2XTNA

Crystal structure of gtp-bound human gimap2, amino acid residues 1- 234
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
208
Chain Sequence
SELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords GTPASE IMAP FAMILY MEMBER 2
publication title Structural Basis of Oligomerization in Septin-Like Gtpase of Immunity-Associated Protein 2 (Gimap2)
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtnA00
1T0JB 1RJ9B 4ZV4A 2BMFA 4Q4HA 1AK2A 2CCKA 2RGDA 4LHZA 5LBIA 4RZ2A 4E07A 1DPFA 4N1AA 2QMHA 4GI7A 5KOYA 1AM4D 1W0JD 1AQYA 2C96A 2QROA 4GFDA 1OFHA 2QP4A 5F2EA 4KVAA 2W6IA 3EASA 4TQ9A 3LVRE 3PEYA 1HEIA 2C8VA 3Q3JB 1KI8A 2IEZA 5DHAA 1G16A 2VP6A 4NBSA 3NEJA 4HZUB 1KNQA 3DL0A 1UAAA 2VSFA 2ZREA 2ONJA 3NC0C 2CVFA 1XTJA 1PLKA 1AIPA 1TNDA 2ODNA 3QQ5A 4CEIB 1FNMA 5GJVC 1B23P 3QXXA 5AK0A 4BLPA 3D6TB 4W7SA 4OQFA 1ZP6A 3LA6A 5B64A 1FX0B 3D8BA 2F1HA 4Q9IA 3ECCA 3ETLA 4LY6A 3FWYA 1N0WA 3T1OA 4D6PA 2FWRA 2IYLD 3RWOA 1G8FA 1JEEA 1T5LA 2WV9A 2IA5A 4MKHA 1ANKA 221PA 4I1UA 5FOXA 3AF0A 3SYKA 4OQNA 5FPTA 4QRHA 5J4HA 1SZPA 4XVRA 1N6RA 4R7ZA 1M7BA 4DSOA 4UNRA 4AWXA 1T5IA 1QHNA 2QPAA 1N5LA 2ZVPX 5FOTA 2NZ8A 2GTPA 3LW8A 2ZJYA 1NLZA 1WF3A 5EE3A 1N2CE 5JJLA 1LFDB 1G8GA 4D2IA 1XJCA 3H86A 4NYMQ 1R2QA 4Q4LA 2OFXA 4BRWA 3LO5A 1R8QA 4GDFA 3VU9B 4GSYA 3UMSA 5FOVA 4A82A 4NCJA 4OJKA 1M74A 1SKQA 3RC8A 4ZKDA 1X8KA 2PL3A 2QGNA 2F1IA 2JJ2A 1AKYA 2QA5A 2QRNA 3EIHA 4XH9B 2Z5FA 2E87A 1ZINA 2XNSA 2DWPA 4PSAA 4Q9KA 1BMFD 3NG1A 2HT1A 4Q48A 2V7QD 2CL6X 2OM2A 4N0DA 5CIWA 3I92A 5J47A 3THXA 1ZUNB 5H8WA 1ZAKA 1D8TA 1SVKA 3AVVA 3PUZA 3AKYA 1GITA 3EX7C 5AJYA 5EP2A 1DS6A 5B57C 2RHDA 5KSYA 3D3QA 3EC1A 4JKIA 2G0TA 5EE5B 5JMTA 1W4CA 5E3HA 4PQYA 1DG1G 2LKCA 3V4FA 4R71A 5C46F 4DT1B 2CNWD 4TMVA 1ZIPA 1U8YA 1FW6A 3BJIC 3ASYA 2CCGA 5FTMA 2A3RA 2R65A 2NIPA 1R8SA 1T91A 3X1YA 2I1QA 4NONA 5LDDC 3L43A 4KBGA 4WXRA 3ADBA 1HH4A 1ZM2A 4ILEA 4PQRA 2JASA 3EG5A 5L3VA 1W36C 3ZD7A 3L2OB 4MGIR 2PCLA 3B1ZA 2FMXA 2IF2A 4AI6A 3C14C 4BZPA 5FL3A 4CT5A 4DDTA 4O3MA 4B43A 2ZJ5A 5CDFE 2ONKA 2G9NA 3AVUA 4MGYR 1NIJA 2VRWA 3BERA 4RD6A 4CEHA 2VF8A 4KFUA 3BH0A 5FL7D 5KDOA 3U61B 4QC2A 1ZW6A 2XXAA 4L8GA 1WCV1 1ESMA 2A30A 4HYYA 4X8HA 1XDBA 1XF9A 1BKDR 1FQJA 3FOZA 2GZHA 4ZDJA 4O2LA 3BH6A 1XJQA 4QBIA 1NN5A 4OK6A 3AVXA 1ODFA 1N6KA 4TT3A 3EPLA 4DEXA 1OIVA 1G3MA 1UBFA 1IY2A 5E7JA 2HV8A 3LNCA 5TMPA 3AEZA 4B74A 3MUFA 2AKYA 1W0KA 2YKGA 4M1SA 3AF4A 2FNAA 1GNPA 4JL6A 4LX0A 4MGZR 5EE1A 4L16A 2V4ZA 3KJGA 5HCNA 2JIZD 4TLCA 4HDOB 3WRXC 1NF3A 1TPZA 2WJGA 4PO9A 4U5XA 5IF9A 1KI7A 3EZ7A 1F48A 4MH0R 3ZIAD 2IYRA 2VH5R 3NVAA 1U2RA 5BN4A 1T8UA 3H0KA 2H16A 4G5OA 2AD5A 2BIFA 1RPZA 1E2HA 4JLOA 2C9OA 2BMJA 2PMDA 4NCNA 5JCZA 2CVHA 2ZSBA 4LUCA 5AUOB 3HP1A 3RDPA 1W49A 3D7MA 1SVOA 1E6CA 1H8HD 3PUVA 121PA 2RGAA 4K46A 4IVRA 4Q4JA 3RYTC 2P2LA 2ZANA 2DR3A 4Q19A 1W47A 1UBGA 3UWKA 4EIWA 3U7GA 1C9KA 3RRNA 2V6IA 4JVMA 3QF4A 3FMPB 4NCIA 4I1SA 4ZCIA 2WJHA 1GILA 2XJ9A 1XXHA 2WSSA 1RC8A 3CUEF 3G0HA 3A4LA 3B5JA 1DELA 1US8B 3K9GA 1FP6A 4FMBB 4B3GA 5B2ZA 2W6ID 1SXJE 1U0LA 2KSQA 4M9ZA 1Q1BA 4G01B 3VX3A 3Q5EA 1GSIA 1XD9A 3ZS9A 4WZBE 4D4MA 3EWAA 1E94E 4URUR 4OI2A 2ORWA 5KSPA 4V0OA 1YR8A 3EAQA 3TR0A 1CLUA 1Z6YA 4M1KA 1IY0A 4CW7A 4LBWA 4JBWA 3W5JA 4DCUA 3NH6A 2F43B 2GVZC 4KVGA 4QG7A 1U99A 4IXNA 1E2NA 4KFSA 2AN9A 4QHYA 1L4UA 2EFHB 1NNEA 1KI3A 3R7WA 3SQWA 4B71A 2JAQA 1EFRA 3A36A 2J9RA 5UKDA 3BWDD 1F60A 2I3BA 4ON9A 4OK5A 1Q22A 2GXUA 3AV0B 3GJ4A 4MGKR 3KTAB 2ZRBA 2J5XA 3WNCA 4GZLA 2WJJA 3QVUA 4MA4A 4EKDA 1E2DA 3RRYA 1KY3A 4E03A 2PEZA 4A0FA 4Q47A 1OH8A 2FZLA 2VP2A 2GF9A 5GVSA 3TUJC 1E2MA 1KI9A 1F6BA 1LF0A 2IK8A 3TMKA 2O8EB 1VCIA 3E70C 3HU3A 2DCUA 4ZDIA 4LYHA 4L5BA 4BFWA 1VECA 2W83A 2KB0A 5DI3B 3EPKA 1VYUA 2KBEA 2WKPA 2PBRA 3QY0A 4E5UA 2ZJOA 1NP6A 1ZM3A 3HYTA 4JL5A 1MRSA 1XD8A 4NZYA 5AJVB 4FW9A 2FGKA 3T15A 5JRZA 1X86B 3VKHA 1LS6A 5HZKA 3QBVA 5L3QA 1LS1A 1R0XA 3MD0A 1IJEA 1G7SA 4FMDF 4OHWA 4P32A 1GL6A 1UPTA 3ZLJA 2PX0A 2G0NA 1OXSC 3AKDA 2BOVA 2XTMA 1VDZA 2DFTA 2FU5C 3TSZA 5IRCD 1Z0FA 1FZQA 3NKVA 4US2R 1Q1QA 3MJRA 4M0LA 1W1WA 3AH8A 4GP7A 3FE2A 1F2UA 3H1TA 5EE9A 421PA 2RGEA 4HB3A 5DYGA 2W00A 1JNYA 2E9SA 2QAGC 3LAWA 4TLAA 4GPTA 4TL6A 2VHJA 5BQ5A 1E32A 2BHRA 4AIIA 2EW1A 4BECA 4D0LB 2ZRHA 4RD1A 5EXTA 4JS0A 5TV2A 3OE7D 1R7RA 4B3CA 4GL2A 1TEXA 1N6LA 3PIRA 1AN0A 4KI0A 4TYWA 2XSZD 3A1WA 3K0AB 1E9AA 4HUQB 3OHMA 3GLGA 2WHXA 4C2UA 2R6AA 3THWB 2W2TA 4PHHA 2OFOA 2RKOA 4DLUA 4IOMA 1OT3A 2JA1A 4JL8A 3X1ZA 3P4YA 3TH5A 1EGAA 1NG1A 4S35A 1RE0A 2OCPA 1Z2CA 3PXGA 3GJ3A 3HPQA 4CT4B 4HUTA 1UBCA 2JJ8A 4MKGA 4Q1EA 1TQ2A 3KJIA 4NCHA 2CHVA 1KI2A 1KO4A 3FDIA 1G19A 3OEHD 1UKYA 1XJ0A 4OL0A 4BFTA 3BB3A 1NIPA 2WM9B 2ZPTX 3EIEA 3W6OA 2FPMA 3GLFA 2CBZA 1P5ZB 4Q1BA 4XSHA 3VR4A 4B6FA 4LI0A 5EQTA 4LRWA 1M8PA 4B48A 4DDVA 5KSZA 2QU8A 2ZRNA 4FIDA 4LV8B 3AUYA 3FMFA 2VTKA 2OUKA 1SXJD 3LXRA 4NH0A 3U4QB 1Z63A 1EFHA 1XPRA 5FOSA 1A2KC 4GT1A 3IO3A 1CXZA 2FEOA 1A5TA 2FDCA 1OPXA 2C9CA 4AYWA 2NGRA 2W2XA 1U9IA 1MH1A 2AHOA 1K6MA 4HAXA 4LK2A 2VEDA 4Z1MA 4NDZA 2O8FB 1ZCBA 1RW4A 5IK2A 4O25A 3QE0A 1KI4A 3PVSA 1ZC3A 5IHPA 3A1VA 1XBTA 2QZ4A 2QY9A 4MKFA 2AFIE 1YR7A 4LHXA 1W4AA 3CO5A 1JQLB 4H1VA 4M1WA 2QBYB 5D3MA 5G40A 1KO7A 4TSFA 3CM0A 1P73A 4FINA 3TAUA 1GRNA 1Z6TA 2ASEA 4Y0VA 2N1BA 4KLNA 1GRQA 3KL4A 4II7A 2ZVQX 2O0KA 1P9WA 1P9RA 4V0ME 1G20E 4BE7B 4LJ9A 5KHOC 2XNDD 4J0QA 2IYVA 1QVAA 3THYB 4BPBA 1JR3E 3U7HB 3ZS8A 3GLHE 3OZXA 2VYFA 3MFYA 1OB5A 2V55B 1N5JA 3UATA 1HURA 2J87A 1G5PA 2VP5A 2EVWX 4BFVA 5P21A 4OHXA 2ZTSA 4JJZA 4XTRA 621PA 1GZSA 2AXNA 2HYIC 1PJRA 4A2WA 2X2FA 3QKUA 4JLPA 3QKSA 3PEUA 1IN6A 3Q8XB 4OI0A 5FBWB 3CRMA 1DAFA 4FCVA 2RB4A 4A2PA 1GKYA 4JLJA 3U3OA 1L2TA 4Q7MB 4B73A 1KOFA 2OBLA 2IWHA 2A5FA 3IO5A 2WWXA 3JZMA 2ZM5A 1G1MA 4QNMA 3P20A 2NQ2C 5A5GA 1R0YA 4A0HA 2ZJBA 4A8JB 1OSNA 4PPNA 1H8EA 4O2RA 5HCIA 4WBSA 2HLDD 4MRSA 1IJFA 4FI3C 2HJGA 4JVLA 4ACAA 4US0R 3AP3A 3VKWA 4AKIA 2JATA 2PX3A 5FTKA 4OKSA 3TR5A 3K9HA 3QOFA 2WICA 3KDSE 4S2EA 4URZR 1TL7C 2IUTA 3GEEA 1NVVQ 4UJ3A 4EPVA 1E2GA 1KTVA 2IS1A 3SJBA 2YNMA 2ZSFA 3BFKA 1F2TA 2GWHA 2VP9A 1E4VA 3PEWA 3AGQA 1Q12A 4RD0A 3GLIE 3KXIA 4XD7D 1I4LD 3HU1A 3MMPA 1U94A 3K9LA 1E0SA 3ZZ0A 3GJXC 3NXSA 3EPJA 1Z83A 1G41A 2RGNA 3BK7A 4OBEA 2GEUA 1E98A 4F38A 1KDRA 2ODBA 4V03A 2NMVA 4FCTA 3TUIC 4KAXA 3GFPA 2BKUA 4C0JA 4C7OB 4DB4A 2ZSEA 1VCNA 2G88A 2X19A 2EFDB 4G5QA 3CF6R 4YXWA 1OHHD 4G5RA 2DFLA 3GEIA 1XZQA 1CJMA 3IGFA 4Q4AB 4QM6A 1D9ZA 3RVBA 5GVRA 2QM7A 2QORA 2QMEA 2A5DA 4M4SA 3OIYA 2O8CA 2QUZA 2IXFA 4FCWA 2QT1A 1R0WA 1SHKA 3CH5A 3HJNA 4DRZA 2ZE5A 4WIAA 1GUAA 1UEIA 5AWFC 1VIAA 2I1VB 4IOJA 3U5ZB 3W8NA 4B3XA 1G8PA 1P62B 3N2IA 5FI1B 3U7FB 5HR5A 3K0FA 4M9XA 3OESA 4PC6A 2FE4A 2A5GA 3OEED 1LW7A 4JSTA 1Z22A 1OYYA 1C1YA 2ZQ5A 4LGMA 4DCTA 5M04A 3CNOA 4LYAA 3X1XA 4BEBA 4QHSA 3WBKA 4BUJA 5TB5A 3TUZC 2QSYA 3QEOA 4EUNA 5JEDA 1RRCA 3S1AA 2EU8A 1E3MA 2ZRLA 3CPHA 4JLNA 3QPUA 4DCSA 3A4NA 3DOEA 3BRWD 2FSGA 4Q03A 4XTCS 2WKRA 4KSBA 5TY0A 3PEVA 5CK5A 3IQWA 1E79A 2AL7A 2ZI5A 2XITA 4M9QA 2NG1A 3O8BA 1QHIA 2J7PA 4PO1A 4PTLA 1F5NA 3ICEA 1P2SA 1QHHB 1S1CA 1KSFX 1OXXK 3L8ZA 2F55A 2A9KA 3DPUA 4TL7A 3CR8A 2UZIR 3L0OA 1R10A 2A7QA 3THOA 2OLJA 3AF3A 5CLQA 2VO1A 4Q02A 2WPDA 1JPJA 5FUXA 2ZETA 2P5TB 5FUYA 5C4GB 4DUGA 4LC1A 1II8A 1ZNWA 4PFSA 2O8BA 5JHGB 1W36D 2WWYA 5TDHA 1AQUA 1G6HA 2JJ1D 2DFKB 2ZIAA 3UXMA 4BWYA 5JECA 1KHTA 4KYUA 2H18A 1UEJA 1OB2A 1RFLA 1T3LA 3CONA 3ZVRA 5LD2B 3JVUA 1CEEA 4NCKA 1YQTA 4Q1AA 5KNBA 3I5YA 1M2OB 1V5WA 2V1XA 1X1SA 4ARZA 4KXFB 3KKPA 1CRPA 3NHAA 1YKSA 4DXAA 2Q3MA 2VSOA 4LJ8A 3WMEA 1MKYA 1VYVA 1E0AA 3I8SA 1NBMA 1P75A 3B2EA 2P6NA 5JRJA 2FF7A 4B3FX 4MDFA 1E2EA 1I4DD 1CR1A 1G17A 1N0UA 3VHXA 1E1RA 2VSXA 3I8XA 4B47A 4Z1MD 2GCOA 2XZLA 2QN6A 4JLAA 1TAGA 3IDQA 2WJYA 5E7IA 1SXJB 2GJAA 1KK0A 1W5TA 3AB3A 1AS3A 1X3SA 1DVRA 1TX4B 5FBLB 1MABB 4CDGA 1IN8A 1XNJA 1OFUX 1IN5A 1NMXA 1XEXB 2IYQA 1K5DA 1OH7A 4H9GA 4L9SA 4BFSA 3V9PA 4QGGA 1SULA 1L4YA 3TAHA 1KMHB 2Q9BA 2W2VA 3C5HA 4TMWA 2GRJA 3RS2A 2CJWB 1BO6A 3T34A 1N6IA 3TIFA 5GJCA 2JLYA 1ZNXA 3VR3A 2MSCB 3SHWA 5K8IA 3BE4A 5JWOA 2ECKA 3ZQ6A 2O8DA 4TWZA 3FMIA 2G6BA 2ZRCA 4A9AA 4AYTA 1CP2A 2BMDA 2XEXA 1EFTA 2C98A 2J41A 3GD7A 1BYIA 3R8FA 1XTRA 3SU8A 5L3SA 3WYGA 5FPHA 2J46A 2WIAA 1E9EA 5TXGA 1IXZA 3FFAA 4ZIRA 2GDJA 3CR7A 3WHKA 1E99A 1II0A 1WE2A 2OXRA 5CLLA 1ZU5A 2O5VA 4ZCMA 2PLRA 4LCBA 2X1VA 1TF2A 5DISB 4A0GA 4DLSA 5F9FA 4EPRA 2RGCA 1OLOA 2ZE8A 4ESVA 2IHYA 2P0EA 3WYAA 4OHVA 1COWD 4OHYA 2FZ4A 3WBJA 2IXEA 2OLKA 3BB1A 3RANA 5G53C 1VG8A 4BLSA 3J81k 1GM5A 4FMDB 2FA9A 2Z4RA 1CRQA 2WOOA 4F93B 3FKQA 1RYHA 2Q21A 3U7EB 1N3BA 4IFBA 4QBGB 4D0NA 2V1UA 1E0JA 4AYXA 2Q9CA 3IKJA 1FTSA 4D80A 2GBLA 5J5CA 5HE9A 3TBKA 1WA5A 3BS4A 4IDOA 2CK3A 4CYMA 4C0HA 4C0BA 1ZD9A 3AUXA 4LC0A 2ZYTX 3SDZA 3QXHA 4YMSA 5FTLA 2B21A 3M4YA 1HV8A 1NL3A 3QKRB 5AR1A 3EC2A 1S8FA 1S1MA 3VKGA 4LPSA 1E0KA 1ZD8A 2IWRA 1D2MA 2V3CC 4PPQA 3GJ7A 3RNLA 1EX6A 4K81B 3B85A 1AS0A 4OQLA 1SVIA 1Z0AA 2FGJA 3FVQA 2FFHA 1OFTA 3W3ZB 1EXMA 1Z07A 4RY2A 4LBVA 1KIMA 4Q9HA 3I32A 2BVNA 4PQFA 1FQKA 3VAAA 4A1FA 3ND9A 2WMOB 3GFTA 3DHWC 4Q00A 2A5JA 3B9PA 1AKEA 2J7KA 1GKUB 3KB1A 4IW3B 4R2HA 3K0SA 4POAA 3K1JA 4BQSA 1KJWA 1WP9A 1XFAA 4AG5A 1TU3A 1KKMA 1R4AA 4QJ5A 2B6HA 4MKIA 3LQQA 2JLRA 5DO9A 2AR7A 3R9XA 4G5GA 3TW4A 1CBUA 1DBSA 3CNNA 1A2BA 1P72A 2ZU6A 5H68A 1VKJA 4HLUA 1E2QA 2F9MA 1DAHA 2ZITA 1ZIOA 1OKKD 1TF5A 3ZVLA 2D74A 3W3AA 2NO6A 1Z2AA 3IUYA 3WMFA 3U3JA 4TZ6A 2VP4A 4WAUA 1HQCA 1GVNB 2IF0A 4PR0A 2H1LA 2FJUA 5AUQA 1WMSA 3FKSA 2ZUCA 1HE1C 3CKLA 3K53A 3AQ4A 2REOA 4PHGA 4URVR 1VCOA 4MRVA 3QG1A 4PC1A 5DN6A 1Z0IA 2O52A 3EPHA 1NVWQ 1U9IC 2ZI4A 1AS2A 1BIFA 1RZ3A 5HZHA 1E2KA 2D7DA 1Y3AA 1ZD1A 4MITA 4LPKA 4Q1DA 1OH5A 4AY2A 1TUIA 1ZU4A 4C0KA 4HLDA 5EXPA 5K8LA 1P4SA 3L0IB 4UNSA 4PO8A 4DVGA 3LX5A 1JJ7A 3IEUA 1GRRA 1PVOA 5F9HA 3QI2A 4G3XA 3A1SA 5D3QA 1Z6XA 1YZTA 1YZKA 2CHQA 2FPLA 3GLHB 1BS1A 5G41A 2WWGA 2W0MA 1ZNZA 1M7GA 4NYIQ 3SYLA 4ZDKA 3HYRA 2PT7A 2VBCA 1UJ2A 3FTQA 1YR9A 3TK1A 1RJ9A 1W36B 3IQXA 1QZXA 3A8TA 4TYQA 4XOIA 3VTKA 4QJ3A 3NBXX 2YHSA 3BOSA 1VHLA 1HTWA 5KNDA 4URXR 1TQDA 4EQ6B 2QE7D 4BLOA 1CULC 4OQMA 4ZDWA 5AUPB 2WWHA 2R8RA 1CR4A 4B76A 4WW0A 4W9MC 2F3RA 1G9XA 4HLQB 1MO3A 2V9PA 4D4JA 2RMKA 5JWHA 1SQ5A 2P67A 3RS7A 3GP8A 4DLXA 2ORVA 4KFTA 4HZUA 5HKKD 3K8YA 5JCPA 3UG7A 2N46A 4NYMR 1VMAA 2VL7A 3T12A 1IAQA 2JLSA 3R8CA 1DAKA 3IPYA 1E1QA 1OE0A 4DC9A 4GOKA 1XEWX 4KITB 4QBFA 1FX0A 1W48A 1N6NA 3BORA 4JLBA 3U3MA 4JJKA 1ZRHA 1E4YA 4B3DA 4DDWA 5JEEA 4EJSC 1E9BA 1K5GA 3T5GA 3RLFA 1NLFA 2Z43A 3L0SA 4EFMA 2SHKA 3RAPR 5D3MB 1Q1EA 2ZR9A 5KO2A 1Z28A 1E2JA 2I4IA 1J99A 3AVYA 2GAAA 2OBMA 3TVTA 4QFMA 1Z29A 1HUQA 1QVRA 2ZI7A 2H7VA 1G3QA 3FHCB 3ZH9B 5JSZB 3GLIB 1XMSA 1KAGA 1YVDA 1U0HC 3EA0A 3H4MA 2OZEA 4DLYA 3RS3A 3B82A 1C4OA 1CJVC 2D62A 3U6KA 4GOXA 1ZJ6A 4EDHA 2QMUA 3VR1A 2B8TA 2ZJ8A 1N6PA 4V02A 2BEJA 1SGWA 1M34E 1GNRA 5BW8A 2D3WA 4WOPA 2P6RA 4UJ5A 1KI6A 2RGNC 2IUUA 4GZMA 3A4MA 3VU9A 2AWOA 2ZU0C 4DBLC 1N6OA 3BIFA 4TN1A 2BC9A 1Z0JA 2QAJA 2RH5A 1Z5ZA 3UANA 2C9YA 1S9HA 4LYJA 4DLTA 4ASUA 5FPKA 5BYKA 4WZAE 2GHIA 3LRPA 4JYBA 2GJSA 5KPDA 4A2QA 5JS8A 2CHGA 1MO6A 3A6PC 3GJ6A 3VHLB 3PFIA 1NG9A 1CF4A 2AWNA 3TE6A 1E9DA 5FFMA 1MOZA 1GIAA 2QNRA 3HU2A 2AXPA 2CCJA 3U44B 1JB1A 2ZRJA 1NSTA 2OSBA 2P5SA 3CRRA 3IPXA 4JSYA 2XTNA 1CR2A 1XXHE 4QJ4A 4EJSB 3VR5A 3U3KA 3HR8A 3DZ8A 1NN1A 2JLVA 2JJ2D 5FTJA 4B6EA 3K70C 1NY5A 1SVMA 2O0HA 3CWZA 5L3RA 2JDIA 4UNQA 1YZLA 1R5BA 1IXSB 3KJHA 4DT1A 2B8WA 1W44A 2FFBA 2GZDA 3BGWA 3AF1A 2PEYA 4JBYA 2ZR7A 5BXQC 2ZAMA 3C15C 3P1JA 1JPNA 2QP3A 3F8TA 1GDDA 3EZFA 4F91B 4XSGA 2JCSA 3N2EA 4PC3A 1OYWA 2YWFA 1SHZA 3NWJA 4A6XA 3VNUA 4TYYA 4HZIA 3L0PA 4Q7LA 2YZ2A 4YDSA 1N6HA 4YLGA 4TZ0A 3MSXA 4JIMA 1Q20A 1VTKA 1NN0A 2OHFA 4DLRA 1E9FA 1Q44A 5B30A 1GKIA 5EJEA 2WTUA 3Q7QA 2XOKA 2VP0A 5GJBA 3OAAA 4IHQA 2QPTA 4L15A 4RD3A 3RS0A 4BLQA 4YDHB 1VHTA 3FMOB 3SC3A 2PH1A 3T35A 2DBYA 4F4IA 1S3GA 2WMNB 2XAUA 3RHFA 3LQRA 4NYJQ 4I1VA 4XVUA 4LHVA 3CZQA 3MWLA 2QM8A 3MCAA 2IYYA 5AJZA 1ESNA 4PHTA 4US1R 4P0TA 5EP4A 4NL4H 4BZXA 3PG5A 2EQBA 1E69A 3AKEA 1IM2A 3RS5A 4M1MA 3FHTA 5J4LA 3KQHA 1KJZA 5FBQB 1M1YE 4NU0A 1QHXA 4IOKA 4KU4A 2Q3HA 4Q18A 4MYUA 3KFXA 2ZS8A 2CE2X 3WP0A 4MYTA 2ZYUX 2W6JA 1VYTA 1FP7A 4IVQA 3NTUA 4R2IA 4V0LA 1XCGB 2QTHA 3M1IA 4KV9A 5DIFA 1RRGA 1F3OA 1XMIA 1S3SA 2G77B 2EWVA 2IXGA 3SEAA 3SJAA 2HXYA 3QF7A 4IOLA 1FNNA 1JR3A 4OYHA 4XJXA 1ZCAA 2KWIA 3B13B 2A2ZA 1ZUHA 3NDBB 5JJIA 1DAGA 4Z8XA 1XU4A 3OFNA 2WVJA 2YINC 4URWR 1SVSA 3I72A 4TT3D 2BBWA 1N5IA 4QGFA 2QAGB 4DIDA 1A4RA 4PAOA 2BBOA 1T3SA 2WZQA 2FFAA 1G4AE 3O8DA 4DDUA 3KQLA 2IC5A 2EWWA 2CDNA 3KB2A 1EWRA 1OV4A 1W0KD 3B1WA 3DZDA 2ODWA 1N25A 1P3JA 3LD9A 4TMZA 4BGDA 2AFHE 3X1DA 1G8HA 2GKSA 1LTQA 2V6JA 3NBZC 2GNOA 2J1LA 5GADl 1HE8B 2YVUA 2OO7A 4N0EA 1IQPA 1P9NA 3FYHA 2R6FA 5CJPA 3K09A 2FSFA 4PPFA 4C9BA 1A7JA 2DY1A 1N0VC 5DH9A 4HDCA 4KODA 4HEJA 4NTZA 1I2DA 2OAQ1 3CF2A 1ONBA 2ZRKA 3QVVA 2ATVA 3GLGE 4C0QC 1XCMA 3LLMA 5KPJA 1G3UA 1TEVA 1TF7A 1XWIA 3WXMA 3OIUA 4QL3A 2HXSA 1US8A 4B2IA 2GESA 2Q9AA 1I2MA 5FUWA 1JAHA 2WJVA 2ZRGA 4PAMA 4N3NA 1UFQA 4MRNA 2REBA 2Z0MA 3Q85A 4URYR 1QG2A 4TQUS 2GETA 3KKMA 4HB0A 1P2TA 3QUSA 2GCPA 3GMTA 2QPOA 3QNUA 2F43A 3NIBA 4RKFA 5FBRB 2ZJ2A 4EPTA 1EFUA 4G0NA 1P60A 2MSEB 2WSSD 4LHYA 4PC2A 3GLFE 3MRSA 5F98A 2XB4A 3FGNA 2C04A 3MWJA 2VHUA 1KDPA 2EYQA 5C2JB 1JXOA 3EXAA 1GOTA 3EZ2A 4Q4HB 3MWYW 1KSGA 2QTFA 5C4MA 3ND8A 1SVWA 1HT2E 1HA3A 3KTAA 3T5DA 4RCZA 3A37A 1CR0A 2GBLC 2J3EA 3WYFA 4DLWA 4E22A 3TJZA 5CM9C 4CEJA 1NSFA 2IUSA 2O8EA 4F7WA 1XP8A 4OK3A 5FUVA 4B35A 2F1JA 4P4SA 1FUKA 3W34A 2AK2A 2GJ8A 1WDTA 1EFRD 1XPUA 4EPYA 1NI3A 3C4JA 3CX8A 2FSHA 1L7VC 1OFIA 3LW7A 3KKOA 5DI3A 2ZUDA 3O8RA 3X1WA 2R6CA 4DLZA 3BXZA 2HCBA 1QHYA 1W2GA 1ZBDA 3QKTA 4P3YA 3LBNA 4NHOA 1D5CA 1KMQA 4TQAA 3LV8A 2OV2A 2ZRDA 1W4RA 1W4BA 1VPLA 4L4UA 3K0EA 4LBYA 3SBEA 2YYZA 3OF5A 5CM8B 4C30A 3EZ6A 1MV5A 2F1RA 1VIYA 3R9IA 4QGAA 3REGA 2H8KA 2ERXA 3ZYCA 3TQCA 3B1VA 1VG1A 3ADKA 4HAZA 3GJ8A 5DYIA 1IY1A 4OI1A 1Y63A 1BMFA 2R2AA 2ZR0A 5HTKA 3VNVA 2G83A 4BEJA 3U6BA 2V7QA 1MRNA 2FFQA 5FH9A 1JXMA 2J0QA 2YC2C 5KYKA 2NO7A 3QXSA 4Q5IA 5J4KA 4HLUC 1HY3A 1CKEA 4P31A 2YV5A 3F5FA 1JQJC 4D26A 1XPOA 2EYUA 2VHTA 1NJGA 4C0SA 3ADCA 3NHBA 2Y8EA 1JAIA 5CIQA 2H17A 3LVQE 3K0AA 4HUQA 5GJWC 3CNLA 3THWA 2G3YA 3IBYA 1UBEA 3UG6A 1Z6GA 4FXPA 4LWZA 3VMFA 1T0HB 1DEKA 2CNWA 2AKAB 2ANCA 4MYCA 4TYPA 4DZZA 4IDQA 4KLZA 1H65A 4B75A 4TMKA 2IYUA 4ZCLA 3THXB 2KJQA 2ZJZA 4HAYA 3UWOA 2IYXA 4X8MA 3DKVA 1G6OA 4D82A 2F9LA 1AZTA 1LB1B 2ANBA 2KBFA 5CITA 1QRAA 4LYFA 4TTQA 2GEVA 4RKEA 4DCVA 4MRPA 3KQNA 1ELOA 3MGCA 2GA8A 1RIFA 1KK3A 5KTYA 4I99A 2WKQA 3VQTA 2PMKA 1IN4A 721PA 2D4HA 5JFGA 3U4QA 4RFSA 3R9WA 5EP1A 5EZ6B 3SJCA 5FPSA 5FL7A 1TMKA 1RVDA 4LHWA 2JLQA 3CRVA 3SE0A 2ZRPA 4TTRA 1DO2A 1R5NA 1TADA 1L8QA 5EE0A 3W8RA 3V4RA 4UQOA 1GG2A 2O8FA 4X8LA 1G291 1S0UA 5ANRB 4UKDA 4LZZA 1E9SA 4D0GA 4B44A 5CYPA 2F7SA 5HPYB 2R44A 5DI9A 4DEYA 2J0UA 3OIWA 3LDAA 2JLUA 2J0SA 4A36A 5CB6A 1KJYA 3I62A 4CEHB 2OCYC 3WNDA 3UK6A 2OAP1 4C0AC 2XXAB 1KZ7B 3CRW1 1Z3IX 4HATA 2HF9A 2QQEA 3B78A 2JIZA 2OXCA 1U98A 2NZJA 5JHHB 1XB2A 3ZIAA 4BFZA 5IK2D 2ZI6A 5JJKA 2ZS7A 1Q0UA 2C2HA 1KI1A 3THYA 4GMXA 1XD2A 3B9QA 2OCAA 3KJEA 3KQUA 4M21A 5FR1A 3TKLA 1G5RA 4TSFD 5FBVB 1NVVR 2OCBA 1SKYE 2BCGY 2X2EA 4O0MA 4XVQA 2ZEJA 2JLZA 2G1KA 2QI9C 4GP6A 4JVNA 1P2VA 3GPLA 1H8HA 1XZPA 1P7CA 4GBMA 1DTSA 2Z83A 3UIEA 2EFCB 5EP3A 3C8UA 1E9CA 5EZ5A 2G1JA 3A1UA 2DPXA 2Z4SA 3IIKA 3LWNA 3UKDA 3EWSA 2BM1A 5EXXA 3CX6A 1EX7A 1T9HA 4HAUA 4X8OA 4A8JA 4LJ5A 3SOPA 3VFDA 4BASA 2YWEA 4RD2A 3CPEA 2QGZA 2TMKA 2PJRA 4TYNA 5LB2A 1A82A 4W5JA 2J0VA 2FSIA 2X77A 1G8YA 3ZQJA 4Q4JB 4DLVA 3ONWA 4P4TA 5BWMA 2WWFA 3WRYC 3NC1C 2CEAA 1CS4C 1AZSC 2JLWA 1YU9A 4RFVA 2P65A 4W5WA 4FMCF 3A58B 1T6NA 3DMDA 3SQXA 3NDPA 2ODEA 3T1VA 3QF4B 4C2TA 2IYSA 1NBME 1XXHB 2C99A 5CB8A 3DVLA 3LLUA 1H8ED 4C3ZA 2R6DA 2HT6A 4RZXA 5FOUA 2DYKA 3IBGA 4XWKA 4PSVA 2B7CA 1J8MF 1ZMXA 5E7MA 1G7CA 3F3YA 4DCNA 1DO0A 3L82B 2FH5B 4R9UC 1ETUA 1Z47A 1Z06A 4XWOA 4IDHA 3BBPA 4BFXA 1QHSA 1O87A 4MUBA 1G21E 4C7OA 3AVOA 1JEDA 3K0CA 2WOJA 3REFA 5SZIA 4AC9A 4GMDA 2XTZA 521PA 3TSWA 2X8AA 1BYUA 1Q21A 4OJQA 4Q4AA 1QG4A 3U60B 2ZSDA 3Q7PA 5E4FA 4XIGS 4IEIA 4LSGA 3R7WB 3MLEA 1AA9A 2BM0A 4TLBA 2NO1A 2BV3A 2FEMA 2K5UA 4JKYA 5B58C 1K8RA 6Q21A 2BJVA 4EAQA 4G5SA 4TMTA 1PLJA 1GAJA 3MAAC 3N5CA 2WAYA 3B1XA 1KI6B 4MUAA 4UXIA 5CDFA 5AUNB 4ITRC 1EWQA 3K9NA 2ZRFA 5IDVA 2XX3A 5K8UA 4G1UC 2QP9X 5DNYB 4K8OA 3PENA 3EA5A 4DIEA 3SBDA 4B3BA 5FI0B 4YXWD 3RSOA 4IJMA 4IVPA 4B2LA 4Z54A 3AP2A 3TLXA 5KDDA 2GZAA 5K8TA 4I4LA 2CL0X 5G3YA 4EPWA 1EK0A 4AKEA 4CF7A 4M53A 4Q7KA 3AP1A 3QENA 4QNRA 4Z8YA 1W5SA 2H92A 2VF7A 2QMOA 1U8AA 2RGGA 2OEPA 1KK2A 3K70D 2NOAA 1R5OA 1AJEA 5L3QB 2HF8A 1E96A 1IONA 4JLVA 4BFYA 4DJTA 1QHHA 4UXHA 3Q9LA 3OE7A 4MRRA 1JR6A 1PUJA 4PZLA 4DWJA 1YZUA 2YOHA 3CX7A 1YHNA 3P26A 3SZRA 1ZC4A 5CK4A 2XSZA 3H84A 1FOEB 1RRFA 1KK1A 1G5TA 4B32A 1NLYA 2QEQA 1F2UB 3B6EA 3AKCA 1YZGA 2DB3A 1Z6AA 4JBXA 4PANA 4B34A 3HWSA 5DSZA 3DOFA 3PR1A 4W5HA 1E79D 3WNBA 2RGXA 4Q7JB 4JYCA 3OIVA 1X1RA 2J7PD 3LBIA 2ATXA 4Q1CA 2GILA 3B60A 1J8YF 2VHQA 4LV5B 4QXAA 2GXAA 4ZI3A 1M7HA 4Q9JA 2WAXA 2WPDD 3OEHA 1DAMA 1D6JA 4HDQB 5JS7A 3JVVA 1T3HA 4DUGD 2PLFA 3GLGB 3Q5DA 1OJLA 3K09C 3SR0A 5TVKA 1NVXQ 4QOSA 3KXKA 1LNZA 2D7CA 2IL1A 3TGPA 1NKSA 4UNPA 2OG2A 2RAPA 1YRAA 1IXRC 3QG5A 1J2JA 2ZS9A 1Q3TA 1DOAA 1SXJA 3C16C 1JI0A 5E95A 1QF9A 3DEFA 3H2YA 1X8JA 1MABA 2EFEB 3GEHA 1KO1A 1GTVA 1XEXA 2OESA 3GJ0A 3KKNA 3EIQA 4TMXA 3UMFA 3DKPA 2QSZA 4MYHA 1ZM4A 3KXLA 2IYWA 1KMHA 1CJTC 2XJ4A 3ZJYA 1NBMD 1G3RA 1NY6A 2CJWA 1LY1A 1PLLA 3PUWA 4QHTA 4RVCA 3GLFB 3PJRA 2Q6TA 3KFVA 3FHOA 3AVPA 1E1RD 1PV4A 3AM1A 4I1OA 3AF2A 2H5EA 4C0LA 4CVNA 1CJUC 1J90A 2V8OA 5J4VA 1ZNYA 5ELXA 2V54A 2QT0A 4M8NE 1XEWY 4DKXA 4HB2A 1FL9A 5FOWA 1T8TA 1KGDA 4M9SA 4CEIA 2QG6A 2ERYA 3PQCA 1VCMA 3QPWA 3UMRA 5BYJA 2XNDA 2DWOA 4B33A 1CTQA 2KI5A 3QBTA 4HI0E 4PC7A 1BH2A 4BFUA 3SFZA 3CW2A 1J70A 4LV6A 5CYOA 2N42A 4IKEA 2R62A 1S9DA 1WBBA 2YWGA 2D2FA 2VA8A 2VLIA 1W7AA 3AVWA 4BLRA 2J45A 1MO5A 3D31A 3P32A 3CRQA 3ZVMA 3FFBA 3FPAA 1M6NA 4PZZA 2D06A 3QEJA 1FUUA 3T1TA 4QBHA 2RCNA 2YC4C 2UVQA 4GOJA 1UKZA 4NP6A 1P6XA 4EPXA 5A4JA 4DSTA 3AVTA 4A92A 4TTPA 3AGPA 5BN5A 1WBDA 2HDNB 4M1TA 3SN6A 5JZVA 2CLSA 1XMJA 2ZRAA 1HQYE 1S96A 2MSDB 2IS6A 3A1TA 1KDTA 4F4CA 2HLDA 4EFLA 3PCRB 2CLCX 3BC1A 3W9YA 1OH6A 1E2PA 1U81A 1ZM7A 3HPRA 1XTKA 3CIOA 3QKRA 3QKSB 4QM7A 1DARA 2QL6A 1Z8FA 2O0JA 4GNKA 1JECA 4RCYA 2GEDA 4LOAA 4B2PA 1B0UA 2NPIA 3IIJA 2FX3A 1UM8A 1WRBA 3TSOA 3GCGA 3ZDQA 2OT3B 4E09A 4PX9A 2OE2A 1XRJA 3C5CA 2LCFA 4JT2A 2CK3D 4LJ4A 4XD7A 3B7GA 2IYZA 1WB9A 3MG9A 1OF1A 2PT5A 4CEJB 3RRMA 1TQ4A 4TLEA 4A0RA 4P4SB 3QIAA 3CBQA 2C78A 3LH5A 3U2QA 2ZE7A 3PUYA 3QPVA 4D25A 1KKLA 4RJLA 1AGPA 1D2NA 4RD4A 4A4DA 5SZJA 4DSNA 4MDEA 1F2TB 1I4TD 1OHHA 2VIIA 1G4UR 3L8YA 4U00A 821PA 3BD9A 1ZUIA 4R98A 2Q0HA 2C03A 4FWIB 1ZYUA 5J40A 2FV8A 3C7KA 1U8ZA 3BB4A 1MT0A 3IILA 3G5UA 3SFVA 4M1OA 5AJWA 1OIXA 4NYIR 4Q66C 2CXXA 2QENA 2HYDA 2REXB 1UDXA 4FWTA 3ZGXA 1VG9B 1LF5A 2IEYA 3JZAA 3OEEA 4YQFA 2HJVA 2R6GA 3LBHA 5AJXA 3MJHA 4AKHA 1KO5A 1DG3A 5H70A 1S2MA 3W6NA 1II9A 2B7BA 2UKDA 3E5HA 4PAQA 2O8CB 3CB4A 2LKDA 5C18A 4KYIB 3IEVA 3G82C 2BBSA 3DMNA 3CWQA 4IDPA 1OXTA 1O3YA 4L9WA 2ZSAA 4HAVA 4ESHA 1Z0KA 3K70B 4DHEA 1RRPA 1YJ5A 4HSEA 2MMCA 1R6BX 3BFVA 2F6RA 3K0FB 4DB2A 1J7KA 3EZ9A 3N70A 2GVDC 4V0MA 1KZGB 3RS4A 2BKEA 3FKSD 4RZUA 2CL7X 3RRZA 3ICQB 2ZAOA 4PPGA 1KY2A 2ZRIA 2IT1A 1PZNA 1IN7A 3B1YA 1P61B 2BJWA 3SYNA 1LVGA 3GLHA 4QGHA 3RABA 5DN6D 3SNHA 4NPHA 1EG7A 4KO8A 4WXPA 4CRWB 3S1AB 2AD1A 4AK9A 1WQ1R 4IXMA 1OXUA 2FOLA 4KFRA 3VR2A 4QKQA 1S4QA 1XEFA 2HUPA 3CF0A 5DGXA 1U0JA 3TVDA 1SKYB 2JJ1A 1NJFA 3LY5A 3ZZUA 2D2EA 2WBLC 1OIWA 1JALA 4EQ6A 1Q1ZA 1XTIA 2YJTD 3LFUA 4BLTA 1P2UA 2ZROA 5JBQA 4CZ2A 5LPNA 2FN4A 2IS4A 2FPKA 3BFXA 4FD2A 4WA7A 2H57A 2Q3FA 2XZOA 2IS2A 1KAOA 4I81A 2QRZA 4JLDA 3QXJA 4RFSB 2C77A 5DE3A 2CE7A 3SI7A 4C4PA 2BDTA 4ERNA 1XMVA 4HB4A 3KQKA 2UZ3A 1II8B 1X6VA 2O8BB 1CIPA 2W58A 5EXSA 1Q3HA 3QXCA 4JT4A 2HEIA 5LB4A 4GRAA 1Q57A 3VX4A 4LJ6A 4LBZA 4A8JC 4DSUA 4ZKEA 4IRUB 2BBTA 4FMCB 3SJZA 4YMTA 1E2LA 2L0XA 2CMKA 4Q21A 1UKEA 2ZYWX 1D9XA 4ARZB 3I5XA 1YZNA 1XX6A 2J0UB 1FTNA 2KE5A 3MWKA 4IDNA 4A6PA 2DWQA 1TUEA 3LX8A 3DDCA 1DE0A 4Q01A 1TQ6A 1W0JA 4JZKA 1IOZA 3EARA 2BWJA 4RSGA 3RSLA 3GLIA 1GL9B 5JSZA 1ZVQA 5EUMA 5JWRA 5C1BA 3ADDA 2RGBA 1G7RA 2GCOB 1E1QD 3I73A 1W46A 4PZYA 1NMZA 4CGZA 5SZKB 8OHMA 1XD2B 3P4XA 1IHUA 2BEKA 3O47A 3EW9A 2Z6VA 1XCPA 3LXXA 3HR7A 4Q1FA 2QQ0A 4TLDA 2GAOA 4ABYA 1FFHA 1ZM9A 4YONB 3HDTA 1TU4A 5G3ZA 4UNNA 3GJ5A 1W2HA 2A78A 4LJYA 4BZQA 2JLXA 4ZPXA 2JEOA 1D2EA 3I3SR 3K0CC 3KUCA 4HAWA 5L8VA 2CLDX 4YMVA 3I4LA 4V0NA 2RHMA 3CZPA 4LJAA 4F92B 2ZI9A 4A15A 2ZRMA 2ORIA 2O8DB 1QBKC 2FG5A 1YE8A 1UADA 2C5LA 1UF9A 1KDOA 3U44A 1COWA 4UXJA 5IT5A 2B92A 4TL8A 2GXSA 5L3SB 5KDLA 5BN3A 1V43A 4EJSA 1MO4A 1NN3A 3KZ1E 2WWIA 4ASUD 4IEEA 4NYJR 4ZIRB 4YMWA 3T1QA 5F3WB 3IHLA 4AKGA 2C95A 3NEYA 2GXQA 1E2FA 1OW3B 5EUQB 3RWMB 3WP1B 1NMYA 2R9VA 4KSCA 1QDEA 1OXVA 2WJIA 2A5YB 4LJ7A 3M6AA 2NTYC 2ZJAA 2LWIA 4IFEA 2GF0A 1LV7A 1NVUQ 4KJZA 3TRFA 1EESA 2IHBA 4V0KA 3TQFA 4JVSB 3AVQA 4U02A 1PUIA 4YC7A 2XZPA 3IHWA 1UKVY 4LDJA 1GP2A 3DO6A 1AGRA 1KYIA 5TARA 2JDID 1EFCA 4OI4A 5HKKA 3RC3A 4NMMA 4KBFA 3W90A 1RKBA 1TTTA 4TL9A 1U90A 1X8LA 5FPYA 4AG6A 4AURA 1YZQA 1KSHA 5DLQC 1GFIA 3M0EA 1DADA 1JBKA 4CIDA 3KKQA 2JGNA 2GJKA 5HE8A 1MR3F 1Z08A 3SS8A 4EFNA 2WSMA 2XB2A 2OFWA 3W5IA 3O8CA 1VG0B 3CPJB 2BCJQ 2ZYVX 3C41J 3X2SA 3SHFA 4WZ6A 5H1YA 3CLVA 1NRJB 3IIMA 4PSKA 4NKRA 5LD2C 1SVLA 2BMEA 3ZD6A 5DHFA 3E2IA 3ASZA 2XOKD 2P6UA 3GFOA 3PUXA 3OAAD 3VR6A 1IBRA 2AX4A 2YOGA 4Q9LA 1OKKA 4U7DA 2ZXUA 1KO8A 3NH9A 2GK7A 2WWWA 3NBFA 3PV0A 4OQXA 3UPUA 3ZVNA 2XGJA 1E9RA 1XTSA 4M2LA 4WVFA 3WY9A 3DM9B 4ZI2A 2PZEA 3F0TA 2PZGA 2DHRA 3QJYA 5JI3E 1E2IA 2PCJA 1GNQA 2ZI3A 3ZZTA 4HLCA 1CU1A 1G7TA 1GL7A 1Z0DA 4JLMA 2NPFA 4D4LA 3CH4B 2IX3A 2QAGA 4AD8A 1SXJC 4YMUA 4M1YA 1HT1E 1BOFA 4OHZA 3T61A 5SZHB 3U3RA 3E1SA 2PJZA 4P33A 3R20A 4H1UA 1HYQA 2F3TA 2E1RA 2GJ9A 4JMPA 2W6JD 1KNXA 2OBNA 3QSYA 5CJ2A 3I61A 2QTVB 1DAEA 2VHCA 4JLKA 3TW8B 1QHGA 3W6PA 2NO9A 2IBMA 1JR3D 1G3IA 1R0ZA 1KSJA 3DM5A 3PITA 3T06B 2QBYA 1CJKC 2PZFA 3GQBA 5KUTA 3OFND 1RYFA 2DFNA 5JLJA 1A1VA 3NBYC 1WXQA 1FPMA 2ZUBA 5FR2A 2MMGA 3KUDA 3BH7A 3KX2A 1N5KA 2YOFA 2YWHA 5J4YA 5KNCA 1FMLA 1YRBA 5FTNA 4D81A 4BRUA 5JI2E 4MQBA 3V00A 3I1FA 4NE2A 1JJVA 4M22A 4Y0AA 5KSOA 2GK6A 4ZO4A 5A0FA 3WHLA 4KHZA 2NO0A 3WMGA 2P3SA 4D4KA 1T4GA 2VQSA 4FN5A 2EFGA 2W0SA 4PXAA 3TNFA 1DAIA 1XTQA 2IYTA 2WIBA 3BAFA 3FB4A 4XWAA 2QE7A 4P4UA 1GWNA 1FMJA 2GCNA 1UDWA 2VPPA 4RZ3A 2ZE6A 2IW3A 2HCJB 3B8HA 4Z51A 4ACBA 2J59A 5KU1A 3Q72A 2AK3A 1G18A 4F4JA 4KCGA 1G64A 1NKTA 2OILA 1YR6A 3P27A 4PHFA
chains in the Genus database with same CATH superfamily
1EUDB 3IPCA 4UMDA 1AK2A 2HZBA 1XZCA 2CCKA 1B2RA 4G5HA 2DTXA 4KK3A 3H9QA 4RZ2A 4E07A 5KOYA 2QMHA 1AQIA 1WF6A 3P2EA 4HDNA 2R4UA 4RHTA 3DV2A 4KWEA 1OFHA 3OMXA 1POWA 3ZI4A 1FSSA 2GI4A 2QP4A 1GTSA 1ZLYA 3P45A 1E8DA 5F2EA 3MJSA 2W6IA 3LY9A 4HRXA 1JIVA 4UAUA 4B7XA 1CC1S 4UHKA 1KVSA 2LV8A 2E0IA 4ZHSA 3IVXA 1GQFA 3TQSA 4HL6A 2JIDA 2VP6A 2WTBA 3HDVA 3JU3A 4HZUB 3QE2A 3BCHA 3W9SA 1GZ5A 2VSFA 2YIVX 3LPLA 4E2ZA 1VE5A 2X1MA 3H5AA 4HLNA 1PLKA 1JDZA 2GA9A 1TNDA 1N5RA 3QQ5A 3QLJA 1FNMA 4KDFA 2DPLA 3QXXA 4KRYA 4LWPA 3W04A 4D79A 2F8MA 2D4AA 4BVFA 2HJWA 5B64A 1P5RA 2CB0A 1RJWA 1CWUA 1GCIA 4ZT4A 1FX0B 2Q5LA 2YYSA 1Q7BA 2C3UA 2VPYA 4II3A 2VJPA 3MRVA 5ALVA 4HGZA 4Z0NA 3ETLA 2GHTA 3FWYA 2M6KA 4ZI5A 2IYLD 3RWOA 5JC1A 1G8FA 1JEEA 2G04A 3LKVA 2JAUA 1T5LA 3BJEA 4MKHA 3OZRA 4UDNA 1ANKA 1FUYB 221PA 4HFRA 4X3OA 4Y2YA 3RKUA 4OQNA 3V8QA 2BE7A 4QRHA 5BVGB 1WZ2A 1X77A 2L69A 4KB5A 1AUOA 3LUDA 5H02A 4OMUA 5TEVA 4GC9A 4UNRA 4BKMA 3SIXA 4AWXA 1T5IA 3QYAA 1QHNA 1N5LA 3BWXA 5FOTA 4RELA 1G0OA 2GTPA 4R1UA 1H1LA 1Q11A 3QU7A 5F33A 4JQOA 1RWVA 2OK7A 1BWPA 1NURA 2EGUA 4U5QA 1XJCA 4NYMQ 3PEEA 4JYPA 3ZQ4A 4BMZA 2HMYB 5ADUS 1LLQA 5CBKA 2VDKB 4KFCA 2CD9A 3PX2A 1FYDA 2W70A 4YRZA 1SUEA 2ZTMA 1AKYA 3FYSA 5THKA 1OVGA 2GMWA 2DPYA 3WJAA 3S40A 1SU7A 2Z5FA 5E4JA 5I7OA 2DWPA 3OPYB 1IU9A 3GO4A 3PYXA 1FRQA 2V7QD 3M2TA 4MI1A 2YFHA 3BCRA 3RARA 3KJQA 3EMVA 1XKLA 2EKDA 5CIWA 4YFVA 3FNQA 3I92A 5J47A 1ZUNB 5H8WA 3QMWA 1E1NA 1D8TA 3CH6A 3DVRX 3PE6A 4RK4A 3BD7A 1NATA 4DIKA 3CLTD 3EX7C 3Q40A 4G6ZA 1G1AA 1DS6A 5B57C 3ZBUA 3URMA 3KVVA 3EY9A 3U3ZA 5KSYA 1JDBB 5FO1A 1JFFA 1VLVA 1WHSB 1Y8QB 1E2UA 2ZIVB 4BUCA 2HREA 1WMFA 4MWCA 3ELYA 5E3HA 1GAXA 1Z12A 1R6VA 3F90A 3ZHCA 4TMVA 2G9RA 3L01A 3LG2A 3UUGA 4H77A 1ZIPA 3SM3A 3EXEB 1U8YA 1FW6A 1ACJA 2R97A 3ASYA 4ZVNA 3EYAA 2A3RA 3Q6NA 1T91A 4FBLA 5EUCA 5I9BA 4RVSA 1RSZA 4O2AF 2I1QA 3R24A 3OPXA 4NONA 3V46A 5LDDC 4X20A 3AIMA 4WXRA 1TIBA 1HH4A 4PS0A 3GT0A 5JYEA 2JASA 2YN4A 1E62A 5KYNA 4M9CA 4GZ6A 1NM5A 3I2JA 4MGIR 1JRLA 3DF9A 1K4KA 4AI6A 1IRXA 4OVKA 2Y1GA 3DEZA 3DFMA 3OE4A 4ZVLA 3ZU3A 2BGWA 1Z88A 3SJ7A 4ZXPA 4D1YA 4BNIA 4P92A 3Q6IA 3ZV5A 4B43A 2ZJ5A 4MICA 2OB1A 1L4FA 2GNPA 2ONKA 4PF1A 4BV9A 1NIJA 5KIAA 4RC9A 4MYDA 2VF8A 3V4OA 1QFMA 2GERA 2O2YA 1FLVA 3U61B 4L8GA 3FI9A 1WCV1 5JE8A 3RTAA 5GINE 1HOXA 5A9RA 1OXKB 2K7ZA 3CEJA 3LPMA 3CXRA 4HYYA 1QMPA 1FMTA 1I13A 2IITA 1XDBA 1FQJA 2QT9A 2CJFA 2GZHA 3F4LA 4FLEA 2DR0A 4O2LA 3R1IA 2VAMA 1T1IA 4ZOLB 4DPKA 5GV7A 1CFJA 1ODLA 2O48X 5A2QA 4R1TA 1JEYB 1QH9A 3QVJA 1SA0A 3BD6A 1T1JA 1E89A 2ETVA 2P7HA 2RHCA 1ZVVA 5FWNA 2DUWA 3I2GA 3BJMA 1G3MA 1EX9A 4B31A 1YRQA 4OGKA 3BXXA 5CLHA 1W88B 4B74A 1SU8A 4XQGA 4YBRA 1W0KA 1YJBA 5A0TA 2RHHA 1WR8A 4ZGBA 3MNFA 3T7DA 5CGZA 2H2GA 3DLCA 3RFCA 4JIGA 5KJEA 4MGZR 2I03A 1KS9A 2Y0EA 3U9SA 1KRHA 4R2MA 3GVXA 3KJGA 2JIZD 4HDMB 4BO0A 2WJGA 4J94A 5CP8A 1KI7A 2WHEA 4KMRA 4Y1EA 4AY3A 4OB6A 2O14A 1KZ6A 1M34A 1ORRA 1W87A 1NBIA 3MXOA 2FG6C 4MP6A 4A5SA 4EOGA 5KWSA 4UE3S 2H16A 3GGDA 2AD5A 3UB4A 4YBZA 3L4BA 4J1NA 2XH8A 4YV1A 1E2HA 5C3MA 5CURA 4JLOA 1RHRA 2BMJA 3I34X 3HC7A 4NCNA 1XHLA 1XRMA 4RETA 4ZVVA 5JCZA 1P2BA 4Y2HA 5AUOB 1V5GA 4NXNB 1IATA 2OYCA 4MV3A 2P9HA 2YJ3A 5A05A 1TKBA 3LKBA 3D4IA 3OTWA 2WFLA 1H2ZA 4OD0A 4K46A 4UEOA 3RYTC 2EBWA 2HH9A 2NLOA 2Z5LA 3O1LA 2QLTA 3EOZA 1AZWA 1SU4A 1UBGA 2ASVA 4NE7A 3OVMA 4V3BA 4CL8A 4YHBA 3C0KA 3GYGA 1C9KA 3TZHA 3PJGA 4DQKA 3COVA 3ROZA 2ZYDA 4EB6A 5MGBA 4V0QA 4HK4A 3ZI0A 1VRWA 1CV2A 4LFBB 4TWIA 2WSSA 1SUWA 1ZZEA 2CYCA 1L8LA 4IF4A 5IYZF 3A4LA 4LMAA 4QASA 1MJNA 3A2LA 1FP6A 4NY1A 4B3GA 2PMCA 3OTGA 2BTOA 2C3OA 2MWMA 4N5HX 5MHTA 4RZIA 3VPCA 1OILA 1WSDA 4QSHA 4WZBE 5B1DA 3WMWA 4D4MA 2A6PA 4B83A 2I1LA 1GVHA 1U0RA 3EQ8A 4OFZA 3RB8A 3TSCA 1L1FA 3U5TA 2PRIA 3OJXA 4ZVPA 3EAQA 2HF7A 1J8VA 4GGPA 5IC5A 2GCEA 2NNWB 1Z6YA 1FSZA 2X23A 4NJOA 3ZE2B 2QUKA 5IFLA 4F3TA 3PK0A 3NH6A 2F43B 2GVZC 2QN7A 3H7AA 3FCOA 4IXNA 3ADOA 1EJ2A 2YS6A 3KEOA 2QTWB 1YR3A 3QW2A 4K9OA 3RU9A 4MLCA 1EIWA 4E5VA 1T3GA 2BGKA 3R7WA 1V47A 3PVZA 1WOMA 4B71A 2JAQA 1DIOB 1NPTO 4RS3A 1NVFA 1PL6A 2HOQA 4TS9A 4X97A 5BQPA 3A36A 2RHLA 5D85A 4B0PA 3D8RA 3BWDD 4JOBA 4NZ9A 2IBTA 1H9CA 1AGXA 2I3BA 4JB0A 4ON9A 1QUFA 1PD0A 2GXUA 3AV0B 2CF6A 3L1HA 4HJRA 2XCQA 2FKNA 3WNCA 4EKDA 5BYAA 3WLKX 5IJ0B 1T3ZA 1IZ7A 5LZ4A 3GUZA 4QDZA 4E03A 3L7NA 2BI4A 4Q47A 4YIHA 2FZLA 2IODA 2IU3A 3F3KA 2AG0A 3PVCA 1IPHA 1TGYA 4PTZA 1RPAA 5D00A 1P1BA 2WUWE 3TUJC 3BXGA 2IEDA 3AUTA 3P9SA 5K20A 1F6BA 2IK8A 3K2BA 4MXDA 4ZC1A 3TMKA 3E70C 2C0QA 2QZSA 1RQGA 5HMLA 2Q3CA 2XBMA 3OZBA 4I6JA 2WYIA 4JSRA 2QRPA 5MN4A 1RWWA 4E0BA 2QLLA 5LQDA 3BGDA 3WNQA 5IFKA 3HJBA 5MDHA 1VYUA 3TNDA 1EHIA 1KAEA 3V8MA 1TXGA 1GDHA 2Y1OA 1YIAA 3BZBA 3QY0A 3WGOA 3H2BA 4UU0A 3FSGD 1E60A 5AJVB 1X86B 1A9YA 1AXEA 1PYDA 3QBVA 4CLHA 4MIOA 3HJCA 3H2IA 2NU6B 1KYYA 5COAA 4YT2A 3AL2A 2VDWB 4YGYA 2X3UA 1RHKA 3AK4A 3MQFA 5E3IA 1G7SA 1R18A 3ZLJA 3DQQA 2D0DA 4WASA 5EXEA 2FPWA 3FB1A 2G0NA 1V6AA 4AXXA 4TKZA 4N54A 2WTMA 4MHSA 1ESCA 2EP5A 2XTMA 4NATA 3U4AA 2DFTA 1ISRA 2OB2A 3AFMA 3C7AA 4UARA 1M8FA 4RA6A 4JBHA 5GMOA 4LTDA 4US2R 5CA1B 1LSJA 1ZN8A 3H1TA 3KR0A 3GEGA 2E21A 1YFKA 4ANFA 2E9SA 3KHSA 4A23A 2EW1A 2X8LA 3CU5A 3RNOA 4K9PA 2XMBA 5LP1A 3E0XA 2WHPA 3RUPA 1YZHA 1YQUA 5GZ6A 1MIOA 3I1IA 3OE7D 1EVZA 2P69A 1GXSA 4H6WA 5J58A 2TMYA 3PC4A 5EHGA 1TEXA 4PQGA 3VKFA 4TYWA 2WV7A 3RS9A 1AQJA 1PFQA 1NC1A 3GLGA 2SECE 2YJGA 1JSXA 1LPOA 1SCDA 2HEGA 2WHXA 3N2YA 4RGQA 6PFKA 3THWB 3RU7A 3JRXA 3OIDA 3C6XA 4QREA 4V2UA 1DQSA 3R7FA 5HJ2A 5PGMA 5KYUB 2UZ0A 3HZRA 4WVLA 1IJKA 5TPZA 1KEZA 1PT8A 4DMUB 3TH5A 4R3NA 3G9QA 3VYRB 3G2HA 3L7MA 4MPDA 5BY2A 1C1DB 4TTAA 1LPNA 3JYPA 3RBAA 3PT9A 1ISMA 1Z5VA 1Z2CA 4ZO6A 3GJ3A 4L51A 4R9NA 1HC7A 3NFRA 1UBCA 4TLMB 1TQ2A 3C6ZA 4CKEB 2CHVA 2ZZNA 1B6RA 2CVOA 2JFOA 4CFYA 5AM1A 5L7WA 1TW3A 3PNPA 2ACKA 5BYBA 4AO7A 2VNAA 3JRWA 4B84A 3WFZA 4EG8A 1MXFA 1P5ZB 4R98A 4B6FA 5T3UA 4PG4A 1IJBA 5ALSA 1X80A 1YAJA 1JEAA 3L1UA 3QU2A 4HN4B 1T5TA 1VL5A 3AUYA 2VTKA 3D59A 4NH0A 1WU8A 3SAJA 3VZQA 4JD5A 2FDRA 3K8QA 3NHWA 3TCKA 3G0GA 2YTZA 2XRZA 1CXZA 2XCSB 1A5TA 3R0VA 2RJOA 5GZ3A 3GGJA 1H1TA 3BG5A 2NGRA 2W2XA 1PX0A 4ID9A 4NDZA 3U3DA 1F2DA 3I76A 4IMIB 5IK2A 4NDAA 4DM7A 1M76A 2PMFA 3QYPA 2XT6A 4RMGA 3A1VA 1VBKA 1E59A 5K3DA 1LRLA 2O2ZA 2QZ4A 4I55F 2DT5A 4KXMA 3GGOA 1B7GO 4QAQA 1CJCA 4LTMA 1CETA 2VS1A 4G2TA 3VZDA 2H31A 1OZFA 4ZAVA 5GM2A 2ISCA 2QN8A 3KEQA 3T9EA 3ZDCA 1NI5A 3IRVA 1BFUA 4FINA 2R1TB 4E88A 2A9RA 2JK0A 1W93A 1FX1A 4W99A 4C5AA 1JHAA 5ALHA 1C9JA 4II7A 3CEPB 3EEIA 3ZGOA 1NJ2A 4JKOA 1PYGA 3FX2A 1UMCA 1F3LA 2O4CA 4E2XA 2AJTA 2WAOA 2JH3A 3A2MA 2GX6A 4J0QA 4LJ9A 1THZA 4NG4A 3PT5A 2IYVA 4MV7A 1IEQA 3F67A 3FBTA 3G59A 2BFAA 3OZXA 1EVJA 2VYFA 1NZDA 3MFYA 3KIPA 5SICE 3T9FA 4FFBB 5BV2P 1HURA 3GAMA 3LT4A 3L79A 2W42A 2EVWX 2GD1O 5DBIA 5HM8A 1PWYE 4E4YA 1EI9A 2ZTSA 4RM2A 4NPCA 1J2YA 4I46A 4ALNA 4XWYA 3LCCA 3BQMB 3DBIA 3K31A 4XTRA 2AXNA 2BAGA 5DCYA 4F8JA 2HYIC 3COPA 2X2FA 3QKUA 4CMCA 1PT5A 4JI2B 4F6LA 3EOAI 1IN6A 4Z4GA 1LZKA 1CQXA 1GKYA 4JU8A 4MPRA 1L2TA 4Q7MB 2BEWB 1ZNQO 3SVTA 4MR7A 5L4NA 5E9QA 1Z38A 3JASA 3PZBA 1NT4A 2GK4A 4RW0A 4MS1A 5KC9A 1RHJA 4OIFA 4TOIA 2NQ8A 5ES4B 2NQ2C 1BE1A 2XEDA 3RBXA 4D8XA 1NW6A 1EK2A 4GZ3A 4MUXA 1IMOA 1XTTA 2W2QA 1KL7A 2QU7A 3K0BA 1JN0A 3JSXA 1Q7GA 1LJLA 4MCAA 2FZKA 1IJFA 3CVUA 4FI3C 4ACAA 3IQGX 4GM0A 3AP3A 1C8KA 3JWGA 4AO6A 3OUTA 2XTAA 3QTLA 2JAHA 2PX3A 2C8LA 1Y4SA 5FTKA 2EFJA 4D9GA 1KEPA 2YCLA 2YUIA 3TR5A 4I6EA 1G2QA 3GMIA 4S2EA 3VZPA 2O2JA 1MC1A 3FCUB 2IUTA 1NVVQ 4QQRA 1YXMA 3NHYA 1ZWLA 3U7QB 5T4FA 1XZJA 5NULA 3OZDA 2G4CA 1QE5A 1PW5A 3QE4A 4X1IB 4Z53A 3AGQA 4OHPA 1CUJA 1U0TA 4LKRA 1NPDA 5DTRA 3ZXYA 5F7XA 2P4UA 4RV4A 1C1XB 1I51A 3HB5X 5T3YA 5EUBA 1CR6A 2Q4EA 3K9LA 4YB8A 1KVRA 3E8SA 5EMMA 2JGKA 3CJQA 1E3WA 4OBEA 1E98A 4LW8A 2QDXA 2XQIA 1UPUA 3ZIUA 3H3XA 4V03A 5AHWA 1NPYA 2W98A 4ND2A 1HDEA 4FCTA 2IH5A 3SXUA 3EBPA 3E2MA 3GFPA 4FD3A 1VCNA 3N2NA 4TUYF 1X1BA 2EFDB 4W1PA 5KTKA 3CUVA 4L72A 4BMCA 2OENG 4QYIB 5JAIA 2VYNA 1SB9A 1TJNA 4Q4AB 1UK7A 2VYQA 2HBYA 1W19A 3I9KA 1D9ZA 3RVBA 4HQOA 1BX1A 2QMEA 4UUPA 3KJXA 2IVZA 5DBEX 4AJKA 5A4FS 2IHNA 2XB6A 5EIFA 3S4YA 2PUBA 3UT5B 1QPZA 1G59A 2IXFA 4ZYZA 1U0BB 1R0WA 3CH5A 4I9UA 2IQ5A 3O1JC 5J59A 4CFSA 4O2BF 1OX6A 3WADA 4ZQIA 4AG3A 3FMVA 1VIAA 1I3NA 3Q1KA 4CU2A 6REQA 2PGXA 2D1QA 5KYXB 1PX2A 5JMPA 3W8NA 3A6HA 4B3XA 1KWKA 2AVDA 2QRLA 2Q5QA 3BXOA 1OAOA 1TZCA 1O8CA 2FE4A 4HXGA 3FVWA 3N5KA 1OYYA 1C1YA 2ZWMA 5SYAA 2ZQ5A 4DA6A 2CXSA 2EZUA 2NXNA 3S2IA 5JAPA 3KZOA 3X1XA 5AM5A 4XI9A 1X1EA 3WBKA 1TC2A 4BUJA 4RK6A 3CPSA 5JEDA 1QTNA 2EU8A 1ZPDA 2ZRLA 1C3VA 1CUBA 3N2LA 1W85A 4G85A 4YAJA 4ZALA 3VVMA 4MKZA 4BJ1A 1Y0BA 1Z5PA 5C8VA 2ISQA 3QEMA 2PQ2A 3H2GA 5TY0A 4BNYA 5IXSA 2FWIA 1E79A 3VYVA 3IPRA 4JJEA 2NG1A 3ESBA 4OQZA 2J7PA 4PTLA 1F5NA 1OAAA 1K5HA 1P2SA 2A9VA 2OC4A 1S1CA 2EL7A 2RH8A 3L8ZA 3ORHA 3ICEA 3A14A 2A9KA 5FLEX 3CR8A 1KDYA 3ZVKA 3L0OA 1R10A 3PX3A 2LD4A 2PH3A 2YS7A 2V7XA 4FFOA 1PL8A 3AF3A 4WFJA 3WLSA 2VO1A 4WK6A 2EC5A 4IGFA 5CNJA 5JFOA 1ZN7A 2GPJA 3CNBA 1GL3A 2CUZA 3UVEA 2PK3A 1K7FB 2E6UX 4LC1A 1II8A 4PFSA 4DUGA 4EDFA 1B1AA 2FDXA 3BEOA 5JG7A 5H82A 4DRYA 4RKRA 2H2FA 1XIVA 1JG7A 1JLLB 4FOSA 4R16A 4KR0A 3PFBA 2AOUB 5JECA 3HNRA 5K0JA 4MW0A 3FETA 3MOIA 3IEPA 3GIWA 4AVYA 1U2PA 1NJSA 2C1EA 3CONA 1T3LA 3I4CA 4HWRA 3ZVRA 3JVUA 5IANA 4NCKA 3V4LA 4MVXA 3IL2A 1JIUA 4D9BA 1V5WA 4DMLA 1U8FO 3UMMA 1O95D 4B17A 2PUFA 1CNMA 1X1SA 5EIXA 1JG1A 3G7NA 3KD2A 3QWIA 3LSTA 2CXHA 4L8YA 2WPNA 4Q1VA 1CRPA 2R8OA 1Y42X 2J9GA 3EVFA 5AKIA 1V39A 3GD5A 2Q3MA 3IAUA 2VSOA 2XVYA 3PE4A 1ZD5A 4G1BA 2IV2X 4UUBA 3I8SA 4YP6A 3CF4G 1VKZA 2H2IA 3UPDA 1P75A 3B2EA 3M7IA 4PYQA 5KVQA 2GM4A 1IY9A 3WLEA 2NZVG 3VYUB 3DBLA 4LGCA 4FGLA 1JLKA 1AKNA 2BLLA 3I04M 2HV9A 2AYXA 4TXLA 1EWYA 2XADA 1A2OA 3A3PA 2LIVA 5BSWA 5J43A 2JPDA 2Q2WA 4X7RA 2WJYA 1BFDA 1X3SA 2C2GA 1TX4B 4LF5B 1MABB 2PRKA 3IUEA 2HNBA 2ZPAA 2AUMA 1OFUX 4CDGA 5B2EA 4DR6B 3BKWA 2EXXA 2IYQA 5KYVA 1FJHA 1K5DA 3NM4A 1GQ2A 3CEAA 1R9NA 1I24A 2WFZA 4QGGA 2YXBA 3G2OA 4NENB 1GZ6A 3C5HA 3B1KA 2W4IA 3FVVA 4OJMX 5FBKA 5DK4A 2VJCA 3W2IA 2JFZA 1OX4B 5J2TA 2CXPA 2JLYA 1XLVA 2WD7A 4LE2A 3A26A 1DT5A 4F6RB 2HPZA 3OWXA 5E6SB 4BJHB 3RG8A 5AVTA 1A9XA 1Z4OA 3WL3A 4XCVA 3ZJUA 3ZCPA 1F2VA 1SXHA 4HT3B 3BJZA 1C9EA 5KTTA 1TA9A 2V7BA 1Z9BA 1GG5A 4KR6A 4X7BA 1EFTA 4YCLA 1YIDA 4LYGA 3UHOA 5JD6A 1XTRA 3DXFA 1FJGB 4IS3A 2ZULA 4XIYA 1ECJA 5FPHA 5GZ1A 3K30A 3T0IA 4CKZA 1AD2A 5BSFA 1CX9B 1V8FA 2Y9MB 1VJ1A 3O91A 3FFAA 4CODB 2VTBA 4HN9A 1U8TA 4NK4A 1E99A 1II0A 2OECA 4MR8A 1ZU5A 2O5VA 1GADO 4QQKA 4LFCB 1VLLA 2A9QA 2DKNA 2X13A 2R6HA 4E6EA 1T8YA 4KX5A 5K3FA 2X1VA 3QUTA 3HY6A 4JASB 4DLSA 4OGWA 5CAEA 5F9FA 4KE6A 1E6WA 3UXHA 3R6GA 2XCOA 4MHOA 4ZHQB 1B8VA 4D74A 4O5AA 2Q99A 4MW6A 3FCEA 3WYAA 3KQSA 1I5OA 2F3UA 3P5SA 3F2VA 1YS1X 3TLGA 4OHYA 3WBJA 2OLKA 2C29D 3BB1A 3P7MA 3WGUA 4Z9YA 2MT9A 3MGBA 4KWTA 1CRQA 1YU6A 2WOOA 4ND1A 1H3NA 4MTLA 1RYHA 3UWSA 1FVHA 2ZIFA 2Q21A 3U7EB 2R1VA 3L84A 4GEGA 4C6TB 4C89A 4HV4A 2V1UA 1E0JA 2HMTA 3IKJA 1CUGA 4ND8A 4OLFA 5KYTA 1KRXA 4EY8A 1WA5A 4UPEA 4IDOA 3L46A 1VJGA 1BE6A 1ZD9A 2YWJA 3AUXA 1UMBA 2ZYTX 1H05A 4LDZA 5MN6A 1FDUA 1ZK0A 1O6FA 3QKRB 4BVBA 1U3CA 1FFGA 1PK8A 1T9GR 2XMSA 1FSGA 3HVJA 3SX2A 2H5JA 4HDRB 3VKGA 4NS4A 3EEBA 4EAAA 1XQ1A 1ZD8A 2II6A 2VJDA 4BN5A 5EI5A 4PPQA 1MHTA 2V3CC 3I53A 3B85A 6ABPA 4QJBA 2XMZA 2DEUA 1GZUA 1M6VA 1GY8A 2AH5A 1R0CA 1Q0LA 4XGRA 2FGJA 3FVQA 1AKVA 1IUKA 3O7WA 4X1YB 3RRJA 4BMPB 1ECBA 1GU7A 4LYYA 1J22A 2B25A 3QNMA 5SY4A 1EXMA 2JAWA 1K06A 5C53B 1KP3A 2JH9A 2XQVA 4RY2A 4LBVA 4Q9HA 1PQWA 3QELA 3N2GB 5BSVA 3DHYA 4WFIA 2X6RA 2AN1A 2O1XA 3OEYA 5ALZA 1P7PA 2Q7DA 2NTVA 3B9PA 1T2VA 3ZPXA 1AKEA 2VNKA 3E22A 2ZYIA 1YBMA 2J7KA 2J5BA 2A0KA 3KB1A 2DRIA 1U2SA 1R88A 3WA7A 3K0SA 4NCAA 1NR7A 4BQSA 1R8XA 1WP9A 5DHTA 2AW3A 3KSDO 1XZGA 5DX8A 1Z5GA 1KKMA 4TWBA 5DO9A 2B6HA 1X92A 2G5CA 2OMEA 4MKIA 3RYCA 4CBVA 5HDQA 3PNMA 4XQCA 3E9YA 2BH9A 4RHEA 3TW4A 3UJ9A 5TNXA 4MPTA 5FV7A 1A2BA 4XUGB 5H68A 1VKJA 3PZRA 4HLUA 1PS8A 4LNUB 4OFWA 2R2GA 3DVAB 1ZGHA 3MB8A 1TF5A 3OM9A 1UJNA 2Q1SA 2XECA 1QIKA 5J2UB 5DBGA 3B89A 4IKOA 2O2IA 1XHEA 5EZYB 3TM5A 1JSCA 1RABA 4MDHA 2ID4A 4M8KA 3M1YA 4UATA 3LUFA 5CCEA 1GZ4A 1UINA 3B3AA 5ERGB 1OGJA 4DJ5X 3RJ9A 4FI3F 3NUGA 4PR0A 4C04A 3MB5A 3DCIA 1WMSA 1LQ2A 3AU9A 2ZUCA 2HA0A 1HE1C 3K53A 1A8UA 3HYLA 2QW0X 1T6BY 1K8ZB 1IFXA 4PHGA 2PMBA 4BP1A 4URVR 1XL1A 1RKUA 4CQMA 4MRVA 4YCSA 4J0KA 2D5BA 1NVWQ 5AM0A 5SV2A 1AS2A 4YT5A 4DG9A 2C5FA 3Q2IA 4C7MA 1E2KA 4OXQA 4X94A 1SO8A 1Y3AA 4RE6A 5IUKC 3IT3A 1MB9A 3JW8A 3BGOS 4EG4A 5BR1A 4HLDA 4MWTA 5EXPA 5FYQA 1VSUA 4C6SA 4UNSA 4F84A 4WADA 4M7WA 1XWWA 3ICVA 3LX5A 1JJ7A 2HGSA 1TM4E 1D1PA 3EMBA 4IV0A 2JL1A 4R9SA 4R8RA 4YH1A 1RXSA 4G3XA 3UGTA 5F9HA 4YMIA 5KNCD 4OAQA 1GTRA 1GSOA 1XVIA 5IVIA 1YZKA 4FE7A 1BU5A 4PY2A 2I33A 2O20A 2W0MA 3GBPA 2QVLA 1M7GA 3L4EA 4I19A 1JHQA 4O5OA 5ENDA 3T52A 4DN6A 4YK7A 4ZDKA 1IUPA 2PT7A 3HGQA 4P7FA 1EUDA 1UJ2A 1Z39A 1YR9A 2QQGA 3AFOA 3GGCA 4YEDA 4BMVA 4PZDA 2V7EA 3BF7A 5C32A 1ORIA 4XOIA 1QTQA 3GJZA 4UHDA 2P27A 3VTKA 2JZNA 1B3BA 3L7YA 3VJLA 1MVNA 3N07A 1V4NA 1K86A 5KNDA 2H2AA 1PWEA 4ZDWA 4ARSA 1OTXA 4WPGA 3HCDA 2Q4TA 4YRCA 2XA2A 2H52A 1CR4A 4YAOA 5I4CA 3K05A 2NU7B 3F6YA 4CV1A 5ITVA 3S81A 1VE9A 3U4MA 3GI1A 1AA6A 3GP8A 2CNKA 3QMPA 2PVCA 3AL0C 2B99A 5ERXA 1ZIDA 1P1IA 4Y6SA 5AVVA 4HZUA 3HHEA 4E15A 5FD8A 5FLKA 4I8IA 3PUHA 4JFRA 2IU4A 1WW2A 4NFSA 3HO6A 5DHFA 3R8CA 4BN0A 4QUEA 4DC9A 3OBBA 3BMNB 4MROA 1FX0A 2FZWA 4RACA 2B3DA 1LDBA 1XMPA 2X9GA 4AZTA 2V0NA 1E64A 4DDWA 2XCRB 2JKVA 3QVLA 2RHWA 3QHQA 1T6ZA 2VF4X 3FDXA 3T5GA 2Z43A 4TVKA 2H9AA 4G25A 1A5BB 4IQ0A 5KO2A 5GIPE 1E2JA 2CLOB 1J99A 3AVYA 5YASA 5BVGA 4PYNA 3R40A 1NQWA 1GA6A 4WHMA 5IBPA 3TVTA 3TFOA 1UFVA 3GBVA 4RSHA 1VPDA 3FHCB 3II6X 4OB8A 1XMSA 2PYZA 4PG6A 1M72A 2HRDA 3ME5A 2EHJA 2ZBPA 4J2OA 3RS3A 4DLYA 5BSHA 2AZTA 4C88A 4K03A 2UUBB 3LOQA 3U6KA 3SF8B 3OLQA 5BMVB 3TLMA 2QMUA 3TGWA 5A71A 1KJQA 1Y7HA 2BEJA 1ZRMA 3O2SB 3P2MA 3UMJA 5BW8A 4EZIA 4C5BA 1NVDA 5KWIA 3WNVA 3ISTA 2P6RA 1HYHA 3DEYX 4UJ5A 1A2QA 3D3JA 3A4MA 4PIMA 4GWLA 3SF0A 1N6OA 4CWAA 3BIFA 4ZZ2A 2ZQZA 4TN1A 2BFEB 3T3EA 3UANA 2PS1A 5LKRA 2C9YA 4LYJA 5FPKA 3BTUA 2DZDA 3TE7A 2GHIA 3CUKA 1BNCA 4JYBA 2GJSA 4DLKA 3OPYA 4KN8A 2CHGA 1K0FA 3K71B 3GJ6A 4IHJB 3AUUA 4IIBA 1CF4A 1BS9A 2QRKA 3SNKA 3EIFA 3B12A 3EUWA 3TE6A 1YC2A 3HU2A 1EBBA 2ON6A 1ZUNA 3DGEC 3KVNA 3U44B 2E48A 2FWBA 3HJRA 3HI6A 5ENZA 4EF6A 1WKBA 4DARA 2P5SA 1DXQA 3CLSC 1RLMA 5LQKA 5GONF 2EQAA 3ORRA 3SS7X 4MUFA 1M8KA 3GCWA 5BN3B 2PL9A 2G70A 1WHSA 1Y8QA 3U3KA 4WNYA 5CXUA 1NN1A 2JLVA 3E61A 3FUUA 2FSVA 1R0RE 1BQEA 3K2EA 3FA2A 2Z1MA 1E7YA 1IXSB 1IEXA 3KJHA 1OAOC 2YX1A 4PX3A 2L17A 3EXEA 4I0WB 1YB1A 5IBRA 3DS8A 2TS1A 2ZAMA 2LZ0A 3ZWVA 4FFSA 4RK7A 1S2OA 5LMUB 3RUEA 4ZQFA 1C4XA 1XDDA 1NW5A 3ONDA 4WDRA 2X76A 3GYBA 4FDLA 1OYWA 2YWFA 1PFWA 3MHPA 1UOPA 4TWAA 4TYYA 4YDSA 4D8UA 3DDOA 3LL7A 5G0VA 4NH4A 4IPTA 1ORVA 3Q7IA 4JIMA 3DMTC 3HL4A 5L4LA 2ZWPA 2P4EA 1TEZA 2B5OA 3WGZA 4HMOA 2DPMA 1ZH2A 2O2SA 3KT6A 1CUUA 3RJ5A 2XOKA 3JQ9A 1CQZA 4M0KA 1GUFA 2V3WA 4IIXA 2VJYA 3RS0A 2D00A 4LOKA 1WD7A 2AF3C 1KIFA 5C1IA 2QX9A 5MN5A 2C88A 2NAPA 2Z2IA 1F51E 2G8NA 2X9NA 1LSOA 3C7CB 3V2HA 5DNCA 3ZE9A 4R1OA 4FGJA 1E4EB 2VK1A 4UUOA 5JXGA 3C98A 2FVXA 2JLAA 4ZOLA 3AKEA 2AOWA 2EW8A 1JEYA 2VT6A 4M1MA 3S68A 1VJRA 5JO0A 3KQHA 2DFDA 1JIQA 5FBQB 1M1YE 3RS8A 1U3FA 5E6UB 1JIJA 1FUEA 1XOIA 4KU4A 4FNAA 4MYUA 3GN2A 1W88A 1T5DX 3WWPA 1EDDA 1VMDA 3TZQA 1WVMA 2A94A 2FETA 4MYTA 1AC5A 2BTEA 2QD5A 1PDVA 1VYTA 1FP7A 4IVQA 1XR3A 4R2IA 1CDZA 1SQGA 5E1BA 3NOXA 3SEAA 1XMIA 2IXGA 5AM4A 1QWSA 3TB4A 4ZARA 2HXYA 1USVA 1E5LA 1FNNA 4HDMA 4IOLA 4CHTA 4KUGA 3K9FC 4AL4A 1ZCAA 2JH8A 3AFHA 4M8LA 4AJEA 2A2ZA 5IT0A 1QZ3A 2JI7A 5K4AA 4TTIA 1XU4A 3OFNA 2NZUG 5ECGC 2YINC 1L5GB 1SVSA 4RKYA 2PZKA 4PAOA 3JQCA 2BBOA 5KAMA 2FFAA 3G2NA 3N2KB 2E5LB 5I3ZA 5LZ2A 2Q0SA 4E1AA 1AKUA 1YTLA 4O02B 3C3JA 1W0KD 4ZICA 4CM8B 1N25A 2GYVA 2W8ZA 1NASA 4TWRA 4CG3A 4WY2A 4KQIA 3BRQA 4MVJM 4JI6B 2WE7A 5J9FA 2GNOA 1LLUA 3JX9A 3M2PA 3P0HA 1GKLA 1DIBA 1W5FA 2OO7A 4G9BA 4N0EA 4ZU3A 4LXIA 3UAGA 3OTHA 1IQPA 1P9NA 2J3IA 4Q0MA 4YGXB 1X9HA 2NUPB 4FM9A 4J0FA 3F46A 2I1WA 3K09A 3INNA 3M70A 2HQ1A 3IQEA 1UZNA 4NTZA 1YS6A 3CF2A 4RTMA 4ZK6A 4C0QC 2IZ6A 1Y4ZA 1SJ9A 4F4UA 1FTQA 2CXRA 1W1IA 3DAGA 4MIYA 1VPTA 3BUSA 3TIVA 3QUQA 4HF7A 4EY7A 5FBHA 1LC0A 5C0OE 2QSUA 2GESA 3NTOA 4U1RA 1I2MA 3DBVO 2XWJI 2JHPA 3LO8A 3OOYA 2LP4Y 4BZWA 1UFQA 4UE6A 2B4YA 4MRNA 4URYR 4LOIA 1GAEO 2DGDA 4RMHA 2C0CA 3KKMA 4ND6A 2Q3LA 1QQ7A 4HB0A 4MW1A 2FQYA 1P2TA 2JGIA 3QUSA 1SC1A 1PNQA 1GPKA 3JWHA 3FH0A 5JCOA 4ZGGA 2F43A 2HTEA 4PW0A 3T5AA 2ZJ2A 4K9KA 1RBYA 1EFUA 2O2CA 3LHIA 1U5BB 1PO7A 2WSSD 3D9QX 1CS0B 3GLFE 3DG9A 3R0JA 2P4SA 5F98A 4BL5A 3UM9A 1FZTA 3U09A 2R0QC 4Z9XA 2YWXA 1LI4A 1YL5A 3FLAA 3OQPA 3Q11A 4QBKA 3PC8A 1JXOA 3EXIB 1GOTA 4Q4HB 4WNCA 4A1OA 3IESA 5JISA 3ZU2A 3ANNA 2YZNA 1SBHA 3ND8A 1E1CB 2VVTA 2H2DA 1HA3A 3OP1A 3T5DA 4D9NA 4L74A 2CJXA 2EX0A 1H85A 2XKBA 3H2HA 2EZ9A 5IJ0A 1O9BA 4GR5A 1QYIA 2Z9CA 3D3KA 3FJOA 5C7YA 3QEKA 1RMTA 3LHDA 4OBBA 3RTCA 4K9RA 5JD5A 4CEJA 3Q0IA 2XUJA 4Z4EA 1F1BA 2VUTA 2ENWA 2OBYA 4EELA 4I2VA 4BB0A 2V6BA 4WN9B 1XP8A 4F0JA 4B4UA 1XSEA 4B35A 1WP4A 4UM9B 2IHZA 1FXSA 2RGWA 4JY7A 1DFHA 2AK2A 1W6RA 2GJ8A 3GVPA 4C20A 2P62A 4RK5A 4AW9A 4GBGA 2FSHA 4L7QA 4HVLA 3C5VA 1LBQA 2ZUDA 3V2GA 1R27A 2R6CA 3E9MA 4PZUA 3WK7A 3WL5A 1RQLA 1WUIS 3L06A 3PPYA 3PUJA 4JP8A 2GSWA 3BXZA 1ZMRA 4MQ4A 1IE3A 3I9LA 5DX1A 1QHYA 3QKTA 1ZBDA 4BNJA 2VCYA 2VXOA 3GOQA 4PBSA 3LV8A 4QARA 2B8JA 2NU6A 3PFKA 3U9LA 2VDWA 2QYTA 4NK5A 4RAOA 3VVBA 1W4BA 4F5EA 1Y5LA 2XW6A 1NVBA 4J4HA 4Y1RB 1QAMA 4WLNA 2YW9A 3H9UA 3SBEA 1UT5A 4ZC8A 3ZNQA 3EZ6A 4HGPA 2FRXA 1MV5A 2XA1A 2J3DA 3R9IA 4LA4A 2W37A 3TQCA 5DTQA 1R6UA 2X4IA 1DHTA 3NHLA 2HBRA 1YASA 3NATA 1EFLA 5CA1A 3LJKA 4QQNA 2OORA 3TQRA