3GDGA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
b'MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable NADP-dependent mannitol dehydrogenase
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
molecule tags Oxidoreductase
total genus 88
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdgA00
1KEPA 4J6FA 3VPFA 4Q3DA 2CD9A 2DBRA 4IGFA 4IXTA 3C85A 4UEKA 1ENOA 2PH5A 4B7XA 3DZIA 2BELA 3L4BA 4J4TA 4P22A 4ZVVA 4I5GA 3T4XA 5IXSA 5GMOA 3WJ7A 1IYZA 5ER9A 4OIMA 1A4UA 1PQUA 4TWRA 3K31A 2Y67A 1KEVA 4PIVA 2GUGA 1QLJA 3ONFA 4J1NA 3UUWA 5ENDA 1VE9A 1FJHA 1MG5A 4J2OA 3NDRA 3RAJA 3MWEB 1NPTO 4CQMB 4D0RA 5LDGA 1KERA 2FR8A 2VWGA 2VHZA 3TSCA 3AOEA 4TZTA 4MP6A 3JQCA 3N74A 1BXKA 2AG8A 1PGNA 4IM7A 3KYDA 2C82A 4IQ0A 4W7IA 3QY9A 4BUCA 2X7HA 3ZWWA 1X7GA 2CF6A 1HDYA 3JQAB 4GKBA 1LU9A 3GUYA 1Z45A 5JYDA 1M76A 1I36A 1TT5B 4BNNA 5TT0A 1LSSA 3RASA 1P77A 1W6UA 4CM9D 3D4PA 4GPD1 4PZEA 3VH2A 1JTVA 5JY6A 4BL5A 4HADA 1DO8A 1T2CA 4NK5A 4AJLA 3BMCB 4NNJA 2J5QA 2GCGA 3ZNPA 3RU9A 4A03A 3DZJA 5IDQA 1DIAA 3F1LA 5KWEA 1EUZA 2ZB8A 1QSGA 5KJCA 3KHUA 3LT2A 3KV3O 3GEGA 3NX4A 4DLLA 3H3JA 2VOJA 4YACA 3NEPX 5T57A 2PZMA 4AG3A 5T64A 1JKIA 1VJ1A 3HB4X 4XQ9A 1XQ6A 3PVZA 3LF2A 4AL4A 3GAZA 3G17A 1P31A 4BO7A 3FWNA 4XJTA 2BFPA 3F4BA 5FEUA 4LK3A 3GF4A 3LC7O 1AXGA 4E2ZA 3Q9NA 2VHYA 4MVJD 2P5UA 1UJMA 1IHYA 2P68A 4RVHA 3KVOA 3D3WB 3NRCA 4CJXA 4BO4A 3EMKA 3VDQA 3KLPX 4FJ1A 1FDWA 5HBRA 2ZKLA 5JXWA 4CMKA 2HCTA 2WM3A 3KYDB 4QECA 3VVCA 4W4TA 1YOVA 5JYEA 2AE2A 1P9LA 3L77A 4NPCA 1PJ2A 3AM5A 3AY3A 3F5SA 3NKLA 1A27A 3DL2A 1FDUA 3ZWCA 1D4FA 4IS2A 1HSZA 2UVDA 3WLFA 3ANMA 3HHPA 1I3NA 3RQSA 3W1VA 1E6EA 3JQ8A 2QRLA 3AI1A 1NQTA 3NYWA 4R16A 3WIDA 4YJDA 3GPDG 4MKXA 1K6IA 4DRYA 2G82A 2OORA 3DXFA 4CM3A 5TSDA 4R4JA 4DPLA 4D3FA 5L95A 2JFHA 3DWFA 4FFNA 1NP3A 2W8ZA 3H2SA 1LEHA 4EDFA 2ZTLA 4YJHB 4ALIA 5A3JA 3FNGA 1QORA 4FCCA 3VZSA 1ZO8A 5H81A 5JC8A 4QXMA 1M6WA 2D8AA 4D41A 4I9NA 3D64A 3OJLA 4YWJA 3ANLA 3U49A 1J6UA 4TSKA 2NWQA 2PTGA 3DTYA 4JP2A 4IZIA 4GGPA 1DRVA 1KVSA 4GX2A 4Q9NA 4WCFA 2BFMA 4BNLA 3RFVA 2AXQA 3I83A 2DBVO 4ZHSA 3W8EA 5I7SA 1YOVB 2RIRA 3K30A 3MJ4A 2RH8A 1WAMA 4H16A 5LCXA 5THQA 3PZRA 4FJ0A 3WMWA 4QSMA 1NXQA 4ROSA 1BVUA 3IP3A 3I6IA 3SEFA 1T24A 1EEHA 1G0OA 3KEOA 1XYGA 2VRCA 1M6HA 2ZIZA 2P4HX 1EQUA 4QQRA 2VWQA 1ZCJA 4RDHA 4CM4B 4BNGA 4LCEA 4RZIA 5JS6A 3FNFA 3PTZA 2FY8A 3BMOA 1VL8A 3F46A 4W82A 1U28A 5EERA 2R2GA 5JDIA 4ND2A 4PFJA 2Y1GA 4WLFA 2JCYA 4D45A 4DLAA 3VH1A 4WASA 1V8BA 3DMTC 2HLPA 5A9SA 3O9ZA 3GC6A 3DBRA 2V65A 3DAPA 5B4TA 2PZLA 3K96A 1XR3A 4WLVA 5EQFA 1ONNA 1Z74A 5A5FA 4BGIA 4FDAA 3RFTA 1B8VA 2B4RO 2HDHA 4M54A 1GL3A 1P3DA 2WSBA 3GGOA 3R6DA 1E3EA 1XGKA 4WCFB 3GVHA 1Z6ZA 2X9VA 5AQ1A 3NT5A 3ULKA 1UXKA 1DLIA 1LI4A 1KVUA 1XU7A 3HWRA 4YAEA 4ALLA 2BGLA 3JQ6A 4RLHA 4DPMA 1EFLA 1Y81A 2AQIA 2UAGA 4HFRA 3WOHA 1NM5A 1YJQA 4OXKA 2FWMX 2ZYGA 1N1EA 2PFGA 3GG9A 2PKQP 1ZZEA 1J0XO 4D0SA 3KO8A 1E6WA 2Q1WA 3E5RA 1YQXA 4XRRA 3BHIA 4WEOA 1BXZA 2GZ1A 2BHLA 2VUUA 3ZWPA 1LC0A 1ZFNA 5DCYA 4E33A 2X1HA 3H7AA 4ZN6A 4EI2A 1H9AA 3TF5A 1I3MA 4HBGA 1BW9A 1EVJA 4N18A 4NJMB 1HTBA 5MGBA 3AM4A 3RC1A 2PD4A 1NPYA 2GN9A 3BMOB 3VPHA 3P2OA 1NAIA 4TROA 1HDZA 3B1JA 1ENZA 1PL8A 3D4NA 4XDZA 5CAEA 1DFGA 4CMEA 4QO7A 4XB2A 4WGGA 3PJDA 1JKFA 1HDXA 4PRLA 4W6ZA 5G0WA 4BO9A 2GGSA 4E5KA 3M1AA 4LRTB 2FZWA 3V1YA 4A2CA 1YBMA 4II3A 2OP0A 3ZU5A 2JD0A 1F12A 4Y6SA 2C20A 2ET6A 5AXDA 1HWYA 1B8UA 4ILKA 4F6LA 5I9NA 1SPXA 1OOEA 1C0LA 3PGJA 1ZIDA 4FGWA 2B5VA 4LSMA 3OJEA 3NT2A 3OECA 5KVQA 4XQGA 1LDBA 3AUAA 1V6AA 5K6AA 4PLWA 1EVIA 2IZ1A 8LDHA 1WVGA 2VYNA 1Z75A 1RM3A 2Q45A 2G1UA 5T8KA 3C8MA 4EUEA 3GHHA 3ONDA 1H5QA 3IL2A 1SMKA 3WQQA 2HSDA 3TZ6A 2O2SA 3QSGA 3DHYA 3WNVA 1F0YA 2DTEA 3GNSA 4U6SA 3MZ0A 3L6OO 1UAGA 3PHLA 4NH4A 1ZSVA 3ZH2A 2O3JA 1A5ZA 4CV3A 1GPDG 4Z3KA 1IB6A 3EC7A 5T6BA 4DGSA 2B4QA 3H5NA 2JL1A 1EUCA 3X2FA 1YGYA 3OFSA 2OMEA 3GDOA 4PLGA 1BW9B 2EXXA 4YRDA 5F1KA 1W8DA 5TJ9A 3U9LA 1PIWA 5BSHA 4LISA 3FNHA 3GNQA 3L6EA 4JX8A 4DQUA 3ZWAA 1QYDA 5L53A 1LJ8A 1GTMA 2FHSA 4GL4A 1Y1PA 5JCXA 1BHSA 1ZNQO 2GO1A 4MO2A 4J7UA 1G6KA 1NFFA 1RM0A 1HEUA 3WSVA 1UUFA 3LU1A 3PXXA 2VHVA 3K92A 1LSOA 3QA9A 2Q49A 2O7QA 3K8ZA 1MB4A 5ILGA 4ZGWA 1LSJA 1E7SA 2WWRA 3FNEA 9LDTA 1YS4A 1BWSA 2TMDA 3B20A 4Q3BA 2CDAA 3KYCB 3QVOA 5IDYA 1IPEA 1QYCA 2GDZA 2YZ7A 4I08A 4NZ9A 4DQVA 2VRCD 5B4VA 3JYPA 2IYPA 3Q2KA 3LLSA 4R01A 2BI7A 2NV6A 3OJ0A 3RUCA 3RUIA 4DIOA 2Q4BA 2UYYA 5DN9A 3C1OA 4LMPA 3WFJA 4L75A 4OHUA 2ZB4A 3NJ4A 4ESOA 5L7YA 3JCZA 3IDSA 1UDAA 2R00A 2V6GA 3G3EA 5IZ4A 2X9NA 2X58A 1B3RA 4IPTA 4YR9A 1QYXA 3NGXA 3H4VA 3GEMA 1P1RA 3AOEC 4WUVA 1JVBA 1WXDA 3DZGA 4IZHA 1KY5A 3KETA 1E7MA 1ZK4A 4NMHA 6ADHA 1MFZA 2EHDA 4B3JA 1I3LA 4HFNA 5CEEA 2IYOA 1O95A 3EK2A 1X15A 2JHFA 4WOKA 3RVDA 5JAQA 1KYQA 4JCOA 4BO2A 2YW9A 1RPNA 1S6YA 2B36A 3JQ9C 3BHMA 3PHIA 3PQFA 4OKNA 1XQ1A 1NTOA 2WJPA 1E7QA 5CDYA 1B7GO 2O23A 1P0FA 1MV8A 3NAQA 4PG7A 5KTKA 4QX6A 4YT2A 4GWGA 2C5AA 4QFCA 1SCUA 3AOGA 4RDIA 4MP8A 3WGIA 5A3VA 4PLZA 4KOAA 3DBVO 5GZ3A 5JFOA 3BMQA 1DJQA 4LCJA 2C7VA 2Y0EA 4OXYA 3KSDO 4PLTA 4U8GA 2J3KA 3OP4A 4NBVA 2YJZA 2CF5A 3IOYA 1JA9A 1TVEA 4J7CA 1U1IA 4BMSA 4E2YA 3DZKA 3E1KA 3GG2A 2DBZA 2ZJ0A 4JIGA 2AG5A 4ZU3A 4ZQBA 1KBZA 4RPGA 1E3LA 4I9HA 1YB4A 4YCAA 1EDZA 5TC4A 4TKMA 4GMFA 2VN8A 4AJIA 1X1EA 1ISJA 3HSKA 1JVSA 2C5EA 4OSPA 1SNYA 1DRWA 4INAA 2X0RA 1B26A 3DHNA 1DC5A 4KTTE 4PN3A 2PD6A 3GRPA 1K2WA 4H7PA 2VUSA 1N2SA 4PLPA 2GRAA 1YB5A 4MVJG 1T4DA 2EV9A 2VYND 5F5LA 4I5DA 1R12A 3RFXA 4OQZA 3D5TA 1EFKA 2BD0A 5KJ1A 5IN5A 2QX7A 4ND4A 3FRJA 1Y9AA 2DVMA 4YXFA 3DOCA 4DMLA 3U4IA 1H6DA 3STHA 4RPJA 1HZZA 5A1TA 3FBGA 3DFUA 3RUAA 4UEOA 1Y9EA 3F5QA 3WWYA 4AJJA 1B8PA 1B16A 1ENYA 1VL6A 4DMMA 1ZK1A 3HFSA 3T4EA 2HK8A 2X9GA 1ZEJA 4R3NA 3FPLA 4NBUA 5IDXA 2HRZA 1LLQA 3SC4A 2V7PA 3HADA 1E6UA 3BTVA 3O4RA 2OHXA 5JAMA 1BDMA 1ZH8A 3GZ4A 2WYVA 1B3BA 2CVZA 4GX1A 2QYTA 1HZJA 4QUKA 4YAIA 1WZIA 5JCJA 3SVTA 4HP8A 1HYEA 3JD3A 3ZI0A 2HU2A 4IBOA 3ZV4A 4NQZA 3U09A 4RPKA 3GZNA 1YO6A 4J9UE 3RUDA 1O9BA 3F4LA 1R0KA 5DZSA 4NK4A 4QTZA 1E3SA 1NFRA 5F1PA 1E5LA 1XIVA 1GUFA 1R4NA 2PH3A 1O5IA 2Q1SA 3RJ5A 4OKIA 4BNTA 1AUPA 2HMVA 4JN6B 5L9AA 3E6AA 1LRKA 1GZ3A 3PWZA 4CMCA 5G0TA 4TQGA 1VM6A 3KUXA 6LDHA 2I5PO 1NFQA 1SZJG 2HMSA 3NTOA 1VJTA 4ZRNA 3GN1A 4BO1A 5A4DA 3QQPA 4Z9FA 5A02A 1ADCA 1U4SA 1GEEA 4W9NA 1K6XA 5I8WA 1M75A 1PL6A 1YXMA 2O50A 1JAYA 3INRA 2Q3EA 4JGBA 4MIOA 4FFPA 3TZHA 5IN4A 4DXHA 5CP8A 2Q1UA 4CLHA 1IY8A 3TFOA 1MFPA 2B37A 5C5IA 3CPSA 1P1FA 3JQBC 4Z0HO 3CE6A 1GV1A 3GFGA 3E8XA 1R6DA 1YWGO 5F5NA 3WB9A 1NQ5A 4E21A 4BOYA 1OC2A 2IZZA 3P7MA 4GGOA 4GLOA 3O38A 3PYLA 4WECA 4E4YA 4R41A 8ADHA 1VSUA 1GZ6A 3RC7A 4BB5A 4WOJA 4P4GA 5MDHA 4TRMA 3H2ZA 3WG9A 4R51A 3BMCA 1GUYA 2YHUA 4J4HA 4FD3A 2W4QA 3B70A 4M87A 3WGTA 4XA8A 4U5QA 1ZBQA 1KS9A 3W4IA 2D59A 3BMNB 3GZNB 1DXYA 3BIOA 3MOIA 5IJZA 1WWKA 4B7UA 2QW8A 2ZYDA 2X5OA 4PCVA 3UCXA 1NWCA 1R4NB 3BTUA 1X0XA 5U1PA 2A94A 3PDUA 5KVCA 3A4VA 2E48A 2ZQZA 4I9UA 1CWUA 2AE1A 2GYYA 2ILTA 4YB8A 5CEJA 5JO0A 5K9ZA 5EL0A 4R5HA 2QZZA 2CY0A 1DLJA 5JAZA 4O1MA 4J49A 1JWAB 1E3WA 4CLOB 1WP4A 4ZQEA 2GF2A 3GH3A 4M55A 5C3MA 3Q9UA 2XXJA 5EINA 5G4KA 3ABIA 3VHRA 3L9WA 2EJVA 3OMLA 2C07A 3BYZA 3O8QB 1I5RA 1LLUA 3DFZA 3D3WA 1QG6A 1C0KA 2YUTA 3L9XA 3I3OA 3ROPA 5A9RA 4EW6A 2BMAA 1GYPA 1XU9A 2FPIA 3ZWVA 3H9GA 4QEDA 1DHRA 4B4OA 2QRJA 4I5FA 2Q46A 4J0FA 3I9NA 2NU9A 1B2LA 1ADFA 2ZK7A 1WDMA 3CSDA 3QVSA 1T2FA 2YV2A 1CDOA 1MXFA 1I30A 1UH5A 3CZMA 3ZW9A 1ISFA 4CM6A 2B83A 3DTTA 4FFLA 4ZD6A 1YL7A 1PSDA 4KWHA 4OM8A 1VJ0A 4CMAA 3D4OA 4M8SA 4BGUA 4BNKA 4IGEA 4FQ8A 1NVMB 1QR6A 3GK3A 5CFZA 3PPIA 1NHWA 2NVBA 5GY7A 4E2WA 2J3HA 2Y1CA 3I1JA 4R1TA 5JC1A 1Y8QB 1HYGA 1EBUA 4FGSA 4L0QA 4GSLA 3AU8A 3ZV6A 3AJRA 1W73A 1SB9A 2IRWA 3M2TA 4NJOA 4PG4A 5I7EA 1HKUA 4PLFA 3QVXA 4YJHA 3WGZA 1DSSG 3TZQA 1ULUA 1E3WB 3Q2IA 4ND3A 5L40A 1E7YA 3EGOA 2ZQYA 4FIZA 4BV8A 3DB2A 5G4KB 1ISGA 1SEVA 4JK3A 3VAZA 2G17A 3RC2A 3Q1LA 4XB1A 2D4AA 5AXAA 2BI8A 4G81A 3EUWA 4E12A 4E13A 2ZJ1A 1DOHA 2DBQA 4OOEA 4PG8A 1YDWA 2C59A 3WICA 1FDVA 1TA4A 2IDZA 1U3VA 5K0ZA 1U5CA 2I76A 2VT2A 4EEZA 5JCJD 2E4AA 1F06A 4OO3A 1W0CA 3WBBA 3JV7A 2ZB7A 3SLKA 2Y1EA 3DR3A 3GVPA 2Y0DA 2PNFA 3SJ7A 4Y6PA 1Q0HA 4XKJA 1NR7A 1MGOA 3LVFO 3ZU2A 3VPGA 4JXKA 1U7TA 2HRBA 2OBYA 4DTIA 1XHLA 1X7DA 4BKRA 4XWYA 2YHIB 2O3UA 2BFAA 1AHIA 1I32A 3OIGA 1KIFA 4NBRA 4CM4A 3K5PA 3U5TA 1UAYA 2GLXA 2FN7A 3RU7A 2VT3A 1IHXA 3RSHA 4K6CA 4XZ3A 1GYQA 1LSUA 2JAPA 1T2AA 5B12A 3S2FA 2EKPA 4J16A 2B69A 2HUNA 4IDCA 5FWNA 4BO5A 4MP3A 4BS9A 1LDGA 5JAIA 2R00C 2UUOA 2UDPA 1E92A 1DBVO 1AGNA 1N7HA 3C7AA 4S1VA 4CQMD 1ZXBA 4M89A 2RHCA 2X6TA 4RPHA 5B1YA 2CMDA 3IAHA 3Q0EA 1PJCA 2BF7A 4DUPA 2FOIA 3KOUA 4U0JA 2V6MA 3C3XA 3TL3A 3CEAA 3JQAD 1GY8A 4IJUA 3RROA 3TRIA 4E32A 4YAKA 4G2NA 1XELA 3EVTA 4B4UA 1IUKA 2C54A 2I3AA 3AWDA 3K6JA 2DTDA 3DZBA 4BNZA 3DO5A 2I6TA 3OQ1A 1ZVMA 1JLLA 1YL6A 4ITUA 5I7FA 1BVRA 1PJ3A 1LDNA 4DBZA 4GBJA 3H9JA 3ST7A 4AJ2A 3FD8A 3S55A 1U2GA 3EDMA 4UULA 3CUKA 4B79A 1QXSA 3WS7A 1E7RA 1M2WA 4QFDA 4CLDA 2VCYA 3AW9A 3P2YA 4B3HA 4E3ZA 3JQFA 4J4BA 4KUGA 3Q6IA 3BTOA 3FI9A 1GADO 2POQX 2I3GA 3H5AA 5KVVA 4N7RA 2NU7A 3ASVA 3GAFA 3V8BA 2AA3A 5KJ6A 4NJMA 4GMGA 4RL6A 3JYNA 4XQEA 1YDEA 1KEWA 3PJGA 3GVCA 4U7WA 4IY1A 4R9RA 3VOSA 2C29D 1KVQA 1H94A 2JCVA 4MIYA 4YJFA 1Q2XA 3JSAA 5TX7A 5BSEA 1Q0QA 4TMFA 3UFXA 1NVTA 3NV9A 4ID9A 2DM6A 5JLAA 3PYXA 1ONOA 3WTBA 4AJKA 2XOXA 1FDTA 2X5JO 3ZWMA 3OF2A 2GNAA 3LZ6A 4N5LA 3UOGA 3NTQA 2YY7A 3ZW8A 2PK3A 2HKIA 2LDXA 1GUZA 4CV1A 1ZXLA 3DZHA 4HNHA 5HA5A 4BNIA 2SCUA 1ZUD1 3EZYA 2AMFA 4ALMA 1MXHA 3Q3CA 4QO8A 4DLBA 4M86A 1WDLA 1A9ZA 1PZEA 1BDBA 3WQRA 3P19A 4BO8A 5A03A 1FXSA 3U3XA 2OXIA 1RJWA 1IPFA 4RJTA 3PJEA 2EP5A 4WKGA 1LDEA 3WWZA 5IFLA 3TZKA 1X1TA 1J4AA 4R1UA 2B0JA 1HLDA 1MC5A 4MIEA 4HNGA 4MINA 1AXEA 3LSYA 5HM8A 4MKRA 1GV0A 1FF9A 4PLVA 2P2SA 4LN1A 1FDSA 3S8MA 3HDJA 1HE2A 2HJSA 1QP8A 2CUKA 4I8XA 3WMXA 1D7OA 3GUCA 3NJ8A 4GAEA 4Z0PA 2UUPA 3IUPA 2H1SA 4CR8A 3DQPA 3PIIA 1LDMA 2DPHA 1MX3A 4JBHA 3ZWXA 3KEQA 5KJFA 2Z1MA 3HN2A 5L7WA 4UVDA 1MA0A 4IQ8A 3W4KA 5IZCC 3LC2O 2W2LA 4YJFB 3RBVA 1Q7CA 1EVZA 5JDCA 2Q2QA 3IJPA 2AEFA 2AHRA 2BKAA 3GR6A 4E2XA 3ICCA 1LC3A 4N5NA 5BNTA 2OOSA 1HE4A 2WDZA 5EMHA 1GD1O 3JD4A 3TOXA 4BNMA 3FR7A 3I9JA 1WPQA 4XIYA 3ANNA 1LA2A 3W8DA 3TQHA 5GZ6A 3GNTA 2PA3A 1AN9A 2WD7A 3C1TA 4NG5A 4YAGA 1HSOA 3PK0A 4WEQA 1QYVA 3RKRA 3CMCO 1LLDA 4FBGA 2ZTUA 4IDAA 4JLWA 3UXYA 1CERA 1E5QA 1LRJA 4XCVA 3KYCA 3NGLA 2VWPA 3OIDA 4OH1A 3WSWA 1KEUA 1V3VA 4JBGA 1EZ4A 5F1OA 3SX2A 4IIUA 4KDFA 1Y8RB 2FR1A 3WGHA 2X0JA 4JJGA 5BT9A 4KTVE 9LDBA 4JQCA 1YBAA 1PX0A 3KM0A 2A35A 2E6UX 4RVGA 1ZSYA 4OOFA 1HE5A 4KWIA 5L7TA 2VTEA 4B7CA 2P91A 2PKRA 1HDRA 4NIMA 4BMNA 2CVOA 3HE3A 3PQDA 2AEMA 1GYRA 2EJWA 5I7VA 3LC1O 1NASA 1H6BA 2EKQA 3X2EA 3PFWO 4IMRA 2EERA 1GFSA 5HS4A 1W4ZA 1HETA 1CIVA 3NUGA 4KP7A 2YFQA 3WXBA 4L76A 2O3TA 3K2BA 1ARZA 1KC1A 2X0NA 4P4LA 4D79A 4YPOA 2CFCA 3V2UA 2F1KA 2E37A 2X22A 2E49A 3PWKA 3EW7A 3F6YA 4IJWA 5J23A 1PQPA 2YQ4A 1GQYA 3ZCXA 3KZVA 4BHTA 1V0JA 2J3JA 3AUUA 5CDGA 1F8GA 1VLLA 3SBOA 4F45A 1E77A 1YE3A 1SOVA 2WD7B 4GQAA 1NR1A 2VZ9A 3KTDA 3F3SA 3LK7A 4IDBA 1C0IA 1I10A 3TZCA 1QMGA 1M66A 4WNIA 5G4LA 4IDFA 1PEDA 2GN8A 5AOVA 3RKUA 1T1RA 1TLTA 2QIOA 4M1QA 5JO9A 3UF0A 1LXCA 2I67A 1YVEI 2FZEA 3LDHA 2ZCUA 2DUWA 2P9GA 1KVRA 5CG1A 1UXJA 4IXWA 3L4BC 3P5SA 4BKOA 1L7DA 2V6BA 1S7CA 1LQUA 3JYQA 1HDGO 4UUNA 5IXYA 5TF4A 2WE7A 5IG2A 1NPDA 4A5OA 4O6VA 4BQRA 4MVJE 1P1JA 5G0SA 3BAZA 1U8XX 3VKUA 1UR5A 2A92A 3MOGA 3PDJA 4K28A 2VNAA 5DBIA 5LDHA 1PGOA 2HQ1A 3AU9A 3QVWA 4WPGA 1N9GA 5TT1A 1F8FA 2IZ0A 1MC4A 2VYVA 1EUDA 4HX5A 4Q3EA 3ZU4A 3FTNA 3GLQA 1WMBA 1C1XB 4BNUA 1QRRA 5EN4A 1O8CA 1PJTA 4XJSA 1V9LA 3E5MA 1RM4A 4YA6A 3M1LA 4P8RA 1AE1A 4C7KA 5JE8A 2D5CA 3JQGA 4MPDA 1GEGA 5ILOA 5KVSA 4TVOA 2O2YA 5C7LO 1WNTA 3WQSB 4EEXA 4DVJA 3HFGA 3WDSA 1OI7A 2NNLD 2DFDA 2X8LA 4CPDA 4QT0A 4E5NA 1DHTA 1TEHA 3VZQA 4B4VA 1H2HA 1IZ0A 3WYBA 2WYUA 3QHAA 4FFRA 3H9UA 1TT7A 1E7WA 2EW2A 3PEFA 2JHGA 4PVDA 2DFVA 4TKLA 1PZGA 3DBHB 1UXIA 3ZWNA 3KYBA 3LT0A 5DP2A 1U2DA 3PLRA 4TZKA 1QV7A 4RZHA 1DIHA 4BQPA 2YDXA 1NYTA 2YFHA 4R5MA 2O7SA 2RCYA 4BNHA 2D0IA 4BNXA 4E5PA 3VPSA 2JAHA 5EPOA 2E82A 2TMGA 1BTOA 4UVEA 2DC1A 3FPCA 1H6CA 1NBOA 4LMRA 4ONEA 4YQZA 2AQ8A 2GZ3A 4LW8A 1OFGA 1DRUA 3VKVA 4NI5A 3FF4A 1N9GB 3FWZA 1UXGA 1HL3A 3PHGA 2EP7A 3N58A 3NTRA 3GMSA 4HFMA 4ALJA 4FB5A 4GX5A 3TPCA 3PRJA 3RWBA 4MOWA 2OUIA 5DBFA 5JW6A 1K89A 1PGQA 4AJ1A 3GHYA 4HV4A 3JQGB 1EBFA 4RVFA 1YL5A 4A73A 4RLSA 4BVAA 3W8FA 3M2PA 1Q0LA 4FC7A 5FFFA 3FTPA 2V6FA 1Y5MA 4WCDA 3DMTA 2WE8A 4MVJF 4NU6A 3TDKA 1HYHA 2B4TO 4OYRA 4A0SA 4XEHA 1TI7A 3VTZA 1K5HA 4O5OA 3LT4A 1LTHR 2QG4A 2BGKA 1BMDA 2HMTA 3MTGA 3RI3A 2O4CA 4R9SA 5ITWA 1H0KA 1Q7BA 5TS3A 3IP1A 4JBIA 3I9LA 2JFGA 4W99A 2Y1DA 3L0DA 4ZRMA 3G79A 1GPJA 5HRUA 4FPXA 1IULA 4BNJA 2QQ5A 3OH8A 3DC2A 3CIFA 3OBBA 1YONA 2GSDA 3KSZO 2EEZA 1CQIA 3ROQA 4J90A 4NR0A 3ZNNA 3PLNA 4CV2A 3FSRA 3SLGA 1DIGA 3U62A 1T1SA 2ZB3A 1CRWG 1OZAA 5ICMA 1VSVA 4C7JA 4WJZA 1ENPA 1XA0A 3D5QA 3V5NA 3VPXA 1BRMA 4L4SA 4WLOA 3TL2A 2DQ4A 2G0TA 3RCBA 1KETA 2QYSA 4WCFC 1HE3A 2RBEA 1PJQA 2NQ8A 2W98A 3AI3A 3HNPA 3AFNA 2NUAA 1A71A 3PP8A 5JBIA 4BNVA 1ZK3A 4DWVA 3V1TC 4ZICA 1JWBB 3BMNA 3TN7A 2O3RA 4Y8VA 5BQFA 2EF1A 4ND1A 2LDBA 4GVXA 1KVTA 4XYBA 4A26A 2VZ0A 4FJ2A 4YT4A 1SC6A 1HLPA 4UVHA 4A27A 3B6ZA 2NVUB 5CDSA 1PJBA 3E9QA 3DZFA 1DIBA 2P5YA 1Y7TA 1E3JA 2AQKA 2XAAA 1PS0A 4CLOA 3IUSA 1OAAA 4HY3A 2C2YA 3GGGA 5A9TA 3ETGA 4DREA 2A4KA 2WMDA 2J5RA 3AY6A 3NT4A 4CODB 3U0BA 3H9QA 1PTJA 3O8QA 4D42A 5JDIC 5A5EA 2DPGA 1U4OA 4J2HA 4YT8A 5IDWA 5HWSA 1D1SA 4RQTA 3C24A 2VYVD 5G2OA 1ADGA 1JQBA 3ENKA 4U0KA 4PZCA 1J5PA 3V2HA 3HDHA 1V3UA 2XF8A 2YQ5A 4MDHA 1KC3A 1SO8A 5JPIA 4KUHA 3QLJA 4K6FA 2X86A 3O03A 4D46A 3LF1A 4FOSA 4RV9A 3PZBA 4AJHA 4YDRA 4OSOA 2PGDA 4F3YA 3AY7A 4KQXA 1E1LA 5KKAA 1NAHA 2J5KA 4Y98A 5DOVA 2CZCA 5L4NA 4TRRA 1L1FA 2GN6A 4CM1A 2HAEA 1Y8QA 1D3AA 3CINA 3KRTA 4FOOA 2VOEA 3GN2A 4WLUA 2X23A 4CMHA 2Z95A 3VH3A 1NVGA 4IDDA 4RVSA 2VNSA 1X14A 3PFFA 3TOZA 5L51A 3H65A 1JAXA 1K6JA 2PWZA 4A10A 1GAEO 3DDNA 2IXBA 5FI5A 4CM8A 4BKUA 2PLAA 2CSUA 2OL4A 4BNFA 5L4LA 3KB6A 5LC1A 4D44A 2GPTA 5JDCC 4ND5A 4CMEC 2CDBA 2D2IA 2NVWA 2ZATA 3A1NA 1XCBA 4B8WA 1G1AA 1PGJA 3PJFA 4EJ6A 3ADPA 4PZDA 1A72A 5BSFA 2VZ8A 1F17A 4XGKA 3BA1A 4YVFA 2EKLA 2GERA 4G5HA 1HF3A 1R15A 2C2XA 3ZNOA 4YTEA 4IINA 2ZTVA 2G76A 2GASA 3WYCA 4L9RA 4R3WA 1PU2A 4YBZA 3JQ7A 2JCXA 3ETDA 4E5MA 4NDNE 4IDGA 2OP1A 4UAGA 4RVDA 5K6AC 1NWHA 3GMDA 3RBZA 1E0DA 3KBOA 2ZYAA 4Y6RA 3E18A 2NM0A 2AEJA 3GRKA 4CQLA 3E82A 4Z9YA 5T8KC 2YHIA 3OJFA 1GU7A 1EMDA 2W2KB 3DOOA 4K1LA 4NBWA 4CUJA 1XKQA 3ZN2A 5CPFA 1UP6A 1VKOA 4XYGA 1I3KA 3ZV3A 1X7HA 5TIIA 2BFOA 4IDEA 4MVJP 4EZBA 5BR7A 3NDJA 3WYEA 4S3MA 1YKFA 1L7EA 1BGVA 5DBGA 4OJNA 3PIDA 3WBFA 4CM5A 2F00A 1ISIA 4OL9A 3ZHYA 2NU6A 4YYZA 1ID1A 4XGNA 2GD1O 2EG9A 3JQ9A 1BXGB 2EGHA 3WR5A 4B8ZA 4Q3AA 2CNBA 1P33A 1PS9A 3PHJA 3H5RA 4ZQGA 2GZ2A 1WMAA 3KLMX 1Q7GA 2I65A 3ZNQA 4CM8B 3GGPA 4CMIB 3DMYA 2D1YA 2P9EA 1PJSA 4GWKA 3R1IA 4BO3A 4E31A 4XRGA 5CHEA 3QWHA 4XX0A 3ADOA 5TLSA 1ZJZA 2Y05A 2OO5A 1XDWA 3DHEA 1EE9A 1GQQA 4NFYA 3LLVA 3QVTA 4PLYA 4RF3A 2X0IA 3OETA 5T5QA 3UHAA 1UXHA 1NQAO 3I5MA 3OHSX 4H3VA 3JQ7B 1OMOA 4FS3A 4JJFA 2HMWA 5BSGA 1PJ4A 3ETEA 4YEDA 5GZ1A 1C3VA 1SBYA 3GEDA 1UZNA 5T67A 1QV6A 1LLCA 4RF5A 1LUAA 1VRWA 3UAGA 3S2IA 3GT0A 5THKA 3V1UA 4FFMA 4CQLB 1XWFA 4I1IA 2BGMA 2IE0A 4IJKA 1QKIA 1Z7EA 3JD1A 4B3IA 4HFJA 4GVLA 4RVUA 4OXNA 4CMBA 4PVCA 4F46A 3K73O 3LQFA 1E1NA 3W6UA 4HWKA 3H9EO 5I9LA 2Q4EA 3I9OA 4BB6A 3CKYA 2NTNA 4DL9A 5DDIP 4EYEA 3R3JA 3JQEA 3HDQA 3A28A 1ZJYA 1SOWA 3OSUA 3FN4A 3M6IA 4ZQFA 3MEQA 4L74A 2Q50A 5EIOA 1U3TA 1I24A 1BSVA 3PGXA 2Q2VA 1HXHA 1O0SA 3GFBA 5A05A 3BHJA 2VRBA 3C7CB 4GH5A 5DULA 2H63A 1A7AA 3CMMA 3HB5X 1Z73A 5ICSA 5HTOA 1I33A 3GOHA 2EIHA 5DF1A 4EGFA 2I99A 3TJRA 2Y99A 4N54A 3WTCA 4AVYA 4PRKA 4UEJA 4YRAA 5ADHA 1VI2A 1R16A 1O6ZA 1V35A 2Y1OA 1DEHA 4UVIA 5U9CA 2AW5A 5C7IO 2O48X 1J49A 2JD1A 1DC4A 1FK8A 4J43A 3O26A 4LGVA 5KNLA 3OEWA 1YQGA 3G1UA 4R69A 2Y68A 3AI2A 4L4RA 3RC9A 3GVIA 4BO0A 2Y1FA 1G0NA 3HN7A 4K26A 5TJHA 4FR5A 1P1KA 2J8ZA 3HG7A 4KMSA 1H9BA 4EITA 1KY4A 2AQHA 4UUMA 4UUOA 2NLOA 4XGIA 4BNWA 3I23A 2PGLA 4FN4A 3WGYA 3EZLA 1ML3A 5H82A 2B35A 4URFA 3QWAA 1UZMA 4DC0A 1D8AA 4XIJA 3HUDA 1ZMOA 4DIBA 1HRDA 3JQ8B 4XYEA 3N7UA 1CF2O 5IAAA 1F14A 1R0SA 1I8TA 3G1TA 4RO0A 4IS3A 3QWFA 1YBVA 4F6CA 2G5CA 5JSFA 1ULSA 2DAPA 1U3UA 4GI2A 5ER6A 5L3ZA 4D3DA 3I9MA 3RUHA 1P0CA 3ZHZA 4Z6KA 4GKVA 5DNAA 1JDJA 3S2EA 3CXRA 4CMJA 2XPCA 3MJTA 2ZTMA 3SC6A 5CDUA 1LX6A 3C7DB 4WLNA 1UDBA 1ORRA 5FI3A 4NBTA 2D3TA 2OGUA 2HK9A 4O59O 1Y8RA 2CDCA 1N8KA 3WIEA 1JU9A 1OC4A 4TRJA 2DKNA 5ITVA 2JD2A 3JQBA 4XYLA 3QIVA 2FPGA 4Y9DA 4J3FA 1RM5A 4L8VA 4ZA2A 5A06A 4KZPA 2IEBA 3L6DA 4AJEA 3TFQA 2QZ9A 4CR7A 3ICPA 3MJCA 3W6ZA 3JD2A 1Q1NA 3PWSA 3QW2A 2I66A 1DFIA 1LRLA 4IUYA 4B4WA 4I5EA 2NU8A 1DPGA 1Z7BA 3GY0A 2YV3A 1IZ9A 1X13A 1WZEA 3GDGA 4Y67A 4II2A 1FMCA 3E48A 3FBTA 3ONEA 1EDOA 1R0LA 3V2GA 4CL8A 1SB8A 3D0OA 1P1HA 3VZPA 1PZFA 1QYWA 4P38A 4R68A 4L4XA 4A7PA 4Q3CA 3ZHBA 4CR6A 3U4DA 3IC5A 3RJ9A 1I2CA 4DQXA 3CZRA 1K3TA 4WNCA 3H8VA 1PR9A 2Q1TA 1PJLA 1VPDA 2HJRA 3WGQA 2FSSA 3MJEA 2NACA 1GDHA 2WD8A 1K0UA 3OM9A 4D7AA 3VTFA 4O63O 5KKCA 2BLLA 4XQCA 1GCUA 4BKPA 5JY1A 1C1DA 2YYYA 3H3FA 3JYOA 4NFSA 4XDYA 4Z0TA 4HKTA 3ROKA 1B0AA 4PGFA 3VZRA 1T4BA 1R37A 2O3QA 1QLHA 3DAFA 3F9IA 3RBXA 3LYLA 3D7LA 1DJNA 5A9SB 1DC3A 4HUJA 4EUHA 3GPIA 2PZJA 3DBRB 3TWOA 4R1NA 3IKVA 1C14A 3INGA 4J1SA 1WDKA 2PY6A 2PD3A 4TRNA 3DBLA 2JJYA 2DT5A 3QRWA 1ONPA 1DFHA 3HDYA 4UUPA 1LBEA 4JROA 1LDYA 3C1AA 4W9NC 3DEYX 3L4SO 4LSWA 1IL0A 3EHEA 5COBA 5DP1A 4IMPA 3ITKA 1LNQA 2Y66A 2WTBA 5KOIA 4AJPA 1C1XA 1MG0A 4GLLA 3EVNA 1A4IA 3WGGA 1H6AA 2O3SA 1N5DA 3HZZA 4JNKA 4YT5A 3UKOA 3BXXA 1E1MA 4P4NA 4FC6A 3ZDFA 2X5KO 4XD2A 3EY4A 3R0IA 3DONA 4HXYA 3MCVA 1P44A 2XXBA 3WNQA 4BGEA 5TRTA 2VQ3A 1U5AA 4TVBA 2WYWA 4AFNA 3ZZNA 1PL7A 1DIRA 2PV7A 3ASUA 5I9MA 3VVBA 3OICA 1ZMTA 4IIVA 3UH1A 1PWXA 3NDIA 1NHGA 4R1SA 1CETA 2Z1NA 2UV8A 5AXBA 1MP0A 1D1TA 4CLXA 5CPBA 1C1DB 1Z82A 4NHEA 4E6PA 4GSKA 4E30A 4CL3A 3DBHA 1H93A 4K9DA 5L4SA 3QJ5A 1YB1A 1Y5RA 5DCWA 4RORA 1JKJA 3U4HA 2FR0A 4Z9XA 1RYEA 2NTJA 2NSDA 5AXCA 2DU8A 1ZW1A 3QV1A 1H2BA 4BIIA 3DBLB 4N5MA 3SJUA 1U9JA 2OBNA 1PR3A 2A9FA 4U6QA 4DYDA 1T25A 1O94A 3JQDA 3RUFA 1EVYA 3AFMA 2PZKA 2O4UX 1DC6A 3AUSA 1X0VA 5ENVA 5G0UA 2J3IA 2VHWA 5BNIA 3A06A 7ADHA 1I2ZA 5HS6A 3K2EA 2PKQO 4EJMA 3ZWBA 1E3IA 2H9IA 3OEYA 4BV9A 5JNLA 5I8ZA 5CEFA 5KCZA 4XR9A 3IIEA 5F3RA 4CUKA 2FPPA 3G0OA 4ZJUA 2EWMA 5KIAA 1U7HA 4RGBA 3WX0A 1YRLA 4KQWA 2Y93A 1M67A 3PYMA 1EQ2A 5B37A 4YJGA 1YH3A 2W90A 3DOJA 4RQUA 4YQYA 3INTA 2B5WA 5COAA 3T7EA 2BRUA 2IODA 2FMUA 4CLRA 5U4QA 1UDCA 4DYVA 1UP7A 2EW8A 3PHHA 2DUUA 2R6JA 3FCOA 4RPLA 5CG2A 3D3EA 4BKQA 1DAPA 1NQOA 1IE3A 1N1GA 2RAFA 3EAGA 2NQTA 3BTSA 5CDTA 4AJOA 1E1KA 2J6IA 3QWIA 4J9VA 1P74A 3L07A 1HDOA 3UGKA 1N7GA 4AJ4A 1ZK0A 4E5YA 3DAGA 1RWBA 1WLYA 1U8FO 4UREA 5TGDA 3WFIA 4MJLA 1HDCA 5EESA 3VDRA 1CYDA 4IJVA 1GQ2A 3RIHA 1YQDA 1ZK2A 4MVJI 4FW8A 3I52A 3S1LA 4OMUA 5AYVA 3ROMA 2DTXA 3UN1A 2W2LD 2ZCVA 3ZGYA 4LVCA 1GCOA 3F1KA 1A9YA 4X54A 3ZHXA 5H83A 1XEAA 4PLCA 1YJ8A 5DOZA 1I01A 5COQA 4CMGA 3A9WA 3WLEA 5C37A 2VUTA 4R54A 4BMVA 1I2BA 3EYWA 3D1LA 4WLEA 4IQGA 5FF9A 4KUEA 3ITDA 2VTDA 4J7XA 4DBVO 4YRBA 3JYLA 2Y0CA 2I9PA 4NU5A 4EUFA 3ORFA 4YJGB 3MJSA 1GZ4A 3ZWOA 3OJOA 3GQVA 1P1IA 3MTJA 2NVUA 1PQWA 3KSUA 2H5LA 3ZWYA 4CLRB 3ON5A 3QWBA 3H6KA 3OA2A 1O89A 2D5AA 3GDFA 3PI7A 1N92A 1I0ZA 3ZV5A 3A14A 4NFHA 4XYMA 3CTMA 4CM9A 5F21A 4CM7A 4WK6A 4J1TA 4L73A 1UP4A 1RYDA 1MUUA 3R3SA 1EK5A 3IMFA 1PGPA 1CQJA 1UZLA 1WW8A 3HJAA 2NADA 4CUZA 1V3TA 1T26A 3JTMA 5IF3A 4LVUA 3I4FA 3S2GA 4EBFA 1EK6A 4D43A 4DIFA 1JW9B 1JN0A 2OFPA 3UCEA 1IOLA 3KXDA 3PQEA 1MLDA 1XG5A 3FR8A 3I4CA 4BO6A 3UVEA 2GR9A 1DDOA 3IJRA 3U4CA 1PS8A 4D3SA 3BZUA 4Q39A 4DC1A 3IKTA 4AICA 4ALKA 4PG5A 4MKZA 5JMPA 3LT1A 1ZEMA 2PR2A 3COSA 1SEPA 5L45A 3ZU3A 1AHHA 4CV0A 1PZHA 3QP9A 4MVJH 3UICA 3F47A 5KJEA 3BMQB 2FSVA 4J91A 4ALNA 1LQTA 1ZSNA 4GX0A 4EJ0A 3E9NA 2RH4A 1SAYA 2Q2WA 2C7GA 3I9KA 4J0EA 4MVJA 1XSEA 5IZCA 5BNFA 3AK4A 1PWZA 3MWDB 2DLDA 4O0LA 1XLTA 2BH9A 4JJIA 1C0PA 1U3WA 3OA0A 1ZKMA 4FSHA 5TQVA 3B1KA 4C4OA 3JQFC 3W4JA 3CH6A 1T2EA 3QE3A 4KDEA 4Q3NA 3GA0A 3GVXA 3TNLA 4DPKA 1DB3A 3FHLA 1A7KA 5B4UA 1R4MA 1RKXA 2NTVA 2JKVA 2IXAA 1ADBA 2YV1A 4OAQA 2YDYA 1Y6JA 3HQ4O 1ISHA 4OGWA 4BNYA 1NNUA 1VC2A 1B15A 4H15A 4UVGA 4CLEA 2P9CA 4PLHA 5EQDA 4W7HA 5C7OO 1GR0A 2FRDA 2H6EA 2IEDA 3I6QA 4RF2A 1TXGA 3UCFA 3G49A 4Z3DA 4M49A 2CVQA 3B1FA 3IS3A 4FFOA 4JP3A 3MJVA 4DA9A 1VKNA 1T2DA 3K9QO 5ES3A 3RUEA 3AM3A 3JD0A 1CEQA 4LRSB 3WJAA 4CQMA 3Q11A 4J1QA 4G65A 3E9MA 1KOLA 2RHRA 3T7CA 3UW3A 2W2KA 4AJNA 3VH4A 4E0BA 3E03A 3OIFA 3WGOA 1EE2A 5G0VA 1P45A 3JQAA 2HO5A 1CJCA 5A04A 3AUTA 5JMWA 1ISMA 1TT5A 3OQBA 3VC7A 4MVJM 3ENNA 2VWHA 2PGJA 2X4GA 1VL0A 4WE3A 4RCVA 1OBFO 3RD5A 4RF4A 7MDHA 3SXPA 4OQYA 1BXGA 1BG6A 2JFFA 1DAOA 4YAJA 5TNXA 2OZPA 1B14A 5FYDA 2WEKA 2QRKA 2Q99A 4XR4A 5EJ2A 5DCUA 2GN4A 2VHXA 2QHXA 1R4MB 4PG6A 1NX6A 1TB4A 4CMIA 2HK7A 1HT0A 4ZQHA 5AVOA 2P4QA 4BGVA 2HMUA 1R66A 3OQ6A 2FP4A 2Z5LA 2EGGA 3IQDB 2C0CA 5DT9A
chains in the Genus database with same CATH superfamily
5CA0B 4Q0MA 3GJZA 3O47A 3T3PB 1V45E 1BCSB 2C0PA 2YWHA 4IGFA 4G0PA 3KK0A 3TKLA 2COEA 5A7FA 1YQQA 2RGCA 4Q9JA 4UEKA 4ZCIA 1ZJJA 5JBQA 4HGOA 3PQ6A 5F7OA 3CSSA 3ZHVA 3ABRB 3DOHA 4B7XA 2YIJA 3GW8A 2QUKA 4HI0E 1O4WA 3MTEA 4M1EA 4QBKA 2WWXA 4I5GA 3QE2A 3T4XA 5GMOA 5J5CA 3C15C 5D6NA 1DT5A 1SKUA 4BFTA 3K31A 1XHFA 3FWHA 4JKIA 4PIVA 1K97A 3ZUGA 4B3MB 4W1QA 1KAHA 2KS6A 3UUWA 4HGYA 1QG0A 1FJHA 3G6WA 4J2OA 5EXEA 5F51A 2WMOB 3MWEB 2PWYA 3N8HA 4CQMB 2HA2A 5K0FA 1KERA 4HNUA 4G25A 2FR8A 1E2UA 1SURA 2Q5OA 2VHZA 4MX8A 3VOTA 1GNSA 1E32A 2JRCA 2YYZA 3JQCA 1OYYA 4FFBA 4IM7A 1KOFA 1GQOA 3WK6A 2C82A 4DA6A 2JJ1A 5EZYA 4Q15A 2XE7A 3N87A 3A0UA 3QY9A 5ALFA 3JQAB 3TQTA 1HDYA 1S1CA 4MUNA 4BBPA 3MERA 1XUOA 4IRUB 4IRMA 5BV8A 2ZYIA 1C8LA 1M76A 2XOEA 3VISA 4BNNA 1C7ZA 1LSSA 2N46A 3L7CA 3TLMA 1ZD8A 1P77A 2XUAA 4UU0A 3OUTA 4UPDA 2X8BA 1II8A 5JY6A 2WJ4A 4BL5A 3N2KB 1DO8A 1O58A 1UKAA 3NBXX 2V98A 5TGZA 4CU2A 4UDXX 5DO9A 3CF4G 4NNJA 2A0KA 2IOHA 1DBIA 4GC9A 3FCYA 3CVWA 3R7LA 1LV8A 1QE0A 2E5LB 1F9AA 1DIAA 1FFBA 3F1LA 1EUZA 3WV4A 2ZB8A 1RCFA 3DR5A 3KKMA 4W8GA 5DMHA 1N32B 1FMJA 2YMMA 3THXB 1EFPB 1ULBA 3W2TA 4NDZA 3CXUA 1KDPA 3T3HA 2OLJA 4M1YA 1E9EA 3F5MA 4DLLA 2VOJA 3LG2A 4YACA 5EHGA 5K0JA 3PUJA 5B1SA 5T64A 3HB4X 3GLGB 4AL4A 3PVZA 1GRRA 3GAZA 2G0AA 3SX0A 2Y76A 1W4AA 2OBFA 5JARA 1WTCA 2P2NA 3E9YA 4DCUA 1XT6A 4AP9A 4YHBA 4MLCA 4MQ4A 1T91A 4ASUD 4LK3A 3CX7A 3LQ2A 5SV2A 3FPHA 4BWVA 2ZVQX 2AZXA 2IT1A 2X0DA 2YXNA 2VHYA 4B3XA 5KINB 3DYIA 2P5UA 4EA6A 1BDIA 1XXHE 2GEDA 2P68A 3V7UA 1K7XB 4LPSA 4UNSA 3KVOA 3D3WB 4D82A 2XVMA 4RMNA 1GZ5A 4IHQA 2BFFA 4CJXA 1GKUB 3VDQA 1WV1A 5HKLA 1T3SA 5EJ7A 1RDFA 2VYFA 3FHCB 3NASA 1FRFS 3KJEA 4LYGA 3HV0A 4ACBA 1RC8A 1H3EA 5JANA 4NWIA 4OGLA 3VVCA 1D6SA 4QECA 1U1EA 3ZDDA 4MPRA 5F3WB 2G28A 4C0BA 5JYEA 2Z8XA 1NYLA 1P9LA 1NXSA 2ECOA 3LHDA 5DXJA 4EUSA 5BYKA 1JKMA 3AM5A 1NKSA 2QNBA 2IELA 3DL2A 1AQ6A 1Y1TA 3ZK8A 2PL9A 4TGLA 1D4FA 1ZHHA 3E0QA 4X6YA 4Y2VA 4IIFA 2OV1A 1S4QA 1XZAA 3RANA 2R8YA 5AHXA 3LUJA 4DLRA 2REOA 1QO0D 2VJCA 2QRLA 5EXDA 1TM4E 2C03A 4X1IB 3KB1A 3GPDG 2HR1A 3ADDA 1K6IA 1EJ6A 2AN4A 2BHSA 5G1NA 3SJAA 4BJHB 2OORA 1NLUA 4RJKA 3FFXA 3I4LA 2ODBA 4Q4JB 4BRWA 3PR1A 4JVLA 1E4OA 3HUTA 1KXJA 4XWGA 2P6RA 3W1WA 4KPUA 2XGMA 1J21A 4NOLA 4WXEA 5U4XA 2Q3JA 1MO2A 1SHUX 3B3FA 4C1NA 1SELA 3WDLA 2IH5A 2CYAA 2QQFA 4P84A 1M73E 1KZ6A 4X85A 4JBYA 2Q4DA 1YFKA 5EE3A 5JVDB 1VL2A 4AAYA 1LEHA 1UEIA 1P5FA 4DABA 4EDFA 5DW0A 4B85A 4DA7A 1Q95A 3K8YA 2XZDA 1MRNA 2C1ZA 3II6X 3VZSA 4EMTA 3T9AA 2IW3A 4L6IA 2G5PA 3O4JA 1WEKA 2F8LA 2Q3LA 3WWOA 2IZ7A 1VJGA 5AWFC 2AC7A 1MAVA 3P9PA 3ANLA 2BI4A 1KJJA 1ECFA 4O1HA 4TSKA 2NWQA 4DC9A 1BYUA 3H97A 4D8VA 2PTGA 2OD2A 1T0JB 3DTVD 4JP2A 5ESRA 4BQQA 5A7GA 4US1R 3U44A 3M5DA 4QLBA 4YPVA 1O97C 4OI1A 1CUIA 4UTXA 3GQBA 4BNLA 3HXMA 3SQWA 1LLFA 2V7VA 4Z8XA 5ABPA 5K4GA 3ZLTA 3QKSA 5I7SA 1L5QA 4EL0A 3MJ4A 1CZRA 1CUBA 4Z7NB 2GVDC 3WADA 3LX6A 1RLJA 1GGMA 3MJHA 5CM2Z 5AHOA 7REQB 3UUFA 2GQ0A 1DIOB 2YBEA 1KWGA 2O2CA 1BVUA 4JOSA 4CQJA 5LA6A 1P75A 3IP3A 1OXKB 2GZMA 3SEFA 3IDZA 2QRGA 4DB4A 4UEWA 4LDPA 1SOMA 2VRCA 4DDVA 2W00A 3V8RA 3FKQA 2DHRA 2PVPA 4D9HA 5JHHB 4Z9AA 1RT9A 4ZT4A 2AOTB 2JVKA 5DASA 3ZKAA 3IYLW 3M6XA 4FXOA 1DI0A 3INYA 1TJPB 2FY8A 3F46A 5CB0A 3CRQA 5FFFA 3E5NA 4RCZA 5K20A 4YRGA 3QMVA 5EERA 2PKXA 5JDIA 4HDMA 2RGNA 1B0PA 2Y1GA 2O0HA 3KXIA 4WLFA 3AESB 4RGQA 4LMAA 4D45A 5KYWA 1BNCA 1JGTA 4FTWA 4DLAA 1T5LA 1K5GA 3OFJA 4WASA 3T9EA 3DMTC 3G1WA 3GJ5A 4PEVA 1SIBE 3TXYA 3A2MA 1C7EA 1ESNA 3Q3GE 3DBRA 4R9UC 4TKZA 1ZJ6A 2B6NA 2M6KA 1B23P 1G6OA 2I2XB 2ZRCA 2XH8A 3HYSA 1JNXX 1XR3A 3K96A 4WLVA 5FBWB 1JNYA 3VDXA 3RRMA 4UDOA 3SXUB 1IN6A 3Q0IA 4M54A 1GT6A 1P3DA 4N12A 2ZPAA 1KXZA 3NI2A 1YZUA 2GK7A 4H6PA 4IO0A 1R3DA 3GVHA 3PXUA 1E59A 1Z6ZA 2B3TA 1A5SB 3NOQA 1I0IA 3NT5A 1UXKA 2KPOA 2WLTA 3AP3A 3PT5A 2B1JA 4QOJA 4MWSA 1NP6A 2NSLA 2DE0X 2ZWPA 4DPMA 1EFLA 2VSQA 2C2ZA 1Y33E 3QXXA 3WOHA 4CKXA 4BTLA 1FJ2A 2WILA 2P0YA 1R6UA 3OCXA 5IJXA 4U9UA 1HM5A 3B8HA 1SU4A 3IHTA 1X3SA 4ZQBA 2H4HA 3LTEA 4D0SA 3T94A 1P7WA 1WHSB 4FGKA 5CFLA 3U7FB 3R9XB 2GPNA 3A70A 2XBLA 2BHLA 2VUUA 3SHFA 3ZWPA 1ZFNA 4P98A 1KDRA 4EI2A 5K45A 1XTQA 3COJA 1RS0A 3P20A 2FEAA 2C7RA 1KBQA 2VK2A 1HTBA 1M34A 3AQIA 3F8WA 4JELA 2HPHA 4LXGA 4F0JA 5MGBA 1GA1A 3HC7A 4NECA 1NQXA 2VTKA 5MFPA 4XJVA 1L5VA 1NAIA 4TROA 4CNQA 5C8YB 1PV2A 6YASA 3D4NA 4QAQA 1POWA 3G0IA 3BK1A 2ZR9A 3V8QA 1NBHA 3KKKA 4ENVA 1U0JA 1QHHB 4H4EA 2PUFA 4CMEA 3PL1A 5KNCA 3JQRA 4XB2A 5EJMA 3AJEA 1QB7A 2OXCA 2ZSUA 3SOPA 2EBUA 1WZCA 4C08A 1J0EA 3M1AA 5I9TA 1TUBA 5DFAA 4KQGA 4A2CA 3TLCA 1YBMA 3TGPA 1AGPA 4JUIA 2EFHB 4RXTA 4P82A 3PUWA 1TF7A 3RE1A 3EN0A 2ZW9A 4M0KA 4XASA 2BWJA 4EB3A 4ILKA 3KJXA 4F6LA 3FLMA 4LSMA 1C0LA 4MB6A 1WRBA 2EJCA 2PBFA 3OJEA 5IBQA 2ZIVB 1A9PA 2C2BA 3CJTA 3DV0A 1KJ9A 1PTJC 3FIJA 4ZO9A 3ZQJA 4UBJA 4MCHA 1EVIA 2HL6A 1Z75A 1UCFA 5AIAA 5EKSA 3R7BA 5BPFA 2GO7A 3K2IA 2IY9A 1TO2E 1WUTA 3OZFA 4EUEA 2R66A 4PANA 4OJQA 3RS8A 1JP7A 1KI7A 3E4DA 3IUMA 4LYDA 1TM3E 2CK3D 3WQQA 1NXTA 3MTIA 4PW0A 2JFPA 4A15A 3RYCB 3OZEA 4JQYA 4JSRA 1GPMA 3CH7A 5LU9A 1ISSA 3WNVA 1F0YA 1XXHB 1XPRA 2GXAA 2P62A 2DTEA 4WKPA 4C4PA 3MZ0A 4X6LA 1UAGA 4P4SA 4WDRA 4WL0A 2O3JA 3OE7D 1OX4A 3GUZA 1TYZA 1A5ZA 3AF0A 5BSUA 3RSQA 1FB5A 1R5BA 5KYGA 2QTBA 4Z3KA 3EC7A 4KITB 3VNSA 4AB1A 3BXZA 2B1RA 4CKEA 2JL1A 1EUCA 2FFJA 3IKJA 3FZEA 3UB2A 2A1TR 4KIJA 3SBDA 1BW9B 4Y1FA 3VKHA 4GRDA 2FN3A 2FLKA 1XALA 3KQNA 4QU9A 4I4CA 5FR1A 4H3HB 2IXFA 4L2IA 4CG2A 4HEA1 3BF7A 3FNHA 3L6EA 5MN5A 3H2IA 1RVDA 3UK7A 3OX3A 4KI7A 5HIIA 2BSAA 1BVYF 2NUPB 5FWYA 1NXPA 1ZNQO 1M54A 1P6UA 4J7UA 1CUUA 1C3OA 4Q3LA 2EW1A 3P9QA 3TCKA 1HNWB 1IQUA 2V0NA 4P5DA 5BMVF 1G5HA 3ER8A 1HEUA 4RTJA 1UUFA 4AWAA 3F6CA 5EJAA 4M3NA 3R9IA 2QVGA 3K92A 1LSOA 3QKWA 1MA3A 5EIBD 3P32A 2R96A 2V3CC 1IWBB 4RKWA 1E7SA 4HT3B 1RHQA 3FNEA 5BW5A 1YS4A 9LDTA 5LZ4A 3B20A 4Q3BA 5E7IA 2JFBA 4DJTA 4NCIA 3DCJA 2B7BA 3CRW1 1QYCA 2GDZA 1YS2X 2DPMA 2NO6A 2UKDA 4W63A 4JI7B 5SY4A 4YV2A 5B4VA 1WCIA 2BI7A 4YAUA 4CKCA 3EIHA 1KBOA 4N76A 4PPNA 3RSOA 5FI1B 1LBQA 5KREA 2GHIA 4QLAA 4DEXA 3HS3A 2C4NA 2XZTA 4JLBA 3Q8WA 3VNQA 3MCWA 3Q7PA 5IP5A 4GLFA 5HJEA 4LE0A 1A82A 3JCZA 1NONA 1Y3IA 2R00A 1W85A 3AEKB 3G3EA 2X9NA 3MM4A 2J9GA 1QBGA 5FA8A 3PICA 4S12A 2A3RA 2COUA 5EZ6B 1P1RA 1E66A 2BFCA 2XRYA 1IM2A 3AHCA 3HR7A 4Q7MB 4YGXB 3S8EA 2W2OA 3A1TA 4FVTA 1KY5A 3WIUA 3KETA 2HPAA 4OA5A 4NMHA 4C20A 4O4HF 4B3JA 5BVHA 1I3LA 3AHEA 1G41A 2W6NA 2XSZD 4J0DA 3AL3A 4QPCA 3A4TA 4QOFA 4KBFA 2ZBDA 3EK2A 3TIFA 2Q27A 1J22A 3WRWA 3ZE6A 3I37X 3F6SA 1OYWA 3F90A 3RVDA 5JAQA 1SUWA 4JVOA 1DMSA 2VHEA 5KTMA 3RRNA 3TNYA 5EIAA 2YW9A 1VJCA 2IOQA 4YV0A 2BM0A 1GDDA 4M46A 3HVIA 1NXOA 1YMUA 1LY1A 1E69A 1S6YA 4HK4A 3HCOA 5D3KA 4DIEA 4RD6A 3SVZA 3CT4A 4V0LA 1XQ1A 5KVAA 1NTOA 1P0PA 1VCMA 2C94A 1VPTA 1G8AA 3FSGD 3E22B 2QN8A 2WJPA 3ESBA 3I3SR 1WXWA 5JAUA 1X7YA 2VA9A 2PCLA 2WVHA 4HLQB 2JA1A 3IQZA 1MV8A 3NAQA 4IAOA 4UM5A 5I8PA 4OFWA 4QX6A 1P39A 5LOVA 5EVCA 4PNZA 1R9MA 1H65A 1UC8A 2OENG 3F3YA 3QEKA 3KZMA 1QH8A 4Q1CA 5KNDH 3AOGA 3UJPA 3DE1X 3W34A 2GHTA 2QMUA 5JISA 3WGIA 1EWYA 2FWNA 4KOAA 3QA3E 4PLZA 4CG1A 1RBMA 4JI2B 1FTYA 1PN3A 4U63A 5B1IA 2ARKA 4YJ3F 3ZHCA 4ZAYA 4DS3A 4LNHA 1LV7A 3BMQA 3IV9A 1W5FA 1B6SA 2PSFA 4UBNA 2PU7A 2QLTA 3KDPA 4K9PA 4EY7A 5DI3A 1OFIA 4MYDA 3CZQA 1E1YA 1Y63A 5DK4A 5DNCA 3S44A 3E53A 3RC3A 4C14A 3JZDA 1MVOA 3EIQA 4EHDA 6PFKA 1T4CA 2BW0A 5IU6A 1N8SA 3ZDRA 1HK7A 4E2YA 3HH8A 4MWEA 3IBCA 4B45A 4TTTS 2WNIA 1YRBA 3PLAE 3IT1A 2AG5A 5TPZD 1OTHA 3U4QB 4OFXA 1KBZA 2L42A 1E3LA 1SZDA 1OWNA 2Z3ZA 1E9DA 4I9HA 4RPGA 4ZEXA 5BOVA 10MHA 2W6OA 3B5JA 4URXR 5JCOC 1FS4A 3QH4A 4M76B 2VN8A 4EW2A 4PICA 2N42A 3A3PA 1JVSA 3ISVA 3L0OA 4MPPA 5FT9A 4EHNA 5C1DA 4CE6A 1GNVA 1XQYA 2X1LA 4RS4A 3RV3A 2MHCA 4H7IA 3V1MA 2X0RA 2YS6A 3DHNA 2XRFA 2HNAA 4DQLA 4H7PA 4K8OA 4PLPA 1OIWA 2VUSA 2YJGA 5LPNA 5FUYA 1YB5A 2O5RA 1T4DA 2EV9A 2R1TB 2PBRA 1Z29A 3BSFA 2EFJA 4OQZA 5NLLA 1NJ8A 5IN5A 3ZY6A 2IZOA 1KR5A 4RK0A 3PRKE 3ZDYB 3K0SA 2G08A 5ECGC 4NV1A 3VZDA 1F2VA 2GJAA 1CUFA 1FLVA 3D8NA 3FRJA 4MQBA 1CS0A 2DVMA 4R9NA 3JWPA 5AT1A 1DAGA 1YU6A 2LKDA 2OESA 4ZVNA 2ZJ8A 1FMFA 4UM9D 4C4RA 4DNFA 1G3QA 1TVKA 4UEOA 1A5TA 2UZ4A 4G5XA 1NW4A 2HHLA 1L4MA 4QDJA 3LHKA 2GF0A 3WWYA 1NJFA 3QX8A 1K6EA 1SCKA 5B3LA 5AMXA 1YZHA 3HFSA 4JY7A 1R18A 3LD9A 3UAYA 4JL8A 3QF4A 2BSXA 1ZEJA 1Q3HA 1SCQA 5F98A 4NAHA 1I94B 3WMEA 1H1TA 2V7PA 2C57A 4B82A 3BGIA 3K0CC 2HD4A 2NYVA 2P65A 4R7GA 4F9GA 5JAMA 3A32A 3GZ4A 4XSHA 2NO7A 4S2EA 2DWOA 1AKMA 3LHFA 2LCIA 2QLJA 2R3SA 3CC8A 4IHAA 4TLCA 2C2HA 1K8ZB 2Q5FA 2PIDA 3EXFB 4AF6A 2FJUA 1WG8A 1XD2A 2F43B 3HVHA 3PUHA 1IEXA 3MTBA 2GYWA 3EULA 3ZI0A 1J23A 4IUDS 4KCGA 1THTA 3OT1B 1E8MA 3DVAB 1ZESA 3BCHA 1DQYA 5B7GA 3H11A 2Z57A 4J9UE 3ER9A 1FIUA 1O9BA 1U8AA 2QR2A 3F4LA 4BFLA 2I9KA 4NK4A 1NFRA 3A6DA 1YI1A 1XIVA 3KT8A 1Z2CA 3PITA 3EQ7A 4X5OA 2P2ZA 2P7HA 3D6HA 1FP7A 1XQWA 1QAMA 1RWPA 2DCMA 4TLBA 1V5WA 4JN6B 5L9AA 5E3HA 4C0WA 4R0NA 4ZGGA 3V1KA 1GZ3A 3PWZA 2VXBA 1T8YA 2EIXA 2Y9PB 1GA6A 2I5PO 2PCJA 1QOQB 2GM3A 3MOSA 1SZJG 5DNVA 1KDTA 3W0LB 5D86A 1W7AA 1QBKC 2Z2YA 4R83A 2IWRA 1QU3A 4C6SA 4RTMA 3N8GA 1RZRA 2IHUA 2GPJA 4AT1A 3D6JA 2CNKA 3FSJX 1UBCA 3G9ZA 4WACA 4GM4A 3EC1A 4L3VA 421PA 2SKDA 4FX2A 5C4GB 1M75A 4LRYA 4WY8A 3ZG6A 3HK2A 4A3SA 3TZHA 3PC4A 4FFPA 4HRYA 2ZJ6A 2ZJAA 1NU6A 3MWJA 3HU1A 4DXHA 5CP8A 1AXRA 2ID9A 2QPTA 1IY8A 3BG5A 4IFEA 5CJJA 3TFOA 1DKLA 1BAPA 3T0IA 5D5HA 1OLSB 3SX4A 1ZWLA 1YASA 3KQOA 3CE6A 1GV1A 4HLDA 5F5NA 4Z0HO 2YMQA 5FBKA 1K9VF 3GA7A 2M9MA 4E21A 5EIFA 1HFWA 4BOYA 3HNOA 4YMHA 3R8FA 4GLOA 2G25A 3LWBA 1A98A 3P7MA 1CEEA 4XAQA 3QOFA 2QMHA 4E4YA 8ADHA 1QKJA 2CFOA 3REOA 1IRXA 1TYDE 4HH3C 5CCDA 1AM4D 1TPZA 2GBCA 3DD1A 4IIBA 3WG9A 3BMCA 1GUYA 1V37A 2W4QA 4PNHA 3RPEA 5JWRA 4B3DA 3LX8A 2D59A 4N7JA 1MJGA 3SXJA 1WWKA 3N53A 4M8IA 1PEYA 3ASZA 4JLOA 2X1VA 3T5GA 4R9VA 4ZARA 2IYZA 2FOXA 1X0XA 4KLNA 1JPJA 5U1PA 1F1JA 4UAVA 5GVSA 2J0VA 2ZQZA 3ZCSA 4HH0A 5IT5A 3T3NA 5CEJA 5JO0A 5K9ZA 1XJ0A 4PM4A 3SDSA 1KTIA 1JSCA 2CY0A 4DJJA 2WWYA 4MKIA 4JLPA 4J49A 4RU1A 3X1ZA 1JWAB 2I8LA 3M9XA 2IYQA 1FNDA 3DOUA 3N2LA 4HX9A 3UC9A 2VTBA 1XTIA 3PE6A 3GH3A 2J59A 3BCSA 4C0SA 1H85A 2R97A 4N5HX 4OBWA 3VHRA 3ABIA 1DTEA 4IQFA 2CYCA 3VNBA 2OHJA 3L9WA 3OMLA 1J25A 2C07A 3DDHA 1QQ6A 2XBUA 3T1VA 1JUDA 2XKAA 5B3KA 1H3NA 3DFZA 1WQ3A 4IEEA 3O6VA 3EPPA 2VO1A 3ROPA 2BPOA 3KFLA 2BMAA 1GYPA 2FPIA 3BHNA 4TVKA 2GKOA 5FR2A 2GWRA 5IARA 5CA1F 1EKXA 2HYDA 1DHRA 4TN5A 5AW5A 4B4OA 3NHAA 3BBLA 3ZGXA 1T3HA 4I5FA 3U1TA 4CGYA 4D4JA 2Q46A 3G9TA 2ISQA 1OXBB 1V4NA 4J0FA 2NU9A 2ZK7A 1ADFA 2BDUA 1WDMA 4QDUA 5JNUA 2G1PA 4F5DA 1CDOA 1Z5ZA 4RUKA 1FNSA 2XUPA 4JFRA 1M1UA 3IL2A 3ZW9A 2OAEA 2NXJA 4KFUA 2B83A 3FHJA 3OI7A 3RO7A 3DTTA 4EHJA 3NHWA 1JI0A 2W37A 4CMAA 4IH9A 1VJ0A 4PU0A 2DCUA 4AUKA 4ZODA 4TWZA 4WK0B 2A78A 2CEKA 4E1AA 3BM5A 1TCBA 2OK8A 4R2JA 3GK3A 1J8MF 5CFZA 3PPIA 2JVIA 2ONZA 2W2VA 1YS1X 2JKYA 3L0SA 4P08A 1UMBB 3FYCA 4YH1A 2Y4OA 4I1YA 3UJAA 1XP8A 3V4PB 2X7XA 4IWNA 5C8XA 2H1IA 4J3NA 4TV9F 4E6EA 2P3LA 2ANBA 1EBUA 2FQWA 3CB4A 4FGSA 4UNNA 2H92A 4WXRA 3VO8A 4GSLA 4C0XA 3V1NA 4CIYA 3ZV6A 1W73A 5J63A 4E22A 1SB9A 4RYLA 4H7JA 4H6XA 4PG4A 3BRQA 5FPYA 4F4UA 5I7EA 2GK6A 5FPTA 5TF0A 1T5DX 4D5EA 1Z6XA 4YJHA 3FY4A 3LRPA 5EWMA 3Q2IA 4N6OA 4A0HA 1E7YA 1IQ0A 3EGOA 2FEKA 4WKCA 3FOFC 5IUJC 1DUIA 1QGOA 2AXNA 2P5TB 4OU4A 1QU2A 4HBZA 2V4ZA 4HDKA 3ZK9A 4BV8A 3UMFA 1XVUA 2YRXA 1GGEA 1D2RA 1AKTA 5G4KB 5I45A 2XB2A 1Y5LA 4DBVO 1WOMA 4MK4A 3E5HA 2ON6A 2VPTA 4G1BA 2G17A 3VAZA 5ITSA 4BY9E 4N82A 4XB1A 3EXG2 3U39A 2OV6A 1XA3A 3C87A 4LQLA 1FOEB 1C8VB 2AYZA 1YB2A 1H8ED 3LWZA 2JI9A 3EUWA 4RIFA 4CHTA 4E13A 4E12A 2DBQA 1HYQA 1W5BA 4OOEA 5H3HA 1MIHA 1XTBA 1EYZA 1JJAA 3K4HA 4PIPA 4RSRA 2R6AA 1U3VA 3WICA 5K0ZA 2GTPA 3WGMA 1K98A 3DA8A 2VT2A 4WI1A 2XKBA 3O91A 2GFQA 4WOCA 2E4AA 5FNZA 6AT1A 4B44A 4NZZA 3ZWDA 3JV7A 3B1ZA 1SD5A 4EJSA 1IN8A 2QE7A 1D6NA 4BLTA 2PNFA 3UJ9A 1ND5A 4HC4A 4EVQA 3DEFA 5KCMA 1NR7A 3G8BA 3LVFO 4M4SA 3ZU2A 4LZNA 2PAAA 5F5XA 3SF8A 2ZPUA 2D7DA 2F1OA 1Q1BA 2G4VA 4U7FA 4DTIA 1XHLA 1Z2OX 4DG5A 5HM6A 2F64A 3QJGA 4XWYA 2O3UA 4F4FA 1D1QA 1W44A 3C8ZA 1KIFA 4FMBB 4NBRA 4YJ2A 4DV1B 2YJ5A 2FN7A 3RU7A 5GV7A 3RSHA 3BL5A 2WK1A 4K6CA 1UQRA 3CO5A 4I36A 1LSUA 1NBMA 2QMEA 4IMJB 1JSRA 2EKPA 1E2EA 1MGPA 1ZGGA 1GRCA 1JG1A 2WAMA 3NB0A 4IIJF 4KN9S 3PQ2A 2GF9A 4BS9A 3L0ZA 4DMHA 4GT1A 1GKIA 2UUOA 4JJZA 3LOUA 2UDPA 2ZSKA 3JWJA 3GJ6A 3EE6A 2HIHA 3VTAA 1MO5A 2I6FA 1XNGA 3D0KA 3C7AA 3M6VA 1U9CA 4CQMD 3ZCRA 5KNBH 1BOFA 1G38A 3Q85A 4B3BA 2O06A 1WHTA 2PLNA 2ZPTX 3N2GB 1WD7A 2FOIA 4FZJA 4L9AA 1I9GA 3JQAD 4NICA 3F5DA 4HQFA 3TRIA 5FV4A 1S2OA 1GM5A 4HUQA 2RHWA 4E7OA 1N6RA 1R74A 3HGQA 1ZDMA 1HOTA 4FLEA 2GAIA 2BDTA 4PX2A 2O07A 1V3QE 3DXYA 1UK7A 16PKA 1ZVMA 3B51X 4CTKA 4RTRA 1IN5A 2OWEA 3ROTA 2IUUA 2BHNA 2KI5A 5I7FA 1PJ3A 1LDNA 3O9MA 1AKNA 3TL6A 3TE7A 1M7HA 3K0BA 4IKOA 3RSZA 3OWXA 3ST7A 3DF7A 4OQXA 4D3XA 3UMBA 2QSUA 1PFQA 1MAAA 1RQLA 3FD8A 4OB7A 2REQA 3KAKA 3U9TA 2C98A 3Q3VA 4FOTA 3UZUA 4D4KA 4DLPA 1O57A 3AEZA 1BYIA 2GK4A 1UQTA 5EIXA 3BUSA 2A9OA 3A6LA 3RIEA 1WABA 2ZRIA 4B79A 5KDDA 2CCGA 1EK1A 2J7PD 1LK5A 1TC2A 2YINC 4QFDA 2XZOA 5HUQA 2ZRLA 3K6RA 4E3ZA 5ELMA 3JQFA 1PD0A 1P7ZA 4KUGA 3Q6IA 1KE1A 4AUMA 2P78A 4BUZA 1YQEA 2I3GA 1UC9A 3H5AA 4UASA 5E8JA 5JEEA 2BP7B 4C4SA 5L3RA 1N75A 4ARIA 1M8GA 5K3DA 2AA3A 3ZD9A 4MS4A 4WFKA 4K8RB 1P6QA 2CBGA 3JYNA 2ZT6A 2J32A 1FS6A 4OK6A 3PJGA 2IHTA 5BN4B 4I4TF 5LM3A 2OTCA 3VNUA 1HDIA 3DKVA 4F3KA 4NBNA 1H94A 4CIXA 1Q2XA 1SVOA 5EXTA 5TX7A 4PR0A 5JSZA 2VP4A 1A8QA 5D51S 4YCLA 5DX8A 3EA5A 4TMFA 5AD1A 2XVZA 2C5SA 1NVTA 5BQOA 1T5HX 2DM6A 3ELWA 4PSKA 2A9PA 1C80A 3LCJA 1DQNA 3PYXA 4AJKA 4F2DA 4F3TA 1FDTA 2X5JO 4YC7A 3OF2A 2Z3WA 2R8PA 4LQDA 5J4VA 4KO1S 3GJ7A 2HHJA 1ZOPA 1ZD1A 3SEZA 3NTQA 3GZTB 3SBXA 2YY7A 3K1AA 2C4TA 4JUCA 2IS1A 2GHQA 2W0MA 2LDXA 3VR2D 3ZHOA 4C88A 3REQB 1ZUD1 5EI5A 3VNAA 1YZFA 1V1MA 1MXHA 3FYHA 1LGYA 1W6RA 1L4NA 1WDLA 1JDUA 3CWZA 4ZI5A 1PZEA 3NBYC 4EKIA 5C32A 5IT9A 1OW3B 3R8XA 1J0BA 1FXSA 2G4CA 4BO8A 2OXIA 4DQKA 5LQMA 2OQIA 4RJTA 3E27A 4WKGA 1U7PA 4X60A 1RAHA 1NYQA 1VI5A 3O8OA 5IFLA 4I50A 3TZKA 2Z0MA 1P19A 1KY3A 1VGQA 2YN4A 1MC5A 2ZS8A 4U7HA 1W5TA 3AVTA 1P9OA 2AMVA 2ZJZA 4JVSB 5CVEA 5DI9A 3ZDEA 1AXEA 3WIVA 3QEJA 3FDJA 4QGFA 1P9RA 5E9WA 4IICA 1N0WA 1P9NA 3OOHA 4PLVA 2RHLA 3GLTA 2P2SA 3S2ZA 1Y7HA 2FPMA 2XLCA 4LE1A 3WHPA 2P77A 1OBHA 3ZX4A 4AS1A 4BX0A 4B48A 1M2OA 3GAAA 4P0PB 2CE2X 2JH3A 2QX4A 1D7OA 3SN6A 4PXYA 2A9QA 2W8BA 4DY6A 4Z0PA 4B0PA 4URWR 1ZL2A 3RAPR 2H1SA 3OX4A 2J0EA 5KMGB 4K0KB 4XJXA 2FSVC 4Q01A 4JBHA 3CIOA 4L0MA 4MV1A 4F2GA 1XTZA 1Y9JA 3KEQA 5DLEA 1VKZA 3ZVRA 3B78A 3ZR4B 3B52X 5G3YA 4IQ8A 2YNMC 4D6YA 1EHYA 2HBRA 2W2LA 4MS1A 4YJFB 4U2FA 1EVZA 2IV7A 1XVLA 2Q2QA 2ZRKA 4D3ZA 3A6HA 4E2XA 3GR6A 2PWAA 3IGFA 1XPOA 3ICCA 4N5NA 5BNTA 2JLAA 3MGBA 3B1YA 1RU3A 3SPXA 1GGJA 3TOXA 3OQJA 4BNMA 2WIJA 2BBOA 1WPQA 2UZ1B 3EGCA 3I9JA 1M0TA 3QXHA 3WLMA 5IC4A 2MSWA 3KZKA 4WNYA 3H1TA 3MELA 3WGKA 1DKRA 2ZG6A 3CNNA 3C1TA 4WY2A 1I4LD 1UBTS 3X3HA 2ZSAA 3RKRA 1LLDA 4J0JA 3HCEA 1MENA 4HZGA 1JJBA 4BTVA 2O8BB 4CZ2A 3B5EA 3KQMA 4JITA 4MQFB 3SHTA 2VS1A 2XVXA 1VLVA 2R4UA 1WXIA 3KYCA 4CTJA 5I7WA 5JJKA 4DKJA 4KJXA 4ZDKA 2RHHA 4R3UC 1HX7A 1J0CA 1RLOA 1KEUA 4O2BF 4K9SA 2YHBA 2ZRNA 3L0IB 1JI3A 4IIUA 1XEXB 1Z5NA 3IPYA 2FR1A 2VIIA 3EISA 3GI1A 2FRDC 3KPJA 3Q0TA 1RYFA 3A1SA 3OLVA 1YBAA 2WWTA 4JQCA 2AN3A 4L07A 3KM0A 5AJZA 2IU3A 3RVNA 1XB2A 2Q6OA 3EVEA 2XB4A 3UYLA 5IEJA 1YRQA 3A9RA 3OPYI 4Y2RA 4B7CA 4BVBA 4DVGA 5IAKA 4ECEA 1L1RA 5FL7D 3ZW7A 1SCNE 3ZVMA 4D9FA 2AC2A 1GYRA 2OCIA 2NU8B 2CJXA 1NSYA 2EZ9A 2GM9A 2CLHB 2R4TA 3H1AA 4XIIA 5EEGA 4IMRA 3X2EA 4BWFB 3SYNA 2FRVA 4EGQA 4HNAA 2DPYA 2PVSA 1S2LA 1BMQA 1CIVA 3TOSA 5JZOA 2LUOA 2WT9A 2CJPA 2ZITA 4JODA 1T1JA 2SECE 3AJ8A 4OUDB 2BFDA 2YRWA 3JPWA 4W8OA 5HVNA 4P4LA 1KC1A 4PGMA 4Q1DA 3C4QA 4DM7A 2CFCA 3V2UA 4YPOA 1K4MA 2QTCA 3QK7A 2E37A 4K3UA 4TTIA 4IJWA 5LZ5A 1BHQ1 2MINA 1DKUA 4JX9A 3RABA 4DLVA 2CLMB 4CDMA 3HEAA 2OCYC 3W5BA 2Z5FA 4LYJA 4KNWA 3BGWA 5DYNA 5FKJA 4IHKA 1F8GA 2XYQA 4LYHA 2JJQA 3BILA 1YC5A 2WD7B 1SOVA 4Q4CA 1IXSB 1NG1A 1ZAKA 1NR1A 1X80B 4ZWNA 4M53A 2VZ9A 2EBHX 2YWDA 3KTDA 4LECA 5A4JA 3KG2A 1SKAA 1KEZA 3F3SA 2JS7A 5BV2P 4K0RA 1I10A 4J3JA 5FAXA 1JG2A 3E9CA 1GWNA 5TY0A 4UFPA 4IDFA 1PEDA 2GOYA 4JBLA 1ZCFA 4OPMA 4QTXA 2OFFA 3RKUA 5C18A 5AKEA 1C41A 4KLRA 5JO9A 4LWOA 3U3RA 4C0JA 2C9DA 2ZCUA 4JVMA 1PFGA 3K70B 4ZDIA 3ESAA 3FNQA 5DHQA 1UXJA 4M60A 5BSVA 1E4VA 1PE0A 2Y92A 3P5SA 4GOND 2V6BA 1BQEA 1S7CA 4HPWA 3ORQA 5IXYA 3BDVA 1XNQB 1X42A 4JZYA 4NS4A 5AM0A 4K6HA 4UMEA 5TF4A 4A5OA 2CC2A 4YRCA 4BQRA 3LLCA 4MVJE 5IHPA 1PJAA 3CZPA 1Q17A 4JLUA 1VIAA 3HP1A 4B7AA 3ECAA 1Y7LA 1GGVA 1N25A 2A92A 3LP6A 3PDJA 3PDIB 5LDHA 1KY2A 1PGOA 2HQ1A 1M6YA 2E87A 1KI6B 1N9GA 1Z4QA 2PGOA 3AU9A 4Q1AA 2OYCA 1MC4A 1GN8A 2OCDA 2BM9A 2JLBA 1D2NA 2BLNA 3FTNA 3ZU4A 3I8SA 1J20A 1HNZB 1QRRA 1YCHA 1JBEA 1NTRA 1O8CA 5JIBA 2DHQA 2VXCA 4LWZA 3M1LA 4P8RA 3AG5A 3CVJA 1DARA 1C8BA 2D5CA 1E9VA 3FBWA 3OM1A 1QP7A 2IBMA 4IZOA 4M0LA 4MPDA 3UANA 4QLOA 5JH7F 3EFOA 4TVOA 6REQA 1QNLA 5LYJB 1TNDA 5C7LO 1ZUNB 2XKKA 3LY8A 1FFXA 4G0ZA 4HN9A 3N7AA 1D04A 4QQ8A 2BFNA 3LP8A 2HF8A 4KQKA 5ESXA 5HCUA 3ZPXA 3GGDA 3OE1A 4EF4A 5BMOA 1MPTA 3HR8A 3PPWA 4Y2UA 1XDSA 1XZIA 2QAGC 1EM8B 2QM8A 1H2HA 3WYBA 3AGPA 5K3BA 2WYUA 3QHAA 4PRZA 4M36A 1TT7A 4WZAB 1E7WA 4WJLA 1DV1A 2JHGA 1IM8A 3DLBA 1P7VA 3DBHB 5IJ9A 3KYBA 4MB0A 3FVQA 5DP2A 2R6GA 4TXLA 1TU4A 2YYAA 3MUNA 1M74A 2YDXA 3G8YA 4GLBA 2HU8A 4R5MA 4UNIA 2VLBA 5HIAA 2BE9A 5KPDA 4DCCA 2AR7A 1CUDA 2DC1A 3FNBA 1H6CA 2D2FA 4LHXA 1NBAA 4BZZA 4DAOA 2IYUA 4QT4A 2ZIFA 1K75A 3N0WA 3DVLA 1TOAA 4URZR 5A9RA 2QTWB 5G41A 1U98A 4CIVA 4D9IA 4LTNA 1YR3A 1F9EA 3DW3X 3EXEA 2CDRA 5HP4A 2WZDA 3DE2X 3FWZA 4IIHA 1UXGA 4C2TA 4IX9A 1XQVA 3N58A 3RK4A 1J9GA 3NQ41 1RI3A 1MT0A 1N5KA 2ACVA 2VJPA 5ITZB 1P0QA 4MKGA 3W5IA 5HOEA 3BQMB 1F0NA 1E3MA 4QWWA 1MN6A 2ZDQA 5FCDA 1OT5A 4H7FA 1BU8A 4JXXA 2J3MA 4RVFA 1YL5A 4A73A 4RLSA 4HXFB 4BVAA 3W8FA 3M2PA 2B82A 4ZAFA 2AKYA 3DMTA 3IMGA 1X1QA 3PVCA 4NU6A 1RRVA 2PYIA 4UUAA 1JEOA 2B4TO 4OYRA 4PS1A 3ZIAA 1GL6A 1M9NA 1TI7A 2C5LA 2WQZA 3IVAA 3BX1A 4TLAA 5K0BA 3N3AC 1CUJA 4LJ7A 1HKHA 4YREA 2AS0A 2PRKA 3M6FA 3EGXA 3FFBA 3RI3A 3UGQA 4M83A 1H0KA 3K2QA 3PI6A 3WY9A 5TS3A 3IP1A 3QG5A 4Z1OA 4JV5B 4JBIA 4UXHA 1VCHA 4W99A 4ER0A 1G4HA 1Z5VA 4ZRMA 3G79A 2OILA 3ESDA 5FLKA 2QQ5A 2Q2OA 3CIFA 1T36B 2O2JA 1FDRA 3GB9A 2EEZA 1DCKA 1FLNA 3KSZO 3SIPA 3ZIDA 4NR0A 4AKGA 3OOJA 3PLNA 4DLTA 2VDKB 3FSRA 5FULA 1P7YA 5ICMA 4NMLA 2IXEA 4WJZA 2XBMA 4G4JA 4HAZA 2Y77A 4QJ5A 4ZVRA 1E9CA 4BP3A 5CLJA 1CR6A 2MIIA 4DLSA 4UUBA 4I55A 4DDMA 3D5QA 3TRDA 4HQ0A 4RMGA 5BN3A 2Q9BA 3VPXA 2GXUA 3EPRA 1BRMA 3ME5A 2VDPB 4TL9A 2DQ4A 4KE6A 3CLSD 4WLOA 2F17A 3AFGA 1SPBS 1ZRSA 2VDVE 4JJ7A 5FJIA 4TMXA 3LBYA 2GEVA 1NUSA 4F3CA 1RNLA 1BJRE 1JPNA 1Y6QA 1WZNA 4CKWA 2NUAA 2YL2A 2BV3A 4QREA 3WLQA 1AX9A 1KO8A 3BMNA 3QU7A 4Y8VA 3U4GA 8ATCA 5B6PA 2EF1A 4MJ7A 1N5IA 2LDBA 1KP2A 2OCBA 1GFIA 4LHYA 1MNAA 5D7BA 5CFRA 4MJ3A 1A9RA 3AO0B 4HF7A 2OG2A 5F4ZA 2IP4A 1NU8A 2OKCA 2LVBA 1SC6A 4B71A 2GKGA 1LKZA 2EEPA 3UJNA 1ZGAA 2BR5A 4BEWA 3ILXA 4C3OB 3FUTA 2E55A 3E9QA 1G17A 1J0DA 1KYTA 1W1IA 2HGZA 1SY7A 1LNSA 2WTMA 5FOVA 1TYAE 4CLOA 4HY3A 3WIBA 4U2DA 2R5WA 3C3WA 3GGGA 4EB6B 2A4KA 3AY6A 1V8PA 4ZC8A 3FYDA 3NT4A 4CT5A