2XTNA

Crystal structure of gtp-bound human gimap2, amino acid residues 1- 234
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
208
Chain Sequence
b'SELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE IMAP FAMILY MEMBER 2
publication title Structural Basis of Oligomerization in Septin-Like Gtpase of Immunity-Associated Protein 2 (Gimap2)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtnA00
3SBEA 4X8LA 1XD2B 4A1FA 721PA 3IBGA 1SKYB 1F3OA 3VX4A 2P67A 3UWOA 2ZM5A 1KI3A 2IUSA 2G0NA 4A36A 3WP0A 1EGAA 2GEVA 1W44A 2I1VB 3GCGA 2QPTA 5H1YA 4QBHA 4NYMR 5AJWA 2QPAA 1XEFA 1S3SA 3PXGA 1VIYA 1VG8A 1UM8A 4FMCB 4TQ9A 2HJGA 4XWOA 3DM9B 2ZYTX 5FI0B 3VR2A 4P3YA 1U0LA 4OQMA 4LPKA 2IX3A 2N1BA 4ACAA 4DRZA 2JLXA 3AF1A 3FOZA 4YDHB 4M9SA 1E98A 5JRZA 1YZUA 3VMFA 1ZVQA 2QA5A 5EXXA 2BBWA 4DEXA 1FZQA 4PX9A 1GTVA 1GL9B 2GBLC 4N0DA 5CYPA 1U9IA 2QY9A 2CLSA 1Q1QA 3I8SA 1PLKA 1N6IA 3A4MA 1CU1A 2WJIA 4Q1FA 2D74A 3WMGA 1GILA 3KXLA 2ZJ2A 1SVSA 4HAVA 5HZHA 3OEEA 4GFDA 4LWZA 4KODA 1Z22A 4C9BA 2IS4A 3IPXA 4ZKEA 4A2WA 3WHKA 3ZZTA 3U7GA 3DKPA 2C96A 4OHYA 5DNYB 4OJKA 1UFQA 2O8EB 2FFHA 3KL4A 4ZIRB 3U60B 2YNMA 3LW7A 4AK9A 1F2TB 3GEIA 5GJBA 3EC2A 1NVVQ 3GLGA 4F4CA 1W1WA 4FCWA 4EDHA 3CH4B 1KIMA 2YYZA 1Q57A 4R7ZA 5DGXA 1WRBA 1OT3A 5KHOC 2ZRPA 3GQBA 1VCMA 3E70C 1H65A 1MABA 4KVAA 4JL8A 3IEUA 4AURA 5EE0A 2PLFA 3EWAA 5TDHA 1GSIA 3L2OB 4X8MA 1E2MA 3ZVRA 2AXPA 3SYNA 1T3LA 2FG5A 1GITA 3AF4A 1DAHA 2ZSEA 4II7A 5EP2A 2VHTA 3SBDA 2Z0MA 2A9KA 4RD0A 1H8ED 4JBWA 2BIFA 1M7GA 2R2AA 3THOA 3CRQA 3L82B 1U0HC 4Q4JA 4QJ5A 5HR5A 2YWFA 4D26A 2QRNA 3DKVA 1OB5A 2J7KA 2R8RA 5JFGA 2FV8A 1CIPA 3KUCA 2WKQA 1IN6A 4N3NA 3C41J 1NN3A 1NI3A 2YINC 2QSYA 2CLCX 3AVQA 3W6PA 4Q9KA 1E9EA 2OILA 2EYQA 4QM7A 2GEDA 1SQ5A 3AF0A 4C0AC 2C03A 1KI7A 2RCNA 2EQBA 1W4CA 1Z06A 2CHVA 2EW1A 4DCUA 4I1SA 4AG6A 2ZR0A 3GJ0A 1KK2A 4IRUB 4KBGA 2FMXA 1FQJA 1BOFA 4LOAA 4P4SA 4RD2A 4B47A 5AUPB 2ZJZA 2Z4RA 4TYWA 1NBMD 2FE4A 1D2MA 1KSGA 4DLUA 2XNDD 3R9WA 1DOAA 3B85A 2F3RA 2QM8A 4RFVA 2EFCB 2PT7A 1M7HA 1N0UA 2KE5A 4G5GA 1X1SA 1Q12A 3CZPA 4URXR 1S1CA 3QKTA 1D8TA 1E0SA 3ZDQA 1CS4C 4PPFA 4B3BA 1KI8A 4B44A 4F4IA 4B71A 5CB6A 3B13B 4PHFA 5GJWC 1E2DA 4A0HA 3FHOA 1S96A 3AKDA 4JVNA 5FPKA 3X1ZA 1LTQA 3W5IA 3KKNA 2G3YA 1P9WA 3PEVA 5A0FA 4DLRA 5FOWA 1TU3A 3QEJA 5DI3B 1G5PA 4YMTA 1COWA 1QHXA 2AN9A 4HUQA 4LJ6A 1QDEA 2R44A 1T9HA 4MYTA 2OUKA 4C0BA 2IYQA 2BM1A 2XZPA 3B60A 4JYCA 3F5FA 2RHMA 5AWFC 2P6NA 3IILA 4OHZA 4FXPA 2ZANA 3HYTA 2QMOA 1MKYA 2F1IA 3G0HA 4ZCMA 3THXA 2J5XA 3GLFE 1NG9A 5FPSA 1KO8A 1W46A 3ONWA 5BYJA 4UXHA 3UMSA 1OHHD 2X19A 4TMZA 3GJ8A 2HYIC 2ZI7A 1CJVC 1XMIA 3GLIB 5DSZA 1E4VA 1Q22A 1OYYA 1KK1A 1Q1EA 3MJRA 4NPHA 4PHHA 4LY6A 4D0LB 2Z83A 1W48A 2EWWA 1GG2A 3M0EA 2WOOA 5E7IA 1N6PA 4LZZA 4UNNA 1U9IC 4A8JA 5C18A 3UMRA 1ZW6A 3GEEA 1QRAA 3LO5A 2R6AA 1NG1A 3IEVA 4B43A 3DMNA 3P4XA 3AKCA 2JEOA 3Q7PA 2D2FA 2CVHA 2OBMA 3QJYA 4V03A 3WBJA 4B2IA 4E09A 1Z63A 1E94E 2CNWD 2NOAA 4IFEA 3MJHA 1U8YA 2J0VA 3QKRA 3BWDD 3NG1A 4LBWA 2PZFA 1R0ZA 4ZDWA 3ADBA 2IF0A 2ZJ8A 4HLUC 4PPNA 4LJ9A 3Q72A 3W3ZB 1FTSA 1Z8FA 2W0MA 3CX7A 1DS6A 4PPGA 1EXMA 2IYSA 4EUNA 2AR7A 4CYMA 1OKKA 2CDNA 2OEPA 4U02A 2QE7D 5JEDA 2ZYUX 2SHKA 4DDTA 2QQEA 4ARZA 2ZJ5A 3ASZA 3CKLA 3CNOA 4Z1MD 3H84A 3CX8A 4Q1AA 2NPIA 4C0LA 4TL7A 3QIAA 2GJKA 1ZD1A 5CM8B 4JIMA 2QGZA 1FMLA 5KSPA 1RJ9B 3TAHA 1JEDA 2N42A 2XX3A 1HURA 3BFVA 1P61B 1P5ZB 3B1YA 3CPJB 1E9BA 4M1SA 4PQYA 1BKDR 2YKGA 1VYVA 4DC9A 1AKEA 1MO4A 3KQNA 2GCOA 3AM1A 3IHLA 2ZS9A 4HSEA 4TMXA 1YHNA 3SYKA 1II9A 2V8OA 3C15C 4PC1A 4B2LA 1U8AA 4HEJA 1IOZA 2O0KA 2WHXA 3O8BA 3ICQB 2NGRA 4JVMA 4DLYA 1P9RA 4HUTA 2Q9CA 2QT0A 4G5QA 5FTJA 1ZIOA 1E9CA 4PO1A 1Q20A 3GLHE 4HB4A 1RRCA 4R71A 4LUCA 3DEFA 4B3CA 5JLJA 5FH9A 4CEJB 3TUZC 1TMKA 5AUOB 1JR3A 1NBMA 4PC2A 2FOLA 2ZIAA 5LD2B 3KQHA 2W58A 1T0HB 4CVNA 4CZ2A 2NO9A 3P20A 2EWVA 2AKYA 3VHXA 1E1RD 2EFEB 2OAP1 3R8FA 1ELOA 1IONA 3NXSA 1VPLA 2QMEA 3BOSA 4ITRC 1ANKA 1F60A 5KNCA 2XSZD 1Z2CA 4KXFB 2ZEJA 2A30A 4E07A 2OCBA 3GPLA 2O52A 4QG7A 1SXJA 4PZZA 4U5XA 3A8TA 3K70C 2HV8A 5AK0A 5FR1A 4C7OB 2Q21A 1NMZA 1KK0A 4Q9LA 2VP2A 1JPNA 1NKTA 2BJWA 2R65A 5DHFA 4DCVA 1R0XA 2ZJOA 3MFYA 2OM2A 1XMSA 4AI6A 1P73A 2VBCA 2F6RA 4JLDA 2A78A 3LBIA 5HZKA 2HF9A 4CW7A 4TMWA 4JYBA 1HQCA 1QHGA 2XB4A 5EXPA 3O8CA 1KO7A 5DLQC 1E4YA 2I1QA 1PJRA 2ZI9A 1ZUNB 4JS0A 1G3UA 4UKDA 4H1UA 2XAUA 4IXNA 5CM9C 1VG9B 3LQQA 3QG1A 1FW6A 3CZQA 1TF2A 4GMDA 3VU9B 3OESA 4QJ3A 1QHNA 3DDCA 4US0R 1Q1BA 4IEIA 2Q9BA 1OFHA 1OHHA 4DUGA 1CRPA 5EP1A 2JLWA 1HA3A 3IPYA 1IN5A 1P2TA 2WTUA 1ZAKA 4OQNA 1U98A 2ZI6A 3SZRA 3A4NA 2VYFA 4TLDA 2J87A 1S8FA 2PMDA 3IQXA 1CP2A 5CITA 4Q21A 2X2FA 4O25A 3RLFA 2RGAA 3U2QA 4TT3A 5FUWA 4PZYA 2P65A 5BN4A 4XTRA 2IBMA 1JJVA 4A8JC 4AIIA 4PO8A 3ND8A 2F43A 3AF3A 3A1UA 1JNYA 4M1MA 4DSUA 2PX0A 2JLSA 1ZM7A 1G7SA 3Q5EA 3FB4A 3WRXC 2QZ4A 1Z0DA 1XB2A 2WPDD 4JVLA 3D8BA 4URYR 4FWTA 3LX5A 3IO3A 1TU4A 4BLSA 4HAZA 1ZM3A 3RS0A 2J0QA 2VP4A 4MKFA 2PH1A 3AEZA 4RCYA 2YOGA 3WNCA 1R4AA 2P2LA 1OJLA 2B6HA 3S1AA 1KO1A 5K8IA 1JR3E 2QPOA 1GNRA 3GFPA 621PA 3MLEA 1GZSA 4YXWD 4TMVA 2PCLA 2R6GA 2ZR7A 5F98A 2CL6X 2WJVA 3E2IA 4FWIB 3NBFA 5FI1B 5FUVA 1M1YE 1OIWA 2JDID 3QKUA 3UWKA 1NVWQ 1SXJE 1OE0A 2ORVA 4LHXA 1JR6A 2H7VA 3SE0A 3GJ5A 4DIDA 3U7FB 4URWR 4YQFA 4IVQA 2D7CA 1YZNA 3PR1A 4ARZB 1UKEA 3AP2A 1HTWA 1Z0JA 5CK5A 3Q8XB 2QN6A 2PT5A 5AJZA 3T15A 3B1VA 2ZAOA 5KSZA 2F1JA 3KFXA 4P31A 1VHLA 1X3SA 1W7AA 2NO0A 2V6IA 4Q1BA 4ZPXA 1L8QA 2KI5A 2FF7A 2WJJA 1XTIA 3WRYC 2AWNA 3RVBA 2CXXA 4TZ6A 1KNXA 4KU4A 5P21A 4BZQA 4RZ3A 2HDNB 2RGDA 3Q3JB 4LHYA 4BWYA 5J4VA 1OW3B 3RS7A 4C0KA 2WKPA 1G4AE 2VP6A 2QAJA 1G7RA 4LYAA 3CBQA 5G3ZA 1XFAA 3NC0C 2FNAA 2WVJA 4M1OA 2FZ4A 1W5TA 4DLTA 1P60A 4TLCA 3N5CA 2KBEA 2ZXUA 3DPUA 2VHJA 1G3IA 2HCJB 2REBA 4ON9A 1M8PA 3REFA 3T34A 4UJ5A 3NWJA 4A0FA 1HQYE 4PANA 3EASA 3T1TA 2CK3A 4M1YA 3WYFA 3U44A 4JLBA 4BFTA 3NKVA 3RC3A 1ESNA 1IBRA 1LB1B 3F8TA 1M2OB 5JI3E 1SXJC 3I5YA 1MRNA 4XOIA 5FFMA 2VPPA 4HDQB 1PZNA 4LJ8A 2C9OA 4JLKA 3TK1A 3CF6R 4TYYA 3IQWA 4QKQA 2QEQA 4TZ0A 3I92A 4D0NA 2DHRA 4GPTA 2GBLA 4NTZA 4RY2A 2RH5A 1W0KA 4GL2A 4AY2A 4PSVA 3ZIAA 3F3YA 3B6EA 3BFKA 3TH5A 1EFCA 1U2RA 5JSZB 4D4JA 1E1QA 3LD9A 1C9KA 3K0FB 4JBXA 3CRW1 3OEED 4GOJA 1IQPA 2GZHA 1KI6B 4L15A 3TRFA 5AUQA 4D2IA 2ZE6A 1O87A 4IOKA 4DLXA 2XXAB 1GAJA 3PITA 4H1VA 3QENA 3B7GA 3W8NA 3VQTA 1IY0A 1ESMA 4G3XA 2QP4A 1JXOA 3DO6A 4H9GA 2C77A 3U6BA 1DAFA 5D3MA 4B6EA 1CXZA 1UBEA 5ANRB 4BPBA 2DFLA 4DLSA 1AQYA 1C4OA 1XXHA 4M9XA 5J4LA 1FP6A 3A1VA 1DPFA 5EE3A 5JECA 1PV4A 4F92B 2R6CA 1G6HA 3JVVA 3MWLA 5EZ5A 4BFSA 3N70A 3OAAA 3THWA 5KDDA 1LF0A 5JHGB 1SVIA 4LCBA 4NDZA 3CWZA 4DCSA 3H1TA 3AB3A 2BMDA 1KKLA 4XD7A 3EG5A 3BJIC 4AWXA 2A3RA 2OSBA 4Q4AA 3MWYW 2OV2A 1R7RA 3CRVA 2QAGB 3HU2A 4RFSB 4NYJR 2JCSA 3HJNA 1DAIA 2ZJYA 3OEHA 1IY2A 2B7BA 2G0TA 2XJ4A 2R6DA 5C1BA 4DXAA 3B8HA 1Z5ZA 2ZSDA 1G20E 2GCNA 3OF5A 1H8HA 2G77B 1B0UA 1HV8A 1XP8A 3R7WB 1TNDA 4CEHB 4AKHA 1OFTA 1R10A 5IDVA 5FOSA 1XD8A 5FOUA 2PJZA 1KO4A 2MMCA 3P32A 1UEIA 4Q7JB 1S9DA 4I1OA 3TE6A 1D9ZA 2Q3MA 3HYRA 1D5CA 1OB2A 4M22A 1QHYA 4MRVA 2IS2A 4LPSA 5BYKA 3AGQA 1SKYE 2D06A 1R0WA 4G5RA 1FUKA 4JLMA 3K8YA 4WAUA 1S3GA 2FA9A 4OQXA 3IBYA 4FD2A 5H68A 3K9NA 4Y0AA 2JJ2D 4KV9A 1Y3AA 4V02A 3KKQA 3SEAA 2WWFA 4ZCLA 1KMHA 2VHUA 5JHHB 3E5HA 4XVRA 1D6JA 3VR1A 1ZNXA 3B1ZA 5HCNA 1N6RA 2W2XA 2WWGA 5G40A 3RWMB 4MQBA 4QHTA 2HT1A 1LFDB 4Q4HA 2CCJA 3C4JA 3REGA 4RD6A 4AC9A 1ZP6A 4TYPA 1G7CA 4MGZR 5FR2A 3EZ6A 821PA 2ZRLA 4DHEA 1OLOA 4JL6A 3EIQA 3LA6A 4Z54A 1QG2A 4UNQA 4PQFA 4UQOA 3T61A 2GXAA 4ZO4A 2GHIA 1JPJA 4DLWA 4C30A 2ZSAA 4OQLA 4P4TA 5GJCA 3SI7A 1E2EA 3H2YA 1COWD 1MH1A 2GF0A 2NO1A 1XXHE 4KFSA 2AHOA 3R9XA 2O0HA 2C99A 5IRCD 2NO7A 3K0AB 4RD3A 3I32A 1T6NA 3THYB 1IXZA 1RC8A 3SS8A 1Z29A 4HI0E 3SC3A 2ZRMA 3GP8A 2OLJA 1IXRC 2ODWA 2LCFA 3JVUA 2V1XA 1A82A 3RYTC 4JBYA 4NYIQ 1N0VC 2GEUA 2V7QA 1XTSA 4QGHA 3UMFA 3EIEA 1RRGA 1Q3TA 2BC9A 2A7QA 3CONA 3I72A 5FPTA 5A4JA 4NCHA 4ESHA 5EP4A 5CYOA 1F2UA 3SOPA 1N5JA 1YVDA 1TEXA 2YV5A 3B1WA 3A58B 2GJSA 1WE2A 2J0UA 3FE2A 4LHWA 1E2GA 5CIQA 4LV8B 1W49A 3K0EA 4K8OA 3CNLA 4NYIR 5CLQA 3SJZA 3GJ7A 4BGDA 4V0KA 3ZJYA 1A2KC 1XWIA 4MRSA 2J59A 4A0RA 5DIFA 1CR2A 1R8SA 4XIGS 1CR1A 3NC1C 4OHWA 4MUAA 2FFQA 5B58C 1A5TA 3BBPA 4EFLA 3A4LA 4ACBA 3LVQE 3SR0A 5EE1A 2BVNA 2E1RA 3WMFA 3LWNA 2V54A 3U6KA 5KNDA 1YZGA 4HLUA 1ZIPA 4W5JA 3WHLA 1JEEA 1G5TA 3KTAA 1RW4A 4JJKA 3EIHA 4IKEA 1Q1ZA 1UBCA 5KSOA 2ANCA 5E95A 1OKKD 5L3QA 2C9CA 4TN1A 3GD7A 4M2LA 1LF5A 1CLUA 4LYJA 5C46F 4FI3C 4YLGA 4DVGA 1T5LA 2FGJA 3GLFA 1A2BA 1TX4B 2DFKB 2WSSD 5EJEA 1DAGA 3L0OA 4XVUA 1ZU4A 1E2NA 2IYZA 3PVSA 4CGZA 3B2EA 1WP9A 3HPRA 1G6OA 1NVVR 3FMIA 2QUZA 4C2UA 3CB4A 4EJSA 5FTNA 2MMGA 1YZQA 3CO5A 2ATXA 4TL6A 4DSOA 3CLVA 4W9MC 1V43A 5EUQB 1VIAA 3B5JA 3QXHA 1NNEA 1ZC4A 1SHKA 2ZROA 4GBMA 1KI4A 4S2EA 1YE8A 2VLIA 3Q5DA 1XTKA 3TNFA 1MV5A 3IHWA 3U3OA 2IXFA 2ASEA 1X8KA 3LX8A 3QXSA 1QHHA 5SZKB 2CCGA 4EQ6A 2IHYA 1YR7A 3I73A 1NVXQ 1DAKA 3QKSA 3SHWA 4DLVA 4Q66C 4MGIR 1IXSB 1YRAA 3EZFA 3QF4B 4G1UC 2Q3HA 3KXKA 3X1WA 1OXXK 2NIPA 3BB4A 1Z6AA 2JJ2A 4BE7B 3ZD6A 1EX6A 4O0MA 2VH5R 4OI2A 3RRMA 3CWQA 3ADCA 4YMWA 3TR5A 2QBYA 1JR3D 1TUIA 2FEMA 3HR7A 1J8YF 1G16A 5KDLA 1TQ4A 1NLFA 4TWZA 2ZE5A 4BFXA 4C0QC 2WOJA 4CEIA 4GMXA 1KJZA 3T1VA 4OK6A 4AKIA 4RZXA 2HCBA 4A9AA 1TQ2A 3EX7C 1X6VA 1VTKA 1DE0A 3V4RA 5F9FA 2QM7A 3FWYA 4L5BA 1N6NA 3HU1A 1SXJD 4QHSA 3D3QA 1RRFA 1HUQA 1ZINA 5CIWA 5EE5B 2Z6VA 1DELA 3CF0A 4QRHA 3L8YA 2J7PA 5EXTA 4GT1A 1K5DA 2PZEA 5F9HA 2GZDA 4IEEA 4TYNA 1WDTA 3QVVA 5CDFE 1G291 1KSFX 3AV0B 1UF9A 2D62A 2CHGA 1BYIA 1J90A 4RZUA 4URZR 3D31A 4X8OA 1XPOA 1T3SA 2IS6A 1UBGA 3BB1A 3RS2A 2NQ2C 4DSNA 2ERYA 1E2QA 3FYHA 1CULC 1KI1A 1OFUX 3ZGXA 2ATVA 1G17A 1XTRA 4IDHA 2GA8A 2X1VA 4MYUA 4V0OA 4GDFA 2V3CC 3AVXA 2V4ZA 5TARA 4NP6A 3PV0A 3IKJA 4KYUA 5JS8A 3C14C 4N0EA 2KSQA 4TMTA 4DUGD 3GLHA 4L4UA 4Q4LA 221PA 4TL8A 4YONB 2BV3A 2YC2C 2CL0X 2WAXA 4BZPA 4CRWB 1FQKA 1GRRA 1O3YA 4MRRA 3EPKA 1UPTA 2A5YB 1QVRA 1P3JA 1KMQA 1X86B 4TT3D 3ZQ6A 3V4FA 4ABYA 1G64A 3BK7A 2RGCA 4MRPA 3MRSA 4LHZA 3X1XA 1Z83A 1P2UA 2YWEA 4FMDF 2O8CA 1SHZA 3BERA 1S2MA 4B6FA 1VECA 1KDRA 2ZR9A 1Z28A 1KZGB 4KAXA 4MA4A 3I3SR 1FMJA 2XTZA 4TLAA 2G9NA 2IA5A 4GRAA 3NH9A 3LLUA 1HEIA 2HJVA 3WP1B 3O47A 2QRZA 3B9PA 2ZVQX 4M1WA 2AK2A 3KKOA 1TQDA 3LY5A 1XEWX 1YZLA 3PUXA 2JATA 2ZE7A 1T8TA 2NZJA 3X2SA 1L7VC 4I99A 3W5JA 2QP9X 1KAGA 1ZUIA 3CR8A 3U5ZB 2V1UA 1N5IA 4LC0A 1YR6A 1ZBDA 4BEJA 1Z0IA 1IN7A 1NKSA 3AVOA 3DOEA 3IIMA 5TB5A 3EPJA 2XEXA 3VNUA 2E87A 1R0YA 3DZ8A 2ZI4A 2QTHA 4XWKA 4QC2A 2DPXA 1GOTA 4BFYA 3OIYA 4TQAA 2NMVA 1M7BA 2VQSA 2ZRIA 3WYAA 3GLGB 2Q6TA 3FHCB 3KB2A 4B35A 4Q19A 2WSSA 4IXMA 3C16C 2GRJA 2QT1A 4E22A 1SZPA 2BCGY 1E79A 3PUWA 1WB9A 1FOEB 1MABB 5KDOA 1LS1A 2FSGA 2IWHA 4TTPA 5FPYA 2ZITA 4EJSC 4M0LA 4QFMA 1BIFA 2H1LA 1W47A 2ZS7A 1ZNYA 2CEAA 2VF8A 3RS5A 4DCTA 2H17A 2J45A 4YC7A 1II8A 2F1HA 5TXGA 3I1FA 5J40A 4BLTA 4WOPA 4URUR 3EWSA 3I8XA 3EARA 3O8DA 4BRWA 4A15A 3FTQA 5FUXA 2ZI5A 2ONKA 4Q48A 4ZDKA 4MKHA 4Q4JB 3VKGA 4C2TA 2ZRBA 4NL4H 4A6XA 5EZ6B 5EUMA 3FKSD 5L3SA 1MR3F 1NN1A 3C7KA 1PVOA 2D2EA 2WWHA 4AKGA 1G19A 5JWRA 5A5GA 2GK6A 4Q7LA 4OHXA 2XJ9A 1JAHA 1N0WA 2BWJA 3KDSE 2FPMA 2RGNA 1JALA 3VAAA 3FFAA 4TLEA 3H0KA 4MGYR 2W6IA 4UNSA 4RD1A 3SN6A 4IVPA 1L4YA 4Q7KA 4OI4A 2JLVA 3I62A 2ZVPX 4P4SB 2E9SA 2PMKA 5CK4A 4US2R 2CK3D 4JSTA 5L3RA 3K0SA 1OSNA 2X8AA 1FPMA 1OXSC 1US8A 1P6XA 1UADA 1TF7A 8OHMA 5J4HA 2B7CA 1YKSA 2AFHE 1FX0A 3QVUA 1XX6A 4YMSA 1QVAA 2WV9A 4M8NE 3W8RA 2B8WA 1SKQA 2BBTA 2WJHA 4U00A 3VFDA 2ANBA 5SZJA 1XPUA 3EAQA 4ZDIA 4EFNA 4BLQA 1XMJA 3K70B 4WZBE 4BECA 2GTPA 1C1YA 2WBLC 3IGFA 1W0KD 1HH4A 2GNOA 2UVQA 3ZIAD 2OHFA 2IC5A 3A36A 4UNPA 4PC3A 4HUQB 3AKYA 5BQ5A 3OE7A 1E1QD 2TMKA 3ND9A 2GILA 2JLQA 5BXQC 5L8VA 4GP6A 5HE8A 1I2MA 3RAPR 1Z2AA 3BS4A 4HLCA 4KJZA 5E7MA 3KB1A 2C98A 3U7HB 3LLMA 4JLNA 4LDJA 3THXB 4D25A 4TYQA 1IY1A 2V6JA 4IOLA 5HTKA 2QNRA 1KAOA 3KZ1E 4R2HA 3TVTA 2IXEA 4MDFA 2AXNA 3KKPA 2ONJA 2EYUA 5J5CA 4BLRA 1AJEA 4E5UA 2QROA 3CNNA 4B48A 2PZGA 3OAAD 2NPFA 1KDPA 4TSFA 3NBYC 2BM0A 3MAAC 4F38A 1WCV1 2Y8EA 1OH8A 2OO7A 5IK2A 1BYUA 4BRUA 2H57A 1NP6A 1GL7A 1VCNA 3X1DA 4XD7D 2P3SA 3CX6A 3L0SA 4FIDA 4A8JB 4DT1A 4UNRA 1R5OA 2W2VA 3T35A 3BC1A 4DIEA 1E2LA 1WA5A 2FZLA 4KLZA 1DAEA 4L8GA 4OQFA 3RSLA 3WXMA 4K81B 4JKYA 1HT1E 2J3EA 2ZQ5A 3OEHD 4QBFA 4BQSA 2VA8A 3TJZA 4RKFA 2XTNA 1HE1C 2DYKA 5J4YA 1CR4A 4B3FX 4ILEA 1H8HD 3I5XA 2CCKA 1Z08A 3P1JA 3QKRB 3UKDA 4V0LA 3W3AA 2ZRHA 3FFBA 1OIXA 4QL3A 2ZRFA 3AF2A 2VO1A 3D7MA 3W90A 4KCGA 1Z07A 3MD0A 2WWIA 2FDCA 4OK3A 1AS3A 2I3BA 2FPLA 1ZCAA 4DKXA 4HB0A 3KJIA 1I4LD 2JIZA 3EA5A 3KXIA 4EAQA 4YMVA 3LFUA 4LI0A 2RHDA 4JLAA 4WVFA 2O8DA 3GJ6A 3PUZA 2B21A 4A0GA 4EKDA 4Q1EA 4NE2A 3CRRA 5KPJA 3ZH9B 3AP3A 4Q9HA 3ZVNA 5FBRB 2JAQA 1W4BA 1G5RA 2G6BA 4I1VA 4QBGB 1E9FA 4BUJA 3BGWA 2IUUA 2JJ1A 1DADA 1I4TD 1G4UR 1XDBA 3MUFA 4FN5A 5JJKA 2BKEA 2OBNA 1CJMA 2F9MA 3A1WA 3D6TB 2GCOB 2GETA 1G8HA 1G7TA 2KJQA 3FKSA 3TGPA 5C2JB 1W4AA 1AGRA 4P32A 4FMBB 1E2HA 3QG5A 2OXRA 3UPUA 3C5HA 121PA 5FBWB 3U4QA 4DEYA 1KZ7B 1R5BA 4MH0R 3RRYA 3TLXA 1VYUA 5UKDA 3SJBA 2RGNC 5EXSA 1NJFA 5DO9A 3V9PA 1XEXA 3VKWA 4Q03A 1ZMXA 4D4MA 4WXPA 5FTKA 1ZYUA 2BBSA 1CTQA 4WIAA 1J2JA 5DN6A 1RYFA 1W0JD 1JQJC 2WAYA 1DO0A 4LV6A 3F0TA 3OZXA 1J70A 1MO5A 2PL3A 2V7QD 4PSAA 5B2ZA 2ORIA 1NRJB 3VR5A 3TAUA 2QORA 1JI0A 1GRNA 1Z0FA 1WXQA 3J81k 2BMJA 4KFUA 2VP0A 3NDBB 1CJKC 2IS1A 5KTYA 1SXJB 1F6BA 3GFTA 4Q7MB 2F9LA 4FMCF 3TW4A 3U3JA 1E96A 4HDOB 1E99A 2IL1A 5KOYA 4BEBA 1XNJA 2REOA 2DWOA 1E6CA 3K09A 3BRWD 5KSYA 1A4RA 4Q01A 4B3XA 5BN3A 3L0IB 3GJ3A 1TADA 2FWRA 1FL9A 4TTRA 4B2PA 1YZKA 2QSZA 4HAYA 4QNRA 2OT3B 4BASA 2C9YA 2W83A 1ZRHA 2CVFA 1CEEA 2FU5C 3RWOA 1R5NA 4LC1A 2AL7A 5G53C 3LV8A 3R20A 1OFIA 4DWJA 1J7KA 1T3HA 4PQRA 3SYLA 3TIFA 2NO6A 4AD8A 1Z0AA 1GUAA 3T12A 5EQTA 1P2SA 5LDDC 2XZLA 1OPXA 2CE7A 2PEYA 3B78A 3M4YA 4LRWA 4V0ME 3AVYA 3LXRA 3PEWA 2ZE8A 3DOFA 4GOXA 2JJ8A 2OXCA 1L2TA 1J8MF 1Z6XA 3PENA 1TTTA 1M34E 5F2EA 4ZIRA 1FUUA 2REXB 4WA7A 4DLZA 4JZKA 1F2TA 1W5SA 1PUJA 3P4YA 1UKVY 3QI2A 4M53A 4QOSA 3CW2A 3ZS9A 5JWHA 4Q18A 2XZOA 2F43B 1Z6GA 2JA1A 4C4PA 1P9NA 2JLRA 2IYTA 2QMUA 2W0SA 1GKIA 4QJ4A 3W9YA 3IUYA 2P5SA 2WZQA 4MYCA 4IVRA 4BFWA 2ZJAA 4ESVA 2QI9C 2ZJBA 1OH6A 1DARA 2EFHB 2HXYA 4WXRA 4M9QA 4L9SA 1UKYA 2RGXA 5FTLA 1NLYA 3K9HA 5FPHA 1Z6YA 1NMXA 1YQTA 1KJWA 4TLBA 3NVAA 4IW3B 2ODNA 3S1AB 3X1YA 3QXJA 1FNNA 2PLRA 5C4GB 4ASUA 1AK2A 3BORA 4G5OA 2D4HA 4LJYA 4KLNA 3DMDA 5EP3A 1T91A 4JT4A 2YZ2A 1DG3A 3KQLA 3QXXA 1NL3A 1NVUQ 1F5NA 1ONBA 4B3GA 2VL7A 1P4SA 5DHAA 1Z6TA 3CUEF 4K46A 2C04A 5JJIA 4LJ5A 5FBVB 1N6KA 5DE3A 3AH8A 4B32A 1PLLA 2YWHA 4XSGA 4FW9A 1BMFA 2JLZA 3QBVA 4KSBA 2BMEA 3DM5A 1E9DA 4IDNA 2IHBA 2GVZC 4F91B 4MDEA 4UJ3A 3R8CA 1UEJA 1U8ZA 3WBKA 1W36C 3IDQA 1JECA 4R2IA 2KB0A 3AP1A 4EPYA 3QE0A 4KITB 4HYYA 2VSXA 4JVSB 1LS6A 3L8ZA 4P33A 1KO5A 2WM9B 1XCPA 2OZEA 3K70D 2ZI3A 2HLDA 4Q9JA 2XOKA 4GZLA 3QPVA 3T5DA 2J7PD 1IN4A 1NN0A 1NIPA 1Q3HA 1G3RA 4BFZA 2RGBA 3EZ2A 2ERXA 3K53A 4O2LA 1PUIA 1NY6A 3ZZUA 3FKQA 4MUBA 4R9UC 4YMUA 5BWMA 1Q0UA 5L3VA 4OKSA 4HB3A 2JGNA 3QOFA 4MITA 4UXJA 4ZV4A 4BLOA 5JWOA 3ZVLA 5DI3A 4PHGA 1OXUA 4OI1A 1U81A 1KSHA 2GJAA 1A7JA 1SVOA 2VHCA 1W0JA 1G8YA 1NY5A 2YHSA 1S9HA 1NSTA 2J0SA 2IUTA 4NBSA 2BOVA 1NMYA 2DFNA 1XBTA 2R62A 5JI2E 1IJFA 1KTVA 1ZNWA 3U44B 1G21E 3ZD7A 2QG6A 2A5JA 3PEYA 2ZREA 1AGPA 2BDTA 3AKEA 1HY3A 4GP7A 5LPNA 4PHTA 3ZS8A 3UIEA 3PUVA 1HE8B 3I61A 3P26A 2P6RA 3K0CA 1NJGA 3MWKA 3AVVA 3K09C 1P62B 5AJVB 1OF1A 1E3MA 2O5VA 1OH5A 1JXMA 3CIOA 3DVLA 3GLIA 1E2IA 1SVWA 2Q3FA 5FUYA 1EX7A 1Z0KA 2RMKA 3QEOA 4QXAA 5SZHB 1HYQA 2BEJA 1EFRA 2BEKA 4LGMA 4KVGA 4XH9B 5GADl 1YRBA 5B64A 1BH2A 1RE0A 4GNKA 1JBKA 1T4GA 2BMFA 5J4KA 2A5FA 3ECCA 4M4SA 3SJAA 1ZNZA 2FPKA 4JMPA 3OIWA 2DFTA 2ZUBA 2OFOA 4A2PA 5CDFA 1KOFA 1XPRA 2Z43A 2GXSA 3VR3A 4B34A 1KI2A 1LY1A 4MYHA 3M1IA 2VSOA 4D6PA 4XJXA 1RRPA 1Y63A 5D3MB 3NTUA 2G88A 5KYKA 1MRSA 3QY0A 2I4IA 2QQ0A 1AKYA 1XXHB 2WWWA 4C0JA 2VP9A 4CDGA 4DBLC 1ZM2A 2ZUDA 3CH5A 1XRJA 1BO6A 4PO9A 3FHTA 3FVQA 1DG1G 4JLJA 1E79D 1EG7A 5C4MA 3THWB 4P4UA 3QF7A 5CJPA 2OFXA 3VX3A 4C0SA 3NBXX 4QBIA 4LV5B 3PEUA 2WICA 1W4RA 4HB2A 1GRQA 1N3BA 1F48A 2C78A 5B57C 2MSEB 1FNMA 5FL7A 4Q4AB 3UATA 4U7DA 1GVNB 3SFVA 4QGFA 1RZ3A 3HU3A 3G5UA 4RVCA 3AVPA 3HWSA 1RJ9A 4W7SA 2V55B 3M6AA 1RKBA 3QPWA 4A92A 1XEWY 2A2ZA 1L4UA 2NG1A 2WMOB 3G82C 3RRNA 4D4LA 2QENA 2VSFA 3PIRA 3SQWA 3ZVMA 1CF4A 4AYWA 5BN5A 1IAQA 4G5SA 1IN8A 5M04A 1QBKC 2QMHA 4X8HA 2PJRA 2GWHA 1EWQA 4LBVA 1D2NA 1T8UA 1KY2A 2X77A 2W6JA 2OG2A 2F1RA 2QTVB 3KJHA 4MGKR 2JLYA 3EXAA 4LBYA 1TEVA 2W6ID 2WMNB 1EFUA 4D80A 1CR0A 3LRPA 5E7JA 2O8BA 1EFHA 1VCOA 2HXSA 4KBFA 3OFNA 1A1VA 1KMHB 3GLIE 3QUSA 3EA0A 1G8PA 3I4LA 4BLPA 4B74A 4CEJA 2MSDB 2FFAA 4Q4HB 4NCKA 5F3WB 1X8JA 2C5LA 4PC6A 5HCIA 2XNSA 4OK5A 4NONA 2WSMA 3LBNA 4D0GA 4P0TA 4EPWA 2R6FA 3TQCA 3N2IA 3UXMA 1V5WA 1ZJ6A 4I1UA 1E0JA 3TUJC 4YDSA 3U3MA 3LQRA 4CT4B 2JLUA 2XB2A 2QL6A 3NH6A 1KDTA 2RGGA 4BFVA 3NDPA 1ZC3A 1DBSA 4JKIA 2CJWA 1E0AA 4HAWA 2OAQ1 5HKKA 3WMEA 4WZAE 4C7OA 3PFIA 2PEZA 5TV2A 1GKUB 4NKRA 1ZU5A 1QZXA 2W00A 3C8UA 1MO3A 3GJXC 3Q9LA 4RSGA 5TY0A 2W2TA 2IK8A 1XTQA 1N5LA 2AKAB 4GI7A 5LBIA 1K6MA 3OE7D 5HE9A 2LWIA 3E1SA 1CJUC 5JEEA 5LB2A 4ZKDA 1E2PA 4G0NA 4AG5A 3KKMA 2ZAMA 3EZ7A 1KY3A 4KHZA 2UZIR 2QGNA 2ZU6A 3EPHA 3A6PC 2YC4C 3Q7QA 5DISB 2F3TA 4D81A 1SULA 1LVGA 3GLGE 1KSJA 2O8FA 1SVMA 3SU8A 4B75A 2CE2X 4NZYA 5D3QA 4Z51A 4KSCA 2ZRNA 3BB3A 2EFGA 1UDWA 2H8KA 3ASYA 1VG0B 4N1AA 1IJEA 1Z3IX 3VU9A 1F2UB 3TUIC 2PBRA 2EFDB 3K0CC 1E2KA 1II0A 1KGDA 3KX2A 2AK3A 5K8TA 4TSFD 3UG7A 1GDDA 3QSYA 1WBDA 4HATA 4RZ2A 3VR6A 3LBHA 1GL6A 3ADDA 2J0UB 1RIFA 1SVKA 1N2CE 5AR1A 3WYGA 5IK2D 4PPQA 4LBZA 5LB4A 5JS7A 2ZPTX 3ICEA 1FTNA 2P6UA 3KUDA 2YWGA 4IDOA 1HT2E 4M21A 3R9IA 1MO6A 1RVDA 4POAA 2GAOA 3AQ4A 1GP2A 1KDOA 1G3QA 1OYWA 1XZQA 1NIJA 3L0PA 4HLDA 4IJMA 1AS0A 5AUNB 5JCZA 1IHUA 1UAAA 5JCPA 1U99A 5E3HA 4A82A 1ZCBA 3C5CA 5AJXA 2YOFA 3RNLA 1EFTA 3SQXA 3AVWA 2L0XA 3BFXA 3DHWC 1EWRA 2GZAA 3T06B 4O3MA 3FMOB 1S0UA 5AJYA 2HUPA 3KTAB 2LKDA 1D9XA 2ZUCA 4HZUA 2EVWX 4IOMA 1OXVA 2H16A 1G1MA 1E0KA 1MT0A 4QHYA 3JZMA 2JIZD 2BBOA 5L3QB 3SFZA 1AIPA 2NZ8A 2WWXA 3LAWA 4RJLA 4Q5IA 4XTCS 3GLFB 2VEDA 2QU8A 5EE9A 3P27A 3UG6A 3HPQA 1AS2A 3U7EB 4EJSB 3CR7A 1W36D 4FINA 4KO8A 3H4MA 4O2RA 3CRMA 2IYXA 2JJ1D 1YR9A 2DWPA 4W5HA 2HT6A 2B8TA 1R2QA 1P2VA 1U90A 2OLKA 5DYGA 3PQCA 2B92A 3MGCA 3A37A 1M6NA 1W2GA 1K8RA 1TPZA 3UANA 3K9GA 2WJYA 1GNQA 2ZRAA 2ZETA 1G3MA 1H8EA 2UKDA 1QHHB 1XJ0A 5FBQB 5CJ2A 4EQ6B 2GCPA 1I2DA 4URVR 4ZCIA 5BW8A 2OFWA 2GAAA 4HAUA 4RCZA 3QKSB 3ZQJA 2WJGA 5K8UA 2FH5B 3LW8A 3PUYA 4I4LA 3HR8A 5KPDA 3K9LA 1YJ5A 2EU8A 4DB2A 1G8FA 3AUYA 2H18A 4LYFA 1DTSA 3KJGA 1KK3A 3TSWA 4IDPA 3FMPB 4Z8YA 2QBYB 2BHRA 4Q1DA 4F93B 2GJ9A 3AVUA 1D2EA 2A5GA 4NCJA 4TL9A 521PA 1EESA 3GFOA 1WMSA 2X2EA 4PFSA 5DN6D 4CEIB 4MRNA 2O8BB 4F4JA 5LD2C 2VIIA 1UJ2A 2ZRCA 4GSYA 3RDPA 1KNQA 2VRWA 3U61B 3QXCA 2H5EA 5ELXA 2XNDA 3GJ4A 4LX0A 3FMFA 2IXGA 2QTFA 2DY1A 3A1SA 1GKYA 4JLPA 4PAOA 1ETUA 3PCRB 1XF9A 3TR0A 1CJTC 4EPXA 4F7WA 1E32A 2DWQA 4FCVA 1WF3A 2ZYWX 2XGJA 4Q47A 1J99A 3RHFA 2J46A 1MOZA 4PSKA 2FGKA 2CJWB 1BS1A 5KUTA 2J1LA 2GJ8A 2WWYA 4JLOA 1E9SA 4DDUA 2IWRA 2GXUA 2R9VA 4G01B 4OL0A 3AGPA 4JSYA 1AZSC 2FSFA 3H86A 1LNZA 1UKZA 1E9RA 1E69A 3IO5A 5JSZA 1AA9A 4TMKA 5FBLB 4J0QA 3T1OA 2G1KA 1AM4D 1G18A 3K0FA 5GVRA 4EPRA 4QGAA 2Z5FA 1KI6A 4Q9IA 1AQUA 3GEHA 3GLHB 2ZRDA 4DSTA 1WQ1R 2XXAA 4WW0A 2WIBA 2O8FB 3DZDA 3FPAA 5B30A 4C3ZA 1TAGA 1X1RA 4QNMA 2O0JA 2HF8A 4NCNA 2ZTSA 1TQ6A 5G41A 1RFLA 1SGWA 3N2EA 4XSHA 2UZ3A 2BCJQ 4OYHA 1ZM9A 1N6OA 1NLZA 4E03A 5K8LA 2OESA 2FJUA 2IYVA 2O8CB 2AX4A 4DB4A 4S35A 3VR4A 2ZRGA 1OV4A 1T5IA 3OHMA 3LH5A 4FMDB 2ZU0C 2IYRA 3NEYA 4OBEA 4AKEA 1JQLB 1GIAA 4PAQA 3IIKA 2ODEA 1VYTA 4IHQA 5KNBA 2FSHA 4L9WA 2DB3A 2AD5A 4OJQA 3OIUA 4RFSA 2QAGA 421PA 1QF9A 1DAMA 2D7DA 4JJZA 1ZUHA 4QGGA 4ASUD 1AN0A 1XMVA 5TMPA 2CNWA 4C0HA 5JRJA 3U3RA 3VHLB 2ODBA 3CPHA 3R7WA 2BJVA 4CIDA 4CEHA 2HEIA 1N6LA 2V9PA 4KFTA 4TQUS 5H8WA 4HZUB 4I81A 3SHFA 2Z4SA 1N5KA 1NBME 2J41A 2PX3A 4Y0VA 5FL3A 4GZMA 1BMFD 2ZRJA 3HP1A 4HAXA 1P72A 3ZLJA 4V0MA 2ZRKA 2QE7A 3JZAA 3WNBA 4PR0A 3NBZC 5G3YA 4AYXA 2AD1A 4DZZA 4Z1MA 4Q00A 4Q1CA 2IT1A 2CBZA 1G41A 5IHPA 1SVLA 5TVKA 3ADKA 1II8B 1KI9A 1OXTA 1Q21A 1W2HA 2C2HA 2IF2A 3WY9A 2HLDD 2WIAA 2XOKD 1DO2A 3IIJA 1ODFA 3ZYCA 3VKHA 4LSGA 2BKUA 5DI9A 1NSFA 4GOKA 4HZIA 4CF7A 3U3KA 1KJYA 1ZD8A 4B76A 4CT5A 1Z47A 2P0EA 5DYIA 5FOTA 4B73A 5L3SB 2HYDA 2OCYC 2IYWA 2DBYA 4Q02A 5JBQA 2FFBA 1E9AA 4B33A 3FDIA 4WZ6A 2CHQA 1JJ7A 2D3WA 2KBFA 4LYHA 3TVDA 4EFMA 2IEYA 3K1JA 4NMMA 4JLVA 3MG9A 2AFIE 1FFHA 5SZIA 4D82A 1LW7A 4IOJA 4L16A 1VMAA 4M1KA 5H70A 4EIWA 4DDVA 4LJ4A 1XD2A 1CRQA 1ZD9A 3Q85A 3QBTA 4JL5A 3K0AA 3THYA 1US8B 3T5GA 2YOHA 4NH0A 2IYYA 1UDXA 2VHQA 1FX0B 1YU9A 1YZTA 1VG1A 3OIVA 2RKOA 4BZXA 1KHTA 1E1RA 3L43A 1EK0A 1P75A 2FN4A 1E2JA 3TSOA 3PG5A 2RB4A 5DH9A 3RS4A 3BH6A 1KYIA 3TBKA 4ZDJA 1VDZA 2IYLD 1JB1A 5JZVA 4OI0A 3KFVA 2XSZA 4HDCA 1I4DD 1N6HA 4MKGA 4AYTA 3W6OA 4XWAA 3T1QA 2ZYVX 3LDAA 2F7SA 5JJLA 4M1TA 1EFRD 4LJAA 4US1R 5FOVA 3NEJA 4UXIA 3VTKA 2C8VA 1S4QA 3QNUA 4NHOA 2XITA 4A2QA 4ZI2A 4EPTA 1R8QA 1XJCA 1RPZA 3VNVA 1K5GA 1R6BX 5GJVC 3BE4A 5JMTA 3PJRA 3LNCA 3W6NA 1QHSA 1XZPA 1ZM4A 5KU1A 1OH7A 3TQFA 3KQUA 3DL0A 1B23P 4IDQA 4XVQA 4A6PA 1LV7A 2AWOA 3LXXA 1XCGB 1VCIA 3BD9A 2GK7A 3ZZ0A 2FX3A 2O8EA 4FCTA 4IFBA 5E4FA 2DCUA 3A1TA 3B1XA 3WNDA 2OCPA 1WBBA 2CLDX 1E2FA 2ORWA 1U0JA 2YJTD 5GVSA 2MSCB 2OCAA 3CPEA 3B82A 1T0JB 1NN5A 1XD9A 3LVRE 5KO2A 2GXQA 2RAPA 2LKCA 2J9RA 3SDZA 5FOXA 1FP7A 4PAMA 3SJCA 4DJTA 2G1JA 4PTLA 4DDWA 1PLJA 2Q0HA 4MKIA 4QM6A 4PZLA 2GF9A 4KI0A 4NYJQ 4PC7A 2GESA 2ZS8A 3KQKA 1U94A 3EZ9A 4DT1B 1OIVA 2JASA 3TKLA 2A5DA 3MCAA 2CMKA 2ZSFA 2CL7X 4OHVA 3MWJA 5FL7D 2F55A 3QPUA 2OBLA 1DEKA 3W34A 1IM2A 2IYUA 3CF2A 2G83A 2OE2A 2QAGC 1XTJA 3BAFA 4DCNA 1GFIA 3NHBA 2FEOA 2WPDA 1G8GA 1XJQA 1N25A 4JT2A 1JAIA 1VKJA 4KYIB 2C95A 2GVDC 2DR3A 1NF3A 1AZTA 4LK2A 2VF7A 1TL7C 2GDJA 2P5TB 2VP5A 3EW9A 3NIBA 3NHAA 2PCJA 1CBUA 2W6JD 1XU4A 2QP3A 3O8RA 4W5WA 4YXWA 3RC8A 4LHVA 1GNPA 3HDTA 4A4DA 2YVUA 3UK6A 3ETLA 1M74A 3TSZA 4ERNA 3B9QA 5CB8A 3QF4A 2ECKA 1UBFA 2O8DB 3AUXA 3BIFA 1XCMA 3OFND 4R98A 2JDIA 3KJEA 1DVRA 2KWIA 3QQ5A 5IT5A 2H92A 4PXAA 1P7CA 3RS3A 6Q21A 1TF5A 3EPLA 4M9ZA 4BFUA 2GKSA 1W36B 4EPVA 1RYHA 2Q9AA 3TMKA 3EC1A 2IW3A 3RSOA 1GWNA 3MSXA 4B3DA 5IF9A 4RKEA 1S1MA 2N46A 3BH0A 4WBSA 2WKRA 3GMTA 4RD4A 3RABA 1TUEA 3BXZA 3SNHA 3FGNA 4V0NA 4D4KA 4ZI3A 1Q44A 3TW8B 1GM5A 1KKMA 2RGEA 2IEZA 5HKKD 3CM0A 3U4QB 2K5UA 2VTKA 1YR8A 4Z8XA 4NCIA 5CLLA 1CKEA 3V00A 4TTQA 2NTYC 3AVTA 4KFRA 1VHTA 1XEXB 2ZSBA 3BH7A 1QG4A 3MMPA 4NYMQ 5FTMA 1X8LA 2XTMA 4HLQB 5J47A 4NU0A 3RANA 3RRZA 4LJ7A 1G9XA 1QHIA 2FSIA 5HPYB
chains in the Genus database with same CATH superfamily
1KJ9A 1C0LA 3V4PB 1PJTA 2X41A 3UMBA 3GC6A 4EVIA 5FP0A 2FCRA 3C6ZA 3IOEA 3ISTA 1Q2UA 3OZWA 721PA 5D3ZA 3IBGA 3VX4A 3G1WA 4FEGA 3BA1A 3WP0A 1EGAA 1T9BA 5H1YA 2Y0EA 3L6RA 4DMGA 3TZCA 4DPKA 5KNDH 3VO2A 4ND1A 2DPHA 3SICE 3PXCX 5JS2A 2PYDA 5I7VA 1AB5A 1VIYA 1VG8A 5JSHA 1YWGO 5DMXA 1OX5A 4IEFB 2HJGA 2LD4A 5BR1A 1B0ZA 2Y66A 3DM9B 4WINA 3VR2A 2HGSA 5AW9A 4AWAA 2I22A 2VJMA 5BN3B 1U0LA 3I6BA 3IMFA 4LPKA 4OQMA 5H9WA 4YQEA 1VHWA 5KBYA 2W6CX 3C1AA 3AF1A 3RJTA 4CEIA 1GG5A 1K75A 3BHJA 1ZVQA 2QA5A 1G5IA 1WD7A 2PGJA 4LW8A 4TS1A 1FX1A 1GL9B 3BRSA 5KVQA 4B3RB 2CLSA 4DCGA 2ZUFA 1E7RA 1N6IA 3JTEA 5I9IA 1W8IA 4YWHA 2XTAA 3V4SA 1U2PA 3ABRB 4K1XA 4LE2A 3M4XA 2D74A 1C9EA 4WZAA 3IOMA 3GGOA 3WMGA 2XVXA 1XDUA 4JQCA 4KQ9A 5JJCA 3OEEA 3CGGA 3SYMA 3OIDA 1H2EA 2FPGA 4LWZA 1D0IA 1XZHA 1Z22A 3IPXA 3I1JA 4BKQA 4A2WA 3WHKA 1Q0SA 4OOEA 3ZZTA 2C96A 5IWCA 2A5LA 5DNYB 3A28A 2CVOA 2PZKA 4GD3Q 1LKZA 5AQEA 2O8EB 2BT4A 1ORIA 3IBSA 3IDSA 3KL4A 1M8FA 3VOBA 4XXHA 3DAOA 1J9EA 2DUNA 4N0QA 4ZO9A 3IMKA 5GJBA 4H1TA 4F4CA 3MTJA 1W1WA 4FHFA 4KOEC 1G5FA 5IJXA 4RPHA 3UBMA 4I55B 1LSOA 1OT3A 1P7VA 4IFIA 1MU0A 3E70C 1MPXA 1NE2A 3O8NA 3FY4A 2V0GA 1G21B 1MABA 3F9CA 4IINA 5CPBA 4AURA 1BCRA 3C7TA 1CV2A 1V3VA 5JYBA 4DTIA 1O4VA 3BFPA 2VJKA 4G23A 4YWJA 5MFZA 4ZYVA 3SYNA 5JARA 5L9AA 3T4PA 1TCAA 5TC4A 4R7TA 1DAHA 1J09A 3QBJA 1WZEA 2A9KA 5F1OA 3GRYA 1SCQA 4KBYA 4MK4A 4YBZA 3RF7A 3THOA 4QDOA 1Y5NA 4QJ5A 3UMMA 2TMDA 2XWQA 2IEGA 1DC7A 1R0LA 4O4LF 2M98A 1H0SA 2H48A 1UR5A 2YBEA 3GLFA 4EFDA 4O4LA 2OBXA 1O97D 4CIYA 2WKQA 3KYIB 2PT6A 4UC0A 3KM0A 1UZMA 2CFSA 2PKXA 4IJVA 2CLCX 2FPWA 3AVQA 3WKDA 2HDHA 3M8KA 1CEYA 1JDSA 1VPWA 1U2GA 2AOUA 3CXUA 4QAQA 2WD7A 4BGEA 1ZPDA 1PT5A 2I2BA 2QJFA 1IZ8A 2C03A 3AF0A 3HN6A 5DV9A 5T5QA 1IPEA 4GEGA 1UFVA 4OUDA 4I1SA 2PKCA 1E5QA 4Q3DA 2H00A 4KBGA 4AG6A 1UP6A 2FMXA 1BOFA 3H9UA 1GUDA 4D3YA 1E8DA 4DR1B 5LMZA 2FE4A 5AKZA 4C6TA 3BD8A 4PZAA 2XNDD 1V37A 1R12A 2F3RA 1Q6ZA 5AKHA 2EFCB 3AFOA 4Y6PA 4DW8A 2FN3A 1GYPA 1MJGA 2GI4A 2KE5A 1DZIA 2M6RA 2Q5HA 2ZBEA 3BBLA 3D1JA 4G5GA 4MUGA 3T0FA 1T8PA 3HL0A 3NWOA 4YUYA 1DFIA 1E0SA 4QXQA 4PHCA 1H4VB 3EGDB 3OE1A 4PPFA 3Q2IA 4B3BA 4B44A 2DG2A 4KH0A 4DARA 5CB6A 3LT2A 3B13B 2KS6A 4N8EA 1T9DA 4R8MA 5BVGB 4HEQA 1S96A 5EUCA 4P0PB 4QDXA 1EXWA 1H2BA 1SIBE 3BTSA 3M6XA 3O5AA 3TNLA 4ND8A 1Q15A 1U3TA 2D1SA 4GEKA 3PEVA 5DLDA 2WUDA 1OX4B 4JR0A 1UPCA 5FORA 5FOWA 1IBLB 3GAAA 4FYPA 3EF1A 4DILA 4YMTA 5I9NA 2PLNA 4UDNA 1QHXA 2AN9A 2FSSA 1HWYA 4LJ6A 1EUQA 1KH1A 2OUKA 1J0BA 2X76A 4F9TA 2IYQA 3GL9A 1O95C 2W70A 1GYQA 4RLHA 3WO0A 2J5RA 1KWGA 1O0CA 1YL6A 1LWOA 1Z26A 2RHMA 2QN7A 1V45E 3FROA 1T8RA 3M2TA 2A1UB 1ZXLA 4RVDA 2XZTA 2ZANA 5BNZA 2QMOA 3VZSA 3KSBC 2F1IA 4RMNA 3LZCA 4JP5A 2FPSA 2R8PA 1KO8A 1W46A 4R54A 4LZPA 5BYJA 3V8PA 3ZCVA 1JSRA 4HF7A 1WMEA 2JI9A 4UXHA 5KOJA 2V7GA 4CR8A 4B6PA 1YULA 3EGXB 4XZ3A 4RTRA 4N40A 3ZK7A 3GJ8A 5KKNB 2HYIC 5F35A 3VR4D 4EMSA 5JXJA 4NU6A 4BO7A 2IH4A 3N3AC 4LY6A 3OETA 1OI3A 4TOIA 2ZBUA 4NF2A 4XUGB 4B0OA 4EUEA 2HV9A 5LP6F 5A5DA 3M0EA 5ERGB 3ZCTA 5E7IA 1WXIA 2Z04A 4UNNA 1B1AA 1U9IC 1X80B 4WLNA 5C32A 4JD5A 5LP6A 4KUGA 4X6YA 1VZ3A 2J31A 2R6AA 1P5FA 4B43A 3HJBA 1JKIA 2WU0A 2JEOA 3Q7PA 1YVEI 2WINI 4WNYA 3QJYA 4BYMA 4B2IA 5B4UA 4NG4A 5CCXA 3G6WA 3AHIA 7GPBA 2K7ZA 5DTIA 3EXG1 1VJTA 4MOWA 2CYCA 3V1TC 4ENQA 1H0HA 3S70A 3RT7A 3BWDD 1JYSA 2J67A 2P6RA 3LSTA 3EWIA 4Y6QA 4BAUA 4DXHA 3ADBA 4FFVA 4MVJF 1R3DA 3P96A 2HU8A 2ZWVA 3K05A 4GPAA 4LJ9A 4YI3A 1NMQA 2YNMC 1QTIA 5E7QA 5H3LA 5LQNA 2WYIA 2AF4C 1FTSA 4OH7A 1ZD3A 4MVJA 2W0MA 1WZ2A 4G85A 4PWYA 1S3IA 5DIZA 3VPGA 1OKKA 2UZ0A 2EKPA 2CDNA 2A9RA 1FUEA 3UAXA 4E5KA 2NVWA 3TD9A 3FBGA 3GGPA 5FAXA 3ROQA 5JEDA 4UAVA 2ZT7A 5CFOA 2IU0A 2K7FA 4GMFA 3U80A 3CKLA 2CV0A 3CX8A 2GAIA 2A1TR 2NPIA 5JAHA 3R7FA 4P5PA 3NJRA 5H02A 4K6FA 4C0LA 4MKZA 3HGQA 4WADA 2FWBA 1GCGA 2GJKA 4Y2XA 5CM8B 5TRTA 4JIMA 3RG2A 1Z6ZA 1DEAA 2HSJA 3DVAB 3TAHA 4CCSA 2XX3A 1LI7A 4M0MA 2AMFA 1TA0A 4IKOA 4Z3KA 1JB9A 3B1YA 3CE6A 1SJ9A 3IPCA 3TSCA 3VPSA 4M1SA 3EY9A 3RODA 4KL8S 1VI2A 2YKGA 4DC9A 1T36B 1AKEA 4YCCA 3SDBA 1NPYA 4XFJA 2GCOA 1AF4A 4QFCA 4UTOA 3KQNA 3AM1A 3IHLA 4DM3A 4TMXA 4L0CA 1FS5A 2DPGA 2P9BA 3NC4A 2PPVA 4G24A 3WRYA 4HEJA 4W5TA 4DDKA 2NGRA 3RTCA 1Y8RB 3NKFA 3B6KA 3X43A 4ZEVA 3O7WA 4JV5B 1VP9A 2Q9CA 3B89A 1IWPB 2A4MA 3VYUB 8ADHA 1TRHA 4NZMA 3LWDA 4G5QA 3L79A 3SK0A 3RJMA 1IK6A 1N1GA 1SKUA 3GLHE 3H7AA 1RRCA 4R71A 5FBKA 3D6HA 3W2HA 1AH2A 4G86A 1R8JA 1NR1A 3PICA 4G8BA 4YPVA 3BDIA 1EGMB 2HFKA 2JBHA 2I3GA 2PX5A 4UHFA 4PC2A 4UU8A 4IX1A 3U49A 3V2GA 3E9MA 3D0OA 4KXVA 1QK3A 2R5NA 2OHIA 4GKAA 4EW1A 2GOYA 2FSPA 2EWVA 2I67A 1EH5A 2XF2A 3FPJA 1VFPA 3LBFA 5E6SA 3RI3A 2AKYA 4MLPA 4E33A 4EDFA 1E1RD 1PFWA 3NX4A 3RWBA 2WB2A 4G89A 4K9RA 1CY2A 4LFBB 3LP8A 3ZDZB 3L77A 2HK9A 4M0FA 4NU5A 4ES6A 5CFRA 3ZNQA 2GEFA 1IXYA 3ZDDA 1F60A 2FUG1 3O8QA 2XSZD 4NMWA 5EAIA 2A30A 4OJMX 2OCBA 4XLZA 2R00C 3GPLA 4QG7A 5EXEA 4L5AA 1SXJA 2Q6LA 3PUIA 4HY3A 1P19A 3UPDA 1UXOA 5BR4A 2QL9A 2ZBFA 2HV8A 3NQ41 4WUTA 5AK0A 5FR1A 3WTCA 1KK0A 3HCWA 1BE6A 1JDJA 2P35A 4QD3A 1NKTA 1PWEA 5M29A 2BJWA 1ZCJA 2DUWA 1FNCA 4U1RA 5ICSA 2ADOA 4J43A 4U3JA 3ESCA 1P73A 2NYUA 3ZK8A 3EVTA 4WN9A 3I1IA 1C8BA 1QH1B 4JLDA 4QTXA 1NLUA 2A78A 2P1RA 5HZKA 2PVPA 4CW7A 1EFVA 1PJQA 1GU0A 4JYBA 4QU0A 2ECQA 1QHGA 1TOAA 2P9GA 4YB8A 5EXPA 4GMHA 3LM8A 5JZ9A 5K9ZA 3IB3A 2YHUA 1R50A 1V41E 2I1QA 3EGCA 3QUBA 2QW8A 5KINB 1LLCA 4JS0A 5EIHA 1ACJA 3EYAA 3G0OA 4JJIA 5JY6A 1SK8A 3NJ8A 4O1MA 4CF6A 4IYJA 2EJUA 3Q7TA 4GVXA 5KNBH 4XASA 3ZC3A 3QVWA 1VLVA 3WG9A 1QHNA 2FPRA 4LF5B 5B5SA 2JLWA 1QIDA 2JFWA 2WTUA 4EHDA 1XC7A 3FNQA 4RFLA 5AI8A 1U98A 2ZI6A 4JYZA 1HR0B 2VYFA 4TLDA 3IQXA 5C7YA 1CP2A 4QTZA 2PGAA 2WIFA 4Q21A 2X2FA 3BJMA 3HJGA 1RQGA 4O25A 1Z8HA 4V3CA 5KYTA 4RTJA 3U2QA 4TT3A 2P65A 3UMVA 4D41A 1GTJ1 1JJVA 2GARA 2PM8A 1CE8A 2A4KA 2F43A 5D85A 4IGKA 3TOZA 3WLIA 1OC2A 3A1UA 4M1MA 4EF4A 3DF7A 1XKTA 3M3DA 1AKVA 1CUXA 1ZD5A 2A0UA 4CNQA 3Q5EA 4X00A 3FB4A 1LJLA 3PNVA 1LEHA 1XB2A 1PBTA 1Z0DA 4JVLA 5TQ0B 2ZPUA 5DOVA 3IO3A 1HZZA 1RAHA 3RS0A 4OP2A 2OOKA 4Z86A 4F06A 2Y71A 1M33A 1PFVA 4UD6A 1WZCA 1PU2A 1R4AA 2B6HA 4MQEA 1KO1A 4NS4A 5K8IA 3IDOA 1CJCA 5MF6A 5MGBA 3GFPA 1RXIA 1GZSA 2EGHA 2JH3A 4OMFG 4J16C 4CM9A 4CFZA 1DIAA 2C5FA 3HLTA 3D9QX 1BEUB 2NXNA 5F98A 1GGFA 4S24A 5I3ZA 2WHYA 4G9BA 4L28A 4R9NA 5CT9A 1YO6A 2I66A 4YJGA 4PVDA 5FPQA 3IURA 4MHSA 1WCXA 3L05A 1M1YE 3FR8A 3DDSA 2JDID 5D86A 3QKUA 3ZHSA 1ZCFA 1OE0A 2ORVA 3ND7A 1G98A 4CLDA 1B6TA 4M0EA 4A0SA 1I5RA 1KOJA 1SZDA 4NJMA 4IQFA 2IPNA 4IVQA 3T41A 1E63A 5B2EA 1A7KA 5AI9A 2BFCB 1UKEA 4K86A 4KC0A 3SKXA 1HTWA 3CX3A 3TDKA 1DL5A 4BQNA 4F3RA 2PT5A 4IP0A 5ABPA 4CV0A 3L0YA 2G40A 5JPIA 6REQA 2Q46A 2IU6A 2DQ4A 5HQJA 5GAJA 3QKIA 5A3QA 1D0VA 2Y1EA 2JVKA 2E4UA 3U26A 3G5TA 1X3SA 1GDTA 4PGMA 4AULA 4F12A 4N41A 2HMTA 2D1TA 4CMHA 4TV9B 3WLLA 5BN1A 1JHQA 4WH0A 1VLJA 4H4DA 1XTIA 1J2UA 3D6UA 4TZ6A 1N2IA 1FVOA 1FFBA 4ZA2A 3BEOA 4ZHQB 3QMWA 2RONA 3Q3JB 5JH7B 4E4YA 4AKTA 3CR3C 1QGOA 1IRXA 5JISA 3L8CA 4I8DA 2R8YA 1XQYA 2NO4A 3QGMA 5HDQA 2OXIA 3RS7A 4AJ9A 5G3ZA 1XFAA 4X3PA 2D1QA 2FNAA 4FBMA 1P0MA 3SHVA 4DLTA 1W5FA 3ACCA 3N5CA 1K98A 4OLFA 4CQNA 4TQGA 4C4RA 4Q4CA 4ED9A 1ECLA 4G8DA 1ZMOA 3DPUA 1NDHA 1G3IA 4ON9A 3FOWA 1VE1A 1Z75A 1OV6A 4BV2A 2GAFA 3DOOA 5AI6A 1W96A 5DYYA 3FNBA 3LX6A 5JW6A 1GZ7A 3T1TA 1Z7WA 2JIQA 4AKSA 1YFLA 3PDIA 1QIEA 3U44A 3DPSA 4JLBA 1MAHA 3NKVA 3VJKA 2ZVDA 4ZOQI 3UC5A 2NV2B 1UFRA 2VYVD 1M9NA 5JI3E 2AMJA 3AOEA 2B2NA 4FILA 1N7JA 3R3ZA 4HR7A 3CQ9A 1IVNA 3P2KA 4RDXA 2VPPA 4HDQB 1PZNA 4ROTA 3LC1O 4JLKA 3CF6R 3R5KA 2H0RA 3OCYA 3IQWA 4Q16A 4DIBA 4TZ0A 2VJAA 2I4NA 4KP7A 5KHLB 4L4YA 1T3ZA 3KSMA 1I14A 2DHRA 2HC9A 3I58A 3K32A 2PQ2A 4O1HA 5ALYA 3MBKA 2GBLA 1SK9A 1UH5A 1YKGA 4HYQA 1LVUA 4NTZA 4UUNA 3T9AA 4CF3A 1MD9A 3ZI0A 4AY2A 4N65A 4GL2A 2QX6A 1LWNA 2ODTX 3N7UA 4LYYA 1SBYA 4YP1A 3PNLA 1GRCA 4FPXA 2NU9B 3TH5A 1EFCA 5JSZB 1M72A 3WYNA 4YLEA 3AJ8A 3DBLA 2I2AA 5IW8A 2XLCA 3CU5A 1PWXA 2HRDA 2J9FA 3GG9A 3OQ1A 1C0EA 1U0EA 3CRW1 2AS0A 3INGA 4TKUA 1IQPA 2GZHA 2PBZA 3ETCA 3PYXA 5JTTA 5KQPA 1EK6A 2OK8A 5BVHA 1GV1A 1BEZA 2Q8QA 1N7HA 4KEAA 4TKMA 3TRFA 1YJBA 3D4PA 4IOKA 2VTBB 1RLIA 4OF4A 5TGDA 3TI7A 5JZBA 4H1VA 2XXAB 3K1ZA 3BGVA 2B25A 2RJOA 4R1TA 2GTIA 1IY0A 1ESMA 3QUQA 4MWZA 4I1YA 1JE0A 4U2DA 1ZHFA 3O2SB 4OA8A 3STVA 2JB9A 5K4AA 4D4GA 1DQZA 2BM8A 2B3TA 1UBEA 4RHTA 3T7IA 1W87A 1RI4A 4B6EA 4BPBA 2HBYA 1GPLA 1XXHA 4FI3F 3A1VA 1DPFA 4RYDA 5EE3A 4RKWA 1FB5A 1IZ7A 3JVVA 1G6HA 3MWLA 4HXEB 4F92B 5AVRA 3E2PA 3VKFA 1X0VA 2ADMA 2AJLI 4K1LA 2V5VA 4K6HA 1E3WA 1LF0A 1UPFA 1NZFA 3BPSA 3ZYZA 1MB0A 4LOHA 1R3UA 2RHOA 1AMUA 1SVIA 1N8NA 3KLMX 2DRIA 4OYRA 4PRLA 4ALMA 4PCAA 1A7AA 2BMDA 4F2HA 1KKLA 1T3GA 3KKEA 3IP7A 4AWXA 2QJWA 1R66A 4OKNA 5BSTA 3ZR4B 4B40A 4Q4AA 4B0PA 3MWYW 4Z9XA 4EH1A 4TVKA 2C0PA 1ILWA 4NYJR 2C94A 4MROA 3HJNA 4JVOA 2YV1A 4U6QA 1PT8A 3OEHA 4ARAA 2R6DA 2XUOA 3JAKA 4PIVA 4JNCA 2X2OA 3C7CB 2ZSDA 1G20E 5LU8A 2OPBA 3RBAA 4DV4B 1CUBA 2GFHA 1XP8A 3ER9A 4Z7JA 3DBRB 3E9RA 4GG1A 4RPKA 2HTEA 4JI6B 1PJAA 1NAIA 4WCFC 5FOUA 3GLKA 1C1XA 2PJZA 1UEIA 4Q7JB 2H6EA 3F6CA 4DBZA 3TE6A 1PGQA 2Z2YA 3DTNA 1FVFA 3IKMB 4LDZA 3USES 1OB2A 2W48A 4QSMA 3BGSA 3BG5A 1JZSA 1QH8A 1R27A 4IIXA 1YJ8A 2QTVA 3P0FA 2JGKA 1YB2A 1JAYA 2D06A 4DJ5X 4WAUA 1QQAA 4OQXA 2B9VA 1SG0A 3IBYA 4Y0AA 1WW3A 2XE7A 4QEKA 4REQA 1ZRMA 3AHGA 3DP7A 3V3KA 1Y3AA 3ADCA 1DRWA 1FXSA 1WB5A 1YB5A 3KKQA 3SEAA 5CAEA 1A72A 1OT5A 2WAMA 2LZ0A 5DHQA 4AAYA 3H9EO 2BMAA 5AHRA 2I6QA 4KR6A 2GEBA 4FS8A 3T8YA 5GINE 2O59A 2EJBA 2W2LD 4Z0HO 2SBTA 2UYGA 4Q4HA 3EDQA 1FIUA 2A0WA 1P4RA 3N53A 2W2KA 4TYPA 3ZXIA 3VU3A 3N2GA 1YTUA 2R6JA 3HVIA 1EUCB 5D7NA 1I2AA 3MD9A 2NZUG 2ZRLA 3R5FA 2ODAA 4M1QA 1Z4MA 4QNNA 4MGEA 3TNYA 1QG2A 1TZCA 4UNQA 3F7TA 4RH0A 3IESA 3I5MA 4UQOA 3T61A 3SVTA 2NTJA 4ZO4A 4X66B 3ZHTA 3GFVA 2Z2IA 4FX5A 4BMCA 4D3DA 1NRIA 3PQ7A 3SXJA 4KTVE 3QFRA 1JBQA 2HIGA 4WL0A 4OQLA 3PVZA 1TCVA 2EP8A 1RT9A 4LXIA 1E2EA 3SI7A 3V9AA 4EHJA 3NPAA 2WDZA 3F6PA 2V7XA 1PYOA 3N87A 2IH2A 3BCHA 3HBJA 5IAJA 3R9XA 2O0HA 4R2XA 2JZNA 3T52A 5JXIA 5IRCD 2NO7A 3JPYA 3MRTA 1AUXA 1UMDB 1Z0UA 4RD3A 2GLUA 2P3LA 1RC8A 1IXZA 3JZIA 1Z29A 4X6LA 3SC3A 3UT6A 4DDMA 4QZVA 4YAUA 2VRCD 3GP8A 3PT9A 3N39C 2EL9A 1IQRA 2NPOA 2VNKA 3RYTC 3PTAA 1Z17A 5IJ9B 2JS7A 4E15A 2V7QA 1TJYA 1QWOA 1XTSA 2GASA 3EIEA 2FEPA 4GYJA 5FPTA 3TINA 1IJKA 5EP4A 2W43A 3SOPA 4ALNA 5K0FA 1NOKA 2YZ7A 4CG0A 1YVDA 3KZVA 1TEXA 2GH1A 5AW4A 1ONPA 1UJCA 2WY2D 1UOPA 3A58B 3AB8A 3D3NA 4GX2A 5ITZA 3D81A 1WE2A 2H4FA 2WYHA 1E2GA 2OD7A 4TZKA 3SZOA 2NP7A 1GZUA 5MN5A 3RAFC 1B42A 3KE9A 3S99A 4B85A 2UZ1B 2V0CA 4YUXA 1C7RA 2R8ZA 3GLQA 3GJ7A 5EHXA 4NZZA 4KGDA 4BGDA 4RWZA 3W05A 3SC2A 4BRSA 5A7GA 3F6YA 1XWIA 1IXKA 5G4KA 4Q34A 5DIFA 4A0RA 3FWPA 1CR2A 4HBGA 3WLRA 5KWIA 1R8SA 5GQSA 4XIGS 1M2VB 5JAUA 2JHAA 3CLTD 4OHWA 2ATEA 2FFQA 5B58C 4E2XA 1U7ZA 3AHDA 4ACBA 3A9VA 1R6AA 1CRWG 3QSGA 3SR0A 1TEZA 4NOKA 3BXFA 4EG4A 1YRLA 2D0PB 3UT5A 1Y3IA 3SIXA 4W5JA 3WMWA 1YQUA 3N59A 1TXGA 2VUIB 3LZDA 4GC9A 1RW4A 2C5AA 3VNAA 3D2BA 4RTNA 2SNIE 1E1LA 4H15A 2Y1LA 4MKRA 1TTHA 3Q1KA 1QE0A 3OHSX 3C48A 1XTBA 2QRUA 5CT5A 5IXSA 5L3QA 3RSFA 3ZGLA 4YROA 1CLUA 4I5GA 2UUBB 5LBUA 3KQPA 1WXWA 4DQVA 3DMTA 2UUPA 1TX4B 3SSOA 2DFKB 5MN6A 4ZQHA 1QFJA 4JQSA 3ZDXB 5CBPB 5CW2A 2PRZA 5IU6A 2O2XA 1XN1A 5HGJA 3DMYA 2EWMA 3OO1A 3HPRA 2B1JA 4GNRA 1NVVR 1YJQA 1KARA 2Y4OA 5CNKA 4C2UA 4EJSA 5FA6A 3KT6A 2A9QA 5HQTA 1KMNA 3M89A 3DDOA 3PXDA 1TVKB 1YZQA 4D56A 5JNWA 4IIJF 5IJ0A 4JWKA 2CXTA 3MINA 4WLFA 1MAWA 3E9YA 1VIAA 3FTPA 4LZJA 3JPWA 4RZIA 3S2FA 3HXOA 1CZNA 1ZC4A 4IIJA 1NNEA 3MQFA 4GBMA 4RAOA 3REQB 1KI4A 2WT4A 2XGMA 1RZUA 1C8LA 1DRKA 2GFIA 1U0RA 4HOYA 2Y1KA 2XPCA 1KYQA 3IHWA 4ZVPA 2FMTA 1NUQA 2IXFA 4B8WA 2ASEA 2CJFA 3LX8A 4HXYA 4Y2GA 4MDEA 4HXGA 2IYPA 1PYGA 4W7IA 2IHYA 2RGYA 1RI1A 3GRVA 4TT8A 1JEQB 5CHYA 1NVXQ 2EBWA 1YZHA 4OP1A 4DLVA 4Y2QA 3A9CA 1QYWA 2G5CA 4X5OA 4I3FA 1L4LA 4MQ6A 3OX2A 4NARA 4C22A 1L5YA 3KXKA 3X1WA 5AM1A 3NVMB 2HSDA 2VK8A 1OXXK 4JT9A 2PJUA 3EC7A 1J9GA 5ALZA 3KCQA 2QVZX 3C1UA 5DT2A 3ZD6A 1SHJA 3PFFA 3I04M 4JY7A 5T4BA 3H1EA 3WGHA 3ZJ5A 4F46A 1IQ0A 4C4TA 3BWCA 2FEMA 4M1ZA 3T1NA 2VJCA 1J8YF 2BGRA 1TQ4A 4JGBA 1NLFA 3HY6A 3DR5A 3DUWA 4DM4A 1HYHA 4UW9A 4C0QC 1RLMA 1LBEA 2QN3A 2W6MA 1E8MA 1KJZA 3LRTA 4OK6A 1AUVA 3CYFA 4RZXA 2HCBA 5DEIA 3JD4A 3HXQA 1GZ6A 3EX7C 1DE0A 2WZDA 4FJ0A 2HTFA 4XGIA 2QY6A 3WLEA 2QM7A 3GLUA 3RC9A 1BXKA 5JCOA 5L53A 3C3JA 2ZB7A 4C4OA 4M99A 5E3IA 3H2GA 4HEA1 2AOTA 2FPIB 1Z68A 2OCXA 4XIIA 3L1KA 1HUQA 4JU8A 1NVAA 1QRDA 2FMHA 4QATA 3UT0A 2Z6VA 1DELA 2XH8A 3L8YA 4X93A 2J7PA 2IDMA 2R86A 4YCDA 5EXTA 4GT1A 1E1YA 5M34A 2GZDA 3HNOA 3HNRA 5CX1B 1AKTA 1PVDA 5C0OE 1ABFA 1OBVA 1V5EA 4A6EA 3BE6A 4MVJG 3QYPA 4MW0A 1HE5A 1Z74A 1OU4A 3DMPA 2D62A 5JNLA 3NTLA 5JS1A 2ZW9A 1U3UA 4KKVA 1J90A 4FT2A 1CVIA 4RZUA 3I9MA 2YVQA 4X41A 2WTMA 3KEOA 4HQKA 4KUEA 3BB1A 2FP3A 3WZLA 2ERYA 3MWDB 3ZCRA 1BDIA 3NM5A 1BKSB 4FD3A 3TJMA 4D8VA 4U8HA 5J43A 1ZK1A 1UMKA 2GA8A 2X1MA 2ZJ3A 4B1FA 2V3CC 3AVXA 4NP6A 3PV0A 5JS8A 4HTAA 4EG8A 2QNBA 3Q6MA 2QQFA 3DT8A 4NENB 2FQWA 1T0IA 3OCCA 4XD2A 4L4UA 1X0XA 4Y9SA 3ZI4A 1DIRA 2BV3A 2HREA 4HNVA 5KYNA 3AFGA 2H1CA 4D9HA 4XDYA 2HBRA 3VC1A 4JAVC 3WZMA 2VZ0A 4BZPA 4CRWB 4C4AA 1W59A 2QIPA 3IIIA 1FRQA 1T1GA 1HXHA 1P3JA 4UOEA 1U0NA 1Y6QA 2P3QA 1G64A 3NCTA 2RGCA 2Z8ZA 3QA9A 4FMDF 1T4MA 1SHZA 3BERA 3CIFA 4LQ4A 4UBJA 4KQEA 2SCUA 4O02B 1SBHA 1XMPA 2G08A 3RYIA 2PMEA 4EMBA 2Y6UA 1VE5A 4MA4A 5HFNA 3WRXA 2G9NA 3B5EA 1OLUB 4EB6A 5BV2P 2BHSA 3H8VA 3MWGA 4C7JA 4D0SA 3FZNA 4EGCB 4EG0A 2QRZA 1FDUA 3B9PA 3JQRA 4NBWA 3SAJA 2O57A 1TQDA 3CEJA 3JVIA 3KIPA 3NIGB 3D2CA 1H0KA 1P1RA 4G8CA 3VDQA 4CG2A 2JATA 2Q5OA 1QPGA 5G0TA 1VHQA 2IOFK 1O77A 4YDQA 1L7VC 4N5MA 1QQ5A 1GGEA 4R3NA 3I83A 3E05A 5C34B 2C4KA 4MB6A 1SMKA 1YR6A 3D6FA 4H1HA 1Z0IA 3DOEA 1NKSA 3UW3A 1ID8A 4JK3A 2DFDA 5C81A 2R60A 3BILA 4EK9A 1PKEA 2VSQA 4EW2A 4QC2A 1KAQA 4BFYA 4KE7A 3V8EA 5K5EA 2ZRIA 3QBEA 2H1HA 2AJ8A 1RWPA 2JEYA 2Q6TA 2QD5A 3KB2A 1MT3A 4RKRA 5FNVF 4Q19A 4OU5A 4IXMA 1YIDA 3VI3B 4E22A 1NAHA 5FNVA 2OTCA 2L18A 1P9OA 2WTEA 1E79A 4MLZA 3PUWA 5L4SA 1WB9A 1VKOA 5KDOA 3FCSB 1P8AA 5ECWA 3QVKA 3ZEAA 1TECE 2IWHA 2JAWA 1N5MA 3OOHA 3SFTA 4MP8A 3MUNA 1LTHR 1BIFA 4F11A 1BDJA 2X0RA 3L0CA 2HQ1A 2BD0A 2HDWA 3D3WB 4IMIB 5KS2A 1N2CB 3T7KA 3C6YA 1CX9B 4GYYA 5JJBA 1II8A 4GOOD 3I1FA 4KWEA 4KGVA 5AVJA 5J40A 1MBZA 2WILA 3EWSA 5J2TF 1QRSA 2PU7A 4A15A 1GFSA 1MENA 3BMQA 5JLAA 3P2MA 3TQQA 4WV3A 5J2TA 4GYKA 4IDDA 2EKLA 3P2JA 5MFPA 2ZRBA 4Q24A 4RF5A 4A6XA 1L1EA 3I6MA 4LN1A 3ZHQA 2O4CA 3FKSD 5D01A 2HNAA 3C7KA 3WC4A 1Z88A 3RIEA 4B81A 2WWHA 4AKGA 3ORSA 3A6FA 4H2DA 2GK6A 5A5GA 4E7PA 2B61A 3LQYA 4J4HA 3KR9A 4Q7LA 2DQKA 1DV1A 3HFGA 2X9VA 2XT0A 1JAHA 4FUQA 4HGYA 4TTIA 4JDUA 4QXRA 1EBFA 5LOVA 5E1OA 1G59A 1RHUA 5EMJA 2D2VA 1NRXA 4TLEA 3RFCA 3RIYA 5TE9A 1TM7E 3SN6A 2Q6OA 4IZHA 5K7SA 2V7WA 3ANNA 4F5EA 5EVCA 4MICA 4UEKA 2PMKA 3C2QA 4US2R 1UJ4A 4B9EA 1FSGA 2JI4A 1Q0LA 1ECFA 5AOVA 2D5BA 3AU8A 5KOHB 4JSTA 2O3JA 4LDNA 3G3EA 2X8AA 3ED5A 1G8AA 1GCUA 3O4FA 1JMVA 1P6XA 1NZJA 2BSQA 1TF7A 4JLUA 4RMGA 4PN7A 5JANA 4LVNA 3QFSA 3C8DA 4H7EA 1VLLA 2GQ0A 5KTKA 3I30X 2DZDA 1HX7A 1FX0A 1PZHA 2GUWA 3FG9A 5EJ5A 1BWQA 1XX6A 2XDYA 2WV9A 4MPDA 4YMSA 4BNDB 3W8RA 1PIWA 2B8WA 4BNFA 1K4KA 4U00A 2WJHA 4CGYA 3I9KA 5SZJA 3NIFB 4BJ5A 1BC5A 4DSAA 4W6ZA 4WZBE 4RIHA 3UJ9A 1AGNA 5EHQA 4DBVO 5K8VA 1QGYA 2DSTA 5EWLB 3E82A 1W0KD 1JHZA 4R05A 2I4LA 5AM0A 3X3HA 2Z9CA 4YRCA 1LI5A 3ZIAD 2OHFA 2IC5A 3IB6A 3JQDA 3TQRA 1YXMA 4O8CA 4R0NA 4G81A 4PC3A 3F74A 1R0SA 1E7MA 3SP1A 3ZY3A 5CDYA 1IEWA 1N9GB 1P29A 1T1JA 3DHNA 3KAPA 4X6UA 4Y1RA 5IP5A 5L8VA 4GP6A 4D42A 1RWQA 1A95A 4FFBA 2WM3A 1P3DA 3DV0A 2VWPA 3KB1A 4I9FA 2I7VA 2E5FA 3BWXA 2GUGA 4GQIA 1LZKA 1PJ3A 1QWSA 2DPLA 2V6JA 1L5LA 1TGVA 2VOJA 2WNIA 4R83A 2QNRA 3ETHA 2O0LA 2PJDA 1D2RA 3F6SA 3HDQA 4GX1A 4C3VA 2V7UA 2YRXA 2IXEA 3V46A 2D5IA 1XTZA 4YAJA 4QDKA 1UCFA 4E5UA 5L6MB 4W5NA 3NHRA 2OFPA 3LY9A 4MDHA 1OTXA 1KDPA 4TSFA 1JU9A 2BM0A 3W2TA 1QCYA 3ZGYA 2E4ZA 2OO7A 1KHHA 4FFSA 1BYUA 1DKUA 4UMEA 5KAPA 2H57A 1VCNA 2E3JA 4B3DA 4P9NA 4BRUA 1EPUA 5KQRA 1MEJA 4DT1A 2JG3A 2QR2A 4U9IS 2W2VA 4GO1A 4J0GA 1NBIA 4G5FA 1A8UA 4DIEA 2PUFA 1SU8A 3L7JA 1R8XA 4PG6A 4KLZA 5HZMA 2ICAA 1MQAA 3L1HA 2NSHA 1WU8A 2J3EA 4NY1A 1QK5A 1Q19A 5KCMA 4XCVA 3TJZA 4RKFA 2P7IA 2C3OA 5J4YA 4CKWB 5ALSA 1CR4A 4ILEA 4HQ6A 1H8HD 4UHEA 3EDCA 2CCKA 3LZ6A 3S8EA 4RTQA 4MJ7A 1Z4LA 3I9NA 3P1JA 1RP7A 4RNCA 4BFSA 5ESXA 2YWBA 2DTEA 2NNLD 1N4AA 4ZK6A 1QP4A 2ZRFA 1EZZA 3HHEA 4C43A 1AXEA 4KCGA 3W90A 1SIOA 1Z07A 5CFNA 2FDCA 3DAGA 3R0XA 1N0IA 1TVCA 2UZ4A 1CY0A 2IIBA 1Y33E 4DKXA 1YS7A 4F97A 3W2GA 3C6KA 3G7UA 1BMTA 4U7FA 4BV9A 2RAVA 4EVRA 5JD4A 2XB6A 4YMVA 4DS3A 4JLAA 4RJ2A 1HYBA 4WVFA 3TTSA 5C80A 2O8DA 3HB7A 3H4VA 1H3FA 1TM3E 3QVGA 3QWHA 2B21A 4HADA 4A0GA 4EKDA 3G0CA 3N6VA 2E21A 3CRRA 1NV9A 3B9BA 3RRBA 1ADJA 1RXSA 4K40A 3AP3A 4GWLA 3COZA 5DM0A 3Q8LA 3H1FA 4ZCTA 3PNPA 1T1SA 4OJTA 4QBGB 1J2TA 4NAHA 2IQIA 3D5QA 1DADA 1W2WB 1NXXA 2CZQA 1G4UR 1M34A 3IA2A 1OLXA 3PLNA 1A98A 2FN8A 3C5VA 5F1PA 5JJKA 3QIVA 2F9MA 2FQQA 1VGVA 3EAFA 1YQGA 3VPCA 2GETA 3MUEA 4OM7A 3FKSA 1ORTA 3UQZA 3ZTYA 1W4AA 4BO1A 4EW6A 5C2JB 4Q3OA 3TGPA 4ENUA 2BSAA 3KOWA 4FB5A 4ZICA 3UJAA 4JA2A 3KPYA 1CQIB 1GLVA 1J25A 3OJWA 4M83A 1F8GA 4MH0R 1B74A 3TLXA 1IULA 4WT7A 5AJHA 4D8UA 4CQMB 3DKRA 5DBHX 5UKDA 3SJBA 4KXNA 4DANA 3AU9A 4OOFA 3DKKA 3E4DA 3PL1A 2X9GA 1F0KA 1HYEA 2PV0A 2GHRA 1FVHA 5DM70 1ZYUA 4JFAA 1HDOA 3NM6B 5FYDA 4CM6A 4WD3A 4WIAA 3Q7IA 4BVGA 4EY8A 3LUFA 3EB9A 4MCHA 2GPBA 1FU4A 1M6EX 3EXIB 3GGGA 3R6LA 3OU2A 3VZQA 1Y9EA 3F0TA 3QOXA 3WDSA 3BKWA 2CDBA 2ORIA 2TSYB 3RUAA 3TAUA 2QORA 2XYQA 3TRHA 1PJLA 5A06A 4G0OA 5LQRA 5ALWA 3AESA 2BMJA 3GUCA 3PNQA 1X3LA 4KFUA 4RPIA 4JSRA 1G2QA 5G0SA 2IPXA 2PWAA 2UVPB 4O63O 3N8HA 5KTYA 3UFXB 1F6BA 2BGWA 4IXDA 2F9LA 4PS1A 3U3JA 2ALJA 4HDOB 4UUPA 2I6TA