2JJ8A

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
197
structure length
184
Chain Sequence
b'TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERCVPLKYLQELHELHEDWLIHPQSCKVLVLDAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
molecule tags Transferase
source organism Drosophila melanogaster
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
total genus 66
structure length 184
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2jj8A00
3BH7A 5P21A 1KDRA 2FFAA 3CF0A 4TTPA 1AGPA 3WMEA 3ZIAD 4A4DA 1JAHA 3SEAA 4PQFA 3QKRA 4XJXA 5E7MA 1KYIA 2QENA 4URWR 2ONKA 2KE5A 3GFOA 1P2UA 5F98A 1U8AA 3CPEA 2ZRNA 3DPUA 5DHAA 2WKQA 4Q7LA 1HEIA 3T1QA 4HLUA 4BFXA 4P4SB 3I61A 4Q4HA 1UBCA 4CZ2A 4BGDA 2ODWA 1QG2A 3D6TB 3RABA 1NJFA 1RIFA 3C16C 4PHTA 3HDTA 4B3BA 1XXHB 1YZTA 5FL7D 2FG5A 1DO2A 4OQMA 4TL6A 1P72A 2IX3A 3DOFA 2PL3A 1W5TA 1E94E 1BMFA 1Q57A 4H1VA 5DGXA 4GRAA 4D4KA 1G17A 2RGCA 4C0AC 1A82A 3NG1A 4B3CA 3EARA 1FPMA 1Q1EA 1OPXA 3LDAA 4LC1A 5JI2E 1XJCA 3D31A 2ZS8A 1DELA 2WICA 3L0SA 3OZXA 5FUYA 1Q22A 3ZS8A 4L5BA 3WYGA 3HPRA 3EPHA 4Q4JB 1OYYA 5FOWA 1L4UA 1EFCA 2XNSA 1E9EA 1Z07A 2G1JA 1C4OA 1E2HA 2UKDA 2QL6A 2ZRGA 4ZDWA 5C1BA 5KSOA 3K53A 2RH5A 1P9WA 3TW8B 3PV0A 3N70A 1SVIA 2GDJA 1YR9A 3K09A 4HAVA 1A1VA 1G3IA 4EPRA 2FNAA 1ESMA 2B8WA 4TMWA 2YZ2A 4HEJA 1WE2A 3E2IA 1HQCA 1LFDB 3FGNA 4QKQA 5J4KA 3N2EA 1G64A 1OIVA 3E5HA 2GILA 4BZQA 3FB4A 2J1LA 2Z6VA 4TYNA 1GDDA 2V9PA 1T5IA 3DM5A 2IS4A 2OLJA 1TTTA 4KO8A 2F6RA 1UDXA 3SZRA 3N2IA 2WV9A 3IKJA 3SYLA 3SR0A 4RJLA 4IFBA 1NMYA 3NVAA 3ADDA 4NHOA 4B47A 4Q1DA 3AKEA 3WXMA 4A8JC 3PQCA 2J7KA 4B74A 5JCZA 3CRQA 3FHOA 2KWIA 1DVRA 1ZNZA 2Q9AA 5KSPA 4Q19A 1P6XA 1Q12A 3DL0A 1E0JA 3BORA 4BFTA 1EGAA 2IUUA 3UMSA 3VQTA 4PXAA 2FPKA 3QXSA 2KBEA 1YZNA 3BFVA 4NCJA 3ZVLA 2O52A 1CEEA 2ZI3A 3QPVA 2FWRA 3LA6A 1GM5A 1P73A 3OFND 4MGZR 2R62A 3BD9A 2D7DA 1FFHA 1G8HA 1XZPA 2BDTA 4CEJB 4KXFB 4GFDA 4RD4A 2NPFA 4MDEA 2ZUDA 3W9YA 2UZIR 5CB6A 4GI7A 3OE7A 3IIMA 4PO9A 1P9NA 1OH5A 1XCMA 3U6KA 2GK6A 2IEYA 4NKRA 3IPXA 1XEXB 4YDHB 4OI1A 1Z2AA 4PX9A 1L8QA 3EC2A 4M22A 4PSAA 5SZJA 3UATA 3KQNA 1WB9A 4BFSA 3U44B 4JT4A 1TQ4A 2VP5A 5TXGA 1Z22A 4QGGA 2OFOA 3BC1A 2C9YA 2GK7A 2W2TA 3IO3A 2G6BA 4RZ3A 4B2LA 4EFMA 1S8FA 4EUNA 3GEEA 1DBSA 5JCPA 1KHTA 1E6CA 3IBGA 1MKYA 2V1UA 4M9ZA 5IRCD 1GSIA 4UJ5A 1CJKC 4TQ9A 4FMCF 2PMDA 3DZDA 1YR7A 3G82C 1KI3A 3K0CC 3QBVA 1GG2A 1NLZA 2KB0A 1KSFX 4L8GA 1TUEA 4KLNA 2CLDX 1OXSC 2A5FA 1K5GA 1BYUA 4ZI3A 2IYSA 4NONA 3WNCA 1CJUC 2GTPA 2JEOA 1RKBA 2UZ3A 4Q9IA 3GLHB 4HUQA 1T5LA 2LKDA 2CJWA 3C41J 3NH6A 2VP4A 3BXZA 1XPOA 3MLEA 1Q44A 1KNXA 1NG1A 4ZCIA 4QBGB 8OHMA 2R8RA 3FOZA 2FFHA 2NIPA 1ZBDA 3GLFB 3RSOA 1YR8A 2QMHA 3AEZA 2ZYWX 3I8SA 4RZ2A 5EZ6B 2IYYA 2H7VA 2ZTSA 3ZH9B 1DS6A 4FCTA 3MMPA 4M2LA 2HT1A 2F3RA 3RS5A 4KYUA 3QIAA 1DOAA 1VDZA 3SBEA 5HE9A 4NMMA 4TZ0A 1WQ1R 5DI9A 1T3HA 1FP6A 3KJHA 1R5OA 3MRSA 1XCPA 1VHTA 3BH6A 3H0KA 1ZINA 2ZR9A 5E7JA 4X8HA 3ZVMA 3IQWA 3FMPB 4V02A 3IIJA 4IDOA 2QTFA 2BM1A 5F9HA 2GKSA 2HXSA 2QU8A 3KZ1E 5FTMA 5FBVB 1QHSA 1ZCBA 2WTUA 1QDEA 1XF9A 3THYB 2WSSA 1QHYA 5JRJA 3VNVA 4IOJA 3O8BA 4NP6A 1LW7A 1WRBA 2R6AA 5FUWA 1S4QA 2KSQA 3U3JA 4NH0A 4PFSA 4II7A 2BBWA 4QJ3A 4XVQA 2I1VB 2ZS9A 3BFXA 3R20A 3TH5A 2GEUA 4Q9JA 1G7TA 1LF0A 2VEDA 5DE3A 2HYIC 1NJGA 2J0QA 3LVRE 3TUZC 4LX0A 5KUTA 2CDNA 2CE7A 4RD2A 5CM8B 4ZIRA 2ANCA 4P3YA 3EC1A 4YQFA 2B7CA 1Z08A 2AK2A 1JPNA 2IWRA 4C7OB 3CX7A 4HDCA 3BOSA 4XTCS 3B6EA 4C2TA 4RCZA 2GHIA 4G5SA 5GADl 3V4RA 4A0RA 2DPXA 3B1WA 4AYWA 2O8EB 1JNYA 4ZPXA 1W36D 4M1SA 3RRNA 4M0LA 5CLQA 3C7KA 5G40A 1VECA 4Q1EA 1G1MA 4BLRA 2E1RA 2IYZA 2SHKA 2IS2A 3AB3A 3ASZA 3LX5A 3QBTA 2CHGA 4UNNA 4K46A 4D2IA 2BKUA 2OT3B 3CRVA 2BMJA 3BK7A 3KKPA 3K9LA 1VYTA 3IILA 3OESA 5KTYA 4BE7B 4DT1A 3OEED 1VKJA 2C04A 2HEIA 2YOHA 2JLZA 4PR0A 1E2FA 3ZQ6A 2C78A 2JIZD 2PEZA 4JIMA 3NDBB 2V54A 4LY6A 1QBKC 2GJ8A 4ZCLA 3QF4A 4BRUA 4NCIA 3BBPA 5B64A 2FFBA 1PUJA 4RKEA 3DMDA 4P4UA 3ZQJA 3QKUA 4I1SA 4M21A 2ORIA 5IK2D 3KKOA 4KSBA 3RAPR 4OKSA 1E1RD 1JR3E 1NKTA 2V6JA 1NVUQ 1VPLA 2HF8A 3I3SR 4MDFA 1AK2A 2NZ8A 1X3SA 2ORWA 3BFKA 4TLEA 4X8OA 1CJMA 1XD2B 4M9XA 3ZS9A 3NHBA 2PX3A 2ZANA 4O25A 1OLOA 1X6VA 1QZXA 1XEWY 1QG4A 3DHWC 3LAWA 3EASA 3UK6A 3TJZA 4GZLA 2D06A 4HDOB 1N6RA 1G3QA 3B8HA 1AA9A 1KJYA 3WHKA 3AF1A 3SFZA 1GITA 2QROA 2WWFA 1IY0A 4Q4HB 5JWRA 2X2FA 3EPLA 3OFNA 1XD9A 1KMHA 4XD7D 2BIFA 1OF1A 3RS3A 4ARZA 3PITA 2QQEA 3CZQA 2ZRCA 3SC3A 2QAGA 4QRHA 1KNQA 2HLDD 1XDBA 2D2EA 3ONWA 2FZ4A 4DUGA 5FUVA 1N6KA 2OCYC 2FX3A 2ZYUX 3DM9B 4O2RA 1SXJE 2J45A 4OK3A 3MFYA 4DCSA 1TU4A 3B9QA 4LYAA 4LI0A 4A2QA 2ZRAA 4US0R 2QMEA 4LC0A 4IVPA 4ARZB 1J8MF 4OBEA 4CEHB 4B32A 5FTLA 2PJZA 2EFEB 3EWSA 1XJQA 1KZGB 4HAZA 1WF3A 3AP2A 3FPAA 5E7IA 3K0FA 3LW8A 4TYQA 4B75A 3TAUA 4V0LA 1KI6B 2K5UA 5EUQB 3ADKA 4B48A 3EIHA 3CRW1 1QHIA 4ESVA 4BLPA 3THOA 4DLWA 1H8EA 1E4VA 2CL6X 2ZJZA 5E3HA 2ZAOA 1E9RA 4LV6A 1R2QA 4C0BA 1ZUHA 3SU8A 1Z63A 4Q66C 2WKRA 2HCBA 1NSFA 2YOGA 4TMXA 5C4MA 2Z43A 3GLFA 5JEDA 5K8UA 4M1OA 1HV8A 4GL2A 1U94A 2ZJOA 4DKXA 4ZIRB 3HP1A 3AKYA 2FA9A 3X1ZA 4EPTA 1OFIA 2F3TA 4RD0A 4ABYA 4EPYA 4UQOA 1KAOA 4MRPA 1RJ9A 4CIDA 1E9CA 3T5GA 3TSWA 1AZTA 1IXSB 4LJ5A 4TTRA 4CEHA 3GJ6A 1CR0A 2REBA 1VIYA 2QT0A 3P4YA 2ORVA 1II8B 2BV3A 1E69A 4BFWA 1N6OA 3VKGA 2P0EA 2FPLA 2PLRA 4B76A 2QP3A 1W1WA 5DI3B 2ODBA 4MGYR 3K0SA 4TMVA 5CIWA 4R9UC 5K8TA 2JAQA 4FINA 3K9NA 3IO5A 2O8BA 1LV7A 2CNWD 3GJ7A 2VO1A 1W4RA 4KVGA 1OH6A 1Z2CA 5J5CA 1JJ7A 1XEFA 4V0OA 1IQPA 4ZCMA 4XWKA 2ZJ2A 2OZEA 3TQCA 1YHNA 1XWIA 1W4CA 2WIAA 2AD1A 1XX6A 2RMKA 2VSOA 5L3VA 5KDOA 4M1WA 4A8JB 6Q21A 1G5PA 2CXXA 2RKOA 4FI3C 3GJ0A 5LD2C 3HR7A 3R7WA 4HB3A 1ZD1A 4AG6A 2WAXA 3CO5A 1BO6A 2I4IA 3ADBA 2WJGA 5EUMA 2O0HA 3KFXA 1TEXA 1ZC3A 4D81A 1N5LA 4F4IA 4IEEA 1HA3A 3WYFA 4M4SA 4HB0A 2QBYB 3T12A 2DWQA 4GOKA 4ZDKA 3NKVA 4UXJA 4BUJA 2EFCB 2HJVA 4PC1A 4NDZA 2QTHA 4LJ8A 4JKYA 4PPQA 4OL0A 1TADA 1FP7A 3KB2A 3KJEA 1YZUA 2V7QD 3EG5A 3K0CA 5EXSA 1VTKA 4XSHA 4PQYA 4JBXA 4QGAA 2Q0HA 4LYJA 3GQBA 4D25A 1DG1G 1KI9A 1Z29A 5JZVA 2MSDB 5EQTA 2W58A 1JQLB 1ZP6A 2P67A 3ZD7A 1CF4A 1ZNYA 3K8YA 4B71A 2WWGA 3Q7PA 1EK0A 2JLRA 4Q9KA 3A1SA 3NTUA 1NP6A 4PAQA 5JSZA 4DUGD 5IHPA 5BN5A 4DLZA 1CKEA 1P7CA 3C4JA 3FKSA 1JR6A 4TL7A 2D4HA 1SXJD 2FH5B 3UG6A 3CPHA 2OILA 1VYVA 2AWNA 2MSCB 1W4AA 5GJBA 2BCJQ 1PZNA 2MSEB 4CRWB 1KO4A 2ATXA 3AUXA 1OIXA 1BIFA 3TKLA 2ZPTX 4LV8B 5F3WB 2IS1A 2X8AA 1GVNB 4LBVA 1VG1A 3UANA 1SKQA 3GLGB 4O2LA 1XTRA 4UNSA 1G5RA 2AD5A 5KOYA 2PZGA 4FMCB 4EKDA 2DHRA 2IXGA 1T8UA 5ELXA 1UPTA 3REFA 5H8WA 4LPSA 3PUZA 4CYMA 3OIUA 1IY1A 3GD7A 2D62A 3JZMA 2PBRA 1OXVA 3PUVA 3A1VA 1SKYE 1CP2A 4HAWA 1E2QA 2RCNA 4EQ6B 2QE7A 1AM4D 3SYKA 2IS6A 1AQYA 1YJ5A 2A2ZA 2EQBA 3PG5A 3TSZA 2RHMA 4HZUB 4LGMA 5E95A 3SS8A 1G16A 4GMXA 2PZEA 1KK2A 1TEVA 5IF9A 1Z47A 2OCBA 2XSZD 2WKPA 5DHFA 1P75A 2C9OA 1NRJB 2DY1A 3PXGA 4BLTA 2VSFA 5AJYA 4HYYA 1KI2A 2IC5A 4C4PA 2PX0A 2W6ID 3LV8A 2JCSA 3AM1A 4G1UC 5J4LA 2BBSA 2IYQA 1EESA 4H1UA 4Q9HA 5SZIA 1MO4A 3HYTA 4A2PA 2OAP1 2XOKD 3EXAA 4DLTA 2ZIAA 3HU2A 3QKSB 5C4GB 4MRNA 5A0FA 4G3XA 3TR0A 5JEEA 1KK1A 3LY5A 1N5KA 1NY5A 1JI0A 2AN9A 2BM0A 2AKAB 4RSGA 1RRGA 1FX0A 4MUBA 1G6OA 2J41A 2E87A 1KY3A 4K81B 3F5FA 2JLUA 4OHZA 4F92B 1E2IA 3FYHA 3GEHA 4OQNA 1N6PA 2GXSA 3M6AA 2TMKA 2WWYA 1F2TA 1CTQA 2PT7A 5BXQC 1RFLA 2BEKA 3AF0A 4JLKA 3QXJA 2P3SA 2H16A 3AVQA 3MG9A 4KFSA 5EE1A 3AKCA 3LBHA 4NZYA 4PHHA 1YVDA 2XB2A 1P62B 3FDIA 2JDID 3CLVA 2JGNA 2ZU0C 4RZXA 4ZO4A 2KI5A 3NEYA 1O87A 3QKTA 4BFZA 4W9MC 2HXYA 2ZRDA 1ETUA 3Q9LA 1FW6A 2R44A 4JVNA 3KXKA 1KSHA 4QOSA 4L16A 2QZ4A 4AC9A 3U4QB 1ZRHA 2ZI7A 3X1DA 4TZ6A 2V3CC 2P2LA 1I2DA 1VG8A 2CCJA 2XJ9A 4W5WA 4HLUC 4DXAA 1CRPA 5FOUA 4DSOA 1E2DA 1T91A 3CWZA 3HU1A 4OQXA 4V0NA 1J90A 4AYTA 2JLWA 4BZPA 2DFNA 4TYWA 4EQ6A 2EVWX 2FSFA 4Q4AA 2Q9CA 1CS4C 2JJ8A 3GJ8A 3MJHA 2VPPA 2GCNA 1F2UB 4QM7A 2QI9C 2QAJA 2WAYA 1Z0DA 3VHLB 1KMQA 1MABB 1G8YA 5FPTA 4A82A 1DAGA 1SVLA 4PQRA 4M9SA 1OH8A 5H70A 1NVWQ 3IEVA 2L0XA 1ZAKA 1Z3IX 3K0FB 4MKHA 1GL7A 1NIJA 3RANA 4NYIQ 1DAEA 4A0HA 5DIFA 1GRNA 3KL4A 1HURA 3I8XA 3P27A 2OBMA 4MGIR 1EFRD 3E1SA 3EX7C 4LPKA 2RGEA 5FBRB 1QHXA 2R65A 3NC1C 3VKWA 4I4LA 1FOEB 1CR4A 1D9ZA 1DTSA 2VBCA 1U0HC 2IUSA 3QJYA 4IKEA 2D2FA 2DB3A 3TUIC 1OV4A 2GZAA 5KDLA 2FJUA 1VHLA 1AN0A 2JLQA 4OI4A 2BMDA 2ZVPX 4R7ZA 3KQKA 1H8HA 2PH1A 1ZU4A 3Q72A 2A9KA 1R8QA 3QXXA 4BZXA 5KU1A 3U6BA 1KKLA 2VHTA 4MKFA 1XRJA 2IUTA 1G20E 1IN6A 1N2CE 1RJ9B 1Z0AA 5CIQA 5K8LA 5LB4A 1XPRA 1N25A 3ICEA 3WMGA 5DISB 1XP8A 4ESHA 1WXQA 4KV9A 3T61A 2GEDA 4LDJA 1RYHA 4BLQA 3TNFA 5G3ZA 4BFYA 4ZKEA 5FPKA 3AVXA 4OHXA 1R0XA 3AV0B 4KFUA 1E2NA 2G0NA 3IDQA 5JI3E 3S1AB 2FGJA 4PSKA 1XBTA 5HR5A 1YR6A 3SBDA 5LPNA 2FEOA 4LHZA 3IUYA 3U7FB 1EFTA 2A7QA 1GNPA 2VA8A 4FXPA 1T0HB 3R7WB 3VR6A 1UFQA 4A92A 1NVXQ 2YINC 4M53A 3MWLA 1GFIA 2KBFA 4QJ4A 3REGA 4AG5A 1L4YA 2ZUBA 4Q1AA 5GJWC 3WNBA 1QHHA 1GTVA 4PPFA 2RAPA 1R6BX 2VP0A 2WSMA 1PLJA 4FN5A 3AF2A 2FFQA 4JL6A 4OQLA 4PPGA 1S3SA 3AVWA 4CDGA 3LX8A 1K8RA 2EYQA 5D3QA 3LW7A 4WVFA 4FMDF 3SN6A 1ZNWA 1WBBA 3UG7A 4P31A 3FVQA 3DO6A 1OT3A 4A15A 4UNQA 4Q02A 3WYAA 2O8FA 4Q7JB 1CXZA 3RWMB 1EX7A 1FMJA 2XITA 1E99A 1TL7C 3ZIAA 2RGXA 1FQJA 1RE0A 4B2PA 2AX4A 3I1FA 1BH2A 1ZM9A 1E2LA 2BEJA 4Y0VA 5G53C 1JALA 1U0JA 2GA8A 3B1ZA 4TLCA 1JB1A 1TAGA 5KO2A 5EXXA 3CH4B 1ZJ6A 3KXIA 4M1KA 2ZR0A 3EWAA 1PJRA 5L8VA 4ILEA 5KSZA 1U81A 3E70C 4FCVA 1FMLA 5B58C 3VMFA 2NO9A 5A5GA 3FHTA 1E0AA 4EFLA 2NO1A 4A9AA 4DCUA 4G5RA 4OJQA 4R2HA 1GL6A 4A0GA 2JJ2D 2Z4RA 1KI6A 3RS4A 4GDFA 4JLDA 1ZUIA 4RD1A 4TLBA 1V43A 4Q4AB 1E1QD 1E9AA 2ZXUA 3VU9B 3LQQA 5C46F 4C0HA 1AKYA 1E2EA 4JJKA 1A2BA 3B13B 4E22A 3UPUA 4O3MA 3D3QA 3K0AA 1Q21A 4DVGA 4OK6A 3VFDA 1Z5ZA 1SVOA 1AJEA 4U00A 3QY0A 3EAQA 4IJMA 3GEIA 3KJGA 2ZREA 1W4BA 5LD2B 2WSSD 3UKDA 3QQ5A 4KYIB 4JVSB 3RDPA 1IXRC 4JVLA 2F7SA 2IXFA 2ATVA 3RC8A 1J7KA 1P61B 1W49A 4MKGA 4G5GA 1RRCA 4NPHA 3LLUA 4DDWA 2A5YB 1XZQA 4B2IA 1SHZA 2X2EA 2P5SA 3LQRA 4WAUA 3IQXA 1QHHB 1ZMXA 4EPVA 3LLMA 4WW0A 1HQYE 1D2MA 2NZJA 4RFVA 1RC8A 5B57C 4XVUA 3WP0A 4GBMA 4DRZA 3HYRA 2W0MA 4FW9A 4DZZA 4IOMA 3OEHD 4Q18A 1SXJA 1WP9A 5EE9A 2XTZA 4TYYA 121PA 2WM9B 2ZAMA 4C7OA 1T8TA 2BWJA 4TL8A 1DAMA 2GF0A 5CYOA 1NMXA 1SVSA 2XGJA 1TQDA 2HF9A 4DSUA 1E9BA 2ZJBA 5J40A 1UEIA 2OM2A 2R2AA 4UXIA 1U98A 2WOOA 3GJ4A 1XJ0A 1FTNA 1U8ZA 4AI6A 2O8DA 3PUWA 4IDHA 4JL8A 3JVUA 4WZAE 1X1RA 4EFNA 1UJ2A 1EG7A 2JLSA 3QG5A 1GKIA 3MCAA 4XWAA 1A7JA 3PEUA 4DLYA 3AP1A 4PHFA 1DG3A 4YMSA 1IY2A 3O47A 2OSBA 4URUR 4AKEA 5A4JA 3LD9A 4DT1B 4UKDA 1DADA 3AGPA 4US2R 3NHAA 1GP2A 2QSZA 2FOLA 3AVTA 1R0WA 4DEYA 3OHMA 4KCGA 4RVCA 1OSNA 2BOVA 4OYHA 1EWRA 5D3MB 1ZIOA 3ICQB 1KTVA 4LJ7A 4JLAA 1COWA 1JXMA 2WMNB 4F38A 1KK0A 1M7BA 4MA4A 2AHOA 1ZM4A 1X86B 4BFUA 2GAOA 2OBNA 1NI3A 4YMUA 1XXHE 5FR2A 5DO9A 3OIWA 1U8YA 1XEXA 4LHVA 4NYIR 1LY1A 2OHFA 4OI0A 4MRVA 2GVDC 2PCLA 3W3ZB 1AGRA 2BJWA 4TMTA 2IF0A 3EA5A 1XMSA 1XU4A 3NWJA 3ZZUA 1IHUA 4D26A 2HYDA 4LHYA 3IHWA 2NG1A 1BYIA 4DC9A 1Q1QA 4LOAA 4OI2A 5DNYB 3PEVA 4XSGA 4TTQA 5DN6D 3L82B 1HYQA 3SQXA 2XAUA 4Q03A 3CUEF 4E07A 3TK1A 3ADCA 4PZYA 4I1UA 4DCVA 3KX2A 2H5EA 1MH1A 2BMEA 4LJ9A 1U2RA 3TVTA 3HR8A 3DEFA 4YMVA 1TF7A 5FL3A 3GLHA 1LS6A 2ZSDA 3THYA 2J87A 3T1OA 2EWVA 2YYZA 3AH8A 3DMNA 4Q5IA 1CU1A 2C03A 2ZROA 3U3RA 2OXRA 2WPDD 2W0SA 4IW3B 4R2IA 4U02A 2RGAA 1I4DD 4MUAA 1Z0KA 1T6NA 2F1RA 4U7DA 3M0EA 1HE1C 1FUUA 1UM8A 3TGPA 2F1JA 2IF2A 4KFRA 2W2XA 1IN4A 1T3SA 3L8YA 5AR1A 1Z0JA 1E0KA 1OIWA 1TNDA 5G3YA 1ZM7A 1D8TA 1F60A 3K1JA 3BS4A 2QRZA 1ESNA 2Y8EA 2QPTA 2ZRPA 4TT3D 1Z6YA 2ZRFA 2V7QA 1YZKA 4KSCA 1Q1ZA 1UAAA 2A5DA 1J99A 4XD7A 2VH5R 1JR3A 5JECA 3GLGA 2B6HA 3AGQA 5EE3A 3AVOA 3FE2A 4AKHA 1HE8B 5EXPA 1EWQA 2QY9A 2ZSFA 2WOJA 3B5JA 3Q5EA 1S9DA 1G8GA 3B2EA 4UXHA 4RD3A 5FH9A 4S2EA 3GJ3A 2XZOA 3GJXC 2XJ4A 3FHCB 5B30A 2NTYC 4QG7A 1SVMA 5TV2A 4HB4A 2WVJA 4TYPA 3VX3A 4LHWA 3A8TA 1DEKA 3IBYA 1ANKA 4ZDJA 3RWOA 1A4RA 1S3GA 1Q1BA 5CYPA 1GNQA 3HJNA 1I2MA 5JJKA 1ELOA 2FN4A 3CONA 3MJRA 2ZSBA 3DVLA 3PUXA 3LH5A 3VU9A 4BLOA 2FZLA 1VIAA 1R0ZA 3AUYA 2ZJAA 2DBYA 4A36A 2DFLA 3B78A 1II9A 1W0KD 1OB5A 5CK5A 2ASEA 2R6FA 5FTKA 2AKYA 2CMKA 1P2SA 4UJ3A 1MO5A 4QHSA 1OXUA 1RYFA 4F4CA 2QEQA 5F9FA 5JJIA 2YWGA 2CL0X 3GJ5A 4UNPA 3GMTA 4Z8XA 5BN4A 2ZU6A 3MAAC 4P4SA 4JLOA 2J7PA 3CF2A 5H68A 3CRMA 5K8IA 4N3NA 3PEWA 1JAIA 2PLFA 3U60B 5FOXA 1FUKA 4L9SA 4QGHA 3U3MA 4PTLA 4Q00A 3SJCA 421PA 1GRQA 5FPHA 2P6RA 3MGCA 3DOEA 5L3QB 5D3MA 2JIZA 3OAAD 1AZSC 2ZI4A 1PV4A 5M04A 2P65A 4NYJQ 2OG2A 1IN8A 4Q4LA 2PEYA 4P33A 2WJIA 1H8ED 4UNRA 2G9NA 4BRWA 4FCWA 1M7HA 4QGFA 2OBLA 2X77A 3GCGA 3UWKA 2Z4SA 4P0TA 3K9HA 1Q20A 2R9VA 2N1BA 3RC3A 4C3ZA 4DLVA 3QEJA 5TVKA 1HT2E 2ZRMA 1E2JA 3K70D 4DEXA 1A5TA 3NBFA 1YZGA 2OXCA 1TMKA 2VL7A 1F5NA 2GCPA 1QHGA 3H2YA 2F1IA 4TSFD 3C15C 4QC2A 2FDCA 5CJ2A 2NGRA 2VHCA 3H84A 1QHNA 3CM0A 3VR4A 2JJ1A 2ZUCA 3A4NA 4W7SA 2V55B 3B7GA 1LTQA 4E09A 4DCNA 1VCIA 5EJEA 2HLDA 4ON9A 3R9IA 2YWHA 2ZS7A 2LKCA 3A1UA 4LBWA 4MYCA 2EWWA 4I81A 1D2EA 4QNMA 3ZZTA 5KNBA 3AF3A 5FI1B 5IT5A 1SVKA 1MOZA 2VF7A 3Q3JB 1JJVA 3SJAA 4BPBA 2HT6A 2YC4C 1G4UR 4L15A 3L43A 4Q47A 3TSOA 4B3DA 3CB4A 1NIPA 1IAQA 1UBGA 1Z28A 4AURA 1X1SA 2CEAA 4A8JA 1YU9A 3I72A 4NL4H 3MD0A 1MO6A 3EA0A 4KODA 1ONBA 2J59A 5JJLA 4GPTA 4GOXA 1SXJC 3CBQA 4JVMA 4Z51A 2ERXA 1G9XA 1XTJA 1NVVQ 4QJ5A 3GLIA 3FFBA 4BASA 3QNUA 2CNWA 1R7RA 1VG9B 4DHEA 4Q4JA 5JFGA 4G5QA 2ZE5A 2ODNA 2QAGB 4ZV4A 3W5IA 4YMTA 4QHTA 4TQUS 4JLPA 4N0EA 2LWIA 1S2MA 1OE0A 4US1R 1II8A 2QUZA 1KI1A 3GFTA 2G0TA 2OCPA 1UKYA 3O8CA 3O8RA 2ZI5A 3K09C 2JDIA 5AJXA 2J3EA 1VMAA 1NBMA 5CK4A 5HPYB 1OW3B 4N0DA 3G0HA 4DB4A 4M9QA 2QTVB 1J8YF 3FKSD 4LK2A 2F43B 2ONJA 3OEEA 3ND8A 3B1XA 1LS1A 3AQ4A 3CZPA 2WBLC 5EE5B 4Q1FA 1AIPA 4LYFA 4RY2A 2GAAA 3EZ7A 2E9SA 1XD2A 2J5XA 2RB4A 1C1YA 3FMFA 2FMXA 2I1QA 4NTZA 3X1WA 1ZYUA 3WRXC 3NBXX 2CVHA 3FTQA 1ZU5A 5KYKA 1KAGA 4PANA 1P2VA 3X1XA 1NN3A 2QQ0A 2WWWA 4KAXA 1JEDA 3OAAA 1WBDA 4KJZA 3AVYA 2O8CA 2CVFA 5HTKA 4QM6A 1G19A 4Q1BA 3QF7A 4KBFA 1N6LA 1OXXK 4IDNA 2OCAA 4JBWA 3THXB 3NC0C 1ZD9A 5FBQB 3U2QA 4DDTA 2G83A 1FZQA 4RFSB 4QXAA 4LHXA 2NMVA 1D2NA 2J7PD 2NO6A 1IJFA 3BGWA 2VHQA 3M4YA 2IT1A 4ZKDA 3QXCA 3QVVA 2OESA 4JBYA 3LVQE 4DIDA 3K0EA 2ZRJA 1FTSA 2JLVA 2YWFA 3HPQA 4Z8YA 1Z0FA 2Q9BA 4D0GA 1YZQA 3IPYA 3CX8A 4QNRA 2UVQA 1NVVR 1P60A 4JSTA 4KHZA 3K0AB 4D0LB 4EJSA 5L3QA 3JZAA 3PR1A 3F3YA 1W48A 2BKEA 4ASUD 1E9SA 2GCOB 1VCOA 1CLUA 1UBFA 1K6MA 1NKSA 4Q7KA 3EIEA 1N5JA 2O5VA 3R8CA 2IHBA 2KJQA 4JL5A 3KFVA 4OJKA 2V4ZA 4E03A 2GXAA 3F8TA 3BH0A 2I3BA 3EZ9A 1JEEA 3W34A 2IBMA 4PC7A 1CULC 1BMFD 3W90A 2J46A 2FGKA 1SZPA 3QKSA 3NBYC 2YKGA 4FWIB 3C8UA 1G41A 2ZJ8A 2VHJA 3QOFA 1M8PA 1CJTC 4JLJA 4C0JA 3CNLA 1V5WA 4OQFA 1Z6XA 3KQHA 2J0VA 1W44A 1PVOA 2QMOA 2AR7A 1ZIPA 1DPFA 2QGNA 821PA 4OHWA 5KNCA 1QVRA 5EZ5A 1EX6A 1Z06A 1YQTA 2DWOA 5J4VA 1Y3AA 1TQ2A 1DAHA 3W6NA 1N6IA 1K5DA 4B43A 4ACAA 4QBIA 2GXQA 1J2JA 2FF7A 4IDQA 2YOFA 2JASA 1D6JA 3WBKA 4PO8A 2GXUA 3I32A 4AWXA 2QORA 4XTRA 2WJJA 4ERNA 2QPOA 1Q0UA 4TN1A 2B8TA 4C0LA 3G5UA 721PA 3THWB 1R10A 4QBHA 3SE0A 2O0KA 3UMFA 4KI0A 1G6HA 2OLKA 4DJTA 1GKYA 1KI7A 4Y0AA 3EW9A 1NSTA 1OKKA 3W3AA 4IRUB 3PENA 1XFAA 4XIGS 3KKMA 1D5CA 4JJZA 1N0VC 4HLQB 1UBEA 4BWYA 1MABA 1YRBA 3WRYC 2AWOA 2WHXA 1F2UA 2FSHA 2OE2A 3WHLA 4KU4A 4HB2A 3PUYA 3RS2A 5HCIA 3FMIA 3KXLA 1FX0B 1OYWA 3GFPA 3IHLA 2GJSA 5EP1A 5DSZA 4LZZA 4X8MA 1TUIA 1J70A 3A1TA 4K8OA 2NO0A 3DZ8A 5AUQA 5J4YA 3ZLJA 2WMOB 2WWHA 3RVBA 2QM8A 3TE6A 2ZSEA 3RNLA 4WA7A 4Q21A 1E2PA 5FL7A 2QPAA 3KUDA 1MO3A 3NH9A 5FBWB 1G8PA 4DB2A 1RRFA 3LBNA 2AXPA 5CDFE 4Q01A 2IYRA 4IXNA 1TF5A 3RRMA 1D9XA 3W8RA 5TARA 2F9LA 5GJCA 2ZJYA 3U3KA 4N1AA 1NN1A 1GOTA 2QMUA 5KHOC 4EIWA 1MRSA 3ZYCA 3GPLA 2YVUA 3O8DA 1MRNA 1NY6A 3T35A 4NU0A 2R6DA 4L4UA 4TMZA 3BERA 1US8A 3Q5DA 3VTKA 1UKVY 1E9DA 1JXOA 2ZVQX 1B23P 3T15A 4RD6A 2AL7A 2C96A 2ZRHA 4C0SA 1CBUA 3C14C 3UIEA 3U44A 4AYXA 3VHXA 4F7WA 1WMSA 2GJ9A 4HSEA 1M34E 4KITB 2NQ2C 3P26A 4GP6A 3QXHA 1KKMA 4D4LA 3I73A 1PLLA 1RW4A 1UADA 4R71A 4HAYA 4PHGA 4HAXA 2XZPA 4YXWA 5BN3A 3A37A 5UKDA 1F6BA 1ZVQA 1KSGA 5AUPB 2W6JD 4PPNA 3RRZA 1QF9A 2CK3A 4J0QA 5KPJA 5L3SB 1Z6TA 4PAMA 1KO1A 4LJ6A 2C95A 1E2KA 1SHKA 2DWPA 4V0KA 1MV5A 4GOJA 3RSLA 4LJYA 2OUKA 2LCFA 1XB2A 4DLUA 3UWOA 3QPUA 3ZGXA 4TSFA 3L2OB 1AS0A 4LCBA 2GJAA 4AD8A 3QSYA 2ZQ5A 3VAAA 1E2MA 5AK0A 4C9BA 4M8NE 3I5YA 2O8DB 1EXMA 1ZNXA 3CH5A 3MWYW 4DCTA 2D74A 4HZUA 1N6NA 1DARA 2QE7D 4MYHA 5FI0B 5JRZA 2Z0MA 2D3WA 2BJVA 2FEMA 4EJSC 4A1FA 2CL7X 4WOPA 2QNRA 3VNUA 4AY2A 3H4MA 2BC9A 3EZ6A 1IJEA 2ZE8A 3SQWA 1T4GA 3VR2A 1JPJA 2GETA 5AJZA 2VIIA 3CF6R 4MYTA 5EE0A 1KO7A 1SKYB 1S0UA 4LWZA 5J4HA 4WIAA 1AS2A 1W7AA 3ZVRA 4BEBA 2G77B 2C8VA 3W8NA 2DR3A 3R9WA 1RZ3A 1E2GA 4GNKA 5F2EA 1R8SA 1SVWA 1R5BA 2G88A 3NDPA 1KDPA 4I1VA 4TLAA 3A36A 3MWKA 4M1MA 3W5JA 3CW2A 3THWA 3PIRA 2WWXA 3QKRB 2C9CA 1WA5A 2RGNA 2HUPA 3F0TA 4X8LA 3U7EB 4LYHA 4KVAA 1E4YA 4G0NA 3ND9A 5FOTA 1IOZA 1YE8A 3LXRA 4CEJA 3A4LA 1DE0A 3GLIB 3BB4A 5DI3A 2P6UA 5FR1A 5TB5A 2Q3FA 1KDTA 3TAHA 3KKQA 1L7VC 2IEZA 3CWQA 4FD2A 3RLFA 4B35A 1E79D 3WP1B 4RCYA 5DH9A 4URYR 1KI4A 3TBKA 5C2JB 3LO5A 3LNCA 2DFKB 4FMBB 1CR2A 3U7GA 4C0QC 2Z83A 4EPXA 2A30A 4IOKA 1U9IA 2PMKA 5CJPA 1M7GA 2BHRA 4IVQA 2XTNA 4ZI2A 3Q7QA 2J9RA 4HZIA 4PZZA 2IHYA 2CCGA 2J0UA 2YJTD 5GVRA 2HV8A 4DBLC 621PA 3J81k 1FNMA 5AJWA 3QEOA 1G291 1P5ZB 2EU8A 1G5TA 3T34A 4NCHA 2QGZA 1ZC4A 2R6CA 1W2HA 3U61B 1G4AE 2CBZA 4HUTA 5BW8A 1BS1A 3SI7A 3ECCA 2OEPA 1XMVA 4IVRA 5FOVA 1BKDR 2GZHA 2OFWA 4EJSB 1U99A 5E4FA 4CF7A 3HWSA 4PZLA 3AVVA 4GSYA 5JHHB 5SZKB 5HCNA 3VKHA 4DWJA 5LB2A 5BWMA 4AK9A 4CGZA 1KGDA 3QF4B 4MRSA 4IXMA 5FPSA 4B3GA 2XSZA 3ZJYA 2XNDD 3DKVA 3GLHE 4YONB 2YWEA 5AUNB 1P3JA 1WDTA 4PSVA 5ANRB 4NBSA 5FUXA 2JLXA 2QT1A 2IL1A 2ZR7A 4MYUA 1AKEA 4XOIA 1ZCAA 2V1XA 3B85A 1GNRA 1S1MA 2IYTA 2RGGA 4DSTA 5JS7A 1LVGA 2GESA 1CIPA 1JBKA 4HAUA 3UMRA 3MSXA 3SNHA 4WZ6A 2AFIE 1SGWA 1CJVC 1CR1A 3CNNA 2MMGA 4NE2A 3B9PA 3DDCA 3RRYA 3KTAA 3KKNA 2VSXA 1M1YE 2FPMA 2CHQA 3EIQA 3P32A 4DSNA 2EYUA 3K9GA 2O8CB 1DAIA 1ZD8A 1VCNA 2XEXA 2H1LA 1JECA 3B1YA 5DLQC 3PFIA 5IK2A 3Q85A 4CEIA 5AWFC 4HLDA 5L3RA 3W6PA 2IYWA 4ZDIA 4G5OA 2MMCA 1IN5A 4DLSA 4IEIA 1NLYA 3CR7A 4RKFA 1G21E 3SJBA 4TT3A 4PC3A 3U3OA 3CX6A 1R4AA 1R5NA 5JWHA 1KK3A 1EFUA 1TX4B 1Z83A 5CITA 2PZFA 2GCOA 5HZKA 2ZYVX 3T1VA 4B6EA 2XXAA 5TMPA 1COWD 2ZEJA 3OIYA 2EFGA 3AF4A 2ECKA 1YRAA 3I92A 4YC7A 2VRWA 2QM7A 4A6PA 4MQBA 5GVSA 5BYKA 1OFHA 4V0ME 2QG6A 4YLGA 1N5IA 2BVNA 2C98A 2O8BB 2FE4A 2EFHB 4U5XA 5EP4A 4HDQB 4WXRA 5KNDA 3EZFA 1XTSA 1GZSA 5JMTA 1X8LA 1S9HA 4C0KA 2OFXA 2H18A 4QL3A 5FBLB 3EPKA 4G01B 2CK3D 4D4MA 2XXAB 2YC2C 2GF9A 4HLCA 2IYXA 4Q1CA 2BBOA 3BRWD 1KSJA 2GBLC 3IEUA 3TMKA 1NL3A 3BWDD 4YXWD 2IK8A 2GBLA 221PA 4FIDA 5H1YA 2FSGA 4B6FA 1HTWA 2BMFA 2ODEA 1M74A 3CR8A 3A58B 2H17A 3ETLA 2VP6A 5B2ZA 1F3OA 3SHFA 1M2OB 4KLZA 4Q7MB 1NN5A 4GT1A 1W36C 1YKSA 2P5TB 1HY3A 3TQFA 1FQKA 3OEHA 3X2SA 1C9KA 5FPYA 2H8KA 3NIBA 2QAGC 1X8KA 4LBZA 5FTNA 3S1AA 1Y63A 4Q9LA 2W2VA 4ACBA 4LJAA 1P4SA 4D0NA 1IBRA 1UEJA 3BAFA 4EDHA 3L0OA 1KO5A 1E3MA 2RHDA 3KTAB 1Q3TA 2ZRLA 4JSYA 1E98A 3P4XA 3VX4A 1DO0A 3TUJC 3GLFE 3ZD6A 2H57A 1GL9B 1CRQA 5AUOB 3TRFA 1Z6GA 2V8OA 1NF3A 4PAOA 4IDPA 3L8ZA 1DAKA 2GEVA 4DLXA 5SZHB 4L9WA 3AVPA 5EP2A 3TVDA 2EFDB 2XTMA 2CE2X 4JYCA 1XTKA 4IHQA 3N5CA 1IM2A 3CPJB 2HDNB 4M1TA 4QFMA 3RS0A 3GLGE 2ZJ5A 1LF5A 2IWHA 3CRRA 3TIFA 1O3YA 2GZDA 1OFUX 3KQUA 4BEJA 1XD8A 5JBQA 3QENA 2B92A 1UKZA 1ZUNB 5HE8A 4Z1MA 4GP7A 4JKIA 2OV2A 1G7CA 1GKUB 4YMWA 4URXR 5FTJA 1Q3HA 5LDDC 4KFTA 3B60A 3OIVA 3SFVA 4Z1MD 1HT1E 1E9FA 2O8EA 1G3MA 3U7HB 1VCMA 2GNOA 2F9MA 1KMHB 2QA5A 4URZR 2YV5A 5DYIA 5HKKA 2F1HA 2A78A 4D6PA 2N42A 3P20A 1KOFA 2ZETA 3KJIA 1KJWA 4GZMA 5J47A 1LNZA 2ZI6A 4NCKA 1KI8A 1U90A 1QVAA 1OB2A 521PA 4QBFA 3IGFA 1G8FA 4RZUA 4V03A 3DKPA 4HATA 1M6NA 1NMZA 5CLLA 2WIBA 1EFRA 4I99A 1E0SA 2J0SA 3PEYA 4PO1A 3K70B 4MH0R 4AIIA 1NG9A 3R8FA 1OJLA 3SYNA 4JS0A 3U5ZB 3LRPA 2QSYA 2CJWB 1TF2A 1IN7A 2WPDA 3WMFA 4CW7A 3AKDA 3FWYA 2CLCX 1KZ7B 2O0JA 3NXSA 4JLMA 3ZZ0A 4QHYA 1NNEA 5TDHA 3FKQA 4YDSA 4MRRA 4LV5B 3SOPA 2WJHA 3T1TA 1T0JB 1KIMA 1SQ5A 3L0IB 5GJVC 3CKLA 4B73A 1KY2A 2REXB 2BBTA 2PCJA 1P2TA 3NBZC 1TU3A 2WWIA 4ASUA 4C2UA 4H9GA 4B3XA 3BB1A 4AKIA 1UDWA 1OHHD 4I1OA 4EPWA 5L3SA 1HH4A 3BJIC 2VF8A 4B3FX 2NPIA 3VR1A 2IW3A 2NOAA 4Z54A 3ASYA 1AQUA 2A5JA 2W83A 1F2TB 3RYTC 5KSYA 2WZQA 1RRPA 1XTQA 3WNDA 3CNOA 2B7BA 1EFHA 3JVVA 2AK3A 1S96A 4F4JA 1A2KC 5FOSA 5IDVA 1ODFA 4MGKR 4B33A 2ANBA 5JLJA 3MUFA 3AVUA 4LJ4A 4KBGA 3WY9A 5JHGB 3T5DA 1GAJA 2ZITA 1US8B 2IYVA 3KB1A 1TPZA 2CCKA 1RPZA 1XPUA 3QI2A 2G3YA 3I5XA 4HI0E 2D7CA 1JQJC 2IA5A 3LXXA 4TQAA 4HUQB 2FSIA 3UXMA 2OO7A 2R6GA 3R9XA 1XNJA 4BFVA 1ZM2A 5JWOA 1GUAA 4JLVA 2A3RA 2AFHE 2C2HA 5JSZB 1QRAA 1VYUA 1H8HD 2JA1A 2HCJB 4TWZA 4C30A 1X8JA 4URVR 4WZBE 3PCRB 1GILA 2Z5FA 2XOKA 1MR3F 2ZRKA 4O0MA 3RHFA 3B1VA 5EP3A 1JR3D 1E79A 2VLIA 2VHUA 2ZRBA 3K70C 3LWNA 2WJYA 3QG1A 4PC6A 1DAFA 3QPWA 4JLNA 4F93B 3GLIE 1W2GA 1FL9A 2QBYA 4V0MA 5KPDA 2OAQ1 4JZKA 3KUCA 1HUQA 4TLDA 2XNDA 2YHSA 3SJZA 4M1YA 4JMPA 2QP4A 4XVRA 4NYMQ 1XMIA 2Q3MA 3OE7D 1NBMD 5BQ5A 4OHYA 3OF5A 4ITRC 5DN6A 5JS8A 1XCGB 4S35A 1B0UA 1E96A 4TL9A 2QRNA 1E1RA 1R0YA 2NO7A 3EZ2A 3V00A 3VR5A 4OHVA 4MKIA 4AKGA 1II0A 1OHHA 4Q48A 2XX3A 4WBSA 3A4MA 2XZLA 4CVNA 1RVDA 3TLXA 1Z8FA 4JT2A 3FMOB 4FMDB 2AXNA 2JATA 4F91B 3X1YA 2F55A 1SULA 1W0JA 5EXTA 1KO8A 3BE4A 4RFSA 1ZM3A 2Q6TA 2VYFA 4MITA 2GWHA 3AP3A 1XTIA 3I4LA 1WCV1 1U0LA 3KQLA 3P1JA 2QN6A 3QVUA 1XEWX 3A6PC 2B21A 4OK5A 4TMKA 2DCUA 2BCGY 5CM9C 1GRRA 5LBIA 4DLRA 3HU3A 1NLFA 2JJ1D 1G7SA 1H65A 2IYUA 5DYGA 1Z6AA 4GMDA 2FU5C 3H86A 1N0WA 1OKKD 3BIFA 4P4TA 1E32A 4D4JA 1GWNA 4WXPA 1E1QA 2H92A 2VQSA 2GJKA 1G3UA 4LRWA 4XWOA 1PLKA 3EPJA 3L0PA 4JLBA 4BECA 2XB4A 4CEIB 4R98A 1I4TD 2C77A 3SHWA 2W6IA 3B82A 3NEJA 4A0FA 2DYKA 1BOFA 4NCNA 2CLSA 1AS3A 4IFEA 2DFTA 2V6IA 3V9PA 4IOLA 1N0UA 4FWTA 1ZW6A 3PJRA 3D8BA 1KJZA 1OFTA 5BYJA 1XMJA 3SDZA 4DIEA 5TY0A 1LB1B 2ZRIA 1IONA 2REOA 1L2TA 1YZLA 1N6HA 3TR5A 2ZM5A 2W6JA 2Q3HA 2ERYA 3V4FA 2ZI9A 3ZDQA 1OH7A 2O8FB 3Q8XB 4BQSA 2C5LA 2P6NA 1G3RA 4LSGA 5G41A 2PT5A 1T3LA 1N3BA 2IYLD 1Z0IA 3M1IA 2RGBA 4DDVA 1W0JD 3MWJA 4PC2A 3QE0A 4A6XA 5HZHA 1NBME 5AJVB 2VP9A 4B34A 4BLSA 2HJGA 2YNMA 1G7RA 4B44A 3A1WA 2WJVA 3LFUA 3GP8A 4A2WA 3D7MA 3T06B 2ZE6A 3THXA 1U9IC 5FFMA 2IXEA 1W0KA 1W46A 1VG0B 4P32A 2X19A 4W5HA 3PVSA 1XXHA 3C5CA 2FV8A 5KDDA 1P9RA 3ZVNA 3WBJA 2W00A 1W47A 2A5GA 3KDSE 4DDUA 1UF9A 1TQ6A 5CB8A 1F48A 1PUIA 1SXJB 2EW1A 3TW4A 1MT0A 5C18A 5CDFA 4NYMR 2JJ2A 3BB3A 1T9HA 1S1CA 2J0UB 5HKKD 2GVZC 2PJRA 1KDOA 1UKEA 2F43A 2QP9X 4POAA 4JYBA 1NN0A 2CHVA 2C99A 2RGNC 3VR3A 1OXTA 2VTKA 4LUCA 4CT5A 2VP2A 3CIOA 3H1TA 3QUSA 3FFAA 1W5SA 3W6OA 2ZYTX 2X1VA 3RS7A 2N46A 3U4QA 2Q21A 4E5UA 4D82A 1GIAA 4CT4B 3LBIA 4EAQA 2JLYA 1I4LD 1FNNA 1IXZA 2ZE7A 4NYJR 4W5JA 2G1KA 1W36B 3I62A 2ZSAA 2RGDA 2GRJA 1G18A 3C5HA 3IIKA 4D80A 4LBYA 4XH9B
chains in the Genus database with same CATH superfamily
5ISMA 3H9JA 2I2CA 3CF0A 2FFAA 3KKLA 4MQUA 1K7YA 3SY8A 2JKYA 4X7RA 1AGPA 1JFTA 1JAHA 4BMSA 3TG8A 3ZHRA 4XJXA 2A1UB 4URWR 1AHPA 3L6UA 4I4IA 1EDBA 3HO1A 3D3EA 2Q5HA 5TR9A 2DKOA 1P2UA 5U1PA 1TM5E 8LDHA 1KEEA 3CPEA 2ZRNA 4G8BA 3GLVA 3P7MA 1AB6A 4Q7LA 2F8MA 4K9DA 4HLUA 4ZVPA 2O3SA 3T1QA 3ZE7A 3ZWVA 4EFKA 4P92A 4EX6A 4WGFA 3ZBUA 2VOJA 4ZGWA 4PYRA 1O7JA 3NFYA 1JHVA 2ODWA 3DDUA 3AFNA 2ZB2A 3D6TB 1TC1A 3RABA 3C16C 4XVCA 4IG4A 4EA7A 1XXHB 1EFPB 1T5HX 3LPDA 1NASA 3A1DA 2XTAA 2IX3A 3PA8A 2X0DA 2GEBA 2BONA 4HYTA 1S8OA 2JVJA 3LL7A 1IEQA 1Y37A 2D1TA 4K40A 1V37A 1I3NA 2PKYX 2YR0A 2CVPA 4D4KA 1FLNA 3HEMA 3I5AA 4H6VA 5IYZB 5M5BA 5LL6P 2EBUA 3ERCA 1E2UA 3OJFA 3A4IA 4P38A 4AJ4A 4WNYA 1OPXA 3CVJA 3HZRA 3E18A 2QR3A 4C4RA 3UAYA 1W34A 3WL4A 1KWKA 3WA7A 3WA6A 2V4MA 4QWWA 4BP1A 1DELA 3LUFA 3AYZB 3L0SA 5FUYA 3QX8A 4R5MA 4LXTA 4YUYA 4BZZA 4J76A 4KH0A 2GVNA 5MFPA 1E3IA 3S81A 3JQGB 3WDKA 1R74A 2NNWB 2P6PA 4QEDA 3EXEB 1GT6A 1C4OA 1USUA 5A4AA 2UKDA 3LCCA 3CVVA 4J1NA 3DDNA 4Q4CA 3K53A 3U39A 1O5OA 3BICA 3BTVA 1P9WA 3MVEA 3PV0A 4YXFA 2J9FB 3OPYB 4ML3A 2CFTA 5K3EA 1KU6A 1UMDA 1YR9A 2XYGA 4CG0A 1I6MA 1ZRNA 1VPDA 3G9QA 2XDQB 2JRLA 1IWOA 3KLMX 1S5PA 1L7NA 1GTL1 2YZ2A 4TMWA 1WE2A 3W5HA 2FZCA 4LE2A 1R3UA 1JIVA 5J4KA 2PUBA 4KSYA 5D01A 3WJ7A 4DJEC 1OIVA 3E5HA 2AIRA 3FB4A 1W93A 2Z6VA 3EQ7A 3RYFA 1GGMA 1LI5A 2PK3A 1GDDA 5DSXA 3O93A 4PNEA 1EZ1A 1T5IA 1GCUA 2V45A 3CZ5A 4G97A 4N3GA 3SMQA 2IS4A 2WJZB 1L4MA 2OLJA 4P7KA 3HSKA 4KO8A 3K0BA 2F6RA 3PDHA 1IXYA 1J8DA 3O9ZA 3SZRA 2VT3A 4RZQA 2I4NA 2R8YA 5B4TA 3G89A 1E2BA 3DLTA 3AY0A 4PLGA 1IWBB 3KHTA 3N6XA 2JGEA 1YHYA 2NXEA 3N8HA 4Q1DA 4Q3CA 4FN4A 3WXMA 3CUKA 2WT9A 4BVHA 1HOXA 1K3TA 1HLPA 3KEFA 4FQ8A 1IK6A 3CRQA 3RAEC 3FHOA 2XWPA 2KWIA 3U9LA 1P6XA 1M5UA 2XECA 2HTFA 2H08A 4MUHA 3FTFA 1CZHA 2BZSA 1KU0A 3FETA 4BFTA 3DFFA 3I42A 5K0LA 4NCBA 1QS0A 3ZVLA 4F3NA 5BR4A 2ZI3A 1L1RA 1TAHA 3OCZA 1N2ZA 5DX1A 4Z3OA 5C4IA 2D7DA 2R62A 3BD9A 2VDMB 7MDHA 3C6MA 4KQ1A 1ODKA 1VJ0A 4CEJB 4MQ6A 2Z6UA 1DC4A 1KS9A 2H7CA 1DAPA 3Q40A 4IZIA 5G4KA 3OJOA 4ZEWA 4AZVA 2ZUDA 3KLBA 3IBCA 4PX5A 3N05A 1RI4A 1V6CA 3NT2A 5IASA 4IFTA 1QX4A 3ND7A 1CUVA 5EZYB 2D59A 3GLQA 5FLKA 3IIMA 4BUCA 2QD5A 1XCMA 3DQQA 4YRJA 1P1CA 1NBIA 2IEYA 1ACMA 1LD3A 2A5LA 5CDYA 1XEXB 1QGYA 4PX9A 1YC2A 3EC2A 2K7FA 1YE3A 2YV4A 4M22A 5SZJA 4QGSA 2VDPB 5FBKA 1THMA 2VP5A 2QPLA 3ZQ4A 2F4NA 3P0JA 3AEQA 4H4DA 4B6SA 5U9CA 4B2LA 2G6BA 4EFMA 3M5PA 5BW5A 5JCPA 4HS4A 5KJEA 3IBGA 4JASB 4M9ZA 1JTVA 3TRDA 1ZI8A 1W52X 1UXOA 2IYPA 4IPTA 1CK4A 1ECCA 4L7VA 5FD8A 5B1SA 3RODA 3DZDA 1D09A 1YKFA 1YR7A 1Z9BA 1I13A 1ZY2A 3BEOA 3G82C 3R3HA 3KCNA 1KI3A 1QH8A 3GAZA 3H1EA 2VTVA 3QBVA 2NX2A 3G5TA 4UUOA 4BNIA 4HK4A 1NLZA 1QV6A 3VZDA 3WWCA 1PK8A 2OG1A 4OLAA 1ZGBA 4L8GA 3IUQA 4AXBA 1OYVA 1DXQA 1P1IA 2DG2A 1RXEA 1WMDA 1GA1A 2CLDX 1WUTA 1N7IA 2A5FA 1ENYA 3BMOB 1XDUA 2IYSA 2RBGA 1Z15A 3CF4G 1NBWB 3DFUA 3HB7A 2OAEA 4JY7A 4KQ9A 1Z4LA 1NUAA 2GTPA 3N87A 2JFWA 1O77A 4GZ3A 4NNOA 4Q9IA 3DUWA 4XEUA 4CQLA 5KWIA 4FZVA 2Z95A 1QV7A 5HMLA 3TPZA 4BB9A 2LKDA 1QIJA 4WY5A 3RVJA 2YCLA 1R88A 1M67A 2CJWA 2QTRA 2X4LA 3A6GA 3C41J 3HWRA 4P3XA 5CNJA 2OMKA 3MLEA 3SS9X 1JP7A 1DXOA 3IQZA 3K1AB 2PUAA 1Q74A 1KNXA 8OHMA 2BFCA 1YIAA 3OO1A 1BMQA 4LQLA 2FFHA 2NIPA 3OSZA 1UK9A 1XUOA 3I2KA 3H1FA 3RSOA 2HRZA 4W8OA 1JAYA 3U1TA 1C1DB 2JKVA 2QMHA 2QNBA 2XUFA 2HJSA 4JFRA 3C87A 2H7VA 1K5PA 1AG9A 2Y0BA 1NXWA 3M6LA 4TZKA 2NZWA 5K8CA 1IL0A 5AHRA 1T2DA 2B5VA 2CVOA 3CCFA 2H1WA 3HYCA 4M2LA 2DPYA 4TTIA 3HUEA 4GF5A 3SF0A 4WN3A 4ZHSA 5FV4A 1SB8A 1LI4A 4WLNA 3S2YA 4C4OA 5DI9A 5G0WA 1RTKA 1T3HA 3PL1A 3QLUC 1SC1A 4MVXA 4CIVA 4MS4B 5AK6A 5FWYA 1SWWA 1YTLA 4Y6OA 1W6UA 1KOLA 5CBPA 5C8YF 2Z6AA 1QQ7A 1VHTA 4NF2A 4R51A 2OSVA 3N2LA 5IAOA 3IJPA 4KPGA 2QRVB 3RBXA 3MXTA 4EELA 5HRUA 1LBSA 1YR2A 2WQ6A 2QRMA 5CPFA 2GKSA 3DVQX 3I83A 5CXSA 1QYIA 3H17A 1LLFA 4JUBA 1QHSA 4G07A 4TKVA 2PL5A 2KLBA 3GUHA 1GPUA 3ZE8A 3THYB 1RHQA 3E7DA 5K09A 1YULA 1SBIA 4NP6A 3MYYA 1LW7A 1Z45A 2VRCD 2N47A 3I09A 2ZQYA 1YUBA 4NENB 1D1SA 2HFKA 2R6AA 4U2GA 1L7RA 1S4QA 1G21A 2QN9A 2DWUA 4JVOA 1HETA 4NH0A 4D9EA 2RHWA 4II7A 3DEIA 1E1NA 3AR8A 5FFFA 1VLLA 3UAVA 1Y4UA 3BFXA 3V5NA 4BO2A 2IPXA 2QX8A 3F6SA 3R20A 2OCDA 4Q1VA 1LSJA 1ZQ1A 4TXMA 4U0KA 4UFOA 3W8EA 4F0JA 4ARIA 2NYRA 4LYDA 1M2VB 2VEDA 1NJGA 4O1MA 3L1UA 1NW6A 2X1MA 4MVJE 1C80A 3NI2A 4LX0A 1HQDA 5C51B 4CM8A 3M4NA 5C1PA 1H4TA 3N2GA 4P3YA 5EMLA 5YASA 4YQFA 3ZVKA 1JPNA 1C8BA 5HFNA 1T4CB 2BGMA 2I3ZA 3B6EA 4RCZA 1M1UA 3LY8A 3E5MA 1YI1A 4AMYA 3V8NA 3C3JA 1E6KA 4TWBA 4AYWA 3P9KA 2PLAA 3UAWA 4ZPXA 1H2WA 1N2IA 3RRNA 3FG9A 5CLQA 1QYRA 3C7KA 2C7PA 4PY2A 5G40A 3QU4A 1VECA 3A9CA 1OZ0A 2B2CA 3AIIA 1IXKA 3IRVA 1E89A 1U2DC 1DEHA 1NQWA 1NXXA 3ONFA 5FYQA 1V8ZA 2IYZA 2ZB3A 3ELDA 5DNVA 2JFBA 2PNJA 3RGWS 3KSAC 4INPA 4UNNA 4HVCA 1RXUA 2CUTA 2O05A 1I6LA 3CRVA 3JR7A 3TIIA 1YJBA 2BMJA 3BK7A 3K9LA 3OESA 3SYTA 1XROA 2RGUA 3VR3D 4K9NA 1ODSA 1VKJA 2ILVA 1ADGA 1OQAA 3L3BA 1FDUA 4EAAA 4CTNA 4E7OA 5JYCA 1CQXA 1KR5A 4OXNA 2X4IA 4NCIA 1X7XA 1KH2A 3UOAB 3TBFA 3ECAA 4JUAA 4II3A 2VNKA 3HE3A 2EKZA 2LNDA 3DA8A 3FJ1A 4I1SA 4QVIA 3GZNA 1JVBA 5IK2D 1IY8A 1FJGB 1FU4A 1SC4A 3KYJB 4EL0A 4WHMA 1E1RD 4ITUA 1USIA 1VFNA 4KO3S 1NKTA 2JGAA 1H0SA 2UZ4A 2JJQA 2MT9A 4ZJYA 2HF8A 3C7DB 5IDWA 5JY6A 4XDHA 1LA2A 5D7BA 2ZTMA 2NVBA 5JSFA 3V3KA 1EJ6A 3AU9A 4DV5B 4UUNA 2ZANA 4O25A 4J7CA 3WIBA 1QZXA 4L3VA 4XYGA 4YP0A 1QG4A 4GZLA 1F51E 1MW9X 2D06A 2GPSA 3P9SA 3H65A 2QTTA 1GU0A 1MU0A 1N6RA 1AA9A 1H2BA 1RM3A 2X13A 3DUFB 3G8DA 2QROA 2WF7A 4DLLA 2AW5A 4F4UA 3VSCA 3NVMB 1YUMA 3Q3CA 3BZWA 5CUQA 4DG9A 1T2UA 3YASA 1E3LA 5LQRA 4BEWA 1DWQA 2P2ZA 5DLPA 4FU0A 4L8LA 5FLYA 1P19A 3E5NA 4BXOA 3LGSA 4H31A 1GDHA 2XOEA 3SC3A 1NVMB 2HR1A 1S02A 1ULZA 3CG0A 2Q3DA 3H1PA 3UN1A 4X20A 1TEZA 2HLDD 1BS9A 3BXGA 2WI8A 3ONWA 1M2NA 1MXFA 3NT5A 5JATA 4C88A 2I2BA 2FX3A 2ZYUX 3DM9B 5HQ3B 1C2YA 1W0CA 4GHWA 3MGAA 3TOCA 1LFAA 4CWAA 4D4HA 4ZQEA 1R37A 4P83A 2FHSA 1OZFA 1U3UA 5C0OE 2MCFA 2AFVA 1AKTA 2HQSA 4JITA 4ZAYA 4ARZB 1J8MF 1X87A 4Z7JA 3J80A 3W7VA 1P91A 1JQ3A 4WL0A 3NHPA 4LTDA 5E7IA 2RJNA 1K4YA 1GKKA 1LCIA 1YB6A 3AM5A 4BQPA 4BO6A 5C8XA 1TK3A 4Q82A 3LQKA 3I04A 3ADKA 4LS3A 5KYYA 3CRW1 2A6PA 1QHIA 4ESVA 3BWXA 3ZTTA 1NW7A 1HZJA 5G1PA 1ZUD1 1AKQA 4LV6A 1GG5A 1NPYA 3OTHA 3T0GA 1PHPA 1VOTA 3SDBA 4CKCA 5LP6A 3WX0A 3NZEA 2DHDA 1NSFA 3OPYI 2Z43A 3CB2A 4YP9A 1FDSA 4M1OA 1NVDA 3QELB 1U94A 3ORFA 1SUPA 4DKXA 1ZH2A 2FSSA 1I1NA 2BE9A 2IEDA 3D3KA 3JQCA 2FA9A 3OZCA 4W1PA 5CD9A 3OWOA 1UJ6A 2Y1KA 2OXTA 4EDFA 4ABYA 4EPYA 2LW7A 5AM4A 3R0XA 2EBHX 1GUDA 2XGMA 5GZ3A 4MRPA 1RJ9A 2SKDA 5KNDH 3ELBA 1OX4A 5T57A 1G6KA 2VK1A 3AR4A 3H4TA 4MCAA 4TTRA 2AMFA 4UTXA 3ZCXA 2VKTA 3JRXA 5KQPA 3QOYA 2ORVA 2I2WA 2VHXA 1RQNA 9GPBA 4KN6A 4Y6GB 1UJCA 2OENG 2H4HA 3VKGA 2JAUA 1MBZA 2P0EA 1FRNA 5LMNB 4UUPA 3WKAA 4MGYR 4KWCA 4CTMA 4HWTA 1YI0A 2C2YA 2I1LA 4P82A 5CIWA 4B3JA 5H9WA 5K8TA 1JZTA 1VFPA 5EEGA 1NBEA 2FEWB 2O8BA 1QNLA 2VO1A 5B6PA 1Z2CA 5DWDA 1A8QA 5EHNA 5CNKA 3TRJA 1J2EA 2Q2VA 3EGDA 2XE4A 1SOVA 4DUZB 3KBOA 3TQCA 2PXXA 3ER8A 1JTFA 3BD6A 2UDPA 4Y2SA 5HVNA 4N8DA 1O4WA 4I8DA 1ZGJA 4GUDA 2CXXA 2I6SA 3RRJA 4BKMA 1G8KA 1LBEA 1K7EB 3CLTD 1U5CA 2I87A 3HR7A 2PD3A 4QTUB 4AG6A 2A33A 2WWTA 3FZGA 5CR9A 1PGPA 3FVVA 3KFXA 1TEXA 1XZMA 1ZC3A 1N5LA 1X38A 2WEKA 4IEEA 4JENA 2R7NA 4QODA 3BM5A 4X94A 3THRA 5TGTA 3WYFA 4UM9D 4M4SA 2HXGA 4LGVA 1OI4A 2JRCA 3A9VA 1EVJA 4WV3A 5FQOA 3VNQA 4IO0A 4LYYA 4A26A 2HJVA 2PPLA 4PC1A 2JBAA 1GR0A 3AEKB 4R3WA 1FYWA 2A9OA 4C76A 1YMQA 4OL0A 3DXYA 4JOSA 3KB2A 1I32A 1YZUA 3EG5A 4AIRA 2QRGA 5AXAA 1XN1A 3PRKE 3DULA 3QHPA 4YRIA 5I9SA 4CDMA 1DG1G 1KI9A 1Z29A 2FG7C 3PLNA 4OOFA 4MK4A 1Q83A 2V1UA 1ZP6A 1YS2X 1D03A 2VJCA 1W94A 2I80A 1FYXA 1Q7BA 3C7AA 3AUUA 1J7JA 3E3OA 1EK0A 4U8GA 4RA9B 1HLFA 2R87A 4PAQA 2NU8B 5GOZA 3GFGA 3LU1A 4GC9A 4W7IA 5EZYF 4YCCA 3KP1A 1H0HA 3CH6A 2XMQA 4KWHA 3VSEA 5IHPA 3QA9A 4CM7A 4FUTA 1XZKA 3G88A 5KTPA 3C4JA 4GX5A 2I4TA 1SXJD 1BU5A 3B1JA 3GBPA 3NJ8A 5GJBA 3U7QB 2MSCB 3V55A 1ISPA 3M7IA 5GIPE 3NBQA 2O3TA 1ZD4A 4C08A 5L45A 4DQUA 2ATXA 3IUEA 1OIXA 4I4TA 4FHZA 4Q6WA 4ZQBA 3TKLA 3WJ1A 5F3WB 3PCTA 2X8AA 4BMVA 1TJNA 4LBVA 1SKQA 2PGDA 3GLGB 3LQYA 2CMHA 1PR9A 3O38A 2DGDA 4UNSA 3ZV6A 2SCUA 1TJ4A 2DY0A 3HSSA 3V1YA 3DEJA 1T1JA 1SH7A 1ZJJA 3N3AC 1T5BA 3EDOA 3HCPA 2BFPA 5DK6A 3EVFA 3WXBA 2DHRA 3HNOA 4C4TA 4EKDA 3CIFA 5ELXA 1UPTA 4LPSA 3PUZA 3K94A 4MPTA 3OIUA 1CIVA 1Z37A 2D62A 2SCUB 3GD7A 1AH2A 1EZZA 2YXDA 3ANTA 4ZVRA 4WK6A 3KQQA 3UV3A 3MWDA 3ACDA 4KDEA 1T4CA 2ACEA 2C00A 2VF2A 1CP2A 4UFPA 5DNCA 1WZIA 4GUAA 2FW7A 4HAWA 2QE7A 2CB9A 3A0RB 1AM4D 2WHRA 1M2KA 4G5XA 4QX6A 5EMMA 3C8ZA 2E21A 4RWZA 1AQYA 1YJ5A 2EQBA 4WEQA 4BYGA 1FFEA 1TJ3A 1ADFA 3MJTA 5BPFA 1UPUA 2IKQA 4GMXA 2B0CA 4FT2A 1KK2A 2J08A 3NW9A 4XDZA 4BN5A 1JSLA 1ZSNA 2XSZD 4G85A 4LSWA 4MS3A 4XX0A 2WTNA 1NRJB 3ELYA 4OCZA 4BLTA 2GLUA 5LQSA 2CXQA 2IY7A 4EHDA 4C4PA 1Q2UA 5JZSA 4F2DA 2R11A 1PK7A 2W6ID 3BXOA 3LV8A 1K8YB 2XKAA 3F96A 5J4LA 4B4UA 2Y99A 5DB4A 4H1UA 3TDKA 3W77A 1TVKB 3H2BA 3PFGA 3WSWA 2HHHB 4J43A 3BSSA 3NEPX 1FSFA 2TMYA 4R8VA 2XB6A 4BKUA 3G9ZA 2AMLA 5IJ0A 1RWNA 3EXAA 5EJ6A 2ZVJA 3QKSB 2I54A 2B3TA 4OQYA 3M6FA 4MRNA 4YGYA 3CUTA 2Y0PA 5H81A 2ETXA 2CNOA 2VJBA 2L82A 1NY5A 1JI0A 1RMTA 4ZZ2A 4LDRA 2AKAB 4JI0B 5AESA 4LDQA 1A4XA 1KEWA 1ZGCA 2YRWA 1A5ZA 1FX0A 1SK9A 1X7GA 2ZBRA 3MCTA 4OAOA 4U7FA 4UVIA 4X41A 5JBQA 1H05A 5LXTA 4FX5A 1JZQA 3JWHA 4X1YA 4E1BA 5JROA 2JLUA 1E2IA 1QCZA 3PS9A 1F12A 4BV2A 3PFNA 4OQNA 2GXSA 4MS1B 3M6AA 2TMKA 4JMLA 4Y9SA 1IHDA 4FHFA 2J4DA 5DP2A 1CTQA 1R12A 4AW9A 4V1CI 1J06A 2IP4A 1VYHA 3FNFA 2NAPA 3ORSA 5BXQC 1FSSA 3AF0A 2WU3A 4S1NA 2OGSA 2P3SA 3R5KA 3AVQA 2P9QA 3PIDA 5JPIA 1WHSA 4LG1A 4DJDC 4ND6A 4NR0A 4PHHA 1P7PA 4P6VF 2XB2A 3FDIA 3RSCA 7REQA 1M2FA 2JGNA 3CLVA 1OA1A 4OPMA 4RZXA 1JF8A 4ZO4A 5AW3A 5IANA 4IJWA 1V35A 2FP3A 2AFIB 3NEYA 3V8VA 4BMDA 1DT5A 4E2FA 3VJRA 4S1TA 3R41A 4NDNE 4BVLA 1Q0ZA 3M6WA 3KXKA 1KSHA 7MHTA 3EA4A 1KP9A 2QV7A 2QZ4A 3KTDA 1ZRHA 2J3LA 4L16A 3HXOA 4TZ6A 1I2DA 4C1NA 5JCOA 1QGZA 4Z4CA 4DXAA 2P3LA 2EZ9A 1NZDA 3IVCA 3O1IC 4RA9A 5B1DA 2Q8NA 5AVQA 4H7EA 4JC0A 4DSOA 3K71B 1RCFA 3FNRA 4RNCA 1E2DA 5DCUA 4OTZA 4BJ1A 4BMZA 3BXEA 3D4OA 3GUCA 1XZGA 4OBWA 3ZWKA 1T6XA 2JLWA 1J90A 4BZPA 2C3MA 4IGFA 3FCXA 2PLWA 4Z4IA 4EQ6A 4TYWA 1J09A 2FSFA 4DVJA 5GOTA 4BX2A 1KTIA 1I24A 3CXUA 4DNQA 1EEHA 5IJ9A 3LUHA 4XIJA 2QAJA 1WXGA 3JVIA 2X7JA 3GK3A 2HHJA 1P4RA 1KMQA 2OD7A 1UK8A 5F1KA 1Y6GA 5FPTA 3WO1A 1QWSA 4L6IA 2LTAA 4JI2B 2VAPA 4RXMA 1PJSA 5FJJA 3IJEB 1LGYA 4LSZA 1Z0UA 2C5HA 2ZVDA 1GL7A 3LM8A 3NYIA 4NYIQ 1DAEA 3IT3A 4L4SA 4A0HA 1GRNA 1LU9A 4RELA 1P39A 3C39A 1XVTA 1GNTA 4O3FA 3VNAA 3WOHA 4H1TA 4OY3A 1SG9A 1B14A 4B1FA 5L4SA 1PS9A 2XGSA 1LNQA 5KOHA 1U3TA 3CCBA 3K20A 4RZSA 4EHFA 1SG0A 1B8UA 4ZMSA 1JQ5A 1QZUA 2RGEA 4V2IA 1FY2A 1PT7A 4WMLA 3STWA 1VB5A 1TO1E 1QHXA 1E7MA 2DR0A 2XNHA 3P2OA 1VHQA 5DBGA 3UGQA 1DHRA 4A8JC 5HK8A 1CR4A 4IKEA 2GZRA 4AF8A 1U0HC 2IUSA 3QJYA 1XZ8A 4BO9A 3LUBA 1DJLA 1RXIA 3DVSX 1VHLA 5CT5A 1RJFA 3BUSA 4R7ZA 2GEFA 4R1SA 1H8HA 1G5QA 1ZU4A 2C2BA 2OQRA 2F3SA 3AHHA 1NFFA 3U6BA 1KKLA 3GAAA 2VHTA 4MKFA 3FCEA 1XRJA 3CC8A 3OP4A 1G20E 1NULA 4QARA 1IPFA 5E6RA 1JFVA 3CZMA 3S40A 1VJ1A 5CCEA 2AKEA 4W5NA 5LB4A 1E3SA 1ZPDA 1RI5A 1W9MA 2HKIA 3GQVA 1KAQA 4M99A 3TQRA 4LF8B 2R751 2FK8A 5DISB 4PGMA 3HO6A 4KV9A 4MYDA 2GEDA 2OUIA 1RYHA 1WNTA 1X3LA 1QSGA 2COUA 3DC2A 3KPYA 4TTAA 5GPBA 4BFYA 1YQEA 4ZWNA 5GTDA 3AVXA 1R0XA 4TWAA 1J6UA 2OWDA 1QORA 4KFUA 5E8RA 1A9ZA 1E2NA 1WW3A 2YIMA 3G85A 5TF0A 5E9AA 4AN1A 1PJZA 4PSKA 1XBTA 2HRDA 5TJ9A 4C0XA 2O8CA 2IHVA 3U7FB 3IUYA 4ZEVA 2A7QA 2QNIA 1GNPA 2VA8A 3ACBA 2QU7A 4M0DA 4KGXA 2O1EA 3HXMA 2Y66A 3KZKA 4S1OA 5TQ0A 3NHJA 1GFIA 3N2ZB 4QJ4A 4AG5A 4Y6PA 4HY3A 3FF1A 2ZUBA 3OZBA 2DJ5A 1YA4A 3ETEA 2IY8A 2YH2A 2WSMA 3D8TA 1NFRA 3F49S 1FB5A 4IHKA 3ZNPA 1KC1A 1UJBA 2VYNA 4OQLA 4ALIA 4CODB 1YB7A 4PPGA 5TGZA 1HK7A 5HIMA 1K8RA 3FPCA 5BQXA 3JPYA 3QITA 4MV7A 4FFBA 4WVFA 4FMDF 5D51S 1ZOSA 3VC7A 1GQSA 3HYSA 3UG7A 3VPBA 5TGDA 3QMMA 1BCSA 1FVOA 3DBHB 3HBAA 3DO6A 4UNQA 3R40A 1TYZA 4Q02A 3WYAA 2O8FA 2FETA 1PKXA 2I03A 4EHHA 3KEGA 2WTXA 4XIIA 1ULTA 3SLRA 3RWMB 1EX7A 3ZIAA 1BJTA 2RGXA 3K5WA 3CSUA 5DM2A 1RE0A 1XKXA 1ZM9A 2BEJA 1E2LA 4K86A 3K6SB 1ABEA 1LBHA 2EX4A 1FTWA 1U0JA 2JFUA 4RO0A 2ECOA 5G53C 3WK6A 5AVJA 4AJHA 4HTAA 5JJ5A 2E4VA 4XJVA 4D9CA 1DOZA 3KLPX 2PX4A 4TLCA 3FLAA 4WLVA 2PGOA 5EXXA 5FULA 1YBMA 4Q34A 5TLSA 2WKSA 1PJRA 1Q84A 3NJ4A 3S5JA 1LRJA 3TQTA 4R8SA 1G8JA 3VMFA 3FHTA 2QVGA 4YP7A 5B3AA 2HQ1A 3ZY2A 4A9AA 1ORRA 4BO7A 2RH9B 2O59A 4EMBA 1L5FA 2VEOA 1ZBQA 2SBTA 1QMGA 3ZD8A 4A0GA 3MTIA 4N3BA 2RHTA 5AM0A 3RS4A 4GDFA 1GAQA 4JR0A 2XADA 3N2NA 1W9HA 4HOYA 1V43A 2CLLB 2O19A 3NP9A 1W581 4Q4AB 3TM5A 1A72A 5F35A 4IILA 3VU9B 2BFOA 2FPPB 2HJWA 2ZWIA 3ST7A 4BCBA 1DJOA 4PX3A 4M7PA 3L7NA 3CVXA 4DWWA 3D3QA 1L5GB 3R76A 4OX9Y 2OGUA 1XTZA 2WVAA 2Q7XA 1Y89A 4MUNA 1NU8A 4C0WA 4B3TB 4AB1A 3EAQA 2CN1A 2XNKA 1I2BA 3GEIA 3KUKA 4IJMA 2X5JO 4KKXB 3C3EA 1DFHA 1M54A 1Z39A 3UKDA 3QQ5A 4PICA 5CBKA 4KYIB 1POWA 4MV9A 5KINB 2IXFA 1ZN7A 4JI6B 1WUHS 2YQ5A 3A70A 3ENQA 3EN0A 3OO0A 4LDNA 3JQFC 3VNBA 3WIDA 4J0FA 2Y77A 3V2GA 5DASA 3LWDA 1NRWA 1B76A 2GYWA 3UJ7A 4C4YA 4PLPA 2R6HA 1FDOA 5HIJA 4B2IA 4YYZA 1SHZA 4LTNA 4O4IF 4ID9A 1KYVA 1R8JA 3IQXA 3LZCA 3IESA 4DV2B 1P5RA 2IE8A 4O63O 2NUPB 2YXEA 2ZUSA 1XTPA 4L1KA 4HQ6A 4G65A 3AYXB 3GRCA 4WW0A 2Z2KA 4Q6BA 3GGGA 2D5IA 3I2GA 4RFVA 1RC8A 3L01A 3CSSA 4G41A 1VL1A 2ILTA 3WP0A 2R6JA 3LP6A 3HYRA 4JT8A 1T43A 1G55A 3UENA 4MQEA 1GN9A 1SC9A 2ZSHA 3M6IA 1FEZA 2XA1A 3IE0A 1WPRA 4IOMA 1UAYA 1OGJA 4QBTA 4I55B 4P4LA 5EE9A 121PA 3T3EA 4RLHA 1M75A 1CZNA 1T8TA 2BWJA 2IU4A 3C1AA 1AKVA 3EYWA 5ALRA 1NMXA 1KE1A 1IUOA 2LV8A 2I9KA 1TQDA 4HDSB 3SWWA 5ALNA 1YJ8A 3VYVA 4DA4A 2I2DA 2YWCA 1U1CA 2OM2A 3FKJA 2DT8A 3RPEA 1SOUA 1XK7A 2R6R1 4GGPA 2WT4A 1XJ0A 3QUAA 2RIPA 4PGGA 3SQMA 2YL2A 1RXVA 5E7QA 1I14A 3EGWA 2A59A 4JL8A 4WZAE 1X1RA 2ZSIA 3FSGD 2HY7A 3MCAA 2I7TA 3T5BA 5IKMA 2D2IA 2IHJA 2DTDA 3L4BA 4WBNF 3OJWA 1NZFA 3KS9A 1OBCA 4WZZA 4QPZA 3O4RA 3OF3A 5FWXB 4UKDA 2I3DA 4NJMA 2JCGA 1JGTA 5DTIA 1L7QA 1D2CA 3L46A 5EIXA 1WZ2A 3R5TA 4H7FA 1E8DA 2ZDHA 4D42A 1Y8ZA 4UM7A 4OFXA 4F12A 4MWBA 1O9GA 3D1VA 4OYHA 4CKEA 1CPYA 1T1EA 4ODIA 4UM9B 3OJEA 4JLAA 3EMVA 2VDLB 2FLVA 4QVKA 3ZXUB 4CL0A 3GUVA 1KK0A 3QU7A 4JBNA 2VWPA 3T0FA 2AHOA 3IBSA 1X86B 3BZUA 1GUFA 1YVEI 4NABA 1XXHE 5H16A 3OIWA 3NHSA 4LHVA 1Z5OA 1M73E 2WFZA 3KG2A 1X1CA 3QY9A 4GWKA 5KZMB 1XGKA 1IJKA 1MX9A 2PCLA 3HR4A 9ABPA 4EI8A 2IF0A 3O7MA 4CMHA 3DOJA 5DM0A 5K3DA 1YMVA 3RYIA 3ZZUA 4EBBA 3O9VA 1GO2A 4HTFA 4OHMA 4D26A 1XI2A 4L78A 1C3VA 2F2TA 5HM6A 1BYIA 1D5WA 4LOAA 3FOCA 5LP1A 2GF2A 3PEVA 4WXHA 1BH6A 5DN6D 1Y6ZA 4NJMB 3Q8WA 3RTAA 2P4QA 1G63A 2QW0X 4F2GA 1V95A 2YZKA 1VRVA 5GGYA 3ADCA 1GFZA 1UDRA 1BSVA 4PZYA 3AHFA 3SMVA 2LRHA 4BRSA 2YZMA 3JYNA 1NQVA 2H5EA 4JC4A 4ALNA 1U7HA 5JBNA 5FB3A 2VBGA 4MVJP 1L5WA 3EVAA 4WZBB 3DJFA 2ZSDA 3R8CA 1ENZA 1R9JA 3THYA 2J87A 4K9OA 3GPDG 3HKCB 1VQ1A 4IH1A 3S2FA 3T1OA 1CU1A 2ZROA 5FCDA 1Y9JA 3WDLA 4G0VA 1CVLA 2FW1A 3CW9A 5CFRA 4QTYA 1M9NA 5BVHB 4NG5A 2OXRA 3PQDA 2WPDD 4IW3B 1DQYA 4S12A 5B4UA 3IB6A 2RGAA 5B2EA 2UU9B 1K4MA 4NPCA 4DLAA 4MUAA 1IATA 4U3JB 4L95C 5FX2A 5HW0A 3DYIA 3BILA 2ZOSA 1R66A 1QDLB 1UM8A 2P4SA 3P97A 1YONA 5JNSA 3GLTA 1ADJA 3T5CA 1S8AA 3HRHA 3L8HA 3HKEB 4GC5A 1XHLA 1TYAE 1Z0JA 1RWVA 1OIWA 2AR9A 4GKVA 4YALA 1TA0A 2GD2A 3JQ6A 3LCJA 3UPDA 1D8TA 2RB5A 4EZIA 4RTOA 1F60A 1Y9DA 2HNBA 2RHHA 4G6ZA 4KJXA 4V3CA 3E9ZA 2QPTA 5EVCA 1W19A 3D5TA 4E12A 2ZRFA 3PFBA 1NA5A 3IEIA 5LXTB 4F3RA 1UAAA 2BKLA 2A5DA 4KEAA 1V8OA 3GLGA 2B6HA 3GMSA 3AGQA 1H5UA 3DOIA 1KVTA 4LCEA 4RSHA 5EE3A 4AKHA 2RK3A 4X61A 1HE8B 4OB6A 4CM5A 3K96A 4G09A 1EWQA 2QY9A 2JHAA 3M33A 1DX9A 3PP8A 5EHGA 3FYTA 3PQEA 1KOJA 1G8GA 5FH9A 4RD3A 4X1KB 1POXA 2HA0A 4R3UC 3GJ3A 1CS0A 4S2EA 3R0QA 4ZOBA 2PUDA 2DLCX 4RXUA 4WCFA 1TAUA 1K6XA 2NTYC 3CGWA 4D4GA 3AJAA 3C3AA 3SQNA 1H4SA 2HK8A 5TV2A 3VX3A 1A71A 1QLWA 4LHWA 3W4IA 4N6NA 4O1HA 3X1KA 1DEKA 1K66A 3ME5A 1RAHA 3RWOA 1AA6A 5IJWA 3QQPA 3ABZA 3O3NB 1IBSA 2XXBA 5A05A 2P0AA 1D1TA 1ISMA 2DUWA 4TX1A 5MDHA 1DRVA 3ZCQA 3MJRA 1QK3A 5KX5F 1W73A 3OMLA 3UK7A 3QVXA 4RAQA 1XQ1A 3TCKA 5BWLA 2GN8A 3VU9A 1GYRA 4BLOA 1R8XA 1NYQA 1R0ZA 1YC5A 4TSRA 5JYBA 2ZJAA 2DBYA 4FE3A 1HX7A 1KZ6A 3B78A 2OO3A 3A0UA 4AAYA 1THGA 1W0KD 2MYNA 1NATA 2PRKA 4ZREA 5E1BA 1OY1A 1RTTA 5DYYA 3EXG2 1V39A 2P2SA 4W1RA 2E49A 1RYFA 4TRRA 3VI4B 1W2WB 2C8LA 1Y5RA 2CL0X 3GJ5A 4LA4A 2OV4A 3CLKA 4UNPA 2YVKA 4BX0A 1NVGA 4MB0A 3X43A 4BNHA 4GBGA 4JLOA 3H5RA 4H59A 3H13A 1KYWA 2ZYAA 1UWKA 1QOZA 2HWUA 2QK4A 1MG5A 5FOXA 1U28C 4LZAA 5B4VA 3C2QA 2BLLA 3I6YA 1X42A 4RM2A 3BCHA 4PTLA 4Q00A 5BSRA 4B3HA 421PA 1GRQA 1CP3A 3FYUB 3LT0A 1OX6A 3PVCA 4AP5A 2JIZA 2QLFA 1VGQA 4P08A 4FEEA 1XHFA 3CVOA 2GSDA 5D5HA 4WBNA 2XCSB 2DBQA 2XQVA 4OP3A 1J5XA 5FLXA 1IN8A 4IHJF 4CV1A 4RE6A 2PEYA 4P33A 4RYDA 4YNBA 4YV7A 1H8ED 5CP8A 1Q1AA 1B6RA 4M6WA 4FCWA 4OXXA 3TW8A 1KMNA 3RIGA 1S2DA 4U9IS 2IXBA 3KJZA 3GELA 1BGXT 4S1WA 5HMMA 4ZYYA 2VVTA 4DLKA 2N1BA 1PJQA 3P19A 3PHCA 2O2IA 1PJCA 5FV7A 2EJVA 2Y76A 4OQPA 2VF5X 3K70D 1XR3A 3PDWA 1A5TA 1WSAA 2H1SA 3R6GA 2X76A 3GVCA 3VH1A 3CLTC 3PFFA 1OI7A 2VL7A 2ZJ6A 4HQFA 4HRXA 3ZGZA 3FVWA 1QHGA 3H2YA 2F1IA 4TSFD 3VBEA 3RKSA 5CJ2A 4ZVVA 2NGRA 5F4BA 4UVGA 4QU8A 3HWWA 3LOPA 4JLSA 4JQOA 2JJ1A 4KI7A 3G5AA 5MFZA 1ZICA 3EUEA 1D6MA 3B7GA 3E84A 2OPBA 4MWDA 2ZR8A 3HB0A 1EE2A 3VDNB 4DCNA 4EGQA 2NXJA 2YWHA 5AXDA 2LKCA 3R9IA 1A9SA 4BTVA 5D6OA 2X22A 3CEAA 4H08A 6REQB 1D2EA 1P3Y1 3D7SA 5CLGA 3ZZTA 3CMMA 2CKDA 4FOTA 1ZEJA 4FJ1A 2BZGA 5E1DA 4E2YA 2QRHA 3V7WA 1QIKA 1PYDA 2Z3WA 2CD9A 4Q47A 3L43A 3MINA 4KXVA 4M0UA 4E21A 2CWDA 4RXTA 1NHGA 1XP5A 2P62A 4AURA 3QWAA 5CXQA 1UXHA 4A8JA 1B4DA 1L8AA 1NXSA 1SJ9A 2HB6A 5KVAA 3GAMA 1Y1SA 5K4AA 3MOGA 4KPFC 2LE0A 1ONBA 2J59A 4NCXA 4P34A 3OZGA 3R4VA 1SXJC 4GOXA