3IB6A

Crystal structure of an uncharacterized protein from listeria monocytogenes serotype 4b
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
b'LTHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPEALLLLKKIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of an uncharacterized protein from Listeria monocytogenes serotype 4b
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 59
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ib6A00
1ZD5A 3L8GA 5AKXA 4CF5A 1L8LA 3AR9A 1PW5A 3L0YA 2HHLA 3M9LA 2PR7A 4CF3A 1Z4KA 4Y2YA 3OCXA 4HGQA 2I33A 3QU5A 2P11A 2YBDA 4L6CA 3UM9A 1ZOLA 3FPBA 2C4NA 5AVUA 2RB5A 3FM9A 4I9GA 3OPXA 5AW6A 3QYPA 2Q4TA 5IT0A 4J03A 5ALVA 2AH5A 5AVQA 2W43A 1ZRMA 2WF7A 4C4RA 1N8NA 4KX5A 2GHQA 5ALEA 2WFAA 5ALMA 3OCUA 4UARA 1SWWA 3L8HA 2EARA 4OFZA 2R8EA 3W5CA 2NYVA 5AKIA 2IA5A 1T5SA 2FPSA 1YS9A 2GO7A 3AR2A 4UAUA 3IJ5A 1IWOA 3ESRA 1T9ZA 1RRCA 2OBBA 4Y2JA 1F5SA 4IFTA 3SD7A 2I54A 3MPOA 1ZD2P 5AIAA 3WK6A 1RC8A 4DCCA 4EX7A 4UMVA 3M1YA 1TE2A 2CFTA 2AGVA 5AKZA 3U7FB 4XE5A 5ALNA 5ALUA 2JARA 2P9JA 3R09A 1VJRA 2PKEA 2ZOSA 5AW8A 3HLTA 2YJ4A 2YMLA 5AM2A 3ZX4A 2EAUA 5E0OA 4AS2A 2G09A 2ZBEA 1RMYA 1L7PA 3NUQA 3PDWA 4UATA 2HCFA 2WF5A 4UU1A 2O2XA 5ALFA 4IG4A 4EEKA 3PCTA 5ALYA 3WKBA 3WK7A 5AI5A 3S6JA 5AKYA 3WGUA 2G80A 1U7PA 3EF1A 5ALKA 3NRJA 1QQ5A 1O08A 3J7TA 4YIHA 5ALTA 4EENA 5A3SA 1YJ5A 3WKAA 1WZCA 3KC2A 4EZEA 1L7OA 2I6XA 2MU1A 1S8OA 2PQ0A 5A3QA 4F71A 4PNHA 4OCZA 3QGMA 4KYTA 5AK3A 2P69A 4G63A 4MWOA 3ZU6A 2QYHA 1Z4IA 3R9KA 3UMGA 3FZQA 2I55A 1U7OA 5ALPA 3BWVA 2RBKA 4C4SA 4KNVA 3SHQA 2GFHA 2C9MA 3RF6A 2RARA 4RETA 4BX3A 1MH9A 4UMFA 1QH9A 3KDPA 1XPJA 1ZD4A 2W4MA 3KD3A 5ALIA 3MC1A 4QQFA 5AW1A 5AM5A 4NWIA 3QUTA 3OCYA 5AIBA 3ZWKA 1L8OA 1Q91A 4XOUA 1RMQA 3ZVMA 1VJ5A 4YCLA 2Q5EA 5ALSA 2DQSA 2GHTA 3R4CA 5ALXA 1TJ5A 5IT4A 4HGNA 1U02A 5AESA 1ZJJA 1SWVA 1XVIA 3I28A 1QYIA 3SKYA 1Z4MA 4Y2SA 1Z88A 1WR8A 5AI8A 4CF4A 1ZD3A 4HGRA 2B1RA 2VKQA 3RFUA 1L7MA 1RKVA 4BEVA 2G1AA 3U13A 5AVSA 4NV0A 3QUQA 4BYGA 3N5KA 1YNSA 3E84A 3F9RA 3B9BA 4KNWA 3OCVA 3WK9A 2JAWA 3GYGA 4UU0A 1K1EA 2NO4A 3L8EA 4KN8A 3B9RA 3FVVA 1NRWA 3NIWA 2G08A 2GMWA 2BDEA 5AVZA 1RLMA 4I9FA 5A3RA 2HO4A 4FE3A 3VAYA 2HEGA 3OTQA 2IOHA 1AQ6A 2QLTA 4OHFA 1EK2A 3KOOA 4BX2A 4Y2UA 4HAIA 4YIKA 2YMQA 5ALGA 4F72A 5AVVA 2R8ZA 2B8JA 4C4TA 1QQ6A 3N8GA 1Z4OA 3D6JA 3WK8A 2ZG6A 4GXTA 1NF2A 1TJ3A 5ALOA 2IYEA 3AR6A 4YCMA 2AUTA 4YH1A 3W5DA 1EK1A 5AW2A 2YY6A 5AKJA 5AVRA 3QXGA 3AR4A 2ODAA 4FYPA 3A1CA 3SF0A 4J2TA 3PGLA 4Y2PA 3NAMA 1WPGA 2Q4RA 2FPRA 1ZRNA 3L0CA 5AW5A 1YDFA 3L5KA 4EX6A 5ALLA 5AW4A 1YMQA 5AK6A 4MUMA 4JB3A 3FPSA 3WGVA 4Y2XA 4BKMA 3ESQA 5AK4A 4GIBA 2YMMA 1RLOA 2B1QA 2FPXA 3WKCA 3NASA 4AP9A 5AVYA 4ZEWA 3N28A 3QX7A 3WKDA 5AI6A 2X4DA 4NABA 2YN4A 5FP0A 3CNHA 3I1YA 3U7GA 1Q92A 4ZEVA 3EWIA 1RKUA 3A1DA 4E88A 1NNLA 2I7DA 2G06A 5AM0A 4UW9A 5ALDA 3AR7A 2I34A 1RQNA 4Y3UA 5ALJA 1ZS9A 1KYTA 4Y2VA 1LTQA 2JAUA 3DDHA 5AI9A 3TLMA 2WHEA 5AKGA 2ZXEA 3DAOA 3IRUA 4BBJA 3L1VA 4UMEA 2YJ6A 2YMPA 2B8EA 3QU2A 2FI1A 3L0BA 3L7YA 1Z5UA 5AVXA 1RLTA 2O9JA 4Y2RA 1Z4NA 1O03A 1XP5A 2HOQA 3U7EB 2CN1A 3HYCA 2CFRA 5ALZA 4Y2TA 2YFYA 4DFDA 2BY4A 2HI0A 3EF0A 4Y2QA 2WM8A 4UM5A 4YGYA 1CR6A 1N9KA 4HGPA 3I76A 5AM1A 1WVIA 2NO5A 4YCNA 2JAOA 5AVWA 2OM6A 1L7NA 4NFLA 1RQLA 3ZUPA 4O8CA 3ZX5A 4H1WA 4XPZA 5AI0A 5AHXA 5IS2A 4BEWA 2IOFK 5AW0A 2FDRA 3IB6A 1VFPA 3A3YA 4XQ0A 3WKEA 3I6BA 3PGVA 4HYTA 4BNDB 5ALWA 2C8LA 3UMBA 1X42A 3CZ4A 5ALHA 1Z4PX 2B0CA 4BNDA 2FUEA 2JGAA 1S2OA 2HX1A 1Z4JA 3DV9A 2EATA 1J8DA 4RESA 3ZW7A 2WF8A 3A1EA 4OD0A 1SU4A 3U19A 3N07A 1Z5GA 3U26A 3QU9A 3AR5A 5JJBA 2OYCA 2B30A 5AKKA 1Z4LA 3E81A 3ZTWA 2W11A 2BDUA 5AKEA 2FPWA 1FEZA 3P96A 4EELA 2WF9A 3BA6A 5AK5A 1CQZA 4CE6A 1Y8AA 3SMVA 4NAVA 3AR3A 3QUBA 4B6JA 2IOFA 4UASA 3U7HB 5AW9A 4UAVA 4UMDA 3WK5A 2YJ3A 4FFDA 4KX3A 3MN1A 3ET4A 1U2SA 2RAVA 3UMCA 4G9BA 3ED5A 5AW7A 2ZBDA 4DWOA 3ONNA 2C88A 2R8YA 2WF6A 4L57A 5AKHA 2HF7A 2ZBFA 4AS3A 1RDFA 3ZI4A 1T5TA 3KZXA 1JUDA 3B8EA 3DNPA 3FGOA 2G07A 2MSNA 3L8FA 2CFSA 4JDPA 5AM3A 3OCZA 2FUCA 3ET5A 3E58A 1RKQA 3ZVNA 1RPZA 4HGOA 3K1ZA 4ZEXA 3W5AA 2OA0A 2HSZA 5AW3A 1J97A 3WK4A 5AM4A 2R8XA 3QU7A 4CNQA 2YJ5A 5AKLA 5ALRA 4DW8A 3MMZA 3SKXA 3L1UA 3QNMA 2FEAA 1Z4QA 1TJ4A 4L6AA 1QQ7A 3ZWDA 1RMTA 5AI4A 5AICA 3QLEA 2HF2A 5ALQA 3N1UA 5T41A 3ZTYA 2ZBGA 2G0AA 3AR8A 4BX0A 2FPUA 3EPRA 1TA0A 3E8MA 3ZVLA 2HDOA 1L6RA 4UM7A 3W5BA 5AVTA 3SLRA 3NALA 1U2TA 2P27A 1LVHA 3NANA 1YV9A 4QJBA 2C8KA 2AMYA 2D2VA 3QU4A 2B82A 3QUCA 3OCWA 3KBBA
chains in the Genus database with same CATH superfamily
1VRVA 3R0JA 5BQ5A 2FQWA 3LLUA 4MI1A 1ZJ4A 1PW5A 2GR9A 2Q3DA 4FUTA 3MMNA 4CF3A 2I4TA 1OMOA 2NQTA 4ND7A 3FJYA 1BMTA 3MWDA 5TPWB 3QFTA 1CKEA 3PGKA 3EMKA 3VJMA 4ETMA 1GKYA 4UREA 4CG3A 1JFVA 1UCFA 1V7CA 1ZM4A 2JIBA 1TCAA 4Q7JB 5JPCA 3FZYA 1FL9A 4R1MA 3KAPA 1RHQA 3TLGB 3ND5A 4B81A 3BJIC 1WL8A 2H17A 2PZFA 4J9UE 5LA6F 2QW0X 4UHCA 4BB5A 5CFPA 1H93A 3PCRB 2IHYA 2YFKA 2WU1A 1MA3A 5FA6A 4G84A 4NBUA 1AC5A 4P54A 2C99A 1HZZA 2LP4Y 4ETNA 2ZWPA 1L5VA 2IBMA 2WSMA 1TFUA 1NBME 2HV8A 1PZXA 4HDKA 2W43A 4N18A 2I9KA 1S8FA 1Z2NX 1VE1A 3L82B 4OTZA 3K70D 1XPRA 4OQNA 3HSKA 4HBZA 4IH4A 5JZBA 1KVTA 2ATCA 4V24A 4U2DA 5ALEA 2EYQA 1C7JA 3CBGA 4HNAA 4TS1A 4WKBA 1KSHA 1RSZA 3H9GA 5T6MA 4CIXA 4XIFA 4ZT6A 3UK1A 3ZDEA 4ETWA 3QEAZ 4DM3A 2NG1A 3OPYA 3W5CA 2W6CX 2NYVA 4TUYF 1UOEA 1ORVA 4TT3D 3QVUA 4US1R 2G4CA 2Y1DA 2VH2A 3BXGA 4GR4A 5LBTA 3HN2A 4XVCA 4XVUA 3U5ZB 4OMDA 4WW0A 2BYTA 3G1WA 1N6KA 3ZD7A 2BFBB 1RXIA 1UWCA 2QXYA 3DZFA 2V6FA 4P9NA 3BQMB 4TSRA 3W04A 4Y6SA 3K31A 4TL6A 4P80A 4IEEA 5AXCA 3MCWA 5E4JA 1JHXA 1V5EA 4LGVA 1PWEA 1R0CA 1INLA 1MTZA 3KKMA 3L5OA 4OJYA 2AJ8A 3T7DA 2VT7A 1RXSA 2VZ0A 3E9EA 1DBWA 2GD0A 3UIEA 2GLTA 2LCQA 1O9GA 2XUJA 2IHJA 2RBGA 3ROTA 1RWNA 5TY0A 2QD5A 3RRYA 5LOVF 4G0UA 4F9EA 3L1IA 1SA0B 1XK6A 1V5WA 3A1FA 2W6ZA 4W9NC 2C2OA 2GQ0A 3E9CA 5ALNA 1IZZA 4N7RA 2PNJA 4JEIA 2BGLA 2ZUSA 4GI2A 5JAOA 1J39A 1MJHA 1Z6GA 2CFOA 2W00A 4R2JA 2IH4A 3DL0A 3OEEA 3R9IA 3VZBA 3Q10A 3OZGA 3QF4B 1SCBA 1QTIA 1ZRSA 3E8XA 8GPBA 2P2SA 1KP2A 4D9EA 2O3TA 3FI0A 2DBYA 4GHWA 3NBZC 3BCHA 5EKXA 4B40A 5LLDA 3HGMA 3U37A 1L7PA 5A4AA 2JA2A 2VP9A 3HHEA 3NUQA 4GG1A 3AEUA 1XMVA 1MV5A 3MCTA 1KDZA 1QTRA 2WF5A 4C22A 4JI7B 4OH7A 1Y34E 4QQNA 5EVJA 4HLQB 4L5AA 3OOJA 3AM4A 3GQBB 1WW8A 5EVCA 2AFHB 2YHSA 2ZKIA 1U9JA 5HKAA 1U5BA 4HH3C 2FRDA 3ZGNA 1L5YA 3P45A 4OMFG 3S6JA 4Z53A 2Y9MB 2OXIA 4BNLA 2WVJA 1B41A 1VG9B 4F9TA 4XWOA 2POQX 5EZYA 1DIOB 1GU0A 4LPSA 4O02B 3DM5A 3O74A 4B4OA 2CXPA 1FJGB 4EENA 4UHBA 4U7TB 4MINA 1N0HA 3NM6B 3QE2A 4XGNA 4BLRA 4EZEA 3EWNA 1L7OA 3MG9A 3CUKA 2F1RA 2IDZA 3DBIA 3E3AA 3GZNB 4FDTA 3A3PA 4L0MA 3LYHA 4PW0A 1VJ0A 3CLKA 1T15A 4R1TA 4Z4CA 5IU6A 5KOHA 4RZQA 1TZMA 4BNDB 4M1QA 3FWZA 2YYAA 2OOKA 3FZQA 3OU2A 4FUQA 1CYDA 3DT8A 3VPBA 2YHAA 5GJBA 1JE1A 1IVNA 2C77A 1AGYA 3G2IA 3K0CC 3RK0A 4KNVA 3THYB 1UK7A 1V4BA 3O8DA 4V0ME 1WVMA 5CHEA 2IKSA 2Q3EA 1V41E 3QYAA 2GZ1A 1G8PA 1ZMOA 3IH5A 1EFVB 3FHCB 1N2CA 3BF7A 3MC1A 4MV4A 3R5XA 3BE8A 5DZSA 2PX2A 5ECYA 5TSDA 3G8DA 1A1VA 2V7UA 3EIWA 1A98A 3EIXA 2YJNA 1U9YA 1E77A 1VLVA 3CRQA 3NTQA 1LDMA 4GICA 4XOUA 4DCPA 1Z18A 4B75A 4WBNB 5JT1A 2B21A 4Q19A 1GZUA 2FSPA 2PPVA 3EFHA 2A9JA 2FMHA 5J1TB 1A1SA 4YCLA 2HU2A 5C0OE 3CLUD 2CMDA 3HR4A 3D6TB 4IJQA 4Q12A 1FLVA 1EP1B 1W4LA 1VPDA 3P71T 4EJFA 1EFPB 1ZIDA 2H06A 2Q6VA 3FZNA 3HWSA 2VRWA 4TQ9A 3G2QA 2OBXA 4CMHA 4OY3A 2VLIA 2UVQA 2WQZA 3GH1A 3JPYA 1G3IA 3LPNA 4HDQB 3LUJA 4JBGA 3B51X 4GI3A 4WACA 2EP5A 2PT9A 3D2CA 3GFRA 3OJWA 5BRAA 1SXPA 4MI9A 3RTEA 3SKYA 3L7LA 4FEAA 1N2ZA 3PDJA 3I9LA 3HPQA 1QR6A 1QX3A 4IQ8A 4L8WB 2RGNA 1F9AA 3ST7A 4AN1A 3FCXA 4YXFA 2O5CA 3HJRA 1H0SA 4J4TA 4ALIA 1VSBA 4E2YA 2E1RA 1FFDA 4ZZ2A 3RFUA 3V48A 1AH2A 3AL0C 2GUGA 1QBGA 2JFPA 2R1TA 3DEYX 4MR9B 2I2WA 5DCUA 1QNFA 1K8ZB 1P9RA 1YB5A 1CWUA 3OT4A 1BE1A 1E2PA 4KH1A 1KMNA 4EPRA 3KQOA 2JIRA 5REQA 2V03A 3QVXA 2XUKA 5E9JA 4Q4HA 5C46F 3QPDA 4O8ZA 1NJ5A 1JI3A 4XWGA 3R5HA 3RVOA 3CM0A 4RELA 1V7QA 2VYCA 4MDFA 1YKGA 1LV8A 5JSUA 1AZWA 3DBRA 2V98A 5JXIA 5B37A 2NIPA 5DYNA 2WJVA 1DAOA 3H5RA 4CMEC 1ICEA 1XYVA 2PK3A 2J9GA 4WXRA 5DNWA 3G6KA 5JCJA 4UUPA 4FE3A 1WKCA 4YFVA 4BC1A 5CBPA 5D3MA 2Z5FA 1NVXQ 4UVIA 4KK3A 1TM1E 1WRBA 2Q0HA 2DCUA 3QMVA 1S4QA 1H1TA 5EMLA 3CINA 3IE1A 1JJIA 4QAJA 3RAFC 3OEYA 2D3WA 4NG5A 1Z37A 1UMKA 3WLKX 4BZQA 3JQBC 4NTZA 4C4TA 4N7JA 2VIIA 2BFDA 3E2MA 2H3HA 4HTFA 5TDHA 4ZC8A 1VE3A 4GX1A 1OA0A 3QV2A 2QI9F 2W6JA 1AUXA 1H8HA 4YA6A 5T64A 3PUVA 4F2GA 2X6RA 2NGRA 2UZ4A 1TQ6A 3CQ9A 2D7JA 3L7DA 1SHJA 1Q0QA 2A5GA 1N3LA 2EJUA 3F4LA 2IP2A 1Y1PA 3JZMA 2BF4A 2UUAB 5UKDA 3RIXA 1ZNYA 2YY6A 5LMNB 3OURA 3HCWA 3QXGA 1H1DA 1C5KA 1UQUA 2VDWA 3IIJA 2ISCA 1XELA 2X76A 1P0CA 3AI2A 2DU8A 3MYRA 1T35A 3RVNA 3ZDFA 4MQEB 4D44A 4OHZA 4AQ7A 2XVXA 3QIVA 3ZIDA 4XEHA 3K2IA 4QG3A 5GADl 2R6GA 3JAMA 1KAOA 2WAAA 1L5KA 5KJCA 1FMJA 2N3ZA 4IDOA 5AW5A 4H4CA 5H3LA 1JR4A 3MLBA 4X44A 3E5HA 2YWBA 5EE9A 2IS2A 1KPGA 2A5LA 1UXGA 4AO7A 3OFNA 2HLNA 2I8LA 2O05A 2I6SA 3EOBI 2IYXA 1XZKA 1ZI8A 3V55A 1F4LA 1NBWB 1SKYB 2IHBA 2KMLA 2ZUWA 3ZZ1A 3UFBA 1GPWB 1DB3A 3OJLA 4HDNB 2DB3A 2EJCA 2N1MA 4D8VA 4TRNA 4NJEA 1RLOA 3AVTA 1T13A 2XJ4A 3I92A 1PFGA 5AVYA 3TUZC 2PZGA 4D9KA 3DXYA 4E3WA 3BEOA 2BF7A 4LX0A 1ZA1A 2DWCA 2JD1A 5I9MA 2H9IA 1ESZA 4EIWA 3CTPA 3I1YA 5FBRB 4DR1B 1VPVA 1IBKB 4MWBA 3P9NA 3W79A 2IHUA 2FUNB 3ES9A 3INNA 4GYKA 1L5HA 4IDQA 1KVUA 1LX6A 4QVIA 1Q15A 2OB1A 4ZEMA 1U0JA 3PXUA 4IMIB 5KYXB 4NL4H 4LI3X 3MAGA 4UTPA 1FIUA 1V35A 1E0SA 1SQ0A 1ZVQA 2BEUA 4GPIB 4WK6A 4D43A 1GNLA 2C95A 2AJCA 2FWNA 3CLSD 3ISJA 3TLMA 5KWIA 1YOVA 5JMOA 1ZR4A 5AKGA 1SU8A 3W34A 2KS6A 1KJYA 4ERNA 1KMHA 1OILA 5AUNB 1KFJB 2QZPA 3PX7A 2Q5FA 3NT4A 4D57A 1TX4B 3M6IA 4WHMA 4R2HA 4ZQEA 2XDQA 4BQSA 2VUHB 2GUWA 3X3HA 5HSGA 1VP9A 3G2MA 1J00A 1T1RA 3PBKA 4L9WA 3A31A 3RHZA 2DXIA 3EJWA 2D0DA 3HWRA 2XNDD 3W1VA 1Y5LA 2WLTA 4MZDA 3BQ9A 4YWHA 3UH0A 2HADA 3AHGA 4NBWA 4ZYZA 1TUBB 3E5NA 3S27A 4A0HA 1KJIA 1OD6A 3K6KA 2VJQA 1YS2X 5A6SA 4TZ6A 4M9QA 2AWNA 2GF9A 3VPHA 3NATA 4QM6A 2CFRA 1N5KA 1PWHA 5CK4A 1GEEA 1DADA 5IARA 1SKAA 1KI3A 2HMTA 3DD1A 3ORYA 4DCNA 3OLQA 4I1SA 1T4CB 1L3BA 3G49A 4CUZA 5JH7B 4Q15A 1ZEMA 2NO5A 4L0DA 4W1PA 4YRIA 4QZVA 3OLXA 2GYUA 3DBHA 3EG9A 5HGJA 3A9UA 3WLRA 5E6SB 4BJ1A 4OOEA 4NH0A 3T34A 3ZX5A 4AJ1A 2ZDGA 2YVQA 2FWAA 3RGWS 4YQFA 2I2FA 2R6CA 3A2LA 3MMPA 4W5WA 3B3QA 1R8SA 1CZLA 3GNTA 4R68A 4J2HA 4EGJA 1NI5A 4FKBA 4CM8A 1B00A 1V1RB 4MULA 2C8LA 3BIXA 1ZMTA 2QMEA 3ID6C 4XYBA 3U56A 4W9MC 4MIOA 3HH8A 2AR9A 1FCJA 1A4UA 2OHFA 4P3XA 4BNDA 2HXYA 4UPVA 5HK8A 3X1MA 5EWJA 8OHMA 5ISMA 2WB2A 3N59A 2Q7XA 1GP2A 3EWSA 1FUIA 2NAPA 1Z4JA 3CUEF 3SJZA 3WB0A 2R25B 5HKLA 1LC3A 2PX5A 4YALA 4OD0A 3T3IA 3WYCA 5K7SA 1IN5A 1IPHA 3DLPX 4I14A 4DSNA 6REQA 2C7QA 3ACDA 2OGSA 4RVSA 3LOUA 2C8JA 5DO9A 4BP3A 1DOAA 3HYLA 1TQDA 1AXGA 2K5UA 2W11A 4Z4FA 2XMBA 2H5EA 4DA6A 2D5IA 3II6X 4GKJB 1DX9A 3SZOA 3KAQA 4K9DA 2Y0CA 4PBSA 1HLDA 3VR3D 5BSUA 4YDHB 1C7IA 2YHIA 1DQYA 4S04A 1CCWA 1NW7A 1HC7A 4CNQA 4TXNA 1HX7A 2HPAA 3VTAA 3K0FA 3G7UA 5G3ZA 3J81k 5D84A 1BJTA 2B8WA 2QTFA 3H8SA 3UMCA 4ER3A 1XTQA 2XUPA 2BL4A 3BJZA 3IP1A 3QENA 4JBYA 2ZBDA 4HI0E 4N8EA 4QUBA 3RYIB 3ZCUA 4QAQA 4A2WA 4ARBA 1YH3A 3A06A 3LUCA 4L8VA 1RDFA 4XSHA 2D1TA 1E99A 4D3FA 3O82A 2HJVA 1JE0A 2BGKA 4IJWA 4XFJA 2WY2D 5LL6P 2AYXA 1QU2A 1XEXB 3L8DA 1VYTA 1Z34A 2XDWA 4LTMA 3NBUA 3OIWA 3T0FA 2WFMA 3TRJA 4AF7A 5KOJB 1ZPDA 4AN0A 3E03A 3HO1A 2MCFA 3AJ9A 3LCVB 3H7IA 1JMYA 4ZOBA 3MMSA 3NH6A 4H1TA 4QEZA 4NXNB 4FFBB 5D86A 2RGNC 2ZB8A 1KPHA 2G9RA 2WG2A 4QWMA 1V3QE 4X9XA 4DW8A 2IPOA 3U7RA 2GSDA 1LCIA 4WXPA 5JD5A 5KBYA 3W4KA 3AVOA 1V11B 3P1JA 2L18A 2F3RA 2G28A 5D8DA 5TS3A 1J2JA 4A27A 5GIOE 3Q7EA 5AH0A 3LHIA 3ZXIA 3TQRA 3KAJA 3MFQA 2C9YA 1UDWA 3AZQA 4K6KA 3ZK8A 2XT0A 3KQSA 3BH6A 3G2LA 1Z45A 2W48A 4IM7A 1W75A 4ZXFA 4O08A 1PKEA 1H0HA 1WUIS 3G7SA 1TA0A 1WW2A 3DSRA 3QH4A 2JI8A 4EDFA 3H6HA 1BXKA 1L6RA 1TPYA 3U4IA 1JR3E 3I72A 5ED0A 3OBBA 4ZI5A 2XYVA 4RHFA 3NNNA 3OICA 3IQEA 1NG9A 4I50B 1K8XB 3RS9A 1K6XA 1KYQA 4CN8A 5KYWB 1ITZA 1D5CA 3LO5A 1ZXXA 4QGBA 4B0PA 4DUPA 4K6HA 2IY8A 1A95A 3O2QB 2R7AA 4UUBA 2A8YA 1ZGJA 4LBVA 1JAZA 5F7JA 2C58A 2YICA 4E5UA 1A77A 4I3HA 4MIKA 5AJYA 3P9YA 2C7BA 2JLBA 1F8GA 2D4HA 3L0OA 2BJHA 4H27A 3ZHQA 1T2UA 1EWQA 3PDIA 5BXQC 2ZYTX 2AYZA 2I3ZA 1RPAA 4KGXA 5KAMA 2FN8A 1JSCA 4HGQA 1JB1A 1UF9A 3TRHA 4BWFB 4L6CA 4IGKA 4WH0A 1I2DA 4GMGA 4BUZA 5ITWA 3V2GA 4PO9A 2YNMD 3N8NA 3O93A 4IQFA 1X8KA 4BTVA 3D8BA 5C8VA 4DLVA 4ESHA 4DL9A 2ZATA 1EB8A 2J5KA 2VXBA 3H97A 4X60A 3UH1A 3MQ4A 3H19A 3RR2A 1H5QA 3CS3A 5CDHA 3KTOA 2EEZA 4R6WA 4BVFA 3OQNA 4PX9A 1D8TA 3TF5A 1M74A 2HXGA 3O2SB 1E4OA 13PKA 4ZDIA 3DWGA 3OZWA 4C4RA 3IEVA 1XX6A 4BFYA 3EGDB 1N25A 4G9EA 1NMEA 1WZUA 2W5UA 1ICIA 1ODTC 3OCUA 1BW9B 4BVJA 4MRMB 3MUNA 2XYGA 1WUJS 3TNJA 1ZHHA 3KOYA 2O2JA 1ULUA 2WKPA 4AZ0B 2IWHA 4NV1A 1UJ2A 1OIVA 2GCIA 3P0RA 4HOYA 2CLHB 1KOGA 2PGNA 3CG4A 2PWPA 4ZQBA 5AKIA 1UMBB 1T6NA 1H42A 3PFBA 4L78A 4C21A 4M0PA 1XMOB 4P4SB 4JLWA 5F77A 2PUJA 4MI6A 4RH3A 4ILEA 4KKVA 3P26A 5AOCA 1THGA 2FX2A 2H48A 2DR0A 3UQYS 3B48A 4W8HA 4JMLA 2MSCB 3WJ7A 3IESA 3X2SA 3OLVA 2EZUA 1YQUA 1ZO8A 4U6SA 1XZAA 3SFZA 3UICA 4BBZA 2NO1A 1TQ8A 2CWDA 2JASA 1XVAA 3U4HA 1N3BA 3K09A 3S3TA 2HZBA 1XDGA 2JHPA 4JLJA 2YJZA 2O59A 1KY3A 2FFQA 3KHUA 3L4BC 4LAFA 5B1EA 2FPLA 3JATA 3FCOA 3NGXA 1YZHA 3X43A 1JJFA 5CNKA 4EABA 1R5NA 3AHDA 2X1LA 5M04A 1C8BA 3NTUA 2C8VA 5EMNA 4RM3A 2EWMA 4ZMSA 1AXRA 3NHZA 4P2BA 4F6RB 5I8PA 5CCDA 3AJDA 3HJHA 1KDYA 1UZUA 2HWUA 2VF8A 4MHSA 1Z56C 3LBNA 2Q5OA 2X14A 1Z0IA 3TLAA 2RCYA 2BTQB 3C24A 3FWHA 4MEJA 4IHQA 3ROGA 4R2WA 2QDKA 1LGYA 1RYMA 2XWBF 1AKQA 2EKZA 2FAXA 4OLBA 3I53A 2BGIA 1H4QA 2G63A 5DGHA 1RTKA 2V3VA 5CCXA 5ALFA 3UHPA 4GMHA 4MS3B 1KQ3A 3VM6A 3LF1A 2AYYA 4N5LA 2CHFA 3ADOA 4WK0B 5AKYA 4NOLA 5CDGA 2X5NA 4O4HB 1QQ5A 2QQ5A 2TECE 4ZRDA 1AURA 2C7GA 2RAUA 1ZN8A 1VB3A 4OQLA 2C97A 5DTRA 5K3BA 3WKAA 3ZHZA 3PE3A 2ISQA 1Q7RA 1QLHA 4LJ4A 1UINA 2C54A 1QANA 3JRWA 2PX6A 2P9ZA 4S1VA 3WLNA 2PSHA 3OZUA 3F5MA 4Z5XA 3RAEC 4TROA 2A3RA 2OO7A 5FJJA 1YCGA 4FEEA 3UYKA 2GETA 2PG3A 4HSGA 2HMAA 2JK1A 2RH9B 1EQ2A 4PZEA 1Y98A 1PHPA 2AHRA 1U7OA 2HU5A 3VPAA 3ZNNA 3W9UA 2JLQA 3P0IA 1IEVA 5GJVC 3CNNA 3F6RA 4DHWA 1RWOA 3L6DA 4O4LF 5TQJA 5CUQA 5EPUA 3RF6A 1RI4A 4H1VA 3FMGA 5MHTA 2GCOB 1NXQA 1U04A 1W5AA 2IHVA 1C3OA 1WEHA 3K4QA 3P9RA 1VBFA 1NYLA 2EQAA 2I99A 2C7RA 4BMPB 4NYMR 1SB9A 4Y67A 3LT4A 4NCAA 4PZDA 4MVJG 2I6UA 3GT4A 4ROSA 4I4LA 1O95C 3QUTA 5A02A 1VLJA 4G41A 1Q3TA 2RJOA 1Q0RA 5DP1A 3ZCQA 4YBRA 1RJEA 1RRFA 4G1MB 1T8PA 4YREA 1U5AA 1NW4A 1RJ9A 3HR8A 4CGZA 2BFFB 2JIQA 3O8LA 5AYVA 2ES4A 2CLMB 5ABPA 4JK3A 2EG5A 2J1LA 3IUSA 3DE5X 1A3CA 1IJFA 1GSHA 3ZEIA 721PA 2NU7B 4UTOA 1R8QA 3JR7A 1OT5A 4FQ5A 3DVAB 4J0FA 2HXSA 2J3KA 3MTJA 5KKCA 5EMHA 1ISMA 1FDUA 3GOQA 1PEKE 4DDVA 5BXYA 1CUIA 4HEA1 1C81A 4MUHA 3FCEA 2F8TA 4LF7B 3EVBA 1SWVA 2HK9A 3T3DA 1KAEA 1XVIA 1Q74A 3R3JA 2NVUB 4UNRA 3RV4A 4DQVA 2Y71A 5K8UA 2XECA 4TMTA 4CNBA 4HJRA 1I2ZA 1SMKA 2C84A 4EMTA 1AHPA 1NXSA 4RX1A 2WUEA 3V6MA 1RRKA 2G6BA 2O8FB 3BSFA 2FN3A 4ALLA 3PEVA 4E32A 1T0UA 1JLLB 3W2IA 2NNWB 1V4VA 2LE0A 3GRYA 2Y1GA 4PFQA 2HRCA 2HHHB 3WVNA 1JIXA 3OQJA 3H5WA 4HX9A 1K9VF 4UPDA 1YNSA 4JN6B 4PC7A 3FTPA 4Q3KA 3TQIA 1VBMA 2OHIA 4BGUA 4DIDA 1KIAA 1YB7A 4MV8A 5C3MA 4J4BA 4DQKA 4YUZA 1WUHS 1E3QA 1OXSC 4R05A 3L06A 3OCVA 5HMMA 2JAWA 3RS8A 1MB2A 1PDOA 1X7DA 2XB2A 2NO4A 4ZVOA 3L8EA 5FPYA 3V8EA 4B4UA 2JEOA 1EQUA 2QVXX 3R3UA 4UBIA 3U16A 2ZPUA 1MJGM 5I4BA 4AJ4A 1CFZA 1Z28A 5IW8A 1ZVKA 1MN6A 3QEMA 4F2HA 5JMWA 2WM2A 3O1JC 3QHAA 5JDIA 4P0TA 4QYIB 2O54A 1P7WA 4GOOD 4JKYA 5IVDA 5A3RA 2HY7A 5MN6A 5JW6A 5EJ2A 5KKAA 4V39A 5TARA 4LQCA 3RJMA 1NI4A 1UFOA 4I5FA 3OTQA 3PQEA 2A9QA 1DHRA 4YAWA 1TDJA 2V6GA 1EGQA 4OXYA 5CDFA 3TZCA 2XXJA 1XYGA 4ENSA 3KUCA 1EDZA 2YOGA 3EQZA 2I1WA 4B4VA 2V97A 1DBPA 4BLPA 4MRNA 3O91A 5T4BA 1M1UA 3UFXB 5KPDA 3I62A 2J0QA 1W52X 4EY7A 3VDRA 2MR5A 2G7ZA 3TINA 1V8DA 2FXVA 3IJRA 3LD9A 3L7AA 4AY4A 1GZ3A 3GLFA 2IYPA 1NW5A 2Q3JA 3OMXA 4XM1A 4I50F 3ZY3A 3JS5A 5A5VA 2QR5A 3D6JA 3N3AC 5JCXA 3HACA 4ZVVA 1U2EA 2L19A 3PWZA 2JCSA 1NY5A 2NQ2C 3N0WA 2GM5A 4R9RA 1Y8CA 2O1WA 4HQRA 1LNZA 1VJGA 2H1LA 4EZIA 4QGGA 1IY2A 4AKSA 5CLLA 5HFNA 1MD9A 3GFGA 2WD7A 2ODAA 1RKBA 3EXIA 3A1CA 1U9IA 3LCUA 4KXYA 4NZ9A 1Z35A 1C0PA 2GF2A 4PO3X 4BMOB 1RXVA 4LC0A 4B2LA 3GFVA 2Q9CA 4WXHA 4QICA 2GNPA 3WGLA 4TSKA 3A0RB 5HILA 1QFMA 2Q5JA 2X9NA 5K0BA 2O7SA 3IKJA 3UHFA 3CUWA 4K6CA 4EZBA 4P82A 4R2LA 1ZK3A 4YUYA 5A9SA 3BMOA 2ZS8A 3FPSA 1RBYA 1JDPA 2BFOA 5BN3B 4W5NA 3OHSX 5BW6B 2G5PA 2QN7A 3FPGA 3PHCA 4WV3A 2O2IA 3P7MA 1FFHA 4Q39A 4G0OA 1OE0A 2V96A 4MNTA 1U2ZA 1KVSA 1PL0A 2GLXA 2FZWA 2O2ZA 2PWZA 2W0MA 2PL5A 3NASA 3QPUA 4MVJH 2X0DA 2GHIA 3VVCA 5FWXB 1V37A 4NABA 5LQDA 3FR7A 1HQCA 1JPVA 4L85A 4A8JC 3EWIA 4NMLA 4U9UA 2EX0A 1JH9A 4OXQA 4KREA 5COBA 4QDUA 3VNQA 1BX1A 2PQ6A 2XUAA 4DA4A 2DHRA 3MD0A 3Q1LA 1O58A 5G1NA 1S8NA 2UUOA 2HTFA 1R6BX 2YXEA 1YIOA 1NRXA 2CLSA 3D81A 1C0KA 2ZXUA 4X1YA 2VTBB 1HL3A 3SM3A 3F3MA 4YAKA 5H82A 2YINC 3HLKA 3R6DA 3U3RA 1LF0A 1NN5A 1Y3HA 1TEZA 1XF9A 4ZQHA 3GLHB 2ZZKA 1JG3A 1PJ3A 2BHRA 1VSQA 3SK0A 2JLZA 4MYTA 2OEPA 3BN3A 4EI9A 4XJSA 3X1KA 2Z04A 3NAQA 3EDQA 4OA8A 5JVDF 3ZGZA 1UC8A 3M0EA 2YMPA 2ZQYA 4H3VA 3T9DA 1LRJA 1U2DC 1MPXA 2FI1A 3PRHA 1J2RA 2ZLBA 3GJ8A 4JJ4A 4CFSA 1CP3A 1GPH1 1KHHA 2P6MA 3FPKA 3IEXA 4OGFA 4IVNA 2J3IA 1USKA 4JEMA 3HJUA 4EVQA 5I01A 1NYTA 2BKUA 3BXXA 4Y1GA 5E2BA 1HEYA 1PTJC 2JVKA 2GN9A 4D26A 5LB4A 3I05A 4L8LA 3DPSA 4GX2A 1C14A 3O0DA 1VG8A 1RBZA 3H83A 4I55B 2CN1A 1MAHA 3ROQA 1N6LA 2FUKA 3H5LA 2FFBA 2HLDD 5ALZA 2PV0A 2Z2KA 3BGVA 1DQNA 1CRLA 2X9VA 1LBEA 3CX7A 3SWWA 1P4SA 4IDHA 1G98A 3KVYA 5HQ3B 2BKEA 4UNIA 3ICPA 3I42A 1OBHA 3DXZA 3PQ7A 4HGPA 4QX6A 3VZDA 1AE1A 1JQDA 1J90A 4A0SA 4BKOA 3BXHA 2HQBA 1QZZA 2QY9A 2YR0A 2QUIA 3IUEA 3KEGA 4KV7A 5JNRA 2ZREA 4PIMA 5JEEA 3ZUPA 2QM8A 1UJNA 5TMBA 3C39A 4C4AA 1A2QA 2WSSD 2X2OA 1J21A 3SJCA 4F9FA 2PH3A 2FZLA 3TZBA 4B6QA 4F04A 1N2SA 2W6QA 2JBWA 2QJRA 3IPAA 3D6VA 1DO8A 1SPBS 2FDRA 3H05A 3Q7RA 4BEWA 2WG0A 3A3YA 3WKEA 1RADA 4DDKA 5DCWA 2E48A 3WLFA 3BTUA 4XFDA 1HTWA 4PN3A 4CV3A 2QDXA 3I39X 3KTDA 2OCYC 4MWSA 5ALHA 3RYCB 2HREA 3PKIA 2WWIA 1VXOA 3PB3A 4RF2A 1Q3KA 2EVWX 4WLUA 4Q3OA 3DJYA 2GILA 2YNMA 1HDXA 2VZ8A 3TUIC 2ARKA 4XUEA 3G5UA 1U2QA 4O4IB 2C5SA 3H9UA 1YQ9A 1Y5RA 3GHHA 4CDGA 1M10A 4WL0A 1W0CA 5JISA 4JSYA 1HE1C 3HP7A 4BFLA 3CRVA 1TZJA 2GCGA 2C3PA 1FU4A 3BIWA 5EI5A 4D99A 3O8CA 2GXUA 5EYPB 2FPWA 3WDMA 2X5KO 4I5EA 4KG7A 4F4FA 1Y6GA 1X80B 1ZAYA 1WZ2A 3BA6A 4XX0B 1K2VN 2R96A 3ESAA 3G79A 1N34B 3BTVA 5K6RA 3X0DA 2MYUA 2QP3A 4HWOA 2OG1A 2CJWA 1O87A 1MG0A 4E70A 5CG2A 1YBHA 2C2BA 2ZM5A 2WDZA 1JDBB 1HLGA 3F5QA 4R01A 2BLNA 3M9XA 4R41A 2CMGA 4KX3A 4QXPA 1E59A 3IT2A 3M1IA 4CR7A 4RD2A 4DIUA 1DHTA 5KC9A 3ET4A 5T7BA 4DR5B 1N6OA 3MMXA 2L42A 3T0IA 6ADHA 1E5QA 4DR3B 4BRSA 1E61A 5I7OA 3AF4A 5DGTA 4HEQA 4WZBA 4Q9KA 1W5EA 1FDRA 1NVAA 4PQFA 1MT0A 5EJ4A 1XBTA 3GUCA 2NZVG 1YRQA 5DRTA 5LUAA 2JFXA 2MSNA 2G9ZA 2CFSA 3PR1A 3WIEA 1QX4A 3W3ZB 2C5LA 4OFBA 2OAGA 3ORHA 1KF0A 1FPMA 3LKZA 1FJXA 3CCBA 4JEHA 2ZXFA 4EG1A 3BFJA 3UMRA 1D2RA 3KB8A 4HATA 4DA8A 4KXQA 5JCZA 3U0BA 3P0EA 1GGVA 3SKXA 3KSMA 3L6CA 3GPCA 4RLHA 3VH2A 4MI3A 5AO9A 1YB4A 1R0RE 2MSKA 1G5RA 4HMQA 4Q4AA 2ENUA 1BAPA 1UT6A 3GI1A 1M1YE 4JU8A 1YVEI 3I0ZA 1Z6PA 3TIXB 3M6WA 4HDMA 1E89A 5ECDA 3GLGA 3KU4A 2X0JA 1QIGA 3Q7SA 4MLZA 5TGZA 1HBJA 3TH5A 1M0TA 4B6GA 3MRXA 1CUBA 3OU7A 3NGMA 1Y63A 3Q88A 4MQFA 1FMLA 2ODPA 5DISB 4BX0A 1BX3A 1ZM2A 2IWRA 4DDUA 4G65A 2QTVB 4MWTA 1NR1A 4M6WA 3ZXSA 1BCSB 2B25A 4MW6A 4DPKA 1UBUS 1QSGA 2IIBA 3VHLB 5TLSA 2IS6A 3FNIA 1ECGA 1SEPA 5IAKA 5CRIA 1RLIA 3VNRA 3T41A 3V7WA 4JLMA 1R16A 3ANXA 1U2TA 4X1KB 1NTRA 1ULBA 2WM3A 2WU4A 4KLRA 5CLGA 3THSA 1ZLXA 1VE6A 3IQWA 3IVMA 4MP8A 1IZ0A 1QS0A 1B6SA 1SIUA 3N5CA 4NENB 1E3TA 2XOXA 2YBEA 3AWDA 1A9ZA 3NQ41 1Z8FA 3ZE9A 3O6VA 2JZOA 5JDCA 5LYJF 2JGEA 4YJGB 2DJIA 4UUNA 2UYOA 4MV7A 2DBVO 3AY6A 4R8KA 1NYQA 4Q48A 4H60A 2W2KA 5JV5A 3H9BA 3RU9A 3UJCA 3SHTA 3EXG1 5I8WA 1K8YB 4PXAA 3O2NA 3VZCA 2CLCX 3PR3A 3OQIA 3SFVA 1ZYUA 1F8XA 2BLLA 2BWJA 5DEOA 1WMSA 1ZKDA 1L0BA 1Q1ZA 2X8WA 5DWQA 4DCOA 1R0KA 4LVCA 3C4QA 4GGOA 3R5FA 4MJ7A 1D2NA 4EJMA 1CZKA 3FFXA 3A04A 2J9ZB 3L05A 1TXGA 4MJ3A 1XZFA 4HNGA 4U3JA 3WBFA 2IYVA 1U7TA 1UJ6A 3J81A 1JIIA 2JIZA 5AOVA 1EEHA 5SYAA 2B61A 1SG6A 3O7MA 4R8SA 5G0WA 2O2YA 3DGFC 3RUEA 3V1MA 2J59A 3FDZA 4BNFA 1QWOA 5KKNB 2WF7A 4H6XA 4JENA 1QLJA 3VU3A 1UBLS 1U9IC 2M6SA 1U8UA 3A0UA 1NURA 1NQTA 3OZBA 1GSAA 1Y8RA 5AQEA 2FCAA 3GRAA 5KSZA 1CP2A 3V5NA 1JLHA 1E1RD 3WAGA 1SWWA 1V95A 1E8NA 2DQZA 2B83A 4GX0A 1DQSA 3KLMX 2XCLA 1DO0A 3VUFA 1NZJA 3B52X 1H8ED 3I2FA 5DNEA 2R7LA 2I2CA 2XGGA 3AZOA 3K1JA 5DLQC 1RXYA 1XTBA 3O75A 3WNZA 1EZ1A 1ZFNA 2DP4E 3OC6A 3VOTA 1HT0A 2LCIA 1T9ZA 4JLAA 1MB4A 4MVJM 1RRCA 1R3DA 1NIPA 2AN1A 3AO0B 1C80A 1PV1A 1XAJA 3GEIA 2D0PB 4X97A 3WB9A 3GVHA 2E4WA 4CMAA 5LQNA 2XTMA 3FOAA 2NXJA 5EKUA 1JIJA 3ZYCA 4B5LA 2HDWA 3TAXA 5JROA 1OV6A 2GN1A 3IJEB 2LIPA 4EG3A 4ZJZA 2HD4A 4P5EA 3VI4B 1LDEA 1P2TA 3FLBA 4FW9A 5IDXA 2GJKA 1T2CA 4MGHA 3R44A 1J06A 1P3JA 3AL3A 3G2PA 4E1BA 2ZJ7A 2CSUA 4CTMA 2FH5B 3GO4A 3GX1A 4ZAWA 3VKVA 3VHXB 4OJTA 3W1WA 5JALA 3ZKWB 1J0BA 2I7VA 2JDID 2JHAA 3AVQA 3HM9A 4JA0A 1X6VA 2QAGA 4TLEA 3BPSA 1OZFA 1FS5A 4TSFA 1Y8QA 5CB4F 5AW8A 4PC6A 1P75A 3O73A 3HK2A 3UV3A 3A4YA 1EESA 2CMKA 1TECE 2YMLA 2HA5A 2EAUA 4R7ZA 1V26A 2PMKA 3EXFB 3VSEA 4UCXA 3KVRA 5CFNA 4QA9A 3R7BA 3WIBA 1B0AA 1QIKA 2DH5A 2WE8A 1JWBB 5IRCD 4IKPA 3RIHA 4IYJA 4F3YA 1JDNA 3ZC3A 3T5MA 1PK9A 4ON9A 3L7OA 4QE3A 2Q41A 1Y9EA 4H6VA 2FFHA 2GPSA 2DFTA 4P5PA 2WYWA 1XDWA 4MKZA 2HQ1A 3ZDZB 1JQJC 5KTRA 2HB6A 3RHSA 1DG1G 3HYNA 4I4TA 1HDIA 3LSTA 2G3YA 4XIGS 3VBCA 7REQA 2VXYA 2ZBRA 5K4HA 1O08A 2R6ZA 3JYHA 4H2DA 2ZBVA 2Y3IA 5CXQA 4I55F 4RY8A 4UCWA 1Q0UA 4Q4JB 1XA0A 2VOJA 3C3AA 3OE1A 1KQPA 3FYUA 3P9SA 4FDLA 4HPWA 4Q3EA 4RAQA 4UFOA 2XKKA 2C9ZA 5K51A 1T9GS 1CW2B 5B2ZA 1Z63A 1I30A 2IZ1A 4KI0A 3OWOA 2Q3MA 4A36A 4PG7A 2GDJA 1H3FA 3BHNA 4G4JA 3AKEA 4JJ8A 1RACA 2YYYA 4OCZA 4DLBA 4IDPA 1KGSA 2D2FA 3OJCA 4TVOA 4ND2A 3Q87B 2CJYA 3DAHA 5DE3A 2VATA 4PIPA 4GFDA 3KZCA 4F1JA 5KQGA 3F8TA 2GZ2A 3C70A 1EXWA 1TLLA 1DRVA 4ECAA 1T36B 1J42A 1FUKA 1P9OA 1CVIA 3M82A 1X3SA 4DARA 2O7VA 1D2CA 3ZK7A 1Q1BA 1XZNA 4YMUA 3M6UA 3W2EA 4MS1B 4MS4A 4TKMA 3NI2A 5DGXA 3T6KA 4D97A 1BS9A 2CLLB 5A7GA 1DQPA 4A26A 2OV6A 3IPRA 5FIUA 2FZGA 3ZJYA 4ERXA 4HWPA 3PQ3A 3K8QA 1PVDA 5A4FS 3QLTA 1P17A 1XD2A 4OXRA 4LXTA 2P6NA 4URWR 1SD2A 1G2OA 2XZPA 1B3BA 2P5TB 1Q91A 1MOSA 4ZZ3A 5FV7A 4ZJUA 1Z75A 4XYLA 2Q0XA 1A8SA 5EHGA 2HSWA 2NUAA 4WZAE 4Z9XA 1ONSA 1AM4D 4MTLA 3NBQA 2JLXA 5ALSA 4J1TC 1SURA 3QBDA 5F3DA 3EIUA 2AEEA 2VPXA 3W2FA 1SNYA 2IOYA 1S8AA 1YC5A 3NP7A 4B6SA 4D9NA 2PBLA 1P91A 2DBQA 1WLYA 4DSUA 1X3LA 4K0RA 3F78A 4GXRA 5AUPB 1E2HA 5G4KB 4HF7A 2YOHA 4XCVA 4TV9B 8LDHA 5IAOA 4J2OA 3TM5A 3RJTA 1YRLA 2QTZA 3DOEA 2XGOA 3D59A 1QOPB 5FI5A 5L40A 3HA3A 4DR2B 3NVKI 3KKNA 4LVNA 4KFUA 1E9FA 1QLWA 2NO7A 4TRMA 4UUOA 4HN9A 1QHSA 2W8ZA 4PNEA 1SCIA 1P2UA 4CMKA 2YTZA 3UCFA 3RNLA 4QBIA 4FKZA 1DC7A 4H15A 4QO8A 3T7RA 1W5FA 1YDGA 1E7YA 3JYOA 2I2AA 1O5OA 1S02A 1BU5A 2J9YB 3GEPA 1ISIA 1RYBA 5EQDA 1ZONA 1RM0A 1QFYA 1L4BA 3C1OA 3DNFA 4RSHA 2HHJA 1P4RA 2XVAA 3KJFA 4IIJF 4ER7A 4DR7B 1DRWA 1EJ2A 3H2JA 4EG7A 4MQUA 4ARIA 2A9RA 2C2KA 3MJRA 1WCWA 4Q24A 3IUNA 3OLZA 1NN0A 3QVKA 4HAOA 4KN8A 3STHA 1XHFA 3TSZA 2Q1TA 3KWLA 1JDZA 4I7EA 1FRVA 1QO0D 2OO3A 3C7AA 4YDRA 3PXBA 4AMGA 4DQUA 5GOTA 2QRZA 2HKIA 4XYEA 4MIEA 1GAJA 1W0KA 1MB9A 2OV2A 5EEHA 3E05A 1WKBA 4L0CA 4LFAB 3FTNA 3LOPA 2JLWA 1FRFS 4QREA 2IVFA 1FW6A 1U94A 2GBCA 3LQ1A 5DCLA 4RQAA 5FBWB 5FDFA 2JLVA 5J4VA 5KYNA 3B8HA 3UF0A 2I76A 3ZS8A 1U4NA 1TW2A 2A5DA 2EP8A 2RAFA 1KEWA 2VXCA 2WJ6A 1MVOA 2ZRLA 3BCUA 3VYUB 1YA4A 4BZPA 4MYSA 2B3TA 3IUBA 4D9CA 1BD3A 4JLVA 5H70A 1Z4OA 1F51E 3FHLA 2R6R1 2WSSA 3MWKA 2AZXA 4J0EA 3ZHRA 1XNGA 2UUCB 4GXTA 4EA8A 1G5FA 1LEHA 1QH8B 5JSZA 4EYQA 2OHHA 4KIGA 1PDVA 1R5BA 4Y9RA 2BE9A 3WV4A 5HNKA 2ZT6A 2BGUA 1RFGE 1D03A 4S05A 4N5NA 3FUWA 1XDSA 3PNOA 5GY7A 3U4AA 3WY9A 4I9HA 5KMGB 4D9BA 3PHLA 3EEFA 3TK1A 4BZZA 4ABYA 3AR4A 3JALA 3OZFA 4F1KA 4DABA 2XKAA 1GT91 3KQWA 5ARDA 1KNXA 4U7JA 5D01A 4F6RA 1J70A 1OFVA 1O6GA 2G77B 4ID3A 5I5EA 2UZ0A 2GESA 2NUBA 4KN9S 1SKBA 1E7MA 4L3WA 5EAIA 4A03A 5IWAB 3TTSA 3DF9A 3FVWA 4FZRA 4AJHA 2X9GA 5FWYB 3ASVA 4EKGA 1N9GA 3KQLA 1DKUA 2CZGA 1JB9A 4JJAA 3S44A 2MMGA 1XVTA 2EFGA 4DC9A 4R9SA 4BKMA 2EIHA 3MHPA 4XUDA 3LKVA 3O3NB 4LX8A 4JJIA 2FPXA 1XPUA 3A6HA 1MB3A 4Y0NA 4R2XA 2P9FA 4M1EA 4AP9A 2ZYUX 3C5VA 5KCMA 4CRWB 1OFHA 2Z4TA 4E5NA 3WYNA 4ARVA 1O0SA 5F52A 4HAWA 2QNRA 1M7GA 2ETVA 1WJGA 2ZWAA 4MVCA 5G40A 5ITSA 1C2YA 2BCJQ 4PQRA 5B58C 3MEQA 4YJ2B 3AUKA 4ZCLA 5T57A 3Q6NA 1AS0A 2EFJA 3CR8A 3HKBB 4O2AF 1ONNA 5GZ6A 1MX9A 1J33A 1H2ZA 2RH5A 1SUEA 3IIEA 4L74A 3C8DA 3INGA 4TV8A 4B2PA 1TAHA 2H7YA 3HVHA 4MOWA 1TT5B 4BVEA 4QYWA 3FH0A 2YZGA 4ENPA 1KYTA 4K9QA 2JIOA 1PHRA 3M4ZA 1AKMA 1YRYE 2RHBA 3H1EA 3ZY5A 4A5OA 3ANLA 1PEAA 4FGSA 1CR4A 1Y48E 5JHHB 2P2NA 1U99A 3K94A 1Y7IA 1EBFA 2BMFA 3OOHA 5DM2A 2PJZA 1OVMA 1O95D 3RQIA 3WLHA 1GCIA 1LC0A 2QX4A 3QXSA 5JAUA 1C30A 4U63A 4W6QA 2WJHA 3ETLA 3RTAA 4P3OA 2ZTSA 3FCSB 1SD5A 1SBHA 3GVXA 4D9HA 3A26A 8ABPA 2GARA 5EGNA 2WU8A 4EW6A 1A9QA 1K75A 2NYUA 4L08A 4B3GA 5B7QA 3TR5A 3R3VA 2ZULA 1LK5A 4B3CA 4KUHA 1B74A 3QFSA 2I6TA 4BFCA 5CFQA 3SSOA 2BI7A 2G72A 4OP3A 1G20B 2DFVA 3EIEA 1CBUA 3G59A 1JSRA 3ILXA 1GGHA 2P75A 1SVIA 2BY4A 3OLWA 5KHOC 2D2XA 2REOA 2RIPA 1OH7A 4C0JA 4WTOA 3W5HA 2SHKA 4ZGWA 3I76A 2J3JA 1M66A 1MHTA 2GRUA 5AVWA 2Z8YA 2R68A 5CEJA 2C98A 2EBHX 3NPMA 2DWOA 4TTIA 4A6XA 2GJ8A 3OEHA 3U31A 2P2GA 4RIIA 5JD3A 2RI1A 3LV8A 1LU9A 3O4IA 4LISA 3I52A 4H1WA 1QO7A 4R1OA 5AI0A 4PRZA 4BCCA 3L6RA 1R74A 1OHHD 1EGMB 1UXJA 4Q82A 4YQYA 4MVJI 1SBIA 3N8KA 3NKLA 4XQ0A 1Q6ZA 5L9AA 5BV8A 2F3UA 4BWYA 4G5SA 4C0XA 2AZMA 3TI7A 1CB0A 1SBYA 2X8LA 1Z4PX 4A0RA 2OE2A 3IMGA 4MR7A 3OIGA 4Z0NA 4B7AA 3K96A 2ZFUA 1II8A 4JLSA 3VSBA 4MMXB 1N8KA 4B3JA 1VQ1A 1PJAA 2BKVA 4MVJF 3MCAA 1CDEA 4KWIA 2B7BA 2R6FA 2EWWA 1XXLA 2VWHA 3PS9A 3U26A 3QVVA 5HYVA 2RCNA 3KXLA 1J8FA 2MINB 2NV6A 2AKEA 5BVHA 2B5VA 2ZSHA 3H18A 5HOQA 3FB1A 1G60A 2BEKA 2ZR7A 1G8JA 3K0HA 3QM1A 2VF5X 5J2TA 1MU0A 2HCTA 2PYDA 3HJGA 4OHBA 3WGQA 4EELA 1U7UA 4CG1A 3OG9A 5K3SA 1N5IA 1XTJA 2PH5A 1E94E 2XNCA 1XG5A 4FJ2A 4NDAA 4UULA 4BV8A 5A5DA 1GLGA 2CV1A 2RH8A 4WLVA 5JD4A 1I6KA 3ZW9A 1E1RA 1TUIA 2B1GA 1W94A 1Z7YA 2HYDA 3EGCA 4FTWA 1QF7A 3S70A 4DM7A 4QOSA 3U7HB 2CNWA 4FU0A 2PUAA 1U0BB 1Z6ZA 4NEHB 3JVDA 1K6EA 1UXIA 2ZT7A 3A10A 4H3HB 3SHVA 4HDAA 1RW4A 3TD2A 4M1ZA 2RGRA 5F9FA 3T99A 2NT4A 1PS9A 1XNHA 5DYWA 1E96A 2HF7A 4D46A 4DA9A 1YQXA 2OPBA 2FZ5A 1E9SA 2P90A 2NZWA 4MV1A 2QTBA 1EVKA 1QHFA 1R9JA 1SC9A 2VEDA 3H17A 3N2LA 3CPHA 3OCZA 3PLNA 3E58A 4Z1MA 3ZY2A 3HDTA 1XKTA 4U5QA 3UB4A 4OL0A 3GPDG 3IAS6 1BJKA 3FSEA 4BNJA 1W47A 2R44A 4UTNA 1U6KA 1UKEA 2VYVD 1XCLA 4X3PA 5I7VA 5KOIA 3HQ4O 5DBHX 3GDFA 4YP6A 1DFHA 1I0IA 1V5IA 2AK3A 1NT2A 4PXSA 3OZVA 3AZPA 2Q21A 4L6AA 3UBMA 4OHOA 1ZH2A 4AIIA 3Q1KA 3S2IA 3U3KA 3WIDA 3DDSA 2II6A 3AF5A 2V7PA 2YHBA 1XQVA 4LCEA 5AICA 1WU8A 4U4AA 4YAOA 3ONFA 1P0FA 1XTRA 3JQ9A 2W8BB 4KN5A 1SHUX 1T5LA 3ADCA 1JWAB 1W88A 1NXXA 1YCFA 1WO8A 4ZCRA 2ZBGA 2CXQA 5EIHA 2OL4A 2PHZA 1HA3A 1X7HA 1MNQA 1PFUA 3LL7A 4NAVA 2HRBA 5KINB 1W4AA 2ZUFA 5JQGF 4OLHA 2WIGA 1WUKS 2DKOA 4W82A 3TGWA 2B4KA 3BE5A 4KRFA 4RBNA 3TBKA 3REQA 2A0XA 3B6JA 1MJGA 1RZVA 1R5OA 1U7ZA 4N0PA 3RC9A 4NBKA 2FR0A 2Q5QA 3W5SA 2O3RA 1AV7A 3WFIA 1BXGB 3AF0A 4PG6A 2SCUB 3AUUA 3MGCA 5CA0B 4E30A 4M1WA 3I8OA 2J7PD 2A5JA 1PK7A 3UJDA 4D74A 4N8DA 1MRZA 1RJGA 4DMRA 3L2OB 3AR9A 3HB5X 1CY4A 2FPPA 4X8MA 4C43A 3W9BA 4LBZA 4OKIA 1TTTA 2NAFA 2CNDA 4BATA 4GUDA 1QFJA 1NVVQ 1FVFA 4RJTA 4KEAA 4EEXA 1A9XB 1TRHA 4RVOA 3VSDA 3BL6A 3UAGA 2YYZA 1EWKA 3I9OA 1V48A 3TN7A 1VKZA 1V1MB 1Z17A 5A0FA 3S8YA 4GMDA 2I7XA 2ORIA 3QY0A 4RZIA 3RUCA 4LJRA 2NZ2A 4JBLA 4PLVA 3V1UA 2BM0A 3UMMA 1CUWA 3LUGA 4RTSA 1YVRA 1MPTA 5FUBA 3ZDDA 1D2HA 1WOMA 1NUHA 3URMA 4Z0TA 5JIBA 5E38A 4R69A 1QGUA 3SQMA 1ABEA 1Q95A 3UY4A 2TMKA 2BM8A 2E49A 3LHFA 4LV6A 3WYEA 4FZ3A 2AI2A 2QGZA 3JVEA 2AV6A 2ZJ1A 5KDLA 3EVFA 3THXB 4I99A 3CUSA 2EARA 3H8WA 2XSZA 1VRCA 2I4MA 3U4QA 2DLCX 4KQEA 1OBOA 3HJFA 1WB5A 2O19A 9MHTA 3R7FA 3FXAA 3MT8A 1IRXA 2QTGA 3F3SA 1T5SA 2IXFA 4JUFA 2W2LA 2XVMA 4UAUA 1B0UA 5CVEA 1E2UA 2BH2A 2QL5A 4UHEA 2XBMA 5L6LB 4IJ5A 1K8RA 5L7WA 5ELXA 5JJIA 4Y2JA 3KRTA 4W1QA 1TYEB 2ZSBA 3EZGA 5IT9A 4W5QA 3L7MA 3OZIA 3RT1A 1KMQA 3PNKA 2J32A 2FCRA 2KWIA 2VHEA 3UPDA 4ME6A 1I5RA 2Y1CA 4C6TB 1G5TA 1Z5OA 3RS4A 3W6OA 3WK6A 4E08A 5A2GA 1Z5ZA 1RC8A 1OPXA 4MWZA 4NP6A 2VPTA 4IL5A 4YJ2F 3WX0A 1YA8A 4Y7DA 1NMXA 3HUTA 2WEKA 3LW8A 4BGEA 4PWYA 2X40A 2A9VA 3GLQA 3ELDA 3GUHA 1GTJ1 2X0NA 2A1IA 1DP4A 2RGBA 1TU4A 4PZYA 5CM9C 4EAQA 3HFSA 4KDCA 4RMIA 4V1CI 2P9JA 2QS9A 3SSAA 4GVXA 3LDFA 1R4NB 3TVYA 4HVCA 2B5WA 1PGJA 2X7HA 1CY6A 3L40A 4Q34A 5FOUA 4EA6A 2UU9B 2BSQA 5CX4A 1YRAA 3VJLA 4MEAA 2Q6TA 2VOEA 2XBLA 4P58A 5DHPA 3IKMB 2J31A 3HSSA 4K1XA 5LP6F 3RQSA 3H84A 1VHWA 1JEYB 1UMCB 5AP9A 2GAJA 4G0WA 4AM8A 5AD1A 2GKSA 5KYVA 3OPVA 3V4OA 2WD8A 1NKTA 3AJ8A 3KPJA 5EWLB 1PO7A 1T8YA 2IL1A 2XMCA 3LVQE 3ZOZA 3F67A 2IIQA 2Y93A 2NTEA 3I9NA 4JV5B 1XDUA 4QLAA 5DSZA 1GZ5A 3PTLA 4P4UA 3WBJA 1F06A 3DMPA 1A5SB 5GP1A 1XLUA 4YIHA 3VR4H 4GKKB 2GVDC 3ZGVA 4G0MA 3PSHA 4DUGD 3E1GA 4KODA 3SXPA 1YZNA 3FGPA 2X9LA 1YFKA 1YRWA 3ACCA 4ZAVA 4INZA 2AQIA 2R66A 2Y77A 1O96B 5F78A 1H6BA 3C8MA 4IIGA 4P38A 4IXWA 5CJPA 5JHGB 4G63A 3WICA 4QTXA 1W1UA 2QL7A 2GEUA 4JSRA 1B8NA 2X5JO 2R6JA 3G9ZA 4QOHA 1DX4A 1N2CE 2JAPA 2Q3CA 2WUGA 4IR7A 2CKDA 2G9QA 4JJFA 2IXGA 3B7WA 3GGSA 3MCZA 5ANRB 1CE8A 1QYCA 4ZOLB 4EW1A 3WRXA 4MDHA 5GINE 2C9MA 3ETHA 3CZ9A 2C82A 3NEJA 5HHTA 4FB4A 4N5IX 2A86A 4PZUA 4TQUS 3IILA 3HCPA 4W1RA 2XMDA 4RY9A 1JHAA 4YJDA 2DKNA 3UAYA 3VOSA 1D4OA 2WTUA 1KU0A 2JBHA 1OFIA 3KD3A 4QQFA 3ISTA 5CTAA 3DKVA 1CZNA 4GXNA 1JKMA 1I9GA 2CB0A 3OCYA 1OBFO 2FZVA 3KSAC 3IDSA 1KI6A 4C4OA 1KMMA 3Q9NA 4OHVA 4B3SB 7MHTA 4F7WA 1O94A 1Q14A 1Y9AA 5JZ9A 4JROA 1HO3A 3M89A 1WULS 3HB9A 2QW8A 1P33A 2QN9A 3D02A 1RQ2A 4ZO7A 2VSYA 3WL3A 4UOQA 2VRCD 2YXDA 2Z9BA 1RYNA 4BLSA 2NV0A 4NS4A 1P5JA 1OREA 4OMUA 5H4HA 2QLFA 1QIDA 5L3RA 4CQLA 1FTQA 4NCHA 1GNSA 1R6XA 3TQOA 2BUCA 2JKVA 3PHGA 4KVGA 4IVRA 3BHMA 3S1AB 1IDOA 2IIPA 3KSRA 2WYUA 3NORA 3R6GA 1QYVA 1J2UA 1RAFA 4Q4DA 1E8DA 2A1TS 1I3KA 1KYVA 1VMDA 1YR3A 1Z5WA 2OTCA 5BWCA 5CA1B 4EM6A 1Z38A 4CI9A 1T1EA 3FWYA 4MQMA 2GBIA 2Z57A 3P8ZA 5CLQA 4ZGBA 1OAKA 4NU5A 1B2RA 3CZPA 2R5WA 4LHWA 5JWHA 1JZSA 3B1JA 4RV5A 4RVNA 4ZOEA 1F60A 4CCWA 4D9MA 1VMAA 1CUHA 3QA3E 1E6WA 1RKVA 1IHPA 2I3BA 3LY8A 3TTUA 3UAVA 4IXMA 5DP2A 4ZARA 4EA7A 3KQKA 1S7GA 1M73E 4FFSA 3NAZA 1ESEA 1WG8A 1K27A 2HIGA 4XASA 4E5VA 3CUVA 1NQOA 1Q19A 3T9CA 1GSOA 2EBUA 2D5LA 3I83A 3L7IA 3Q5EA 4M0KA 5FEMA 4Q3BA 1M83A 1JHDA 2VJMA 3RKRA 5HJEA 2WJPA 2X2PA 4ZT4A 1CIPA 1S1MA 3HKCA 1H9AA 2Y2UA 3LLSA 3A9SA 1H2YA 3FVVA 1PX0A 1MO4A 3KWMA 1B73A 1NZDA 2P9EA 1AUOA 4LMBA 4PZLA 5IMSA 1C9EA 3G8CA 5JYCA 3JAKA 1PFQA 3V4LA 1O77A 1GRNA 3AIMA 4MR8A 4PR3A 3FYTA 4Q9HA 4DANA 5KTMA 4ENQA 3A3KA 4AP6A 2R00C 3QI2A 3WGJA 1EK0A 2CMFA 4E1VA 4JY7A 4CU5A 2DETA 1EA7A 4O33A 4ZDKA 3L6BA 3TX2A 2PWYA 3FMPB 1K9SA 3HJNA 2PRSA 3B53X 4BLQA 4O2LA 4AN4A 2Z6AA 5DHFA 1Y1LA 3PFKA 4ZQFA 1M2GA 3E0QA 3HNPA 5D00A 3BXPA 4HQFA 2BZSA 3FSGA 3HZHA 1ONPA 2GPYA 3K70B 3N8GA 3BXZA 5KYUB 1RQGA 4YJ3B 2PLNA 1P1HA 3O4VA 4KMMA 1ZUIA 4TMFA 1AN0A 3C6QA 4PN7A 1IM2A 4H6PA 4NQRA 1KORA 5IEBA 3WDLA 4B71A 5BPFA 1P19A 3O8OB 1KFEB 1YB6A 2AF3C 2YJGA 2IYEA 4N5MA 2ONZA 4BL5A 4CXMA 3TOZA 1E92A 1US8B 2QE7A 2NLOA 4MUAA 1NU8A 5FEUA 3D9QX 5AW2A 4H3SA 1KY2A 2GVZC 3JWGA 2A14A 4KPUB 2HNBA 2ZIZA 2E4AA 1E5TA 4BVLA 2IBTA 2OM2A 4GRAA 4PLYA 1ECLA 2E4YA 3PK0A 4P7KA 3FTCA 2WINI 2XHZA 5G0VA 4LYJA 5A04A 4MDYA 3BWBA 4N3AA 4XCXA 2AXNA 4HNQA 1UH5A 4CIDA 2VP6A 4JP1A 2VNKA 4QXRA 5ALLA 3MXTA 4MW4A 4KWEA 4EGAA 4GDFA 1NLUA 3DB2A 2Y1LA 4MMZB 2C00A 2HNKA 5CX1B 3DZ8A 1PP4A 5IC6A 2AC4A 1PQYA 1JDUA 3QBJA 1IBCA 3GJ0A 4RXUA 5HIKA 1N6PA 1Z0KA 5AK4A 2YMMA 4KHPB 5FADA 1Y42X 1NJ1A 5DIZA 2OVBA 1V3VA 3VC7A 5JS1A 1FFCA 2C2XA 5FR1A 3LC0A 3W6PA 2YWDA 1E6CA 3M83A 1KJZA 2C4UA 1RJDA 2Q6KA 1OX4B 4K8RB 1M8FA 5GPBA 4TTSA 3RTBA 4Q1BA 3RSOA 3WLQA 4ZYTA 1GGEA 4A91A 1L7EA 3FMVA 4LXHA 4AX8A 5CBKA 4RKQA 1M5TA 3GGGA 1DFIA 5LOVA 3D3WA 3QQ5A 4DVGA 2A7XA 2BFCB 4ISBA 1UKCA 2I7DA 3IULA 3W05A 1FQOA 1S96A 2J0UB 2QTMA 3LHKA 1P2BA 5D6OA 4LRSB 4DKXA 5ILQA 1LS6A 3VO1A 3OEWA 4B3MB 2FSVC 2GEFA 4XLTA 4QUAA 3UHAA 5LLSA 1JX6A 3JQPA 4WWHA 1KS2A 4CKBB 1L4YA 1UT8A 4N0DA 3CLVA 3BB3A 4V3CA 1DOHA 2WFZA 3DTYA 2EP7A 4JUIA 2C3YA 2QTCA 3I6QA 4PTZA 1NJGA 5IUKC 4ZI7B 2OD9A 1J09A 1NX9A 2JGMA 1XRJA 2RHTA 1U7XA 3DE2X 4N47A 1TK3A 2GSWA 1B16A 2OORC 3SICE 3KBOA 1ZMRA 4DLRA 5HW0A 4MV0A 4FCWA 1FYXA 1EDDA 3UKDA 1EFKA 3HFJA 2AE2A 3ETCA 4X41A 3ZLJA 1EEXB 1PR2A 1U7HA 4W63A 1V16B 2C1EA 3N53A 4JP8A 4KACA 5C34B 3U7EB 1C3VA 5C32A 1D2EA 5MN5A 3QJYA 2HMWA 4L02A 5G3YA 1BMQA 3HC7A 1M6WA 1SOAA 4O4JB 4UCQA 2M1ZA 3LK7A 4G26A 1N77A 1Z12A 3U44B 1O3YA 2WPDA 3HDVA 1KRWA 3AI7A 2HMVA 1CQIB 1A96A 1QAMA 4IIHA 4XX1A 5EGSA 3UUEA 1CR6A 1N9KA 2NXCA 5FTJA 1P2FA 3LQ4A 2GJ9A 2RGXA 4RA6A 2XQVA 2YIJA 4JKOA 4AMUA 3CVOA 4CIBA 1NLFA 3K1AB 1OBCA 4C0LA 1NVDA 1ONOA 1TYZA 1ZLYA 4MO2A 4W99A 4RDCA 1FYVA 1TNDA 1U2RA 3VA7A 3TFWA 3T38A 4BGDA 2E4ZA 3RVPA 4FOLA 4EUFA 4YV1A 3HZZA 4WINA 5KNDA 3IEKA 3GR6A 4YXWD 4WNIA 4LK2A 5DLEA 4QUJA 1WMFA 1FY2A 2ZJAA 3CIFA 4MAFA 3DBLA 1W581 4ESVA 9GPBA 3CPJB 1SIOA 3OWXA 2B0CA 3EVCA 5MFPA 1MAUA 5G1OA 3V4SA 1QP7A 5E95A 1G6HA 2ORED 1EX1A 4H77A 1ZOOA 3OOSA 3AJEA 3BMCB 4BTLA 2HF9A 5AJTA 1L9XA 2G9VA 2B2XA 5C5CA 4P3KA 2J08A 2N75A 4EJ2A 2C4MA 4JI5B 1AKNA 1GL9B 5K0LA 2W6IA 5BSTA 4WOPA 4OHKA 1FDVA 3PC4A 4DA7A 5BO5A 5MGNA 3K05A 1Z4LA 3O9VA 1VHDA 1W5BA 3E81A 4LECA 3HJBA 4UAJA 3SQOA 5KHLB 4XZ3A 1FEZA 3L1JA 4C2BA 3BOSA 4CE6A 1YONA 3QG1A 1NXOA 1OWOA 1U0NA 3S28A 1FNSA 3AKZA 1I1NA 4EQ6B 4ZALA 3ROZA 4D3DA 3VTZA 1C1YA 4KE6A 4L27A 1T3ZA 5DCYA 4XJTA 4LZZA 4L72A 2JFUA 2PMBA 5BUSA 4XYGA 7ADHA 4EBFA 3ER8A 4UDXX 2NW6A 4DNOA 4KFRA 3CHYA 4NBSA 1VCMA 4ANFA 2R8YA 1WUYA 2R86A 3JAWB 3T7SA 3JQFA 1K7YA 1YHNA 4CBVA 4QPNA 1G8YA 1KEZA 3RIMA 4DLLA 4J0QA 4YRTA 1GXSB 1XKLA 5HMLA 1SCNE 3EZYA 3HV0A 3LA6A 1E6UA 3MW8A 4L1KA 3RAPR 4GI7A 1LLQA 1XMJA 1AIPA 4PAWA 4YCAA 5J5CA 1H2HA 4HFRA 4MRVA 1GAEO 3PSAA 5YASA 1NFFA 3R5SA 2B37A 4AULA 3QLVC 2HQSA 4XEUA 3TBHA 5EHQA 1Q12A 4K6FA 5IXYA 1V5GA 4D81A 2ZJYA 3PYLA 4HJXA 1SAYA 3B6MA 3TEFA 4A6PA 3U7GA 3S2YA 5HEKA 1RCFA 3AY0A 1B3RA 3HKEB 1PF7E 3PXDA 1BNCA 3ZWDA 1Z0ZA 3QK7A 1YIDA 5EIBD 5MGBA 2J6BA 3QOFA 1RZ3A 2EBFX 3OCJA 3WLOA 3WADA 3GGOA 1MT3A 2BHLA 3PWKA 4E33A 1F7UA 1YFLA 1V7PC 1SBZA 4NULA 5BV0A 2PD4A 2Q4BA 2QSUA 3ESDA 3CZQA 3GJSA 3PT5A 4OBEA 1VBKA 2PO5A 1SUCA 2GBGA 4RK0A 4XVQA 2NXWA 2FG6C 1SXJD 5I8ZA 1NASA 1G21A 1U0RA 3EPRA 3EY9A 4KH0A 3K0AB 1QZ3A 2B4TO 3ZWBA 3C3EA 1NWHA 4ICIA 1EXVA 1JKIA 3CNBA 4DZTA 3LM8A 4Q1DA 2QL9A 2I22A 3NYWA 4G07A 5FTMA 3ZHYA 5KREA 1DAKA 2PIDA 1LJUA 3ABRB 3SR0A 1M1XB 3HBNA 2AIRA 3O8NA 4C0WA 3DV0B 3CKLA 4S1WA 1C0LA 2IHTA 2B5OA 1C1XA 4KE8A 2GKOA 1T2DA 1G0OA 1GAQA 4PLGA 4B7CA 4IIYA 1XEAA 1NXPA 1F6BA 4RVFA 4V02A 5FBVB 3AKCA 5ED4A 2YBDA 5TPWA 1FDSA 4C87A 1N5LA 3N70A 1NP3A 5EPOA 4MYUA 2C4NA 3HU5A 4FVTA 7AT1A 1J8QA 1KQOA 1Q11A 1Q1NA 2FFJA 3AXTA 2MSWA 4MUNA 3TLGA 1U8YA 2OMEA 3F3KA 1QJCA 4OMCA 2XA2A 3VO8A 1U8FO 4EW3A 1IM5A 1LDBA 2E89A 1KARA 1SBTA 3B7GA 3VR6D 4UEJA 1NR5A 1UFVA 2XNSA 5DNYB 4G56A 4V0RA 1WOYA 1VI6A 3CEMA 2PS9A 2QN3A 3CWCA 3C3MA 2CK3D 3UGKA 1HYBA 3VKFA 3ODPA 5DHTA 4O2BB 4KPFC 3RM3A 3KTAB 4G5XA 2O1XA 3SEQA 2LDBA 4UCFA 2VRNA 4L16A 2RGYA 1DE0A 2O8CB 1Z0JA 3QSYA 2EU8A 1GCAA 3H1AA 3A1TA 4RAOA 2YWHA 3A1SA 1KZ6A 4WLOA 4F46A 1JZQA 5IJWA 1JG6A 1HDRA 2O0HA 4OK3A 5U4XA 4Z8YA 1SQGA 1U1DA 3W6ZA 3DHNA 4QOFA 4Q3LA 4CTJA 4YP5A 3GGCA 4RU1A 1KZ7B 3V42A 4I3FA 3WC4A 4KXXA 3LHSA 5HIJA 3A27A 2FB9A 3ROXA 1SBQA 2BFBA 4LJ9A 3R8XA 4B74A 3D7MA 4TVKA 1GO2A 4GAEA 5I4IA 2ZJ5A 3ZD8A 4I19A 2GFIA 4NEQA 2ZUVA 5AIAA 3P2OA 5DX1A 3LUAA 5C7IO 3EB9A 4QXOA 1J1UA 2ABWA 2R87A 1PT8A 4NR0A 5MF6A 4AVYA 3LYUA 3FCAA 3OJOA 4EHFA 3CCCA 3QXCA 3I23A 4CTKA 1GRVA 4G5RA 2FLKA 1QMGA 4UVGA 4XAQA 3KV3O 5IH7A 4IHAA 3GDGA 2CVHA 3GN2A 2C5AA 1SA0A 2B20A 3KV1A 3UWPA 4A1OA 1ZW1A 2BN4A 3B3GA 4MLDA 1VBNA 2QNIA 5G53C 2BI8A 3K32A 3FNHA 5JO9A 3ZCPA 1THZA 1V9SA 2VYND 2PDAA 2C83A 1LSOA 4H59A 1TZ2A 4BPRA 3CVWA 1JA9A 4H7FA 2FEPA 1JIUA 1H2FA 3QF4A 5AM2A 3NYQA 3OSZA 3O84A 1AN9A 5A9TA 4PCVA 3CEPB 5BV1A 4ZI7F 2L2QA 4GZLA 4BO4A 1D5WA 3PZRA 3IAM1 2G67A 3BJEA 4OQZA 2ZJ0A 3ABSB 3R3YA 4YUVA 5AT1A 4BB9A 4GR5A 3ZHTA 4EEKA 1IRIA 2PUWA 3G9UA 3ORQA 4P08A 4RYLA 3GQBA 1KETA 2OQ2A 2AFHA 4R8LA 1WZIA 5LM3A 2ZDHA 3NRJA 5L8VA 3LX5A 4AB1A 1GZDA 3H2ZA 1Y9ZA 1W2WB 4QT0A 3G88A 4J16A 5FLEX 4F06A 3W9SA 5TT1A 1X7YB 3TQFA 1ZM3A 1OAOA 2JCVA 4O4JF 1KQFA 1QXSA 3TNLA 1XIVA 3NHJA 3U0VA 5KVQA 1GV1A 3O9ZA 5JNUA 2MU1A 1S8OA 1XA3A 1JLSA 1RXWA 3SZ3A 3GZNA 4M54A 1Z2OX 1S7CA 2P69A 2B1JA 1L7AA 3C3XA 1BQEA 5JXJA 5FUMA 2VHXA 4KIJA 1G18A 4EOGA 5JTUA 1MO3A 4FS3A 4C7OB 2ETXA 2IE8A 1JJAA 3C5HA 1JXQA 2Y0DA 1F12A 3PFCA 2C29D 2UVDA 2V9CA 4K46A 4KR9A 5B7GA 1YR6A 4CDMA 5LP1A 4M7RA 4CLDA 2QU7A 3KL4A 3EFBA 4PLWA 2R8BA 1EAYA 4LOKA 1AGXA 3PUWA 1J1ZA 2EC5A 3EVAA 4YCBA 4HT3B 1KAQA 1EFVA 4EHAA 5BYKA 2CBXA 1H0KA 5AJZA 3KLPX 4BLTA 4EUEA 2GM9A 2LIVA 3LDAA 2QMYA 4OYRA 1NJ6A 2JJMA 3ADKA 4J1QA 5LB2A 1EZZA 1I3CA 5L3QB 3CW8X 4YRZA 4WBNA 4B8YA 5AJWA 4EY5A 5BWOA 3ZHCA 2VT6A 3K2BA 1I10A 1VKRA 2FEMA 3DO8A 5EIOA 4KO3S 3UUWA 2B78A 1EVLA 5I9BA 2HQOA 3BGSA 1EFPA 3BRWA 1PR3A 3HUFA 4GD3Q 4ND8B 3ZV4A 5KDDA 1E1QD 3DW3X 1OROA 2FEKA 1XJQA 5HM8A 1Q21A 1LWOA 4AMZA 5IULC 2BMDA 2YVAA 1Y4ZA 4KR6A 1I5OA 4HS9A 4RTRA 1YI1A 3GZJA 3TZKA 1GNRA 4QBTA 2ZIGA 4DQXA 3NXKA 1ZIYA 1DGQA 1C9MA 4KQCA 3ND7A 3UG7A 3H65A 2CWWA 2JGDB 4FHFA 2V3CC 1KZYC 3ZCTA 4DBLE 1U1EA 1QK3A 5LXTF 3T3PB 3JQFC 2XWPA 2OCKA 5E8RA 4JX8A 2O7NA 4NV0A 1GPDG 5FBLB 1VIMA 3LUDA 1G9XA 4OEHA 1X7XB 4MR9A 3BIFA 3GT3A 3FWPA 1JQKA 4MGYR 2EFEB 5EY5B 1G2QA 4JB2A 4UOEA 1K4MA 1CV2A 4V2UA 3VZQA 1RJFA 5U1PA 5DBIA 3EIQA 1EJ6A 4QDJA 4EF6A 3TUJC 4RJLA 4N12A 1JAXA 3HRIA 1PD1A 2L69A 5JATA 2QE6A 1SPXA 1WCV1 2JNWA 4WSOA 2Q2QA 2Q7OE 3ED1A 5AFSA 5CDFE 3VKUA 3RG8A 2UYQA 2X4IA 5J2UF 4YCCA 3M5WA 1U8CB 1KE2A 2YQZA 1KYYA 1RXEA 4GZ5A 3SYRA 1E79D 4ZQGA 1LWNA 2O0JA 3RIEA 4ZWNA 4EFMA 3GEBA 4O5OA 2IHNA 2GRJA 4GQBA 3YASA 1RHJA 3GLFE 1F8UA 4RJ2A 2PL1A 1D6JA 2ZI7A 5TEWA 4MKHA 5FFNA 2XT9A 1XYYA 4Z2AA 1XLTC 5JECA 1AO3A 3M5PA 2P41A 3P19A 1TM4E 4OPMA 4QNNA 3WV5A 4F72A 1SXGA 2OECA 4U2FA 4D92A 4LNUB 1YQQA 3NFRA 4QTZA 4HC4A 4RUKA 1XK7A 2CEKA 2ID9A 4GZMA 1PR1A 2WIBA 4G81A 2REQB 1I1OA 3AEZA 4DMGA 2QXTA 1W4ZA 2ZG6A 4LV8B 1ZQ1A 4E5PA 2NO6A 1E98A 3JSXA 4RPLA 2MYTA 4X3CA 1EVQA 2FF7A 3WO0A 2QQ0A 1J56A 4GNRA 1QVVA 5JWRA 3T1QA 5C5EA 4YRBA 4RFLA 5BY2A 4X1OA 1RT9A 4FMDB 4EPXA 1XALA 3NETA 4IV0A 1LPBB 1C9YA 1CJMA 2V0CA 2G4LA 5JMTA 4U2GA 4LF6B 3S2SA 1H2AS 2YYSA 2AOUB 2ASVA 4FWIB 2DVMA 1L1RA 2C4VA 3CWZA 1JKFA 5C1DA 4D0SA 4ZTUB 1GQOA 4MQEA 5E6UB 4AKIA 4DSTA 4ILKA 2XVYA 5I48A 2LBPA 2XYQA 2DT8A 4S1NA 4JR2A 5LP6C 2XEXA 3L3BA 5T8KC 2ZRCA 4UZSA 4J94A 3C1UA 4DYHA 3NCTA 4LS3A 1I7PA 1R18A 1KRHA 1BEZA 1SC6A 4K9OA 2ZYGA 2OK7A 5K6AC 1HT3A 3X1DA 2PNFA 4HDNA 4TKVB 3AI3A 4BP8A 4J0GA 1M0SA 3L7CA 4IDFA 4OQQA 1V8OA 4NCNA 3IQDB 4AXBA 4B47A 1JHPA 1ZXLA 1I2MA 1MXHA 2PSSA 2PGOA 3OZCA 1UBSB 3R3XA 3T95A 3ZWWA 2VDJA 3GUZA 1U90A 5JPDA 1VRWA 3O03A 3A1DA 1E0DA 2PH7A 3GQVA 3HPRA 4BNWA 2ZI6A 2PPLA 2OAQ1 5LD2B 2AZTA 4XSVA 1T0BA 1XU7A 1WMDA 2QTNA 3ECSA 2F17A 2E87A 1KQNA 1RIFA 1DCTA 4OYYA 3TMYA 3ZU5A 4JC4A 4RD6A 5KYXA 3NOOA 1SXQA 1JQEA 2C3OA 1PZFA 1Y6RA 3FLEA 3MUOA 4AQDA 4BN4A 4CL3A 3GCXA 1H5UA 1YE3A 2WWGA 1QHHB 1KI9A 1Q50A 3BICA 3QEJA 5AUOB 3KZVA 1EJBA 3IKLA 5I7SA 3HMKA 5LQKA 2AMLA 4YJFB 1MUUA 1BKYA 3T5TA 2GERA 2V7QD 4QGHA 3KSBC 2DTEA 4N3NA 1L7RA 3A14A 5GM1A 4GP6A 1K8QA 3OD5A 4F3NA 1ZMXA 4QPCA 1SRQA 3INRA 4OGGA 3LVBA 3OIDA 1Q1QA 2YZKA 3HSYA 1KJWA 1EWRA 2FQXA 4LJ8A 1V8PA 1R12A 4JVSB 4YLEA 4LRUA 4LWOA 4OH1A 3SC6A 5BR4A 1SVSA 1IK6A 4MGEA 4MPPA 4EKIA 3DE4X 4QBKA 3O8RA 2NXNA 1TUBA 2ZGVA 1Q0SA 3EZ7A 1N2HA 4B3RB 3U49A 2QG6A 2B3DA 3RAGA 2EX4A 2BHSA 3NBXX 3OAAA 3KZNA 3ANTA 3V97A 4GLFA 3PFHA 2JFVA 2PUEA 3ZDYB 1ESNA 4B9EA 4MSUA 1LTKA 3UQZA 2OD7A 1ULAA 3F9CA 4M9ZA 1L4UA 1KWKA 1XCMA 1T4CA 3PFFA 7MDHA 2H9YA 1YO6A 4P5DA 3RKSA 1U80A 2ECPA 5DF1A 3ESCA 1ZK0A 1NUTA 1OI2A 4IIXA 5EKTA 5JH7A 4RK6A 2H2FA 2VSQA 1U3GA 4Y1RB 4Y6QA 1E5DA 4GLLA 4HWTA 2BGMA 5E6SA 2WKWA 2ORYA 4D6PA 2IOFK 4YJKA 2XUFA 2JFNA 2YKGA 1MAWA 1YJ8A 1HT1E 2PEYA 3KFLA 1KEUA 2QEQA 2XKJE 1HURA 1SK8A 4ER6A 4HYTA 2WP0A 4H17A 3IAM6 4Z4IA 4GBJA 4LY6A 3X1JA 1SFRA 1V4NA 2YIVX 2H18A 7ABPA 1V1RA 3H1PA 5CDSA 5E7IA 1DTEA 1IU9A 4NRDA 1N7HA 3FOEC 3R