3GDGA

Crystal structure of the nadp-dependent mannitol dehydrogenase from cladosporium herbarum.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
267
Chain Sequence
MPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum: Implications for oligomerisation and catalysis.
pubmed doi rcsb
source organism Cladosporium herbarum
molecule tags Oxidoreductase
molecule keywords Probable NADP-dependent mannitol dehydrogenase
total genus 88
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.138: Mannitol 2-dehydrogenase (NADP(+)).
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3gdgA00
1H0KA 1BMDA 4WOKA 3U4DA 5JO9A 3HJAA 3ZWMA 5AVOA 2PY6A 4E5PA 4J7CA 3C7DB 3LU1A 2NUAA 1YL7A 2X9GA 4MDHA 3AFNA 4PZCA 3VPGA 3JV7A 4MVJA 4EUHA 1P74A 3CMMA 2ZQZA 1I36A 5DULA 5EN4A 4YRBA 1RM0A 4CMEA 3AI2A 4OSPA 2VWGA 1T4DA 4JJGA 1JAYA 4U5QA 4BNLA 3M6IA 1JVBA 1JQBA 1YDEA 1UAYA 2Y1EA 4K28A 4PLVA 4KUEA 1XELA 2GZ3A 1GPJA 4JCOA 5BNTA 4YA6A 4XD2A 2FPPA 3VOSA 4BB6A 3JQ7A 1KS9A 5JW6A 3KTDA 3PYLA 4PG7A 3X2EA 3ZV4A 2DKNA 3TQHA 4CUJA 1NQAO 2Y67A 4BKPA 4E6PA 2HJRA 4L9RA 3PHIA 2IXAA 4RQUA 4URFA 2G82A 4CLOB 5JYEA 3K5PA 1HLDA 4FIZA 5DZSA 3EAGA 3ZNPA 3JD3A 4ZJUA 3RUIA 2X7HA 3QVTA 5A9SA 2WD7B 2G5CA 2Y1FA 4BO5A 2RHRA 3AY3A 3SLKA 5TC4A 4MVJD 2I3GA 2FR0A 4I5FA 3G0OA 3S2EA 4XIYA 5A06A 3L4SO 4N7RA 2AEJA 3F3SA 1E6WA 4E5YA 1YBMA 5H82A 2HK9A 3OHSX 4GI2A 1PGOA 5L7YA 1R15A 4W9NC 3JQAA 4E4YA 3K92A 4BKOA 4JBIA 4D0RA 4ND1A 2O3QA 1VSUA 1KYQA 4NI5A 2B5VA 3IKTA 4DYVA 3ETGA 4IIVA 2XAAA 4FSHA 4WPGA 1WXDA 2EW2A 3H65A 4C4OA 3PZRA 2ZJ0A 2X0JA 1WZIA 4KMSA 4R1NA 1A9ZA 3E48A 2IRWA 4FC6A 3JYLA 1W6UA 4HUJA 4IXWA 1LLCA 4OOFA 1GEGA 2IZ1A 4ZQBA 2X23A 1BVRA 1LQUA 1P1KA 1RYEA 4CV1A 4D43A 2IXBA 3BZUA 3GG9A 3A9WA 3JQCA 3RBVA 5EERA 2NM0A 4PLPA 3AW9A 1YOVB 4FOOA 1BW9A 4W6ZA 4XQGA 3UKOA 3ZU4A 5TX7A 1F17A 4ILKA 4RPGA 5L4LA 3OF2A 3JQAD 1M66A 4QT0A 3QQPA 4PLGA 5IDYA 1ISJA 1SOVA 3E9QA 4ITUA 3OEYA 3RIHA 4YEDA 5ER6A 2CFCA 3UH1A 1SPXA 2Q99A 3Q2IA 4RZHA 1UJMA 1HE5A 1DOHA 1EBUA 2NTVA 1D7OA 1PL6A 3VZSA 4IUYA 3MJCA 3OFSA 1DC6A 1EK6A 1NP3A 3OQ1A 1PJ3A 3DMTA 5EIOA 5DCUA 3ENKA 4UVHA 1MP0A 2VHYA 4QUKA 5ICSA 2DUUA 3ZCXA 4CJXA 1E5QA 1IPEA 1O9BA 2OMEA 3GHHA 3OQ6A 3WTCA 2JCVA 3W8DA 4GX2A 1ADFA 2DBZA 4RVHA 4UUNA 3I9OA 4BNXA 4XGIA 4EI2A 4J4TA 1KVUA 2JFGA 4MVJG 4XX0A 3IJRA 1LSUA 2AQHA 4DREA 1HDZA 2VQ3A 3MJ4A 2B37A 4AJHA 2D0IA 1K2WA 1ZK0A 3ZV6A 3ROQA 4BO6A 2Q45A 1DFHA 2O3TA 3UAGA 1PJ2A 3KSZO 4OKNA 1PL7A 2YHIB 1LXCA 4YACA 3U49A 3WB9A 3WIDA 1X13A 1SC6A 1ZO8A 4CM1A 4CLOA 3DAPA 4INAA 1WMAA 5KCZA 3Q6IA 3IS3A 4FPXA 2A92A 1DIHA 3WBBA 3HE3A 3JQ8A 1DRUA 2DTEA 5I8WA 1DAOA 1UDAA 2EWMA 3BXXA 3RUDA 4XRGA 5BSFA 4W9NA 3MJEA 1V3TA 2QW8A 3U4IA 1Q7GA 1LBEA 2NU6A 3ZWNA 4IPTA 3B20A 3OA0A 2PKQO 3VVCA 4II3A 2VYND 3QE3A 2YV3A 1B3BA 4MIYA 4KTTE 1B26A 4P4LA 5B4UA 3RSHA 3HZZA 1E7RA 5ICMA 3NDIA 4S3MA 3A1NA 4RV9A 1LI4A 5F1OA 5BSHA 5K9ZA 4XGNA 4IM7A 4G81A 2Q1SA 4N5MA 2NNLD 5FI5A 5I9NA 1N2SA 3I1JA 5TIIA 4FJ1A 4A5OA 1B16A 4WJZA 1ADCA 3D3EA 3GNSA 3WGGA 4DIBA 2FSVA 4OIMA 4HNGA 4B3JA 5I7VA 3EUWA 5GZ6A 3GVPA 1TB4A 4P38A 1H94A 1R0LA 1YRLA 4NMHA 4N54A 1EVJA 3GR6A 2D8AA 1QLHA 1Y9AA 3WYCA 5BR7A 5THQA 5CDYA 1LSJA 4A73A 3PFFA 1OFGA 2J3JA 3JYNA 1NXQA 5IXYA 4W7IA 1A72A 1KEVA 2HDHA 1IHYA 2YV1A 4IS3A 2IYOA 3LQFA 5JDIC 2V65A 1N5DA 5CG2A 3GG2A 1FF9A 4O63O 4JJIA 3GMDA 2GZ1A 4TVBA 3DOOA 4DRYA 1MUUA 3ZWVA 1BGVA 4MVJH 2WYWA 4E2ZA 1NFRA 2VHWA 1OC2A 4NFHA 3HFSA 3JQFC 1SB8A 1T1SA 1DBVO 3K8ZA 1FDTA 2O2YA 1ZK1A 3ZI0A 3GMSA 1NASA 1L7DA 3HUDA 1YH3A 2Q2VA 4B4OA 3SVTA 3QHAA 3ZWYA 3HWRA 1WDLA 2CF6A 1PSDA 3TWOA 3WSWA 2G1UA 3B1KA 3D1LA 3RROA 2GZ2A 3E8XA 4WLOA 2VHVA 4JBHA 1NVGA 4WEQA 2Q4EA 3CE6A 2GCGA 4E31A 1AXEA 4UVEA 4DBVO 2QYTA 4KUGA 2UUOA 4FFPA 4Q3DA 2RCYA 5GZ1A 3NJ4A 3FI9A 3DOJA 1XR3A 3G1TA 4CM6A 5EQFA 1WMBA 1DXYA 4ZGWA 3VPHA 1V6AA 4R69A 3UFXA 1DO8A 3KUXA 1BDBA 3NDRA 4MIEA 1R4MA 2EGGA 1H6CA 4GMFA 4K26A 3VKUA 2EKPA 4GBJA 1U2GA 3FF4A 1SEVA 2HQ1A 1A7AA 5JO0A 4ND3A 4XRRA 4CQMB 1OC4A 4D41A 4DQUA 3BMNA 3C7AA 2AA3A 1KC3A 4DVJA 4R68A 1S7CA 4YJFA 3BHJA 3KYCB 5IAAA 3LK7A 4M86A 2QG4A 3GAFA 3A4VA 1U3TA 2IZZA 2VT3A 3JQ8B 1X7HA 2AE1A 3DOCA 3WFIA 3BMCA 1JKIA 3H9JA 2VYVA 4GVXA 1XHLA 1XDWA 1NPDA 4DPLA 3WQSB 1GZ4A 4FC7A 4N5NA 4BB5A 4LVCA 3FNGA 3GEMA 3S1LA 5EL0A 1HEUA 3I9NA 3OMLA 2DBVO 1BHSA 4EJ6A 1FDUA 5DBIA 3ZH2A 4RF2A 1B14A 1Q2XA 1SB9A 2B4TO 5A02A 4TRJA 4EZBA 1PJTA 3L9XA 5IDQA 4XCVA 2BMAA 4HWKA 3ZWAA 1FMCA 1MFZA 5DNAA 4E32A 1EDZA 5MDHA 1ZMOA 1B8PA 1XIVA 3BTSA 5F5NA 1EEHA 2EKLA 3EZLA 2JFHA 4UVIA 1U4SA 1CETA 3ZWOA 1V3UA 3WGQA 2Y93A 1QMGA 3L77A 4LRTB 5AXBA 1E0DA 2EW8A 4AJ2A 1V9LA 1E3IA 5COQA 4D7AA 4OJNA 3MOGA 5DN9A 1NPYA 2IEBA 2PKQP 2ZB8A 3WDSA 4B7CA 3AY6A 3AUSA 1A27A 4AJPA 3EVNA 3ZWXA 2WYVA 3BTUA 5JNLA 5JFOA 4MKRA 4J7XA 3K6JA 4RQTA 1Z7BA 3GPDG 3DFZA 2WEKA 4BQPA 1UUFA 1VPDA 1UAGA 1NQOA 1R0KA 1QORA 2VHXA 4XYMA 3LSYA 4Q3EA 3UN1A 1LDEA 4DUPA 3LC1O 4P22A 1DRVA 5JAQA 1TI7A 3AOEA 3EMKA 3U3XA 3NGXA 4RLSA 4ALNA 3K73O 2Y1DA 1XU9A 1YB5A 4YDRA 1DFGA 1UR5A 5DF1A 3ICPA 2HMWA 4S1VA 1YJ8A 4J16A 2Q2WA 2Y1GA 2P5UA 1YQGA 3BHMA 1PR9A 4B79A 2EV9A 3JD4A 1Z6ZA 1T2AA 4WK6A 3LLSA 4DA9A 4OO3A 1FDSA 4KQWA 3IJPA 4MP3A 2JAPA 4KOAA 4RF3A 3GVXA 4M1QA 2JHFA 2F00A 2D3TA 5A5EA 1NNUA 4J43A 4OXNA 1KVTA 3QY9A 5K6AC 3ANMA 3GNQA 4KDEA 1HDXA 2A94A 5JMWA 1NR7A 1O95A 1JTVA 1OI7A 2I67A 2OBNA 3C1TA 4RF5A 4NK4A 1XQ1A 4H3VA 1QYVA 1RM5A 2TMGA 3DZBA 3E9NA 2BHLA 3O26A 5I9LA 3OJLA 1YQDA 4YJDA 3V2GA 3FN4A 4DIFA 3IC5A 3BMNB 4JK3A 1QKIA 1IL0A 5KKAA 1C1DA 3DBHB 4CM9D 4WASA 1XWFA 4MVJI 4RVDA 4Z3KA 1NHWA 1ENYA 1NPTO 2H63A 5T6BA 1U3UA 3OP4A 5U1PA 4OXKA 3WIEA 4Z9XA 4YJHB 4NR0A 2FHSA 2BFOA 1ULSA 3OM9A 4IMPA 2OXIA 2AQ8A 3LF2A 4OMUA 4UULA 4IJWA 3GF4A 1EQ2A 4YRAA 5IJZA 1I2CA 3K96A 1VKNA 3RFXA 3PWZA 2PZKA 2QIOA 1E1LA 2EP5A 1PJCA 1HXHA 2P2SA 4DMLA 4PLCA 3HSKA 4FJ2A 2O3RA 4WKGA 2O23A 2B36A 1A5ZA 1RYDA 2EKQA 2OORA 4LK3A 5ADHA 4EDFA 1RKXA 3RFTA 1KVRA 4LMPA 2VCYA 5DP2A 3ZHZA 2A9FA 3DBRA 3DHNA 1CQJA 4PLHA 3UUWA 3OICA 4R1UA 4IDBA 1IUKA 4MOWA 4N18A 4B4UA 5B1YA 4NZ9A 2HU2A 1PGNA 4BNVA 1E3WB 4UUMA 4YJGA 5CEFA 5MGBA 1GDHA 1ML3A 1N9GA 4BO2A 4YPOA 2Y0DA 2IZ0A 1DEHA 1V3VA 4Y6PA 4TWRA 3NT4A 5F5LA 3WJ7A 2ZB3A 3NKLA 4ND2A 5TLSA 4QXMA 3WS7A 1CERA 3BA1A 4YB8A 5CP8A 1QYDA 2W2LD 4CLRA 1DHTA 5F1KA 5HBRA 4BMVA 4YAKA 5A3JA 2DM6A 2OOSA 2BELA 4F45A 3PI7A 1PGPA 2AXQA 3FNHA 5TS3A 4O1MA 3KXDA 1ZBQA 2V6MA 2VHZA 1GV0A 5KJ6A 2X4GA 2FN7A 2RBEA 4HP8A 4BNNA 1UZMA 2X9VA 4R16A 1FDVA 2W4QA 2E37A 4JN6B 1H93A 5JY6A 1K6IA 1OMOA 4BO1A 1AN9A 4OH1A 3QSGA 1U1IA 1NAHA 2OL4A 4F6CA 1HETA 4RVUA 4D79A 5AQ1A 1ZEJA 2A4KA 3A14A 3HADA 2DFDA 3H8VA 1UXJA 3GN1A 4WCFB 1OBFO 1E7QA 3JQBA 2BH9A 3BMCB 1ZK4A 3H3FA 3W4IA 3E18A 3JCZA 3PRJA 2NLOA 3TN7A 5AXAA 3DZHA 3U4HA 4HV4A 5L45A 3PHGA 1E5LA 3KRTA 4QTZA 4MJLA 3Q9NA 1CYDA 3AI3A 1Q7BA 2DTDA 3O9ZA 3RWBA 4ZHSA 4R3NA 1PEDA 3LT0A 3RJ5A 5DT9A 1RM4A 1J4AA 1PS0A 5DP1A 4GKVA 4CUZA 2HMSA 3DBRB 1HWYA 3PEFA 2JKVA 4NPCA 5DCYA 4A26A 5TJ9A 2CF5A 4UUPA 3WG9A 3U0BA 5FWNA 4PLZA 1I8TA 1LU9A 2BGMA 4HKTA 1EK5A 1X0VA 3OIDA 1YS4A 4PIVA 1UXIA 1AHHA 4BOYA 5CAEA 4AICA 1I3KA 1NWHA 2V6FA 3PJGA 3LVFO 4Y9DA 4WE3A 1ISMA 3UVEA 7MDHA 1LDMA 3GGOA 3JQ7B 4FCCA 4CMCA 4D0SA 5HTOA 1GD1O 2VOJA 1GYQA 3HHPA 1KETA 2BGLA 2X22A 3QVSA 4NDNE 4NBUA 4XYBA 1U8FO 1PZEA 4Q3NA 5HA5A 2NADA 3UCFA 3ZV5A 1E6EA 4JXKA 3OJEA 1Q0HA 1GYPA 4J90A 4L4SA 5GMOA 2X9NA 2DBQA 4BMSA 4FR5A 1H6DA 3H2SA 4Q3AA 3U4CA 2UVDA 3WLEA 2X86A 1Y8QA 4CLXA 1MA0A 1PL8A 4EW6A 4MVJP 4D3FA 2QX7A 4JQCA 2ZYAA 3QWIA 4WCFC 1L1FA 2IYPA 3QVWA 3ZW8A 1T2DA 4IZHA 3GOHA 5KIAA 4F46A 3GFGA 3TPCA 3H5NA 2J3HA 3ICCA 5IXSA 2PFGA 5KOIA 2R6JA 4MP6A 4L73A 3IIEA 3M1AA 4QEDA 5BNIA 4JROA 1VC2A 3PTZA 5H83A 4BNUA 4O6VA 1NTOA 3NDJA 1TT7A 4FFOA 1ISFA 1PWZA 4FQ8A 2IODA 3BHIA 2I66A 3WXBA 4YRDA 4YAEA 2RHCA 3INGA 2YV2A 4PG6A 1HTBA 4FBGA 2PGLA 3R3SA 4JBGA 3CUKA 3IQDB 2R00C 3CMCO 2CDAA 1PS8A 2FRDA 4BNTA 4KDFA 3H3JA 3IMFA 4XGKA 5L53A 4YR9A 2AE2A 2NU8A 2PV7A 3ASUA 2PA3A 5IDXA 3GZNA 5I7EA 2PD4A 4AJ1A 1U3VA 2QYSA 3LT1A 1ONNA 4NFYA 4OQYA 4CV0A 2NU9A 1BXGA 3NV9A 1IE3A 4R41A 3VDQA 3AU8A 5B4TA 3IL2A 1I3NA 4MKZA 3TF5A 2JCYA 4LN1A 3MJTA 4R1TA 1E1MA 3I9LA 1UZNA 4OL9A 2D2IA 4CMBA 1A71A 4A0SA 4LW8A 3DMTC 3HNPA 1C0LA 3BAZA 2JD2A 2SCUA 3NYWA 1J49A 3RUAA 4XQCA 3W8FA 5B4VA 3E82A 4CQMD 4DYDA 1ORRA 4J6FA 2DTXA 1NX6A 3GVIA 1R4NB 1C0PA 3TSCA 1ENOA 3W1VA 1NQTA 4IDGA 2DFVA 2EJVA 4UVDA 4LGVA 1Z45A 2LDXA 3DB2A 2HK8A 2UV8A 4BNMA 2EGHA 1I01A 1VE9A 4GGOA 1ONOA 2YZ7A 3FR7A 3ZU2A 3BMOA 2Y0CA 2CVZA 4FGSA 4G65A 4IDAA 1LC3A 3QWFA 2D1YA 3AM3A 4CL8A 3JQGA 3FTPA 3PGJA 2RIRA 3C7CB 3NT5A 3FHLA 1MB4A 4E0BA 4E5KA 4R5MA 1DB3A 1HE4A 1KEPA 2VZ0A 1LDBA 3O8QB 1GZ3A 5C37A 1M6HA 1C1XB 3HDQA 5KJCA 4YJGB 4U7WA 2H1SA 5HS4A 4NU5A 4HADA 4TZKA 3RBXA 4PG4A 1SAYA 3SC6A 2PH3A 6ADHA 1CRWG 1QR6A 2Q4BA 1ISIA 2B5WA 3DZJA 3KV3O 4CQMA 5JY1A 5F1PA 2VOEA 2XXJA 4DL9A 4J1SA 1LJ8A 1PJQA 3QA9A 1ZEMA 1HKUA 1T2EA 5K6AA 3VH2A 1EZ4A 3HQ4O 4UREA 1VL0A 1ZIDA 3ADPA 3D4NA 1GCUA 2CVOA 3JSAA 1F06A 1I10A 1ZJZA 3QP9A 3VZRA 1GQQA 1BXGB 2PZJA 3G79A 1DJQA 2W2KA 1H9BA 5J23A 1H9AA 2X1HA 4IDEA 5LDHA 4PCVA 3NRCA 3KOUA 4IY1A 3T4EA 1LRLA 1PQPA 1ZK2A 5TRTA 4CM7A 4E30A 2W2KB 3RUFA 3W8EA 3WYBA 1Y8RB 4GX5A 2C0CA 3PQFA 4GSLA 4EGFA 5JBIA 2YDXA 1WLYA 2NWQA 1I3LA 5AXCA 2BF7A 4FW8A 3ZNNA 4AJ4A 2YHUA 1NYTA 1U4OA 3GN2A 1C0KA 5AOVA 3T4XA 1M75A 3TL2A 5A9SB 2ZTMA 1DFIA 1UXKA 1O5IA 3OECA 1P77A 2VNAA 3ZV3A 1AGNA 3FPLA 1EE2A 3GVCA 3KYBA 1LRJA 2PD3A 2FZEA 3UXYA 1ZSVA 1PJBA 4PLWA 4ZQHA 3ASVA 2C82A 3AUUA 1V0JA 4J2OA 1T2CA 4QECA 3EVTA 4JX8A 1QG6A 3E1KA 1E1KA 4DGSA 3X2FA 1BTOA 5L7WA 2Y05A 4I5EA 5IG2A 1JA9A 3I9KA 4ZICA 5T64A 1HE3A 2NVWA 3R6DA 4GLLA 3AUTA 3C3XA 4Z3DA 1Q7CA 4HXYA 4RVSA 1GFSA 3TZKA 3WWZA 1WNTA 3W6UA 2Q2QA 4ND5A 3SC4A 3QVXA 3F46A 4ALJA 3NGLA 3H9EO 1MC5A 3ANNA 2W8ZA 4XYEA 3V1YA 2UYYA 3PYMA 4XEHA 5IN5A 2Y1OA 1P33A 3GPIA 3GC6A 5ITWA 3BTVA 5C7IO 4XR9A 3ZWPA 2WDZA 1B3RA 4BO7A 4YT4A 4TRRA 3D5TA 2QHXA 4E5NA 5JCJD 1ISGA 1XG5A 3CZRA 3FCOA 2DU8A 2E6UX 4WECA 4ZQFA 2CD9A 4CM4A 2E4AA 1Q0QA 2HK7A 2XXBA 4XJTA 3E03A 3PIIA 1DIRA 2HMTA 4AJNA 2NSDA 2E82A 4DXHA 1M76A 4RLHA 4XR4A 4ALLA 4YAIA 3P19A 4F6LA 4MPDA 4BS9A 4MKXA 2E48A 1Y6JA 3CPSA 4KUHA 1PIWA 4L0QA 4AL4A 1EUCA 3H9UA 3TL3A 1UDCA 3G3EA 4IIUA 3L9WA 1XEAA 4ZD6A 1G6KA 3MOIA 4U0JA 1E3WA 5KTKA 2B4RO 3AFMA 3DC2A 1ADBA 1B15A 1VJ1A 4Q39A 3QIVA 1W8DA 5CFZA 4D44A 4PG5A 1KY4A 4ZRMA 1I32A 5KVCA 1VSVA 3MEQA 2R2GA 2X0RA 1ZH8A 2XOXA 1PQUA 1TLTA 1U2DA 1QP8A 3KYDA 1LQTA 1SMKA 4OXYA 4DTIA 3LC7O 4U6QA 1D4FA 1TVEA 4TZTA 2C2YA 3OQBA 4H7PA 3UCXA 4L75A 2FPGA 3LT2A 2ZTUA 2ZB7A 3VZQA 4CUKA 4ESOA 1DSSG 4LCEA 4J0EA 4RPKA 3DMYA 5FI3A 3ETEA 4FFNA 2D5AA 3EW7A 3D5QA 2P4HX 3H7AA 4WOJA 4BO8A 3RASA 3V1TC 4J2HA 4EUEA 3V2HA 3QVOA 5T8KC 1YOVA 3RC9A 2XF8A 5ITVA 3FSRA 3D0OA 3GEGA 3VZPA 5JYDA 3FRJA 3FNFA 1KERA 3LLVA 4DLLA 1B7GO 2C54A 1NQ5A 3JD1A 5JPIA 1DC4A 1YONA 3PPIA 1T1RA 1X15A 4IBOA 5JCXA 3FNEA 4WCFA 1N9GB 3S2FA 3ANLA 3TOZA 4XDZA 4BNZA 1LX6A 4GH5A 4AFNA 5BQFA 3HN2A 1X7GA 1J0XO 4TMFA 3SJUA 3WTBA 1DRWA 4BGVA 3TDKA 3KBOA 5CDGA 3DBLB 1MG5A 4E3ZA 4RVFA 1U28A 3ROPA 1JU9A 4L76A 1XU7A 3LC2O 3N74A 5U9CA 1M67A 4WUVA 2BRUA 4YQYA 3FWNA 3PWSA 4BL5A 1R37A 3B70A 3HB4X 3PP8A 2WD8A 4I9UA 3QRWA 4ZA2A 1IB6A 2VZ9A 3OEWA 3WQRA 3JD0A 2QRLA 5IZCA 1FK8A 1IHXA 3FPCA 3OETA 5G4KA 3KYDB 4M87A 3VVBA 3D64A 3P2OA 1I30A 1E1NA 1KC1A 1PQWA 3S2IA 1SCUA 1GADO 3C1OA 1EMDA 4XKJA 2CNBA 3ZGYA 5GZ3A 5JDIA 2ZIZA 4K6FA 1UZLA 2YFHA 3MCVA 4O5OA 3WGZA 1E7WA 3VH4A 3PYXA 4RVGA 1GYRA 3F5QA 4OOEA 5COAA 5FYDA 1YGYA 3RUEA 4E33A 4KTVE 2GSDA 2J5QA 2UUPA 5L3ZA 1H2BA 4B8WA 4PRKA 1MV8A 2DPGA 3GQVA 5ER9A 1WVGA 1E7SA 4JP2A 4RGBA 1VJ0A 3IUPA 4J91A 1NHGA 1Y1PA 5T5QA 4BGEA 2HAEA 1DC5A 5KJ1A 4WLFA 3RCBA 3ZHBA 5DDIP 4CMKA 3DWFA 1VJTA 3I6QA 1ZJYA 5BNFA 5BSEA 1P1HA 1QYWA 3VKVA 2Q1UA 3UGKA 4BKUA 1GZ6A 1VRWA 3UF0A 3GGGA 1QLJA 3B6ZA 1RJWA 3WGHA 3ZU3A 4NNJA 1G0NA 5H81A 2Z95A 1B2LA 4L4XA 1GR0A 4QQRA 5ILGA 4CM5A 4BMNA 1Y7TA 3I4FA 1LSOA 2GNAA 4XZ3A 4NBRA 3AJRA 1HT0A 4XWYA 3I6IA 3KEOA 3QJ5A 1D3AA 1N1EA 4LCJA 5CEJA 1YQXA 1ID1A 1L7EA 1SEPA 3R3JA 4YAGA 1LLUA 2ILTA 4CLDA 7ADHA 4M54A 2JAHA 4BIIA 4KP7A 4U8GA 4Y6SA 5HS6A 2EERA 1P44A 4NH4A 4AJIA 3QW2A 4R9RA 1F0YA 3OH8A 4LRSB 1M2WA 2G0TA 3JQ9C 3PHHA 5A9TA 1UXGA 1VM6A 3W4KA 5DBFA 3F1LA 1TT5A 2GR9A 2HO5A 3PQEA 4MIOA 2VT2A 5HM8A 1Q0LA 1J5PA 1XKQA 4J9UE 3F6YA 3WFJA 1P9LA 4QFDA 2EP7A 4W7HA 4R5HA 2OBYA 4A10A 3Q0EA 5TF4A 2YFQA 2DC1A 2JFFA 3TOXA 4CLEA 5LCXA 3WR5A 4IMRA 3N58A 4MP8A 1GCOA 4WCDA 5G4LA 3DR3A 3G17A 5CDUA 4BNFA 3EDMA 1P1RA 3GY0A 1ZSNA 1AHIA 1GU7A 3BIOA 4GGPA 2C20A 1DLIA 2PKRA 1Y5RA 3RQSA 3O38A 1WAMA 3I9MA 2QZ9A 2J3IA 3PGXA 4B7UA 1NBOA 1K89A 1MC4A 4IDFA 5DBGA 3Q9UA 3H9QA 5ENVA 4TRNA 5IZCC 2CSUA 3GEDA 4W82A 4DQXA 3CSDA 4ALKA 4J1QA 2W90A 4BGIA 2C2XA 2ZTVA 3COSA 2V6BA 1XQ6A 2VYNA 3PDJA 3TFOA 1O0SA 4BGUA 1A7KA 1YB4A 2WE7A 2G76A 3L4BA 1EDOA 4GPD1 4GVLA 4IINA 5IDWA 3LDHA 4MVJE 2W98A 3GNTA 1HF3A 5F21A 3KHUA 3OSUA 3K31A 3RFVA 1N92A 1E7YA 2Z1NA 5T67A 1LLDA 1QXSA 1C3VA 3VAZA 4PFJA 1ISHA 4ZRNA 3IAHA 3GRPA 2ZYDA 5HRUA 2IDZA 4JP3A 4I08A 2QQ5A 2H5LA 1K5HA 4IDDA 4TROA 4Y67A 5G4KB 4PLYA 1R4MB 4YTEA 5ILOA 1SBYA 2CVQA 5FFFA 3UW3A 1JLLA 2WSBA 5K0ZA 4M55A 1BXKA 4FDAA 1LEHA 1ENPA 4L4RA 4EUFA 2C7GA 1H6BA 4ZVVA 3LYLA 2OHXA 2X0NA 4IJVA 3WGIA 4FD3A 3VPSA 3WNVA 3DHYA 3E5MA 3JQ6A 4ZQEA 4CR7A 5DCWA 3ZU5A 5TGDA 1QV7A 1EUDA 2J6IA 5B37A 1PU2A 3VPXA 1ZCJA 3GGPA 3W4JA 3WMXA 1A4IA 4R01A 1YBVA 4EITA 2CZCA 3BTOA 3GDGA 3RI3A 4GX0A 1GUFA 2FR1A 1O94A 2JCXA 4L8VA 1EFKA 4DIOA 4BNWA 1R12A 2PD6A 1HDOA 1O8CA 3AU9A 3D4OA 2B35A 4QO8A 5G0VA 5JMPA 1LDGA 3AWDA 3R1IA 3RVDA 3VTZA 2EG9A 4A2CA 4CMIA 1DAPA 3P7MA 1QSGA 1PR3A 5JAIA 3C8MA 2RH4A 1PZFA 2VUSA 3F47A 3HB5X 4G2NA 1P1FA 1D1SA 3WBFA 2A35A 4UAGA 2AEFA 1UDBA 4JJFA 1HDCA 5I7SA 2GN9A 5T8KA 3W6ZA 1BRMA 2Q46A 3RC2A 1T25A 4QX6A 1AUPA 1WDKA 1H2HA 4WLUA 3KLPX 3TZQA 4A7PA 2YHIA 3EYWA 3WMWA 3D7LA 5A9RA 1P0FA 3HFGA 3PQDA 1MXFA 3DONA 2C07A 4PG8A 1U7HA 4NBTA 4RDIA 2GO1A 3ZWCA 4UEKA 5G0WA 4K1LA 1HL3A 4RL6A 4CL3A 4YT8A 4DBZA 3DAFA 3F4BA 2I3AA 2PH5A 2X5KO 2NACA 4PGFA 4B8ZA 2DVMA 2Q1WA 3JQ9A 3WGTA 2C59A 5TNXA 2P5YA 3P5SA 1PGQA 1GQ2A 4KZPA 4TKMA 1BWSA 3ZWBA 4U0KA 1QV6A 1F14A 1Z73A 4RO0A 1C0IA 1EFLA 4KWHA 3IUSA 1PWXA 3ZW9A 2CMDA 4LMRA 4H16A 4LSMA 3H2ZA 4CV3A 3GHYA 4XIJA 5DOVA 1EVYA 1Y5MA 3AY7A 2FY8A 3ROKA 1ZXLA 4BNIA 1P1IA 1IZ0A 3ETDA 4M49A 2VYVD 2FZWA 2PWZA 3FBGA 2Y68A 5TSDA 1TA4A 2GN4A 4YT2A 1BSVA 4PZDA 5IN4A 4P4GA 4Q3CA 2EF1A 1RM3A 1D1TA 3JQDA 3GZNB 1Z75A 3P2YA 2BKAA 1WZEA 1BDMA 1VL6A 2GN8A 4NBVA 3I83A 4AJJA 3VDRA 3MJVA 1U7TA 2BFMA 2OGUA 3OJFA 3QWBA 4EEXA 1ULUA 1KIFA 2RH8A 4D3DA 4CR6A 2VTDA 1IYZA 2HRZA 4IJUA 3DTTA 4WNCA 3C1AA 3M1LA 4HBGA 1DIGA 4HNHA 3WQQA 4BVAA 2NV6A 3LZ6A 1GV1A 1HYHA 4YYZA 1YKFA 2J5KA 4GKBA 5G2OA 4UEOA 3MTGA 5JS6A 1X14A 3DDNA 1O6ZA 2X8LA 4YXFA 4AG3A 3HDJA 1CIVA 3NTOA 3PZBA 5JAZA 4PZEA 4DC0A 3T7CA 1ZKMA 4XQEA 4J1TA 3VH1A 3AOGA 2OP0A 2VWHA 3I9JA 2VWQA 5EINA 5JDCA 3D3WA 3B1JA 1IOLA 3SJ7A 3O03A 4B4VA 1DIAA 1NAIA 3K9QO 3A28A 2D4AA 3QWAA 4WLVA 5JDCC 2QRKA 1I0ZA 5EJ2A 4BO3A 3QLJA 3O8QA 1Q1NA 1PJSA 1E7MA 2WJPA 1LSSA 1G1AA 2BLLA 3DZKA 3OJ0A 4XB2A 2F1KA 3PJDA 1ADGA 1AXGA 4I5DA 4WGGA 3CTMA 4GX1A 3HDYA 4IQGA 4RF4A 4NU6A 3ZHXA 2CDBA 5L40A 2FWMX 4E21A 3Q3CA 3SLGA 3ONDA 4CM8B 2PNFA 2JD0A 3LF1A 1T4BA 1E6UA 3FWZA 2I99A 1SNYA 3CKYA 1EE9A 1ZUD1 4FFRA 4CMEC 2WYUA 3PLNA 2IE0A 4EEZA 3EHEA 4R51A 1EVIA 1XA0A 3EC7A 4M89A 1R0SA 3JQEA 3ZWWA 9LDBA 1I3MA 4YJFB 3IOYA 5IZ4A 4II2A 2NQTA 3QV1A 2I9PA 2DLDA 3JYOA 5C5IA 5KNLA 3AM5A 4IQ8A 4OHUA 5AYVA 4J49A 4BV9A 2Y1CA 2GGSA 2FSSA 5BSGA 1FXSA 3JTMA 1Y8QB 2ZCVA 2GD1O 3HDHA 3KETA 2H9IA 3PHJA 3ONFA 4R3WA 5A3VA 4U6SA 1K0UA 2AG5A 2DQ4A 1PTJA 2I65A 3CXRA 1OOEA 4B7XA 3SEFA 4K9DA 1JW9B 2I5PO 4ALMA 3GAZA 2OO5A 4EJMA 3PIDA 1KVSA 3ONEA 4M8SA 1CDOA 4J9VA 2PGDA 3DO5A 3WGOA 1PGJA 5IF3A 1MFPA 1N7GA 2AHRA 2C29D 4GSKA 4CMJA 4NJMB 5CEEA 4OM8A 3GRKA 3V8BA 1N1GA 2JJYA 1JDJA 1R16A 3NEPX 4JGBA 1ZSYA 4UEJA 1T2FA 5F3RA 3GLQA 3RU9A 5CDTA 4XYLA 4NJOA 4CLRB 4NJMA 3F1KA 3CINA 1CF2O 1K6XA 3UCEA 3A06A 1ONPA 5EESA 1EBFA 1SO8A 3H5RA 5G0SA 1BVUA 3EZYA 5EMHA 1MXHA 3WSVA 4BNYA 1LC0A 3U09A 2GDZA 1F12A 3UOGA 4E2WA 1XYGA 1TEHA 4XYGA 4WNIA 1G0OA 5EQDA 5JC1A 1ZK3A 1NFFA 3PHLA 1KEWA 3KO8A 3L6EA 1ZNQO 4J7UA 5JE8A 1KVQA 1B8UA 3G1UA 4QO7A 4PN3A 2YJZA 2PZMA 2W2LA 3KSUA 3GUCA 4XJSA 1ARZA 2VUUA 1DIBA 6LDHA 3AK4A 5C3MA 3TZCA 4Y6RA 2FP4A 2HUNA 2EXXA 4IJKA 2OFPA 4QSMA 4NQZA 2B4QA 5L4NA 1V35A 1W0CA 2WD7A 2YYYA 4PVCA 2ZTLA 2XPCA 1YDWA 4CM9A 1HE2A 2OUIA 4O59O 2BFAA 5JAMA 2BI7A 1X1TA 3TRIA 1Y8RA 3CIFA 3ITKA 4R9SA 1SZJG 3DZGA 4PLTA 4Q3BA 1KY5A 4MO2A 3VC7A 2B83A 1XLTA 4WEOA 4BKQA 4DC1A 1B8VA 4RDHA 5BT9A 1VKOA 2ZATA 2TMDA 2VRBA 3ADOA 1CEQA 1U5AA 3C24A 4OQZA 3F5SA 4RPJA 4BHTA 4A03A 3HG7A 1UP7A 1JWAB 3IP3A 4ZU3A 2P9EA 4NBWA 3PVZA 3DEYX 3M2PA 4G5HA 5FF9A 4Z9YA 4AJLA 8ADHA 3ENNA 1JWBB 4OGWA 1H6AA 2BFPA 4NK5A 1MLDA 1MG0A 5KWEA 2PK3A 1ZW1A 1HDRA 3OJOA 4W4TA 3WLFA 4ALIA 5A5FA 1KBZA 4EYEA 3KB6A 3I23A 4RJTA 1C1DB 1GL3A 4R1SA 4IGFA 5L7TA 1HRDA 1U8XX 3ORFA 3GVHA 3NT2A 2ZKLA 3PFWO 3I5MA 4HY3A 1UH5A 4J4BA 1PZGA 1P3DA 3MZ0A 2EJWA 1DLJA 2X5JO 4E12A 2CY0A 3Q2KA 4B3HA 3ZNQA 2X6TA 2V6GA 3DZFA 4BUCA 4CQLA 3IDSA 3MWDB 5CHEA 1LLQA 2AG8A 4E5MA 1PJLA 4F3YA 3L6DA 3BMOB 3KZVA 4FN4A 1HSZA 2ZK7A 3Q11A 1C1XA 4GQAA 2PLAA 2VTEA 3MWEB 5A04A 2DBRA 2FR8A 3PJFA 4BO0A 4BNGA 1J6UA 4GMGA 1WP4A 3DZIA 5T57A 1IZ9A 3IP1A 1BG6A 2VWPA 1R66A 3CEAA 4MVJF 5L4SA 3GUYA 1YBAA 2PGJA 4N5LA 3VHRA 4Z0PA 2DUWA 2WM3A 4JNKA 3KVOA 1JKJA 4OSOA 1JKFA 1ZFNA 1UP4A 2AMFA 4OAQA 2X0IA 2Y66A 3DXFA 1F8GA 3VPFA 1I2BA 1WW8A 5A4DA 3Q1LA 2GASA 5KVVA 3L4BC 2VN8A 4TSKA 3RC1A 3CH6A 4LISA 5KJEA 1PJ4A 4DPKA 2GLXA 1LUAA 1E92A 2HMUA 4YAJA 4WLNA 4CLHA 3EK2A 2ZYGA 3VH3A 3NUGA 4BQRA 3RAJA 1GPDG 2G17A 1E3EA 4TRMA 1WPQA 2GRAA 2GPTA 3HN7A 3L0DA 4FFMA 4FJ0A 4CM4B 2WTBA 3RUHA 3ZHYA 3V1UA 1QRRA 2Q50A 5AXDA 3ST7A 1V8BA 4RORA 4E2YA 2JHGA 1I33A 1LNQA 3TZHA 2RAFA 2VRCD 1T24A 3GDOA 5I7FA 4C7JA 1YE3A 5COBA 1W4ZA 4PVDA 4X54A 1P31A 1FJHA 4UVGA 2I76A 2P9GA 3SBOA 3NX4A 1ZZEA 2DPHA 1WDMA 4J4HA 2C7VA 1CQIA 5G0UA 1CJCA 2D59A 4HFJA 4MINA 1N7HA 1D8AA 3JQGB 3D4PA 1GEEA 3H5AA 4HFRA 3OA2A 2EIHA 1AE1A 2P9CA 1A4UA 5ENDA 1EQUA 4Z0TA 2P68A 3V2UA 3GDFA 3GK3A 3ROMA 4EBFA 3FR8A 1EVZA 5A1TA 3UHAA 2Y99A 2WWRA 3ON5A 1DDOA 2J8ZA 3DAGA 5I8ZA 3L6OO 5A05A 1KEUA 3OIGA 2EHDA 1P45A 5HWSA 1MGOA 1ZXBA 4C7KA 4CMGA 5CG1A 2AW5A 1NVMB 4FB5A 1IY8A 4YWJA 5TT0A 2ZCUA 2VRCA 4BO4A 2POQX 3NTRA 5IFLA 2B0JA 4NHEA 4Z0HO 2EEZA 3FTNA 3GFBA 1NM5A 3WOHA 4Z6KA 1XSEA 4AJOA 5FEUA 3S8MA 4IGEA 4TKLA 3PK0A 4YJHA 1GUYA 1U5CA 4Z9FA 2DT5A 3CZMA 3F9IA 4XA8A 5TJHA 3PLRA 4FGWA 3FD8A 3RKUA 3KEQA 3WJAA 2E49A 4P4NA 4ZN6A 3E9MA 3C85A 3WYEA 3FBTA 2O7SA 1GAEO 4D46A 4DQVA 5L95A 4BKRA 3WNQA 3INTA 2NTJA 4BNKA 2UDPA 2YUTA 4XB1A 4RPHA 3NJ8A 2Z5LA 2BGKA 2PZLA 3TNLA 1PZHA 3G49A 5L51A 1C14A 1E3LA 1X1EA 5CPFA 3RJ9A 2QRJA 4NIMA 4R54A 3PXXA 5JLAA 4DPMA 4LVUA 3WWYA 1BXZA 4NG5A 4CQLB 1JAXA 3ULKA 1S6YA 1R4NA 1O89A 2JL1A 3JD2A 4IDCA 4CODB 3GZ4A 2HLPA 2NVUA 3H4VA 3PWKA 5THKA 1YXMA 4CM3A 5KVSA 4CPDA 1TXGA 1YB1A 3H6KA 2D5CA 3RBZA 2O2SA 3KSDO 2NVUB 1VLLA 4LSWA 4XQ9A 1UXHA 4YQZA 4CMAA 1X0XA 5JC8A 4DLBA 4BV8A 3BMQB 4CMIB 4D3SA 1GQYA 5CPBA 1Y81A 4EJ0A 5U4QA 3UICA 2Y0EA 4CM8A 4TQGA 3V5NA 3SX2A 3OBBA 1ENZA 2X5OA 1P0CA 2HRBA 2HKIA 3KM0A 3K30A 2HSDA 1E3SA 1OZAA 1A9YA 2O3UA 1QYCA 4L74A 1HYGA 2O4UX 4E13A 3ITDA 2BD0A 1YO6A 5KKCA 3DQPA 3ZNOA 4FS3A 1N8KA 2AEMA 3GH3A 3LT4A 4Y98A 5JSFA 3PJEA 3I52A 4JIGA 1Y9EA 1YJQA 1Z74A 1HDYA 3R0IA 1HDGO 4YT5A 2X58A 5L9AA 1UP6A 1ZVMA 4KWIA 1XCBA 3IKVA 5A03A 1M6WA 1NVTA 2VNSA 4MVJM 4FOSA 4YVFA 3OIFA 3N7UA 3T7EA 2P4QA 3MTJA 4R4JA 4OYRA 4YBZA 2FMUA 5C7LO 3D3WB 4ID9A 1Z7EA 2J3KA 4IZIA 4BNHA 3JYPA 3GT0A 4I1IA 3RD5A 4E2XA 2AQKA 2O50A 2O3JA 2LDBA 5C7OO 1FDWA 3MJSA 1LRKA 1Z82A 2Z1MA 4JLWA 1EUZA 4DWVA 2DAPA 2O7QA 4PLFA 2YY7A 2ET6A 4XDYA 4BNJA 2BI8A 4HX5A 3JQAB 1WWKA 4TVOA 4W99A 1IPFA 1YWGO 2OP1A 3U9LA 1I5RA 2NVBA 1R6DA 3RU7A 2ZB4A 5KVQA 5G0TA 3AM4A 4IXTA 1LA2A 1YVEI 2I6TA 4KQXA 3E6AA 4IQ0A 2OZPA 1PX0A 4P8RA 2GYYA 4RPLA 2HMVA 5EPOA 3BMQA 4I5GA 3INRA 1HSOA 1I24A 5I9MA 2P91A 2UAGA 3TZ6A 1H5QA 4OKIA 3U5TA 3WGYA 3K2EA 3NAQA 2NU7A 3ZZNA 5JXWA 3EGOA 2C5AA 1NR1A 3DTYA 3RKRA 3H9GA 1VI2A 4ROSA 2FPIA 1DJNA 2NQ8A 1RPNA 3M2TA 3B1FA 3E5RA 3ZDFA 1GTMA 4GWGA 4CR8A 1TT5B 4GL4A 2PTGA 1HZZA 3DHEA 3BYZA 1HLPA 3KYCA 3RC7A 4NFSA 5LC1A 2O4CA 8LDHA 1E3JA 3O4RA 1VL8A 1GY8A 3DL2A 4CV2A 5TQVA 2CDCA 2R00A 3AI1A 1DHRA 4B3IA 3ABIA 4ZQGA 2YQ4A 1LDYA 2GF2A 5LDGA 4BO9A 1P1JA 1DPGA 1W73A 4J3FA 4GWKA 2QZZA 2VUTA 1SOWA 1YL5A 2GERA 4CMHA 5B12A 3K2BA 1HYEA 1F8FA 1E77A 5KJFA 3KLMX 1T26A 2H6EA 1XGKA 4O0LA 3AUAA 1K3TA 3L07A 4Y8VA 4ND4A 2NTNA 2PR2A 4PRLA 3STHA 3TJRA 2AQIA 1JN0A 1U3WA 3U62A 4RCVA 1DC3A 5JCJA 2V7PA 4Q9NA 1QYXA 3PDUA 3I3OA 3NTQA 4WLEA 4ONEA 5DOZA 3DBHA 4HFMA 3EY4A 4AJKA 3S55A 5GY7A 4HFNA 4FFLA 5TT1A 4GLOA 2IEDA 1IULA 3JQFA 2ZJ1A 1X7DA 3QWHA 4I8XA 4AJEA 3AOEC 2WE8A 4RZIA 1HZJA 1I2ZA 2O48X 1NFQA 3I4CA 4UUOA 1LTHR 2FOIA 2CUKA 3JQBC 2YDYA 4K6CA 2Q3EA 2O3SA 1LDNA 1OAAA 2Q1TA 2HJSA 2YQ5A 2WMDA 1NWCA 3F4LA 3WICA 4A27A 3JYQA 4I9HA 3TFQA 4DLAA 2YW9A 2HCTA 1JVSA 1PS9A 2VZ8A 1GUZA 2B69A 3SXPA 5CDSA 3S2GA 3DBVO 1U9JA 4J0FA 1B0AA 3GA0A 4B4WA 1BW9B 4YCAA 5ES3A 4D42A 4H15A 4QFCA 4DMMA 3RUCA 1MX3A 1ZMTA 3ZN2A 2GUGA 4AVYA 3VTFA 2ZQYA 3DFUA 4IS2A 3WX0A 2Q49A 4I9NA 4D45A 2J5RA 2JD1A 1KOLA 2GN6A 1K6JA 4GAEA 1RWBA 2C5EA 3DBLA 9LDTA 1YL6A 1CWUA 4J1NA
chains in the Genus database with same CATH superfamily
4NCAA 1BMDA 1NNI1 4YRLA 4WOKA 2PMCA 1PVDA 4JBNA 1Y8AA 3HJAA 3TLGA 4R2HA 3ZR4B 1Y63A 1QBGA 3CVYA 1F4LA 4E5PA 3R76A 1H4QA 2ONJA 2OAGA 1Z17A 2P8SA 3VC3A 5LN1A 4BBPA 2BL4A 2X9GA 4MDHA 1Y0BA 4KXXA 3RHFA 5DGIA 1FU7A 2WWTA 3QU4A 4YAWA 1JG1A 1XLWA 4MVJA 5AVTA 1L8XA 2ZQZA 1I36A 4OX9Y 4IILA 1YQEA 4EA8A 1IG0A 3OI7A 4MYTA 4OSPA 2V7GA 2ATIA 3PQCA 3M3PA 4BNLA 1Y1RA 4Q24A 3NLLA 3RLIA 1E2BA 5K0GA 2Y1EA 4K28A 3QEAZ 4PLVA 2GZ3A 4JCOA 1E9BA 1T4MA 2YMMA 2FPPA 3CFYA 4ON9A 3JQ7A 1KS9A 4PBRA 3V7YA 5JW6A 2Q3MA 2H54A 4X65B 2DP4E 4WY5A 2XCTB 1FBTA 3MPOA 1XMVA 2DMRA 4KE9A 3R8XA 4BKPA 2H1IA 2PCJA 4AD8A 2Z2XA 5AVWA 5KTNA 1SC4A 4HDRB 1U0GA 1Y3CE 1Y9DA 3EAQA 1VZ3A 4UDXX 3GLGE 3NHAA 4JKIA 5C8VA 1HLDA 1RQRA 2JHCA 2IPLA 3KCQA 5FEMA 1L1RA 1P3Y1 2PKCA 1FFBA 1RFLA 3QVTA 5A9SA 3QX7A 2M1XA 2V0CA 3AY3A 2BSXA 3SLKA 3TLXA 4WADA 4EAQA 5CW2A 5E6SB 1BCRA 3KCNA 3AEKB 4JFAA 3G0OA 3S2EA 3OG9A 2Z2KA 2OB2A 4XIYA 3TBKA 3VM6A 1PG5A 3A10A 3H2IA 2DFTA 4OJQA 5CLQA 3PEYA 2ODPA 1AS3A 1CZNA 2GH1A 2DY1A 3F3SA 4I2NA 1S8OA 4F4UA 3W0LB 3E22A 5L7YA 1R15A 3IO3A 2V3VA 2E5FA 2R66A 2CZGA 2YXNA 3JQAA 3A1FA 3MGAA 2FEWB 4HB2A 4BKOA 7GPBA 4JBIA 4B4DA 2GN2A 3FLMA 2C3UA 4EF6A 2X4LA 2ANBA 2ZJ5A 3CKKA 1YK0A 4B3BA 2C5BA 2YVQA 4HDOB 1EI9A 4Y1FA 4C3UA 3HJCA 3KQNA 3DM5A 1C3OA 4V38A 3TVTA 2GKOA 4K9OA 3QI7A 3ZZTA 1QFXA 3OFVA 4PQEA 3DEHA 1WU8A 3VISA 4KLAA 4DZRA 3WOVA 1HL7A 4IKPA 5KU1A 4JMLA 4Z7QB 4R1NA 1R4AA 3E05A 3E3MA 2ZIXB 3L4JA 3AF4A 5LZ2A 4ZCLA 3IXLA 1W6UA 2Q3CA 1GZUA 3O3OB 1LZLA 1G5TA 2E1RA 3UAOA 4QNMA 1CZRA 2IZ1A 2WC1A 2AB0A 3OE5A 4HDQB 4LZNA 4RD2A 3CS3A 4H2DA 4C0JA 5K99A 1SN7A 3GCXA 3L41A 4IWXA 1WCV1 4UHJA 3IIIA 3LVRE 1E1CA 1DI0A 2HPAA 5KWJA 3KEGA 5BN1A 5BSRA 3KJNA 4OPMA 1VXOA 3IDQA 4N5HX 1G3MA 2NV0A 4DILA 1YOVB 2NZXA 1BW9A 2P9FA 4FOOA 3REOA 4WKNA 4XQGA 3UKOA 2YY5A 5F9MA 1C8VB 2F62A 3K0AA 4UAVA 3ZU4A 4EJSA 4RPGA 4G8BA 1T0IA 4O3MA 2BV3A 4TZ0A 1WUTA 3PT9A 3JQAD 3WLKX 3MPUA 3BDVA 3C45A 5K03A 1JEQA 3KKPA 1XWIA 2CHUA 3U44A 2LNDA 2MSEB 1EG7A 4QT0A 3QXJA 1OD6A 1XAJA 2J6BA 1QZ3A 1YRQA 3QQPA 4L0DA 1R27A 1G42A 1V1RA 3ZUPA 1QK4A 1ISJA 3E9QA 4ITUA 5IDYA 3OEYA 1JSLA 3RIHA 2FZVA 4XUEA 2O2DA 3BC1A 5HFNA 2GA9A 1AKRA 2CFCA 2HCRA 3AERA 1T8RA 2Q99A 4RZHA 5KYVA 4A36A 2NSHA 4W5NA 4CT4B 1HE5A 1QHSA 2UKDA 1DOHA 1PL6A 2PYIA 4IUYA 3OFSA 1DC6A 1WXFA 1NP3A 1U04A 1PJ3A 3QXXA 4XX1A 1TADA 5EA2A 4LF4B 2RGAA 5TEVA 3ENKA 3D6HA 2AOUB 1L6RA 4NX2A 1PX2A 3BVPA 3VC2A 4KHPB 4TGLA 4HAVA 4X5OA 4CJXA 1BJTA 1IPEA 2OMEA 5AVJA 5HKLA 3UK2A 4CU2A 4UOQA 4DCVA 1VIVA 2Q8QA 4RK4A 1YFKA 3OPQA 1ADFA 4GX2A 4DLRA 2PLRA 2DBZA 4G24A 4OMDA 621PA 4RVHA 4BAUA 2WHEA 4RJKA 8GPBA 4J4TA 3FSGD 5HJEA 1JPNA 3CWCA 4TL7A 1ZN2A 4R2JA 1OWPA 3K3PA 3WQHA 1HDZA 5FPPA 2IHBA 2B37A 1CUDA 2H4ZA 2YNMA 3BGWA 4G9BA 5JZMA 1K2WA 1KJNA 4RGVA 2WINI 3LBYA 3IAM1 1W5FA 3ROQA 3UK0A 2NO5A 3ZIUA 4BO6A 1DFHA 4AMGA 3P2JA 2GKGA 5HNKA 4BMDA 4OKNA 1PL7A 1NXWA 2N3ZA 2ZPUA 3I30X 3WB9A 1LXCA 3WIDA 1ETUA 1J07A 1I80A 2R1ZA 1X13A 3PXGA 1AGXA 1G8KA 3WMRA 2MSKA 4R7ZA 1E4YA 1OZHA 1A1VA 1ULTA 3Q6IA 3IS3A 4K6KA 3CH7A 1EJ6A 3KTOA 1WB5A 1MZPA 2A92A 5IP5A 4BU0A 3O4FA 1VCIA 3ABOB 3WBBA 5KSYA 1NZFA 1X8JA 2VCHA 4ZRDA 1WCIA 1DRUA 2QN2A 1W1IA 2P11A 2DTEA 3LGXA 1DAOA 1UDAA 4F9EA 2XB6A 3MTBA 3KB1A 2NUPA 1Z12A 2A6PA 3SHWA 4XRGA 5BN3B 3AGPA 5LP6B 3IT3A 2QW8A 2G5PA 1MQ9A 3O2QB 1H8HA 3CUEF 1D03A 1C30A 4IPTA 3ZWNA 2PKQO 4E5VA 4WBNA 3UT0A 5TR9A 1FJXA 4DBLE 1B3BA 2ZT7A 3ITEA 4BXOA 4B5KA 3UUEA 1T8WA 1ODSA 3PT5A 5DE3A 3N8HA 4EATA 2EF0A 5BSHA 2R5NA 4N47A 5K9ZA 4MLCA 1EX6A 3WJ1A 3D8BA 2D74A 3WFZA 1XROA 1O0CA 2J9RA 3UT5B 1HNZB 2F1OA 4L8LA 5FI5A 1CF4A 1NP7A 3H97A 1N2SA 3I1JA 3OPVA 5KHLB 4B8YA 1QONA 3D3EA 4V0MA 1ZXXA 2PRKA 2VP4A 1IZYA 3GNSA 4P1ZA 3SLRA 5I7VA 3D6UA 3B8HA 3B13B 3UB2A 3V1KA 3BB1A 1T6NA 3VJRA 3NU1A 1TB4A 4PS0A 4KR7A 3O7MA 4Q9IA 1DT3A 1RIIA 2AC7A 1LV7A 1R0LA 2QOEA 1JEDA 3AFOA 5B55A 4IXNA 3HTXA 1EVJA 3MELA 3DV9A 2JCBA 3HWSA 4DG5A 1RXIA 1SQGA 3H9CA 3M5WA 5EIFA 3GLTA 4I4TA 1ABEA 2FLVA 4DA7A 2GXAA 3UV3A 4AZ3A 3OTHA 2XH8A 2ODWA 5THQA 3BL6A 2B3DA 2CLKB 5CDYA 1B00A 2FUG1 2QVXX 1JILA 2J3JA 1NXQA 4W7IA 4QUHA 4Y7CA 1AC5A 2CL5A 2YV1A 3COZA 2IYOA 2SCUB 3K4QA 4YBRA 5DHTA 2Z9BA 1WA5A 3K0CA 3KZ1E 3CNBA 1UBSB 1DWPA 3S2SA 3BBPA 3A6PC 5HW0A 3GYBA 1JR3E 1UBOS 1MUUA 2DPXA 3ZWVA 4E2ZA 3D8NA 4DCTA 4MW7A 1OC2A 1Z8HA 1NW5A 1PBNA 3H75A 3OLXA 1J09A 1SB8A 3UHPA 4C2AA 3QHQA 4EKIA 2O2YA 4RVNA 5KEIA 2CN1A 1XDSA 4GP7A 3GMSA 3NZEA 4A8JA 4AKHA 1P2GA 5JJLA 1YH3A 2AXNA 3IH5A 2E4XA 3DEAA 4Q1EA 3SVTA 2VUHB 4TMXA 3ZWYA 4AG6A 4TV8A 2PSSA 3MM4A 4XCXA 3TWOA 3WSWA 3A0RB 5TMEA 1FSPA 1GNLA 3B1KA 3D1LA 4GR9A 5DNVA 3RROA 4JV5B 2XB4A 4X92A 4DR7B 3UPUA 4FILA 1X80A 3AFHA 2VHVA 3BAFA 2J32A 1GRVA 3E8XA 3GJ7A 1KBOA 3I1YA 4WLOA 1AO0A 2ACKA 3Q3IA 4FYIA 2Q4EA 1SH7A 2Z1DA 3CE6A 4QYWA 3WK7A 4H6WA 1SCJA 1G6Q1 3GGJA 4E31A 4UVEA 4K3VA 3AETA 3DQQA 3HLYA 2BONA 2QYTA 4Q3DA 4CKWA 4PAOA 4FHEA 4TT8A 1P29A 3O21A 1GPNA 3R40A 4GMXA 2VAMA 2IW1A 3RSFA 4QXOA 1Y8CA 5JHHB 2QPTA 4CM6A 1Y6ZA 4H4EA 4G9GA 3T7TA 2GVDC 2VF8A 5BR8B 3L02A 4ZGWA 2QL9A 4R69A 2UUAB 2Z2IA 4IDHA 4AMUA 4FDLA 4B9AA 3S99A 2H3EA 3RAEC 2EGGA 1H6CA 4RKQA 2BKLA 1YD7A 3C6BA 2QF7A 1FNBA 3H1BA 2HQ1A 2ZUVA 5ANRB 3RDPA 3HO6A 3PXDA 3KB2A 4CTOA 3KS9A 1W75A 3GROA 5JO0A 4TTAA 4ND3A 3ECCA 3H0EA 4CQMB 4DQUA 5I4KA 4PR3A 2CJWB 3AY0A 3BMNA 3GBVA 3AVXA 1QRSA 4XB6B 1JSRA 1NYRA 4DVJA 4HUQA 1ZCZA 1S7CA 5E9JA 2X4DA 5I4BA 5KOYA 4EZEA 4OLJA 1PWEA 3EVBA 3HB9A 2FEMA 2JJ1A 5BUCA 1TTHA 3B9QA 4JYPA 3O1JC 4RM3A 1GT6A 4WGFA 3L0OA 2ZI5A 3Q4GA 1VLMA 3ZH9B 1KSHA 3C3CA 4IW3B 2VT3A 4ID3A 4KIJA 1X7HA 3DF9A 2WY2D 4ETMA 2FPRA 2FQXA 2ZBEA 1JKIA 1FP6A 1U7ZA 1V9CA 3E3AA 3H9JA 4GVXA 5ALXA 1BZYA 4YJ3B 4GPIB 4D9NA 3CZCA 4TSRA 4I55F 3FOCA 1GZ4A 4FC7A 3WQSB 1ZUWA 4M0LA 4BB5A 4M7PA 5FUQA 2JFWA 1NULA 4RHXA 1US8B 5SZHB 1QO0D 1EHYA 3IPCA 3K35A 3N28A 4IRMA 4CKCB 1FDUA 5DBIA 2L17A 3WK8A 4QUBA 4B6GA 1YZGA 4I3FA 2JAUA 3AESA 1RAEA 1XKLA 2JFNA 3CX8A 4XCVA 3RG8A 4JLBA 4PU0A 1FMCA 3EVFA 3JS5A 4H7EA 4IGKA 2O8VA 1GSHA 5JCOC 5IARA 1KI6B 2C61A 1XIVA 3KT3A 4MPJA 2CEAA 1CZUA 1EEHA 1XJ5A 2Y76A 3AFIA 4DKXA 3IUEA 1N5IA 1U4SA 4UVIA 3ZWOA 2JJ1D 2X42A 1D0IA 3L7IA 5LA6A 4OHWA 4AUNA 1RADA 2J87A 1N32B 1V4NA 5DSXA 5C81A 3MIZA 2EW8A 2X0KA 1V9LA 2R47A 1WPRA 4OGKA 1NRIA 1PRYA 1NUSA 1RZRD 2FWPA 4YFVA 1G5IA 1ZM2A 2F3RA 2IEBA 2ZJ7A 4LWPA 1QJCA 1Z2AA 4PRZA 3TQCA 4G1CA 3AY6A 4IDOA 1A27A 2RKOA 3EVNA 4PFSA 4UMDA 3PQ6A 3SX0A 3BTUA 4XTRA 3IQEA 3V6MA 4YCLA 5JFOA 4WXYB 4RK6A 4FGUA 5JNLA 3K6JA 4KK4A 3EIUA 4UQPA 3GPDG 2W43A 1E64A 5I5EA 3QEOA 3C2QA 4BX8A 1UUFA 4NPAA 3ROEA 1NQOA 2VHXA 2Z8YM 4HBZA 4MS4B 4AZ3B 2IGBA 2O0HA 4ZO4A 4DDTA 4KR0A 2J46A 3OY2A 1DX9A 2MSCB 1YZFA 2JJ8A 4P22A 5JARA 1J5EB 1XZ8A 1QYRA 2WIAA 2XTJA 5IWAB 1T8PA 3PC7A 2BE7A 2Y1DA 1YB5A 4YDRA 2P2DA 1UMKA 1USUA 5EZYB 3BRQA 1SCBA 2R8BA 4H6VA 1J2RA 1KIMA 2E18A 1L1QA 2RK3A 3PRYA 2Y1GA 5HQ3A 2E89A 3A9UA 3ZZ1A 4HWSA 1RPZA 2I3ZA 2I2BA 3JD4A 3WRXC 4UBKA 1KDRA 1Z6ZA 5F12A 3LLSA 5EE0A 1IN8A 4MGZR 2RHLA 3FPSA 3PFGA 1QG4A 4NENA 1E61A 5E3IA 1XB2A 4CCYA 1VPWA 3IJPA 2Q5OA 2JAPA 2ZRMA 2IU6A 3AHEA 3GJXC 4H1VA 4L4ZA 4D9HA 4CL2A 3FZNA 1SG0A 2D3TA 3AWIA 4HNSA 1NNLA 1MABA 1UFOA 2H1WA 3WKEA 1KVTA 2OWEA 2PUGA 3C6QA 5EWJA 2NTEA 2O6HA 3EN0A 3EZ7A 3ZGZA 5AKIA 1O95A 2ZULA 4U7HA 4C4AA 5CJ2A 1ITZA 1OE0A 3C1TA 2X1MA 5LFAA 1QZUA 3D2BA 3OZVA 4LYYA 1P73A 1UJ2A 1BCSB 1XQ1A 1K3UB 5AVYA 1RM5A 5TQ2A 4A6XA 5FTLA 4DIFA 1ULZA 1V45E 3FN4A 3IC5A 4A3SA 1W9MA 1YRBA 2HMYB 4EMTA 5IKPA 1IL0A 3V8PA 2BFDB 2VDQB 2LIPA 4ZQIA 3C3YA 1P5JA 4AQYB 1R8JA 4LBWA 4HVLA 1E2MA 2ZM6B 4MVJI 4RVDA 3TRFA 3AEQA 1RHRA 1VJDA 2JHAA 1W52X 2RGXA 2Z08A 1NPTO 3QYJA 1XVTA 2I0FA 3IGFA 1KFEB 5G4KB 2G9NA 4TUYF 1AZTA 2BTQA 5K09A 1JDUA 5LDDC 2MINA 4AMYA 3PTAA 3ABRB 2VPYA 3LUCA 4J0JA 4YJHB 5HUJA 2BFOA 1ULSA 2FHSA 3QKWA 3V7UA 3IAEA 2AQ8A 3CF0A 2AWOA 3CE9A 4BVHA 2VQDA 3CLHA 3OOEA 1CFJA 1KFJB 2FK8A 1TMYA 1ZL0A 4YRAA 3KSBC 1RXVA 1WUYA 3WL7A 5DN6D 2WSMA 1OH5A 2XSZA 4YP0A 3LP5A 2YWRA 4TMVA 4BPRA 1E1LA 1JL3A 1O95D 1PJCA 2VPIA 4G5XA 1SA0B 2FB9A 3AJ9A 3L2OB 5CH5A 1VKJA 1X6VA 1LI7A 3PQ3A 2Z6AA 1IY1A 2P1ZA 2IYNA 3V4RA 1BOFA 3IELA 4PQYA 1HEYA 5KHOC 2PX2A 1KVRA 3B1ZA 4C6TB 3QKTA 4ZPXA 1L7AA 2VIIA 1KH1A 2ZAGA 3QLEA 2OQ2A 4IYRA 1PFUA 5DXFA 3EA5A 4KPYA 3BIWA 3FLBA 4IDBA 4MOWA 4EA9A 3LFTA 2BUBA 2MSLA 4NZ9A 4P3KA 1KXJA 3VJLA 3A3OA 2P40A 2QV0A 1KJJA 4L5BA 4MR7B 4YJGA 1UMCB 2P4SA 5MGBA 4YPOA 1N9GA 5L6LB 1NV9A 2AJTA 3P8ZA 4MGEA 2QXYA 3NHWA 4NOMA 4UHKA 1G5QA 4RMGA 5B30A 4FYJA 2CMKA 2IZ0A 1DEHA 2QP9X 3CH5A 2I54A 4UXHA 4UZSA 1RLIA 4TWRA 3DUFB 3H13A 2ZB3A 1EFDN 2FEKA 4HJRA 4I81A 4Q9JA 5TLSA 5TQ2B 5IM4F 4FFDA 4KVZA 1CERA 3BA1A 4K5QA 5JPDA 2XRFA 3BWMA 3MMSA 2MTBA 2W58A 3ACCA 1E2PA 2VP5A 1U9YA 4MS1A 1L5QA 2ATXA 5KOHB 1WKVA 4YAKA 4K9NA 1EFVA 2OOSA 4HQ0A 1J2JA 1GCAA 2BR5A 3AHGA 3UJ8A 4BE9A 1ZBQA 2V6MA 1Z5PA 1YZQA 4X7MA 1ZYUA 3D5EA 2X4GA 3THYA 2RBEA 3FRIA 4G4SO 2IELA 1UZMA 2FX5A 2RDMA 4O33A 3VR5A 4PYOA 5FYQA 1E9FA 1BO6A 3WIVA 1WZCA 1J21A 1EA7A 2WA2A 2CFSA 4JN6B 2HDOA 3ZBTA 3NC4A 4OM7A 1A2KC 1B2RA 2J0QA 5H68A 5EWLA 1P4HA 5EG5A 4BO1A 3PFCA 4NOJA 3HYNA 2GX6A 1A8PA 1JG4A 3EDOA 2PUEA 2OSVA 4EHAA 3SGLA 1Q83A 2C0PA 2QNBA 4J8PA 5KYYB 2ZYRA 3KWMA 5HSGA 2EJUA 1L4EA 4DCOA 1KZ7B 2A4KA 4TM7A 3Q7IA 2PX8A 3JU3A 5HOEA 1UKAA 3FCXA 3MILA 1CUYA 4LNUA 1E7QA 5TQ0B 3TLKA 3JQBA 4C01A 1I9GA 2AFHA 2OBMA 2WOJA 1N6HA 1ZN8A 2ERCA 3H3FA 3KDPA 3W4IA 2FUKA 3MCZA 3NHBA 3F5DA 4B0PA 3TN7A 2UZIR 2INGX 5AXAA 3I8XA 3QKSA 5EUCA 4AKGA 3PHGA 1E5LA 1QKKA 2XCIA 3DBOB 3KRTA 3O8OB 3N07A 3Q9NA 3QBEA 2OFFA 3O9ZA 4UD6A 3K6SB 3RWBA 5BWOA 4EY5A 4MMZB 1PEDA 3LT0A 5DVZA 4ZHSA 1CB0A 3RJ5A 5DT9A 5FHQA 3C3EA 1SXHA 1IJFA 3ED5A 4FMCB 2WG2A 3QPVA 2HMSA 4UXIA 3R41A 1MIOB 5DTMA 4S1WA 1XYYA 3M6AA 4F7DA 2J0VA 3GV0A 4LOHA 1B6SA 2CF5A 1MTZA 2HT6A 1L7OA 1TZ2A 1IQUA 1L9XA 3OZGA 5TJ9A 2XT9A 3WLSA 3W6NA 1MOSA 3S7TA 1JZQA 4MUMA 1I8TA 1LU9A 2DUJA 3CO5A 4YGXB 1I7QB 1G8YA 4JVOA 5B6PA 3QFRA 2RGGA 1UXIA 4M4SA 5FV4A 2KBFA 1QUFA 1WV1A 2A59A 5EIBD 1I3KA 1NWHA 2QZJA 3PJGA 4I4CA 4AICA 1ISMA 1P7ZA 2CL0X 3AEZA 3UVEA 4DJEC 1ODIA 1LDMA 4FCCA 3JQ7B 4D0SA 1BNCA 3SZMA 3SXPA 1GYQA 5KNDA 2X22A 3R5XA 2NYRA 3QKRB 3FOAA 2O59A 4JZKA 1UWCA 5EIAA 3WYAA 4Q3NA 1U2PA 1E0AA 2NADA 4OQNA 1F3OA 2R11A 2XZPA 3OJEA 1UIRA 4NEHB 3V80A 2MR6A 2IHNA 4DRZA 4LOLA 3R8FA 2VSFA 2RHTA 3Q6NA 4YUVA 2X9NA 4LC9A 1YMVA 4W8GA 1M8JA 4FR5A 5B7QA 4G25A 4L72A 1AOXA 2UVDA 4NAUA 1FA9A 2BY4A 1Y8QA 4ZEWA 1P62B 1TK3A 1KK3A 4QHYA 1Q77A 2AK2A 3L8CA 4MVJP 4HAYA 4AULA 4JVMA 4LEIA 3D2AA 4MS4A 4RQBA 3W8NA 1AMOA 3A04A 1P2FA 1CEYA 5FKJA 5B58T 4AN1A 2KBEA 2HRQA 2FJPA 1U9ZA 1YCGA 3GFGA 3IQZA 4L3OA 3H5NA 1QGDA 3DTNA 2J3HA 4NMMA 1N4AA 1JLSA 1D4OA 1Q7EA 2PUCA 2BDUA 3G9UA 3ICCA 4GLBA 2H7CA 2JFYA 2ROQA 5IHXA 1N2GA 3IIEA 4B3SB 2QZSA 2XCSB 1VC2A 3PTZA 5H83A 4BNUA 3IBFA 4P81A 3PGLA 4Q82A 1XL0A 1WMEA 2Z83A 4HGQA 2ZS9A 5EVJA 3WXBA 4AQ7A 1SOMA 3DP9A 4WK0B 2DT8A 2I6QA 2RHCA 1NNSA 3INGA 5M3BA 3FDJA 4RIIA 4NC9A 4QXRA 1MIOA 4PG6A 2XUGA 1HTBA 4JBGA 2R96A 4URZR 3TXXA 3NVAA 1G17A 4WZAA 1QH8A 3CMCO 5DI3B 4B9EA 5DIZA 3IMFA 4XGKA 3PSHA 3H5WA 4CIXA 2AUMA 1FSFA 2CHQA 2EARA 1NVDA 3AKYA 3ND6A 1NSYA 2PV7A 1KJQA 2O06A 5CA1B 4M38A 4N5DA 1Y33E 4ND8A 1K4KA 3GLHB 5FR1A 2NW6A 5E8JA 5J2UF 4YUYA 1HFKA 5ULLA 4A0SA 5JAUA 4EQ6B 4M8LA 4FLMA 2CLEB 4OQYA 4NFYA 2IYUA 2NU9A 4ZOEA 4C1NA 5FA5A 4ANFA 4EPYA 1I7DA 4HMOA 1VIMA 2Y2UA 1RC0A 4JI0B 3VR1A 1DWUA 2XX3A 2QAGC 4GKKB 1KFKB 2J7KA 3VDXA 4DLVA 4MKZA 3TF5A 1PHRA 2XGGA 4LN1A 1XTRA 3MJTA 2XWPA 3W6PA 2DFPA 4R1TA 2QQGA 3I9LA 1UZNA 1D09A 2PJDA 4CIDA 4D9FA 3PV0A 4IJ6A 4OL9A 4X6YA 2A58A 3BRSA 5TB5A 2VDUE 3ECAA 3HCEA 3I5UA 4LW8A 3BAZA 4YDSA 1UPTA 3HSYA 5AVKA 3AGQA 5HBGA 2XEXA 1QC5B 3IULA 4KFCA 5B4VA 3M4NA 2QLTA 4DYDA 3IOCA 3U48A 4J6FA 2DTXA 3TSCA 1R4NB 1CZKA 4EHHA 1ENOA 1NQTA 2RKBA 3G2JA 2DFVA 5EJGA 2IYAA 4BFYA 4BMZA 5JNSA 1JPUA 4RTSA 1Z45A 3JR7A 2HK8A 3N3AC 4NYJR 4C0SA 4DUGD 1BVHA 1G20E 1UK7A 1I01A 1M6VA 1N25A 4LI0A 3GUHA 4GGOA 1VE3A 3EIWA 3JSXA 4LZLA 5A2GA 1VLQA 2YZ7A 3ZU2A 1QH1A 3G9QA 2Y0CA 4FGSA 4G65A 4IDAA 3H2JA 1LC3A 1LNZA 3O75A 3WMGA 4LRWA 2FSHA 5F98A 3JQGA 2R1TA 2RIRA 2VFAA 3N1UA 3FHLA 1MB4A 1QGZA 4MQUA 3UG7A 4E5KA 4FFBB 2C42A 1OH7A 3OTGA 1AK9A 2H2AA 2ODTX 5DLEA 2XBMA 1C1XB 1ZRMA 5DRTA 3QKIA 4YJGB 3NOQA 4HG2A 4RFSB 3IB6A 4KK3A 4BATA 1JH9A 3OSZA 1IIRA 3L0SA 4HADA 4NU5A 4QVGA 5IYZB 3ZOKA 3PKJA 4QEKA 3H2GA 2BZSA 3IEVA 1YR1A 3VYUB 4DJFC 2O8DB 3F90A 4YH1A 3H5VA 4QPNA 2Q4BA 1KQOA 5H80A 1JAIA 2ZDGA 2PL9A 3DZJA 3MOSA 4MQ4A 4URVR 1P0PA 3HA2A 4YQEA 3IP5A 1LJ8A 1WHSA 1FBNA 3N8IA 5EZ5A 4AY6A 1HKUA 4BU1A 1T2EA 3IVGA 6AT1A 4YGYA 4DLKA 3CM0A 1A9QA 4IVRA 4UREA 3VFDA 3IXMA 3C3PA 5HRAA 3M4ZA 3KJQA 3PI6A 3GFTA 3ADPA 4N40A 4RLQA 4ADSG 1KEKA 1GCUA 3JSAA 3W3AD 1I10A 1ZJZA 3GELA 2IH5A 3VZRA 1KAQA 4M36A 1R5OA 1X8LA 3SHVA 4DABA 5K4AA 5A6SA 1BXGB 4TOIA 2JI9A 3E23A 3G79A 1JMKC 1DJQA 2J9FB 2VF2A 5J23A 2IHTA 2X1HA 3NH9A 1PYDA 4QE3A 4IDEA 4F4CA 5LDHA 4TTVA 3ZQJA 5LU8A 1TECE 1PQPA 2AZXA 4QGFA 1MEEA 4N4AA 2W2KB 2XVYA 3HCDA 2OM2A 3CKMA 3KYJB 1STOA 5GVRA 2W6CX 4ZC8A 4YJ2B 4RY0A 2VR1A 2QTVB 2W11A 3FVWA 4QDZA 3VYVA 4EARA 1DKLA 1X7XB 2EOAA 3O5AA 5SY4A 2M6LA 1M75A 3T4XA 1JMYA 1EXVA 1OX6A 1UXKA 2AUTA 3D7MA 3BRWD 3FPBA 1MJ5A 1X2EA 3DV0B 3SNKA 3ZV3A 4EELA 3STYA 1RJDA 1GILA 3PC8C 1K0FA 1ZD3A 3PPYA 1U7PA 4RK5A 4BEJA 4ER5A 2WMYA 2ICAA 1PJBA 3FCYA 2AJBA 4PLWA 2C82A 4ZQHA 3VKGA 4Q9KA 1E2GA 2YBEA 3FROA 5B1SA 1UQTA 3NBZC 3IP7A 4J0CA 3SXUB 4JEHA 4PAQA 5E7MA 1TKRA 3PUVA 2Y05A 3Q7EA 3DLTA 1JA9A 3R44A 1NONA 2ILVA 2R44A 4QOSA 3Q3HA 3ZD8A 3R6DA 1GU1A 1SIOA 1RJEA 4MRAA 2J31A 4P92A 3FOZA 1W36D 4Z3DA 4JLUA 4RVSA 1GFSA 5FPYA 4MWSA 1QRDA 3E9YA 3HKCA 1ZGGA 4JOBA 5CR9A 3RRZA 4GP6A 2Q2QA 4QYMA 2X1VA 3ZOZA 3NGLA 4ALJA 3H9EO 3NYIA 3ANNA 1M34A 2W8ZA 1PKEA 3PYMA 4KGXA 1GL9B 3PGA1 4URUR 2Q6IA 4BE4A 2HBRA 2Y1OA 2QUIA 2OXEA 4YMTA 3HBJA 1RE1A 3K1AA 4H08A 3ZWPA 5C7IO 1FP2A 2WDZA 4HX2A 3FFBA 2ZITA 4XM0A 1K4MA 1T3TA 1EPUA 3AEKA 2WVGA 2R62A 4WECA 3RIXA 4XJTA 1EFRA 1IWPB 1Z6QA 4MYDA 3BRCA 2XOKD 2ORED 2ZLBA 3PIIA 4G4JA 4TKZA 2QTGA 4N9WA 2G83A 2HO4A 4C2TA 3THWA 2E82A 2JLQA 4XR4A 1WW3A 1NLYA 1NU6A 1EXWA 3WGKA 4ALLA 3BH0A 5AW5A 2FETA 3P19A 4YAIA 5TMBA 3GD5A 3G5MA 3VNSA 5IVPA 3GFQA 5KO2A 1Y6JA 2KB0A 1PIWA 4MYHA 5KSWB 1UDCA 4C89A 5CHEA 5HEKA 1FRFS 4IIUA 3V34A 1IAVA 3L9WA 4ZD6A 3HJFA 1G6KA 1EP3B 3KOXA 4OQFA 4ITVA 3JAWA 1BD4A 3AFMA 1G1MA 1O95C 2WU8A 1EFCA 2ISQA 4Z51A 2FTKE 1G55A 4KN9S 3I6MA 1SBTA 1CUFA 3LXRA 4MGYR 4LZOA 1N2HA 4MWEA 1VSVA 2PUHA 4D1YA 3IAS1 3A3YA 5FPSA 1HURA 2R2GA 1II0A 3IUQA 1CLUA 4JYCA 1QBKC 4HATA 1C81A 1Y9JA 2W42A 3UYKA 5HCIA 5FBLB 3QGMA 3O8BA 2WG0A 4BLSA 2RAVA 1S0UA 4DTIA 3W5IA 4U6QA 3O4JA 4TZTA 4EFMA 3CRRA 3OQBA 3UCXA 5JVDF 3NUZA 4GOND 1PYGA 3RSZA 2ZB7A 1JHPA 3VZQA 4HC4A 4ESOA 4ZYZA 1OV4A 4JD5A 3K0BA 3TNDA 4J0EA 3DMYA 3ZG6A 1XN1A 3EW7A 3LT5A 5B6JA 2YRXA 3DKKA 3D5QA 2P4HX 5B64A 4EYGA 3RF6A 3LPCA 3NNSA 4J2HA 1SBIA 5CYGA 3KXPA 3NRJA 1J42A 2JJMA 1C80A 3FYUB 2BGIA 1YOVA 2ZIFA 3CEHA 2CLLB 1JLRA 3M1IA 3LQ2A 1HC7A 5CDHA 1DARA 4KEAA 4KLZA 1OB2A 1QVWA 4Q1AA 3TW8A 4PYRA 5TMPA 1E1CB 2YX1A 3FSRA 3N70A 3JAMA 4P83A 4MPTA 1IVNA 5AJUA 1THGA 4QKQA 3F6SA 1HOTA 1KZGB 4KU4A 1T5BA 1K27A 4JELA 2VH2A 2ZSFA 4TSFD 1GGNA 3ACBA 2R48A 5JPIA 1MX9A 3ZUGA 3OZAA 1T1RA 2FLKA 3DJYA 4IBOA 1IHOA 3J81A 5HXAA 2GAIA 2XUDA 1KSFX 2IW3A 3GRRA 3B7GA 1N9GB 4N12A 2Q4TA 5DKFA 5H9VA 1G3RA 2ONCA 3S2FA 3HY4A 3JRWA 3QLVA 1S7GA 4XDZA 4AFNA 4EKNB 1E60A 4LTNA 3WL4A 2FEOA 5LPNA 4F3NA 3GGCA 2GVNA 1ZA1A 1J0XO 3CLRC 3HGTA 4KVFA 4KWCA 4UE6A 3SJUA 4J3NA 3WDMA 5ARBA 2N1BA 5D84A 4GE3A 3O91A 3DBLB 3GLFB 2YZNA 2A3NA 3GPCA 2KMLA 4RVFA 2G5TA 3IBTA 3K4PA 3KUKA 4AF7A 5CK4A 1Z6TA 4N48A 4GR5A 1GFIA 2XUQA 4JHXA 3R7NA 3DDZX 4HGZA 3EPLA 4WUVA 1E2NA 4KLCA 4LZAA 4Q34A 3DVRX 1TZJA 3LVBA 3REFA 2ANCA 5FPHA 3R9XB 3CR8A 1WBJB 3H05A 4H3KB 4I9UA 2WTUA 1OLOA 2F9LA 3QRWA 1M2GA 1POXA 3IV9A 2VZ9A 2NAFA 4A2PA 1KAOA 5AD1A 2BZGA 1EVLA 2VLIA 3R0XA 4HZIA 5BOSB 3K71B 3EXG1 5TPZD 3QE2A 1IHXA 5K01A 1JNXX 2A67A 2Q4DA 1CEXA 2C92A 5A71A 3QEKA 1B0PA 2EDAA 4BJHB 1ZGJA 1RRCA 4O2LA 1J1IA 4FEEA 2NX2A 4K87A 3KKOA 4P54A 1PQWA 2GJKA 3L7KA 3S2IA 1SCUA 1UBGA 2MINB 2PL5A 5AHOA 1XQYA 5DEOA 3U7FB 3ZGYA 2XJ4A 5GZ3A 4WY8A 1YHYA 2Q0HA 2ZIZA 3HKBA 3O8CA 4WL0A 2YFHA 3MCVA 1H85A 3VH4A 1V8PA 2XWJI 1GYRA 2NYVA 3DHWC 1PZMA 1ONBA 2UUPA 2K7ZA 4FNGA 4FE3A 2PVPA 3B7WA 2DPGA 4RJIA 4WT7A 3UYLA 2QTNA 5ER9A 1DNPA 1DELA 1E7SA 1NVXQ 5TQJA 4JYAB 1VJ0A 2F1JA 4DGQA 1NHGA 4MR7A 2XA2A 5T5QA 5KIAA 4RXMA 1M2OB 4J76A 3PC2A 5LWQA 3DW3X 3TW8B 2PZEA 3NDPA 5DDIP 3KQTA 1ZJYA 3KV1A 2VLBA 3L8ZA 4OEHA 4W5OA 1KOJA 2FXIA 2Y9MB 1NT2A 3THWB 2BPOA 3D6AA 3MWGA 3VSDA 2QROA 2DYKA 4UNRA 3GGGA 4M0DA 3WNCA 1ZQ9A 5LB4A 3WGHA 4D3XA 2OWDA 2VBCA 2WT4A 3W2TA 1WUKS 2LRHA 2C58A 2DLCX 2B20A 4TYQA 1B2LA 1U6JA 1ZC3A 5D3KA 1M6EX 3QQ5A 4L4XA 1GR0A 1NKSA 3G9XA 3K9WA 4HN2A 4QQRA 1C7RA 4X00A 5AJVB 2EKDA 1L4UA 1HH4A 1Y7TA 1P4GA 2AD5A 1XD2A 3LUHA 3I5XA 1L5HB 1LSOA 2QB5A 4KO4S 1QGUB 1V1MA 4Q7KA 4XZ3A 1HT0A 3O95A 5DSZA 2PX5A 1N1EA 4TTSA 3GEHA 1DXOA 1MJFA 5AKHA 7ADHA 3HKCB 1V5EA 2FUCA 2GD2A 3PXCX 4RD6A 5KOHA 4KP7A 4MW1A 2GJ9A 4U8GA 2PDAA 5EUMA 2HUPA 1QHFA 3OZ7A 4ZTBA 2ZWMA 5HGJA 4AJIA 3OH8A 4C30A 4MVYA 1YIOA 5ALGA 1M2WA 5LP6A 5DI9A 4HEA1 4IFBA 1UXGA 1VM6A 1UKBA 3NGMA 5AW2A 2RGRA 2VXYA 1TT5A 1THMA 2AI1A 3I0NA 4D9CA 3QVVA 4H3HB 2PX6A 4LDRA 1YDFA 1OXBB 3Q7QA 1LBTA 1Z3CA 3F6YA 4WA8A 5LB2A 3VKFA 1GG5A 2PWPA 3KQUA 4QFDA 5AUNB 2C95A 2ZM5A 3KZKA 1YRWA 2EAUA 4F5EA 3X44A 2ZWAA 1PSWA 3ENZA 5LZ8A 1UDXA 3TIIA 4U9UA 1ECLA 2FZLA 3RVSA 2CXPA 1Z34A 2JFFA 3IBGA 4GG1A 5LCXA 1XZJA 1ZNXA 5D8DA 5G1NA 3MK31 2D7DA 3QF4A 1GAQA 5DNDA 2AF4C 2OV1A 3G17A 1RC1A 1VKRA 1XKTA 2PVSA 3EDMA 3P2KA 4IYJA 3QNUA 4MK4A 5EXTA 4ZARA 1AQ6A 1P1RA 3KYIB 5LZ7A 1DZ3A 1MIHA 1MO6A 4GOJA 1PTKA 4RZUA 4GGPA 2AN4A 1DLIA 1XRMA 2A0UA 4V0ME 3RQSA 5KMGA 2HSGA 4Q1VA 1RKQA 1BKYA 4YRNA 1DRJA 3O38A 4RS4A 3UC9A 2QZ9A 4GT1A 2J3IA 3KUUA 3OZFA 4B7UA 1K89A 1E99A 2VXBA 2A0XA 4KACA 3H9QA 4XFKA 4G0NA 4TRNA 4UMFA 1CRLA 4KAJA 4W6QA 3EEBA 4G85A 1U8YA 3CSDA 4J1QA 1QIIA 2XMCA 4YAFA 4D5GA 5BNWA 5AK0A 3COSA 3R0JA 1BQEA 3QFHA 4V0NA 4QLAA 2VYNA 2IZ6A 3TFOA 5KYKA 1A7KA 2G8LA 3GEBA 3L4BA 4OK3A 1E2IA 1NSFA 4CN9A 5B2FA 2FQWA 2QTCA 5EGSA 5REQA 2BZ1A 4IF6A 4MUAA 1SXGA 1MZVA 1HF3A 2GWRA 3A4YA 3S5JA 4YECA 3OSUA 3RFVA 2FRXA 1TJ3A 4OGGA 4DNFA 2Z1NA 3FTQA 3HEAA 2VTKA 4IOMA 5LLTA 2DEUA 1CE8B 1IPHA 1RQPA 1U8EA 3UGQA 5HR5A 2BFDA 1XCMA 1VBKA 1C3LA 4OK5A 2VK4A 3DEIA 3LCJA 1J8MF 5G02A 3L7BA 5J5VA 3U7QA 4R8LA 4UBOA 4XPIA 5LMNB 3ID6C 1VE5A 2IDZA 5JSYA 3D3QA 4TROA 5CRIA 2H5LA 1U5BB 1KMCA 2HH9A 1IEVA 4IDDA 4WTOA 3CCCA 4Y67A 3SCZA 4Z5XA 2I1LA 2I2AA 2JI7A 2CBXA 3KNZA 4KXYA 1JLLA 2H11A 2OHJA 3FG9A 4I50F 4M55A 4NS4A 4UBJA 3WHIA 5A5GA 5HKKA 3GQBB 1SCUB 1HQCA 1FCJA 1ENPA 1GU0A 1LFDB 2VF5X 3DVAB 4FDAA 4L2IA 2W6ID 3LYLA 4OQLA 5DTQA 5CLHA 6GPBA 2OHXA 3GLRA 1HUQA 3WGIA 2JLZA 4FD3A 2IIVA 1T9ZA 2XEDA 4IHJB 4OBXA 4F4JA 1VCHA 2HJVA 3STUA 3WNVA 3VR4A 4EG4A 1E3QA 4M6WB 4MLPA 3E5MA 1T43A 3K8QA 4R1QA 2W4IA 4UXJA 2KJQA 3ED1A 4ZQEA 2XVZA 3OPXA 1SU4A 3ZU5A 1QV7A 1ZNYA 1ZGCA 3RK4A 4ZYUA 5KINB 4JOQA 2I7DA 3L0CA 4B6JA 1PU2A 3UJNA 1ZCJA 4EQZA 1R18A 3TQQA 2GBGA 1A4IA 4I8IA 4QULA 1C3OB 4ZVRA 4W1QA 2JIOA 4R0NA 1UINA 3C48A 2APJA 2CZCA 3OT1A 2XV1A 1CUJA 1EAYA 2EL7A 3MSXA 5HK9A 1GUFA 4IIJF 2FR1A