3GDGA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
molecule tags Oxidoreductase
molecule keywords Probable NADP-dependent mannitol dehydrogenase
total genus 88
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdgA00
1HDCA 1GQQA 1VC2A 3ETGA 4TZKA 4YT8A 1P1JA 3IJPA 5BNFA 4HY3A 4IS2A 3DDNA 3UF0A 4E12A 3MJTA 4TRMA 4B79A 1YB1A 2W2KA 3Q11A 1NX6A 3OJOA 1EE9A 3ZGYA 2CUKA 2EW2A 3OJFA 3RSHA 1R4MA 2WD7A 1FMCA 2YHUA 4GPD1 2D3TA 2AXQA 4EW6A 2ZB3A 4FIZA 5AXAA 4CMCA 3AI2A 3D1LA 1LJ8A 4GKVA 2Q4BA 3NT4A 4R5MA 3L6DA 2JD0A 2E48A 2VHXA 1A4IA 3DFUA 1HF3A 4YACA 4BKOA 4ND4A 3VVCA 4FDAA 4IZIA 3RIHA 3IP1A 4IDGA 2IODA 4I5GA 3UCFA 4ZRMA 3WTCA 4DUPA 2C5EA 4NFYA 1PR9A 4XX0A 1DC6A 3QWBA 4RVFA 1RM4A 4RLSA 3ZV4A 3JD2A 9LDTA 4XZ3A 4CLRA 4P4LA 3DBHA 3PHHA 2VUSA 5JYDA 1WDLA 1PJLA 2P4HX 4GBJA 4IIVA 3ASUA 1Y5MA 3E1KA 2FR1A 3EC7A 3WQSB 1R0KA 3UAGA 3MJ4A 2GD1O 2QW8A 1UH5A 2DBZA 2DPGA 2J5QA 2EGHA 5JAIA 4DBZA 1U3TA 3BZUA 5F1OA 4AG3A 1ZEMA 3IL2A 1XELA 6ADHA 1RM3A 1TLTA 3GVPA 4QT0A 2Y1CA 4CMIB 2UUPA 3GNQA 2FP4A 4Z0TA 2FZEA 1DHTA 3WWYA 3NRCA 4ZQEA 2J5RA 3WNQA 4I08A 4TKLA 1XA0A 3I4CA 3VKUA 1YB5A 4DYVA 1DPGA 4QFDA 1RJWA 2BFAA 4WNCA 3D4OA 3V5NA 5H81A 3H8VA 2IXAA 3ZWMA 2C20A 1DHRA 2R6JA 5TS3A 3W8FA 3NTQA 4QECA 3WLFA 3AY7A 1OOEA 1K0UA 1VLLA 2QQ5A 3LC2O 3PYXA 1GEGA 3M2TA 4JBGA 1N9GB 4WCFC 1NHWA 2E82A 2WWRA 3T7CA 1L7EA 1ZZEA 4H15A 3HDHA 1D1SA 2ZTMA 4XD2A 1I32A 3DEYX 3JQFA 3Q1LA 3ZZNA 1PQPA 4D0SA 1K6XA 5F1PA 1GYQA 1OMOA 2GSDA 5HM8A 5K6AC 2C0CA 3VZRA 1HEUA 3PRJA 4GX5A 3TZ6A 1NPTO 3OJEA 3AU9A 3NAQA 4RVGA 2O3JA 4GKBA 2VTDA 4DQVA 4DQUA 3K2EA 4U6QA 2XOXA 4L4RA 1PL7A 5KVSA 2CVQA 3F3SA 1ZCJA 2VZ0A 3BHJA 1NAHA 5KJFA 3FI9A 1N5DA 1S7CA 1T24A 1QYCA 4OQYA 4NI5A 1PR3A 5KVQA 2AQKA 4NIMA 4YYZA 3HADA 2F00A 1MFZA 1JW9B 2AQIA 2NADA 1E1MA 1MP0A 3ITKA 3QA9A 1ISIA 4DLLA 5JYEA 3ENKA 2G17A 2PKQO 3MEQA 3WQRA 1PWXA 5G0TA 4BHTA 3ZHBA 3DZHA 1YL7A 2V65A 3B6ZA 3I9MA 4GWGA 1VL6A 4DBVO 1DC3A 3A9WA 2OORA 4OH1A 5DNAA 3WXBA 1IOLA 1F8GA 1NP3A 4EJMA 2RAFA 3GUCA 1AXGA 2RHCA 1PX0A 1C1DA 2HQ1A 3WTBA 4IQGA 1UUFA 1I3NA 1JWBB 4PLYA 4CMEC 3JQCA 4XJSA 1K2WA 3FR7A 1LDBA 1MG5A 3I6QA 3ZW8A 5DT9A 3D4NA 1C1XB 3KSZO 4ALMA 5L4SA 5A9RA 5JC1A 5LDHA 5HA5A 1N9GA 1TA4A 1V9LA 4D45A 4BNFA 3HDJA 2HRBA 4Q3CA 4BNKA 3HFGA 1C3VA 4R1SA 3UICA 1DXYA 3NTOA 3KYDB 1P9LA 5F5LA 1ZMOA 3ZHXA 3DWFA 4P22A 4BGVA 4CM9A 2B4QA 2NSDA 3LLVA 4FR5A 1BXZA 1LTHR 2ZJ0A 3O38A 1U1IA 4BNXA 2I76A 2J3KA 4DTIA 1NASA 4CM5A 4UVHA 1PEDA 1IY8A 1SMKA 2YUTA 4N5NA 1RM0A 1V3TA 4GGPA 3FF4A 4MVJF 3WGYA 4BMNA 1ISGA 2VNSA 3I9JA 3QRWA 5IDYA 4D0RA 3PDJA 4WUVA 1DC5A 1GUYA 3FD8A 3HWRA 1A71A 4NBTA 4DL9A 1YH3A 5DOZA 4Q9NA 4M86A 3PWZA 1YQGA 4YJHB 3PHLA 1HE5A 2IZ1A 2X9NA 4EDFA 1KY4A 4Z0HO 4R5HA 2DVMA 1ZEJA 4FD3A 1EK5A 3BA1A 2GCGA 1XYGA 1TEHA 3GZNB 2HK8A 3JYNA 3VDQA 5DBGA 1JDJA 1HDZA 1A72A 2DAPA 4LRTB 4PVDA 4B3JA 2QHXA 4PLGA 3TN7A 4BNYA 5KJ6A 2VOJA 1LX6A 1XKQA 1JAXA 2GDZA 5KTKA 2I5PO 1EVYA 2Y1OA 2D59A 3G17A 5I9NA 1Q0QA 4UEOA 3M1LA 3GUYA 4K6CA 4UUMA 4D3DA 2B4TO 5DZSA 3GAFA 4YAJA 3WR5A 1EVIA 1E3LA 1MLDA 4MVJA 5JBIA 5AOVA 1LLUA 1DB3A 1NR1A 2DBRA 4KQXA 4BNIA 2IZ0A 4ONEA 4L4SA 2HU2A 3D7LA 2W8ZA 3VDRA 1P1RA 5FI5A 1JAYA 5DP1A 4EJ6A 2WD7B 3RFXA 4RV9A 3MTGA 4YJGB 1YVEI 4NG5A 1JKIA 2VHZA 1RM5A 3DHYA 4OGWA 3PXXA 2YDXA 3ICPA 3ZWXA 4LRSB 1ZKMA 2A9FA 2F1KA 4X54A 1YDEA 4RDHA 1FDTA 4ND3A 3QY9A 4B8ZA 3H4VA 4BV8A 5B4TA 3NJ4A 3JV7A 1A7AA 4E3ZA 2VWQA 1SB8A 4LN1A 1PS8A 4ALNA 4IXTA 5A3JA 5JCXA 3Q9UA 3CZRA 1DDOA 4IJVA 3TPCA 4H7PA 4K6FA 5BSEA 5C7OO 1ULUA 2UDPA 3MTJA 1GV1A 2J3HA 5EL0A 5CG2A 1GV0A 1JKFA 1H6CA 1PJTA 3H3FA 4WEOA 2E49A 3LYLA 3ZNPA 2HLPA 3FPLA 2Y1GA 4W7HA 5I8WA 3IS3A 3HDYA 3CUKA 2NVUB 3ZNNA 5A9SA 3D3WA 1GZ6A 1ZMTA 1LC0A 5G0SA 3KXDA 4ILKA 5K6AA 4WK6A 3GGPA 3TL3A 5HS6A 2O3RA 4OL9A 3TL2A 2RH8A 3GMDA 3LK7A 1JKJA 1P77A 4BMVA 3ZU4A 2O23A 1ZFNA 1U8XX 2ZQZA 1ZBQA 2P2SA 1UAYA 3PZBA 4IGFA 2PY6A 4NJOA 4YCAA 3NYWA 5JW6A 4QEDA 4P4NA 2O3UA 4MDHA 1Y8QA 1BWSA 5F3RA 4CMEA 3ZHYA 2YV3A 4FB5A 5I7EA 5KJCA 4KWHA 5CDSA 3DONA 5G0WA 1MX3A 3LT2A 1ADCA 5L4LA 3NT2A 3LVFO 2YYYA 1IHXA 1QV6A 4BB5A 2Q1UA 1DIHA 3K2BA 3KUXA 1N2SA 4HNGA 4AJ1A 3ONDA 3CSDA 3EZLA 4QTZA 3V1YA 3ZV5A 1KYQA 1KS9A 3JQDA 4YJFA 4MIYA 4YRDA 1BHSA 1VKNA 1EBFA 2AW5A 1XU9A 1WAMA 3LDHA 4NZ9A 5TNXA 4XKJA 1LBEA 2UUOA 1D3AA 4MJLA 1E1KA 4RF5A 1BDMA 2O4CA 3FCOA 4J1NA 2OBNA 1I8TA 1EE2A 1P31A 2Y93A 3DBLA 4Q39A 3RUIA 4ZVVA 3W4JA 4BKRA 1NBOA 2QRLA 4LISA 4UUNA 2P9CA 5ILGA 1A27A 3ZWNA 4BV9A 1QV7A 2EG9A 5K0ZA 1VI2A 5JMWA 1NPDA 4PLFA 4E0BA 4IDBA 1KEUA 1U28A 1T1RA 1Y7TA 3WFIA 1ONOA 2CD9A 3MJVA 2CVZA 3RC2A 5TX7A 3OQ1A 5IDXA 2BH9A 1EUZA 4WE3A 4KUGA 1E5LA 5IG2A 4IS3A 1NPYA 4UUPA 4M1QA 4MKXA 1WMAA 1ZXBA 2I9PA 5TT1A 3ITDA 5DBFA 4J2HA 4XA8A 1BW9B 4JX8A 4CR8A 3F5SA 1WXDA 2JHGA 5G4LA 1G1AA 4B4OA 5A5EA 1QKIA 1A5ZA 1Q7GA 4INAA 5EQFA 2O48X 3M6IA 3KYCB 1SOWA 4DLAA 2BLLA 4HFRA 5GZ6A 4CR7A 4EITA 3M1AA 2XXJA 3Q2IA 4MVJD 4J9UE 2J5KA 1DRWA 3P19A 1J4AA 4R3WA 2JHFA 4FFLA 1YGYA 1N8KA 1ZSNA 1OFGA 5TT0A 3H5AA 3WSWA 2UYYA 1Z6ZA 4E6PA 2VHVA 1U4SA 5C5IA 2GPTA 1GTMA 2EHDA 4Z9YA 3GDOA 4TRRA 1JWAB 3DO5A 3BMOA 4IUYA 4PLVA 3JD4A 2QIOA 5EQDA 4YT2A 1E1NA 2AQHA 2GN9A 1E7WA 2CMDA 4NBWA 5IZCA 1DRUA 4RVUA 3E18A 3DC2A 4PZCA 1W73A 1DFGA 1GDHA 1N7GA 4LSWA 4IDCA 3K92A 1KY5A 3KSDO 5B4UA 2B5VA 2VRBA 2ZCVA 3ROQA 4YRBA 1V6AA 1XDWA 4I1IA 4B7XA 3AOEA 1LNQA 4BMSA 4OO3A 1DLJA 2PGLA 2QYTA 3QHAA 5IZ4A 5DCUA 4XYBA 1IUKA 4XJTA 4BO9A 3QWFA 5IDQA 3AW9A 3OETA 1XR3A 4Z0PA 1H5QA 2B35A 1HYGA 2NLOA 2O50A 2FZWA 3V2UA 2CSUA 1LSJA 1C14A 1LA2A 3IDSA 3WGOA 3NGLA 4O0LA 4Y8VA 1YOVB 2V6BA 4PZDA 4IDFA 4A7PA 1HT0A 1LU9A 1UXJA 3V8BA 7ADHA 4DWVA 1E0DA 4LMPA 2CY0A 3KEQA 3LQFA 1DBVO 4J1TA 3TZHA 4ND1A 4BNZA 4CM7A 4II3A 4JBHA 4KUEA 3GOHA 1NHGA 2VHWA 1GZ3A 5L51A 1T2CA 5IJZA 3QV1A 1HDRA 2QYSA 1LRKA 3WYCA 2DUUA 4YAGA 5THKA 3WWZA 2X0NA 3COSA 4A03A 3IC5A 3H9JA 5FYDA 3GDFA 3RCBA 1V3UA 2WSBA 2YFQA 4IBOA 3TF5A 3HNPA 3ON5A 4DLBA 4YT5A 3FNGA 1AUPA 4J49A 1GD1O 2PD6A 4BKUA 1ENZA 3OQBA 3UGKA 4CMAA 3ONFA 2YQ5A 1BVUA 4KP7A 3AWDA 4CMHA 4E21A 3C85A 2QRKA 2CNBA 3PJFA 3PGXA 4W6ZA 5I8ZA 3F5QA 4RL6A 3D5TA 1FDVA 2XAAA 4YXFA 5TJHA 4TVBA 5BNIA 1UP7A 4AVYA 4CLDA 2NU8A 3RD5A 3ZWVA 2I6TA 2NVWA 1AGNA 5AXCA 4E5NA 4DREA 5DDIP 4E5PA 4RVHA 3SXPA 5KJ1A 1KC1A 4NU6A 5F1KA 2NUAA 1SNYA 3OMLA 3FTPA 4OHUA 1KVUA 4AJNA 2ZYAA 1DRVA 2EWMA 2EV9A 5G0UA 3WGTA 5IZCC 4J0FA 4RF4A 2IXBA 1ZVMA 3HB5X 4MINA 1KVQA 4L74A 1M2WA 3B1KA 1P0CA 3R3JA 2Y05A 3JQ8A 2W2LD 5IDWA 1E3JA 1G0NA 1LQUA 1UJMA 4CUJA 4E4YA 4JQCA 2NWQA 3LU1A 2DKNA 3PJDA 1WMBA 4URFA 3L4BC 1D1TA 3BMOB 1PJBA 2ZTLA 3O26A 4FFNA 4YTEA 1LXCA 1P45A 2Y67A 4XQEA 1EMDA 4PLTA 5JAQA 1YO6A 4ZN6A 5CG1A 3FN4A 2JJYA 2TMDA 3S1LA 3PPIA 4RCVA 3UXYA 1EQUA 1ISMA 2DTEA 4KTTE 2YHIA 1A4UA 2Q49A 2HAEA 3D64A 4WPGA 4OM8A 4DMLA 5U9CA 5A06A 2UAGA 5U1PA 1RWBA 4NK5A 3ZV3A 1LDGA 1P1FA 1HYEA 2PD4A 4RZHA 4O59O 1E5QA 4RGBA 4E31A 2W98A 1TT7A 1OAAA 2FPPA 3BMCA 1TB4A 1IB6A 4J4TA 3KLMX 2POQX 4U7WA 5TSDA 1I3MA 3EDMA 1PGOA 3AM3A 2D1YA 3RUEA 3UW3A 3WB9A 3KLPX 3GF4A 2FWMX 4MIOA 1KERA 1A9ZA 2P91A 2P9GA 4B8WA 4Y9DA 2E6UX 8ADHA 3DXFA 4TRJA 1E3EA 1PZGA 5TGDA 1ML3A 5KNLA 3TFQA 4TMFA 4YJDA 1LDNA 4HXYA 2Q1TA 3GGOA 3A14A 4M8SA 4F45A 1I30A 4CM6A 4W4TA 1KOLA 4BO6A 4J4BA 1CWUA 4JJGA 5TLSA 3L0DA 4FCCA 3LT1A 4WCFB 1W4ZA 3IOYA 4LMRA 5JAZA 3QW2A 2OP1A 4GSKA 4A0SA 4YJFB 3F1KA 5KWEA 3B1FA 4O5OA 4D3FA 3WX0A 2Z95A 4E33A 1VJ0A 2PA3A 3Q9NA 4GMGA 4PRKA 3JQBA 1Z7EA 1T1SA 5TRTA 3BYZA 1ZK1A 2DTXA 1B7GO 2WE8A 3AM5A 5JO9A 1ZSVA 1YB4A 4F46A 1NM5A 1EDZA 1QXSA 5T64A 1Y8QB 5AXDA 1B3BA 4J0EA 4L4XA 5G0VA 3GHHA 3G0OA 4FC7A 1YQDA 4E2ZA 5C37A 3RC9A 1J49A 1ENPA 1HL3A 3K5PA 2JCVA 5COQA 4HV4A 3DBHB 5DCWA 1YXMA 4JCOA 3DZFA 1MXFA 3EGOA 4AJOA 4I8XA 4YRAA 3KEOA 4Y6SA 2Y99A 2WEKA 3RFVA 1CEQA 4HFNA 3L77A 4BQRA 3KETA 1BW9A 5TF4A 1BDBA 3I9OA 5H82A 2OHXA 4JXKA 1G6KA 1Z82A 4CQLB 4CODB 4BNTA 2PGJA 1HDOA 1NWCA 4CQMB 5BR7A 1HTBA 4I5DA 4I9HA 4WEQA 4NPCA 5EPOA 4UAGA 1HDYA 3VH2A 4UEJA 3AM4A 4XGKA 3OA0A 1N92A 4ZRNA 3VPFA 1CIVA 1ZH8A 2CFCA 1P3DA 2VTEA 4IIUA 3RROA 3D4PA 4BO7A 2J8ZA 3BTVA 1E3WA 3WMXA 4ZJUA 1AE1A 2NVBA 3SLKA 2JD1A 4Y98A 2IE0A 3M2PA 3U62A 2W2LA 4IDEA 1GY8A 1B14A 1CYDA 2WM3A 4PG4A 4UULA 3EHEA 2VWGA 4XQCA 2PFGA 1ID1A 1V0JA 1Z45A 1I10A 1PWZA 4K1LA 3OBBA 4S1VA 4Y6RA 3NJ8A 3GY0A 1P1HA 2NTJA 3DBLB 3GZ4A 1GQ2A 2Z1MA 3P2OA 5CDGA 2LDXA 3T4XA 5KKCA 3OP4A 1YQXA 1UZNA 2AEFA 3IQDB 3JQAA 1DIBA 1Q1NA 1WW8A 1SEVA 4NH4A 4CQMD 3JD1A 3IKVA 4ZGWA 1ZK3A 1ISFA 1EK6A 4RPHA 3HDQA 4MP8A 1PZHA 3SLGA 3MJEA 3NEPX 4WECA 1MG0A 5IN4A 3SBOA 4R69A 1VL8A 2X9GA 1LLDA 1RPNA 1UDBA 3DTYA 3ICCA 2PWZA 2VT3A 1IULA 2DT5A 2GUGA 3GN2A 3WDSA 4QX6A 2VYND 1IPEA 3CINA 3PEFA 4B3IA 3BMQA 4MVJH 2YW9A 4AFNA 4CM8A 3ZU5A 2AQ8A 3R3SA 4M55A 4YBZA 1NAIA 4AJJA 4MKRA 2NNLD 4EI2A 1X1EA 5A04A 5A5FA 5JFOA 3KTDA 2VWHA 3E5RA 3GMSA 3IP3A 2C59A 1R12A 1YDWA 3GZNA 5T67A 4F3YA 4PFJA 1EFKA 3B1JA 4DYDA 1E7MA 5K9ZA 3OJLA 1U3WA 4TRNA 4YJHA 4IJUA 3UVEA 4IM7A 3Q2KA 3W4KA 1X1TA 1LDMA 3GFBA 4IJWA 4IXWA 1K6IA 4IJKA 2WE7A 2PD3A 1PSDA 4M49A 3CMMA 3EYWA 1I33A 4YPOA 3HN2A 4CV0A 4XRRA 3MJCA 3UFXA 4ALLA 5L45A 1UXIA 4ZQBA 2DUWA 2GO1A 2C07A 3RKRA 1KIFA 4YWJA 1NQOA 2RCYA 3JQFC 3MOGA 1NVTA 2IZZA 2P68A 2IRWA 1NTOA 2V6FA 1D8AA 4OSPA 4CMGA 5HS4A 3CPSA 1KBZA 2XF8A 4DXHA 1I2BA 1IHYA 2NQ8A 3H3JA 4S3MA 5CPBA 2DQ4A 3BTUA 2EW8A 3H9GA 1XQ1A 2GGSA 3TWOA 2DFDA 3OIFA 3INRA 3ETDA 1Y6JA 1I0ZA 3HE3A 1F17A 3TNLA 4B7UA 1BGVA 3D5QA 3ADOA 4CUKA 2PZJA 1Y9EA 1YONA 1E7RA 4NFSA 3MOIA 1SBYA 4YEDA 3N74A 2AG5A 2HJRA 1FF9A 3I6IA 3VHRA 1GUFA 3IMFA 5DOVA 1PIWA 1PQUA 1X0VA 3RJ9A 1MFPA 1QG6A 3SC6A 4DPKA 4YT4A 3I3OA 2A35A 1KVRA 3GT0A 4FGSA 3PK0A 1X7GA 4JN6B 4R54A 3UHAA 5MGBA 1LEHA 1I36A 1LI4A 4QO8A 3RUFA 1UP4A 3CIFA 5BT9A 3RQSA 4CMJA 1PZEA 1H94A 2Q99A 1Y8RA 1HZZA 3I83A 3VPGA 1ULSA 3K96A 4EBFA 4BIIA 4XB2A 4I9UA 3WYEA 4E2WA 3BXXA 4UREA 4HWKA 1WLYA 5CAEA 5CDUA 3IAHA 2B83A 4UVGA 4RQUA 2A92A 2DLDA 3IIEA 3JQ8B 1LRJA 4H16A 1E6EA 3DAPA 5CEJA 5A03A 4WOJA 2UVDA 2WYWA 1HRDA 3JQAD 3STHA 2NU7A 3AUTA 3G49A 3JQBC 3EAGA 2JCXA 3H65A 4UVIA 2VT2A 2YV1A 2Y1EA 2Q2QA 4MP3A 2E37A 2WTBA 3AOGA 3HHPA 1B15A 4CL3A 1NFQA 4QQRA 4E30A 3RU9A 3S2GA 5DP2A 5C7IO 1VKOA 3FBGA 3ZH2A 5B1YA 1OC2A 1TT5A 1U9JA 2VNAA 4Z3DA 3VOSA 4AICA 3ZWCA 3VAZA 1CERA 4FS3A 1FDUA 1DJNA 2GLXA 4GAEA 4BVAA 2VOEA 5JLAA 4CM9D 1R15A 4BGUA 2V7PA 4ID9A 4RPLA 4I5EA 4FJ1A 3HFSA 3C1OA 2ZB8A 3DZKA 2H1SA 4DIFA 2GN6A 3ANNA 3RKUA 1MV8A 3K8ZA 3RJ5A 3E5MA 2D8AA 3TOXA 3ZW9A 3QWIA 3UCEA 3MWDB 2HSDA 1PGPA 2VRCD 3GFGA 4XIYA 2JAPA 2PTGA 4RVSA 3DMTA 3WG9A 4EZBA 4OOEA 4UVDA 4LCEA 1ZSYA 2R00A 4D42A 4U5QA 4MKZA 4IQ0A 4OXYA 4NDNE 5IXYA 3ZWPA 1ONPA 4DPMA 4BL5A 3WSVA 3OECA 3E9QA 5ER6A 5T6BA 2D2IA 3SVTA 1F14A 2C7GA 3LSYA 2HK7A 3GPIA 2X5OA 3ADPA 4R9SA 3TOZA 4CLRB 3RBZA 1FDWA 1V3VA 3WFJA 3JSAA 1R6DA 4E5KA 3GK3A 2AHRA 3SC4A 1DFHA 1W6UA 3ANLA 1M6HA 4FPXA 3ROKA 4B4WA 4Q3BA 4YA6A 1ZXLA 3E03A 5JSFA 3HSKA 2Y0EA 2HUNA 3U9LA 2Q46A 4L8VA 1S6YA 1LSUA 2Y1FA 1Q7BA 2EF1A 2A4KA 3EK2A 4XYEA 2C54A 3OICA 4FBGA 2ZK7A 1R4MB 3PDUA 4RF3A 3WQQA 4A5OA 1AN9A 1E92A 1GUZA 5JDIC 2Q1SA 1HE3A 3G3EA 2OFPA 3KO8A 3KOUA 4R16A 4W82A 4WLUA 1KC3A 4BQPA 1MB4A 4NJMB 2IYOA 1PGNA 1BXGA 3LF2A 2FSVA 3LC7O 1B16A 1P1IA 3JQ9C 2ZTVA 4ZU3A 4ZD6A 3ZDFA 4XYMA 4GVLA 3D0OA 3QVOA 4ALKA 2EGGA 1DJQA 2Y66A 4HUJA 3TZQA 3F9IA 2HMWA 3H6KA 1H9BA 4GI2A 4BB6A 1XU7A 1B26A 3KYCA 4BNMA 1DIGA 2D4AA 3L9WA 4E5MA 3LT0A 2G0TA 4D3SA 1Z73A 3VH3A 3O03A 4NHEA 5EIOA 1F06A 1JLLA 2RH4A 4U8GA 4XEHA 5G2OA 1VSVA 3IJRA 5EMHA 3JCZA 3P5SA 3MCVA 4Q3EA 1KETA 1U5AA 2B69A 4KDFA 4I9NA 4J3FA 1LLQA 3ZCXA 4CLOB 4M87A 5BSHA 3RWBA 1XEAA 3QVTA 4IQ8A 1SPXA 4ZICA 1I2ZA 2FN7A 4XCVA 2IDZA 2ZQYA 4TWRA 3QJ5A 4MIEA 1DC4A 4PZEA 4GLOA 3QVXA 4BOYA 1QRRA 3CKYA 3AUAA 4Z9XA 1UXGA 1PJSA 1IE3A 2ZB4A 2DU8A 4L0QA 1H6DA 3GRKA 4NQZA 3H2SA 3NX4A 3VZPA 2BFMA 4AJIA 3C8MA 2EKQA 2YDYA 1UAGA 3V2HA 3P7MA 5L9AA 4RF2A 3ROPA 4GSLA 4Z9FA 3WS7A 3W6ZA 4XRGA 2ET6A 3WIDA 1E1LA 3H5NA 4DA9A 1H2HA 2Y1DA 1GPDG 1DFIA 2C82A 4ZQFA 2D5AA 1QSGA 1H6BA 1UZLA 2EP5A 3QIVA 1P33A 3CTMA 1MC5A 3I23A 3L4SO 3DR3A 3DMTC 5JNLA 1R4NB 1QMGA 4PLZA 5ENVA 1HLPA 2OP0A 3OF2A 1ARZA 4GWKA 2PKQP 4DC1A 4E13A 3W8EA 2VYNA 3OEYA 4NNJA 5FEUA 4K9DA 1VE9A 1U2GA 3CEAA 2X0JA 1N1EA 4JLWA 3DOOA 4RLHA 3HG7A 5JDIA 1WPQA 2OZPA 3QWAA 2EXXA 4JBIA 4QSMA 1EVZA 1YJQA 1CQIA 1HYHA 3QVSA 3RC1A 2C5AA 1PL8A 2AE2A 2BFOA 2BGMA 1XLTA 1PZFA 4JIGA 4YVFA 1QORA 3PIIA 4B4UA 2RIRA 2W90A 3ENNA 3GEGA 2YV2A 4XIJA 1O95A 1YBAA 4MVJP 2BELA 1IL0A 1JTVA 4J7CA 4N5LA 3RBVA 1NXQA 4NBVA 3BMNB 3RI3A 3D3WB 3G1TA 2B37A 1PJ4A 5JCJA 2QG4A 5JDCC 5JXWA 1ZK4A 4XDZA 5T8KA 3AI3A 2PZMA 4XGNA 5TJ9A 4CQLA 2VHYA 4U6SA 1K6JA 5FWNA 2V6GA 2QRJA 1H0KA 4PCVA 3BMNA 4J16A 1F12A 4WCDA 4NBRA 3ONEA 2AA3A 4CV3A 2EJVA 3FBTA 3VPSA 4XWYA 2FY8A 2JFGA 3WOHA 1O94A 4J7XA 3RC7A 4PLPA 3R6DA 2GN4A 4XYLA 5KIAA 3S55A 1Y1PA 3L07A 2GZ2A 1EUCA 2Q2VA 4JP3A 5L7TA 1DSSG 4ESOA 2PH5A 3FPCA 1F0YA 5KOIA 2I66A 2HO5A 3HZZA 1BRMA 4XYGA 3LF1A 5BNTA 2D5CA 3O8QB 3X2FA 1WDMA 5BQFA 3VC7A 3PP8A 3AOEC 1EZ4A 3AJRA 3DMYA 1E3SA 3C1TA 1PJ2A 4ND5A 3GVIA 2EKLA 2R2GA 3UCXA 3GN1A 3RUDA 1R4NA 2IYPA 1PJ3A 4CJXA 2VUUA 1SOVA 1KEWA 2X5KO 3K9QO 4RPJA 2XXBA 4HADA 2H6EA 3NDIA 4HP8A 4GLLA 4PG5A 4GMFA 3WJAA 4D79A 3W8DA 5JS6A 5I9MA 1U3VA 1ZUD1 5EJ2A 3BHMA 4IDAA 4C7KA 4HBGA 5A05A 1R16A 1SEPA 3U4DA 1BVRA 4WLVA 4WCFA 1YL6A 2A94A 3ZU3A 2GF2A 2C29D 3A1NA 4TVOA 4BNVA 2PH3A 4MO2A 1RYEA 1NNUA 1C0LA 2FSSA 2GZ3A 1V8BA 1M76A 2G76A 5ICSA 2ILTA 2OGUA 4OXKA 1M66A 4GQAA 3DZGA 1PQWA 2YQ4A 4FJ0A 4D7AA 5HRUA 3DZIA 4ALIA 3L6OO 2GR9A 2JCYA 3GQVA 3O9ZA 2GRAA 4BKPA 4O63O 3DOCA 1BG6A 1DEHA 4LVCA 2X1HA 2AMFA 2DBVO 4EUFA 1B3RA 3CMCO 2NVUA 4RPKA 2EERA 3BMCB 4DIBA 4D44A 1X14A 2VYVA 3FRJA 3GG2A 3K6JA 3ULKA 1BMDA 4AJPA 1UR5A 2IEBA 3EVTA 3ZNOA 3U49A 2AEMA 2PR2A 5A9TA 2G82A 3KRTA 4Y67A 3R1IA 3TSCA 4AJLA 4DVJA 4Z6KA 4OYRA 2P5UA 4QO7A 3GVHA 4RORA 4BO0A 4B3HA 5JDCA 1YKFA 4TKMA 1U4OA 4L76A 1ORRA 1Q7CA 3FHLA 4BNWA 2EKPA 1BXGB 1YE3A 2PGDA 3JQGA 3QVWA 2Y0DA 1LLCA 3ZN2A 4NJMA 4BGEA 3N58A 2VUTA 4PVCA 2HMSA 2NTNA 3SJ7A 4BNJA 2WYUA 4R4JA 1T2FA 5ER9A 1CRWG 4LK3A 3VPXA 4A10A 3PQEA 2JKVA 3V1UA 2RHRA 3VVBA 1HLDA 4ZA2A 5L53A 4YJGA 5L7YA 4RJTA 1NWHA 4IINA 5U4QA 4DIOA 4ROSA 3Q0EA 1I3KA 1JVBA 1C1XA 1KVSA 1WZEA 2ZYGA 4HKTA 3GEMA 2YY7A 3JD3A 3C7CB 2Z1NA 1EVJA 2VZ9A 1IYZA 1C0PA 3JYPA 1SZJG 1C1DB 5DBIA 2VRCA 3H9UA 4BGIA 3GDGA 2BKAA 3L6EA 3WICA 2XPCA 3G79A 4MVJI 5F21A 3FNEA 2WMDA 3GNTA 1K89A 1U7TA 3PQFA 3BTOA 4G5HA 4F6LA 4FFPA 3OM9A 1XWFA 2BFPA 3E6AA 1YWGO 1H2BA 4PIVA 4M89A 5DF1A 1KEPA 1TT5B 4QFCA 1B0AA 3NGXA 3U4HA 3H5RA 1QLHA 2SCUA 3KHUA 4OOFA 5H83A 5T8KC 3IUSA 3BIOA 2BI8A 4JP2A 4EJ0A 2B0JA 4CL8A 4PGFA 1W8DA 5KVVA 2PKRA 3I9NA 4OSOA 4CM4B 3S2EA 4B4VA 2X6TA 1JQBA 2B5WA 2AEJA 3LC1O 3OJ0A 3RUCA 5AXBA 2GYYA 1HKUA 3E9NA 4N18A 1HSOA 1GCOA 2ZATA 5L40A 4GH5A 1JVSA 4R68A 2QX7A 4UUOA 1MC4A 1U7HA 1YRLA 3SJUA 1GL3A 3ETEA 4FGWA 3NTRA 4FFMA 4CMKA 5JAMA 1KVTA 4GX1A 1B8PA 3DQPA 1YOVA 1I5RA 5GY7A 3KYDA 2OBYA 2PK3A 2C2YA 3WYBA 3L4BA 2NV6A 3GNSA 3PZRA 4BUCA 1SCUA 2Q3EA 3VH4A 4L73A 2WYVA 4I5FA 4KDEA 1QYVA 1X7DA 1WVGA 3KBOA 3IUPA 5COBA 5B4VA 1UXHA 1T4DA 3PYLA 3Q6IA 1PL6A 1A7KA 3PVZA 4WLNA 5J23A 1ENYA 3V2GA 1MUUA 2H5LA 4EUEA 5BSGA 3HN7A 4J43A 4CMIA 1QYXA 1E3IA 4U0KA 4RZIA 2ZJ1A 2NM0A 1XGKA 3ORFA 4LGVA 1P44A 2CDAA 4N5MA 5DULA 5ENDA 1HXHA 4CMBA 2OO5A 4J7UA 1RKXA 2O2YA 2VYVD 4ZQHA 3VKVA 1Y8RB 4CLXA 3FWZA 3DZJA 2O7SA 2O3SA 3FNFA 4KOAA 4BNUA 1T25A 1GAEO 1I2CA 1ZJZA 4R01A 1TI7A 4BO8A 4D43A 4L9RA 3QE3A 1CJCA 1LUAA 2DBQA 2BF7A 1EDOA 3JQGB 1ISHA 4GVXA 4CM3A 4E2XA 5EINA 3PI7A 3QWHA 8LDHA 1GYRA 4MOWA 3C24A 5IF3A 2ZKLA 3OIGA 3U4IA 2CDCA 4G65A 4QXMA 3JQEA 1P74A 1K3TA 1GZ4A 4TZTA 4RO0A 2CVOA 3EUWA 9LDBA 4F6CA 1DO8A 1HDGO 1LRLA 4DGSA 1R0SA 2X9VA 1SO8A 1X13A 1ISJA 3PLNA 4WKGA 3RASA 1D7OA 1E7QA 2ZIZA 4EGFA 4TSKA 2DPHA 1ZIDA 2VQ3A 3AU8A 3NV9A 1VPDA 2DC1A 5FI3A 3RFTA 4IY1A 3I9LA 4ND2A 3RAJA 3WGZA 1GU7A 1L1FA 2C7VA 5B12A 2OOSA 2X22A 2I67A 3GVXA 3NDJA 5ADHA 4XQ9A 4FJ2A 5I7FA 2AE1A 3GA0A 3H7AA 3AUUA 4MP6A 3BAZA 4TQGA 4K28A 4YAKA 3I52A 1YBMA 5COAA 1RYDA 4CPDA 4RVDA 3TZKA 1XIVA 1T4BA 4YAEA 4JROA 5LC1A 2GZ1A 3FSRA 3PHGA 3QSGA 4FC6A 3OQ6A 5I7SA 1PS9A 4KWIA 3A4VA 2J3JA 1I01A 3JD0A 3PFFA 2NU9A 4CV1A 3PHIA 4DMMA 3KZVA 2H63A 4OXNA 4MPDA 3WBFA 1H9AA 4A27A 4PLHA 3JQ7B 1DIAA 5MDHA 3HUDA 3OFSA 5KKAA 3I1JA 1O6ZA 1P0FA 3JQAB 2G5CA 1H93A 1N7HA 2OXIA 5C7LO 1NQAO 3S8MA 4IDDA 3N7UA 4KUHA 3ABIA 4FSHA 1LC3A 5A4DA 4ZQGA 1U5CA 1J0XO 2X4GA 2G1UA 4J1SA 4NMHA 3RUAA 4G81A 3PQDA 1SB9A 3CH6A 5DCYA 3DHEA 4W7IA 2BI7A 4J6FA 4OJNA 5CFZA 5G4KB 3U5TA 4XB1A 2NU6A 4LCJA 3HQ4O 2YFHA 4YR9A 4W99A 3ZWYA 3WMWA 2UV8A 4R3NA 3Q3CA 1E3WB 4P38A 1PTJA 1P1KA 3WGGA 5IAAA 4WLEA 1O0SA 2EIHA 4WLOA 1J6UA 4P4GA 1HZJA 4J2OA 1ADBA 4E5YA 4AJKA 3NUGA 3AI1A 3MWEB 3TDKA 1Z74A 1DIRA 3ROMA 1ADGA 1PGJA 2YZ7A 3W1VA 3TFOA 1ZJYA 4LVUA 2QZ9A 1FDSA 4JJIA 2P5YA 1AXEA 4OKIA 4TROA 4B7CA 1GQYA 3AUSA 3UKOA 3VTZA 2FR8A 3R0IA 2FR0A 4N54A 3RU7A 2NQTA 5L95A 2X23A 2HDHA 3KSUA 5A3VA 2I65A 5G4KA 2W2KB 2FHSA 3JTMA 4AJ4A 1VJ1A 2Q1WA 3TJRA 4OIMA 3INGA 2WJPA 4MVJM 4XDYA 4GGOA 1YBVA 4UEKA 3ZI0A 4A26A 1B8VA 5AYVA 5HWSA 1DAPA 1OI7A 3PFWO 2GNAA 3JYOA 4NK4A 2FPIA 3ZNQA 5T5QA 4DQXA 2X5JO 5EERA 3WIEA 4W9NC 3SEFA 3K30A 4DRYA 5GMOA 2IEDA 1PGQA 1JU9A 4CQMA 3C7AA 1MGOA 4FOSA 4D46A 1T26A 3KVOA 3EW7A 3AFNA 3RBXA 4L75A 3F4LA 1DOHA 4BNNA 2OUIA 4BO4A 5FF9A 3TZCA 4CUZA 1QYWA 4A2CA 1NFFA 4OAQA 3GC6A 5GZ3A 2HMUA 3ZWOA 4JJFA 1SAYA 3AY6A 1NVMB 2EEZA 1LSSA 3JYQA 2AG8A 2FPGA 1QLJA 4J1QA 3RUHA 1QYDA 4OQZA 4BKQA 1PU2A 5GZ1A 3RVDA 2NTVA 1DAOA 2RBEA 4LW8A 3PYMA 1HE4A 1OBFO 1Y9AA 1M6WA 3VZQA 3AK4A 3E48A 4II2A 3LLSA 4XR4A 2Y68A 3OH8A 1T2AA 1EEHA 4FOOA 1I3LA 4A73A 4YDRA 5KJEA 3OA2A 1O89A 3PJGA 5ILOA 4KZPA 5CHEA 1KEVA 1X15A 4KQWA 4GL4A 5FFFA 4NFHA 5AVOA 3GHYA 2FRDA 1GEEA 5HBRA 4NR0A 3W4IA 1AHHA 5CEEA 5KCZA 4OMUA 4RPGA 1Z7BA 3WGIA 1XCBA 5IFLA 4R41A 5TQVA 1OZAA 1GFSA 4O1MA 4MVJG 3C3XA 4CM4A 5JC8A 4DC0A 3PWKA 1CETA 5THQA 5CDYA 4JGBA 3H2ZA 4WASA 4R1NA 2JL1A 2YHIB 3QLJA 4ZHSA 1ZNQO 1BSVA 4W9NA 1NQTA 1OC4A 3PIDA 1QP8A 2CDBA 1O5IA 4FN4A 2I99A 1NYTA 3PJEA 2E4AA 3G1UA 4OKNA 4K26A 3JQ6A 2W4QA 1YL5A 4Q3AA 3UH1A 4YQYA 4BO2A 2HCTA 2TMGA 1HE2A 3OEWA 2J6IA 3H9QA 1UDCA 3DL2A 4UVEA 5ITWA 1E77A 1G0OA 2HRZA 2O7QA 2X8LA 2JD2A 4P8RA 1WWKA 2DM6A 3ANMA 3ZV6A 4PG8A 3MZ0A 4EEZA 1O8CA 1CDOA 4KMSA 4PLWA 3CZMA 4C4OA 5JO0A 2ZTUA 4DPLA 3DBRB 1AHIA 3PWSA 4PG7A 1DLIA 1LDEA 3DTTA 4BO3A 5ITVA 1T2EA 1IZ0A 4WJZA 1HWYA 4FFOA 2EJWA 1UDAA 5CEFA 1H6AA 4HFMA 5IXSA 2HKIA 4KTVE 3CE6A 1HETA 4IZHA 1L7DA 3TRIA 3QP9A 1UP6A 4E32A 3WLEA 4WNIA 4EEXA 1XSEA 4IPTA 3AFMA 5JCJD 2BMAA 4CM1A 2P4QA 1YS4A 1UXKA 3V1TC 4D41A 5JPIA 2X0IA 2NACA 1EFLA 3OHSX 2H9IA 4CV2A 3P2YA 4HX5A 3NT5A 4NBUA 4NU5A 1XHLA 3FNHA 3PGJA 5HTOA 3F46A 2BGKA 3JYLA 1NR7A 3I5MA 2X7HA 4BNLA 2GN8A 1R66A 4R9RA 3FWNA 2Y0CA 3BHIA 3VTFA 5B37A 1FXSA 1VRWA 1EQ2A 4XQGA 5IN5A 2JFFA 3S2IA 3LZ6A 4PN3A 1EBUA 1U2DA 1E6UA 2ZB7A 3E82A 4EUHA 2QZZA 3LT4A 1D4FA 2ZYDA 4AL4A 1IZ9A 1E7SA 1XG5A 3DFZA 5A02A 1WZIA 4WGGA 3O4RA 2JAHA 4WOKA 3FTNA 1ENOA 2PZKA 2DTDA 3DAFA 1Q0LA 4ITUA 2WD8A 1GPJA 5JE8A 3T7EA 2DFVA 3WJ7A 1HDXA 5T57A 4AJEA 4BO1A 3VZSA 2Q45A 1A9YA 3B20A 1GR0A 4XGIA 2CZCA 4Q3DA 3UUWA 1B8UA 4JK3A 3X2EA 3VPHA 1LSOA 3WBBA 1CQJA 5TC4A 2HMVA 2GERA 1Y81A 2P9EA 2EP7A 3QQPA 5TIIA 4J90A 4BO5A 3A06A 2HK9A 3GRPA 4N7RA 4R51A 2YJZA 5JY1A 2X0RA 3IKTA 3HB4X 4PRLA 1LQTA 4QUKA 4GX2A 4E2YA 3DOJA 4BNGA 3DB2A 5I7VA 3U09A 1GYPA 1C0IA 4HFJA 1X7HA 1ZK2A 2PV7A 3GEDA 1PJQA 4IMPA 2OMEA 4PLCA 4U0JA 1C0KA 3GVCA 3DAGA 2CF6A 4CLEA 1J5PA 1Q2XA 4R1TA 4LSMA 1Q0HA 4RDIA 1R37A 2VWPA 3A28A 3EZYA 3KV3O 3DBVO 4BS9A 4BNHA 5L7WA 1ADFA 1NFRA 5F5NA 5ICMA 3ASVA 3INTA 3C1AA 5LCXA 1SC6A 3GG9A 3F47A 4IGEA 5CP8A 1V35A 2JFHA 4MVJE 1Z75A 1BXKA 2LDBA 3K73O 2CF5A 5AQ1A 3KB6A 4FFRA 4CLHA 3WNVA 3DBRA 4RQTA 4PG6A 2FOIA 3EMKA 5I9LA 1B2LA 4YAIA 2Q4EA 1U8FO 3PHJA 2GASA 3OIDA 2O4UX 3C7DB 3CXRA 3GGGA 4FQ8A 3H9EO 5BSFA 5CDTA 5CPFA 1NQ5A 2V6MA 1MXHA 3TQHA 5L4NA 2C2XA 1FJHA 2Q2WA 4GX0A 2ZCUA 4XR9A 1ZW1A 3FR8A 3EY4A 2VCYA 4IMRA 1E7YA 2BRUA 2PNFA 3L9XA 2O3TA 4O6VA 4FW8A 2X58A 4WLFA 3F6YA 3HJAA 4JNKA 3GR6A 3PTZA 2BGLA 1O9BA 4AJ2A 1ZK0A 4ALJA 3JQ9A 1T2DA 2VZ8A 3NDRA 2BD0A 4J91A 1ONNA 4J9VA 3K31A 2X86A 3UOGA 3UN1A 3ZWWA 1K5HA 1M75A 3WGQA 4HNHA 1WP4A 1Y5RA 1VSUA 3F1LA 3DHNA 1JN0A 1GADO 3GPDG 1BTOA 1PJCA 5EESA 3BTSA 5L3ZA 1FK8A 3I9KA 3F4BA 3GAZA 2PZLA 4H3VA 4YB8A 1HSZA 4EYEA 4YQZA 2BHLA 6LDHA 3AY3A 1CF2O 1WNTA 2B36A 3WGHA 1IPFA 2J3IA 4J4HA 3OSUA 3U0BA 3E9MA 5JMPA 3O8QA 5C3MA 4R1UA 3ST7A 1VJTA 1EUDA 2OL4A 3E8XA 3MJSA 5LDGA 4C7JA 7MDHA 3T4EA 1PS0A 1I24A 1JA9A 1YJ8A 2I3AA 1M67A 1R0LA 3W6UA 5DN9A 5EN4A 1TVEA 4Z3KA 3EVNA 2Z5LA 2O2SA 3NKLA 4Q3NA 4CM8B 3VH1A 1X0XA 3BMQB 1N1GA 2HMTA 3GH3A 3GLQA 1WDKA 3ZWAA 4CLOA 2B4RO 2FMUA 3PLRA 1E6WA 3S2FA 5A9SB 1GCUA 2WDZA 3D3EA 3KYBA 5ES3A 2D0IA 3DZBA 4CR6A 4AJHA 1ZO8A 5JY6A 2PLAA 1XQ6A 1LDYA 1NVGA 3JQ7A 3SX2A 2R00C 3ZU2A 5A1TA 5KVCA 2VN8A 4M54A 1U3UA 3KM0A 4Y6PA 3ZWBA 1VM6A 1MA0A 3U3XA 2HJSA 1VL0A 2O3QA 1W0CA 1TXGA 4G2NA 3B70A 3ZHZA 1QR6A 1F8FA 1UZMA 3I4FA 2I3GA 3U4CA 2Q50A
chains in the Genus database with same CATH superfamily
4TZKA 4Z1MA 3ZHSA 1L7VC 1YHNA 4ZGGA 2A9PA 4IS2A 5C1OA 1EYZA 5DSXA 1Z29A 4LG1A 3QOWA 5DLQC 3PFNA 3F8WA 5BYBA 4XOUA 1QG4A 1GAJA 1EE9A 3ZGYA 2WW8A 4GZ5A 3M8KA 2QMUA 4I55B 2JFNA 2LUOA 3OM0A 2EW2A 4KX5A 4TWAA 1GU0A 1KE1A 2XZLA 1R64A 3OEHD 2YHUA 4GPD1 4M98A 4MR7A 3HJGA 4G0OA 1C7IA 3TB4A 3UMRA 5C7YA 1LJ8A 2Q4BA 3W5DA 1KORA 2EJBA 3I8SA 4YACA 1A4IA 2FFQA 4GZ3A 3ZG6A 2FAXA 4AO6A 2EKBA 4IDGA 2IODA 5LP6A 4I5GA 4DMUB 3WTCA 5HCNA 4NMXB 2W2VA 4YQFA 4Q34A 1BROA 1FFCA 3KFLA 4X5OA 3B9BA 2OM6A 4MS1A 1DC6A 3QWBA 4LPKA 4RVFA 4TWZA 5CU7A 3RYHB 4INPA 2ES4A 3AFGA 4XZ3A 1TW3A 3DBHA 1WXWA 2WICA 2XTJA 4JT8A 3KVNA 5TPZA 4CKBB 2P4HX 3N2GA 1PK9A 4RXUA 4IIVA 5FR2A 5IJWA 1Y63A 1P6UA 1KJNA 3KB2A 2XYHA 1SN7A 3E1KA 3PDIB 3PPXA 3QXJA 3IILA 4Q01A 4LFCB 4CKXA 5K8JB 4QTTB 3P2MA 4FYXA 4QU9A 5CJ2A 3REFA 4A8JC 3LVBA 1GSAA 4O2RA 3UAGA 3MJ4A 3KKZA 2UYGA 4R71A 1UQTA 4YDQA 2QD2A 4XXHA 2PWYA 2H4FA 3W34A 1WG8A 1FZTA 2J9FB 3KZMA 4DUGD 2ZWMA 3BXGA 1P9OA 2O2GA 2OCPA 3MNFA 3I30X 1Q22A 3KVVA 4BMZA 4J07A 5K0EA 5A0FA 1JEOA 1TYDE 2C0PA 3W77A 5CA1A 3GVPA 2GHIA 1UQUA 4KCGA 5ILQA 1V4VA 4O29A 5B7PA 4W1SA 2GSWA 1QHGA 2LPMA 4HBZA 1QBKC 1DHTA 1Y3CE 3O0DA 1VA5A 1XAGA 2XMPA 1P19A 1K8YB 4ZQEA 1W7AA 3DVLA 4FXPA 1PLJA 3H11B 3CBGA 3I4CA 4GKAA 4RD4A 2H2WA 1KAHA 3P9XA 4R81A 4U2FA 3SU8A 1SCBA 2G1KA 2EJCA 5DYYA 1RJWA 3A11A 1TKBA 4D02A 5J3JA 1IH8A 1SBHA 4MV9A 4WNCA 3I5UA 2V45A 3TTVA 1WPRA 4FMCF 4M7WA 4WFIA 4Q82A 2R6JA 2VNJA 5TS3A 3NBZC 3LI2A 2WJWA 1JU4A 2FB9A 4B3TB 3AY7A 3IUYA 2PNJA 1VHQA 3PYXA 1ZGHA 1GEGA 3O3MB 3IR7A 4NZMA 4G8JA 3V55A 3AUXA 3H5OA 1K7SN 5E9WA 2VCHA 5A4MS 3VR0A 1S3FA 4K86A 2J3LA 3TXAA 4H15A 4ZVLA 4GI3A 3UPDA 3K6RA 4S1WA 2ZTMA 5IKMA 1B1CA 4CDNA 2FWBA 2MSEB 4EW3A 1I32A 1KDTA 2CBZA 3BHNA 5A4KA 5A6VA 2QJFA 2G72A 4W8HA 1VKRA 1OMOA 2IYWA 3LUHA 5K6AC 4BXOB 3HJBA 1VP9A 4GXRA 5BMVB 1QIDA 3PE4A 4I8IA 2ZYSA 3AU9A 4D80A 1TJ5A 2E87A 1JLSA 1BD4A 1FNCA 1G5TA 2QPTA 3DZDA 1VB3A 4DQVA 4DQUA 4U6QA 3VC3A 4I2VA 5JHHB 2HD4A 1JT2A 1U1FA 2XOXA 1PL7A 4XE5A 5ALFA 5KVSA 5LQDA 1ZCJA 2H2DA 3BHJA 3OIYA 4FZRA 1COWD 1I5EA 1NAHA 1NQVA 4HHEA 3TMYA 1N5DA 4LJ5A 1T24A 1QYCA 1Y1RA 2R96A 4I1UA 4AYWA 2W2OA 4C2TA 3BWEA 5B2FA 2ZBFA 3C3KA 1F4PA 4ICIA 4G97A 1N5MA 3TIXB 3GUZA 1JW9B 2XR1A 3B8HA 3SF8A 1VXOA 2AQIA 3CNLA 3GPBA 3RK1A 4L51A 5BN3B 2QPLA 4PZZA 5D5PA 2BFWA 5E6UA 2G17A 2PKQO 3MEQA 3PCTA 4LHVA 1FP7A 5G0TA 5BR4A 1ISPA 1SWVA 4BHTA 3H6GA 3DZHA 2QX8A 4AAYA 5KTNA 4U3JB 3I9MA 4GWGA 1C4WA 1WB5A 3LXMA 3UYLA 1OH5A 3H86A 1IMOA 1KI2A 4EG5A 2OORA 3S7ZA 1N6LA 2AZ4A 2PWBA 2C84A 4OH1A 3WXBA 5KX5A 1K08A 4P86A 3KJGA 2V8OA 1VRVA 2QRHA 1FQJA 1QNFA 4M2LA 3GUCA 2PJUA 3AYZB 4DXDA 4GWLA 5GVRA 1EWVA 4IQGA 1TQ8A 2N47A 1FFGA 1TO2E 1ZH2A 4KK3A 3IBTA 1I3NA 4PLYA 5DEIA 5BUCA 2WWGA 3NHBA 4IV5A 4NFLA 3H1TA 3JQRA 4ZT6A 2J32A 4TS1A 5AM4A 5JCOC 2R8ZA 3ZE1B 5HPYB 1GPAA 3ENQA 2O2JA 4FFWA 4UTOA 3KSZO 1A9QA 3HCAA 3QPBA 4XTRA 5JC1A 3TO5A 1N9GA 1TA4A 1V9LA 2FUKA 2V7XA 2XX3A 4GOLD 1QBGA 5GJCA 3KZCA 1DO0A 4AY3A 2C4MA 1UJBA 1MPTA 4R8RA 3HFGA 2YHSA 3V7UA 4MPJA 3S28A 2BEKA 4KWEA 1VTKA 4LZNA 3U31A 5F76A 2BV3A 3ZHXA 4MYCA 4EP1A 1J24A 1NXPA 2OCGA 4IG4A 4KN8A 4P22A 2B4QA 1NW3A 2ZJ4A 2GAOA 4FR5A 4MQEB 3OOWA 4K9SA 4Y0VA 3D5EA 4QXOA 2ZJ0A 3O38A 3PENA 5ICCA 1C8VB 4HDKA 3RSQA 1WL8A 2ZSUA 3ESDA 1SMKA 1RM0A 1V3TA 2UVQA 1H2RS 1ZHOA 1M8PA 2QRQA 1GGNA 1ISGA 1VMEA 1RABA 1YUMA 1ECPA 1ZNWA 1V26A 2ZSAA 3CFYA 3QRWA 4HQOA 3ROEA 3PB3A 3ZIAD 4BJ1A 4ZZ3A 3QLVC 3FD8A 2JVKA 4NBTA 4YO8A 1XRSB 4H7EA 4RPCA 2JS7A 3KAQA 4M86A 2NYAA 2X8BA 2ZBEA 1SXGA 1YQGA 4WBXC 5C80A 5IKXA 3F5DA 2AOTB 2HQOA 4HEA1 3FFAA 3M4XA 4Y2XA 5CD1A 3CSSA 4BY9E 2JH8A 1KY4A 3D6UA 4J7AA 4Z0HO 3RGWS 3RVSA 1TU0A 1W5TA 3EARA 1SH7A 5CFPA 2F7SA 5ADVA 2B1RA 1SCDA 1PLKA 4RAOA 4RMNA 3GZNB 1N5RA 5CXSA 3NAZA 5HZKA 1HMPA 1CJBA 3HLKA 5DBGA 3SJAA 1YNSA 1E9EA 1NJFA 1HDZA 3N2KA 4MULA 1QOPB 3G2QA 1AUVA 3CG4A 3O7WA 4REQA 3KT8A 4ZO8A 5ALOA 4FYYA 4AS3A 4DCJA 3HA5A 2WM9B 2BDTA 2X8WA 4AMUA 5KJ6A 5DLEA 2VOJA 1FU8A 1U8UA 3D2LA 2AKYA 2Q4OA 2CXPA 4HWGA 3K09A 3A1FA 1NV8A 2Y1OA 3RYHA 4EYSA 2BKEA 1Q0QA 1L5HB 3I58A 2PANA 5DASA 4KC0A 2Z5VA 4IFBA 4UEOA 1E2QA 3GT3A 4Y30A 3OM1A 2Y2UA 4X7MA 4ZO7A 4UUMA 5LMZA 1MJFA 1BYUA 1FVFA 3GAFA 2AG1A 1W87A 2QVXX 2NO9A 2ZOSA 5JBIA 1P1CA 2PX5A 1CBUA 2IU0A 1P7CA 2HN9A 3D3KA 4W6QA 1NR1A 4KQXA 4DDVA 1IIBA 3N86A 4W5WA 1GQSA 2ZYIA 1SXJA 3T12A 2WOOA 2IKSA 3D8SA 3MXTA 1JQEA 4YI5A 3G59A 3VDRA 3ZQUA 5KVAA 1JFVA 5D6OA 5FI5A 3OAAD 1OBHA 2WIFA 2Q2OA 3FPAA 2ZLBA 4YDHB 4EA6A 4YJGB 1YVEI 4NG5A 5LNK6 3NHKA 3UBTA 4DV0B 3CLRC 2VHZA 3AV3A 1ZIOA 2R9VA 3N28A 5IAKA 1O96B 5JS2A 3UWKA 4UHHA 4RL4A 4LPSA 4BE9A 2ZIXA 5EXXA 4OREX 1QP7A 2GUWA 3PNBA 4LRSB 1B00A 1YV9A 4BLSA 2BZSA 4RDHA 3K4QA 3AQ4A 2NZVG 4B76A 3D3QA 3T06B 3JV7A 1JL3A 4QPDA 4MR9B 2VWQA 1CR6A 2HIGA 2BMFA 1EFPB 5EPUA 4LN1A 4EQZA 2XTZA 3T7IA 4KO3S 4GYKA 1L7PA 2D6FA 1A8HA 4YX9A 4LQLA 2GEDA 2BLNA 4XEUA 4F3KA 4Z4CA 2A78A 2P75A 3OZXA 4NABA 5IARA 3WKCA 5BSEA 4B87A 4I50A 4I1OA 3EA0A 4QJ4A 4QU5A 3Q8MA 2W6MA 2DMRA 2Y1KA 5EP2A 3L93A 1H2XA 2R8PA 2GCPA 4TLDA 2JBHA 4W7HA 1C8LA 4ZEXA 5HZGA 3IS3A 1T0JB 3Q3JB 3HDYA 4DJ5X 5I8WA 3CUKA 1DV1A 1HY3A 2BFDB 1E18A 2ZRHA 3AVXA 1PEKE 1ZMTA 4Z54A 3KXDA 2B7LA 1Z0SA 2N1MA 3AJAA 3TLGA 4B2LA 3VSCA 5HS6A 2AJ8A 3UMFA 4KQMA 3GMDA 2Q29A 2VJAA 1KTIA 3GMTA 8ATCA 1P77A 1GARA 1TVKA 3C6MA 2O23A 4G5YA 1ZFNA 4YRTA 1F20A 1ZBQA 4IGFA 1GFZA 1UAYA 3PZBA 2DYKA 4OGKA 5ECDA 2X0EA 4B3CA 1TOAA 4YLYA 4ZYXA 2P0YA 3CRNA 3GFPA 3GEIA 4EO7A 2F9MA 4GW3A 3EVCA 2H48A 2PX8A 5LXTF 3TZLA 2GPJA 3ZHYA 5KJCA 1EX1A 2QAGC 5G0WA 4G9EA 1TECE 2DQZA 4GMDA 3PHCA 1KHTA 3SYRA 1ADCA 2X0DA 3LD9A 2O8BA 1ZH6A 3KSMA 2YYYA 3HCRA 4X3PA 1MRNA 3VNRA 1MQ9A 3OZAA 5J59A 3VU8A 2HBQA 4BB5A 3MB8A 1PWEA 1V8PA 1JBKA 1X42A 1KH1A 2D2FA 2GA8A 3IA7A 5H5JA 4UAUA 1KS9A 1WUHS 4YJFA 2XA2A 3DE0X 4YRDA 1BHSA 4Y2RA 5BNWA 3E4CA 3OO0A 3PGVA 1LBEA 2NAFA 1D3AA 2Q9BA 2UUOA 4MJLA 4Q9KA 5AVJA 1V25A 3K16A 4G09A 4FKMA 2O4CA 3P4UA 1PR2A 4ZHQB 3WKDA 4N3BA 1I8TA 2B7CA 4XJXA 4DEVA 2B2NA 2H7VA 4ZTBA 5E8JA 3RUIA 3MPOA 2IIQA 4BKRA 4DN6A 1APBA 1N3LA 3N87A 3CO5A 3NBMA 3R5XA 4G4SP 5LOVF 1A27A 3PC8C 1BU8A 1NPDA 3ND9A 4PLFA 4C07A 2C8LA 1G66A 3PL5A 4M9ZA 1PV2A 2EDCA 4E0BA 2JJ2A 5AVUA 1ONOA 2CD9A 3FYCA 4OV6B 3SD7A 3CT4A 3GLVA 1KYYA 1CUZA 3IOCA 3T1TA 2OCLA 2JFQA 1CT9A 2YXNA 3D6HA 4HLUC 5IDXA 4QE3A 2BH9A 3A1WA 3ZGVA 4OHRA 4RE6A 3ZJ4A 4RA6B 3Q8KA 1E5LA 5AJUA 1I6MA 5CA0F 1U7XA 4Z2YA 4MEAA 3JVIA 3P71T 1FSPA 2I34A 3EEFA 4ZO6A 5BVGA 2NT3A 1RPZA 1F2TA 1A76A 1D0SA 4LZPA 2I9PA 1CF9A 1UKYA 2TRSB 1WU8A 2WR8A 3ITDA 1T3LA 2CXTA 4X85A 1MB2A 1XD2A 1BW9B 2G0NA 4FQ7A 4MAMA 1J1IA 5G4LA 4B7ZA 4EFNA 5J4VA 4FK8A 5A5EA 1QKIA 2FDXA 1Q7GA 1RZ3A 4MX8A 3M6IA 5TQ0A 5HHTA 1KOFA 1MENA 4HFRA 1L3BA 5JDIC 4ZT3A 3L1KA 2II6A 3PD1A 4R3WA 3TLCA 4J9UE 2J5KA 3P19A 4KN6A 4YP5A 5JEDA 3DNMA 4F4FA 1H2FA 2XRYA 3H0EA 3FPKA 4KGVA 5FLEX 2JHFA 1NOIA 5D51S 1JAZA 4Y1FA 2QUZA 2JLBA 4NE2A 1X92A 3H5AA 3UUFA 4KXLA 2ZI3A 1QFJA 1M72A 2UYYA 3CF4G 3CEHA 1I5OA 1U1CA 4WACA 1XLUA 2XNHA 5LJIA 2ZYUX 3V48A 1ZUNA 1GTMA 1X1RA 1M10A 3A1DA 4Z9YA 3H05A 3DO5A 3BMOA 2GH1A 4DCSA 2QIOA 5EQDA 1WIWA 4G0PA 2QRVB 4CZ2A 4QLBA 4K40A 3DF7A 1Z8FA 4DV4B 3F5FA 2HRDA 1GRQA 2I8LA 1SHLA 2J1LA 1YQQA 4JB0A 4R2LA 3T5GA 4DGQA 2R6R1 1X77A 1QS0B 4IDCA 5L3SB 3KSDO 1J1ZA 1RI3A 3FPFA 1UIMA 1UINA 5DHTA 1V5GA 4AZTA 2ZCVA 3HKEA 1I4EB 4YRBA 2DXIA 3HP4A 3J81k 2VPWA 1V6AA 4I1IA 3L0YA 2YWFA 3ED5A 4B7XA 3AOEA 4HQLA 4BMSA 4C20A 5C18A 4BO9A 4AO8A 1UBHS 2XB4A 2DKOA 1MO3A 3AIOA 1XR3A 2VAVA 1H5QA 3L0ZA 4MVXA 1FU4A 5FIUA 2NLOA 4RHFA 4Z4HA 4Q1DA 4UE6A 2O50A 3KDPA 3X0DA 5CX1B 3O7MA 1TK2A 1I0LA 1UWVA 1NUAA 2CSUA 4IX9A 4EKDA 1C14A 1QNLA 3V4ZA 3K1AA 5GM1A 2D2EA 3QVGA 2Q1XA 5AVVA 1OGIA 3NGLA 4O0LA 4LGYA 3AV0B 3IAFA 2V6BA 3IEUA 4PZDA 1SIOA 3ZV7A 5IAEA 2CNWA 2OV1A 5F12A 7ADHA 2PJRA 5DHQA 3KTAB 5AKLA 4UU1A 3KEQA 3N0XA 4Q7QA 3IPRA 1S3IA 2FFHA 4CM7A 2E85A 3AP3A 4MLPA 2CYCA 2CFIA 4G01B 4G4SO 4JBHA 4TMWA 1F0NA 2BPOA 2BFFB 1T2CA 2OHGA 3QV1A 1Q7TA 4D4GA 4FCWA 4YIHA 2BH2A 5C8ZA 3WYCA 2DUUA 3AWIA 2YNMA 3ESQA 5C0OE 4MV7A 4E2FA 1SM4A 1AK1A 5KWJA 2QUHA 5AUNB 3BGOS 3KPWA 4QDJA 1JLLB 2QN1A 3RCBA 1DKQA 4E14A 2H5IA 1YAHA 1CUDA 3HNPA 3RDPA 1GNPA 3JAMA 4GT1A 2IL1A 3COPA 3F7TA 1VMDA 2OAEA 1GD1O 1TAHA 4J49A 4EVRA 3AHIA 4FKZA 4YMVA 1XNHA 3VKFA 5KHOC 1F7VA 1D2EA 3COYA 5JEEA 5JS8A 3HKDA 2AFHA 2AD1A 1BVYF 2PD6A 3N07A 1EWYA 4CMAA 2VIIA 2YQ5A 3CYFA 3ONFA 4MW7A 1WZUA 1T2NA 5FO0A 2WB4A 3UO8B 2RD2A 3BL6A 2FGJA 3PJFA 2NPOA 1IPHA 3F5QA 3SZLA 3D5TA 3T7JA 1FDVA 9ATCA 2I4TA 2V0CA 2IUFA 2F3RA 2NGRA 5TJHA 1LPSA 1UP7A 3V34A 3SCZA 1N3IA 2BF4A 5D1NA 3W2IA 3HRHA 4CLDA 1F6DA 2PS0A 4IOKA 3RS0A 3ED1A 2I6TA 2NVWA 3SZMA 4PQRA 1ZVJA 2W6IA 3U81A 4YC7A 1LF0A 3ZZ1A 5DDIP 4E5NA 2WPNA 2JANA 4E5PA 4M37A 3SXPA 5JSUA 2FQXA 1GFWA 2FUG1 3P97A 1QWOA 3L04A 4PEVA 1ICIA 1YR8A 4OHUA 3PC8A 2ZYAA 3AP1A 2AJTA 2X40A 2EV9A 3CONA 5G0UA 3WGTA 2GPAA 4DV6B 1FP6A 4RF4A 2UYQA 1V11B 2IEYA 3SHQA 5KYUA 4RSRA 5KWSA 4YI3A 1M2WA 4ENUA 5JJIA 1G0NA 1LQUA 4ZIRB 1DG3A 2ADMA 4JQCA 5IJ0B 3VKWA 2CLKB 2PQ0A 4DRZA 3HP7A 3HJCA 3LCJA 4RM3A 4KG7A 2QROA 1X7ZA 2DJIA 2B98A 1QRUA 5SYNA 2QRVA 4IXNA 4WZZA 4PANA 4LY9A 1XFAA 3EXG1 2F1HA 4IF6A 4FFNA 5DXJA 4D92A 1M1NA 1P45A 2Y67A 3BWMA 3MRTA 3VVLA 3C6QA 5NLLA 3BSWA 1XO1A 2IOYA 1I7LA 1QIJA 2RARA 1MC1A 4FWIB 2JJYA 5HGJA 2BC9A 4YUYA 3VDMA 2WT8A 3ANTA 3HB9A 1UOEA 5AICA 2J31A 1ISMA 2DTEA 4KTTE 3GJ6A 4NJEB 4PNPA 5KQPA 2HAEA 3K0KA 1MAUA 3ENVA 5U9CA 1RKBA 2HJWA 5A06A 1V1RA 4JC4A 1COZA 3U2QA 5U1PA 2PA0A 4QPPA 3IDQA 1JG3A 3MIZA 1JLKA 1HYEA 5HP4A 5HKOA 4O59O 1RKUA 3CUEF 5A4IS 4AURA 1PNQA 2ATIA 2W98A 4L16A 2CCGA 3ER9A 2CKDA 3I12A 5SZHB 3RS9A 1JFRA 1SKUA 3PDWA 2IKQA 4WXHA 1M6YA 4C3OB 4EHNA 1CJVC 1V8OA 3JVUA 4LZZA 4FOTA 3ZYZA 1S3GA 4F4DA 1LQ2A 3KLMX 4EMTA 1YU9A 1EWQA 1TE2A 2G77B 1QCDA 2ZS9A 2G83A 4DMCA 5J2TB 5TSDA 1F8YA 3CRVA 3LRTA 1U0RA 2ZPUA 4LOLA 1C30A 1Z2PX 1FFAA 3SQMA 4R05A 4G0WA 3IAS6 2KWIA 2F3SA 1T3SA 2W6OA 1QG2A 1B4DA 2L17A 3AW8A 2KSQA 4QG3A 2VF7A 1XZIA 4X62B 2FJPA 3TIGA 1TW2A 3K5HA 1JTEA 4Y9DA 5F7OA 4RGQA 4GF5A 3W2EA 3RK4A 4TRJA 4BEVA 1E3EA 1DWUA 1L9XA 1PZGA 2WSSA 1Q57A 2PH1A 1AV7A 4YJDA 1E1DA 4HXYA 3GGOA 3QU7A 3IEMA 3R09A 4IXDA 3W05A 3M5DA 4F45A 2FP3A 2EATA 1NT4A 4EHIA 3O47A 5FNVF 4W4TA 1B43A 1X39A 1KKMA 2FNAA 1HOTA 1TK9A 3N76A 5TLSA 4L8LA 3TIIA 1WDTA 3DTVB 1NX9A 2BHTA 2ZT8A 3GNLA 3IEKA 3L0DA 3G1WA 1GTVA 2CXOA 3LT1A 4FCCA 3R7LA 1JHDA 5IK2A 4DRXB 2HWUA 4HYQA 1T6BY 4JT9A 4PO3X 5DWQA 4ZT2A 1N0IA 1ESEA 3I3SR 5B1HA 4MGKR 3F1KA 4PX3A 3Q6MA 2ARKA 2IPXA 4O5OA 4D3FA 2Z95A 3VU9A 1VJ0A 4RHEA 4Z4FA 1IN1A 5KTSA 4GMGA 2VYQA 2GJSA 4PRKA 3VR6A 4I66A 4OA8A 3HXPA 4M9SA 4ZDWA 5E7IA 4XD7A 5CVEA 2DTXA 3C8UA 3EW9A 4M6WB 3Q0TA 1WOYA 4F46A 4Z1OA 1BJRE 1SKQA 2XE8A 4MQLA 2R6GA 4KE9A 4KVGA 1EP1B 2QVYX 4PPYA 5I5EA 1QXSA 5KNCA 3CUVA 1U0EA 3PPYA 1VHDA 3DDZX 4G36A 5G0VA 3NHZA 5K03A 3LIPA 1DP4A 4LJ9A 2X2EA 2ZBRA 1T91A 3PF9A 5F2NA 4OQNA 5B1SA 1ESMA 2XQKA 3TVDA 3G2OA 3OOEA 4MAAA 2ZM6B 1SVMA 2XSZD 3O1IC 4X7RA 3ZBTA 4YCCA 2CXHA 3AIKA 1L2TA 4N1AA 4BPBA 1NUUA 1XMIA 3ORHA 3DZFA 2AZMA 4FLMA 3EGOA 3OX1A 4MV0A 4QARA 5ALKA 5B1DA 1XWWA 1FFYA 1MTZA 1RP7A 3RFVA 3RS3A 3WJ1A 4L5CA 5DX0A 1YZGA 2P0AA 1FUUA 2IZ5A 2OHXA 4Q3KA 1QU2A 5FKJA 1MOPA 4GPTA 4BNTA 1NKSA 2ZAIA 4PX2A 3TR6A 2NYRA 4I5DA 4XJVA 4UPEA 4DDWA 4WEQA 1N6RA 2B8EA 4MIKA 5EPOA 1HDYA 2EL9A 2QTVA 1M2NA 4O1IA 5AK6A 3VH2A 2H4YA 4EHDA 4MYUA 1BMFA 3EUAA 1AKRA 5CR9A 3WL5A 1ZH8A 5KOHA 3L8CA 2NG1A 5ERYA 1O8BA 4BO7A 4RU1A 2HO4A 2K7ZA 2ZITA 4ZJUA 3OFKA 2ZP1A 4MUXA 1FC0A 2IE0A 3U62A 4I6GA 3JAKA 3JY6A 3OT5A 1GY8A 4WNYA 1AF4A 3B1YA 4UCWA 2WM3A 3EHEA 3D31A 3KQQA 2PFGA 1J8YF 1II0A 3WO1A 3B6IA 5DCLA 1JJVA 4GPBA 2IXFA 3NC0C 5A4JA 1DTEA 2W43A 3GY0A 4DCTA 4DM3A 3R9XA 3RC3A 3L5KA 1OHHA 2Z1MA 3P2OA 4TXNA 3T3HA 5C1BA 2LDXA 1BMQA 1EWKA 2ZR8A 1XKLA 5C51B 4B33A 2AI1A 4V24A 5GQSA 3JQAA 5LJLA 1RTTA 4NH4A 2ZCJA 1U3CA 2GXUA 4ZI2A 2WVJA 3CNHA 5HMLA 4ZGWA 2OAQ1 3I2YX 5JJLA 1EM8B 4RPHA 5EJGA 3HDQA 2QX9A 4ED9A 4KBFA 3VNVA 5GONA 3MWLA 3NEPX 1GPYA 1GGJA 5KNCD 3A6HA 3E7XA 5KU7A 1PDWA 2PVCA 4R69A 1T8PA 1UDBA 4LI3X 1QQTA 2PWZA 1CP2A 1JR3A 3M81A 4HDMA 4HWPA 3RS7A 4P0PB 3O3CA 3CINA 4KDRA 4GOJA 4ZREA 4AWXA 1L5HA 1P3JA 2O1SA 4B3IA 4MVJH 1GA1A 1X1SA 2YW9A 5C1DA 2JF0A 4RDCA 1HYQA 3FLAA 4ZOLF 5DGIA 1GITA 4HZUA 2WZBA 1Y8CA 3R3SA 4M55A 3S5JA 4EI2A 1X1EA 3X1ZA 2D1TA 1XNGA 1JIJA 4V1CA 3AYXB 3ZDDA 1QU3A 4HSGA 3GMSA 1TQ2A 2RGBA 4CKCB 4K6OA 2ZYTX 3PC6A 4LQCA 4PZYA 3RWOA 4Q4AA 4F3YA 3K9FC 2DJ5A 1EP2B 1OXUA 1IUNA 1ZONA 2A5FA 2G9ZA 1J70A 4DYDA 2QVBA 1Z83A 2BTQA 3D8BA 2ONYA 2WWXA 3E9ZA 4IH4A 4XW2A 1XL1A 2VHQA 4IJUA 5DGDA 2QLLA 3QHPA 4IM7A 1L7BA 1DZIA 2RJOA 3W4KA 3DE6X 5CFOA 1TM2A 1LDMA 1H4TA 2V54A 3GFBA 4NEGA 2WE7A 2PD3A 3QXSA 2EVWX 4M49A 1NVDA 3E4DA 1BD3A 1EFTA 2A9VA 2HXSA 2QS9A 2Q0HA 3HN2A 3PUWA 3PCXA 4YPOA 5AIBA 1QG0A 3MJCA 4P34A 3TW4A 4ALLA 1LS1A 1L4LA 2R65A 3HRIA 5L45A 1L5FA 1RCUA 2DUWA 3SSNA 4EZEA 5CB4F 3IOMA 4YWJA 3C97A 5FDFA 2ZAYA 1KWKA 1H5UA 1P2UA 2H07A 3PFHA 3V8PA 4PAWA 2VYFA 1HNXB 5BURA 1SRQA 3C5VA 2QPOA 3EGCA 5FX2A 2P68A 2O5RA 3C5WP 3KZOA 3WNCA 1D8AA 4CMGA 4DIBA 4ARAA 1CR1A 5AM5A 2WTAA 4JHXA 3KR2A 1U63A 3B7WA 1U3FA 2QORA 1YRAA 2XF8A 5FD8A 4DXHA 1I2BA 1GU1A 1IHYA 3BL8A 3QNUA 4YGXB 2KMLA 4ID3A 1JS1X 1XQ1A 3CX4A 3U7HB 1UBRS 1TRKA 2GGSA 1XX6A 3LBHA 3EZXA 4PPGA 5ALTA 2UVPB 3MIIA 4BEBA 4EGJA 1U0HC 3ETDA 3OY2A 3I04A 4WKOA 1QIFA 1Z5OA 3TSYA 2ZT6A 3OAAA 5FPPA 1P9RA 2F62A 1I0ZA 3HE3A 3N9IA 3LC0A 4LA4A 4PSAA 3CC8A 3QTLA 4RZSA 4FGLA 3TNLA 4Q7KA 3D5QA 1Z5NA 4JWTA 1NJSA 2O06A 1WVMA 2CFSA 5AP9A 3AEXA 4NFSA 1ZN9A 3MOIA 4UZEA 1S4QA 4Y18A 1JHUA 3IBYA 2AG5A 2HJRA 4HGQA 4C4ZA 4IIYA 4TM7A 1Q50A 1X7WB 2Q8PA 3HNRA 1AGYA 3DPIA 4NBLA 5DI9A 2COKA 2RK6A 5EA2A 4ZYUA 1S1MA 5CB6A 1TC1A 3PC7A 1MFPA 3TI9A 1IATA 4ZK6A 3THWA 1RYZA 4DPKA 5NULA 3I3OA 4MQFA 1MO2A 4BP8A 4H60A 2A35A 3WB2A 1NONA 5BN3A 1L4HA 2J7PA 3B7GA 3IIMA 1PWHA 1JV2B 3PK0A 2XNDA 2PMDA 2AG0A 3TRHA 1O0BA 1N2JA 3L01A 1I36A 1QDLB 4HLUA 3WRWA 2C5BA 1LB1B 3HKBB 4YAWA 4G89A 2N3ZA 1H94A 3ZHOA 4GXQA 2F3TA 3KG2A 4Q37A 3RPEA 3N0TA 3QI2A 2C2MA 3Q7SA 4FE3A 2QG9A 4ZI3A 4II7A 1Y34E 1VKHA 3CRMA 3K96A 3D6JA 3R0XA 4BIIA 1C80A 2XUZA 2PUTA 3DGEC 5CAEA 1Z0UA 2BSAA 4UREA 2IW1A 4JI7B 3OTIA 3OCYA 3V7FA 3SSOA 3IIEA 3JQ8B 2ZZMA 1KO4A 4LYAA 3NZEA 3WRYA 1K1EA 4EX7A 4FBLA 4FDMA 1CHDA 3PHBE 2HPVA 1NRIA 2PX4A 3D3NA 5CM8B 5CEJA 2WYWA 4RK6A 1EJBA 3MMNA 2F55A 1K8QA 1T8YA 2RK3A 3JQAD 3F3YA 2NU7A 3AUTA 3PXAA 3G9TA 3WRXA 1K4MA 2CLDX 3F7MA 3IUMA 3JQBC 4C03A 4DT1A 1MO5A 1KEEA 3A4TA 3PVSA 4UTPA 3NO4A 1IJFA 4QUBA 2I8AA 2AZXA 5DIFA 2J9ZB 1W1UA 3TOVA 1BN6A 3OZFA 4CEHB 4JS0A 3QEAZ 2E37A 5E2AA 1FOEB 4GNKA 2QZ4A 1KRWA 3AOGA 1B15A 4LY6A 3ZE0B 2Q5EA 1W85B 3S2GA 5C7IO 1VKOA 3ZH2A 5H8WA 4M0DA 4URUR 2NZXA 3VOSA 1L4GA 5JJBA 2EFYA 2XQVA 1WV1A 5FV4A 5UKDA 1VPEA 2C4NA 2C9BA 4EJSB 2GLXA 2IPNA 1O3YA 4GAEA 1A9TA 2QRUA 1ZBDA 2V7PA 1RLTA 3BQMB 4RPLA 2PMCA 2WWTA 4I5EA 1C3JA 4FJ1A 4GOOD 2ORWA 2XIJA 3C1OA 3S1AB 5KYXA 2WWYA 1FXWA 3QA3E 3B9QA 4I8DA 5CGQB 1NVXQ 2GHTA 2LZ0A 3HCOA 2GN6A 3I39X 3HI4A 4AKEA 4Q3OA 2EQ5A 1TF7A 4OLBA 4JENA 3PUJA 3RKUA 2BIFA 3K8ZA 4BBZA 3E5MA 3B85A 3QWIA 3K72B 3UCEA 4EQ6A 1PGPA 2ROQA 3GFGA 2PTGA 1GN8A 1MZPA 4JT4A 1IMJA 2WHPA 4R3UC 4TLBA 1DMRA 4RVSA 3DMTA 3WG9A 3RTDA 3ORSA 1JEYA 2F4VB 1JXQA 1CKEA 1A9PA 4W5HA 5LA6A 2PQMA 1DL5A 4XM2A 2GXSA 3NBAA 1BQ3A 4NDNE 4Q19A 3ZWPA 4Z4QA 1ZQ9A 1ONPA 4DQDA 3OECA 3H1EA 3E9QA 5T6BA 2O20A 3FVRA 2NTEA 4GUAA 3N2GB 5KTYA 1F14A 2OCDA 2C9OA 2XD9A 2IPOA 2XB9A 3L7MA 5AKHA 4HNUA 3GPIA 2X5OA 4CLRB 2P9TA 3RBZA 1UKEA 2DBYA 1V3VA 5HSGA 3HEMA 1YZLA 1DU4A 2VK8A 3FBWA 4PC1A 4KREA 5E1OA 4WZBE 5CYOA 4J29A 1VKZA 1ODFA 2WHEA 3JPYA 2AHRA 5JVDB 5JJCA 1QPZA 1DFHA 1E9BA 3UATA 1WMSA 2G40A 2OLJA 3BZWA 1FEZA 4B4WA 4OX9B 2Y0PA 2PJZA 2FXVA 4YA6A 3S2UA 4YYEA 4IHJB 4KIUA 2AJCA 2Y0EA 4L7QA 4LXXA 1Z13A 3T3IA 2APJA 1G8MA 2Q46A 5KYUB 5LVAA 5FPHA 1Z22A 5ICFA 4DCOA 3WLSA 1Q17A 1V9CA 4BVGA 1QDEA 3A05A 1JQAA 1U3DA 3ETJA 3TNYA 4FBGA 2BFBA 1R4MB 3NUZA 1YZQA 1Y82A 4A5OA 5E4FA 2O2ZA 3TRFA 3ZPXA 1P81A 2Q1SA 3EAFA 2PYDA 3L0SA 2JW5A 5DNVA 4R16A 4Q00A 4WESA 3UV3A 4UMDA 1IY0A 1Z4QA 4CKEB 3MT7A 5H4HA 1OR8A 1W9HA 3QLEA 4HO1X 2FSVA 1KIMA 1N75A 3LC7O 3EA4A 2XGOA 5IM4F 3H2HA 2JGKA 3VNBA 3ZZ0A 1OYOA 3D0OA 1MQSA 4H4EA 3LH5A 1UWKA 4MW1A 3UWPA 4ALKA 3AR7A 3U7FB 1JXAA 4HUJA 1VCMA 3DXYA 2VBGA 4WX2B 3SEZA 3TZQA 1H9BA 4GI2A 1L7NA 4AMBA 4BX8A 4Z51A 5EE0A 5EP1A 3AR9A 4I2NA 1FJGB 3WDLA 1DIGA 1TZBA 2PYIA 2VXCA 1JALA 3R7SA 5AK0A 5EOVA 2AS0A 5FT9A 4LAFA 1NVVQ 3FUVA 4A6XA 3VH3A 3O03A 4NHEA 4MI3A 4Q15A 2V0NA 2O8DA 1JA0A 1NLZA 3CG0A 4OMCA 2G4VA 1L6RA 4U8GA 4XEHA 4NESA 1M2FA 3IHWA 3OQIA 5EZQA 4Q3EA 3BULA 2BFEA 3FKJA 1E89A 2Q6VA 4J3FA 4DSTA 4MRMB 4CLOB 3TZEA 2XVXA 5AQEA 2XUAA 2CJXA 2CWWA 4JJ8A 3COWA 2FEPA 4RA9A 3TAXA 3KHTA 1I2ZA 3IVRA 4ME6A 5AVKA 4M8IA 4MS4A 1VL5A 2WVHA 2ZGVA 3W2HA 4ZZ2A 3FNQA 1AVTA 2HWWA 3BDIA 2ZIEA 1CS0A 2HJ9A 3QVXA 1MH1A 4BOYA 1DOAA 3VU3A 2A7XA 2ID7A 1SBIA 1ZYUA 2OB2A 4P98A 3L40A 1OV6A 1QAMA 3ZC3A 4OTZA 3USCS 5B57C 1MNAA 2DU8A 3OPVA 3VHLB 2PGXA 4ZVSA 5REQB 3TLAA 2R7MA 1BC5A 1MEEA 2ZROA 4G0MA 3HXQA 4O4JF 4QBKA 5IJ9A 1OU0A 4OFWA 4TSFD 3H2JA 3P7MA 4CIXA 4RF2A 1OHHD 2NO5A 1P7YA 1Z08A 4GOXA 5KQLA 1UBMS 2H1HA 4Z9FA 2UKDA 3EBLA 4F3RA 3DB1A 4FYMA 4JCCA 4R0NA 2G9VA 2WG1A 4V02A 3W6ZA 3ISTA 3ZDZB 2O14A 1O57A 5F64A 4JWKA 5IVIA 4RELA 1H2HA 1C41A 2Y1DA 3AXTA 4MAFA 3VQTA 2ACEA 4WXPA 4F8EA 2P3SA 3X1XA 5KYNA 1YZUA 1V1MA 3N7AA 5J4KA 2D5AA 1TEZA 2HT6A 1R2QA 2EP5A 3MM4A 1OXSC 1YHZA 3QIVA 16PKA 4X7BA 4K9LA 2YYAA 4EPYA 1THTA 2Y27A 1T9KA 4QBHA 3DMTC 1VBKA 1QMGA 3ND8A 4IKPA 3K0FB 1ARZA 3LT5A 2JLYA 4C0KA 4DC1A 3QXHA 4I4NA 4NNJA 4K9DA 1RQPA 4HQNA 2FPIB 3HWSA 4G25A 1SKAA 2GMWA 4HDRB 2OZPA 3QWAA 2EXXA 1Z8HA 1Q91A 5DBEX 1EVZA 1R3UA 2O7RA 4YMLA 3QVSA 1ECGA 3RC1A 1N1MA 2C1EA 1VI6A 2F90A 3R20A 2P2CA 3GJTA 4IIFA 1GTG1 3HUUA 4JIGA 5LP1A 4JBXA 1QORA 1ORVA 5JTUA 2V5AA 2QN6A 1P8AA 3GEGA 5JSYA 1J23A 5LB2A 1RR6A 2HNAA 3AUKA 5FADA 2PR7A 1IL0A 4DQLA 3CX7A 2PGAA 4V0OA 3VHXA 5C35A 1NXQA 1P2FA 3FPEA 3BMNB 2WTMA 3LUKA 3O82A 4RVOA 1PJ4A 1DZ3A 2HB6A 4WGFA 2JIDA 1VIYA 5JCJA 1UKZA 5JDCC 3UUGA 4CKWB 4RHYA 1PKXA 3AI3A 1UK6A 4XGNA 1J7JA 2HA0A 3VR6D 3V3KA 5B36A 3B89A 5BV2P 1KU0A 5FWNA 4OF4A 4CKWA 2AWOA 5L6MB 5FWDA 2QNBA 3KXPA 3ADCA 2KW5A 4A3SA 4F60A 3IIJA 1FSZA 3K1JA 3PNOA 1F12A 1ORWA 1O6BA 4ZANA 4RMHA 5D3MB 1CJMA 1TU4A 3BJZA 2P2NA 1E2MA 3OE4A 4PS1A 1IN8A 1GAWA 1R8QA 2VG8A 3KCNA 4PLPA 1PVOA 4P53A 1Y1LA 4NENA 3H42B 4XYLA 5KOJA 5KMGA 3HPRA 2GBGA 4ZYZA 1EUCA 2H8GA 4DJDC 1OPRA 1RC0A 2W4MA 3FPCA 4LXIA 1F0YA 1K06A 1V71A 2HO5A 2W11A 3AHEA 3FYDA 4HJXA 4OU5A 1EUDB 2CUTA 4HDRA 4RTQA 3O8QB 2B8TA 3Q7TA 4N39A 3CX8A 3TUIC 3O8LA 3X2FA 4L5JA 4EYQA 5J4HA 1H69A 4HDCA 1U7PA 1EZ4A 1QPGA 2GBPA 1FRQA 1KR2A 4PN7A 2D74A 1TUEA 1PJ2A 2WC1A 3G7NA 4H18A 2ZG6A 3PVCA 2EKLA 4MUHA 4P32A 3A2LA 2OM2A 3MLBA 2GQ0A 2IYPA 4R40A 2R44A 3B8EA 4AP5A 2H06A 5JZSA 3WAGA 3UGJA 2XXBA 3D54D 2AR0A 2H6EA 4D79A 4PG5A 2G7MC 4GMFA 3WOVA 4UNRA 4YAFA 1J9GA 1BCSA 1ZUD1 4DZZA 1Z07A 5EJ2A 4IHJF 4C7KA 2ZXUA 4UMFA 5HCIA 4DIMA 2CVFA 3V1NA 2H0QA 1NUTA 1BVRA 4WLVA 4IZOA 3GJZA 5E6RA 3C6YA 3M7IA 5FOVA 4BNVA 1SHUX 2R6FA 2A0UA 3VTKA 1NNUA 2FSSA 4WN9A 2YXDA 1ZM4A 2NXNA 4IKEA 1NVEA 2QMEA 3B53X 2CV0A 3B6KA 2G76A 3FCEA 4FUTA 4D3YA 2OGUA 4GQAA 2WK1A 3DZGA 1UPXA