 4LV8B 3A1VA 1IN4A 1Q22A 3AF4A 4DCVA 5J4HA 3PITA 4KAXA 2WMOB 2C5LA 1XTKA 2ZYTX 2VSXA 3H2YA 4Q9IA 4EKDA 1OYYA 3CIOA 2WJHA 1DO0A 2LWIA 2D7DA 1I2MA 3RDPA 2FF7A 1KMHB 2FOLA 4F4JA 3V9PA 3CPEA 4GP6A 4CZ2A 1VCMA 1IXSB 3CNOA 2CNWA 4IFEA 5E3HA 3LRPA 1T0JB 1VYVA 3LY5A 3AKCA 1K5DA 4W5WA 4WZAE 4QXAA 1P4SA 3MWLA 1Q1QA 1P7CA 4MRRA 2ZSBA 5FBRB 1PVOA 1E1QA 4POAA 2GA8A 2G1KA 1DO2A 3K9GA 4PAQA 4XVQA 2WWXA 1D9ZA 3AVUA 3NHBA 3MWYW 4DSUA 4Q1AA 4MYUA 2O0HA 1G16A 3UK6A 3HU3A 1DG1G 4ASUD 4BPBA 1OB5A 4DC9A 2OZEA 2A5JA 4Q4HB 4TYPA 4G0NA 1E2EA 1F2TB 1SKYB 1UADA 1ZIOA 1PZNA 1QG4A 1RJ9B 4MDFA 1IHUA 3X1ZA 1S8FA 1E9AA 1A5TA 5LBIA 3VR2A 1XB2A 4BECA 2VTKA 2H7VA 4II7A 4LBZA 4M2LA 5J40A 1R10A 5J4VA 4DB2A 2FFBA 521PA 5FL7D 1R8SA 2VHCA 3A58B 4QBHA 4B34A 1XCGB 4URWR 1CF4A 1P9NA 2W6IA 5EXPA 2MSCB 2IUSA 1YR8A 1ZYUA 1SVSA 3ND8A 4BFUA 4OI4A 2WJVA 2RGBA 1TF2A 2IXFA 4M9SA 1AIPA 4JLDA 2XITA 4OK6A 4AKEA 1G7RA 2QG6A 1WF3A 3HP1A 4LYFA 3CR7A 3PEUA 4YONB 5IK2D 4TL9A 1QHIA 3CH4B 4B3DA 3TUJC 1LNZA 4D81A 2ZI6A 1KAGA 3PFIA 3DMDA 1KK3A 1W36D 5AJZA 2HYIC 1OF1A 3LLUA 4LZZA 4BWYA 4IW3B 3N2EA 2WSSA 2VP4A 1GL6A 4G5GA 5E4FA 4DEYA 2C9OA 4LHYA 4PZLA 2QZ4A 3QSYA 1ZIPA 2V6JA 3SFZA 2FX3A 4D0LB 4WA7A 2HEIA 1LTQA 2GBLC 3U6BA 4US0R 3K0FA 2WJYA 3B1YA 1OV4A 3Q72A 1Z3IX 1F2TA 1CR4A 4QBFA 2N1BA 1CJVC 4V03A 2G83A 1FMLA 3T1TA 4CW7A 2OG2A 4DSOA 2MMCA 2OCPA 1FNNA 5KSPA 4BFTA 4GT1A 5FUXA 1RC8A 1FQKA 3KQHA 4NCHA 1ZP6A 1UKEA 2ZU0C 2R6AA 2W2VA 1UKVY 3AF2A 1E2HA 4FMDF 4NU0A 5LD2B 1NLYA 2NIPA 4NCKA 4URVR 1IXZA 4X8HA 1LS6A 1Z2CA 2OBNA 2YJTD 5FI1B 3C7KA 4A0RA 2MMGA 2BKEA 3W5IA 4EPRA 2AD1A 4C9BA 5TB5A 421PA 4I81A 5KPJA 3A37A 4PC7A 3DM5A 2GEVA 3T1OA 2GEDA 4TT3A 3LV8A 4K8OA 4QM7A 1RZ3A 2GAOA 1JR3D 2RCNA 1Z08A 1YU9A 1Q12A 4XSGA 4A6PA 2IA5A 2OXRA 4C4PA 4LCBA 5FR1A 5L3SB 1TUIA 2LKDA 2ZRCA 3GJ5A 5IDVA 2ZUDA 3KKPA 2DYKA 1G6OA 4XVRA 4LX0A 3K53A 1ZU5A 4BRWA 1BIFA 4IFBA 4HYYA 3B1ZA 3FHCB 3RRZA 2BBSA 3QUSA 4GOJA 4RD6A 2IK8A 3B78A 5AUQA 4OKSA 4A2PA 3TIFA 3SU8A 3D6TB 4JS0A 4PQYA 1DTSA 1RYFA 1AM4D 1N5JA 2C03A 2ZETA 5JCPA 4JVNA 2HDNB 1YR7A 2JATA 1VHLA 3ASZA 4DCUA 3ZZUA 1E2IA 1QRAA 2CHGA 5FR2A 2WPDD 4GOXA 3RS4A 2JIZA 3NEJA 4LC0A 1IJFA 4BEBA 3SQWA 3AP3A 4HAYA 3LA6A 3SE0A 1XMIA 2IL1A 1CLUA 4ZDJA 1P62B 1GUAA 4XWKA 3THOA 3L0SA 3MGCA 1Z47A 2CCGA 4GPTA 1Z6GA 1CBUA 2J5XA 2QI9C 2HT6A 3PUXA 1JALA 1W48A 1ZUHA 1W36C 4TWZA 5HE9A 2O8FA 5FUVA 5JHGB 4QNRA 1G5TA 2PL3A 2OT3B 2NQ2C 2ZI3A 1GRRA 4RKFA 2I1QA 1ZM3A 3NH6A 3QXJA 4BZXA 1TF5A 2H92A 4BQSA 4X8LA 2VLIA 4RZXA 2JLUA 4FXPA 1VYTA 1UF9A 3K9LA 4AY2A 2JA1A 5EZ5A 1Z06A 1NJGA 3B2EA 1VCOA 5DHAA 3KXIA 2P2LA 8OHMA 3OIWA 3ZH9B 4Q7JB 1XD2B 2ATXA 3AQ4A 1CR2A 4LJ8A 4D2IA 4ACAA 1CJUC 4Q1FA 2HLDD 5FOVA 3T15A 4YXWD 4KI0A 2GVDC 1OH5A 1GP2A 2CBZA 2EU8A 2PZGA 1T91A 3CX8A 5SZIA 3AVXA 2QN6A 4OI0A 3EPJA 3HU1A 1E9RA 4G5RA 4X8MA 3MD0A 3S1AB 1WBBA 1PLKA 3C5HA 2X2EA 4NYMQ 1E2JA 4GNKA 1DG3A 2IYSA 3THWA 4JIMA 5KSOA 1E96A 1NLZA 3SYLA 3U7HB 3QIAA 2IWHA 3GLFB 2O8FB 2ZJ8A 4MYHA 1BMFA 1GRNA 5CM8B 5BN5A 4KO8A 5TV2A 2NOAA 3DL0A 1NG9A 3GLIA 3P26A 3IBGA 1IBRA 2FSGA 2HUPA 2QPOA 1N6LA 2FPLA 1L4YA 2P0EA 2IX3A 3U61B 4CYMA 4DLWA 2NZ8A 3B5JA 1CTQA 1E4VA 2F43B 621PA 2DCUA 1GILA 1IAQA 3TK1A 4G5OA 1NBMD 2JLWA 3RS7A 2YHSA 4CRWB 1UDWA 2IYWA 1J99A 1OE0A 5TARA 5BN4A 4P33A 1ZD1A 5C18A 3AB3A 4C2TA 5GJWC 2AD5A 1PLJA 3GJ8A 4AI6A 2C99A 4MQBA 5B57C 5FOUA 4H9GA 4QGHA 1KDRA 2ZI5A 2O8CB 4QHSA 1NY5A 3ZYCA 4WZ6A 3DM9B 4D0GA 4AYTA 2VF8A 1NSFA 4CT4B 2JGNA 2BHRA 1LV7A 4EJSB 4CGZA 1W0KD 2V1XA 3THXA 3VKGA 1HH4A 4PO8A 2CE2X 4URUR 1SXJE 1OJLA 1KJZA 5JI3E 3TJZA 4EFNA 1H8ED 1P3JA 1JEDA 4AYXA 2XSZD 3BH6A 3GEIA 5FPYA 3K09C 4HLQB 1KSJA 3BFKA 1I4LD 3VHLB 1WA5A 3GLFA 3U3JA 4MGYR 5JI2E 3I62A 1SQ5A 5CDFE 3E1SA 3K0FB 4JL8A 1MKYA 4LJ6A 5JMTA 1N6HA 3BH0A 3GLIB 1W0JA 2O5VA 1NP6A 3KQLA 2YOGA 1ZCAA 1D2NA 1R2QA 1HQCA 3SQXA 1ZC4A 1AZSC 3BXZA 3LDAA 2V7QD 4BRUA 2OCYC 4HB3A 3KZ1E 3TMKA 2VH5R 4TMZA 2ZE5A 2J0UB 4R98A 1G4UR 3UMRA 1KSGA 1OLOA 3K9HA 3DDCA 5FPHA 1P75A 3ZVRA 2OFXA 5LB4A 4LOAA 2EWVA 3R9WA 4ZIRB 2KWIA 3CX7A 5FOXA 2YNMA 4Q9HA 3VFDA 2EFHB 1NIJA 1PUJA 3H4MA 3W8NA 3TSOA 1NF3A 3P4YA 3REGA 2QP3A 4Q9KA 2MSDB 3KUCA 4LBVA 3QXCA 1NG1A 1W44A 1HV8A 1Z0FA 3VU9B 4DEXA 1CJTC 2F1IA 3AVQA 2C8VA 4KV9A 4DXAA 4L4UA 4PSAA 1KSFX 2QM7A 2AKYA 3Q8XB 2GF0A 2GJSA 4LGMA 2W2TA 1MO4A 2FEOA 1IY2A 2WSMA 2ZYUX 1XEWY 2J7KA 4M4SA 2YVUA 3JVVA 4P0TA 4TL7A 3TAUA 3FKQA 3THYA 3R7WA 2CHVA 4XTRA 2DFNA 3Q85A 1WE2A 2B21A 2NZJA 3FDIA 2R8RA 2J1LA 3D7MA 4MDEA 3UMSA 1QZXA 1KI8A 2Q3MA 5BYJA 3SI7A 3WBJA 1XPUA 1E2NA 2UZ3A 1TAGA 3CF2A 1XEXB 4TSFA 4ZI3A 2RB4A 2F6RA 1KI4A 2QSYA 2P5TB 4FCVA 2WKPA 1E0AA 5JCZA 2X1VA 1IN5A 3WMEA 2D7CA 2P6NA 2WAYA 3U2QA 3X1XA 5DISB 1LFDB 4WZBE 1U2RA 3RAPR 1SXJD 4C0SA 4OQMA 3ZLJA 3LBIA 1OW3B 5E95A 2VSFA 2P6UA 5FBLB 3I4LA 2Z5FA 3RS2A 1Z83A 2ZI7A 4OI1A 3T06B 2PLFA 3P27A 5JWHA 1NMXA 1NN1A 3KDSE 4KSCA 1FX0B 1K5GA 3BWDD 3UANA 3PUYA 4YXWA 5CB6A 3DKVA 4B47A 1NJFA 3RS3A 3A6PC 4G01B 2ZE6A 1VTKA 3QY0A 4DUGD 4F92B 5EXSA 1AKYA 3ZD6A 2NPFA 1GL9B 2QL6A 3ZJYA 3QBTA 2NPIA 3QKSA 2OLKA 3WNDA 1NVWQ 3OAAD 2J0VA 4RCZA 4Q47A 2RGNA 4TYQA 2FSFA 2UVQA 1E79D 3AGQA 1EX6A 1QVRA 1EFRA 3BGWA 3PENA 1PUIA 4S2EA 3EXAA 3CW2A 4TMTA 1IN8A 4DLXA 4DLSA 4IXMA 1VPLA 3T5DA 2XB2A 1FMJA 4IEIA 1AA9A 3W8RA 5JJIA 3HYTA 1Q20A 2F9MA 3VQTA 1MV5A 2J0UA 1G19A 4JYCA 3QPWA 2IYRA 3OFNA 1XPRA 3OHMA 1TNDA 1HURA 2V3CC 1KSHA 4IOLA 3UWKA 4B3BA 4A8JB 1OFHA 1TU4A 1KK2A 3K0AA 3W3AA 1ZD8A 3KKQA 4WXPA 3W6PA 2QTHA 1EFTA 2ZRIA 3DKPA 2GJAA 4NHOA 1M8PA 4B6FA 4DIEA 2I3BA 4LYAA 1QHSA 3ZVLA 3ZZTA 1U0JA 4JKIA 5UKDA 5HKKA 1J7KA 1TU3A 3I5YA 1Z8FA 2AHOA 1OFUX 1JECA 4DCTA 1E2LA 4LJ4A 2Z6VA 3JZAA 3O8BA 4AYWA 3HR7A 1RFLA 2NG1A 2QROA 3FFAA 4BLPA 3BK7A 5GVSA 4OK5A 2QSZA 1EFRD 4DLRA 5H8WA 1G1MA 2Q9BA 3REFA 3FMFA 1XDBA 2QTVB 3DEFA 4Z1MA 2O8EB 1GNQA 1H8EA 3MJRA 4Q9JA 3L8ZA 3IIKA 4JLBA 2D74A 4F4IA 2OBLA 2ODNA 4MA4A 2IYTA 4Z54A 3WYAA 2KE5A 3B8HA 1DBSA 3ZQ6A 3UXMA 3UWOA 1N6RA 3FMPB 5B2ZA 2JJ2A 1TQ6A 1MOZA 3DVLA 1E2GA 2HYDA 4M1WA 1CS4C 3EX7C 1CU1A 4PAOA 1BKDR 3EARA 1ODFA 2IBMA 2PX0A 3WHKA 2GXSA 2HT1A 2IEZA 1S1MA 2DWQA 3LNCA 3RWMB 5FH9A 121PA 3EWAA 4RY2A 4NCNA 4M0LA 3GPLA 5KDLA 2ODWA 5KO2A 4C0KA 2QMEA 2GCOA 2JJ1A 1II0A 2FE4A 2FWRA 4RFSA 5AK0A 4HDOB 4L9WA 4ZV4A 2NMVA 2QMHA 5KSYA 1MO5A 2VHUA 2FFHA 2JIZD 1E99A 1OHHA 3EC2A 4HI0E 4LRWA 3K8YA 3IHWA 5ELXA 1FFHA 4LPSA 1U8ZA 1W0JD 2VSOA 1GOTA 1NL3A 3U4QA 1GKYA 3GJ4A 4IVPA 2VYFA 1Q1BA 2IXEA 4OYHA 3EPKA 1LS1A 2ZS7A 1GG2A 1P61B 2IC5A 4N3NA 3SS8A 3G82C 2IS6A 1Z6XA 2ZS8A 1X1SA 2C98A 4DSTA 3K70B 3SHFA 1HY3A 4AD8A 2J59A 5HE8A 2EVWX 1VMAA 2KI5A 5DE3A 4NPHA 4MUAA 5HTKA 3RC3A 5H68A 4E07A 4ZIRA 3FKSD 4TTRA 2R6CA 4LUCA 1KOFA 3GJXC 1E1RD 1KK0A 3WHLA 4A2WA 4CIDA 2ZRLA 4RKEA 1WB9A 3W34A 4FIDA 4BFZA 4WOPA 1N6PA 2BBTA 4Q48A 2SHKA 3CM0A 4EJSC 1GKUB 1AS0A 2D06A 1YZKA 3LAWA 2BJWA 5JEDA 1G8GA 4BLRA 1EWRA 3P1JA 3QI2A 4DDTA 1P5ZB 2NO1A 2ZRMA 4N0DA 3CONA 1KKLA 2ZREA 721PA 4ZPXA 3SHWA 2D4HA 5TMPA 2ZRFA 3CPHA 1HTWA 2H5EA 4TYWA 2X19A 3K0SA 1EG7A 1YZTA 4DRZA 4M1SA 3FHOA 1AGRA 2ZITA 3WRYC 4A6XA 4QM6A 1C1YA 1OSNA 2OESA 5G3YA 3TAHA 4AKHA 2PBRA 3EAQA 4ABYA 4D26A 3DPUA 2R65A 3F3YA 4L8GA 2Z0MA 1ZJ6A 4B32A 2JLZA 5JJLA 2BCGY 2GZHA 5L3RA 3PEWA 1US8B 2A9KA 5F3WB 2ASEA 2O0KA 5EE9A 4U00A 1GNRA 2C78A 1GZSA 1X8JA 3KB2A 5L3QA 3ZQJA 5FTJA 3TH5A 2ZPTX 4ACBA 4TYYA 3SC3A 3B1VA 2JLQA 1SHZA 2P3SA 2WWFA 3AKEA 3K0CA 5J4KA 1QHXA 2PZEA 4Q4HA 1SXJA 4URZR 3ASYA 3NBYC 3SR0A 3U3KA 2VHJA 3Q7QA 1KZ7B 3TNFA 1NIPA 1SXJC 2J7PD 4PXAA 4BFVA 1CRQA 1ZCBA 4DSNA 5CJ2A 4B33A 3GLFE 2FZLA 4IDHA 1KI6A 1QG2A 4D4JA 4PHTA 1GKIA 3W90A 4Q21A 3Q3JB 1SVKA 2HJVA 5GJBA 4OI2A 3GLHB 2JCSA 1F2UB 3SOPA 4D4KA 1KDOA 4NYJR 2C96A 2DY1A 1W7AA 2A5GA 3WNCA 3CR8A 3RRMA 3VMFA 1M74A 1AN0A 1PJRA 3E5HA 3N5CA 2V6IA 3CBQA 1E79A 4KYUA 4C0JA 4B48A 1G8PA 3TGPA 4NYJQ 2FFQA 2XEXA 2B8TA 3QQ5A 1T0HB 1KMQA 3VX4A 1GM5A 3VR1A 5HKKD 3OZXA 1XWIA 5JSZA 2G3YA 2JEOA 2YOHA 4KFRA 4US1R 3X1DA 2HJGA 4LHZA 5FTKA 5BYKA 3V4RA 2Z4RA 4TQAA 4OHXA 2B7CA 3PJRA 3C14C 3CRRA 2LKCA 2REBA 3X2SA 2QU8A 3ICEA 4V0LA 3V00A 1NN5A 3Q5EA 1K6MA 5FOSA 2RHMA 4C30A 4TLCA 4QL3A 4DVGA 1XU4A 3ZVMA 1SXJB 3O8CA 5J4YA 3KQNA 4H1UA 4IHQA 3SEAA 1EX7A 3BERA 4A9AA 1IY1A 1E2KA 5EP4A 1E4YA 2EYUA 4PFSA 1RJ9A 3TQCA 2WKQA 2EFGA 1GRQA 4D4MA 3FYHA 4Y0AA 1P9WA 2V4ZA 4BGDA 3IQWA 4FMCF 4BZPA 1UBEA 1IQPA 4EJSA 2RHDA 1TX4B 3MWJA 4IXNA 4Q7KA 4XTCS 4LC1A 1P2UA 4JT4A 1CEEA 1KHTA 3IKJA 4IOJA 1ZAKA 1YZUA 3OF5A 2OBMA 4DBLC 4ZKDA 1ZM9A 2ZIAA 1P2SA 4OHZA 1RRGA 4JLJA 1VIAA 1WMSA 4LJ9A 4FN5A 3VAAA 3BE4A 4ESHA 3IGFA 4PHFA 1FPMA 2R62A 4LBWA 3WY9A 3CRVA 3CO5A 1NMYA 4L16A 4YC7A 3L43A 5L3VA 1E9EA 2PZFA 2GXUA 3AUYA 2WJIA 1JR3E 1E0SA 4N0EA 3VKHA 3LXRA 3T61A 5L3SA 1RRFA 4RD0A 5H70A 4XVUA 2J46A 4DDWA 2ZU6A 4U02A 3RNLA 2CEAA 1FP7A 1Z2AA 4D6PA 4W5JA 2NTYC 2X2FA 2BEKA 5L3QB 4NCJA 2B92A 4O0MA 2FSIA 1HA3A 4Q7MB 3I5XA 1K8RA 4RFVA 1LF5A 2GJKA 1JR6A 1G20E 4M1OA 4P31A 4DT1A 1SVOA 1HQYE 2DBYA 3A1TA 3GD7A 3IO3A 2NO7A 3IIMA 2VL7A 4TSFD 1ZC3A 4IVRA 1FW6A 1MR3F 2IYLD 3A4LA 3CLVA 3ZGXA 1MRNA 4Q00A 3L0PA 4CVNA 2ZJZA 3C16C 4PO9A 4EFLA 1GNPA 3W5JA 2FJUA 2GK6A 3RVBA 4AC9A 2XJ9A 3DOFA 1VIYA 2A7QA 2Z4SA 2EFEB 2ZS9A 4PANA 1DAGA 1N2CE 2A5FA 2Q3FA 3BD9A 2WSSD 3CF6R 2R9VA 2H8KA 2NO9A 3QF4B 3NTUA 1KDPA 1TMKA 2VBCA 4R71A 2BCJQ 3RSLA 4BLQA 2OFOA 5FL7A 4R7ZA 2EWWA 1FTSA 2BKUA 3TKLA 2RH5A 2VP2A 1IXRC 4I4LA 3KL4A 4WAUA 5CLQA 5EXTA 4KYIB 4E22A 3OESA 1WXQA 1ZM7A 1I4DD 4YMUA 2J9RA 3A4MA 3CKLA 4UNRA 1R5OA 2G77B 1JPNA 1P2VA 1Q44A 4M21A 3HYRA 3OAAA 5F2EA 2R44A 4W7SA 1EFUA 2DFKB 3EIEA 5EP2A 1YR6A 3QENA 5DO9A 4YMVA 4MRPA 5G3ZA 1N0UA 2XJ4A 4XD7A 1CIPA 1N0WA 3FE2A 5L8VA 2ZJYA 4DLTA 1G8HA 1G4AE 2IW3A 3AH8A 3ZZ0A 3O8DA 3LFUA 4B2IA 2BIFA 1JAIA 3TW4A 1LF0A 2WBLC 3CX6A 4KLZA 4M1YA 3B85A 4B3GA 3C41J 4XH9B 3KFXA 1AQUA 1OFIA 3R9XA 2FDCA 4PPQA 1OXTA 1OKKA 2IYUA 2PMKA 1HUQA 3H0KA 1D5CA 4NCIA 4IDQA 3VNUA 4TLAA 1ZNWA 2BC9A 2QP9X 1NI3A 4UJ3A 4Q18A 1DAFA 2ZE7A 2WJGA 4BEJA 1P6XA 1MO3A 1S2MA 1KTVA 2OE2A 3ND9A 4GOKA 3DHWC 4DWJA 2AX4A 3U5ZB 4KJZA 2IXGA 1SZPA 1E6CA 3CZQA 3NC0C 3CPJB 1KNQA 2OSBA 3DZDA 3H1TA 3QXXA 3BB3A 1KDTA 1UKZA 4TQ9A 2GKSA 2ZRJA 3PUVA 2ZROA 2XAUA 4PTLA 3FWYA 2QE7A 4LHVA 1X3SA 4LYJA 4KODA 5TDHA 1JNYA 4PC2A 2G1JA 4BUJA 2QPTA 2CLDX 3QEJA 3TVDA 3M4YA 1BOFA 4PZZA 4TT3D 4L5BA 5DN6D 4YDSA 3QVUA 2Q21A 3AP1A 2J3EA 1GTVA 2YOFA 5CK4A 1KO7A 4JLOA 1D6JA 2HV8A 4JL6A 1J2JA 4MYTA 2WMNB 1DAHA 1UBGA 3C5CA 3KX2A 3PVSA 1F3OA 4GMXA 4IDOA 4JLAA 3SDZA 5J4LA 4RZUA 4RZ3A 1AJEA 4MKIA 3NBZC 3QXSA 1XJQA 2YC2C 2ZYVX 3B60A 1J70A 4M22A 2O8CA 2C77A 2CNWD 1R0XA 1C9KA 3NHAA 3L8YA 4MGIR 1L4UA 221PA 2NO0A 1GFIA 2P67A 3GJ7A 3H84A 1P60A 2GXQA 2ZRBA 3J81k 2WICA 1ZBDA 2BM0A 4LJYA 1EWQA 1DARA 3AM1A 2QMUA 3C8UA 2PH1A 1YQTA 2AKAB 1W4BA 3D3QA 2OO7A 5P21A 2VHTA 4NONA 3TQFA 5D3QA 5KNCA 2OCBA 4NYIQ 4FMCB 3PV0A 2CJWB 3QNUA 2H17A 2YZ2A 4BLTA 1GITA 1W49A 1NKTA 1SVLA 2K5UA 3AVVA 1OHHD 1ZMXA 4BLOA 2GDJA 1BS1A 1S4QA 4MKGA 4JJZA 4B74A 1VDZA 1OIWA 2O52A 3NVAA 2I1VB 4DJTA 1O87A 2ZR0A 3IQXA 4NYIR 1N25A 4PR0A 1VG1A 1W36B 3CWZA 2KSQA 4IJMA 1P72A 3CNNA 4L9SA 2C04A 2XX3A 3QKRA 3HPRA 4Q4JB 1ESNA 1FUKA 4V0OA 5AJYA 3K0EA 3BOSA 1OH7A 1A82A 3C15C 2EFCB 1G9XA 3SN6A 4PPNA 2E9SA 3SJZA 2VHQA 4TYNA 2WHXA 1OH6A 1ZM2A 4V0MA 3FVQA 2XTMA 3TLXA 2GCOB 3LX8A 4HLDA 1M7HA 1XNJA 3MLEA 5DLQC 2WTUA 3A4NA 2ZR7A 4B3CA 2ZTSA 4JBXA 5C4GB 3D31A 2QENA 3AP2A 1Q1ZA 4V0ME 4BASA 4DZZA 4DIDA 4G3XA 3ZS9A 2VPPA 1Z29A 3SBEA 3Q5DA 2HLDA 2BBWA 1U81A 2GHIA 4GI7A 3GLHA 1Z0AA 4OJKA 3RYTC 3I61A 2B7BA 4QBGB 2D3WA 1BH2A 3OEEA 1AZTA 2OLJA 3BORA 2KJQA 4JZKA 3NDPA 5KU1A 4TL8A 1G3QA 1W46A 2VP5A 4DB4A 2XZLA 2TMKA 3I8XA 1YR9A 5TVKA 1Z07A 3MCAA 3SJCA 1ZINA 4ZI2A 1FTNA 4E09A 3ADKA 1UAAA 4CEJA 4URYR 1HT1E 3Q9LA 2BDTA 3B6EA 4QJ4A 1JBKA 5B58C 2ZSAA 1U0HC 3K9NA 4U5XA 5GADl 2OHFA 1RE0A 1XEXA 2Y8EA 3AVTA 4A0GA 4F38A 3W6OA 1WP9A 4DLZA 3FMIA 2F3RA 3QF7A 4OQLA 2ZSEA 3NWJA 4PC3A 4RZ2A 2REOA 1NSTA 1NVVQ 2JJ8A 4PPGA 4CF7A 5HZHA 3KB1A 4OBEA 4V02A 3OEHA 5DYIA 1T3HA 1UJ2A 2CXXA 1DELA 4JBYA 3U7GA 4QKQA 4LWZA 3R8FA 4MITA 4RD2A 2PJZA 3T5GA 3BFXA 3EIQA 3OFND 4AURA 2XNDD 4HATA 4S35A 1CR0A 3QXHA 1ETUA 3W6NA 4JLMA 1U94A 4HAUA 2IYZA 1Y3AA 5BXQC 5JLJA 1T8TA 4UNQA 2G0NA 2GNOA 3NEYA 4RCYA 4OHYA 3BC1A 2ANCA 1NVUQ 1GIAA 1UFQA 1T6NA 4HB4A 2EW1A 3ECCA 2QT1A 4O2LA 1OB2A 2AXPA 3BB1A 3EC1A 4Q1DA 2IHBA 4QRHA 5C2JB 2ZSDA 5K8LA 4US2R 1Z0IA 5JS8A 4XD7D 1WBDA 3VR3A 4K81B 3AKDA 2WOOA 4D80A 3ADCA 4GL2A 4Q1BA 1KY2A 4ESVA 1PLLA 4B35A 3NC1C 5CYPA 3B82A 5IK2A 2QAGC 5E7JA 4P4SA 2NGRA 1NNEA 4Q1CA 2R2AA 3I3SR 5EXXA 1WDTA 5LDDC 5IT5A 1RYHA 1XP8A 4PC6A 1X8KA 1F2UA 1YHNA 2A5DA 2JDIA 3HWSA 4A4DA 2XB4A 5BWMA 4A36A 1QHYA 2B8WA 4XSHA 1EESA 3W9YA 1XD9A 1W5TA 4DHEA 4JLVA 2ZRDA 2AWNA 4Q1EA 3B1WA 4AKIA 3HR8A 5FPSA 3I8SA 3T12A 1KO4A 1LB1B 1KI9A 4TL6A 1YZNA 5JZVA 2QGNA 4IEEA 3LO5A 1N6OA 4XIGS 1II9A 5J5CA 1QHHB 3N2IA 5HCNA 1XMSA 1KJWA 3KUDA 2QAJA 4ZCMA 3JVUA 5D3MA 3LW8A 1S9HA 2HCBA 3BH7A 4B75A 4URXR 3QG5A 4TMWA 3T1QA 2O8DA 4LY6A 3AV0B 3PEYA 3QKSB 1GSIA 3GJ3A 2YINC 4JVLA 5CJPA 2EQBA 1Q3HA 1FOEB 4PPFA 4FD2A 2ZUBA 3GQBA 3P32A 2Q6TA 4Q01A 3LVRE 1JXOA 3SFVA 1M2OB 2XZOA 4NP6A 3KKMA 3CH5A 1G5RA 3MJHA 4BFWA 3LH5A 2ZAMA 3T1VA 4EPTA 1Z22A 1RIFA 1VG0B 2YV5A 2Q9CA 5HCIA 5FOTA 1UBCA 1BYUA 4HLUA 2C9CA 2W00A 3DOEA 2FFAA 2H57A 3WNBA 1M7BA 3OIVA 1W4AA 3VR5A 4HDQB 2QPAA 2ZJ5A 1G17A 3HJNA 1E9CA 2BV3A 3OE7A 4JLPA 4O25A 5FPKA 5F9FA 3GLGE 2GESA 3RS0A 3WMFA 1WCV1 2KB0A 2R6GA 2IYXA 1E0KA 4ARZB 3NKVA 3CNLA 4Z8YA 4QGAA 3LD9A 1S3SA 2DFTA 1OXUA 3CRMA 2AN9A 1N6NA 1S3GA 3KXKA 1T5IA 3MMPA 4YMSA 3EZ9A 4LV6A 1AS3A 4RD3A 1XCPA 4C0HA 2VA8A 5C1BA 4YQFA 2FA9A 3B13B 3V4FA 3U4QB 2ZJ2A 3TUZC 1P9RA 4RJLA 2BMFA 1ONBA 1Y63A 3CF0A 4NKRA 4HSEA 3RRYA 1I2DA 2WIAA 4XWOA 5DIFA 4C7OB 2OCAA 1CRPA 2GK7A 3UKDA 1XZQA 1P73A 2QA5A 1IM2A 5KNDA 2O8EA 1BO6A 2ONKA 3AVYA 3EPHA 1KIMA 2FH5B 2GF9A 4DUGA 4KXFB 4DT1B 5IHPA 4QOSA 1XD8A 1A1VA 1A2BA 4I1VA 2F1JA 1T8UA 4UXIA 4IDPA 2ZJBA 3CRQA 2XGJA 1YJ5A 5GVRA 3WRXC 1XTJA 1E32A 1GDDA 4P4SB 1O3YA 1W0KA 1YZQA 3UG7A 3KKOA 3U3OA 1FL9A 2ZI4A 3VHXA 1F60A 3U6KA 3RC8A 1RPZA 3I73A 2JLSA 1EFCA 4C3ZA 3UPUA 2BWJA 5AJWA 2CL6X 1SULA 2H18A 3NIBA 5KHOC 3KTAB 1LW7A 4B3XA 5DI9A 2OV2A 3THWB 3IPYA 3QF4A 2RAPA 2F55A 4MGKR 2RGCA 2VP6A 3VKWA 3SBDA 4C0AC 3OEED 5CLLA 1TEXA 3WMGA 1OH8A 1UDXA 5TXGA 2WWYA 5DH9A 1BYIA 2DHRA 3GFOA 4HAXA 4KLNA 1TL7C 5C4MA 2GZAA 2UKDA 4QHTA 5CK5A 2IYVA 1IONA 1JQLB 2AXNA 2JASA 5A5GA 1TQDA 1RVDA 2OAP1 2QRZA 1VG8A 2VIIA 2AK3A 1G3IA 2XNDA 2GTPA 2IF0A 3E2IA 3R20A 5FBQB 3THXB 5TY0A 2GEUA 3LBHA 3R9IA 5LPNA 1J8YF 5A4JA 2CJWA 3TBKA 2WWWA 1JAHA 3TR0A 2W0SA 4A0FA 2J45A 2WV9A 2KBEA 2F3TA 1ZNZA 2FNAA 4LBYA 1XF9A 4EQ6A 5K8TA 2ZVPX 1CP2A 4G1UC 3PQCA 4HAZA 2V1UA 2GAAA 1G64A 2DPXA 1H8HD 1QBKC 2D62A 4FW9A 1ZUNB 1W5SA 4EPYA 2ZRAA 1ZU4A 4OK3A 4R2IA 2QUZA 2ZJOA 5DYGA 1DAKA 5SZKB 3EZ2A 2N46A 3CZPA 3U3RA 2XZPA 4HZUA 3UMFA 4LJ5A 5KSZA 4W9MC 1MH1A 3GEHA 1VCIA 3RHFA 2VP9A 1XEFA 2F9LA 1E94E 4MGZR 3K09A 2IS2A 1COWA 4M9QA 1AGPA 4CT5A 4Q9LA 1NY6A 2ZRKA 5EUQB 2CL7X 1WQ1R 1CJKC 2G88A 1XTSA 4HDCA 4F4CA 2B6HA 2W2XA 2ZRPA 1C4OA 1OYWA 2ODEA 3UATA 4L15A 1KZGB 4D25A 2AFIE 4CDGA 5E7MA 3EPLA 4C0QC 5JRZA 2HXSA 3IIJA 4KVGA 4TMXA 4V0KA 1NLFA 5BN3A 4A15A 4D4LA 4JKYA 1U9IA 2DFLA 1KMHA 1X86B 2RGNC 3QJYA 4MRSA 1UEIA 4P4UA 4RSGA 2FU5C 1H65A 1AS2A 1FZQA 1YVDA 2UZIR 1B0UA 1KJYA 4FMBB 1US8A 5IRCD 3M1IA 1HEIA 1TEVA 2X77A 1ZUIA 2AWOA 4ZCIA 4UXJA 2GJ9A 821PA 4NDZA 3F5FA 2YWEA 1GL7A 1AK2A 1DVRA 2QAGB 4QHYA 4RD1A 4O2RA 1XRJA 1S0UA 2OM2A 3A1SA 1FP6A 4I1SA 3A1UA 2RKOA 3L2OB 2JLYA 2PCLA 2QP4A 4UNNA 1U9IC 2QQEA 4Q02A 5KDOA 2WJJA 3THYB 4QGGA 2WPDA 5DI3A 5H1YA 1D2EA 1COWD 3I1FA 4ZDIA 3IEVA 1A4RA 2KBFA 2IUUA 3FKSA 1A7JA 2FG5A 1QHGA 2OUKA 4H1VA 5EQTA 2OAQ1 3OIUA 2ECKA 3HDTA 1E1RA 4I1UA 3FB4A 5D3MB 4PX9A 2N42A 5B30A 2ZVQX 5F9HA 3AVWA 4NTZA 3F0TA 1IOZA 1M1YE 2ZXUA 1TPZA 2ZUCA 3QE0A 3PG5A 4D0NA 1UM8A 2IS4A 1E1QD 5FTMA 1KI7A 3GLIE 2IUTA 2R6FA 4Q03A 4P32A 4BLSA 2VQSA 1ELOA 2PMDA 2ANBA 2E87A 3WYGA 3ZIAD 3BS4A 4DCNA 5JEEA 2V9PA 2GBLA 3ICQB 3CB4A 4HUTA 1N6KA 5FPTA 5KDDA 3IBYA 2WM9B 1EFHA 5EUMA 4IOKA 2OFWA 5AUNB 3FMOB 1W2HA 2ZM5A 3WYFA 4WW0A 2WWIA 1DE0A 5ANRB 2CDNA 2F1HA 3EASA 1GVNB 5FUYA 4ON9A 5G53C 1YRAA 2W0MA 3K1JA 2A2ZA 3CRW1 3OE7D 4HUQA 4JSYA 4LJ7A 4DKXA 1E0JA 3QPUA 1TF7A 4W5HA 3LX5A 2FPKA 2W6ID 1E9BA 4QFMA 4XOIA 3SZRA 2OILA 4ARZA 2XTNA 3TW8B 5KUTA 3IHLA 4F93B 1G18A 3BIFA 1SKYE 4Z8XA 2HXYA 4JLKA 2QMOA 4HZUB 3F8TA 3MAAC 4LSGA 1I4TD 1W1WA 2EFDB 1FX0A 3U60B 3PIRA 2ZRGA 1U98A 2CLSA 3TSWA 4LI0A 2A78A 5EJEA 1CR1A 4AG6A 5JBQA 1DPFA 1N5LA 4KBGA 3HPQA 3LLMA 1G6HA 3O47A 4CEIB 1XBTA 2LCFA 1XEWX 4TZ6A 3OEHD 2RMKA 5FTNA 2VO1A 4LHXA 4WIAA 4A2QA 2ZRHA 2NO6A 5CDFA 4A8JA 1X1RA 2F1RA 1JJ7A 1SVWA 2MSEB 3MG9A 3BBPA 3ZIAA 3K70D 3O8RA 1XPOA 1Z6TA 4DCSA 1XFAA 1HT2E 3PEVA 2ZEJA 1W47A 2QEQA 1Z6YA 2G9NA 2PJRA 4CEJB 3NXSA 4LPKA 3DMNA 1YZGA 5KYKA 2JJ2D 2V55B 1KI2A 1UEJA 1W4CA 1R4AA 3MUFA 4TN1A 1JPJA 3QVVA 2HCJB 3T34A 1Q21A 3EA5A 4NBSA 2P5SA 4KITB 4LHWA 4M1MA 4ZDWA 1DAMA 2GCPA 4JSTA 4MKFA 4HUQB 3P4XA 1R5NA 4QGFA 4ITRC 3ZVNA 4TLDA 4ZKEA 3R8CA 1NN3A 2PEYA 2J0SA 3BRWD 1KYIA 1X8LA 4M1KA 3TE6A 2FMXA 3LVQE 5KTYA 4Q4AB 2WWGA 1QF9A 3AUXA 4AK9A 1FNMA 4N1AA 2ZYWX 5DI3B 3PR1A 3QG1A 2IYYA 1EXMA 4GZMA 4AKGA 2RGDA 1D9XA 2CLCX 3FGNA 1A2KC 1G291 3WXMA 2ZE8A 2ATVA 1SGWA 2YWGA 3L0OA 3K0CC 4LK2A 5DSZA 4A1FA 1JR3A 3AF1A 1NBME 3I92A 5EZ6B 1VKJA 5CIWA 1II8B 3FOZA 1R8QA 2G0TA 2JLXA 2E1RA 4Y0VA 2VRWA 1VG9B 4BE7B 4RFSB 5SZHB 4A0HA 1IJEA 4PSKA 1EGAA 2BMEA 2G6BA 2GCNA 2V7QA 3GMTA 5F98A 4HAWA 4DDUA 1X6VA 4ZDKA 2ONJA 3FPAA 2AK2A 3SNHA 4PHGA 4U7DA 1MT0A 1N6IA 3VTKA 1G21E 5EE5B 3ZDQA 4JMPA 2ZRNA 1KO5A 5DHFA 4EUNA 4C7OA 4GSYA 4MRNA 5AR1A 3KXLA 4B2PA 3IILA 2F43A 3QKUA 1U0LA 1ANKA 2WWHA 4FWTA 1NKSA 6Q21A 1XMJA 4EPXA 2JAQA 4UJ5A 1D2MA 3VR6A 1ZNYA 4QBIA 2ERXA 1GWNA 4EPWA 1R7RA 1TUEA 4Z1MD 2DR3A 3MSXA 1CJMA 1WRBA 4QJ3A 4K46A 1XD2A 3A8TA 5JWRA 3EZ6A 3GLGB 2FV8A 3KQUA 2WVJA 2BVNA 5AUPB 3FHTA 2O8BA 3U7FB 2PCJA 2PLRA 3QOFA 2GRJA 4F91B 4EFMA 2XOKA 1Q0UA 4GBMA 4FCTA 4JJKA 1XX6A 2YC4C 2O8DB 2CMKA 5DGXA 1NMZA 3S1AA 1IY0A 2DWPA 2VEDA 1DEKA 3PUZA 3QKTA 3GP8A 1U8YA 4AWXA 3MFYA 1DAIA 5GJVC 3AKYA 4GFDA 1E3MA 2P65A 2QGZA 3UIEA 2VP0A 1OXXK 2BJVA 4KSBA 5FTLA 3AVPA 3G0HA 1OFTA 4MUBA 3SJAA 4TMKA 4A82A 2YKGA 1LVGA 1TQ4A 3QKRB 2J7PA 1XTRA 4JT2A 1GAJA 3KJHA 1AKEA 5JHHB 1FQJA 3KKNA 4IRUB 5BQ5A 3L0IB 2CL0X 3TSZA 3VX3A 1U99A 1P2TA 2I4IA 4MRVA 4GMDA 1E9FA 3DZ8A 3X1WA 4JLNA 3E70C 2PEZA 2XXAB 1XJ0A 2H16A 1G3UA 4FMDB 4Q4AA 1T9HA 3B9QA 2XOKD 2CK3D 3NDBB 2AL7A 1KKMA 3RABA 4KVAA 2IEYA 1HE1C 1KI3A 2GJ8A 1Z0JA 4HZIA 2FPMA 5K8UA 1N5KA 1XJCA 4LYHA 1AQYA 1BMFD 3AF0A 4PQFA 4E03A 2C95A 4C2UA 2QNRA 1OIXA 2QY9A 3EWSA 3VU9A 3EZFA 4Q4LA 3CWQA 5G41A 1KI6B 4NMMA 2J41A 1OXSC 1II8A 2F7SA 3U3MA 4C0LA 1KAOA 3QBVA 3W3ZB 1XMVA 3EZ7A 3KJGA 1UBFA 3WBKA 2A3RA 1NBMA 2FGJA 2FGKA 2ZANA 3GJ6A 3HU2A 3I72A 2DWOA 3NH9A 3SYNA 2ZI9A 2WZQA 4B71A 4M9XA 5DNYB 4G5QA 1Q3TA 1KK1A 1S9DA 1ZRHA 1E9SA 3ONWA 4TMVA 1OXVA 1JB1A 3DO6A 2PT7A 1XXHA 5EP1A 1PV4A 1RRCA 2ORVA 3RLFA 3LQRA 3L82B 1XZPA 4M9ZA 4QC2A 1N3BA 2Z83A 2ZSFA 5JRJA 2REXB 4WBSA 1T5LA 1S1CA 5JSZB 1SVMA 4OQNA 3AVOA 1DAEA 2QAGA 3NBFA 4YDHB 4ILEA 2CK3A 5FI0B 1YE8A 2CE7A 2RGAA 1XXHE 3I32A 3NBXX 4B43A 5J47A 5AJXA 2L0XA 2XXAA 4UKDA 3IEUA 4EDHA 3P20A 1G7SA 1Z5ZA 3ADBA 1G5PA 1MABA 4Q66C 4FI3C 4MYCA 4IVQA 3UG6A 3GLGA 2XSZA 4GZLA 2O8BB 5CM9C 2JLVA 5EE0A 1U90A 4KU4A 4B6EA 1T3LA 3GFPA 3RANA 4AIIA 2P6RA 3AEZA 1T4GA 4LJAA 3RRNA 4A92A 1IN7A 1KY3A 5CITA 4KCGA 4B73A 4TTPA 1Z63A 2CCKA 2RGGA 5EE1A 4JYBA 1TQ2A 4QNMA 1NRJB 1TTTA 5JJKA 1J90A 4KHZA 4DLVA 3Q7PA 1JQJC 4UXHA 3EW9A 2FN4A 1JJVA 4P3YA 4MKHA 3KJIA 3JZMA 4M1TA 1U8AA 4DLYA 4EQ6B 4R9UC 4TLBA 1T3SA 5K8IA 2IF2A 3SYKA 5JECA 1CULC 4R2HA 1KI1A 1F6BA 4OHVA 4PAMA 2J0QA 3PCRB 2D2EA 4ZCLA 4D82A 1RW4A 1G3MA 5G40A 5LD2C 1Z28A 2ERYA 4IDNA 4FWIB 1F5NA 2W83A 4YMWA 1KGDA 3GLHE 4Q7LA 4M53A 2JJ1D 1DOAA 2QORA 2A30A 5LB2A 4B44A 2GETA 3EIHA 1YZLA 2GVZC 5AUOB 1L8QA 4HLUC 4PO1A 5JS7A 3EG5A 2OXCA 1MABB 5FBWB 1OPXA 2PX3A 1R0ZA 1F48A 3K0AB 1G8FA 4FINA 5B64A 3OIYA 2XTZA 5CB8A 2QRNA 2A5YB 4WXRA 5JWOA 1E2PA 4G5SA 1YRBA 4YLGA 1MRSA 3ZD7A 2ZAOA 4P4TA 1M6NA 2V8OA 3BJIC
chains in the Genus database with same CATH superfamily
4JU8A 3ZDXB 3C4JA 3TLMA 4CR8A 4QT4A 4KMOA 4EAQA 1JI0A 4RE5A 5FKJA 4N49A 2I66A 3NALA 4B4DA 3F3MA 4Q19A 3W5AA 3PCTA 3NUGA 5DCYA 3IO5A 3AB7A 3EEBA 3GO4A 2GWHA 3NHPA 4X5OA 3PQ2A 2WKRA 5BYBA 4IHJF 2FK7A 3C7AA 3PPWA 4LKOA 4G0YA 4ASUA 5AJVB 3H42B 2X14A 4XJVA 2QBYB 2ETVA 3TO5A 4BFXA 4PW0A 1COZA 4U6NA 3JQGB 1AQLA 1CD5A 2GZ2A 3AU8A 3GRRA 3HNPA 1Y1LA 3MCZA 1MJHA 2WAXA 3OJXA 4EIWA 5KTOA 3U44A 4GYJA 2MDTA 1UC9A 3HZHA 1DBVO 2ODBA 3T41A 3KKEA 1QDEA 4CEHB 1E2QA 4Z7NB 3L01A 3O03A 4DAOA 2R5NA 1TUGA 1QPGA 2RJOA 4OHMA 4B17A 3TD6A 2XODA 5KVSA 3WC4A 1WV1A 4A0SA 1CERA 3A1WA 3BQNB 2HREA 3A1DA 3D8BA 3LFTA 4LWOA 4OHKA 3ZGNA 2FDRA 2P9ZA 1YKSA 2DB3A 1E2MA 4JVMA 4F7WA 1ZHFA 3LBNA 3RWOA 4OOEA 4CU2A 3KKZA 2G5TA 1P29A 4L85A 3OZAA 4KNVA 4XLZA 5TSDA 1G41A 4RV4A 5IF9A 1YZ3A 4KTTE 6YASA 3THSA 1Q57A 4FB4A 1AB5A 3UAWA 1PNTA 5IXSA 2C7OA 2H1IA 4CQMB 1J56A 1T9BA 1H1TA 1Z4OA 3GU3A 4ZOLA 5CT5A 4EUKA 3KFVA 1MO6A 1QHNA 4CF6A 2VNHA 1LTHR 4GAEA 5SICE 1V1MB 4NZYA 4CQMD 2DQSA 4BFSA 2OK7A 3LUDA 1UPXA 4EB6A 1L4BA 1MJGM 1YL5A 4KGXA 4E2WA 5I7SA 1SVIA 3RC7A 1YJXA 3KEGA 3LQFA 4XGNA 5C5CA 1O6FA 1HXHA 3BGSA 4HS4A 4X6UA 2HUNA 9LDTA 1RSZA 3RT9A 2HHCA 3TWOA 1IG3A 3UPDA 1RLIA 2QBYA 1DXQA 2AFHE 1OBVA 2C9YA 1L5LA 5A71A 3GZ4A 5AK3A 3VHRA 2WAMA 2BDUA 2D5CA 2QL7A 1G8YA 2W58A 2YYZA 4OVKA 4FGKA 1RADA 2IXAA 4NE2A 2PKRA 5BNFA 3UHOA 3VR4A 2WB2A 2D2FA 5A0FA 5BSGA 3R76A 2F55A 2RH4A 4XD2A 2ZWVA 1N0IA 2Z43A 1ZAYA 3GJ0A 1YNSA 3OHSX 3K70C 2VKQA 1LI4A 1M9NA 1U9YA 2DSTA 2ZQ5A 3CNHA 4MWBA 1NDQA 2JAHA 3GEEA 5FX2A 5LIRA 3ID6C 3WLNA 1PV1A 4M8NE 1H2AS 1O7JA 2I2BA 5CA1A 4KPYA 5AW4A 4OL0A 4R16A 1T10A 1BJTA 2AQKA 1NOIA 1ZD2P 1G42A 2CVFA 2NUAA 2R87A 3QVJA 4K26A 4KH0A 3RQIA 1DI0A 1XWFA 3S2IA 5IFLA 3DMYA 3S8EA 4QG7A 1S4MA 3WB1A 3E61A 2PUDA 5JRDS 5KCZA 2C1EA 2VNAA 1BN7A 2H48A 1C0EA 1IATA 1P1IA 2XRFA 4OX9B 4EWLA 3EDOA 2WJ6A 5AVZA 5E9WA 4GWGA 3M9WA 1VCHA 4CBVA 5FPPA 2J4FA 4RF4A 1BQ4A 5EP3A 4J0QA 4IR7A 1ZM4A 5GJCA 3TNYA 3ETLA 4FNMA 5HZKA 1K5PA 1NVVR 1V43A 1W73A 2Y27A 3F71A 3NCTA 4E46A 4PLHA 4DDVA 2IT1A 4ARIA 4X8OA 4AJOA 3OPMA 1GA1A 1PP4A 1W6UA 4I4TF 3RSSA 1NR1A 1K9SA 1I4EB 5FUWA 1EK0A 4KBFA 4Z4GA 3E22B 4O4JF 2PBZA 3UK2A 1EIZA 2BM1A 1CKEA 4YJ3A 2ZSJA 4J0HA 2FE1A 2YYAA 3ICPA 3UVEA 5C46F 1G7TA 2Q9AA 3VYUB 4DREA 5A5FA 2Q1YA 4GC9A 5CYOA 5DLPA 3W5SA 3WRVA 4AY4A 2HA0A 1T9DA 1EX9A 1G7CA 4I3FA 1XTIA 3A14A 4IIEA 3E9CA 3ZU3A 4AMZA 3MBIA 4O4JA 5A3SA 4OQXA 5HWSA 4LXTA 1E8NA 3RU2A 2A67A 3K8QA 2QSJA 4G4SO 4JNCA 4GGPA 1DGQA 2I2CA 5E2IA 3RRBA 5K09A 4QASA 4A8JC 2E21A 2GZDA 2YWDA 5I6DA 2ZUUA 5P8WA 2PJDA 2IS1A 4JD5A 4OLFA 3RTAA 5A0VA 2XI4A 2C2HA 3I6MA 1Z0UA 1N0VC 5D00A 4D9GA 5I3CA 2FR0A 2QTZA 3NBAA 1X7WB 4PYIA 3V7FA 1KNXA 1IK6A 3FBWA 2GRUA 1Q1EA 3M1AA 2I9KA 3DVSX 3MRSA 3Q9UA 3DXYA 3JAWB 4R7GA 1HTTA 1SCDA 2WUDA 3IQZA 4YJHB 1Q50A 4E2YA 1FJHA 1OLSB 1DIGA 2B9VA 3JQBA 3WMXA 1YGYA 1R4NB 1KYXA 4WQMA 4X20A 3T6KA 3PITA 2WMOB 1P7PA 2C5LA 2EZTA 4BMXA 2ZYTX 4MDFA 5BWNA 4LQ4A 2VSXA 3H2YA 3BQMB 2IU4A 1K2VN 1M76A 1MUUA 1MVOA 3K4QA 3CIOA 2LWIA 1FFAA 4UMEA 4I50B 5IMSA 4BIMA 2D7DA 3ZU2A 2O1XA 3DL4A 1I2MA 1LZKA 3W4KA 5KBYA 1Z34A 3NFYA 5EWMA 5IKOA 2WD7B 1VCMA 2I7XA 1QGUA 2OV3A 4IFEA 5E3HA 4HGPA 4RANA 1T0JB 1XTBA 5CPBA 4JELA 4FDTA 3GWZA 3DHEA 4QXAA 3MWLA 3CN7A 3FIUA 1P7CA 3CGWA 3HWRA 5EXEA 2H63A 1RYNA 3EDRA 1L7QA 4JUBA 1SMKA 4F3TA 4MLPA 3HVJA 2GA8A 1PT6A 2G1KA 1D9ZA 5JD6A 2O0HA 1G16A 2I67A 4IMRA 2P9CA 1IDOA 3L7KA 3W1EA 2FVYA 7REQA 1Y9DA 3BYZA 3Q10A 3QJ5A 5B1IA 4G0NA 1F2TB 1TYBE 1XTUA 1PZNA 5TPWB 1EJBA 1IB6A 3ZIDA 1QG4A 3QU4A 4WKNA 1T3ZA 1IQRA 2Z9DA 3I0MA 4KZPA 4XLTA 5ALHA 4IZIA 5FA5A 1UL1X 1S8FA 2E82A 4WL0A 5BWLA 2WWVD 5LBIA 5CVUA 1GZ3A 1N57A 2VDKB 3Q2IA 1JEOA 2GM4A 2H7VA 2GN1A 3PQFA 4M2LA 4OHBA 2XLCA 1TKAA 1FNBA 4GLOA 2FFBA 3ZYZA 5AI0A 1CF4A 3E9MA 1XCGB 1Z74A 1P9NA 2W6IA 2X8WA 4W5QA 1YVPA 2MSCB 1ZYUA 2ENUA 3ND8A 1VZ2A 1MQ9A 2VT6A 4OI4A 3W3AH 1QO0D 2RGBA 3U7RA 3SXUA 2NUTB 2HY7A 1PWHA 2XITA 3BULA 1G7RA 4NZNA 2IKQA 2VOJA 3F97A 3V2GA 4YONB 3N2YA 2JFPA 3ZEAA 5JSYA 1JH9A 4D4GA 3ST7A 1A4UA 3PIDA 3R3VA 3N8DA 1SK9A 3UENA 2EG5A 4ZAGA 3ZDEA 4HQRA 4D81A 5T8KC 4XSVA 1KK3A 2HYIC 2JK0A 2D2IA 4BWYA 5JATA 1FJXA 2WNHA 3C1AA 1UIMA 2QTTA 4IZHA 3IAEA 2H5JA 1KXZA 3C1TA 2JKVA 1ENYA 4DTIA 3ZE7A 5AW8A 3EEYA 2CBGA 2C9OA 3LQ1A 3RSFA 2I76A 2VHWA 1ZIPA 1BWRA 3I09A 4UASA 2FX3A 4ZPJA 5LJIA 3OCZA 4WA7A 2HEIA 2MT9A 1LTQA 2GBLC 4WJKB 3KM0A 1L9XA 5CT6A 4UOZA 5ES3A 3U6BA 3K0FA 3WAJA 1A8QA 1RTTA 4IILA 5CLHA 5G0TA 2FRDA 3B1YA 3E81A 3G0OA 3U40A 4MHSA 3A9RA 1F2TA 4V03A 2N1BA 4QDOA 5EC8A 4MV0A 1FMLA 1BQEA 1JDSA 1V3VA 2C0PA 2OCPA 4CW7A 1XDGA 4F06A 1ZMTA 4GT1A 5EWJA 1TB4A 2ILVA 1OU4A 1X7ZA 2ZJ0A 3A2MA 5EIWA 4FT4A 1FQKA 3BRQA 2WAOA 3PIIA 4X9XA 3RG8A 4DR1B 4YI3A 2OG1A 2OGSA 4REQB 4WBNF 2CWWA 3ZJ5A 2CNLA 3IPRA 4QSHA 3WLIA 2NIPA 2E37A 3PD7A 3MRXA 2GK4A 3Q9NA 1TK2A 4UUQA 5DW3A 3ZCXA 1WSDA 2FUEA 5DBEX 2BFBB 3CX4A 5FI1B 4A0RA 3WDLA 4ARBA 6PFKA 3AO0B 5EZYF 4D3DA 1CVIA 2BTQB 1JHXA 3FX2A 3TQSA 1T9GR 5CP8A 5AKYA 4DUYB 3ZWNA 1ECPA 2XUZA 4HDNB 3DM5A 1T2NA 3ZCUA 1ZI9A 3LCJA 3EXHB 3NRCA 3RVRA 2GEDA 4X97A 4F11A 4R0NA 1PL6A 4EFDA 1DBPA 4RHCA 2YHBA 3D1JA 5EMMA 1C5KA 2H1OA 3H05A 5DYTA 3FIJA 4CMIA 2AQ8A 1Z08A 1R16A 1Q12A 4FOOA 4XSGA 2XCSB 4C4PA 4YAGA 4KR2A 1L7AA 5KWIA 3NORA 1ZI6A 4M37A 5LQMA 2QTRA 1IY9A 3L0CA 1V16A 1YRLA 3LYUA 4P92A 5D87A 1A9RA 4GOND 3VC7A 4A8PA 2ZUDA 1JIVA 4QYXA 4BB9A 5CDSA 1G6OA 4EYOA 4C7VA 4DLKA 3K53A 2JPDA 1MH9A 1MRZA 1VBMA 1WSBA 3AHIA 3QVOA 1BIFA 1E1KA 4GVXA 2EP5A 4HYYA 3TM4A 3RRZA 3WL8A 3QUSA 2X9QA 4OXRA 2PZMA 4A2PA 3JASA 3QLVC 3VOBA 1VE3A 2WMYA 1Q14A 2BEWB 3LECA 4RQBA 1MVLA 2EX4A 5FP0A 3SU8A 3UB2A 2BH2A 4FW8A 5JAIA 3NDJA 3D4BA 2HDNB 1YR7A 2JFFA 3GDFA 4MQUA 4BKQA 3QBEA 3RIEA 4KB5A 1L6RA 2B99A 2CN1A 3KKKA 3MIZA 3RUEA 5AVKA 3ZZUA 5CYFA 3T7KA 2CHGA 3OA2A 1JLLB 2FQXA 3OMXA 2B4YA 5C8YA 1TC2A 2JIZA 5HK9A 1WY5A 4X1KB 4NEQA 4R8MA 1MQ8B 1IJFA 2G40A 3I0NA 2AZ4A 1ZGGA 4HAYA 2WUFA 4HPJB 3ZUGA 1PDOA 1XMIA 2IL1A 2YIMA 4D0SA 5JJCA 3VDQA 1V8DA 4U2DA 1P62B 1GUAA 3L0SA 1Y1QA 4ARAA 5BNZA 3BWYA 4FJ1A 3QU7A 2CCGA 1YI1A 1GL3A 1CUIA 1QFZA 4HPWA 5JYDA 3F98A 2F8TA 3ROFA 1MIHA 1V7CA 2HT6A 4A26A 1JALA 2AJBA 2GPJA 2FW9A 3DFUA 1RWBA 1ZN9A 2BL4A 4A23A 5DX8A 2AN4A 2JAUA 3ZLUA 2IUEA 4QNRA 2PL3A 3I9OA 1GRRA 3AU9A 1GTMA 1ZM3A 2OKGA 2MJLA 2QR3A 1DIRA 3NH6A 4W9RA 2Q2VA 4V39A 1T1RA 3PR3A 1OV6A 1TF5A 4LN1A 3E9NA 2OTCA 3QVMA 5CD1A 4FYYA 3H1PA 1PYGA 3GROA 1R4MA 1RQXA 3H9UA 3KYBA 4FXPA 2Z1DA 5DB4A 2DC1A 5BYAA 3G0CA 3K9LA 1U5BB 3ZD8A 1Z5VA 4RWEA 5EZ5A 4RELA 5BR4A 3B2EA 3HK2A 3CLSD 5HGJA 1PL8A 2P2LA 4O2AF 4Q82A 3WFZA 4DQ0A 4URFA 3O6VA 3G2QA 5BN4B 4Q3BA 5ALPA 3EVBA 1IG0A 1M5UA 2AUNA 2PO5A 2VLBA 4KG7A 2EZ8A 3R23A 4UVGA 4YRDA 1D7AA 2PRIA 4CG2A 5KOIA 5GINE 3RE1A 4NMHA 4X92A 4D2IA 4ACAA 4D6YA 2B78A 4H1WA 3OPYI 1ZG3A 1CUZA 1NDUA 5FOVA 5TGDA 4PWYA 4YXWD 4V3BA 4LF9B 5AXDA 3G5AA 3I5UA 2CBZA 1Z82A 3LHKA 4YCLA 1UJBA 3RLIA 4BO9A 1QG6A 3G0IA 3R3WA 4X45A 3F3KA 1T91A 3R3XA 3CX8A 5MF6A 3AVXA 1LKZA 2QN6A 1ZLYA 1E9RA 1SD1A 2P11A 4X8MA 3S1AB 3T0FA 2X1HA 1WBBA 5B3JC 2OP0A 3CXRA 2X2EA 3I6ZA 1K7XB 1ST2A 4WZAA 1MB3A 3L77A 1IOWA 4N48A 3LT5A 3I6QA 5JSHA 3H3JA 4KAFA 3S8MA 3BTOA 2AC7A 3EGDA 2O3UA 5I8ZA 2ECOA 1BQ3A 1ZXBA 3RSCA 3AFNA 3SYLA 4P35A 1OWOA 3QIAA 1PFVA 4PCAA 2G17A 2B8JA 4IKPA 4HNTA 5KYXB 2O8FB 3IB3A 3E3LA 1AVTA 2VK2A 2PE5A 3DL0A 1RZUA 1TYZA 1XRQA 1ESEA 4HGZA 4WXEA 4E1AA 1I7DA 3P26A 3KLPX 1FDRA 1IBRA 4M0UA 2VNSA 3VYSB 2PN1A 3T9DA 1D1PA 1MX3A 1G66A 3BMNB 3KWFA 2QRVA 1Z68A 3AM5A 5CBKA 1SVNA 3V1YA 4WESA 3MK31 2A1TS 4XA8A 5AP9A 1TE2A 4PLCA 3SY8A 4LDZA 5CA0F 3VDNB 3H2SA 4MVJA 1UDWA 4MR9B 1OE0A 2Z8YM 5TARA 3TNDA 5BN4A 1YL7A 2FQQA 5BWOA 1ISGA 1ZD1A 1S8AA 2Q5IA 4NFSA 4C2TA 2VK1A 3DBRA 4MB0A 4EUHA 4Q3DA 2YV2A 5DBFA 3GJ8A 3O75A 3U39A 1M75A 2IYEA 4I5GA 1W34A 4JODA 2C99A 4WLNA 5CAEA 4H9GA 1MEOA 4QGHA 3MMSA 1XLTA 1XZGA 1T8SA 1VL6A 1KDRA 2R5WA 3FTNA 4GUAA 4ZOLB 1OASA 3HUUA 3TRJA 2O8CB 3PF8A 3ML1A 1JQBA 3ZYCA 1H4SA 4G65A 1BAPA 2IXTA 3N28A 1TCBA 1O6CA 1ZBQA 3G2PA 4CT4B 1NSFA 2HRBA 3IB6A 2I3GA 2W4QA 1FUYB 3HXLA 3V4PB 5EJ7A 1C8LA 1B4DA 2JIBA 4PO8A 2CE2X 1SUPA 2DFDA 3C6MA 4TTVA 4URUR 3RKRA 3EFOB 1JEYB 2P40A 3JWPA 1GPAA 4BBJA 3CUUA 1S7GA 4X3CA 2V96A 2XY4A 1H8ED 1RWVA 4OXKA 4AYXA 5LBUA 5EWLA 4CLHA 1OT5A 2XSZD 4DIMA 3BH6A 3HKBB 1PR0A 4AO7A 3P9KA 1I4LD 4W6ZA 3VHLB 3INTA 3FNGA 3LYLA 4MA0A 3KB8A 2HF2A 4YN3A 1ZGCA 1EJ0A 4MJXA 4UUPA 4RPCA 1MKYA 4LJ6A 4RLQA 3WL4A 5ALVA 2XKKA 2XE7A 1AT1A 1D2NA 1JIQA 3SQXA 1LJLA 1ZC4A 3LDAA 5E4JA 2FK8A 5EJ2A 3AINA 3L40A 1MJFA 2J0UB 1TZBA 1BE6A 1GN9A 3DFFA 4CM1A 1LNQA 1PZMA 5KWSA 2PZLA 1HPLA 1TZ2A 3MMZA 4BIIA 1UZLA 4IMJB 1JPVA 2EWVA 1ZR4A 1XKQA 4ZIRB 5AHWA 2Q8QA 3KIPA 2GBGA 2YNMA 4X3OA 1NT4A 2P78A 4PO3X 4Q9HA 3OIGA 3QFCA 2FPXA 4B3IA 1NIJA 1TD9A 5ALRA 4LZLA 3U4GA 5DM60 3NEAA 4JENA 3GRUA 4GI5A 4NESA 4NX2A 2GX6A 4V3CA 4LBVA 4M83A 3G13A 1W44A 4CCYB 4EI2A 4Q37A 1NJ8A 1V95A 1D4OA 5I4CA 4WY2A 1UEXC 2JIQA 3P9YA 4J4BA 1YIOA 3NBUA 3HDJA 1QOPB 3PXBA 4ARUA 1AO0A 3L6OO 4YJGB 4CM4B 1SCBA 1NQ5A 3H9GA 2QD2A 5FDFA 3SD7A 5L51A 4B82A 3C3BA 1YH3A 1GGVA 2RDMA 2AKYA 4XW2A 1PD0A 2GF0A 2IP4A 2WU4A 3N6VA 3U81A 5IYZA 1IY2A 2J7KA 2JVJA 2YVUA 1HTBA 4TXMA 3TAUA 3R7WA 2QGFA 3OJWA 3PJDA 4XTRA 4V24A 4GXQA 2O3JA 3W1WA 1U5AA 1NVGA 2B21A 2NZJA 2YUTA 3MCUA 2E89A 3L5KA 3PB3A 4M0MA 1DHTA 1AX9A 1NR7A 3WBJA 3PTAA 1LI7A 4C7KA 3LUJA 2HBRA 5IASA 3QFRA 2DH5A 3LC7O 1HDRA 3HDHA 4L4YA 5DT2A 4ZI3A 2RB4A 4UUOA 1KI4A 2H4FA 2P5TB 1K8YB 3D3WB 3R5JA 4JC0A 5JCZA 1V35A 2HA2A 2X1VA 4QOJA 1P3Y1 4RJ2A 5EIBC 1VJDA 2AJTA 3TM5A 1RRKA 3A4YA 5C1PA 2HW8A 5LOVB 1LFDB 4WCFA 3HNOA 1I3OA 5KYYA 2D2VA 3V4OA 3SLKA 2J5RA 3MJVA 2V7TA 5LP6B 1UFOA 2P6UA 1Z8HA 3I4LA 2YICA 4C20A 1GPNA 4ND6A 2PRKA 2ZI7A 3MW8A 1EKXA 3FCAA 2OQ2A 4OI1A 3QE4A 1TCVA 5JWHA 4L57A 1NMXA 1NN1A 4KSCA 1GPKA 3UB4A 4AL4A 2D1SA 3L49A 5EUBA 2X13A 2ZTHA 3UANA 4YXWA 4RDHA 1H6DA 1NJFA 2WA1A 3BMXA 4B3HA 3V8QA 4RULA 2I2DA 3D6HA 4PGHA 5DWQA 5C4IA 1KJIA 3F96A 3UJPA 4C1NA 4OUDA 2CV1A 1GL9B 3F4BA 3Q3HA 3I42A 4L9RA 3B51X 3ZJYA 3QBTA 8LDHA 3VO8A 4XB6B 5AKXA 3RUDA 2OLKA 5A9RA 1NVWQ 3BGIA 4RXMA 4LOHA 3OAAD 4RCZA 4ZEOA 2VCYA 2RGNA 1FRZA 4C5BA 1EX6A 3ZE1B 3BGWA 3BCUA 5LA6B 1R8YA 4S2EA 4BMPB 4ODIA 1MBZA 2ERCA 3JD4A 3FNRA 3DAHA 3CLRD 4DLXA 3T7TA 4UULA 4B9AA 1EE9A 1Y6RA 5FB3A 1FFCA 3T5DA 4IEIA 3ICCA 3GYGA 5FFFA 1NUSA 1ENZA 3QYJA 4DM7A 2EERA 1I1NA 3EDQA 3VV3A 1FDTA 1G9TA 2OB2A 4DMKA 1G19A 4AO6A 1YVRA 4JYCA 3QPWA 1HEYA 1NNUA 2WTMA 1TNDA 2YQ5A 4FKMA 4G1BA 4OV6B 2V3CC 5HK8A 1I51A 1QCDA 2C9ZA 5ALKA 1WU7A 2QQGA 1WV0A 5LU8A 1KVTA 5AMXA 5CDHA 2IBTA 4IO0A 2JW5A 4P81A 4J0FA 5FLKA 1K6JA 3CLUD 4MVJD 3VR6H 2NP7A 1IEWA 2X8BA 3KKQA 2JIOA 3W3AA 1GT91 2DPGA 4WXPA 2HB6A 3PUHA 5TS3A 1JEQB 1EMDA 2OV8A 3W7AA 3K16A 5LQDA 3V1TC 4IVNA 3BWBA 5A06A 3VZQA 3GK3A 2ZSIA 3HFJA 3ZVLA 1HRDA 3SX0A 3ZZTA 4JKIA 4AT1A 2IZOA 1Y3IA 5HKKA 1JX6A 4J91A 3I5YA 4MWEA 4NPAA 1PEDA 1ZH6A 2IY7A 4B9EA 4ZVRA 1VE6A 2FN7A 3GAFA 3GCXA 1N2XA 2ZKIA 4KE9A 3O8BA 4LJ4A 3KSUA 4WOBA 4AO8A 1GNSA 1RFLA 3G1UA 2CZCA 4QOIA 2UUAB 2FEXA 3TDNA 4CCSA 2YVKA 4OK5A 1Q0TA 4DR7B 1X1QA 5D3KA 4FQ7A 5LZ7A 1QGED 3PKZA 4M8SA 3REFA 1XDBA 4CMKA 5C7OO 2BI8A 5FI5A 4CMEA 3IXMA 2VH1A 5KQSA 3IIKA 4F4IA 3ESZA 3PE3A 4K9PA 2RC6A 2XV1A 4BP1A 2X3UA 1J42A 2IYTA 4IX9A 2KE5A 3RJ9A 3WYAA 3S7ZA 5BQPA 5DHTA 5TQVA 1KIAA 3UWOA 5B6IA 1PR2A 3KT0A 2J5KA 4F46A 2CNDA 2ESRA 4MKRA 1EUCB 4RA6A 2A92A 1Y82A 1KAHA 2C31A 2JJ2A 1TECE 3GOQA 1JIXA 2VJOA 1E2GA 1LDBA 2HYDA 1GYPA 3L7YA 4M1WA 1Q0QA 4R2KA 4BQFA 3U7QB 3H3FA 4DGSA 2PX0A 4BLUA 4L4SA 1PZEA 2HT1A 2DWQA 4Y6QA 3LNCA 3B6KA 3FG9A 5JTTA 2HI0A 1JE1A 1A9QA 3Q7TA 2BELA 1J25A 5KO2A 1U1EA 5KDLA 3IJRA 3CJTA 3TL2A 2QMEA 3V1MA 5AVTA 3T99A 1MPTA 2JJ1A 3I6YA 4YMLA 1DC3A 3RRXA 4HDOB 1U0RA 4R8SA 3PE6A 4TTSA 2ZWAA 5KAMA 2NMVA 2PS3A 5JNSA 1EFDN 2FW1A 5I9MA 1CSEE 3AUUA 4NMWA 4TS9A 2V7PA 2VZEA 4MPJA 1P18A 3LOUA 5JQGB 3EC2A 3IAFA 3MLBA 3OU6A 4KXNA 4UM9D 5AOAA 1FDSA 2GTHA 2YXDA 3S0JA 2BD0A 3K8YA 5CXXA 3GFBA 4K40A 3KPVA 3TZLA 4F84A 1ZH4A 1U0BB 3U4QA 1IK4A 4UUAA 1B2RA 4YJ3B 2UYCA 1JHQA 1B43A 2BR5A 1MC1A 1LS1A 4IUBS 4MJ7A 2IC5A 4DR4B 3VC2A 1CDZA 5GONF 2F2TA 3NAZA 1HKHA 3BN3A 4YPVA 4U2EA 1X1SA 4DSTA 4HNRA 4UEOA 2XKJE 3ELUA 4QIHA 2PD3A 1PF7E 2QLFA 3OM8A 3AIKA 3BXXA 4ETWA 1CRWG 1TDJA 5HE8A 1G60A 4O1MA 1VMAA 2KI5A 2BEWA 4Q0MA 5DE3A 4MUAA 3DTNA 4F9TA 3W5BA 3HXKA 4E07A 2XA1A 1L5FA 4L1KA 1E6WA 3IR7A 5FWYA 1QC5B 3EMVA 3ABIA 2VDMB 1GCAA 3O94A 4HWKA 1YS4A 4CIDA 1WB9A 3K94A 1U8XX 4BNDA 4WOPA 5K2OA 4Q48A 3REQA 3LPLA 4S1TA 4EJSC 5JJ5A 2FPPA 2O5CA 3LAWA 1SUCA 1RABA 2BJWA 1T36B 2BONA 3S28A 5JEDA 1CYEA 3TZCA 3P1JA 2X0EA 4DDTA 2VCHA 1LRKA 4N0DA 3CONA 2ZREA 3DAPA 3WLEA 3M8KA 5IJWA 2D4HA 3G6KA 1XZAA 3T7IA 2NNWB 2FUG1 2HIGA 1Y6QA 3NPAA 4HQ0A 3NHJA 3KALA 1DKNA 3DG9A 1V9CA 2ADOA 1DJNA 1KH2A 3CU5A 1OZ0A 1YZTA 2ENWA 5DM4A 2E55A 1AGRA 2ZITA 1FSFA 2I6QA 4ZJYA 1G5HA 2IPAB 4KL8S 4QM6A 1YC2A 1SZJG 4NNOA 5G1OA 1X39A 5B1SA 1APBA 1EQAA 2DFVA 1DINA 3AESB 1FXWF 2EEPA 2ZULA 2PBRA 3EAQA 3RSGA 4EJ6A 4AKHA 1E20A 2FSPA 4I9UA 4EGCB 4L8GA 4KQGA 4B32A 2JLZA 3DEAA 3AKZA 1VE9A 4M98A 2A9KA 3TMYA 1O54A 3AR2A 4U00A 1GNRA 2C78A 4R40A 2I2AA 3VKUA 5F64A 5L3QA 1Z5OA 4RYDA 4TYYA 2WDPA 2HJ9A 4PRKA 3T3MB 3CUKA 2YRWA 1Z6PA 3AKEA 3K0CA 3T9CA 1IVNA 2PZEA 3GVPA 1XQYA 4DCMA 3IOMA 1SXJA 4ABTA 4URZR 2VHJA 3U1VA 1C0IA 1E8MA 1KZ7B 1TK3A 1B8PA 1TU0A 3TNFA 3ZGZA 1RHUA 2OO5C 4Z4CA 3REQB 5GIPE 2VG8A 5D86A 4Y2XA 4Y98A 5IWCA 4CKEA 4I19A 1SUWA 2YNMC 5CJ2A 1QR2A 4DSNA 3OQNA 3IEMA 3TDMA 2VBFA 1QO9A 3GF4A 1VKOA 3SS9X 4RADA 4FP9A 5DHQA 3F6RA 4FYMA 4BS9A 4ZT3A 1Q7EA 4WNIA 1LSOA 4YAKA 2JCSA 4D4KA 3H16A 4HDKA 3ZHZA 5KTSA 1UMCB 5BR7A 2QRPA 2EZUA 2VA9A 3CR8A 1JYSA 4KP7A 1JLRA 1MC8A 3IT3A 3IPAA 3HABA 5A2GA 3HCDA 4HR7A 3KXPA 3E5HA 3N5CA 1E79A 3RWBA 1FDVA 1E77A 1O5OA 1YIDA 3K8ZA 4HGQA 3PKJA 4UAUA 2FFQA 2XEXA 4N5IX 3WLHA 3PFFA 3QQ5A 1JBQA 1JU9A 1T1SA 1UZUA 3TLBA 4AWBA 4WBNA 5ITVA 3DMPA 1QTRA 1GM5A 1FYXA 1XWIA 1MX1A 1KOLA 5JSZA 3G02A 4KFRA 5K6AC 5FTKA 5BYKA 2PIDA 4C0WA 3I61A 4BBPA 2FLVA 4G1FA 3ROEA 3PJRA 2X0RA 3C14C 2LKCA 2Z4TA 2GAJA 2QU8A 3ICEA 3Q5EA 3SP1A 1K6MA 3MD9A 4J2OA 3K30A 4MYRA 5J63A 4C30A 3DKIA 4Y1FA 3AFIA 4TV8B 1Y1PA 2A9JA 4C14A 1SXJB 2IEBA 3O91A 3OE1A 1SU7A 4XPIA 2D6FA 3TB4A 1G0OA 4XM2A 2VT2A 3ENVA 4ZAFA 1E2KA 3OQIA 1E4YA 4PFSA 1RJ9A 2A8YA 3QMMA 1NUUA 2FP3A 3NNNA 4Q9NA 2WF5A 3FYHA 4KX3A 3L79A 1USUA 4BGDA 5ICMA 3CF4G 3GLRA 1UBEA 3NYIA 4ND3A 4N40A 2RHDA 4UAVA 1NF2A 3TRIA 4FZVA 2P4UA 3O92A 3WFJA 1PJBA 1V8PA 3GGCA 4L0CA 2BFBA 4ENPA 4U9HS 3ZTTA 3DV9A 4TKMA 4AX4A 3D7NA 4HN4B 4EF4A 5FLEX 4DBLC 2OD9A 1ECGA 2ZIAA 2IIBA 4GG1A 1H0KA 4QTXA 3HJRA 3UT5A 4B7XA 3AC0A 1FMCA 4LJ9A 3OLYA 1VGQA 4GI2A 4HVTA 4M3NA 1VSTA 4YXFA 1F38A 3G7SA 3VAAA 4ESHA 4RTOA 4PHFA 1TQ8A 4RMNA 1FPMA 1M1ZA 2R62A 1EP1B 3CRVA 4L16A 1YR2A 2WFMA 4HXGA 4N5NA 3WKBA 2LXNA 2RB5A 4PCUA 5K0SA 1RWMA 1K9VF 2WJIA 4GRIA 5CVDA 4N0EA 3VKHA 3EUFA 1PEAA 2LNDA 3M9XA 5EI5A 5AXCA 5JUWA 5NLLA 1OC2A 3IAM1 4FHDA 3T5TA 2BJHA 1DPGA 5AH0A 4DA0A 5TNXA 1YFZA 5IM4A 4LY3A 4FOTA 3T3GA 2CEAA 2E7ZA 2O48X 2PGIA 1FP7A 1Z2AA 1Z4IA 4ZARA 1IBLB 1JG6A 2VAVA 1HDYA 2BEKA 1J8QA 2R751 3UMCA 2B92A 3ZNQA 3DWIA 3D8NA 1Z6ZA 3T0IA 4AN4A 4JUCA 4QBTA 1LXCA 4LY0A 1H2FA 3AEXA 1J22A 4QICA 1G20E 1P7WA 4M1OA 5ESXA 3R75A 2HNKA 3WTBA 4DT1A 2VZ8A 2DBYA 2ET6A 2Z9BA 3W06A 1EIWA 5BP7A 1ZSYA 2FI1A 3HHEA 1T0BA 3IO3A 4TKZA 3RC2A 3ZY3A 3O7WA 4NQRA 4CQMA 2CSXA 2GEKA 2R11A 4IVRA 3NIWA 3GA5A 3A4LA 1HE5A 3VVMA 5CFOA 1PW7A 3L0PA 2XMRA 3GPDG 1IQ0A 1MO2A 2OCLA 4P22A 2HQ1A 4BBAA 3TYXA 2Q6IA 1NRXA 1GNPA 1UAYA 4HS9A 1V2GA 4AC9A 1TXGA 1Y9ZA 2WIFA 3DW1X 1EYZA 5B36A 3NV9A 5HZMA 2K7FA 2A7QA 5CA0B 2EJTA 1M1YB 3KRTA 1N2CE 2A5FA 3BD9A 1OBOA 2ZUFA 3IAAA 3RJZA 3E23A 2VNIA 4FOLA 2O2HA 2O7VA 3CINA 1IBCA 1KDPA 4HWTA 4LZAA 4C5CA 1VDMA 2FHSA 1I3CA 5A1TA 1P5HA 1JQAA 3JQGA 3QWIA 1PR9A 1RBYA 3BL8A 4TOIA 4MX8A 3MT8A 4BLQA 5HQTA 1FTSA 1K7FB 2BKUA 1UWCA 3CY6A 1KR5A 3VI3B 3WYDA 1P1JA 3KL4A 5BPFA 5CLQA 3PL5A 5DVZA 2WF6A 3N2KA 1T13A 4I4CA 2NXNA 3OESA 4E22A 4R7TA 4QUBA 4ZXPA 1HNZB 1U7DA 5FADA 1C41A 2R6JA 2QX4A 1RNLA 4IF4A 1XCBA 3AR8A 5JS2A 1A7KA 2E85A 4QDZA 4BNXA 1XE3A 1I2AA 5E9QA 1NW4A 2VF4X 2DFKB 3EIEA 1JXAA 1BU5A 5D85A 3T38A 5G3ZA 4XD7A 1CIPA 3CTPA 4U4AA 4MW5A 3EG9A 5ALJA 2C58A 1X7YB 2ZIZA 2WI8A 4D02A 1G4AE 3AFGA 3ZZ0A 4XRGA 3LFUA 3RGGA 4ZVMA 1H85A 2X4LA 2WBLC 3I2GA 1MENA 3B85A 1B41A 2FPIB 3C41J 3AJAA 3KYDB 4GM0A 2XQGA 3KFXA 5CHEA 1AQUA 3RF7A 4D7AA 1T5DX 4PPQA 1OXTA 4DL9A 2IYUA 1XROA 5CNIA 1PV2A 1N75A 3ZKAA 4NAUA 2GZ1A 4NCIA 5A3QA 3SSOA 3G8BA 1IBMB 4IDQA 3CZCA 4I6EA 3VNUA 3A6EA 4G4JA 5FAKA 2BC9A 5L4NA 1A69A 2GKOA 1QK5A 3NT2A 1BOOA 2BUBA 2GK3A 5K0FA 3AY0A 3MB5A 2JJQA 3OOJA 1RPNA 3DE0X 4HGNA 3TTVA 3EGDB 4PYQA 4EFKA 4Y3UA 2YVAA 1FXWA 2F90A 4QTTB 4ZI5A 3V1UA 3OSZA 3LT4A 1KTVA 3HY6A 3MELA 2XXBA 3DHWC 4RS4A 2AX4A 3U5ZB 4IJ5A 1M3SA 3FROA 2I87A 1QM5A 3VR4H 3CPJB 2Y92A 3STXA 1UKZA 4TQ9A 2W2PA 1PFGA 3D0KA 5BQXA 1N33B 5K05A 1WXEA 3HP4A 1ZZEA 2VWHA 4LXHA 4QQKA 1BDIA 2D0OB 1FZTA 4ZCSA 1JDJA 1RQLA 1YQEA 2H4ZA 1CQIA 4YQZA 1WTCA 3FWKA 3DOJA 2QPTA 2CLDX 4I3GA 3IFSA 3M4YA 1BOFA 1CHNA 1H5UA 2A1IA 5EVCA 1X1TA 4TT3D 5REQB 3D8TA 3LK6A 4L5BA 5DN6D 3QVUA 3KYIB 2J3EA 2G82A 3D0RA 1KC3A 5HRCA 1KO7A 2R7NA 1RD4A 2WMNB 1DAHA 3HUEA 5JY6A 2OXTA 1Q6ZA 3X3HA 1HZZA 1O8CA 2JFUA 1GJRA 3QXSA 2VPQA 3AUFA 4BO4A 2D1YA 2ZZMA 1RRVA 5EHIA 3ROGA 1ILWA 1H5NA 3H8WA 4M22A 1XZLA 3NVMB 3NWPA 1GRVA 3O0TA 1CY2A 4K6KA 1OREA 3TZ6A 2FHPA 3U3ZA 3L8YA 1L4UA 1V7QA 1ULTA 4R2MA 1QP0A 1QRSA 1ZN7A 3H84A 5LP6F 5D6NA 2BM0A 3AI2A 3N0WA 1DARA 2VAPA 3WKEA 1BHQ1 1R1DA 2WVAA 2AG0A 3D3QA 1R0BA 1W4BA 1JV2B 4WERA 4NONA 5BRAA 1O0SA 2LCIA 4QWWA 2C82A 1NHGA 1EUDA 1LRLA 3QNUA 3FPHA 4BLTA 1VL8A 4BNYA 3AVVA 5LQKA 4BLOA 3FWNA 4KE8A 2IP1A 4TWRA 3QOXA 4JJZA 4MKGA 4W99A 1OIWA 3EPPA 3NVAA 2I1VB 4DJTA 4D79A 1AKTA 1DJMA 1W36B 2NPOA 1GPJA 4LECA 4MUNA 1G21B