4CMJA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmjA00
3PGXA 4RVSA 5G4KB 1YONA 1MB4A 2XOXA 4BKRA 5FWNA 4W99A 6ADHA 1DO8A 2IEBA 3DAPA 3ZWBA 3CEAA 5THQA 3GVXA 4Z9FA 2P68A 1FDTA 2Y93A 4JXKA 4DWVA 3NX4A 2QYTA 4JQCA 2O3UA 4WLEA 3BAZA 1XG5A 1Y9EA 1ADFA 2XXJA 1E77A 3JD2A 3GMDA 4J1TA 3PJDA 1Q0HA 3INGA 1MP0A 1EVYA 1G0OA 3PP8A 4TVOA 3GGPA 1U3WA 3UVEA 2X0IA 3DOOA 3DZKA 1YJQA 4YRAA 1CDOA 4B7UA 1SOVA 2BLLA 1B15A 4M49A 4R3NA 5TX7A 2ZB8A 3PYLA 1L7EA 3AOEA 1L7DA 1LSOA 5DBGA 4ZD6A 4RJTA 3WS7A 3WGOA 1CYDA 1LDYA 5FYDA 2OP0A 4E6PA 3FRJA 3NAQA 5B4UA 4RO0A 2EG9A 2Q4BA 5F3RA 1H6AA 5A5EA 2H6EA 1FK8A 2X9GA 2ZB4A 3JQ9C 3R3SA 5FI5A 4FJ1A 4A2CA 4BNFA 3TZQA 4D0SA 3JTMA 3WFIA 2GNAA 2HMWA 2VUTA 3ZW9A 4ZQHA 3OIFA 1OC4A 1UH5A 1MXFA 1NTOA 5L53A 1DRVA 3LC2O 2A35A 4FN4A 4XDYA 1B2LA 1QV6A 3TRIA 2HMSA 1NPDA 1Q0LA 3RFXA 5GZ1A 1HXHA 1YE3A 1K2WA 3L9WA 1K6XA 2DUUA 2DUWA 1P9LA 3GDFA 5DP2A 3W6UA 1DJNA 1BVUA 1DIRA 4JBHA 3TZCA 3PHIA 2DTDA 1R0SA 1HRDA 1UZMA 2AMFA 4PLTA 1HDXA 1V9LA 2PZJA 3HQ4O 3INRA 4MVJH 2NQ8A 2G17A 4J0EA 4Q3DA 4XB1A 5IXYA 1YS4A 2C54A 2VHZA 4TRRA 3WWZA 1T26A 2TMGA 1E0DA 1DIHA 2E37A 3M1AA 4XRGA 4XEHA 1MV8A 3RUHA 2YJZA 1P44A 1KOLA 2SCUA 3K92A 4AJ1A 1FJHA 1Z7EA 2Z95A 3ETDA 1Y7TA 4H15A 4BNWA 4BNKA 3AU8A 4I5EA 3QVTA 5B1YA 4OOFA 1PL7A 3KYDB 4J43A 1P1JA 4MP8A 2B36A 3SEFA 2NM0A 3U49A 2P91A 2ZB3A 1XIVA 4EZBA 1PSDA 3I23A 2YUTA 1WDLA 4FS3A 3E8XA 4GX0A 4BO7A 3PWSA 5L7TA 3B6ZA 1H5QA 1Q7GA 1NAIA 5BR7A 2C29D 2CDBA 4AJIA 3SXPA 5DCUA 4LK3A 1YBAA 1H6DA 3GAZA 2X5OA 3RC9A 5A1TA 4FJ0A 4RPLA 2OO5A 2PKQO 2O3JA 1LSUA 1LDMA 1YOVB 1EK6A 3PIIA 4WLOA 3ROQA 4ILKA 4ZVVA 1UXHA 3FCOA 3WICA 2JCVA 1B14A 1F0YA 1NVTA 1WXDA 1XSEA 4YJDA 5ENVA 4ZICA 5U1PA 1U8FO 2PGJA 4C4OA 1NHWA 4HY3A 2YHUA 1EDOA 1VL6A 1VM6A 3KLPX 3EGOA 3E9NA 3AM3A 5HS6A 4ALMA 2NUAA 2QG4A 4BO1A 1DBVO 2YZ7A 3JQFA 1EE9A 4MVJA 4NIMA 2BFMA 4RQTA 2HMUA 1M75A 3LVFO 2Z5LA 4J0FA 3VPXA 3L4BC 4UUPA 1Q0QA 2NTNA 2NVWA 1ZO8A 2QRLA 3M2TA 4BGUA 2CZCA 4DIFA 3CZMA 1PS8A 3PQEA 3IAHA 3ZHXA 4J1QA 3H4VA 3C7DB 1ENOA 3C1OA 4N5NA 3F5SA 4XYGA 5IZCC 3GF4A 4ZQBA 1TT5B 4L0QA 3PQDA 2JAHA 3DBHB 4UUOA 1FMCA 4CQMB 3VC7A 5H81A 2VRCD 4EUEA 5JAZA 1LUAA 2YY7A 4IDCA 5BT9A 3C3XA 2AEFA 5GY7A 4KQWA 4CMIA 3O9ZA 4RVDA 1B8VA 4N54A 5G0TA 2AE1A 1MG5A 2AW5A 2PD3A 1IOLA 2GN8A 1R4NB 2O3TA 2BH9A 5AXDA 4CL8A 1T4BA 1X0XA 4BNJA 2C7GA 2VWQA 4NBVA 1JQBA 2E82A 5ITWA 2E4AA 4ID9A 5KJ6A 3L6DA 1PQWA 4UUNA 2Z1NA 3VZPA 4Y6RA 2X5KO 2PKRA 2X8LA 2WEKA 4NFHA 4IM7A 1O89A 2X0JA 4PLYA 1A71A 4FIZA 1LRKA 3UHAA 4CV2A 4DLAA 1E3IA 5AXBA 5CEJA 3DBLA 4E2WA 1CETA 2NVBA 2O50A 4CM9A 3IQDB 1K6IA 4CR8A 1PR3A 3JQ6A 3OJEA 5JDCC 3D4NA 3KEOA 5I9LA 2AEMA 3R6DA 1Y8RA 1EZ4A 4Y9DA 1PJ4A 8LDHA 3ONEA 4DLLA 2VUUA 1HT0A 3GA0A 4XCVA 1M76A 1ISIA 4DL9A 1HF3A 1RM4A 3LF1A 4QXMA 3U4CA 4PRLA 3RC7A 3H7AA 3LT4A 2FHSA 1H2HA 1EVIA 4KTVE 2QZ9A 2V7PA 3DMTC 3PZBA 4LISA 3FNHA 2O4CA 1PGPA 2WDZA 4R4JA 5EERA 2F00A 4L73A 4BS9A 4MVJM 4PLGA 5H83A 3OFSA 4Q3AA 2IE0A 4IDBA 3PYXA 3AUUA 4PLHA 2VYNA 1CIVA 1AXEA 4IJKA 3RBZA 4PG7A 2ZYGA 5EQDA 3RCBA 2VOJA 4IDAA 1D1SA 2X9NA 3JQGA 5EN4A 2GYYA 3ROMA 1JU9A 1BRMA 2RH4A 4R69A 2GF2A 4EBFA 4J90A 4RVFA 5G2OA 3GNSA 1P74A 1K89A 3IJRA 3LYLA 2EP5A 1XU9A 3RSHA 5C7LO 5JCJA 3WIDA 4MKZA 2XXBA 1PEDA 1V8BA 1DRWA 1XEAA 2GCGA 1UUFA 5TT1A 1PL6A 1X1TA 1J0XO 2R6JA 1LBEA 1Z45A 2XF8A 3ZNNA 2GRAA 1OFGA 3F1LA 3PXXA 3RUCA 1RJWA 1WLYA 4INAA 4NR0A 1VSVA 5KCZA 4TSKA 2DKNA 4WNIA 4IQGA 1BDBA 3P5SA 1I24A 3JCZA 3H5AA 2DPHA 1LJ8A 4ONEA 1HDOA 4M55A 2W2LD 4O0LA 3K31A 3MJVA 4YB8A 4EDFA 4F6CA 3JD3A 1NR7A 1FDUA 4OSPA 3S2FA 4E5MA 1YKFA 4IDFA 1VJ1A 3GLQA 4Q9NA 3OJFA 4CLDA 5TC4A 4A27A 4M87A 4FSHA 3I5MA 3GOHA 4KQXA 4QFDA 4R9SA 3PHGA 4UAGA 2D0IA 3H9GA 3DTTA 2ZCVA 3D7LA 1HDCA 1ZW1A 5L51A 4PIVA 3G0OA 3E9QA 4NK4A 4HXYA 1I30A 2PZKA 1ZK1A 3NEPX 4J4TA 4QT0A 4CMJA 4JJIA 3GDGA 1QR6A 1C14A 1HZJA 5DOVA 4J1NA 3JYOA 1TLTA 1QORA 4ND3A 4HWKA 1MGOA 1ORRA 4YJHA 2VWGA 4MKXA 5DZSA 1LLDA 1NASA 2AQIA 2VNSA 2G5CA 1G0NA 1LLCA 4DBZA 3BMQA 2Q46A 3CINA 4AJLA 3NTQA 3EZLA 3UCXA 2EEZA 4UVEA 1GYQA 1XCBA 3ICPA 4II3A 3ETGA 4OXKA 5JCXA 3S8MA 1DJQA 3K96A 4NFYA 3DHYA 4LSWA 2HAEA 3QQPA 1EBFA 2AA3A 2GLXA 3ZI0A 1XELA 4MKRA 5DDIP 1SEVA 3WIEA 2OBYA 3ASVA 5KWEA 3VDQA 4N5MA 3ZWAA 3AY3A 2HJSA 1EQUA 2DPGA 2ZTMA 3PJGA 3G17A 4HADA 4RVHA 1GL3A 4NH4A 3KXDA 1DC3A 2JJYA 4TWRA 3AFNA 4WLUA 1HTBA 4QFCA 5TJHA 3I9OA 1QXSA 1MLDA 1CERA 1IULA 2CF5A 1Y1PA 4I8XA 2TMDA 2I9PA 2J5QA 1PZHA 4U6QA 3ZW8A 4YAIA 1UAYA 4EYEA 4KTTE 3B1FA 1ZBQA 4O63O 4ALJA 4RLHA 2FR1A 4NHEA 5JNLA 1HDRA 5EESA 1ZUD1 2UDPA 4F3YA 2I67A 4H3VA 2Y1CA 4H16A 4JIGA 4KUEA 4W9NA 3STHA 4J2OA 1U7HA 4RVGA 3OM9A 3VOSA 1NYTA 1JWBB 2BKAA 4S1VA 3VPFA 1MA0A 4EUFA 5JO0A 3L6EA 4D41A 1V6AA 4DC1A 5G0WA 3PWKA 1X7GA 4RV9A 3ZHZA 1U4SA 2A9FA 1P1FA 1HE3A 4DQUA 2CFCA 3WYBA 1WAMA 1K6JA 2X4GA 1VSUA 1LDGA 1HETA 3INTA 2ET6A 2VRCA 2PV7A 4LRSB 1QYWA 2EKQA 4DRYA 1JKIA 3AJRA 4XGKA 4U5QA 2IZZA 2G0TA 2VHYA 3AUSA 1XDWA 3A06A 4OH1A 5K6AC 2CMDA 2NU7A 4EEXA 3RUFA 2NSDA 1A9ZA 1EE2A 1V3TA 4TZKA 1W4ZA 2CUKA 3RUDA 2QRKA 3UOGA 3GN1A 1YL5A 1GCUA 5C3MA 4GVLA 2POQX 5HM8A 4R5HA 5CP8A 2E48A 2P9CA 3ROKA 1M6WA 3IOYA 2X6TA 4GMFA 4CMIB 2GZ1A 4PVDA 3JSAA 4H7PA 2NWQA 4J3FA 1KC1A 3I83A 1IB6A 5A9RA 3I6IA 1RM0A 1SZJG 4B8WA 4GKVA 3NDJA 4B3HA 1ZXLA 1LQUA 4MP3A 4I1IA 4CM5A 2P5YA 2VHXA 4YYZA 3BIOA 3OIGA 4NJMA 5ILGA 4WK6A 5DOZA 2GN4A 4FD3A 1Z6ZA 3U4HA 1SB8A 2YHIA 2WMDA 1DC5A 1DHRA 3Q2KA 3DBLB 5H82A 2WM3A 3G1TA 4R1NA 3PLRA 3TPCA 3VVBA 5B37A 1DFGA 1Y8RB 1E6UA 2OP1A 1LSJA 4AFNA 2CNBA 1BXKA 5G4LA 4DXHA 1P1RA 4DGSA 3W8EA 4FW8A 4BNLA 1UP4A 3O8QA 4OL9A 4EUHA 2HRBA 5GZ3A 2YV1A 4RL6A 4AJEA 2QW8A 4LGVA 1WNTA 4R51A 3ZV4A 3DWFA 4PFJA 1T25A 4CM1A 2QIOA 4TKLA 5COBA 3RAJA 4P38A 2V65A 4A10A 4GGPA 4UEJA 5EINA 4XIJA 3ADPA 4DMMA 1YL7A 2GZ3A 1YH3A 2BELA 2Y0EA 4IS3A 5DCYA 2NV6A 4BIIA 3JQGB 4I5GA 1H9BA 3U3XA 1LEHA 5BNTA 3WTBA 4BV9A 2FSVA 1C0PA 1EQ2A 1XGKA 1NWCA 2HRZA 2D4AA 3WGIA 3IIEA 1VL0A 3JYPA 1E5LA 5CEFA 3VH2A 3EVNA 1GFSA 4NDNE 3W8DA 2V6BA 3M6IA 2BHLA 3QWBA 3QY9A 5IF3A 5KJCA 4YTEA 3NYWA 4KUHA 4WLNA 3GNTA 2ZTVA 4FC7A 2YQ4A 3PVZA 4PLWA 1LC0A 1J6UA 3OETA 3IJPA 4IIVA 4DQXA 3HFGA 3PFWO 3KEQA 4CODB 3V2UA 4GMGA 3SVTA 5JAIA 1E1NA 1QLHA 4IJUA 5ENDA 2VRBA 3E1KA 3E03A 2O3SA 2OUIA 4C7JA 1BXZA 3GVHA 4OQZA 3LT2A 4DMLA 2HKIA 1C1DA 2JCXA 2D1YA 2Q99A 1B8UA 1PGQA 4BNGA 2R2GA 5HS4A 3JQCA 1R0LA 4QSMA 4MP6A 3FBGA 4WOJA 3VZRA 3NUGA 5TNXA 1ONPA 3ANLA 2BRUA 2XAAA 5L7YA 3UICA 4HFRA 3GC6A 1DRUA 3A4VA 1KETA 5JY6A 4B4UA 3VPSA 3KYCA 1GQ2A 4ND4A 3BA1A 1M2WA 2P5UA 4ZGWA 5BSGA 1HE5A 3QP9A 5L9AA 3EZYA 1ONNA 5T6BA 1HYHA 1E1LA 1Q7BA 3BYZA 3AU9A 3ZN2A 4M89A 5A04A 5ICSA 3FBTA 1GCOA 2HDHA 5C5IA 4WLFA 2OORA 3CUKA 3PHHA 2I65A 4L8VA 4UVIA 4TQGA 3ITKA 2FP4A 1VKNA 3F5QA 4QO8A 4YJHB 1ISGA 1QYCA 2PLAA 5A9SA 3HUDA 2VHVA 5KNLA 2GO1A 4GLLA 1CQJA 1ID1A 3BMQB 1VRWA 4JNKA 4Y8VA 4WEQA 2BGMA 3OH8A 1WDKA 5IG2A 2VT2A 4GX5A 4AG3A 2J3HA 4QTZA 1B0AA 3GPIA 1U4OA 3UXYA 2NU9A 5CHEA 4LMRA 1VE9A 1HDYA 1NX6A 1XYGA 1GY8A 3KUXA 3H5RA 2J6IA 3MZ0A 5JYDA 4WLVA 2PA3A 4RDIA 3D3WA 5CDTA 2G1UA 3SJ7A 2VWPA 1UDCA 3C1TA 1U7TA 3ZDFA 1SMKA 3IKVA 5ES3A 5L4LA 2HJRA 4IMRA 4ZRNA 5GZ6A 4D0RA 2ZJ0A 5JDCA 3TFOA 1YDWA 3EUWA 1U8XX 1NR1A 2ZQZA 4GWKA 2FR0A 3L9XA 1YB5A 2YFQA 1EBUA 1PX0A 1S7CA 3IP3A 1IHYA 3H9JA 4XJSA 1TB4A 1Z74A 2ZK7A 5JAMA 2FZWA 2OXIA 1YDEA 4FOOA 3UKOA 3ZWNA 4DREA 5JBIA 2X23A 3C8MA 3ZNOA 4E5PA 1ZSNA 3KHUA 2Q1WA 3SC6A 1P33A 4ZQFA 1VLLA 1HSZA 2JHGA 4BNHA 1E7WA 3ZV3A 3KYBA 3AM4A 3MTGA 4F46A 5KOIA 3D5QA 3TN7A 1MC4A 1PGOA 4XR9A 1PJBA 3AOGA 1P31A 4RF2A 4M8SA 3I52A 1ZCJA 4L76A 1NFFA 4BOYA 2NLOA 4AJJA 1YBMA 5G0SA 3D5TA 4DUPA 3C7AA 2Q2QA 4EI2A 5KJEA 2FSSA 2D59A 4GLOA 4R1SA 2AEJA 5C7OO 3WDSA 2NTVA 5JS6A 1DIGA 2JFGA 2X7HA 3KV3O 2GERA 4MVJF 4WCFC 7ADHA 3ZV6A 3CPSA 1RKXA 2JFFA 4FCCA 3HB5X 3A14A 3ZWPA 4CMAA 4RPGA 1Y8QA 5KIAA 4RZHA 1DAPA 3EY4A 4NG5A 3QSGA 4II2A 1JTVA 1U9JA 2GUGA 2W8ZA 3OECA 4TRJA 4BO5A 2DU8A 5FEUA 4R9RA 3GUYA 3ZU3A 3PLNA 2O3RA 1JAXA 4I5DA 1VI2A 2B4QA 4J4BA 1HZZA 3GK3A 5FF9A 1ULUA 3JV7A 3W8FA 1BW9A 3RD5A 4JX8A 2VOEA 2I99A 1SB9A 1X14A 4J9VA 3VAZA 2Q1UA 5ER9A 1TXGA 1VPDA 1ZMTA 1ZEJA 3OMLA 3TL2A 1ARZA 3FSRA 3DTYA 5IAAA 1PJQA 4NJMB 3WB9A 4PZEA 4CMKA 4PLZA 4NFSA 5CPFA 1DPGA 1KY5A 2YHIB 5JFOA 3ZH2A 4D3DA 3LQFA 3DONA 4PG5A 1Y6JA 3HHPA 3IL2A 3WOHA 1X7DA 3IC5A 1YB4A 4JBGA 3U09A 1ADBA 5U9CA 1ZK2A 3IP1A 3PEFA 3GG9A 2OBNA 4BGIA 4D3SA 1BVRA 4DPMA 1KS9A 4K28A 4E32A 1GADO 1I32A 5F1PA 3O8QB 3RQSA 3WJAA 3A28A 4BNXA 1D8AA 4R41A 4U0JA 4HFJA 4XZ3A 2DQ4A 3WG9A 5KVQA 3CTMA 3VZQA 4YCAA 2IDZA 3OQ1A 1F14A 2BMAA 2PFGA 3WBFA 4IJVA 1I8TA 1PJSA 1JVBA 3FTNA 1QSGA 1SNYA 5AYVA 2CSUA 4FGWA 4P4GA 2WYUA 1IPFA 3P7MA 1H2BA 4GPD1 1KY4A 2I6TA 2QRJA 3F6YA 3KBOA 5AQ1A 1N7GA 3WGZA 1IY8A 1QYXA 3PHLA 2PZMA 3EK2A 4AJ4A 3JQAA 4RF5A 1VC2A 1PJ3A 3HSKA 3QHAA 3W1VA 2OGUA 2HK9A 4OSOA 4DPLA 1PQPA 1TEHA 4MVJP 3V1UA 3S2EA 3AY6A 1AUPA 2YYYA 4YPOA 1ISFA 2VTEA 3F4LA 2VYVA 5DT9A 1U3VA 3OICA 4R1UA 5T8KC 3RBXA 1K5HA 3KSDO 4P22A 4W4TA 5GMOA 3AI1A 3UN1A 3PJFA 4CMEC 4ITUA 3KO8A 4A73A 1DC6A 4BO0A 2IYOA 4NU6A 1DB3A 2RHRA 3CSDA 2Q4EA 3PWZA 4NBTA 3PYMA 4WEOA 1C1DB 3EMKA 3H3FA 3Q9UA 4XR4A 2EHDA 4B7CA 3GEDA 3ZGYA 1R6DA 1KVUA 2OOSA 3QLJA 2C5EA 3WGQA 3Q1LA 3WGGA 1UP7A 3K2EA 4HKTA 4XYLA 4FR5A 4FC6A 3FNEA 4YXFA 3LDHA 2BD0A 5JY1A 4R3WA 5CPBA 4XYBA 3KYCB 3I9MA 3O4RA 1A72A 1W6UA 3ITDA 1E92A 5IDXA 3KVOA 2B4RO 1NQ5A 4EEZA 1PU2A 4GGOA 2OMEA 2Y0DA 5K6AA 3DEYX 3UCFA 2JD2A 5BSEA 2RBEA 1GAEO 4XQ9A 3S2GA 2X5JO 1U28A 1O0SA 3E18A 3OIDA 2EXXA 4J91A 4BVAA 5IJZA 5KJ1A 4K9DA 2DFVA 2O2SA 3WGYA 4GI2A 3U5TA 1U2DA 3TOZA 1XLTA 4DQVA 2B37A 1JVSA 5IDYA 1Y5MA 5A9SB 4P4LA 2E6UX 5EIOA 3ULKA 4NU5A 2WD7A 4AJKA 2OZPA 3B1KA 4HBGA 1LU9A 3PTZA 3VH3A 2ZQYA 1OC2A 1J5PA 3MJSA 3QWAA 3GZNA 5HBRA 5JDIC 1H0KA 3I6QA 3DMYA 3H5NA 2UYYA 4PLPA 5LDHA 3K9QO 3BXXA 3L07A 4GVXA 5CFZA 1HYGA 1A5ZA 3NDIA 3D3WB 2OL4A 2V6MA 3FR7A 3KZVA 1DC4A 1U1IA 3OBBA 4O59O 1E7MA 4FPXA 4TMFA 1EMDA 3PIDA 1I2ZA 2HUNA 4M86A 3DL2A 3WYCA 1PJLA 3NGLA 3H8VA 4KOAA 5TLSA 1I3MA 1VL8A 3LU1A 3RC2A 4BNNA 3MWEB 2DBVO 1ZJYA 4LVUA 2W2KA 4WJZA 4P8RA 1R16A 4BNVA 3NKLA 1E3SA 2LDXA 3GT0A 4CQMD 1E7SA 4JJGA 1O5IA 1U2GA 2Y1EA 1B8PA 2A94A 4BKPA 1ZJZA 4DIOA 2W90A 4N7RA 1A7AA 1M66A 3CIFA 4EJ0A 4Y6PA 3GRPA 3Q2IA 3RI3A 3UF0A 1C3VA 3OHSX 5C7IO 1LX6A 3MJTA 1ENZA 1N2SA 3WMWA 4UVDA 3RROA 3KSZO 5JPIA 4BKUA 3RKUA 1BDMA 1Y81A 1QYDA 4D3FA 2NU6A 4DYDA 5A5FA 4RVUA 4OKIA 1UDAA 1N8KA 4XRRA 3QA9A 3MOGA 4BGEA 2Q2WA 1XR3A 3FTPA 1HYEA 1B3BA 4UVGA 1X15A 2EF1A 1UZLA 2VCYA 3GVPA 4FFMA 4JP3A 4Z0HO 2PZLA 3I1JA 3VVCA 5L45A 4IIUA 1IPEA 3HDYA 2YDYA 4YAKA 1PWZA 4LMPA 2VZ8A 3MWDB 1T1RA 3TSCA 1XU7A 1Y8QB 4YAJA 2AQ8A 2JAPA 1E7YA 1GUZA 3NJ8A 2JD1A 2QZZA 4IDEA 4L4RA 1KEWA 2NTJA 4WOKA 5JE8A 5CEEA 4I9NA 3K6JA 2BFPA 4CM4A 5L4NA 1YQDA 1NPTO 3GDOA 4BKOA 1DFIA 3W4JA 1ZKMA 1X1EA 4D42A 2IYPA 4OO3A 4B4VA 1LLUA 2VQ3A 5BNFA 2FOIA 2F1KA 4DLBA 1BW9B 1KBZA 1CWUA 4JP2A 3ZCXA 5AVOA 3ZWXA 3GFBA 1GZ4A 3D4OA 5JMPA 3QW2A 4XB2A 4CLRA 1GTMA 5BQFA 4BGVA 1LI4A 3COSA 4YT5A 1I3NA 4XQGA 4A26A 1R0KA 4B4OA 4DBVO 3KLMX 4IGEA 1NXQA 3KOUA 1SO8A 2DFDA 3SC4A 1Q7CA 4JLWA 3T7EA 3QJ5A 1R4MA 4CLOA 3ZU5A 4KWIA 3U9LA 1PJCA 4R5MA 2RAFA 3HWRA 1MUUA 2NNLD 2CVQA 3MEQA 3NGXA 2EJWA 3I9LA 2YV2A 1ZZEA 2NQTA 2HLPA 3GGGA 1QLJA 3RFTA 4GWGA 1Q2XA 2JHFA 1MFPA 2BI8A 2H63A 4YVFA 1GZ3A 9LDBA 4CPDA 1S6YA 1Z82A 2D3TA 4WECA 5COQA 4YT4A 3B1JA 4W7HA 4J9UE 5DBIA 1YJ8A 4NJOA 3A9WA 3GEGA 3L4SO 3OQ6A 2UUPA 5ICMA 2ZIZA 1EEHA 1YL6A 3ZV5A 1UXIA 3PI7A 5JC8A 1F06A 5A4DA 2VWHA 2HO5A 4CUKA 1T2AA 3ENKA 4CMBA 1A9YA 3GUCA 1A27A 3DZIA 1WPQA 2PGDA 3G49A 5DP1A 3EC7A 1NNUA 1WMAA 1LXCA 5JO9A 3ABIA 3NT2A 3AUAA 5DF1A 5JC1A 1PIWA 2DT5A 4ESOA 3TZ6A 4BL5A 3I9NA 5DCWA 4K6CA 4MOWA 1U5AA 3JQAB 3N58A 4J7CA 1LLQA 5F1KA 3RIHA 2WSBA 3EW7A 3RU9A 3CMMA 3N74A 5CDUA 1NVMB 1N5DA 2GD1O 1DFHA 3WNVA 2DAPA 4D7AA 3ZWVA 1N9GA 5I7EA 2P2SA 1IL0A 4XYMA 2D5AA 4CM8A 1TI7A 3KTDA 4UEOA 2C59A 4Y67A 2O7SA 1D4FA 3F1KA 2PD4A 1H6CA 3FI9A 4DC0A 4AJ2A 2EJVA 3ADOA 3MCVA 4W6ZA 3RUEA 4LN1A 4NBRA 4YT2A 1O9BA 3BTOA 4OYRA 4CL3A 2A92A 2FR8A 2VNAA 1W73A 3AM5A 1U3TA 4L4SA 4E12A 4J4HA 2V6FA 4DVJA 1DAOA 2C2YA 1DEHA 2PH3A 4B7XA 1PZFA 3QE3A 3NTOA 3JD4A 4Q39A 5FFFA 3G79A 1H93A 3GZ4A 2O3QA 4WGGA 3ZWYA 1O94A 1T1SA 2WJPA 3DOCA 3VH4A 4A5OA 1U5CA 4BKQA 4QUKA 1NFQA 3DFZA 1O95A 3JQ9A 4E13A 2FY8A 4YA6A 1EFLA 3EYWA 2RHCA 5JMWA 3CH6A 4WCFA 3OSUA 4OKNA 3VH1A 1PR9A 3ASUA 1CF2O 3D0OA 4XWYA 5HRUA 3BHMA 5BSFA 1KC3A 2RIRA 4PG4A 1NAHA 2X9VA 3Q0EA 1FXSA 4XYEA 2X22A 3DZFA 2PWZA 3L0DA 3WLFA 1PTJA 1LRLA 1DLJA 2Q50A 3UGKA 3ON5A 2OHXA 5L3ZA 1C0KA 5B4TA 1NFRA 4RQUA 1E5QA 1IUKA 4NI5A 5BSHA 4RORA 1T24A 3ZZNA 1L1FA 4Z6KA 2BF7A 3KETA 2C2XA 3VDRA 4QX6A 3X2FA 4YR9A 2WD7B 1Z73A 2VHWA 3DXFA 1MXHA 2W2LA 2YQ5A 5EQFA 3GZNB 1H6BA 4XIYA 1BSVA 1MC5A 4YJFA 1ZMOA 1I3KA 5J23A 1Y9AA 3E48A 5TS3A 1I33A 3IUPA 3DZBA 1YQGA 4L9RA 1IE3A 2HK8A 5I8ZA 1B26A 4CMGA 3I9JA 4F6LA 2O23A 4OOEA 4DIBA 3UAGA 1LTHR 7MDHA 4CLEA 1IHXA 1UR5A 1F8FA 4MVJD 4Z9YA 1JA9A 4CMCA 4XDZA 4ZN6A 5ADHA 1PL8A 3V5NA 5DNAA 2Y0CA 2D8AA 1WMBA 1QYVA 3CXRA 4GQAA 3K73O 3GY0A 5IDQA 1KVTA 1R4NA 3BMCA 3FD8A 4QO7A 1GDHA 1OBFO 2W2KB 3QVWA 3D4PA 1YRLA 4BO3A 2B83A 4N18A 3QVSA 3AY7A 2HMTA 3MTJA 1ML3A 5EL0A 3K2BA 5F21A 3ORFA 4G5HA 1PS9A 2PK3A 3N7UA 4YEDA 5BNIA 4E2YA 3QRWA 5K0ZA 3GPDG 3W4IA 4FB5A 4XJTA 5IDWA 2WD8A 3F4BA 2E49A 3V8BA 1HE4A 4LCJA 3L4BA 2A4KA 1TT7A 3WSVA 2HQ1A 3AFMA 4WKGA 1VKOA 4KP7A 3QV1A 3FNGA 1P0CA 4RPJA 3DHEA 5KJFA 1VJ0A 5MGBA 5IZCA 4FFRA 3JQDA 3SBOA 2P4HX 3LC7O 3Q9NA 5HA5A 2Y1GA 4W7IA 1LRJA 4RZIA 1V0JA 4J6FA 1P45A 1R12A 1UXKA 2DBZA 4GL4A 5F5LA 1WVGA 1GQYA 4IINA 1NM5A 4ND2A 2B5WA 1P1KA 3JQBC 5EPOA 4UVHA 4YWJA 5T57A 4E5YA 5K9ZA 5A9TA 5IZ4A 2CF6A 3DBVO 3W6ZA 3IKTA 3CE6A 3EAGA 2QQ5A 3RKRA 4ZA2A 3E6AA 2DVMA 2H5LA 4Y98A 2YDXA 3ZWMA 3GGOA 3R1IA 1RYDA 4LSMA 4CMEA 3DB2A 5G0VA 2D5CA 4P4NA 4ZQGA 2EIHA 2J3IA 4XQCA 4CM4B 1YWGO 2J5RA 1DDOA 2HK7A 2NADA 2X86A 3DOJA 1T2EA 4RF4A 4MINA 4XKJA 3NT4A 1NPYA 1T2CA 1M67A 4A0SA 3DDNA 4MIOA 4BNIA 1HE2A 3H65A 5IXSA 2FN7A 1RYEA 2G82A 3TL3A 1UXGA 4CLRB 2UUOA 3HN2A 3SJUA 4XGIA 2HCTA 4IUYA 2DBQA 3JYLA 4D43A 1DSSG 3WNQA 3UCEA 4WCDA 1R4MB 4ZRMA 4CLOB 4OIMA 3DMTA 3OA2A 3ENNA 1FDVA 4O5OA 2Q1TA 4EW6A 5L7WA 3LT0A 5C37A 4W82A 3WFJA 1AHIA 2VZ9A 3P2OA 5IN4A 2QYSA 4CLHA 2FZEA 3TFQA 3MJCA 4KUGA 1QMGA 4CM6A 1E7QA 4J2HA 2PY6A 3GR6A 3R3JA 5CG1A 1K3TA 1Z7BA 3I4CA 2EERA 1SEPA 3ZWCA 1KEUA 2C5AA 2FPPA 3WQSB 1ZXBA 4IXWA 2Y1OA 3ZWWA 1RM5A 5I9NA 3E9MA 2C0CA 4LRTB 3EDMA 2PGLA 4GX2A 3ANNA 2BFOA 3MJEA 2C07A 4BQPA 4TRNA 1NVGA 4NQZA 3TNLA 4QQRA 2EGHA 1ZFNA 3NDRA 3TOXA 3CKYA 5JDIA 5JLAA 4D79A 3KM0A 5CDGA 4B79A 2VZ0A 1BXGA 4OXYA 5I8WA 4ND5A 4URFA 5JXWA 3L77A 1N1GA 4UEKA 3TQHA 3GN2A 3IUSA 4L74A 1JLLA 3C1AA 3O26A 3K8ZA 4E5KA 2LDBA 3QWFA 3DR3A 2I5PO 4G65A 5I7FA 3DC2A 3TZHA 2FWMX 2X0RA 4NMHA 2DTEA 4FFPA 2YFHA 3M1LA 2ILTA 3NJ4A 4WPGA 3V1TC 4BB6A 5JSFA 1NQAO 1YGYA 3NT5A 3RJ9A 2B35A 1GZ6A 4B8ZA 1N9GB 4KDEA 1G1AA 4CM8B 1J49A 3VPHA 5DULA 1GPJA 1E6EA 5AXCA 2JFHA 4EJMA 3CZRA 2Q45A 3WJ7A 1HKUA 3GEMA 3DBRA 5TJ9A 2FPIA 1VJTA 3HN7A 5TF4A 1IZ9A 4ALNA 4FBGA 4FGSA 1EDZA 1PGNA 1NBOA 2CVOA 2JKVA 2O48X 1BGVA 1AHHA 4AJOA 1ISMA 3P2YA 4A03A 5TT0A 2B0JA 1SOWA 2EGGA 4IBOA 1YBVA 4HX5A 3HDQA 1UXJA 2ZYDA 4Q3CA 4R16A 4YAEA 3A1NA 4WCFB 3LSYA 1HLDA 3LLVA 5JAQA 1B3RA 4CV0A 2R00C 4HUJA 2CY0A 1A4UA 4C7KA 3NRCA 1P0FA 1Y5RA 3FF4A 4PN3A 3AI3A 3HFSA 4ROSA 2RCYA 4Z3KA 1I0ZA 4RGBA 3LK7A 3V2HA 2DBRA 1ZH8A 4OMUA 4I9HA 1RM3A 4CM7A 4KZPA 4D44A 1OI7A 1LDNA 4R54A 3GVCA 4Z0TA 2J5KA 4GH5A 3MJ4A 3HB4X 2W98A 1QP8A 3F9IA 4E31A 2X0NA 3RC1A 3FWZA 1KVRA 6LDHA 3H6KA 2EWMA 4OM8A 1K0UA 3OQBA 4BB5A 8ADHA 4B3IA 3GFGA 4OJNA 4EGFA 2P9GA 4BNYA 2GGSA 4YJFB 3T7CA 1JKFA 1N1EA 1G6KA 3DQPA 3RASA 5A02A 3HZZA 1PZEA 4MVJG 2JCYA 1V3UA 2JD0A 3U4DA 3U0BA 4E2ZA 3EHEA 4AJNA 1I36A 4J7XA 3R0IA 3T4EA 3H9EO 1Z75A 5ILOA 4YT8A 3WQRA 1Q1NA 4ZHSA 4PVCA 4ZQEA 4GX1A 4J49A 5F1OA 4UULA 1AN9A 2QHXA 4MIEA 5EMHA 1TVEA 2IODA 4JROA 4FDAA 2XPCA 5KVVA 1WW8A 3BMNA 4B4WA 4TRMA 3BZUA 2AXQA 2GR9A 5I9MA 3KSUA 2DLDA 1ONOA 4LW8A 5KKAA 4TVBA 3DZJA 3BMCB 1E3LA 1N92A 1FDWA 3KB6A 2IZ1A 3ZNPA 2PH5A 5F5NA 3S55A 3IS3A 3UH1A 1RPNA 2ZKLA 3ANMA 2Q2VA 4HNHA 4B3JA 1W8DA 1PZGA 3GHHA 2Y05A 4YQYA 3G1UA 3I3OA 1XWFA 2VUSA 3JQ7A 1BMDA 3I4FA 1J4AA 2I76A 2WWRA 3EVTA 3ROPA 4FFOA 2DC1A 3W4KA 3H2SA 4MDHA 2X58A 1WWKA 3O03A 2UAGA 1JN0A 2ZATA 3V1YA 3AWDA 3UW3A 4IQ0A 1F17A 4CJXA 1EVZA 4BMNA 4HP8A 2EKPA 3QVXA 1XHLA 2J8ZA 4GBJA 4GSLA 4OAQA 3VTFA 4YJGA 1AGNA 1HDGO 1ZK4A 3WR5A 5HTOA 1YXMA 4E33A 1C1XA 3BMOA 3FWNA 5ITVA 1JDJA 4IPTA 1KERA 3C85A 3WBBA 4I5FA 4PCVA 3JQ8A 1GD1O 1EK5A 2I3AA 1V35A 4HNGA 3AOEC 1ZSVA 3BTVA 4OXNA 4PLCA 3PGJA 4GKBA 1KYQA 5T5QA 4GSKA 2AQHA 3AW9A 3OJ0A 4BNUA 4WUVA 3OJOA 2I66A 2C82A 4EITA 3DZGA 1B7GO 2UV8A 3K5PA 2C20A 4FQ8A 4KMSA 1E6WA 1I5RA 1A7KA 1PQUA 4J7UA 1ADGA 2VT3A 2Y68A 4Z3DA 1HLPA 4Q3NA 1KVQA 1DOHA 3TJRA 1OZAA 3OP4A 1NP3A 4J16A 1NHGA 3RJ5A 4BO6A 3NTRA 4RCVA 4E21A 1QG6A 4U7WA 1R37A 4YDRA 1EUDA 3WGTA 2O7QA 3T4XA 1O6ZA 4PZDA 3OEWA 4OHUA 4NNJA 3WSWA 4YQZA 1UP6A 4IMPA 4IY1A 3HNPA 3DZHA 2WYWA 4BNTA 1GPDG 3H2ZA 3VHRA 2DTXA 1LDEA 1LSSA 1JWAB 2ZCUA 4D46A 2EKLA 5TQVA 4ALKA 4PG8A 4E30A 4RLSA 4WNCA 5JYEA 1P77A 4XA8A 3I9KA 4YRBA 1EUCA 2PNFA 1SAYA 3TZKA 5AOVA 2Q3EA 1I2BA 3ZNQA 4BNZA 2AG5A 2ZB7A 3LT1A 1A4IA 4XGNA 2BFAA 5TRTA 1C0IA 4TKMA 1HWYA 3JQEA 2BGKA 2UVDA 1ZSYA 4PLVA 4CV1A 3L6OO 2EV9A 1R66A 2I3GA 1ENYA 1GYPA 2NVUA 3GH3A 4JBIA 4ZJUA 1BXGB 1HSOA 1PJ2A 4YRDA 5TGDA 3M2PA 4PZCA 3BTUA 3PQFA 4E2XA 1ENPA 4K26A 5T67A 3VKVA 2H1SA 3IDSA 3WXBA 4CM3A 4U8GA 4E5NA 4HFMA 1I01A 3LLSA 3HJAA 3ZHBA 3GMSA 2GN6A 3U4IA 3S1LA 5T64A 5COAA 4IGFA 4D45A 4NPCA 4YBZA 5A03A 5IFLA 4MVJE 1W0CA 4CMHA 1T2DA 1AE1A 3TF5A 2WTBA 1XQ6A 3H3JA 3JQFC 2YV3A 4WASA 2GASA 4E0BA 1ISHA 4U0KA 1HEUA 1P1HA 1X13A 3F47A 4IZIA 4ALLA 3PDUA 1UAGA 1T4DA 4CQLA 1E3WA 5U4QA 1KEPA 1C0LA 1DXYA 1GR0A 2PKQP 4AICA 3HDHA 1PWXA 1GEEA 1GUFA 2AHRA 2J3JA 2RH8A 5A3JA 1TA4A 2ZTUA 5THKA 3TDKA 5CDSA 2H9IA 4IXTA 5G4KA 3WLEA 4XX0A 1GUYA 2HSDA 3DBRB 2C7VA 5CDYA 1DIAA 1P1IA 1P3DA 1ZEMA 2HMVA 4MPDA 3PPIA 3PRJA 1BHSA 1NQOA 4BO2A 2IEDA 4NK5A 1EFKA 3Q6IA 3OEYA 5B12A 2WE8A 4G81A 1MX3A 4RDHA 4CLXA 4FFNA 3VZSA 4O1MA 2GPTA 2PD6A 2PTGA 3LZ6A 2P9EA 1FF9A 5A06A 3JQBA 3C24A 3QIVA 3BTSA 3B20A 3DAFA 3SLKA 4PLFA 1B16A 3O38A 4BO4A 1WDMA 2CDAA 3F46A 4DTIA 1YQXA 1LQTA 1R15A 3P19A 4RPKA 5IN5A 2CD9A 1HL3A 3BHIA 2Q1SA 3JYNA 5KVCA 3E5RA 3WYEA 4JN6B 5AXAA 1D3AA 3F3SA 4Z9XA 2Q49A 2O2YA 1IYZA 2HU2A 4TZTA 4JK3A 3QVOA 3FHLA 1E3EA 4YACA 1UJMA 1GU7A 2FMUA 1F8GA 1F12A 3K30A 2Y1FA 1I3LA 1QV7A 3PFFA 4BMVA 3ZU2A 4IQ8A 1SBYA 4JCOA 2AE2A 1QKIA 1JW9B 2CVZA 1ZNQO 3DAGA 1FDSA 3FN4A 1LC3A 5L40A 3GQVA 2BGLA 1JAYA 1HDZA 1PS0A 4AVYA 2JL1A 3WWYA 1DLIA 2GDZA 4PRKA 5A05A 3LC1O 3D3EA 4IDGA 1BTOA 1E7RA 1V3VA 5I7SA 2OFPA 4NBWA 1XA0A 1NQTA 4FOSA 4R01A 4Q3EA 3PDJA 1QRRA 1WZIA 1GEGA 2GSDA 2DM6A 4NBUA 3RWBA 1GV0A 2Z1MA 3FPLA 1X0VA 1ZVMA 4DA9A 1ZIDA 1O8CA 3BMNB 9LDTA 4QECA 3OJLA 3WQQA 3GNQA 5A3VA 1NWHA 2GN9A 1CJCA 2Y66A 3FNFA 3PJEA 4HFNA 3ONFA 4IJWA 2D2IA 4BHTA 3Q3CA 3DFUA 4U6SA 3D64A 3KYDA 1BWSA 1WP4A 3ONDA 4IZHA 4A7PA 3OF2A 3RU7A 5KKCA 4L75A 3JD1A 3JQ7B 3WTCA 3AI2A 3UFXA 3MOIA 4R1TA 1I10A 4BQRA 1PGJA 1YB1A 1OAAA 5LC1A 1SC6A 3H9UA 4S3MA 1JKJA 3S2IA 1YOVA 4RPHA 5LDGA 1RWBA 3VTZA 3QWHA 4ND1A 4MJLA 4MO2A 4HV4A 4YJGB 3DO5A 1SCUA 3IMFA 4R68A 3BHJA 4I9UA 4BV8A 1C1XB 2ZTLA 3BMOB 4UUMA 1KEVA 3SX2A 3D1LA 3X2EA 3PZRA 4IDDA 1GYRA 2IRWA 5FI3A 1EVJA 2PR2A 5MDHA 3ST7A 5DBFA 1XQ1A 3PHJA 4Y6SA 3JQ8B 1U3UA 3ZU4A 2BI7A 4XQEA 1UZNA 1YO6A 5G0UA 2EP7A 3V2GA 1E1KA 3TWOA 1X7HA 1YVEI 4BO8A 4BMSA 1DHTA 2J3KA 1E1MA 1T2FA 2B69A 2IZ0A 2YW9A 3SLGA 5TIIA 4QEDA 4F45A 5ER6A 1TT5A 2EW8A 2EW2A 3DBHA 4MVJI 4CQMA 2O4UX 1GQQA 3G3EA 4LVCA 1GV1A 4E4YA 3Q11A 4BUCA 4M54A 4Z0PA 2Y1DA 3ICCA 4UREA 1MFZA 5CAEA 1CQIA 3U62A 3DHNA 1BG6A 5B4VA 3RUIA 2IXBA 3VPGA 4LCEA 4RF3A 4I08A 3VKUA 4DYVA 1M6HA 4CV3A 3JQAD 3KRTA 4FJ2A 3WX0A 2NACA 3HADA 4AL4A 2AQKA 4N5LA 1LA2A 3GHYA 2R00A 1KIFA 2P4QA 1H9AA 1OOEA 1N7HA 3GVIA 4FFLA 4YAGA 2G76A 2FPGA 3GRKA 5I7VA 3FPCA 2VYVD 2Y67A 1ZK3A 1OMOA 3CMCO 3PK0A 3RFVA 1XKQA 2ZYAA 4JGBA 2IXAA 2FRDA 1CRWG 3E82A 4TROA 2GZ2A 1KVSA 1I2CA 2X1HA 3ETEA 3HDJA 5CG2A 1SPXA 5KVSA 4AJPA 1D7OA 5JW6A 4Q3BA 1UDBA 3JD0A 2ZJ1A 4OQYA 2WE7A 1ADCA 1DIBA 4O6VA 4KDFA 3RVDA 1D1TA 1LDBA 1WZEA 4W9NC 4BNMA 4NZ9A 1ULSA 2CDCA 3FR8A 4X54A 4CM9D 4MIYA 4CR7A 2AG8A 3GG2A 3QWIA 4JJFA 3HE3A 5LCXA 5L95A 4L4XA 2W4QA 2B5VA 3GAFA 3JYQA 4J1SA 1CEQA 3E5MA 2Y99A 3NV9A 2NVUB 5T8KA 4ALIA 1MG0A 4GAEA 4K1LA 5L4SA 2WYVA 4PGFA 4BO9A 5KTKA 5DN9A 2V6GA 4WE3A 5TSDA 4CUZA 4DPKA 2B4TO 2VTDA 3B70A 3AUTA 1IZ0A 1ISJA 3RUAA 1LNQA 3UUWA 1AXGA 4ZU3A 1EUZA 1PJTA 3C7CB 2VN8A 4E3ZA 5HWSA 2VYND 5EJ2A 3LF2A 4CUJA 3RBVA 3HG7A 4G2NA 4AJHA 4CQLB 3OA0A 1E3WB 4CR6A 3ZWOA 3WGHA 4OGWA 2QX7A 3WMXA 4M1QA 3H9QA 4K6FA 4EJ6A 3AK4A 2NU8A 1H94A 3ZHYA 4XD2A 1ZK0A 5JCJD 4IS2A 4PG6A 4KWHA 1E3JA
chains in the Genus database with same CATH superfamily
3JYHA 1QE3A 2WKQA 1V1MA 2X6QA 1XI2A 2E3JA 2QTNA 3A0RB 3QPDA 2HB6A 5G4KB 1N25A 4BKRA 4BXOA 2BKUA 1KYIA 1X3SA 4X1IA 1Q0TA 3GRFA 1YACA 2X8WA 2CNNA 3CEAA 3VSEA 4A2QA 1WR8A 2QN1A 3Q98A 4Z9FA 1T0UA 2P8SA 4F4HA 5EKUA 4DR5B 3P2JA 4X62B 4JXKA 2XUKA 1CQPA 1N8SA 4M8LA 4YROA 1Y9EA 1S0UA 2ZI5A 5AKLA 3BE6A 1JH8A 1CJSA 2XXJA 3JATA 3SIPA 1RVV1 2WSSA 3DUWA 3GYGA 4J1TA 1XZCA 3PJDA 5E1BA 3EUEA 5KS2A 4YCLA 2CDNA 4L72A 5F2NA 1DU4A 3U1TA 1EVYA 1DAKA 3GGPA 1G9TA 1R0WA 4HC4A 3SEQA 4ZT5A 3SZRA 4PY2A 2CNLA 4C43A 3DZKA 1T9ZA 1XMXA 2ZLBA 4U7GA 3SYTA 1B74A 5EFOA 5IX8A 4K9OA 2INGX 4TUYA 3EF1A 2BLLA 4TMTA 1GJRA 2V9PA 4TYMA 3UGQA 2GBIA 2ZB8A 2BR3A 3PNVA 3SI7A 1LSOA 1EVLA 3C41J 3PQ8A 2TYSB 1JX6A 4ZD6A 2OB2A 4R2JA 4EG0A 5KOJA 3AEUA 2AG0A 4IWXA 1JNXX 1LVHA 1BYUA 5B7QA 4F9TA 2XZTA 3NAQA 4EB3A 5B4UA 5CB4B 4V1CI 3G2OA 4G41A 5A5EA 2H6EA 3D8SA 1NR5A 4KAAA 1MAVA 1Q21A 2PA0A 2X9GA 2ZB4A 4Q15A 2ZWVA 3BBLA 3R3SA 4WZAA 4BNFA 4AP6A 3GLSA 3JTMA 2WFLB 3WFIA 5MFPA 2BYTA 1MQ9A 2HMWA 2NXWA 3ELYA 4ABYA 4C4AA 1OC4A 1UH5A 2ONCA 2V7QD 5FLKA 3ZLJA 2O8BB 1KMNA 1DRVA 2A35A 3EOBI 4FN4A 4LOAA 2XQFA 1B2LA 1KIMA 5JQGF 1MJGA 1IEXA 1DKPA 2MYUA 3ROTA 3AGQA 4KQFA 5CYFA 5ILQA 3SQXA 5KYUA 5I4IA 2R79A 4K0KB 5AP9A 1NPDA 5AICA 5K1ZA 1K2WA 1Y8AA 1Y6GA 5AJXA 4CI0B 4ZI5A 1X87A 4HNRA 1ZDMA 3KSMA 4NHOA 3AO0B 1DIRA 1PEYA 1MIOB 1UEJA 4KREA 2DTDA 1HRDA 3DYBA 1DQRA 1V9LA 4PLTA 4RD4A 4XB1A 2JIQA 5IXYA 1NIPA 2C54A 3WWZA 1YDHA 3LCCA 3BJMA 2TMGA 4BP9A 1FRZA 3WWDA 3OEHA 3IFSA 2J45A 1E0JA 3SG0A 2ZG6A 1X38A 2BFBB 3D2AA 2SCUA 2QY6A 2J87A 3BRWA 1Z7EA 2Z95A 4YQEA 1Y7TA 2EQBA 4OQFA 1ILWA 4TKZA 2O6HA 1GL6A 1SUPA 3IB3A 1W5BA 2AFHE 2PH1A 3IEKA 3QVTA 5AM3A 3C6YA 2HF8A 3DLPX 1X8KA 1VIVA 1NN3A 3KYDB 4J43A 2PGAA 2B36A 1Y9DA 3CZPA 4MP8A 1IJFA 2NM0A 5FULA 2FE4A 1GPMA 1Z15A 3NYQA 3JRNA 1P4JA 3I23A 2YUTA 4GX0A 3O92A 5ULLA 1RQLA 1I6KA 4RFSA 1U0JA 4R8SA 3QG5A 2EFEB 5BR7A 4BB0A 1J9ZA 2C29D 2CDBA 4UE2A 3SXPA 5KYXB 4YPVA 1Q15A 3LX8A 1UBHS 3V4ZA 2X5OA 2XKAA 2PBZA 1X39A 4W7SA 4F86A 1SXJC 4J6EA 4NZPA 2C1ZA 1PTKA 1YOVB 2IUFA 5CW1A 3GPLA 4FBMA 1R0YA 1UBUS 4Y2UA 1GUAA 3ZEIA 4BLPA 5LLDA 1E62A 5DM60 2JCVA 2JK1A 1B14A 1F0YA 1NVTA 2QRMA 4YJDA 5AK6A 4BTLA 2P2CA 1JLHA 4B6QA 2W6CX 5U1PA 3P1JA 5B58C 1U8FO 2FSUA 3M0EA 4K6OA 4C4OA 2PXHA 3HC7A 2HSEA 1NHWA 4EB8A 4IOLA 2YHUA 1GHTA 4H4DA 2HU8A 1QQTA 3EGOA 3GFRA 1PLLA 1QB8A 4L8YA 1ZS9A 4NOLA 4C88A 5KQRA 3B1XA 4BO1A 1BC5A 4PYQA 3UW1A 1EE9A 1C1YA 3L06A 2K7ZA 5A3SA 1JECA 5BP7A 1YMQA 2P40A 1NYQA 2AXPA 2E4ZA 1AS0A 4QYIA 1Q0QA 2AYYA 2QRLA 1OFVA 3CPEA 2XNCA 4TTPA 1U9CA 3VJMA 2CB9A 2FKNA 4CG2A 3W5CA 4RD6A 2XE4A 3WDLA 4UTXA 1W36B 2QT0A 3IIMA 1GNPA 3ZHXA 4J1QA 3VYUB 1WTCA 1PVOA 3PEVA 5CH5A 1BFKA 2XA1A 3C1OA 2C96A 3GJQA 1K68A 1WMFA 2RHLA 3D81A 1RHUA 3O3MB 1J07A 1MABB 4PZUA 4L0QA 1E2FA 2JAHA 3RU3A 4Z49A 4EJ2A 3VC7A 2ODTX 3NWBA 3B78A 4IDCA 4YUXA 5E6RA 4G5FA 2JRLA 3DZDA 3MINB 3QNUA 5AI5A 1R9GA 2O2CA 4IO0A 1URPA 1CU1A 1E5XA 2ZE6A 2W11A 5G0TA 2OM6A 1YULA 3EEQA 3NC4A 2PD3A 2R60A 1KYVA 4O2AB 3X1JA 1GUDA 1REQB 1R4NB 1ZAYA 2BH9A 5AXDA 3UJDA 3HP1A 3RSCA 5IHPA 2VWQA 4NBVA 4GR9A 4EYQA 3IMGA 1R3DA 5ALGA 1KRHA 3SMQA 3WB1A 3WVNA 2E4AA 5HIJA 2Z4TA 3O83A 4Z8XA 3L6DA 3F6PA 3U7GA 4Y6RA 1ULZA 2X5KO 2X8LA 3IELA 1XQYA 2D0OB 1PT6A 1O89A 3A9VA 3BXZA 2VF7A 4KXUA 1A71A 1W85B 3GRAA 3ZDZB 4DCPA 1AA9A 2OV2A 3H5LA 4E2WA 1AKNA 1P73A 1QIKA 2NVBA 4NQRA 2FPGB 5CK4A 5AVJA 1L8XA 4PGAA 5BQ5A 3HS3A 5KQMA 1JXAA 5I48A 3HCPA 3CRZA 3M83A 5LQSA 4MPPA 1S1MA 1KA9H 1Z6QA 2GPYA 5HCIA 4YIHA 4R81A 3TM4A 4DLLA 3OD5A 3GA0A 2ACWA 1N2EA 4ZYVA 1ISIA 4INZA 4DL9A 1HF3A 2GK7A 4GECA 4PRLA 3LT4A 4O2BA 1O08A 2H4YA 1MAAA 4JYZA 2C57A 3RSOA 2V7PA 3DMTC 4TOIA 4BBJA 3QXCA 3HYLA 4LISA 2O4CA 4EF6A 4R4JA 1KZ4A 4F92B 1NKVA 4MW2A 1AKWA 3E84A 3SQDA 1Z2NX 2F9FA 2ZI7A 3GJSA 4I55A 2G80A 4MVJM 4WKCA 5H83A 5H9WA 4XOIA 4ZVKA 3FMVA 3CJRA 1Z7GA 2VBCA 3AUUA 3OTWA 2PEZA 4IJKA 3RBZA 3WLJA 3MMNA 4PX3A 4C5CA 2AI1A 2WUEA 1OU4A 1EB9A 4TWIA 1MZPA 3M4ZA 2Y71A 5EN4A 2GYYA 4WZAE 1P5FA 4OAOA 5HUHA 1XZBA 1BRMA 2RH4A 3DQZA 3GNSA 4PNHA 5B6IA 1UPUA 1ZD3A 3AF1A 4IIDA 2EP5A 3EIXA 1KI7A 5ALRA 3WIDA 1YU6A 2XXBA 3NXSA 2IS6A 4OHWA 1U0GA 3O4HA 3GJ6A 4DLRA 1UUFA 4WD3A 3EDYA 3CNEA 1PL6A 4KQWA 1MR3F 1YFLA 4F8JA 2X3UA 2GRAA 2IY7A 5I4BA 1Y3HA 2IBSA 1A76A 1GPH1 2W6PA 4J07A 4Q7LA 4WERA 2FUG1 2V0CA 4UM8B 3RUCA 2IOHA 3R0XA 1XQ9A 3I32A 1YJBA 2VAMA 3DEKA 1VSVA 4INAA 3T5TA 4PQFA 4UPEA 1S8FA 3BD6A 3Q88A 4NNOA 2NPOA 1SCDA 3JARA 3UOAB 2EOAA 1EK2A 4ONEA 1SK9A 1UANA 2AVNA 4YMSA 1XA4A 4O0LA 2QBYA 4FMDB 5C5DA 2PT9A 1KU0A 1NQXA 1M2KA 2V6IA 3RVQA 2UKDA 3ZC3A 4F6CA 1E1QA 1EXNA 3SQNA 1NR7A 4H2DA 2CHQA 2W8BA 2XY4A 5M04A 2FUG6 2PDAA 1ECPA 3K35A 3LXMA 3GLQA 2BM1A 2ZSIA 2AF3C 4MV6A 4CLDA 2YCBA 2IVZA 5K3CA 2ZJOA 4X9XA 2Y1WA 4MR9B 4ZOEA 3VVMA 5M2QA 4MMXB 2F3PA 3GOHA 4URWR 2D0IA 1IG0A 7MHTA 3OZTA 1UOOA 3DKKA 2XSZD 3KQVA 1CR2A 2PX4A 3UJ7A 2J3MA 1ND6A 3G0OA 3CNBA 3IA7A 1B43A 1ODKA 1OYVA 4KE7A 2WUWE 1H2WA 4NOJA 1SXJD 2PM8A 3LL4A 5JBNA 1EFHA 2Z2JA 2YIMA 2FFQA 3NEPX 4MTLA 1T6BY 4X7BA 4G01B 2WDPA 4CMJA 1Z17A 1ZD5A 4M8KA 5KTYA 1JQLB 2IHKA 3N6XA 4J1NA 1U5BB 1XJQA 4JYAB 1U7DA 1TLTA 4P36A 5CB4F 1G98A 1SKBA 1XTUA 2BFCB 1GNTA 1BX3A 3ELBA 4ND3A 2IX3A 2J30A 5M7EA 4P58A 3ZTYA 3TD6A 5DZSA 1Z8FA 2YH2A 5B53A 1NASA 4TS1A 4V3BA 1DWQA 5CBPB 2BLNA 2G5CA 2OLEA 3CX4A 3PL1A 5I45A 3AJEA 3UJPA 3CINA 4AJLA 4JVMA 2QUHA 3NFRA 3UMJA 3K5HA 4B7AA 1QRDA 4G5YA 3L6RA 2NXJA 3DFKA 4RKYA 1XRSB 1R74A 4ZC1A 2YUIA 1IXSB 2TECE 4LSWA 3N0RA 2HAEA 2ASVA 4RHTA 5J63A 3IBTA 1T8SA 1V26A 4LOIA 4DSAA 1UPXA 4GKAA 4ZVQA 4MKRA 2LVBA 3NTVA 3QU5A 5DDIP 4ZVNA 3OZGA 3WMEA 2OBYA 2ZYUX 3ASVA 5KWEA 1QS0B 4KR0A 1L4LA 3ZWAA 3ZCUA 3A2LA 3DLIA 4CTMA 2HJSA 2R11A 4H35A 2B4YA 2DPGA 3G17A 5AVUA 5INTA 4HADA 1U3CA 2HLHA 4C0HA 2CXUA 2FOXA 2RI6A 2VJOA 2BI4A 2FFBA 3KXDA 3UJ6A 1DC3A 4BLQA 3LY5A 2R8ZA 2NG1A 4XARA 3W5VA 1YQEA 1WCIA 2CD7A 4NS4A 4QXRA 3P5BA 4NECA 4CKEB 1YZLA 5KYYB 2LRHA 1K0FA 1MLDA 1CERA 1IULA 4B6OA 3FYUC 4YRRA 4KR7A 5ECGC 3R9XA 2I9PA 3V48A 2ECKA 1I51A 2FK7A 2IYYA 3TQQA 3VR0A 1UAYA 5DX1A 1FS6A 3N8IA 1ULBA 4OQQA 1L7MA 1ZBQA 4I6JA 1RYNA 4O63O 5JNLA 4NHEA 1NLZA 1MW9X 4A0QA 2M6LA 3DLBA 2ZB2A 4FIDA 4LZJA 2Y1CA 4H16A 2I1LA 2J6BA 3CLKA 3NHJA 4JIGA 4KUEA 1Y89A 2O07A 4W9NA 4XVHA 2BFEB 4HLDA 2ECQA 2BZ1A 2P6MA 2OYSA 4UXJA 4RVGA 3UMCA 1M2EA 1OT5A 2IYLD 3NVAA 4NG4A 4CDRA 2OCIA 3IYLW 4LXGA 1VLQA 2BKAA 4HAOA 4A9AA 1G7SA 5JO0A 2PMCA 2BF4A 2G8NA 1Y4AE 1ZU5A 4MXDA 5ANRB 1V6AA 3VPDA 1OFTA 4DC1A 1WOYA 3BREA 2DH6A 3F3KA 1N3LA 5G0WA 1NUSA 2QN2A 4BBPA 5J4HA 3HKCB 3OUUA 3ZHZA 1FVXA 5LJLA 1RYBA 2A9FA 1AGXA 3WJ1A 2GEFA 3Q9LA 3DOFA 2X4GA 1FFXB 1UOEA 2XB8A 1JXOA 3U3KA 1BS2A 4US1R 3I0NA 3AVTA 3FMOB 1B8OA 2R5NA 2P2LA 5JEEA 2VRCA 3WLQA 4CGYA 5EC8A 1T34A 2ODWA 4LRSB 5C5CA 3EIEA 4FN5A 5JLJA 4E7OA 1OV6A 3TVDA 1G4UR 3SYNA 3IAAA 3MA0A 4BRSA 2VHYA 3E0XA 3I6YA 3A06A 5CLJA 5JI3E 2CMDA 2NU7A 2YRXA 4C3ZA 4EEXA 5K6AC 2ZI3A 2RHOA 3U7IA 5ALUA 2XCUA 3S68A 5C1PA 4ZT6A 1SVNA 4QKQA 4QYWA 1KMCA 5ALNA 4QEKA 5IK2D 2FMFA 3IDQA 4YGXB 1W5TA 3P2IA 3T0IA 2CUKA 1OBOA 2MSEB 2IX9A 1YDGA 1MKYA 1N5KA 2QRKA 4ZODA 4KAJA 3B2EA 3LDGA 1X80A 3KKPA 4B6JA 1U6KA 4R5HA 3EH1A 2P9CA 5J43A 3QBVA 4TL8A 3ROKA 5CVUA 1I7QB 2ZYTX 3ZI7A 3VYWA 3ZG6A 4CMIB 2GZ1A 4QFBA 4LWQA 4G56A 4XGRA 1KC1A 1P0PA 3IUMA 4MS1B 3I6IA 3KZMA 4D9NA 1SZJG 5K2MA 1QK5A 1ZXLA 3DL7A 3GT7A 2YVLA 4MP3A 2I2BA 5KNBD 2V45A 1NVWQ 1R2QA 2HZ7A 1RP1A 2RHTA 4QNRA 4ENQA 1LCIA 1MOSA 3U4HA 3K8OE 4X41A 4TKVB 4YV7A 1F2DA 2QROA 2Q1YA 1COWA 2RG7A 2WMDA 5JS1A 2H51A 4RACA 1EXDA 2E4YA 4FU0A 1RKQA 1HG0A 5H82A 1II8A 2WVHA 3G1TA 2XVXA 2GS9A 3OOEA 5B6PA 1YZGA 1TVKA 3FLEA 3PRHA 4QOFA 3RV3A 1DJPA 2QS9A 3Q87B 4MGHA 2OP1A 1LSJA 4AFNA 3MXTA 4JB0A 4AZSA 4RCYA 4DIEA 4X0EA 4DQKA 5K45A 5G4LA 2XODA 4F5ZA 3W8EA 1MH1A 2ZAMA 4BNLA 2KM1A 4Q00A 3N07A 2XQGA 3O8QA 5JNVA 1U11A 3TE6A 3QXHA 2HRBA 4GC9A 4JJAA 4RZQA 4YWHA 4MGEA 3QXSA 1CRLA 5GZ3A 4HQLA 4H3SA 1FYEA 2QW8A 2I4RA 2AH5A 1WNTA 2XBLA 1YNSA 1I6WA 1RI4A 3A26A 4UCXA 4YS6A 5JU6A 3DWFA 1LGYA 3Q5DA 5JSZB 2R8OA 4UPDA 2E55A 3V4OA 4CM1A 3T3MB 4YBRA 1FTSA 1VDZA 5KC9A 2Q5OA 3ZDXB 5CNMA 4P38A 2FFAA 3ZX4A 2OM2A 1GZSA 3DE4X 4UEJA 4Z7NB 2PZ8A 4AP5A 5DNYB 4F9FA 3ZJTA 5FNVB 2ABWA 3DMGA 3ZDRA 1Q0SA 3CF4A 3RRMA 2HY7A 2GZ3A 1YH3A 5FBWB 4JLDA 3HLKA 3NEJA 1UK9A 3G2NA 1FRNA 4CRWB 4ARZA 1CVRA 9MHTA 3M4JA 4D56A 5K0LA 1J1IA 2IP4A 4IGAA 2HQOA 4QL3A 2VJQA 2RKWA 2VC2B 4IKEA 4K87A 4R1OA 1SH7A 1XGKA 3L0CA 4K6GA 3SF8B 1XVVA 2HRZA 2W5UA 3OTQA 4B3CA 3WGIA 5DMHA 3RS3A 1AO3A 2GKGA 2AX4A 3PGMA 4FR0A 5K20A 2WT4A 3Q10A 4NDNE 3UMFA 3W8DA 2V6BA 1RD4A 2CUNA 2XA9A 3G2PA 3ZGVA 3M9XA 3QY9A 5BV8A 4MI1A 2CYBA 5EWLB 1WXEA 1QHNA 3PUJA 2OENG 2OAGA 1A97A 4OQLA 4PHCA 4EM6A 4KUHA 3TNJA 4WLNA 3TIGA 4ZEWA 4OB7A 2I2DA 3E7PA 2PGOA 3LGAA 2E5WA 3OETA 2Q5CA 4IIVA 4NZZA 1EGAA 4WESB 3BPSA 2XMRA 3DW3X 3OPXA 2BEWA 5CIWA 2R7LA 3VR4D 4BCCA 2H3HA 2WHPA 4GMGA 4PBSA 1KTIA 2YWFA 1E1NA 4FMDF 4IJUA 4WFIA 2JBAA 3U3OA 5M5BA 5EP1A 4C7JA 1RYZA 1AS3A 4PYNA 5G02A 3LBNA 3LT2A 1IVSA 5F9FA 4C5AA 4DMLA 1C1DA 4G67A 3RYFA 1W34A 1K6EA 1B8UA 1PGQA 3VO8A 1NBME 2Z56A 3EF3A 2QZPA 3NI2A 1R0LA 2I4OA 3SZLA 4N49A 1RI5A 3C74A 2QWXA 4AN0A 4WOJA 1US8B 3C3MA 4AZ0A 2SECE 2O5CA 3HB1A 4TV8B 1XALA 2VUHB 3EXG2 3WK4A 1AHPA 1TMKA 1GSIA 2WKPA 3ZZ1A 5BMVA 4V3CA 2Z5GA 1G7TA 1XNHA 3R20A 5JY6A 5KKNB 3V7UA 1ZW6A 4QTTB 4GKKB 4JBWA 1M2WA 3FF1A 5ALJA 5FTMA 1JHOA 1V8DA 1Y6ZA 2NO1A 4QQFA 2Y4OA 1SULA 4J0IA 5CLIA 5L9AA 1M2OB 2FX3A 1L4NA 1DIOB 4RVCA 2G6TA 2UYQA 4HGYA 4QNNA 5CLGA 1RTTA 4M9CA 5A04A 5JWOA 2ZYHA 3FBTA 1GCOA 1SWVA 2OAQ1 3O3OB 4EF4A 5C5IA 4WLFA 4RMHA 2OORA 2WKSA 1V11A 3SNHA 1J22A 3HP7A 1FNMA 4TQGA 3ITKA 3T9EA 4AQDA 4B6PA 5JJBA 3DJYA 1AK1A 4M98A 1XRLA 4QO8A 2WIAA 4YJHB 3CR8A 5E7IA 1D4OA 1DC7A 3K0FA 1VHTA 5JFTA 2GQ0A 4DMHA 1LS1A 5K2OA 1YQTA 3KR1A 3NBKA 5KNLA 4NYIR 2ZBUA 4MW5A 1V8FA 1K66A 1R8XA 3E2IA 1FS4A 3KALA 1Y3BE 4R1PA 2ATVA 4JL5A 1WNFA 2MTBA 3CH4B 4QD3A 3WAKA 2UUAB 1CXZA 4LGYA 5HOQA 4GX5A 4AG3A 1XL1A 3DS8A 4FDMA 3GPIA 3UXYA 1K9SA 2NU9A 4W1PA 3HCFA 4LMRA 3A36A 1HDYA 5B2FA 3O8OA 2LW7A 1JHZA 5CNJA 4QODA 4ZV7A 3RFFA 3MWYW 3A32A 2WIBA 4KYTA 3BWVA 3IHLA 3IR7A 4DFDA 1V3QE 3G02A 2BBSA 1G6Q1 3R7LA 5CDTA 3UV7A 1BN7A 2A0XA 8GPBA 1J0DA 1UDCA 5B3JC 3F73A 1HNZB 1HTTA 1XVLA 1GFWA 1SMKA 2ZSFA 3RYHA 4N8DA 1SBZA 5L4LA 2ZCJA 1XRJA 2GTPA 1UBTS 2WMNB 4BMYA 3U7JA 3G6WA 5JDCA 3TFOA 4DV2B 4I9GA 3EUWA 4H4EA 3CRMA 2IUYA 2ZQZA 4RA6B 4GWKA 5E6SA 2P9JA 5SICE 4B09A 4GYWA 5DI9A 1HL7A 3PT9A 5JALA 3QVJA 1KE2A 1WCV1 4AKSA 2JFNA 2Q0XA 4EKNB 3RS8A 5EJ5A 1S7CA 2CLOB 2YWXA 1IHYA 3I04M 3C4QA 2VEDA 4C14A 1FA9A 1KU6A 1WUKS 5JAMA 2ZE7A 1OT3A 1K9VF 3KL2A 4G0PA 2X23A 5CR9A 4ZOLB 1VZ2A 1Z16A 3KK0A 3GT4A 3SC6A 2HL6A 4DV0B 4FWIB 1HSZA 2JHGA 4OY3A 4YRMA 4PINA 3M5PA 5FWXB 1O8BA 1RE1A 3SC2B 4BNHA 2FRXA 1N5RA 2OK7A 1M8JA 3EZ7A 3KYBA 2QG9A 3MPOA 1AKEA 1MC4A 5E3JA 4ZOQI 3WAJA 3O84A 1G5HA 1PGOA 1V1RB 4KVZA 1IAVA 1K5DA 1P31A 2IDJA 1DJMA 5JUWA 2AB0A 1X92A 4EB6A 2P77A 1RTKA 2QP9X 3OOWA 1NFFA 3ERCA 3RPEA 4YMWA 3T35A 4W5WA 2Q2QA 4EI2A 5KJEA 4ZJYA 1DBPA 1TC1A 1R0ZA 2D59A 5CMLA 4R1SA 3SZUA 3NNSA 5C7OO 3E35A 1UZUA 2OD2A 4C01A 2NTVA 4EGCB 5BN1A 1TJ5A 1DELA 1CEXA 3MTDA 4J0DA 4QLAA 4WCFC 5TPWB 2FN3A 4YRIA 4MEJA 1IJKA 3OEEA 1P2VA 1UXOA 2QG6A 2CFSA 4RK5A 1ZD2P 3DCNA 3GRZA 4F56A 3ZZUA 3G2HA 2X76A 2XOEA 1THZA 4FD2A 5IJ9A 3VPBA 4QUAA 3ZD8A 2IJGX 3OLZA 4BVEA 3ZHQA 3HBNA 4N8SA 3WMFA 1ODTC 1Y8QA 5KIAA 4RZHA 1DAPA 1CUWA 1RQ2A 3CQ9A 2N46A 1JTVA 2GUGA 3OECA 4YRKA 1NW9B 1HLFA 3C5HA 3VR5A 1IN6A 3R6GA 3X1WA 1TFUA 2XQKA 5KTMA 4I5DA 1JFRA 4IYJA 5DGCA 4BMXA 2B4QA 1XZEA 5FOSA 3R3YA 2AZXA 3C3YA 4J4BA 3GK3A 1HMYA 4BECA 2XGMA 1ULUA 4CTNA 2OD9A 2XZLA 1GAXA 5EKSA 2WJWA 3TLEA 2C9MA 4I99A 3X44A 4K46A 3Q8LA 3TBFA 4Z4FA 1H4QA 2WB2A 1NI4B 1UFKA 5B1HA 4LOHA 3HLTA 2XDAA 5ER9A 3ZWQA 1TXGA 4IXNA 1HGXA 3A1DA 1ZMTA 1NBIA 1ZEJA 3OLCX 4DSNA 2QMHA 3E27A 2ILVA 1G5IA 1JSCA 3DTYA 2KBEA 1Z5VA 4NJMB 5HIAA 3ENWA 4ZCIA 2I4NA 2D5LA 3FFTA 4Y2GA 3GX1A 3DFIA 2I2WA 3PF8A 4AY5A 4WK0B 1BIFA 4RTRA 1WBDA 5EYPB 4KJXA 1IBRA 1CS0B 4US0R 1ZLXA 1ZNZA 4CCYA 2R8XA 1X7WA 4D3DA 5KWSA 5FXMA 1KEEA 1A95A 2FA9A 3JPWA 1BCRA 4R9VA 3HXMA 5D84A 4Q4JB 3IL2A 1G60A 2O2HA 2YZMA 4FQ5A 4CU5A 4W8OA 1OKKA 2JG3A 4M7WA 3OKAA 1ZWKA 4GZ5A 3UZUA 5EFZA 1NX9A 4WNAB 1PW7A 1VIAA 1WL8A 3IP1A 2OBNA 3KZXA 2G08A 3I2JA 1H2EA 1QHHB 1E1RA 3J7TA 4LBVA 2WJAA 2A9RA 4P82A 3CRVA 2Q9AA 5F1PA 3RQSA 1GG5A 3DHWC 1LS6A 3EXIA 4BNXA 4E1BA 4R41A 1ZJ6A 1SCUB 4IHQA 4U0JA 5DXAA 5EUBA 2R4UA 3V8PA 1GKKA 3AERB 3WG9A 3EOZA 5KVQA 3TKAA 3VZQA 3FKQA 1P2GA 3OQ1A 2BMAA 3AONB 3P96A 2P75A 2YYZA 1J56A 3V7YA 2F3RA 2XGGA 5FNVF 3N1UA 2MMCA 5E2IA 4O4IF 2CSUA 4Y9SA 4P4GA 3WNCA 2O7VA 1RRGA 5B1EA 3NP7A 2QT1A 3TTVA 3RVJA 1AQJA 4GPD1 1JHUA 2XUZA 1ODCA 3F6YA 5G41A 4EQZA 2F9LA 3RVOA 3USES 1L7QA 3TSWA 1ISSA 1CP2A 3KKNA 3A1EA 5T3YA 3U19A 3DMNA 1GZHB 3JQAA 1JSLA 1VC2A 4GR5A 1PJ3A 5DTMA 1KDZA 1ZRMA 2UZIR 1H2XA 2H1VA 4P08A 2HK9A 2DPLA 2FVXA 2PMWB 4OSOA 4MYDA 3G0BA 4DMKA 1IVNA 3Q1KA 4O29A 2ZKIA 3KQSA 1E0KA 3DOHA 3AL2A 2YYYA 3QKSA 4YPOA 1DWOA 2Z8ZA 2VYVA 4AQYB 2WA2A 4Y1GA 5T8KC 3N8DA 1XL0A 1E4VA 4IJMA 3QZUA 4KE6A 3KSDO 4W4TA 3UHOA 5GMOA 4BJHB 2FQQA 3TSAA 5CB8A 2Q8QA 1NRWA 1YB7A 3BK1A 1DT3A 4ITUA 5D3QA 4I4TB 4A73A 2IYOA 2X2FA 1FSGA 1G3MA 2BGIA 4OJMX 4CEIB 5H5JA 1DC8A 4NU6A 1DB3A 1N8NA 2V5UA 3L7YA 2V0NA 1U2SA 3ESYA 3HY6A 4XW2A 3QVMA 1KSHA 5AHWA 2HLDA 4DIMA 4DMRA 2PRZA 4YMLA 4IWNA 3BK7A 1P62B 5IABA 3B9RA 1T5IA 5LQJA 5LZ9A 2QUAA 3EMKA 1A8UA 1SXJB 2BHTA 4OHCA 2VIIA 1F2UA 3O8RA 1R5BA 2DH5A 1AX9A 1IOVA 2HADA 3WGQA 4TV8F 4UDYX 4XYLA 4FR5A 5HMMA 5BWCA 3SY8A 4CCWA 4W5OA 4YXFA 2FXIA 2VAWA 1EAYA 4GZMA 3B9QA 4YALA 5JNTA 2P9BA 2VDMB 4G23A 4CL3A 2OBFA 3KYCB 3MWFA 4O1HA 2GHQA 2D1FA 3GEHA 4FHGA 4HLQB 3HU3A 1I94B 1PU2A 4GGOA 4ND8A 2CEAA 2OMEA 1SVOA 2PGXA 2Y0DA 3RF6A 2NZUG 4C87A 4F97A 2ZOSA 1D0IA 1E9FA 3LPMA 3S2GA 4XQ9A 4ZCPA 2XWPA 2BFFB 1U28A 1A8PA 3OIDA 4F6RA 1ZICA 5K3EA 4WA8A 1QGED 2WIKA 3N2KA 5BV1A 4UQPA 4I8IA 4OLFA 4Y9TA 3UB2A 3C98A 3TOZA 1XLTA 3P2MA 4HWPA 4IV8A 4JB8A 4DQVA 1G19A 1YS7A 3DZ8A 2B37A 4LF8B 4J1TC 1BWQA 2R6R1 5FBHA 1WV0A 3CRNA 4NU5A 1CJMA 3WLOA 2QTTA 2Y3IA 3D6UA 4WZBA 4AJKA 4EMSA 4P7JA 3FYCA 2VQ6A 4BZZA 2JJ2D 4OK5A 3ZXXA 3ZBQA 3QWAA 4OYHA 2NSYA 4U6NA 4LVOA 3F4KA 5HBRA 5LBUA 4LNHA 1DBSA 1JIJA 4LA4A 4MYTA 1EJ2A 4G0QA 5BN5A 2I7DA 3C43A 5LDHA 4JUDX 1BN6A 1KEZA 1MNAA 4CKWA 4KODA 2B6NA 2NO9A 5C8VA 2C9DA 4F93B 1HYGA 3NDIA 4OFBA 3IPRA 2C4VA 2H7YA 2OL4A 3ZY5A 1PNOA 2OB1A 2QNBA 4BP3A 4O59O 3KWMA 2WTAA 4FPXA 3D0KA 3HVRA 5D6NA 1EMDA 4NYIQ 4UMEA 3RHZA 4C0JA 1E5VA 2J07A 4QOGA 5EXTA 3S7TA 2ISSD 4DCNA 2HUNA 3DL2A 2DB3A 2ACVA 3NGLA 5SYMA 3KXLA 2PX3A 3HBLA 1V25A 2ZTHA 4KE8A 3LU1A 4Q93A 4TQ9A 3MWEB 1YAHA 2MINA 2W2KA 1YR3A 5HZKA 4Z86A 3A4TA 3CISA 1X7YA 1P0IA 1ZJJA 1R16A 4QRIA 1E3SA 4ZOLF 4Q1AA 2LDXA 2UYOA 2I62A 2YHBA 3NB0A 3DYVA 4Q6WA 1G59A 3GD5A 2A94A 3KKZA 4AKHA 1ZJZA 3WGVA 4PTLA 4F4UA 2RBKA 4JXJA 4LXIA 1NXSA 2W90A 3T9AA 5LN1A 4EB0A 3KAJA 3H0KA 4INOA 3AILA 4GP9A 1BHQ1 4LMAA 3BFKA 2D54A 2Z9BA 1C3VA 2HNAA 3A6KA 4LYGA 3HXKA 4XUEA 1N2SA 2PG3A 3WMWA 4D80A 3RROA 4U7DA 1VGRA 3LV8A 3I37X 2R1ZA 3UEOA 1YB6A 3SBXA 5CDFA 4L2IA 2JRCA 3GA7A 2NU6A 3TRKA 2RGYA 3PFHA 4GF5A 2O14A 5AD1A 1UK6A 4IIYA 3AW8A 5BYKA 4XRRA 4OV6B 4BGEA 1Y7PA 4MMYB 3D7KA 3L1UA 2NN3C 2B21A 2B3TA 4FS8A 1B3BA 5C7YA 2GJAA 2VAXA 3KVNA 2EF1A 4Z0HO 4BV3A 5L53A 1NNEA 3I1JA 4ESEA 3RRBA 1KAMA 1YS9A 1J23A 1WABA 3KJEA 3MK31 1PWZA 2I7CA 2VZ8A 2C2HA 4OATA 3NEYA 4HQ0A 4KVAA 3NEAA 1ONBA 1QH1B 1W5EA 4WKBA 1RT9A 2AQ8A 1E7YA 5AVYA 1GUZA 4TYYA 2QZZA 3KD3A 1KEWA 1QF9A 2NTJA 4WOKA 5CEEA 4QARA 1F8UA 2RK4A 3T3PB 3UC9A 4QT4A 5L4NA 1NPTO 5EMJA 4F3TA 3W4JA 3CLSC 2V1XA 2I22A 2H8GA 5DHTA 1T3ZA 3CSUA 3WL5A 2HI0A 2HSJA 3M4XA 1FYDA 3CPJB 3LH5A 5BNFA 2BMFA 1N2OA 2XNDD 3HRHA 2C4WA 1UPAA 3U3MA 4DLBA 5EZSA 2BC9A 2AR0A 2H5JA 1TGVA 2OHJA 1IUNA 4JP2A 1NONA 4YP5A 5B5SA 3UHPA 2WQ6A 1TCCA 3G7SA 3GFBA 3I4LA 1U7WA 2G77B 2QN8A 1EWTA 4ZYUA 3U16A 4Q4AA 1GQSA 1WKBA 4TLDA 1W75A 4DG8A 4G84A 1AQ6A 4MKFA 2VPXA 3L8ZA 1JDBC 4QUBA 3KOUA 4JI1B 3C3DA 4HQNA 3HYCA 3AUJB 3NZEA 1TQDA 4CLOA 1D2MA 4NMXB 4GQIA 2Y77A 5FD8A 3ZU5A 1ZVKA 2FEPA 4KWIA 3LFTA 1PO7A 1V2HE 1ZC3A 4R5MA 2RAFA 4M1MA 3ZHUA 1U99A 2CVQA 3E3OA 5CUQA 2EJWA 3RRZA 2YV2A 2V5VA 3N6RA 3NHBA 4KLAA 4TTIA 4TN1A 4BKMA 5D7BA 1FNBA 2IPAB 4Q18A 3RFTA 4RV4A 4GWGA 3DV9A 4RFVA 2EVWX 1A82A 3L0YA 3R6LA 2Z6AA 4YVFA 1NDHA 2FTKE 4CPDA 1SUFA 1EXVA 1M6VA 2D3TA 2D1TA 2YOGA 2CXRA 4Y2TA 3G5AA 3N39C 1ECJA 1DP4A 4PQYA 4JV5B 5IT9A 3MBKA 3LIPA 4BLRA 2M32A 3UKJA 3BXPA 4XWOA 1YJ8A 4NJOA 1U7XA 1SD1A 1VPVA 2G3YA 3DEHA 3H5TA 5AKGA 1WQ4A 3S5UA 4OQMA 5C2JB 1MA3A 1N7IA 4KNWA 4LUCA 2JPDA 3TUZC 1YL6A 1RXUA 2HQBA 3K5WA 1NU8A 3SJZA 3CB4A 3PI7A 3FUTA 1VHDA 3TCXB 2HO5A 3SQMA 3IBYA 1F9EA 3D6FA 2R9VA 1G9SA 3EFBA 5IYZB 3KLOA 3DZIA 5LQKA 1JSZA 1L4YA 4QJ5A 3G49A 2FP3A 5DP1A 1II9A 3JPYA 5AVKA 3K0AA 1LXCA 3ABIA 2OV8A 1PT5A 2BGRA 3AUAA 3GJYA 3QLVC 4G1FA 5JC1A 2E4VA 3K9FC 3EDOA 3RRYA 3UUEA 5HZMA 4BL5A 3I9NA 4PONA 5FPTA 5CCXA 1GDTA 1M2JA 2Q9BA 2CHFA 3UYKA 1U5AA 4K3UA 3N58A 2X40A 3VU9B 1GIAA 3LDUA 4CL2A 4DLSA 2XXAA 3QEJA 4PHGA 4BFYA 1RLIA 2NYVA 2WSBA 3N2LA 1NTRA 5FOVA 1UBFA 3DUFA 3KJQA 4IVPA 4J29A 1A1SA 2GD1O 3UPTA 4U7HA 4B3MB 3T3NA 2WSMA 1P2DA 1VFNA 4KV9A 5JNUA 1S7GA 5I7EA 3DF7A 2P2SA 5EIXA 2RB4A 4MV3A 4XYMA 2D5AA 2Q4OA 4OHMA 4QBHA 3KTDA 1YMUA 4PICA 1YE8A 4I4TF 3BB4A 4U5XA 3F1KA 4XLZA 5I9IA 1H6CA 2FGKA 2LUOA 2WUVA 4DC0A 1T9CA 4JQOA 1CUVA 3UK6A 4MLCA 1PSWA 2NW6A 5LKRA 4NBRA 4EW2A 2JEYA 2XDQA 3GFVA 3T1TA 3QYPA 1M1YA 1E20A 3DPUA 4PNPA 3AM5A 3FZEA 1THGA 2V6FA 1K7XB 3BIFA 3F97A 4LHWA 2C2YA 2H0AA 1DEHA 4MVXA 3KHTA 4FTWA 4ASUA 2VZEA 1VE6A 1L2TA 2AWOA 3JD4A 5FFFA 1L8QA 1H93A 1X9IA 1G2PA 3GZ4A 4S1WA 1XN4A 4QBGB 1YQQA 4XVQA 2VDPB 2OYCA 3W3AA 3VH4A 3DOCA 4RPCA 2P7HA 1OHHA 5CA1B 4GOXA 1O95A 3JQ9A 4E13A 3BDIA 1FFGA 3B38A 3A3YA 4J0HA 3EYWA 3ZCQA 5FIUA 3ESRA 4AG5A 2GM9A 2HTFA 3CH6A 3PDIA 5AOCA 5KYKA 1RPTA 4OKNA 2OQIA 3VH1A 3ASUA 5JARA 4GLFA 1CF2O 3D0OA 4XWYA 1QFMA 4DLTA 3UMYA 2OFWA 4UU8A 5JQWA 3Q0EA 1E4OA 1FXSA 3GEPA 4XYEA 1JEJA 1P2FA 4QLBA 3DZFA 5GONB 2I8AA 3IH5A 2CXXA 2P9FA 3UGKA 1U1GA 1LPOA 3B8HA 1AZTA 4LXTA 5L3ZA 2ZRJA 3G1WA 2DGDA 2Q6LA 5B4TA 1QP7A 1F0PA 5JCOC 2F4VB 4HNQA 1EWRA 1SKMA 1T24A 4M0LA 1EINA 1L1FA 4Z6KA 1KL7A 3ORQA 1C7JA 1Q57A 1ZD9A 2XYVA 3AETB 3NORA 3S1AA 2UXBB 1WUHS 3ILHA 4OD0A 3JAWB 2V8BA 3KQHA 3ETCA 4X94A 1AHNA 1SURA 1KO1A 3I12A 4Q66C 2VHWA 1P61B 1EDDA 3G8AA 3PFGA 3DXFA 2PMEA 4B9EA 1L0BA 1RWWA 1TYDE 3P9NA 2O2GA 3MC1A 2D2EA 1DADA 3VDXA 3GZNB 1TL7C 1G5FA 1USVA 1H6BA 4ZVMA 1F2TA 1BSVA 1MC5A 2V1UA 1PR0A 4ENTA 1QFYA 3E48A 4TT3A 2NZJA 3V55A 1XCGB 4JJ7A 3AV0B 1PF7E 2I80A 4RHYA 3BA6A 4ATNA 1IE3A 3H04A 2BKVA 2AL7A 1B26A 1Z28A 2GA8A 1YA8A 2GXUA 1UODA 4LZLA 1GGVA 2I2CA 2O23A 4MITA 4OOEA 2LV8A 4RD0A 3ESXA 4DIBA 1ZUWA 4IOKA 3THWB 4TS3A 5JD3A 7MDHA 3HP4A 2EKBA 4CLEA 1UR5A 2RONA 4F2GA 3WBKA 4JXXA 2J9FB 1JA9A 1SIBE 3ESCA 2BWJA 4QYSA 3IUBA 4Z1MA 1WCYA 3UAYA 1G2OA 2C99A 4JWKA 1TU0A 3CXRA 4LZNA 4DIKA 4INPA 2JIZD 4KYUA 3P97A 4K03A 3SDSA 3PPWA 3FD8A 3ZXUB 1J39A 1XMSA 4GE3A 3T9CA 1WOMA 4FUQA 5E2AA 5L3QB 2V7EA 4UD6A 3FPGA 1USKA 4WBNA 3EASA 1YRLA 3OI7A 1XTTA 4N18A 3D8UA 2QUKA 1S3GA 2FX2A 3AY7A 1ZHOA 4RKWA 3MTJA 3TQFA 2TMKA 4OHVA 1YZFA 4KR3A 2E4UA 1RXYA 2X14A 3HJRA 4G5HA 4YEDA <