4CMJA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 91
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmjA00
1SCUA 4BNKA 3FWNA 3OP4A 4CLRB 5TF4A 1K5HA 3FN4A 2JCXA 3I9KA 3MJEA 5AXAA 4AJKA 4DL9A 1S7CA 2AG8A 1E7RA 3WLEA 4DYVA 1CQJA 3GFBA 4D3FA 2E4AA 3ANMA 1T4BA 3ADPA 4GLOA 4PIVA 4F45A 4DMMA 2Q1TA 4IDCA 4M86A 4E12A 4TRRA 3JQEA 1OI7A 4PLPA 4Q3NA 4BGIA 3EYWA 1QV7A 4MINA 5TX7A 4IXTA 4YRAA 4HBGA 3AK4A 4IDEA 5C3MA 3QQPA 1HLPA 3UN1A 3PFWO 4JQCA 2ET6A 5L45A 1QSGA 1MGOA 4GMGA 5G0TA 2WD8A 1E1NA 3AM4A 3TDKA 4CMIB 2J3JA 4TRJA 5ILOA 3PYMA 2E49A 3RUHA 1A4UA 3KLMX 2VUUA 3QSGA 4XJSA 5TT1A 3HQ4O 1NQTA 2NVBA 3D0OA 3WJ7A 2RHCA 2VCYA 4XIJA 3ADOA 4UUOA 1Z82A 2G82A 4MPDA 4OM8A 1XEAA 3DZHA 2YHIA 1YKFA 1E3IA 4JJGA 4CR7A 1OBFO 3OEWA 2X22A 4GWKA 1NFQA 1V35A 3BMOB 3MJTA 2J3IA 4AJ1A 5HTOA 1OMOA 3E18A 2HDHA 2W8ZA 1GV0A 2CZCA 4CUJA 5TIIA 2Q46A 1E3WA 1Y7TA 4II2A 3LT4A 3QP9A 1KOLA 4BNWA 3KVOA 3TJRA 2ZYAA 3HG7A 2IE0A 2PGDA 1NQAO 3KV3O 1YDEA 4R69A 3FSRA 5C37A 4I8XA 2GO1A 1MG0A 3OMLA 3HDYA 1DPGA 1LX6A 3PHIA 3H5AA 1A7KA 2O48X 3OJOA 1TT5B 4W7IA 1GTMA 4K6CA 4QECA 4BKUA 4B4VA 3DBVO 3EW7A 5L51A 2X4GA 4DWVA 1GD1O 2DKNA 5TQVA 5LDHA 1QLJA 1Y5MA 1KVTA 4BNYA 2YHUA 5L7TA 4RDIA 4NBRA 1WLYA 5IZCA 3BZUA 3BHMA 1SNYA 3DBHB 1C1DB 3OEYA 2FRDA 4J7CA 4F6LA 3AUSA 3L6DA 3SLGA 2QRKA 1PQWA 1TXGA 1BXZA 2EJWA 4XRRA 2NVWA 4Y6RA 4BS9A 5THKA 3W8EA 2G76A 4FPXA 1XWFA 1DLJA 1MLDA 4Z3KA 3PYXA 5T6BA 4ZHSA 3R0IA 2WEKA 1S6YA 1ZMOA 2O3UA 3GVCA 3NTOA 3AW9A 1H6CA 1PGNA 3HB5X 1LQUA 4GX5A 3O03A 1H6DA 3LT1A 3WWYA 2OHXA 1FJHA 1UP4A 4EEZA 4I9NA 1NWCA 3JYPA 3PIDA 3OHSX 4UUNA 3ZWOA 1TLTA 3JD1A 2A94A 2EKQA 3A9WA 1VSVA 3VVBA 5CDYA 1CDOA 1NHGA 1QYDA 3Q9NA 1N92A 2YZ7A 4NHEA 1B14A 4RQUA 3WNQA 2Q99A 1P1IA 3SBOA 3VZSA 1YL6A 3VZPA 1PZHA 3K96A 3FTPA 3RU9A 1BVUA 4XYBA 4CM8A 1BW9A 3BYZA 1DC6A 3BHJA 2EKPA 4IY1A 5GY7A 2PD4A 2P4QA 4FCCA 2FPGA 3ZHYA 3I9NA 2D8AA 1I2ZA 1E5QA 4J6FA 4TRMA 3V2UA 1HDOA 1L1FA 3V1YA 2NTVA 2X1HA 2DT5A 4Z6KA 4GGPA 3HDHA 3VVCA 4NI5A 1WAMA 4OOFA 3WX0A 1X7DA 2QZ9A 1E7SA 3AI3A 3LK7A 3K5PA 2P9EA 3D3EA 1LBEA 3O8QB 2Q1SA 3ROMA 5G4LA 4EJ0A 1X7GA 4TMFA 3RIHA 1ISHA 3WQQA 4BVAA 5IAAA 4RPHA 5IN4A 2OGUA 2BH9A 3LC7O 4DTIA 2DFVA 1U3UA 4DGSA 5A03A 1LDEA 1JW9B 3Q2KA 3WS7A 4NBTA 4E5MA 2EP5A 2C20A 3N74A 4FW8A 1X15A 4WLFA 4IS2A 1WDMA 4P22A 3DBLB 3Q9UA 3V2HA 1YL5A 3ROQA 3SX2A 4PZEA 1A5ZA 4J1TA 5A05A 1K89A 4BB5A 3UW3A 1KEVA 2G0TA 1I3KA 5G0SA 2W98A 2X9NA 3H5NA 3RFVA 4URFA 4PZCA 1KY4A 5G0VA 4GBJA 3S8MA 1VSUA 3G49A 4KP7A 4AJEA 5BSGA 4W9NA 5A5FA 1EE9A 1EUDA 2ZTLA 5DP1A 4KQWA 5HRUA 3VAZA 1DRVA 1HETA 3ORFA 4J3FA 1ZIDA 2ZCVA 5KWEA 4D0RA 4WK6A 1I30A 3ZWVA 1DDOA 5KNLA 3QE3A 2PKQO 4JLWA 1DIAA 2PGLA 3F1KA 4ZJUA 3F47A 3QVTA 2VWGA 4IZIA 2GZ2A 2WTBA 1X1EA 4CMKA 2C2YA 3ZHXA 2HUNA 1SB8A 3D64A 3LZ6A 3ZWAA 4TQGA 3WYCA 4DIOA 1GZ4A 4HFRA 3GG9A 1MXFA 4D7AA 3GMSA 2A35A 1P44A 1ZW1A 2PD3A 3GQVA 3U49A 1LI4A 3KZVA 5IDQA 2GN6A 3FTNA 3VTZA 4AG3A 4MO2A 2BRUA 5TSDA 5KVVA 4FFRA 3ONDA 2DUUA 4NDNE 3SJUA 4YVFA 2BI7A 3GMDA 5KOIA 5JO0A 3GUYA 1I36A 2Y1DA 3LVFO 3G79A 3X2FA 1R16A 2C0CA 3AOGA 3RUEA 4MKZA 1IY8A 5TC4A 4CR6A 1LXCA 4CLXA 4ND5A 3FBGA 4B3IA 2B4TO 2BFAA 1HKUA 4KUEA 2G17A 5HWSA 4LK3A 1TB4A 2B0JA 5ADHA 1NQOA 1Z7EA 1A4IA 2VUSA 3JQDA 3BIOA 1QKIA 4FJ2A 1EE2A 2YUTA 4LVCA 3WBFA 4E3ZA 4GPD1 4EZBA 3TZCA 5KJCA 2O50A 4WLVA 1LLQA 4HADA 4JIGA 3RSHA 1U4OA 5CDTA 3HFGA 4LGVA 1YJ8A 2WWRA 4FFOA 4CMAA 4DPMA 1DRWA 3LDHA 1UXIA 1KYQA 2DTEA 3FPLA 4FJ0A 4GL4A 3E9QA 4ESOA 4MJLA 3KYDB 3MOIA 1F12A 1U7HA 4QEDA 3HUDA 4IJKA 3IJRA 1DO8A 3KLPX 5ENDA 3ZI0A 2DQ4A 3SEFA 3P5SA 1GL3A 4BL5A 4OYRA 1E6UA 1VRWA 3WTCA 5DOVA 4BO1A 1W4ZA 1IE3A 4BNLA 3GR6A 2AE1A 4ZGWA 4ALKA 2E82A 1R0LA 3DBRA 4EUEA 5KVSA 3INRA 3NT5A 2WJPA 1PR9A 4LMPA 2NQTA 1EVJA 4K6FA 4MDHA 4AJPA 1J49A 2D0IA 4BO9A 3F4BA 4RLSA 3WQRA 1E3SA 4WNCA 1E1LA 2WE7A 4RJTA 4OKNA 3GF4A 2GZ3A 2QYTA 2YQ5A 4MVJG 2CVOA 5TJHA 4BHTA 2VOJA 1K6XA 2PTGA 4ZQFA 1LSUA 5TS3A 1H5QA 4AJ4A 2UUOA 1HWYA 1MC4A 3ZNQA 1ADGA 3G17A 1MG5A 2C82A 1UP7A 1LUAA 4UVHA 1H6AA 1EUCA 4PLVA 4HFNA 4YJFA 1PJ3A 5FI5A 5I9NA 1ISMA 3UVEA 3UCFA 3IC5A 5A4DA 4BO0A 1FDTA 3A14A 3OICA 3PWZA 4F3YA 2PLAA 3I23A 4J2HA 4PLZA 1LDGA 1I01A 4M1QA 2GLXA 1C1XA 3GRKA 3ZNPA 4E0BA 5ICSA 3RD5A 2BLLA 3AJRA 1T2EA 3NGXA 1PEDA 1LA2A 2NV6A 1HE3A 1T2CA 5B37A 5JC8A 4D43A 1O94A 4NK5A 4RPLA 1PS8A 1E77A 4WLUA 5IZ4A 5DOZA 4PG7A 5DNAA 2C59A 4E2YA 4ZQBA 1ADCA 3PP8A 3BMQA 3V1TC 2JAPA 5ICMA 4AFNA 1GU7A 4J7UA 3QRWA 1W73A 1ZZEA 3EVNA 1U5CA 3DMTA 4E21A 4U0JA 3Q6IA 3E5MA 5G0UA 2BELA 4IQGA 4ZD6A 2GNAA 2J8ZA 3GNTA 3ON5A 3FR8A 4IGEA 4BMNA 2A92A 2VT2A 5H82A 3D4OA 4BGVA 3D4NA 3OSUA 3IL2A 1ORRA 5A3VA 3RJ5A 3RC1A 4R41A 2FMUA 8ADHA 5EQDA 3W1VA 4IM7A 2C2XA 2HK9A 3DZFA 4BGEA 1F8FA 4XZ3A 4XR9A 3E48A 1ONNA 4A03A 3PLRA 4JBGA 1ENPA 4P8RA 3KRTA 4RO0A 4GKBA 8LDHA 1VL0A 3S2EA 1CIVA 4JN6B 2O3JA 2AG5A 1D4FA 1OFGA 1DFIA 1WDLA 3U5TA 1UXHA 3GNQA 2H6EA 4YQYA 1LU9A 4QFDA 1KVUA 2HAEA 4OOEA 1IZ9A 3C1OA 3L9XA 2XF8A 5A06A 1ZCJA 3AFNA 1TT7A 2GGSA 4LSMA 4E6PA 3OQ1A 3C24A 1DBVO 3U4DA 2JD1A 1BMDA 4CQLA 4GVXA 5G4KB 5HS4A 4A2CA 1TI7A 1Z73A 3RUCA 3N7UA 3WGYA 1HRDA 2P91A 1M2WA 3GGOA 2IODA 4ONEA 4BO7A 2HMVA 1YQGA 3RC2A 4BUCA 1XCBA 2WYUA 1HE4A 1ML3A 1U28A 1DAPA 3QV1A 4ND3A 4CLRA 5B4VA 1HYGA 2I66A 9LDTA 1H6BA 5AXCA 3TZHA 1GEEA 1GYRA 1I0ZA 4ZA2A 4YACA 2YY7A 4A10A 4D44A 3VDQA 3O4RA 4P38A 4XDZA 5JW6A 1U4SA 1YJQA 2NQ8A 3OQ6A 4XQCA 4BGUA 4L74A 1OOEA 2ZIZA 2BMAA 2FHSA 1PJ4A 2ZTMA 3PEFA 4CMEA 4DPKA 2B37A 1KETA 2NU7A 1BXGB 2PGJA 5A02A 1MFZA 3E6AA 4R54A 2X0IA 1ULSA 4WLEA 3ZV6A 3H2ZA 4OKIA 1ADBA 3RAJA 1P74A 1RJWA 3QWFA 1UXGA 5T8KA 2VQ3A 4FOSA 5F1OA 3ZHBA 1ZVMA 3GOHA 3UICA 4CMIA 4OXKA 2YQ4A 2O3SA 1EQ2A 3JD3A 3Q1LA 4N54A 3WYBA 4CR8A 5CG1A 5IDWA 4R4JA 3RJ9A 1ONPA 1U1IA 2CY0A 3U4HA 2VYND 1U3WA 4JNKA 4R3NA 2HMUA 3PWKA 1R15A 1QXSA 2ZK7A 2XOXA 3PIIA 3DHEA 4RORA 5COQA 1ZSVA 5G0WA 2GN9A 1CRWG 3ANLA 3GPIA 3PJEA 1JN0A 3OIGA 4PLTA 3WGIA 1R12A 2I6TA 1EVZA 1YH3A 4ALIA 1VKNA 4WOJA 2VHVA 1YB1A 1ZMTA 4W4TA 3S2IA 5A1TA 3OIFA 2EHDA 4JJFA 4XD2A 1CJCA 1HF3A 1YRLA 4RF4A 5KTKA 1HYHA 3B20A 1SO8A 2HQ1A 3KSDO 4FFPA 4UAGA 3U4CA 2VZ8A 1ZJZA 2UAGA 1H9AA 1YGYA 1CEQA 4WCFB 1C14A 2F00A 2FR1A 4QTZA 4DQXA 3OJLA 2DBVO 1H9BA 2J5QA 3F9IA 5DZSA 4DUPA 4ZN6A 1PGOA 1E0DA 3ZZNA 5JFOA 1F14A 4KUGA 2FSVA 3EK2A 2CF5A 3S1LA 1P1RA 5DN9A 2PFGA 1GQ2A 3DDNA 2FR0A 3JQAA 4YAJA 3ICCA 1SPXA 3NUGA 2G5CA 1HT0A 4DQUA 2PZMA 4BNFA 3WQSB 3F5SA 5G2OA 5B12A 1ZK0A 3JQBC 4Q3BA 5EJ2A 5T5QA 4UEKA 5L40A 1ZH8A 4J0EA 1ID1A 4CMCA 1P31A 1U8FO 4OQYA 4B4UA 2Q2WA 4J1SA 4XQGA 2BFOA 3UOGA 1PJQA 2B36A 3GVPA 2Q2QA 4RVUA 4INAA 5A9RA 4NBUA 1GADO 5JAMA 3GGGA 2EG9A 3N58A 5MGBA 5EL0A 1ZEJA 3CZMA 1MX3A 4XGKA 3C8MA 1NYTA 4K28A 2FY8A 3PXXA 1V8BA 1HE5A 3U3XA 3LLSA 1K2WA 4GQAA 3GLQA 4K9DA 4U8GA 4BKRA 4FD3A 4BNMA 1KERA 1PL6A 2XAAA 1PGPA 2Q4EA 1E3EA 4QT0A 3DAFA 3BA1A 1Y8RB 1RPNA 3HHPA 4BNJA 2ZCUA 2HMWA 3HWRA 3I5MA 1DHRA 3I83A 3DMTC 3PWSA 1BDMA 1QRRA 2WM3A 1NASA 4XYLA 3IIEA 3SVTA 3H9GA 1DFHA 1WZIA 2Y0EA 3TL2A 3F46A 4WLNA 3KETA 3T7CA 1DJQA 4OH1A 3JQFA 3QW2A 3JQ8B 1P0FA 1XKQA 4J1NA 1LNQA 2D4AA 3NEPX 4QO7A 1PQPA 1DAOA 4A27A 2EW2A 3C7AA 4BNNA 4FDAA 2EV9A 5JYEA 2UUPA 3WBBA 3LSYA 1XLTA 5IJZA 2JD0A 3KTDA 2GASA 1MC5A 4U7WA 2QX7A 2Y68A 3PJGA 1SOVA 3MEQA 3CMMA 3IMFA 1V3UA 3QWBA 4UUPA 2VHYA 2O3TA 1GUZA 1FDSA 3RUFA 5A5EA 5F3RA 4IJWA 5KVQA 4FC6A 3I9OA 3FCOA 2AQ8A 1PJLA 4YAEA 5EIOA 5AXDA 5IXYA 1N7HA 3CZRA 4DMLA 4GKVA 4RPGA 1TA4A 2CDCA 3C85A 4RL6A 1M67A 4FC7A 5L3ZA 5BNIA 1I2BA 1FDVA 2O23A 5EPOA 4IPTA 3OETA 4BMVA 1U2GA 4JXKA 4O59O 1CWUA 4PG8A 1IHYA 1YE3A 2W2LD 3OA0A 2NNLD 4YTEA 1F8GA 1ARZA 2X9VA 4WEOA 4WJZA 2FWMX 3VHRA 3TPCA 4L8VA 3GT0A 4CM4A 4A7PA 3I1JA 3A1NA 2CUKA 2OP0A 4Z0TA 5KVCA 5LCXA 1DFGA 3C1AA 4NQZA 4D0SA 3H4VA 4BO5A 3AI1A 5DBGA 4YJGA 3D7LA 3HB4X 4JP2A 4KTTE 5L4SA 4BNTA 4ZQHA 3IUPA 4CV0A 1JVSA 1L7EA 4I08A 4MKRA 4Q3CA 1KEUA 1QMGA 3WSVA 2ZATA 1ZK4A 1DC3A 1UXKA 3GPDG 1GYQA 4PG6A 3ZDFA 2NVUB 1NWHA 4CLEA 5HBRA 4Z9YA 5JCXA 1UAYA 3EY4A 4LISA 1QR6A 2YDXA 3D3WB 5T8KC 4F46A 2C29D 1UZNA 4J90A 4Q3AA 3NDIA 2CD9A 3AWDA 2CVZA 4BNVA 5A9SB 1A71A 2CDAA 2HSDA 5B1YA 5GMOA 3PDJA 2RH4A 5IDYA 1N8KA 1WW8A 1ZEMA 3CKYA 4J7XA 4W99A 4CV3A 1PL7A 3F6YA 3NJ4A 2ZKLA 4NFHA 5JAQA 4E5PA 5EERA 2FN7A 3RBXA 3FWZA 1PIWA 2X5JO 4OHUA 2OFPA 4G2NA 5HS6A 3ASVA 4XGNA 3I3OA 1UZMA 1UR5A 2VOEA 2VHZA 1I3MA 3GVIA 1Y8QB 5BR7A 3GVHA 4PLCA 3RUIA 1HDYA 5JLAA 3K8ZA 2Y1EA 2CDBA 4J49A 4XJTA 1XA0A 4CM3A 1JWAB 1NX6A 6LDHA 4D45A 4XQEA 2YW9A 3JQ6A 4FOOA 3BAZA 3EUWA 1KEWA 1T2AA 3E82A 3PK0A 5C5IA 5TJ9A 5CHEA 2GPTA 1B16A 4II3A 4EI2A 3QLJA 1SBYA 2VTDA 1ZSNA 2Q1WA 2IZ1A 1PS9A 2D1YA 3PHHA 3ZWWA 2HJRA 1EDOA 1AXGA 1WDKA 4IJVA 4XYEA 1SZJG 4GAEA 4CQMB 2X58A 1P33A 2BFMA 4XRGA 1T2DA 3MTJA 5KKAA 2XPCA 4O1MA 4GVLA 5KJ6A 4HY3A 1HDXA 4OSOA 2IEBA 4KOAA 4Q3DA 1NXQA 5U1PA 1I3NA 5FFFA 4AJNA 4S1VA 4CMBA 4CM6A 2PH3A 1HTBA 4RF3A 3AOEC 3DOCA 1Q2XA 5ER6A 4RGBA 3I6QA 3FNFA 1N5DA 4BO6A 4YQZA 2JFFA 1BVRA 5JSFA 1B8UA 4MP8A 1ZXBA 2NM0A 1EFLA 2Y1GA 4I5EA 1JDJA 1YBAA 2IXBA 3GZ4A 3AM3A 4G65A 4LSWA 4GLLA 1MFPA 2ZTUA 1IHXA 4N18A 5IXSA 1PSDA 1N1GA 3HN2A 2RH8A 3ITDA 1UZLA 1VC2A 4YJHA 1BHSA 3BMNB 3I9LA 4CM9D 5I8WA 2EP7A 4IBOA 3ICPA 5L7YA 3JD4A 1EQUA 4ND2A 3B1KA 4JROA 4YB8A 3STHA 4B7XA 3PRJA 2YFQA 3H6KA 3F3SA 4IQ0A 4DLBA 3NV9A 4WKGA 3W6ZA 3CUKA 3EHEA 4KDEA 3K2BA 2C54A 3L9WA 3KUXA 5A3JA 4HXYA 2BI8A 2QQ5A 1PS0A 1GY8A 4FFLA 3JQFC 4HFMA 3WSWA 1YOVA 3RWBA 3QVSA 2Y67A 1LLCA 5F1PA 4EGFA 3KO8A 4NU6A 2V6BA 1NVTA 2X7HA 3NKLA 4WCDA 2YV2A 1DIRA 4PG5A 2PNFA 3FNGA 2P5YA 3GRPA 3QHAA 3LT0A 3WLFA 1E92A 3RUDA 3H9QA 4JCOA 3GZNB 3GY0A 3P2YA 2NTNA 5TNXA 3D4PA 3G0OA 2V6GA 3LT2A 2QG4A 3ZWMA 3B70A 4XYMA 1X0XA 3PLNA 4RVDA 1HZJA 4NBVA 5K0ZA 1EDZA 1U5AA 4BV8A 3O38A 4CL3A 2P5UA 3DZGA 4RZHA 1QORA 2IDZA 2FPIA 1YL7A 1TVEA 4CL8A 2HK8A 5JE8A 3WXBA 1JVBA 2VWPA 4I5GA 4O0LA 3E5RA 3AUTA 1D1SA 2IYPA 1DC5A 3VZRA 2FOIA 3OH8A 3S2FA 4BKOA 4WASA 2AQHA 4GSKA 4EBFA 2CNBA 1VJ1A 3RFXA 3SXPA 1UUFA 1P0CA 4ZRMA 4BO3A 5L4LA 4RQTA 3ZV5A 2AA3A 3OA2A 1LLDA 1WZEA 4DBVO 2J5RA 1Q0LA 4RLHA 3RC9A 4YT8A 1X0VA 3WGQA 4TVOA 1NVMB 2X5OA 4NIMA 3DTTA 3JQCA 3NGLA 1GDHA 1P1FA 3R3JA 1R4MB 3C7CB 2JFGA 4H15A 3WR5A 1LRKA 3WGZA 1Q7CA 1P45A 1EBFA 3HNPA 5ENVA 5K9ZA 1G1AA 1T4DA 3BHIA 1B3RA 3LC1O 2P9GA 2Y0CA 3TSCA 3S2GA 2D5CA 2VRCD 4IS3A 1I8TA 2NU6A 3FD8A 2GN8A 4FN4A 1MV8A 4R1UA 1NVGA 2VYNA 1CERA 3A4VA 3GHHA 5EN4A 4HP8A 4TVBA 3ETEA 4R1SA 4KDFA 1NBOA 3W4JA 2D3TA 4D79A 1PZEA 3L0DA 5DBFA 4A26A 3EZLA 4KWIA 3JQ7A 1LSSA 2DVMA 5CFZA 3WTBA 3ETDA 4OAQA 3VPFA 4DLAA 2FZEA 5IZCC 3GUCA 1GR0A 3OBBA 4A0SA 1I24A 4AJ2A 2ZB8A 2Q49A 4HWKA 2TMGA 2OP1A 3RQSA 3SC6A 3ZWYA 1UJMA 3CIFA 2C5AA 4IDFA 1GPJA 4YAKA 1A7AA 1PZFA 3ZNNA 3H3JA 3WFIA 1YO6A 3KBOA 1PGJA 4E2WA 1PJSA 5TRTA 2O3QA 3ROPA 3DWFA 3FPCA 3WIDA 4XB1A 1YVEI 2RHRA 4IINA 2HU2A 4Z0HO 4IIUA 1VL8A 2VNSA 2Y66A 2PZKA 3V1UA 4UEOA 3AY3A 1DC4A 5L9AA 2EERA 3EGOA 2JFHA 1LDMA 3B1FA 4CUKA 4IDAA 3JCZA 4H3VA 1RM5A 4BB6A 2WSBA 2ZYDA 3DTYA 3H8VA 2QHXA 2RCYA 1UXJA 3DONA 1BW9B 4W82A 3ZWXA 3KB6A 3TF5A 1LLUA 1B15A 1KEPA 1P1HA 5FEUA 1LTHR 4BNZA 1ZKMA 5JS6A 4H7PA 4YEDA 1XR3A 3JQGA 1PWXA 4YXFA 4NZ9A 1HXHA 2WD7A 4XYGA 2NLOA 3ENKA 4J16A 4OXNA 4B7UA 2IXAA 1HL3A 3PHLA 1SOWA 4XR4A 4QXMA 4L4SA 3JD0A 1NQ5A 2E37A 4PLHA 1YB4A 1Y5RA 1N9GA 3PVZA 3EVTA 3L6OO 1DOHA 2Q3EA 5EESA 3VH3A 1X7HA 2X0JA 3VKVA 3O9ZA 1R0SA 4B4OA 3H2SA 5I7SA 4JBHA 3WWZA 1BTOA 2ZB4A 4YDRA 3NAQA 1NP3A 3RBZA 4WOKA 4R1NA 4MOWA 2DTXA 5GZ1A 3U0BA 4R16A 4CLOA 3VC7A 5BSHA 2Z95A 3TZKA 1ENOA 2Z5LA 1X14A 2GCGA 2CMDA 5EMHA 1K6IA 2FSSA 4BQPA 5CP8A 1QG6A 5I7EA 3MCVA 2YJZA 3G1TA 2D5AA 4LRSB 2Q4BA 3AY6A 1BWSA 3K9QO 4DBZA 1AHHA 2IYOA 3KYCA 2HRZA 4ILKA 4NBWA 4W6ZA 5HA5A 2VYVD 1A9YA 1IB6A 4N5LA 2E48A 4B4WA 3PJDA 3HADA 1QYXA 3BTUA 5AXBA 1LDBA 2AW5A 4EJ6A 1ZK3A 2UVDA 4XQ9A 4DIBA 2YV1A 1WNTA 1WWKA 3LC2O 4TWRA 4AJOA 1LEHA 1ISJA 2I5PO 4W9NC 4R01A 2ILTA 4Y6PA 1U9JA 4AJHA 4BOYA 4CMGA 3K2EA 3TWOA 5T57A 3K6JA 5JCJD 2DU8A 3OECA 2ZQYA 3U62A 3VH2A 5J23A 1HDZA 2OBNA 4J0FA 5JAIA 3BMCA 1RM3A 4IDDA 4ROSA 4I5DA 4OL9A 3ABIA 4RVHA 5CEJA 4E2XA 4B3HA 5I8ZA 2W2LA 2NADA 2FP4A 1Q0HA 2W2KA 3ZCXA 3VPXA 4CUZA 1VI2A 3OM9A 3GA0A 3PGXA 3JYQA 3ZW8A 4KZPA 4X54A 5IDXA 4R9RA 2P4HX 2JJYA 1YDWA 4Z9FA 2AMFA 3D5QA 1VPDA 3P19A 4M49A 3ZV3A 2BGKA 2I3GA 1Y1PA 1ZO8A 2OZPA 1M6WA 1Y9EA 3IKTA 1Z74A 2Y05A 4TROA 1HSOA 4U0KA 1UDBA 4O5OA 4Z9XA 3DHYA 4LRTB 3RCBA 1EEHA 4AJIA 1FMCA 2EEZA 3GK3A 3H9JA 3MWDB 3DAGA 4CM1A 1GV1A 2OXIA 4DREA 7MDHA 3EC7A 3DC2A 2H5LA 4L76A 5JPIA 3GFGA 3CSDA 1IYZA 1BXKA 1R37A 3KEQA 4FIZA 3WMXA 3PTZA 4R5HA 4NK4A 4PCVA 1L7DA 4DPLA 4K26A 1H94A 2H63A 3EZYA 4LCJA 4BKPA 2YYYA 1XQ6A 4HNGA 4RF5A 4OQZA 3CE6A 1SEPA 4NJMB 3CINA 5T64A 1FXSA 3M2PA 1E1MA 3ZN2A 3BMOA 3W8FA 3F4LA 3NTQA 3QVWA 1WPQA 3WFJA 2NVUA 4HNHA 2GYYA 2PV7A 4NU5A 2PZJA 1FF9A 4GGOA 2E6UX 3TZQA 4CV2A 1SB9A 3OJEA 3PQDA 4Y8VA 2VN8A 5KJEA 5A9SA 3M6IA 4MVJI 3INTA 5ITWA 3OJFA 3HN7A 3PFFA 3VTFA 5CDSA 2G1UA 1O9BA 3E9MA 5T67A 5TT0A 3DB2A 5JMWA 1NHWA 3W6UA 4EJMA 3G1UA 1TT5A 1XELA 2HJSA 2VWHA 1YQXA 1G6KA 3GEDA 1IUKA 1NM5A 4J4BA 3EAGA 4MVJD 1KBZA 1X13A 2PD6A 1IPEA 2WYWA 4J9VA 1GQYA 1UDAA 4CLDA 1VJTA 4ITUA 2OL4A 1YWGO 2Z1NA 3WGTA 2QRLA 3DBHA 3ZH2A 1C1DA 4R51A 3GH3A 3I6IA 5F21A 4EUHA 1G0NA 2Y1FA 4Q39A 3ZU4A 3H3FA 3ZV4A 1GCUA 4GMFA 4YJFB 3ROKA 4BO2A 4L9RA 5CEFA 4L73A 3TOXA 3P2OA 1IULA 2BHLA 1FK8A 3WG9A 4CPDA 1BSVA 4B8WA 5AOVA 4FS3A 2VRBA 3MWEB 4CM5A 2B35A 3GNSA 4AJJA 4BQRA 4FQ8A 2PKQP 4IDBA 1N7GA 4ALMA 3B1JA 4F6CA 1A27A 3ETGA 1NAIA 3ZU2A 4A73A 4TRNA 3RC7A 3GGPA 7ADHA 1NR1A 4DC0A 1M6HA 3GHYA 1DJNA 5DP2A 1BDBA 3U9LA 1HDGO 1Q7BA 3BXXA 1AN9A 4NR0A 3HSKA 4E5KA 5L95A 1PWZA 1GCOA 3BMQB 1QYVA 5FYDA 2AEJA 3ST7A 4ZRNA 1VJ0A 1J5PA 3DHNA 1T25A 4ALNA 1EK5A 1N1EA 4CM9A 3E8XA 4E30A 4O63O 4PVCA 2V6FA 3WGGA 1B26A 4U6QA 4KWHA 5A04A 3V8BA 2O7QA 2PH5A 4U6SA 4ZU3A 3AU9A 1HSZA 3FNHA 2O7SA 3Q2IA 2PWZA 1O8CA 2GUGA 1DIBA 1KC1A 1NTOA 3AM5A 2EKLA 4IMRA 1K0UA 3O8QA 4CJXA 5KJFA 1BG6A 3KM0A 3E9NA 3WICA 5KIAA 2JD2A 1KVQA 3GN2A 3IP1A 4MVJE 1EBUA 3NYWA 2GZ1A 1E7MA 2DTDA 2FR8A 3BTOA 3VH1A 4JBIA 3L4BA 1AGNA 4D42A 3DBLA 2EF1A 2POQX 3I4CA 1XSEA 3ONFA 4YRDA 1GZ6A 1Q7GA 4YRBA 1EVIA 4NNJA 2CF6A 4CQLB 2AEFA 1UAGA 1H0KA 3NT2A 1AUPA 1CQIA 1QYWA 1DRUA 3QA9A 2JL1A 1XYGA 2AEMA 1HDRA 2I3AA 3DR3A 3H9EO 1UH5A 3S55A 4DRYA 4PFJA 4DQVA 1I3LA 3GZNA 3KXDA 2A9FA 1CF2O 1PJTA 3HDQA 3TQHA 2RIRA 2BD0A 4KUHA 2NACA 2GSDA 2WMDA 1E7QA 4L4XA 1Z6ZA 2BGLA 2EXXA 1QLHA 3E1KA 4O6VA 3UF0A 3ZGYA 3MJSA 2ZB7A 1LSOA 5BQFA 3HJAA 4HKTA 5DCUA 2P9CA 1WVGA 4FJ1A 4E5NA 3V5NA 4PZDA 4CMEC 1ENZA 5LC1A 2GRAA 5JO9A 3RKRA 4P4LA 1EZ4A 3RASA 3GEGA 3VPHA 1D8AA 2JAHA 3L77A 3OFSA 4E32A 5BNTA 4L75A 4NMHA 1O6ZA 4C7JA 1JU9A 2O4UX 1QV6A 3RKUA 4DA9A 2BFPA 1JKIA 1ZFNA 2R2GA 4B8ZA 4DVJA 1HZZA 1EVYA 4JGBA 4QUKA 1BRMA 2OUIA 3K30A 2OO5A 1P77A 4MIOA 3JYLA 3PZRA 1DEHA 4EEXA 3H7AA 5KJ1A 1U2DA 3TN7A 4E13A 4L4RA 2VRCA 2EIHA 1JKFA 5H83A 1E6WA 4J43A 4WECA 4UUMA 2HK7A 1AXEA 1R4MA 5JDCA 1N2SA 4LCEA 4MIEA 1JAYA 3RVDA 4WLOA 3CXRA 4DIFA 2PKRA 4PLYA 2OORA 1B8PA 1KIFA 1UP6A 2GN4A 5DULA 5ES3A 4BNUA 1JKJA 1V6AA 3H5RA 2YV3A 4WGGA 3QWAA 4QQRA 1I2CA 4HV4A 4TKMA 3GVXA 1JA9A 4PGFA 3NX4A 3JQAB 2H9IA 2V65A 5F5LA 4A5OA 3KYDA 3KYBA 4XIYA 4BNHA 1JWBB 1YQDA 1W8DA 5U9CA 2DM6A 2YFHA 2UYYA 1J4AA 1LDNA 1ZNQO 2C7VA 3IJPA 4IXWA 3ZWCA 4GX2A 1BGVA 3Q3CA 4J1QA 4D46A 4Q9NA 4R9SA 3BTSA 3HZZA 3JYOA 3RBVA 3H9UA 4RPJA 3JV7A 5JY6A 5C7LO 3JQAD 1B7GO 4XEHA 4Y9DA 1OZAA 1VM6A 4FR5A 5DBIA 1R4NB 1PX0A 2H1SA 4DXHA 2B4QA 3JTMA 4CQMD 3L07A 4J4HA 5DT9A 2FZWA 4B7CA 3M2TA 3DXFA 2IZZA 5GZ6A 1WP4A 4OMUA 3PPIA 2WE8A 1B2LA 4D3DA 3WGOA 2PA3A 2X9GA 1LSJA 1GFSA 2EGGA 5THQA 4LVUA 3JSAA 3AI2A 1KS9A 4PRKA 2Q45A 4I5FA 3SC4A 2NU8A 2AQKA 1XIVA 3UCXA 2VZ9A 1CYDA 1R0KA 5K6AA 2Y1OA 1ISIA 3I9MA 3DZIA 2R00A 1A9ZA 3UKOA 4D3SA 3K31A 1Z45A 1ENYA 3AY7A 1GUFA 3IOYA 4FGWA 3CPSA 1GPDG 1ONOA 1XHLA 1VE9A 3O26A 4UULA 1G0OA 1T24A 1EK6A 4CM7A 4DLLA 4YBZA 1P9LA 1DXYA 3ITKA 4ALJA 2GF2A 1GUYA 1F06A 1OAAA 1OC2A 1LDYA 4LN1A 4N7RA 1U3TA 4GX0A 3WJAA 4MVJM 1LC0A 1ZK2A 4UVDA 2R6JA 3WGHA 4BNIA 3CTMA 1NAHA 2C5EA 2GR9A 2VYVA 4NH4A 2HMTA 3D5TA 5JDIA 3NRCA 5FF9A 4BKQA 3TFOA 4UVGA 1E5LA 4EDFA 4J9UE 3IP3A 4HFJA 1PL8A 1HE2A 3L4BC 5U4QA 3EMKA 2Y0DA 3UHAA 2TMDA 4PLGA 5EQFA 3GDOA 3Q11A 3RROA 4N5MA 2P68A 3K73O 5JCJA 4FSHA 4IUYA 1IL0A 1UDCA 2VUTA 4CM4B 5L7WA 3I4FA 1J6UA 2DC1A 3C7DB 3D1LA 4Y6SA 4FGSA 5ER9A 1C0KA 2F1KA 2AE2A 3R6DA 4I1IA 2AXQA 4YJGB 3LLVA 3DZJA 4JJIA 3UGKA 5I9LA 2HRBA 1M75A 3FBTA 1RKXA 4MVJF 4CLHA 2NSDA 3UXYA 3AU8A 2X23A 2O2YA 4WUVA 2Q50A 2YHIB 3W4KA 4I9HA 5I7FA 4M87A 1NFFA 3COSA 1T1SA 5G4KA 1FDWA 3T4EA 1I32A 3AUAA 3NDRA 2X0NA 1E3WB 1DSSG 3FNEA 1RM4A 3TNLA 1ZXLA 1F0YA 1DIHA 3VOSA 1Z7BA 3NTRA 1JTVA 4RV9A 1EMDA 1XQ1A 4YAIA 1E7YA 3ULKA 4XWYA 2VHXA 4H16A 2ZTVA 1NFRA 3PZBA 4GX1A 1BXGA 3CH6A 3LU1A 3RI3A 1C0PA 2UDPA 1JAXA 1GZ3A 3MJVA 1E3LA 1M66A 4J91A 5JMPA 4EITA 3OQBA 1R66A 1T1RA 2O3RA 3Q0EA 4I9UA 5JDCC 4BO8A 1V0JA 4UVEA 3R1IA 3ZNOA 3GEMA 1E6EA 5C7IO 3L6EA 4CV1A 4LW8A 2P2SA 1NR7A 2JKVA 4PRLA 2HKIA 5IF3A 2Y99A 4N5NA 2B4RO 3DOJA 3IKVA 4EYEA 2VT3A 1K3TA 2VTEA 3CMCO 1T2FA 3I9JA 2WYVA 1NPYA 1RWBA 3IUSA 2CSUA 4U5QA 2DAPA 5L4NA 2ZJ0A 4PLWA 5BSFA 1TEHA 3GC6A 1E1KA 2QW8A 3T7EA 2Q1UA 4NJMA 2A4KA 3MOGA 3DZKA 4ZVVA 3V2GA 2J3HA 3C1TA 3WYEA 1WXDA 5H81A 1AE1A 2NUAA 3FR7A 4MVJA 3DMYA 3DO5A 5ILGA 2X6TA 2JHFA 1H2BA 3JYNA 3X2EA 2RBEA 1ADFA 2OMEA 2YDYA 3F1LA 5JAZA 1W0CA 1B8VA 1LQTA 4XGIA 5BT9A 1P1JA 4XDYA 4WCFA 3DAPA 3RU7A 1YONA 2X86A 2PK3A 3DFUA 1NPTO 4ALLA 4QX6A 2VHWA 4YWJA 1PQUA 3PQFA 4IIVA 2QYSA 4CM8B 4BMSA 1V9LA 1Y6JA 3IQDB 2NWQA 3A06A 3L4SO 4ZQEA 4ND1A 3KSZO 4DC1A 2J3KA 1YB5A 3GN1A 3JQ9A 1IZ0A 2V7PA 1Y81A 3RUAA 4B3JA 1A72A 5B4UA 1T26A 5BSEA 1EFKA 2UV8A 3JQBA 3P7MA 4YCAA 2DPHA 4RVSA 4TZKA 1ZK1A 3JD2A 3QJ5A 4M89A 4OO3A 2OOSA 4ND4A 5CPBA 4BIIA 1C0LA 3WOHA 2J5KA 4YJHB 1ZBQA 5BNFA 3ZWBA 4WNIA 1I5RA 5IFLA 2B5VA 1YXMA 3F5QA 3PQEA 5DF1A 4AICA 1V3VA 4JP3A 4EW6A 1XU9A 1XGKA 4K1LA 4ZICA 2FPPA 3FHLA 4XKJA 4M8SA 5AYVA 1YBVA 1RM0A 5HM8A 1M76A 1O0SA 2OBYA 1QP8A 3MTGA 1ISGA 5K6AC 3DFZA 3LF1A 2R00C 3ASUA 3BTVA 1HEUA 4IQ8A 4Y67A 4Z0PA 3HE3A 1E7WA 1GQQA 4M55A 1LRLA 3ZHZA 1YOVB 3TFQA 3UUWA 4KMSA 2BGMA 4PVDA 4RVFA 4MIYA 2J6IA 1HYEA 1JLLA 2O4CA 4AVYA 3DQPA 4MVJP 1PTJA 3MJCA 2B83A 2W90A 3IDSA 4NG5A 4Q3EA 3VKUA 4EUFA 4YR9A 1Y8RA 5JXWA 1RYDA 1PJCA 3KEOA 2B5WA 3WDSA 4OIMA 5KKCA 3VDRA 1Q0QA 3QIVA 4YT4A 1D1TA 2CFCA 5JNLA 3LYLA 1DHTA 3LF2A 2NU9A 3KHUA 5JDIC 1DIGA 5JC1A 2QRJA 3MJ4A 5JBIA 4IZHA 3PGJA 3WMWA 3JQ8A 1ULUA 3G3EA 4FBGA 3QWIA 3NJ8A 2XXJA 2WDZA 2GDZA 4D41A 4KTVE 1KC3A 3RFTA 4R1TA 4ZQGA 5I9MA 5CDGA 4P4NA 2V6MA 3C3XA 3GAZA 3QY9A 3K92A 3SLKA 1LJ8A 3VPSA 4NFSA 4JX8A 2HO5A 2HMSA 1KVSA 3B6ZA 4RPKA 5AQ1A 1YBMA 4BNXA 2HLPA 1SMKA 5DCWA 1WMBA 4GI2A 2PY6A 4TSKA 1U3VA 4IGFA 3W8DA 1VKOA 2QIOA 2X5KO 4MKXA 2Z1MA 1SAYA 2LDBA 4Y98A 5JYDA 2AQIA 4RCVA 1MA0A 2IZ0A 1IPFA 1C3VA 1Z75A 1I10A 4E31A 5I7VA 2D2IA 4IJUA 5CPFA 4CMHA 3VZQA 3UFXA 5CG2A 1PZGA 4IMPA 4MP3A 4QSMA 3SJ7A 4E4YA 3OIDA 4YJDA 1E3JA 3R3SA 3UH1A 5ITVA 3PYLA 1SC6A 4P4GA 1DB3A 4CODB 4JK3A 3ZU5A 4G5HA 1U8XX 2EJVA 1H93A 2W4QA 4OSPA 1GYPA 1MXHA 5TGDA 1LRJA 5MDHA 3WB9A 2DBRA 2O2SA 3ZW9A 1K6JA 4UEJA 5TLSA 2DUWA 1D7OA 2CVQA 3FF4A 5LDGA 1HLDA 2IRWA 3E03A 3U4IA 1P1KA 4M54A 3U09A 2DFDA 4YAGA 4S3MA 3JQ7B 4R68A 1I33A 4HX5A 1MP0A 4PLFA 3D3WA 4UVIA 1GEGA 2EW8A 2C07A 1Q1NA 2EWMA 1ZJYA 2X8LA 3OJ0A 3QVXA 2X0RA 4WPGA 2JHGA 3CEAA 1PR3A 1X1TA 2ZB3A 1VL6A 3DBRB 4GWGA 2VZ0A 4BV9A 3NDJA 3INGA 3VH4A 1GAEO 4BO4A 1FDUA 4DYDA 2HCTA 4RZIA 2AHRA 2DPGA 1B0AA 3IS3A 4NPCA 3KOUA 5CAEA 4E5YA 1WMAA 2JCVA 3GAFA 4MVJH 5F5NA 5COAA 4E2ZA 2XXBA 4OGWA 2I99A 3ANNA 1ZSYA 2NTJA 5FWNA 1XU7A 4TKLA 1Y8QA 1P3DA 1YS4A 4HUJA 2I9PA 3TZ6A 4G81A 5COBA 5F1KA 4R5MA 4L0QA 3M1LA 1C0IA 1MB4A 3DOOA 1V3TA 3FRJA 2I67A 4MP6A 2JCYA 4WCFC 2LDXA 1Y9AA 1U7TA 1F17A 1XG5A 3M1AA 3UAGA 2DLDA 3AFMA 5DDIP 4UREA 4OXYA 5DCYA 3WNVA 1O95A 2DBQA 3KSUA 3TOZA 1C1XB 5CDUA 4PG4A 2RAFA 4OJNA 4QO8A 3JQGB 4RVGA 3ZWPA 3ONEA 1PJ2A 3GDFA 2VNAA 2WD7B 3HDJA 3JQ9C 3MZ0A 4NFYA 3OF2A 1KVRA 4FFNA 4CQMA 2SCUA 1SEVA 3UCEA 4TZTA 5KCZA 4GSLA 4WE3A 2D59A 4YT2A 2ZYGA 2BF7A 1OC4A 1N9GB 4R3WA 1O5IA 4BNGA 3I52A 5L53A 3EDMA 4AJLA 4J4TA 3AOEA 1VLLA 4GH5A 5GZ3A 5IG2A 6ADHA 3PJFA 1R4NA 3HFSA 2GD1O 2I65A 4W7HA 4YA6A 3TL3A 2EGHA 5A9TA 3DL2A 2C7GA 2Y1CA 3QWHA 3A28A 4CLOB 4PN3A 4RF2A 3AUUA 3ENNA 3ZU3A 5C7OO 4B79A 1PJBA 2BKAA 4FFMA 1D3AA 4FB5A 1RYEA 4AL4A 1DLIA 1HDCA 4XA8A 5CEEA 3LQFA 1XDWA 3PHGA 5B4TA 2I76A 1ZUD1 1PU2A 4KQXA 3PHJA 2GERA 3TRIA 1MUUA 4QFCA 2PR2A 3KYCB 1IOLA 1NPDA 1O89A 3BMNA 4LMRA 3PDUA 4NJOA 4XCVA 2DBZA 5IN5A 3DEYX 3WIEA 1ISFA 1H2HA 4WEQA 4IDGA 3QVOA 3NT4A 2Y93A 3H65A 4XX0A 3PI7A 4C7KA 1KY5A 5FI3A 3VPGA 4XB2A 9LDBA 1W6UA 2ZQZA 1PGQA 1EUZA 5EINA 4E33A 2IEDA 3W4IA 3GG2A 5AVOA 2Q2VA 1NNUA 4J2OA 1CETA 5JY1A 3GDGA 4YYZA 3IAHA 2B69A 1JQBA 4YPOA 3ZWNA 3BMCB 1J0XO 4YT5A 3T4XA 1QYCA 2PZLA 1B3BA 3FI9A 4ID9A 4C4OA 1LC3A 1R6DA 2QZZA 4Z3DA 3DZBA 2W2KB 4CMJA 1AHIA 4RDHA 2VWQA 2ZJ1A
chains in the Genus database with same CATH superfamily
1VI5A 4Z4GA 2YWJA 4B5KA 3OP4A 3AJ9A 4H7HA 1RAIA 1S5PA 3RH0A 1SU6A 5LLTA 2O1WA 3KIPA 3EVZA 5C8YA 3RHTA 4P83A 5P21A 4YCLA 4A15A 2AC4A 4D3FA 3ANMA 3DLAA 1BCRA 1PEAA 2M98A 3E1GA 1GL6A 4WY8A 3JQEA 1OI7A 3PXBA 1XZPA 3EYWA 1AURA 1C7EA 1QV7A 4JHXA 4URUR 5KS2A 1W59A 2W6OA 1EGHA 2UKDA 5EMNA 1CCWA 1G41A 4BFLA 3K6KA 3PPVA 3QQPA 4G5FA 5K0CA 4X00A 4I6EA 1ATZA 1T5DX 4JQCA 1GGMA 4O3MA 1C3XA 3KVYA 3GRZA 5G0TA 2XBMA 3NPAA 5HGJA 1RYZA 1CUAA 1E1NA 1SKAA 1L4NA 2E55A 3HWSA 1GITA 3PYMA 4MUGA 3HCNA 1FUKA 3EXHA 5GADl 1FYDA 3VVMA 4GW3A 4TYMA 2IU0A 2C9DA 1YDGA 3GUVA 5TT1A 3ZGVA 1NQTA 4WVFA 1MIOB 2G67A 2D2XA 4MW5A 3GUUA 3H75A 1J8DA 2RHCA 2VCYA 3WJ7A 3ADOA 1RQ7A 5ECDA 1IZ7A 2OEPA 3E2PA 3AQIA 3FZQA 4WVLA 5LBTA 2G82A 1UK6A 1C9KA 4MPDA 1WEKA 1XEAA 4OM8A 1UBOS 1MB3A 1YKFA 1IMOA 2YHIA 4RLQA 4UU8A 3ZD9A 1OBFO 1AHPA 5B55A 2BMVA 3DFIA 1L8QA 4GWKA 1NFQA 4Q3KA 1AQUA 3MJTA 4BFTA 5CA1A 4B3RB 3EF3A 2A84A 2RKOA 2W8ZA 3C6ZA 2VAXA 3DV9A 2BSAA 2CHQA 3E18A 3KR1A 4RA6B 1KO8A 1ZISA 5H5JA 1E3WA 4CGYA 4PZLA 1YK1A 4LRWA 2O06A 1J2TA 4EJFA 1FRQA 2BGNA 2H08A 1KOLA 1J1IA 1LPBB 3KVOA 2XUIA 3GFOA 5K51A 3IUQA 3TJRA 4HRAA 3U81A 5FQNA 1N2IA 3BD8A 3ZY5A 2PGDA 5TXGA 3PXGA 3HYCA 3L0PA 2OHGA 3FSRA 4NAUA 4R69A 4DCNA 4OL0A 1ABEA 4RYLA 4D4LA 2ECFA 2E6KA 3ROGA 2Q1YA 4E5UA 5JI3E 2GO1A 1EFVA 1PSZA 1U02A 1UODA 4G56A 2DR0A 3CZCA 3A6FA 1PBNA 3NOQA 3QBVA 4BC1A 5JXGA 1OX5A 3VMMA 1GNPA 2OZEA 1GPWB 1GTMA 2VJQA 4QECA 1KJIA 4F72A 4DWVA 2HA2A 4LOAA 1GD1O 5LDHA 3I37X 4MW1A 2FX3A 5AUQA 3ANTA 1Y5MA 421PA 2EGUA 4BNYA 1ODIA 3LWDA 4AB1A 1Y3FE 4AYTA 4BNDB 4C2AA 2CB0A 4F4DA 4RDIA 4YMHA 1ZP6A 2A9VA 3CF4A 4ZV4A 5IK2D 5JRJA 3IOBA 3BHMA 1UK9A 3KKLA 3OEYA 1W5BA 3NHRA 4LV6A 3RV4A 1IG0A 4ER3A 2NZWA 1MZPA 2EKZA 2KB0A 4F6LA 1U0LA 1MAVA 3V48A 3KJNA 4B4DA 1H2FA 3BSFA 4BQEA 5E3JA 4DLKA 2GVNA 1QAOA 4XRRA 2NVWA 2W22A 4Y6RA 5CM8B 1TU4A 3CPEA 4MUNA 1R10A 1Z4NA 3WY9A 3MJRA 3G85A 1W9MA 3AEQA 1FPMA 1XWFA 1YTLA 5ABPA 3Q6MA 1JLRA 3PYXA 1ZZGA 3N8GA 4H6PA 3EIFA 1ULAA 1ZMOA 4QYSA 3W2IA 4OJTA 3AW9A 2QI9C 2HJWA 4GX5A 3D7SA 3EA5A 3LT1A 1ZHFA 2IBMA 2OHXA 3K0AB 3JVIA 4P4SB 1AKTA 4YRCA 5ALSA 2GXQA 3CRMA 4TKVA 2NMVA 1H66A 3PIDA 2HT6A 4Y9UA 5M04A 1SKUA 1OSNA 3ZWOA 1UKAA 3U7HB 3SGLA 4NICA 4ZO6A 4FSDA 1YUBA 1NUTA 1QYDA 1N92A 4P35A 1Y33E 2J0UB 3A3YA 4RQUA 2D3WA 2Q99A 1ODFA 1P1IA 3F3YA 5H1YA 3LLMA 1W85B 3MERA 3QX3A 3K96A 3W2FA 2G40A 2RAPA 2R8ZA 3BYZA 1DC6A 2W8BB 3GJSA 1CEYA 1JIIA 5EY5B 2EL9A 1YHZA 5CK5A 4GOJA 1DAHA 2P4QA 2FPGA 2IITA 4C0JA 2RI0A 4KACA 1I2ZA 2XWPA 4YJ3F 5KYVA 4LI0A 3I28A 1ITZA 3HDTA 5ESRA 4PU0A 4IFIA 2BUAA 3AV0B 5B57C 3JWJA 1DTWB 4Q37A 2H51A 4EG1A 2CEKA 1R64A 3CCBA 1WAMA 5TF0A 1X7DA 2QZ9A 1E7SA 4JJZA 2RDMA 3WLSA 2WTMA 4ASUD 1NSTA 3D3EA 4CQJA 3P9ZA 4Q03A 5KHLB 5DI3A 3WQQA 1F7UA 1ISHA 5IN4A 2FPMA 4RPHA 2OGUA 4DTIA 1DQRA 3SEAA 3SFZA 4E7OA 1U3UA 5IKOA 1J8YF 4WZAE 5C1DA 4H17A 4CFYA 3FMFA 2G1PA 1SZDA 1V1MA 4E5MA 4A6EA 2BDTA 4QQKA 1X15A 1ODSA 4IS2A 1XCOA 1WDMA 1BCSB 2V0NA 4LDAA 4C08A 1GNLA 1PZXA 3AM1A 1EFRD 4MCHA 1NC1A 2X0KA 3JS5A 3FPEA 4R31A 1ZA2A 4YLEA 3ROQA 2AR7A 3SX2A 3N2IA 5KNBD 4J1TA 5A05A 2NAPA 1YB6A 4UMDA 3K9BA 1KEVA 1LK0A 3TBFA 4PQRA 2Q4DA 2VO1A 4U6NA 3L0YA 5CD9A 5LKRA 3LUDA 1G8JA 4HG2A 4CEHA 2ZPUA 3NW9A 2P6NA 3WP1B 3CUEF 3PKJA 4RL4A 3QE2A 1KY4A 2GOYA 1N2HA 3S8MA 4DV6B 1UPXA 5B53A 2KBFA 1K7SN 2Q21A 3NWOA 5BSGA 1RWPA 4RZ3A 2P2GA 1FNSA 3DWEX 1EE9A 1EUDA 1TK2A 1TUGA 2ZTLA 3R3ZA 4KQWA 4Q9HA 2B4KA 4X65B 2O0LA 1DELA 2ZIGA 3TCKA 1HETA 3ORFA 4J3FA 2JGEA 4GL2A 3L0IB 3QYAA 3G6WA 4G4GA 1SQ5A 2IVFA 3B1WA 1I5OA 4U7GA 4WK6A 3LH5A 5GAJA 1UAAA 1I30A 3V7NA 1ZCFA 2LD4A 2C7BA 3ZHSA 5KDLA 4DG8A 1CJSA 2LRHA 1A98A 1OT3A 3F1KA 3OTWA 2QGNA 4NYJR 3UIEA 3WHLA 4AC9A 2D2FA 4HI0E 1X1EA 2CWDA 1IM2A 3KKPA 4CMKA 1UPAA 2C2YA 1UQTA 1JHRA 2YWFA 3HSSA 3PT9A 3UXMA 4YUYA 2IHNA 4BLQA 4H7KA 1MQSA 4ZVMA 4JBNA 1XX6A 3ZWAA 1QFXA 1CVLA 5EJ7A 5K4HA 2V5AA 5IKPA 1DC8A 1TUIA 1MXFA 2YIDA 1TQ4A 3QTLA 2A35A 2ZSKA 3QI2A 3PDIB 1ZW1A 4KODA 1M9NA 2YMLA 2X9QA 3ZJYA 3U49A 2H5EA 3KR0A 3KZVA 3IBGA 4KQEA 3EXHC 4AKTA 2GN6A 4WOCA 5BRJA 1BE8A 2P77A 4MW6A 2C2BA 5TSDA 2XHEA 4QBTA 4EPYA 2FHPA 2CLIB 3BOSA 5JZMA 5E1DA 2X7XA 3BXOA 3S28A 1FFXA 3QG1A 5L3QB 4YBRA 2DUUA 4L8YA 3ITEA 4NE9A 2C2HA 4C0LA 1BKDR 3SJUA 2OO5C 4LMAA 3WWEA 1CVRA 3AR3A 4NATA 2XRYA 4PAMA 3PPYA 5JO0A 2AFIB 1N2CB 3GUYA 3ZKAA 1MOQA 2NUPB 2LP4Y 2XDWA 3G79A 3O2NA 3ZDDA 4CG0A 4MQBA 4MKZA 1IY8A 5C3UA 3EWSA 2C0QA 2GHTA 2L0XA 1LGYA 3ILSA 3BWBA 2M6SA 1ZESA 2OM6A 3PNYA 4KG7A 5BN4A 4U7DA 3JVDA 4KI7A 2YZ2A 4ND5A 1N3YA 2J4CA 3T41A 2B4TO 5JXJA 4KUEA 1L7VC 5CFPA 4UBMA 2JFXA 4L51A 4G0WA 1BO6A 3OM0A 1M6NA 4Q1EA 4GBJA 5B1IA 4CLEA 2VUSA 3BJZA 2VP6A 1QKIA 2YUTA 1J22A 1TA0A 1EUQA 1HO3A 2O50A 2KE5A 4M1KA 4KCGA 4X1OA 3VKFA 1LLQA 4P7JA 3RSHA 5CDTA 1N7JA 2BKXA 4C0XA 1YJ8A 3BXPA 1WSDA 3VAYA 1Z47A 4MYHA 4JLMA 3C3EA 1KYQA 1NW6A 5DNYB 4GL4A 3E9QA 3M3PA 5DB4A 3HB0A 3KYDB 3WO0A 4G8JA 5AWFC 1F12A 1U7HA 4PSVA 5P8WA 4D9BA 1FMLA 1GA4A 2XDQB 4IJKA 2H4WA 2H0AA 3K0CC 1P6QA 4LJ9A 4NYIQ 5CH3A 3RJMA 4C4AA 2V5UA 3IJRA 4I50F 5ENDA 3ZI0A 3DEFA 1C4OA 3L7YA 2MR5A 4PZ9A 3L8CA 1GL3A 2NZ2A 4HDRB 3WTCA 1E6UA 2YW2A 5ECWA 5CA0A 4C0HA 1XVLA 4G23A 1DBQA 2AE1A 3SQMA 1TVMA 4ZGWA 1R0LA 4EUEA 2ZXUA 2GM4A 1V6SA 4B73A 4CG1A 2VDPB 4QHSA 1EVJA 4MDHA 2VAVA 3M5WA 1CS4C 3PRKE 2XYVA 2FWIA 4BO9A 3DXYA 4MGHA 3H11B 1BGWA 1E1LA 1A5TA 1SQ0A 4LKRA 1QIEA 1Q21A 3WBJA 4HNTA 3NM6B 5FLYA 1ONBA 1WZ2A 2QYTA 5IPFA 4IYJA 2VNKA 5JVDF 2V7GA 4G5GA 1I6MA 2BR4A 2X3YA 4OUKX 4BCDA 5K05A 3I92A 4YUZA 1MNQA 1SURA 1TYDE 2RGCA 3D6AA 5CB4F 4ZQFA 1LSUA 2QTNA 5TS3A 4MRRA 3RC8A 4MTLA 1UJCA 2PBRA 1HWYA 4FNAA 3KEFA 4GNKA 1MC4A 3D6NB 3PQCA 3RG8A 4HUTA 2JLRA 4HXEB 3G17A 3EDOA 1MG5A 4YRQA 1G9SA 2C82A 4JJEA 3LIPA 1UP7A 4HB4A 3SSNA 3U39A 3A6PC 3WL7A 2OB1A 3KZMA 4HFNA 4UARA 2UZ0A 4P2BA 5FI5A 3RYFA 1FOEB 5I9NA 3UVEA 4EF4A 1JYSA 1N3IA 1QUFA 2FSPA 1DKQA 2MSEB 2P65A 1JBEA 3FDFA 4ZOBA 1RE1A 1WCIA 2AJBA 4F3YA 4YMGA 5A4DA 4NBSA 1VXRA 4PLZA 4KEAA 1FTNA 1HFEL 1I01A 3N0RA 2GLXA 3GRKA 3GJ7A 4M1QA 1W8IA 2ZP1A 1LPPA 2NUTB 3AG6A 3LGSA 4A9AA 4CKEA 4DM3A 4E0BA 5ICSA 2QZPA 3RD5A 4KR3A 3UHOA 1IJKA 5K3FB 1R88A 2JRLA 4LPSA 1C3OA 2AJ8A 3FDIA 4YYEA 1T36B 3MRSA 1BEEA 5B37A 4QUAA 4PM4A 4DEVA 3F6CA 5JC8A 4QREA 3ZR4B 1WJGA 2AN1A 3GT3A 3U7IA 1VCMA 3VNQA 2Z2JA 2FETA 4ZP1A 5I45A 4LRYA 3NHYA 5IZ4A 3ASYA 4PG7A 5IAGA 5CIYA 3KPYA 1R0WA 2ZSBA 4MWEA 2ZFUA 4K9OA 3VR4D 3QVGA 3OLQA 1WKBA 1ZZEA 4P0TA 4E21A 1U5CA 3DMTA 5SZIA 3V4SA 3CO0S 4M9ZA 1OGYA 4X7MA 4ZD6A 1USWA 1Q7EA 2B3DA 2J8ZA 3QITA 1AB6A 4I46A 4JR2A 4TUYF 4KQGA 4ESEA 1QANA 2WUGA 1YJ5A 2JGNA 4GPZA 2PNJA 3HJFA 5AK3A 2XQKA 4YH1A 4COKA 5H82A 1OASA 2EDCA 1EP1B 4H1TA 3IL2A 3RVOA 5A3VA 3RJ5A 1RD4A 3RC1A 5AUNB 3GRVA 4EHHA 1KZ7B 3I6ZA 2PAAA 4RIHA 4XM2A 8ADHA 4GRAA 3L02A 2E5WA 2C2XA 4J1TC 1F3LA 3C6YA 4GO1A 2AOVA 2V97A 2DSTA 2PRIA 4TQUS 3T5BA 4YCMA 4XZ3A 2BSQA 1HQDA 3E48A 3F2IA 3L7BA 3B12A 3PLRA 1CRPA 3LKDA 3L1IA 4JBGA 2NO6A 5JNSA 1ZX1A 2AOUB 3OIWA 3TQRA 4GM4A 1BMQA 4RO0A 3DO8A 5IC4A 4RGVA 5IVDA 8LDHA 2QS9A 2IUUA 3O2JA 3FETA 3BRWA 2O3JA 1D4FA 1E3DA 1C30A 1OFGA 2AG5A 3QYPA 4ZMRA 5JS8A 5LQUA 5CFRA 3HGMA 1PDVA 1ORVA 1QDUA 2H6EA 4YQYA 1CEEA 5HP4A 3GLTA 4RKFA 1U2ZA 1IZ9A 3HEMA 1RQ2A 2XF8A 1ZCJA 3DB1A 2GGSA 3D6VA 3GGDA 4HYQA 5HCIA 1ACJA 4BLVA 4C21A 3DTVB 3OQ1A 3U4DA 1DBVO 5FOUA 1BMDA 2O8VA 1R4AA 5AXCA 2WFAA 1B74A 3MT9A 4M60A 3L18A 1TI7A 4IIJB 3RUCA 1NW3A 2JGJA 3N7UA 1HRDA 1XTSA 2G09A 1M2WA 4HNAA 1J33A 3MAGA 4KB5A 4NENA 2IODA 1VGRA 2W93A 2ZKIA 3KKOA 1BWQA 3DOFA 4XTRA 4IJQA 1SBQA 3USCS 5IBCA 4IF6A 2WUWE 3PC2A 2ERCA 2Z6QA 3I12A 2DE0X 1HE4A 1U28A 2WYUA 2XCQA 3HO6A 3VR6D 2AZMA 1SRRA 3WLAA 1N0IA 9LDTA 1H6BA 1LTQA 4W8HA 3L8DA 1AGRA 5DBEX 3LPAA 3VDQA 2AZTA 1OCEA 5JW6A 1XF1A 1U4SA 1SBZA 2NQ8A 2PQ0A 2VATA 1OGIA 3ROZA 4BGUA 2QAGB 2X2EA 5J1SB 3NNSA 4YP0A 4JBYA 1B6RA 2NU7A 1BXGB 2QA5A 1MFZA 1Z34A 4R54A 1FDRA 1FE8A 1ULSA 2RHGB 3N2GB 2RJOA 4OKIA 2HHAA 3ORSA 3TGLA 2CNDA 1FFSA 1P74A 2EOAA 2I29A 2I4NA 4JUIA 5IAJA 4FR0A 4RMIA 3TTSA 5GONF 3QWFA 1TK3A 1UXGA 4FOSA 4RZQA 2IHZA 4OFWA 1ZVMA 3ETNA 3ZGLA 3WLLA 4DLVA 2YQ4A 2PCJA 4XLLA 4ZU1X 3OCXA 3WYBA 4LGCA 3VI4B 4Z49A 1M6EX 2FN3A 4ARCA 5AKLA 2Q0XA 1T5OA 2A9QA 3RJ9A 3UTDA 2EX1A 2P7HA 2CZGA 1BX0A 1U3WA 3IVCA 4MJXA 2C88A 3I0ZA 3L4JA 1VDMA 2XSZD 4HDNB 3UJPA 1CJUC 2J0VA 2XOXA 3HCEA 2XWJI 3PIIA 4RORA 5COQA 4MV9A 2C7PA 2MSLA 3K9NA 5DSZA 1CRWG 2GMWA 3GPIA 5JQGB 4HX9A 5KTMA 3AY0A 3O4VA 1AF4A 5AHRA 2ZJ4A 4ALIA 4WOJA 2BEVB 2VHVA 1R0XA 4MQUA 2DPYA 4L5JA 5ESWA 3VU8A 5KX5F 1OH5A 3LY7A 1HA3A 2A5DA 2JIBA 3OIFA 1GZSA 3V55A 4RF4A 2EQBA 5KTKA 3B20A 2WU3A 2VSXA 4S35A 5EIWA 2Y6VA 4BNDA 3RVPA 2D2EA 2XB8A 4A4DA 1H9AA 1B2RA 1CEQA 3NBKA 4LOJA 1RRVA 1JAHA 3M3DA 4DQXA 3OJLA 4TLDA 3UB2A 2O0MA 5DZSA 1PGOA 2NTYC 3GGSA 1UC4B 3Q7SA 4AY3A 4LHZA 3ZZNA 4KSYA 5K0FA 2XW6A 5IJ9B 4XPIB 3AB3A 1CF4A 2KW5A 3TLGB 4F5DA 1N5OX 4KGVA 2CF5A 3PRHA 2C4MA 5DN9A 1IZZA 3UJCA 1LPAB 2R4TA 3L40A 1GQ2A 3L7NA 4D4JA 1T8SA 1XQXA 2ADOA 1JILA 1YRHA 3JQAA 4MAMA 4R1MA 3JRXA 4EHNA 4WT7A 3PHBE 1AZSC 4P3YA 4Q7MB 3NUGA 4D9EA 1V16B 5F7XA 1OLOA 1X80B 2PZMA 4TYWA 2WB4A 4QGFA 3WQSB 4DR4B 1M7HA 2G08A 1IN7A 2OGZA 1ZK0A 3JQBC 4Q3BA 4QDJA 4UEKA 5T5QA 1M33A 4AZ3B 1ZH8A 3DGEC 3EWAA 4O4IF 3TS1A 3ZHVA 1UBUS 2FYTA 3PENA 1XZ8A 3Q5DA 4DZZA 5B36A 2V7XA 2IKQA 5AVUA 1U0OC 2Q2WA 4J1SA 4JT4A 4WX2B 3UOGA 4TN5A 4S2EA 2GA9A 2GEJA 3G6KA 3I73A 4QJIA 2Q2QA 3H86A 4C30A 1Y3CE 3TECE 3RADC 3SS9X 5EZYB 3FUTA 3QU9A 3FTQA 5A9RA 4RIEA 4NBUA 3VBCA 3AETB 3PKZA 2PV0A 2Q3MA 4KKXB 1HFWA 1ZGZA 2YBEA 3VISA 2GPBA 3K0AA 2AIRA 1Q57A 5HBGA 2HW8A 1G9TA 4FKMA 2VNIA 3CA8A 3GJXC 4LJ5A 2FW9A 3OZIA 1V8BA 4I2NA 3TMYA 3GLQA 3B48A 4BKRA 5FDFA 1VG1A 5FOVA 1VIMA 2BGIA 1MDFA 4MCIA 2XAAA 3P97A 3AG5A 4QLBA 3LWNA 2PDAA 2WU0A 2OHFA 1Y1TA 2ZI7A 1QAMA 2HMYB 4FYXA 1W85A 4L74A 4LXGA 2JFPA 3N53A 4J03A 4ZOAA 4A1FA 1RJEA 3HWRA 1DHRA 2W8BA 3DMTC 4V39A 4X63A 4GXNA 4CGZA 5H59A 2NU9B 1NASA 3GDWA 3IIEA 4WA7A 1XPRA 2FSHA 4A8PA 3KB1A 3HCBA 3ZTWA 4PC2A 4CNQA 5A0FA 3TL2A 4HT3B 1FFYA 2Z9DA 2H2FA 3AVVA 4OH1A 1S2LA 3EJWA 3L2OB 3VKWA 3JQFA 4DCPA 1EXDA 1EXWA 1U0JA 3JQ8B 2AYYA 2RBKA 1NVVQ 1MBZA 4MV5A 1PQPA 4QO7A 9ATCA 3TNJA 4EGJA 4CCAA 4N6GA 2PKWA 1QHIA 5KAMA 2QL5A 1M8PA 3OIYA 3I2KA 1Z16A 4CCYB 4DV2B 4RZSA 4HGQA 2PMFA 5JYEA 2GETA 2HJGA 3O90A 2RGBA 3KTDA 3BJEA 3ND5A 4S0XA 2QX7A 4L22A 1IOVA 4J0HA 7REQB 1QE0A 3CMMA 4GM0A 3QOXA 1V3UA 2O3TA 3QYJA 4ZZ2A 4CIYA 2DJ5A 3TTYA 1B4DA 5IEJA 2VPXA 3FCOA 4G37A 3SOZA 1QZZA 3UWDA 3ILHA 3VPCA 5IXYA 3SDZA 4DMLA 2IQIA 1QPZA 4RPGA 1TA4A 1BCSA 2CDCA 2D54A 2I54A 1FW8A 2QVGA 4FC7A 2YWGA 3BSWA 3PD7A 5ESXA 3UHFA 1EM6A 2D0PB 3SYLA 3VZDA 3EAQA 4TXJA 2WYIA 5H3HA 3REQB 1OI3A 4WBNB 4LZZA 5E7MA 2ZW9A 1U2GA 2WWXA 3HR7A 4B7AA 4EM6A 3IR6A 5EP4A 2H17A 1FMJA 4RC9A 3IYLW 3DEIA 4MYUA 4O4HA 3S7ZA 2OHIA 3TMKA 3DAHA 1ARZA 1O8BA 3RYTC 3IAM1 2FWMX 1RRMA 4WZ6A 3SVZA 3SIXA 3WGVA 1NVWQ 3THWB 1PDWA 2PRJA 2P41A 4TSRA 5KVCA 3RAPR 2AXPA 3KL4A 1JFVA 4YP5A 4D56A 1DFGA 3SYKA 4R05A 4K40A 2UVQA 4NQZA 5DMHA 1SXJB 5C32A 2JHAA 5AM2A 1SA0A 1U28C 5JJCA 4H0NA 1RYMA 1ID8A 2Q62A 2G5GX 2OVBA 1NW7A 2A9JA 3G0DA 4OB6A 4BNTA 5L4SA 2UXDB 5F35A 1MNAA 3ZUPA 4I08A 4JNCA 4YDSA 1NMSA 2SNIE 1RFLA 1JXAA 5IUNC 4Q3CA 1BX3A 4AKHA 4XWTA 3CLTD 3WSVA 4PZUA 1R7RA 1JMKC 1ZK4A 4IF4A 3RRXA 4B9EA 1ZM4A 4DWJA 1QBKC 4XTCS 3E9DA 1GYQA 3ZDFA 2MYUA 4NMXB 2NVUB 1NWHA 4B33A 2ZE6A 1Z0UA 1YQ9A 4MV1A 3BL6A 1QR6A 4RQAA 4F46A 2W71A 1ICEA 4LYEA 1E2BA 2C29D 4JLDA 3NDIA 2CD9A 5F7OA 3AWDA 2CVZA 4BNVA 3HCDA 1LWNA 4MV0A 2SKEA 4U2CA 3K4PA 1IHDA 4IG4A 2JGDB 5GMOA 1IG3A 3INNA 3IPAA 5IDYA 4YNBA 3UMRA 1RJDA 5FTJA 2YC4C 5BOSA 3NJ4A 3K32A 1F2UA 1A0OA 1GL9B 2HH9A 3HV0A 1XZAA 3ESBA 1UOOA 4ZI2A 4ZYUA 3EG9A 2FN7A 1TGVA 1XDZA 3ED1A 1YZKA 3NWEA 3GCZA 5BVGA 4G24A 4KXUA 2AFIA 2NZJA 4MVWA 1I7NA 3FWZA 2VP4A 4HTFB 4OHUA 2W0MA 3SK0A 3OP1A 5LUBA 5HPYB 1XHEA 1NMZA 2EZ8A 3LE8A 4MR7B 5FX2A 1UR5A 1JIXA 3MRTA 4JI6B 2AHOA 2DKOA 3OOWA 3UC9A 1PUIA 4HLCA 3PF8A 5LQAA 2I3BA 3GVIA 4IRMA 3P32A 1W0JA 5BYJA 2P67A 3E5NA 3JW8A 3K8ZA 2CDBA 5DV9A 2ZT8A 1CF9A 2IYQA 4NOKA 4XJTA 5KC8A 3Q2OA 2WVAA 2W4IA 4OHFA 4XQEA 3JQ6A 3SS8A 5DEIA 1GGEA 1U1GA 1QZUA 3EUWA 1T2AA 3E82A 4KO3S 1TQ6A 4IH1A 2FSIA 4Q4HA 5CHEA 4II3A 2NOAA 1JKMA 2JLSA 3F8WA 5BW8A 3TB4A 2BTOA 1SVSA 3B8HA 2HI0A 1T5BA 3QLJA 2DPMA 1L5HA 1PS9A 2D1YA 1QG2A 2INGX 3QW4B 4OLHA 3TW0A 2Y1XA 1RLJA 1EG7A 3AFGA 1XC7A 2HDOA 3NS7A 4GAEA 1UIRA 2SCUB 3ROFA 2X58A 3SKVA 5CM2Z 3RIEA 3BBLA 3OQMA 1FFCA 3CLSD 1JF8A 1AK2A 4ZAFA 3RAGA 3UENA 5EJ9A 3ZJVA 4LZLA 1KZ4A 5KJ6A 3CLUC 4GPTA 5AJYA 4QU9A 4LKOA 2YIJA 4BAZA 4CMBA 4P93A 4EOGA 5FFFA 4S1VA 4YJKA 3I8OA 2DUMA 2ASVA 2JJMA 4CM6A 4WBSA 1ZU4A 3EH2A 3HYNA 4OQXA 1WUTA 3ZCTA 5L3VA 1BOFA 4D2IA 3L6UA 1N5DA 4N5DA 4R1LA 3I8XA 2C7RA 1TJ5A 2JF0A 1XZHA 3W7BA 3RYCB 2H11A 1BVRA 3SQDA 1L5YA 2HU5A 5AVYA 3B53X 1Q0RA 1EFLA 2WHPB 4BTEA 5JNTA 2HRQA 1M2OB 5H4GA 5AW8A 1GZ7A 1NOKA 4JUCA 5IABA 2IBSA 1JDJA 1QNFA 3D3NA 4G65A 3KUDA 1MFPA 2NO4A 2ZTUA 4N18A 3PC3A 1PSDA 2RK3A 2RH8A 2XCUA 3LUKA 1JNXX 3J81A 2PPVA 3AHDA 1OROA 1FSSA 1XCMA 1BHSA 2NZUG 2YCBA 4QGBA 2QGZA 1EFCA 3DPUA 4YJHA 4DIDA 4FNGA 2DWUA 3T7IA 1T3HA 3IRUA 3QF4B 1L1RA 1PHPA 2QX8A 4YB8A 1CUWA 4DLBA 4F9FA 3H6KA 3F3SA 1ZGHA 4IQ0A 2NUTA 2NSLA 4RSHA 3T0GA 3NV9A 4RNDB 4V38A 4WKGA 4F0JA 4D4IA 3QPWA 2F90A 4NTZA 2FG7C 5DM4A 3JVVA 5K3FA 1WKVA 4HAIA 1LW7A 4QNNA 1T36A 4XSHA 3C3BA 4HXYA 2BI8A 4Q1FA 3IEMA 1JT2A 1PS0A 1GY8A 3FSGD 3JQFC 3UJ6A 5I51A 1C4XA 1DAGA 1L7OA 2J08A 2Y67A 2AFRA 5E95A 1JFTA 4UXHA 4Z2AA 2H18A 3WIUA 2X7HA 5I9TA 4WCDA 3S7TA 1DIRA 1VPEA 1KYWA 5BWOA 4B46A 2PNFA 3FNGA 3KP1A 4XX1A 4EK9A 3EIOA 3R3UA 1ZM9A 5FADA 1ZD2P 3LK6A 3N0TA 3WLFA 4HATA 3RUDA 4F06A 1QK5A 3H9QA 3IDFA 1YRBA 3V9PA 3GEHA 4Q4LA 3G0OA 4MA4A 4AW9A 1Y34E 4F9GA 1II9A 1O03A 1C7JA 2O2GA 4RMJA 1Z5UA 1E0JA 4XYMA 1G8FA 1X0XA 1U3FA 3M4YA 1SBCA 3DEAA 2WKPA 5LQRA 1H23A 1LPMA 1U4NA 5JTTA 1CQJB 1Q1QA 3KOWA 4HYYA 2XCOA 5K0ZA 5T4HA 4E1AA 3AUFA 1TRKA 3D2CA 1I2MA 1RNLA 1S89A 3N0VA 4I1OA 3LP8A 4ENPA 3R2JA 4ZEMA 3O73A 1R8JA 3TDNA 2FPIA 4FYIA 1YL7A 3I9V1 5I7WA 3H05A 1LBHA 4WHMA 4AMUA 3UT5B 5ALHA 1OWLA 2HXSA 4YAUA 1J20A 4O0LA 3E5RA 1AT1A 4MICA 1D1SA 2FAXA 1XF9A 5F78A 4G0UA 2FOIA 3LP5A 4JL6A 3UMFA 3S2FA 3WMEA 4G5QA 1TAQA 4O2RA 4WASA 2AQHA 3D6MA 1B93A 1UDWA 1O0CA 3SZGA 4CN9A 3RFXA 3SXPA 1VECA 3IT0A 4ECEA 2PN1A 1Y8CA 1OFTA 2Q8QA 3JR7A 121PA 3PC6A 2CHEA 3BAFA 2HF2A 2I2AA 5K03A 3T1QA 3TAXA 3NBMA 3RS2A 5DWVA 1KAHA 5KDDA 3DNMA 1Z22A 4IDQA 4RLHA 4YT8A 1HQYE 3W1EA 4JI5B 1K27A 1S3FA 3NMUF 1H2YA 3UWOA 1NVMB 2IS1A 4QDZA 1OPXA 1P4AA 1VLZA 5CVDA 1GQOA 4B6RA 3KT6A 5JSZA 4LOKA 1G55A 4W5JA 1TZ2A 3UXEA 1R4MB 3BSYA 3IBFA 2C4HA 3AF3A 2FLVA 5EHZA 3P8ZA 1Q7CA 2YVKA 5A3QA 1MB0A 4EY6A 1G1AA 1T4DA 3LXRA 1V9CA 4QICA 2LW7A 1EGAA 3U2QA 2FH5B 1EVLA 3I6BA 2Y0CA 1FCJA 4MRAA 1JZTA 3KUCA 5ELMA 2VK4A 1LS1A 4ANFA 1I14A 1I8TA 1E9SA 1N0WA 1Y7HA 2JIRA 5IXJA 3P0EA 4FN4A 1MV8A 2QJTA 3A4VA 4Y9SA 4HB3A 4PZAA 3A1FA 5EN4A 3OKPA 4OQDA 3T9FA 3WK7A 2V6JA 3KT8A 2ZT5A 2QT0A 3PXAA 4RH3A 2YNMA 4G4SP 4KE9A 4PWZA 4IGIA 4YROA 3W4JA 1JGTA 4L50A 4ZDIA 1FFBA 2R96A 1XXHB 4RM2A 4D79A 3R3HA 3QFCA 3HCFA 3F98A 1SY7A 3RVQA 1DAFA 2BFEB 2RB4A 1J8QA 4HQ0A 1LSSA 2DVMA 1JQ3A 2V9PA 3OUZA 4M8IA 3QNWA 2PT6A 3MJDA 4HRYA 5IZCC 1CULC 1Q15A 1U3CA 1WTCA 3DFFA 3AMVA 1A8QA 2X1MA 4INZA 1I24A 4ZANA 5JLJA 4MRSA 3GLGE 2Q27A 3VOTA 2TMGA 1STOA 3N59A 4RESA 1PNQA 1UJMA 4I55F 3LZDA 3IJEB 4C7BA 1HGXA 3CIFA 2C5AA 4IDFA 4E2FA 2I2CA 3HBLA 3ZNNA 3OPQA 5KINB 1YO6A 2FW7A 1PGJA 2V98A 1KKMA 1U5BA 2ZEJA 1NP7A 4BLWA 5JQGA 5KU1A 5KO2A 5TRTA 1XMSA 3ROPA 4Y2XA 3WNCA 4KQFA 2ONZA 1L3CA 2BEVA 4GP6A 3KQVA 4IINA 2HU2A 4Z0HO 1XMVA 1VL8A 2VNSA 3EXIB 2NO9A 4J0KA 3N76A 4TWIA 3E7XA 4JVSB 2XTJA 1N57A 1CIJA 2RI6A 2WPDD 1V1RB 2JFHA 2OTCA 3VU0A 3B1FA 3GRCA 4YS6A 5DBHX 4QG7A 2AB0A 3FSEA 4JT8A 5TMPA 2UUAB 1ZUHA 3IVAA 3A6JA 4XFDA 4DQKA 2JHCA 5IKMA 1NBHA 4X61A 3GJYA 2NU8B 4XPIA 3DOUA 1UXJA 4O33A 4PQEA 2OV8A 3FWPA 4PC3A 3W5SA 4ZT3A 5JH7B 3KB6A 3TF5A 1LLUA 1OH6A 1CNMA 4V1CI 1NI4B 4FYMA 2BZGA 5H80A 2OFOA 4BNZA 5FEUA 5H4HA 1FTSA 1FNCA 3FAZA 3JQGA 5EI5A 5CLGA 2COUA 1PWXA 2A1TS 5FP0A 5KREA 2C83A 2WD7A 1RI2A 1SHJA 1X80A 1CW2B 4LXQA 2BBOA 2I2FA 2NLOA 3ENKA 4XYGA 4AZSA 2ZM5A 1YVDA 2TS1A 2PUDA 1V8DA 4LZJA 1ORTA 1JQEA 4AU1A 2DHCA 4LDJA 1G38A 1UCFA 4H1VA 3GPLA 5AM0A 3O8CA 2E37A 3EEFA 1JXOA 1YB4A 2E4ZA 4G0PA 4PLHA 2A5GA 3UBTA 3L6OO 2WQZA 4D8TA 2B7CA 1WMFA 1NN3A 3QNUA 2X0JA 4RJIA 5JRZA 3G0HA 3H2SA 2Q5FA 6GPBA 2WWVD 4JBHA 1XAGA 5BSMA 2HQOA 4ZEVA 4YDRA 2DPLA 2WF9A 3HCPA 3SI7A 3OHMA 1QRAA 2XUPA 1VFPA 5KAPA 1MB2A 1IHPA 3M82A 1JDSA 3C3YA 4WTOA 2HCFA 2ZBGA 4J0QA 3TCNA 2GAIA 1PSWA 3L0CA 2IKSA 2FF7A 3CW8X 4BU0A 2GCGA 3B82A 4X1IB 4FLEA 2CMDA 1IK4A 1RYNA 3A9VA 2PZ8A 5I7EA 1CS0B 1QG6A 2UZ1B 5KYYB 2F3SA 1E18A 3EA4A 4HQNA 3B3JA 4YO7A 3G1TA 2D5AA 1NJ6A 1BWSA 2XQFA 2ZJAA 4MZXA 2IYOA 5AR1A 3F5FA 3RC3A 2HRZA 2ZIWB 2H52A 1E4EA 1M2FA 2B4AA 2VYVD 3NHMA 3X1MA 2OKCA 2C1EA 1J7JA 1QYXA 4IR7A 2W5UA 5LMCA 3T0IA 3A26A 4DIBA 4TYNA 4RSRA 2YV1A 3THRA 5DNCA 3LUAA 5ILQA 5AKIA 3M9LA 5GM2A 1Z2AA 1LEHA 4WZBB 2J9XB 1LH0A 1NOIA 1UOQA 2QL7A 3JQRA 1REQB 2W6ID 3UK0A 4Y6PA 4G8CA 3C3KA 3CVYA 2JIPA 4EI9A 2X77A 2E2WA 2YQZA 3N8DA 1E32A 4MLDA 3WYAA 3ZCVA 4KQ1A 3QF7A 3DLPX 4AN0A 2XZLA 3EGWA 2ZDHA 3U7EB 2DU8A 3UJAA 3OECA 3EEOA 3VH2A 1HDZA 5LA6B 3NEYA 1W75A 4CCYA 2JARA 3GJZA 2GZAA 2EBUA 2H7VA 4HJXA 4IDDA 4WY2A 5JAIA 1MD9A 4GNRA 4EA9A 4K6GA 2UYHA 1LFDB 1G5PA 3F8SA 1ZNYA 2KYRA 3LYHA 1KJ9A 3M6LA 4UBIA 2IV3A 2WIJA 2IV2X 3JQPA 2W2LA 4NV0A 4S2UA 4B3HA 4UTVA 5HGXA 4M53A 4OBBA 2W2KA 4JA0A 4RXMA 2H1CA 3E3AA 1X19A 1WXEA 2L69A 3GMIA 5HMMA 3TIIA 5EHXA 2M1ZA 3QXSA 3ZW8A 2FI1A 1XTBA 4FMCF 3HS3A 1KQNA 1G5FA 2UUBB 4X54A 2BEUA 2P4HX 3I72A 2R7AA 1AB5A 2I91A 4RTLA 2ASEA 5K8JB 3U7QB 1JEQB 4AIRA 1VPDA 3C6KA 1RC1A 3ZV3A 3DTVD 1Y1PA 4HXGA 3OKAA 1SKYB 4WMLA 3IKTA 1I7LA 3CE9A 2Y05A 3K9FC 2DB3A 3HKBA 1AQLA 1JLMA 3H9BA 2JVJA 4MULA 5CB6A 3DL0A 4EHDA 1YJCA 4RTMA 3PEVA 4Z9XA 1PVDA 1TQHA 3IHWA 1CXZA 2FFQA 3MNFA 4F4FA 5EHNA 2GBLA 3IMEA 1FMCA 2P8SA 2RHJA 4AJIA 3THWA 3MWDB 3DAGA 2FQWA 1KHTA 1WEHA 2OXIA 1G9XA 7MDHA 3DC2A 2H5LA 1YCHA 2C58A 2TMYA 5EZQA 3V8PA 1HQCA 1XTKA 4IO0A 1SD2A 1SXJA 3V4OA 4M9RA 2BSXA 1IYZA 3IP7A 4CIWA 3EGDB 1A9TA 3WMXA 2EJBA 4U39A 3NALA 4WESB 3UMVA 1ZS9A 3EA0A 4DPLA 1L7DA 1G3RA 1NXXA 2H63A 4PC1A 1JL3A 3FYCA 4P08A 1DMRA 4BKPA 4TMTA 4HNGA 3LW8A 4RF5A 1HMYA 5D84A 4OQZA 2G9VA 5F77A 2OPBA 1JR3A 3W2HA 3N6XA 3DKPA 3BE6A 3F4LA 3NTQA 3QVWA 3KQNA 2NVUA 2ZTSA 2GTIA 1AK1A 4ME6A 3H16A 2PV7A 4YRGA 3ANYB 4NU5A 1FF9A 2CLSA 1YQTA 1IZYA 4V2IA 4NF2A 4QUBA 3TZQA 1N6RA 4CV2A 5F98A 2XTAA 3TLXA 1QHEA 3GFTA 4PGHA 5CLLA 2OQVA 2W2TA 1QH9A 5CYOA 4IFEA 2WWHA 3BIFA 4ZI7B 4XIGS 1TEZA 1TM2A 4M0FA 2VRNA 3VTFA 4D6YA 4FFBA 5AI9A 3CVVA 3E9MA 1F0PA 2X2PA 5T67A 5TT0A 1JJBA 3HP7A 5B58T 3TD2A 3U6BA 3E9ZA 2CN1A 5JMWA 1OZHA 3W6UA 2OG2A 2ZE5A 2A33A 3FYSA 3OQIA 4F5EA 1YQXA 4CIDA 3ZY4A 1DL5A 1IUKA 1MORA 4DMHA 1E2LA 3F2VA 3HY6A 4K9RA 5CVVA 3UT0A 4BVEA 3PFCA 1IPEA 1H05A 5LOVA 1UDAA 4ESHA 621PA 1C81A 1K8ZB 4UDNA 1KAGA 1V4BA 2QMEA 3O8BA 3QHPA 4RXTA 4TT3A 4YRKA 3DBHA 3DPIA 1JALA 1JEAA 3I6IA 1AKQA 2A58A 3CT6A 3H5IA 4YJFB 1Q3HA 3FPHA 4D9CA 2WUVA 3GJQA 4BO2A 4L9RA 4L73A 3TOXA 3P2OA 1IULA 2BHLA 1K7XB 3ZLBA 1R50A 2YOFA 2ZYHA 1SWVA 2K2QB 2P9QA 2V5VA 1JS1X 3HLTA 4FS3A 2PX4A 3P9PA 4EGSA 3T12A