3GDGA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable NADP-dependent mannitol dehydrogenase
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
total genus 88
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdgA00
4FOSA 1GADO 5AXAA 1C1XA 1LXCA 1M76A 5L4LA 2X9GA 3QVSA 1UUFA 2J3IA 3GZ4A 3TNLA 1NVTA 1U3TA 6ADHA 1JTVA 3Q6IA 1GQ2A 1E3LA 1R0SA 1XYGA 3WNVA 1PZEA 4A27A 2XPCA 4NDNE 2VYNA 1ML3A 1A9YA 3V1TC 5FYDA 1HYGA 1LRJA 4OO3A 2H63A 4CM9A 3D64A 3WMWA 4Y98A 4IM7A 4D0RA 4M89A 2PKRA 3L6EA 1PS0A 5I7VA 2GUGA 3ZHZA 4PFJA 4DTIA 2AQIA 3ASUA 4NIMA 1PQWA 2EGHA 4FS3A 3I52A 3H5AA 3ZGYA 1QYVA 3AY6A 1EE2A 3JYNA 1Y8QB 3CKYA 4BKOA 4L8VA 2ZQYA 2NVBA 4L4RA 1YB5A 4CM1A 3JD2A 5EN4A 1RM5A 1ZBQA 2CUKA 3DBLB 3RCBA 3QY9A 3WICA 5I8ZA 1XLTA 1ZJYA 2GASA 2A35A 4RPJA 4LMPA 4YRAA 1Y9EA 5K9ZA 3SJ7A 3RUEA 1Y8QA 3PFFA 1IUKA 5DBFA 3PQDA 3ZW8A 4DUPA 4RLSA 4CL3A 1AXGA 4FPXA 3DBLA 3EMKA 5C5IA 4YAKA 2DTXA 3AI3A 5JE8A 3VPHA 4I9UA 5JSFA 3D1LA 1OOEA 2GNAA 4E5NA 4MVJD 2YZ7A 2X7HA 4E5MA 3WIDA 1YJQA 3ZWAA 5L7TA 2YHIB 3H7AA 1LUAA 3V8BA 4BNMA 1OZAA 2WJPA 4IQ8A 4RVHA 1D3AA 3I9OA 3DOCA 3FR8A 5F3RA 2W2KA 1LC3A 4ONEA 1YB1A 5A3JA 3HE3A 5LC1A 1K3TA 4CLRB 1V6AA 3PHGA 5IN5A 1IL0A 4DQXA 1VE9A 2YHIA 2LDXA 2P5UA 3IJRA 2Y67A 4R5HA 1R6DA 3UICA 4URFA 5KCZA 2Q1SA 2O23A 5L7YA 2CVOA 4E12A 1ZVMA 5U1PA 4CLRA 5T5QA 3H2ZA 2DTEA 3BHMA 3H65A 3ANMA 5DN9A 3VC7A 4WE3A 3K30A 9LDBA 3WG9A 3VPSA 4U6SA 5A9TA 4XEHA 2JD2A 3U4CA 1CQIA 1YJ8A 5FI3A 1D1SA 1DDOA 2X23A 1XQ1A 1DLJA 1QKIA 1ZNQO 4PG5A 4YCAA 4XGIA 4BNNA 4FC6A 4D46A 4XR4A 4XYLA 4GQAA 1DRVA 4QECA 4YWJA 5CG1A 1TT7A 4P4GA 5KJ6A 3Q3CA 3RUHA 1H6AA 4ALIA 3ZDFA 3GPDG 3RC9A 3QWBA 2P68A 5JY1A 1ISHA 2C2XA 1NPTO 1RKXA 2FP4A 5KJEA 4AJ4A 4RPHA 3I6QA 1DFGA 1SEVA 4IDAA 4TRJA 4W6ZA 5CP8A 1N1EA 1WMBA 3GN1A 2IRWA 4K9DA 3ROKA 3UH1A 1FDSA 1O8CA 3IJPA 3WGHA 1X0VA 1ZK3A 4O63O 3PWZA 2HKIA 3RUCA 3K5PA 4FW8A 4MKZA 1DOHA 1W0CA 5ICMA 4YPOA 1C0LA 1LQTA 3I9NA 1CYDA 2AE1A 2O48X 2O50A 2DBRA 3KOUA 2B5VA 4BO8A 4DPLA 3GR6A 1MGOA 4RCVA 4LSMA 4MP6A 2HMSA 5GZ6A 1PZGA 2JHFA 1P0CA 2DC1A 3MZ0A 4II2A 2AQ8A 4B4WA 1JU9A 5KWEA 3VZQA 3IP1A 4JBGA 4RDHA 2HU2A 5LDGA 1ISJA 2JHGA 4I5EA 4TQGA 3E18A 1OBFO 2UUPA 2Y1FA 2GZ2A 3IAHA 4NG5A 3TZQA 1U3WA 1EMDA 1XWFA 2EXXA 4MDHA 5KKCA 2GN6A 1YWGO 2NSDA 4FFPA 3AU8A 3NT2A 4E2XA 4M55A 1F06A 5I9MA 1KVQA 4A10A 1NHGA 3DDNA 3PTZA 4IINA 1K6JA 1OAAA 2O7QA 1YO6A 3U4DA 4NBWA 4ALLA 4UUNA 1XGKA 3EHEA 1C0IA 1T4BA 3UHAA 1I2BA 5CPBA 4BO7A 3H3FA 3IUPA 3ZHYA 1DRWA 4XKJA 1VRWA 2EW8A 4NBUA 3WQSB 2FSVA 3NTQA 5DP2A 2AEFA 1T26A 4U7WA 3UGKA 2AG5A 1L7DA 4I5DA 4J6FA 1DPGA 1HDRA 4Y67A 4YT5A 1IULA 2VZ9A 4BNGA 4B8ZA 4CR6A 1Y81A 1LSUA 3GG2A 4Z6KA 4BO0A 4YAIA 1ULSA 4YJGB 1ZIDA 4CM3A 2ZTVA 1ONOA 3RI3A 1VSUA 2HK7A 5EESA 4F6CA 3D5TA 5ADHA 1H6BA 1MXFA 3LVFO 3HWRA 4D3DA 4QO7A 4UUPA 3I83A 1E7SA 3MJEA 4M54A 3A14A 4OQZA 3SVTA 1GYRA 1TT5A 2FZWA 1HDXA 4CQMA 5FWNA 1TLTA 4JK3A 5G0WA 4HFJA 1JN0A 2DUUA 4DRYA 3C7CB 4FFRA 2J3KA 3IP3A 3ZV5A 2ZATA 1XG5A 3NV9A 5TSDA 1LBEA 3LYLA 3PJGA 4P22A 3KVOA 4J1SA 1UDBA 4DYDA 4NK5A 4OYRA 1U8XX 3VKUA 2ZIZA 3BTSA 3QE3A 4ZICA 1P1IA 1WZEA 4BNHA 3O8QB 4BKUA 1GPJA 3VDRA 4FSHA 2BKAA 1EK6A 4OL9A 1I36A 1K89A 2VYVD 4WCFA 5CDSA 4WOKA 1IHYA 3I9MA 4UREA 3JSAA 2CF6A 3O8QA 4M49A 2GO1A 3ROMA 1H2BA 4EEXA 1NPDA 1D8AA 5JCXA 4BL5A 4UVHA 1VL8A 5IF3A 3AUTA 2H5LA 1K6XA 2EIHA 2YJZA 2X58A 4JX8A 2GD1O 4ALMA 1HEUA 3BMQB 1EQUA 2Y1CA 5KNLA 3LF1A 3OFSA 1VJTA 5L95A 2VHWA 2NU7A 3Q0EA 3D7LA 4J49A 1Y5RA 3HB4X 3TRIA 3D4OA 4NR0A 3WBBA 1HDOA 2DFDA 2NACA 3UVEA 3CMCO 2AE2A 3TJRA 3ORFA 3JQBA 3BMQA 2PZLA 4L74A 1I10A 5DBIA 1NXQA 3BA1A 5A5FA 1AXEA 4YAGA 1PL7A 3HHPA 4AVYA 2FN7A 4DMLA 3BMCA 1BSVA 4Q3CA 5TT0A 3PGXA 5KVCA 2PY6A 1WXDA 4YB8A 4IXTA 3S8MA 1UH5A 4CUKA 1BDBA 2QQ5A 2IZ0A 3ENKA 3NRCA 1U3VA 3GEGA 1I30A 5CEFA 4R1TA 1PJ2A 3RWBA 3DZIA 5B1YA 2QZ9A 4BNLA 1VKOA 1W8DA 4AJJA 2YV2A 4HKTA 1U8FO 4O59O 4GI2A 4DIFA 4WLUA 4FQ8A 1Q1NA 1U5CA 4QQRA 3ZH2A 3RJ9A 3DMTA 4GSLA 3KB6A 3WWYA 3GUCA 2AEMA 3LT1A 3DB2A 3ZV3A 1GY8A 4AJ2A 3NUGA 4WCFC 3JCZA 1IPEA 3CUKA 4RLHA 3JQFA 1JWAB 2B35A 5EJ2A 2Y0DA 2JFFA 2IE0A 4HP8A 5L51A 4XQEA 3JYOA 2E6UX 3OICA 4JXKA 5ER9A 3DWFA 1TB4A 4I9HA 2BLLA 1LRLA 1PJQA 4OSPA 3GN2A 3OA0A 4S3MA 1U9JA 1K2WA 2HQ1A 3LLVA 4RPGA 3ZNNA 3JQEA 1V8BA 3GG9A 1Y5MA 1HT0A 1MUUA 4D0SA 4ZQBA 3UFXA 4DBVO 1Z7EA 3U09A 2VUSA 3HFSA 1R0LA 1QYWA 4MP3A 3U4HA 1I5RA 3MJ4A 1B14A 4BO5A 6LDHA 1EBFA 5KVSA 1PGOA 1B15A 3P5SA 3GGPA 4DREA 1MP0A 2B37A 2Q46A 2RH8A 1LI4A 1YRLA 3G17A 4IGEA 3BMNB 2QRKA 3G0OA 4CV2A 3GNTA 5JO9A 1FDUA 1E77A 1H6DA 2I65A 1WP4A 2C82A 1VKNA 3AOEA 3ZWMA 1KVSA 1HE5A 3G79A 1WAMA 3BMNA 5COAA 2UAGA 1HKUA 1GDHA 5DCYA 1U1IA 5A02A 2WE8A 1KS9A 5L3ZA 3JTMA 3WJAA 1ADBA 4TVOA 4PG8A 2RCYA 1ZW1A 2PGJA 1EEHA 1UAYA 4R1UA 5IFLA 2A4KA 4GX1A 5COQA 5KKAA 2W2LD 3RC1A 3C7AA 3CPSA 4ROSA 1NVGA 3EYWA 3FRJA 4XWYA 4QX6A 3T7EA 3WGTA 4RL6A 2HDHA 1DHTA 1ZJZA 2AG8A 5AXDA 1ZSYA 3PVZA 4XB1A 1NYTA 4NJMA 4EW6A 2OORA 3JD3A 4GH5A 2VTEA 3BZUA 4W82A 1F0YA 2JFGA 3DZBA 1W4ZA 1JVSA 3GY0A 1BVUA 4IMRA 5TLSA 4ZQHA 3WYBA 2BGMA 4BNWA 5FEUA 1LJ8A 4GVXA 4DPKA 3ZWPA 2FMUA 2X8LA 3D4PA 4N5MA 1CRWG 2PGLA 4DA9A 1KEUA 1P1KA 3EZYA 1KEWA 2X5JO 3FF4A 4IS2A 5C7LO 4IDDA 2EG9A 4HNHA 4W7HA 4J1TA 5L7WA 3BAZA 1GCUA 2D4AA 3S2EA 4FFNA 1NQ5A 4CMAA 4B7UA 2EP7A 1PGPA 4PCVA 5C37A 4E30A 5HWSA 1B3BA 5CEEA 2Q99A 2Q1UA 3TL3A 2CVQA 4YRDA 3WWZA 1GZ3A 4CLEA 1X7DA 4QXMA 3RBVA 2EWMA 1U28A 3W4IA 5BR7A 1O0SA 2BD0A 1XR3A 3GPIA 3JQ9A 3TOZA 3VAZA 3H9JA 5JCJD 4JCOA 4XCVA 4W4TA 5JS6A 2EJWA 1YQDA 3UCFA 4KP7A 1LLDA 3ZV6A 3AUAA 2IEDA 3R6DA 1PTJA 3AI1A 3SX2A 1ENOA 4J4HA 5LCXA 4R16A 3D3EA 5H81A 4NFYA 5HS6A 2OMEA 4BO1A 1MX3A 2IZZA 1LSJA 2NM0A 2O2SA 3IIEA 3QJ5A 2YHUA 1JA9A 5KOIA 3KETA 2JL1A 1WPQA 1ZO8A 3DTYA 1AN9A 3WR5A 2V6BA 2X0IA 3RFTA 1YXMA 1N5DA 4M1QA 1A7AA 3TQHA 4BV8A 1FXSA 1HETA 1UZNA 2NQ8A 4UAGA 5L9AA 4MVJA 3PZBA 3INTA 1BW9A 3ZHXA 3QLJA 3DZGA 3CSDA 1VSVA 4KUGA 4UVGA 2WTBA 1OI7A 4BNTA 4JGBA 4DLAA 3QSGA 2GN8A 3FNFA 4QFDA 2UUOA 1XU7A 4HWKA 4XA8A 1GYPA 3QWIA 5BSFA 3FI9A 3Q11A 2I5PO 4XZ3A 3IKVA 2QYTA 4BQPA 4BO3A 2VHVA 1XA0A 2CFCA 1P3DA 2D1YA 4DBZA 5BSGA 2IYOA 2X1HA 3PK0A 4FGSA 5JDCA 4A5OA 3RU7A 4RJTA 2Y0EA 3WTCA 3UCXA 1X1EA 3OBBA 4D43A 4EUFA 1G1AA 3GUYA 1T25A 3JQAA 1VJ0A 2E82A 5L45A 3H9UA 1HSOA 2OBNA 2X0NA 4MVJF 4R5MA 2PV7A 3VZPA 4CV1A 3UW3A 3F4LA 4MVJG 1QLHA 1H5QA 3WGYA 3U5TA 4WLFA 4DL9A 4ZD6A 3GK3A 3WXBA 2GRAA 2HRZA 3VH2A 1EFKA 4N5NA 1XELA 1DIAA 3I3OA 1F8FA 1UZMA 3KO8A 3GGGA 1RYEA 2Y93A 3FNHA 1NR1A 4J7CA 2C29D 1R4NA 2OUIA 4K1LA 5HRUA 1YVEI 4GAEA 1JVBA 2X86A 1BXGB 1RM0A 2RH4A 4PIVA 4BGVA 2AXQA 3I9JA 1ZK1A 4J9VA 1A5ZA 2C2YA 2EKLA 1DB3A 3NKLA 1Q7BA 4ZQEA 1WDKA 2XOXA 1NQTA 3DZHA 3HDYA 3WFIA 2NLOA 5L40A 4BB5A 2SCUA 1BXGA 2V6GA 4BMNA 1U4SA 2ZK7A 4R69A 3PFWO 1EFLA 1HZJA 3DONA 3DXFA 4GMFA 2AQHA 3E5MA 4MVJM 1PSDA 1KVRA 4IXWA 4J0EA 1B8VA 4YQZA 1NFFA 1U3UA 2PZMA 1LDMA 3VH3A 3BHJA 4MKRA 4Z0HO 2E49A 5TNXA 1T2FA 3VH4A 3WGZA 4CMGA 3S2FA 1NFQA 3OEWA 4YACA 4B4OA 2ZTLA 1DFIA 1MC4A 2WD8A 4L73A 1V35A 3STHA 1ZK4A 1E1MA 2GR9A 3GLQA 1MA0A 2Z1NA 3DFZA 5T6BA 3WQRA 3WSVA 3X2FA 4M86A 2PK3A 3IUSA 4DXHA 4ALNA 3L77A 5JDCC 3ZW9A 2JFHA 3DBRB 3BHIA 4YT4A 4X54A 1DAOA 3DHEA 3Q9NA 1GEEA 4K6FA 1NBOA 3V1UA 5CDUA 2H1SA 1NTOA 1VJ1A 4YAEA 3CIFA 1GV1A 4XGNA 1E7WA 4AL4A 3DHYA 2JCVA 2FPPA 1SOWA 1EVYA 1JAYA 1DIGA 1A27A 3M6IA 4YJDA 1E1KA 1HXHA 4J0FA 1BWSA 4ND3A 1U2GA 2Z1MA 1EVJA 2VOJA 3RUFA 3IDSA 4OXYA 4BNVA 4XYMA 3GEMA 5I8WA 1Y8RB 2PD6A 3CINA 4QEDA 5JPIA 5ER6A 3AM3A 4BVAA 3JQ8B 2CF5A 2JJYA 2WD7B 4XX0A 3FBTA 1Q0HA 1JLLA 3H6KA 4NFHA 4HADA 1Y8RA 1SAYA 2W8ZA 4CJXA 3QA9A 4QT0A 1EUDA 3JQ8A 4H15A 3RC7A 4TZTA 2WD7A 5JYDA 4N18A 2FOIA 2YV3A 2Q4EA 4DIOA 3ST7A 5IDYA 4GX5A 4ND4A 1SC6A 4H3VA 4TSKA 1GV0A 1HDCA 2GZ1A 2G5CA 3ZU5A 4Z0TA 3K73O 2V6MA 3DHNA 1NASA 4NBRA 2IXAA 1HE3A 3OQBA 4NFSA 2O3RA 3ZI0A 2V7PA 3SBOA 3FPCA 3WOHA 3E8XA 2VYVA 1NWHA 3U62A 2IODA 3F1KA 3NT4A 2HMTA 1PJSA 3Q2IA 3L6DA 3CE6A 5CDGA 3WNQA 2P9EA 3JQ7B 3K2BA 5F5LA 3C3XA 3MJVA 3PZRA 1GAEO 1BMDA 1JDJA 3ITDA 5IDQA 1CQJA 1PZHA 1FDTA 1GTMA 4CUZA 5F1KA 1J6UA 1EUCA 3AY3A 3BXXA 2O3QA 3E48A 3O38A 4DYVA 4JROA 3C7DB 4PLFA 3I9LA 1KC3A 3ROPA 1LDYA 3F46A 4R9SA 3JD1A 3KSZO 2FRDA 2VRCD 4YEDA 3UF0A 1H94A 3TSCA 3QWFA 1ADGA 3GVIA 5JC1A 5KIAA 3KV3O 3ONDA 4NBVA 5ENVA 5IXSA 3LF2A 1Q0LA 4BOYA 1MFPA 2DKNA 3LT2A 3NJ8A 4GX2A 4GL4A 3V5NA 1R15A 4HUJA 1ISFA 2UYYA 3L4SO 1QV6A 2CNBA 4E21A 4YTEA 4CMBA 1XU9A 2GF2A 4I8XA 4YT2A 2P4QA 3QWHA 5HS4A 4GKBA 3UXYA 4F46A 3WB9A 5A9SB 1XIVA 1GPDG 2PZKA 4E0BA 3NDJA 3GGOA 5THQA 3G1UA 4BKPA 3B1KA 1JKJA 5IJZA 1JKIA 1HF3A 1M6HA 4U8GA 4CUJA 5I9LA 4EI2A 2GERA 3AJRA 3RQSA 4FJ1A 2XAAA 4PZDA 1E6EA 3OA2A 3Q2KA 3ZU4A 4C7JA 4Z3KA 2DBQA 5KJ1A 3WGIA 1DLIA 1N2SA 3OIFA 4ZQFA 4E6PA 2NU8A 4OKIA 3INRA 2WE7A 2OFPA 4CR7A 1WDMA 1DC3A 1PQUA 5U4QA 5IN4A 5F1PA 4Z9YA 5A5EA 5HBRA 1LLUA 2AQKA 3H3JA 4IJKA 1J49A 4K26A 3C1TA 3OIDA 3KHUA 4OHUA 3ICCA 4RGBA 4PVCA 4QTZA 2YDYA 2HUNA 3ZNPA 1I2CA 1DJQA 5GZ1A 3R3JA 1YL5A 4NJOA 4OOEA 4Q3AA 3MTJA 4RZHA 3QWAA 1B0AA 1GUYA 1YKFA 4PRKA 3KSDO 4J4BA 3QV1A 4GWGA 3WGQA 1M66A 3RASA 1L1FA 1GUZA 4F3YA 2GCGA 2I67A 1EE9A 1GEGA 1D1TA 3GNQA 2JD1A 1ZMOA 1NAHA 3VHRA 3DO5A 1NNUA 1OMOA 4CMKA 2XXBA 2D59A 4J43A 4BO2A 1B2LA 4LK3A 2B36A 4GMGA 4UUOA 4LN1A 2PH5A 2O3UA 1BXKA 2BI8A 1EDZA 4LCJA 1QORA 1P1FA 2XF8A 1LDBA 4P8RA 4IGFA 1KIFA 4F45A 3AOGA 3GRKA 3ZV4A 5IZ4A 1D7OA 3U4IA 2NTVA 1GL3A 2HCTA 1P1HA 3QP9A 3ZNQA 2FY8A 5TRTA 4IPTA 4MVJI 4BNXA 5KJFA 4P4LA 5KVVA 1BDMA 4RPLA 2VCYA 3INGA 2DQ4A 4Y6SA 3PJFA 2QRJA 2VWQA 3FR7A 1DAPA 1KBZA 3R3SA 4UVDA 3UN1A 2DT5A 4ND5A 4WOJA 2CDCA 1X1TA 4XDZA 4YJGA 3PLNA 1R4MB 2W2LA 3MTGA 1Q7CA 2TMGA 4MP8A 4DC1A 2VQ3A 2PKQP 4KWHA 5KJCA 4RPKA 4A26A 1O6ZA 4GKVA 2R6JA 2Y68A 5A04A 3BTOA 2FWMX 4M87A 4R3NA 4W99A 3HB5X 5CEJA 4D3SA 1R4MA 1PZFA 3OJEA 3RUIA 1YOVB 3ICPA 4HXYA 1EK5A 2NU6A 2O3TA 3GVHA 4R9RA 4L4XA 2D8AA 3I1JA 3PWSA 1QYXA 2DBZA 2OGUA 5K0ZA 4CPDA 2PR2A 4RZIA 1YOVA 3ZWYA 2Q1WA 3ULKA 1AE1A 1GZ4A 1UXJA 3TDKA 1SEPA 1ENPA 5B12A 3QRWA 1HE2A 4IS3A 2GPTA 4JP3A 3KZVA 1I8TA 4L9RA 5FFFA 4CMHA 4KDEA 1ISMA 1NM5A 3AFNA 3PYXA 3WTBA 1HDYA 4CMEA 2ET6A 2FPIA 3E9QA 2DAPA 1XCBA 4LRSB 4E13A 3MJTA 1QG6A 3HJAA 2UV8A 3K8ZA 4EJ0A 2P91A 3NDIA 4UEKA 4JJFA 3G49A 2ZB4A 3F1LA 4I5GA 1YBAA 2WYUA 3DOJA 4BHTA 4B8WA 4B3JA 4ZQGA 3KYBA 4RQUA 5JDIA 2VWPA 2QHXA 2CY0A 5JCJA 3L9XA 4OOFA 1ORRA 1E7QA 2CVZA 1F12A 3OETA 4RV9A 3S2GA 4C4OA 1DC5A 1KVTA 4CM8B 3DTTA 2JAPA 3AM4A 3BIOA 1E3EA 1NWCA 4DVJA 2D3TA 4YA6A 1WW8A 2POQX 1U7TA 4IDCA 1YBVA 4MJLA 4CM8A 3EDMA 4XQCA 5JMWA 1TEHA 3OIGA 1FJHA 3IOYA 2C20A 2RHCA 4CLXA 4YVFA 2CD9A 1YB4A 2Y05A 3UKOA 1OFGA 1O94A 2Q2QA 1H9BA 3OSUA 5JAQA 1Q0QA 2J3JA 5T8KA 1IYZA 4A7PA 2B83A 2TMDA 3C1OA 2C54A 2V65A 4RF4A 1I33A 3GDOA 4EEZA 4D7AA 2P5YA 2G76A 4N54A 5EPOA 2D5AA 2Y1GA 4R4JA 1DRUA 3MJSA 1YBMA 1YGYA 4WGGA 2QW8A 1A9ZA 1PGQA 4U0KA 3IMFA 4JN6B 1SPXA 1Z74A 4CMEC 2VRBA 4JIGA 1MG0A 1I3KA 5T57A 3HNPA 1PU2A 4FOOA 2PKQO 1N7GA 2GSDA 4WK6A 5CG2A 4CQLB 4K28A 1E92A 1E3IA 4EZBA 4GGOA 3CTMA 2R00A 5A3VA 1I0ZA 3RU9A 1OC2A 1KVUA 1LC0A 5GMOA 5CHEA 3LLSA 5EINA 3D0OA 4OMUA 4OXNA 4Z9XA 3K2EA 4R01A 4WCDA 1PQPA 3L4BA 1DHRA 2PWZA 3JQBC 2H6EA 4PG7A 1PGNA 3KLPX 1WLYA 2EEZA 2NTJA 4IIVA 4NK4A 1BRMA 1U5AA 3AUSA 3KSUA 4PVDA 4YYZA 4AJHA 4WUVA 2WYVA 3PLRA 4O1MA 4Q3DA 4RO0A 3PQFA 4WEOA 1ZMTA 3HSKA 1V9LA 3G3EA 1LLQA 1M75A 1ZUD1 3N7UA 3U49A 3JD4A 5IXYA 2E37A 2P9GA 4XR9A 4XRRA 3LSYA 1LDNA 5B4UA 5TQVA 4GPD1 1B26A 1PR3A 4P38A 4XYEA 4J16A 2D0IA 1SO8A 3O4RA 5F1OA 1PJTA 5CDYA 3LT4A 3DC2A 4MVJE 2D5CA 2ZTUA 2Q49A 1X7HA 5G0SA 3ABIA 3D3WB 3TZ6A 4EITA 3DMTC 3RFXA 4CM6A 4AJLA 1B8UA 1EVIA 1DC6A 3FCOA 4J1QA 5TJHA 1IHXA 7MDHA 3QQPA 1CDOA 1ZEJA 3PPIA 2FZEA 4FC7A 1A4UA 3CH6A 4ESOA 3JQFC 2Y99A 1DBVO 5J23A 3JD0A 3O26A 4BNKA 3DAGA 2O7SA 1QV7A 3H5NA 3WLEA 4B7CA 3S55A 3SC6A 3VZSA 1X13A 1PJLA 3GHYA 3ZWWA 1V3TA 3TZCA 5L53A 2LDBA 4IIUA 4PLCA 1F8GA 4CQMD 4BNZA 1ONPA 1E7YA 1XDWA 4KUHA 3H9GA 2C5EA 3T7CA 3WYCA 4RQTA 1E7RA 5DOZA 1QYDA 3NJ4A 3WLFA 1PEDA 3L4BC 4E5PA 4ND2A 1V0JA 2P4HX 1V3VA 4E32A 1KC1A 3A28A 2BHLA 1WDLA 2HRBA 3EGOA 3PJDA 4TWRA 5BNFA 3NGXA 1N9GB 3A4VA 2HJSA 2EP5A 2ZJ1A 1YL6A 4PLZA 1LA2A 5DCWA 4YJHB 4OH1A 1UXGA 1FDVA 4E4YA 1QR6A 1MB4A 2O3SA 1NQAO 3AOEC 3K9QO 3KYCB 1E1NA 3W8EA 5FF9A 4CLOB 4ZRMA 4WKGA 1Y1PA 3ENNA 1YS4A 4AICA 1T1SA 3RJ5A 5TC4A 2GN4A 4BKQA 1GCOA 1E3WB 1U2DA 4WEQA 3WX0A 4DLBA 4E5YA 1SCUA 3ZWCA 4BNUA 4CL8A 1MLDA 3OEYA 2PA3A 1HWYA 3GZNB 4MIEA 4NU5A 1AHIA 1O95A 4NU6A 1I24A 5K6AA 3ZU2A 4QFCA 1ZEMA 1C14A 4AJIA 4R51A 1E3WA 4G2NA 1ZK2A 3PWKA 5TGDA 5U9CA 3C85A 4BIIA 2OOSA 2I76A 3EC7A 1UJMA 2FR0A 2R2GA 4I5FA 3JV7A 4EBFA 4CM4B 4LVUA 5ENDA 4ALJA 4TRMA 2X5OA 3JYLA 2AW5A 2UVDA 1G0NA 1VC2A 1UP4A 2DBVO 3CZRA 3BTVA 3GEDA 4BQRA 1VM6A 3FN4A 1ZK0A 2Y66A 4IBOA 3RVDA 4ZN6A 1DC4A 4BO6A 3AU9A 3MCVA 1C0KA 4RDIA 2C59A 2Y1OA 5G2OA 3DR3A 3NTRA 5ITVA 3DZKA 3ANLA 4BKRA 3DL2A 4LMRA 5JC8A 3NX4A 5AOVA 1YE3A 4F6LA 4FBGA 4H7PA 1IB6A 4DC0A 4HBGA 1IOLA 3HDHA 1VLLA 1U4OA 3F47A 3KM0A 3PHHA 1PR9A 4H16A 2GYYA 5EQFA 1EVZA 1GZ6A 2VRCA 1ZFNA 4J1NA 1IZ9A 1UR5A 3HFGA 3PI7A 5G0UA 3SLGA 4DPMA 3NYWA 3JQ9C 4KQWA 4XD2A 1HYHA 3FTPA 1D4FA 2J8ZA 3GMDA 5BSEA 1S6YA 2PZJA 1YDWA 3OMLA 2BELA 4CMCA 1P44A 1ONNA 3GMSA 1M2WA 3GQVA 1EQ2A 3OP4A 4B4VA 3CEAA 1F14A 2Y0CA 4XJTA 1N8KA 1DEHA 1K6IA 2ZB8A 3ONEA 1WVGA 4GGPA 1RYDA 4BGIA 4EJMA 3B70A 2RIRA 5IAAA 5HA5A 1R16A 4Y6RA 2B0JA 4IJUA 5ITWA 5C3MA 1CWUA 3KYDB 4M8SA 1Y9AA 3LU1A 2XXJA 4B4UA 1KY5A 2YV1A 1MV8A 3M2PA 3DAFA 2CZCA 3PIDA 4KZPA 2NUAA 4AFNA 4AJEA 1IE3A 4TKLA 4EYEA 4PGFA 4B79A 5F21A 1H2HA 5GZ3A 9LDTA 5COBA 1YQGA 3KBOA 3P7MA 1BG6A 2WMDA 4TVBA 2J3HA 2BGLA 3Q1LA 4OAQA 1X7GA 4J4TA 1PJ4A 1ADFA 2ZKLA 4E31A 3H9EO 5DF1A 4FB5A 3N74A 4L4SA 2FHSA 1DIBA 3P2YA 2EHDA 1A71A 2FSSA 4YQYA 3DAPA 3KXDA 3WGGA 3WGOA 1KEPA 4Q3BA 3W8FA 3L07A 1UZLA 2HMVA 1XHLA 2NQTA 5A05A 5DOVA 5KTKA 3RIHA 2X9VA 4WLOA 1PWZA 4GLOA 1W6UA 3ETGA 2BFOA 3FHLA 5EQDA 4CV3A 5JNLA 3NDRA 3DBRA 4ALKA 4HFMA 3ANNA 3PJEA 5A9RA 4CM7A 5EERA 5MDHA 4LSWA 4HFRA 4IDGA 3HN2A 4L0QA 2ZTMA 4FDAA 2I3GA 3RSHA 1Z75A 5CPFA 3RD5A 2X4GA 5JXWA 2OP1A 3ADOA 3KUXA 1E5QA 2GN9A 1NP3A 5TX7A 4I9NA 2EKQA 1S7CA 4UULA 3WJ7A 4LW8A 1J0XO 3PYLA 5G0TA 1RM4A 1XSEA 2Z95A 3F3SA 2JD0A 1IPFA 3B1FA 1QMGA 5G0VA 1DIHA 1ZCJA 1DFHA 3NTOA 4WLVA 1CERA 3QVWA 4WPGA 4U6QA 1HLPA 1SBYA 3DZFA 4WLNA 4NH4A 3U0BA 1HDZA 1P31A 4MIYA 3VDQA 4KWIA 2DM6A 4IQ0A 2DUWA 3E6AA 5H83A 3QVOA 4B3IA 1HLDA 1ARZA 1ISIA 3JQCA 4J9UE 1O5IA 3QIVA 3WBFA 4GSKA 1WWKA 2VZ0A 5DBGA 3RUDA 1OC4A 1LU9A 4L76A 2B4RO 5ES3A 2YW9A 1I3NA 4OIMA 2B5WA 4AJPA 1E3SA 5JAIA 1T2AA 3DMYA 4FIZA 3PIIA 1KEVA 5AYVA 5MGBA 3OH8A 1P74A 4WNIA 5DZSA 3RC2A 1R12A 2ZYDA 3IQDB 3KRTA 2ZB3A 4Q9NA 3SEFA 2I9PA 4J91A 3PEFA 1F17A 4HX5A 3PQEA 4QUKA 2PFGA 1KETA 2PH3A 1X14A 4RVUA 1FK8A 1T2CA 3EY4A 5JO0A 1DO8A 4NI5A 4TROA 3TPCA 3MWDB 2PTGA 2HSDA 1QXSA 4N7RA 3PHLA 1BVRA 4YR9A 1KYQA 1L7EA 1LLCA 1XQ6A 2FR8A 3RBZA 1RJWA 2BFMA 2BI7A 4BO9A 4ILKA 4CLHA 3JQ7A 4OGWA 3PXXA 3AM5A 2HMUA 2W2KB 4UEOA 4II3A 3GC6A 1A72A 4J7UA 3H2SA 4XIYA 2J5QA 3F9IA 2VWHA 5TF4A 1XKQA 4XYGA 3EUWA 5JMPA 4WJZA 3HZZA 1HRDA 4MKXA 4OSOA 3MOIA 1SNYA 1GQYA 4PLHA 1LDEA 4BNIA 1R66A 3A9WA 3AW9A 4XDYA 1PL8A 3GH3A 2NADA 4O5OA 4Q3EA 2EKPA 5JW6A 4EUHA 3PRJA 3UUWA 1B7GO 3JQAD 4IDEA 3ZCXA 2OXIA 3C1AA 3ZNOA 2OP0A 2YYYA 3LC2O 3OHSX 2F00A 3GHHA 1LSOA 3FNEA 1B3RA 1RM3A 5DT9A 3RKRA 4AJOA 1CEQA 3NEPX 3E9NA 2UDPA 4E2YA 3CXRA 5A9SA 3PDUA 1E6WA 1HZZA 1UXKA 4PG4A 4DIBA 2JAHA 1LTHR 2EV9A 3AK4A 3W8DA 3B6ZA 3AUUA 3HDQA 3KTDA 4YT8A 2IZ1A 4NNJA 2VNSA 2YQ4A 2QX7A 4UEJA 3DOOA 1C0PA 3PHIA 4RF3A 1MXHA 2Y1EA 1T2EA 5LDHA 4YAJA 2BFAA 2A92A 3SXPA 1E0DA 5IG2A 1DJNA 3BYZA 4IDFA 1UP6A 3K92A 2HO5A 3H9QA 4GLLA 5I7EA 1R0KA 3MOGA 4DGSA 3EVTA 3SJUA 5ICSA 4NMHA 2C0CA 3CMMA 3C8MA 3WIEA 4O0LA 4TZKA 2EW2A 1ISGA 3E82A 4E3ZA 4J3FA 4OJNA 1Z82A 3BMOB 3FPLA 3LQFA 4TMFA 2G17A 2YUTA 4J7XA 4C7KA 4DQUA 4JP2A 5JYEA 2HK8A 1ADCA 3U3XA 1XEAA 3QHAA 5T67A 1LNQA 3BMOA 3VVCA 2ILTA 3I9KA 3I23A 1CIVA 2CSUA 3B1JA 2VZ8A 1G0OA 5IZCA 3AI2A 3G1TA 4XRGA 1K0UA 5TJ9A 1JQBA 2NV6A 2A9FA 4BGEA 5AXBA 1X0XA 1SB8A 7ADHA 3IC5A 1T1RA 2OBYA 2OO5A 3GA0A 3GT0A 3TL2A 5EL0A 4LVCA 4MINA 3VTZA 1EDOA 1Y7TA 5BQFA 5I7FA 5THKA 1AHHA 5JBIA 1CETA 2JKVA 1MFZA 5B37A 3UAGA 1JWBB 2RAFA 3UCEA 5EMHA 2IXBA 2BF7A 1GYQA 4Z9FA 4EGFA 2I99A 4D44A 4ITUA 2YFHA 2VT3A 2VYND 2GZ3A 4WNCA 1FMCA 2P2SA 5A1TA 3E03A 4OQYA 4PZEA 1GR0A 4FCCA 4IZHA 1TXGA 4B3HA 2X9NA 4CM9D 4BB6A 3LZ6A 4ND1A 1Z73A 3KLMX 4EUEA 3BTUA 3FTNA 4G65A 2VHYA 2ZQZA 2IDZA 1NAIA 3P2OA 4D42A 1V3UA 2BGKA 4AJNA 4DQVA 4XJSA 2W98A 1LQUA 1TT5B 3K96A 3KEQA 4CQMB 5A4DA 2GGSA 3M2TA 3L0DA 4KMSA 1GUFA 4NPCA 1VL0A 1K5HA 1X15A 3VPFA 3DZJA 4KQXA 1H93A 2O4CA 5AVOA 2E4AA 3PP8A 1E1LA 3H4VA 1BHSA 1SZJG 3OF2A 4IUYA 1C3VA 2BMAA 1SOVA 1Q2XA 2BFPA 2NU9A 4NZ9A 1E5LA 1KERA 3T4EA 4E5KA 4MVJH 1P1RA 2V6FA 5CFZA 4WCFB 4RF5A 4Z3DA 4JNKA 5DDIP 5IZCC 1R37A 3DQPA 4R54A 2W4QA 1HDGO 3I6IA 5BNTA 3HUDA 3K31A 3QVTA 3GVCA 4AG3A 1CJCA 1Z6ZA 1I2ZA 3GNSA 2G82A 4EJ6A 4ZU3A 4BMVA 1IY8A 2A94A 3DEYX 4YXFA 3WMXA 2J5KA 4RVGA 3OECA 8ADHA 5TIIA 1UXHA 4JBIA 3W4KA 5I9NA 3WDSA 2YY7A 3MJCA 4I08A 2I6TA 4LRTB 4R1NA 4CMJA 1LX6A 1PL6A 2VNAA 3QVXA 4UVIA 5BNIA 5BSHA 3H5RA 2Y1DA 1HSZA 2ZB7A 4JQCA 3GFBA 1E7MA 4CMIB 1GU7A 4D41A 1SB9A 1NX6A 3AFMA 3V1YA 1UP7A 4GBJA 4GWKA 2QG4A 3VVBA 3TF5A 1J4AA 1ENYA 3LC7O 3ZU3A 4JJIA 4MPDA 2VHZA 3FBGA 2H9IA 4IY1A 4ZA2A 2PGDA 4CMIA 4XYBA 3BMCB 4Y8VA 3H8VA 2G0TA 3X2EA 2J6IA 3VOSA 3D5QA 4TRNA 4FFOA 2C5AA 3ZN2A 2DPHA 2VUUA 4QSMA 1IZ0A 1HTBA 4U0JA 2WWRA 1H0KA 3N58A 4P4NA 3TFQA 3WFJA 4HV4A 3O03A 3O9ZA 1FF9A 3HDJA 2PD3A 1YONA 1WMAA 3V2GA 1RPNA 4CLDA 2BRUA 3GAFA 4R68A 1ZSNA 1QP8A 1LDGA 3LDHA 3P19A 4RVSA 3JQGB 3HN7A 3HG7A 5TT1A 1ZZEA 4ZRNA 2DLDA 4FJ0A 4YRBA 2Q3EA 3ONFA 4G81A 5A03A 3U9LA 5F5NA 3JQGA 1PIWA 2GLXA 1DSSG 4IJWA 1UDCA 3ETEA 1B16A 1RWBA 3FWNA 4U5QA 3VTFA 5B4VA 1Q7GA 3EZLA 4PLTA 3PYMA 1N7HA 3PDJA 4CQLA 1YDEA 3V2HA 3F4BA 4KOAA 4A0SA 4D79A 4YDRA 3OQ1A 2RHRA 4E2WA 3VH1A 4YJFB 1MC5A 5JDIC 1T2DA 4S1VA 4MOWA 3TWOA 3NGLA 2CMDA 5CDTA 1GFSA 1P1JA 1H9AA 2O3JA 3GVXA 4WASA 5C7OO 3F5SA 1I3LA 1J5PA 4YJFA 3JYPA 1NVMB 1PJCA 3GFGA 4XQGA 2VT2A 3ROQA 1U7HA 3W1VA 2DTDA 2VN8A 4HY3A 3LK7A 3WYEA 1O89A 2QIOA 3EAGA 4R41A 3CZMA 4CM5A 2C07A 5JFOA 3A06A 2NNLD 4KTTE 3ETDA 3GVPA 3JQDA 3R0IA 4RVDA 2O2YA 3IS3A 1KOLA 3W4JA 4EDFA 5KVQA 3D4NA 2HMWA 4PN3A 2JCXA 4J90A 1NHWA 5L4SA 5FI5A 4Z0PA 3PHJA 3QW2A 5T8KC 4UVEA 3SC4A 4XQ9A 3ZWXA 5DNAA 5HM8A 4BMSA 4PLWA 3W6UA 1M67A 2AMFA 3R1IA 4I1IA 1JKFA 4JBHA 2Q2VA 4B7XA 4TKMA 8LDHA 4ZVVA 2YFQA 1UDAA 1NQOA 2DVMA 3TFOA 1MG5A 2IYPA 4UUMA 2BH9A 5G4LA 1NR7A 3WQQA 3D3WA 1N92A 2Q2WA 5CAEA 1E6UA 4LGVA 5A06A 4A73A 4KDFA 3VPGA 1QSGA 3FWZA 1UXIA 3ZWVA 3WSWA 1QYCA 1B8PA 1I3MA 3V2UA 4DLLA 4FFLA 4MO2A 4JJGA 3RAJA 2ZCUA 4FGWA 4IQGA 1PS9A 2I3AA 4PLGA 4PLYA 3F6YA 2JCYA 2R00C 4BGUA 2HLPA 1DXYA 2WSBA 4INAA 4NJMB 3ZWNA 1HL3A 3M1LA 1YH3A 4BNYA 4KUEA 4NQZA 4OKNA 1PGJA 4WLEA 5C7IO 2VWGA 3F5QA 3E9MA 1P77A 2Q45A 2OHXA 4PZCA 3VPXA 1TVEA 4AJ1A 5JY6A 2PNFA 4DWVA 2ZCVA 4PLPA 3FNGA 4XIJA 1C1DB 4E2ZA 1LEHA 1NPYA 1TI7A 1ZH8A 3HQ4O 2QYSA 2ZYGA 4PRLA 3RFVA 2X0JA 3MWEB 2W90A 5T64A 4CV0A 5ILGA 1JAXA 4IJVA 3TN7A 2C7GA 2HAEA 1JW9B 3W6ZA 2CDBA 3RKUA 5ILOA 1N9GA 1C1DA 1I32A 2X22A 4FN4A 3GAZA 3DBVO 2QZZA 4XGKA 4Y9DA 4YJHA 3S2IA 4A03A 5AQ1A 3TOXA 4MIOA 3FSRA 3E1KA 4MVJP 1KY4A 3ASVA 3UOGA 2DPGA 2NTNA 4OM8A 3KYCA 3L9WA 4CR8A 4CLOA 1ID1A 2B4TO 3EW7A 3TZHA 1QRRA 1PJ3A 2I66A 2NVWA 2DU8A 3I4FA 3PGJA 3VKVA 4PLVA 3IKTA 2GDZA 1AUPA 4RVFA 5GY7A 1G6KA 3Q9UA 1ZXLA 4AJKA 1YQXA 4BNFA 4RF2A 3GZNA 4LISA 2IEBA 1O9BA 3IL2A 3AWDA 1E3JA 1P0FA 5G4KB 3RROA 2Q1TA 3NT5A 3RBXA 1PS8A 4KTVE 2WDZA 4JLWA 2NVUB 3JYQA 1M6WA 1BXZA 1T4DA 1UAGA 1SMKA 3OJ0A 4CM4A 3WS7A 4RORA 3NAQA 5G4KA 3ZHBA 4ZHSA 5L4NA 4D3FA 4OXKA 1PX0A 2VUTA 4YBZA 4K6CA 3JQ6A 3I5MA 4E33A 2NVUA 4LCEA 3TZKA 2HJRA 3I4CA 2ZJ0A 3AY7A 1A7KA 4IDBA 1BW9B 2VTDA 1LRKA 4BO4A 1YL7A 4IMPA 5DULA 3OM9A 1ZXBA 4O6VA 1GD1O 2EERA 3LT0A 1CF2O 1N1GA 5B4TA 4W9NA 2DFVA 4IZIA 4DMMA 5IDXA 3DBHB 3L6OO 4BUCA 1P33A 1EBUA 2RBEA 1Z45A 2EGGA 4G5HA 5JAMA 4ID9A 2AHRA 2PD4A 3OJFA 5EIOA 5DCUA 3A1NA 4PG6A 1VI2A 1W73A 1PWXA 3JQAB 3GOHA 1Z7BA 3COSA 4FR5A 4L75A 1BGVA 5DP1A 3DBHA 4GX0A 2B4QA 2EJVA 3OJOA 2B69A 5I7SA 2FR1A 2J5RA 3S1LA 2D2IA 1QLJA 4FFMA 3K6JA 2Q50A 4Q3NA 4R1SA 3LC1O 5K6AC 4WECA 2WYWA 3GDFA 1BTOA 1NFRA 2HK9A 1AGNA 2C7VA 5AXCA 4D45A 2VOEA 4HNGA 4NHEA 4GVLA 1ENZA 1A4IA 3ITKA 4FD3A 4QO8A 4XB2A 1R4NB 3EVNA 4N5LA 3EK2A 2CDAA 4J2OA 4NBTA 3C24A 2AA3A 1VPDA 3RUAA 5H82A 1Y6JA 4TRRA 4Q39A 1FDWA 2FPGA 4FJ2A 1EZ4A 2EF1A 3ZWBA 2Q4BA 4ZGWA 5TS3A 1T24A 2YQ5A 1TA4A 1ZSVA 3OQ6A 1WZIA 2YDXA 3KYDA 3T4XA 2O4UX 1WNTA 3GRPA 1ZKMA 4W7IA 3E5RA 2NWQA 4BS9A 5BT9A 2PLAA 4A2CA 4ZJUA 1GQQA 3ADPA 3ZWOA 3GF4A 2AEJA 5HTOA 2G1UA 5JLAA 2ZYAA 1HYEA 4CODB 5JAZA 2OZPA 3B20A 1EUZA 2X6TA 4Y6PA 3M1AA 2Z5LA 1H6CA 3OJLA 1DIRA 1LSSA 2OL4A 4HFNA 2WEKA 3DFUA 4W9NC 3HADA 5IDWA 2WM3A 3VZRA 3GDGA 2X5KO 2P9CA 3KEOA 4BV9A 2QRLA 1VL6A 3ON5A 4BNJA 2VHXA 1PJBA 1C1XB 1ULUA 4R3WA 1HE4A 1P45A 2X0RA 3MEQA 1I01A 3FD8A 3ZZNA 4J2HA 2E48A 2F1KA 1P9LA 3SLKA
chains in the Genus database with same CATH superfamily
1GZVA 4UCXA 4DJAA 2FPPB 2QTGA 4YRLA 3OUTA 2X9GA 1YZTA 2J3IA 1AKRA 1W29A 2W2NA 5DLEA 1JA1A 2AYYA 5EZQA 5BUSA 1JG4A 1UKZA 1D9XA 1KOFA 1NMQA 5ESRA 1T0PA 1T8WA 1IWPB 2ZUSA 5KNDA 1V39A 3B78A 3CUEF 4NOKA 3WNVA 4KOEC 4DUYB 4FYPA 4M60A 2Q2OA 2XOKA 3SQWA 1FDIA 4NDNE 3EGXA 4F84A 4OHZA 3BA6A 3QPBA 3K32A 2C3UA 4QLAA 1JIXA 3MGBA 3OE7D 4WZAA 5E0OA 3B53X 1C9DB 2CFIA 2Y1WA 1HYGA 1J0BA 1LRJA 4C6TB 4YUWA 1UPFA 2QMHA 4FDLA 4QJ5A 4ZDWA 3LPNA 4AY5A 3K9NA 3WMWA 4Y98A 5AOAA 3SIRA 3S7TA 5I3CA 1M10A 4G4GA 1E2DA 3EE6A 3L6EA 5DGHA 3KJIA 1HORA 3CPJB 4RUKA 4Y2TA 3F3MA 2GUGA 3X1JA 4FGZA 3G7UA 2M98A 2AQIA 4NIMA 4UARA 4FS3A 2HXGA 4HQLA 3VSEA 1KY3A 3T3MB 1S2MA 1OLXB 2VQ6A 1QYVA 3AY6A 4ENPA 4H1WA 3NTUA 1Y8QB 2QUKA 3K9BA 4BKOA 4L8VA 5L3RA 3GL9A 5HYVA 5HQ3A 1RMQA 1UJNA 4E51A 2ZREA 4UBLA 3FRHA 4L6AA 5AI9A 1RM5A 1ZBQA 4XIIA 3ZY3A 2P65A 5I8ZA 4LMPA 5K3FA 3U5ZB 5K9ZA 3HCCA 3VJKA 3RUEA 3OTIA 4IJ6A 1H4VB 1DCTA 3OX4A 1Y8QA 1EWQA 3S2ZA 5DBFA 2ZBUA 1ORWA 4DXDA 4RLSA 2V58A 1NVDA 4AKHA 1AXGA 3DGEC 4FPXA 2PGIA 3K4PA 1CHDA 5AKGA 5KEIA 2P2CA 1YUNA 4I55A 1S8AA 3CNQS 3DMFA 2WTNA 1JLRA 3DE3X 3LIPA 3D1LA 3R3UA 1OOEA 4I9UA 4MHSA 4E5NA 1G4AE 1PV4A 3K94A 1UMCB 1XWWA 4ZVMA 4ZK2A 4I1SA 3BEOA 5I4IA 1UPCA 3JAMA 2JEZA 4E5MA 1KGDA 3FTQA 3DTNA 1EESA 5L7TA 3ZJ4A 4FDTA 2CMHA 3L4KA 4C4YA 2YHIB 1H0HA 3V8BA 4F04A 2QM8A 3BCUA 1URPA 4IQ8A 1UMCA 3ZS8A 3KDSE 1K6MA 3GI1A 3EASA 2WJGA 2V7XA 2JIPA 4DCUA 4RK5A 1OA1A 1VE5A 1YB1A 5LC1A 2IZ7A 4CLRB 1V6AA 1Z6PA 2QPOA 3LUBA 3RKSA 3ZOZA 4DQXA 2YHIA 3A0RB 1RZRD 1IN1A 1WKCA 2GEVA 2IY9A 5ED0A 1SXIA 1KFEB 1TVKA 2NSHA 2C9BA 1AHNA 3DE0X 4X1YB 5KCZA 2NN3C 4KLCA 5REQA 5HPYB 1HNWB 3SLRA 2OB2A 1ZRHA 4RE6A 4TXHA 2CVOA 4E12A 5JFGA 2VT6A 4CLRA 1XZNA 1NLZA 4EABA 2NGRA 2H51A 3BCRA 4ZAYA 1P4GA 2C1XA 2CJYA 1MKYA 4A1OA 1DC8A 1M1XB 2PRKA 3VX3A 1COWD 1E3DA 5GJCA 4IP0A 2PO7A 4XEHA 3LOQA 4DV6B 1D1SA 3KEGA 2O8CA 4YCAA 3L8GA 2LR0A 3NVDA 1W25A 3QH4A 3EIEA 1F2TA 3KXLA 4FC6A 3OT1A 4R31A 4XR4A 4D46A 4GR5A 2VJDA 1RYHA 3PTLA 4KXYA 4JVMA 4I50F 3WDLA 1TT7A 1XD9A 3TI7A 2IKQA 2XB6A 3TKAA 5KJ6A 3G88A 5IJ0B 2XCTB 4GM4A 1DX6A 1GZSA 1P72A 1Z2OX 3C3WA 4QWMA 2I29A 4Q15A 1Y0BA 2JFWA 3GPDG 5DFAA 3FPEA 5JWOA 4OHCA 2CBXA 4G67A 1KKLA 5JY1A 2B61A 3RVOA 3F3YA 1GGMA 1MOPA 3H2JA 1N5MA 1NIJA 1XYYA 4KK4A 5CP8A 1TZ2A 3GN1A 4K9DA 2O5CA 1JBEA 1CEYA 1KSHA 1NBWB 3VOTA 1R6TA 1ZK3A 2ZRDA 2HKIA 2DF8A 3P20A 4G0NA 1SQSA 1EHIA 2E2WA 3FH0A 1PEYA 4B6OA 2FSIA 3NUQA 1V6SA 1F2UB 1W0CA 5ICMA 2ORED 4NENA 1ODLA 4JENA 4PQEA 1MB2A 2WQ7A 2DBRA 4F85A 1JQAA 1KTVA 4EY6A 1YZUA 2ZE7A 4CWAA 4YRNA 3RSQA 3P5BA 3ROXA 4TPKA 3SEQA 1LFAA 2XGOA 1RC1A 3BL6A 1V9CA 2FVXA 2IVZA 3IP1A 4EG5A 3JATA 5AI5A 2ZXUA 3ZY4A 4B71A 4TQGA 1FYDA 4KRFA 4LF9B 2IL1A 2PMWB 5IF9A 1CZUA 2G1PA 1CZRA 3CEPB 4NG5A 1AH2A 3Q8KA 5D3KA 1YWGO 2I1LA 1XTZA 1XI2A 3QJYA 4E2XA 3C41J 5ISMA 4XCQA 3PFIA 1LB1B 5GJWC 2WV9A 1NHGA 3DDNA 3PR2B 1F2DA 3PTZA 1W1IA 3EXFA 4BLOA 5KYYA 4IINA 1TEVA 2O7QA 1NQXA 3C3MA 4MZDA 1SUDA 3EXHC 1VKJA 1QAOA 3PEVA 2WFLB 2Q07A 3EVGA 5L3SB 1C7RA 3BCSA 1V16B 4DB2A 3KR9A 4A4DA 1VRWA 2INGX 4LC0A 2Q1XA 1EFVB 3NTQA 1VTKA 4N8EA 1L5NA 5B6IA 3K0SA 1MQ8B 2QPLA 4YMSA 4U7WA 1XTRA 1E66A 1S8FA 1RIIA 2ZBEA 3KDPA 2BMFA 3EGIA 4D2IA 2WFLA 4HB4A 4NESA 4IWYA 1V16A 1EQAA 1KAEA 4BMCA 4TTTS 4CR6A 1CP2A 1WB5A 4QJ4A 4L02A 5LNK6 1LSUA 4B3RB 3EA0A 1JHOA 3NIWA 1JFFB 1GNPA 3HCBA 4BO0A 3K15A 4ZAGA 3A6GA 5ALNA 1LPPA 1VRVA 5HKOA 1P7PA 5JEDA 4KU4A 4QASA 1DXHA 1KOJA 4JU8A 4NJEA 4C7VA 4D3SA 2R2AA 2C5GA 4O2BB 4HRXA 3LL4A 5EESA 3R7DA 2QV7A 5F7ZA 1FJ2A 3E3LA 2C3PA 3ENVA 2W0SA 1IUNA 1UKCA 4M9SA 1E7SA 3MJEA 5ALZA 3A14A 2OFOA 1GYRA 1JIJA 1QGUB 2XGSA 4CQMA 2CVFA 1DMRA 5HFJA 4O2BA 1X7WA 4CCYB 2O20A 3TSZA 5K3BA 3VGPA 4RA6A 1DL5A 1GL6A 1XG5A 3NV9A 3TTSA 3PJGA 2QMOA 4LX8A 1UFVA 2EKBA 1PHRA 5HRCA 2W93A 1UDBA 1QGUA 2A5GA 2C0PA 3OOSA 3P9CA 4OB7A 4P5EA 5J2UB 3VKUA 3QE3A 4US2R 5KQGA 4BNHA 1WZEA 3HMKA 4PYOA 2IIQA 1Z4KA 2K7FA 5CK5A 2GA8A 3HNOA 1BVYF 2QLNA 2QA5A 3M49A 2ERXA 2JGLA 4FSHA 4J0HA 3VDMA 1C7JA 4EKNB 2GF0A 5J2UA 2WIDA 4WOKA 4BVFA 1T29A 2X3FA 2ZUFA 3H18A 5F2EA 4HYEA 1UBFA 2GO1A 4MYRA 1PR4A 2O5VA 4TSFA 5KWVA 4EEXA 2MHCA 4PSKA 1LX7A 4FZVA 1D8AA 4BL5A 2CK3A 2H5LA 4P0QB 2NU7B 1F9AA 1H3NA 2Y2VA 4TLCA 2EIHA 4DA7A 1KFCB 2YWBA 4CIVA 2X58A 3E2PA 1SCDA 3TAHA 5C4GB 1EWTA 1JHAA 4XB6B 3I12A 1Q0RA 1QQBA 1SCNE 3OFSA 4I14A 1FP4B 2NU7A 1SIOA 1F6DA 1J25A 5JYCA 1XZGA 4V0MA 1SIBE 1Y5RA 5A7GA 4HO1X 5BW8A 3CMCO 3E27A 3TJRA 3M6UA 3ORFA 1DRKA 2PZLA 4W1SA 4ZT5A 4P58A 2ECPA 4TUYB 1FP4A 4FMPA 4GBMA 1XTJA 1F5SA 5I9LA 1KYIA 4OP1A 3LSTA 4GNRA 3LC0A 3VO8A 5A5FA 3G2MA 5IM4F 3RK4A 3L7KA 5M5BA 3HHPA 3NHKA 5J2TA 2QLBA 2FN7A 1N5LA 5J4LA 4Q3CA 3DEHA 1DEXA 2FXIA 3PGXA 5I9IA 4TUYA 2PY6A 1QIMA 1BN6A 3S8MA 4Z4EA 2O0KA 4JA0A 4WK2B 3ENKA 3DP9A 4MLPA 1U3VA 1YRBA 2XECA 2O57A 5E4JA 4BZZA 3O2SB 2XRYA 1ODKA 2VBFA 1G3MA 1CJSA 1XEWX 4MQ6A 1W8DA 3N8IA 4DAOA 3FYSA 4QATA 5JZVA 4JI4B 1JDBC 4EECA 3EWAA 3ID6C 4RHEA 4WLUA 3U7HB 3ZH2A 3TR5A 3DMTA 3NASA 3WWYA 1GLNA 3EWNA 2MYNA 1AKMA 4AKEA 3N0VA 2XQFA 3AC0A 5DN6A 2O8VA 5BQXA 3TSAA 2PUDA 2OO3A 3NR2A 1XXHE 4TOIA 4DSZA 1IPEA 5C53B 3NYQA 2IX3A 4X1KA 1GT6A 3PKJA 4P0TA 1UOEA 1G4UR 4H2DA 2YWFA 3SQDA 2Y0DA 5GADl 2JFFA 2C98A 5FAKA 1JHMA 2E6UX 1Y4SA 1P8AA 3AJEA 3OICA 1HGXA 1TB4A 2PPLA 2C03A 2G9RA 3DHVA 2AFIE 2HT6A 2IIVA 1LRLA 3N05A 3O1JC 4IIXA 4RKQA 2G9ZA 1HT2E 1K7YA 3UTDA 1XVIA 5K1ZA 2HJWA 1K2WA 4R1PA 1OX4B 3KALA 2BTOA 3D81A 1V8BA 2WIGA 2NZWA 2XYRA 3SF0A 1Y5MA 5FOSA 4JI3B 1MUUA 1BA3A 4D0SA 4ZQBA 4E4RA 2I0FA 2MT9A 2PANA 4EPYA 2R8XA 2G25A 3WK9A 2Z2XA 4HEA6 1GR1A 1L4GA 3HFSA 4IIJF 4R81A 1QYWA 1ISPA 3WB2A 5BUZA 1OX4A 1KARA 1PGOA 1ZGGA 3JPWA 2VQSA 3GGPA 3GPCA 2JIQA 3I2HA 4HF7A 3KSAC 4I1OA 2O6HA 4IXDA 1K88A 1S2GA 4IGEA 4JZKA 3V00A 3EXG1 1Z2EA 4CV2A 2PE5A 2PIAA 3EVEA 1A2OA 4L0DA 4ZI5A 2NO9A 1H6DA 3TQCA 1EK1A 1QCDA 4BBZA 5AVYA 4I4LA 4U4AA 4WKOA 3ZWMA 2RHGB 4D4GA 1WAMA 3KVRA 1P6UA 3LL7A 3UUWA 4FZ5A 3BIXA 5DCYA 4M0MA 1YBHA 4M6WB 2AEEA 2WE8A 2YWHA 3U48A 4TVOA 3PC3A 2WF8A 3MWYW 1TCCA 4R1UA 1TUEA 2OLKA 2EBFX 4RWZA 3REFA 1ZD3A 4LF6B 4MRMB 2PUHA 3FETA 2XNHA 3Q3JB 4M6WA 4TL8A 1BS2A 4LECA 5KKAA 4ROSA 1NJFA 1PG5A 5FTWA 6AT1A 5BSRA 1REQA 1ZGJA 1QV9A 1Y3CE 3KWMA 4W7SA 3D0KA 4C22A 2C8JA 4WFKA 4RL6A 4IRXA 1R1DA 3O47A 4RKYA 1DHTA 2IY8A 1EGAA 3TUZC 1PG0A 1E9BA 3UXEA 3V46A 2O8FB 1M7HA 2IS4A 4BVBA 4ACBA 5BYKA 3JD3A 3NBFA 1U0BB 1JBQA 2WA2A 2JFGA 3ADKA 1WV1A 5DK4A 2O2CA 3ZQ4A 4BVJA 5B1EA 4CTNA 1YC2A 1BVUA 4R84A 3T5PA 1FIUA 3TNYA 1FC0A 3UPUA 3A2LA 1E32A 1SUWA 2JCGA 1XYVA 5FEUA 3NP9A 4QGSA 4BFCA 3TGLA 4UOEA 1ZA2A 2Q8NA 2DQZA 4QFMA 2AJDA 1EG2A 3FF4A 4MWEA 2ZI7A 4IDDA 2ZYRA 5JI2E 2HU8A 2V3WA 4YN3A 1ISRA 1O96A 1GCUA 4HH4A 1A4XA 2G6BA 1NQ5A 4FFNA 1AK2A 4ZZ3A 3G2QA 1I51A 3MWEA 3N59A 5BRAA 3AT1A 1NT4A 5B3JA 5HWSA 2XWQA 3MQ2A 3PX7A 3BE5A 1KH2A 1UANA 3CUUA 1C7QA 2BISA 1B3BA 2WWGA 4K9NA 4TN5A 4TS1A 3UJ8A 6CHYA 1VKZA 4NDAA 3TL3A 2EDAA 3ECSA 4I9GA 2ZE8A 1MENA 2RCNA 4OJMX 2X15A 2CBZA 4NABA 2HJ9A 2C2WA 3AKZA 3C6ZA 1BU5A 3TOCA 2GCOA 1Z0JA 3RBVA 4A0GA 3W4IA 2BD0A 4JJ6A 4LHEA 1KH3A 1ZN2A 3MLAA 1QMPA 4AURA 5JS6A 1HBJA 2ANCA 3PD1A 3ESXA 3UCFA 4MMZB 5EE3A 5HGJA 3R6DA 2R8YA 1Z4IA 3C16C 3I4LA 1PTJA 2ZRQA 5EFOA 2C5LA 4DNXA 4Q9LA 2R6GA 4LX0A 4Q9HA 1QVWA 5H81A 2CV1A 3AIOA 3AVTA 3GJ6A 3G0GA 1A2KC 2O2HA 4NL4H 3H99A 3GCDA 4NFYA 4YCMA 1MX3A 3HXPA 1B1AA 1Q15A 4ZT3A 4LJKA 2GRUA 5DMXA 3QJ5A 2NUTA 3KETA 3NOVA 3KAJA 5T6MA 4M1SA 5C80A 1CCWA 1I0IA 1T3TA 5ALEA 3ME5A 1A8IA 2JANA 3TNFA 3R4VA 4L8LA 2X0IA 1LCIA 3AF6A 2H1FA 2J9GA 2AIRA 3HLKA 3HSSA 3HUTA 4K9RA 4M1QA 3VPCA 1CZNA 2PXHA 3NU1A 1A7AA 3C6KA 4AKTA 1HETA 3QLUC 1GL9B 4RKWA 3AR9A 2NQ8A 4JBXA 4UAGA 4MRAA 5L9AA 2P6NA 1MDBA 3B82A 1PQ4A 1BW9A 2BMVA 3BWVA 3L06A 3GIWA 3QLJA 4KREA 5HZGA 1VSVA 4KUGA 3E9DA 5ITSA 1NVFA 4BNTA 4JGBA 2ZJBA 1VP3A 3IV9A 3FNFA 4MUJA 4QFDA 2GVDC 4HWKA 1AKNA 1ZNWA 4XA8A 2GK7A 3M81A 3OZVA 4CTOA 3PD0A 2DR3A 3NNSA 2J7KA 5H7XA 1SXJD 2QYTA 3D4BA 5B1DA 3SD7A 5B55A 4CF3A 1VL1A 5BSGA 1NUQA 4C0WA 5M29A 3WGNA 1SG6A 4ZAVA 2IYOA 2E7ZA 1U9ZA 2H4ZA 3PK0A 3P9KA 5K3AA 3AI7A 1DJPA 4A5OA 4A6EA 3ZX5A 5A3QA 1UM9B 5JDCA 5CW1A 1RI1A 3LHKA 3WTCA 1H1LB 3LW8A 1WOYA 1X1EA 1XRJA 3D6FA 1NJ1A 1G1AA 3WYNA 1VGRA 1T25A 3RSLA 5IT9A 1Y98A 1YASA 4NF2A 5L45A 4X93A 1HSOA 5B3KA 4R5MA 4UD2A 3SG0A 3VZPA 1ELOA 1UM9A 4WN9B 4BUZA 1QPZA 1QLHA 2OY0A 4C78A 4M76B 3ZZ1A 1JDPA 4HDAA 1H5QA 1TC2A 1A9RA 3IDFA 2ZT5A 1OJ7A 3HPQA 4HOYA 4MLCA 4NICA 5CX1B 5DJ5A 5SY4A 1E96A 5DHAA 5DTIA 4ZD6A 2Z83A 3F67A 2BEKA 1JVNA 2GRAA 3OZXA 2IWRA 3GBVA 3IQIX 1EFKA 5CM2Z 3K6KA 1XELA 1DIAA 1QGYA 1RU3A 2DJ5A 4L9SA 2CHUA 4FFDA 5J59A 4CW7A 1HQCA 5C4MA 5K2OA 4DKJA 1R18A 3GFQA 3GGGA 5LOVA 5CX1A 4J7CA 5JASA 3EODA 3P26A 5AKIA 1OQAA 4Q3KA 5DGXA 2W2QA 5HRUA 1L4LA 3AB7A 5DW3A 4KV9A 1RMYA 3G8DA 2VJLA 3JTEA 1OGYA 2RH4A 3QMMA 3T7IA 2AXQA 5KSPA 3D02A 2EKLA 4AZTA 2ZJYA 1R7RA 1KHHA 5K0JA 3HDYA 1L8XA 1RYNA 4G0ZA 2FWIA 2OSBA 3DCNA 3X1MA 3F6EX 4FNOA 3WDMA 3FPBA 5DSZA 2CL5A 3AL0C 1AJEA 2DT8A 4R69A 2QMQA 1EM8B 3DONA 1ITZA 1JR3D 4YMTA 8ATCA 2ZSAA 2VP3A 3E5MA 1PSDA 4F4UA 2G06A 1JSRA 2QDKA 4YQZA 1NE7A 1U3UA 2AB0A 3IHKA 4AW9A 3TW4A 3WHPA 3R77A 3BHJA 4Z0HO 4CMGA 1T2FA 3AQ4A 4WW0A 3MFYA 4NRDA 1Z5GA 4QM7A 1EM8A 1F20A 1DZIA 1V8DA 3H9BA 3IUYA 4L27A 1QF7A 4C6SA 1JHVA 1DADA 5FP0A 2JG3A 2AMLA 1OE0A 4H4EA 3ZDAA 2ID4A 5A71A 2TECE 1G55A 1QG4A 1T1GA 5HILA 1YB7A 4ALNA 3L77A 4M0UA 2KI5A 1G60A 2YXEA 3FF1A 4G9EA 4YT4A 4MS3B 2IYWA 2VXOA 5AW3A 3VJRA 1NW4A 1LH0A 3DHEA 4K6FA 4H3KB 4NBKA 5CVTA 4TZ6A 1EXVA 5CDUA 1OZHA 2P6UA 2R1UA 2PXXA 4UNSA 3HU2A 2ZUDA 4PE5B 2X7JA 4UTZA 3N5CA 3CUWA 1PUIA 2P4SA 1PG2A 3HJCA 4MS3A 1AURA 2XD9A 1GU0A 1RQXA 4MUAA 3AXSA 2YWDA 1WCIB 1BMTA 1C8BA 4ID3A 1CQPA 1U2RA 4C05A 4XQ0A 2JFBA 4KRGA 1WHSA 5IKOA 4J0FA 2R7MA 2ZIXB 1QF9A 1UOPA 5M3BA 4HCJA 5A2QA 2VOJA 5AIBA 5AW5A 3U7JA 5FWYA 3D3NA 3E9RA 4F8JA 2PUVA 2H65A 5G3YA 3N39C 3IDSA 4OXYA 3E70C 1WS6A 5I8WA 3RAFC 1Y8RB 3CH4B 4RFLA 3ETNA 1C1HA 2GAFA 2ZIXA 4POOA 2OCIA 3JQ8B 3TX2A 1QO0A 2WD7B 3K20A 3PVCA 3CPEA 3FBTA 4GI5A 4XI9A 2MSDB 1JLLA 2XI4A 5HDQA 1Y8RA 3KUDA 1Z0SA 1X7XB 2BKXA 1DQSA 3CZQA 4CJXA 3IDQA 1Q1EA 1QHNA 2ZYIA 1O77A 1NZDA 1IBSA 3JQ8A 3OLYA 2WD7A 4OHWA 5JYDA 5EAIA 3RIYA 1M8PA 2C5HA 2E55A 3MN1A 1GM5A 2Q4EA 1HURA 3OZDA 2IEZA 1X7XA 3E2MA 3IA7A 4KFRA 4JUDX 3VAZA 2HUPA 2Q0QA 4ND4A 5M04A 3IEUA 1AQJA 4PQFA 1LK7A 2PN1A 2CLDX 3PNVA 4TSKA 2ZUEA 3Q98A 1ECLA 5K6RA 1GV0A 2X14A 2F7SA 2ZTSA 2V6MA 3DHNA 2YW2A 1CUSA 1WO8A 5AK5A 2OC9A 4NBRA 4FZJA 1HE3A 4DY6A 1APBA 3CJTA 2XWSA 1J33A 5JAHA 4URZR 2Y6VA 2YX1A 4B85A 3ACCA 4R0VA 3CEJA 2WP0A 5SY9A 3UMMA 1E2PA 1YS2X 3D8UA 4PXAA 2HSEA 5A3SA 2PA0A 4DJDC 5BN3B 5EJ4A 1N6HA 5ELXA 4YCLA 2IODA 1J39A 1L7OA 1CQJB 1YC5A 3F1KA 3F4KA 3IUJA 3CE6A 4X84A 4OK6A 1EUCB 2ZYHA 1YAHA 1FLNA 3SYRA 2FZ5A 1PVDA 1MHTA 5FUQA 3ADDA 4IYJA 2HBZA 5B57C 1BMDA 1MAUA 3ANYB 4YCBA 2K4MA 5EMNA 1Y1SA 2QNRA 2YZ2A 4KH1A 1G2QA 1NXVA 3K1TA 4JKOA 3NHSA 5EIBC 3JW8A 4K2AA 2IV7A 1CQJA 1KI4A 1PZHA 1ESNA 1FDTA 3ORQA 4MI1A 4RAOA 3SYKA 4AN4A 2IH2A 4MV1A 1EUCA 3KZOA 3D4LA 3OFKA 3BVPA 3KL2A 4JROA 3HXLA 4PLFA 3I9LA 4Q4JB 1TK3A 2GZAA 3H0KA 3KDAA 1F0KA 3IYLW 4MPTA 5U4XA 4IEFB 3BXGA 3ROPA 2OO7A 5EJ8A 3EMBA 1XAHA 1ST3A 3GA5A 4CG1A 4HPXB 1ZMXA 3V9AA 3R0ZA 1U0JA 1H94A 2P3QA 3TSCA 3QWFA 3EAQA 5GQSA 3GVIA 5EJ9A 5KIAA 3KZXA 2GJ8A 2IPOA 3ONDA 4OHBA 5ENVA 4JJZA 4JITA 3SSOA 4Q4JA 1MFPA 3UJ9A 4F96A 1TL7C 1QWOA 3F96A 2L69A 3GMIA 4QGHA 1V7QA 3L4SO 3BSFA 1PJZA 1Y82A 3WYDA 3WAGA 1GZ7A 3EBOA 4S1OA 1LJLA 4CMBA 1CJTC 3EGEA 3EPRA 4MYTA 3RB8A 3OPYA 1JKJB 2DJIA 2P4QA 3GUZA 3QWHA 4KMOA 4GKBA 3WZMA 3ZK8A 1DI0A 2CEAA 3ZDDA 1V2HE 5A9SB 1XIVA 2PZKA 1UC9A 3LZCA 3NDJA 2RK6A 2HDOA 2ADMA 1AOXA 1RMTA 4YAFA 1GIAA 3G1UA 4BKPA 1ZQ9A 3B1KA 1JKJA 2DECA 2ZYVX 1JKIA 4NEQA 3BGWA 4X92A 3O74A 5TB5A 3TINA 1EFTA 1GKLA 3NWPA 2VBIA 1ULZA 4RX1A 5ANRB 5T4FA 3AJRA 2B1RA 2NZVG 3RQSA 3RVJA 3WWCA 4DRXB 4EI2A 2ZRPA 4V1CI 3CRZA 3WNBA 3OA2A 4J76A 2N42A 3TIVA 5KJ1A 1QDLB 2PJZA 4UU1A 3EG9A 3WGIA 1XN1A 1I5OA 1ORVA 2A9RA 1KMHB 3L8ZA 2XNSA 4ZQFA 2NU8A 3KJXA 3ELWA 2WE7A 3MJHA 4GQBA 1T8YA 3L46A 1Z07A 4BVGA 4BMOB 3ZD6A 5F1PA 5AJVB 4Z9YA 3SE7A 1W44A 2KS6A 3DLAA 3UJBA 1JEDA 2YHBA 4I4TB 1J8MF 2WAYA 1JECA 4LRYA 4BEVA 5AUNB 1J49A 4K26A 4TQUS 3C1TA 3L1KA 3KHUA 4P2BA 2AWOA 4PSDA 1FRFS 3HJHA 2YDYA 1KH1A 3IAS1 4Y2VA 4F86A 4AKIA 2YOGA 3ZE1B 1D2GA 3R3JA 2GKSA 1QB7A 3HCOA 3MTJA 5EXTA 3CKKA 3QWAA 2EG5A 1YKFA 3LA6A 1C7ZA 4PRKA 4LSZA 4J4BA 3QV1A 1NXOA 1G3QA 1G6HA 2GFQA 3ZI7A 1KZ9A 1L1FA 1X87A 1SG9A 4UTNA 1A50B 4BUJA 1D1TA 4DV1B 1KJWA 4RADA 1CUIA 1IG3A 1JXQA 4I5IA 2OV2A 2E6KA 3LUDA 4GPBA 3SKYA 1TYZA 3PC6A 2XXBA 2D59A 3U7RA 3VKFA 4CMKA 3QPWA 2FW0A 2B2NA 1NKTA 2PH5A 2O3UA 1KJNA 5DGDA 1NGSA 2IELA 3ND8A 4L4UA 2BI8A 1XVTA 2YV4A 3M5CA 1QORA 3E9YA 3ENQA 2E5FA 2Q9AA 3G82C 3L7LA 5KCMA 4ZHQB 4QGBA 3X3HA 1HUQA 1TTPB 5FPSA 4GP6A 4PZYA 3ZV4A 1IAQA 2XUAA 4LYHA 4W5TA 2OV1A 4NYMR 2YXLA 1P5FA 1H42A 2FW6A 2JFOA 3QP9A 3U4IA 3WQBA 3L4JA 3OF3A 1W1UA 4L7VA 5TRTA 4IPTA 4BNXA 1S89A 3ND5A 1DKPA 2CNWD 1BDMA 1UDXA 3SQNA 4ZHQA 5BOSB 5IAOA 3OTQA 4NH0A 4X44A 2VCYA 5FJJA 5PGMA 3PJFA 4R6WA 1YI0A 3GUVA 1G5PA 3MM4A 1IQPA 5LZ9A 1RBMA 2CZQA 2GEBA 3HVUA 1HA3A 1GAWA 1KBZA 3WGLA 5LQAA 4M8LA 3UN1A 5JSZB 4LY6A 3H05A 4XDZA 1X1TA 2O59A 2AOVA 3PLNA 3I9FA 1UOOA 4FT4A 3BXEA 3SJZA 1W6RA 2GHIA 4EW1A 1N8TA 3AJ8A 5KJCA 1L5RA 1CQWA 1DG9A 2J45A 3F6RA 3MMXA 4KXUA 1O6ZA 4X95A 3EIFA 3PDWA 3O9MA 2WOJA 4W99A 5JSZA 4QYMA 3NCHA 1JPJA 3ICPA 4AY4A 1EK5A 2NU6A 1VZ3A 4C6HA 5C9ZA 2ZWAA 4DDMA 2D8AA 1YR8A 5E6RB 3A36A 4RK6A 1DG1G 1QYXA 5ICFA 3BJZA 1T6BY 3WLAA 2XB8A 4DQDA 5K0ZA 1TUBA 1OWMA 3ECCA 4BP9A 3DJYA 3CX6A 4BN4A 1A2BA 2Q5IA 3O9VA 2QVYX 2MIIA 3JY6A 3MWJA 4RZIA 3T7DA 3ULKA 4AG6A 1AE1A 4RGVA 1DRJA 2XTMA 3EXIB 4L08A 3WL4A 4YIKA 3E53A 5E6RA 4H6WA 5GTDA 2P78A 2VYCA 4IS3A 3REQA 4BGDA 1CF9A 1DX4A 3G5UA 4CMHA 1AQNA 1QHYA 4WNAB 4E3WA 5FOTA 1J24A 2PUWA 4ZC8A 4I4CA 1V8ZA 2PFKA 4OQLA 1MJGA 4QHTA 3E9QA 5CK4A 4UFNA 4O5AA 5AKYA 3OWHA 3X43A 5EIXA 2XUIA 3NH6A 2QORA 1JMKC 3BMXA 4ZOLB 4NONA 4E13A 4P5PA 3FGNA 3PNSA 1FTYA 4CCSA 1WBBA 1FRVA 4WNAA 3BIJA 3NDIA 4F5YA 3EQ9A 4JJFA 1FS5A 3G49A 2BCGY 3N2KB 4FDUA 4KODA 3VGJA 1G9TA 2EJUA 1YFJA 1W0JA 4JDUA 4KXFB 2WYUA 3DOJA 1CY2A 3CTPA 4ZQGA 3I64A 1MVOA 4ZOLA 1ESMA 3VZDA 3SHWA 3OZWA 2VWPA 3CM0A 3DA8A 2LP4Y 4OFBA 5JCJA 3SJCA 3L9XA 4ZT2A 3NETA 5DEOA 1RXWA 1YZLA 3MAGA 4OUDA 3AZQA 4LOLA 2R96A 4HEQA 1F12A 5BRNA 5LQSA 4FYJA 4DDWA 3S2GA 8AT1A 1DC5A 2C04A 4EKDA 4LXGA 5DHPA 2XA9A 1NWCA 1G8GA 4WZBA 1RJEA 4YA6A 3DAHA 2R0QC 1JA0A 3O4IA 3QK7A 2QL6A 3BM5A 3COYA 3HCAA 4PX9A 2F9LA 5EP1A 4FE7A 3TDMA 4MJ7A 1MVNA 1TZMA 1L5GB 4YUAA 1E1YA 3H5TA 5JMWA 3GPBA 3W2GA 1RKUA 5CLJA 3OIGA 2JK0A 2NUBA 4GW3A 2HHJA 5FUWA 2VNJA 3MHTA 4YVFA 1YB4A 2WINI 2GEUA 1OD6A 1GL7A 2W5UA 4US0R 1KF0A 1J9EA 4ND8B 1IY9A 1IYZA 3OQHA 4GZ5A 3NBMA 1QANA 2BI4A 2C54A 2O0HA 4GBED 3TQFA 1PF7E 5ELMA 4F5WA 4EEZA 1HL7A 1RD4A 1KSFX 1L4KA 2G76A 3WISA 5CB0A 5HSGA 4FGKA 1SN7A 1Q0TA 1DRUA 2I4OA 4P0PB 4PC3A 2ZGVA 5TPWA 3JQQA 4IIJA 4DSOA 1YGYA 2O2ZA 4GYYA 2QW8A 3AP1A 1PGQA 4U0KA 1Y48E 1JIIA 3ZCRA 3S8EA 4PC6A 2J33A 1Z74A 3KEMA 1T6ZA 4JIGA 4NZPA 1MJGM 1PU2A 4FOOA 3PXDA 3QKTA 4WK6A 2GSDA 4EA8A 1L8QA 4BEBA 4EZEA 4IHJB 4K28A 5DK6A 2UXDB 1E3IA 2BFFB 2LVBA 3BGIA 4TKVB 5F33A 4FMDB 1SCKA 4DANA 1GFIA 3SCZA 2OV4A 4Y6GB 2J30A 5KDOA 4RZ3A 1KVUA 3TO5A 4F1KA 4EVQA 5EINA 4OMUA 2WWIA 3AQIA 3KUCA 4IHJA 2IH4A 4WCDA 1OI3A 2CLLB 1VYHA 3MMNA 4UNRA 4MA0A 2Y92A 4Z7NB 3LHDA 4P7KA 2PWZA 1M54A 2Z9DA 4AWXA 3V8VA 4EUNA 1K98A 1WLYA 1WTCA 3OCUA 3CWCA 4O4JF 2LW7A 4ER5A 3HEAA 4FD2A 1PD1A 4GECA 2ZI5A 1P91A 2WYVA 1PTKA 4QBIA 5DNCA 4Q3DA 4M21A 3RRZA 2DH5A 5B7GA 2QR2A 3T1HB 5LQRA 3EDQA 3B12A 3DMHA 3D6VA 1V9LA 4MZXA 4RK4A 3JD4A 4XFDA 4XR9A 5IXYA 4EJFA 1Y42X 3WA7A 4ARAA 4GPD1 1GITA 2AFRA 2Y71A 4P38A 3G2JA 4ES6A 1M6EX 4XYEA 2XGJA 4J16A 1Y3AA 1AM4D 3NJRA 1RJFA 3R5XA 3ZIDA 3RW9A 5F1OA 3L1VA 2Y4OA 3H17A 1XRSB 3LT4A 3MS4A 4ZQIA 3IQHX 4BE7B 2XRFA 3PJRA 2Y0BA 1L4HA 4GF5A 3N2ZB 4Q66C 5G0SA 5K3EA 4DIDA 5I4KA 4JASB 1P2TA 1NVVQ 4JLUA 4U7TB 4CM6A 4E88A 1QCCA 4LHSA 1DC6A 4J1QA 4BTLA 3GOQA 2FVYA 1N3LA 7MDHA 4D4KA 4E07A 2C9OA 5WRFA 3S2UA 2I7TA 4JOBA 3LUKA 1UM8A 1ZEJA 3LP8A 4EKGA 1KO1A 1UBLS 1B00A 1N9KA 1Q0UA 3CH6A 4OFZA 2H52A 3JQFC 2XYHA 5HTKA 1PO7A 3NP7A 4X97A 4BMDA 5J23A 3KPWA 2QGFA 1K92A 2UYHA 5EZSA 2ZKIA 3CRMA 3DAGA 2DWOA 4NCBA 5DI9A 4LBVA 4LWZA 4B7CA 1K27A 1PJLA 2XA2A 3ZWWA 5B58C 1WUTA 4Y6OA 3C3EA 1Z4QA 1L5SA 1L5WA 4AUEA 5AM2A 5KNBA 1Y5LA 2Q5LA 2OCYC 4Y0NA 1RI3A 3A70A 3VSCA 3RC3A 3H9GA 2C5EA 2V6IA 2AK3A 5EXEA 4RQTA 4DYHA 1W36C 1U9CA 1WCWA 3GDWA 1V0JA 4TT3A 1P17A 2DX7A 3M4NA 4NLLA 4EVIA 1KC1A 5BQ3A 5JNTA 4O02B 1XF1A 1G17A 4H4CA 4BAGA 5ALPA 3FXAA 3SM9A 2DKOA 2P3SA 1J7JA 5ADVA 1Z5PA 2WG2A 3JZMA 3KKOA 3VYSB 4B4DA 3FWYA 2C7OA 1KU0A 1SK9A 2YN2A 3OE7A 4PLZA 4YJHB 2XTZA 4E5UA 1UXGA 4OXIA 5HKLA 4DE5A 4E4YA 1QR6A 5EIHA 2O3SA 5ED4A 1NQAO 1DIOB 2JFNA 3F6SA 3A1SA 4ISBA 3UXHA 3K9QO 5CCXA 1E1NA 2OLJA 4RLQA 1JLMA 1JMVA 1N2CE 2HB6A 4PYNA 4C4TA 5E4FA 1YS4A 3N7AA 5CFNA 1DS6A 2H2IA 4L2IB 3RJ5A 4FR0A 3UGQA 2GN4A 2OD9A 1OPRA 2TYSB 1U2DA 2I34A 4BQNA 2JLYA 4DMUB 1G8KA 4QZVA 4UHCA 1SCUA 4E5YA 4BNUA 1MLDA 1LV7A 4LXXA 1GVNB 1YFKA 2NXJA 1EB9A 3L5KA 2L82A 4OK3A 3GZNB 4ZAWA 1AHIA 1W94A 4Y9SA 1I24A 4JUCA 3JWIA 2O2JA 1ECJA 4NXNB 2AV6A 3D7RA 3IXLA 4TYMA 3V33A 1CFZA 3P8ZA 2HWXA 5H0IA 2IUTA 3ES9A 4DG5A 3C85A 2EFEB 1LPOA 5E9WA 3WB0A 2FR0A 5DRTA 5AVKA 2BJHA 4DZRA 4CI9A 1FDRA 3FKSD 3NAMA 3D7MA 4NBLA 5ENDA 4KJZA 5FOXA 4OLHA 4TRMA 4LWQA 5LZ7A 3OCZA 1TKBA 3STWA 3DW1X 1ZHOA 2VR1A 5CA1B 1OJLA 1USIA 4PZLA 4X91A 2BZ1A 1SC1A 1C41A 4AB1A 3QUCA 4IBOA 1T6XA 4QUBA 4ZOCA 4CDNA 4EQ6A 4KYIB 4ZO8A 1W5SA 2W11A 4UOQA 1K75A 1Z8NA 1FU8A 4LNAA 3PENA 4WUTA 1BX3A 2E18A 3BUSA 3NTRA 3ZCQA 3KTAB 4GI1A 2VXYA 4HG2A 3W5AA 2OZEA 3M1IA 5DWDA 5ITVA 4MVYA 1TU0A 3MTBA 3DL2A 4DGQA 1P60A 2YS7A 3NX4A 1YE3A 2ZIWB 4TVKA 2OUKA 3TEMA 2WQZA 1XQWA 3DTVB 1D03A 1KZ4A 3C6YA 1Y1RA 3L1UA 4PYJA 1RZRA 2RK4A 2ZRLA 1IB6A 1DPFA 2IK8A 1YBFA 4DC0A 2LE0A 5IRCD 3W2EA 4P7BA 2WA1A 2YNMA 1M5TA 1V25A 3HY3A 3PCRB 3IBYA 3PTAA 1U4OA 3F47A 3GJ5A 4BASA 1PR9A 4DWJA 4Z9AA 4EG1A 5LA6F 3DTVA 4GYJA 1NBAA 1EVZA 5AVJA 4B32A 1P0PA 2XYQA 5AJTA 1U28C 1SJ9A 1ZFNA 4EA9A 2VNKA 2Q62A 1QFJA 3PI7A 3SLGA 1AMOA 1T8PA 2FZ4A 1M5RA 1DBQA 1RSZA 2QZJA 2QRHA 4XD2A 1JHYA 2CLHB 1D4FA 2GCNA 2N9UA 4JLAA 3V4FA 4FIDA 1YDWA 3OMLA 4OH7A 1YT5A 3PLAE 1JI0A 4ZEWA 3PE3A 1KYZA 1QR2A 3VR5H 3ZHRA 5JAPA 4G0XA 3UMBA 3BKXA 4MW1A 1ZN9A 3GMSA 1M2WA 1JDTA 3GQVA 3WAJA 3MAAC 3R6TA 2NZJA 4JQZA 3BDIA 3HA7A 3PHCA 1N8KA 3KVVA 2FOXA 2JFQA 3VR2D 7YASA 2QRVB 4W7HA 5DNWA 2X1VA 2Q4DA 2G3YA 4EJMA 3S1SA 2RIRA 2SBTA 3K9LA 1YKGA 1GZDA 1R16A 2HX1A 3SNKA 1WXFA 3LDFA 5D00A 2QRVA 1TMKA 4IJUA 5ITWA 5C3MA 1TEZA 2YZKA 3RIXA 3LU1A 1D6SA 4B4UA 1TTHA 4PY2A 1PBTA 2WSSD 2QF7A 2YV1A 4HQKA 3DAFA 2N75A 3PIDA 4KZPA 2I4RA 4N47A 1IM5A 2YR0A 1GZUA 4EYEA 5JYBA 1VSBA 4YPFA 2J5BA 4G4SO 3W06A 4AAYA 3Q7QA 4ETMA 3OJXA 4TQ9A 2HCBA 5COBA 1A7JA 9LDTA 2WWHA 3QG1A 5C8YB 4LHZA 4MA5A 3ZLVA 4MYUA 2EATA 4FTWA 2I7XA 2J3HA 4G1BA 5J5VA 3LDGA 1RYYA 4JBYA 3DL4A 3I1YA 1PJ4A 3WK6A 3TVDA 3E3AA 1N5JA 4E31A 1DMSA 1L5VA 5CT5A 4FB5A 3N74A 5IARA 1U11A 1FYFA 5TY0A 4KO8A 3H2IA 2J6HA 1K6EA 3ZQUA 2EHDA 3WGGA 4YQYA 2JIDA 5IAJA 2R6FA 4JI5B 3QTTA 4X66B 1N3YA 1KEPA 1FFCA 1QFMA 2Q27A 2XIJA