2XTNA

Crystal structure of gtp-bound human gimap2, amino acid residues 1- 234
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
208
Chain Sequence
SELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Oligomerization in Septin-Like Gtpase of Immunity-Associated Protein 2 (Gimap2)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GTPASE IMAP FAMILY MEMBER 2
total genus 81
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtnA00
1JAIA 3D3QA 2QUZA 2FEMA 2FSHA 2RGBA 3MUFA 3QVUA 5EE5B 2GJSA 3N5CA 3GMTA 4A2WA 5DI3B 1N6RA 1QDEA 4MKFA 2O8EB 3LD9A 5FBVB 2GJ9A 1G8HA 2C95A 2R9VA 4B3CA 5FTJA 4BWYA 3IIJA 4TYNA 4AI6A 3ZD7A 3CWZA 2P65A 4Z54A 1U0HC 2WJVA 2HYIC 2IHYA 5HE8A 4WIAA 2ANCA 2O8DB 5GJVC 4OBEA 3BH7A 1TUIA 4MRVA 3B1WA 2X8AA 2ZI4A 3AH8A 4M21A 3M0EA 4CDGA 4YC7A 1X86B 2VTKA 5JEDA 4Q1BA 5HKKA 2J7PA 1DAGA 3THYA 1D9XA 4B75A 1Q20A 2HDNB 1KSGA 1MV5A 3A1SA 2F43B 1OH5A 1E79D 2EFDB 4Q1EA 2ECKA 4Y0AA 4DT1A 2YKGA 1XMJA 1ZIOA 2ORIA 2P2LA 1E9AA 3O8BA 4DEYA 2XXAB 3KFVA 3PEWA 4DDTA 3RRMA 3CPJB 4LHZA 1VECA 1AS2A 4PR0A 3GLIA 2NO6A 5FTMA 3LWNA 4YMWA 1SVKA 3GFPA 3BJIC 1E2GA 3LXRA 1NSFA 1UKZA 3J81k 1TQDA 2V7QD 3MG9A 1FNNA 1YQTA 4R98A 1Z06A 2RMKA 3TR5A 3QIAA 3N70A 2J46A 4KSBA 3RS0A 2DY1A 1PVOA 2EFGA 1E9DA 2OM2A 2ZU0C 4IVPA 2IYSA 1RVDA 1ZVQA 4DLXA 4G5OA 1KK2A 4JJZA 1G6OA 3SC3A 2Q3FA 1BIFA 5SZHB 2ZIAA 3C5CA 3LO5A 2AN9A 2PEYA 3DPUA 4TMTA 4EFLA 2CHGA 2Z5FA 3I62A 2FA9A 1RIFA 2OT3B 2WJJA 2Z4SA 2ZUCA 1SXJC 4ON9A 2JLQA 3ICEA 5CDFA 3NHAA 4NTZA 2KJQA 3UMRA 1IY2A 121PA 1E6CA 4PAQA 3SJBA 5HKKD 3AP3A 2XGJA 2CL0X 4HLQB 1UM8A 2DFLA 3EWSA 3KTAA 2G3YA 4K46A 4OK6A 4QXAA 4D82A 3O8DA 2ORWA 1KDPA 2ODWA 1YZGA 3SOPA 2H18A 2OCBA 4EQ6B 1UEIA 3OEHA 3QKTA 3K9GA 4B44A 2V6JA 5SZIA 1LV7A 1QHYA 3AP1A 3LW8A 3AB3A 2Q9CA 2ZANA 4WW0A 5KTYA 4UXHA 2OFWA 4I99A 1Q1QA 1UBEA 3FPAA 4ASUA 4BLPA 3I8XA 1DEKA 4A0FA 2NPIA 3AVXA 1P73A 1S9DA 2EFCB 1NJFA 3L0OA 3P20A 1G8YA 2JATA 5B58C 3TBKA 5JZVA 5IT5A 2IS1A 4OI0A 2DFTA 3WRXC 4D4JA 1YHNA 2OCYC 4DC9A 5CITA 1VHTA 5FOUA 5L3VA 2F9MA 2OE2A 4Q4AB 3Q85A 3W3AA 5P21A 4A0HA 4C0AC 1KGDA 2E1RA 3R8FA 3VMFA 1E96A 2H92A 4P4TA 3I5XA 3K09C 5FUYA 3FMFA 1QF9A 2GXSA 4V0KA 4ASUD 2L0XA 1KAOA 3GEEA 2E87A 3A4MA 4HUQA 2WM9B 4RKEA 3E5HA 2GF0A 4HSEA 3CNOA 4JYBA 2Q9BA 4RZXA 3PENA 2VLIA 4C0BA 2A78A 1KAGA 4QJ5A 3K70C 4TYPA 3ZS9A 5IK2A 2O5VA 3BB4A 4HLCA 1GIAA 1RRGA 1R4AA 1ELOA 3SN6A 2WSSA 3FKSD 5K8UA 1NG1A 4Q4JB 3MWYW 5CB6A 1LFDB 3HDTA 4Q47A 3A1WA 3NXSA 2ZJOA 4MDFA 2G83A 4M0LA 1RYHA 4ILEA 4EFMA 3TGPA 1XEXA 4MYHA 4MRNA 3NC0C 4OHWA 1OIWA 2ZPTX 3DZDA 4AG6A 3T35A 4A0RA 2GEUA 3O8CA 2IK8A 3VQTA 3K53A 4A6XA 1E4VA 1XD9A 3UWOA 1D9ZA 3CF0A 3B1XA 2AL7A 3IDQA 2NQ2C 3P4XA 1M8PA 4JIMA 1P9WA 1H8EA 1FX0A 1K6MA 1UDWA 1VG9B 4EPXA 2QP3A 5EJEA 5FL7D 2B7BA 4IRUB 4OK5A 1W36B 4Q18A 4II7A 3BFKA 2KSQA 3GJXC 2C77A 5UKDA 2GAOA 4Q1FA 2YC2C 4TLAA 4CEIB 3QG1A 1OXUA 4XH9B 1DPFA 1Q1BA 3FKSA 1CLUA 2CDNA 3A58B 3IEUA 3EZ7A 5KNCA 4W9MC 2F55A 1O87A 4ZI3A 3Q5EA 4LJ4A 3K0FB 5JJIA 4Q03A 3P26A 4AC9A 2CNWA 2WWGA 1II8A 1ZU4A 1KKLA 2IHBA 2VP2A 3HPQA 2OFOA 5TVKA 3CRW1 4Q9KA 1G16A 2ZJ2A 4LJ6A 4QL3A 4B3BA 1W36D 4DBLC 3RS3A 3THWA 5K8LA 4OHZA 1U0LA 5DE3A 3KQLA 4CRWB 3W6OA 4OI1A 1G4AE 4M8NE 4LY6A 1CBUA 3RANA 1XZPA 3NEYA 2PZEA 1IM2A 3DMDA 4NYJQ 3UK6A 2OHFA 2GCOA 5KYKA 3OHMA 2ZR7A 2QAGA 4QFMA 4QGGA 5EXTA 1ZCBA 4Q4HA 2RHDA 4DVGA 5BW8A 3TQCA 4MRPA 4BLRA 2QG6A 1BYUA 2ANBA 2IWRA 2AK2A 5KU1A 2BBWA 1U2RA 4A82A 4BPBA 4QG7A 1KZ7B 2CVHA 3PITA 4Z1MD 3THOA 1BS1A 4AK9A 2YOHA 2X2EA 2BJVA 2Z0MA 3QF4B 1M7BA 2IYZA 4HAWA 1GZSA 3H86A 1DTSA 1AZTA 1Q1EA 4IJMA 1IOZA 3EAQA 4JLMA 4XD7D 5AUNB 4R7ZA 1OE0A 3C5HA 1NBME 1JEDA 4CEIA 1CS4C 4FINA 3I92A 1AGRA 2G77B 2ZRNA 4LJ7A 5AJWA 2H8KA 3ZZ0A 2RGCA 3IPYA 2ZQ5A 2OUKA 3FHCB 2B8WA 3X1YA 1PLLA 1OXSC 2IUTA 2J3EA 3ZLJA 3ECCA 2ZXUA 2UZIR 3BS4A 4KVAA 4B71A 1XZQA 1E2DA 2QBYA 1GSIA 3ICQB 1SHZA 3SBEA 3D6TB 1SVIA 5BN5A 3HU3A 4F7WA 1ZM7A 4WOPA 2VBCA 4GMDA 3KQNA 2C9OA 2C99A 2ZYTX 1ZBDA 5CB8A 1DAEA 4B3GA 3QNUA 2W6JD 2BEJA 1XXHE 2PT7A 4C0QC 3PUVA 5G40A 1UEJA 1DO0A 4GPTA 3K0CA 3FVQA 1N0WA 2FG5A 3SYNA 1XTKA 1W7AA 2QZ4A 1RW4A 3QI2A 1U9IC 2C78A 2J0QA 4OK3A 1NP6A 3CZQA 4OHXA 1Z22A 2QL6A 3OIYA 2YOGA 4PSVA 3MSXA 4C7OB 1F3OA 1ZM2A 1RZ3A 2HCBA 3QQ5A 1WXQA 4Q4JA 1D8TA 3SQXA 4QGAA 1P60A 2GZHA 3QY0A 2JDIA 1KOFA 2ZI9A 3SI7A 3TRFA 1JAHA 4LI0A 4WZ6A 3GPLA 3NDBB 4KYUA 5TB5A 4LPKA 4V03A 2V3CC 4IOJA 1T3HA 5FUXA 4B35A 4DLSA 1T0HB 1PJRA 3Q7PA 3CRQA 4X8OA 4KU4A 2JIZA 1JR3A 1M1YE 1P4SA 4AYTA 2JA1A 3ZQJA 3KXKA 1MO6A 2ZREA 2WOOA 4US2R 1EK0A 2JLXA 1A5TA 3H84A 2F1IA 2WIBA 1E69A 2OLJA 3PV0A 4ZCIA 2O0HA 3TAHA 1OV4A 4FN5A 3TSOA 1E2JA 1CRPA 3PVSA 1COWD 5F3WB 3A8TA 1AJEA 5H1YA 5C2JB 3U3OA 4LC1A 2A5JA 1E3MA 1E99A 2NO9A 4HDQB 1KDTA 3W34A 2XJ4A 2ZYWX 2CNWD 4JLVA 3RSLA 1MABA 4L8GA 4A2PA 1KJWA 1YVDA 3GD7A 2O8CB 2D7CA 4KBGA 2FV8A 3MD0A 4B48A 1X3SA 5IF9A 1T5IA 3LAWA 4WA7A 2LWIA 1N5IA 2DHRA 4M9QA 3VR4A 2IS2A 3CPEA 1JBKA 1BH2A 1F5NA 2RGGA 3IHLA 2ZM5A 3AF3A 2A5GA 2P5SA 2EWVA 2W0MA 1XTIA 3MAAC 4YXWA 3MFYA 3OFNA 3SHWA 3KQKA 1KO5A 1E9FA 3BERA 1QG2A 2XJ9A 3B13B 1SULA 2YJTD 1XBTA 5KDDA 4JVNA 3OIWA 5FBWB 1CR4A 5BXQC 2RGXA 3IILA 4LUCA 4EAQA 1J90A 2ZAMA 1IAQA 4W7SA 4AKIA 1NJGA 3ZS8A 3QXHA 5JSZA 1BMFD 4CEJB 3JVVA 1W48A 3QXSA 1IJEA 4F4JA 1NRJB 4NYMR 4TL8A 1SGWA 1U81A 2J0VA 4R9UC 2DWOA 3AQ4A 4M1YA 2AX4A 2GBLA 1NSTA 4TSFD 2WWXA 3MWKA 2PLFA 3K0AB 3PEYA 4MGIR 1HE1C 1OIVA 5JMTA 2HT6A 3AEZA 1OH7A 1QHHB 4US1R 1WCV1 3CPHA 4FMCF 4GZMA 5E7MA 2KB0A 1DG1G 4URYR 2C5LA 3RABA 5AJXA 2W58A 3NBYC 4AKGA 3B6EA 3GLHB 2IEZA 1RPZA 4ZCMA 4BRUA 1UDXA 1IN4A 4KSCA 3OEED 1IJFA 2ZROA 1E1RD 1SKYB 1G41A 3BH0A 3AVOA 1JEEA 3QXXA 1G3QA 2YZ2A 1ZM9A 2R6GA 4FMBB 3CO5A 2D7DA 1J8MF 3QEJA 4RD4A 4NE2A 3NTUA 2B7CA 3REFA 1EXMA 1W5SA 1YZUA 2IYQA 4QHTA 4NKRA 4LCBA 2QMHA 3ND9A 3FB4A 3THYB 2BCGY 4URUR 3FHTA 2MSDB 2G6BA 4X8HA 2WZQA 3LLMA 5FTLA 3AGPA 5DI9A 2WWYA 1GAJA 4D0LB 5DYGA 3P4YA 4XTCS 1U9IA 4HUTA 3BBPA 1G20E 3VTKA 4EDHA 3C15C 3B78A 2IXGA 4EKDA 2IYTA 4M1MA 4TLDA 1TX4B 4UNSA 3T1QA 2FGKA 3F5FA 4PANA 4TL9A 5FBLB 2DWPA 5AJVB 2JLRA 5JLJA 4TQ9A 5FUWA 1U99A 4AYWA 1FL9A 2ZSBA 1N25A 4JLAA 1OB5A 1L4YA 1N5KA 2BC9A 1P2TA 1T3LA 4M1TA 4WBSA 1EWRA 3UPUA 2JLSA 3WYGA 1SZPA 2WJYA 1UBCA 1G64A 4D80A 4IOKA 3T1VA 3BD9A 1R7RA 4FWTA 1HT1E 2VP9A 3ZVNA 3WMEA 4DLUA 1C4OA 1N0VC 4TTQA 3KKNA 2J1LA 2FFAA 3Q7QA 2ZRFA 1O3YA 3NKVA 2FDCA 3QSYA 4NZYA 3SJZA 5E7JA 2JIZD 5FPKA 3WBJA 2ZJBA 4IDNA 3GLHE 1ZINA 4MRSA 4C0LA 1Z2AA 2GHIA 3RVBA 2XITA 3HWSA 4NONA 4XVUA 5B30A 1T9HA 2ZRGA 4C9BA 3B1YA 1NN1A 1HQYE 3QEOA 4A15A 5EE9A 2R6FA 4N3NA 4D81A 5CLQA 3L2OB 1G18A 4QHYA 2N46A 2WWFA 3PG5A 1T8UA 2VP5A 3LY5A 2RAPA 3FFBA 4RVCA 2QROA 2X1VA 1XPUA 4PTLA 1E98A 1YJ5A 2GVZC 2ZJZA 1VDZA 3NEJA 1DG3A 1W4RA 5FR2A 1XWIA 1WE2A 4NCIA 1SXJD 3VX3A 1G3RA 1U0JA 3DOFA 1FZQA 1XTRA 2XNSA 5GJBA 1P7CA 2VIIA 2KWIA 4NYIQ 2VH5R 3K0AA 4TLCA 1ESNA 2CEAA 4LYAA 2PZGA 4C0SA 4QJ3A 4HB4A 4PC1A 4CT5A 2JAQA 1F2TB 5EQTA 5BN4A 1OIXA 1E2FA 1OFHA 1U8ZA 4P0TA 3NH9A 5IK2D 1N0UA 1CJVC 4ARZB 1S96A 4GT1A 4YMSA 5JI2E 1D2MA 4BEJA 1JPNA 4HATA 4UNPA 4Z51A 4O0MA 2J7PD 4B76A 4NH0A 4DCUA 3PCRB 1OSNA 1K5GA 1M74A 3PIRA 4Q7JB 3RS5A 4M2LA 2HYDA 3ZQ6A 3AF2A 4K8OA 4FD2A 3AKCA 4UNRA 1ANKA 3QE0A 1DVRA 5CDFE 3GFOA 2RGNA 3WMFA 2VHUA 4LV6A 2Z43A 2GVDC 3B1ZA 4YQFA 4CF7A 4LJ8A 1CR0A 2QI9C 4IXNA 4ZIRA 5L3SA 2DCUA 4A92A 1SVOA 4MH0R 4CZ2A 1UKYA 1OHHA 2IF0A 4W5HA 5G3ZA 4ZDWA 2FGJA 4HDCA 2GJ8A 4BFYA 4XTRA 2F9LA 5JJKA 1HTWA 2D4HA 4RFSB 4BUJA 1QHXA 2VP6A 3NHBA 1MOZA 5JJLA 2CHVA 3PJRA 3O47A 2IYXA 5JSZB 1ZP6A 1AM4D 1JR3D 2A5DA 2JJ2D 1N5LA 1Q44A 2DBYA 5AJYA 1UBFA 1LS1A 2HLDD 5F2EA 2J45A 1G8GA 2CCKA 3T5GA 2ZI5A 4AURA 5IRCD 4P4SB 3ZD6A 1TEVA 4QNRA 2AXPA 4XIGS 2FN4A 5HE9A 5C4GB 2P6UA 3SFZA 2F7SA 4FMCB 3CF2A 4Q21A 5JS8A 1GOTA 3DKVA 2C2HA 2VEDA 1G7TA 1MABB 1ZM4A 4CEHA 1QHNA 3U61B 5KDLA 3FDIA 3GJ0A 1KZGB 1TQ6A 4Y0VA 2OAQ1 5JCPA 1OKKD 4LBWA 3I8SA 1JXOA 4TWZA 2IF2A 5M04A 5H8WA 2WPDA 1VPLA 4QGHA 1GKUB 5EZ6B 5FR1A 2QAJA 1KSHA 4D25A 4G0NA 3T1OA 5EP1A 5SZJA 1E1RA 1XMSA 1H8HA 1KMHA 2AD5A 2A3RA 2FWRA 2NIPA 2ZE8A 2AFIE 3CH4B 3D31A 3X1DA 2OV2A 4AKEA 2R6CA 4ZKDA 3KKMA 3RAPR 1L8QA 2IYLD 3KB1A 4GZLA 4JVSB 1SVMA 4MGYR 1W0JA 1FP6A 5BWMA 1OYYA 5AJZA 3AVQA 3CX7A 3DZ8A 4LSGA 5GADl 1E0AA 4I81A 2WVJA 3LV8A 1F60A 3LBHA 4TLEA 2O8EA 2QTFA 2QBYB 2WICA 4JSYA 2WKPA 4PHFA 2IYRA 1X8LA 2EFEB 4RZ3A 3KKOA 3W8RA 4B3FX 4DUGD 3TSWA 1D5CA 4L15A 1Z3IX 1UJ2A 3NDPA 1Z6YA 3B9QA 3VR5A 2YV5A 2BBTA 4GMXA 4PSAA 5DISB 4PO1A 2ERXA 4X8LA 1Z63A 4GI7A 1CU1A 3VAAA 4JLKA 2G0TA 5FH9A 1XDBA 3DOEA 2DYKA 2OBMA 3FGNA 5L3RA 2IS6A 4D0NA 1CULC 2OCPA 4GL2A 2OEPA 3CUEF 2XNDD 3KXIA 3TVDA 1W5TA 4KLNA 4GOKA 2JLYA 1BYIA 1YU9A 4CVNA 3AKEA 3B82A 4KFTA 4OQXA 1A4RA 3V4FA 4TL7A 2NZJA 4ZDJA 3TQFA 1WF3A 4IFEA 3IQXA 4AYXA 2H1LA 3A37A 4C0KA 1X6VA 4F92B 2HCJB 1G3UA 2PH1A 4MYUA 4BZQA 4HB3A 1A2KC 1KJYA 1NIPA 4JBXA 2JLUA 1BO6A 2CBZA 1R10A 1G8FA 3T12A 3NC1C 1NIJA 4D4LA 5JS7A 3DKPA 1W2HA 1IXZA 2NO7A 4TZ6A 3W5JA 4BFSA 1PV4A 4QC2A 1NBMD 4JL6A 1LF5A 3CR7A 3WXMA 3QXJA 3LBIA 1HUQA 1LW7A 4IEEA 3ZIAA 4LZZA 4JMPA 4AWXA 1OHHD 3VU9A 1ZUIA 3KB2A 3I61A 2J0SA 1U8YA 2BIFA 3TKLA 4N0EA 3NVAA 1R5NA 4BLTA 1OLOA 3EA0A 4NU0A 4B2IA 1Z0KA 3U3JA 1N6NA 3TSZA 2WJIA 3CRVA 2ZSFA 2V9PA 3KKQA 4KO8A 4XSHA 2WIAA 3ASZA 3X1ZA 4YMVA 4C7OA 3BB1A 4MA4A 1NI3A 5E95A 1ZD8A 1KI9A 3CRMA 3DM5A 3HPRA 3U44B 2OSBA 1Z6GA 3WNBA 1WMSA 3LA6A 1G3MA 5KUTA 1KNQA 5JHHB 2CE7A 3LRPA 2BOVA 2WTUA 4X8MA 5JWRA 4UQOA 2PLRA 4C2UA 3K70B 3CIOA 1N6PA 1XFAA 3PQCA 4ZO4A 4B34A 3F0TA 1GM5A 3S1AA 1HV8A 2V7QA 1IHUA 3DM9B 1CJTC 2ERYA 1OFUX 2EW1A 3EXAA 2P5TB 3L43A 4LDJA 5D3MB 2WPDD 5H68A 1L4UA 2D2EA 5JRJA 2EWWA 5FOXA 1W46A 1HY3A 3C8UA 1ZJ6A 1T91A 4IOMA 1Z6AA 5FFMA 2ZJ8A 1TL7C 4IKEA 1Q57A 4V0MA 4ZV4A 1GL9B 2ZUDA 1D6JA 4JLNA 4EPTA 4UJ3A 1XCPA 3HYTA 1H8HD 3U7HB 1A2BA 2Q9AA 3SDZA 1NY5A 1IXRC 2A5YB 3SE0A 2DR3A 4HB2A 5E7IA 5C1BA 1XTQA 2ZRCA 5FPYA 2V54A 3LVQE 3EG5A 4QM7A 2WMNB 3WP0A 2J9RA 4TT3A 2BVNA 2FPLA 3KKPA 4IVRA 2H16A 1YR7A 1E79A 4MYTA 4HLDA 5D3QA 4DIEA 4NCNA 3N2IA 5DSZA 1K5DA 2WSMA 1W4AA 1Z0AA 4YXWD 5HCIA 2D62A 4IHQA 2E9SA 2FFBA 1JQJC 2ZE5A 1Z28A 4BFZA 1PLKA 4BLOA 3A1VA 1SQ5A 4IW3B 3BC1A 2FSFA 3AV0B 1I4TD 1P72A 4KHZA 1QRAA 5J5CA 1Z2CA 3BORA 2RGAA 2QTHA 4DJTA 4KLZA 3LX5A 4P31A 2VYFA 5B64A 4DB4A 4G01B 4DCSA 4BE7B 2JJ2A 3B9PA 4KV9A 1ZUNB 1DE0A 1UPTA 4ZPXA 2ZS7A 5DI3A 2P67A 4FMDB 3R9XA 3DDCA 1XB2A 2UZ3A 2GXAA 1T3SA 1VYTA 2KI5A 5FPSA 3QF7A 1XEXB 4GNKA 5KSYA 2WV9A 1R5OA 5DNYB 1OYWA 3ADCA 3BOSA 5BN3A 4BGDA 2PJRA 1OH8A 1QHGA 4KI0A 1VCOA 1TF7A 3I1FA 1T8TA 1ZD9A 1S2MA 5J40A 3SYKA 2XSZD 2XNDA 3R9IA 3VNVA 1QHSA 2PX0A 3LW7A 1F6BA 4A0GA 2QM7A 4RZUA 5SZKB 2OXRA 4NPHA 1GDDA 4FMDF 1ONBA 2GXUA 4HAUA 2O8FA 2YNMA 3T1TA 2W2XA 5EP2A 4NBSA 3QKUA 1DADA 5IHPA 1W4BA 3I32A 3TNFA 2V8OA 3RRNA 2EQBA 4CW7A 4GFDA 1NN3A 1SXJA 4Q9LA 1E9EA 1GNPA 1XNJA 1E2EA 3DVLA 3EWAA 4HAXA 2EYQA 4DSTA 4TMZA 4B32A 1E2HA 3GLGE 1NVWQ 2IW3A 3NBFA 3TMKA 2GESA 2TMKA 2W2VA 2BBOA 1HE8B 2D2FA 4BFVA 2QU8A 3U7EB 1XF9A 2ZUBA 3W6PA 1U8AA 2QA5A 2WHXA 4NDZA 4IEIA 3R7WA 3TK1A 3T5DA 2ODBA 1T0JB 2IXEA 3KJGA 1Z0JA 2F1JA 3PUZA 4NL4H 2IS4A 2QSYA 4R2IA 3R20A 2VF7A 2A9KA 2XAUA 3IQWA 4LBYA 2I1QA 4URWR 3RYTC 1FNMA 1NMXA 2NPFA 3TUJC 4DLYA 1CF4A 1CKEA 2AHOA 2F3TA 3FYHA 1F2TA 3OZXA 4D6PA 3R9WA 4LJYA 5H70A 2BM1A 4PQRA 4KODA 3VKWA 1SKQA 3QKRB 5L3SB 2J5XA 1S4QA 3IUYA 2GNOA 1AS0A 3H4MA 2HLDA 4PHTA 4F38A 3W3ZB 1JQLB 4MKHA 3GQBA 2LKCA 3A6PC 2NGRA 4HZIA 1NKSA 1P2VA 1RJ9B 2R2AA 5CIQA 1TU3A 5KSZA 4EJSC 3TIFA 1EFRD 3QKSB 1OXVA 1KK3A 1N5JA 3B5JA 4M1SA 4OJKA 4DDUA 2CLDX 5L8VA 3U7FB 1B23P 2FMXA 2QORA 2O8DA 2EFHB 2REBA 3TE6A 1RFLA 2JCSA 4KVGA 3CR8A 5FPTA 2PMDA 2J0UA 2XZPA 3BGWA 4TTPA 4JSTA 1R6BX 1R5BA 1P2UA 1DARA 4UJ5A 4YONB 4GP6A 2OILA 4JL5A 2ONJA 4O25A 1E9RA 1JB1A 3R8CA 2XTZA 4DHEA 5FL3A 2BEKA 3AKYA 4D2IA 4QM6A 1KNXA 2NMVA 1GRRA 1RJ9A 3OAAD 4OYHA 1HT2E 1OF1A 1X8JA 2ZETA 1GVNB 3OE7D 2QMOA 5JHGB 1GFIA 1CRQA 1UKVY 2VHCA 3B7GA 3B60A 1IN5A 4BASA 2QNRA 1XD2B 3OEEA 1G5RA 1Z29A 3DEFA 3KQHA 1G5PA 1Z07A 1H8ED 4QBHA 3K1JA 3X1XA 4P33A 2FE4A 4Q4LA 2VRWA 3P27A 4WXPA 1J8YF 4CIDA 3GLFB 1MT0A 2A30A 3C16C 1G6HA 1XEWY 4LYJA 4TQAA 3VR3A 4HLUC 3M4YA 1FMJA 1MKYA 4A36A 4RD6A 2CXXA 2QEQA 1N6KA 4O3MA 1NLFA 2YWGA 4Q1DA 4P4UA 5TV2A 3H1TA 3FMIA 1OB2A 5F9HA 2Q3HA 4ZDKA 2YWFA 2OAP1 2ZE6A 2OZEA 3AVWA 4RY2A 2GK7A 4TL6A 3QOFA 4B3DA 3U4QA 4LOAA 1W49A 5EXPA 2R8RA 2QRZA 1IN8A 2QMEA 1XD8A 4V0NA 2WKRA 4JZKA 1W0JD 1TMKA 3V4RA 1KYIA 5KHOC 4PC7A 2JJ1D 3SQWA 4AY2A 1SHKA 3PUXA 5FOWA 3BWDD 4TSFA 4LBVA 1M34E 3M6AA 4D0GA 2V1UA 4LJ9A 2VHTA 5G3YA 4IDQA 4GP7A 3GJ5A 4PPFA 4U00A 2GXQA 1YZKA 2F43A 3MWJA 1G21E 2ZSDA 3SHFA 2DFKB 1P9RA 1DAFA 1ZD1A 2GEVA 4A1FA 2BDTA 4C0HA 4EPWA 1P62B 1DO2A 1KDOA 1TADA 2CJWA 4P4SA 1JR6A 3PFIA 4XD7A 3T15A 3WHKA 4MGZR 1NN0A 1FUUA 1JNYA 4BFWA 3NBZC 3KQUA 3SYLA 3UXMA 3VKHA 1E32A 3P1JA 4DSOA 4QGFA 1SKYE 3D8BA 5BYKA 3IIKA 3RSOA 4JLOA 1S0UA 3FHOA 4B74A 1AA9A 3U3RA 4LK2A 1DELA 1NMZA 4OI2A 5AUPB 4CEJA 2CL6X 4RFVA 3ZVMA 3GLFA 3IO5A 1X8KA 2HF9A 3OF5A 3RWOA 4I4LA 4DCTA 3LQQA 1EFUA 621PA 4M53A 3QJYA 1J99A 4KBFA 5JECA 5B57C 2ZI3A 1YE8A 3CM0A 4G3XA 3Q8XB 4M1WA 3TH5A 1EESA 3RNLA 5K8IA 2FX3A 5KSPA 1XCMA 4RJLA 2OBLA 1A82A 2ZRJA 1ZRHA 4EJSA 1Z0DA 1U94A 4PAMA 3X2SA 3OIUA 4BFXA 2QT0A 4Q7MB 4CT4B 3ZGXA 1XXHA 2MSCB 3LQRA 2FOLA 2QM8A 3GEHA 4DZZA 4ZI2A 1VG1A 3KXLA 4XOIA 5DLQC 4TQUS 2QENA 2W6ID 4MRRA 4Q9HA 3UG7A 4DDVA 1IONA 2C98A 1KI7A 4PPGA 4Q4HB 3K0CC 2XX3A 2BCJQ 4MKGA 3HU1A 4PAOA 2QSZA 2DB3A 4BLSA 3BIFA 3RS7A 3PEVA 2JLZA 1HA3A 4WZAE 3NG1A 5JWOA 5KDOA 2HV8A 2R44A 3U4QB 3K0EA 1ZC4A 1ZYUA 3TW4A 1JJVA 1KKMA 1K8RA 2GJAA 4G5QA 1US8A 1JXMA 2UVQA 2GEDA 3FKQA 1RRCA 1JR3E 2MMCA 4BECA 1T5LA 3U60B 1D2NA 3SJAA 5CIWA 5CK4A 2R6AA 4Z8YA 2LCFA 2W6JA 3C4JA 2J41A 1T4GA 1Q3TA 4OJQA 3SR0A 3S1AB 4C0JA 1W47A 1YZLA 1WDTA 3U6BA 1HYQA 2J87A 1VIYA 4PC3A 4DWJA 4DRZA 3A1UA 1VKJA 4W5JA 4FWIB 1JI0A 2WAYA 5AUQA 3V9PA 4JVLA 4WAUA 2HJGA 2V55B 1P6XA 3NWJA 2O0KA 1G1MA 4BEBA 3E1SA 4C4PA 1XP8A 5EE3A 4XJXA 4OHVA 1QZXA 5DN6A 4F4CA 4RKFA 1UAAA 3IIMA 5C46F 2IXFA 3CKLA 1CIPA 3QF4A 3FOZA 1VTKA 2B6HA 1VG8A 1FOEB 3NH6A 4XSGA 4Q9JA 1XPOA 3SBDA 1KI3A 2XZOA 1G7CA 2I3BA 2G88A 3P32A 3JZAA 4URVR 2FZLA 1TAGA 4NYMQ 1ESMA 4PFSA 3KL4A 1KI6A 2H7VA 4MQBA 3VHLB 1Q1ZA 1J2JA 2VPPA 5JWHA 2VP4A 2YWEA 1E2IA 2OXCA 2C9CA 5C4MA 4DLVA 5B2ZA 2FEOA 2ONKA 3GLGB 1LY1A 1OFTA 1FFHA 2ATXA 1SXJE 3CWQA 3DL0A 5AK0A 4MUAA 5AR1A 1CJUC 1M2OB 1OXXK 2QT1A 5JCZA 1P75A 2GETA 2GTPA 2VA8A 1MO4A 2C03A 4Q01A 3QENA 3RDPA 2RHMA 4B2LA 1E2PA 5HZKA 2C9YA 3VKGA 1FTNA 3A36A 5AWFC 4FXPA 4HZUA 1ZCAA 3FFAA 1BKDR 2BJWA 4JL8A 3RWMB 3KFXA 3CZPA 2WKQA 2ZJAA 3EIHA 4DUGA 4YMTA 3B8HA 2EVWX 2REOA 1AN0A 1B0UA 1C1YA 5FI1B 2R62A 2HJVA 1E9CA 2GA8A 4LC0A 2WJGA 1XPRA 3EZ6A 3KDSE 2GCPA 3EIEA 3MJRA 3HR7A 5DIFA 1G19A 4TYWA 3PUYA 1G7SA 2XTNA 3KZ1E 1IXSB 4FI3C 5FBQB 4E09A 5A5GA 2RB4A 1N3BA 2P6NA 1Y3AA 1KK0A 4GSYA 1E9BA 1KSFX 2XZLA 1FUKA 2YINC 2EU8A 4PZYA 2ZITA 4B33A 1W44A 1EFCA 2NZ8A 1W0KA 4S35A 5LDDC 3AGQA 1P9NA 2Z83A 5DYIA 4QHSA 2CLSA 2Z4RA 1XRJA 3I3SR 2VSOA 4LX0A 5GVRA 2ZRHA 2CCJA 1Z8FA 3K0FA 2QPAA 1IY1A 1V5WA 4MKIA 2GZDA 1YR8A 4XVRA 1AKYA 2YYZA 3A4NA 3TJZA 2O8BA 4AG5A 3GLIE 3HU2A 4LJ5A 2GF9A 4M22A 4NCKA 1YR9A 4DLWA 4ZKEA 5LB2A 1AQYA 1JPJA 2WSSD 2ZRIA 4Q02A 2D06A 2J59A 1I2MA 2SHKA 2ZRAA 3ZVRA 3I5YA 4MDEA 2PCLA 1QHIA 3ZJYA 3KJEA 2VHJA 3ZDQA 2O8BB 2H57A 1EG7A 2BV3A 3GCGA 2GRJA 2VSXA 4FCVA 5C18A 1OH6A 1D2EA 4Z1MA 1U90A 2FFHA 2XOKD 3BK7A 2NO1A 4LPSA 3GLGA 4IDOA 4PXAA 1MRSA 3GLFE 1P61B 1T6NA 2AFHE 4LHYA 5IDVA 1OJLA 3LBNA 2WOJA 1S8FA 4NMMA 4RSGA 1LB1B 5CLLA 2FJUA 2GCNA 3LH5A 4KFSA 3L0PA 1MO3A 1NMYA 3LFUA 4E07A 4ZIRB 4NYIR 4PZZA 3SZRA 2RGDA 1YR6A 1GUAA 1H65A 1AS3A 4B6EA 4XWAA 2FSIA 1ZM3A 4FCTA 1VCNA 1DAHA 2NG1A 1BOFA 1KI8A 4KFRA 3AF1A 4LHWA 4HAVA 3O8RA 1XCGB 1R0ZA 2XOKA 4LHVA 3E2IA 2ZJYA 1MH1A 2YHSA 3PUWA 3B1VA 4MGKR 4GDFA 4P3YA 1FQJA 5CYPA 4TYQA 2ASEA 1P3JA 5KPJA 3BAFA 4C2TA 3UKDA 421PA 3QPUA 4M9ZA 4MITA 2A7QA 4FCWA 3GJ4A 5G41A 1OXTA 2AK3A 2JJ1A 4DIDA 3T06B 4YDSA 1A7JA 2FH5B 4B73A 2OESA 2YWHA 4RFSA 3WP1B 2J7KA 2P3SA 2GILA 3RRZA 2QAGC 1Z6XA 1N6HA 5JEEA 3AUXA 2IWHA 2IYWA 1KIMA 1W0KD 2ZJ5A 3CF6R 2W83A 1VCIA 1FX0B 3BRWD 4OQLA 3QPWA 5BQ5A 4HUQB 4GBMA 4JLJA 4LRWA 3TUZC 4PO9A 1TNDA 1KI1A 4A8JB 1HURA 4OQMA 3JVUA 3L8ZA 1R0WA 3M1IA 4L4UA 3EPKA 4TZ0A 5KOYA 3QBVA 2MSEB 1KY2A 2G1KA 4F93B 5J4HA 4US0R 1OT3A 1UBGA 1E0SA 4KJZA 4Z8XA 3KUCA 5FI0B 3CX8A 3U3MA 1AQUA 3BB3A 3K9LA 1WQ1R 1UFQA 1ZMXA 3UWKA 1XTSA 1FP7A 3REGA 3RLFA 3D7MA 4PQFA 2ODNA 4R71A 2KBFA 5CK5A 1VYVA 1Q22A 2FFQA 2BMEA 3I72A 4ESVA 3PXGA 4MYCA 5EP3A 4Q9IA 1TTTA 2XB4A 2ZRDA 4Q00A 1QBKC 2JLWA 5JFGA 3IGFA 2ZRMA 2QN6A 2JEOA 4HZUB 4LWZA 2ZI7A 4UXJA 2XB2A 2QE7A 3AF4A 4PZLA 3VNUA 4DXAA 1WA5A 3IKJA 5TXGA 4D4MA 4P32A 4EJSB 4QKQA 4G5SA 1TF2A 2RCNA 4IDPA 1XXHB 2XSZA 3RS4A 1ZAKA 4DLRA 1GTVA 4QBIA 3LXXA 2Y8EA 4HB0A 3QKRA 3OE7A 4Q7KA 5FOSA 4AKHA 5EZ5A 721PA 4A8JA 4I1OA 1ZUHA 4HYYA 1EWQA 1NN5A 2HF8A 4A6PA 3EC2A 4B47A 4D26A 1S3GA 1NBMA 1XMVA 2AD1A 2QGZA 2QP4A 1N6IA 4MUBA 4DB2A 1KO1A 3LVRE 4GRAA 5FTNA 1EX7A 3IBGA 1SXJB 4JKYA 4GOXA 4RCYA 1XEFA 1LNZA 2YOFA 4ZCLA 3W6NA 3TLXA 1F48A 1KK1A 4TN1A 3JZMA 1RRPA 2B21A 1YRAA 1Z0FA 4HLUA 4BZPA 5CJ2A 5DN6D 2FNAA 1NKTA 3HJNA 2HXYA 4PQYA 4BFTA 2ZSAA 2ZVQX 4IDHA 2IYYA 3MLEA 5J4YA 4TMXA 1VCMA 2RKOA 2QGNA 1GITA 4EUNA 1NVXQ 4JT4A 4I1VA 4KITB 4R2HA 2FPKA 3GJ6A 1FW6A 1G17A 1VYUA 3QBTA 5CM8B 1AK2A 1KI4A 1G5TA 2QTVB 3I4LA 3THXA 2P0EA 1VHLA 1NNEA 4XWKA 2CL7X 5ELXA 4JS0A 1S3SA 3ADBA 3L0SA 2ZEJA 4L16A 2N42A 2QE7D 1ZU5A 1YRBA 2BWJA 3F8TA 3WHLA 4NCHA 1XTJA 1AGPA 1NY6A 2Q3MA 1FQKA 3H2YA 4OQFA 4CGZA 1W4CA 4JLDA 2GKSA 1E0JA 3GLHA 5EE1A 1F2UB 3MJHA 1QHHA 4QBGB 3W5IA 4C3ZA 4NCJA 1CR1A 1NL3A 2BHRA 2WMOB 3AUYA 5FL7A 1S1MA 1GNRA 1ODFA 1LS6A 1RE0A 4DEXA 1ZNXA 3BE4A 3A1TA 3WRYC 3IO3A 1A1VA 1U98A 4KXFB 1XEWX 1II9A 4I1UA 3K70D 1Z83A 3GJ8A 2CMKA 2ZRLA 4LV8B 4N0DA 1IQPA 1JJ7A 2BMJA 5J47A 3IEVA 3LDAA 1E1QD 2DWQA 3VR6A 1GG2A 1XJQA 2YVUA 1XX6A 1P2SA 3WMGA 4ABYA 4ACAA 4B3XA 1AZSC 1OPXA 1RYFA 3LLUA 5CYOA 3VX4A 3EASA 4C30A 1NG9A 2DPXA 2Q0HA 4L5BA 2ZE7A 1I2DA 4E5UA 4PPNA 1R2QA 1OFIA 3OAAA 1YZQA 2I1VB 3EA5A 4DDWA 1R0YA 1WBDA 3W8NA 4EIWA 1KO7A 4V0OA 4WXRA 4NP6A 5KNBA 3LNCA 3DMNA 1OKKA 5LD2C 2VQSA 3EZ9A 5KSOA 3CRRA 2WWHA 1RC8A 3F3YA 2GWHA 2A5FA 1I4DD 3K09A 2PT5A 3CONA 2VF8A 2YC4C 4B6FA 2G0NA 3BFXA 4TLBA 2KE5A 3GEIA 4H9GA 3VR1A 4POAA 2ORVA 2O8CA 5K8TA 3B2EA 2VHQA 3V00A 3FTQA 2GK6A 3IBYA 1EFTA 5BYJA 1ZNYA 5GJWC 1R0XA 1ETUA 2CK3D 4HI0E 2A2ZA 2H5EA 5TMPA 2HUPA 4H1UA 1N6LA 2V1XA 5CJPA 2BM0A 3CB4A 4GOJA 3GP8A 1CR2A 1MRNA 2CLCX 2FZ4A 3WYAA 5TY0A 1PLJA 4QOSA 1UKEA 1GKYA 1DAIA 2HXSA 2RGEA 1CTQA 3AKDA 4JT2A 1QVAA 5E3HA 1COWA 5LPNA 1YZTA 3G5UA 2LKDA 2IX3A 2C04A 3PEUA 3MWLA 2IYUA 4M4SA 4Q19A 3T61A 4DLZA 1DBSA 2NOAA 1E2MA 3ZZUA 2VP0A 1II8B 3PR1A 1TU4A 5GJCA 2BMDA 3VU9B 2N1BA 3H0KA 3WY9A 3FMPB 2REXB 2QQ0A 3GJ7A 1KJZA 3C41J 3SFVA 1WB9A 1KDRA 4ARZA 1E94E 5FOVA 3CNNA 2ZRBA 1XU4A 1KO4A 5LBIA 1CEEA 5KO2A 1AIPA 2JASA 5E4FA 3Q3JB 1Y63A 2F3RA 1G3IA 4OQNA 2XTMA 3WBKA 1ZW6A 5G53C 4BRWA 2WWIA 4PSKA 4DCNA 4L9WA 1KSJA 2QPOA 1PUIA 4EFNA 4M1KA 3A4LA 5EUMA 4JLBA 4PX9A 5HCNA 2D74A 1NLYA 521PA 5D3MA 4KYIB 1F2UA 1N6OA 1BMFA 2V4ZA 4Q66C 3RS2A 4K81B 1R8SA 1V43A 3ASYA 3BH6A 4G5RA 4S2EA 3L0IB 1L2TA 4L9SA 2WAXA 3N2EA 3QVVA 4WZBE 4KFUA 1US8B 2ZYVX 2W00A 2K5UA 1UADA 2GZAA 2CVFA 4LJAA 3EPJA 2W2TA 2CHQA 4BFUA 2ZR0A 2AR7A 2IBMA 3LX8A 3QUSA 2ZSEA 4V0LA 3IPXA 1E2KA 3G82C 3X1WA 3U44A 2GDJA 4RD1A 3W9YA 3ZYCA 1E2LA 1RKBA 2CCGA 5FPHA 3R7WB 4QJ4A 1TF5A 5DHFA 2QMUA 4B43A 3ADKA 3W90A 2ZS9A 4HDOB 4OKSA 4URXR 2PX3A 1FTSA 1NF3A 1W1WA 2NTYC 3GFTA 3KJIA 4BQSA 2IEYA 2ZAOA 1AKEA 3ZH9B 1SVLA 3CW2A 3T34A 2OO7A 4PHHA 4LBZA 3CLVA 4E22A 3FE2A 5JBQA 1IY0A 3EZ2A 3MMPA 3NBXX 4KCGA 4XWOA 4JKIA 4A4DA 4WVFA 1SVWA 2OG2A 3K9HA 3CBQA 1GKIA 2ZTSA 4U7DA 4DKXA 1Z0IA 1GRQA 5JRZA 2GCOB 3QXCA 1WRBA 2PEZA 3EARA 1MR3F 5J4KA 4YMUA 4LV5B 3U7GA 2JLVA 3UIEA 3RRYA 5EXSA 2FF7A 1KI6B 3NIBA 5HZHA 1G9XA 3VR2A 3OEHD 2QP9X 2QPTA 2PJZA 1VMAA 1NLZA 4CYMA 1CP2A 2RGNC 4FW9A 4TMKA 2D3WA 2RH5A 3G0HA 1EGAA 1QG4A 2O0JA 4DCVA 2BKUA 1SVSA 5L3QB 3HYRA 1YZNA 3KUDA 4LHXA 2WJHA 5JI3E 2JJ8A 4KAXA 2IUUA 5ANRB 2P6RA 1KMHB 1EX6A 1WP9A 2PBRA 4JJKA 1KI2A 3AP2A 3AM1A 2O8FB 1KO8A 4JBWA 4E03A 2PL3A 2JGNA 4Q1AA 2X2FA 1FPMA 3AVUA 2IUSA 2OCAA 1VIAA 5EE0A 4DSUA 2QY9A 5HPYB 4LYHA 1GRNA 1II0A 3ZZTA 4Q48A 2ODEA 3TAUA 2AXNA 8OHMA 1OW3B 1KHTA 4JVMA 1NVUQ 3BXZA 1GNQA 3CH5A 4O2LA 5DH9A 1G7RA 3EW9A 3L82B 5AUOB 4A9AA 1W2GA 4JBYA 4U02A 1HH4A 3TR0A 5TDHA 1Q3HA 3AVVA 4U5XA 2QAGB 1M6NA 1TQ4A 1Z08A 4TTRA 1M7HA 1ZC3A 2Q21A 4A2QA 3UANA 4ESHA 4V0ME 4RD0A 4TMVA 3U2QA 1TPZA 3ONWA 2AKYA 4PPQA 3EPLA 4M1OA 3EC1A 2IC5A 1Z6TA 4UKDA 4M9SA 1G291 2CE2X 4N1AA 4OI4A 2WBLC 1J70A 3B85A 1HEIA 3C14C 4Q5IA 1GP2A 1IBRA 4PC2A 2ZVPX 4ITRC 1CJKC 1VG0B 3U3KA 4BZXA 4EPRA 1ZIPA 1DOAA 3ZVLA 4RD3A 1XJCA 4EPVA 3SJCA 2ZU6A 4DLTA 5J4VA 3FMOB 3AF0A 3MGCA 1Z47A 2BBSA 1L7VC 1Q0UA 3IHWA 4NHOA 3I73A 4DT1B 4NYJR 1M7GA 3KJHA 3RC3A 3THWB 4J0QA 3UMFA 5L3QA 3U5ZB 4UNNA 5FOTA 1DS6A 1S1CA 4G5GA 1UF9A 4TMWA 5F9FA 2X19A 2ZS8A 4UNQA 4ERNA 2VSFA 4JYCA 2ZI6A 3K9NA 5FTKA 4RZ2A 4HEJA 4M9XA 5A0FA 2OLKA 3BFVA 2IL1A 2AKAB 2X77A 1KY3A 3OFND 3OIVA 2F1RA 1IN7A 1JALA 4H1VA 1NVVQ 1KTVA 2R65A 2IA5A 2ZRPA 1J7KA 3DO6A 1E9SA 3MRSA 3ZIAD 1GL7A 6Q21A 5GVSA 3EX7C 2Z6VA 4F91B 4URZR 3MCAA 3Q5DA 4LYFA 4TYYA 2KBEA 2ZYUX 1TUEA 4EPYA 3U6KA 2BMFA 2FPMA 4AIIA 1MO5A 1CJMA 4V02A 3TW8B 1JECA 1LVGA 5DGXA 2ATVA 2FU5C 4W5WA 2W0SA 2R6DA 1WBBA 4CEHB 1X1SA 3EIQA 1G8PA 2CK3A 1LTQA 4TT3D 2MMGA 2WWWA 3VFDA 3GJ3A 4OL0A 1KMQA 5J4LA 1P5ZB 4PC6A 3AVYA 5F98A 2F1HA 2G9NA 3TUIC 3THXB 1ZNZA 1GL6A 5HTKA 3Q9LA 2HT1A 4O2RA 3HP1A 4D4KA 5EUQB 1CXZA 1DAMA 1EFRA 3DHWC 1I4LD 2B92A 2VL7A 4JLPA 221PA 2VO1A 5HR5A 3AVTA 1NVVR 3Q72A 1XMIA 4EQ6A 3CNLA 3AVPA 4G1UC 3SNHA 4YLGA 3UATA 1TQ2A 4IXMA 3GLIB 3K8YA 1W36C 3VHXA 1E1QA 1TEXA 1E2QA 1Q21A 2NO0A 4IOLA 2OBNA 2JDID 4Q7LA 5LB4A 4B2PA 3SEAA 1Q12A 1Z5ZA 3OESA 2QQEA 3ETLA 3RHFA 2UKDA 2B8TA 2J0UB 4IFBA 4QNMA 1G4UR 5DHAA 5DO9A 5FBRB 3ADDA 3RC8A 1PZNA 4RD2A 2H17A 2GAAA 4IVQA 3QPVA 1E2NA 3CX6A 4AD8A 1IN6A 3ND8A 2HEIA 2IYVA 2ZR9A 1N2CE 2XEXA 2QRNA 1FMLA 4PHGA 3UG6A 4LGMA 4BLQA 1R8QA 5FUVA 4OHYA 3K0SA 3FWYA 4DSNA 1YKSA 3QG5A 1GILA 2I4IA 4HAYA 3WYFA 1C9KA 2G1JA 2PMKA 3UMSA 3EZFA 4PO8A 4Q1CA 4ACBA 4ZDIA 821PA 2OFXA 3WNDA 4A8JC 3SU8A 5A4JA 2C8VA 3KTAB 5TARA 4QBFA 2C96A 4XVQA 2BKEA 1EFHA 5EP4A 2O52A 4I1SA 4UXIA 3TVTA 3EPHA 2AWOA 2GJKA 4HAZA 1E0KA 1XJ0A 2AWNA 5EXXA 3SS8A 2XXAA 1DAKA 2GBLC 4FIDA 3L8YA 4F4IA 2IT1A 2V6IA 3QKSA 3HR8A 1LF0A 1PUJA 3WNCA 2FSGA 2Q6TA 1QVRA 3E70C 1XD2A 5CM9C 2W6IA 1RRFA 1X1RA 2PZFA 2F6RA 5KNDA 4RCZA 2DFNA 3C7KA 1S9HA 4YDHB 2EYUA 5KPDA 1E4YA 4QRHA 1GWNA 2CJWB 2ZRKA 4Q4AA 1ZNWA 3KX2A 5LD2B 2PCJA 1HQCA
chains in the Genus database with same CATH superfamily
4MWDA 5ETJA 4C04A 1OLSA 2IZOA 2V74B 4P2GA 4JC8A 2RGBA 2IHJA 3DWGA 1OAAA 3ZZMA 1L3CA 2BGUA 2GJSA 2H1FA 3ADPA 3GMTA 3DFMA 3LHDA 1O9BA 1Z17A 1QDEA 2XYRA 2Z5VA 3BRCA 4FLFA 3LD9A 4J2HA 4BO3A 4E13A 1G8HA 4B3CA 1PDOA 5FTJA 4X60A 3WAGA 3N0WA 2C5FA 4AI6A 5A3VA 3CWZA 2P65A 3EXG2 2Q4TA 1U0HC 1RHMA 3C3MA 3QX9A 3LC7O 4D9CA 1T2AA 5JY6A 2P68A 4G41A 4MQFB 3OT1B 2O8DB 4OBEA 3AKZA 4CL2A 1OD6A 3RIHA 2PJDA 4YUYA 2X8AA 2ZI4A 3AH8A 3ERCA 4L51A 3DCYA 2O7SA 3QKIA 4ZVOA 5G4KA 3M0EA 4MV5A 3PE3A 4TV9A 2JZOA 5HKKA 2J7PA 2VDWA 2VJDA 3LPMA 1U4OA 3THYA 1HE4A 1QE3A 4UD6A 3BBLA 3KAKA 1X38A 4YRGA 1W85A 1KSGA 4H0FA 1MV5A 5EL0A 4HGPA 5DVZA 4QVKA 5TT1A 4CMIA 3BICA 3OKAA 1EDOA 1QYXA 3OLCX 5E9AA 2ECKA 2L82A 3I4CA 4GH5A 2FMTA 4CIVA 5HCUA 1DEOA 4ISCA 3DCIA 1UAYA 2EKQA 4RF3A 1W52X 4C4XA 1XMJA 1E9AA 4DEYA 3O92A 4OH1A 2OD9A 3WMXA 2XCIA 1KEWA 4FZ5A 1W2WB 4X00A 2CYBA 3WIUA 3BKWA 1JHQA 1WV1A 4RQTA 4J2TA 4EG1A 4UQLA 2NO6A 5FTMA 4HDRA 5KMGB 1PT9A 4DHWA 1MQAA 3UXYA 4Y6OA 2VAPA 1XOIA 1UKZA 2O3RA 3OQIB 4WN9B 3KBBA 4DFDA 3MG9A 1YONA 1Z3CA 2JFVA 4CMEA 4TS1A 3MXTA 4KNVA 4YASA 2JIBA 1FNNA 4MIKA 1Q2XA 1Z06A 4IILA 2AGVA 4LK3A 4L5YA 3LF2A 4RLSA 2DBQA 3ZLTA 2MR6A 1TJNA 3N70A 4KSBA 1WEHA 4RCVA 5JCXA 4D8VA 3ZEAA 1VB5A 1E9DA 2EFGA 2VKTA 4MUJA 4LOKA 1QF7A 4C3UA 4JI4B 4JR2A 3PNSA 1ULTA 1RVDA 4UU8A 4BPRA 1ZVQA 3AHJA 4G5OA 1KK2A 1QVWA 2VQ6A 2VH1A 2PT9A 3WRVA 1FYEA 2AN9A 3DPUA 2OV1A 1O08A 1YQEA 2FA9A 2GYWA 1FUYB 1I7LA 3C3AA 3H18A 4DJDC 2PUCA 4XGKA 1YBVA 1SXJC 2DFPA 3C3KA 5EMLA 4ND6A 1MAUA 4RF4A 2N75A 4MQ6A 4NTZA 4PRLA 1F0PA 1YNSA 4EKGA 2BFDA 3HJTA 2CKMA 4PW0A 5F7XA 3F7OA 1E6CA 2PFKA 5HKKD 1SHUX 3AP3A 5KYTA 2CL0X 1UBJS 5MGNA 4OFBA 2CV2A 2BUCA 2DFLA 1J0AA 3MWEA 1R15A 1Q7BA 2EZTA 3WGKA 1KDPA 2BGIA 2PUTA 2V6FA 4WEQA 2FQYA 1JIIA 2ZP1A 2V6JA 3E61A 2CF6A 1GSOA 3OX2A 1O96B 4BJ3A 3AP1A 1RBZA 2Q9CA 3KLMX 3QE9Y 5DCUA 3MS7A 2CFRA 1KMCA 1DX6A 4UXHA 4AWAA 2AUNA 3PDCA 4H6WA 1ABEA 1Q1QA 2SNIE 4RETA 1RE1A 4KDCA 3D43A 4YO7A 3SOZA 4L1KA 3RF7A 1GCGA 2NPIA 4O4JF 5A04A 4A23A 2F1OA 4LZLA 1K6JA 1TVCA 2J67A 5F1YA 3NFYA 2C3MA 5WRFA 2GOYA 4B85A 5GIOE 4D74A 3CVWA 4OI0A 2Z3VA 1LDBA 1GGNA 2O6HA 2OCYC 3C6QA 3EAGA 3F2IA 4JROA 1NULA 4DC9A 2R60A 3VZQA 6CHYA 2X0RA 5K6TA 4QXPA 3R44A 3SLKA 3RK1A 2CNBA 3K2QA 2E5WA 2E1RA 3TLGA 6REQB 2H92A 1C1XB 4KN6A 2A9OA 3I5XA 5FUYA 4KH1A 1DPGA 2C54A 1Q19A 3BWYA 3C74A 4BZZA 4PWZA 3L7DA 4ASUD 2E87A 3URMA 1LI7A 3E5HA 2WD8A 3MUOA 2GF0A 3JALB 1D4ZA 1X1DA 4HSEA 4G81A 4JYBA 1PD1A 4FS3A 3M6MD 4QYXA 3BMQA 4QJ5A 3QEKA 1TZJA 4PICA 1ZESA 2O5VA 3BB4A 3NM4A 1SN7A 4HLCA 4LISA 5DHPA 5EPOA 1R64A 4KHPB 1JDBC 1BCSB 3LUDA 3LUGA 3PGXA 4NYMQ 3UYKA 2PY6A 1EQ2A 3OCCA 5K8UA 2OB2A 3IMKA 4YAUA 5HIAA 4FXOA 1K9VF 3N8GA 1LFDB 1ABFA 3HDTA 3RC7A 1S02A 3A1WA 4IHJA 5LMZA 3SF8B 2O2EA 3BREA 3K8QA 4M0LA 4RDHA 4QU0A 5A4IS 4F2GA 5LOVF 1X1BA 4EFMA 1U2SA 1ZGAA 4F1WA 4ESEA 4NG5A 4IEFB 2J9XB 3SZ3A 1RRKA 4XYEA 5EEHA 1EXVA 2QUKA 3IXQA 3UT5B 2VA9A 4INOA 2GEUA 2IK8A 2PLWA 3OECA 1TRHA 3K53A 3VQTA 4A6XA 4RA6A 1D9ZA 3CF0A 3FBWA 3B1XA 4QXRA 5K0FA 3IDQA 4YP0A 5BN5B 1MHTA 4JIMA 4TSKA 1A8PA 1H8EA 1K6MA 1V5IA 1UOEA 3QH4A 4YJHA 2QP3A 3SMVA 2G4VA 4FOLA 4CN8A 4C2AA 2B7BA 4OK5A 4E5SA 3IUNA 4Q18A 2QD5A 1ETHA 1TW2A 1E6EA 2KSQA 2VAXA 5HM8A 4TYYA 1M2GA 4XI9A 3GJXC 4IKPA 5UKDA 1WDKA 2GAOA 1NVDA 4Q1FA 3P9NA 3OUZA 3AC0A 1SKMA 3LVBA 4CEIB 3T9DA 4Y9UA 2PL9A 1LH0A 5B58T 1NLUA 4FB4A 2CDNA 3A58B 1UXGA 3IAEA 3IEUA 3WYCA 2QHXA 1T9ZA 4ZC8A 1J42A 3RYHB 1EHIA 4YJKA 5KYXA 4Q03A 3R0IA 4ARUA 2CNWA 2WWGA 1NASA 1SEVA 2VP2A 4AZTA 3HPQA 4IIJB 5TVKA 1KS2A 2OFOA 4HNQA 1BHSA 3OG9A 3W1WA 2AMJA 2VNJA 4K6CA 4QL3A 4ZT7A 4B8WA 2NZ2A 1MEJA 2OCGA 4LZNA 1QH1B 4DBLC 1X8XA 3THWA 2OENG 3D3NA 4BJ5A 5I8PA 3G8AA 3MJTA 1B1CA 1U0LA 4HDKA 4R0VA 5KSWB 1WNTA 2IP2A 1G4AE 5ALJA 1M8KA 3EXHB 4HS9A 4UUOA 3V5NA 1CBUA 2JI4A 5KTKA 4BO0A 3NM5A 3GMDA 3VSDA 2ZZMA 4X62B 5IZCA 3C1UA 2AF3C 3LT2A 4PO3X 1Z7GA 4A7PA 2VJBA 2X40A 1NMSA 5HILA 3W05A 4M7WA 1PD0A 2OHFA 3FGOA 1EXDA 1G8JA 1RVV1 1ZIYA 3PC8C 1XELA 3W78A 1PE0A 5EXTA 2J5QA 2I99A 3O3NB 2RHDA 1I32A 2VHYA 3NLLA 4MRPA 3A10A 3TOSA 4CDMA 4I1IA 4AJEA 3IEMA 4S3MA 3QZUA 1DXQA 3BGVA 1XT6A 4RGVA 2IWRA 4R3NA 3RO7A 4DC1A 1RPTA 4Z7NB 1RXSA 2PN1A 4FFBB 3C7AA 1VPDA 2HTFA 1T9GS 1XF1A 4YJ2F 3AWIA 5TR9A 1CCWA 3DVRX 3FWHA 1O96A 3GFBA 3UJ6A 2BY4A 1W93A 2BJVA 2XXJA 1C30B 2YL2A 5DYNA 1C3LA 1JHUA 3CGWA 3H86A 1DTSA 4IQFA 1AZTA 4KNYA 4TWBA 3WI7A 1EEXB 2ONZA 4G0VA 2BEWB 1R88A 2DQKA 3EAQA 4J07A 3K5WA 4JLMA 1M0WA 3L7KA 2PRJA 5DXFA 3VZRA 2X4IA 4Y1GA 2B4QA 3O90A 2HDHA 1J49A 4QOJA 3D0QA 3EGDB 1A9YA 2LE0A 2OQ2A 2VYNA 2G77B 2V5UA 3AR7A 3PFKA 4FINA 2H8KA 3CN7A 4GIBA 4LJ7A 4N5IX 3ZC3A 3ZZ0A 2OUKA 2FUG1 3FHCB 1N3LA 2XNHA 1EP3B 5IM5A 4TRMA 2J3EA 2Q3DA 3ECCA 1VJ0A 5HP4A 1DI0A 3RTEA 1E2DA 2QBYA 3ICQB 4DMHA 3JZIA 2AYZA 5ULLA 3PCTA 1AUOA 4MI6A 2DP4E 3ND6A 3MTGA 1NBAA 3RD5A 5K8CA 3KQNA 1FP4B 4CKEB 1U5BA 2C99A 4R1PA 2C0CA 5KKAA 3ZCVA 5CB8A 3AI7A 1DAEA 1FF9A 1XJWA 2VQDA 3HA7A 5K0EA 3QNUA 3U56A 2W6JD 2PT7A 4C0QC 3PUVA 4CQJA 1UEJA 2D1RA 1LSUA 2AYXA 3LGAA 3PLRA 5CGQB 3FVQA 4WY5A 4YGYA 1W7AA 1P80A 1U9IC 2C78A 1AY0A 1DQRA 1AD2A 4CM4B 2QRUA 3GRFA 1OGYA 1VI6A 3MSXA 4FYPA 5ILOA 5KTSA 1KU6A 4ZVNA 1F3OA 1ZM2A 2SCUB 2ZZKA 2HCBA 2Q5LA 3T9BA 1KP3A 1WXQA 5BSUA 1D8TA 2B7LA 3SQXA 1GV1A 1ID1A 3GRZA 3S2UA 3QY0A 4LAFA 1C81A 2PS0A 2ZUSA 3ZX4A 1JAHA 3JQGB 1Y7HA 3E9MA 2OXFA 1T0BA 4L3VA 1Z5WA 4IV5A 4LPKA 4OB6A 4IOJA 4UBKA 1Q17A 2TS1A 2GFIA 4LFCB 2VAVA 3NYQA 3UW3A 3VPBA 4DLSA 3Q7PA 3CRQA 5C8YF 3JASB 3WQBA 2HSDA 1P4SA 4HTFB 4H60A 1A96A 1MO6A 2WTEA 5DM4A 2E3JA 5EHIA 3QLEA 2PKCA 1U28A 3FMGA 3EISA 5BSKA 3AWDA 3FFTA 3I1YA 3JWHA 3SDBA 3UFXB 4W4TA 3ETNA 1SY7A 1B7GO 4HHEA 1SHLA 4YK7A 5AXCA 2IUEA 2CHFA 1DIGA 2VNKA 3TSOA 3MSCA 5JXWA 3OBIA 1A5BB 1JYFA 1ZX1A 5F3WB 1GAXA 3W7AA 4G4IA 2R86A 3A8TA 5H1YA 4GICA 4OUDB 1CS0B 4LC1A 1CZRA 3W3AD 1E3MA 2E49A 3GUYA 2NO9A 2VHXA 3N76A 3V55A 5MHTA 3NNSA 3A9TA 4XARA 3AIMA 4D8XA 5ENDA 4CG1A 2OA0A 3RSLA 1ODCA 4BX2A 3A1EA 3GD7A 4DMUB 3DE7X 5BN1A 2D7CA 1GTG1 4J4BA 1ZBQA 2AZDA 2Q45A 2J6BA 3G9XA 4RHUA 1RWOA 3LAWA 1M5TA 3LXUX 2LWIA 5IDYA 2DHRA 3TQQA 3RYHA 2GR9A 3PPWA 4BS9A 2R0QC 1NZFA 4GRIA 3II6X 3AF3A 5TPZD 3ZV7A 2J8ZA 2O5EA 2P5SA 4X0EA 1PT8A 2B3TA 1XTIA 2BGMA 2EWVA 2PSJA 3OFNA 3V8RA 3F5SA 3BERA 3KCNA 3M2PA 4NQZA 4YN3A 1JX6A 2XCQA 1SULA 3LCUA 1XBTA 4OHKA 5A6VA 1SBTA 3EQ2A 1CR4A 5FBWB 3RUPA 4B7CA 4BL5A 4JT8A 4LUCA 5KNCD 2W4MA 4Q3BA 1G59A 4AKIA 1HDGO 4UUNA 2Y92A 5MF6A 5DU2A 4CEJB 5JSZA 1BMFD 2FPGA 1W48A 3QXSA 4H77A 4MQEB 1E18A 4JJEA 3T4PA 3UMJA 3NRJA 4MKZA 4BVAA 3QWAA 3T5CA 4UBJA 4IXDA 3PQ3A 1U81A 3EWIA 5TVGA 1YGYA 2FPOA 4R9UC 5D51S 4M1YA 3QHPA 2AC4A 2JFUA 3UCFA 4TSFD 4HL6A 1RP1A 2PLFA 3FCOA 3K0AB 5B7GA 3N74A 3COYA 5K6AA 1ILWA 1V16A 4AIRA 2XYVA 1OI2A 2IYNA 4OKIA 3U5TA 1LQUA 3E82A 4ALMA 4DN6A 4FYJA 1PEYA 3BRQA 2BGGA 4GZMA 4FMCF 4FZRA 3L7CA 1RMYA 4OAOA 2YTZA 1HE2A 2KB0A 1BMTA 5JCJA 5AJXA 2W58A 3BE6A 1JKFA 3NBYC 1DC3A 2BI8A 3BIWA 4JVOA 2JFWA 1GTJ1 3WK7A 2HA7A 2IEZA 5B53A 3FDFA 1RPZA 1PNQA 4DREA 1UDXA 4W8HA 3STUA 2ID9A 4WA8A 1VBMA 1C9JA 3OEED 4OD0A 4OXKA 5ESDA 3T3IA 3WGVA 4KQCA 1MZPA 3IP8A 1E1RD 5DBOA 4YRZA 3I01A 4P0QB 1GFZA 2ESRA 2R1VA 3BH0A 4TXNA 1JEEA 2NUPA 3H5WA 3QXXA 4AP9A 1MVOA 2Y3IA 2YCLA 7MDHA 3H3XA 3CO5A 4GX0A 2J5KA 5ECDA 1PR6A 3OJFA 3SHTA 4AUNA 3HCOA 1WKBA 1KYTA 3E7PA 3KVYA 4FFLA 3I6YA 4G1MB 4QHTA 3VYSB 4NKRA 5D84A 3ZXSA 1NW7A 4LCBA 2H2AA 1BXGA 2BCGY 2X2PA 3LYHA 1XVLA 1VGQA 4URUR 3T3OA 3F98A 5ALIA 4YALA 5HZGA 3QWFA 5I9LA 3P4YA 1FYXA 4MUXA 4XTCS 4FOTA 1G20E 1L3IA 1U3DA 1L7NA 4PINA 3WGOA 3PLAE 2IY7A 5FKJA 7ADHA 2IYTA 3MERA 1ESCA 4M1MA 4DM3A 4DQUA 1ZD4A 3KLOA 4PANA 3K9CA 2CW5A 1IVYA 5AJVB 1WLSA 3G23A 3LDGA 4L6AA 1U1GA 1FTGA 4XM2A 1VE1A 2W8BB 4BMVA 4JLAA 4ZCTA 4GOLD 3KD2A 5ALUA 1EFKA 1QANA 1YR3A 1N5KA 3NANA 4L57A 1P2TA 3SVTA 2VCEA 3BXPA 1T3LA 3STTA 4DV1B 1EWRA 1FVOA 1JFFA 1TGYA 4G1VA 3SXUB 1G64A 3C85A 4IOKA 4HWPA 2QB5A 2GHQA 5GONB 4PE5B 2IOFA 1ZN7A 2IYFA 4ZYTA 2FEXA 1NDQA 4DLUA 4KO4S 4D56A 1C4OA 2LDXA 1N0VC 5F2KA 1BSVA 5B4VA 3ED5A 4PS1A 1Q0RA 3WGMA 1TAHA 1X39A 5ALHA 3O95A 1O3YA 3BMNB 3ORYA 3ZQJA 1ZA1A 3CVUA 3DP7A 3RTCA 3VVMA 2NVBA 1QGUB 4KVFA 5JH7F 4RXMA 4V0RA 3M49A 4MRSA 3GLHE 4G24A 3ZU6A 2CXUA 4R1UA 2XITA 3HWSA 4DKJA 4DLXA 4IS3A 4NONA 4X85A 1ADYA 1NOJA 2XNJA 3FVWA 1JLKA 3HDQA 2OGTA 1HOXA 3DLPX 4RYDA 5HDQA 1HTBA 1JU4A 3PG5A 2WWFA 2P79A 2VP5A 4TWAA 5TRTA 4CLXA 2VLBA 1JE1A 4YJDA 2VQEB 1ZVJA 2HEGA 3V8NA 1XZBA 3DOCA 2QIPA 2UYHA 1L5WA 3P7MA 2ZUVA 4FGLA 4TROA 1P0CA 2GZ2A 3WS7A 4EHJA 2X0KA 3DKKA 3K6JA 5KCZA 1W4RA 4E11A 2FDXA 1FB5A 5JFTA 1E6KA 2V7GA 4C7BA 3ZV5A 3AUJB 4UMEA 1AO0A 3QKWA 1LEHA 4DQXA 3DOFA 1D07A 1FZQA 2XNSA 3DMTC 4N5LA 4H1WA 1JFTA 2NVOA 3ISTA 4NYIQ 2BFCB 2VH5R 1FDIA 3QPCA 3K0AA 5SICE 1D4AA 1EVJA 2CEAA 4C0SA 1KWKA 4HB4A 1F2DA 1B14A 1YDWA 2PWYA 4MCIA 5HRCA 1BH6A 1F2TB 1Y34E 2XOXA 4EYGA 5BN4A 3U1BA 4MRMB 1YASA 2PUGA 4LXTA 1OIXA 5LMUB 3CEJA 4P0TA 1U8ZA 2RH8A 4I19A 4MULA 1CYEA 2P1ZA 4AU1A 3HKBB 1S96A 3ZLVA 2KW5A 4F71A 1D2MA 1F51E 2IGBA 2R6JA 4GYJA 4X20A 3RC2A 5GINE 3HADA 4Z51A 4O0MA 2D0IA 4H15A 4B76A 5ITVA 3T54A 5GTDA 5KHAA 2DX7A 3L01A 3NETA 3MT7A 4QJBA 3ABIA 2PT6A 3PIRA 3F2VA 3GDHA 4M2LA 1QDLB 2Q4BA 3OHSX 4P5EA 3K71B 3AVUA 3WIDA 1BE0A 4K8OA 1ZN9A 3AKCA 4FD2A 4UNRA 1DVRA 5CDFE 3GFOA 2OAGA 3NTOA 2XGSA 5JCOA 3PFFA 2HMSA 2OGZA 4HXFB 1D0SA 4IXNA 3G2IA 2DCUA 3KT0A 1F14A 2OBBA 1OHHA 1AKRA 4KWHA 2BYTA 3ESZA 3N2LA 1VJRA 3ZE1B 4UCQA 4QDOA 3ZHUA 4BFYA 5BMOA 3FJYA 1E6LA 1U7UA 4HWRA 4QSHA 4BUJA 3CRNA 3PEEA 3PJRA 3Q2OA 4R6XA 1UDAA 3OCYA 3O47A 3VRHA 2Y0BA 5JSZB 1ZP6A 2RHWA 1AM4D 4ONEA 2QZ9A 5EJ6A 1Q44A 5JNVA 4J43A 4EYQA 2XMDA 2HPVA 4IJQA 2FPPB 4FGJA 1T1RA 4JBLA 1ZK3A 2WB4A 5BMVB 3DXZA 2ZI5A 1D09A 1FFCA 1XQWA 3DEHA 3EBLA 3Q3VA 1N8SA 1RZVA 1J21A 4NV1A 2CHEA 3H4TA 3UJAA 5B7QA 1DU4A 4UM9B 1V37A 1EZ4A 3EVGA 4HDSB 5C4GB 5EYPB 1FDVA 5CXSA 2WNHA 2QTAA 4N65A 1WX1A 5K0TA 1GOTA 1QPZA 4G23A 3LNTA 3C8ZA 1H1DA 3QXGA 4HQRA 2X9QA 4IUYA 5KDLA 3U61B 2OAQ1 5ER9A 4BU0A 1F0KA 5FA5A 4FKMA 4LBWA 5EWLA 2JAPA 3ZDBA 1W5EA 2EGHA 2PTHA 4FEEA 3GLRA 4I5IA 1F6WA 3PUIA 2QAJA 4WHMA 3FKJA 2HIGA 4C20A 5C51B 4LF9B 1KBOA 1PJQA 3T1OA 5EP1A 5CFNA 1E1RA 4MV7A 5D6NA 1M75A 2ECFA 2EHDA 3CYFA 2DGDA 4MTLA 5THXA 2RHBA 3KJFA 3OICA 4UZSA 2R6CA 5KYUB 3RAPR 1I9CA 1L8QA 3UC9A 2IYLD 4A0QA 4GZLA 1JV2B 2B2XA 4MGYR 3ZI0A 1QTQA 1FP6A 3NO4A 1CQIA 2OZKA 4N5DA 1TYDE 1Y4UA 5LXTF 3SYTA 3QNWA 3S0JA 3AVQA 4XB1A 3HBJA 4W8GA 1RXUA 2WVJA 4PM4A 4CMCA 3G0OA 3LBHA 4Z4EA 5K1ZA 2O8EA 3IODA 2NPOA 2QBYB 1FFDA 1MVNA 5LQKA 3WMWA 3PXDA 4JSYA 5K3BA 1F0NA 3QVOA 2WKPA 2IITA 1YVRA 4LDNA 2IYRA 1X8LA 4Y2TA 1CIVA 1CUAA 4MJ7A 4QDXA 3ZWQA 4A26A 4AO7A 1A5SB 4H59A 4QZVA 1D5CA 1Z3IX 3BILA 3NDPA 4HAIA 5CLFA 2JNWA 1Z6YA 3ZNOA 5DTRA 4FD3A 3R7LA 5HS4A 4DARA 1ZK4A 3OFSA 4FX2A 1X13A 3INTA 2QI9F 3LMKA 4PO1A 4PSAA 4QUDA 5DISB 3WMRA 1GZDA 5FLXA 2XCRB 1UJ5A 3DW1X 1Z63A 3VAAA 4FWBA 5B5SA 1PL0A 1YCFA 1XDBA 1XO1A 3A27A 2DYKA 1OUMA 2C7VA 5L3RA 5FO0A 1ZI9A 4XIYA 4BO1A 3L9WA 4TTSA 1LGYA 2LNDA 4B1FA 4D0NA 3I9JA 2Q0XA 5FD8A 3WWEA 2OEPA 3GWZA 3W2HA 5AM2A 1JILA 3UPTA 3A7EA 1W5TA 2GB4A 2YIVX 4O4LA 1BYIA 1YU9A 2R4UA 3HVRA 1L1FA 3AKEA 4KFTA 2P3LA 4OQXA 4YS6A 1SFRA 1OLXA 2H31A 5FTWA 5LBIA 4PQGA 2X5XA 4OJTA 1XWFA 1VXRA 4ZDJA 5H4HA 1WF3A 2QZJA 3GHHA 4IFEA 2H1LA 4AYXA 1X6VA 4FYVA 3LUHA 1HORA 2IDJA 4AF7A 4HGYA 2HCJB 4ML3A 3ONNA 4BZQA 4FNOA 5ADHA 4HB3A 3NAZA 4MUGA 1R4NA 4CFYA 3U09A 4RTRA 2Q2NA 5KC9A 3A1NA 4WV3A 2RBEA 3P2YA 3WGIA 4BO5A 5IDQA 2Q1UA 1T43A 2FEPA 4OXIA 3WL7A 3O8OB 3P0IA 1Y5IA 1GQFA 3NHRA 4O2BA 2C7OA 1IXZA 2Y1OA 4ZI7A 1X80A 2H07A 1G21A 3W5JA 4TZ6A 2X9GA 4XWTA 5JYDA 2RGUA 5SYMA 4HBGA 2RARA 4TLMB 4QC2A 4BIIA 1NBMD 4JL6A 1LF5A 1VGRA 5B37A 4IEEA 1LW7A 1PWZA 2YZMA 4JGGA 5CGZA 1YRQA 3DMGA 4FHEA 4BBAA 3QOXA 4PS0A 4KRYA 4R1OA 4G25A 4N0EA 4EUSA 1PP4A 5G0TA 1K97A 1K06A 1IVSA 1YIDA 1M3SA 5A5FA 4FT4A 1YTUA 2ZSFA 2V9PA 3SQOA 4EY7A 1XZDA 1J1UA 4KK4A 4CLHA 3NHLA 5CIYA 2GK3A 1ORWA 2DRIA 2GN0A 3ASZA 1OASA 2X9VA 1YAHA 2RONA 5JAUA 4C7OA 5CNKA 1XLUA 1V71A 5E95A 1W5FA 2EJUA 1EWTA 1J39A 4TYMA 2JK0A 4WKNA 4BB9A 1ECJA 3F4KA 5F76A 5K2OA 3ZDYB 3U44B 2OSBA 1Z6GA 4ZTZB 4V2UA 1QQBA 2HSWA 3LA6A 3I2YX 5KUTA 4M0DA 3PA8A 3LRPA 2AI3A 5H4GA 2WTUA 5ITWA 2QRVA 4K6HA 4IFTA 5DZSA 3K70B 4NESA 1N6PA 5AQ1A 1FBNA 4XUGB 3KR1A 4EMUA 4WEOA 4FKZA 3T7RA 4YRSA 2FPWA 1CJTC 2AG5A 1OFUX 2P5TB 2G9VA 3UUGA 1QH1A 4LDJA 4X1KB 4LMBA 3OPXA 1KIAA 5DNUA 2W6PA 1L4UA 2GEKA 4FGSA 4MI9A 5JRJA 2EWWA 5FOXA 1DTWB 1U6IA 1W46A 3AILA 1WR8A 4Y0NA 1PSDA 5AXAA 3AIIA 4GYKA 1Z6AA 1U28C 4OQZA 3HI4A 4JI3B 3B48A 3GJYA 3NPAA 3EF0A 5F12A 4ZV4A 3MLAA 2ZUDA 4UJ3A 3G9TA 3HYTA 1IU9A 4RLQA 1XRRA 2Z58A 1A2BA 3H05A 3OT4A 1VP3A 1WHSB 3HFGA 4XCVA 1G8MA 3SDZA 2YFKA 4JYZA 2Q3EA 3V33A 1TM2A 1KP9A 1NE7A 2ROQA 4JQYA 4COKA 4FSDA 3I9LA 4BTEA 1XTQA 2XOEA 2ZRCA 3KJXA 1S8OA 5FPYA 1L8XA 4AZ3A 1SUSA 4EH1A 1BJTA 4KG7A 2GI4A 2X8BA 2X0NA 3D8HA 2AZTA 3BL8A 3G0GA 4IDBA 1Y1RA 4UBIA 4XM1A 3UHPA 1SQ6A 3ZWNA 4URFA 4H7FA 2G8NA 1YR7A 5BURA 5BOSB 1FMTA 1NQXA 3T3EA 2HHHB 4MCHA 1PGJA 2I7XA 1R8XA 2R1ZA 2M9MA 4NCNA 5DSZA 1SU7A 1W4AA 4DLKA 2C5AA 2ZYGA 4IHQA 1VHQA 2HU7A 2WI8A 5HJ7A 1L7EA 1G66A 3EUAA 4BFZA 1SOMA 4BLOA 3PGJA 5DCLA 1G8KA 2C5BA 3EPPA 9LDBA 1LPNA 3BC1A 2FSFA 2EL7A 2BI4A 3BORA 3PPYA 4Y9SA 1NRXA 1XQ1A 5ALPA 3LX5A 4RGQA 1X9GA 2ZVJA 1O1YA 4YJ3F 2I71A 4DXDA 3KRTA 2JJ2A 3MS4A 3B9PA 4UPVA 5C8YA 5JQGB 2HR1A 2H9YA 4AO6A 4ZPXA 4B9EA 2OVFA 2OPBA 5DI3A 2V7VA 2P67A 1GHTA 1VL2A 2XADA 3EFOB 5A1TA 3R9XA 3DNPA 3L5KA 2M6RA 1T3SA 2ZM6B 3ACDA 2RKWA 3BJMA 1XEXB 3HS3A 2ZAYA 1KQNA 3NPMA 1R5OA 2NU8A 1JLMA 5L40A 3ADCA 3MS2A 2Q27A 4RE6A 5IW8A 2WFLB 2GBIA 4U8HA 2BHLA 3C70A 4KI0A 4PHCA 3QK7A 5EFZA 3SX4A 4N48A 1JJIA 5IAGA 1ATIA 2V03A 4OQPA 4D9EA 3W5CA 4TXLA 2QLLA 2IV7A 1M0EA 1P9OA 2XSZD 2XUQA 4MP6A 5BWLA 5BV0A 1NV8A 1AOXA 2PX0A 1QH9A 3AOGA 3E3MA 4MP3A 2X1HA 3OKFA 1EVEA 4C78A 4FMDF 1ONBA 2QQGA 2O8FA 2W2XA 4NBSA 5HMLA 5BQPA 3JQPA 1DADA 2PV0A 3QKUA 8ATCA 3A06A 1QIHA 5IHPA 1CUGA 3KQYA 5IKEA 2VK2A 3M5CA 1IPEA 3QA9A 4P34A 3ZHCA 1GSAA 3PNMA 1K98A 1LZLA 4B09A 3J80A 4Q9LA 4DCGA 3VPFA 3M33A 1I6WA 2AFHA 4IBOA 1E2EA 1YA6A 4HAXA 4DSTA 3TTSA 1JBEA 1Z2OX 4EYSA 4ZAYA 1FDWA 3TLGB 4RZSA 1XLWA 2UZ0A 2WT4A 4KEAA 4DG5A 4R51A 1V3UA 3GEPA 4LMPA 2CXRA 1YJ8A 2IP1A 3QX8A 1V0JA 1H9CA 2OV8A 3KU1A 3AR5A 3UOAB 2QU8A 1JL3A 5F77A 4ZU6X 1G5QA 5E0OA 5TX7A 4FI3F 4IEIA 4C6TB 3E18A 4ROTA 1VI2A 1T5TA 5KIAA 3VH4A 3T5DA 3BF7A 5LZ4A 1T0JB 3KJGA 4KGZA 2VYCA 2MSKA 3PUZA 4PCLA 4O4LF 3DP9A 1SPBS 3T0IA 2VDPB 3HXQA 2HJSA 4R2IA 4LF6B 3R20A 2XAUA 4LBYA 4NDAA 1PTKA 4URWR 1SB9A 3WV5A 4ZVQA 1FNMA 1RYZA 1NMXA 1QIMA 4NZOA 1CKEA 1NZDA 1X3LA 5CW2A 2I8LA 4ZQBA 1DRVA 3G9ZA 1NLMA 1ZRSA 1YB7A 2A7XA 1L7QA 4JI1B 2PQMA 4DEVA 3DOHA 1IG3A 2BM1A 4PQRA 2HCFA 1SKQA 3QKRB 2J5XA 4Y2RA 1LWNA 5T57A 1GPNA 1PR5A 1IOLA 4YRLA 1AS0A 3DHEA 4PHTA 4F38A 2AOUA 4HTAA 4HVAA 1DOZA 5CLGA 3LUPA 1JQLB 3MB8A 4GGMX 4OMUA 3RVJA 4FE4A 3W3ZB 5E1BA 1V5EA 3T7SA 4E4YA 3A6PC 2NGRA 3DH0A 2P2GA 4Y1RA 3X1WA 1TU3A 2WM2A 3D8TA 2CJFA 2V97A 3QKSB 1RQ7A 1CY1A 1N5JA 3ELYA 4DDUA 2NQTA 2CLDX 3H8WA 3U7FB 3B9RA 2FMXA 3DFKA 3OT5A 1SCKA 1LDEA 1O8BA 2XUJA 3HP7A 3LUFA 4MQFA 2O8DA 2ID4A 3TE6A 3Q2IA 2W42A 1W30A 2BSAA 3EJ6A 2Q3BA 4KVGA 4MV1A 3GNLA 1QFJA 4JBHA 2BMAA 3A3KA 3OM9A 4TKUB 3SHQA 2W5UA 4TTPA 4DAOA 3U19A 2Z2YA 4HK4A 4ARAA 3VJRA 2GEJA 1WXDA 5AICA 3HBLA 4YONB 1QF6A 3IVXA 4IGAA 2B61A 2OILA 2NLOA 2MDTA 1Y3FE 4DHEA 4W1PA 4LNUB 5K05A 5L95A 3OTWA 3C3BA 2Q5OA 1UJCA 1XRSB 4YECA 2BEKA 2JBWA 3GT3A 4O4JA 4O1IA 4OEHA 3SQMA 1FRQA 2JCVA 1RJ9A 3OAAD 4GI5A 5D5QA 2JFNA 3CCBA 3OE7D 2Q49A 1JG6A 3OTGA 4FE7A 1A5AB 1CRQA 4YJ3A 2PRKA 1KYVA 2W2MA 3B60A 1NJ2A 1V1RB 2WHPB 3LO8A 2QNRA 1P0QA 4QPZA 1AHNA 1XD2B 2W48A 3K72B 3OEEA 2YQZA 1NUSA 4I8IA 3OLZA 4WXMA 3L4JA 3COWA 1DIOB 2UVDA 4REMA 5FHQA 1E6WA 1C9YA 6PFKA 3S81A 2B98A 3K1JA 2HMVA 1EBBA 4JODA 1P77A 3OY2A 2VRWA 3Q9SA 4R9VA 2YS7A 3BCRA 4WXPA 2QW0X 4JP1A 2FFRA 3OZGA 3QWIA 1T1SA 2A30A 3GFGA 3GRYA 4HPJB 4LYJA 4TQAA 4WFQA 4HLUC 3UJ7A 1VCHA 3ZHZA 5C8YB 4CLOA 2AS0A 2PZJA 1LDNA 2VUHB 1O6FA 2CXXA 5U4QA 5A06A 1NLFA 4P4UA 3H1TA 1OB2A 2MINA 5IAOA 1HEYA 2XDQA 2G25A 3KHTA 3SZOA 1ZD3A 1JVSA 3E7FA 3KL2A 4JBGA 5EJAA 2CMDA 4JB0A 4RSRA 3CLUD 4B3DA 2R8RA 2VDMB 4KW7A 3E22A 2QRZA 5EG5A 3UV3A 4KPEC 4OLHA 1A50B 3COJA 4V0NA 3OMLA 4G6ZA 4JZKA 2PR2A 4LY9A 1W0JD 1LBHA 4DZRA 1B8PA 2JJ1D 4PC7A 2JH8A 1SUCA 2NNWB 1PT6A 3ESQA 3HN2A 4RWZA 4HNTA 5ICEA 5FOWA 2DLNA 2FR8A 4TSFA 1QIIA 3UY4A 4LJ9A 3N2ZB 5BNWA 3HL0A 4LVOA 1I4WA 1ZWLA 4OBXA 4HRXA 4IRXA 4GP7A 2CLKB 3H16A 3VR5H 4F3TA 3IULA 4KPUA 2C88A 1YZKA 3CBGA 4UMDA 2F43A 3UAOA 3W04A 3MWJA 2DERA 4I9UA 3SHFA 3LT1A 5IH3A 3IOCA 2W22A 5I7SA 1M1UA 3H2SA 1K63A 4YRRA 2PE5A 4C0HA 1E5LA 3LCJA 2BGRA 3PGKA 3X2FA 4EGSA 2CJWA 5AKEA 3PU6A 3C43A 5DM1A 1OBFO 3T15A 3WHKA 3V46A 4MGZR 2NU8B 4AJHA 4WZBB 3BGIA 3GA0A 4YV2A 1RSZA 5ADWA 2MTBA 3NBZC 5AP9A 2BFDB 4R1TA 1Z39A 2GK4A 5A2GA 4OM7A 3SHOA 2XT0A 2C7GA 4LFAB 2C9MA 4PZAA 4JLOA 1S0UA 1H6AA 3U3RA 1H5NA 4P54A 2ONYA 2YXPX 2O2CA 2VCYA 2YFHA 5AUPB 2TECE 4KQMA 4YTEA 5EQFA 3GLFA 3IO5A 1QNFA 3DZGA 1KYQA 4DG8A 2HF9A 4TVSA 1BA2A 3P94A 3LK7A 4RL6A 4OSOA 3T5PA 1E58A 1PZMA 3OZIA 3A6ZA 1TJPB 4G5HA 4Q9AA 3D81A 4CQNA 4AJPA 4OM8A 4DDKA 2LVBA 1M1ZA 2QX7A 5EERA 4GR5A 5LU8A 1DQZA 4N7BA 5B57C 4B2YA 3WGJA 2IZ7A 4M1WA 3TH5A 3RNLA 3EHEA 1DUIA 3DDSA 5HQ3A 5FLYA 2XUGA 1VLJA 4TLLB 4R2MA 1NNUA 5IVKA 2VTDA 4NC9A 1P4RA 1RYNA 2A14A 1ZRHA 3PT9A 4EJSA 4ZI7F 1C7RA 3LC0A 4PAMA 4FT2A 1L4FA 3OIUA 4TXMA 4Q7MB 5EIEA 3EMVA 4OU5A 2W6ZA 4REQA 4W99A 2B78A 1WZUA 1M33A 3CUSA 3RGWS 3P45A 5MFZA 3U4GA 1E1CA 4UFPA 4DZZA 2NT3A 4RHFA 4ZI2A 2PD3A 4OMCA 1YRYE 3LCRA 3C3EA 4TQUS 2PKYX 4MRRA 4Q9HA 3KUUA 2A92A 1IONA 2C98A 1KI7A 1HFJA 1RYEA 2QX6A 2AW3A 3K0CC 5EIBD 2VQ3A 3KCQA 1JEYB 1W9MA 4P81A 1EB9A 1GUYA 1XCOA 1YT5A 2XMSA 4GDMA 1RWVA 1RI4A 4WN3A 3O1LA 5CJJA 5DK6A 1KY5A