2XTNA

Crystal structure of gtp-bound human gimap2, amino acid residues 1- 234
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
210
structure length
208
Chain Sequence
SELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Oligomerization in Septin-Like Gtpase of Immunity-Associated Protein 2 (Gimap2)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GTPASE IMAP FAMILY MEMBER 2
total genus 81
structure length 208
sequence length 210
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04548 AIG1 AIG1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtnA00
1ANKA 2W00A 4GMDA 2BDTA 1QHYA 2WV9A 3QOFA 2XAUA 2AN9A 1M74A 1AS3A 3MJRA 1P2VA 4HATA 4CRWB 3IGFA 3Q7PA 3AF1A 4WXRA 2PLRA 4TLEA 1QHNA 1N5LA 5BN5A 4WZBE 3QKRA 3GMTA 4TZ6A 3ASZA 3C7KA 2JLSA 1MO6A 2CCGA 4RD6A 4HLUC 4R98A 3KQLA 2QU8A 3IEUA 3AGPA 3OIYA 4MYUA 3AVTA 1G291 4ZCLA 2V1XA 1G41A 4HB4A 4MRSA 1MO4A 2B21A 4FD2A 1WBDA 3K9GA 2GJKA 1U8ZA 2NO0A 2FF7A 3GLGB 5DN6A 1XJ0A 1KYIA 2PZEA 2F1JA 3BFXA 1TX4B 4LC0A 3QNUA 1KO5A 1KMQA 3L0OA 3K0CC 3U4QB 1MR3F 3IIJA 4JIMA 1W4CA 4P4SA 2RGXA 2WMNB 3KKOA 2XX3A 3QKTA 1KGDA 4JT4A 4V0LA 1NY5A 3QVUA 4MGIR 5LB2A 3W9YA 3HU1A 4OK5A 1N5JA 2ZR0A 3CWQA 4Q5IA 3LVQE 2GWHA 5DISB 5ANRB 3TMKA 3WNDA 1DG1G 4P4TA 5C46F 5EXSA 4DUGA 1LFDB 2AD1A 4LK2A 3RAPR 3QUSA 2P6NA 1YHNA 1NN3A 3MSXA 1XEXA 2IXGA 3DL0A 1ONBA 3FKSA 2PT7A 4TLBA 4ZI2A 3PUZA 3LFUA 4ESHA 5DIFA 3RNLA 4TLAA 5JJIA 3H86A 1II9A 5GVSA 5DYIA 5JCZA 4MRRA 4URUR 3A4NA 2CNWA 1H8HD 2CL7X 1KDRA 2ZVQX 2R44A 4PANA 1T5IA 2QORA 1UJ2A 3SC3A 3PFIA 2CBZA 2NO9A 4L9WA 2OE2A 3GJ0A 5DHFA 4EJSA 5SZIA 4PTLA 2D4HA 3OAAA 3BB3A 4TYPA 1ZNYA 4BZPA 1C9KA 3RLFA 4KFUA 2OESA 2DR3A 2IC5A 2KSQA 4PAMA 3BFKA 1II8B 3QSYA 4WA7A 3W6PA 1KI3A 2EW1A 3D7MA 4A8JA 2IBMA 4MKIA 4TL6A 4QJ4A 4D25A 1L4YA 2XXAB 3TVDA 4V0NA 4EIWA 1Z6GA 2CNWD 4JLBA 5IHPA 2XZLA 2VO1A 3DPUA 4MDEA 4AKHA 1DAIA 3DO6A 2Q6TA 4NBSA 3AH8A 3EZ7A 2XEXA 5FTJA 1DADA 3KX2A 1YRAA 3LBNA 1OLOA 1E2HA 1Z3IX 5EP3A 4RY2A 1P75A 4W5JA 4D6PA 4G3XA 1EWQA 3EZ9A 3UPUA 4ZCIA 2YKGA 4QHYA 4C7OA 3R7WB 2ONKA 2X2EA 3OIVA 1P73A 4O2RA 4NZYA 1ZC3A 1GNQA 1KSGA 3TSOA 1Q1QA 4HDCA 3N2IA 2ZI9A 4Q19A 1WXQA 2JLYA 1BO6A 5FUXA 1NLFA 5CYOA 5IF9A 2QBYA 1FZQA 2FPLA 1YR7A 4G5RA 4MRVA 2RCNA 1E9FA 3MFYA 4BFUA 4WZ6A 2J9RA 2KB0A 2QN6A 3GLFE 5J5CA 3TKLA 5DNYB 2WICA 3FHCB 1IY1A 1Q3TA 4CEJA 1YU9A 2ZI5A 3ZVNA 3NXSA 1S1CA 2ONJA 1ZU5A 4ZIRA 2WAYA 1LS1A 4D82A 3ASYA 2F3RA 2VIIA 2QMHA 1G3RA 3BBPA 1QF9A 1U98A 4ZDWA 2WWWA 4PHFA 5JRZA 3FB4A 2C77A 1Z5ZA 2QGZA 4JMPA 5D3QA 3ETLA 1US8A 2ZI6A 4HI0E 1XPRA 5C18A 1W36B 2O8CB 1QZXA 1NJGA 4BZQA 4Z51A 3WHLA 2ASEA 4DHEA 1T3HA 5P21A 4NYJR 2GJ8A 4L9SA 4V0KA 4L16A 1FW6A 1E69A 2R6GA 1U9IC 4PPGA 2HEIA 1ZINA 2A5FA 1XX6A 3ZZTA 1T91A 1LV7A 1PJRA 1XTJA 3NEYA 1CRQA 1G6HA 4RZ3A 2O8EB 4JLOA 1IBRA 1KKLA 2ZRLA 3UKDA 2NMVA 4U00A 3KXIA 2C78A 1ZD8A 4OJKA 2OBMA 1GOTA 1E6CA 1Z2AA 3THYB 1GWNA 5E3HA 2EYUA 1NIJA 3KKPA 4O0MA 4JBXA 3OFND 3CUEF 4WOPA 2A7QA 1W2HA 4DB4A 2NPFA 3QEJA 1JEDA 2CK3D 4F38A 1J2JA 1ZW6A 2KJQA 3Q5DA 4NYMQ 3RS0A 1V43A 2BM1A 3PCRB 4N0DA 2GZHA 4FCWA 4GFDA 4DDTA 3GJ5A 4DSNA 3OHMA 5JLJA 2VSOA 5FBRB 2VHTA 4UNPA 1X3SA 3IHLA 4MKFA 1JR3A 1SKYE 3U7GA 4US2R 2GXUA 5F2EA 1I4TD 2GF9A 1N6IA 2JASA 3OEED 2HYIC 2R6AA 3TUZC 4RJLA 4D4MA 2RGCA 4KAXA 2WOOA 4TL8A 1D8TA 2J0QA 3NHAA 4F92B 4DLSA 4JYCA 4KCGA 1OFUX 5A0FA 1E2JA 4ASUD 1CR0A 2KBEA 3NBYC 4F93B 2GXAA 5AUPB 4QOSA 1YZQA 1DARA 1E9AA 2MSDB 2OSBA 2IW3A 2QRZA 3K0AB 1AM4D 4GP6A 3MCAA 3I72A 1QHIA 2WKRA 1WMSA 5HE8A 1MABA 4LJ4A 2Q3MA 4Q01A 1JNYA 4DDVA 1GILA 2AX4A 2A5DA 2IWRA 1YZTA 1E2KA 3RS4A 4D0GA 1FQKA 2W6JD 4A9AA 4LPSA 2PZGA 1YZGA 2GF0A 3CR8A 2NO7A 3RRNA 3VNUA 4TN1A 2CEAA 3KDSE 5FTKA 2CHVA 3THWA 1OYWA 2GVZC 1KSFX 1R5NA 1DO2A 3CX8A 4DLRA 3K9NA 5SZJA 4LOAA 3ZQ6A 3I8SA 4E22A 1Z28A 1ZYUA 3BFVA 4S2EA 3T1VA 1KKMA 2ZE5A 2RGEA 2IYUA 3DKVA 4WIAA 3SBEA 3PVSA 8OHMA 1KZGB 2DWPA 3P27A 4I99A 2ZSBA 2UZIR 1E9RA 5J4VA 3BK7A 3THYA 5L3QA 1KO4A 2BCGY 1MKYA 4HB0A 1FTNA 1E1RD 1QG4A 2IHBA 2DHRA 2OHFA 2P65A 3QIAA 4N1AA 4HLCA 4JVSB 3LQQA 1ZP6A 3EX7C 2PLFA 3R20A 4NCKA 5FI0B 4JYBA 1ZVQA 4D80A 2QAGC 2QBYB 1Q44A 4B2LA 2A78A 2PCJA 2VHCA 4JLVA 1YZNA 3QPUA 3ZIAD 3CNLA 2WAXA 4NCHA 1DPFA 2D06A 1IJFA 1NBMA 4DZZA 3C5CA 4C0BA 1M8PA 3X1YA 1SXJA 3FYHA 1XD9A 2NO1A 2Q9BA 4QGFA 4AYXA 1TPZA 4RZ2A 4IVPA 2CL6X 5EJEA 2ZRHA 2ZJ5A 2ZU6A 2VHUA 4JLKA 2ZI7A 1N25A 4G5OA 5CITA 3P32A 3SNHA 2G0TA 1TQ2A 4FW9A 3HR8A 1OW3B 2JGNA 5FOVA 1NMYA 2IWHA 5C4MA 2YHSA 2YZ2A 3H4MA 1GL9B 1JALA 1IOZA 1NLZA 4KFSA 3SJCA 2OT3B 3EIHA 3ZIAA 1UFQA 5FPTA 1HH4A 1W36D 1NIPA 3Q5EA 3GJ6A 3EC2A 4GBMA 3RSLA 3K70B 2JIZD 1PUJA 3VR3A 2QPOA 2UKDA 4BLTA 4DCUA 2QE7A 3DZDA 3HPQA 1L2TA 1Q12A 4JSYA 1PV4A 3C8UA 1P2TA 1T0JB 2H8KA 1AS2A 1W1WA 2GZDA 2V6JA 4I4LA 3W5IA 5BXQC 2VBCA 2Q9CA 1CR4A 1N6KA 3PUYA 1SGWA 1FMJA 1M2OB 4X8OA 4YDHB 1E96A 2R8RA 2GA8A 3OIUA 4MUAA 5G3ZA 3TAUA 1W4BA 1ZJ6A 2VP4A 2BMFA 1N6LA 3U7EB 4DCVA 4K46A 4EPRA 3WY9A 4KYIB 3W6OA 3VU9A 3U44B 3IPYA 4HAUA 3QF4B 4QBHA 1EK0A 1QHSA 2O8DA 1KI6B 5JZVA 1C4OA 1Q0UA 3FHOA 4BLOA 1MABB 1D9ZA 1W46A 1J7KA 3BAFA 5FTLA 1NF3A 2V9PA 4PC6A 3Q72A 2AHOA 3FPAA 4OQNA 1ESNA 3CRW1 1U8YA 3K0SA 1M6NA 2QY9A 1E94E 4BPBA 1IN5A 3PV0A 1XEXB 4LWZA 2HUPA 2ZJ2A 2YYZA 1WRBA 4MYHA 2VSXA 4QXAA 3TW8B 2J0UB 1R8SA 3Q3JB 4EFMA 1XEWY 1ZUIA 4RFSA 5CB6A 1KMHA 4QHTA 3KKNA 2HJGA 5HCIA 2X1VA 4U5XA 4B3GA 1KI4A 3RRYA 3AGQA 2RGAA 1W4AA 4PPNA 1HY3A 2NZ8A 2C5LA 2ZJAA 3DEFA 1UEJA 2IS4A 1K5GA 1CBUA 4MYTA 2ZYTX 1N0WA 1N6OA 1Q21A 1ZMXA 2BJWA 4B2PA 1Z06A 1PLJA 1Q1EA 1KK2A 2H7VA 5EE1A 3SDZA 4B6FA 1RFLA 3RRMA 1Q57A 4UXJA 4BFWA 5L8VA 3FHTA 3WXMA 4M2LA 3R8CA 2IT1A 4TSFA 1KMHB 3QJYA 4MRNA 3OEEA 2QAGA 4Q7LA 2WJIA 1VIAA 2F9LA 4NYMR 1R5BA 1T3SA 4TMWA 1E98A 1P72A 1I2DA 1Z0JA 5JWHA 2F9MA 2ZR9A 3I5XA 3CM0A 3IHWA 1OKKA 4L4UA 3A1VA 3VTKA 3PQCA 2VP2A 2OXCA 4P33A 4B3CA 4ZPXA 2XJ4A 2FFBA 1UDXA 4B6EA 4TQUS 3B1YA 2FOLA 1YR9A 3SQWA 4JZKA 4Q4JB 4DSTA 1EFCA 2G3YA 4JKYA 1P61B 1XD2A 3DM5A 4Q7MB 2CDNA 2ZRCA 4GDFA 4URZR 2C03A 4TMXA 1EWRA 3M4YA 2ANCA 1G8GA 2I4IA 3SN6A 4JJZA 1IQPA 3UG7A 4PXAA 1JECA 2NZJA 3F0TA 2NGRA 3IIMA 1XMSA 1FNNA 2ATVA 2AXNA 1N6NA 4QNMA 1OH7A 2OFXA 3LXRA 4DLWA 5J4YA 1CULC 4B48A 2Q0HA 3SE0A 3IILA 5J4HA 1ZNXA 4GOKA 2GCOA 2IK8A 1FNMA 3SYKA 2HDNB 4ARZA 2OLKA 5EXTA 3SBDA 2BVNA 2RMKA 1SXJB 1U0LA 5FL3A 1OB5A 1KZ7B 1Z07A 2HT1A 3Q85A 4NONA 2CL0X 5AUNB 3CX7A 3KB2A 1TAGA 5C2JB 1EFTA 1PZNA 2IYRA 2ERXA 3ADKA 4LHXA 4LSGA 4NMMA 3UIEA 1VCNA 2ZAMA 4QBIA 4C0SA 4CEHA 2QRNA 1NLYA 1M7GA 2AFIE 4JL8A 1HYQA 1UDWA 2B7CA 3IQWA 4F4IA 1JJ7A 1WDTA 4A82A 4JL5A 3X1ZA 4AC9A 3SS8A 3ZVLA 4B76A 1KAGA 1OFTA 5FBWB 1RW4A 3IO5A 4LV5B 4NYIR 3PEVA 4LY6A 3ZQJA 4KHZA 1G3IA 2R6CA 2GILA 1NP6A 3BH6A 3NBFA 4LJYA 2WMOB 3ZH9B 3LDAA 4BFVA 4MITA 1W4RA 1IY2A 3KFVA 2MSEB 1FP6A 3N2EA 3ZVRA 4Q4AA 1R0YA 1EFRA 2P5SA 4P4UA 3ECCA 3K70D 2GDJA 4LHVA 4OYHA 4LBVA 2O8DB 2H18A 2IUTA 3WRXC 1J8MF 1HUQA 3EA5A 4RD4A 1RPZA 4DT1A 4A8JB 3ZS9A 3AV0B 2XB2A 2WJGA 3FVQA 2W83A 3RS3A 1VKJA 4MGKR 1IHUA 4YMUA 5AWFC 3B13B 3FMFA 4URYR 4BRUA 4BLPA 2QP3A 2P5TB 2YOFA 4C4PA 2CCJA 1PLLA 1L8QA 2NIPA 3CH5A 1MRNA 4HAZA 4B32A 4HLQB 5CYPA 3CONA 2EFGA 2VLIA 3FFAA 3W90A 4GL2A 1QG2A 3P1JA 2FNAA 4HAYA 4TT3D 3SJZA 1YE8A 2VHQA 1TQ6A 3GQBA 2O8BA 1MOZA 2FFAA 3O8RA 5FFMA 4OL0A 1CJUC 1FX0A 121PA 1JR6A 4AYTA 3PEUA 4EPTA 1E1QA 4BUJA 5BW8A 4Z8YA 3VMFA 4WBSA 3SZRA 3LBHA 4KLNA 1R8QA 3THXB 2FPKA 3QEOA 5CDFA 1Z08A 2H5EA 1HURA 3GLFB 2XZOA 2G88A 4OQMA 2WJHA 3KTAB 1PVOA 4DEYA 6Q21A 2D2EA 1WA5A 5H8WA 4NCJA 1BYIA 1TNDA 1VG1A 1J70A 2F43B 2ZRGA 4UJ5A 4HB2A 2WWHA 3AUXA 1JBKA 3LLMA 2WPDA 5HCNA 3A58B 1IN8A 4LYJA 3CZPA 2OZEA 2BOVA 4HUQB 2J5XA 4Q1DA 1NBME 1YZLA 2B8WA 2FSIA 1Z22A 5DYGA 2B8TA 2WBLC 5J4KA 2PJRA 2GJSA 4DSOA 4Q4JA 4DJTA 1AN0A 1LW7A 2PBRA 1K6MA 2NOAA 1DVRA 3GD7A 1GITA 4FWIB 1E9DA 1WE2A 2P67A 4G5SA 3V4RA 4PAQA 3ZD6A 1FOEB 3C15C 4Q66C 1G6OA 4JLMA 2BHRA 2V1UA 4FINA 1B23P 4QNRA 2YOHA 5GJBA 4M9XA 1SHZA 1A1VA 1KNXA 2P2LA 2V7QD 1R2QA 5AR1A 3A1SA 4OJQA 1ZC4A 4PO1A 4PFSA 2QUZA 2WWFA 4A6XA 3AP2A 5BWMA 3BXZA 3FKSD 5EE5B 4C0QC 1GM5A 2O8EA 1U9IA 1VCOA 4C2UA 1G18A 1E2DA 2AK3A 3B85A 5FOTA 2IX3A 1RJ9A 1U8AA 3JZMA 4AIIA 4HAXA 4LV8B 3QQ5A 5EQTA 1XXHA 3WMEA 1NVVR 2FU5C 4GZLA 1MO5A 2D74A 5DI3B 2QG6A 3MWKA 4JLAA 2BBWA 4RFVA 2V54A 2PMDA 3CO5A 3GJ4A 2JLQA 5L3RA 4MGZR 1SVLA 2GBLA 3W6NA 3KKQA 5A5GA 1KK1A 3U60B 1SVSA 4YMTA 3THXA 2JLWA 4O2LA 4Q02A 1E2PA 2HJVA 1NY6A 1TQ4A 2DFKB 1BS1A 2LKCA 3BH7A 2C04A 1OF1A 3EXAA 3GLHA 3NC0C 4M0LA 3AF3A 3B6EA 5HTKA 1G3QA 2D2FA 2A5YB 1GKIA 2REOA 3OAAD 1JXOA 4Q47A 4V02A 3VX4A 3K09A 5KHOC 3PG5A 1DELA 4P3YA 1MV5A 2OEPA 1UBCA 4Q1BA 4OI0A 2OBNA 3QPVA 2F7SA 4KFTA 1ZM4A 1F2TB 1P7CA 3A37A 3EIEA 4M9QA 5CK5A 3WP1B 2W2XA 3H1TA 3RABA 4HLUA 2LWIA 3GP8A 4Q7JB 5L3SB 1CP2A 5DLQC 3K09C 4QGGA 1XTSA 1GAJA 3NWJA 2FMXA 4PC2A 5EP1A 4KYUA 4CGZA 4XSGA 1YJ5A 3H84A 3TSZA 4LHZA 5F98A 3DMDA 1YZUA 4UXIA 1KI6A 3D8BA 4UQOA 1ZD1A 3I32A 5J4LA 1Y3AA 3PUXA 1F60A 1PLKA 5CM9C 2R9VA 4H1VA 1OIXA 5CLQA 4GRAA 3KB1A 3EASA 4BASA 2IS6A 2PX3A 2FSFA 3KJIA 4KBFA 3I1FA 2GJAA 4GMXA 3EZ6A 3WMGA 2XNSA 4QGAA 3ZJYA 2O8CA 4PR0A 4A4DA 1E79A 4BLRA 2WJJA 4M1OA 4DLZA 4US0R 1FQJA 1Z0IA 2JIZA 2Z5FA 5FOXA 5B57C 1RRCA 2R65A 1EFRD 1WQ1R 2ZJZA 1T8UA 5EUMA 4URWR 2OLJA 4Q03A 3QBVA 1WCV1 4B74A 4F4JA 2EFCB 3K1JA 4GSYA 1L7VC 2DWQA 3L2OB 2ZAOA 1QBKC 1AGRA 1IXRC 3D3QA 5JEEA 1XCMA 5K8IA 2IYZA 2AL7A 4OK6A 4B44A 2NO6A 5AJVB 4PZYA 2BM0A 3DZ8A 3T1QA 1TF2A 4PC1A 3U6KA 1BH2A 1JQLB 1G4AE 3ZDQA 1T3LA 2W2VA 3OE7A 2BMJA 1IXZA 4IFBA 4FMCB 5KTYA 1X86B 1ZNWA 1OHHA 3UMFA 2ZRDA 1SVOA 2ZI4A 5TXGA 1RC8A 4EPXA 1SVKA 1E4YA 4HB3A 2BV3A 4BEBA 1E2EA 4DC9A 1KDOA 1G20E 1DOAA 1VTKA 1BMFD 3FOZA 1UBGA 1XD2B 4I1UA 4K8OA 1H8ED 4QM6A 2CLDX 2PH1A 4TZ0A 3GLIE 4PQYA 3CR7A 1CIPA 3LNCA 3QVVA 1CS4C 2ZRPA 1CLUA 1KO8A 1VG8A 4XTCS 4LC1A 3ZVMA 1Z63A 4DIEA 2C9YA 2G1KA 3KFXA 3CRVA 4I1VA 1OXXK 3CW2A 3P4XA 3QG5A 3AM1A 3M1IA 1HQCA 1II8A 5J47A 4FWTA 1FUKA 1GP2A 5DSZA 4RFSB 1OSNA 3HP1A 2RGNA 5HZKA 5F9HA 4G5QA 3IIKA 1J90A 1N5IA 3FMOB 1N0VC 1VG9B 1R0XA 3QKUA 4WVFA 1QHXA 3B5JA 1OIVA 3VHXA 2ZRIA 4DDUA 2O0HA 1Y63A 2ZJYA 5LPNA 2CCKA 2F55A 4EUNA 3GEEA 1CR2A 1TU3A 5BYJA 3T12A 2O8FB 2AWNA 4TLDA 1R10A 4PSAA 1NMZA 2ODNA 4KVGA 3FMPB 2V7QA 4RD1A 4QL3A 4UNNA 4B3XA 5JSZA 2Q9AA 1ZCBA 3G5UA 2ZTSA 1A2BA 2YVUA 4BFZA 2FWRA 5CDFE 4EPVA 4ON9A 2FFHA 3WMFA 4TL7A 3U5ZB 2YWEA 2J46A 1D6JA 3EWSA 5KO2A 2WOJA 1N0UA 3QKSB 3AKCA 421PA 1CJMA 1VCMA 521PA 4B3DA 2WSSD 4PO8A 1XMIA 4UJ3A 3EPLA 3IEVA 2JLRA 1OYYA 3TVTA 5EP4A 1KK0A 1N6RA 3CF6R 4B43A 2QPAA 2MSCB 3K8YA 3VNVA 4OHYA 3C41J 1W0KA 1GL6A 4PPFA 4D4JA 1JQJC 3NDPA 1FL9A 3ADDA 1COWD 1HE1C 3REFA 1RRFA 2D7CA 2ZANA 3B1XA 3MWYW 1R6BX 2J7KA 5L3QB 3U3MA 4II7A 4LBYA 1JAHA 1AZTA 3HR7A 1TU4A 3W3AA 1LF0A 5TY0A 1ZM7A 1FUUA 3TJZA 1G3MA 1Z6YA 1S4QA 2F1RA 4Q9HA 1AIPA 1NVUQ 2V8OA 4ZDJA 1QHGA 3IUYA 5GJVC 2RGBA 1VYTA 3BH0A 3Q9LA 1XJQA 4JLNA 5E95A 2GZAA 1NL3A 4NH0A 5A4JA 1E4VA 4IEEA 3HDTA 1N2CE 2JCSA 4AD8A 3U7HB 3QXCA 4NL4H 1OXTA 3L0IB 4WW0A 4EAQA 4PZLA 4CEJB 4LHYA 2J1LA 3UG6A 5JECA 4HEJA 4C0KA 1M1YE 1Q1ZA 3RVBA 4W5HA 3TIFA 4ZIRB 1RRGA 2WWIA 4M1KA 2HF8A 4LBWA 1G8FA 2WIBA 4FN5A 4NDZA 4ACAA 4LYHA 2E87A 1ZM2A 1E32A 3GFTA 4DLVA 5FPYA 1A4RA 1P2SA 1P6XA 1UPTA 5DI9A 1KJZA 1GRRA 3VX3A 3GFPA 5K8UA 2PT5A 4JL6A 3NBXX 621PA 1W47A 5EZ5A 3KZ1E 2GK6A 3KL4A 1NN1A 3AVUA 2G1JA 3IKJA 5FUVA 4E03A 1G5RA 3G0HA 2A30A 2QTVB 2XNDD 2L0XA 2XTNA 4R7ZA 3O8CA 1XZQA 2C9OA 1XFAA 4NHOA 4PZZA 2MMCA 1KY2A 2QZ4A 1S9DA 5AUOB 1E9BA 5DGXA 3W8NA 4TT3A 4QG7A 4M9SA 3VR6A 4OHXA 1XWIA 4I1SA 5KDLA 4AK9A 3QKRB 4QJ5A 3BS4A 2HLDD 3L0SA 1IN4A 3TH5A 3I62A 2ZUBA 4TL9A 4O3MA 2VYFA 1NVWQ 2DPXA 1F3OA 2GVDC 3MD0A 4TTRA 3CRRA 3DOEA 1L4UA 1LTQA 4JVMA 3G82C 5B2ZA 4KJZA 1SQ5A 1E9EA 2ZJBA 3CNOA 2ZSAA 2QENA 2ZITA 3SR0A 4L15A 4PX9A 1SXJC 3EG5A 3RANA 3P20A 1GRQA 3TR0A 5JRJA 4M1WA 1EFHA 2W2TA 5EE0A 4N0EA 3U61B 1UKYA 3R9IA 4LGMA 4G01B 3THWB 4HDOB 4QBFA 3W5JA 2DCUA 4IDOA 2JDID 4KLZA 4OBEA 1KJYA 4XJXA 5FI1B 5FUWA 1YR6A 4RD2A 3BORA 4TMZA 1FP7A 4LJ6A 2BCJQ 1XXHE 1W48A 5KPDA 4RKEA 1RKBA 2I3BA 1P9NA 2KBFA 2KWIA 4DIDA 1KSHA 5KSYA 3GJ3A 2EWVA 4A36A 1GNRA 2QT1A 4PSVA 2G83A 1G7RA 1EESA 3H2YA 4KSCA 1Z6AA 1G8HA 4M8NE 1ZUHA 1IN7A 4W5WA 4QBGB 3NDBB 1GL7A 4IDQA 1HEIA 1U94A 5CM8B 3SOPA 2QL6A 4FMDF 1TMKA 1H65A 4NKRA 1TF5A 3GLFA 4A2WA 2AWOA 2PEYA 4TLCA 3RS7A 1ZD9A 1X8JA 5DHAA 1UBFA 3M6AA 4JVLA 2VF8A 2ZREA 3TBKA 3TQCA 1QRAA 4KBGA 5F3WB 2W6ID 2ZE7A 1NN0A 3M0EA 5JMTA 4XD7A 5KOYA 1IXSB 1HTWA 3K0AA 2EVWX 5IDVA 5FH9A 4M22A 1IM2A 2OCYC 2ODEA 2WSMA 3DMNA 2ZUDA 1XCPA 1E2MA 3NG1A 3QXHA 4HSEA 3FDIA 5KSPA 4ZKDA 4BGDA 2Z6VA 4RD0A 2RHMA 4AY2A 1DAHA 5FTMA 2ZE6A 3WP0A 4BFTA 4BLSA 2QMOA 4BFXA 3ZS8A 5KSZA 1G8YA 3UXMA 3BJIC 4B3BA 5IRCD 3K0FB 2WTUA 2QROA 1F2UB 1QVAA 1E99A 2EFDB 2JAQA 4ZCMA 1R7RA 3LLUA 4MH0R 1XTQA 2IEZA 2EFHB 5HPYB 4I81A 2J0SA 4MKGA 4Q9JA 2QQ0A 3K70C 4IW3B 4ACBA 3TUIC 3EWAA 4DLXA 3FKQA 4A0RA 4ZKEA 3RC3A 3CPHA 4F91B 4KU4A 2AXPA 3PENA 4MKHA 1W0JA 3D6TB 4LYAA 2WM9B 3DKPA 2R2AA 3A1TA 1R4AA 3AF4A 1G16A 3QXXA 2OUKA 2PJZA 4FMCF 1EG7A 1CKEA 3P26A 3AVPA 1EGAA 3K0CA 3B9QA 2RGNC 2ANBA 1DAMA 1AA9A 1XF9A 1W2GA 2OCPA 3QI2A 2ZSEA 4Q9KA 1N6PA 3WYGA 1Z47A 1D2EA 2VP9A 3BD9A 2JJ1D 1T0HB 3JZAA 1G5TA 2HXYA 4QHSA 2DY1A 2CE7A 3B82A 4LZZA 2YOGA 4LI0A 2J0UA 3VR1A 3U4QA 4H9GA 2PZFA 2LKDA 4A2QA 2FN4A 3V4FA 2IYQA 4TYYA 4W9MC 1NI3A 1WP9A 4M21A 4LUCA 1IJEA 1ZM9A 3U3JA 4Q1EA 2XGJA 2J87A 2EYQA 2GAOA 4BQSA 3MJHA 4FCTA 1MO3A 2GXSA 2QP9X 2X8AA 4P32A 2W0SA 1YRBA 1KI2A 1AK2A 2VH5R 2W58A 3W34A 5H68A 3RS5A 3FE2A 3U3RA 2BBTA 2WWGA 4MUBA 3PEYA 2R62A 3CH4B 3A4LA 1R0WA 1DAEA 3KXKA 5E7MA 3V00A 4C0AC 2BMEA 221PA 4IEIA 3S1AB 1RVDA 4ESVA 5FOWA 4A1FA 4V0ME 3I73A 1KI9A 4MQBA 1SXJD 3TR5A 1OFIA 2DFTA 3U3OA 1CTQA 2XB4A 3LW8A 2EU8A 2GETA 2ZE8A 4CDGA 4A0FA 1QHHA 2ORIA 3HJNA 4D0NA 2P0EA 5TVKA 5K8TA 1TADA 3OEHA 5E7JA 5AJWA 2ZYUX 4CW7A 1YR8A 2J0VA 4WXPA 5JEDA 2HV8A 2RGDA 4TSFD 3GLHE 4NP6A 1G19A 3THOA 3CF0A 2WJVA 4ASUA 1Q20A 3MUFA 1OT3A 2V55B 3N5CA 1ZRHA 5GADl 1BMFA 2Z0MA 3LD9A 1Z2CA 3EC1A 4C0LA 5CB8A 1H8EA 3UMRA 1W36C 4IRUB 1XMVA 1V5WA 3GJ8A 3MLEA 1KHTA 3ICEA 1TEVA 2CVHA 4RZXA 5TMPA 1OFHA 5H70A 3AVXA 1XCGB 4C0JA 1CEEA 3ADCA 2IHYA 4B75A 3TAHA 2HXSA 1KI1A 1D9XA 2FZLA 4GOJA 4TTPA 4Q9LA 1CF4A 3MAAC 4IFEA 4RCZA 3U3KA 4Z1MA 2I1QA 2Q3FA 4CF7A 1FX0B 3K9HA 1Z83A 4XWAA 5SZHB 5JSZB 4OI1A 2OO7A 4HAWA 4IDPA 4G1UC 3X2SA 4LJAA 2XSZD 2ZQ5A 4XWKA 3CPJB 2IS2A 1CXZA 3IDQA 2ZM5A 2ZRMA 3Q8XB 3TW4A 4D81A 2E1RA 4HZUB 4A2PA 3C14C 1JPNA 4LJ8A 4BWYA 1RJ9B 2FZ4A 3WNCA 2ZETA 2I1VB 1NKSA 3TNFA 5EXPA 4QGHA 4DCNA 3J81k 4CEIA 4OI2A 4F7WA 1J99A 3PXGA 5E7IA 3EW9A 4YLGA 1XPOA 1I4DD 5KYKA 4IHQA 3W8RA 1OXVA 2B6HA 4Q1CA 4LV6A 3R9XA 1GNPA 2A3RA 3NIBA 2OCBA 3HPRA 3SHFA 2OAP1 4LPKA 4C0HA 4JLJA 1E1RA 3CPEA 5TV2A 1KIMA 1AJEA 1LY1A 1S8FA 2GRJA 3UWOA 2F43A 4CT4B 2P6RA 2QTFA 1A82A 3LV8A 2JDIA 1VHTA 3T1OA 5HE9A 1W44A 4E5UA 5IK2A 4LCBA 1XDBA 2GNOA 2IUUA 5FOSA 4LJ9A 3BRWD 1VHLA 2BKUA 3AVOA 2R6FA 4M1MA 4ZDKA 1S1MA 4XD7D 1JEEA 1ESMA 1AQUA 3NVAA 3BE4A 3B9PA 1TL7C 2CHGA 4RSGA 3P4YA 1MT0A 2ZS9A 5GJWC 2FSGA 4A6PA 2KE5A 4B33A 1COWA 2BWJA 5TARA 3KQUA 1OXUA 3MWJA 3VR2A 4NTZA 2WZQA 3KJHA 4S35A 4IKEA 1TTTA 1XJCA 3WYAA 3GCGA 5LD2C 2XJ9A 3A4MA 1W0JD 3X1DA 3B1WA 1Q1BA 4Q1AA 1GTVA 4JT2A 2FEMA 4DXAA 3O8DA 1E0SA 1EFUA 1ZNZA 1LNZA 3IBYA 3JVVA 1UAAA 1A7JA 4J0QA 2H1LA 1X1RA 1OXSC 2FE4A 1SZPA 2JA1A 2ZRAA 2W6IA 2N1BA 2OFOA 3DM9B 4DLTA 4XVUA 2B92A 4URVR 4JBWA 5D3MB 3SJAA 2FH5B 1JAIA 2P6UA 4XWOA 4ILEA 821PA 2OXRA 3OF5A 4OI4A 1M34E 1WB9A 3RS2A 5HKKD 2JATA 5FOUA 1Z0AA 3LH5A 4Q7KA 1AZSC 3T5DA 3JVUA 4U7DA 2J45A 3SEAA 3D31A 1OH8A 2QGNA 2GK7A 2G6BA 2OBLA 2XNDA 1LB1B 5K8LA 2IYWA 1M7HA 1QHHB 2BJVA 2GEUA 1KK3A 3A36A 5KUTA 5ELXA 4KITB 1GRNA 3QENA 1GZSA 4UNRA 3FTQA 1P62B 3TSWA 3RWMB 4PHGA 4C3ZA 2C9CA 3DOFA 1W5SA 5LDDC 4BRWA 1S9HA 2IXEA 2OCAA 2ZXUA 1XBTA 3O47A 3WBKA 2XTZA 1K5DA 3T15A 2GEVA 4IDNA 2ZS8A 1T6NA 4IDHA 5TDHA 2FGJA 1W7AA 3L0PA 4MA4A 3BC1A 1KDPA 4TMKA 5G3YA 3RRZA 4DRZA 2QM7A 5HKKA 3R8FA 3REGA 4DBLC 4XOIA 5F9FA 4HAVA 4M4SA 1SVMA 4Z8XA 2C96A 3VAAA 1F48A 4PO9A 5JI3E 1FTSA 1F5NA 1LS6A 2ZYWX 1OH6A 3B60A 3EZ2A 3ZGXA 3FMIA 1D5CA 3DHWC 2ZSDA 3VKHA 1NVVQ 4LHWA 5UKDA 2ORWA 3K0FA 3EPJA 3AVVA 2WJYA 2J7PD 4YONB 2OILA 4LX0A 2ORVA 1T5LA 1T8TA 4GT1A 1E2LA 1Z6XA 3I8XA 2IYXA 3CF2A 2X19A 2VRWA 4IOKA 2H57A 1DAGA 4EPYA 1DS6A 1TUEA 3AEZA 3EIQA 4KVAA 5DI3A 1XD8A 3F8TA 3WNBA 1NMXA 3A1WA 4Q21A 1E1QD 1FPMA 2FPMA 2Q3HA 3I61A 3N70A 2DYKA 2IUSA 4JS0A 4XVQA 5FL7D 4F4CA 3U6BA 1J8YF 2F6RA 2RH5A 1UBEA 4CZ2A 1SKQA 1GG2A 1XTRA 5CIWA 3AF2A 3TE6A 2GBLC 1ZM3A 2HLDA 2GXQA 3AUYA 2B7BA 3L43A 4I1OA 4M1SA 4NCNA 1JPJA 2JLXA 3AVYA 3LRPA 4HDQB 4TQAA 3I92A 4YQFA 5IT5A 3ICQB 1E0JA 4Z54A 4OHZA 3LO5A 4PC3A 2OAQ1 3TK1A 5G40A 4IJMA 4BFSA 4R9UC 4TTQA 4DCSA 2FEOA 1XP8A 3BIFA 1QVRA 4DLUA 1N6HA 1UADA 3NEJA 3I3SR 3KJGA 1KAOA 3LY5A 1YZKA 2Z43A 4PSKA 5GJCA 2KI5A 3V9PA 2A5GA 1XEWX 1C1YA 1TF7A 1UKVY 4WAUA 2IS1A 3TGPA 2BMDA 3KXLA 5J40A 3QXSA 2XZPA 4QC2A 4FXPA 1A2KC 5CJ2A 5FPHA 4DWJA 4YXWD 3QBTA 4UKDA 4X8MA 2D62A 3RHFA 5JWOA 3SJBA 4URXR 3C5HA 1Z0KA 1NNEA 2D3WA 3ZZ0A 1DG3A 4DVGA 5LB4A 1GUAA 4DT1B 1KY3A 1E3MA 4L8GA 1IN6A 4KFRA 1US8B 1ZBDA 1P2UA 1Z6TA 3SU8A 2D7DA 2C8VA 4M9ZA 1KOFA 4HUQA 3T34A 4M1TA 3UWKA 1SXJE 2NG1A 1E2QA 1VECA 1HT2E 4QM7A 2Z83A 3QPWA 1A5TA 3PJRA 4V03A 5C4GB 2XXAA 1I4LD 1G17A 1EX7A 4IOMA 3T5GA 5KPJA 4AKGA 1OIWA 1U99A 4QFMA 3ADBA 2ECKA 4YMWA 2YNMA 3NTUA 1BYUA 2GTPA 4GPTA 2QMEA 2IF0A 2J59A 4C30A 2F1IA 1U81A 1CR1A 3GEIA 1ZCAA 4Q4LA 4EFLA 3BERA 1S3SA 3HU2A 1O3YA 3PEWA 4IOJA 1CJVC 3CRQA 4JLDA 4OKSA 1XTIA 5H1YA 4DUGD 4EKDA 4TYWA 2QPTA 2FG5A 4B73A 4M53A 3UMSA 3X1XA 2EWWA 4XH9B 1KSJA 2FX3A 3IO3A 2YWGA 5CIQA 5FBLB 4WZAE 3LQRA 3QE0A 1H8HA 1XEFA 2MMGA 3F5FA 3GLIB 1GKUB 2Z4SA 2AFHE 1T9HA 5C1BA 1EXMA 4XIGS 3DVLA 2XOKA 5KSOA 1I2MA 5JJKA 2PCLA 1F6BA 1UKEA 1E2NA 3E5HA 4JBYA 5BQ5A 3B8HA 3CLVA 4L5BA 1G8PA 5EP2A 2IF2A 4A0GA 5FR2A 4B34A 4BZXA 2PMKA 1NSFA 3ONWA 3LW7A 2Q21A 4FCVA 5EUQB 1U0HC 4UXHA 4TQ9A 4CEHB 5EE3A 1SVWA 1E79D 1G1MA 1AS0A 2ODBA 5EE9A 4P0TA 3KQKA 2REXB 2VEDA 3AP1A 1DE0A 5KDOA 2CLSA 5KNCA 3T35A 3B1ZA 4PC7A 4XVRA 5CJPA 2O5VA 5B64A 4A8JC 1KTVA 3L8YA 4MGYR 3IBGA 3QG1A 2QP4A 5FUYA 3VQTA 4EDHA 2VL7A 3TUJC 4B2IA 3LBIA 2WWXA 4GNKA 4AURA 2JLVA 3ND8A 2ZJOA 4XSHA 2F3TA 4BEJA 4EFNA 2DFLA 4B35A 1AKEA 2IYVA 4G0NA 2J41A 2NPIA 3I4LA 1X8LA 3GLGA 4RKFA 3K0EA 2ZR7A 1NRJB 4E09A 4EJSC 5JWRA 1Z0DA 2GESA 2W0MA 4TMVA 2AKAB 1BIFA 1Z29A 3ND9A 2YV5A 3CZQA 3VHLB 3SHWA 1XU4A 5FBQB 3FWYA 4DB2A 2A9KA 1Q3HA 2ZRKA 1GIAA 4Z1MD 1XNJA 1WBBA 1ZU4A 2BC9A 5FPSA 2OG2A 2BEJA 4YMVA 1AKYA 3EA0A 1BOFA 2LCFA 5HR5A 2DFNA 3CB4A 4UNQA 2CMKA 1P4SA 4RCYA 2QAGB 2C98A 1E9CA 2CE2X 5LD2B 2GCNA 5BN4A 4NPHA 4P4SB 3HU3A 4DCTA 4Y0VA 1RYFA 1X1SA 2QSZA 2RKOA 1II0A 2V4ZA 5L3VA 1VYVA 2IYSA 3GFOA 5CK4A 2VPPA 2REBA 5DE3A 2QQEA 3A8TA 2QEQA 1LVGA 4MDFA 2K5UA 2X2FA 1CU1A 1JR3D 1MRSA 5FR1A 1G7SA 3SFZA 4X8LA 1JJVA 1HT1E 3RYTC 3VU9B 2ZPTX 1VG0B 3W3ZB 4TYNA 2RAPA 2C2HA 3MRSA 5SZKB 1HV8A 3A6PC 2NQ2C 3E2IA 5GVRA 1ZIOA 3NH9A 5FPKA 3IQXA 5AJXA 2CK3A 1SKYB 2YWHA 4RZUA 2BIFA 2FJUA 3NH6A 3AKDA 4IXNA 2A5JA 4D2IA 1DEKA 3KTAA 2FA9A 2P3SA 4D4LA 4KI0A 3F3YA 2VQSA 2IL1A 5JS8A 3IPXA 1ELOA 1FMLA 5IK2D 2VA8A 2BBOA 4XTRA 1KJWA 4LBZA 4YXWA 2VHJA 4B3FX 2ZIAA 1OE0A 3HYTA 4ABYA 2VP5A 4Q18A 3VKWA 3UANA 1FFHA 3BB4A 4HZIA 1HQYE 4PQFA 3E1SA 3CNNA 3NKVA 1G5PA 1G21E 3OESA 2ZEJA 1VDZA 1RE0A 2JJ2D 2V6IA 4ZDIA 5AJZA 2O52A 3FGNA 4GP7A 5LBIA 3WBJA 2ZUCA 3BGWA 4MYCA 3LX5A 1QDEA 4BE7B 1G7TA 2CXXA 2A2ZA 4FI3C 1NBMD 4ZV4A 1XTKA 4H1UA 2YJTD 1G9XA 1S0UA 3KQHA 5KNBA 3GLIA 3OZXA 2ERYA 4YC7A 2JLZA 3AKEA 5EZ6B 3B7GA 3GJXC 3AB3A 4V0OA 4A92A 4ERNA 4Q4HB 2JJ1A 2RGGA 4Q4AB 2N42A 4Q48A 3U44A 2GEDA 3TLXA 3HYRA 2GCPA 3GEHA 1OJLA 1KO7A 4IVQA 1NKTA 4US1R 2G9NA 4AKIA 3AQ4A 2H92A 3OIWA 4OHVA 4DSUA 1UM8A 2OM2A 3WYFA 1D2MA 3NBZC 4JSTA 4OQFA 1ZUNB 1R0ZA 2H17A 4AWXA 1S2MA 2J7PA 2QSYA 4NU0A 4AG6A 4G5GA 5KDDA 1E0AA 3LWNA 1W5TA 3SQXA 1XXHB 3CRMA 1LF5A 4JLPA 4OQLA 2ODWA 4AKEA 1UKZA 4KV9A 5G53C 5CLLA 4HLDA 2VTKA 2GAAA 5TB5A 2R6DA 3RSOA 2WPDD 4HUTA 4JJKA 3ZD7A 1X6VA 1D2NA 4B47A 2VSFA 2CLCX 3U7FB 4A15A 1OV4A 3MWLA 2Y8EA 1XPUA 4Q9IA 2YWFA 3CKLA 4CVNA 2C99A 5DO9A 3SYNA 5JJLA 1IY0A 4BLQA 2C95A 2YINC 2O8FA 1P60A 2ZROA 5DH9A 2QAJA 1MH1A 4NCIA 3LVRE 1O87A 1VPLA 2VP0A 2VP6A 4O25A 1CRPA 3T06B 3PUWA 4C9BA 4OHWA 2UVQA 2OV2A 3PIRA 1P9RA 3E70C 1N5KA 1P3JA 1RRPA 2ZRFA 1KI8A 2E9SA 3CIOA 3UATA 2F1HA 2XTMA 4C2TA 4BECA 1PUIA 3EAQA 1U2RA 2V3CC 4PQRA 5EXXA 4HYYA 1DAKA 2JLUA 3OFNA 1P5ZB 3CBQA 1OPXA 2W6JA 4M1YA 3TRFA 2CJWB 2QA5A 2PL3A 1AGPA 2CHQA 4KO8A 2IYTA 2CVFA 2BKEA 1AQYA 3HWSA 3QF4A 2QM8A 1ZIPA 721PA 1GKYA 3C4JA 3MG9A 2RB4A 4CIDA 2G0NA 3WRYC 4QKQA 5KU1A 1NN5A 5AK0A 3QKSA 3ZYCA 5E4FA 1G7CA 1RIFA 1Z8FA 3PITA 1XMJA 4R2HA 1IAQA 4AG5A 1M7BA 2CJWA 3DDCA 3QXJA 3LAWA 2ZVPX 5FTNA 4DDWA 5JHGB 4DEXA 4YDSA 4X8HA 5BYKA 2FV8A 5FL7A 3L82B 3QY0A 4RD3A 2IEYA 2ZJ8A 3AKYA 1TQDA 2BBSA 4EQ6A 5HZHA 3BB1A 3EPKA 1CJTC 1G3UA 5DN6D 1OH5A 2ZU0C 2WSSA 1WF3A 4LJ7A 1TEXA 1G64A 4HZUA 1VCIA 2AR7A 4IXMA 4PHTA 2J3EA 1E2IA 5JI2E 4ITRC 3X1WA 3WHKA 1DTSA 2QI9C 1GDDA 2PEZA 1W49A 4NE2A 4B71A 1E0KA 2N46A 4AYWA 2ZYVX 4OK3A 1DAFA 1GVNB 4PAOA 1XRJA 3KJEA 4EQ6B 3MMPA 1ETUA 2GHIA 3LA6A 2FDCA 1OKKD 2BEKA 4FMDB 5JCPA 2EQBA 1SHKA 4Y0AA 1ODFA 5JHHB 2FFQA 2DB3A 4D26A 2HCJB 1OB2A 2GKSA 2WVJA 3EPHA 1R5OA 2IYYA 5G41A 3K9LA 1E2FA 4IOLA 1IONA 2QMUA 2G77B 2AKYA 2O0JA 2PX0A 4JKIA 3C16C 4V0MA 1NVXQ 2ZRJA 1JB1A 1GSIA 1X8KA 3H0KA 2ZRBA 2NTYC 1NJFA 1Z0FA 2HYDA 3LX8A 2WHXA 1KDTA 3KQNA 1G4UR 2AD5A 3I5YA 3RC8A 4U02A 1VIYA 2QT0A 3VR5A 1DBSA 4FIDA 4UNSA 1SVIA 1B0UA 1SULA 3KKMA 1Q22A 3Q7QA 3BWDD 4RVCA 1VYUA 4PHHA 1W0KD 2WIAA 2WKQA 4Q4HA 2HF9A 2O8BB 3B78A 4K81B 5B58C 3T1TA 2JJ8A 4TMTA 1VMAA 4A0HA 1RZ3A 2ZI3A 3FFBA 3LXXA 3RWOA 4QJ3A 2FSHA 4Q1FA 1NG1A 1N3BA 1ZAKA 2AK2A 4R71A 4W7SA 1XB2A 2SHKA 1JI0A 2X77A 4ZO4A 2TMKA 2Z4RA 4DKXA 4CYMA 5JFGA 2YC4C 4R2IA 3S1AA 1KI7A 3PUVA 3GLHB 4NYIQ 4OQXA 5M04A 3KUDA 3ZZUA 2FGKA 2RHDA 2OFWA 4FMBB 5D3MA 4E07A 4LDJA 3SFVA 2EFEB 5KNDA 3AVQA 1HA3A 3SI7A 2DWOA 5AJYA 4D4KA 4Q00A 1P9WA 1T4GA 3CX6A 4N3NA 1RYHA 1U0JA 2ZRNA 1CJKC 1GFIA 3VFDA 2ZSFA 2ZS7A 3GLGE 3O8BA 5L3SA 3AP3A 2IXFA 4AI6A 2GJ9A 2HCBA 4GOXA 3SYLA 3GJ7A 4CT5A 2H16A 3K53A 1E2GA 1EX6A 2JEOA 3R7WA 1DO0A 4ZI3A 4NYJQ 2YC2C 1S96A 2QE7D 3B1VA 3EZFA 2XSZA 3T61A 1NG9A 3L8ZA 1TUIA 3U2QA 3R9WA 1E9SA 4LJ5A 2UZ3A 4D0LB 1UF9A 4IVRA 3TQFA 2DBYA 4EPWA 3A1UA 2VF7A 5AUQA 1UEIA 5JS7A 1KO1A 4TWZA 4KODA 4KSBA 1S3GA 1JR3E 3RDPA 3OEHD 4JVNA 4C7OB 3AF0A 4QRHA 3EARA 1KNQA 4DLYA 1YKSA 3NHBA 3NC1C 2XOKD 1F2TA 2JJ2A 3KUCA 4YMSA 4GI7A 1XZPA 3CWZA 3UK6A 4POAA 5FBVB 1BKDR 2GCOB 4ARZB 1F2UA 1YVDA 1YQTA 2O0KA 4PPQA 4KXFB 3B2EA 1HE8B 3PR1A 4P31A 2ATXA 4TYQA 5JBQA 4EJSB 3ZLJA 5B30A 2QTHA 3OE7D 2HT6A 1OHHD 2IA5A 3BOSA 4LRWA 4MRPA 2WWYA 4CEIB 1NSTA 2IYLD 1U90A 5BN3A 3AVWA 3VKGA 3GPLA 1K8RA 2XITA 1JXMA 4LYFA 3VR4A 4BFYA 4GZMA 3MGCA 2QNRA 2WKPA 3QF7A
chains in the Genus database with same CATH superfamily
1ANKA 5CH8A 3SS7X 4EYOA 4JBNA 3PFNA 3FMGA 2GNAA 3IOYA 3I39X 3QOFA 2FN7A 1M74A 1AS3A 1V4VA 3OY7A 2EKPA 4RVUA 3VH1A 3Q7PA 4K03A 1ZISA 2PLRA 3F2IA 4CG0A 1NLUA 2O59A 1QHNA 3RIHA 3KD3A 4WKOA 5K05A 1P5JA 2GRUA 3TQOA 3DT9A 3V42A 3F97A 3DV0A 5TT0A 4S2UA 1MO6A 1XZLA 3GVXA 4RW0A 3KQLA 2QU8A 3E7FA 3IEUA 1SD5A 1DJOA 2HREA 2V1XA 2RD2A 4MRSA 4DUPA 1JEOA 1E6EA 1YUNA 3K9GA 5ALKA 2GJKA 1U8ZA 2QJOA 4OFXA 5M5BA 2P27A 4LNUB 4HSGA 1L4EA 1VB5A 2XCUA 2F1JA 2ZCVA 4M37A 4ND1A 1VBMA 4KWHA 4C2AA 1KO5A 4JIMA 1T1SA 1W4CA 2Q0QA 2ZBRA 3G2LA 3V8MA 2C31A 2WYOA 2WMNB 3ZZ0A 3UJCA 4JT4A 2IY7A 4V0LA 4FFVA 4OK5A 4KR3A 1GU1A 1Y9ZA 3CWQA 2GWHA 4JUCA 5DHUA 5ANRB 3DO5A 4H7FA 5JU6A 3P2KA 4Y2YA 4P4TA 5EJIA 5LLDA 1RLTA 4CHGA 1LFDB 1O5TA 4GKVA 3IOEA 2RSLA 3U7QA 3ZCQA 4ZYLA 2VK4A 1BMTA 4DCPA 3DL0A 5REQB 2FPIB 5ARCA 2OCIA 3NRJA 4ENRA 3RNLA 2REQA 4D8VA 2PT6A 3H86A 1IATA 2XUKA 1II9A 5DYIA 5HF5A 3L6DA 4MRRA 4P54A 3UUFA 5CG1A 4ZT3A 1P1IA 2CL7X 1KDRA 1M54A 3PFGA 1IHYA 2ILTA 2X23A 4PANA 4CM7A 4L6CA 3RB8A 4RK1A 3A3OA 4YQZA 4H7HA 2OE2A 3R3JA 1HNZB 3KZMA 2BI4A 4FYPA 3I9KA 1D2RA 2D4HA 1MQSA 1XCLA 1M3SA 4BZPA 3RLFA 3QEBZ 4KFUA 3IP6A 4FGWA 4X93A 4UBLA 2IHUA 5K0CA 2F1KA 1II8B 2VUIB 4GZ5A 4WA7A 3W6PA 1KI3A 4PN3A 3F3MA 1MT3A 3OHSX 1DWOA 3EAFA 3K16A 1EQAA 5K20A 4TL6A 3FFTA 4QJ4A 5HX7A 4R2MA 3TVDA 4V0NA 4H0NA 2XZLA 4IZ6A 5IT4A 2VO1A 1VSUA 3UTCA 3DPUA 4MDEA 4OFWA 3I09A 1USIA 4NBSA 3TSAA 3AH8A 3F1KA 5A04A 5MHTA 5C3UA 3DXFA 1BWPA 2XEXA 3FSGD 1HKHA 4D8WA 4EGAA 2YS7A 3GVIA 4YFVA 5IN5A 3ZV7A 2QB5A 1Z3IX 2VATA 1LNQA 4W5JA 2CMFA 2P30A 1DC8A 2A9FA 4QHYA 5FJJA 4C7OA 1Q6YA 2PKCA 3ORYA 1P73A 3TSOA 3EFHA 1ZC3A 3PL1A 1UBUS 4GUDA 5EC8A 3OQVA 5F7OA 5BPHA 1IY9A 1WLSA 1VM6A 1C7QA 2YFQA 1OWPA 1M1XB 1HG0A 4MDHA 3PNMA 3T4EA 4BU1A 4OLHA 4ARCA 1DP4A 5IBQA 4NVRA 1BO6A 1Y7IA 3E53A 5FUXA 4AJ9A 5CYOA 3CRNA 1O95A 3EH2A 3VZBA 2V7VA 3QLEA 5EUBA 2FPLA 5JO0A 3DMTA 1YR7A 3EGOA 4G5RA 3DBHB 2RCNA 4BFUA 1PWXA 4WZ6A 1UBSB 5B37A 2I6XA 1RAEA 4CV1A 2H4HA 3PLAE 1YBHA 2O20A 3F9CA 3HXOA 2ODPA 1E62A 1ZN8A 4FT2A 3TGLA 1FXWA 4J7CA 1JTEA 4JENA 2W48A 4RQUA 1LS1A 2XE4A 4D82A 1IBMB 1TK2A 2FUEA 2O1EA 3KSAC 3IKVA 2A9VA 1OGJA 3GRUA 4BWFB 4PHFA 2ZB2A 1SVUA 4YJ3F 4S24A 4JMPA 3DR3A 3H42B 1RHRA 1MBZA 1SCAA 1C14A 1KQPA 4QWMA 4DGSA 1NJGA 2OV4A 1IK6A 1NQWA 1U3DA 4H2DA 4Z51A 3DGEC 2QIOA 5P21A 2WQ6A 2V03A 3H1FA 3DXZA 1UDAA 1BXGB 4PQEA 4UAUA 4B40A 1E69A 2R6GA 6YASA 5FWYA 1N75A 2J9ZB 3OMWA 3L4KA 2E3JA 1PTKA 1T3TA 1L5HB 4QXQA 1G38A 3D8SA 3ZZTA 1T91A 1LV7A 1PJRA 3BTVA 1C4WA 4UCWA 1XTJA 4ZYYA 1W52X 1RRVA 1G6HA 5TEWA 1KKLA 1KZ1A 1BE6A 1MEEA 4HL6A 2P9GA 3UKDA 3G8YA 5EIOA 1OYOA 1ZD8A 3HJGA 3ORHA 1T6BY 2OBMA 3KVVA 4TV8B 4B84A 1A9QA 1GWNA 3KCNA 1V8DA 1NIJA 2TMYA 3FCCA 2C4UA 4O0MA 4JBXA 5B3JC 3M49A 2PZKA 2XT0A 3CUEF 2V9ZA 2Y0CA 1NQ5A 3E48A 1PZXA 1J0BA 1W2HA 4D43A 4AMYA 4EX7A 3HM9A 3QEJA 5IVPA 4DB4A 2XRZA 1QIEA 1J2JA 3KVYA 3Q5DA 4IWXA 4DGQA 3ZH2A 4J43A 2HK7A 3TBFA 3RS0A 5IEBA 2NM0A 1BGWA 2X4IA 3GC6A 3PCRB 5F1OA 1ZGJA 2X8BA 4YY3B 1PSWA 3LXUX 1M33A 4TWAA 5JROA 4GFDA 3QOWA 4LXIA 3D6VA 4UVDA 2VNJA 3E7WA 1MHTA 1X3SA 3K2QA 4R1NA 2XNCA 2QN9A 2WD9A 4NU5A 1OFGA 4BX8A 4CKEA 2AFIB 4US2R 2GXUA 2B3TA 3I83A 1I4TD 1N3YA 3V8RA 1N6IA 4YBZA 2HYIC 4MQ4A 4BFCA 2Q2VA 1U0TA 4R0MA 1L1RA 2PWYA 3G5AA 4KAXA 1UBMS 5LBUA 4OO3A 3FH0A 1JKXA 2MJLA 4ZQCB 3KR0A 4KPUA 5DHTA 5IJ0A 1D8TA 3BQ9A 1UODA 1MZVA 4DLSA 4RTOA 4D0SA 1ESDA 3EOZA 1Q1GA 3W2GA 4CIWA 4JEUA 2KBEA 3ILXA 1Y7HA 2BN4A 1U11A 4RVHA 5HMLA 4GRIA 2I0FA 3I45A 2OSBA 1MG5A 3S2SA 2MSDB 5IC6A 3SFTA 2XD4A 5IBCA 2QV0A 3SIWA 3K0AB 1SC9A 2DKOA 1QHIA 2D5LA 2XGGA 1O6BA 5IJAA 4O02B 3QTLA 3KB6A 3DHVA 5JSQA 1WMSA 1XZ8A 5JMWA 1FDIA 2YWCA 1HL7A 3CMCO 4FGUA 3EAGA 2IIVA 4N18A 3T5MA 2QQ5A 2QX6A 5THKA 3UENA 1K7EB 4DDVA 1W5FA 1Z39A 1RQNA 4J76A 1BN7A 2XBLA 4FUTA 2YIMA 4ZO9A 1IG0A 4XB1A 1KEKA 1BDIA 4A9AA 1KGSA 4HDRB 2G9RA 2NO7A 2GPJA 2QD3A 4DDHA 2OOSA 4UW9A 4L7QA 2MYPA 4J29A 4WPGA 4ZO6A 5FTKA 2CHVA 2QZPA 2C1XA 2SKDA 1N8NA 1R5NA 3RD5A 1OC2A 1BVYF 2Y1GA 3MN1A 4N8SA 3UQZA 2BI8A 1GPH1 1F2DA 2NYRA 1IG3A 2BGWA 1CZHA 1PBNA 2VH2A 1RTTA 2K7FA 3CLRD 4MICA 5ILQA 1T26A 4EA6A 3HUFA 4Q3KA 1RYZA 3ZW7A 1V0JA 3DKVA 4HFNA 4NCXA 4JOSA 4CG2A 3P27A 1JDJA 3DA8A 2UZAA 3JZDA 3QLVA 2JIDA 2RDMA 4W7IA 3NT2A 5J4VA 4YLYA 3BK7A 2P91A 5AKLA 5L3QA 1MKYA 1U3VA 4HB0A 4OA5A 2IHBA 1ND6A 4N1AA 5AQ1A 2DHRA 2OHFA 3THRA 5KZMB 1V16B 3C8HA 3FYSA 4EHAA 1ACMA 1FBTA 2IXAA 2WD7B 5K45A 1RXIA 3QBEA 2EZ8A 2P68A 4RTSA 2A84A 2G5PA 4JYBA 1ZVQA 3OF2A 4RPHA 4D80A 4DJEC 1NUSA 1QFYA 4JYAB 2I62A 2PKEA 4N5HX 2QBYB 5LNK6 1Q44A 1ZK2A 3MAJA 2B78A 1HR0B 5CBKA 2G4CA 1OZFA 3QPUA 2E18A 1JG6A 3CNLA 2D06A 4FXOA 2G7ZA 2IELA 1RT9A 3CISA 3FYHA 1P0PA 5FO0A 1F6WA 3OQ6A 2JIOA 3ASUA 1PK9A 4XM0A 2QJTA 1FU7A 4N7MA 1SC3A 1LLUA 5EJEA 2ZJ5A 2PUCA 3AHGA 3AWDA 4G5OA 1UIMA 2BKAA 5DGTA 5BQOA 4YMIA 2XA9A 3QIVA 4E15A 3LY7A 4GC5A 2G0TA 2RIPA 4G0ZA 3HJUA 1VHQA 4BNJA 5KVVA 3TQSA 4UMVA 2YHSA 4LDZA 1GL9B 3ANNA 1IOZA 2A88A 2X8LA 1SWVA 4YASA 2HRDA 4GGPA 3S4YA 3SJCA 5FPTA 2HNBA 4RHUA 1GPNA 3SSAA 4GBMA 4PYOA 5DSTA 3RSLA 3N8HA 2IHJA 3ZI4A 4F4DA 1AGYA 1K6IA 2UKDA 3N53A 1EUQA 1XN4A 1NWHA 1WZUA 3DNMA 4AF6A 4EKGA 4LTNA 3DZDA 3ZVKA 1Q12A 2E0IA 2IUYA 4J1QA 4RWZA 1PV4A 1T0JB 2O1SA 5ALMA 3RGGA 4MO2A 4TXNA 5CT9A 3PQEA 4L5CA 3U1BA 4I4LA 2V6JA 5JOQA 3AR5A 3MJ4A 5JY6A 3MPOA 1N6KA 2OZPA 2W6PA 5LSAA 1SGWA 1FMJA 3GT4A 4WOJA 4B3SB 2DLDA 4X8OA 4R9SA 2A14A 5G3ZA 1XRPA 3TAUA 2VP4A 4G1EB 4TQGA 4P7GA 2WFAA 4EVSA 1QH1B 2BP7B 4YV1A 5K4GA 5K0EA 2OCXA 3KFLA 1YUMA 4ZO8A 3RVLA 1E8DA 1X7XA 1Z5WA 4HCJA 4I7EA 2YWBA 3VO9A 4KYIB 3W6OA 1Y6FA 5DX8A 3D2BA 4HAUA 2IX9A 4RZQA 1TJ4A 2CJYA 4I9FA 1ZCJA 3VUFA 1KI6B 5JZVA 5LYYA 3LKZA 1KYYA 1MABB 3O3NB 4OMUA 4OJMX 3BAFA 5AKZA 3Q72A 1AHNA 4HYEA 3A11A 3TMYA 1ULTA 4GLJA 1YQGA 1NONA 2OLEA 4HDMB 1OI3A 2GJ4A 4NCBA 1KY5A 3ODPA 3TOZA 4N48A 2QY9A 3RBVA 1SPBS 1E94E 1WUTA 1RYMA 5F52A 1IN5A 1NE2A 4GI1A 3ZI0A 2PUAA 4BPBA 4YA6A 1VE6A 3T7CA 4MYHA 1ZQ1A 2V4MA 4QXAA 3D7SA 3SZMA 1R8SA 4CJXA 3OICA 4JLWA 2GX6A 5CB6A 3KKNA 4QWWA 1FYFA 1OBHA 2A58A 4K86A 5HCIA 1XK7A 2Q7OE 1KZ9A 2FI1A 4GR5A 1KI4A 2WWVD 3AGQA 3WSTA 1CQIA 2DH5A 4NU6A 4PPNA 2NZ8A 5HQJA 1UEJA 1K5GA 3FSJX 1N6OA 4N54A 5A06A 1SUSA 5CA0F 1GQQA 3Q41A 3JQBA 4EQZA 5LP6F 3O8OB 4M55A 5KWJA 1KK2A 3FHTA 4B6FA 5EEGA 3ZY5A 5KNLA 2FP4B 4TXLA 3WXMA 3SVZA 2IT1A 4CWAA 5MGBA 4XCXA 1PWHA 1Z75A 3OEEA 5C34B 3O82A 4OX9B 1YQWA 2IBTA 3GAZA 1BJRE 5A5FA 4DCOA 2WI8A 2IU6A 2F9MA 2B4YA 3A3KA 3H3JA 1R50A 1RMQA 4MINA 1J21A 3L7NA 4WXEA 5ESXA 3ZGOA 4TKUB 1HE4A 2FFBA 4UQLA 4QTZA 4I1RA 5GONA 4WD3A 2FOLA 2ZUEA 1L5VA 1YASA 3SQWA 4HVTA 3EFOA 2PV7A 4MULA 1ICEA 3D8RA 1T9GS 4LZJA 3RVJA 1P61B 5HIKA 3OOHA 5HF6A 1JILA 4URZR 1YAJA 4AZ3A 1U2EA 3HMKA 3M4YA 2C82A 1GSAA 2I4IA 1CV2A 4JJZA 4YJFA 5A7FA 2IGBA 2Y1WA 3K2BA 1PZGA 2XRMA 4PXAA 1AGNA 1TRHA 4WZAA 5DYTA 2NSHA 4F2WA 5JXGA 4NK5A 1GUFA 2D3TA 3F0TA 4GM0A 4DNOA 2GFHA 4AJ1A 1VGQA 1AE1A 2PXCA 3K92A 3FPLA 3Q3VA 4J1SA 1U7OA 2ONZA 4OVKA 4Q12A 2AXNA 4NX2A 4XIIA 1OH7A 1IJBA 1HI9A 2D1QA 3OBBA 2Y05A 3KYCA 3SE0A 5LP6B 4JQOA 4OXKA 5J4HA 4GOKA 4ARZA 2ET6A 3ZU4A 1QGED 2HDNB 4MR7B 4RV9A 4Z5XA 2EFJA 2BVNA 2RMKA 3M82A 1MQ8B 3ED5A 1IUOA 1JQBA 1A9SA 1M72A 1NI5A 1U0LA 2RK4A 4HWOA 2QQGA 1JH9A 1TT5A 4W7HA 1IMJA 1OASA 2I4NA 1Q91A 2O2IA 3FJ1A 1FVOA 3Q85A 3PT9A 5TSDA 2CL0X 2QF7A 4RKYA 2QVZX 2OECA 5AUNB 2C59A 1BW9B 2AG0A 2AN3A 1K2WA 4BJ3A 3L07A 1K5PA 2FR8C 2OHGA 4FOOA 4PSUA 5I4IA 2Q2WA 5C4IA 1K27A 1JE1A 3AOGA 1DTEA 4RPCA 3B20A 4NMMA 1MZPA 3SKVA 3E6AA 4QBIA 2YWRA 4BLUA 3P9NA 4PQGA 1EEXB 1SXGA 1DJLA 1QOPB 4O4IF 5HOEA 2J3JA 2QRNA 1WQ4A 1WZEA 4DTIA 5KB3A 3CC8A 1M7GA 2AFIE 3Q2IA 1NVEA 4C04A 4ZYVA 1JR2A 4MMZB 4F4IA 1YF3A 1U1GA 4ND6A 3MZ0A 1U2QA 5AI4A 1MTOA 1G55A 2EFYA 1J0XO 1E59A 2YIJA 3KD2A 3SR3A 4C7XA 1KAGA 3CZRA 3O74A 2W2LA 3IO5A 4MV7A 4BRZA 5JTUA 2DX7A 2HQBA 1GZ7A 3K94A 1NP6A 2G67A 4GPD1 4QQKA 4RHXA 2C8JA 2WMOB 3LDAA 3MJCA 4MITA 5H3LA 5B53A 4BFVA 4TWIA 1PNRA 2MSEB 3JQQA 3ZVRA 3FYDA 2CUNA 4LK3A 1KU0A 4X45A 3WICA 5HZGA 1H1LB 1W94A 1HYGA 2H18A 1RQ7A 3KAPA 3C6BA 3DLHA 1HUQA 1X39A 4JVOA 3N58A 3H8SA 4INPA 3DWFA 3IMKA 4A8JB 4YUZA 3CLTC 3AV0B 1VE1A 2FPRA 4PF1A 1YD7A 1C3LA 1FYVA 3RS3A 1SO8A 4MGKR 1BSVA 1IHUA 4YMUA 1JTVA 1CQXA 2RHWA 5DT2A 1FFEA 4URYR 2QD1A 3IKLA 2HFJA 4H59A 4Q15A 2HQ1A 4GZ6A 2P5TB 3GPBA 1WHTB 4L4SA 2XZDA 4XQGA 1E3WA 2DAPA 2H1VA 2CCJA 2J08A 3CH5A 4TXMA 2E4YA 2ZT7A 2PBZA 2YV3A 4B32A 2NZWA 5CFPA 4C5AA 2W98A 4OQZA 3HLYA 3UAVA 4MI9A 1QG2A 2ZAYA 3P1JA 2FNAA 3I01A 3OZSA 1ZGGA 4B45A 4EW3A 3BCRA 2QN2A 1VHJA 3OPYA 3TRKA 1JR6A 1CJUC 1CS0A 1FX0A 2XT9A 4E3WA 5LMUB 4JOQA 2ZDQA 1J07A 5IJXA 4EPTA 1FE8A 4P81A 5BW8A 1W96A 1XAGA 2C4MA 2EJBA 3LA8A 2X0DA 3SYRA 1KZ6A 4I9UA 1BU8A 1I5EA 2WDZA 2X14A 4P36A 4AO6A 3ZCRA 4K9OA 1ZWLA 1YCGA 4EARA 1V95A 1HURA 2QVXX 3GZ4A 4OQMA 5LM3A 1OLXB 3KTAB 2D2EA 2HIHA 3DKKA 4ZVQA 3RTDA 2O6HA 4BLVA 4CN9A 5BWOA 4CI9A 4ADSG 1KDZA 3GEDA 3TL6A 1D6SA 4NCJA 2J5QA 2R5FA 3IBFA 3WTCA 4DPMA 5DLYA 3JQAD 5BRJA 1W35A 2F43B 4NS1A 1AKRA 3IC5A 2Q3LA 5H9WA 3M3PA 2WWHA 1AKUA 1OD6A 1YH3A 2OZVA 3EFOB 2NU6A 2V74B 3E22B 3A58B 3ABIA 4FYYA 5E9QA 5J1TB 3PRHA 1ULBA 2DVMA 2DFVA 1H4TA 2P2SA 3BWBA 3A4YA 2DG2A 1JHMA 3FCXA 1NBME 1YZLA 5DP1A 5CLGA 3O2NA 1C30B 5JZOA 1R9JA 2P9TA 2H11A 3O4HA 3OZIA 1H2HA 1GU7A 2WBLC 1Q19A 3QPAA 5J4KA 1CUFA 1GFWA 4REQA 1OWNA 1AN0A 4UFNA 1SUIA 1GTJ1 2BISA 2FXIA 4FWIB 2MOKA 2CUTA 1ZESA 1FXSA 1E9DA 2ROQA 2P67A 3CW9A 3GOQA 1GPDG 3WG9A 1ML3A 3KTOA 1I2BA 2ZUUA 3QEMB 2OPHA 3H16A 4IJUA 4MW9A 2BHRA 3OFKA 1H3EA 2C2MA 1L5OA 1MVNA 3O2JA 4KPGA 3VVBA 3PQ6A 5DHSA 3EUEA 4L8VA 2BCEA 2PSSA 3F6CA 4PLVA 1C30A 1SHZA 1W1UA 4XKJA 2GBPA 3G8DA 4P7JA 1ENYA 2P2LA 1N2XA 1DKLA 4OJQA 1ZC4A 4E5VA 1A97A 4NI5A 3L9XA 3IE0A 3KOZA 3NHSA 4BKPA 2QUZA 3QV2A 3QU7A 4AJJA 4L0MA 1ARZA 1EX1A 1U4SA 3AP2A 2XUIA 3EXHC 2PX6A 1BDMA 3OQJA 1XGKA 3GT0A 4PLHA 3O84A 4FQ5A 3AVVA 1VMKA 5BWMA 3I5MA 1CERA 2YY5A 2Z56A 5EE5B 4YB8A 2RHOA 2Q0XA 1GZ3A 1ISJA 3BICA 1X38A 1G18A 4M8IA 5E3JA 3STVA 4P7BA 1VDMA 3D3WB 2HBRA 3VV3A 3NHUA 4I50B 1GZ5A 2FU5C 2Q28A 4XWTA 1EK6A 2JD1A 2QG6A 3R75A 2K2WA 5KYWB 2EQAA 3N0RA 4L22A 3WK4A 1RP7A 3O4IA 1YJQA 3OF3A 4ZK2A 4DZRA 2BHNA 2QRVA 3QW2A 4RA6B 3HJFA 2PRYA 1K7YA 1YSCA 4FSHA 2GBLA 4MJLA 1Q0HA 2FDRA 4YN3A 5J59A 3KKQA 4CM4A 5L40A 3UAZA 5ED4A 1NATA 1FFXA 4DIFA 4RLFA 4WXYB 2CT8A 5HFJA 5DNUA 1AO3A 3EXAA 5HVNA 3GX1A 3IL2A 1OF1A 2E5WA 3NC0C 3ZDZB 2R8EA 4UTNA 3WWDA 1EJ0A 1G3QA 5HTKA 2REOA 4Z53A 1JXOA 3VX4A 1B8PA 1EVIA 1PR2A 1S8OA 1G4HA 2TS1A 3IBTA 3K09A 4V02A 2QLMA 3P2EA 2OEPA 5FPQA 4Q1BA 2Q45A 3N2ZB 3STTA 4Y1RB 2H1OA 2VPTA 3OQBA 1S89A 4PZ9A 2ST1A 4KFTA 1QRTA 1ZM4A 1F2TB 5G0UA 3WP1B 2NZVG 5BR4A 2XVZA 3H1TA 5CLHA 3WL6A 4RE6A 4HLUA 1XDWA 1YKGA 3INTA 2QN3A 3GP8A 4F96A 1ZK1A 1ECJA 1PHPA 1RPNA 1ACJA 1CP2A 3FROA 4I6JA 2O3JA 5L3SB 4OY3A 3DKIA 3VAYA 2OCDA 2Z2KA 1FTYA 4U1RA 4PC2A 4F2GA 4KPYA 1EIZA 4LYDA 1YVUA 4JA2A 3H84A 3TSZA 5KSWB 1NZJA 4UXIA 4YPOA 2PVCA 4UBJA 5H3CA 1EB8A 3WAGA 3I32A 3DVAB 2PKRA 3VR2D 2CFTA 1Y3AA 4N8DA 2JFZA 2E89A 1YB1A 5C8YB 2HA3A 2ODTX 4BVAA 4QEKA 5PNTA 1O6CA 1OIXA 5CLQA 4RTQA 1LK5A 1GCGA 3A10A 1OZGA 2ZZKA 3KHTA 4AKSA 3MGKA 2GJAA 3L7JA 4QGAA 4LY3A 1A8SA 4BLRA 2G71A 2AZTA 3W5CA 3VPXA 5FOXA 4LHEA 1CUAA 4MWTA 4WJKB 1EFRD 1T8RA 1AUPA 1K97A 2XXBA 4KO4S 2ZYRA 1LRKA 4KQMA 5EUMA 3I01M 1XF1A 1RS0A 4I9NA 4OHFA 2HM7A 1WCV1 4BKUA 1FLVA 4ZOLA 3LMKA 4BNVA 4Q82A 4F4JA 2EFCB 4PZDA 4QDJA 1GNVA 1QMPA 2QSUA 3PTLA 2NLOA 2DWQA 5K0FA 2ZAOA 1P80A 2J31A 1XMXA 1WCIA 2BZ1A 3EUAA 5H16A 1WMDA 2XMPA 3LKVA 2EKBA 4LZOA 5JEEA 3KV1A 3QEKA 5KEIA 2NQ8A 4R6WA 4ZV9A 3ZIDA 5AKHA 5AM1A 4B44A 4BVHA 1L8OA 3TI9A 1AD2A 4HPJB 1ECGA 3FIJA 3BDAA 3W06A 3T1QA 1TF2A 2Q6VA 2Z08A 4R2JA 4PC1A 4KHPB 1UKBA 1JQLB 1NJ2A 4D3SA 5AVZA 1PFWA 4GGMX 1DBWA 4FGLA 2QMQA 3TRJA 2PRJA 4K1XA 1BG6A 4RQTA 5DWVA 3X1KA 4FOSA 3RADC 2QUBA 3EDOA 2CXOA 1OHHA 4E5KA 4Y9DA 5TX7A 5TXGA 1RC8A 1O57A 2NZXA 2NT4A 4HB3A 5BRAA 3OPXA 2D4AA 2VBGA 3F73A 3UZUA 3I9JA 4ZAFA 2EJVA 1KDOA 3A4VA 4GKKB 4GWKA 4NG5A 1BMFD 3FOZA 5G1PA 1F17A 1L3IA 1LW6E 1K6EA 3CNQS 2FSPA 4I1UA 4WNIA 4KQKA 2CLDX 2AFVA 3IP9A 2PH1A 1QU2A 3BMOB 4R69A 2PE5A 3LNCA 2PMWB 3QVVA 4YWHA 4R51A 1U9CA 1W87A 3A1NA 3TTSA 3MOGA 4PYIA 2RH8A 1Z4OA 2Q07A 3GCZA 1C7EA 2G1KA 2HSZA 4L73A 4DIEA 2CLEB 1OXXK 4XLTA 2QN8A 4V0RA 1TVKB 1RQRA 3S7TA 3CW2A 3P4XA 1M2HA 3QG5A 3P19A 3BM5A 4RIGA 1II8A 2GD1O 2WTNA 4W8HA 2FQQA 3T3MB 5J47A 2BUBA 1RCTE 1Y1QA 4FWTA 1KS9A 1UP6A 4RFSB 3HP1A 3NKLA 1EP3B 1XVAA 1LDBA 2I03A 2XB8A 1AXRA 2G25A 1UQRA 2ZIGA 3FMOB 3GDOA 1JLLB 3GLTA 1Q95A 3QKUA 3B51X 1N78A 1I1OA 3B5JA 1OIVA 3DNFA 3IV6A 1MQAA 2PJUA 5IBRA 3ZU2A 5LQDA 1HRDA 4D45A 2ZJYA 1A5BB 1ZL0A 4X60A 3SHOA 3GJZA 2OAEA 1K98A 4W1QA 2YHAA 3C0KA 5JQGF 4KQWA 1CR2A 4RC9A 1JG7A 4FS3A 4K6KA 1DIOB 2N9UA 3C7AA 2CVZA 3T12A 3T94A 5KOHA 2CJPA 3GJTA 2D0OB 3SQMA 2VTBB 1KEWA 2JI8A 3COJA 2O8FB 4MPRA 3KLBA 5E9AA 4PNZA 5AJTA 4DADA 4B3XA 5K0LA 2HJHA 2Q9AA 3WLSA 1GGMA 1RXUA 3Q0EA 4COOA 2ZTSA 1TYEB 2I9PA 4O4LF 5JTTA 1TMOA 2CV0A 1LTHR 3QI7A 1V5IA 3K5IA 5TEVA 1YE5A 1J7JA 2XE7A 4EPVA 3F96A 1DRUA 1NDQA 2FLKA 3B70A 1ZHFA 3UJNA 1UMBB 2YWEA 2J46A 3G8AA 4FEEA 2IVFA 2DUWA 5JT1A 1N0UA 4CN8A 1SRRA 3DC2A 3PC3A 1BJKA 421PA 1U04A 1ECCA 3ZTWA 1T0BA 3TNJA 3ZWDA 1FJXA 3EPLA 3RU2A 2JLRA 3IEVA 1OYYA 1KK0A 3VNVA 3G2HA 3ER8A 3RK1A 3PFCA 2GBCA 4ND2A 5SYMA 1AMOA 1JQJC 4RF4A 1J00A 1FL9A 5DTIA 1A69A 1XFDA 1HE1C 2V65A 4IV8A 3RAFC 1IN1A 4I8IA 1RRFA 3B1XA 4FDTA 4E88A 5L3QB 4II7A 4UHJA 3ESXA 4F0JA 1TU4A 2B35A 1QM5A 1DIGA 1ZM7A 3PQ4A 4DDKA 1KFCB 1ZXLA 2F1RA 1YGYA 1X0VA 1W25A 1UQTA 2V6GA 2BFBA 4Q9HA 2KQUA 3GUVA 3ZWCA 1ECPA 1AIPA 3L4BA 1SK8A 3E3LA 2FZEA 2V8OA 3WLPA 2GAFA 5HK9A 1D07A 3RSZA 1VYTA 3Q9LA 1XRQA 1XJQA 3WDLA 4HGYA 1P7YA 3S2EA 5E95A 1NL3A 2EBUA 3H9CA 3GQBB 1WDMA 5AW3A 1O9GA 5DGDA 1PT9A 2ZPUA 3R7AA 4IEEA 3TKAA 4NZZA 3QXCA 4NL4H 2AG8A 1Z7BA 2H29A 1OXTA 4NE9A 5FORA 4CM9A 5AM2A 1M66A 3TIVA 3LSYA 2YJ4A 5DMXA 2J1LA 5JECA 3PPWA 4BJ6A 2QKYA 2XQGA 4OAQA 1RRGA 1U0FA 1G8FA 2WIBA 5EHXA 1M5TA 2E87A 4Z7NB 5FPYA 3AHDA 1KU6A 1P2SA 3PX7A 1TJ5A 3BGSA 4IS3A 4NBLA 1UPTA 1JU9A 3ILYA 4WN9B 5TS2A 2H0RA 2QG4A 3EHDA 3G9TA 2H9AA 1WABA 4R1MA 3RG2A 3VX3A 3GFPA 1YHZA 3EZLA 3L6EA 1XU9A 2FZWA 3NBXX 4YHBA 5EZ5A 1TEZA 3KZ1E 4OPMA 2YV1A 2YCBA 2XV1A 4PZEA 3AHCA 3ZJTA 3AVUA 2G1JA 2OHXA 3IKJA 4N01A 2BGMA 5FUVA 3D02A 1ZVJA 1EAMA 3EIUA 3CFYA 2PIAA 2QTVB 3O21A 2L0XA 4I0WB 2Y1CA 3IJRA 4BNMA 4EVRA 3LBYA 1ORRA 1XFAA 1F0NA 3GGGA 1TA4A 2CKMA 4BNLA 4F8JA 4JI8B 3BTUA 1SZJG 2DC1A 5HBGA 5AUOB 1N9GA 2JHPA 3AEKB 4QATA 4X1YA 2VYQA 1P33A 4J75A 1RDFA 1B4DA 1UK6A 4QG7A 4R8VA 5KMGB 1XWIA 4I1SA 4N5LA 2FVXA 4RETA 4YAIA 4UQPA 2IIQA 4WCFC 3PRYA 4YQYA 3L0SA 2HLDD 3FPGA 3NC4A 4YCJA 2JFQA 4D9EA 3R6WA 3IX7A 4LWQA 4TL9A 4CQMA 4O3MA 5DM4A 2VYFA 4HO1X 1NVWQ 5CAEA 1UUFA 3VPDA 3X2EA 4URFA 5B2EA 2YZNA 3O73A 5IMSA 1BEUB 1YQ9A 2P0YA 3QWIA 3TINA 2AHRA 2QENA 2ZITA 4YJ3B 1OX6A 2Q49A 4FYXA 2C4VA 2PD4A 2WQZA 3H1EA 3ZWOA 1QTQA 1X19A 3P20A 3KELA 2EC5A 2I7CA 4M1WA 2FR8A 3IAEA 2W2TA 2JBAA 3JD2A 4G4SO 2QVYX 4NDAA 3NBMA 3I2HA 2F3QA 2YMLA 3PKZA 5IM5A 5CPFA 4BNXA 3BL6A 3U61B 4MUXA 3R9IA 3EVDA 1UOOA 2R5NA 2H0AA 4NAUA 3GCXA 2XBMA 2C5FA 2DCUA 4XJXA 3HKCA 5FUWA 3NEPX 1E2BA 2PGNA 4FFPA 1QQTA 3I04M 4FYHA 4RD2A 1Y80A 2P6PA 4JQZA 3UA3A 1NSYA 3WLKX 4Q9NA 1DFIA 4U7HA 1A96A 2JGKA 3ZXIA 1CNMA 3RYCA 1KETA 4LJ6A 4BB6A 2H4WA 1XXHE 3JQEA 1R00A 1CPYA 2I3BA 3OHPA 1P9NA 2GTIA 4L4RA 4PSDA 4N03A 2HA7A 4AUKA 1GNRA 2EZ9A 1PG2A 2G83A 1EESA 3H2YA 1QB7A 4ESOA 4Z2YA 1RD4A 4PVDA 3TPCA 4M8NE 1ZUHA 4BZZA 5ALJA 3KPWA 1J49A 3V7FA 1NASA 2QN7A 4RZIA 1ODLA 3N8NA 1GL7A 2EP8A 2XZTA 4IGIA 4IDQA 5CM8B 1U94A 2X3YA 3H2HA 3NBUA 5EHZA 4FMDF 3GLFA 1CY0A 1ZOIA 1L7DA 2CV1A 1O08A 1DWUA 4H31A 3L7MA 5HKBA 5DK6A 1FMCA 3M6AA 4YP5A 3UK2A 3VPHA 1LK0A 3TXAA 1A8IA 1PGNA 2IUEA 2VF8A 4DYDA 1QRAA 4KBGA 3O8QB 1UZMA 3L5KA 4WY2A 5GY7A 4DJFC 1NN0A 4JWKA 3G7SA 4ZGWA 4AN0A 4NMXB 3PU6A 4WFQA 5JXIA 1JPVA 4C0WA 5KOYA 5FH9A 2GKOA 2EVWX 4KACA 1U63A 2Q3EA 4ZGGA 3TW8A 1UDCA 3PQ8A 2ZLBA 1CY1A 4IILA 3DMNA 5AHOA 1E2MA 3DO8A 3FDIA 4QNNA 5KSPA 4ZKDA 4BGDA 4N9QA 2FN8A 3MT8A 4MB6A 3ESRA 2ZWPA 1EZ1A 4AWAA 5ICFA 2HU5A 4XX1A 3WP0A 1WY5A 4BFTA 2XB6A 1PL6A 2QMOA 3LOPA 3TSCA 1PT6A 4CM9D 1ZXBA 3DYBA 3OQHA 5KSZA 2WE7A 5IRCD 1ZR2A 3ZTYA 1W34A 1SURA 1QJ4A 2VTVA 3B38A 5F76A 1IB6A 3V4ZA 3ZU6A 1QVAA 2M6SA 1H9AA 1A7KA 4RORA 1C9DB 5A4FS 5FA8A 1SU8A 3FZNA 3SJUA 4MH0R 1P3DA 4UM8B 3WZLA 4CMIA 3R7FA 3RC9A 4D41A 4GR4A 4DAEA 2Y3IA 2G6TA 4U63A 2J0SA 5D7BA 4NJMA 3GLQA 1C7JA 1I51A 2VJQA 5DFAA 3K70C 1ESEA 4ACBA 4D57A 4DQKA 3EWAA 1IOLA 4A0RA 1TVMA 3F49S 5JUWA 4ND3A 3MMXA 3CPHA 2GR9A 1JLSA 3M1AA 3KSBC 4ZT6A 4L8YA 3VC2A 2XMZA 1JSRA 3DKPA 3MINA 3OZRA 5K9ZA 3UGJA 2H5IA 1R4AA 1Y3FE 3NKFA 4IV5A 3T8YA 3RODA 1ZVMA 2GN2A 2DBVO 4O33A 4Z6KA 1EG7A 1Z2DA 3NUQA 1KRHA 1BAPA 3NFYA 4MIEA 4ZOAA 3K0CA 4Y18A 5COBA 4HY3A 2GD0A 1UANA 2RGNC 2VYCA 4G07A 2ETVA 3LPMA 1XKXA 2OCPA 2V59A 2WKWA 4QA9A 4C4TA 4TLLB 2H2HA 4P83A 4PG4A 5EWLA 9MHTA 2ABWA 2QTMA 3ZZ1A 1PQPA 1DEXA 2YRXA 1AGXA 3UAWA 3BXXA 3WC4A 4D3ZA 2DY1A 4C29A 4F12A 4EVIA 1DOZA 2YOGA 3KE8A 4LI0A 1IEQA 2ALJA 3DBRB 1IUPA 4WLUA 5D7NA 3WRYA 4YP0A 4JUIA 4A2QA 1NYLA 1VC2A 3FCEA 2IH5A 2W6OA 4W9MC 1NI3A 5SICE 1WP9A 1JB9A 1Z45A 5KYTA 3OT1A 1IJEA 1JLHA 1ZR4A 1HFKA 2XGSA 2BEUB 4AN1A 5D1HA 4ZZIA 1D8AA 4LJSA 1YXMA 1I6KA 1YRBA 5A71A 5LZ7A 3UAYA 1AK2A 2IYPA 1N33B 4OYYA 1Q83A 2VHZA 1LDMA 3FE2A 4RY0A 3ER6A 4I3GA 4REMA 4BP8A 3A4LA 1R0WA 1DAEA 2DPGA 2MYTA 3GMSA 5E7MA 5F1KA 1HFWA 3V00A 4C4XA 2E49A 4Q7QA 3WGOA 5ILGA 3EXG1 5KNDD 1RVDA 4ND4A 5FOWA 3OTQA 4A1FA 1MORA 1EKXA 4KDRA 3TEJA 3QM1A 4D8XA 1YL5A 2Y0PA 3HS3A 4NJEA 3KQMA 4J2HA 3MAGA 4RA9A 3WOVA 1OFIA 3ZIUA 2P77A 3TLMA 3LECA 5H80A 4M7RA 5HRCA 3LW8A 3BIWA 4WFIA 2GBGA 1L8AA 4ONEA 4ZYTA 3CF4G 1F20A 4MEJA 3HUDA 3L0YA 1LSJA 4O1IA 5E7JA 3TM4A 3BMNB 3HU5A 1YR8A 4CW7A 1J8DA 5K0SA 2C9MA 4U2CA 2VPYA 4N65A 1GXSA