3GDGA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable NADP-dependent mannitol dehydrogenase
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
molecule tags Oxidoreductase
total genus 88
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdgA00
3GY0A 1PS8A 1Y81A 2Q1TA 3Q11A 3ZNQA 4ROSA 4RVHA 2VT3A 4CM3A 3GAFA 3S55A 2FHSA 1RM3A 4PLFA 3D4OA 3P2OA 1I2ZA 2YY7A 3ONEA 1E1LA 1MA0A 2HUNA 1YBAA 5A04A 4H16A 1JW9B 5T8KC 1DBVO 1R0LA 4GSKA 4L76A 2VWPA 4BQPA 4NMHA 1IPEA 3KEOA 1GYQA 2IYPA 2VUTA 1ZUD1 3RFTA 2G5CA 1SZJG 4DUPA 1MXHA 2C7VA 2GN6A 3F5SA 1D8AA 3RKUA 3ETDA 4L4SA 3AFMA 1E6WA 2EXXA 3I9NA 1ISJA 2AW5A 2V6MA 4LW8A 3VDQA 3S2GA 1RM5A 1F06A 3QE3A 1IL0A 1E3JA 2Q46A 3M2TA 4MVJF 1KERA 3HNPA 4URFA 2VQ3A 3A1NA 1HLDA 1DHTA 3TF5A 3ZWVA 3LSYA 1WDLA 1C0IA 4A0SA 1U5CA 3WWZA 5JDCA 3IKTA 3PHGA 4M8SA 4L73A 3H2SA 2BGMA 1GL3A 3DZBA 4Q3DA 2I3AA 1BHSA 3PLRA 1GAEO 4RVGA 1VE9A 4AJLA 1DIHA 1YOVA 2ZK7A 4YJFB 4DBZA 2PR2A 1DFIA 2C2YA 3WJAA 2Y1EA 4ALMA 1T1RA 7ADHA 2Y0CA 3KSDO 2AG5A 4IXWA 5DCWA 3K30A 3QJ5A 1HYEA 3UOGA 3JTMA 3I3OA 4IDGA 5TJ9A 5JAZA 4B7UA 5JAIA 2I67A 3DBHA 3PHJA 4PG4A 4U0JA 4U5QA 4Z0HO 2NV6A 5B12A 1T2FA 3NDJA 4PRLA 4DLLA 2CDCA 2PK3A 2ZB8A 1Y8QB 3GEMA 1E6UA 2HU2A 2AQIA 3TRIA 4BQRA 3D7LA 2Y0DA 1DEHA 3DFZA 5I8ZA 2JFGA 3JQAA 5TRTA 2W2LD 3RWBA 2GN4A 3I9OA 1QKIA 2QRKA 1HDZA 2B4TO 4IMPA 2VYNA 5LC1A 3AJRA 2AXQA 4A27A 4CM5A 2GN9A 1GFSA 4JP2A 2P91A 2FSVA 4GMGA 3RJ9A 1G0OA 3K73O 1HDCA 8ADHA 2C20A 1BDMA 2OO5A 4JBGA 4BO7A 4ZQEA 5HS6A 2R6JA 2GD1O 4I8XA 3UCEA 2GASA 4RCVA 1J5PA 3IJRA 5K6AC 4HFRA 1T2DA 1U2DA 4O63O 4OO3A 2WD8A 1N1GA 3EHEA 1UH5A 1GQ2A 2E4AA 3V5NA 1NAHA 2NQ8A 3FF4A 2C29D 3DHYA 4CL8A 5F5NA 2RAFA 3OQ1A 5ADHA 3JYQA 2GGSA 1NM5A 4E4YA 3I6QA 1WXDA 2BI8A 1HYHA 1YKFA 1PZEA 4YAIA 1PL6A 8LDHA 1Y6JA 2Q3EA 2X0NA 3LYLA 4JLWA 2VYVA 3OH8A 4I5GA 4WEOA 4FDAA 1F8GA 2X0RA 4YRBA 5KJFA 5AXBA 1GZ6A 4Q3EA 3FWNA 3GHHA 2Y1CA 1WAMA 5ENDA 3ZWAA 3DBLA 1BDBA 3EGOA 1PQPA 3ROKA 3VHRA 1PWXA 3GEDA 1BRMA 1GUFA 2A92A 3CINA 2PZMA 1I8TA 3GRPA 4D3FA 3VH1A 2CVQA 2IZ1A 3EVTA 4WLOA 5DZSA 2GCGA 5KVSA 1A9YA 4E2XA 1MG0A 1ZMTA 1AXGA 2Q4EA 5TGDA 3WB9A 1ISHA 1NR7A 1YQDA 1H94A 3C85A 3MJTA 4JQCA 4UREA 4DRYA 4M87A 3I1JA 4EJ0A 3FNHA 4E32A 4ALLA 4CM9D 4KUEA 4PLYA 1LEHA 1PGQA 3IKVA 4M54A 4B3HA 3L4BA 3W4KA 1GYPA 2ZCUA 1B7GO 3U09A 5DP2A 1T24A 4YJHB 3DEYX 1EEHA 4C7JA 1I5RA 1BXKA 3IC5A 3QWAA 5HRUA 3U4IA 4PRKA 4HNHA 4LSMA 3KXDA 5EESA 4J7XA 1PL8A 3W8DA 3RD5A 2DTXA 1U3WA 5U9CA 1CETA 4GSLA 3QWHA 4CLEA 1YXMA 3N7UA 3NGLA 1R0SA 1QYWA 4CQMB 2UUPA 3E9NA 4RF2A 1HYGA 1K3TA 2VCYA 3ENNA 3OM9A 1G0NA 1I3LA 2VHWA 4J6FA 2R00C 4Y6RA 1U7HA 4O5OA 1P1JA 5EN4A 4WPGA 2AE1A 3D4PA 3K6JA 1SBYA 3QLJA 3GDOA 3WXBA 1EVJA 5TLSA 4IDAA 4BNLA 4TSKA 1TT5A 1NPYA 4RZHA 4AFNA 1GZ4A 5JC1A 4BV8A 3GVHA 3GVPA 3PQDA 3CZRA 1ADGA 5F3RA 4XR4A 5FEUA 3NYWA 4J43A 2VNAA 4Z6KA 3WDSA 3AI3A 3AUSA 4Y6SA 2DFVA 1FDVA 2ZTMA 1L7DA 1IPFA 1NBOA 1B8PA 4GVLA 3ZWOA 1DC4A 1DOHA 2QHXA 1WVGA 2PZLA 2IODA 4P4GA 4FGWA 4QT0A 4R01A 5C3MA 2VUSA 3RBXA 1F8FA 3GLQA 5KJ6A 1PZFA 3DMTC 3GC6A 5CDGA 1NASA 4CMIB 3GA0A 2D8AA 3KVOA 1V3VA 2NNLD 4GKBA 2B69A 4BKRA 5THQA 1DRWA 1N2SA 3ITKA 1SOVA 2VRBA 5DF1A 2HJRA 1E5LA 1HE5A 1L7EA 2HLPA 4KUHA 1I32A 2Q45A 2WYWA 4HY3A 3WOHA 4J2HA 1KC3A 3NJ4A 2C0CA 3QVWA 1BVUA 1MFPA 2HMUA 2YQ5A 4IS3A 4BMVA 3PZBA 1TEHA 3HE3A 4BS9A 1GPJA 4NHEA 4KTTE 1PJ2A 3PJGA 1KOLA 1GPDG 3GN1A 1E77A 1LLUA 1YB1A 1K2WA 3AU9A 4L0QA 5C37A 2GN8A 1ZXLA 2WMDA 2O50A 1ADCA 2IZZA 3BMNA 3TL2A 5CDYA 4XQCA 1ZSVA 2VWHA 4B3IA 3WMXA 4ZICA 4BKQA 3D3WB 5L9AA 1ZJYA 3KYDB 1EBFA 3IIEA 5TQVA 2YUTA 3RFVA 2NLOA 4MJLA 4UEJA 2JJYA 4ZQGA 3JYOA 1VPDA 1C0LA 1QV6A 4MKXA 1P45A 1DAOA 4R4JA 4CMEC 4PLCA 1JLLA 4EBFA 1R15A 3QVTA 4W7HA 2YV2A 1GQYA 3F6YA 3I9JA 4LMPA 2DT5A 4IXTA 1EQUA 3NDRA 1DIRA 1ONNA 1IZ9A 1PL7A 2DU8A 4J4HA 3WGOA 1ISGA 3HADA 1NAIA 4RJTA 2PV7A 3S8MA 1ZKMA 1KVRA 1ZNQO 3P2YA 1EK6A 3G49A 4I9HA 1AGNA 4K6CA 3C7AA 1ZK3A 4IBOA 4MVJM 4B4WA 3U3XA 1ULSA 2ZQYA 2C5EA 1X13A 2BRUA 3CIFA 2VHVA 1UDAA 3H7AA 5A9TA 4B7CA 3RASA 3WR5A 1XG5A 1XWFA 2CDBA 2EV9A 1UP4A 1VLLA 3GZNA 2X0IA 3PYXA 3W6UA 2WD7A 4W7IA 3JQBA 4AG3A 2I76A 3GQVA 1M2WA 4GI2A 4ZJUA 3F1LA 2VNSA 4A5OA 2X6TA 3FRJA 1W0CA 1GQQA 2ZYDA 1LI4A 1EMDA 1PR3A 4XA8A 5TJHA 4YYZA 1LC3A 1WWKA 3N74A 1CRWG 2EWMA 5GZ6A 2BHLA 1U9JA 4XDYA 3BMCB 1SO8A 3X2EA 2YDXA 1ZH8A 1EE2A 2ZTUA 5JE8A 1WMBA 4NQZA 2NSDA 2CNBA 1VSVA 5JXWA 2GLXA 3T7CA 3RUEA 3MWDB 3WYCA 4YACA 1TLTA 3A14A 1GV1A 3H9EO 1YRLA 4BNKA 1B15A 2POQX 3LC7O 4BO6A 3RFXA 3GPDG 1E3WA 3I6IA 5HTOA 4YAJA 2PGLA 4DMMA 5KWEA 2E37A 3DAPA 5IZCA 1AHIA 3FHLA 2AMFA 2GSDA 2O3JA 4OIMA 1ISMA 1H5QA 3JQEA 4D0RA 3VH2A 1OC4A 4WECA 4LRSB 1OFGA 5L4SA 2FR0A 3GNQA 3RUCA 4TRMA 1NWCA 5ILGA 1YB4A 1X15A 3F4LA 1U28A 1J0XO 1Y9EA 2HMVA 1XSEA 4IMRA 2ZCVA 3ZHBA 1XR3A 4B4VA 3L9WA 3K92A 4IDEA 4CMKA 3TOXA 1KVSA 3DL2A 4D45A 4EGFA 1LDNA 1N7HA 1Q2XA 2O4UX 3AM5A 3OA0A 4FFPA 4WCFC 5C7LO 5C7OO 5JDIC 2DVMA 3STHA 3HN7A 1LBEA 4O59O 2SCUA 1IHXA 4YWJA 5IDQA 3WGZA 3GPIA 1F17A 4UVEA 1CQJA 4OXKA 2FZEA 3AM3A 5DT9A 3INGA 1BSVA 1T25A 2BFPA 2H5LA 4R1NA 2VHYA 3TQHA 5EL0A 5FFFA 1PQWA 5FI5A 2Q4BA 4WOKA 1LQUA 5I7SA 3MJSA 4HP8A 1X7DA 1VC2A 4CLHA 4II3A 4EUHA 2O4CA 3ETEA 1R4MB 1BGVA 4MVJI 4WUVA 3OMLA 5J23A 3LT1A 2BGLA 1I2BA 4XGNA 1M67A 3RUFA 1YB5A 1NYTA 4YXFA 4YCAA 5CAEA 3D5QA 2V7PA 4J3FA 1T2EA 3TZ6A 2EW8A 3DB2A 5AVOA 2NU8A 2H1SA 3DHEA 1XCBA 5A5FA 1AUPA 3JQGA 4IJKA 5L7YA 3KM0A 3GOHA 2H9IA 3DC2A 4XYGA 3P7MA 3ZH2A 5FYDA 3W8EA 1CQIA 1V9LA 2QIOA 4NG5A 3DOCA 3GDGA 1P74A 2JCYA 4DPMA 2QG4A 4RZIA 4CMJA 2PZJA 3U0BA 1KY5A 4MP3A 3MOIA 2Y68A 4RL6A 2EERA 4G65A 3O8QA 2Q2QA 1MXFA 5IJZA 1XA0A 1Q7BA 3DO5A 3H9UA 4WLFA 3ZWPA 4EITA 4UVGA 4W9NA 1EUCA 3PPIA 2UAGA 2YYYA 3ZWBA 2A94A 1LRJA 3ZCXA 4WCDA 2GUGA 3PJFA 2FPPA 5FI3A 1D1TA 5FWNA 1SB9A 3RUHA 1SEVA 1IULA 1WZEA 3ABIA 5IXYA 4JJFA 3OQBA 5LDGA 1BXZA 3RI3A 4G81A 5KKCA 1PS9A 4K28A 4IZHA 2QZZA 1AN9A 1LUAA 2P5UA 4MPDA 1PGNA 4RPLA 4GH5A 2B35A 3ZDFA 3D3EA 1E5QA 5JAQA 2OP1A 2C2XA 1YOVB 3Q2KA 4CPDA 2NTVA 4IGEA 2JD1A 2VN8A 4YVFA 2G0TA 4E5MA 3M1AA 1ZSYA 5K0ZA 4ALKA 5CG1A 4R16A 1UP6A 3PLNA 1MX3A 5T57A 1QP8A 2W8ZA 4Z3KA 2JAHA 4GX5A 1NFRA 1Z82A 2A35A 2ZKLA 4FFNA 3ORFA 1JVSA 4FFRA 1EVYA 3RJ5A 4DREA 1GUZA 3DBHB 3BXXA 2EHDA 4YRDA 1YONA 3QA9A 2P9CA 3KUXA 1QV7A 4RQUA 2AHRA 3GGOA 3G79A 1ISFA 4CLXA 1CYDA 3JQAB 1XKQA 3GN2A 5HM8A 4BO1A 5U4QA 1HDYA 3GZ4A 1SEPA 5I9NA 2EP7A 3AUUA 2J3KA 5K9ZA 3V1UA 4D41A 4CM6A 1YJ8A 3R3JA 4Z9FA 3MZ0A 1HE2A 1ISIA 1GADO 1GCOA 1XQ6A 3CXRA 3JQ9C 4GL4A 5AYVA 2EEZA 5ES3A 4AICA 2D5CA 2Y0EA 4GX1A 1ONOA 1CERA 3EY4A 1I24A 1YL5A 3NKLA 4HBGA 2CMDA 3WGTA 3OEYA 3P19A 4MVJD 3H9JA 4OSPA 1PTJA 4CUZA 3I9KA 3GG9A 1S7CA 4MINA 1M6WA 1YDEA 4ZD6A 5BSHA 5A1TA 4KDFA 3KBOA 1KBZA 2UUOA 1E1KA 1H9AA 1RYDA 4ZA2A 5EIOA 5ICMA 3S2IA 3W4IA 4C4OA 1QYVA 2VWQA 3ROMA 1VSUA 3DOOA 5EPOA 1T1SA 4TZKA 3WWYA 4MIOA 3KSUA 3DAGA 1MC5A 5COAA 5T5QA 5BSFA 1JVBA 3RSHA 1FDUA 2DAPA 4CM8A 4XB2A 2Y67A 1HETA 2D0IA 2CSUA 1TXGA 3TDKA 1YL6A 2Y1OA 3DBLB 4XYBA 2JCVA 1YQGA 1B8VA 2RCYA 4WNCA 4FC6A 1CDOA 4RORA 4Q3NA 2DBVO 5GY7A 4BKOA 1HLPA 2LDXA 1C1XA 1E7MA 4BNIA 4M1QA 3WNVA 4G2NA 2TMDA 5GZ3A 4QFCA 3E8XA 4NJOA 3S2FA 3UICA 3MJ4A 2BELA 4OQYA 4F6CA 5EJ2A 5ILOA 2V6BA 3M2PA 4TKLA 4XJTA 2HRZA 3LK7A 4DLAA 2I5PO 3BMQA 3V2GA 1KYQA 5HWSA 4ZHSA 4IQ0A 1E1MA 2O3TA 5I7VA 3PJEA 1PIWA 4OOEA 2PH5A 4HUJA 4I08A 4OKNA 4XKJA 2RIRA 3JYPA 1KEVA 3Q0EA 3LDHA 3BMOA 3OJOA 3EAGA 2PGDA 4M49A 1GDHA 1EVZA 3FNGA 3IP1A 3ZWMA 5B1YA 4YQZA 4ZRMA 1U5AA 3VH3A 5JCJA 1O89A 4CQLA 1BXGA 4PVCA 2DKNA 2Y05A 3IMFA 4OH1A 1LU9A 1I3MA 4EYEA 4J0EA 1J4AA 3JD2A 5ENVA 1PGOA 2GERA 2YDYA 3PEFA 2YHUA 1ZK1A 3WNQA 5L4NA 3AOEA 4E6PA 4K9DA 4DA9A 1QLHA 4R68A 4OXNA 2HK8A 4J4TA 3JD1A 1YL7A 2OGUA 3UN1A 3ZNPA 1HDGO 4IUYA 3AI2A 1NX6A 4LCJA 5JBIA 4BNUA 1TT5B 4Y98A 4XWYA 2WEKA 1NFFA 1HL3A 2ZB7A 1E92A 3RC2A 1GCUA 1OMOA 4HKTA 4XGKA 1YJQA 3JQCA 1UDBA 1D4FA 3H5RA 4IDBA 3PQFA 2W2KA 4DMLA 2NVBA 1XU7A 4EJ6A 3PFFA 3GGGA 2BF7A 2OOSA 2NADA 3MTJA 5CHEA 5IDYA 4DIBA 1ZVMA 5DULA 2ILTA 2JL1A 3UW3A 3VDRA 2X9NA 3GVCA 3VTFA 2CVZA 2HMWA 1A7KA 3MCVA 4DTIA 5I9LA 2EW2A 5G4KA 4CMAA 1ZXBA 3UFXA 2I66A 3M1LA 3GNSA 4PZEA 4B8WA 3RCBA 1KEPA 3PYMA 2BMAA 3GR6A 4B8ZA 4LVCA 1B16A 4MKZA 1LDEA 3VZQA 3F9IA 2FZWA 4ZN6A 3O26A 2VYVD 5DBIA 1GR0A 4B7XA 4BMNA 5A9RA 4CMGA 3FR7A 2IEBA 2GF2A 5DNAA 2O3UA 4QO7A 5BNFA 2QW8A 5BQFA 4DYVA 4CM4A 1DFHA 1Y5RA 4WLEA 1E7SA 2B83A 4NFSA 2PWZA 5F1KA 5ER6A 2YHIA 3BMNB 2E48A 3DBVO 1ZW1A 2WE8A 1C1DA 1H2BA 1UUFA 4KMSA 3HZZA 3UKOA 3JV7A 3AUTA 5C7IO 4UUPA 1O6ZA 1IB6A 4G5HA 3WTCA 4WNIA 2IYOA 2QYSA 2W2LA 3TWOA 1ADFA 1GD1O 1U3UA 3AI1A 3KO8A 3RQSA 4AJOA 3F46A 4JX8A 1ONPA 1PJCA 3BIOA 2Z5LA 4D3DA 2OP0A 4UUMA 4BNYA 4E31A 1JAXA 4FPXA 4I5DA 1ZSNA 4N5LA 4BO8A 1EQ2A 3IUPA 3F1KA 3GGPA 3AM4A 3D4NA 4PLTA 5A9SA 1TT7A 1JWAB 3IJPA 1U3VA 1P33A 3MOGA 4LSWA 1Q1NA 4BGVA 1VM6A 4FGSA 2JAPA 3JD3A 2PD3A 4HX5A 3FPCA 3FTPA 3RAJA 5JMWA 1PJQA 3H5NA 4WLUA 1QG6A 3RUIA 1EK5A 4P38A 2I65A 1ML3A 5MDHA 2DBZA 1R37A 1YQXA 4PLVA 3GZNB 3DBRA 3DOJA 2H6EA 3GAZA 1QLJA 3ADPA 3DTYA 4GWKA 1Y5MA 3C8MA 1OI7A 1JN0A 1UXKA 2FR8A 2WSBA 1HTBA 1KS9A 3BTSA 3R1IA 4FB5A 5ITVA 2VOJA 3ZV3A 2XXBA 2P9GA 3AY3A 2B5WA 2EGHA 3C1TA 4OJNA 2IDZA 4DQVA 4QX6A 3OJEA 4PG6A 4OOFA 4MOWA 4CV2A 4DPKA 2ZATA 1FK8A 4PVDA 3UGKA 5B4TA 1K5HA 5DP1A 3K31A 1RJWA 2R2GA 4NH4A 3VAZA 3VPGA 3FBGA 3HHPA 3ZHXA 5B4UA 5IDXA 3GT0A 3PFWO 2V6GA 4FC7A 5A3JA 2NWQA 1V3UA 1F12A 3VH4A 4H3VA 1YBMA 3IOYA 1BWSA 4NBRA 4NU5A 2X5JO 4YDRA 2XPCA 1ZIDA 2Q1SA 2FOIA 3C7CB 3CH6A 5CG2A 4GX2A 5JO0A 1C3VA 3NX4A 3HB4X 1Q0LA 4YAKA 1E3WB 3MTGA 4NR0A 4Q39A 3GMSA 4AJ4A 2X0JA 1EUZA 1HZJA 1ULUA 4J16A 2WE7A 5JYDA 1I0ZA 5ICSA 2IXAA 1N8KA 4QEDA 3EVNA 2LDBA 4ILKA 4QSMA 4B4OA 4YT8A 1GU7A 4YJFA 4GVXA 3E9MA 2J5RA 5H83A 3RIHA 3KETA 3PK0A 4LMRA 4E3ZA 4MIEA 1YH3A 2EJWA 1P1IA 4H15A 5B4VA 4FFLA 4Y6PA 1K6IA 3Q1LA 3WX0A 4ZGWA 4JCOA 4PGFA 3RUAA 2AQKA 5I7EA 4RPGA 4W9NC 5COBA 4MDHA 3H5AA 1VJ0A 2B4RO 3BZUA 2QRLA 2E82A 3FCOA 1L1FA 2C59A 1M66A 1MV8A 4D44A 1PJ3A 4E30A 1B3BA 4I9UA 3C7DB 1DAPA 1N5DA 3VVBA 1K0UA 4M86A 2Q1WA 4GWGA 2OZPA 2Y93A 1E7WA 2J3JA 3ANMA 3KOUA 3WG9A 2BLLA 4X54A 2DPHA 2AG8A 2Q49A 2VRCA 2I3GA 4GLLA 1LRKA 3G17A 3JD4A 3PI7A 4FJ0A 1PX0A 3K2EA 3L6EA 4DVJA 1YGYA 1YVEI 3OECA 3K96A 2JHGA 1J49A 2EJVA 2YFHA 1NQ5A 4BB6A 2RHCA 3LC2O 4CMCA 3WGGA 3D64A 2D59A 5TC4A 4A26A 4R9RA 3E9QA 4XZ3A 4BNMA 4F3YA 1K89A 1TA4A 4YEDA 3U49A 4CM7A 4HNGA 1R66A 3UCXA 2Y1FA 1DHRA 4CUKA 6LDHA 5I7FA 3JQGB 4YAGA 3ZU5A 4B4UA 2PTGA 4E5PA 1TI7A 5CDUA 1E3IA 4CUJA 2NTNA 3BYZA 1FXSA 1I3KA 2Q50A 3GG2A 3HSKA 3QVOA 2WM3A 3VTZA 3HDJA 4QXMA 4UUNA 4YJGB 4J4BA 4IDCA 1DC5A 3PQEA 3OIDA 4XDZA 3L07A 3HDHA 2GDZA 3O8QB 1I2CA 4JNKA 4J7CA 3NTRA 2NU9A 1OAAA 2VZ9A 5L40A 4RDHA 4NBWA 3O4RA 4K6FA 1P0CA 3I83A 4TROA 2XAAA 3WIDA 4YPOA 1AXEA 4YQYA 5I8WA 3KYBA 1LJ8A 4XRRA 4O1MA 1PJSA 3PTZA 1SMKA 3IQDB 4INAA 1EZ4A 2Q2VA 4E21A 1LDGA 3ZWCA 4BOYA 2V6FA 4CQMD 2EKLA 1NHWA 3H6KA 2AEJA 3CE6A 3WYEA 5IFLA 3CTMA 2F1KA 5TNXA 4OYRA 1ENYA 2D4AA 4I9NA 3ZWNA 3U9LA 4CLOA 1PGJA 1KY4A 1JU9A 4U6SA 4E2ZA 5B37A 3ZZNA 4CM1A 4J1SA 3ZHYA 2O48X 4YR9A 3H9GA 5TSDA 1Y8RA 3GFGA 4KDEA 3BHMA 3CPSA 4IJUA 4PLHA 1N92A 1P44A 3JQFC 1R6DA 2EKPA 1MC4A 2P68A 3R3SA 1PZGA 2CF6A 5K6AA 1A7AA 2P2SA 1LTHR 3HN2A 4ND1A 3VVCA 3ZWYA 2VTDA 3UCFA 1ORRA 3GVXA 1WLYA 4BIIA 1UZLA 3RVDA 5BT9A 4AJHA 4E5KA 3PGJA 4Z9XA 2UYYA 5F1OA 4GMFA 1U7TA 3ZV5A 4CR8A 1JTVA 3L9XA 3V8BA 1X1TA 1LX6A 4J49A 3TPCA 4CMHA 1JQBA 4DIFA 1A9ZA 1T2AA 1T2CA 4JROA 1UZNA 2OHXA 4LGVA 5KVVA 3G0OA 4ITUA 4II2A 4YT5A 1HWYA 3GUCA 3INRA 4JBIA 4P4NA 5EERA 3CMCO 4Z3DA 5KNLA 3TZQA 3FSRA 1Y1PA 4BNFA 3WGYA 3NT5A 1P1FA 2AA3A 4E5NA 2HO5A 4GQAA 2ZYGA 1HZZA 4CV0A 5BR7A 2IRWA 1B14A 1PQUA 3WLEA 4FJ1A 1DSSG 4PG5A 4D0SA 3EW7A 4BKUA 3QIVA 4NU6A 3VKVA 4IDDA 3TL3A 5JS6A 1RKXA 2DBRA 4NI5A 4RF3A 4U8GA 3QY9A 3Q9UA 3OJFA 4TRNA 4YTEA 3HDQA 2NTJA 5IN5A 1Q0HA 2RHRA 3UH1A 1BTOA 3TOZA 4ND5A 2GO1A 1DJQA 3ICPA 2OUIA 1T4DA 4EUEA 4S1VA 4OQZA 5JDCC 3T4XA 2DTDA 2AQHA 4IDFA 3WQRA 1MFZA 2BKAA 3EUWA 3RC1A 1VKNA 5G0WA 3QWBA 3NJ8A 4CR6A 1D7OA 2GZ3A 3L6DA 4P4LA 3E6AA 3I4FA 2VUUA 2IZ0A 4UAGA 4NFYA 4BVAA 1XIVA 2I6TA 3PIDA 4L74A 3RC9A 2Y1GA 1C1XB 1E1NA 1M76A 3K9QO 5KJ1A 4Y67A 1PJTA 1U2GA 1ENPA 3VZPA 3ZHZA 3LC1O 3E48A 1H93A 3QVXA 4YAEA 1H2HA 3BMQB 4ND3A 3V1YA 1ZK4A 2W98A 1AHHA 5HBRA 3QW2A 3A06A 4DGSA 2B37A 2WJPA 2PLAA 5TX7A 2BFAA 2X9VA 1SAYA 3L77A 2C07A 4BB5A 3K5PA 3EZYA 3HFGA 3GF4A 2OFPA 1KEUA 1EFLA 4MO2A 4MVJP 4NK4A 1R4NA 3I9MA 4JIGA 4Q9NA 3BMOB 2HSDA 1Z75A 2I9PA 3DAFA 3JD0A 4MKRA 1V6AA 2CUKA 4PIVA 5DOVA 4D7AA 1Y7TA 1UZMA 1LSSA 4RF4A 4BO5A 4CQLB 2HJSA 3ZV6A 1I3NA 1N9GA 1T4BA 1U1IA 1YO6A 2FPGA 2O7SA 2P5YA 3F47A 3TZCA 5L45A 3TFOA 1FDTA 4ESOA 1NNUA 3KYCA 3NTOA 1XDWA 1H6BA 1IYZA 4NJMA 4D79A 4FD3A 3DZHA 4NBUA 2FN7A 3DMTA 3U4DA 5IZ4A 4FR5A 2X86A 4BNVA 3NEPX 1UXJA 4A2CA 3ST7A 2X1HA 1K6JA 2J8ZA 4CV1A 3O9ZA 4BNTA 3G3EA 1DIBA 4JXKA 4WJZA 5HA5A 2VWGA 3PVZA 2G82A 2QZ9A 3HG7A 2WYUA 2YV1A 4BL5A 1ZMOA 2QYTA 3HFSA 4LISA 1A71A 3LLSA 1Y9AA 3QQPA 4F45A 4J0FA 5C5IA 3IDSA 1O94A 2RH8A 3Q6IA 3OJ0A 3T7EA 3L4SO 2B4QA 3KHUA 2C5AA 3NUGA 2W2KB 1WPQA 2X7HA 5F1PA 2VZ8A 4GBJA 3TN7A 2GYYA 4RO0A 2JKVA 3BA1A 5KTKA 1Z73A 1NR1A 3OETA 5JPIA 1CEQA 3IS3A 2BFMA 4AJ2A 1LA2A 3RROA 1VL0A 3PIIA 1ZFNA 2HMTA 1BMDA 3DHNA 1SCUA 5FF9A 3SX2A 5G4KB 1I30A 4C7KA 1VRWA 4CMEA 2GNAA 1ARZA 1RM0A 3PWZA 3LLVA 2BFOA 1WW8A 3ANLA 4NIMA 1I33A 1B8UA 1ZZEA 5BNTA 5G4LA 5F5LA 5AQ1A 4U7WA 3E18A 4ZQBA 1SNYA 1UJMA 3L4BC 3KLPX 4AL4A 1T26A 2ZB3A 3PGXA 2JHFA 2Z1MA 3WGQA 2QRJA 3FD8A 4NK5A 5DBFA 3JSAA 5JFOA 3GFBA 2PGJA 2X5OA 3D0OA 3RC7A 2DBQA 5IN4A 3H65A 3JQDA 5L4LA 2PKQP 3DWFA 2V65A 4RPHA 2W90A 2JD0A 2YHIB 3OHSX 4YBZA 5T64A 4E12A 5DOZA 4JJGA 3EMKA 1C1DB 4IM7A 3U4CA 3IL2A 2WDZA 3W8FA 2E6UX 5DCYA 2O23A 3HWRA 5A02A 3B1FA 4WK6A 3SBOA 1CIVA 3QHAA 4J9VA 5L53A 1VL8A 5KIAA 2DLDA 2J5QA 3JYNA 4AJEA 1KC1A 4ZU3A 5CFZA 5CPBA 6ADHA 4AJPA 2P4HX 2Y99A 4Q3CA 3C1OA 3LT0A 4N5NA 5IXSA 1A4UA 3OICA 4JBHA 5A9SB 4XIJA 4U0KA 5DN9A 3ON5A 1U8FO 3VPSA 4LN1A 2X9GA 1NVGA 3JQ7A 3PDUA 3R0IA 1ENZA 3NGXA 4IIVA 3KRTA 4D3SA 1E3EA 1X14A 5EQDA 3RUDA 4FW8A 4A73A 2NU6A 4DC1A 3B1KA 2QQ5A 2BI7A 5L51A 5BSEA 1LC0A 3LF1A 1OZAA 3X2FA 1S6YA 1Z7BA 2DM6A 4BGUA 4NPCA 4Y9DA 4QTZA 1GTMA 1GV0A 1I10A 3DBRB 3FNFA 3AK4A 1DRUA 2B0JA 1PR9A 1B26A 1NFQA 1U4SA 3RKRA 5HS4A 1B3RA 1LLCA 3CUKA 3QSGA 1O8CA 3QP9A 4TKMA 4IPTA 4CR7A 2W4QA 2XOXA 5BNIA 1YS4A 1U8XX 2BH9A 5GMOA 1Q7GA 1EFKA 1PS0A 1R16A 5G0UA 4A03A 2X5KO 2UV8A 2C82A 4DIOA 1V35A 1X7HA 4PLPA 2PY6A 4OGWA 4PLWA 4K26A 4S3MA 1LLDA 2VZ0A 4K1LA 2YW9A 4KTVE 4EDFA 2Y1DA 4M55A 3ETGA 3CSDA 2EKQA 4XIYA 4CLRA 3CMMA 4WCFA 3JQ8A 2QX7A 4ZQFA 5JDIA 4O0LA 4BNGA 1HT0A 1U3TA 4J90A 3ENKA 4PLGA 1BW9A 1HXHA 5IDWA 2J5KA 3DZJA 4NBVA 1XEAA 3JQAD 2RBEA 2PH3A 3GH3A 1I01A 3GEGA 2FPIA 4GKVA 3S2EA 1LSUA 3SJ7A 1J6UA 2VYND 3B20A 3KV3O 3SLGA 3NV9A 3NRCA 4PN3A 2B36A 1KIFA 3H3JA 5JY6A 1ZO8A 3FTNA 1YWGO 2DC1A 4H7PA 5TF4A 4HFJA 3C1AA 4NNJA 4XR9A 4FQ8A 1HDRA 4R3NA 1IOLA 4NBTA 3H4VA 7MDHA 2NVWA 5A4DA 9LDBA 4A10A 2DFDA 4JK3A 3BTOA 4RF5A 1NXQA 3UXYA 4BO2A 1QXSA 2NACA 3UF0A 3NT2A 4RLHA 3AU8A 3INTA 2NVUA 4RVSA 5JLAA 1MP0A 4XGIA 1Z45A 5CDTA 1E3SA 4BUCA 3NAQA 2HRBA 3H3FA 4OAQA 5JNLA 1VKOA 1KEWA 2E49A 3DONA 4MVJH 1SC6A 4KUGA 4FSHA 4MP6A 3JQBC 3PJDA 3W4JA 3CEAA 1LSOA 1NHGA 1NVTA 1XYGA 1O0SA 1YDWA 3WQSB 1V8BA 4E0BA 1N1EA 4DQXA 5TS3A 1UAGA 3AFNA 1HDOA 3PYLA 5MGBA 4E13A 4NDNE 3QVSA 2OBNA 3DR3A 3ZNNA 4MIYA 1PJLA 2BGKA 1JWBB 4Z0PA 3IUSA 3D5TA 4DL9A 4YT4A 5JW6A 3TFQA 3OSUA 3IP3A 2HKIA 2G1UA 2AQ8A 3TJRA 4IQGA 1GYRA 4OL9A 3RBVA 4ALIA 3WFIA 4DC0A 3I9LA 5KJCA 3NT4A 3V1TC 3TNLA 1RYEA 4UVDA 1NP3A 1GEEA 1JKFA 1VJTA 3PHHA 4YB8A 3CKYA 4R1UA 5AXAA 2NU7A 3GVIA 3GRKA 3WICA 5TIIA 1JKJA 1XLTA 5U1PA 4BO4A 1PU2A 4R1TA 3DMYA 1P0FA 1PJBA 2HK7A 5CEJA 2J3HA 1EDZA 4BNHA 3BHJA 1GEGA 2CZCA 5IZCC 1ZJZA 4FFMA 1PWZA 2OMEA 2A9FA 2WTBA 3SC6A 2IEDA 3ZW9A 1E7QA 2TMGA 5A03A 5G0VA 2X8LA 3WLFA 1DC3A 4XYLA 3ZU3A 4KQXA 4JP3A 1ZK0A 4GPD1 3OEWA 4UEKA 3MJVA 4R9SA 4RVUA 3GDFA 4AJJA 5GZ1A 4EW6A 4FS3A 3GHYA 4R54A 1SOWA 2WD7B 4HV4A 2VOEA 5KJEA 2IXBA 5G0SA 1UR5A 3P5SA 3PRJA 3EYWA 3DZGA 1LQTA 1DRVA 3E82A 3JCZA 3Q2IA 4CLOB 1DIAA 4TVBA 4XQEA 1IHYA 4IJVA 4WLNA 1F0YA 1H6DA 1H0KA 3H9QA 3ICCA 3IAHA 1X0VA 1Y8RB 3U4HA 4QQRA 3OA2A 5LDHA 2O2YA 1HKUA 1MUUA 2D2IA 4DYDA 3JQ9A 1V3TA 3B70A 4D43A 4UULA 1UXGA 1C0PA 4MVJE 2ZJ0A 3WMWA 2P4QA 3I5MA 4KZPA 5DBGA 1DDOA 2DPGA 5ITWA 1W8DA 4FN4A 4R51A 2RH4A 4EEXA 1H9BA 1BG6A 3ZW8A 3U5TA 1MG5A 5L7TA 2GR9A 1QMGA 4I5EA 4DWVA 3ITDA 4RQTA 1A72A 3LZ6A 1NPTO 3K2BA 3ZI0A 1WDMA 2EP5A 3DZIA 3VC7A 4BMSA 5THKA 3NTQA 3PWSA 3HJAA 3WSWA 4L9RA 3I52A 4CM9A 2GPTA 1M75A 1Z74A 5BSGA 4WEQA 1SPXA 3Q9NA 5H82A 3OFSA 2O2SA 3E5MA 4M89A 4CJXA 2CVOA 3RU7A 4KWHA 1E6EA 1P9LA 4ZRNA 3LF2A 4DBVO 2VRCD 3FR8A 4R69A 3PP8A 1WZIA 2NQTA 4J1NA 1R0KA 4FJ2A 4MVJG 2YJZA 1DPGA 1PEDA 1NWHA 1D3AA 1Z7EA 2ZIZA 1NVMB 1O5IA 2XXJA 4HADA 4CODB 3D1LA 2ZJ1A 4N18A 2YQ4A 3FN4A 2AE2A 5KVCA 4RPJA 4R3WA 1VL6A 1HE4A 3N58A 1WNTA 4AJNA 4BO0A 4A7PA 4BNNA 1HE3A 3GUYA 1Y8QA 1LXCA 2AEMA 1E7RA 1QRRA 3ZU4A 1DIGA 3VPFA 4I5FA 2X4GA 5T8KA 3GK3A 3WYBA 4ID9A 4Q3AA 1FJHA 4O6VA 4RVDA 5A5EA 3SJUA 9LDTA 1E3LA 5EMHA 1A4IA 3KB6A 4IJWA 1LDYA 3HUDA 4OHUA 1B0AA 5A06A 3B6ZA 1EE9A 2Q2WA 3SEFA 2HQ1A 4LVUA 4W4TA 4N5MA 3T4EA 3G1UA 1H6CA 2EIHA 3PHLA 3QV1A 5JAMA 4XYEA 4WKGA 1OC2A 2OORA 4R1SA 2EG9A 1IUKA 1ZEMA 4XEHA 5JSFA 2NUAA 5KKAA 2IE0A 5CEFA 3MWEB 5DCUA 3R6DA 5IF3A 1AE1A 4YJDA 5EQFA 4Z9YA 5EINA 4PFJA 5KVQA 4XJSA 1FF9A 2CD9A 5TT1A 2B5VA 4R41A 4R5MA 2C7GA 4HFMA 1X1EA 3JYLA 1E7YA 3WGHA 2DUWA 3ROQA 1RM4A 1YBVA 4W82A 1FMCA 1QYDA 1C14A 5CPFA 3GMDA 3VKUA 2FRDA 3SLKA 4XCVA 4D42A 3OIGA 3ADOA 4XD2A 3OIFA 4QECA 1R4NB 4BNWA 2O3RA 4RVFA 3OBBA 4TZTA 4L8VA 4OKIA 5F21A 4LRTB 4ND4A 5JY1A 1DJNA 3WGIA 1XU9A 2PZKA 3PDJA 3DXFA 4QO8A 1EBUA 1PZHA 1UP7A 1N9GB 4RGBA 3KSZO 3EZLA 4J1QA 3ZGYA 3LT2A 1GY8A 4BNJA 5T67A 3KYCB 4NJMB 4ALNA 4FBGA 1MGOA 2YV3A 3MJCA 1MLDA 1TVEA 4IGFA 2VTEA 2YZ7A 4QUKA 3SXPA 2C54A 3A4VA 3F5QA 2CFCA 3ZWXA 2VT2A 4IZIA 1SB8A 3C24A 2O7QA 3VPHA 3ONFA 1LLQA 1QSGA 2FR1A 3WS7A 4TQGA 4BHTA 3S1LA 4E2YA 3I23A 3ZV4A 1EVIA 5A3VA 2HAEA 3KTDA 5TT0A 3WTBA 5JYEA 3UAGA 3TZKA 1C0KA 1HSOA 4TVOA 2UVDA 4XX0A 5ER9A 1NTOA 4PZCA 4YJHA 4ZVVA 3QWIA 3WBBA 5DDIP 2OBYA 3E5RA 3G1TA 4F6LA 4U6QA 3B1JA 3K8ZA 4OXYA 4UVIA 4EJMA 1P1HA 2D3TA 4AJIA 2D5AA 3VPXA 1PJ4A 1FDWA 4BNZA 5JCXA 1Z6ZA 2HK9A 1NQAO 4CLDA 3BTUA 4CQMA 4UEOA 5IG2A 2WWRA 5JMPA 3KLMX 4EI2A 3GNTA 2ET6A 4WGGA 3BHIA 1K6XA 5COQA 4BO3A 2HMSA 1M6HA 2JFHA 1NQOA 4B79A 2X58A 3ASUA 4BGEA 1F14A 4DLBA 1O9BA 3L6OO 4J7UA 2DQ4A 3PWKA 2H63A 1KETA 1P3DA 2ZB4A 1A5ZA 3ULKA 4WE3A 5T6BA 5JO9A 3DZKA 4IIUA 2O3QA 1P31A 4AJ1A 1DLIA 5IAAA 1MB4A 4ZQHA 3LT4A 4Y8VA 2J3IA 2JD2A 4XQ9A 5AXCA 3AW9A 3H2ZA 2A4KA 4TMFA 1VJ1A 1LDBA 1P77A 2FMUA 2GZ2A 4TRJA 3WFJA 3DZFA 2PA3A 4L4XA 1KVTA 4XB1A 1XHLA 1HRDA 4JGBA 4P8RA 1FDSA 3AOEC 4J1TA 4CMIA 2PD4A 1R12A 3AY6A 2X23A 2OXIA 2P9EA 4L4RA 1JA9A 3KEQA 3WIEA 1XELA 4CM8B 3MJEA 4GAEA 4JN6B 1LRLA 1VI2A 1JAYA 1LSJA 4TWRA 5CDSA 3FPLA 2ZTLA 4GX0A 5I9MA 4BNXA 1NQTA 5CEEA 3C3XA 1IY8A 3M6IA 3ZNOA 1LDMA 3OP4A 3WBFA 1G1AA 1EUDA 3I4CA 4UVHA 3DFUA 4KOAA 3JQ7B 4BV9A 2UDPA 4WLVA 4LK3A 4XRGA 5KCZA 3TSCA 1B2LA 1XGKA 4MP8A 4ONEA 3W6ZA 2R00A 3AUAA 4PCVA 2OL4A 3JQ6A 4DQUA 1RWBA 3D3WA 3EDMA 3KYDA 3EK2A 4J91A 1GUYA 1H6AA 1UXHA 1WMAA 2HCTA 2FY8A 1IE3A 1N7GA 3ANNA 1LNQA 3FWZA 3WJ7A 3ZU2A 1O95A 4BGIA 4KP7A 5H81A 4D46A 4GGPA 1DLJA 4GLOA 4RV9A 4DXHA 4IY1A 5AXDA 4F46A 4I1IA 4YT2A 1A27A 3LQFA 4AJKA 2JFFA 1ID1A 4YJGA 3ZWWA 1BXGB 1UDCA 3H8VA 1W73A 4OM8A 3QWFA 1CWUA 1XQ1A 2ZTVA 4CL3A 3W1VA 2DTEA 5A05A 1G6KA 4OSOA 3HDYA 1PSDA 3V2HA 4AVYA 2ZQZA 1P1KA 1U4OA 3CZMA 2FSSA 3UUWA 3WQQA 3LU1A 4CLRB 4E5YA 3A28A 4WCFB 3JQ8B 1WP4A 2EF1A 4FFOA 4Q3BA 1ZCJA 3BAZA 4PLZA 4PZDA 5L3ZA 4PG8A 3AWDA 1CF2O 1BW9B 2Z1NA 1ZK2A 4PG7A 1D1SA 3ZN2A 1X0XA 1P1RA 1E0DA 2HDHA 1W4ZA 2PD6A 3O38A 2PNFA 4HXYA 2PKQO 3VZRA 1DO8A 4IQ8A 2PKRA 2FWMX 1JKIA 3U62A 5G0TA 2WYVA 4YA6A 4E33A 1ENOA 3SVTA 3TZHA 4J2OA 1RPNA 2BD0A 3O03A 1I36A 4FOSA 3KZVA 3E03A 1HDXA 5JC8A 3FI9A 1QYCA 2G76A 4GGOA 3BMCA 4B3JA 4LCEA 1DB3A 1V0JA 2GRAA 3VOSA 2AEFA 1BVRA 4N54A 1KVQA 2NVUB 4ND2A 2D1YA 1PGPA 4N7RA 4IINA 4RPKA 1HEUA 4NZ9A 3EC7A 2JCXA 4J9UE 4Z0TA 1DFGA 3VZSA 1ADBA 2Z95A 5AOVA 4DPLA 5L95A 4CV3A 3AOGA 2VHXA 1HSZA 1KVUA 2J6IA 1GZ3A 3ASVA 2EGGA 3HB5X 3DQPA 4TRRA 4FIZA 4KWIA 4XQGA 4EUFA 5CP8A 5L7WA 2CY0A 4ALJA 4NFHA 1UAYA 3PXXA 4XYMA 2X22A 1HF3A 4RDIA 2FP4A 5LCXA 4EZBA 2GZ1A 4L75A 2O3SA 3SC4A 4JJIA 4CM4B 3PHIA 4IS2A 3E1KA 1OOEA 2I99A 4WOJA 2ZYAA 3WSVA 2G17A 4BKPA 3OJLA 2NM0A 3F3SA 2Q1UA 3OF2A 1WDKA 4RLSA 1EDOA 3V2UA 1YE3A 4E2WA 1Q0QA 3MEQA 1JDJA 2XF8A 3ROPA 4HFNA 4FOOA 4CMBA 3A9WA 3RBZA 1W6UA 3UHAA 2Q99A 2DUUA 3L0DA 1DC6A 3BTVA 2VHZA 4HWKA 2CDAA 4YRAA 3NDIA 1NPDA 4BO9A 3Q3CA 3RU9A 1DXYA 3COSA 3DTTA 2YFQA 1OBFO 3JQFA 1Q7CA 3UVEA 3F4BA 4R5HA 1QR6A 1IZ0A 4W6ZA 4P22A 4EEZA 2F00A 1R4MA 3ONDA 4W99A 2CF5A 4MVJA 5G2OA 4OMUA 4FCCA 3FNEA 3DDNA 5JCJD 3PZRA 3LVFO 1QYXA 3HQ4O 4KQWA 3OQ6A 4WASA 1QORA 4QFDA 4UUOA 1TB4A 3FBTA 1ZBQA 2PFGA 1ZEJA 3QRWA 1UXIA 1CJCA 3AY7A 1X7GA 2Y66A 5KOIA
chains in the Genus database with same CATH superfamily
2ORVA 5GONB 5J4VA 3EG9A 3UB2A 1NJGA 2F3SA 4NJEB 5FWDA 2XWSA 2GXQA 2C9MA 3CV3A 1ITZA 3EXEB 3B38A 3OWXA 2ZS7A 2HRDA 1RM3A 3G82C 4PLFA 4JI1B 3H1FA 1E1LA 5GAJA 2I91A 2F8SA 5A04A 3AEQA 2VCHA 4EG4A 4WI1A 1T4CA 3QMPA 3FY4A 4ML3A 1Z5OA 1YI0A 1OPRA 2ZANA 3DJFA 4BQPA 4RTMA 3T7DA 4V1CA 1SZJG 4AZ0A 3RJTA 1KZ9A 2GN6A 3F5SA 4EYGA 1TCCA 1JA1A 1WVIA 3KKKA 3ETDA 1K1EA 3RKUA 3EXHB 4FHEA 5AI6A 4BWFB 4UASA 1TLFA 4LGCA 4D97A 3VDQA 3T0GA 2Z3WA 4QEKA 3QE3A 4YBRA 2Q46A 3GBVA 4YXWA 5B6JA 4HGYA 2HF2A 2QDXA 3HNPA 1ZY2A 5EQTA 1PFGA 5CD1A 1IY9A 3A1NA 2GNPA 3OD1A 2FFBA 3OTHA 1GPYA 4UKDA 1CJMA 4BAUA 5CA0F 1IATA 4F71A 1WDLA 3VYWA 3THRA 4BVKA 1UFKA 4L73A 4IHAA 5ITZA 1T8YA 1JR2A 4O2BA 3FI0A 5JJLA 4EB8A 2WSYB 121PA 1P2VA 1GAEO 2JH9A 2WB4A 1OI2A 3OWHA 4AJLA 4D0LB 5IYZF 4P84A 2J0UA 3P5BA 2ZK7A 4DBZA 2PR2A 3M89A 4WCVA 3ZUPA 2Y1EA 2WMYA 3COYA 1XCJA 5CLLA 3RBAA 3VX4A 2Y0CA 5KB3A 1SZDA 3QMMA 1NY5A 1TZ2A 3KR9A 3KSDO 3N8GA 4WOPA 5DCWA 3Q7PA 1F6WA 2GAJA 3UC9A 5AFSA 3UOGA 2Q5EA 2R8RA 3WYGA 2EARA 3I3OA 1N2BA 4IDGA 3VJMA 4F1WA 5JFTA 1CF4A 5K09A 5TJ9A 5JAZA 3WIVA 4UZSA 1GNVA 3PNKA 3EOAI 3RARA 1JHZA 4RACA 3DBHA 3O75A 1N7IA 4QXRA 1SKMA 3LP5A 2YOHA 3O90A 2XCSB 3U7HB 3AIMA 1Y6ZA 2ZB8A 1Z68A 2EL7A 3SCZA 3SOZA 4DILA 5K0CA 4YP6A 2Q1YA 2RGDA 1B1AA 1RPAA 5AI5A 4DJEC 4X00A 3WK5A 3D6AA 1X1CA 1OTXA 4OLFA 2W2LD 3RWBA 3WMEA 3LPLA 3WLIA 1AZSC 2GN4A 2PO5A 1AQJA 3PC7A 2QRKA 1CULC 1HDZA 2Y4OA 1O6GA 2VYNA 4XTCS 5KNDD 1OKKA 4A27A 2YOFA 3G0HA 1BKDR 3DVRX 2GFQA 1OX4B 1OUMA 1G0OA 2ZRBA 3LYAA 3WO1A 1S1CA 2C20A 1BDMA 2FFJA 4JBGA 4JFAA 2RI6A 1G8PA 4JLSA 3WK6A 1GPBA 4ZCMA 4BO7A 3DULA 4ZQEA 5HS6A 3FDIA 4I8XA 3LIIA 1KEEA 4DQ0A 3QXHA 1QO0D 2EQ5A 3BE4A 3EWNA 4G4SO 1P91A 2KJQA 1T2DA 4HFRA 3TNDA 4O63O 2HK6A 1N5MA 1X3LA 2W11A 2HTFA 1N1GA 2JEYA 3A31A 1GQ2A 5JSZA 2H9YA 2JCBA 2QJRA 1S8NA 6YASA 3K09A 4WOCA 2P0YA 2XF2A 1FX1A 4MI3A 4NZNA 2GGSA 1BJKA 2Z5FA 4MK4A 4QUBA 1NM5A 4F6RA 5HKKA 1T8WA 2BMWA 3F8TA 1HYHA 5A7HA 5KOHB 4G37A 2G36A 5JS7A 1YMQA 3DVQX 3AIIA 1OBVA 1Y6JA 4HDKB 1XWIA 3PJRA 2Q3EA 5IXJA 3L46A 3RSSA 3LVBA 4DSNA 3LYLA 1QFXA 3Q40A 4NPHA 4RYDA 2BKLA 4KNWA 3C6XA 5KREA 3OH8A 3ASZA 4LYJA 2WAMA 1F8GA 2ZAOA 1HX7A 2X0RA 4A6EA 4E70A 4Q3EA 2IYLD 2Y1CA 2ZKIA 3ZWAA 1XL1A 3DBLA 4HN2A 3SHFA 3L1VA 4KH1A 4F2WA 4JBNA 2WJWA 1WCXA 4OHPA 3VHRA 2QAGA 4DUZB 4D4MA 2AMYA 1H1LB 4H7HA 3F49S 2A92A 2HPZA 4BXOA 1I8TA 4LRQA 4R1PA 5K3OA 2QQ0A 5EMMA 5I45A 1T5HX 3V6LA 1I5OA 4D3FA 1RU3A 3NOOA 4DHEA 3EIXA 4XWGA 3EVTA 4PFKA 4N1AA 5DZSA 2GCGA 4MUYA 4HLQB 1MG0A 1ZMTA 2Q4EA 4KSCA 5TGDA 1NR7A 1V8ZA 1JR6A 1H94A 2OPHA 2I7VA 3C85A 3N53A 3UPUA 2IEGA 1LVUA 2BTOA 1UM9A 4M87A 2ECQA 4EJ0A 4IVNA 4DN6A 4TV9F 4E32A 1NC1A 2QTGA 5J40A 2F6RA 3LVQE 1U94A 4KUEA 4PLYA 1LEHA 1PGQA 4DJTA 1AOXA 2FN8A 2PR7A 1YZYA 2BBOA 1U2QA 3H2IA 5I7WA 2PM8A 3K5WA 2CV0A 5E6SB 1I5RA 1BXKA 3IFSA 2WQ7A 3KQYA 4PRKA 1TMOA 4QIHA 1JG3A 3UB4A 2CKMA 2PU7A 1B6SA 2ZBEA 5JOQA 2MJLA 2GHQA 2A67A 1TD1A 5EESA 4HTAA 5FLYA 5C8ZA 1PL8A 2JFXA 2LCFA 5JTTA 1C4XA 1UPCA 1W5FA 2MU1A 3B5EA 2XGGA 2BMDA 3NXSA 4V02A 1QU3A 1XAIA 1PNTA 1NUQA 4F2DA 2VATA 5C35A 4F60A 5U9CA 1CETA 4L95C 1H4TA 2ZG6A 4NMLA 4KBGA 1BD3A 1ILWA 1M3SA 2MSLA 3AV0B 4JJEA 1R0SA 1VPEA 1TJ4A 3BIJA 3UIEA 4RM3A 3TM4A 1O87A 2CLFB 1SFRA 4RF2A 1U2GC 1HYGA 4ZYVA 1K3TA 3OOSA 2QRQA 3C87A 5DX0A 1C8VB 2LCIA 3P2KA 3S1SA 1BN7A 1R6XA 1YZQA 3T5CA 1XZEA 1P1JA 1QK3A 1TGYA 2AE1A 4UM5A 3W5IA 1TECE 3D8NA 4KO3S 4OHWA 1V8FA 3L7MA 3OIVA 3GDOA 2NPOA 3QLJA 3WXBA 1CX9B 3CEPB 4M7WA 3KZXA 1Z0ZA 1AD2A 2GBPA 4UNNA 4BNLA 1MAAA 2MDTA 3CRVA 2XMDA 2BW0A 4JT2A 4CKEB 1G59A 1PFKA 1GZ4A 2WPDA 2EW1A 4AFNA 3C1UA 1LV8A 3GVHA 3G2PA 3P9QA 3QFCA 4JC0A 3CZRA 4ENTA 1YCFA 4P54A 3EBOA 4B3MB 3A4MA 3U60B 3DYBA 1NMEA 4J43A 1VDZA 3PXUA 3WDSA 4D4KA 1TIBA 3CXUA 3NJRA 2ZTMA 1FDVA 3ASYA 4HUQA 4ZYTA 1L7DA 2X7JA 2XUIA 5FEMA 1E98A 4E14A 1M8KA 1HEYA 1MVOA 3FSEA 4LRUA 4Q12A 4GVLA 3ZWOA 1DC4A 4TS3A 4POAA 3MTDA 4P4GA 1XALA 2DCUA 2IODA 1Z0UA 3EFOB 1AKYA 3MCTA 3QEMB 1F8FA 3V4LA 5KJ6A 3DMTC 3GC6A 3DOIA 3WLRA 3IO3A 2GPNA 4RTNA 2Y6VA 3O8OB 1V3VA 1JH8A 2UYQA 2B69A 3GFSA 3TLJA 1PNVA 3UPDA 4XASA 3V1NA 2ROQA 2XNSA 3SDBA 3WC4A 4R8VA 3M33A 5DF1A 4QDJA 2RHBA 4UHEA 5CA1A 3VZBA 3WGJA 2J45A 4IVQA 3BK7A 5LLDA 4PQGA 2E18A 4L0MA 3B3GA 4J2HA 3IEXA 3R75A 4F9FA 1DWUA 4IS3A 1L7RA 1T1IA 4K6HA 1POXA 2OENG 3EW9A 5BO5A 1GPJA 3OE1A 3BH6A 2AWOA 4PTLA 1PJ2A 4OQPA 3QVJA 3F7TA 5A6VA 4KQGA 1V8DA 2VHTA 3SKYA 3RG8A 4EHDA 1TGVA 1E77A 2AXPA 5IT5A 4AWXA 1LLUA 1K2WA 2Q4DA 3AU9A 4X3OA 4F04A 1MOZA 3BMNA 1JYFA 1KDRA 4C76A 1ZSVA 1TM4E 4R05A 2FN4A 3WMXA 3ZY2A 4XTRA 2OXCA 1US8A 4V0ME 1TL7C 2I7DA 5GADl 4QG7A 4LV6A 3Q7TA 4MB0A 4B44A 2X2EA 5TQVA 2WJYA 2H7VA 2J5BA 4MJLA 1FYVA 4LRWA 1XXLA 4ZQGA 4OQXA 4BWGA 3T0IA 2NAFA 1I3OA 1N6OA 4OUDB 3SC2B 5KOJB 4L4YA 2J0SA 1DAOA 3SFZA 3C7KA 5FT9A 4EX6A 4EBFA 4QUAA 2VF8A 5TPWA 2L0XA 4PNPA 4WFJA 4W7HA 4DCOA 3I37X 2UU9B 4YS6A 1RWNA 3GAMA 3FWKA 4DCNA 5HMLA 5EEGA 3TSYA 3S2SA 2AOUA 2VA9A 1PL7A 3DZCA 3IAFA 4HDMB 2YCBA 3S0JA 4K86A 4BGUA 3PKIA 1ISGA 1CFJA 2VR1A 2OLKA 2VBFA 3TZEA 3V8QA 4YCNA 1XXHA 2RAUA 3KLOA 1ZKMA 3TLGB 3P2YA 4I9HA 2EYUA 1SBZA 3C7AA 5AM3A 4BAGA 1QFSA 1YQTA 2V54A 1JPUA 4TYYA 1EWRA 1NDHA 4Q37A 4Q4DA 1DWPA 4MRRA 2YUIA 4B47A 4YJ2A 3LZDA 2YL2A 2VHVA 3NIGB 5A9TA 4BBAA 2J9GA 3LKDA 1WV1A 4AI6A 1XG5A 2D62A 3C3WA 1XWFA 2GJ4A 3G59A 2BKUA 4WN9A 1JJBA 2DH5A 2JIBA 3L84A 1E0JA 2D54A 3C39A 4MW4A 2IY9A 5FLXA 3MINA 3R20A 2GM3A 1R7RA 3GJXC 3IAAA 4I2VA 4NPAA 2QVYX 1KYWA 2KPOA 1M2WA 2JB9A 4GI2A 4OP2A 3BUSA 4ACAA 1E9SA 1T4MA 4A5OA 4ZDJA 4AW9A 1KF0A 3FRJA 4FLMA 2FEMA 4XI9A 2IIPA 3IQHX 1GQQA 3GD7A 4UTVA 4YJ3B 5ILQA 2HD4A 4LCBA 4B4KA 5FL3A 4GL2A 1PR3A 4XA8A 3BB4A 4X90A 3U40A 2I6FA 5K05A 3R0VA 1W36B 1TUGA 1IZ7A 2UXBB 5D00A 4O2LA 4YRCA 1CRWG 2EWMA 5KTPA 4YPFA 2VPIA 2YMLA 1U9JA 1XD2A 4RIGA 5GZ6A 3BMCB 2ISQA 2Q07A 4LBWA 4MJXA 3HI6A 2C2KA 5AO9A 1WMBA 5FTLA 1NW4A 4GIBA 3KIPA 4YRMA 1TUBB 2CGEA 1AZWA 5T4EA 3WQHA 3RUEA 4ZHQB 4FYMA 3C70A 3IHWA 3RU3A 3WYCA 4YACA 5JSUA 2IH4A 4CTKA 3QVVA 3OQJA 1J56A 3ZQ6A 2ABWA 2VAMA 3ROGA 3ZHTA 2WWWA 3A14A 1CEYA 5HP4A 3H9EO 3T3HA 1VCIA 4ZVOA 5K2OA 3BH0A 1IQPA 4XVUA 1VMIA 2AJTA 3BEOA 3LC7O 1S3SA 1E8NA 5E2IA 1YIOA 4NBKA 1ZDMA 1B4DA 2OB1A 3MK31 4X6LA 3VSBA 1OWMA 3GPDG 4DIKA 5HTOA 1S2DA 5B3LA 5EP1A 4DIDA 2VXYA 1JXMA 2ZIGA 4HEA1 5FAXA 3EPRA 3VKGA 621PA 5IP5A 1CRLA 1L4BA 1FPQA 2PH7A 3LUHA 4QXOA 3A0RB 1J22A 3AETB 4ROTA 4UFPA 5JECA 4WECA 2OHFA 3KOZA 1T5TA 4EK9A 2I2XB 1C3OA 1XT6A 5JBNA 3KKQA 1NWCA 4MLCA 2WFLB 1OTHA 1Q22A 3A6ZA 1Y9EA 4B73A 4UHDA 5EJ4A 1XSEA 2XTNA 3LW8A 2JHCA 2ZZNA 1XR3A 4RHCA 3KHTA 3L9WA 1USVA 1W52X 3N2GA 1XU4A 1J7KA 4M1ZA 4NCNA 5FIUA 3AINA 1JLSA 4OYYA 5AI9A 4CMKA 1N7HA 1Q2XA 1FVFA 3AM5A 4FFPA 2ZIAA 2P9HA 4YLGA 3ZCVA 1L5QA 1UK8A 3MT9A 3N2IA 4YRPA 3PR2B 4QU8A 3LTNC 5B3AA 2MR6A 1RR6A 3I0NA 3KR0A 3MWKA 4YWJA 1KSGA 4WADA 5BWBA 3MUFA 1JEDA 3L93A 3FAKA 4KQHA 4A9AA 3INGA 4AQYB 2P0EA 2FEKA 2BFPA 1T25A 2ONZA 1UMBB 3NIWA 1MN6A 4LJ4A 4OB7A 5J63A 4ZMBA 3L8DA 3VR3A 5EL0A 3SZRA 3QU5A 2VHUA 1A5AB 4KQKA 4WOKA 4XLTA 5I7SA 4X66B 2RJNA 2IP2A 2CL7X 2PBZA 2ZWAA 1X7DA 2O52A 5CGZA 4II3A 1K8XB 1K5GA 2O4CA 4CLHA 3WB0A 3CZCA 4MS3B 4TTSA 4OJYA 3PNOA 4WUVA 3OMLA 2WHXA 3JRXA 3VM6A 1I2BA 3JAKA 2VPTA 1V1RA 1YB5A 3I0MA 5EXDA 4IR7A 4YCAA 1OH8A 2C1EA 2V7PA 1QGUA 3M1IA 4QTTB 1CCWA 2IYUA 2Q0QA 1OI4A 2D5LA 2PYDA 2W6JA 1T2EA 3HR4A 4UDOA 3BCRA 4CETA 2A33A 2YWRA 2HH9A 3DHEA 1LV7A 1M7BA 5ALGA 1N5IA 5A5FA 1Z13A 3MBOA 3UKJA 2CZGA 2EBUA 3HL0A 3ZH2A 3NBZC 5IYZB 3C3EA 2XB2A 1U99A 2IYFA 2AR0A 5FYDA 1CQIA 4XSHA 4MW1A 5JJ5A 1Q14A 4NG5A 3SJZA 1MAUA 3P9ZA 3D2BA 1P74A 3E7PA 3I5UA 3E9CA 3IOEA 4G0ZA 4CMJA 2PZJA 4DZRA 4YMHA 3U0BA 3G7NA 2R79A 3EXG2 3O5AA 4ASUD 1KY5A 1JLKA 1SUCA 1ZGAA 3V33A 4IIXA 2Y68A 4ZEWA 3I9FA 4UU1A 3ER8A 3RIGA 1RTTA 2Q2QA 1ISPA 1E9DA 4KFRA 5IJZA 1XA0A 1S3IA 2CNDA 1X6VA 2WFAA 3DO5A 3DUFB 4LHEA 1VRCA 2J5XA 3ZWPA 4AO7A 4DJFC 3E5NA 1FP7A 5E4YA 2DETA 1SA0B 3GZTB 3LGAA 1EUCA 4MUGA 4TGLA 5C1OA 5IJ0B 2I6SA 3GZJA 4JI2B 6PFKA 2OB2A 4UFNA 3UJCA 1WXIA 3ZCXA 4X8HA 2Q3FA 5FUQA 1MRNA 4G8CA 4UUBA 4MRNA 4O02B 5FWNA 2KLBA 1VRVA 1L8OA 2WSIA 3AVVA 4M98A 1IMOA 2O8CB 1HOTA 1YASA 2XVYA 3MG9A 4LG1A 3OQBA 5IXSA 2VQFB 2DEUA 2QW1A 4YPVA 1BOFA 2XOKD 3FVVA 1QHFA 3JQQA 4XWAA 2X8JB 4G81A 1E20A 3BJZA 3AX6A 4IV5A 1PGNA 1TU3A 1WHSA 5FOSA 1XP8A 4E1AA 3CF6R 1PSWA 2OP1A 3EGVA 3VR0A 2DF8A 4MUMA 3Q2KA 1PR0A 2B8WA 2MSKA 2QN2A 2N42A 3VAYA 4WJLA 4YVFA 3ROTA 3Q85A 1CZLA 3ZHCA 5IEBA 4RKWA 3M1AA 4YJKA 3HACA 3R77A 5CG1A 4Z2YA 2H29A 2YJNA 3MC1A 1MX3A 4Y1RB 3M4NA 2RHJA 3HVHA 3AVXA 3BFPA 1QP8A 1RJFA 3LD9A 4JR1A 1SIUA 1Z82A 4QJ5A 5DX1A 2A35A 2VSNA 1WUJS 1QRTA 1ZINA 1GLNA 1KMQA 2X19A 4GYJA 2J7PD 5DXJA 2DQZA 5KX5B 1GUZA 4TKVA 4M7PA 3BXXA 1OY1A 2EHDA 3BD6A 3QU7A 3Q3IA 4IL5A 2X2OA 2BKVA 2P9CA 3B6JA 4CF3A 1EG2A 1K27A 1QV7A 2ONYA 3KUXA 4XFKA 5DHAA 2G70A 1J25A 3G79A 5FNZA 4CLXA 2ZS8A 1K8QA 4IXDA 5HQJA 4HNVA 2BP7A 4QWWA 1PBNA 5LXTA 4BO1A 3HI4A 1OZ0A 1QWSA 2A7QA 1VTKA 1BDJA 3T9AA 3U81A 2JATA 4PHHA 3QE0A 4U2BA 2FLWA 4DM4A 5BV0A 1FW6A 1QG4A 4CM6A 4QREA 3UHJA 2IYZA 1YJ8A 4GRAA 5J5AA 3D6HA 2JJQA 1OXKB 3IAM1 4Q4JA 5IK2A 5LBIA 3U4QA 3RIXA 3A1DA 4YONB 3RC8A 1NU8A 1JMYA 2WSMA 4MJ3A 4OAOA 2B1RA 3CXRA 3H9BA 3IQFA 1MB0A 4H1VA 4GX1A 2ODWA 3T15A 4A3SA 1KY3A 1YL5A 1J2EA 1NXOA 3G88A 3NKLA 4BX3A 1AV6A 4EB6A 1ESDA 4LVOA 3J81A 3P19A 4K6GA 4MVJD 4NMXB 4OSPA 4OATA 1PTJA 4QARA 3S4YA 4E46A 2ZTSA 4TV9B 1QQ5A 2R8BA 3L8EA 3GB9A 4ZD6A 5EJ9A 4F91B 1CSEE 4PGGA 5A0TA 3A6EA 1E1YA 4CG3A 3KBOA 2UUOA 4GNKA 5ICMA 4YY3B 5EIOA 3EY9A 5F23A 2JDID 4C4OA 1QYVA 1PD0A 2VWQA 2AUNA 4YROA 5DNVA 4FYPA 3NHJA 4GGMX 4TZKA 3C3AA 3RS9A 4MV0A 4MS4A 1GAJA 3MTIA 3KSUA 4MIOA 1RLTA 4B2IA 3DAGA 1MD9A 1MC5A 1JHRA 4NEQA 5JADA 4IWXA 4XGQA 3UKDA 2XUPA 2FUEA 1OVMA 5IBQA 3WLNA 4NAUA 3W5SA 1SUAA 4CM8A 4F4JA 2QXYA 3M6MD 3N3AC 2Y67A 4GF5A 2D0IA 2RH9B 2ZPUA 5DISB 1AKWA 1CKEA 2C4WA 2CSUA 5AM4A 5BW4A 3R8FA 3I58A 4CQNA 1VCMA 3IP8A 1REQB 1VG8A 2PRJA 5AW6A 3OQIB 4FC6A 1CQWA 4QTUB 1K8ZB 3AR7A 4Q3NA 3EDCA 4UMFA 3SG0A 2I4RA 1BWQA 2O8NA 3FYUC 2LDXA 4C0HA 2JGRA 2VF7A 3JX9A 3BERA 4G09A 4BNIA 5KNCD 2WWGA 2HUPA 2TMDA 3S2FA 2C7OA 3QHPA 1E79A 1CY0A 1GTVA 4JR2A 1ZUHA 3SMQA 4KPYA 5JH7A 3RTEA 4DDKA 4BE9A 5JUWA 3W1WA 4DV6B 4DLAA 1WQ3A 3TVTA 5IVKA 3BMQA 4UNSA 1W0KA 3SC3A 4PO1A 2V8BA 3MB8A 2WG2A 1USKA 3DL7A 4V0SA 1RP7A 3GFQA 4DJDC 4CEJA 3WAGA 1YUNA 2XOEA 2IEIA 4WXMA 4ZIRA 4ZYZA 5KX5A 1C8BA 4K9KA 1PIWA 4JT4A 4WFQA 3UYLA 5IWCA 1HOXA 4Q4LA 1GAXA 4H6VA 4L8FA 4LJ6A 4MI9A 3ZD7A 1BFDA 5AJVB 3JYPA 3DGFC 3B6MA 3Q0EA 3W3ZB 1WCIA 2K2WA 3NOQA 3BMOA 6ABPA 3EAGA 1PFYA 1QVRA 1V16B 5C4MA 1Y6FA 4G0WA 5FOXA 1NJ1A 1HYBA 4M49A 2ZUUA 3FNGA 4YQZA 2XB9A 5DTQA 3M81A 4ZRMA 4U1RA 1FEZA 2OORC 5BSUA 4HZIA 3K53A 4M4SA 1O89A 2OUKA 3BG5A 2QD2A 2DKNA 3IMFA 3KOWA 1LU9A 1I3MA 2I4TA 2YWJA 4J0EA 5E95A 4EYEA 1A8HA 1QAMA 2CDRA 4KK4A 4DOMA 4PU0A 2VQ6A 2IKSA 4DJJA 3ZY6A 1YU6A 3R76A 4AAYA 13PKA 3ZIDA 4FGKA 2FJ0A 4Q15A 4TX1A 5TVKA 2J7KA 2YWEA 3RKSA 4LY0A 3T12A 4BRUA 4I9GA 3BRWD 4K9DA 5TY0A 3LY9A 3I1IA 2FSIA 4R68A 1T2UA 2MOKA 3KPJA 3ZLVA 3C2QA 3GJRA 3MPUA 1GU0A 1R6TA 2PGAA 4M83A 3I53A 2M6LA 1HDGO 1XNJA 5FFNA 4JLNA 2VBGA 1A5SB 4R7GA 4MRVA 3T9FA 1NX6A 4BNUA 2XGMA 4GMKA 4JB3A 2ZXUA 1NFFA 1HL3A 5LMZA 1HT1E 3O2NA 2H2GA 3OX3A 1E92A 3Q7IA 4D9HA 1GCUA 3FETA 3O8LA 1J8YF 2ORIA 1OMOA 3VKWA 5EJ7A 1Z08A 5AVKA 3JQCA 4FMBB 4MYDA 3VZDA 5B2ZA 2AOWA 1JR3E 1TTQB 4P92A 1V26A 1VLHA 3EFBA 2PMWB 4EHNA 1I6KA 1XU7A 4EJ6A 1TZMA 2BF7A 4LFBB 2XCIA 5CHEA 5IDYA 3OPXA 1M0SA 2IUTA 3UG7A 2OHOA 3NYIA 1P8AA 1DXQA 4OP3A 1VJ5A 3VDRA 5AI8A 2X9NA 3GVCA 2OCGA 3VTFA 1FJXA 4BATA 2XQGA 2CVZA 2HMWA 1N6LA 1M2EA 4B82A 3CPHA 2IOQA 4X0EA 1XHFA 3CJRA 3SVLA 5G4KA 1ZMBA 1ZXBA 2Q4OA 4YRQA 1VLZA 3SBDA 2PEZA 1CDZA 3SHVA 2I66A 3M1LA 4ESEA 3RHFA 1I4DD 1QZTA 3MOSA 3NEYA 3V1YA 2CE7A 2HIAA 1KEPA 3SAJA 1G9SA 2PANA 4Z9BA 3A11A 1B16A 5TS2A 2I8LA 3D7SA 1IHPA 4MS1B 1LDEA 3BF7A 3SX4A 3F9IA 2OCPA 3CNNA 1MQAA 1GN9A 1QKKA 4L2IB 4ZU1X 2VYVD 2ZJ8A 1NUAA 4QOGA 3Q3HA 2W0MA 3RTGA 3RRFA 3HDVA 5AW4A 3F2VA 4DY4A 5BN4A 1R18A 2IEBA 5DNAA 4P0PB 2CJXA 5DU2A 4CM4A 1DFHA 4ARAA 1M0EA 1E7SA 5DBOA 4D26A 1EXNA 2JS7A 1SM4A 4QHTA 2PWZA 4B6JA 1V9SA 2Y92A 1BJRE 1Q92A 2CJPA 1U3CA 1N25A 3IUYA 4FN5A 4HMOA 5L3RA 4EMBA 1CZHA 3T1OA 1PG5A 2H17A 3L41A 4KACA 3ZS9A 1I7DA 1WB9A 1XQYA 3UKOA 2IPMA 3JV7A 4HNTA 1EFVB 1TDJA 4MJ7A 5C7IO 4UUPA 4QM7A 1IB6A 3KR2A 2B7BA 1Z2EA 2O7VA 4XUGB 2PMKA 4YUXA 2A9VA 4TTJA 3J7AC 1ADFA 2AUTA 3KO8A 3K9GA 4OFXA 4XLZA 4RY9A 5BQ3A 4JX8A 4LKOA 1ONPA 3ND9A 4JUAA 3GNLA 4G23A 1JLLB 4RHFA 3MS4A 5IUKC 3ZVLA 5HOQA 1A82A 3NDBB 4C7OA 2BFCB 3PPXA 2G8NA 4FE3A 4RETA 1P2SA 4FPXA 5I5EA 4NENA 1FX0A 1EGAA 5KQPA 4BWYA 3IUPA 5A9SA 3HKCB 1ND6A 2Z3ZA 1OBOA 1M54A 1TT7A 1UKCA 3IJPA 4QNRA 3MOGA 4Z8XA 4G4GA 3PTAA 1Q1NA 4ODIA 3QEAZ 1V5GA 1JDUA 1VM6A 4FGSA 5DCLA 4FHZA 1U1DA 2PD3A 1MOPA 3JAWB 5AKGA 1IBCA 4MXDA 3PX7A 3RUIA 1EK5A 2H16A 3BGVA 5AOAA 2ZRPA 4C01A 5FUXA 5JWOA 2F1RA 5F2OA 4ZV9A 2GN1A 3DT8A 3MWGA 2XT0A 4H4EA 3J80A 4MWBA 4JIMA 1EFRA 4AQDA 4J1TC 4WY5A 4Q7QA 2VTKA 3A1WA 3IE2A 2AFRA 3NHUA 4MUIA 4GOMD 4HS4A 4PYQA 3E2PA 2L19A 4G6ZA 4HHEA 1Y5MA 2COUA 4K6KA 3BTSA 1JN0A 3M9LA 1NURA 1KTVA 4FB5A 4PX9A 3P2MA 1WXEA 1E1QA 1MJ5A 2VOJA 3RK4A 3TIGA 3AY3A 1R8XA 4MULA 4RFSB 2EGHA 4OJNA 4N3CA 1IBSA 1KYZA 4C4RA 1S8OA 2WG1A 4JA2A 4DQVA 4QX6A 4X1KB 4OQMA 5C9ZA 4K8OA 3FOZA 3UJ7A 8GPBA 4MOWA 1Y37A 1PLJA 2ZATA 4M9XA 1FK8A 1V3QE 5B4TA 4OTZA 4EFKA 1TTTA 5KQRA 4PXYA 1W47A 3HP4A 4OIFA 3VAZA 4LXQA 3ZHXA 3IT2A 3IDQA 2C04A 3P0RA 1MX1A 4H31A 3FDFA 2ZT8A 3OZFA 4LZAA 1OLXB 5TMPA 5FYQA 1SKUA 4K5QA 2JAWA 1BFKA 1MJNA 1UKVY 3HYCA 4UZFA 3K72B 1P62B 1UBCA 1K3FA 1GRCA 1KI3A 2XPCA 3FX2A 4HPJB 4ZZ1A 1L5KA 1N34B 2C8JA 1JEYB 3LP6A 4W5JA 3I61A 3RS2A 3DE5X 3NOVA 1WDWB 4V0OA 2E4YA 2ATVA 2PT9A 1M6VA 2ZDGA 2PSFA 2ZRQA 4RIHA 3B78A 1E3WB 3WHIA 4CL0A 1ZCFA 2IBTA 5ALVA 3GMSA 3HWSA 2X0JA 1HZJA 1ULUA 1SWVA 2ANBA 3O4GA 4FQ7A 4TKUB 4N3NA 5ICSA 5J5VA 2IYYA 1QCCA 1NBEA 3Q98A 4DQLA 1YA8A 5JSHA 3H8WA 4JHLA 1GU7A 4JJAA 4YJFA 1JDSA 1QRSA 3ADDA 1XTKA 5H83A 1S1MA 1C7ZA 1E1RD 2EJWA 4XPIB 3T34A 5HKAA 4Q05A 4FFLA 1SUFA 2R96A 1V4BA 4C0LA 1NW5A 3OT1A 5F9HA 2YR0A 2YMPA 5I7EA 1OBCA 2Q4RA 2ZUVA 4Z2AA 1G7TA 3JZMA 4L8GA 4PC6A 4W9NC 4C7MA 4MDHA 3H5AA 5BN3B 5JPCA 1EFCA 1EG7A 1KR5A 2QRLA 3CX3A 3HGQA 2E82A 3R74A 3ZDDA 3OLQA 4MITA 4W8GA 1MV8A 1N9ZA 4LY9A 1PJ3A 1QC5A 4R8MA 2F8MA 4I9UA 4OMDA 2HBQA 2BEVB 1DAPA 2SCUB 4PYJA 4X94A 3THXA 1G64A 1XZNA 1Y82A 3DQZA 2OZPA 1DKNA 1KS2A 2O06A 2Y93A 2ZI3A 3IOBA 3KOUA 2Q6VA 2UZIR 1CQJB 2BLLA 1DTWA 2VDRB 1FUEA 2NZWA 3PC8A 4GLLA 5FTWA 4AY6A 2B6HA 3BWVA 3G17A 1SXJE 1SD5A 1X7XB 3F6PA 3WA6A 5C51B 3L6EA 3K2EA 3NTXA 2EWVA 5JWHA 4X65B 1WDTA 2J09A 3L1HA 1GPKA 1EVKA 3OECA 2GKOA 2GRJA 1C7EA 5LB2A 2A5DA 2PX6A 2XKAA 3NBUA 4ZAZA 5HKBA 2PUBA 1NQ5A 3ME5A 4N3GA 4CHGA 3S2YA 3WGGA 3D64A 2QUZA 2AF4C 2WUWE 4ZCLA 3FCCA 2SKEA 4NNOA 4B6OA 2R47A 4ERXA 2ZRHA 1I13A 3WADA 4XZ3A 3KFXA 4GOXA 4BDTA 2HV8A 2I6XA 2Q0HA 2MWMA 3HDGA 4G01B 1IFXA 1R66A 1DQNA 1XI2A 2QEQA 5J2UA 3FDZB 4GECA 2AFIB 4EZEA 2Y1FA 3H0KA 3EVFA 3OE4A 1NP6A 4CUKA 3AEZA 3JQGB 3ZU5A 4B4UA 4G1UC 1D03A 2PTGA 4EVRA 2DUMA 3HVUA 1Q84A 4JL6A 1D5CA 4BE4A 2FUG6 3LQ4A 2FVXA 3C5VA 1DP4A 3VDNB 3ORRA 3SSMA 2N75A 3N5CA 3M6WA 3GG2A 1DBQA 3HSKA 2WM3A 3LQRA 5DLQC 4UUNA 3VTZA 3BXHA 3ZDEA 4BU0A 4J4BA 3TR5A 5REQB 3GLHA 5IMBA 3A58B 4RA6A 3HHEA 4EHFA 3HDHA 5AVZA 2GDZA 4JNKA 4PC1A 5EHGA 3WHKA 3QELA 1TYZA 3N2KA 1MOQA 2NU9A 4BNDB 3VI3B 2VPYA 2VZ9A 1U2SA 5L40A 4RDHA 3O4RA 4S0XA 1THZA 1CG6A 3C3DA 1P0CA 2WIKA 5F3DA 3EGIA 4D8VA 5DTRA 5E3JA 4AJ9A 4DCUA 5I8WA 2ZUEA 2D2FA 4RJLA 1NVUQ 2BH2A 1GG8A 2RGXA 1DAKA 3PTZA 4G5XA 5A2GA 5EKTA 1P61B 3R4VA 5EXTA 1UDWA 1EZ4A 3LHKA 4JY7A 4UAUA 4E21A 1LDGA 5FCDA 3WZMA 4BOYA 1E4OA 4OQEA 4RA9B 3QBTA 1GFIA 5DFAA 3R7WB 3CTMA 4E1VA 1WMEA 2F1KA 2FW9A 1FUKA 5TNXA 2AJCA 4OYRA 2A57A 1Z8DA 5E7MA 4CLOA 3ZWNA 3U9LA 2P78A 1LPMA 3O3OB 1PGJA 4R6XA 1KY4A 4PRZA 3N8DA 4U6SA 4JQSA 2H48A 2W4IA 4E2ZA 4Z49A 3N86A 1UXOA 3ZZNA 1MO5A 4CM1A 1EWVA 4GOJA 4J1SA 2O48X 2Y1WA 2FMFA 2Z98A 2A8YA 2NPIA 1OWNA 4CVNA 5CB6A 1Q16A 3CPSA 3O8NA 3ZEAA 4PLHA 1N92A 1P44A 1MC4A 2ZUFA 4ZAXA 5EUBA 3D8SA 1MAHA 5K6AA 3FRHA 1U3FA 5FTNA 1QO7A 3H0CA 4Q7JB 3FB1A 4KOEC 3ZD9A 3L8FA 3NFYA 3ZWYA 2IHBA 2R8EA 3YASA 4AZSA 5LOVF 1A9OA 2EEPA 2VHEA 4NKRA 5MFZA 3RVDA 2GN0A 3KAPA 3AR8A 5B7NA 1DKLA 3CW9A 3Q4GA 3PGJA 1ZQ1A 1Q2UA 1WXFA 2DWQA 3A9CA 3FVWA 4IEIA 2UYYA 2CDNA 2O2IA 1HNNA 1PR4A 2H5EA 3K0CA 4YLEA 3T9CA 3ZV5A 2V58A 4CR8A 2QJWA 4EG3A 4FE4A 1LX6A 3C3PA 1JQBA 2OO7A 3TQOA 2RK3A 4ZJZA 1A9ZA 5L3SB 1N0WA 3GUZA 3QJGA 2P9ZA 2XRMA 1FFXA 3G9TA 3MGKA 2HWXA 1OH6A 4DABA 3K20A 5EPEA 5JU6A 1FRVA 4AXBA 1O7JA 2FX3A 4ZOQI 4P4NA 2WV9A 3ZWQA 1JIVA 3CMCO 5TQJA 1OF1A 1MQSA 1UMCB 5ARBA 5DBHX 4BNFA 1XPRA 3GA5A 3NT5A 3WGYA 1E63A 1S7GA 4D9MA 5IARA 5HQ3B 4MWEA 3FGNA 3F6SA 4RMHA 3HCWA 3SR0A 2QT9A 3B3FA 4KAAA 1RQNA 2RGAA 3ETLA 4G85A 4Q4HB 3HXTA 4CNQA 1S9HA 2IRWA 2Y0BA 1N78A 3H7IA 1XZHA 1DSSG 5LLSA 2IUEA 3P0EA 3AKCA 1MORA 3VKVA 2IJGX 2XUKA 5DM4A 3JR3A 2C9BA 5JS6A 3UJPA 1CJKC 2DBRA 4NI5A 5ALWA 4NULA 1GWNA 3PUVA 5A4KA 5IN5A 2Y2VA 3NKVA 5LIRA 1IJBA 4ENRA 4LI3X 1Q0HA 1NLYA 4EEKA 5AR1A 2PAFA 3EXIB 5B1DA 3UHFA 3UUFA 3ZXXA 1LBTA 1WIWA 1DJQA 1JZQA 2NSJA 3BRSA 1JHUA 4JKOA 1F0KA 4KGZA 5GV7A 4S1VA 1Z6PA 5KU1A 1Z6YA 3QVGA 4NCJA 3IAXA 1L5ZA 3WQRA 2V9ZA 1M2JA 1V5EA 1JA0A 1YB6A 2NSLA 3DO6A 5F9FA 3DMGA 2X1VA 3EUFA 3GJTA 4CR6A 4KAJA 3U80A 2D00A 1RE1A 1WEKA 2W6CX 3QG1A 2IXDA 2XODA 3EEIA 4YRRA 3UUEA 1K5DA 1LJUA 4BVAA 3WXMA 3RC9A 2DWPA 5GJWC 2Y1GA 4O4IF 3TQTA 1ESCA 2PKXA 4FFSA 3UB3A 2QZJA 4I66A 3ZWKA 1P7CA 2GEUA 2QWXA 2WKQA 4FT4A 3NUZA 4BPBA 4I50F 4TQUS 1CY8A 3ZHZA 4EA6A 1NVXQ 4RLFA 3EEOA 3M3DA 1ZG3A 1DARA 2BV3A 1ZK4A 3TMAA 5BYJA 4DGSA 2WJPA 4U5XA 1TU0A 5D3MB 2X1LA 5TX7A 4X7BA 1SAYA 1H8HA 2O6HA 3ZGLA 2C4MA 4JX9A 2XDAA 5DLYA 4BB5A 3K5PA 5IHPA 3OE7A 1Y1KE 1S8AA 3LGSA 3RDPA 4P5DA 3GF4A 1KEUA 4POOA 1EFLA 3TUIC 4G0QA 5FPKA 1R4NA 4LZWA 3MF4A 4BZQA 5EMKA 1E66A 3WIUA 4I81A 1TC1A 5LU8A 1USIA 3HY4A 4WACA 2PS3A 2VK8A 3AR4A 4G4IA 4XSVA 5EJFA 1VPWA 4MQFA 3RLIA 4A36A 1CB0A 4ITRC 1DXOA 5HILA 1Y7TA 3NCTA 4CT4B 5EJ5A 1LSSA 3UOWA 4HXEB 4P81A 3ZV6A 1I3NA 2FPGA 3HBLA 1KMIY 1YO6A 2ZSJA 1FLNA 4KC0A 4TKZA 3WDMA 3EA0A 3WL5A 4F92B 5LD2B 1FDTA 2P2GA 4ESOA 3OTQA 4IIJF 3ZE7A 2VP5A 5K0NA 1XDWA 1H6BA 3S70A 4UW9A 3Q0TA 3TW0A 2W2XA 2G1JA 3K09C 3DZHA 4Q7LA 4LV8B 4EA9A 3BWXA 2O54A 4BNVA 3LECA 2EZ9A 1UXJA 3NEPX 2QP4A 5J2TF 1MABA 4Q4AB 4QICA 1XAJA 3O9ZA 5ALMA 1OYVA 4EW3A 3G3EA 2F3PA 1JZTA 4FQ5A 4KPFC 3M70A 2WYUA 2A84A 4ACBA 5HF5A 1QQAA 2CVHA 4X41A 3THYA 1APBA 4Y2RA 1Y9AA 4C9BA 4F45A 1W7AA 1KU6A 5LWQA 2ACEA 2I34A 4P98A 4DR5B 1SXJB 3FLEA 3IDSA 5IWAB 1O94A 3LRPA 4KXWA 2JBHA 3PUKA 4NZPA 4D3YA 1JIIA 3CLRD 1A88A 2R8YA 3K6RA 1ORHA 1CR6A 4R0NA 1K6EA 1FVHA 3ENQA 5G40A 3U2QA 2YBEA 3UMSA 3VJLA 1G6HA 2W2KB 2QAGC 2X7HA 4GBJA 4O4JB 3OMWA 4LYDA 5GM2A 3MSXA 1JH9A 4GOLD 1D2HA 1Z73A 3R40A 3MQ2A 4F2GA 1NR1A 2PJDA 3SZOA 1Z0FA 4IJ5A 2YIDA 1FS4A 4RS3A 4MHTA 3IS3A 4MARA 1LA2A 3RROA 1WUKS 1VL0A 3PIIA 1W88A 4TTIA 5DKFA 4DNOA 1GA4A 5FF9A 3DHNA 5LQAA 3CA8A 3UTDA 2IOYA 1OLSB 1P0MA 1I30A 1QIDA 2EATA 1FTYA 2PZGA 5B3JA 1LY1A 1XD9A 5KAMA 3W6PA 5BYKA 5JQGF 4ZAGA 5I4KA 4M1OA 2HRQA 1WSAA 3AHEA 3PWZA 1MPXA 4ZYLA 3D9QX 1WULS 1YZFA 2BFOA 2R7MA 2LIPA 1DE0A