4CMJA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 91
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmjA00
3PZBA 4BO0A 3RVDA 1YKFA 1FDSA 1ISFA 3LC2O 1W73A 4NJOA 1GYQA 1JA9A 1XDWA 3HNPA 1HDGO 3BTSA 1NP3A 4Z3DA 3VTZA 2IRWA 4O1MA 3KM0A 1U4OA 4WLUA 3WWYA 5JNLA 1C1XB 4MVJH 1RM0A 4FGSA 2J3JA 1MLDA 4LVCA 5COBA 3VH3A 4QEDA 1SB8A 4YT4A 3TFQA 3D3WA 1K6IA 1HE4A 3VDRA 2WWRA 2BKAA 4DXHA 4HNGA 3G49A 3S2GA 4GSKA 5HS6A 5IFLA 2EEZA 1YRLA 4A10A 3DBHB 4DMLA 2QHXA 4ZVVA 2Y1GA 4WLFA 2NU6A 4QO8A 3FNGA 4HBGA 1UR5A 1VL8A 4KMSA 3ETGA 2J5QA 2PGLA 2F00A 4A73A 3RI3A 4NBUA 1FF9A 3NT2A 1OBFO 3VZSA 4XYMA 5DP2A 5MDHA 4WJZA 1YBAA 4I9HA 1BXKA 1R12A 3GGGA 2GN9A 1LQUA 4WOKA 3AI3A 2B4QA 1MXHA 3DAFA 2G76A 1VI2A 4GMFA 4WCFA 4UUOA 1JKJA 2AEFA 3NGXA 4W9NA 1CQJA 4ZJUA 2C5EA 3QP9A 4ILKA 4GI2A 4IDEA 3QIVA 1BDMA 5ITWA 3BTVA 3ZHBA 4OGWA 2NTVA 3PWKA 1ISMA 4Y6PA 3S2EA 3OJEA 4MKRA 4RVHA 5CG1A 3NV9A 3WFIA 1DFHA 4PVDA 2EW8A 3P7MA 1J4AA 1CF2O 3ZWMA 2CUKA 2RBEA 2CY0A 3DMTC 3V5NA 1ZMOA 4E5YA 3DOOA 1T4DA 3OJLA 4MP3A 3MWEB 1E7SA 1O9BA 1O94A 2D0IA 3KOUA 1I24A 1LUAA 1ORRA 3ZWAA 4LMPA 4E13A 4ROSA 3GRPA 3EZLA 1UP6A 2YY7A 3DFZA 3GGOA 4I5EA 4K26A 5LDHA 2NU8A 3GNSA 3UCFA 3V2HA 3C1AA 1LDEA 1OOEA 2CFCA 3ZU2A 1SOVA 4D0RA 3JQEA 4K6CA 3QE3A 3GC6A 1UZMA 3M1LA 5DZSA 4XR4A 4XWYA 3M6IA 2XXBA 5H81A 2YHIB 2CVOA 2XF8A 4QTZA 3CZRA 3DBVO 4CLDA 4YAEA 5CAEA 1ZZEA 2EKPA 4Q39A 1PJTA 3PEFA 4YEDA 1E3JA 5JAMA 1D8AA 1KETA 1SC6A 1Y6JA 2RHRA 4IDDA 3KB6A 3PTZA 1Q2XA 2EGGA 4UULA 2B69A 2H63A 2BF7A 1PJQA 5TNXA 3RUFA 4J4HA 3B70A 1HE3A 4BNMA 2FMUA 4NBWA 3UUWA 4P8RA 4CLOA 2O7SA 1V3VA 4OSOA 1Q0QA 4P38A 3WS7A 4Q3CA 4J91A 4CM8A 5IDWA 3C7AA 3IQDB 3ZWNA 3ZWOA 4N5MA 2IZ0A 3K31A 3WTCA 2JAPA 4CQLB 4DPMA 4J43A 2NV6A 3CMMA 3DXFA 1U7TA 2YQ5A 1PX0A 1DIGA 5JAIA 2Q1SA 4L75A 1R66A 2PZMA 4WK6A 1DFIA 2LDXA 1DBVO 2JAHA 3MZ0A 4R3NA 2FR8A 2ZJ0A 1GDHA 1ZK0A 3KVOA 3RUIA 1JAYA 1JTVA 1UP7A 5JCJA 4CMIB 4TRNA 2VWHA 3JSAA 3TSCA 2VCYA 4FQ8A 5CG2A 1UAYA 3GF4A 4KDFA 5U4QA 2OO5A 1YB5A 1WWKA 3V2UA 4ZQGA 2O23A 4YRDA 1DAPA 5CP8A 4PVCA 5DBFA 3ROQA 1Y7TA 4RO0A 5K6AC 1ADBA 1WMBA 1QORA 1XHLA 3AWDA 2DT5A 2Y93A 3H4VA 2AEJA 4TZTA 1Q0HA 1T2DA 4HY3A 1KY5A 2C20A 2OP0A 3LT2A 4WLNA 3GVXA 3TWOA 1LLUA 1E6UA 3RU9A 2P68A 1X0XA 2NUAA 3JQ8B 3WDSA 5CHEA 1NX6A 5JMWA 1QYDA 2FR0A 5C5IA 4RPHA 4ND5A 1PS8A 2PH5A 3Q0EA 4AJHA 2C0CA 1I01A 1R4NB 4O63O 3INGA 4DIBA 1PL7A 1A4UA 1SNYA 2JFFA 4CLRA 4PFJA 3DTYA 1A4IA 4D44A 4A0SA 3DDNA 5DT9A 4S1VA 3ZWCA 3MTJA 4NNJA 1A7KA 1I3KA 1Q1NA 4R69A 4YPOA 4CR8A 4JX8A 1K6JA 3SC6A 3IUPA 3VZRA 2NM0A 4KTVE 4BKOA 3E5MA 4LVUA 5T64A 5L3ZA 4XKJA 5B12A 1ADCA 1UDAA 5G0SA 4BS9A 1MGOA 3WGHA 4AFNA 4BV8A 4OIMA 3OP4A 4YRBA 1KEVA 8LDHA 1UDBA 4I9UA 1BVRA 2EJWA 4WCFC 5L45A 4R16A 3MCVA 2UUOA 2VHXA 5G4LA 1PGOA 3K8ZA 2QRJA 3KO8A 2IYPA 4RVSA 3W6UA 1I3NA 2DFDA 5ITVA 3KYDB 3H5RA 5DNAA 4EDFA 1LDBA 4YJHB 1GUFA 3PZRA 3G79A 4BO5A 4L76A 4Q3NA 4NDNE 5A3JA 4TVBA 4U6SA 5ICMA 4XX0A 2J5RA 4MJLA 1I3MA 3NEPX 1XG5A 4WLVA 4E12A 2CDAA 4ZICA 3NX4A 1I2CA 3AUAA 1RJWA 2G82A 1Q7GA 4J4TA 4UEOA 5IZCA 5A9SB 1LA2A 2YFHA 3RJ5A 1YL6A 2DTEA 2CD9A 2ZQYA 3W4KA 4GAEA 2VTDA 4IMPA 3ZN2A 1A27A 1RM5A 1NVGA 2WDZA 4NFHA 3ZGYA 5JY6A 4MVJP 1E7RA 4AVYA 4IY1A 4L74A 3GG2A 1ADFA 4YT5A 4MVJD 3N58A 4HFNA 1FDTA 4GX5A 1M75A 5HA5A 4IBOA 5AYVA 1L7EA 1X15A 2YW9A 3BHJA 4GVLA 1KEWA 5T57A 3VHRA 1ZK1A 3RC7A 4GX2A 5IDQA 3CXRA 2IODA 1EFKA 1BXGB 2ZYGA 2BGMA 3A4VA 2RCYA 2BI7A 3OSUA 4BMNA 5CDSA 1KEPA 1B26A 3OA0A 4H15A 1R0SA 1WDKA 1I2ZA 4MPDA 4U0KA 4OL9A 3B1FA 3BZUA 3WSVA 5G2OA 4DLAA 1DHTA 3A28A 2X9NA 3DZBA 2VT3A 2ILTA 5G0VA 5TIIA 3UICA 2AQ8A 4ZN6A 4R01A 2JD1A 4R5HA 3GVHA 1K6XA 1MA0A 4JJFA 2JFHA 1LSJA 1O5IA 1DHRA 3QVOA 2F1KA 3FRJA 1UXKA 3ZNQA 1DPGA 3EK2A 1QRRA 1ONNA 4AJOA 1E7YA 1NASA 5ILGA 5L9AA 3U5TA 4NZ9A 3KBOA 3WBBA 4NI5A 4DWVA 4GWGA 1YL7A 1U5CA 3DZFA 1PEDA 1E3IA 4DRYA 5IN4A 1QV6A 5B4TA 1NAIA 2VHYA 3FWNA 5L40A 3H9QA 1Y8RA 3GY0A 2BFAA 1B8VA 2AE1A 4YTEA 1DXYA 4DA9A 2RHCA 1FDVA 3TQHA 3GUYA 5G0TA 3U0BA 2C2XA 2RH4A 4WCFB 1JKFA 1K0UA 2UV8A 2YFQA 2IEDA 4J1NA 5A06A 3JQ8A 4CV1A 3Q11A 1A72A 3RUDA 5JCXA 4AJPA 1KEUA 3HDYA 1EVIA 2ZB8A 3NT5A 4HV4A 3QQPA 2PKQO 3MJVA 2DAPA 2QQ5A 5TLSA 1TT5B 3UHAA 4Z6KA 5ER6A 3RAJA 1XLTA 3Q2IA 2X7HA 1QKIA 3S1LA 5K0ZA 2JKVA 3AUUA 1P1RA 2ZTVA 4Z3KA 3BIOA 1NQ5A 1VC2A 3U4IA 2X0JA 1EVYA 4NH4A 3PJDA 4L8VA 1ZJZA 4GVXA 1U2DA 3FNEA 4BNYA 3LC7O 1P1JA 4EEZA 1HZZA 3CUKA 5TSDA 1YJQA 4RF3A 1T4BA 4BNFA 3TNLA 1M76A 2PR2A 2HJRA 3UOGA 5KVSA 4YJGA 4U8GA 1UUFA 1W0CA 3KXDA 4DLBA 4PRKA 2HDHA 3T7CA 4GKVA 1DO8A 3V1UA 2HJSA 3NTOA 1V6AA 2BRUA 3CEAA 1H94A 1O0SA 3OQ6A 3G1TA 3X2FA 2WJPA 1FK8A 1LRLA 5J23A 1PWXA 4PLWA 1A7AA 1G1AA 4BO2A 4QUKA 4UAGA 2NACA 2X0NA 2Q2QA 4BKPA 3KLMX 1C1DB 4RORA 2GPTA 7ADHA 1HLPA 2R00C 1XEAA 4W7IA 2YZ7A 2W2LD 1GZ3A 2D2IA 1C1DA 2DFVA 3PVZA 4AL4A 1BG6A 1DC6A 4IS3A 3EDMA 2QYSA 1QXSA 4E4YA 3TDKA 1DC4A 1VL6A 2O2YA 1KOLA 4D3DA 3P2YA 1C0KA 3FNFA 4CODB 3VVCA 5KNLA 2HMVA 4KQXA 4OH1A 4PG4A 5KVQA 5T67A 3OIDA 4FFNA 1W4ZA 3EVTA 4Q3AA 1ENOA 3LLSA 1YBVA 4Z0PA 4PG7A 1I3LA 2YYYA 5COQA 2HQ1A 2HKIA 4RPLA 4HKTA 2PWZA 1RYEA 4JJGA 2YV1A 4XA8A 3WSWA 4BO1A 3KRTA 1GUZA 2AHRA 3RUHA 3H2SA 4YAGA 4YQZA 1LU9A 4QX6A 4LRSB 3GDOA 4GPD1 4ALLA 2P4QA 3U4CA 3U62A 4E0BA 5L95A 2CVZA 3LC1O 4JBGA 3WXBA 1C14A 3KZVA 4Q9NA 1LSUA 4DQUA 4B3IA 5ENDA 1U2GA 2DVMA 2NU9A 1D3AA 4ZQBA 1AN9A 5A3VA 4YA6A 5A9RA 3JQAB 1EUDA 3L4BC 4CMIA 1KYQA 3ULKA 2ZB7A 5BQFA 3AM4A 1EVJA 5CEJA 5JDIC 1HE2A 1WDLA 3R6DA 4QECA 2VOEA 1BSVA 3VVBA 2AG5A 4BGEA 4BNWA 1XU9A 3IL2A 3KSUA 4RQTA 2DQ4A 4E2YA 2ZK7A 2OP1A 4OOFA 3FNHA 3DC2A 5IN5A 2JCVA 1B16A 4IDFA 4CM9A 3DZKA 1TLTA 1RKXA 2B4TO 3FR8A 4G5HA 3TZKA 1TEHA 3ZZNA 1NNUA 3ZDFA 4HFJA 5DBGA 3ZU3A 4XGKA 4A2CA 7MDHA 1C0LA 1N9GB 3H5AA 3PIDA 2B0JA 2GYYA 1H6BA 3E82A 4NIMA 5EQFA 4CUJA 3DAPA 1EBUA 5IXYA 3PFFA 4XIJA 3DWFA 2FWMX 4DPLA 1DEHA 5DCUA 1N9GA 1H2HA 4D3FA 2E37A 4R1UA 1EEHA 5L4NA 4O0LA 2FRDA 3WNQA 3Q3CA 4IJVA 2V6FA 4E31A 1U1IA 5A5FA 5C37A 5GZ3A 2G17A 1WPQA 2HUNA 3P19A 2VQ3A 1N8KA 2QG4A 4GBJA 1H2BA 3L9XA 3W8FA 3UKOA 5KIAA 4E5KA 3SLGA 4XQ9A 2VZ0A 4RQUA 2NTJA 4XIYA 1DC3A 4FFRA 3VPSA 5JDCC 3E9MA 4CM1A 1MG5A 3X2EA 5U9CA 2AQKA 4NQZA 4E2ZA 3PJFA 3JQGA 1E7MA 4OQZA 4AJ1A 1SAYA 2H9IA 4G81A 5IG2A 2OORA 3GLQA 3UVEA 2FPPA 3WGYA 3I9LA 2E49A 2I76A 4RVUA 2POQX 4RZHA 1ZVMA 4BQRA 5I9LA 4CM9D 1P1IA 5C7LO 5JDIA 2Y1EA 1PGQA 3OBBA 3UGKA 3ZWVA 1NXQA 1TT7A 2OFPA 3BMQA 4Q3DA 1IY8A 3I9OA 3H3JA 1R37A 3DL2A 3M2TA 1LJ8A 1R16A 2UYYA 3BHIA 3W1VA 5LCXA 1F8FA 2HSDA 4JQCA 1JDJA 4RPKA 4U0JA 3RFTA 1DIRA 3MEQA 2AW5A 1YQXA 1PZHA 2HLPA 5JDCA 1EK6A 3FPLA 1NQAO 3OQ1A 5JC8A 2ZYDA 2P9GA 3CE6A 3ENKA 4BNLA 1E3LA 4P4LA 1XA0A 4CJXA 5CDUA 3MWDB 5DP1A 4DLLA 2Y1DA 1YE3A 1F12A 1B3BA 3LT1A 2HO5A 4QO7A 2I65A 2I5PO 4RF4A 5TQVA 4TWRA 1GZ4A 1LBEA 1YJ8A 1M6WA 2YHIA 1BTOA 1WAMA 4CMHA 2WYWA 1YXMA 3UXYA 4IIUA 3AOEA 3ANLA 5CEFA 4N5NA 4TSKA 5EMHA 4BB5A 5BNTA 1DLJA 1F17A 3QRWA 1BW9B 2AEMA 4YXFA 3JQ7B 2HMSA 4XYLA 2HAEA 1G0OA 4K28A 2P91A 4M55A 4D79A 2A94A 3LSYA 2IDZA 4Z9YA 1GTMA 3PIIA 4IPTA 1BW9A 3MOIA 4Y98A 4W99A 2CSUA 4BB6A 4CQMD 2XOXA 4FR5A 5FF9A 5FWNA 2GERA 5KCZA 1NWCA 1FXSA 4D0SA 1HZJA 3ASUA 3DBLB 4YAKA 3AOGA 1U4SA 1EUCA 3DONA 2DTDA 1RM4A 4CM8B 4Z9XA 4BNTA 1P74A 1N7GA 1E5QA 1NM5A 3OEWA 1V0JA 2CZCA 1ONOA 5A05A 1S6YA 2O48X 4ZQFA 4CQLA 1P1KA 2VRCD 1M6HA 3LZ6A 1ZSNA 2YV3A 1RPNA 4J16A 1ZK2A 1OFGA 3GDGA 4GX1A 1LSOA 3ZWYA 1WNTA 5KJ1A 5F5NA 4N54A 1UZLA 3CMCO 3JYQA 3ONEA 2O4UX 2PGJA 2Q4BA 4QSMA 1ENYA 1ZXBA 3R3SA 1DFGA 2A35A 3KETA 1IE3A 2PNFA 1VL0A 1EDOA 5ICSA 2FR1A 1XELA 3Q1LA 3CZMA 3WWZA 4DBVO 1ULSA 2PY6A 3FF4A 5HM8A 1PIWA 3ZHZA 1DC5A 4WGGA 2X9GA 1WW8A 1Y9AA 4OKIA 2YJZA 2UAGA 2H1SA 4RVFA 1OC4A 1R4MB 1I8TA 3AI2A 4U6QA 4FFLA 4FJ0A 3WJ7A 1OMOA 2ET6A 3IJPA 3PDJA 1BWSA 4E5PA 1IHXA 1GCUA 3DAGA 4FSHA 1Y8QA 1DOHA 1K2WA 1NQTA 2OGUA 4Y6RA 3E48A 3JCZA 4PZCA 3ZV3A 1WZEA 4TROA 5JO0A 4CM6A 2O3JA 3D7LA 3EY4A 3ZV4A 3GR6A 4B4VA 4MP8A 1ZEMA 4B7UA 1NPTO 3FWZA 4J9UE 3AOEC 4R5MA 3U09A 2GZ3A 4K1LA 5KKCA 1PJSA 2EP5A 4MOWA 1L1FA 1V8BA 1ONPA 1ZMTA 2AG8A 4WLOA 4J7CA 2FP4A 1QYXA 3D5QA 3PHIA 4I08A 3G0OA 2JJYA 3O8QB 4IQ0A 1X7DA 2B36A 3GG9A 2RIRA 4NBVA 4AICA 2WTBA 1CIVA 4Y6SA 3PYXA 3OJFA 3U9LA 3BYZA 4OQYA 1JW9B 2Q46A 3LU1A 1MG0A 3OJOA 4E32A 3ETDA 4U5QA 4O6VA 3JD3A 4IDBA 3U4HA 4MIEA 3IKVA 2B37A 4PLFA 4BIIA 3FR7A 3JYOA 3EMKA 4NJMA 1Z45A 1HXHA 2G1UA 3IJRA 3A1NA 3O9ZA 2BFMA 5KOIA 1JWAB 2I6TA 3GHHA 3KSDO 3GN1A 3OMLA 1IOLA 3OICA 4JCOA 5F1PA 3TFOA 3OHSX 1X7HA 2D3TA 1AXEA 5JE8A 5JAZA 3BMCB 5I7SA 5TRTA 3OETA 3UCXA 3GMSA 2Y1FA 3JV7A 5L4LA 2QRKA 2QX7A 4P22A 5JY1A 3VDQA 3E1KA 5DOZA 2ZTMA 4BGIA 1PQPA 2HK9A 3NJ8A 2IZZA 3I5MA 3NYWA 4M1QA 3WGGA 4R3WA 3AY3A 2PH3A 1T24A 3DOCA 1XCBA 4TRJA 2Y99A 2X22A 4DGSA 3L07A 4LCJA 1PJBA 1UDCA 4CMKA 3I83A 1GV0A 1SBYA 1NVMB 1BMDA 3EYWA 4JJIA 2FHSA 5I8WA 4BNZA 4DBZA 2YQ4A 3F9IA 4LMRA 5JYDA 2YUTA 1E92A 4RL6A 1FJHA 5THKA 3P5SA 3T7EA 4RDHA 4EEXA 3HZZA 1G0NA 3I4FA 5ER9A 1X1TA 3DR3A 1HSOA 3DZJA 4DYVA 1Z7BA 1DJNA 3HSKA 1IB6A 5LDGA 1VKOA 2BHLA 3F4LA 4J6FA 5B4UA 3GA0A 4R68A 3GT0A 5KTKA 5TGDA 4YDRA 2EWMA 3OQBA 3I23A 1YL5A 1UXIA 2X8LA 1QLJA 1S7CA 4LW8A 3VC7A 1KY4A 2EERA 3JQ6A 2I9PA 1FMCA 4FOOA 5L53A 1N7HA 3HG7A 2EXXA 4FJ2A 2VYNA 4UVHA 3AM5A 4XJSA 3ZW9A 3H9GA 3KYDA 3H65A 4WEOA 4YBZA 2A92A 1PJ3A 3IIEA 5U1PA 2EKLA 2Q1TA 5JMPA 3UAGA 3RIHA 3ZNPA 2FZEA 1Y9EA 3TL2A 4N7RA 2CF5A 3ZNNA 3P2OA 3SJ7A 5KJCA 4FFOA 2GUGA 1ENPA 1E7WA 4GLLA 1VSVA 2P9CA 1HF3A 1O8CA 3DQPA 3JYPA 3OF2A 3HN2A 1KERA 3DFUA 3PHHA 4WE3A 1J6UA 2ZB4A 3BAZA 3E8XA 3ZWPA 3HHPA 5IZCC 4RVDA 3PI7A 4R9SA 4W7HA 3LQFA 4F45A 4R41A 3WYBA 4QXMA 2ZTUA 2VOJA 4RPJA 4EUHA 1I30A 1BGVA 1HDYA 4D42A 3WR5A 1HYGA 2CDCA 1LLCA 3PYLA 3UH1A 1TT5A 1C1XA 2WM3A 1EBFA 2OXIA 5IF3A 3JD2A 3C7DB 1HYHA 3N7UA 5KJFA 3WIDA 3K96A 1PL8A 4FJ1A 1B14A 1ZBQA 2EW2A 1X1EA 3D4NA 4OSPA 4P4NA 4YWJA 4YACA 5KJEA 3BMQB 3PK0A 2O3TA 3Q9UA 3VH2A 1B8UA 3F6YA 4RGBA 4ALMA 1Z6ZA 3RC9A 1WLYA 3GAFA 3GVIA 1V35A 3GRKA 4QQRA 2HMWA 3PQEA 3QVSA 3G17A 4YVFA 3KEOA 1MXFA 3GEDA 2TMDA 4TKLA 2ZATA 3H9JA 3BMNB 3PJGA 4UUPA 1JN0A 1AXGA 2GZ2A 2P5YA 3LDHA 3GAZA 4L0QA 2IXAA 3GEMA 4NPCA 3O38A 1K3TA 4B3JA 2NLOA 2I66A 1KVTA 1B3RA 3GMDA 1E1MA 1JWBB 3OA2A 2X0IA 1J0XO 5A1TA 2HU2A 5JYEA 1ZFNA 2GASA 5EJ2A 2GSDA 4G65A 4EITA 1GPJA 4E5MA 3PYMA 4IMRA 2CMDA 3PHLA 5EQDA 1M2WA 3WB9A 3PLNA 1P31A 3AUSA 4IXWA 2NSDA 4ZU3A 4M54A 4CUZA 3TOXA 1VM6A 3WIEA 1Y5RA 3QVWA 2C29D 3ZHXA 1CQIA 3RUEA 3MJSA 3RBXA 1LXCA 4D43A 2GN8A 3EAGA 2DC1A 2NNLD 2E6UX 3ADOA 9LDTA 1U8FO 1WDMA 3GEGA 3HFSA 4WPGA 1NYTA 2E82A 2Q99A 5JXWA 3K73O 4FN4A 3I6IA 3ZHYA 4CV2A 3L6EA 5I7EA 3QWFA 4XCVA 5JC1A 4PLPA 2PFGA 4WUVA 1GCOA 1SO8A 2J8ZA 2JCXA 3INTA 3DHNA 3OM9A 4KUHA 3EZYA 3QVTA 3V2GA 3K9QO 5TT1A 4MVJF 5JBIA 4GMGA 4L4RA 4Z0HO 4XRGA 1IPFA 5A5EA 4MVJG 3SC4A 4EBFA 4KWHA 4IINA 4RF2A 3ADPA 4QFDA 1UAGA 4YCAA 4BKQA 3OFSA 3VZQA 4N18A 3BTUA 4A03A 5BNIA 1DLIA 3UN1A 2I67A 1CDOA 4CMAA 4Z9FA 3I6QA 1IZ0A 4XGIA 2V6BA 4ALIA 1MV8A 5TJ9A 1P9LA 2OBNA 1HL3A 1QG6A 3CH6A 2W2KA 4OXNA 1P1FA 3DMYA 4GH5A 3C3XA 4CMEC 4WASA 4F6LA 4PLCA 4XDZA 1YQGA 4NMHA 4AJ2A 2OBYA 3QWIA 4GLOA 1V9LA 5L4SA 3JTMA 4IDGA 1IZ9A 2Z95A 3AFMA 3RC2A 5I7FA 3ONDA 4FCCA 4URFA 5DOVA 3COSA 2DBRA 4BUCA 1MFZA 4NG5A 1EZ4A 4J2OA 5G4KB 2X9VA 4GL4A 1H9AA 4JP3A 2VTEA 3IKTA 1YO6A 4PLHA 5TC4A 4UUMA 2VT2A 2Y1CA 3KYCB 4L9RA 3NDIA 3L9WA 1LLQA 1YDEA 1E1LA 4OXYA 4PG5A 1U8XX 3WTBA 3IOYA 3ICCA 2EGHA 3PFWO 4ZQHA 3IUSA 4BL5A 3FN4A 3DBRB 2WD8A 2D8AA 2CNBA 4NR0A 5H83A 1BDBA 4XYGA 1TB4A 2OZPA 3I9MA 4FB5A 2O3SA 5A4DA 4CM4B 5EPOA 5IJZA 1QYWA 3GZNA 1GQQA 3WMWA 3T4EA 2VWQA 4CLOB 5CFZA 4GX0A 2GCGA 4IJWA 4CM4A 3O8QA 1UH5A 4EUFA 1G6KA 3V1TC 3NT4A 5JFOA 2GLXA 2VZ9A 1PZFA 3ZU5A 1Y5MA 2J6IA 5BSFA 4F6CA 3D4PA 2NQ8A 1PJLA 1SZJG 3NKLA 3VPGA 3WFJA 2X6TA 5BSEA 3PRJA 2X86A 1YS4A 4XD2A 2C2YA 2DU8A 3E18A 3JQGB 4K6FA 4CR7A 2UUPA 2VUUA 3JQAA 4RV9A 1HDZA 4FFPA 4D46A 1UP4A 2W2LA 4UEJA 3ANMA 1OC2A 2Y0DA 5KKAA 1PQUA 1U3UA 4R54A 4JIGA 4WLEA 3Q6IA 4R1SA 2EIHA 1F06A 5GZ6A 5L7TA 4IZIA 4I8XA 4CLXA 1PZEA 3EC7A 1XGKA 4XB1A 1PTJA 3W4IA 3AI1A 3L77A 3EUWA 3JD1A 4PIVA 5B1YA 1Y81A 4D41A 3NTQA 1PGJA 2GGSA 1QYVA 2P5UA 1QYCA 4IS2A 1KVQA 5F5LA 4BO4A 2W4QA 4BKRA 3PHGA 4BO8A 1Y8QB 1LTHR 4Q3EA 4DQVA 1HETA 2AQIA 4MVJI 4DMMA 1RM3A 1T25A 4FS3A 1O89A 3ORFA 1ADGA 2EKQA 1ISHA 3LVFO 3EVNA 3TN7A 3I1JA 3H2ZA 4HNHA 2JFGA 4Y8VA 1R4NA 3ENNA 4GKBA 1I5RA 5FYDA 4DC0A 1CERA 2DUWA 1P1HA 4R51A 5ADHA 2VYND 4I5DA 2PTGA 3AY6A 2FOIA 5T6BA 3VKVA 1LX6A 3PWSA 2VYVA 4U7WA 4CMCA 1N92A 1RYDA 3NUGA 3ITDA 4IXTA 5I7VA 4J3FA 1LRKA 3AY7A 4XRRA 5CPFA 3VH4A 4OJNA 1Z7EA 1SPXA 3W6ZA 5IDXA 1DIHA 3GPIA 3NRCA 4XQEA 1VLLA 1AHIA 1LEHA 3F4BA 3JQCA 1P45A 4BGVA 1Q7CA 1YB4A 3EHEA 4E2WA 1YONA 1BHSA 4J90A 2C7VA 3WQRA 3ZWWA 2BD0A 1GQ2A 4E5NA 4UVEA 3HB5X 1XU7A 4OAQA 3QV1A 3S8MA 1Y1PA 3B6ZA 1W6UA 3WMXA 3S2IA 3QY9A 4PN3A 2C54A 4H16A 1CWUA 2A4KA 4FC7A 2VUTA 1P44A 3KTDA 3CTMA 1GYPA 3C1OA 4ESOA 4B7XA 2Z1MA 2W2KB 2QYTA 2HK7A 1IL0A 1MUUA 1I2BA 3AU8A 2Q2WA 1I10A 4TMFA 1NVTA 2X5JO 1JKIA 2V6GA 3MJEA 5A04A 3ETEA 5A9SA 1LNQA 4M86A 1T1SA 4RZIA 3SVTA 3E9QA 4Q3BA 2C7GA 3Q2KA 4RPGA 3IP1A 4AJIA 2H6EA 4BNVA 1HRDA 1MP0A 2HMTA 3OJ0A 4WEQA 3PGJA 3UCEA 4FFMA 2VWGA 4LISA 1JQBA 5G0UA 4NK4A 2R2GA 4TQGA 5FFFA 3SX2A 4CUKA 4JXKA 3C8MA 4RJTA 1JVBA 4DPKA 2EV9A 4BHTA 4ND3A 3DBRA 3OIFA 3ZCXA 3TF5A 1DB3A 2Q3EA 4XR9A 2CF6A 3D0OA 1QSGA 4HFRA 4J2HA 4E30A 1R15A 2Q4EA 3QA9A 3ZWXA 2E4AA 2W90A 2Q45A 1V3UA 2NQTA 3GZNB 4XQCA 5BR7A 1P0FA 1I0ZA 4LK3A 3DBLA 4R1NA 3WX0A 4LRTB 1Z74A 3RSHA 3FTPA 2PZJA 3RC1A 3BMOB 1LC3A 3JQBA 2FSSA 3FHLA 4R1TA 5FI5A 1NBOA 3L4BA 2GZ1A 1JVSA 4PCVA 9LDBA 3A9WA 4HFMA 4JLWA 5HS4A 3PPIA 1X13A 3OIGA 5L7WA 1PR3A 4IZHA 3F5QA 4AJLA 3WG9A 4ALKA 5B4VA 1D1TA 3JYLA 1XQ6A 1NFQA 3FTNA 1PU2A 2EG9A 3A14A 4MVJE 2P4HX 2X4GA 2UVDA 4MINA 3DHEA 4PG6A 2O4CA 2TMGA 3DB2A 4MVJA 2C07A 2BH9A 1N2SA 4NJMB 1PQWA 5A02A 2PZKA 1WMAA 4IGEA 2FY8A 4NFYA 1EK5A 2Q50A 2V7PA 1C0PA 3I9JA 1GL3A 1SB9A 3UF0A 4DQXA 1H0KA 1YOVA 4YB8A 1Y8RB 4J1QA 1NQOA 4JROA 4PGFA 3I9NA 4XZ3A 4BKUA 1HTBA 4Y9DA 1I32A 3M1AA 1YOVB 1B15A 1ZSYA 4MIYA 1AE1A 3HDHA 4WOJA 4YQYA 1V3TA 3KV3O 3IC5A 4B8WA 3GNTA 3ZNOA 1UJMA 1SEVA 2AXQA 3GUCA 4HADA 4ID9A 1QLHA 4TZKA 4UUNA 2R00A 4WNIA 3ANNA 3ZW8A 2QRLA 1PZGA 1MFPA 4FDAA 5AXBA 4EJ0A 4PLGA 1PWZA 5EESA 4AJ4A 1E3WA 2NVBA 1VKNA 2BI8A 1H93A 4J4BA 1ZK3A 4YJGB 4O59O 2IXBA 4HX5A 2YDXA 5T8KC 2QZZA 4RVGA 1LC0A 4FC6A 4EYEA 1BXZA 5TX7A 3RD5A 4FOSA 3LYLA 5AOVA 4IJKA 4J7XA 1HDRA 2ZQZA 3ZV5A 2VN8A 2Y66A 4BO6A 3E03A 1NHWA 1GEGA 3PGXA 4YRAA 2X0RA 4UVDA 3F46A 4BOYA 1WP4A 5JW6A 4FPXA 4E6PA 3M2PA 3PXXA 4ZGWA 3GK3A 1MC4A 5HBRA 4BNHA 2PKQP 4H3VA 4FW8A 2Y0CA 4E3ZA 4CMJA 1LDNA 2B4RO 4L4XA 3ASVA 3FI9A 2NVUB 1PGPA 4B8ZA 4J9VA 4IDAA 2BFOA 4N5LA 1E77A 3JQ9A 4DL9A 3C1TA 5THQA 1ZEJA 2B5VA 3D4OA 3WBFA 2GN4A 3T4XA 4CL8A 1XKQA 2IEBA 4BNKA 3VOSA 2X1HA 4GQAA 1HE5A 4LN1A 1ENZA 3A06A 3H3FA 4B7CA 5F1OA 5L7YA 3TJRA 1P77A 3LK7A 1T1RA 1LI4A 4TRRA 3WGIA 1DAOA 3IAHA 2VUSA 1HEUA 4OKNA 2WD7B 4MO2A 5BSGA 1AUPA 1H9BA 1B0AA 1XWFA 3HB4X 3ST7A 4XEHA 3QWHA 5A03A 5LC1A 1EUZA 3RASA 2J3HA 4MKXA 1DJQA 4J0EA 1NPDA 2GF2A 5F21A 4KQWA 3STHA 5KVCA 4XB2A 4UREA 1A9ZA 3NAQA 3WOHA 4RLSA 2Q1UA 1M67A 1XIVA 1UXGA 3ROMA 1RWBA 4XYBA 1A71A 4C7KA 2ZCVA 3BTOA 4J7UA 1GV1A 1ZJYA 1BXGA 3QJ5A 4I1IA 3RKRA 4BO7A 1LDGA 2H5LA 3V8BA 4INAA 3I3OA 3VPHA 3TZHA 4ZD6A 2PD4A 3H7AA 2O7QA 3SBOA 1A5ZA 5H82A 3WICA 3HN7A 2GDZA 1YWGO 1U3WA 2NWQA 4PLVA 3JQFA 1NR1A 3W4JA 1P33A 5KVVA 5TT0A 1QV7A 1CEQA 4IQ8A 3RBVA 3CINA 5DCYA 4RDIA 5B37A 2YDYA 3KYBA 3G3EA 4BNIA 2DKNA 2XPCA 4Y67A 1ZUD1 2DM6A 4TRMA 1NFRA 3O26A 2D1YA 2IE0A 4DYDA 4I5GA 5AXDA 3DZGA 3F1KA 3D1LA 4MKZA 1ISGA 1Q7BA 5EERA 1X7GA 2VRBA 3U49A 3NGLA 3JQFC 2W98A 4D7AA 2VWPA 1WXDA 4M8SA 3TL3A 3VAZA 3WGZA 1AHHA 2VHWA 3GH3A 4UVGA 2VRCA 1EMDA 1DRVA 1XSEA 1YB1A 1J5PA 4P4GA 3DO5A 4DIFA 4BNNA 1E3WB 5KWEA 3WLEA 2BGKA 4QFCA 1ISIA 3W8DA 3O4RA 3AJRA 2C82A 2WE7A 2FN7A 1IUKA 3U4DA 5C7IO 4NBTA 3FBGA 4BNJA 4L73A 4ZRMA 4B4OA 5AQ1A 1HDCA 2DUUA 1NHGA 1R0KA 1XR3A 4WKGA 3D3WB 1U9JA 5TS3A 3GHYA 3VH1A 4EUEA 4WECA 3CSDA 3RU7A 4M49A 3VPFA 4NFSA 2A9FA 3C7CB 3BMNA 4LSWA 1DIBA 3EGOA 1GZ6A 2AA3A 4NK5A 1N1GA 3ZI0A 3WLFA 2HMUA 3BA1A 5JCJD 4JK3A 3JQAD 1PJ4A 1OI7A 4J0FA 5DF1A 4EGFA 2PLAA 4DVJA 1GUYA 3ON5A 2O50A 2P9EA 4NHEA 5BNFA 1LLDA 3I9KA 1HYEA 4H7PA 3WYCA 3C24A 4PLZA 1PS0A 2WSBA 1ZNQO 4JGBA 4CL3A 2EHDA 2BMAA 3F1LA 1GU7A 2IYOA 4W4TA 1LRJA 2D5AA 2FPGA 4R9RA 4BGUA 1VSUA 1U28A 4C4OA 4JP2A 5FEUA 1T2AA 3E5RA 2BGLA 4PG8A 4AJNA 2WMDA 5JAQA 1VJ0A 1TA4A 1ISJA 1QP8A 4WCDA 4FIZA 4AJEA 4DUPA 3RUAA 3VKUA 4KTTE 2ZKLA 1YVEI 2BELA 2OL4A 3AUTA 3WQSB 2PD3A 5K6AA 3DZHA 1ARZA 3HADA 1UXHA 4R4JA 1PJCA 3NJ4A 1ZKMA 2WE8A 5HRUA 1E5LA 1WVGA 2SCUA 2JHGA 3VPXA 1EVZA 3ZWBA 3HQ4O 2O3UA 3S2FA 1ML3A 5JO9A 3JD4A 4DTIA 3FBTA 2PZLA 4ZA2A 1GD1O 1LDYA 4OM8A 1U5AA 3F47A 3B1JA 3ZU4A 3LT4A 4CPDA 5CDTA 4FD3A 1EDZA 1QR6A 1UXJA 1Z82A 4J49A 3SLKA 1E3SA 1MB4A 4KZPA 3LT0A 1FDUA 5BSHA 4AG3A 3GPDG 1DRWA 3NTRA 1CYDA 5I9MA 3RROA 3F3SA 2P2SA 2ZJ1A 3BHMA 3QSGA 3I52A 4G2NA 1NFFA 4YT2A 4KUEA 4LGVA 2Y1OA 1N5DA 4E33A 1F8GA 1GY8A 1KIFA 5I8ZA 2W8ZA 4RLHA 1VE9A 5G4KA 1IPEA 5HTOA 1CJCA 3DOJA 1ZO8A 5MGBA 3SJUA 4HP8A 1NPYA 3HDQA 3KYCA 3MJ4A 3QLJA 5DN9A 4F3YA 2EP7A 6LDHA 2C5AA 4MP6A 5JPIA 5ILOA 3LF2A 4K9DA 3DEYX 2O3QA 4B4WA 4GGPA 5F1KA 4AJKA 4D45A 3H6KA 2I3AA 4D3SA 2GNAA 2Z1NA 3IMFA 4BNGA 1H6DA 4ZHSA 6ADHA 3BMOA 1KBZA 4I9NA 4X54A 3JYNA 4ND2A 1ZK4A 3RJ9A 4XGNA 3K2BA 2EF1A 1L7DA 3FCOA 1JLLA 5EL0A 2WYUA 1KC1A 1HWYA 1R6DA 2I3GA 3VTFA 3ZV6A 2LDBA 1B7GO 1IYZA 4CV0A 1JAXA 5C3MA 4YJDA 4CMGA 3HDJA 3IDSA 5AXCA 1LQTA 3DMTA 2NVWA 2I99A 1HSZA 1KS9A 4KDEA 2X58A 3WGTA 3UW3A 2XAAA 3MTGA 5CPBA 1GAEO 1EE9A 1QMGA 2VNAA 1T2FA 4W9NC 4KOAA 4E21A 2HRBA 1I33A 4Z0TA 4BO9A 3N74A 2ZIZA 3PP8A 1X14A 5DULA 3U3XA 2VZ8A 5K9ZA 3GVPA 5TF4A 1F14A 4B79A 4S3MA 2EJVA 4HUJA 3BXXA 3RBZA 1GQYA 1XYGA 4WNCA 4B3HA 3K2EA 2DTXA 2WEKA 1YH3A 2IZ1A 2PKRA 2ZTLA 4ALNA 3HFGA 2Z5LA 4PZEA 5EN4A 2CVQA 3DZIA 5KJ6A 5I9NA 2Y0EA 4CLHA 1A9YA 3RCBA 3DBHA 5AXAA 4A27A 3ITKA 1HKUA 3H9UA 3L6OO 4M87A 5ES3A 1O6ZA 1E3EA 1BVUA 5GMOA 2FSVA 4ND1A 2GO1A 2WYVA 1D1SA 2B35A 1CETA 3D64A 3ROPA 1TXGA 3JQ7A 1ZXLA 1M66A 1VRWA 2B83A 2VHZA 3NDJA 1E7QA 1B8PA 3C85A 1H6AA 2D59A 3CPSA 4ONEA 4IJUA 3PHJA 3HJAA 4PLYA 4OHUA 1VJ1A 1O95A 2DBQA 3GNQA 3K5PA 1E1KA 1GADO 1ZW1A 5TJHA 4RCVA 2FZWA 5IXSA 1DSSG 1EE2A 2QZ9A 3HWRA 4XYEA 2PV7A 4C7JA 8ADHA 1PS9A 2DPGA 3HUDA 3F5SA 5JS6A 2GRAA 2Y05A 1LDMA 2AE2A 2J3KA 3PQFA 1E0DA 4HXYA 3QHAA 4O5OA 3QW2A 1SCUA 3SXPA 3RFVA 4IIVA 3WYEA 4EW6A 4RF5A 4IGFA 2GD1O 3KSZO 5EINA 3CIFA 4DIOA 3KHUA 1U7HA 4HWKA 4BQPA 3S55A 4CM7A 1D7OA 2RH8A 4UVIA 1H6CA 1VJTA 3EW7A 3RQSA 3WQQA 4A5OA 4MDHA 4M89A 4II2A 3GN2A 2JHFA 4BVAA 1C0IA 2RAFA 4LCEA 1VPDA 3VZPA 4I5FA 2B5WA 1ID1A 1T2CA 4GSLA 4GGOA 5CDGA 1I36A 1YBMA 5JLAA 2YV2A 4BV9A 1P0CA 4NBRA 4XQGA 3Q9NA 3RKUA 2Q2VA 4CR6A 3QVXA 2X5KO 2VNSA 2OOSA 4LSMA 4A26A 4YYZA 5FI3A 5IDYA 1EQUA 3E9NA 2OHXA 1R4MA 1H5QA 3B1KA 3I4CA 5AVOA 1HT0A 1B2LA 2NADA 4OMUA 4KUGA 4BNUA 1U3TA 2BFPA 2GR9A 1FDWA 2JD2A 3GQVA 1U3VA 4W82A 5IZ4A 3NDRA 1CRWG 4TKMA 3OH8A 4ZQEA 3ICPA 3FD8A 1W8DA 4ALJA 3L4SO 4JBHA 2G5CA 3GVCA 2ZCUA 2DPHA 2CDBA 4KWIA 3LF1A 5A9TA 3SEFA 4CLRB 4EJMA 2AMFA 1LSSA 2JD0A 1PJ2A 5IAAA 1DDOA 3ABIA 5DCWA 4EI2A 4IUYA 3DTTA 3TZQA 2C59A 3GZ4A 4ZRNA 3KEQA 4JBIA 4W6ZA 3WNVA 1R0LA 4IM7A 1PSDA 1HDXA 4J1SA 4L4SA 4PRLA 3TRIA 5CEEA 3PLRA 3TZ6A 2DBVO 1PL6A 1E6WA 4OOEA 1PGNA 4YAIA 1TVEA 3AM3A 4YT8A 4OXKA 4JNKA 1IULA 1PR9A 1MX3A 3INRA 2PD6A 2XXJA 3K92A 4CM3A 1ULUA 2OMEA 3GFBA 5T8KA 1NWHA 1ZCJA 2JCYA 3AU9A 5COAA 2G0TA 1SMKA 5DDIP 1SEPA 2X23A 1EFLA 1K89A 4AJJA 1ZH8A 4BMSA 2HCTA 2HK8A 2QIOA 4NU5A 4YAJA 3TOZA 2O2SA 4CM5A 3H9EO 4EJ6A 5C7OO 3PDUA 2Q49A 4OO3A 4CMEA 2NU7A 4BO3A 3CKYA 1MC5A 3IP3A 1GEEA 4EZBA 4OYRA 3B20A 3IS3A 4F46A 1DRUA 3UFXA 1T2EA 2BLLA 3H5NA 1Q0LA 3BMCA 4QT0A 1ZSVA 4XJTA 2E48A 3FSRA 3L6DA 3MJTA 2WD7A 5CDYA 1T26A 2Y67A 4NU6A 3KLPX 1OAAA 4CLEA 2V65A 2HRZA 4ITUA 3GFGA 3JQDA 4PZDA 3RFXA 1KC3A 3AFNA 3AK4A 1KVUA 3E6AA 5G0WA 1XQ1A 3ZH2A 4JN6B 3QWBA 3TZCA 1EQ2A 4KP7A 3GDFA 3DHYA 3R3JA 3ONFA 3PJEA 1TI7A 1NR7A 2FPIA 4YJFA 3K6JA 2J3IA 2Y68A 3GGPA 3LLVA 2OUIA 1C3VA 1JU9A 3FPCA 4ND4A 1GPDG 4A7PA 3JQ9C 4UEKA 3R0IA 4YJFB 1OZAA 5BT9A 2V6MA 3H8VA 3QWAA 4TVOA 1YGYA 3JQBC 4CV3A 3KUXA 2R6JA 2GN6A 3WGOA 2Q1WA 3OEYA 2UDPA 3D5TA 3AW9A 2NVUA 2AQHA 1HLDA 1Z75A 4FGWA 1NTOA 2VYVD 4E2XA 2D5CA 1K5HA 4YR9A 4IDCA 4CQMB 3PWZA 1Z73A 3V1YA 1GR0A 2JL1A 3HE3A 4DREA 3TPCA 4YJHA 2ZYAA 1X0VA 5DBIA 4CQMA 1YQDA 3GOHA 3OECA 4B4UA 1P3DA 4XDYA 3RUCA 4FBGA 1YDWA 3ROKA 1N1EA 2ZB3A 4CMBA 2DBZA 2PA3A 4MVJM 3L0DA 2VHVA 4II3A 4J1TA 4BNXA 4BMVA 3G1UA 3D3EA 1HDOA 3WJAA 1D4FA 1UZNA 5HWSA 1KVRA 1BRMA 4DC1A 1AGNA 4MIOA 3MJCA 1KVSA 1GFSA 1ZIDA 5EIOA 2PGDA 3RWBA 2O3RA 4PLTA 5ENVA 1GYRA 1IHYA 5JSFA 5GY7A 3W8EA 5F3RA 3MOGA 3O03A 5T5QA 1DIAA 1F0YA 2PK3A 3PQDA 5L51A 2DLDA 2NTNA 4IQGA 3R1IA 1SOWA 3JD0A 3WGQA 1J49A 2QW8A 2J5KA 1NAHA 1WZIA 4GWKA 2D4AA 1E1NA 2X5OA 3K30A 1E6EA 5GZ1A 2YHUA
chains in the Genus database with same CATH superfamily
5BXQC 3PZBA 4QQKA 2F48A 3ZJUA 3RVDA 3KK0A 2NNWB 1JLMA 3HP1A 3LC2O 5EJAA 3RS0A 3V4FA 4NJOA 1J39A 2FA9A 1W4AA 3G2LA 2I55A 1LF0A 5GOTA 4CIAA 5EFOA 2GH1A 5J5CA 4LHVA 3VTZA 1FFHA 4C04A 1PEKE 1CDDA 3HN6A 3LO5A 4L9WA 5EMMA 4MVJH 2HUPA 4LVCA 3WBJA 4PO8A 3DTNA 3PIRA 4F5YA 4FZRA 4TTTS 1SB8A 5CDFE 2A59A 4RZQA 3ZJ4A 3AEQA 3JY6A 4D9CA 4ES6A 5KU7A 5TQ2B 3COJA 4KXXA 2RHDA 3DKIA 3VDRA 5IT5A 4HJXA 3GJ6A 4FUQA 4C1BA 1FU7A 2W2TA 4HNGA 1MJHA 2PZBA 1WU7A 3G49A 2G0NA 4JOCA 5GGYA 3S2GA 1DWUA 1ST2A 4H3HB 5JVDB 1ZJJA 1PG0A 4BPRA 5IC6A 4LKRA 1U63A 1YZYA 4DMLA 4ZVVA 3ZK8A 4Z51A 1IQUA 1XMSA 4OUKX 3VR2D 2JIBA 4Q9KA 4D9JA 4J0IA 2IS4A 1VL8A 5K0NA 1H1LB 2GFIA 3ETGA 2OESA 4W7SA 4MHTA 4OU5A 4W5QA 4R8SA 4M1SA 3ANSA 2C98A 4NSNA 3OIWA 4QOHA 2YCBA 3NPAA 4LXGA 4RXUA 4KO3S 4QYSA 2HQBA 3CRQA 3NT2A 4TVKA 1P3Y1 1OBFO 1OZHA 5HX7A 1O96B 1T2NA 4CKCB 5LLDA 3NEYA 4WBNB 3EVGA 4WJZA 4QC2A 3TVTA 3OX2A 4IUBS 3FXAA 1T9AA 3BK2A 2CWWA 4WOKA 1TC1A 4EI7A 1UL1X 1XTSA 3HKBB 3AIKA 3G8YA 5KZMB 1J23A 2R8ZA 4JVOA 1NJGA 1JKJA 3R2JA 3TRDA 4MUFA 4ZJUA 2LGJA 4RSRA 5ALHA 1Q0TA 1GHTA 3QP9A 4PYRA 5KCMA 2H3HA 2XTMA 1SUIA 5I7UA 1WXHA 2BL4A 3BTVA 5ITWA 3GARA 1SXJC 4LE1A 2WF7A 1E1RA 2EX1A 3FYHA 1ISMA 1MAUA 3PWKA 3UBMA 1ETHA 1X80B 4H4CA 2KMLA 3S2EA 4UPVA 3KQLA 2YBDA 4HXGA 4X93A 1E98A 4FMCB 2DCUA 3GPCA 3PDIB 3HKEB 3QPDA 1UK8A 4NPAA 4COKA 4E7PA 3U5TA 4AKGA 4H4EA 4I4CA 3LX8A 1IONA 3HO1A 5C2JB 4PC3A 4XTCS 2CUKA 4DSNA 5CVTA 2PSHA 1WSBA 4DLPA 1T4DA 2XR1A 2Y27A 3FLEA 4BZQA 1J5EB 4LVOA 3ADKA 3MRTA 2BHSA 16PKA 4OHMA 5KYVA 3UPDA 1L5QA 1CQZA 2VT6A 3CPJB 3E3LA 3LP8A 5FUYA 5JD5A 2WZQA 5IT4A 1I24A 1J1IA 3ZTWA 3Q7PA 3ZWAA 4P84A 1BEZA 1Z8FA 5LQNA 1N36B 1JS1X 2XQIA 4UAVA 4ZC8A 1HNZB 1UP6A 1SU7A 1Y6QA 3A7DA 3ONNA 1W9HA 1QGED 1Y5NA 1L4HA 1UK6A 2JGAA 3PQ6A 4I5EA 2FE1A 1M34B 4JOBA 2V45A 2CFCA 2MSNA 1EKXA 4D0RA 4M21A 2JKYA 4Q6WA 1MKYA 4MW5A 5B1HA 4K6CA 1UZMA 3OOWA 3CY6A 4MWBA 5DZSA 4A82A 2RK6A 5BWMA 2Q5HA 2VZEA 2GPYA 1PK7A 3BUSA 1WHTA 3F67A 3CF2A 4FI3C 4GOJA 4NLLA 5LBIA 4TKVA 3J81A 2YHIB 2CVOA 2X8AA 5HIMA 4J0HA 4YLGA 4PNPA 5CLGA 3DCJA 1I7QB 4YAEA 3AR7A 2GWHA 5KMGA 1COWA 1DAFA 1ZZEA 2ZOSA 1NOKA 4KLNA 3CVYA 1UQUA 4B48A 2Y71A 4BBPA 4LA4A 3SR3A 1F8YA 1D8AA 1KETA 4INOA 4TV9A 4IDDA 3OZIA 3PTZA 3VHQA 2P6MA 4BV2A 3AILA 2OYRA 3RABA 3A3KA 4RD1A 2B69A 4B6SA 2UXBB 1NVDA 5TNXA 4L22A 3RUFA 5EP2A 4NXMB 1XKTA 4LJAA 4FYKA 1Q95A 2D1FA 3K5WA 2EU8A 3JQQA 3P9YA 4GUAA 2GETA 3IUQA 5IUJC 1R6XA 1AV7A 3K0BA 1RAGA 4KE7A 4M9XA 3KUDA 4PPFA 2PL5A 4Q4LA 4OSOA 5KSZA 3K0AA 5C8XA 3HTXA 4P38A 4BE9A 1XPOA 3IXMA 2D3WA 4NABA 3ZWNA 4IQFA 4LAFA 1OIVA 3PGKA 1E2UA 4FDVA 4IWNA 5DB4A 3TXAA 1AQIA 2JDIA 3WDMA 5ICFA 5AM3A 2WILA 1J0EA 2BZGA 4RJIA 2E18A 2NV6A 3KLNA 3VPAA 5AJXA 4D4IA 2Q1SA 1JLLB 4PR0A 2PZMA 5EHXA 4RY9A 1Y7PA 4KBYA 3SK0A 5J2TB 3GOQA 4CIYA 4JLSA 1ZK0A 3KKNA 3KVOA 3OLVA 4HN4B 3RUIA 3VDNB 3WGKA 3TECE 2DEUA 3MHTA 3EIFA 3LIIA 5CB0A 1VFNA 2VWHA 3TSCA 2BIFA 1YA6A 3W7AA 1N2XA 1VG9B 1WB4A 2XQFA 1SRRA 1THMA 1VHDA 4FR0A 4OBXA 3TRKA 1BS2A 3T1YB 5U4QA 2CEAA 4KDFA 2AUMA 5G40A 1A77A 2AUTA 3A6LA 3V2UA 4DAOA 1DAPA 5DBFA 4PVCA 5FOVA 3ROQA 4HZGA 3FLMA 3NOOA 3TVYA 2QSUA 4KK4A 4NX2A 1CJTC 2AG6A 3AWDA 4F5EA 2DT5A 3SYTA 3UOWA 3ZW7A 2AEJA 1P0MA 4D96A 4K6KA 5HZMA 4ECEA 5DE3A 1KY5A 1PWEA 1Y0BA 1YQEA 4WLNA 2ZI6A 1F6WA 1RD4A 2YWCA 2ZYSA 3GVXA 4M46A 3SF8A 2I80A 3WXMA 1XD2B 1Z25A 2JGDA 3CONA 4XFKA 3H6HA 1U0OC 5CHEA 3BA6A 5TQ0B 5A4FS 4XIFA 5KNCA 5HM8A 2ZI7A 3TTWA 4ND5A 3HGQA 3GFOA 2HJ9A 4UQLA 3ZYZA 3Q0EA 3LH5A 2QTBA 1D4ZA 4DIBA 1R4NB 4L15A 1F2VA 3PF9A 1OV4A 3NNDA 3FTFA 4Z86A 1GPBA 4MEJA 5EHZA 1TA9A 2NTYC 4F5DA 3OUTA 4Y2HA 3P45A 5BSKA 5DT9A 1SA0A 5LU8A 4JI4B 1QB7A 4JSTA 4S1VA 3ZWCA 3RYCA 2HPZA 1I3KA 1Q1NA 4YPOA 1Y1KE 2Q7OE 1ILEA 1OWLA 1W46A 3VPBA 3SMVA 4HF7A 2WNHA 5JPCA 5G41A 3CF4A 3MJDA 1U2PA 2RHOA 3TQIA 4R1PA 1GPAA 3JWPA 3EGXB 4JJ7A 1TMKA 2HU8A 3E5MA 4LVUA 1L6IA 1XDBA 2GN1A 2HQRA 5T64A 4FWIB 4XKJA 5B12A 3B2EA 1ADCA 1GNTA 1R1DA 2B98A 4LFCB 3TM4A 1Y1RA 1YDGA 1V9CA 4HN2A 3WGHA 4BV8A 5BNZA 1UMBB 2E4XA 4TKUA 4ER0A 1R5BA 5ANRB 5ENZA 5KQMA 4UW9A 1IDN1 2IYWA 1IH8A 3MCVA 3O5AA 3W9UA 1RI1A 5G4LA 3K8ZA 2C42A 2VUHB 4JKOA 3HXOA 4UZSA 1GGNA 3AG5A 3U44A 2EZ9A 5E2BA 1VGQA 3KAPA 4C0AC 2C9CA 3LQ4A 2IOYA 1T3GA 1UWVA 3KYDB 4M1ZA 1LDBA 4YJHB 4XVRA 2XYGA 1QQBA 4L76A 4RXMA 2VC2B 2FX5A 2SNIE 3O7WA 5FL7A 3UK2A 4P80A 5JWRA 1OFVA 3WGUA 1SUAA 2XE8A 4HVAA 4LNHA 2OV1A 1SIBE 3EFHA 4E12A 1O6FA 1SUBA 4DUGD 4P92A 3AUAA 3SYLA 1RC8A 2F64A 1M7GA 3AFGA 3UATA 1Q7GA 4J4TA 5DM60 3G7NA 1NOJA 1BJTA 2NSHA 5LXTB 4V39A 3RJ5A 3MBIA 1N5KA 3WLIA 5JWOA 3DV2A 4MQBA 3VR3D 5J2UF 4NEQA 5BMOA 4L5JA 5CNKA 2ZQYA 4LBVA 4R8RA 2VCEA 2GKSA 1LJLA 2VTDA 1NMEA 3ZN2A 2JJ2D 4N40A 1NVGA 2RAVA 2WDZA 2J67A 2ZB2A 4NFHA 4PCLA 4AQ7A 1E7RA 2ZE5A 4MWCA 1M33A 1Z8HA 2OK7A 3WK8A 4POOA 2XQJA 3H7IA 1IZ7A 1PUIA 3MWJA 4YY3B 1SXIA 3T9BA 3MGCA 4PQYA 1FDTA 2PSFA 3PCRB 4OFBA 1G8GA 4IBOA 3BQNB 1TU0A 1X15A 1XTKA 2YW9A 4WFIA 1PSWA 2VDUE 4XXHA 3CJRA 2H2AA 4X65B 1GFZA 4J75A 2WRZA 5DMHA 2WSMA 3CXRA 3OQHA 3X1XA 3DCNA 1RXWA 2GESA 2AUNA 1G20B 1BXGB 3A4VA 3JZDA 1BX3A 3WK5A 2GJ9A 1KP2A 1TQ4A 1P4GA 3WLPA 1SD1A 1KEPA 1T6BY 2ODEA 1KYYA 3SZ3A 1N6HA 4U0KA 4LZJA 1EUCB 4TL8A 3VNAA 3WSVA 4IIDA 5G2OA 1X8XA 3A28A 1PT8A 2X9NA 2VT3A 2ILTA 2C5BA 4PXSA 5G0VA 1GZDA 3HCBA 1K6EA 1DAMA 4N0EA 3VSEA 3EA5A 1YFZA 1K6XA 4OBWA 3L2OB 1HE1C 2B20A 3CYFA 4EY5A 3IB6A 3HP7A 1GZVA 5J2TF 1K4YA 3QVOA 3JRWA 4HPXB 1OVGA 3ZGZA 2F1KA 2NV2B 4HWOA 3SS8A 3SDSA 2I4TA 1SBZA 1RLUA 2WHPB 1C0EA 1YMQA 2LP4Y 2O14A 3CXUA 3OTQA 3PITA 3ETNA 1YS2X 2ECKA 4NI5A 4S1TA 1V8DA 4G1FA 4DWVA 2O5CA 1N2CA 2QB5A 1B1CA 1RWQA 2DPLA 5EI5A 3Q3VA 5ERGB 3V1MA 2IU6A 4UTPA 2QT0A 5A0VA 4PYJA 4LX0A 2FZKA 4GZ5A 3MTAA 4HNSA 5L40A 3FFAA 2H1CA 2WV9A 4JT8A 5HFJA 5BQOA 1XCPA 2J1LA 3GY0A 5DHQA 1SXPA 4PGMA 1DXYA 1V48A 3I73A 2RHCA 2VDMB 3GUYA 5G0TA 3U0BA 1SOAA 1KZ1A 4M0PA 5CDFA 1K0UA 4ZVRA 2YFQA 3EQ7A 5B2ZA 4MMZB 1DE0A 1FFBA 3PU6A 4B82A 4GQIA 2ZIVB 2Z9BA 3IUJA 1JFRA 2E5FA 1L3IA 1Z22A 3C43A 1A72A 2V0NA 1GNVA 3Q11A 3RUDA 1KEUA 2SBTA 2ZB8A 3R40A 4AJPA 4EFMA 4PNEA 3QQPA 3MGAA 3SPXA 1ABBA 1RCUA 2VK1A 2WPNA 3TIVA 3T15A 2DE0X 1JAHA 1USWA 4OGLA 3T3EA 1N0HA 5EIHA 2WFLA 3UFXB 1KAOA 2Q6LA 1UBKS 1E1DA 4ZTBA 5A4JA 2WUEA 2VXCA 1Y4DE 2HBYA 3RVSA 1G2IA 3AF1A 4Z3KA 4CT5A 1RWNA 3U4IA 2HHHB 1OFTA 4QGAA 1T3ZA 1XU4A 3RW9A 4DV4B 1SCJA 2BPOA 2FN3A 2DX7A 4Z0NA 1IDOA 1S2NA 2OYSA 3HYNA 3AEQB 1OZ0A 2JVIA 4LNAA 4W5TA 4RF3A 4K9LA 4JX9A 1EBBA 4HMPA 4BWFB 2PR2A 3UOGA 4XAQA 1KIAA 2ONKA 5JJBA 1QLWA 2DY0A 5LP6C 3U40A 3OZEA 4JASB 5JVDF 2XGMA 4PRKA 2HDHA 2WIDA 1JBQA 4HAWA 2HJSA 4KX3A 3NTOA 4HC4A 1V6AA 2C83A 3TD6A 4JLPA 1ZUHA 4MULA 1ONBA 4O2BF 5CW2A 5J23A 4RZ2A 1DG9A 1PWXA 3ZCRA 1EGAA 5FCDA 2B1JA 2NACA 2X0NA 2PZFA 2PJRA 4GXQA 1FYFA 1EFVA 2Q2QA 3QIAA 5EUQB 3WL6A 3CLKA 4PHHA 1HLPA 4JL8A 4IILA 3HGMA 4R8MA 3TFWA 1H69A 3VR4H 5KNBD 1FZTA 2QTFA 4M7PA 3AQ4A 3QLVA 4JR0A 2JEYA 3I58A 4DMGA 2WU8A 1J2UA 1C1DA 4O4HA 3PVZA 1V8FA 1DOZA 4RK5A 4Z99A 4EENA 1K98A 2C95A 4K8RB 4PZPA 3EDMA 1L5ZA 1SKQA 1QXSA 1Z17A 1GIAA 1EYZA 2XWBF 1DC4A 1VL6A 2GJKA 4D3DA 4R0MA 3K0FA 4ETMA 5AIBA 2ZSAA 1X80A 1CT9A 3SQDA 5LXTA 3EVTA 1Q1QA 2BISA 4EYQA 1C7IA 1X77A 4PG7A 1I3LA 2RGWA 3BRWD 3LX6A 1RT9A 4PRYA 2UYQA 2YYYA 3FUTA 5COQA 1IPHA 1M8GA 2H1LA 4RPLA 4RTLA 1K7XB 2JAWA 4NCNA 4CCWA 3IAUA 4K5QA 5IJ9B 1GUZA 1QDUA 2ZZNA 4CF7A 2NZXA 2C8JA 3H2SA 5LZ9A 4BWVA 1APBA 3QE9Y 4YQZA 5GVRA 3ACBA 3FYUC 1JDPA 4J07A 3PWTA 3HRIA 2P4QA 3KQNA 3U62A 4H18A 2ZCJA 5J4HA 5AJHA 4JBGA 4U7HA 2F3SA 3PNYA 3EGDB 5CLHA 1QO7A 4Q9NA 1LSUA 2WTXA 4DQUA 3SU8A 2DJ5A 4Q1CA 5ENDA 4MROA 5IUNC 1XTVA 3S29A 2GFQA 3WL4A 1D3AA 3EGEA 1MIHA 3WDLA 3JQAB 4CQNA 1O54A 1Q6YA 2W4MA 2R4UA 1XO1A 4DQKA 4URYR 5IF9A 2ZB7A 1DDGA 3AM4A 3P97A 3RTGA 4M22A 5CEJA 4RWZA 4B1FA 1N3IA 3H1BA 2Y0BA 4CFSA 3FOWA 4J0DA 4BAUA 2YICA 4JS0A 2XNHA 1HKHA 3I04M 3R6TA 4BGEA 2XKJE 1E0AA 1JFFB 2A1UB 5EUCA 3TNJA 3BVPA 4E2YA 1GJRA 1WBDA 4U3JA 4OOFA 2DHCA 3TQQA 5IN5A 4DV6B 4PHTA 4Q4DA 4IDFA 4EG4A 3DZKA 1ATIA 1RKXA 4OI4A 1FMJA 3TZKA 4N8SA 4MYTA 3U60B 1ZWKA 1Y6FA 1VMDA 3K05A 2ID7A 1G21B 2X3YA 1NLUA 1NV9A 3R3ZA 4F4HA 1YUNA 2QPLA 1G18A 4JC0A 2NUAB 3BGVA 4A2CA 4TV9B 1A69A 3FSGD 3MTQA 5EQFA 3H5AA 4CUJA 1D2CA 4D8TA 3DAPA 2CXRA 4NE9A 4A4DA 2E6KA 1KPGA 4MYCA 3SJAA 3DWFA 4WZZA 3U17A 6YASA 3DB1A 1U7XA 1IBKB 4K87A 3LV8A 5DCUA 2HNBA 5HGJA 1PVOA 1WB6A 2RONA 4D3FA 1HL7A 4R1UA 3O3NB 4O0LA 1DQYA 1NTRA 1XAGA 2P79A 2QN7A 2OD2A 4B0OA 1FNBA 2H0QA 3OCVA 1BXRA 1F2UB 2W6ID 2H1VA 3AG6A 3Q7EA 2XE7A 5ALWA 5C37A 2XCTB 2BE7A 4P53A 1QU2A 3C8UA 2BMEA 4RPIA 1RTKA 1VG0B 1WPQA 1EJ2A 3P19A 5GQSA 1YMUA 4QGHA 2C4MA 3Q9SA 1N8KA 2QG4A 4AMUA 1S0UA 1XXHA 4GBJA 5DLQC 3THSA 4Q6BA 4LOHA 4L50A 4X1IA 5HGXA 3TUZC 5KIAA 4E5KA 4TWJA 2CD7A 2H4XA 2Q0XA 1CNMA 2RE8A 3I4LA 2OCBA 5JDCC 5DBOA 1DBSA 3I5YA 5D3KA 1MG5A 5J2TA 1O4WA 5AK3A 3RVNA 1XUOA 2A0XA 2ZSHA 4OQZA 4KITB 4AJ1A 2J6HA 1LPAB 2HA7A 5CU7A 1FVXA 1XTBA 2H9IA 1DKRA 3UO8B 1VBMA 3U5ZB 3LDGA 4TLAA 3MCWA 1E3TA 1E5VA 2ZJ2A 4U63A 3UVEA 4QULA 2FPPA 5DTMA 2X1LA 1P4RA 1UKAA 3MCAA 4RVUA 1ZVMA 1ZVVA 3NHUA 5CD9A 4G5SA 2ZETA 4ANFA 5C7LO 5JDIA 3OBBA 1F5NA 1PGQA 4URVR 1WM1A 4I14A 1RKQA 4AWBA 4KN5A 4X00A 4QA9A 1K88A 3Q8WA 4L0DA 4OQLA 2B8JA 2UYYA 2DQKA 4OD0A 1D4AA 4DR1B 3ZVMA 3QLEA 1P2FA 1N75A 3ZDEA 5B64A 5CCXA 2AW5A 4NATA 5TQ0A 2DZDA 3D0QA 1AO0A 4DWOA 1T9DA 2HLPA 3RODA 1QHIA 2YHAA 4ZV4A 2ZYDA 4BNLA 2P1DA 3ENKA 5CTJA 2UZ4A 4KMRA 2ZJ8A 1YE3A 2ZDGA 2DECA 4M7OA 3R7LA 3L4KA 1B3BA 1ZD4A 3KB1A 4I3GA 1SC4A 3KOOA 4GDMA 4OMCA 3UH0A 2PQ6A 2HEGA 2VYQA 1Z5UA 2XUZA 3W05A 1M6WA 2G3YA 1BTOA 4Z4CA 2WYWA 2SECE 1O9HA 3TSZA 3WHLA 5K8UA 3X1JA 4E5SA 3CNQS 4N5NA 4TTRA 5CEFA 3QV2A 2WYIA 1KMCA 1OXSC 2IXDA 4OLJA 3W5SA 1L8XA 3EPPA 4BB5A 1LX7A 1BW9B 2AJ8A 2X42A 1AV6A 2BFWA 2HAEA 2P91A 1B76A 1M0SA 2VJAA 4QQ8A 4D79A 1GG5A 5C1PA 2A94A 2FW6A 2IDZA 2GYWA 1AF4A 4RNCA 5GM1A 4Y98A 3LXMA 2IHBA 2I1WA 4P08A 3TAUA 2WBLC 4CQMD 4PBSA 3AO0B 2REOA 1WCIA 1B0ZA 2KM1A 4HDKA 2WJWA 3NFYA 4OHBA 4JUFA 3TMKA 3H0KA 5FWNA 1B41A 3O74A 1HZJA 3A25A 1Z4MA 4K46A 1FNCA 2Q2NA 3P2IA 5KNBA 1H66A 1HURA 2DTDA 3UB2A 4DUGA 4HGYA 3TCNA 3DPSA 4D5EA 1K08A 4Z9XA 3EZ6A 1Z34A 3K0HA 4GEKA 4DSZA 1E5QA 5B6IA 2BRUC 3JASB 5A05A 1FJGB 1T91A 2A9OA 3FKJA 1CUIA 1S6YA 5CMLA 5AVYA 1IC6A 1N8TA 2PGAA 3PSAA 1JFSA 1Z0ZA 4J16A 4B71A 2C2WA 3HZOA 1BX0A 3G88A 1OFGA 4GX1A 1MOZA 3V4ZA 2E2WA 5DO9A 3ZWYA 3LSTA 2O8DB 2IYEA 2I22A 2J6BA 2UZAA 4N54A 4O2BA 3WWDA 1HZZC 4GP6A 4IRXA 3DCYA 3MJRA 2O4UX 3TE7A 1JR3E 1M2VB 4QSMA 1E4YA 1ENYA 4POAA 1VP9A 1DFGA 4A23A 3PT5A 1ECPA 3KETA 1VFPA 1Y42X 1F0KA 1EDOA 4IH4A 2CLIB 2QRQA 4CG0A 2FR1A 1NI5A 1XWIA 3LY7A 4MLZA 3ER9A 1ZWLA 3WWZA 1CXZA 3RSSA 1Q2UA 2QTGA 3LPCA 4U3JB 4YC7A 5DYNA 3IFSA 5IARA 5HBGA 4EY7A 3DUFA 2C78A 3EYAA 1G5RA 1PEAA 1Y9AA 1OROA 4UE6A 4UMFA 2YJZA 2UAGA 2UYCA 1H2WA 4ETWA 1OC4A 1R4MB 4I46A 3AI2A 5KWJA 4FFLA 5D00A 2WSSA 1JB9A 2ET6A 1W49A 4OHOA 4R8LA 1MIOA 1NOIA 2R8PA 4XARA 3RGWS 1HG0A 1T34A 4JVLA 3U13A 2IXTA 2NN3C 4QARA 1UM9B 5IBPA 1BWSA 1W85B 5KAMA 5SZIA 1IHXA 1NBMD 1U6IA 3SN6A 3VU0A 4A36A 4GZLA 5CCEA 1IXZA 1J8DA 1PV4A 2H2HA 4X1KA 2NUTB 5CT9A 2AN9A 2FDRA 3S68A 3B3AA 4YMGA 4GR4A 1LTKA 4KYVA 1CUSA 4LNUB 3NP7A 2O8FB 3VKGA 3SWWA 5J63A 1WZEA 2CE7A 2RKWA 1N5RA 4OHCA 4CHGA 2H29A 4CM6A 4EELA 1B6SA 3MYYA 4MLDA 1LKZA 3FWZA 3HA2A 3K0KA 3AOEC 2JW5A 3MRSA 4K1LA 1TOAA 3L7IA 4IO1A 1V96A 2AOTA 3H1GA 4F2GA 3FM9A 2CJWB 4YRIA 3FWHA 4XDHA 2AG8A 4J7CA 1U65A 1IHUA 3FTQA 4MICA 4YXWD 1T5LA 4I08A 1LPNA 2CUTA 3E3OA 4C6SA 3O8QB 4IQ0A 2CJXA 4REQA 2UYGA 1NDQA 1X7DA 2B36A 3GG9A 4ZIRB 4DMHA 4EHIA 1HMPA 1CIVA 4OQPA 4Y6SA 1E2GA 3OCXA 1IJEA 1GTG1 1UWKA 3A4YA 3OJFA 1IIRA 3PYXA 3U9LA 4E5UA 2ZRLA 4QU9A 3COVA 2ENUA 4W1PA 4JI6B 3LU1A 1MG0A 4X3CA 1MBZA 1FYVA 3ETDA 2BKVA 4N7JA 1PZXA 3JD3A 1YT5A 4G4IA 3LPAA 3CRW1 4PLFA 1QDEA 2B37A 1Q84A 2B4KA 3GEEA 5LZ2A 1M5RA 1U2DC 1KYIA 2VP2A 4D3YA 4ENPA 2F8SA 1OBCA 1QHNA 1HXHA 1V39A 3G02A 4RS4A 2VDWA 2PMWB 5TEWA 3O9ZA 4EL0A 2Z6AA 1NQWA 2PZGA 2BUCA 1IBLB 1PR4A 3ADDA 1IMJA 2BFMA 3IAM1 3IP5A 5B2FA 5BYJA 1JWAB 5HW0A 1IATA 2PSDA 2R6HA 1GPKA 1IOLA 3EXFB 3KSDO 4P4TA 3D2CA 3TCXB 2GHTA 3ZBTA 3Q15C 5L3VA 2R7MA 2ROQA 1X7HA 2ZFUA 5F4BA 3H2GA 3BSWA 1WB9A 4OK6A 3DPUA 2OXRA 4OXRA 5ALTA 3AHEA 4XX0B 5JAZA 3REQA 4WWHA 5HEKA 3UCXA 3ZXSA 1TGYA 1F6DA 2QRKA 2DKFA 4DNXA 1G63A 1XJWA 2VSFA 4F4UA 1NLMA 1V1MB 5DM70 2FG6C 4BGIA 4IOKA 1KQ3A 1PQPA 2NO4A 1FDIA 4PNHA 5FLXA 1B73A 2NZYA 1JL3A 4ENTA 4EG1A 2BM9A 2FPSA 3T5PA 5GJBA 4M9UA 1P4AA 1REQA 2PH3A 5FYQA 4GZ3A 3RVBA 4HB0A 1Q92A 4JBXA 4JLBA 3WL5A 4XOUA 4QUBA 1U2ZA 4S0ZA 4CG3A 4QYXA 1UQRA 2Y99A 1CEYA 3FROA 4NV3A 1E9RA 1NQXA 4XX1A 3ZI4A 3ZQJA 3ZIUA 1CDEA 1H5NA 3O1HB 4JJIA 1NC3A 2FHSA 3IEPA 5EWMB 1YJCA 4BNZA 1J2YA 4XUDA 1E92A 3GYGA 4EEXA 3COYA 3P5SA 4NBSA 4R83A 5IAEA 3BZWA 4G0WA 3HZZA 1W36D 3LNTA 1X1TA 3AGPA 2C7BA 2HMYB 5ALKA 1QGDA 2KLHA 1THTA 4C2AA 4QXOA 4UHBA 4JD5A 4RTOA 4UTZA 1HNNA 2B9EA 3CH4B 4GMHA 4KO2S 4TXNA 3DT9A 2D1SA 2P0AA 2Q29A 2Y0PA 3F4LA 1J9EA 3IKJA 3GT0A 4FD2A 5H9VA 4GI7A 5HQ3B 5JAHA 5KTKA 5TGDA 4XI9A 3L7BA 1W5SA 3QPVA 3A6GA 2C7RA 1YL5A 3QVUA 4UC0A 2WWIA 5HILA 1ES9A 2A57A 4B3CA 2PYIA 3IBCA 4GRIA 1QLJA 3A37A 5AI0A 3JQ6A 1O6BA 4FOOA 1DAKA 4JC8A 3GPBA 4GZMA 1JFVA 4BFTA 2BBWA 2BTOA 2SICE 1UFQA 2PJUA 2VYNA 5D6OA 1NXPA 2QX9A 4YBZA 5DI9A 3ZW9A 5I51A 4YP9A 1PJ3A 4ZHSA 2IYSA 4O5AA 3C39A 5LP6F 1QP7A 2EKLA 2Q1TA 3EVCA 2PMEA 2Q5OA 5IX8A 4Q12A 1EZ1A 4RGQA 3THYA 4OFXA 4F4IA 2CNNA 1QHHB 4IG9A 5GM2A 2P6RA 1VLHA 2EARA 1L9XA 1B1AA 1IXRC 4RENA 3RIHA 2O52A 4ZREA 3CWCA 1Y3FE 2FZEA 1CUFA 3KEGA 3UKJA 4DMCA 5BV7A 5KYNA 5CIYA 2CF5A 1T4CA 3P2OA 3R0XA 4IIJB 3K70B 2G8LA 3NORA 4PAWA 1L8QA 1ENPA 1XK6A 4AY2A 3EIUA 1VSVA 3DEFA 1UZAA 1O8CA 4ZVSA 3JYPA 2XDWA 4GOOD 3HN2A 2VSNA 1KERA 3N2IA 1IBMB 3NRBA 1JZTA 3ABSB 1UBHS 3KT8A 3PX7A 1ZRSA 2ZB4A 4LWPA 2PT6A 2WT9A 2F8LA 2HA0A 3DJYA 3KXPA 4GXTA 2EJCA 5AVUA 4HR7A 3SE0A 1XZKA 2ZR7A 1V8OA 2PXHA 3IVMA 3JR3A 3K1JA 3LQFA 1K3UB 2ATIA 3PI7A 4JUBA 4QXMA 5EIBD 2PMFA 3WYBA 4MVWA 2IU3A 2I33A 3E0XA 4RPJA 4EUHA 1I30A 3ZJ5A 1W0JD 2L17A 4FZ5A 1INLA 2ZUDA 5DCLA 4DR2B 1Y6RA 2CHFA 3CM0A 4K81B 5AKYA 2CDCA 1QPZA 1RWKA 3Q7SA 3IVAA 4FMBB 1JBEA 2HEIA 3JAKA 4OUDA 3UH1A 3VUEA 1TGVA 5KHOC 1IQRA 3LHIA 1P8AA 5KJFA 5DNVA 4CKZA 3KZKA 1GPNA 2CVPA 4FJ1A 3ZIDA 2FEPA 5AW2A 1ZIYA 3AYXB 3HVUA 4P5DA 2W93A 5IAJA 2D2VA 2AOTB 3O1IC 1KJ8A 3OKPA 4YACA 5FL3A 3BH0A 4B17A 1M8KA 4PYLA 2EOAA 4OVKA 3F6YA 3KUKA 4ZWNA 2P75A 4ALMA 4CU2A 2I4LA 2LTAA 3FDJA 1AIPA 1JU4A 1G21A 3QVSA 4ZMRA 3QM1A 2NOAA 2TMDA 3H2KA 1VMIA 7YASA 4F5ZA 4AS2A 4RTRA 5F9MA 4FFBA 2P5YA 2GZ2A 3IODA 3KJGA 4B3MB 4AZ0B 1Z3CA 3GEMA 2PUBA 2WZDA 3FUVA 1DWQA 4KXUA 4IFIA 2I66A 4FGJA 2IEAA 4Z9BA 1SZCA 1JWBB 2MSCB 2WF6A 3OZUA 4Y0AA 2K2QB 1R6TA 4QYTA 1J0XO 2V7GA 4H1HA 4LWZA 1ZFNA 4H6WA 3GFPA 5DI3B 2QTCA 1W9MA 1F2UA 5BVHA 2JDID 2MMCA 1SRQA 3MUNA 5CFPA 1NATA 2OMKA 3MTIA 3PYMA 2YN2A 4ZO4A 5EQDA 5P21A 3EG9A 5K6TA 1WZNA 3PLNA 4F2PA 1RVDA 2G4CA 3I2FA 4QWMA 2F8TA 1XXHB 1Y5RA 5G1OA 4ETNA 3ZHXA 4B43A 4JLNA 4UHHA 4D43A 3LBIA 1ORDA 3IIIA 4HAIA 4ZCIA 3F3MA 2DC1A 2FSHA 4B81A 1IN7A 2X1VA 2R7LA 3LCJA 3T1VA 3EPHA 2G9NA 1JBKA 2RGGA 4Y0NA 5DGDA 1MMFB 1UBMS 3AT1A 2AD5A 3BM5A 3C6XA 3REQB 5JXWA 3NDBB 3DNFA 3P8ZA 3I6IA 2YJTD 4CV2A 2FZ4A 4GXRA 3QWFA 2BGWA 1E3QA 3GV0A 3ZBUA 3P2KA 3F5DA 3K6KA 4KE6A 2PFGA 5DGHA 4HZUA 4KHPB 4MGIR 4H1TA 1XKLA 3LUPA 4KUHA 4PC7A 3B60A 3K72B 3DHNA 3V2GA 2IYUA 3EZYA 2ZM5A 1T9KA 4A8JA 4ZAZA 2PXXA 4Q37A 3Q8KA 1BOFA 4KAJA 3P27A 4OLFA 3U4QA 4MVJF 3FI0A 1KOFA 4L4RA 5AHKA 5E3JA 5JBIA 3A9CA 2NO9A 5MN6A 5AUOB 5FI0B 1J7KA 5IAGA 1FOEB 4HDAA 2EF0A 2PUJA 3LT5A 3I64A 1WQ3A 4Q9IA 2PBLA 3S81A 2ZM6B 4JLOA 3L8CA 1P7ZA 4YCAA 3VUFA 2FPIB 3MXTA 3BTUA 4N18A 2H65A 2GCNA 4A03A 1EP1B 3UN1A 2C8VA 2PKCA 3LX5A 2F6RA 1XRLA 3AIIA 1CDOA 3B8EA 4FHZA 4I66A 4O25A 3I6QA 4PSAA 5B6JA 3V55A 1IVSA 5I47A 1E2MA 3A3OA 2IQIA 1GGMA 5BT8A 4KXQA 1QQAA 2OBMA 1M6YA 1SUSA 2QM7A 3QFHA 5E2AA 3D2BA 2G9QA 3C3XA 3A4MA 3ETCA 2OECA 1RABA 1WHSA 4X20B 2CV0A 3ZEAA 1ACLA 5EHQA 2ZJAA 3VAYA 1CUZA 3QWIA 4GLOA 3CA8A 1KI3A 1HLGA 5KC9A 1E9FA 2E89A 4LS3A 3THXB 5H4HA 1PEYA 2NUPA 1I51A 2DBRA 2ZANA 4BUCA 1D0SA 1C4WA 1QV9A 2J45A 4X9XA 3KD3A 1A04A 1QH9A 1VBNA 2Z2YA 1YO6A 2BDUA 2ZSJA 1R0WA 1AQUA 2ZVQX 4W1SA 1N3YA 5ALJA 4H6VA 4MHOA 2WT8A 4DJ5X 1YDEA 1HLFA 3LP5A 1MRNA 3IOYA 3ICCA 5HFNA 4FYPA 5KU1A 1N33B 2FG7C 2D8AA 2EAUA 5LP6A 4EJ2A 1J0AA 4QLBA 3VSCA 1XPJA 1TB4A 1WO8A 2Q5FA 3AETB 1TEXA 4Q1AA 3I9MA 2YVAA 4OYLA 3P0EA 4IHKA 4Q4JB 4LOAA 4CM4B 1A2QA 5EPOA 2IVFA 1Q83A 4OEHA 3GZNA 5DMXA 3WMWA 4CLOB 3WMFA 1AXRA 4AG6A 4XH9B 3MJFA 4JYCA 3AVVA 4HG2A 5IC4A 1EM8B 3PC8C 1UBCA 3PPXA 4MA5A 3OQJA 4PTZA 2EFJA 4EUFA 3NT4A 3IP8A 4DLKA 3GRYA 1RHKA 1Y5MA 3GZJA 3SCZA 1U6JA 3ZU5A 5BSFA 1G5IA 1GKYA 1J0DA 2ZBRA 3UT6A 1EXDA 1EX6A 1QJCA 1H65A 2PL1A 2VK2A 4ZT2A 2YNMA 3FF1A 1NSFA 1VP3A 3CLUC 4JR2A 3NKLA 3X44A 5BSEA 4O2BB 2AXPA 3PRJA 4PIMA 1YS4A 4KPUA 4HDSB 4XD2A 4K6FA 3ISVA 5I9IA 4CR7A 2RFLA 5H02A 3S5JA 1I6KA 2Q2OA 1UP4A 2W2LA 2PEZA 3ESYA 3ORHA 1OC2A 4QT4A 4M7WA 1MX5A 5EIXA 1XNGA 1RYBA 1T0JB 1MAHA 4JIGA 2ZI5A 2QM0A 2I6XA 3B3JA 3BWDD 3Q6IA 5GZ6A 3RT1A 1SBHA 5JI2E 2ONYA 1B0PA 2H0AA 3EC7A 1ZD5A 2H92A 5CYPA 4UFPA 2G0AA 3VU9B 5JH7F 4BE4A 3AI1A 4F60A 2XXAA 3EJ6A 5B1YA 1UQTA 2DPMA 3NHMA 4L28A 5IWCA 3NTQA 3H4MA 2WABA 2OPHA 1UM9A 1QFXA 3PUKA 5LMUB 5KO2A 2GSWA 2GGSA 4IEEA 3AHGA 4R6XA 4BO4A 1OQAA 4D9FA 4YHHB 2W4QA 3UJ9A 3DFIA 4DCOA 1LTHR 2MYUA 1KI4A 2GBFA 2GPNA 4MUHA 3MCUA 4MVJI 5TQ2A 3U81A 3NW9A 3EMBA 1FXWA 4QBHA 1RAFA 4YFVA 5FAKA 4ACBA 4KFCA 4B3GA 3HNOA 1JXOA 2EKQA 3LVFO 1UJ4A 3R6LA 1QR2A 3OVMA 4HEJA 3EVNA 1PYDA 2ODWA 2OZLB 3TN7A 4HBZA 1CUWA 2GYUA 3C7KA 2ORYA 2QD3A 3B3QA 2VK4A 4DG9A 3PGVA 1ONSA 3HH8A 3CZ9A 4GKBA 4TV8B 4WN9A 4A5SA 4IKEA 4M8KA 5ESRA 3WSTA 2DUWA 2RD2A 4UOZA 4R51A 4UNIA 1Y3AA 3WLAA 5ADHA 3TLGA 4I5DA 1Z7WA 2H1IA 2XVAA 4L8FA 5E6SA 3K6SA 1WUIS 5T6BA 2L0XA 5ECGC 4LQCA 3HU5A 4FMCF 3VKVA 1LX6A 1KQGA 3WHKA 3L43A 5JD4A 3NUGA 2FPGB 4BLSA 5I7VA 2G28A 3I72A 1S01A 1TFUA 2O7RA 4UM9D 1LRKA 4LY3A 1J42A 3L7OA 1X74A 4OJNA 1SPXA 4QDZA 5IDXA 5CURA 3RFUA 1M2FA 1MB9A 1RAIA 1A5SB 1USIA 3BN3A 1KR2A 1VCMA 3MMNA 4IIXA 3T4PA 3JQCA 1LQ2A 1Q7CA 2QSYA 3CRZA 3UUEA 3WIBA 1SCIA 5JH7A 5K20A 4E2WA 5A71A 1ETUA 1BHSA 4UDYX 5EJMA 2FW9A 3CSSA 4B85A 3CUTA 1KDPA 4MV6A 3EIWA 1GQ2A 3G0CA 4UVEA 1E2IA 3PEWA 3AVTA 1TA0A 3ICOA 3D6HA 2WVHA 5LUBA 3KFXA 3S8MA 2J87A 3IT0A 2OGWA 3JATB 3JSXA 4NS1A 5AR1A 5JSYA 1U1DA 2WOJA 4J03A 4RE6A 2AOVA 1CQXA 2X7JA 1QVAA 3FOCA 1L5HA 2J07A 1E6KA 3N8GA 1AF7A 1P44A 2HA4A 2P2CA 4A6PA 4BN4A 3C1OA 5LWQA 1V95A 4C4ZA 3D3KA 1PR0A 1RAHA 2P5TB 4QVGA 2HK7A 2PRSA 1IL0A 4EMSA 3R7BA 3NVMB 1AKYA 1I2BA 2MYTA 3R7SA 2Q2WA 3I1FA 2BFNA 4HB2A 4JWKA 4C89A 3A1TA 3L7NA 3V7WA 1NI4B 3FVTA 1IZ8A 1UT8A 2FUKA 2FHPA 3RIEA 2W2XA 2CFIA 4P86A 2RGCA 4P0QB 3OP1A 3SVTA 2V3CC 3Q2KA 3TO5A 5EKUA 3AF5A 2KHZA 3TBKA 2YFKA 2YIMA 3GQBB 3OJ0A 1JYEA 1A9RA 4WZ6A 4FFMA 2VWGA 3ZZ0A 2VDJA 2XWJI 5LXTF 3AV3A 2R2GA 1SUDA 2KX7A 3OTHA 4L3OA 2WFZA 1XNJA 3HEBA 3KOMA 4JXKA 4YX9A 3R20A 5LN1A 1PQ4A 4BHTA 1UBUS 3ZCXA 1Z0AA 4R40A 2RGDA 2R6CA 4Q9JA 3RS8A 2COUA 1JT2A 2JIOA 1CV2A 2WIBA 3V3TA 1Q0RA 2OFOA 1BFKA 3IPYA 3L0ZA 5BV2P 3QA9A 3DVQX 2C2MA 2WKWA 3V97A 1A97A 2PS9A 4ZOLB 2NQTA 3GZNB 3KJQA 3ZLVA 4EGCB 3VJLA 3OWOA 5LDDC 4JJ4A 2PCJA 4B3SB 4ZYYA 1MQSA 3RF7A 2OBLA 5SYNA