4CMJA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 91
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmjA00
4BUCA 1I36A 3BIOA 3BMNB 4E5NA 5COAA 1RM0A 1YXMA 1E3LA 2C0CA 3B1FA 3K96A 3ORFA 4WOKA 3OJOA 3GQVA 1LC3A 1QYWA 4Y67A 3SLGA 1I2ZA 4NBWA 4J6FA 2LDBA 1UAYA 4BMNA 3DBHB 4BOYA 1XDWA 4IDCA 7ADHA 1DRWA 1C0KA 1DC3A 4ALNA 3M1AA 4A10A 1P45A 2Q2VA 5C7OO 4R5HA 5KJCA 1JVBA 1BW9B 4IZHA 1DRVA 5F5NA 2GSDA 3PHLA 4Q3BA 4JX8A 4D7AA 2J3JA 3GUCA 4GLLA 4II3A 4XGKA 4YAEA 1PTJA 3O4RA 1LLCA 1PSDA 4BV9A 1P77A 4RVUA 5DOZA 3WDSA 5HBRA 1HXHA 1GD1O 3K31A 3FF4A 1WVGA 3E82A 3ZZNA 1QRRA 1KEVA 1UXJA 2Y1EA 4XJSA 2DPGA 4CMIB 2OUIA 3ANNA 5L4LA 4HP8A 1HF3A 4OQZA 1W6UA 1YGYA 3D3WA 1V9LA 1H6DA 2BI7A 3JQBA 5AXDA 2I66A 3JV7A 1LLUA 4MP6A 2AQ8A 5LDGA 1ML3A 5B12A 1IYZA 4CM1A 3IKVA 2YQ4A 4CLEA 2QRLA 5TGDA 2PZJA 5DOVA 2POQX 1QG6A 1PGJA 1N92A 1KERA 1EFLA 2NNLD 2EW2A 3RI3A 3ZN2A 5AVOA 3CSDA 1C0PA 4Q3DA 2HMSA 4H16A 1NAHA 2WM3A 3R0IA 1P33A 3FD8A 1NQOA 3KM0A 4FQ8A 3CINA 4Y6SA 4YJFA 5ILGA 4J43A 3EMKA 5G0WA 5AXBA 5B1YA 3E03A 4HX5A 3OETA 1EBUA 3JQFC 1R6DA 2C82A 2NWQA 1R4MB 2ZTLA 2E49A 4YJGB 1GU7A 4XDZA 5T8KC 1M2WA 3WYBA 2O4CA 4DPLA 3EY4A 4J1TA 2QQ5A 5KOIA 3EC7A 4W4TA 4XYMA 3JQ8B 4WCFB 4HV4A 1C1DB 2GZ2A 4ZGWA 3JYNA 1Z73A 1N7GA 3C7AA 4FFPA 4J7CA 4OGWA 1BGVA 1YL5A 3WICA 1OFGA 5DP2A 4OSOA 2VHWA 1PZEA 3RD5A 2VHZA 4DC1A 3HB4X 2NACA 2ZB4A 3ANMA 4I08A 1V3UA 2P4QA 4BNVA 4DYVA 5KCZA 3KSUA 1E7SA 3PVZA 2HK7A 5L3ZA 4JGBA 4WGGA 1QV6A 4OKNA 3WGYA 3WBFA 3LC7O 4F46A 2VHYA 4D3DA 5IDQA 2O2YA 1YOVB 2X8LA 1PQPA 1O0SA 4B4VA 1ZVMA 2ZTUA 3DMTC 3ICCA 3E1KA 3IAHA 4MJLA 3AW9A 4D79A 1N9GB 1Z7BA 4PLZA 3WSWA 3JTMA 1ONPA 1V35A 2W98A 3H8VA 3GN1A 4IMPA 1B7GO 3W6ZA 2B69A 5HRUA 3GRPA 3WR5A 4NJMA 2ZYAA 4EI2A 5BSFA 4KQWA 1H0KA 1N8KA 1V6AA 5GMOA 4ITUA 2GN9A 4I1IA 1WDKA 1U3UA 1I3KA 3ZWCA 1VL6A 3PTZA 2IXBA 1J5PA 2GZ3A 4EBFA 1RYEA 4J2HA 1UJMA 4E12A 3AU9A 3C1TA 3NDIA 3N7UA 5TLSA 3PEFA 1X7HA 2Y1DA 5B4VA 3JQGA 2O50A 4GLOA 3WGOA 4CM4B 3HN2A 2E37A 3DBLA 4A73A 4F6LA 1XEAA 1SOVA 4HADA 3GZ4A 4YEDA 4O1MA 2NTJA 4P4NA 3PP8A 5TS3A 2Y1CA 1AHHA 3QWFA 4Q3NA 3CPSA 4WE3A 1NNUA 1GQ2A 1R12A 4GX0A 4D43A 5A3VA 3L4BA 4EDFA 2HMVA 2V65A 1ONOA 1GFSA 2PD3A 3SEFA 3NJ4A 4M86A 1H6BA 4BGIA 1Q1NA 1VRWA 2E6UX 4RVFA 5EESA 2NU6A 5DCWA 3BMCB 1I01A 4P8RA 3ZV3A 3VTZA 4BNZA 4J16A 1VKOA 3MJTA 4HNHA 4OIMA 1GYRA 1S7CA 4YWJA 1HT0A 2VZ9A 1WXDA 1JLLA 1R4NB 3GN2A 4R68A 3QVSA 4BHTA 1U8FO 3GOHA 1HL3A 3D1LA 4TQGA 3NGLA 2FWMX 3OFSA 3WGZA 2O3SA 5T57A 2AG5A 3H65A 1P44A 1EE9A 3ZCXA 1S6YA 3HQ4O 1FDSA 4NBUA 1PJCA 3ZNOA 4WCFC 4PN3A 1D1TA 2R00A 1EE2A 5EL0A 3DEYX 4XGIA 1SEPA 2O2SA 3TNLA 3MTJA 5CAEA 3WTBA 1YQGA 2FN7A 4Q3CA 3TQHA 5IZ4A 3R3JA 3RWBA 1NM5A 1G1AA 2VUUA 4WK6A 1WDLA 3VDRA 3BA1A 4PZCA 1WLYA 5G4LA 4DYDA 3JQAD 1K89A 1ZJZA 2AQKA 3GVIA 4B3HA 3CEAA 1EVYA 3F46A 5KNLA 1N9GA 3M2PA 2J3HA 2V6BA 4RDIA 2WDZA 4NBRA 4GQAA 1UXKA 3NTQA 4J1NA 3DBHA 3CXRA 3FPLA 1IY8A 3LF1A 1V3VA 3P7MA 3ZWBA 3KXDA 3FTPA 2DKNA 3ASVA 1ISFA 1AHIA 2ZCVA 3FNEA 3KEOA 4LVCA 4NU6A 3BHMA 5KVCA 2GRAA 4YJGA 3S55A 4RCVA 3IJPA 3LQFA 3LT2A 2FMUA 3I52A 1ISJA 4I9NA 1DC6A 1C1DA 4CM5A 2B35A 1NR7A 4FFNA 4FJ0A 4AJLA 4BO6A 3ETEA 1PGQA 5H83A 3TJRA 1BSVA 4NQZA 3DHYA 1A27A 4WEQA 1E7WA 1T24A 1I33A 1NVTA 3LK7A 2HLPA 3WG9A 1XCBA 3GNTA 3HWRA 1HLDA 1DLJA 1X7GA 4HY3A 4B7CA 4PLTA 1N5DA 4Q3EA 5I7FA 3C7DB 3PJEA 4O6VA 2W2LD 4GGPA 1Z45A 1YH3A 2X9NA 2NVUA 2AA3A 1IPFA 3ABIA 5CDGA 2TMDA 3KSZO 5JDIC 3ZWXA 2VWPA 4O59O 3CZMA 3OIGA 4HKTA 1MB4A 1C3VA 3PGJA 5MDHA 2OP1A 4GGOA 4FOOA 1LA2A 4JBHA 4ILKA 2EP7A 6ADHA 4OQYA 2AEJA 1YO6A 4MVJI 4OJNA 1R4NA 2EF1A 4CLHA 1HDGO 1QYVA 1HDZA 1IULA 4B7XA 1GCUA 3INTA 4LW8A 1Y9EA 4EEXA 3DB2A 3GPDG 2NM0A 3ZNQA 1PJ3A 1Y8RB 1L7DA 2BI8A 5DNAA 3RU7A 4C7JA 4CM8A 4CV2A 1F12A 5L40A 4WUVA 4TSKA 1PJ2A 2HDHA 2RAFA 1Y6JA 1E3WA 1ZH8A 2ZK7A 3MJVA 3KUXA 4PLYA 1RM4A 1IE3A 1RM3A 4HFMA 4I9HA 4NFHA 1F8FA 3MOGA 3F3SA 5I8ZA 5I9LA 1A9YA 3OIFA 3GT0A 2Y0DA 1EFKA 1WDMA 3NT4A 4PLFA 5K9ZA 4CM9A 5KKAA 3UVEA 4B4WA 1BXGA 3BAZA 4GKBA 4AJKA 3EZLA 1F06A 1T2EA 3AUAA 4IDGA 5T6BA 4DIOA 1F17A 2YHUA 1NXQA 2BGKA 5GZ6A 3GG9A 4DC0A 3LSYA 2C2XA 4ROSA 4RORA 3UH1A 1PQWA 2BKAA 2I9PA 1IHXA 1GPJA 4EJ0A 4XRGA 1YQXA 1X14A 2VN8A 3DHEA 1O95A 1T2DA 5IDYA 3CZRA 5EN4A 3ZWAA 4F3YA 3WLFA 4NU5A 3WJ7A 4K6FA 4EUFA 2IZZA 4RPHA 2Q99A 2UUOA 3TPCA 3LZ6A 3DAGA 1YBAA 3NT5A 4YQZA 3BMQB 9LDBA 3DXFA 4AFNA 1LSUA 1XKQA 4B3IA 5T64A 4E5YA 1OI7A 1JW9B 4IIVA 3I4FA 4QUKA 2CFCA 1NPDA 3DZFA 1ENPA 5C5IA 1Q2XA 1X7DA 2XPCA 3H2ZA 3L6OO 1E7MA 4XQEA 1HDRA 4JP3A 5L51A 3SLKA 2PV7A 4UVGA 4UUOA 5COBA 3HSKA 4NFYA 4BKRA 3F1LA 1LLDA 4BNWA 1T2CA 4WLFA 4CQLB 5HS4A 2A4KA 3Q2KA 3DONA 3FNFA 3TSCA 4BV8A 4RQUA 3S2FA 5LDHA 3R6DA 4CM3A 3K73O 1EVZA 4BO0A 3LT0A 4L8VA 4CV1A 2BH9A 5KWEA 1KS9A 1RM5A 3DZGA 2G76A 2WYVA 4WNCA 4TVOA 3R3SA 5L4NA 2X23A 4DA9A 3JQAA 3SC6A 2GF2A 1WP4A 4CLRA 2UYYA 5CFZA 2O4UX 1R0KA 3KB6A 5CG1A 1BVUA 1XG5A 3OEWA 5G0VA 3WBBA 4ALIA 5JY1A 1VL0A 3PI7A 3QLJA 1JQBA 3SJUA 1RPNA 3DTYA 2EGHA 4MVJH 4YXFA 1XQ1A 2FPIA 1K6IA 4U7WA 3DZIA 1ZSYA 3GA0A 5TJ9A 5K0ZA 3KYDB 4ID9A 5EINA 5JDCA 1U7TA 4DPKA 2P4HX 1I3LA 4AJPA 2WYUA 1U4SA 5G2OA 1I2CA 1EVIA 1X0VA 1R0SA 3K9QO 3IQDB 3WGTA 4A7PA 2CVOA 3DL2A 3W6UA 3U4CA 3QY9A 3ENNA 2DBZA 3IUSA 3HFSA 1MC5A 3ZWPA 2VRCD 2IYOA 2VOEA 1T4BA 1SB8A 3O9ZA 2I99A 1B14A 4R1NA 3JQ6A 2DAPA 2DU8A 5KJ1A 3G17A 3PFFA 2NADA 4BIIA 2H1SA 4I5EA 1K3TA 3WXBA 3QWAA 4AJIA 4XIYA 5GZ1A 1PGNA 2ZYGA 5JPIA 3C85A 1UXGA 3HJAA 4NR0A 1DFHA 2Y05A 2HAEA 5IDXA 4K6CA 1Q0HA 2CDAA 1JAYA 4FOSA 2BD0A 4LK3A 2NUAA 1HE5A 1TI7A 3BTSA 3E9MA 1YJ8A 3RC2A 1LSSA 1EZ4A 3ZV5A 4LCJA 4CMBA 3EW7A 3ITDA 1LDMA 2CVZA 1MX3A 5IFLA 4QQRA 4AJ2A 1KBZA 3TOXA 1V3TA 3PHJA 4K26A 2CDBA 4XEHA 1J6UA 1F0YA 1NBOA 5ICMA 4FB5A 3L9WA 2O3UA 4MINA 2E48A 1SPXA 3GDGA 5DBGA 3IC5A 1I0ZA 1VKNA 4NBVA 1O9BA 2W8ZA 3O8QB 3BMNA 3DFUA 2JD0A 4OOEA 1X15A 4J49A 4RF2A 2GYYA 4YJHB 4CODB 5JXWA 3TRIA 3UGKA 5CG2A 1GYQA 3H5RA 4P4LA 1PIWA 2ZTVA 3AY7A 4WLOA 4EITA 4KP7A 1TA4A 4N7RA 3UCEA 4L4RA 4GVXA 4PG7A 3N58A 1L7EA 2D2IA 4FSHA 4U0JA 1LNQA 3PQDA 2VRCA 4GX2A 2C59A 2B83A 1HLPA 5JMWA 5JC8A 1JTVA 4AJ4A 3MOIA 4DLLA 5EQFA 2VUSA 1J49A 4ZRNA 1K0UA 1PEDA 3KOUA 4MIEA 1A4UA 3RVDA 4J2OA 1DJQA 2I6TA 3QQPA 3HG7A 1VJTA 4RVHA 2A92A 5EJ2A 4E30A 4BS9A 5AQ1A 4Z0TA 3L07A 3ZU2A 1UP6A 1HYGA 4FW8A 3D3WB 4CM9D 4JBGA 4R3NA 3GZNB 2DUWA 3UHAA 1NYTA 2AEFA 3WSVA 1A7KA 3GVPA 4BQPA 1NQ5A 9LDTA 8ADHA 1GDHA 2A94A 3WYEA 2PKRA 2NVBA 1DC5A 4XQGA 4PGFA 2WSBA 4FPXA 1JWAB 3VZRA 4AVYA 1SOWA 1YWGO 3B6ZA 2B0JA 1PJSA 4NG5A 1DAOA 3Q1LA 1IL0A 2ET6A 3GC6A 3V2HA 5ER6A 3PFWO 4W7HA 3BTOA 1GV1A 4TKLA 2JHGA 4MPDA 1QXSA 1Y9AA 3T7EA 3AOEA 1KC3A 5I9NA 1HE2A 4IXTA 2J6IA 5A1TA 3IKTA 3LLVA 2HU2A 3TFQA 1ENZA 3P5SA 3LT4A 1MV8A 3AI1A 5L7YA 3FTNA 1HETA 3UF0A 1QYXA 2PGJA 1DFIA 3EDMA 3AY6A 1VJ1A 2Q46A 1IB6A 3ZWYA 4BVAA 2UDPA 4AJOA 2CSUA 5I7EA 3JQ8A 4WJZA 1QV7A 4W9NC 3EZYA 4YRDA 5JYEA 2WD8A 4MKXA 2NQ8A 3ZW8A 2NQTA 5F21A 1XU9A 4N5NA 1VC2A 1F14A 1E5LA 4LRTB 1P0FA 4LGVA 1U5CA 3LC2O 1U3VA 4O5OA 1T2AA 1ZK0A 2PKQP 1EQ2A 3FNGA 3H9GA 1I10A 1NVGA 2J5RA 3PHGA 1Y8RA 3JD3A 3GEDA 2X0IA 1NHGA 4HXYA 4ALKA 1LSJA 2AEMA 2XOXA 3GPIA 3O03A 1HDOA 4XDYA 2QRJA 2G17A 3PYLA 4DVJA 5HWSA 4CL8A 2PR2A 4IJUA 4D44A 3H6KA 2E4AA 3SJ7A 5L53A 1B8PA 4RPLA 5THKA 1Q7CA 2V6MA 1SZJG 3PHIA 4MVJP 1ENOA 3ULKA 1K2WA 4XRRA 8LDHA 1LDBA 1VJ0A 1EMDA 4GPD1 3DDNA 4D45A 1TT5B 3I6QA 1YOVA 1EUCA 5FEUA 3BXXA 3QWIA 4CL3A 3NTOA 3S2GA 3PGXA 4OAQA 1T2FA 2YJZA 2HK8A 4UULA 5TF4A 3VOSA 4R1TA 1A72A 3I83A 1SB9A 3TF5A 1JKJA 4QXMA 3Q3CA 3PJFA 3RFVA 5IN5A 3GDOA 4BNKA 4J9UE 1JU9A 1TXGA 1I5RA 4OH1A 3AY3A 3FHLA 1ISIA 1K6JA 3OJLA 2Z95A 3HDHA 2O7QA 2XF8A 4WLNA 4BO8A 3NAQA 4U6SA 2Q1WA 1M6HA 1Q0QA 4XD2A 2EHDA 4RVSA 1UR5A 3AFMA 2X1HA 5T8KA 1ZMOA 3F1KA 5TIIA 5U1PA 3W1VA 4KMSA 4ND1A 3DZJA 1UZLA 3NEPX 2ZB7A 2NU8A 1WWKA 3IJRA 4INAA 2DTEA 2C5EA 4M49A 3WMWA 2ILTA 4C7KA 1MFPA 3KYCA 5IZCA 1F8GA 1DHRA 1C1XB 3PIDA 5JCXA 4II2A 3ROKA 2YQ5A 4IXWA 1YBVA 3G79A 4FJ1A 4FR5A 1PL8A 1RJWA 2FPGA 1OZAA 1SCUA 1YB1A 2ZKLA 4PG5A 3DHNA 5JO9A 1SMKA 1MXFA 3PK0A 4H15A 2GD1O 4OXKA 2G0TA 1P0CA 3PZRA 4FD3A 5FYDA 3NT2A 2Q2WA 1WMBA 1FDUA 3DBRA 4GSKA 4H7PA 1MC4A 4W9NA 1ONNA 3MZ0A 1NX6A 5G4KA 4ND4A 4KTVE 1FK8A 3GFGA 3T4XA 4YJFB 4FC7A 3IDSA 2OL4A 5DZSA 3ICPA 1KVTA 1PWZA 2ZJ1A 5I9MA 4MP8A 4RF4A 1OC4A 4KWHA 5A9RA 3DO5A 4Y6PA 4DIBA 4FFRA 1I8TA 4FGSA 1AUPA 4CV3A 4AJJA 3E48A 2AMFA 4BNNA 4Z3DA 4J4TA 4NH4A 3T4EA 1H94A 1Y1PA 5KIAA 4A0SA 3TDKA 4HWKA 3IIEA 5LCXA 2Q49A 1MA0A 5F1PA 2EERA 1IZ9A 4RV9A 1LBEA 3O8QA 2PGLA 4A27A 2PD4A 2VOJA 2X86A 3KO8A 4OHUA 4EYEA 4MIOA 3JQ7A 4WLUA 2RH4A 4CPDA 4E6PA 4PVDA 4PG8A 2X5KO 4IZIA 2PH5A 4I5DA 3EUWA 4N18A 4ZJUA 1H2BA 2HJSA 4ZVVA 3V8BA 2X0JA 2VNAA 4MVJE 3JQDA 1MG5A 3RKRA 2FZEA 1EQUA 2JFGA 1DIHA 4IPTA 4XCVA 4DBVO 1ZIDA 1ARZA 4CMHA 2VT2A 1H9AA 1ZUD1 2QW8A 1JDJA 3W4KA 4PG4A 1NQAO 2X58A 2UUPA 3OJEA 1E1KA 2VRBA 2GNAA 1DDOA 4IJVA 4PLWA 4NNJA 3TZ6A 1LXCA 3GNQA 4DMLA 2WYWA 1YONA 2Q1TA 1GY8A 3AK4A 3HADA 3TZQA 2BFPA 2BHLA 3E5RA 2PY6A 4L0QA 4GX1A 2J8ZA 1EVJA 3P2OA 3RROA 5MGBA 1PZHA 2BRUA 1PWXA 4MKRA 4W99A 4KTTE 1E7RA 1JKFA 2GCGA 3FSRA 2AHRA 1OAAA 3H9QA 2DT5A 2P5UA 5A05A 2B4TO 3SXPA 1LRKA 3WGQA 1XSEA 4HUJA 3AM5A 4G81A 4RPGA 3TZHA 4J0EA 4LISA 4BNLA 5JAMA 2HMTA 1MLDA 5G0TA 5T67A 4E4YA 2YV1A 4BNFA 1E6EA 1MXHA 3HE3A 2Y68A 1ZK3A 1K6XA 3C1OA 3H7AA 3JSAA 2WMDA 4R01A 4MO2A 1A4IA 3HHPA 5CEJA 4RGBA 3EK2A 3AI2A 1UAGA 1E6WA 4TVBA 3DBLB 1Y8QB 1VM6A 1YRLA 2O3RA 4LVUA 4DREA 1R37A 1CERA 1ZBQA 3EAGA 1B3BA 2A9FA 3EVTA 3WGGA 5B4TA 4O0LA 4BKOA 1ZK4A 2EP5A 4QSMA 3U9LA 2OMEA 2O3JA 2WD7A 2ZJ0A 3AWDA 5C7IO 1SBYA 4KZPA 2H6EA 2EG9A 5F1OA 1G6KA 2CZCA 3CH6A 4QFCA 3BHIA 4IM7A 1LJ8A 4GI2A 1FDVA 3E9QA 1LEHA 4R4JA 4BNGA 4E21A 4GWGA 1R66A 1XIVA 3A06A 4M8SA 4XWYA 4R51A 3G0OA 4MVJG 4XIJA 1CQJA 1UZMA 3NJ8A 3QA9A 1B15A 3JQEA 4NIMA 3H3FA 1QSGA 2J3KA 3DR3A 3PXXA 1BXGB 1HE3A 2C20A 1ORRA 3K30A 4OXYA 4IBOA 5AYVA 3JQ7B 1E1NA 1PJLA 1HYEA 1KY4A 1ZKMA 3OSUA 1VSVA 4FN4A 3KLMX 4TWRA 5A5FA 1JKIA 1D8AA 5KJEA 5BSHA 2ZQYA 2Q4EA 3SVTA 3DMYA 4RJTA 3H2SA 2H5LA 4JQCA 5GY7A 3ZWWA 1AGNA 1R16A 2GGSA 2GUGA 3PRJA 4WNIA 5C3MA 3WFJA 4N5LA 1TT5A 2D8AA 1RYDA 3WFIA 2EV9A 3D4NA 3QWBA 4D3SA 2FR1A 4JLWA 2BFAA 4TRRA 1U1IA 2C07A 3MWEB 4DXHA 1QLHA 5I7VA 5IN4A 1LQUA 4NJOA 3GVXA 3UFXA 1B8VA 1PJ4A 4KQXA 1B8UA 2E82A 3MJCA 2NVWA 3KEQA 4IUYA 1YB4A 5CDUA 4CLOA 4M54A 3E8XA 4HFRA 3RSHA 1E6UA 2VZ8A 1IUKA 4FGWA 3WNQA 3U4DA 3HDQA 4I5GA 3CMMA 1XLTA 3L4SO 1QR6A 2GN4A 2QZ9A 1ENYA 4XQCA 1LI4A 3W8EA 4QECA 1DHTA 1A71A 2W2KB 3ENKA 5U4QA 1ISMA 1YS4A 3R1IA 4B7UA 2BF7A 4O63O 2HRZA 4XYBA 4DWVA 4LMRA 4CUKA 3OHSX 4RL6A 1JWBB 3GG2A 2PD6A 4NMHA 2Q4BA 4A26A 4JJGA 4D3FA 1U3WA 4E5PA 1CETA 3G1TA 4UEKA 4YCAA 2R00C 3TZKA 4JROA 4F45A 3EVNA 5DF1A 1HZZA 2P5YA 3Q2IA 4YR9A 3RUDA 2VWQA 3CMCO 1EUDA 2PGDA 5JCJD 1YDEA 3FR7A 3WOHA 1ZK1A 1B0AA 2HMUA 3DMTA 3OQBA 3V2GA 2VHXA 4EUHA 4N5MA 3VH1A 4BO2A 3E18A 1Z74A 1NPTO 3GY0A 1NWHA 1B2LA 4WPGA 1FDTA 2X0RA 4DIFA 1IPEA 5HTOA 1WZIA 2I67A 5BSGA 1LRLA 3LLSA 4U0KA 3GGPA 3OH8A 2Q3EA 4QTZA 3TZCA 3I6IA 2CDCA 1WPQA 3FN4A 3JYLA 3VPFA 5ITVA 4EGFA 4J0FA 3DC2A 3UICA 4BB6A 1ZSVA 4CV0A 5HM8A 3C8MA 1VLLA 2ZYDA 4BNJA 4HFJA 3RFTA 2UAGA 1YQDA 4U5QA 1PJBA 4XX0A 5DCUA 5CEEA 4UREA 4IGFA 3L9XA 1P31A 5JYDA 4ALLA 4E31A 4CLDA 2FY8A 1YL7A 2HKIA 4BNUA 1U4OA 4OOFA 3WB9A 2DTXA 1X13A 3LT1A 3WJAA 4J1QA 2B5WA 2YV3A 3ROPA 4Z3KA 3RAJA 3NRCA 1U2DA 1M66A 1NQTA 4WCDA 4FFMA 5BSEA 1EK6A 3B20A 4CMGA 4QEDA 3I9OA 4Z6KA 4TZKA 4OKIA 5BNTA 3KYCB 5BR7A 1QMGA 1ZSNA 1QKIA 2IZ0A 4FS3A 4E3ZA 2ZB8A 4BGVA 4AJHA 4IDEA 3VKVA 4RVGA 1T26A 2OFPA 3ZNPA 3ZWMA 1YVEI 4W82A 2C7GA 3I4CA 2JD2A 1AXEA 3KSDO 3KLPX 1WNTA 1NFRA 2Y67A 3TL2A 3U5TA 1DC4A 1EUZA 4R1UA 4RZHA 5DN9A 5L9AA 1B26A 3NDJA 4QFDA 2WJPA 3NYWA 3RBXA 3U62A 5L95A 4LSMA 3M6IA 4ONEA 1FXSA 3W4JA 2D5AA 1G0NA 1LDYA 1GQYA 3QP9A 1NVMB 4BKPA 4BNMA 2V6FA 4LMPA 3RCBA 1J0XO 2QRKA 2PA3A 1BHSA 2Q50A 4RDHA 1UUFA 2PH3A 4I5FA 5IF3A 1GAEO 1DIAA 2JFHA 2VWGA 3VDQA 4R54A 4KWIA 3RC1A 3OMLA 5CHEA 3VZPA 5A4DA 2RHRA 3LVFO 3WQSB 3ZU3A 5JBIA 5DDIP 1DXYA 4JP2A 1MGOA 4DTIA 3W8DA 3V5NA 1VL8A 1PR9A 2D1YA 2JKVA 3JYQA 4GBJA 2YW9A 1AE1A 2DBRA 4R5MA 2P9EA 1H6CA 4J7XA 2Z1NA 4FIZA 4PZDA 3H9UA 1XR3A 4E2ZA 4Q39A 1BRMA 3CIFA 2PFGA 3QRWA 5JY6A 4RZIA 2IEBA 5C7LO 4IQ0A 1DOHA 1ADCA 5L4SA 2B5VA 1E3IA 4B4OA 4IDDA 2DUUA 2BGLA 4J4BA 3JQAB 4GH5A 3RUEA 3KVOA 4JN6B 4Q3AA 1NPYA 3V2UA 1PL6A 1UDAA 4Y98A 5H82A 1LLQA 3NV9A 1Y7TA 5FI3A 4IIUA 1NFFA 3IL2A 1YL6A 4DGSA 4BO7A 3F9IA 3GGGA 4CMKA 2X7HA 4EUEA 2W2KA 5IZCC 2JHFA 1P1IA 4XKJA 1LC0A 3KYDA 3C1AA 4JCOA 3DTTA 5CP8A 1H9BA 2NLOA 4DQXA 1OOEA 1JN0A 2EXXA 2DQ4A 1KIFA 1HWYA 3LC1O 1LU9A 3DOOA 3UOGA 3H5AA 5JO0A 3QHAA 4BKQA 3TL3A 4I9UA 1C0IA 1WMAA 3PWKA 3WYCA 4YPOA 2J5QA 5JDIA 2VCYA 1E7YA 1GTMA 3NGXA 4LCEA 4UEJA 5FF9A 4ZQEA 1P1JA 4ALJA 4EJ6A 1KVRA 4R41A 1Z6ZA 2RIRA 4RLHA 3ZHYA 1PZGA 5IXYA 2RCYA 1B16A 2QYSA 4YQYA 6LDHA 1K5HA 4TRJA 3VVCA 1I30A 1E1MA 2EW8A 2HMWA 3QSGA 3ETDA 3OJ0A 4A2CA 1BVRA 4DLBA 2V6GA 4OYRA 2CF5A 4JJIA 4UVHA 5CDTA 3RUIA 4LSWA 2IODA 2G1UA 1SNYA 1KVSA 3DOJA 3AJRA 1NHWA 4TKMA 3PDUA 1MFZA 5DT9A 4G5HA 1MUUA 5BNFA 4URFA 5BNIA 2HRBA 3RUCA 5IDWA 3FBGA 4OO3A 1NR1A 3WLEA 2Y1FA 2BMAA 4BKUA 4IS3A 2VNSA 3AUSA 1LX6A 3MJEA 3INGA 4MVJD 3DOCA 3OICA 3X2EA 3I1JA 3VKUA 4D41A 2C2YA 2X5OA 1HE4A 2XAAA 4YT5A 1KC1A 2OHXA 1BDBA 2AXQA 1ADFA 4UVEA 3HDJA 4OL9A 3VC7A 2D4AA 5IAAA 1O94A 3FI9A 3GK3A 2CMDA 3D4OA 1WAMA 1FDWA 5EQDA 1BXZA 3UCFA 4MVJA 4GX5A 5JW6A 3U0BA 3GH3A 3O38A 4OM8A 2SCUA 1EBFA 4XA8A 1LTHR 3FRJA 1R0LA 3F5SA 4E33A 3A4VA 3NUGA 3RC9A 3D3EA 2PLAA 1CDOA 4PLPA 4CM7A 2PZMA 3JQFA 2DM6A 3AI3A 1VPDA 1LDGA 4MIYA 3MJSA 2VQ3A 4TROA 4M55A 2LDXA 3ASUA 2VYVD 2FSVA 3PZBA 4Y6RA 1BTOA 2Y0CA 5GZ3A 4HNGA 3RBZA 2OBYA 5AXCA 1Y5RA 5ER9A 2BFMA 2D0IA 3WWZA 2Y0EA 1C1XA 4ZN6A 4Z0HO 1E0DA 3IS3A 2UV8A 3I9NA 1Z75A 1D3AA 1OBFO 4R9SA 3WS7A 5EERA 4CLXA 4CMEC 3AFNA 3WQRA 1E3WB 2FPPA 3WTCA 4IMRA 4D46A 3U09A 4K9DA 2ZTMA 3K8ZA 4EZBA 3RUAA 4NHEA 1TVEA 2A35A 3D64A 4PLGA 5TNXA 5U9CA 4BO3A 1DO8A 1E92A 2P9CA 4PLVA 5KVQA 2NVUB 3OA2A 4YA6A 2QZZA 1Y81A 5TSDA 4AJ1A 2X9VA 2I3AA 2YV2A 2DVMA 2JAPA 4L4SA 1GUZA 1NTOA 1ZK2A 2P91A 4AG3A 3WGIA 3I9JA 4P4GA 2UVDA 2G5CA 3INRA 4XGNA 5CPFA 1H6AA 1W73A 1U7HA 1QLJA 4NI5A 2PNFA 1ID1A 4BNTA 4YT2A 2J3IA 1O8CA 2DPHA 2OP0A 2YUTA 2X22A 3V1YA 5JNLA 2YFHA 4R1SA 2AW5A 3P2YA 4WLVA 4ZQHA 1LUAA 1SO8A 2HK9A 4YT8A 1KEWA 3QJ5A 4DPMA 4WEOA 3S1LA 1R4MA 5T5QA 1KY5A 2NV6A 1P1FA 5TT1A 3QWHA 1ZO8A 2O3QA 3ZWNA 4F6CA 4AJNA 4FDAA 1ZEMA 3VH3A 1E3JA 5JDCC 4PIVA 1I24A 4HFNA 2I65A 4ND5A 2G82A 4B79A 2X6TA 3I3OA 4CR8A 2I5PO 4TRMA 2FR0A 1XYGA 1PGPA 4YAGA 3OEYA 1BWSA 3SX2A 1XU7A 4BNHA 3K6JA 2VWHA 1AXGA 1QYCA 3ROMA 4JK3A 1P1RA 3STHA 2PWZA 4G2NA 1B3RA 5F3RA 1YJQA 1GADO 4OSPA 1YDWA 3WWYA 4J91A 4AICA 4UVIA 3JD0A 1M6WA 1CJCA 1ULUA 3W4IA 4HBGA 3JCZA 1E77A 3OECA 2D5CA 3OP4A 3L4BC 5ITWA 2H9IA 3UKOA 3ADOA 2VUTA 4YAKA 1P3DA 4B8ZA 4NPCA 1C14A 1GZ6A 3HDYA 3I9MA 3KBOA 3OQ6A 5B4UA 3VPSA 2V7PA 4U8GA 4A03A 2ZIZA 5EPOA 4YRAA 1CQIA 2AQIA 1D1SA 3NKLA 3RJ5A 5A04A 4BO4A 1QP8A 2W90A 5DCYA 4MVJF 1GYPA 2CUKA 5KKCA 1UP7A 4YAIA 1XQ6A 4XR9A 4CLRB 3M1LA 1Q0LA 3TOZA 1YE3A 4TRNA 3PQFA 3KZVA 3KYBA 3GDFA 2IDZA 4ZQGA 5LC1A 4ND2A 4L75A 3QV1A 4B8WA 2IXAA 1E3SA 3L0DA 3PLNA 1DLIA 2O48X 4UAGA 3PLRA 3BYZA 4FBGA 1IOLA 4XZ3A 5F5LA 4RLSA 5H81A 4RF5A 5CDYA 3FPCA 3D5TA 4BO9A 3BMOB 5I7SA 2Q1SA 4BMSA 2JJYA 4BGUA 4J1SA 3VPGA 4R69A 1W0CA 1DEHA 4FFOA 3JQBC 3NDRA 1KEUA 1UDBA 3IP3A 4E5KA 4GMGA 1GZ3A 3LF2A 1HZJA 2O7SA 4BNIA 1DAPA 2EKPA 3FWNA 2W2LA 4MDHA 3GVHA 5TQVA 1SC6A 3RBVA 4PZEA 3V1UA 4Y9DA 1DIGA 1XA0A 3JD1A 5ENDA 2HCTA 4P22A 4KDEA 2F00A 4WKGA 3A28A 4MOWA 1PU2A 3A9WA 4R9RA 2WWRA 3DFZA 2WEKA 2FR8A 3RU9A 1X0XA 4QO7A 3BMCA 3ZU4A 1PS9A 4ALMA 3CUKA 2B37A 4L74A 3V1TC 4CMCA 4CQMD 4DQUA 3DAPA 4RPJA 3EHEA 3MJ4A 3UAGA 3B70A 1E5QA 5JAQA 3ZI0A 5L45A 3NX4A 4R3WA 3KHUA 2YDXA 4X54A 2AE1A 2ZQZA 2DC1A 4YVFA 5IXSA 3I23A 4KUEA 4PVCA 1P1KA 1U2GA 3JD2A 1DIBA 4UUNA 2FRDA 4ZD6A 1E7QA 5A9TA 1BDMA 1ULSA 2B36A 2Q1UA 2X4GA 4YDRA 3H4VA 1T1RA 2VTEA 4IQGA 1ZW1A 1XHLA 1GEEA 2IE0A 1LRJA 3PWZA 2BLLA 1TLTA 2PZKA 2CF6A 3VH4A 3B1KA 1EK5A 3FNHA 3IUPA 4ZQFA 3F4LA 2O3TA 4CMJA 3GRKA 1U5AA 1DB3A 3E5MA 1DJNA 4RO0A 4C4OA 3AM3A 4IDAA 1M75A 4JBIA 2HQ1A 3M2TA 2B4QA 4CLOB 3BTVA 5KTKA 2GN8A 2WD7B 3PWSA 4RPKA 3RIHA 3ZWVA 4NZ9A 1GL3A 3WIDA 5KVVA 1PS8A 1E1LA 4L76A 2AQHA 2D3TA 3D0OA 3ZHBA 4R16A 2DLDA 3JQCA 5G0SA 1SEVA 3PHHA 3AM4A 3NTRA 1MG0A 4YAJA 2DBVO 4GMFA 3COSA 1LDEA 3DBVO 3VVBA 3BMOA 3FBTA 1D7OA 3AUUA 1HDCA 1UXIA 2P2SA 3HN7A 5A03A 1PZFA 1EDOA 2RBEA 4IJWA 4EW6A 2OOSA 2Y93A 3UN1A 4ZA2A 3U49A 3ZHZA 2HUNA 1HDYA 4NBTA 1HEUA 1CWUA 4XQ9A 2JCYA 3GAZA 3L6DA 1V8BA 2H63A 1PL7A 2HJRA 2WTBA 3GZNA 2GDZA 4ZQBA 3RKUA 3GHYA 4MKZA 2P9GA 4LN1A 2GN6A 2PTGA 3FCOA 3RFXA 3VPXA 1KVUA 1GUFA 4IJKA 3D5QA 3DZHA 3GLQA 2X5JO 1GCOA 2YY7A 4E5MA 4JIGA 4YJDA 4WLEA 3FR8A 4KUHA 5I8WA 4E2XA 3GFBA 2J5KA 3JQGB 4CM4A 4IGEA 2EGGA 2C54A 2NSDA 1NASA 4L4XA 1EEHA 5ICSA 3ONFA 4ZICA 1M76A 1PQUA 1UDCA 2CD9A 3GGOA 2OXIA 3DQPA 3GEGA 3S2EA 5A06A 3ON5A 3T7CA 5K6AA 2PK3A 3OF2A 4H3VA 1E3EA 3G3EA 5ENVA 1I3NA 3A14A 1W4ZA 3TN7A 5BQFA 2HSDA 3ITKA 2NU7A 2GZ1A 3WQQA 3AU8A 3QVTA 4CR7A 3GEMA 1NWCA 4L73A 4BB5A 5JAIA 3GR6A 4BL5A 1N7HA 5A9SA 2IEDA 2P68A 4UVDA 1J4AA 3ONEA 1HSZA 2AG8A 3SC4A 5ADHA 1Y5MA 1HSOA 1QORA 1Z7EA 4NK4A 3S8MA 4BQRA 4D0SA 1GEGA 1CEQA 2C7VA 1H5QA 4E32A 1DRUA 3BZUA 4CQMB 4YRBA 4YB8A 3GMDA 1BXKA 2EEZA 1ZCJA 4BMVA 1DBVO 4PRKA 3KV3O 3ST7A 4TMFA 4AJEA 4QT0A 4RVDA 5IG2A 4RF3A 4K1LA 3N74A 3H9JA 4XYLA 4M89A 3GF4A 1O5IA 3B1JA 5AXAA 1GPDG 3O26A 4JNKA 3GUYA 4E2YA 3SBOA 2X9GA 4FCCA 1VI2A 2FZWA 1YB5A 4DUPA 4BO1A 4JJFA 4U6QA 2QX7A 1U28A 4YBZA 5L7WA 2O23A 3ETGA 3CTMA 3JYOA 2JL1A 3U4HA 2PZLA 2GR9A 4EEZA 3OIDA 1JA9A 3F47A 4PFJA 4ZRMA 1PS0A 4ZHSA 4CMAA 3IMFA 3OA0A 1LSOA 4DQVA 4QX6A 4W6ZA 1XELA 4WASA 5TC4A 1RWBA 2FSSA 3IOYA 2JAHA 1GR0A 2YZ7A 3DAFA 3L6EA 5ILOA 5AOVA 4IY1A 2JCXA 4Q9NA 4E2WA 1BG6A 3C24A 1PJQA 1P9LA 5JAZA 4TZTA 2GLXA 1U8XX 1UP4A 5TX7A 1O6ZA 3Q11A 5JSFA 1ADGA 1GV0A 2PKQO 2IZ1A 4ND3A 2NU9A 4DRYA 5FWNA 2D59A 1L1FA 1I2BA 3ROQA 2DBQA 3RUFA 2XXBA 2TMGA 4J4HA 1NP3A 3IP1A 3MCVA 2Y99A 4XYEA 4XB2A 2NTVA 4RQTA 3D4PA 4UEOA 2YYYA 3PJGA 1JAXA 3OQ1A 4GKVA 4CUJA 4E13A 3WNVA 2Y1OA 4IDBA 7MDHA 2OO5A 5KJFA 2OBNA 1WZEA 3PDJA 1G0OA 3K2BA 2XXJA 4FC6A 2CNBA 3EGOA 4KOAA 3OJFA 4PCVA 5FI5A 1KEPA 1IHYA 2IRWA 3I5MA 5K6AC 3ZH2A 1ISHA 2Q45A 2VZ0A 2EJWA 1IZ0A 1FF9A 3CKYA 3GHHA 3GMSA 3H5NA 1OC2A 4Y8VA 3ZGYA 3WGHA 2VYNA 5JLAA 3WMXA 1P1HA 2W4QA 4S1VA 2EIHA 1R15A 3QE3A 1PJTA 1YKFA 4PG6A 3ZWOA 3ZV6A 4NDNE 4WOJA 5G4KB 3HZZA 3LU1A 1DFGA 4BNYA 1CF2O 1YBMA 5TT0A 5JFOA 3RASA 4DBZA 1XWFA 3VTFA 4WECA 3ZNNA 1XGKA 1A5ZA 4CMIA 3JQ9A 1DPGA 3JD4A 4CM8B 4DL9A 2OZPA 3Q9UA 3UUWA 3L77A 5HS6A 4E0BA 1KETA 1HYHA 2QIOA 3HNPA 2VYVA 3Q9NA 2QYTA 2BGMA 3VH2A 3RUHA 4A5OA 4AL4A 3G1UA 3KTDA 4IINA 4W7IA 2YHIB 4XB1A 2X0NA 3ZDFA 1NAIA 4CQLA 2JD1A 2VYND 3RC7A 1ZFNA 1HDXA 3F5QA 2FHSA 1VE9A 3QW2A 5JS6A 2QG4A 3HUDA 3PQEA 1QYDA 5DBIA 3DBRB 5COQA 4D0RA 3GVCA 3G49A 2DFDA 3VAZA 1M67A 1Q7BA 2VT3A 2WE8A 1RKXA 3S2IA 3VZQA 1VSUA 4MVJM 2GO1A 4GL4A 2R2GA 4NJMB 3PYMA 3VZSA 5IJZA 1ADBA 3X2FA 2CY0A 3K2EA 2OORA 4Z9YA 1I32A 2I3GA 3PYXA 3ANLA 3E9NA 5G0UA 2EKLA 5JC1A 3HFGA 3CE6A 2BFOA 4LRSB 4K28A 3DWFA 2CVQA 1I3MA 3FWZA 4GAEA 2I76A 4GWKA 1LQTA 5JE8A 5JMPA 1ZNQO 1DSSG 1V0JA 5L7TA 3U4IA 5HA5A 4J9VA 4XJTA 3D7LA 4IS2A 4BNXA 4B3JA 5A3JA 2C5AA 4I8XA 5EMHA 4QO8A 3QVWA 3GAFA 4GSLA 1X1TA 3BMQA 4J7UA 4EJMA 4CM6A 1N1EA 3JQ9C 1EDZA 2R6JA 3C7CB 2YDYA 1BMDA 1CYDA 2ZB3A 2IYPA 4XYGA 1HTBA 3DZKA 2VTDA 1ZEJA 4CQMA 4UUPA 3ZHXA 2F1KA 1H93A 2WE7A 1PX0A 4FJ2A 4B4UA 4YJHA 1HRDA 1UZNA 4J3FA 1SAYA 1D4FA 2Z1MA 1GZ4A 4L9RA 4PRLA 2EWMA 2GASA 3K92A 2RH8A 3GNSA 5ES3A 1JVSA 1CRWG 4MP3A 5KVSA 2HO5A 3A1NA 1ZJYA 4Z0PA 1W8DA 4XR4A 3P19A 1FMCA 3MEQA 1PR3A 4D42A 5FFFA 2RHCA 3K5PA 1Z82A 3QVXA 4J90A 1P74A 1UXHA 5BT9A 5F1KA 1X1EA 4M87A 1T1SA 3H3JA 3ZW9A 1OMOA 4ESOA 4YYZA 1T25A 1PGOA 3U3XA 4PLCA 5JCJA 3KRTA 5CEFA 4PLHA 2JCVA 4JXKA 2B4RO 4FFLA 3QVOA 2EJVA 5KJ6A 1ZMTA 4DLAA 3LYLA 3PIIA 4YTEA 3ADPA 4UUMA 3ZU5A 1GUYA 4OMUA 3WX0A 3LDHA 1DIRA 4NK5A 2Y1GA 3AOGA 2DTDA 3PJDA 1NFQA 2ZATA 1N2SA 1BW9A 1N1GA 4N54A 5A9SB 3RJ9A 4BGEA 1U3TA 1FJHA 1MP0A 1HKUA 2QHXA 4S3MA 1CIVA 5DP1A 3DZBA 3UW3A 1WW8A 4YACA 3MTGA 1Y8QA 3I9LA 3H9EO 4IDFA 4OXNA 5B37A 4Z9XA 4NFSA 3KETA 1UH5A 1Q7GA 5THQA 3QIVA 3HB5X 1GQQA 3AUTA 3VPHA 1ZXBA 2Y66A 4IQ8A 3UCXA 5TJHA 2DFVA 3OM9A 3UXYA 1LDNA 1KYQA 3TFOA 5A5EA 1A9ZA 4CUZA 5CPBA 2C29D 5J23A 1KVQA 2NTNA 1T4DA 2ZCUA 4P38A 1TT7A 2FP4A 4G65A 3ZV4A 3F4BA 1TB4A 3WIEA 1A7AA 1O89A 3C3XA 1AN9A 2OGUA 3BTUA 4GVLA 4Z9FA 3OBBA 3Q6IA 5A02A 3W8FA 3RQSA 1C0LA 2YFQA 3F6YA 2AE2A 3Q0EA 5DBFA 2EKQA 4DMMA 4ZU3A 5EIOA 3EYWA 2JFFA 4KDFA 3PPIA 4BO5A 4KUGA 5C37A 1ZXLA 1TEHA 5TRTA 3VHRA 4CJXA 4YT4A 5CDSA 2Z5LA 2GERA 4M1QA 2GPTA 1ZZEA 1ISGA 3ONDA 5DULA 4WCFA 1U9JA 2BELA 2VHVA 2YHIA 3I9KA 3MWDB 1KOLA 4CMEA 2FOIA 2Q2QA 3BHJA 3JYPA 3TWOA 3E6AA 1H2HA 4CR6A 3AOEC
chains in the Genus database with same CATH superfamily
2AJ8A 4HG2A 5AK4A 1QC5B 4AP6A 1H4QA 3BMNB 3CRNA 4E5NA 5COAA 2IITA 3K96A 4DZTA 2GK7A 2UKDA 3JASB 4N3NA 4QGBA 4DM3A 1ZCAA 5HX7A 4ME6A 1QYWA 4Y67A 2QL7A 4HAIA 2LDBA 4QOFA 4X64B 3O31A 2MYNA 1XEFA 2CT8A 2Z56A 2R66A 1EJ0A 4PHTA 3L18A 5FL7A 2HB6A 1WD7A 4HXFB 3TG2A 1DRWA 3ELUA 4NS1A 1DC3A 2QD5A 1DTEA 1L7VC 2W0SA 3C4JA 3OPXA 1TIPA 1V1RA 4G0ZA 4F5DA 5H4GA 4B09A 3EB9A 1P45A 2Q2VA 5KYWA 4RTMA 3T5BA 4H7HA 5KJCA 3Q7EA 1BW9B 3A4TA 2G7ZA 1DRVA 1T0HB 3EIEA 4Q3BA 1NNI1 3BB4A 3BRWD 3QVMA 1YNOA 4GLLA 4INPA 4NTZA 4QSHA 3MCWA 3TMKA 4II3A 6ABPA 2PS9A 4TTRA 1PTJA 5I7WA 3HYSA 1U0SY 4OMFG 4FX2A 2XKKA 4PC6A 2HWWA 1DG1G 1WVMA 3B48A 1V37A 3K9HA 5BVHB 4EPRA 2EZTA 3E82A 4XEUA 3BEDA 1RT9A 4Y0AA 1XN1A 3T3NA 1ATIA 2ZUWA 2H51A 2ATXA 1T0BA 3AR8A 4ZVRA 1W6UA 3QYPA 4AN4A 4FB4A 1TZKA 1O2DA 3AONB 3D3WA 3C3YA 4JB2A 3CVUA 3B78A 1GPLA 5HPYB 4D6XA 2I03A 4D9EA 1KOGA 1VPTA 4AKGA 2GILA 3G0DA 3SZRA 2XB9A 5DHRA 5B12A 4AO7A 4BATA 4O2BA 3DULA 5LLDA 2HU8A 1M7GA 2QRMA 4DJAA 2E4ZA 1JYFA 1V1MA 4L50A 5H3LA 4G23A 2XNHA 3BB3A 5C1DA 3ICEA 1NN3A 1KQGA 4FFWA 2I4NA 3W9BA 2GEFA 1G2QA 4P3OA 1GZ7A 1OX4A 2NNLD 4I5IA 3UNXA 2EW2A 3W3AH 4DBLC 1GG9A 3DTVD 4I1UA 4GMHA 3CSDA 4XGQA 2HZBA 4Q3OA 3TINA 3P96A 4IILA 2HMSA 5KYYA 1Z2EA 1SY7A 4UZSA 1P33A 3FD8A 4Y6SA 4EG3A 1OYYA 3CINA 1QAQA 1RR6A 1XROA 2GTPA 1HNNA 2H9AA 1L4NA 2VLBA 3EMKA 5AXBA 3QBEA 2XBLA 3BQ9A 4UDYX 1GGVA 1PFYA 3D6FA 2XECA 1RHKA 2E49A 1GU7A 2CDNA 1LD3A 2I6SA 4LFBB 5FADA 4MV7A 3OPQA 4W4TA 3JQ8B 4XYMA 4DLRA 4AG6A 4BMPB 2P27A 5CT9A 4HV4A 1GA4A 2GZ2A 3JYNA 4G5QA 3H0EA 4DTCA 3TTWA 2BOVA 4H0NA 4TGLA 5LQMA 3IMEA 1EGVB 2WJ4A 3U39A 5B7QA 4OGWA 4ARAA 2QQEA 2ZDQA 1BE0A 4C03A 3B3AA 2Q8NA 1JIJA 4KOEC 4DSAA 3LPDA 1I3CA 5I7HA 5TMBA 3C6QA 5DP2A 3UA3A 1YNSA 3UA4A 3DAYA 3SC2A 1P5RA 1PZEA 3WO1A 5JXJA 3E4CA 3QVVA 1A9TA 5H02A 2X3FA 4LGMA 3ROTA 4Z7QB 2ZB4A 1KZ4A 2QY9A 3GJ4A 4BNVA 3E3MA 4QARA 1QPZA 1JEYA 4H31A 4TXJA 4CI0B 1WSBA 2H0AA 1WXGA 3PV0A 2XMBA 3VU9A 2WA1A 2OE2A 4MR8A 1SHUX 3IR7A 1PE0A 3QVJA 4MPTA 3PPXA 2WIGA 4UU7A 3SDZA 2FPOA 4UDOA 4WGGA 1C29B 4QVGA 5DGXA 2K2QB 5LOVB 1FSZA 4H7KA 1M2HA 4CEHA 3TQCA 3M6FA 1CEYA 4IOKA 4MR9B 3S5JA 1FZTA 2LGJA 4PSAA 5CFQA 2RAPA 5KDDA 5TMPA 3ICCA 4I9GA 1LVGA 4D79A 1Z7BA 5JWOA 2DCUA 2LUOA 4KXXA 1HNZB 2XT0A 3H8VA 5IVIA 3SE7A 1B7GO 1ULZA 1LY1A 3B60A 3KELA 4TLBA 2B69A 3W6ZA 5C5CA 5JJIA 1S8AA 1USUA 3GRPA 1F7UA 4NJMA 3ZG6A 3GRVA 3HZHA 3GLHE 1Q7RA 1IBSA 5T4HA 3MOSA 1SBNE 4KG7A 1C50A 4QPPA 4G4GA 4B4DA 4HLCA 2RJ3A 4RSGA 1K4YA 4EPVA 2CHEA 2LR0A 5DW3A 3EFHA 4V39A 2CKMA 1CJKC 3BRCA 4IFEA 5IVKA 1UQUA 3EJ6A 2A9RA 1I7DA 4N41A 2IXBA 2GZ3A 1A3CA 4G8CA 4M83A 1GPNA 4WXHA 1QDUA 5E7MA 1UJMA 1C7JA 3C1TA 1PVVA 4QPDA 1HYBA 2RD2A 1ZZGA 3RVBA 2VAWA 2WTAA 5J4KA 3PEFA 3PTLA 1X7HA 1FUYB 3T41A 1TM4E 2BGRA 3JQGA 3WGOA 5CFMA 1RXWA 2REOA 2IH4A 1OWNA 3ZDEA 1ABEA 1OXMA 1A7JA 1F4PA 3F98A 2YHSA 2CNDA 1XEAA 3O82A 2I7CA 2PPLA 4Q19A 4F6LA 1RLIA 4O1MA 5FLKA 4CU5A 1T5LA 5E6SA 2R7KA 4M8LA 3M6MD 4FLMA 4D4IA 2Y1CA 1AHHA 1E9CA 3OPYI 4ZJZA 1TCBA 1NT2A 5J5CA 4N9WA 1P60A 1TTPB 3CPSA 3RYCA 3IAM1 3VZBA 1N2BA 1LVUA 1YU6A 4NONA 4JZKA 1YV9A 1GAQA 4EDFA 3VHLB 2F6RA 2V65A 3NUZA 2PD3A 2JKYA 3E4DA 4FYYA 2HY7A 4Q03A 4K9MA 2LPMA 3GGDA 4GXRA 3RTBA 2GF0A 2E6UX 4RVFA 4ZDIA 3U7RA 5EESA 5DISB 4B6SA 3BMCB 4EBBA 1KQFA 4JI8B 2GK4A 3VTZA 1JP7A 1Q83A 3MA0A 1JQ3A 2VSXA 3GRAA 4BVBA 3TLGB 1QFZA 2IUTA 4OIMA 1YJAA 5J63A 4KXLA 1RW4A 4R68A 4C4PA 3SG0A 1KXZA 2FW7A 2O0LA 3JATB 2VAMA 3QVSA 3NHZA 3S6JA 1HL3A 3CF2A 1XCGB 3AHIA 4P4SB 3OFSA 3KPWA 4L5YA 2QMYA 2GUWA 2WM9B 5GGXA 3EWIA 3H65A 1IBLB 1UBRS 2PX5A 3GAAA 3NP7A 4LRXA 5EUQB 2ZT5A 4L3WA 3SSNA 3VR5A 4D8YA 4DLYA 3G1WA 5CA1F 1KZHA 2XMSA 1IBRA 2W70A 3DUFB 2B2CA 4DQDA 1SEPA 1PWEA 2O2SA 2ZKIA 2ZP1A 4CF6A 1QO0D 2VQDA 3TNLA 1T5DX 5LR6A 3C3AA 4Q3CA 2FN7A 4BLOA 5C46F 4TLLB 3HRIA 4OATA 4LF9B 1G1AA 1ZWLA 2N46A 4WK6A 3BA1A 1Q6YA 4RFLA 3CRVA 4HDMA 1FVHA 5IKXA 2FVXA 1NP7A 1L5MA 2WFZA 3DVLA 1L3BA 3DM5A 2AQKA 3GVIA 5LYYA 1Y3IA 3O1IC 5EMMA 1EA5A 4KDRA 1OTXA 4RY0A 2BI4A 3LO8A 1L5NA 3SZOA 5KYKA 5MN6A 1OASA 2ECKA 1UXKA 4WZAE 2OHFA 2ZE7A 1Q57A 2HREA 2D7DA 2OILA 1CQXA 2BH2A 5C4IA 5EWLB 1UFQA 1UODA 3K1JA 3L84A 1XZNA 3TW0A 1V3VA 1SD2A 5C31A 4HBZA 4N48A 5D5QA 4OVKA 1RC1A 2DKNA 3ASVA 3E2IA 1JQLB 1IVNA 4Y2HA 1EXVA 3RADC 3E15A 1SA0B 4FGLA 1XJQA 3H2YA 5JAUA 2Y9MB 4BTEA 4L0DA 3C6KA 5KVCA 2O19A 2KWIA 2QV7A 3EUFA 1A9SA 2FMUA 2AUTA 3I52A 3RQIA 3HA7A 3OFNA 3B38A 3IVMA 2Z4TA 1VMAA 3QKIA 2B35A 4FJ0A 4DA8A 4DCCA 4L2IA 1E8NA 1QYIA 2YVLA 3SDBA 2MMCA 3SGLA 1BSVA 3CA8A 3FCEA 3DHYA 3VXKA 5IAGA 4Z49A 1E7WA 1T4GA 3LK7A 2AOTA 3RGGA 4H1WA 1AGRA 1QIJA 1XCBA 3E2MA 3L1KA 1UIMA 1HLDA 3ABSB 2C3UA 5D3MA 1N5DA 5I7FA 5C81A 1GQOA 5FBZA 2G1KA 2LZ0A 4I6JA 1YZUA 5F3WB 3EPRA 2XQFA 5FWAA 5FUBA 3IE2A 5CK5A 4PR3A 2VPZA 4GGPA 4YGXB 4LRQA 1Y6RA 2NVUA 2O8VA 4PS0A 1EXDA 3L79A 4HNSA 4DVGA 2FOXA 2O7NA 2FW6A 3NTXA 4AECA 5JDIC 3ZWXA 5E6UA 1YZYA 3CZMA 4BPRA 4W63A 2ZM5A 1Z5WA 3K0CC 3KYIB 3AINA 2EFEB 2JA1A 3OQIA 3ZBUA 4ILKA 3TXXA 2RGCA 6ADHA 4GYKA 4CG3A 1JMKC 2QTAA 2PYIA 1YO6A 1N6RA 1RPAA 4YRQA 3B8EA 1HDGO 4CLHA 1QYVA 1Z07A 4FDTA 1IULA 4ZOBA 3SZLA 4UTPA 2XWPA 4JMLA 4YRGA 1T5BA 3A7EA 3OTQA 3RU7A 3VX4A 5L40A 3NTVA 4ZV4A 4QTUB 3UGJA 4BRUA 1YZKA 3ZGVA 3CRW1 1Y6JA 3K5WA 4KNWA 1HI9A 3CNEA 4M0UA 3DFIA 2X8BA 4TTAA 3VPBA 3MJVA 3TSOA 4PLYA 4LZZA 1RM4A 2VTVA 1IE3A 1SK9A 3WRXC 5IK2D 2A9OA 3O4GA 3O47A 4M1MA 4I9HA 1TJYA 1F8FA 1M5UA 3F3SA 3H0KA 1RAEA 2F90A 2R60A 3I0MA 1E1QA 3MOGA 4QGFA 1HT1E 2Q29A 3C3MA 3FZEA 4KN5A 3WLLA 3Q9SA 2Y0DA 4PLFA 4HDNA 2ZJ4A 4CNBA 5KKAA 4NZOA 5KTSA 1JF8A 4B4WA 1M6YA 2PXAA 3LP8A 4X93A 1DQRA 3BAZA 1F2DA 4GKBA 3TLEA 4CEIA 3TAHA 1HK7A 1T2EA 1SFRA 4OP2A 2AFVA 4TL7A 4DIOA 5KNBD 1F17A 1MNAA 1Q77A 5C5EA 3HCOA 1HFEL 2BGKA 5K3BA 1QNFA 4Q3LA 2G0NA 3LQ1A 2XA1A 1BD4A 4ROSA 2BKAA 4Y2YA 4XRGA 5DI9A 4LHYA 3QKWA 5KYUA 2Q0SA 5AESA 2AJLI 3DC7A 3DHEA 3RTGA 3HPRA 2IK8A 2NZUG 3FWYA 3W5VA 1HV8A 4L8FA 5IDYA 5EN4A 2PS3A 5I6DA 5JV5A 1P5HA 5JCOA 3WVNA 2A5JA 4BXOB 2HXYA 3P4YA 3CG0A 5DHTA 2FWJA 2IZZA 3EZFA 2F9MA 2GESA 2Q99A 2J67A 3LI2A 3K94A 3LW7A 3LZ6A 4HDOB 4V0ME 4WGFA 3RYIA 3Q8MA 1H4TA 4BLQA 4FE7A 1P7CA 4FW9A 2AN4A 4E5YA 1ZIPA 3GL9A 1IHUA 3ZD6A 2CMGA 1L4YA 2HFKA 1H0SA 3HJRA 3I4FA 3BH0A 3ADCA 5KQLA 1JE0A 3ITNA 3DZFA 4GM1A 1NVEA 5C5IA 2JIMA 3G2LA 2E4WA 2WJAA 2ZAOA 1XJ5A 3O9MA 4LWZA 7ABPA 1X7DA 2IDKA 4J0QA 4EYOA 1XXHE 3HYRA 4BB0A 4U7DA 3LK6A 4XQEA 2E7ZA 3AHFA 1XMIA 4JP3A 3ZJ5A 4D74A 2C4TA 4UUOA 1J2RA 1KK1A 2Q5QA 4XE5A 5A4KA 1TDJA 1K1EA 4BNWA 2KLBA 3LWBA 1QRSA 2GX6A 4GNRA 4ARUA 3AFOA 1SXJD 3L4JA 3FNFA 4D5GA 2AZDA 4BV8A 3S2FA 3WLAA 3FXAA 3GCXA 4YUYA 4PQFA 1T9AA 3C8ZA 3K0CA 3OCVA 4BO0A 1LKZA 1C30B 4JKIA 1DEKA 2W11A 3UATA 2UYCA 2BH9A 5KWEA 1PD1A 4YBRA 2RB5A 3FAKA 2XIJA 2Z09A 3W2FA 1DEAA 1X7ZB 3IV9A 4TVOA 4WNCA 3UJ7A 4MHOA 1JKJB 1Q15A 2GWRA 3LZDA 5LJIA 3JQAA 1P18A 2CYBA 4FK8A 5EXXA 5IKPA 4Q18A 4P4UA 3UC9A 1NL3A 3IYLW 5CFZA 1DGQA 1KZYC 1R0KA 1PBNA 2A5YB 5CG1A 5GWXA 1XG5A 1FL9A 3OEWA 5CD1A 4B8YA 3KHKA 3OIYA 3AYZB 5BUSA 2BP7A 3TTTA 3PI7A 5JY1A 1JQBA 1DJMA 2ZYUX 1EJBA 4ZK2A 4GU5A 1RPNA 1VOTA 5B58T 3R3ZA 1P4JA 1P17A 3EARA 1AK9A 3SY8A 1XQ1A 3CZCA 1K6IA 1G18A 4ZAGA 3S40A 1JG6A 1ZSYA 2EZ9A 3GA0A 4TTTS 4Y0VA 4B76A 1IJEA 5ALZA 3GMTA 3BL5A 4Q4CA 1M7HA 4MPJA 4UBIA 4B47A 2YKGA 1C7FA 1JKXA 1MC1A 4Y1GA 4F72A 1L5LA 2O5RA 1I6LA 1KRWA 3FBWA 1QLWA 3FYSA 4FZ5A 2IKSA 4RHEA 3IQDB 3ICWA 2WKSA 4H18A 3L8GA 3SVZA 1ZD4A 3WGTA 4A7PA 2CVOA 1T4CA 1DBRA 1PR5A 2DHDA 4LV6A 3GFSA 1L7PA 1HFJA 3FSEA 4JBXA 3JZFA 1M34E 4NMMA 2VRCD 2ZIUB 1VTKA 3A6KA 3KQVA 2VOEA 1T4BA 2EDAA 2G5GX 3AEZA 1SB8A 3TIIA 3ZE0B 1BZYA 2PT7A 4YCMA 1G42A 3LQRA 4DJEC 4WBNF 1OW3B 5KJ1A 5KOHA 3PFFA 3FWHA 2H1SA 4KK4A 1DRJA 1GNVA 4FEYA 4BIIA 2JBAB 3HXQA 3T7TA 2BZ0A 1KYZA 1L5YA 2Q8QA 1JSLA 4KV7A 4O8ZA 3T8YA 2ZANA 3P9CA 5LQNA 1GUDA 2Y05A 3KQMA 4IWYA 3QXGA 2A58A 3SM9A 3UUEA 2F1OA 4FOSA 4EHBA 2ZAIA 4JXXA 2BD0A 4LK3A 2DFNA 4HQKA 1G63A 1HG1A 4RA6A 6AT1A 5KEIA 1AM4D 1IEVA 4KPUA 3V55A 3V8QA 1RI5A 3X2SA 3ZBTA 3AR6A 4CMBA 1MVOA 1E62A 3SJAA 3AEXA 1NKTA 1H3NA 4YAOA 1XRLA 3NONA 3K35A 1QE5A 3R6GA 3O9VA 4QQRA 4Q9HA 5HE8A 4RMHA 2BHTA 3G7SA 1UFRA 2QTRA 2FEOA 1J6UA 3PEVA 3QTLA 1EKXA 1XAGA 1U0HC 3B3JA 4AZVA 1XFDA 5EP3A 4QBKA 4U8HA 4NZYA 4FB5A 3L9WA 4MCHA 2K6GA 2JFVA 4FWIB 5DV9A 4ENUA 1HA3A 3O73A 1SQGA 2Q5FA 4MINA 3PC7A 2CWWA 2FJPA 3PHCA 4O1HA 5AJUA 2N1MA 4K6OA 4WY5A 5ANRB 5JYCA 1O9BA 4YV2A 1T9CA 1RHMA 3BMNA 3AVPA 4OOEA 4DNPA 1BJKA 3LRTA 4RF2A 3WHKA 4L3VA 3A8TA 4QTTB 1AKVA 2JIQA 3UGKA 4ZYUA 5CG2A 1GYQA 1Y6FA 2P78A 4PIMA 3VR3A 3DXYA 4P4LA 1PIWA 1CUDA 1FXWF 1W4RA 1YIAA 2WFLB 4M0PA 3GI1A 3WLIA 1F5NA 3TQFA 2JGDA 1TA4A 1FMJA 1Y7LA 1ZQ9A 4D0LB 4GVXA 3N58A 5EXEA 4F60A 4CIWA 3AP3A 2OHOA 5JAHA 5DRYA 1KYWA 3PQDA 4N39A 4ZYZA 3HS3A 4GX2A 1Z06A 5ESRA 3JVUA 2LE0A 3J81k 2B83A 2PUAA 3CGWA 2C5LA 1X1QA 3E22B 4FZRA 5JC8A 4AJ4A 4GZ6A 3FVQA 4EDHA 1SRRA 1UK6A 1UZAA 3MOIA 1QVWA 4DLLA 5JHHB 4DR6B 3OZRA 3KOUA 1RMQA 3RJMA 1A4UA 3RVDA 5CTAA 4N6GA 3GRFA 3GQBB 3FRIA 4UFOA 2R86A 3KKMA 2FOLA 4DLXA 3DTVA 3MIZA 4X8MA 4BS9A 3A9TA 5JU6A 4Z2YA 3L07A 3PFKA 3ZU2A 1DWOA 1RE0A 1RQPA 5E3HA 4GMKA 3KFLA 1T1EA 4HPXB 1BKSB 3D3WB 4X20B 1C7ZA 5L3QB 4Z3OA 3WGKA 2DHCA 4JBGA 1Z3CA 2BC9A 2OCDA 3MWFA 4GFDA 2HC9A 4CM9D 4IXNA 3ROXA 1J0EA 2DUWA 5EMNA 2AEFA 3A3KA 5CNMA 1A7KA 2HMYB 3WKBA 1GGHA 4IEEA 1ESEA 1OFTA 2A94A 3RG2A 3OZFA 3ER9A 1J9GA 4XWAA 2PLRA 4O4HF 1UBGA 1OWOA 5EKDA 1IH8A 2FKNA 3B6ZA 3PNOA 5BQOA 2XJ9A 1HDIA 1N2OA 4FWTA 3DQQA 1EUYA 2VJMA 1DAOA 2BEUA 3L8FA 1KH3A 4R05A 3SFVA 1IXRC 5LXTA 3GC6A 3V2HA 3VR2A 1OU0A 1P91A 2ZIXA 4XUCA 3KVVA 2GD6A 4G86A 2AUMA 4TKLA 4BP9A 3GP5A 1VYTA 3AJEA 3PSAA 2BFBB 3N6XA 4D25A 2WOOA 1VIDA 1KI8A 4RZXA 5AW3A 1HE2A 1KJNA 1JR3D 1EVQA 3G68A 1HT2E 4M8KA 3UC5A 1CC1S 3DKVA 4MUGA 3WA6A 3P5SA 3LT4A 4DIUA 5SY4A 4Z4HA 1E3MA 4E3WA 1QYXA 2PGJA 3EX7C 3BRSA 2PX0A 3ZWYA 2ZDGA 2N3ZA 2PBLA 3IJ5A 4AJOA 4BNDA 1UWLA 2CSUA 3RS2A 4WBNA 5I7EA 3JQ8A 5B3KA 3EZYA 1HQKA 1G21B 4WACA 4ZAWA 1URPA 1WUKS 2JI7A 5AJXA 4CT0A 2WU4A 3AKDA 5KDLA 5GAJA 3IDQA 4S12A 1TPZA 2CZQA 1E5LA 4LRTB 1HBJA 2EC5A 2J41A 4NOMA 3LC2O 4JASB 4O29A 4DJDC 4MV4A 1EQ2A 4FTWA 3GGCA 3QFFA 3HBLA 4JI6B 3SIRA 3ZH9B 3PHGA 3SC2B 3JD3A 3T5MA 1YB7A 2DJ5A 3DE1X 3U40A 2QT1A 3WMGA 3I6MA 4H6VA 3O03A 2PZ8A 4MIKA 1KDOA 2G17A 2R7AA 1ECPA 2QUZA 2W2PA 1IXZA 3IP5A 3PYLA 1CR6A 1ODTC 2PR2A 3AEQB 4OHOA 2QTHA 4ZZ3A 1VYUA 2E4AA 3R5FA 2ZIEA 3SYTA 2B4YA 4K9SA 3OM0A 2ON6A 3MWJA 4MQ6A 1WCWA 2GZMA 3DF7A 1SJ9A 1SZJG 3K1TA 3BF8A 3OLYA 4XRRA 4QJ3A 1UEJA 8LDHA 1OZHA 2MHCA 1VJ0A 4NJEB 4GPD1 4LY0A 3REQA 1TT5B 3I6QA 2JGLA 4PAOA 4QDUA 2Z5GA 5BMVB 5FEUA 4NAUA 5J43A 1C8LA 1L4HA 2B92A 1C9MA 5DTJA 4ATNA 4JR0A 1YZQA 2K7ZA 1T34A 2XDQB 4JCCA 1QG4A 3DJYA 4JLDA 1T2FA 2VJYA 3AIOA 4N0MA 4MKGA 1KWGA 1A72A 1JQ5A 3TF5A 3L7IA 1FXWA 3N7TA 1RZRD 1WV1A 3Q3CA 2QQFA 3K9LA 4KX5A 2NUAB 3GDOA 1V8DA 1Z4KA 2FEAA 3LWNA 3QFHA 4IIUA 4ZXPA 1SIWA 2Z3WA 3FUUA 4OH1A 3AY3A 3FHLA 3OOWA 1ISIA 5TVGA 4ZYVA 3NU1A 2OFFA 3AV0B 2Z95A 4LHVA 5AW0A 5JMTA 1A50B 2O7QA 4PZYA 1NLYA 3NAQA 4LHSA 1B73A 1FYDA 1NI4A 4XD2A 5IHPA 4N0PA 3NTLA 1RLMA 1ZMOA 3EIOA 3W1VA 4UAVA 1QOPB 1YS1X 4ND1A 1J39A 1UM9B 3DZJA 3NEPX 4XH9B 3UB2A 4DKXA 1H2FA 4F0JA 4EY8A 3WAJA 1CF4A 4G1CA 1LK0A 4DT1A 3U1TA 3C3CA 1TF5A 5AJZA 1MFPA 4P80A 1F8GA 2O1WA 4HHEA 4U2GA 5C32A 5DLPA 2RMKA 3OFJA 5D86A 1C1XB 3HRKA 1FVOA 3PIDA 5J9FA 3SNKA 5JSUA 4U7GA 5JUWA 2XMQA 1OKKD 1AD2A 3UJ9A 3I42A 1X3LA 1R4AA 3RYCB 1P7YA 2G09A 2NNWB 2Q3HA 2XA2A 2FPGA 1AKRA 1EUDB 1MIOB 2ZKLA 3A7DA 4PG5A 4REOA 3TLMA 2QLTA 4DMUB 1E94E 2NZJA 1T3ZA 1UWVA 4PSCA 1DE0A 4IZ6A 3VYUB 1G8PA 1D6JA 4TYNA 1JAZA 2IOFK 5CYFA 1U0FA 2QVLA 2X7XA 2G1AA 4OXKA 4FD3A 4FXPA 4IDOA 3TEJA 2QR3A 1SKYB 2EX0A 2YMLA 3BXPA 1KJZA 1Q2UA 1EEXB 1ZMXA 3H5LA 1OLSA 2ZRIA 2C7QA 2AGVA 3NHSA 4HZUB 7YASA 1P6UA 4WT7A 1GKIA 3EY9A 4ND4A 3SI7A 4DB4A 1FK8A 3PX7A 3WHPA 1K7SN 4JHLA 3CQ9A 1M6NA 3FUCA 3DB1A 4RIGA 3CH5A 2NZ2A 1KZ6A 1PL0A 1RKUA 4KO3S 2C2BA 3F7TA 4BCBA 1KY3A 3ABQB 2G9NA 3ET4A 5HFJA 1XK6A 3EC2A 1I7PA 3ENZA 2GVZC 4PYLA 1DCMA 1R1DA 1K75A 2ADFA 5H59A 1QO0A 2ORED 2JLRA 2VF7A 3IAEA 3B82A 3R5SA 1PHRA 1KH1A 1I8TA 2GS9A 1AUPA 3JAKB 1NX9A 3PUJA 4BE4A 4KQ9A 3QEJA 1WW3A 5AIAA 4BNNA 1S8FA 4J4TA 4NH4A 4AW9A 4EKYA 4A0SA 1ECJA 4JUIA 5FNZA 1L3IA 3O95A 4XWOA 2YJ3A 5FT9A 2WMNB 4RX1A 3TRHA 4LC0A 5F1PA 2ERCA 1IZ9A 3U16A 3O8QA 2PGLA 2A9VA 4A27A 1ORIA 4M36A 1P7VA 2FN9A 4OHUA 3WMRA 2Z1DA 3NEJA 4G36A 3RIGA 3JQ7A 4WLUA 4CPDA 4E6PA 3A1DA 3HY3A 4PVDA 4C87A 4AI6A 3HZOA 1E8DA 4RMIA 5K3DA 2JBHA 4PG8A 4Z4CA 5HJEA 4IZIA 2Z6AA 4GPZA 3U7IA 3ONWA 1FNSA 4I5DA 4EQ6B 4D9GA 3TFWA 3V8BA 5K0CA 2SHKA 2VYFA 3R8XA 1SIUA 1MG5A 3RKRA 4CF7A 3BT7A 3A9VA 3OWHA 1EQUA 4P08A 1DIHA 3MTIA 2PUJA 3VHXB 1HURA 1Z26A 2G9UA 3WY9A 1ZIDA 1ARZA 3PGMA 3AXTA 2W71A 4QQNA 3SU8A 4C6SA 4I3FA 1W9HA 1AZLA 2QW8A 5J1TB 3OJEA 4X24A 1CBUA 2GNAA 1DDOA 4IJVA 1F6BA 1YJBA 4J2TA 3U1BA 3W5HA 1LXCA 1SC9A 2FN8A 4HATA 3IVRA 4C7XA 5FUQA 1RJFA 2B99A 4OI0A 4RHTA 4YONB 2A0FA 4YMTA 1Q7TA 2ICAA 3HADA 3ZEAA 5LP6B 3FMGA 3M5WA 2ZUBA 1E1YA 1C7IA 5CR9A 5IAJA 4YASA 1Y1RA 2FSVC 2FXIA 4O4JA 3RROA 4TWAA 5MGBA 5H9WA 1PWXA 3JXEA 5BP7A 1FRZA 2GCGA 3LNCA 3QOWA 5C8YA 1ISPA 1TZJA 1OAAA 3H9QA 4G07A 2WRZA 5EQJB 5IHXA 2IY8A 2B4TO 2Q3BA 4H4CA 2H92A 4A0GA 1QRAA 4G81A 3KWJA 4XIFA 3AEKB 4BNLA 1MLDA 4E4YA 5GM2A 2J0UB 3AF0A 3DPSA 4LYAA 4H1TA 1MXHA 2PSHA 3P8ZA 3WBKA 2Y68A 4QRDA 3X1YA 1EG2A 4F3NA 3T5AA 1NQXA 3PQ5A 3EK2A 3EZ9A 3T9DA 3AI2A 4B6PA 5L8VA 2OYRA 4MUAA 3DFFA 4MUFA 2HW8A 5A5DA 1B2RA 1FW6A 1Y8QB 1VGRA 1VM6A 1GUAA 4M88A 4ZXFA 1R37A 2B30A 3WGLA 1NVFA 2HJHA 1IU9A 2RGBA 3CPEA 3DDUA 3EVTA 1PVDA 1SIBE 2ZE5A 3QUAA 2J9YB 3RREA 4R9VA 3PNLA 3TM5A 1ZK4A 3QE9Y 2HGSA 2O3JA 2WD7A 1MN6A 5C7IO 4GZ3A 5B2ZA 4D8UA 2EG9A 3V32A 1E4YA 1ICIA 3GRRA 3Q3JB 3PFCA 5F1OA 1G6KA 1P0IA 1RJ9A 3IAXA 4DXAA 3UWSA 3KDSE 1LJ8A 4GI2A 4QNMA 3ORRA 3E9QA 3PLAE 4C7VA 2GD2A 4BFUA 4UHBA 4JGIA 1DKMA 1Y5NA 4TKUA 4BB9A 1XIVA 3A06A 1HG0A 3CWQA 4TMYA 3M4JA 1U8ZA 2ATCA 2QRNA 4FZVA 1MF7A 4HGPA 4XIJA 1QIIA 2JCSA 4IOJA 1I1OA 2HRDA 4PM4A 1E6KA 1L5FA 1QSGA 5IPFA 1TKAA 3BFPA 1PUIA 3DR3A 3JATA 4YMIA 3F97A 3GLIA 1HE3A 3RARA 3TB4A 4HB2A 4P54A 5I51A 3IILA 3MUEA 2HTEA 1HYEA 5A1JA 3OSUA 1XZQA 3RG8A 3KLMX 4QYWA 1XA4A 1Z6YA 4NF2A 3B3FA 2CXXA 2J3EA 1NURA 4ITRC 4YI5A 1D8AA 2EKBA 5KJEA 4AMUA 3LY7A 1W59A 5A5FA 3WA7A 3S27A 1WZ2A 3LUFA 1I2MA 4TWBA 1G19A 4GEGA 2V7VA 1EJ6A 1WSAA 3NIFB 1VFNA 4TMZA 1R16A 2GGSA 1WBJB 2GUGA 4AIIA 1G4HA 4YLYA 4E1VA 3HO1A 2ONCA 3QMPA 1FRVA 3I45A 1OT5A 5GTDA 5FO1A 4N5LA 2R1VA 2X41A 1ND5A 1RYDA 3L7LA 2H08A 2GM5A 2ID4A 5K0GA 2B98A 1CZKA 1ZA1A 3D8NA 4MX8A 2ORYA 2CXOA 4UZEA 2WJ3A 4O4HA 1GL9B 3R2JA 2FR1A 4V0RA 5EHQA 3UTCA 2XUZA 2BFAA 1GNTA 4XARA 1U1IA 5BXQC 2BPOA 3H9BA 5EJAA 1DKUA 2YVAA 3AVXA 2X7JA 1LQUA 4NJOA 3QKUA 4I14A 3H1EA 4MJ7A 3P0FA 1IPHA 3OUTA 4KQXA 4U2CA 2BSQA 2H4JA 2E82A 2NVWA 3KEQA 2IIBA 3U7QA 2Y1WA 4C0HA 1IOVA 4CLOA 1D09A 3TCXB 3E8XA 3RSHA 3G0HA 2VZ8A 1IUKA 3WNQA 3HDQA 1ZHFA 4C3ZA 2WJJA 1XLTA 4MA0A 1XEWY 3SJCA 3K0AB 3S5UA 3RIXA 4MI3A 1EHYA 2ZWOA 4QXOA 4V1CB 2GN4A 2YZKA 4QU8A 2FGJA 3THXB 1LI4A 2H5JA 3RT9A 4PBSA 4YJ3B 3ZW7A 5U4QA 5JADA 4WKBA 4FMPA 3BWDD 4ZOAA 4B7UA 1XNHA 1TQ4A 3EXEA 4XYBA 1FSPA 1J0DA 4B6QA 4CT5A 3QVGA 4E5VA 3A26A 1KDYA 4RL6A 3Q5EA 2IYEA 3GG2A 3DP7A 2PV0A 3D8UA 3OAAD 4KHZA 3V4SA 4A26A 1Z5PA 5EKTA 3AP2A 3LTEA 4HDRA 4JJGA 4AZTA 1M34A 3TSYA 4D3FA 5K0BA 2DG2A 1Y4AE 5CT4A 1AGPA 3G1TA 4GOND 4YCAA 3PJRA 4JROA 3T1TA 2J4DA 3EVNA 1HZZA 2DECA 1J1IA 1SHZA 1T0JB 4YR9A 2H48A 3CMCO 1DJOA 2YN2A 3P0IA 1GQFA 4YUXA 2XB2A 5JCJD 1RKQA 3R0XA 3WOHA 2KLHA 1R0RE 4LG1A 4F12A 4RNCA 2BEWA 2QL6A 2F67A 3UK7A 4YMUA 2JKZA 3KZKA 5B6JA 5PGMA 1G3MA 4AX4A 1MJGA 5LQKA 2R97A 2P77A 3AEUA 4WPGA 3UV3A 3EA5A 4DIFA 1L2TA 1OGYA 1TFRA 4K9PA 4W1RA 2P69A 1CJMA 1X1CA 3LLSA 1C4WA 3BCUA 1ZRNA 1THGA 2X14A 3S2ZA 2B8EA 3TZCA 5KC8A 1WPQA 3UG7A 1UJCA 3EC1A 1NA5A 4J0FA 1RQ7A 3DC2A 3GLFE 2HDOA 3EGDB 4LA4A 5CYPA 5HM8A 3BJIC 5IU6A 3ZDXB 1KYVA 4YRMA 1PJBA 2HQBA 4O2BF 4UD2A 1QCCA 3NHKA 2W6QA 1XZBA 3NJRA 1G3UA 3NANA 5TEVA 3G9XA 2FWPA 4KXQA 5JYDA 4ALLA 5A4JA 1L7XA 4QJ4A 1XZMA 4E31A 1Z0AA 4D0NA 2IEZA 1YL7A 1VGQA 2VDKB 4HQFA 1SM4A 4H2DA 3D2LA 3IR6A 1XRMA 1ZNZA 3VPCA 1FQWA 2IPOA 2VPPA 3N8NA 4WFIA 5ICFA 2PLFA 1IDOA 1RS0A 4J1QA 2YV3A 3F96A 4YDHB 3EGIA 1FX0B 2X0EA 4KGVA 4C0LA 1M66A 2QGNA 1XA3A 2Q5EA 1NQTA 1NT4A 1PKXA 2PT9A 2Q3JA 4IIJF 5IP5A 3SYNA 4FFMA 5BSEA 1EK6A 2P6PA 2Q0HA 2VPTA 5EGSA 4G0UA 1X1BA 2W22A 4MQBA 4QEDA 4TZKA 4TSFA 3OQPA 3U9SA 4CCYA 3KV1A 3IJEB 3GLTA 4EW3A 5C7YA 3OESA 1UOQA 1N6IA 1QMGA 1XXHA 2NV2B 4H0CA 4S24A 4DCTA 3G0IA 4ZI7F 1JFSA 3KB1A 3HGMA 1WMEA 4F5YA 4FS3A 2YL2A 1OGIA 2D54A 3D8HA 2XTAA 4BGVA 4AJHA 2B1JA 3AF2A 4IDEA 3VKVA 2N9UA 4RVGA 1E1RD 3UQYS 3ZWMA 3ADKA 2QRVA 3ZLVA 4IJ6A 3I4CA 1IN1A 3AERB 2DPLA 3A27A 2YWGA 1ADJA 4DYHA 3TL2A 1V11A 4KPEC 4WNYA 3DT6A 3NDJA 2QAJA 4QFDA 3NYQA 3ESBA 1E79A 3ORQA 3NYWA 3RBXA 3U62A 5L95A 4LSMA 2OHIA 3I64A 3RU3A 1FXSA 1CY8A 1XTQA 2HJ9A 3PUXA 2QEQA 5HF5A 3ADBA 1G0NA 2H2HA 2H31A 3S2UA 3EG9B 1QQAA 2PWPA 3MUFA 2ZR8A 1XOIA 2WPDA 1GNSA 1N25A 5A5GA 1NXOA 1QIKA 2IYXA 3BH7A 3QHPA 1W88B 2Q50A 5JEDA 2QZ4A 3OCWA 3VNUA 3C6YA 3BXZA 3ND5A 4RFVA 1LVHA 4RK7A 1ZRMA 1GAEO 1W85A 3JWHA 3F2VA 1F2VA 1CE8A 3H6GA 3WK6A 3VM6A 4TYYA 5D87A 3R41A 5CHEA 1IFXA 2E5LB 3F8WA 3H17A 3MERA 3C45A 4LYEA 3AETA 3PS9A 4HUQB 3LVFO 3ZU3A 2YZGA 4UBJA 3R7SA 4MQ5A 4JP2A 1R3DA 4BU0A 2IA5A 1DX6A 2PT5A 3A6JA 4IOLA 4L5JA 5FIUA 5J59A 1ZGBA 1L7MA 2Q3DA 1IWBB 1PR9A 3P71T 2PQ0A 2D1YA 2JKVA 3ZXYA 4PYJA 2IEGA 2QJWA 1KMQA 4FS8A 1MEOA 2QU8A 2YW9A 4P98A 3KOYA 4DQLA 1FP4A 2DBRA 1NIPA 4FZ3A 2AZTA 4G9EA 4DDTA 2Z1NA 2FFHA 2II6A 3KT6A 4Z7NB 3BWBA 4C08A 1RI2A 2KE5A 4RV4A 1BRMA 3BWMA 4XTRA 1OYVA 3OC0A 3L6CA 4AMBA 4RTQA 4F92B 2ZCJA 3IDOA 4RZIA 2IEBA 1FUEA 2D7CA 1ZA2A 1ZN7A 3AM1A 2YYZA 4KPFC 5B36A 1N5OX 3T3IA 3ZX4A 4YV1A 5JSZA 3SP1A 1E3IA 2F9LA 4GYWA 4IDDA 3GPCA 3JQAB 4GH5A 4PNEA 2CYCA 3L3BA 4OHXA 5B58C 1WDTA 1WG8A 1NPYA 3FYDA 3GJYA 3CHYA 4IDNA 4JKOA 3UMCA 3ZIAD 4F4CA 4AZ3B 2X76A 1LLQA 1KI2A 2PAAA 1E18A 1ECGA 2G4CA 2VBGA 1BC5A 1LH0A 2BHSA 2VEOA 2XMGA 1OILA 3NOVA 3PXEA 4LYFA 3W2GA 2QE6A 4ZPJA 3WL3A 1T6ZA 2VF2A 1KI1A 1V43A 2X7HA 3IGFA 2XYQA 5KINB 3AHJA 3PBKA 1CSEE 1CUHA 1OLOA 2YBDA 1G8FA 1IHPA 2FSHA 2VNHA 3H8JA 4GYYA 5D6OA 1IB0A 5IZCC 4FGJA 3I9FA 1LC0A 4QUAA 2H85A 4W6QA 4MKFA 2XKAA 1VLVA 4JCOA 2NLOA 4AF8A 4LDJA 2NQ2C 1JN0A 3OLVA 3DKPA 3JR3A 1Z0KA 3E9YA 1EIWA 4I81A 4HQ0A 4IWNA 2XZOA 2PUWA 1HWYA 2RARA 3LC1O 2WWYA 4DADA 3VGPA 3N2KB 1Y3BE 4NH0A 5JO0A 5DXAA 4I9UA 1A2BA 4WDRA 3TPZA 4OX9B 3VO9A 3W5SA 2VCYA 5DYYA 2ID7A 1GTMA 1T8UA 1IY9A 3Q5DA 4L0CA 2GZRA 4MW0A 5HXAA 1Z28A 2FSFA 3VYVA 1MCZA 3X1MA 4Z99A 1Z6ZA 2F62A 4RLHA 5KYWB 3I34X 4ZTZB 4EX6A 6LDHA 2G72A 2ZJ5A 1DAIA 1NTRA 2ZR7A 4ZMSA 3HJNA 4TWJA 4OYRA 4XDYA 1ITZA 3GRUA 4JJIA 1RQGA 4MW7A 3BK2A 4C5CA 1PQYA 3V34A 2V6JA 4O5AA 3SYKA 1P2VA 2G1UA 3W5BA 1H22A 2NX2A 4FD2A 4JLMA 1SNYA 4KXFB 2J6BA 4R98A 1UOPA 3NQ41 4I55B 4F21A 2ZUCA 4TOIA 5EMJA 1MFZA 3H2KA 5CNIA 2H4HA 4G0VA 2V7UA 3VUEA 4B81A 2HRBA 3R5HA 3RUCA 4RHXA 3PDIB 3NXKA 4MAFA 4UMDA 4JJZA 4JEIA 2V59A 4PZ0A 3MGGA 2E1PA 2FK7A 1XMQB 2AYZA 2RHJA 3I01M 3INGA 3MJEA 4YP0A 2XXAB 5D3QA 1FFXB 3DOCA 4D41A 4TYMA 2C2YA 1HE4A 3EVEA 5FTWA 4KK3A 1KC1A 1Q6ZA 2IP2A 1GR1A 2OHXA 3E3AA 5AVKA 3CONA 3UMJA 2I6FA 4KVFA 3TOCA