3IB6A

Crystal structure of an uncharacterized protein from listeria monocytogenes serotype 4b
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
179
structure length
179
Chain Sequence
LTHVIWDMGETLNTVPNTRYDHHPLDTYPEVVLRKNAKETLEKVKQLGFKQAILSNTATSDTEVIKRVLTNFGIIDYFDFIYASNSELQPGKMEKPDKTIFDFTLNALQIDKTEAVMVGNTFESDIIGANRAGIHAIWLQNPEVCLQDERLPLVAPPFVIPVWDLADVPEALLLLKKIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of an uncharacterized protein from Listeria monocytogenes serotype 4b
rcsb
source organism Listeria monocytogenes
total genus 59
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ib6A00
4NAVA 3I6BA 3FPSA 5ALDA 1PW5A 2HEGA 5AICA 1ZD3A 4Y2JA 5AW6A 1SWVA 3NASA 4UAVA 1ZJJA 3WK8A 3ESRA 4KNWA 2IOFK 2FPSA 2HF7A 1T9ZA 3I76A 1WPGA 2G08A 2ZBFA 3SF0A 5A3QA 4DWOA 3MN1A 5ALPA 2EAUA 4CNQA 3OCUA 2Q4RA 5ALUA 3QU5A 3I1YA 2IOHA 3OCYA 1YNSA 4Y2YA 1RQNA 2GHQA 2YMMA 5AKKA 1CQZA 2VKQA 3L0CA 4AS3A 2R8YA 1L8LA 2HO4A 4ZEXA 3KD3A 1N8NA 4HAIA 4KN8A 1S8OA 5AKIA 4BNDA 1Z4NA 2PR7A 2JAUA 3FGOA 3K1ZA 3ZWKA 2I33A 5AESA 4HGNA 1Q92A 1Z4PX 4UU0A 4UMVA 1QQ5A 2C4NA 2OBBA 1NF2A 1Z5GA 3A1EA 4RETA 1RQLA 3U19A 2HDOA 1YJ5A 1S2OA 5AVVA 2I7DA 3ONNA 3ZX4A 2O2XA 4JB3A 3NUQA 2B8JA 3DDHA 1T5SA 3EWIA 4Y3UA 3RF6A 2P27A 3EF1A 1TJ3A 5ALXA 3A1DA 1WVIA 3EF0A 2O9JA 1AQ6A 4QJBA 3A3YA 3L8HA 5AI5A 3WKCA 2EATA 1VFPA 2P69A 2YMQA 1VJ5A 5AW5A 3L8GA 2NYVA 2R8ZA 2YY6A 5AW2A 2NO5A 3E84A 4EENA 4XE5A 4UU1A 4OCZA 5AIBA 3L1UA 3ZVLA 2YFYA 4O8CA 4L57A 2P11A 2IYEA 2PKEA 1QQ6A 2YJ6A 4UARA 4UMDA 5ALQA 4YIHA 4CF4A 2FI1A 3ZI4A 3QGMA 3NAMA 5AK5A 3SKXA 3NRJA 2C8LA 3U7GA 1F5SA 5ALMA 3P96A 2ZBDA 1Z5UA 1L7PA 1Z4JA 3WKBA 3KOOA 3M1YA 4YCLA 5AM0A 2B30A 3ZWDA 3ZTYA 5AVYA 3N28A 1U2SA 2YMPA 3FVVA 4KNVA 2JAOA 3ESQA 5AKGA 1KYTA 3QU9A 3OPXA 3WKDA 3N8GA 5AK6A 1L8OA 3TLMA 4C4RA 1J97A 1O08A 3QLEA 4AS2A 3NALA 3ZTWA 4NFLA 3S6JA 3WGVA 2B82A 2YMLA 4Y2PA 4F72A 4YCNA 1MH9A 1L6RA 2BY4A 1O03A 3A1CA 4FE3A 1X42A 2CN1A 3SMVA 3WK4A 3SHQA 5ALZA 3BA6A 2YN4A 2W11A 2OM6A 3R4CA 4KX3A 2HOQA 2ZG6A 3QU2A 2G80A 2OA0A 2JAWA 2HHLA 5IS2A 2GMWA 1Z4OA 5AKJA 3WKEA 3ZW7A 5AM4A 3QNMA 3QUCA 5AI6A 2R8XA 4NABA 1RPZA 4UASA 1L7NA 1ZD2P 5AIAA 3QXGA 3AR9A 5AVQA 5AKLA 5ALSA 3PGLA 1SWWA 2FUCA 2AMYA 2I34A 4YCMA 5ALEA 4G9BA 3N5KA 3DAOA 2HF2A 5AI9A 2ZBEA 4UATA 3F9RA 4KX5A 3WK9A 1Z4KA 3L8FA 2FEAA 2AH5A 5AK3A 1L7MA 4F71A 1ZRMA 4NWIA 4ZEWA 4PNHA 2WF6A 1SU4A 3OCZA 3WK7A 4B6JA 5IT4A 3AR5A 3FPBA 2I54A 3WKAA 4ZEVA 4Y2XA 1RLTA 5AVWA 3I28A 5AW0A 1TE2A 5AVRA 3E8MA 4OFZA 3U26A 3OCWA 1TJ4A 3AR8A 2YJ3A 1QH9A 2PQ0A 4GIBA 4FFDA 4Y2RA 3HLTA 3R09A 1RKUA 3UMBA 3ZX5A 1Y8AA 2ODAA 2FPXA 1XVIA 1RC8A 3CZ4A 4NV0A 5AKXA 2YJ4A 5ALJA 5AM3A 1L7OA 3QYPA 1RMTA 3EPRA 1IWOA 1RMQA 3J7TA 2AGVA 2CFTA 4BNDB 3NANA 4QQFA 2WM8A 5AW1A 3WGUA 5IT0A 1RLOA 2NO4A 3OTQA 3NIWA 2WF7A 4C4SA 5AI4A 1Z4LA 1XP5A 4DFDA 1RRCA 5AHXA 1JUDA 2WF5A 4UM5A 5AW8A 2WHEA 5ALHA 5AKYA 1NNLA 4Y2UA 4IFTA 5FP0A 5AKZA 3M9LA 4BKMA 2G09A 2C9MA 3QU4A 5AI8A 1FEZA 4MWOA 3B9BA 1TA0A 3QUBA 1RKVA 5ALGA 1ZS9A 5AVSA 4XQ0A 1J8DA 3ZUPA 3OCXA 2ZXEA 4EZEA 3UMGA 1VJRA 1WZCA 3MMZA 2G06A 3E58A 5AVTA 2G07A 4EX7A 2YJ5A 2ZBGA 5AKHA 1U7PA 4J2TA 2Q5EA 1Z4QA 2GHTA 2HSZA 2CFRA 5ALLA 3AR6A 2FDRA 4Y2SA 2HCFA 3B8EA 1RDFA 5ALYA 3U7FB 3AR7A 4KYTA 3GYGA 4BX3A 3ZVNA 4EEKA 2I6XA 4I9FA 2AUTA 3R9KA 2RB5A 1XPJA 3AR4A 5AI0A 4AP9A 2YBDA 2C88A 2QLTA 3L0YA 1YMQA 4CF5A 5AW4A 4BX0A 5ALKA 1K1EA 4MUMA 2JARA 3ET5A 3L5KA 4OHFA 2HI0A 4Y2QA 5ALNA 3B9RA 4EX6A 5ALVA 1U7OA 3UMCA 2GFHA 3SLRA 4G63A 3ZU6A 3U7EB 4H1WA 1ZOLA 2P9JA 3L8EA 1RLMA 1QQ7A 5AW9A 1RKQA 2WFAA 3VAYA 2RBKA 3QUQA 3DV9A 4UAUA 1YV9A 2I55A 4UMEA 1NRWA 2RAVA 3SKYA 4HYTA 2OYCA 2B1RA 5E0OA 4BX2A 2B0CA 3DNPA 2B1QA 2X4DA 4Y2VA 5A3SA 2G1AA 3U13A 3W5DA 2FUEA 4HGPA 5AM5A 2BDUA 4EELA 2W43A 1TJ5A 1U2TA 2HX1A 2MSNA 1Z4MA 2ZOSA 3MC1A 5JJBA 4J03A 5T41A 1RMYA 2FPUA 5AKEA 2QYHA 4C4TA 2IA5A 3IRUA 3KZXA 1U02A 2G0AA 3WK5A 1Z4IA 4FYPA 5AVXA 3W5BA 1LVHA 3KDPA 1EK2A 4IG4A 3D6JA 2C8KA 4YH1A 1ZD5A 3W5AA 4I9GA 3L0BA 2GO7A 3MPOA 4UM7A 2WF8A 4Y2TA 3QX7A 5AK4A 4HGOA 4JDPA 2RARA 1Z88A 4L6AA 5AVUA 3U7HB 3QUTA 3FZQA 1Q91A 1T5TA 3HYCA 1N9KA 3IB6A 2B8EA 1YS9A 3PDWA 4CE6A 4XPZA 4CF3A 5A3RA 4BEWA 4E88A 2Q4TA 4BBJA 3CNHA 4YIKA 2WF9A 1LTQA 1WR8A 4YGYA 2D2VA 4HGRA 5ALFA 3QU7A 3KBBA 4DCCA 3AR3A 2R8EA 1QYIA 2CFSA 5ALIA 3RFUA 5AW3A 4XOUA 4UMFA 2FPRA 3W5CA 3OCVA 3N07A 1ZD4A 4L6CA 2BDEA 2EARA 3ED5A 5AM1A 4DW8A 5AM2A 3ET4A 3AR2A 5ALOA 2W4MA 1ZRNA 3SD7A 2FPWA 3IJ5A 3ZVMA 3KC2A 4BEVA 2DQSA 3PGVA 3L7YA 5ALWA 3WK6A 4OD0A 3BWVA 4RESA 1EK1A 5AVZA 2MU1A 1YDFA 3L1VA 5ALTA 3N1UA 2IOFA 3E81A 4GXTA 4UW9A 3UM9A 4HGQA 3PCTA 5ALRA 4BYGA 3FM9A 5AW7A 2JGAA 1CR6A
chains in the Genus database with same CATH superfamily
4WZAA 4YRZA 4ETMA 1V2GA 3MWFA 1CUJA 4FDTA 1L7XA 4JCCA 3O4RA 7REQB 2W93A 4YUXA 1XOIA 1X77A 4RVDA 4UVDA 2I8LA 3NI2A 1G3RA 4KNWA 3JARB 2Q1SA 2Z1DA 3VR4A 4UHDA 1XTTA 1H85A 3H7AA 2Z5LA 1W2GA 1OFUA 2R7NA 2LZ0A 4PNPA 4YP7A 2XZTA 3ROPA 1QYCA 2XKKA 1UKYA 4NU8X 4C0BA 5LQNA 3EW7A 1NJSA 3KV1A 1PGOA 4IDBA 1DC8A 3JVDA 4R8VA 4UCXA 3EG5A 3WGNA 5EZYA 1Z2AA 3G17A 4G8JA 4PHFA 4ZYWA 2O5CA 1RD4A 3R1IA 1N2XA 2E3JA 4PSDA 1BD3A 4URVR 2R5WA 5BVHB 4PLVA 5HK9A 4DDWA 4NU0A 3D3NA 4BVHA 7GPBA 3HGQA 1ETUA 2XHEA 3AUUA 1L7AA 1PJBA 3I6MA 2DT8A 1I4WA 4PG4A 3UFBA 4Z5XA 2BYTA 2FXVA 2OO7A 4CTJA 5I4BA 2XCLA 1N8NA 4FHZA 1CUGA 1T1JA 3A4NA 1HTWA 2VI5A 1WXDA 4KXVA 5F52A 3UAYA 2Z30A 4KKXB 5BQ3A 5IBCA 1DARA 2HU7A 2YINC 2RKBA 5AESA 5IXSA 4NL4H 2BFDA 3FIJA 4OEHA 4DLPA 3BAZA 3H4IA 5L3SB 4ZZIA 1GTSA 2ZETA 3G5UA 1C8VB 1SUSA 5LZ9A 2AOXA 4K6MA 1P9WA 1H2WA 1KGSA 4RETA 3UCFA 2BHTA 4ZREA 1T6BY 1Y3IA 5C7OO 3G2JA 1KI8A 3LUKA 4CLEA 4KACA 3UBMA 1X7YA 4ER3A 4YPVA 4RSGA 4HLQB 2P30A 3GF4A 3JZMA 2OV6A 4FDLA 1TM1E 1T5SA 3LO5A 4N12A 5D00A 1GPJA 1E9FA 3D9QX 4AN1A 4J2OA 1EGAA 3FNRA 4RHCA 3KRTA 3FCAA 2PWPA 4WERA 3C3PA 1JT9A 1NA5A 2JBAA 1F4LA 4IEIA 3ULKA 1A4RA 5C35A 2OZEA 1YTLA 1FSFA 5TT0A 3TW8A 1UDWA 2XYQA 2IWRA 1T8TA 1VMKA 4MARA 1SOMA 1V37A 2QMZA 4JC5A 4FCTA 4LXXA 2YR0A 4EENA 3HR8A 3U60B 3U4DA 2WG2A 5TVKA 2B4TO 2II6A 1GZHB 5IDVA 2NVBA 3V80A 3TDMA 3OQJA 4LNUB 3UQYS 4P0PB 1SKQA 2DWQA 1ORDA 4CV3A 4YI5A 3LVBA 1W5BA 3L6OO 1L5SA 2IKQA 2LE0A 2JFWA 3HE3A 3U4IA 3WL4A 3ISVA 5BSGA 1ZEMA 2FW9A 4JUIA 4BQPA 4PYOA 5JCOA 2DUUA 3NGMA 2DF8A 3P97A 5GTDA 2HSJA 3K70D 3FMOB 2H1WA 3PR2B 4O4HB 4OLFA 3FCSB 1W59A 1KARA 2KB0A 1JG7A 4X66B 3M5WA 4B48A 3S2ZA 4YXWD 3ZE0B 3GCXA 4OP1A 4KE6A 3AM3A 1XU9A 2PH7A 3GCGA 3UV7A 4GMHA 4PAWA 4WZZA 3ZDFA 2YY7A 2E55A 4BPRA 5I47A 1RPTA 5FL7A 2F00A 2AOUB 1S01A 2ORED 1XV5A 1KYTA 1XFAA 1OKKA 1KMHA 3BE4A 1YR1A 2H2IA 3GZNA 2X86A 4ZU1X 5BR4A 3S5JA 5AK6A 4AWAA 4P0QB 2QGFA 2EL9A 3AJEA 3H6KA 3QBEA 1FTNA 5JEEA 2BMAA 3CKMA 3F2VA 2HJWA 3NDJA 5BYBA 1RSZA 4B34A 1E2HA 1O08A 2CEAA 3F8TA 5EHNA 2V1XA 1OJLA 4KRYA 4Q4AB 4EHBA 4XA8A 2PSFA 5A4DA 1FP1D 3MJ4A 4FI3C 1O97C 4AS2A 2HT1A 3IC5A 4TTIA 4YB8A 5CNKA 4IEFB 2PCLA 5CT9A 2R6AA 1FB5A 3VPBA 3CLKA 1KAOA 1N0IA 1YHNA 4GWLA 2DCUA 1CRWG 4NF2A 4CCWA 2QDKA 1Z22A 2EP7A 2ZJBA 5K8IA 2HNAA 1YA8A 2R1TA 4PZLA 3A6PC 4Y2PA 3F98A 3GGPA 5GIPE 3OC0A 4JVMA 4PR0A 3RR2A 1RBYA 5JZMA 2ZSDA 1MH9A 3IURA 2W9XA 3LXXA 3HU3A 4CLOA 1OC2A 1YA4A 3IQIX 2VCYA 4M9RA 3UPUA 2IS2A 5CM8B 2C7QA 1DU4A 1TCBA 3IDFA 1Z26A 2WYWA 4MQMA 3GEHA 4TKZA 4YHHB 2YN4A 2X8BA 4P82A 3ZJUA 1T24A 3A25A 5K09A 1CEQA 2ZIZA 2ZG6A 4WLUA 4WV3A 1NHGA 2WBLC 3QU2A 5EXTA 3VVCA 1RE0A 4EG3A 5JOQA 3JWEA 1TM7E 2GMWA 3DZCA 2QQEA 3FKSA 3PT5A 2XUIA 3FSGD 2YNMC 3G0GA 3ZBTA 3V4RA 2OHHA 4JLDA 1VHQA 1TZJA 4GQIA 1BW9B 2NZ8A 3A3NA 4A27A 1PQYA 5BSTA 5JNVA 5MN5A 4UPDA 5AVQA 3N70A 4Z4IA 1UJ6A 2B20A 1OXKB 5TV2A 3QPBA 2AMYA 4OIMA 3GRKA 3T4EA 3JAMA 1IPFA 4MW5A 1VBMA 3EGCA 1FDUA 2AXNA 4MVJG 2UYYA 1NI3A 3NAQA 3QPAA 2XT9A 5FKJA 1EP9A 5JHHB 2DETA 4F56A 2CMHA 5KNCD 3QPDA 2VJKA 3UT6A 5KMGB 1MPTA 2ATIA 2DJ5A 2R6ZA 4QUDA 3RBAA 4HVCA 3RABA 3KLNA 1PLJA 1Z4KA 4FOSA 4MUYA 1KYWA 3G8DA 1MBZA 2Q3MA 4X60A 1BJRE 4GLOA 4IIFA 3TZLA 4DUPA 3W5UA 2VT6A 4AZVA 4UQPA 3LUGA 3GX1A 3GUHA 3O95A 1KI6A 2Q5CA 3DDZX 2OBLA 2WF6A 1FFWA 4CEIB 3U49A 4J1TA 1P5HA 2W6IA 3HCOA 4OATA 1UBNA 1QH8B 1Y1LA 1Z16A 1E59A 3FPBA 5F2EA 1ZJ5A 3D8RA 2F62A 4BO1A 3MG9A 1TYBE 4TKLA 1W88A 1HBJA 1W36B 1DEOA 2IPMA 1E2UA 1OZHA 3LQ4A 2JFHA 2PFSA 4G01B 1TVCA 3THOA 1A77A 4R8RA 4ZAZA 2R96A 2J3QA 1ZYUA 1VE1A 3LDAA 3GNLA 1D6NA 3TIXB 4MWSA 2YYZA 4RYDA 3E6AA 4R7GA 4DCTA 2B1GA 1YRQA 2XVXA 1I7LA 3H9CA 3L4BC 4MQBA 3WLPA 1PR3A 3WJ2A 4XYLA 5K2MA 3R3WA 1QX3A 3NJ4A 4WN9A 3OQMA 5H3CA 3AF2A 3WGZA 3KT3A 4C4AA 4N40A 2HMWA 2WSSA 1LJLA 4PQYA 4I1UA 2OCDA 1EUQA 5B58T 2B8NA 1DHRA 4LDNA 1HETA 3GQBA 1G8FA 4EB3A 4JLWA 4Y6LA 2WVAA 4AULA 1E3IA 1ZW6A 4HWSA 2PSJA 3W5JA 5B6IA 5KTRA 3BQMB 3CKKA 2Z8YM 3IEPA 1L7OA 4NBRA 4A03A 4MKRA 4ASUA 2NO7A 1TUEA 5I9IA 5L53A 4F6RB 2H2FA 1SB9A 5I5GA 3E03A 1R12A 4XYGA 5AW1A 1SMKA 3IR6A 2CCGA 2I76A 2W6JD 1PWYE 1DPGA 2EBWA 3IT1A 4K1LA 4HB0A 2X0DA 2V7XA 1SCQA 2CZQA 3ADBA 1KXJA 2GILA 2YOGA 1H1LA 4EPRA 1VSBA 2PMCA 4IF4A 3F96A 2WIFA 2WKQA 5TDHA 2WF5A 3C6YA 3UV6A 1H2YA 3VH2A 1Q0PA 3A9WA 1Z5WA 1ZM4A 4FJ1A 1T2CA 5AKZA 1E4EA 4BKMA 4CIVA 2L42A 3KB6A 4C4ZA 3OY7A 3QOXA 4JR0A 4RTMA 1E0SA 2X8AA 3B9BA 4L2IB 5TVGA 3P5SA 1MQAA 4YCCA 2A3NA 1HYHA 1W96A 2Y1KA 3HVJA 4QEKA 4US1R 5ITWA 1JJ7A 1E6UA 1UIRA 1EX7A 4I9UA 2JCVA 1LBIA 4AZ0A 4C7BA 1Q19A 5B37A 1SUWA 5L3VA 2FF5A 2HWWA 4GM4A 3V4SA 3WLEA 2G07A 4ZHQA 1J21A 3C7CB 5KWSA 4PX3A 2X2OA 1U7DA 3TCKA 3G0DA 4FVTA 3ZWVA 1DOHA 1XO1A 2C9CA 3Q10A 5H80A 2XMSA 1VL0A 4PX9A 4OHCA 2FEKA 3ITKA 1G0NA 4P38A 3P20A 1FJHA 1ZAKA 1KFCB 3ETCA 4EH1A 3UJNA 1ODIA 2C3YA 1B16A 3CUYA 2VNAA 3FCYA 1Z33A 2QA5A 1G63A 1YONA 3IJPA 1GHTA 4QTUB 2DWOA 2OGTA 1EXWA 3OCCA 2O07A 3RNOA 2EZ9A 2QAIA 2XB6A 3BEDA 2MSDB 5HTKA 4QNRA 3AR4A 1T15A 2PMFA 3FMPB 3OWXA 4UXJA 5BN5B 4G5OA 2QLTA 4QOIA 1JDUA 1E7WA 4LAFA 3SHOA 2GJAA 1PJ2A 4F9FA 1CZNA 1UWLA 1QU2A 1L4BA 1UDAA 2PFGA 4H4DA 2XD4A 4ESHA 3LIPA 4YJHA 2X1HA 3JWIA 4OP2A 1NW3A 3SNHA 2UAGA 5BW6B 4JI7B 1E79A 2E48A 2ON6A 5I45A 2XMCA 4M54A 2B34A 1EPUA 3K15A 1PW7A 3MIZA 1G8MA 1C30B 5EMKA 4FUQA 1YS7A 3SZRA 2AG6A 2X5JO 3PXUA 4BKPA 3ZHVA 4LMRA 1JQ5A 1Z62A 3O03A 3V7UA 4DADA 3EPPA 5LJIA 1X7HA 2HYIC 5BXYA 4MI3A 5FFNA 4L0DA 4AS1A 1NRWA 5KJFA 3PBKA 3RC9A 5A62A 1RI4A 1FDSA 2Q6LA 1ZAYA 1A04A 4JJAA 1OZGA 3OZEA 3ZN2A 3ZWNA 3O8RA 3V5NA 4GM1A 1E1NA 1DXOA 2JEZA 2R25B 3IMCA 2Y0EA 3OQBA 1TK2A 1FQWA 3PQ6A 8ADHA 3U39A 1PL0A 3TUZC 2EIXA 2ASVA 5JC8A 3O82A 2IY9A 3MB5A 4TX1A 2OXCA 1W6RA 3WP0A 3OTOB 2KE5A 1EJ0A 1T25A 4MPPA 2DULA 5F1PA 1ZU5A 2FUEA 1ZDMA 2HA5A 3KCNA 4ZC8A 4BQFA 1VLVA 2BF7A 2YV1A 1PCXA 1G2PA 5HUHA 5P8WA 1PLKA 5CYGA 4E5VA 4MV8A 1F7VA 1C9MA 3P52A 4M9XA 4V0NA 4O2RA 3PFIA 1P9NA 3QX9A 1ZM2A 3MC1A 5CLQA 2XWJI 5EMNA 3TTWA 3LPAA 2O0LA 1RVDA 1SUAA 3QVUA 4NS1A 2Z3VA 2ECKA 2GBCA 2Q29A 3HXPA 3GLQA 4RZ2A 5BSVA 1Y63A 2C92A 2C98A 4HEA6 4HTAA 3FPLA 3L0OA 4S2UA 5AT1A 4OMDA 1I2MA 1ULSA 5BUCA 3OSUA 5MN6A 1HDZA 1K7FB 2E4UA 1HX7A 3GXOA 4E2YA 4IGAA 1A5SB 3ZZMA 1VCHA 1DV2A 3BYZA 1ISGA 4ITUA 3I58A 5HIJA 4XB1A 2RK3A 2R85A 3SJZA 1UFOA 4LJ4A 2D5IA 4IXNA 2X9GA 4XQCA 3ZDXB 4AG6A 3UG7A 5DYYA 4XR9A 3FE2A 1C1YA 3ICQB 4GZ3A 3VHLB 4B76A 1YUNA 1ESNA 1VA4A 4K1XA 4CI0B 2C61A 1SBNE 2JHCA 2VH5R 3OM9A 3T1VA 4I1VA 1Q83A 1XZQA 1Q16A 4BKQA 4HWTA 3IAS1 1MMFB 1Z2PX 1P0CA 2TSYB 1WSWA 3BE6A 3W8RA 2CNLA 5CA0A 3GARA 4OHXA 2H2AA 4LZJA 2ZI9A 3IO3A 2XEDA 1I3KA 4R2XA 4IZIA 2R6R1 5D2CA 3WGOA 3ZZ1A 3J80A 1YS2X 3V97A 3ORSA 1QGOA 2ZBQA 3FHTA 2J09A 3NIGB 5B4TA 1B14A 2QN8A 4JJ8A 3CRVA 2Q27A 3D5EA 3L6CA 4MYCA 4PIVA 3UOWA 2VQSA 1XELA 1BXGB 1RHMA 1HLFA 3R6GA 3GT0A 2YWGA 2O7NA 4MHOA 1EBFA 4P36A 3SDZA 1HG1A 1NQUA 5LB2A 4B2YA 4WQMA 3A27A 5ERGB 2I1QA 3Q2KA 4IOKA 4KLNA 2VDWA 1ORWA 3EXHB 4P8RA 1E3DA 2WKPA 5IAAA 5KYKA 3ESBA 1QO0A 4ARVA 3DZ8A 1SU8A 3U7QB 4JP2A 3GR6A 3B53X 4X95A 4N65A 2QSYA 4YJFA 1ZD9A 4L9WA 1BKYA 1VI5A 1ZRNA 2HA4A 3BJIC 3FAZA 4C5CA 1MV5A 1UAYA 4BRZA 1GZUA 5IG2A 3IJ5A 2X3YA 3DEAA 3RVRA 3UNXA 3DM5A 1NP6A 4KO3S 5TNXA 4CTOA 4CM3A 3LP5A 4O4JA 4Z4GA 4R9UC 4UE2A 4TLBA 4ENRA 1J0AA 2MU1A 4DLYA 1KF0A 1PD1A 1E66A 5L3ZA 3OJXA 3IDQA 5KX5B 3H05A 4RV9A 4AJ1A 2VH1A 1Y3DE 3CSUA 3P45A 2OR3A 4BDSA 4IDCA 1Z9BA 3GZTB 1SQ5A 3VPFA 1IVNA 1DAMA 1P73A 4FR5A 3FM9A 2NX2A 4LHXA 2GRAA 5AW7A 2WAXA 1VIAA 3DFUA 3L6EA 3EGOA 3OEED 3Q11A 3EXFB 3A58B 1UEXC 5FLKA 3KZMA 5A9SA 1OB5A 3HJNA 3MFQA 3REGA 3DEKA 4GP9A 1PYGA 4D6XA 5B6JA 1KVRA 2NQ8A 4PNEA 2MJLA 2Z4TA 3B6EA 2CEKA 4CJXA 3LP6A 3UENA 5BMVA 1Q7RA 4WXMA 5H4HA 3HPRA 3BWXA 1FXWF 2XWPA 2G08A 4LZLA 3QPUA 1HSZA 1DFGA 3NTXA 4IHAA 3TB4A 3HKDB 3ENQA 1R6VA 1C7QA 1K66A 5IBRA 1OBOA 3P0HA 2RGEA 5SV2A 4EA8A 3OCYA 1W48A 4Y30A 5FUVA 2JGIA 5ECGC 3BCSA 3E9QA 1LQUA 1JIIA 2DLNA 4AS3A 4TV8F 1ZKDA 3E05A 1LC0A 3HFSA 1JHZA 3PR3A 4QDXA 2DLDA 3AUJB 4QOHA 4ZEXA 4H1UA 3G85A 2R44A 2O05A 3R40A 5EWLB 1FJ2A 4KN8A 1JDNA 1KC1A 3GFGA 1JAIA 1IJBA 1S8OA 4HN4B 5AKIA 3TINA 5DEOA 4BJ5A 4JBIA 4MVJA 4GG1A 4Z86A 2ESRA 3MWDA 1KI3A 4BNNA 1TM2A 4PLCA 2GESA 4RIHA 4C3ZA 4KFTA 1SBHA 3RJ5A 3MEQA 3LCMA 2PLRA 4V03A 4WPGA 1U80A 4I3FA 1L9XA 1F2UA 1YWGO 4GI5A 3U19A 5H81A 1XK6A 2J7KA 4F60A 4IFBA 1YNOA 3JX9A 2PN1A 2VKTA 2VRWA 4DREA 4FMDF 1E96A 3SHTA 2XXJA 5KAMA 5TEWA 1X87A 3VVBA 5HOQA 2B8JA 3E53A 2KQUA 4Y6GB 3PQ8A 3MAGA 4AK9A 5LOVB 1G5HA 1IHXA 1WKBA 4PQFA 5JS7A 1P5RA 4LPSA 2I99A 1TADA 4EW1A 1MEJA 3P9KA 2P6NA 4AKHA 5ELXA 4CV0A 1L5KA 4NHOA 3GBVA 4Q6WA 3WFJA 1C9DB 5E38A 1FLAA 4BO3A 3LHKA 3QQPA 2H54A 1MX5A 3IDZA 1ZCJA 4TS4A 2JLUA 5IWAB 2BC9A 2OLJA 4A4DA 2H9AA 2YFYA 4F4JA 4UQOA 5KNBH 3RYCA 3KQNA 5AR1A 2WV7A 1SCUB 4TZ0A 2C4KA 4IUBS 2IYEA 3S2SA 1DJNA 1QQ6A 2YJ6A 4M1MA 3DKKA 3KWFA 1HDCA 2IWHA 4IHQA 3X3HA 5ILGA 2XYVA 4LQDA 4JT8A 1C0LA 3EJ6A 2OESA 2BGKA 1CDDA 2QNBA 3OZDA 1E1YA 2D13A 4LQCA 3N9IA 3RVJA 1QHHB 2IXDA 1EESA 1MORA 2WPDA 2XMQA 1SHLA 2C78A 3BREA 2W42A 3Q7SA 1XAGA 1UXKA 2MIIA 3OSZA 2HCTA 5KKCA 1KYZA 1RIIA 1W0JA 4IHJF 1UKEA 5JNSA 4GI3A 2ZAIA 1I8TA 1UAGA 3CQ9A 4GL4A 4Y2GA 1RP1A 1C50A 1PR6A 1HZJA 1V8OA 2XKBA 2HEIA 2IK8A 1JVNA 4BC0A 4XVCA 5A0FA 3KQKA 5KSOA 2YMPA 4Z99A 1WLSA 5HKKA 2I67A 3F4BA 1RWOA 5FBZA 3PIDA 1L4GA 4DLUA 1N0UA 4HMOA 3VO2A 2ORWA 4X97A 5I51A 1EBBA 1KSFX 1TT5B 1QH1B 4EKGA 2DGDA 1D1SA 5DCUA 5SYMA 4LHVA 3CWQA 2ZYTX 1OLSA 2PIAA 2OV8A 4L08A 1T1GA 2H48A 4KQEA 7YASA 3M3PA 1R50A 4Y7DA 1JPVA 3O1IC 4LZNA 1H6BA 1DZIA 1FU4A 1K8ZB 3B7PA 4DSZA 2VR1A 3HO8A 3N8IA 1EP2B 3H1PA 3KJGA 3COSA 5CDFA 2C7RA 4WZAE 4NV3A 4Q0MA 2OGUA 2XSZD 1YGPA 3HXKA 3S6JA 1KJZA 1ULUA 4LF6B 5JLJA 5K3FA 1GVHA 1MTZA 3KOYA 4GW3A 4TQAA 1JEYB 4NTZA 2DT5A 3S4YA 4QYSA 1C4OA 2YMLA 1SD5A 2C2YA 2OUKA 3IA2A 3I01M 3WGMA 4C04A 3EDYA 1N2BA 3FUTA 2JCGA 3C7AA 4OM8A 4DR6B 3LC1O 4K2AA 2B1JA 4TLDA 1YHZA 1T34A 5JSZA 3LVRE 4M9SA 1MG5A 2EQAA 4FCVA 4JXKA 4Y6RA 1JWBB 3T99A 3GUVA 3SHQA 5IM4A 4M2LA 2B8TA 2HLDA 1TGYA 1KRWA 4BRSA 3RSZA 3LG2A 3RANA 4M1YA 2OO3A 3ZCTA 4DEXA 1YRAA 1L4YA 3X1YA 3WNDA 4KR3A 3EDOA 4Q7EA 1PWZA 3E4DA 3HCCA 2G80A 4HRYA 3IUYA 1F60A 4CKBA 3PHHA 3FTDA 3QI2A 4BLOA 3ZD7A 4NNPA 3DOEA 2QLMA 3RBXA 3VUFA 5JAQA 2NG1A 4QEZA 3ICWA 5KHAA 3MSCA 1JFFB 1Z68A 1SUDA 3G2LA 3UHJA 3OKCA 4GL2A 3DQZA 5AIAA 1ECFA 5SZJA 1JAYA 5HM8A 4D9JA 4PYQA 2A58A 5CCBA 1R4MB 4KVGA 1O5TA 1O95C 1XXLA 2I34A 4FUTA 5FQOA 3T5AA 3N2KA 3AB7A 2CL7X 4H08A 3MINB 1AIPA 4PO8A 4HDKA 3BRCA 3SZMA 1Z82A 2CJFA 5G1NA 3NNDA 1ULBA 4RH3A 4UJ3A 1CBUA 1M8KA 2O2YA 5UKDA 4C0KA 5C4IA 2I9KA 3DBLA 3GOHA 1V9SA 1ZWLA 2FYTA 2PE5A 2IVZA 4TN5A 5LN1A 2NU6A 2G88A 1TAHA 1H6AA 1P4AA 1D9XA 2GK3A 2Z58A 2FEAA 2ZFUA 4FFSA 4IIGA 3NTLA 4DXDA 2FPPA 2XUPA 4DV2B 2Q1TA 3RWMB 4UPEA 1UZMA 1M2JA 4UCWA 1EBUA 1ZK2A 4GBGA 4K6FA 4QATA 4UXIA 1NM5C 2QVLA 3N87A 1ODJA 4Z9BA 2I54A 4URXR 3CNOA 4NYJQ 1OU0A 1W9HA 1DKUA 1YIAA 1I5OA 2A4MA 3H2SA 3TPZA 5F5NA 1WCIB 1H5NA 3FI0A 3RU9A 4YJ3A 1QIEA 1IQPA 3AHEA 1P3DA 2HREA 5EL0A 3W78A 3HA2A 5JJCA 3QVXA 5K99A 5HTOA 1PS8A 4HQLA 4EWLA 1JI3A 1W4BA 5J5AA 1JSZA 1H0RA 1S1MA 1M1NB 2YJ3A 4XIYA 4F91B 1Z7WA 3VHRA 3R9XA 1ONSA 2XX3A 3HABA 3SR4A 3UJ8A 5FDFA 2D5AA 3H9JA 5BN3B 1TZ2A 2CB9A 5CDHA 3T94A 3IVXA 1VG1A 4BFTA 4D3YA 4D7AA 4BXOA 2YYYA 1IM5A 1WSBA 1NVVR 3DFIA 3EZ7A 3JQQA 4M21A 4BRUA 4EDHA 5HRCA 1DAPA 1IONA 1GNSA 1GU7A 3NWBA 4R69A 1RBQA 3K73O 3IVAA 2FPXA 4M83A 3WO0A 3W9YA 3B5IA 1DOAA 2ACWA 4MULA 1L1EA 1R16A 2HRCA 4LOJA 5TPZD 3UJ9A 3ZIAD 2C57A 2FR8A 4A23A 4DIFA 2EQ5A 2WHPA 1QS0A 3M4NA 3L7BA 4RLFA 1V96A 2VJBA 1V5EA 2P3SA 2Y68A 1RMQA 2I78A 3SJCA 3TO5A 4BP8A 4EI2A 5BV7A 3W5DA 2B4KA 5C46F 2VNKA 5BSMA 2XH8A 3U44A 1RZRD 4N41A 5KYTA 2GT1A 3V7YA 1YZ3A 2X2PA 3RFTA 3BSFA 3DQPA 4PS0A 5FR1A 3WMEA 4DR2B 3MZ0A 4D0LB 3VNUA 3ZV7A 3K9WA 4J8PA 5EIBD 4ND3A 4YN3A 3R3ZA 4HNSA 5HDQA 2JBHA 1D0VA 1EVEA 4H7KA 4UM5A 5CURA 3EVGA 3GLGB 1PKEA 3SQLA 5IWCA 3DH0A 3FWPA 5F9FA 2CXHA 1AK9A 1K27A 2HUNA 1RJ9B 4BX9A 5CBPA 4KR9A 2AJBA 1JJBA 2CXUA 1T8RA 1M5RA 2J0UB 4K03A 4R2LA 4JSTA 4ZV9A 1GQQA 2XODA 5JE8A 4DA0A 3E3OA 3MUFA 4EPVA 3HZRA 5IUNC 3OCXA 1KYXA 1TQ2A 3NATA 2UVDA 2FRVA 3V6MA 1MAUA 1GRQA 3WV5A 1HLDA 2QR2A 3WNVA 3CM0A 4GOMD 2BFCB 5K0ZA 4RA6A 4US0R 4OJYA 3WIEA 2C7PA 4KDFA 3AF0A 5AKHA 2WG1A 5EXXA 3N5CA 2DFPA 4J2TA 1GGHA 4DSUA 1KP3A 2XECA 3FMIA 1OT5A 1AS0A 2G82A 4O4IB 4RKYA 1C3XA 2GHTA 3E27A 3DM9B 2HFJA 2C0QA 1MPXA 3K4PA 1YR9A 3GLSA 4X7MA 1DJLA 4GPAA 1VPVA 4KC0A 4QTTB 3UJ3X 1NXSA 2FMHA 2FGJA 3D31A 3DCIA 3K0FB 4CM8A 3VR2D 2A30A 4XSVA 1WWKA 1E61A 3A70A 2WWFA 1EINA 2RH5A 1YR3A 1JEAA 2PUVA 1EGMB 1GPMA 5TR9A 2G1PA 3CF6R 5FYDA 5LZ7A 2V4ZA 4CQMA 1U2ZA 3LKDA 1F17A 1B41A 2VTEA 1NXQA 3GH3A 3SDBA 4KBYA 721PA 3KELA 4YO8A 3DF9A 3K94A 4Y2QA 3S40A 3B9RA 5GZ1A 3PHGA 3ECAA 3NPAA 3IKVA 4CKYA 1I3NA 1QPZA 2ASEA 1NLMA 1V35A 1VG8A 1GFWA 1OAOC 3IUEA 3TMYA 3LDHA 4H1WA 4KMOA 1DX4A 5M29A 2OPHA 4J3JA 2JCBA 2X58A 4X9XA 1RLMA 3RM3A 4GXQA 2R7KA 3A9SA 3ZY2A 4BLRA 1XMVA 4R16A 2CLMB 1TNDA 1QB8A 1DADA 1KBZA 3TXXA 2M2IA 2W90A 1EXDA 3QUQA 1K68A 5KVCA 4OXQA 3AV3A 3NUGA 1JA1A 3IPXA 2NU8B 1DAHA 1E3JA 5IC5A 3SKYA 1VI2A 4XZ3A 4AM8A 1UQRA 2P9YA 5BV1A 1Z2EA 4YV1A 1BN6A 2H7VA 5E0OA 1OFVA 2V7QA 1QBKC 1HFKA 2P41A 3NWJA 1PGQA 1XVTA 2A5FA 3U13A 3DXXA 3HNRA 1AMOA 2B6HA 1LBEA 2XITA 1AUPA 3AY0A 3GFVA 1OXTA 3OIGA 3P0RA 4LJ9A 3GJ3A 4PLPA 3E22A 3PSAA 4BQRA 2GZMA 2P77A 2YXDA 1CULC 3BMCA 3Q6IA 4LBYA 3WLLA 5KOIA 1ZKMA 2YVQA 2FWMX 3L6BA 5LYYA 1G7TA 1OA1A 3K6JA 5IHPA 3OETA 2HNKA 2JLBA 1YOVB 2IE8A 4ZIRB 4V24A 4FNOA 4HXGA 4OV6B 4LJSA 1UBJS 2K7FA 3PNKA 1BE1A 1KSHA 5JD3A 1N4AA 3STVA 2WJPA 3JD0A 4AI6A 4S3MA 2G0AA 3DDSA 2OBYA 2P2DA 1NE2A 2VHQA 5TGTA 1YBAA 4MLPA 4URHA 2JGMA 4JP8A 3ZY3A 1SC1A 4DB2A 3K4HA 3LGSA 4RMNA 4TWJA 2G9VA 5BV0A 1DMSA 1KEWA 3NOOA 5U4QA 1K06A 2VYQA 1HZZA 1OQAA 4BZPA 1PT5A 2O23A 2OCXA 3P2OA 3UICA 4CL2A 2A5GA 4OF4A 5ICEA 5FO1A 1KNXA 5EJ4A 2QPOA 2R2AA 2EZ8A 5CDUA 3U7HB 1U7HA 5DCLA 4Q15A 4AQ7A 1SNYA 1CQIB 4ABYA 1ZA2A 4HLUC 5K0CA 2CYCA 4Y1FA 5F4ZA 3IB6A 5JTUA 1FSPA 2B8EA 3CZPA 4KWHA 3ZXXA 1ES9A 3EMDA 2DCMA 2G6BA 3DE5X 1U9ZA 3IXLA 3NHKA 3DTVA 1J5XA 3UTDA 3KTDA 1CE8B 1I5RA 2C9YA 4EECA 4HO1X 2RAUA 1D04A 3TAHA 2WF9A 3K9LA 3MLAA 3V4ZA 1N6KA 1XDGA 3FFBA 1Q6ZA 3E9YA 2A59A 2OB1A 2RH9B 1GCAA 1TL7C 4LC0A 1JTFA 4Y18A 4CDNA 4N48A 1EFLA 3AVVA 4PRZA 2W6PA 2X0KA 3RFUA 2ZWOA 4LRSB 2B8WA 2QLJA 4DG9A 3KVYA 2MR5A 2VBFA 2EFEB 1F1BA 2IYUA 3EA0A 2ZXUA 2QQ0A 2HMAA 2R4TA 1JHQA 1Y3FE 4JYPA 3FPEA 3F6SA 1PBTA 3Q7RA 1OX4B 3ZE9A 4JOBA 3ZQJA 5BOSA 5HQ3A 2EARA 1GKIA 3G68A 3Q0IA 3VDRA 3ZPXA 2ST1A 4R05A 2H7YA 4I3GA 5JDCA 5HJ2A 4YRAA 1E1KA 4YRCA 1EQ2A 2ONCA 4OBBA 2Q21A 3U4HA 4HGZA 2VRCA 4G5GA 5AHRA 3VOTA 1A8QA 4DY4A 3GGCA 1B8OA 4ALMA 1CJKC 1P2BA 1WBDA 5DBIA 5T4BA 2UUAB 4C2UA 1RLUA 2O52A 1SCIA 5F4BA 1GTG1 1WU8A 1XZLA 3JYNA 1A9XA 2ZUTA 5KSZA 3BKXA 5U4XA 4MRNA 2BE7A 2FPOA 4F2HA 2CHGA 3D7SA 3IIEA 2E82A 2PWAA 3F9IA 3G8BA 3PUJA 4XYMA 1DAFA 1HG0A 2Q5OA 4TZ6A 5A9RA 3IHLA 1Y33E 2DQ4A 1SQFA 1YKGA 7ADHA 4EVSA 3EFEA 4UOQA 1VSQA 1XJQA 2UXDB 1OXUA 2RGAA 1N78A 5F1OA 4DUGD 1E2QA 1HYGA 1PR9A 2QE7D 3AF6A 1ETHA 1ULTA 1E8NA 2FW7A 1B6TA 1RYFA 3AEQB 4X94A 4RTQA 1W52X 3PFNA 1FW6A 1KQ3A 1W8IA 3F6EX 3NHFA 3Q8XB 4ND4A 4XVQA 3ACCA 2GAAA 2ORVA 2FRDC 3UJDA 2BEVB 1SO8A 1GPH1 1N6PA 1IPEA 2C03A 3E5NA 3O31A 4RLHA 5F1KA 4BCCA 1EYZA 2Z4SA 1QVWA 2DKNA 5LA6B 2ZBFA 3V1NA 3FPCA 4LXUA 1EHYA 1XMXA 1BE6A 1EVIA 3R44A 4A6DA 3ZHXA 1LI4A 1WTAA 5IRCD 2V6BA 4K7JA 2ZWPA 2Y92A 4U0JA 1H3NA 1QLWA 5KVQA 2O3SA 4PINA 1OWMA 1QQTA 3ILVA 2QKYA 2ZROA 3ANTA 4YCAA 3SMQA 1GQRA 1XN4A 1PSZA 1KPGA 2V96A 2YMMA 3LVFO 4JGIA 5AKKA 4E3WA 1HNXB 2BSAA 3AY7A 3I30X 4FZ5A 4KIUA 2X0JA 3UGJA 1NBME 4U6SA 1HEYA 3KD3A 3QXJA 4P2BA 4WACA 7ABPA 1JDBB 2FSSA 3LXUX 4BNDA 1LX6A 3PNQA 4QXQA 2XQFA 5LD2B 3IDSA 2XHZA 1Z8NA 3GG9A 1WF3A 1X1QA 4LBZA 1JSLA 2BFEB 5F12A 3NRCA 8ATCA 2E85A 2ODTX 3NHYA 5JRDS 1F4PA 4J4HA 4DIMA 3SZGA 2HWYA 3DFFA 1BWRA 1NQWA 3ER8A 3E9MA 2BPOA 1HLPA 3BB1A 4ES6A 4X20B 4ZRNA 5AVVA 2PUEA 2FUNB 2I7DA 3K8OE 5B7NA 1O94D 3IVMA 4CPDA 1TKRA 2QWXA 1DC6A 2IHZA 2JLWA 2ZZMA 4FEAA 1GLVA 3LECA 2QL9A 4ZHSA 1ZINA 4MROA 4MUEA 1QLJA 1WVIA 4Q4LA 2PBRA 3FGNA 4CT5A 5AI5A 3MVEA 1O95A 2HV8A 4O63O 4PTLA 3GAAA 5CNJA 3VX3A 1B3BA 1U6KA 1V16A 4CMCA 4P6VF 1COWA 3SHFA 4C43A 4EVIA 5ITZB 3MK31 5E8RA 1ZITA 1WXQA 2NNLD 1SQ6A 4DQKA 4MWTA 1CQPA 5LP6F 1U8YA 5HIAA 2VOJA 3FPFA 4TZTA 1P1FA 3TQHA 1RXWA 2IBSA 2P11A 1Y8RA 3M8KA 4KYUA 4O0MA 2Q4BA 2CNOA 1SG6A 2BGUA 1P5ZB 2HK6A 3EY4A 4BV2A 5IASA 1B0UA 3B3AA 5TPWA 4DXHA 2BD0A 4G8CA 5F98A 2IEAA 5DI3B 1TUBA 1IWPB 5KYUA 5TLSA 1AX9A 2HMYB 2WNHA 2WVJA 5IJ0B 4PZ9A 2VWHA 2ZKLA 4XGQA 1GNLA 2C8LA 2G5TA 3U7GA 4EQ6B 4MA4A 3DNMA 4MR9A 4KSCA 5CRIA 1ENOA 1WD5A 4MHSA 3UMRA 4X24A 2ZSUA 2JJQA 1H0SA 3AETB 5BYAA 4PG5A 5JHGB 3WNCA 1VCOA 2O8EA 3U16A 1V4VA 2CUZA 3ZBQA 1Y5MA 4E09A 3ABQB 2J59A 3L0SA 2DPMA 4JY7A 5D87A 1ZOSA 1K97A 2JAOA 1XKLA 1S5PA 5AKGA 3AL3A 2RI0A 2YJTD 4IQ8A 3L7LA 2QRMA 3TQSA 1CW2B 4EF6A 3WOVA 2HMTA 3PDJA 4AP6A 1Z0SA 3EY9A 4IVNA 4XVRA 4IHJA 2LRHA 4J94A 5K0NA 8ABPA 1ZJ4A 1OYOA 1UM9B 1G98A 2AN4A 1STOA 3KO8A 3T5DA 3S27A 3PKJA 1BHQ1 4NFLA 1TA9A 4UBIA 3GDWA 4OSPA 4PAOA 4XW2A 2CV2A 1VSUA 3QKRA 5B53A 5EUBA 2NZYA 2VHYA 3U6BA 1M5UA 4JXXA 4MQLA 5K2OA 3ZDCA 2V7TA 4MX8A 1T9HA 4AECA 3KHTA 2ID7A 1RQPA 4C3OB 3ZIDA 1RYMA 1ABEA 1SK8A 1ADYA 1ZISA 5HQTA 3LO8A 3PGMA 3MF4A 2FR0A 4WW0A 4Z4QA 2JVJA 3KKLA 4ZCRA 4KHZA 4PTZA 1F0KA 3DPIA 2E4VA 3M6XA 1O03A 2PZAA 4BMPB 5I7HA 4FE3A 4X92A 4HDSA 3C39A 3DXFA 4G8BA 1SXJC 1S8AA 2W8ZA 3BMNB 1P45A 3WOHA 4E31A 2AG1A 5A03A 1EJ6A 1JXQA 2E6UX 2E4YA 3BFKA 3TOXA 4A0QA 5B4VA 2PXAA 1ZCAA 3WICA 1JQJC 3DMHA 3ERCA 1SC9A 1FS6A 3DV0B 4AJLA 3L9XA 5AKJA 1AHIA 4L27A 5LPNA 3PIIA 3IKJA 4GI7A 4IZ6A 1OX6A 4P98A 1WMFA 4IDPA 4QPJC 3V1KA 5H70A 2XOKA 4UU7A 5EI5A 4C9BA 4X6LA 1CPYA 2ZYWX 3ZWPA 5KTYA 4KMMA 4MW6A 2Q7XA 4HMQA 1GTL1 2BM0A 2BBWA 4O4HF 1TVKA 4MV3A 1VRCA 2J9GA 2QGNA 4LDQA 4ZDJA 4CMKA 1N9GA 5I9MA 1M8PA 2C3OA 4MVYA 1KPIA 3QKWA 1WOYA 3ADPA 1SHJA 1PKXA 1TJYA 4Q9DA 5DIZA 4C4YA 1TF7A 4GYWA 1EG7A 1C8KA 1WJGA 4AFNA 3SLKA 4AO7A 3THSA 2BTQA 5EHQA 2VUUA 1GN9A 3HS3A 4G1UC 5CW2A 1RWQA 2AH5A 1SPBS 4PLTA 2GPWA 4WRRA 5KNDD 1GKLA 4F71A 5DTEA 3T3GA 2Q0SA 2SHKA 4DL9A 2ZR9A 2BCJQ 1I33A 4L74A 3UGTA 3MJTA 1HGXA 3H5WA 5CX1A 2D1YA 1KFBB 1PSWA 2Q49A 3F4LA 3PC3A 3LCUA 5CYPA 5IEBA 1SBCA 4Z51A 2UZIR 4PE5B 1Z45A 4RS4A 4OHMA 4GGOA 4GICA 5CYOA 3VKHA 4B5KA 1XYVA 1WUYA 2ABWA 4BO5A 3PPWA 1D07A 4CCSA 4PHTA 1WVMA 4YWJA 1O5IA 2P2GA 2XQKA 5LP6C 1IFXA 4B6GA 1XSEA 5TS3A 1G5FA 3TOZA 3CVXA 1FFXA 3CZ5A 4G41A 3VR6A 3FNQA 1JX6A 3W2HA 4C1NA 2O5VA 4NCAA 5BSFA 2NQ2C 3IULA 4UEWA 3HZZA 4A2CA 1QNLA 2OL4A 4Q24A 2IYOA 3ZH2A 1RI1A 1XZEA 4F5YA 1NPDA 4IIUA 1PJRA 3AFOA 2F48A 4LE1A 1U0OC 1CRLA 1QKKA 3I12A 2R62A 4HY3A 2GEKA 3EIQA 4J1NA 2R3SA 5CXSA 2C07A 1R27A 3AU9A 3RJMA 4AIRA 5ECWA 5EJ9A 3LX6A 3P4UA 5IZCA 3EAFA 1R9GA 1T0PA 1Y9AA 2Q1XA 1P29A 1RC8A 1ZXBA 5I3ZA 3QF7A 4MKXA 4NS4A 1ABBA 4FLEA 4HJXA 2VT7A 5K8VA 1XPUA 4OJQA 2Z2ZA 3AYZB 1GCUA 1S2MA 3X1WA 1QV7A 2REQB 1C1XA 2X1MA 4RD1A 3KTAA 1WY7A 2VVTA 3D8NA 4OHOA 4RVGA 4UULA 3LUCA 2IYRA 1RJEA 2I4NA 1A7AA 1L5LA 3W7VA 3ZJYA 1IQUA 5T57A 1GFIA 1B15A 3F7NA 2C3PA 1NW5A 2VLIA 4U2FA 3VHXB 1VXOA 3JVEA 3KS9A 3CZMA 5C2JB 1QRUA 1MLDA 2A9OA 2L19A 3EQ6A 3L5OA 4PXSA 3UY4A 2ZS7A 2PT6A 2VXYA 1R0KA 4XD7D 5C5EA 2WMOB 1E3MA 2P2ZA 3EGXB 1XZIA 4RH0A 2J3JA 2Z8ZA 3K3PA 2IUTA 3PD7A 5E7QA 1TCVA 3E70C 2ZTVA 3EH2A 1OWNA 3NBZC 1Z8FA 1EIWA 1KVSA 7MDHA 4B6OA 1XX6A 2ZEJA 1K2VN 4Y1RB 3CLHA 3K96A 1CVLA 2OVBA 2B1IA 3CO0S 4C2TA 1EE2A 1YZFA 1LDMA 2ZXEA 1XJCA 3HVUA 1VJRA 4B81A 1WZCA 3QFHA 3EAGA 4IF6A 2DTDA 1PJCA 4GOKA 4QAQA 4KGDA 1PK8A 1R0YA 1I0LA 3TRJA 4C0XA 5EJEA 5BUZA 1SIBE 1Z3CA 2ZBGA 5FUBA 2FFJA 3SU8A 4B6SA 1E5DA 1T91A 3VQTA 2VA8A 3H2KA 4X0EA 8MHTA 4N0PA 3FDZB 1UJMA 3N0WA 4ZOCA 2ATVA 3EZ9A 4KN9S 3UPDA 1XDUA 3GA0A 1KJWA 2A88A 4FOOA 1RE1A 3RRBA 2W0SA 4PRYA 5DNDA 1MC8A 4BQOA 1MP0A 3A7EA 4OXYA 3EN0A 3LHSA 3RSLA 5JFGA 5JYCA 4DCSA 1WB4A 3N6VA 4PICA 2LUOA 2I3GA 4NICA 4QJ3A 4O3MA 3S1AB 3SF8A 1GCOA 3II6X 3PNMA 8GPBA 3LZCA 1O58A 1AZLA 5ESXA 1J9GA 3EVNA 3RBZA 2DY1A 2VUIB 3U4QB 3JQBA 1TO2E 4UTZA 1EK6A 2BFBB 3TE7A 4F21A 1S8FA 3BMOA 2BVNA 4FGUA 3WIUA 3D6NB 3H5RA 3O4VA 5KYYB 1NTRA 4LRXA 1FNDA 2HWKA 3M5DA 4UM9B 3L5KA 3ZDDA 3N8KA 4EX6A 3INRA 2NUPA 4QASA 2PRZA 3MQ2A 5A7FA 3KKNA 4D45A 2ODNA 4Q82A 1FFDA 2C00A 3W3AA 1XPRA 3INGA 3EFBA 1XTVA 3AB3A 4D82A 1EXNA 2V1UA 2VPYA 3CUUA 1BVHA 4IDAA 3R75A 1RKQA 2FSGA 3LC0A 2ZR8A 4L07A 4ZN6A 4NOJA 3O9VA 2GZSA 3HRKA 2Q5LA 2ETXA 3DV9A 1X7XA 4TLMB 3VR4D 4A6XA 3PJFA 4PQGA 1MO6A 1Z0JA 3ZCXA 1KKUA 2HHHB 4JDUA 4HYTA 3AEYA 4NNOA 4ZD6A 3RS4A 5BUSA 1YC2A 2CUKA 1XXHE 4F8JA 2DE0X 3PPYA 4JYBA 1WHSA 5A3SA 5JJKA 3AWDA 2EGHA 1JDZA 1I32A 2H4JA 3A26A 1Q0QA 2KBEA 1IN7A 3GFTA 3ILHA 3OEHA 1N5OX 4J76A 4QDUA 5AM5A 4CMIA 5CXQA 1WDMA 5HJ5A 1FP7A 4CM4A 3O7MA 5ADWA 4ZDKA 3GP8A 5BWMA 1IMOA 3D7RA 2VJLA 4DQXA 2I29A 3FVRA 1Y42X 1UMCB 4BXOB 1FDWA 4D96A 2QRKA 4A1FA 3GRYA 2WHRA 5J40A 2BMFA 3U48A 2NZXA 2FSVC 3QEJA 2QYHA 1QGAA 4DF3A 1GXSA 3BGWA 3MS4A 1XL0A 3KJZA 1Z38A 3CLTC 3MCTA 3QHAA 4PBRA 4Q1BA 3RUIA 1R8QA 2IA5A 3IRUA 4HQ6A 5JFOA 1BDBA 2PY6A 2MHCA 3RC7A 3ZKWA 5SYNA 4E08A 4JROA 5CIQA 5FLYA 1Y8ZA 1MIOA 1RKXA 2KBFA 2A9QA 4IIDA 4YH1A 1Q0SA 1CU1A 3FAKA 1XZPA 3PQ5A 5AJHA 1L5NA 1IZYA 1TB4A 1QCDA 2FEOA 3GFOA 4EABA 4JA2A 3DA8A 2ZTLA 5BQ5A 4WOJA 1L4MA 4WCFA 4YV0A 1I6WA 4MYHA 4D4LA 3O8BA 3IAHA 1WAMA 1KMIY 2XF2A 4MWBA 2JJMA 3DZFA 4JLUA 3OO1A 5INTA 1S2IA 4OQDA 5AK4A 5T6BA 1GFZA 4PANA 1EUYA 1E32A 4L6AA 4ZP1A 1V6AA 3E8XA 4AJKA 5EP3A 2J7PA 3M83A 3OT5A 4JMLA 5CAEB 3GJSA 3L92A 4IFIA 4IJQA 2I22A 4P2GA 5SZKB 3RUDA 1J0EA 2PJDA 4FCCA 5HZGA 3SQXA 2ECFA 4I81A 4YJGB 4B1FA 2NU9B 2QTTA 1GPAA 4JIGA 4PCVA 5CEEA 3ZK7A 1KO8A 1D2MA 1BWSA 4LZAA 4LV6A 4TTSA 5G1PA 4ZYLA 3IV6A 1BH2A 5IN5A 5LQCA 2H29A 3DW3X 4BQNA 5KWIA 2VT3A 2WJIA 4HDMB 2HV9A 2IEZA 3ZDZB 2WC1A 3LC7O 1GJRA 4JLVA 3N2IA 3PR1A 1N5JA 3DXZA 4C7KA 2J07A 3GWGA 4ZXFA 5THKA 4HG2A 1P77A 1KDVA 5ITVA 5BQPA 3NWOA 3KXPA 5B57C 2GBPA 1V47A 3OHMA 4EI9A 2EJVA 2QTLA 3OD1A 4ZVSA 1W36C 3CPEA 3C6XA 4FNGA 2AS0A 2Q5HA 2QT1A 5ALOA 5I7VA 3NGXA 3B2NA 4G5QA 1VE7A 1PG0A 3JYPA 1B0AA 3DGFC 3QE3A 4J49A 5AO9A 5K5EA 1KI1A 1I2DA 2PUTA 5CP8A 4XRGA 4TQUS 1I13A 1OKKD 2CZGA 4AJHA 5DRYA 1PJAA 1XQYA 3KUDA 5DK6A 5T3YA 4BLSA 2B7CA 3M49A 5JARA 2ZATA 1XCJA 4TL9A 4YV2A 1GGVA 5JAMA 1Z0ZA 2XDYA 3QITA 3QTTA 4FMPA 3LNCA 1WUJS 3UC9A 4RADA 4JH0A 3RASA 3IAAA 3NT5A 3T7AA 3HA7A 4XX1A 2P7IA 1QFSA 1RADA 4YT2A 3PXBA 5EOVA 4S24A 2BGWA 1U2GA 4D25A 3IT2A 5JDIA 1E6MA 1EUCB 4ZVRA 1TPYA 3TLBA 3LKVA 3KU1A 4INPA 3HCDA 4UU8A 5DDIP 2ZSAA 3SX2A 2AHRA 3V2UA 4F84A 1R0XA 1N3IA 2CVQA 2AZDA 4FLMA 5C8ZA 1B4DA 1SIUA 1WMAA 4OQMA 4BWYA 1T0HB 2A0KA 4JJ7A 4ZOLA 2Y8EA 4OPMA 3JXEA 3STUA 3OFND 3H1AA 4MYDA 3LDFA 3L6DA 4FWIB 2FUG1 1Y7HA 2JGEA 5IUJC 3IUSA 4KZKA 2ZB3A 5CNIA 4ZJZA 4MDFA 1P4JA 3WLMA 4C76A 4OXXA 1W0KA 4OM7A 2GM3A 2VWGA 4AMGA 4HAWA 3T52A 1N6NA 3GUZA 5WRFA 1N2EA 1XTUA 2OXEA 5A02A 4YLEA 2H1OA 4BNGA 2QG6A 4BV3A 2E21A 3OIUA 2HN9A 4B0OA 4EMSA 1SRQA 1SCNE 1CKEA 1CQZA 2G9RA 4OXKA 5DF1A 4A0RA 3RAFC 4OL9A 3FKSD 1DBRA 1YAJA 2OOSA 3KSUA 4OJTA 4RMJA 4DMLA 3QWFA 2QQFA 4UVIA 5EIEA 3TFOA 2RBEA 1Q2XA 4HWPA 1S2LA 2AVNA 4IQ4A 5ESRA 2H92A 1Z37A 2WFLB 1ZD1A 2QIPA 3ND6A 5CFQA 5KOHA 1RHJA 4E5UA 4QQKA 1QK5A 3H6HA 4MUIA 1BTOA 2R84A 2OBBA 3WBJA 4RACA 1ZK0A 3SM9A 3A1EA 2RIPA 2ECQA 5LU9A 2OO5A 1FMLA 3ITEA 2DXIA 4HUQA 4LZOA 3FFWA 4KOEC 1KDYA 4CM1A 3DMTA 2CHEA 1ILWA 1NYQA 3L84A 1QKJA 3NFRA 5DP1A 5AOAA 3IBSA 3ZH9B 5F2KA 4K9KA 4NZOA 3EWIA 1EGVB 2QP3A 5FI3A 3C6BA 3A1DA 5C3MA 2AMJA 1YQ9A 1T35A 3GJQA 3JQ6A 4MS3B 2XT0A 1EFUA 3A3YA 4JENA 2OENG 1U8FO 3Q15C 4R2HA 3TPCA 1PSDA 4MVJP 5T67A 5K7SA 3DLAA 2YMQA 2W6ID 4GX5A 3NBXX 3SZUA 3GDOA 3ZY4A 3ILSA 1PE0A 4EO7A 1X1SA 3SN6A 3VPGA 1YL7A 4I55A 4M99A 3NC4A 4L1KA 4R3NA 3VC2A 2GWRA 2I87A 4OCZA 5EJ5A 3S2YA 3I73A 4Q4JB 2EF0A 1X8LA 1YDGA 5DP2A 3EPJA 4PYKA 4YRJA 4BO9A 4XX0B 1CUZA 4DLAA 4P5EA 3DLTA 5D84A 5HCUA 1W4RA 4ETNA 1G38A 3PSHA 1P7WA 1G0OA 1E3LA 2W6CX 2HBQA 5EYPA 4DQ0A 3AZPA 4LY6A 3A1VA 1UJ4A 4PC3A 4FX5A 1T9KA 1TJPB 5D3KA 2B21A 4EPWA 2DR0A 3A9VA 8LDHA 3CUSA 1OWOA 1NPTO 2VP9A 5AK5A 2YWDA 1FX0A 4QFCA 1GV1A 1C3OB 4G1MB 1IXSB 2WSSD 1ZR4A 2F2TA 3P96A 2FP4B 5HJEA 3I6YA 2G76A 4Q34A 2CVOA 4N5HX 2VT2A 2GA9A 3C1OA 3CRZA 3BWYA 1Z4JA 2WAYA 4R40A 3ST7A 1T13A 5EIFA 1YB1A 1YU9A 1J00A 1QZTA 1R74A 3MJRA 4LC9A 1VHWA 3MCUA 4ASUD 4UTVA 1DAGA 2H4XA 4KAXA 3KEMA 4S1PA 1XNQB 5IDQA 1PUJA 3S7ZA 4EMUA 4CV1A 1GYPA 4HCJA 4OO3A 4TYMA 4KQMA 2QLBA 1NIJA 1ZK1A 4ZANA 4C89A 1N5MA 2OV2A 2XY4A 4P5PA 3I32A 3UOGA 1J23A 4P3OA 1J97A 3QLEA 3B13B 4PPQA 4X90A 1YH3A 5JECA 5BWBA 1ZMBA 3STYA 1AGYA 1N2CA 4CKXA 3DCNA 2GAJA 1CR0A 3LBHA 3O7WA 4ZO9A 2DSTA 2J0QA 2ZIFA 1R0ZA 4GVPA 1V11B 4ZYYA 3WGVA 5DHAA 4WT7A 2FXIA 4BMZA 3LZDA 1E3TA 1K5GA 4HVTA 1ESDA 3CNBA 1VKOA 3ITNA 3OU7A 4HRVA 5J43A 5L8VA 4RV5A 5K4HA 1VCIA 4S04A 3D6TB 4RK4A 2QAGB 2UYCA 3CVVA 1QCCA 3CRW1 1YQDA 4R51A 3SX4A 3K30A 4ZI5A 3B48A 1AUVA 1EU1A 1L6RA 3H75A 4ECAA 5LOVF 2ZI6A 3EULA 2DB3A 2YS7A 4JLJA 3UAXA 3SMVA 1HQKA 3AVUA 1M1ZA 2GKSA 2ZRBA 4LXHA 2UZ0A 4EFMA 5D6OA 4J0QA 2O3TA 1L8AA 4TOIA 2CVZA 5F3DA 1IBSA 3LBAA 1YR7A 4IJ6A 4J0GA 1VYUA 4X7RA 2SCUA 3V8RA 5M04A 4BVGA 3ZHYA 1QX4A 1T36A 3FCOA 1G2IA 4MJ7A 1E1RA 3IIMA 3K4QA 3Q3JB 3QENA 1F5NA 3HY3A 5C8YA 2N9UA 3ZWYA 4Z1OA 2I6GA 2G4VA 4F96A 4PGGA 1G8KA 3BBLA 5FPQA 4XASA 3SXPA 5FNVF 3UB3A 5BOVA 3WKEA 5BVGA 1JAHA 3W4JA 4RSRA 1E7YA 3BK2A 2R8XA 4BMNA 2CMKA 1VC2A 2CFCA 3IAEA 5JPCA 2QLNA 1AO0A 2PD3A 2VUTA 4Z4HA 1EWTA 2CVFA 3PGLA 3RCBA 1SWWA 5FBQB 2AE2A 2Y1XA 1U8CB 4RDXA 2W8BA 1Q3TA 4ZMRA 3F6PA 3SE7A 3TSZA 2HF2A 5TIIA 1V1MB 3EXHC 2OP0A 2OVFA 1Q1GA 4CNBA 1E79D 3G13A 3GPBA 3I52A 3Q9LA 1TLTA 3JALB 4DCNA 4J0CA 3PFCA 3LT0A 3KAQA 4UD2A 2WD9A 1A8UA 4IICA 3WLFA 2Q2WA 2O4CA 4LS3A 5ANRB 3AVXA 2ZVJA 3BXGA 1U0HC 3K70C 2ZPTX 1RRGA 2HF8A 1YZTA 5GGYA 2QP4A 1IZ0A 4NBNA 4PW0A 2VJYA 3V00A 3VU8A 1Q1NA 1SKAA 5M7EA 4HXYA 1T4MA 1R8XA 3GGGA 4QU0A 3L05A 4WZAB 3GBSA 3NV7A 3TLGA 4D3DA 4YUYA 1X8KA 5KYWB 4O4LA 1H1DA 4L75A 2AR9A 3HA3A 3PRKE 3GGSA 4FSDA 6NULA 4EY6A 5JCJA 2XUGA 1EGQA 3UK7A 4MWZA 4IPTA 4RKWA 3I4CA 2WILA 3TW4A 4MS4B 1ZJWA 1W25A 4J9VA 2AFHA 2PL1A 4G5XA 4F97A 2HQSA 3Q6NA 1RXVA 1OIWA 4LTNA 3KTFA 3T9FA 2XMPA 4JC4A 3D59A 4GKKB 4TXLA 1ZK3A 4Y2RA 1P9OA 4CTKA 3N8NA 1Z7BA 5EZYB 3WL7A 2CHQA 3NM6B 2NU7A 3WLNA 3OKFA 4W9RA 4GP7A 1NBWB 1K63A 1T9AA 2GETA 2ODAA 2W70A 1L4UA 1B73A 3D4OA 1FDVA 3Q7IA 5TQVA 5FBWB 4B83A 2PM8A 2Y6UA 2H5LA 3PEVA 3VNRA 4M1QA 4OQNA 4LJ6A 4A3SA 4KUEA 1ZI8A 5K0BA 4F92B 2HQRA 3N53A 1TFUA 3EPRA 1NJGA 1XAJA 4ODIA 2R2GA 4NNJA 1P81A 2E5LB 1XCBA 3ETJA 4GOJA 2VJQA 3K7EA 4REOA 5JQGF 1N7IA 2BFDB 4IY1A 5TC4A 3AL0C 1NUPA 4Q37A 5B1IA 4V1CA 1BEEA 1RWPA 2DHQA 2HNBA 3LV8A 3QG1A 1PRYA 3FLAA 2FSVA 2OEPA 2VXOA 2AJTA 4KK3A 4FFNA 4GR5A 4L0QA 1CF4A 5CLLA 2PGDA 3A05A 2EVWX 3R5JA 3EMKA 4G97A 2A1UA 2E1PA 3GLFA 2B4RO 2D7DA 4WFQA 3FLMA 3H2JA 3HMKA 1V26A 3UH0A 3MOSA 4W5OA 2XD9A 3QVTA 1WCV1 3KAKA 5F21A 1XAHA 1RC1A 3BDVA 2A0YA 1NI5A 1RKVA 4FR0A 4W9NA 1XD2A 3ZG6A 4DJAA 4EW2A 2Z09A 3PK0A 4P31A 1JKJA 4XFJA 3T3IA 2XTJA 1LW6E 3TW8B 1G8PA 2QT0A 3AVQA 3EZXA 3CRQA 3OWHA 1QVAA 2GN4A 2LCIA 3IMGA 4TVSA 4MKGA 2CNKA 2JC3A 2WTBA 4MR7A 3M33A 2QRVA 2Y4OA 3G7NA 1VL2A 1FTSA 3I9FA 3RRXA 3ZLVA 4ZCIA 3SG0A 121PA 3EQ2A 3HQ4O 3S81A 4EFLA 2JL1A 1LFAA 1ZIDA 4FHDA 1QO0D 5F3RA 5FI1B 4LX0A 4NX2A 1G41A 4E51A 3H5IA 1AXRA 1OIVA 2X42A 1DG3A 2E5FA 4JSYA 4KLZA 4Q47A 4Y2SA 4DLZA 3CLSD 1P2FA 1QFZA 2QYOA 2C9DA 2QZ9A 4YAEA 4WXEA 3A9RA 4KUGA 3RYIB 4EVRA 4XWWA 1JWLA 2QHXA 3ZHTA 2AUTA 2BHRA 3R76A 2IQ5A 4OXNA 4JJEA 5AI0A 3GEMA 2G17A 3Q7TA 2F1IA 4O2AA 2DEUA 3OAAA 4YUWA 5K03A 1L5HA 4YMSA 2LPMA 1T4DA 4JLNA 1NFFA 3KYJB 5EUQB 4BJ3A 1K1EA 4NDAA 4W8OA 2VHEA 1T3GA 1W29A 1U4NA 2ZI7A 1GAQA 3DE1X 2IYQA 4EAQA 3EZNA 2J3DA 1TD1A 1G9XA 1K8XB 1KMHB 1QHGA 1ZNXA 2XMDA 3GZNB 4LZZA 4MI1A 4NBVA 4NC9A 5EKSA 3QP9A 3SLRA 4AQDA 1L7DA 1YR8A 3DTNA 5L95A 3GHYA 4AUMA 4IO1A 5FWXA 3NWEA 2QVXX 1R6TA 1NR7A 1QTQA 2CMFA 4HXFB 1B0ZA 2IEBA 2X5NA 4UHCA 2G1JA 1R4ZA 2JFBA 1HLGA 3A4IA 4JAVC 2HXSA 4W1QA 5I01A 2GF9A 3BHIA 1Z8DA 2NVWA 3MXTA 1AB5A 4RJIA 2X6TA 4MYSA 3HVHA 4W5RA 4UAUA 2MMGA 3IQDB 2F1JA 3RHTA 4HZIA 2IW3A 3FWZA 1HURA 4R1LA 4XUCA 2OV3A 1QORA 4EUNA 6PFKA 3D7MA 1BC5A 3WFZA 1U3GA 4QRHA 4HBZA 2ZSKA 5IVPA 2ONZA 2PMBA 3Q8WA 3QLVC 5IM5A 4R1QA 1DZ3A 3G82C 1PZHA 2C8VA 2R1TB 3C85A 1O2DA 2B1QA 1KAHA 1II8A 2CXOA 2X4DA 3GXBA 1ATIA 1BU8A 2SBTA 3IT0A 4HS9A 4UNIA 5ARCA 1KL7A 5A04A 4REQA 3FYUB 4P4LA 4CLOB 4DLKA 4AY3A 1BA3A 4OUDA 3SEFA 2Q5JA 2RC5A 1R0WA 4RHXA 4GXNA 4D4GA 1N32B 3VNVA 3DJYA 5ELMA 3GFBA 3SQDA 4YP0A 1SXQA 1M2VA 1VP3A 1X92A 4NH4A 3W5IA 2H9IA 3DAHA 3DF7A 3LAWA 3P2KA 3SX0A 1JBKA 3UK1A 3ZYCA 3P9SA 1JHPA 1UBOS 2WT9A 4MVJD 2FPUA 2HB6A 2Z98A 3ENNA 3EODA 1BGVA 2DHEA 3LW7A 1G66A 1W85A 5ERYA 4WINA 3THWA 3TTUA 2OE2A 3L6UA 1RNLA 1NVKA 2GEUA 1OCEA 3RFXA 2JA2A 3DWEX 2YVAA 2IIBA 3NYWA 2XCUA 4AZSA 4O4IF 5F9MA 3TL3A 1K86A 1VB3A 2G8NA 3W06A 3ZGNA 4WZBA 3TZCA 4IIHA 2D54A 3PCRB 2P0EA 4DT1B 2BKUA 2QENA 2PR2A 4MS1A 3SFZA 3TG8A 1L4HA 4N5NA 1DIHA 3WIDA 4F2DA 4LKOA 3NDBB 1PT7A 3OPVA 1VJDA 1VHTA 3OUUA 4IEEA 5FWYA 3NQ41 4FZRA 4QQNA 4IWNA 4OH1A 3DZHA 3RIMA 1YB7A 3ZTTA 1NRIA 4JDPA 4MZXA 5D1HA 5AVUA 4FDVA 1S9HA 4RZIA 1U4OA 1B76A 1KZYC 3ZQ6A 2DLCX 3HYCA 3R20A 2P79A 2Q9CA 4PZZA 1HE1C 1BMQA 1KI6B 1Y5LA 1G3UA 3RWBA 3W5SA 1T6XA 1GT6A 5A3RA 3LX8A 4RCYA 1TKCA 9ABPA 4ZCLA 3MGBA 4B4OA 1VOTA 2BIFA 2P35A 2IP1A 1N33B 2L18A 1B8NA 4G36A 4IX1A 3T7IA 1JZQA 1R2QA 1VI6A 3FWHA 4IFEA 3UMJA 1W88B 4U02A 4PZ0A 3MJEA 4I4TA 2WPDD 3ISJA 3ZU5A 2CLOB 1F9AA 2EEPA 1ECPA 3G79A 3I61A 4I5DA 1XTZA 3I8XA 3EZYA 4J1QA 4K9MA 3W8EA 1FPQA 5K3EA 2I4MA 1JG4A 4HVAA 3TZKA 4BP9A 1W0JD 4H9GA 1QC5A 2IX9A 3OZFA 4MQEA 3WIVA 4WCVA 4QM6A 3AJDA 2X9VA 1RTTA 3C48A 2A1IA 3V2HA 3EUEA 3OY2A 3QSGA 2UYQA 1Y9ZA 3AR2A 1DBWA 4NFHA 4WN9B 3O4GA 1K7EB 3RV3A 2O3JA 1DAKA 2YXEA 2BT4A 2LP4Y 2Q9AA 3B6KA 2CC2A 3B82A 3DSRA 5HKKD 3KFVA 4I6JA 4Q19A 3T35A 1PZMA 4WESA 3RG8A 2AZ4A 5IHXA 2OCIA 1DDGA 1PDWA 2Z57A 3DMRA 3GQBB 4PU0A 3EEOA 3TZHA 1I01A 1EK1A 3PXGA 3TFQA 3KEQA 4MKZA 1YQEA 2I2AA 5CIYA 4FT2A 1B8UA 3FYHA 3RQSA 1V4NA 2VSXA 1G3MA 4E30A 2C5AA 3EAQA 1IHYA 4P7BA 2FX3A 1GKKA 2ZIXA 4UOEA 4BFYA 3V4VB 2VPIA 3U17A 5J4HA 1YJCA 3BIJA 1H1LB 3C87A 4GPZA 5D5PA 4HWGA 5IAEA 4Y2JA 1KKMA 3TIVA 4F4UA 2AR7A 1CJCA 3LFTA 1YR2A 5JTTA 2PL3A 4XIFA 3E9NA 2AG8A 3PYXA 4FTWA 4MIEA 3T3OA 1JR2A 1GZ7A 3M3DA 3I42A 1KQPA 3V1YA 2QPLA 4U7FA 4RPJA 3QYFA 1JJVA 1Z5OA 3CVOA 4AKIA 2ZJYA 3Q98A 4D9CA 2ZJOA 1SG9A 1WRBA 1X1TA 1KK2A 4JQYA 5DNVA 1DKNA 5ALPA 2IXTA 4K46A 4KLCA 5DNUA 1IBCA 2HLDD 1J0CA 3LF2A 1PDVA 4I2VA 4LXTA 1U28C 3DTYA 4R5HA 4AZ0B 5M5BA 1KS9A 3TS1A 5HF5A 1R0BA 3ROMA 4Y2YA 1N2JA 3IMEA 4ZYXA 1CR1A 4C1BA 1TM4E 4FBMA 1I1HA 4C2BA 5FLEX 5HZHA 2Z2YA 4YROA 1JF8A 2VATA 3HHPA 5FRDA 4CLRA 4E5KA 1JAXA 3RVNA 4BKUA 1QV6A 2BSXA 3ZYZA 1W35A 2HSWA 1E2LA 4LJKA 5FORA 2HY7A 3Q3EA 2IDJA 1VG9B 2GK6A 3FPJA 3H65A 3FSEA 1SCBA 1S0UA 1Y1TA 2ZRJA 3A06A 2WUDA 4FN4A 1ZGBA 2YW2A 2WWGA 4YV7A 3PUZA 3DBHA 1DLIA 2CHVA 1SEVA 3KUKA 4NEGA 3M2TA 4REMA 5JS2A 3ZXYA 5A4AA 1UEJA 2RD2A 4N01A 4BBZA 2WSBA 2CL5A 2BFFA 1ZUD1 3MA0A 2QAJA 4GLFA 4GSLA 4G07A 4OFBA 2H2HA 4D5EA 2P68A 3DAFA 1YJ5A 4OY3A 1IVYA 1GCGA 1ZOPA 3NBAA 5AUOB 5KHOC 1D0IA 2NTNA 3UKDA 1ID8A 5TMEA 1KU0A 2RGDA 1TU0A 2QX4A 3A1SA 3PIRA 4G0XA 5CX4A 2IV7A 3T9AA 4DR1B 4YJHB 4BKOA 3EOBI 2CDAA 3JQ9A 4KQ1A 3O73A 1FCJA 1HQDA 2F17A 2FPKA 2ZBUA 3OLYA 4OOFA 5KKAA 4BKRA 3B7WA 2WWVD 2UYGA 3UOAB 5LXTA 1KZGB 4WJZA 4DRXA 5IF9A 3FR7A 2Q9BA 3IBTA 1I3CA 4GC9A 3CVWA 2HIMA 2DQZA 3IVRA 1E2EA 2DHRA 1QXSA 4MB6A 3IB3A 3RBVA 4XVHA 1FYFA 1ACMA 3GLVA 4C2AA 4MPRA 3PL1A 4YPOA 5D01A 1T8YA 4B7AA 4FDUA 4TS9A 4WLVA 3WAGA 5AWFC 1QTRA 5NULA 1DCMA 1QWOA 1MZVA 1BNCA 2WZCA 2BEJA 1P1KA 2VTBA 4KWTA 2DQYA 3OZCA 2XVAA 5DB4A 1OH8A 3TQCA 3A10A 2OZLA 2Q0HA 4ZC1A 3PQ7A 1O57A 5BXQC 2VHXA 3NAMA 3BWCA 2C58A 4KB5A 2OCKA 3CRMA 5IH7A 3U1BA 4OX9Y 4BB5A 4WLFA 3TX2A 5LQKA 3EQ9A 1F5SA 5EQDA 5K8TA 5L7YA 4LDAA 1LZLA 5LA6F 2PANA 3L1IA 2ZDHA 3GJ4A 3A3KA 1EAYA 4AN4A 1L7PA 2BM9A 1ZNQO 2C59A 3OJEA 3RJTA 3IIJA 1E4YA 5KUTA 3MGAA 1BCRA 3M1YA 1CZRA 3DG9A 3RB8A 3N28A 1JA0A 2W6ZA 1NVVQ 5C37A 3HJRA 1VGRA 4KNVA 5ECYA 4EUFA 2OKGA 1SY7A 3ESQA 3ZWAA 4GBJA 1R3DA 1VKRA 3N8HA 2FW1A 3OECA 3LFHA 4GPIB 3ADDA 4B0PA 3L4JA 1L8OA 2IODA 2A9KA 3R5HA 3C7DB 4DV0B 1J9ZA 1XRPA 1CCWA 2NZJA 3G9XA 3CF2A 3PDIA 4AB1A 1XZCA 1ZZGA 5EQTA 3DE6X 1U2DA 3O8LA 3VPCA 2HPAA 3EUAA 1A95A 1OFTA 2V6JA 3PWSA 4UPVA 1KIAA 3G1TA 1QHEA 3ME5A 4L5IA 2EW1A 3JSAA 4D8WA 1OJ7A 1AS2A 2QU7A 3E0XA 3KYIB 3MT7A 3SJBA 3LY7A 13PKA 6LDHA 4B3DA 4FYIA 3PNYA 3LCJA 3U40A 4HH4A 2YZ7A 1F4VA 2YCBA 4KDRA 5EHXA 1ZIXA 4O2LA 5DASA 2WM9B 5CA0B 3A1CA 1FTGA 3OIDA 1YJQA 2CN1A 3TBKA 2J6IA 3VZSA 4M4SA 1UBEA 2YVLA 2COUA 3K0KA 1J2TA 1MTOA 1ODSA 1N2IA 3FSGA 4U3JA 4ZAGA 1PG2A 3KJIA 2CHFA 2YFQA 3HJBA 4MLDA 1MDFA 4GWKA 2PBLA 2X4IA 1K98A 3A9TA 3RG2A 3IDAA 5HUJA 1FSZA 4FFPA 4XWKA 3JPWA 1WW2A 1CG6A 2V7UA 3ADKA 3FROA 3FIUA 4L15A 3C6MA 1TOAA 3U0VA 2VDWB 1SXJE 2WWTA 2PRIA 5CVTA 3O21A 3D5QA 1YFJA 3GG2A 1DELA 2CJWA 4IV0A 1MOPA 2GJ8A 1UKVY 1L7NA 1YCGA 1LDNA 3QTBA 2I4IA 3JD2A 1QMGA 5CB0A 2ZSJA 4CQMD 3L7DA 2J85A 3AR9A 3UXHA 2NTYC 4YJFB 3WJ7A 2C2ZA 3K6SA 1QRSA 2PQ2A 1LBTA 4G8DA 4G9BA 3Q1LA 4QIHA 1CS0A 2V0NA 4IH4A 1CNMA 3Q3HA 1GLGA 3NHWA 1OD6A 4IAOA 2P4UA 1M0EA 1N34B 5CT6A 5FNVA 4D4KA 3ZDBA 3O8QA 4Q05A 4TKUB 1HDRA 1E2GA 2EGGA 2D8AA 3I6QA 3BF8A 2W2TA 3CMCO 2O2DA 4YRGA 3LWBA 4DM7A 5CB8A 5HUQA 2HKIA 1AA6A 1POWA 2WQZA 4NPCA 5LUBA 4RHFA 1GEGA 1T2FA 1FNNA 5DGCA 3L07A 4F3KA 2NUBA 4HFRA 5BURA 5KC9A 4RHYA 4WXPA 3SLGA 2ZRNA 2ZWMA 5A9SB 1EDDA 4M53A 4MGEA 1MO2A 4FWBA 3CGWA 3M34A 1XWWA 3B60A 4AUEA 3E82A 4Y9DA 2HD4A 1TEZA 4W5JA 2X8WA 1QH0A 3EZFA 1WPRA 2R79A 4YYZA 5BMVB 2C8JA 5K0JA 4Y6SA 1U4SA 3LXRA 1DTEA 3V46A 3K0BA 4JEHA 1OBCA 4UD6A 2QM0A 3V7FA 4D8XA 1AK2A 3LF1A 4LY3A 4QAJA 3LSTA 3U5ZB 1YCDA 2QX8A 4JB8A 4H16A 5FOWA 2AG5A 3QWHA 2C97A 3X1ZA 4EGSA 3OBIA 2ILTA 1Q57A 5EHGA 2GFIA 1QDUA 2Q6OA 1R5OA 4XYEA 3QVWA 3A1WA 4B3RB 2W6JA 2E89A 4G0YA 4M9QA 4QXOA 1TYZA 5EUCA 2GYVA 2XYPA 3M6FA 1P7ZA 5M3BA 2OXTA 2WMNB 3DL7A 4WDRA 1DXQA 4NYIQ 4PONA 2CFTA 3ANXA 2Q2VA 3GJ5A 1JS1X 5KI6A 5EHZA 1J2EA 4FHGA 2M6RA 4ND6A 3MWDB 5FWDA 4CR8A 4N76A 2PJZA 5J1TB 1NRXA 5B7GA 2R8PA 4NP6A 4OIFA 4LDRA 4WXRA 4RPLA 1P0FA 3LP8A 3GYBA 4Q3NA 4Y2HA 3TI9A 4D4JA 4C4SA 3DKRA 1TO1E 3N0RA 5AI4A 2XNHA 4RFSA 3A6ZA 4DJJA 4L9RA 4K9PA 5AP9A 1N2CE 3HMQA 4Y2UA 2ONJA 4DEYA 4RF3A 3ZWMA 5LD2C 1GG8A 1YQQA 3SEZA 3PF9A 2EBUA 1K8YB 1CUEA 2HJ9A 2JBWA 2YX1A 2B36A 3E7WA 3PNSA 2L2QA 4ZV7A 1FNBA 4PVDA 1AT1A 4OGLA 3THYA 5JQGA 1M67A 3W2EA 4EBBA 3DTVD 4XQ0A 2Y3IA 2HT6A 2GNAA 4QICA 1CYEA 3D3KA 4GUAA 4D6PA 1MOZA 1UP4A 3E58A 3IPLA 4GBED 5FIUA 4BNMA 5AVTA 1Z0UA 3B3GA 3KE9A 4TM7A 3AF5A 1TM3E 4JOQA 5AUNB 1EEXB 3RYCB 4RNCA 4I50A 3DR5A 2Q6KA 4BO2A 5ED4A 3NNNA 4P08A 1BGXT 1ZO8A 3P9NA 2WJHA 2X41A 1QQAA 3DOCA 1G1AA 4D97A 5DM70 2RJNA 5HMLA 5KPDA 1B0PA 4LDZA 3NC1C 4EA7A 4TROA 4E14A 2QD3A 1PR4A 1TEHA 3B1WA 1RHQA 4KYTA 4QPNA 4EVQA 3ZWOA 1C1DA 1NKSA 3BD6A 4PZDA 1M0TA 4JXJA 4DG8A 3EF3A 3GCDA 3K9GA 1NDUA 4CMBA 4EO4A 1RBZA 2H4ZA 2RB5A 2WP0A 3R0IA 4RTRA 1I94B 1NMEA 5E6UA 2XUDA 4H27A 3RRJA 4XDGA 3BSWA 1AXGA 2DTXA 3P8ZA 2HMUA 4JZKA 2OHIA 4KMSA 4XWOA 4KV7A 2QZZA 3G7SA 4HDOB 2WI8A 4W4TA 1N4DA 1YZHA 5EQFA 3UANA 3ESDA 4TKVA 2QVZX 5DLPA 2FSPA 3SEAA 1PTJC 1ZGHA 1RM3A 1P33A 5D51S 1USWA 5SY9A 1Z15A 4ZDWA 5IK2D 1QTIA 1XNRB 4OQ4A 1H9BA 3DS8A 3LY9A 5JS1A 1NU6A 2WTXA 3F7TA 4Y8VA 2AFRA 4N5LA 1I36A 3G2IA 1KS2A 3T3DA 2YWXA 5LIPA 3UK6A 1LSUA 2Q8PA 3BD9A 3PKZA 3IHKA 4NK5A 3V34A 4AUNA 5LLTA 3O38A 3E61A 3UB4A 4KMRA 4JA0A 1TJNA 3W1WA 5GIOE 1LDEA 2HQOA 2I55A 4P0TA 5JSQA 3TJMA 3CSDA 5K3CA 2I4TA 3KK0A 5K3FB 3HV0A 1JTVA 3WISA 2XJ9A 3H17A 2V55B 3DB2A 4MAMA 4BX2A 3HI4A 3CR3C 4TSKA 2HK7A 1Q0TA 2C9BA 1ORRA 2W2XA 2WUWE 1CT9A 1QIJA 2PYZA 4C07A 4ANFA 3U3KA 5LR6A 2NAFA 5L6LB 2V6MA 3OD5A 3OF3A 2RBGA 3BQNB 3GDFA 4GPD1 4MCJA 4PF1A 3RAEC 1AV6A 1TJ5A 4U63A 5TGZA 2QN7A 4UE6A 1Y1PA 2YXNA 5EIBC 4Q5IA 1T4CB 2V54A 3FB1A 3NM5A 2QZJA 1CY2A 1AUXA 3D5TA 4RTPA 4JLAA 4FIZA 3PENA 1IAVA 1FA9A 1U9JA 1YJ8A <