4CMJA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
251
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 251
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmjA00
3EUWA 3GDGA 4RZHA 2H5LA 3GVHA 1EQ2A 1SOVA 5B37A 4YJFB 4Y9DA 2HMTA 3GMDA 4IIVA 4J1NA 4JNKA 3BMNA 4HFNA 1M6HA 3QWBA 3KYBA 4FFMA 3RD5A 4HNHA 3AY7A 2GUGA 2EEZA 4ZHSA 3I9NA 4CV3A 4AJ2A 4WLOA 1ZNQO 2OO5A 3CUKA 1YJQA 4GWKA 4CMGA 3PIIA 3QY9A 3DBHA 1LBEA 1CYDA 2H1SA 2X23A 5EERA 2CMDA 3L4BC 1O89A 4BS9A 4UAGA 4YCAA 3TDKA 4EDFA 2IZZA 1AHIA 1EUDA 3E03A 1ARZA 2B37A 4M1QA 1P1KA 2ZATA 3EHEA 4KUHA 2JCYA 3WNVA 2AQHA 3OP4A 4Y6SA 4E5NA 3ANNA 3D4OA 1N2SA 1XELA 2XXBA 4BV9A 2R00C 1R0LA 1NXQA 4WCFB 1HE3A 1M6WA 4GQAA 2BGKA 4EYEA 3OIDA 1KC1A 2QW8A 5IDYA 2C07A 1ISHA 2Q3EA 1PQPA 3ZWNA 2QZ9A 4Q9NA 2GN8A 2Z95A 1X7DA 3GG2A 5JDIC 5JE8A 4CUKA 1E7MA 3H3FA 1BWSA 3Q9NA 3QHAA 2D5AA 3WYEA 1MG0A 1U5AA 3L77A 4GL4A 3GVCA 2FZWA 3OIFA 5HA5A 3VAZA 5G0WA 3QVXA 3WLEA 3SJ7A 4BKUA 5KVCA 1GYPA 5ICMA 3GUCA 2Q2WA 1HZZA 3MJ4A 4N7RA 1DBVO 4E5MA 1ZFNA 2DC1A 1ENOA 2AA3A 4XYGA 3KRTA 3W6ZA 2AQKA 2Y99A 3DBRA 1XHLA 3QLJA 2R2GA 1B0AA 3JQBA 1VKOA 5A4DA 1E3WB 4MVJM 1PZGA 3EVNA 1KETA 3IJPA 5B4TA 1U4OA 2Y1OA 4RLHA 3CMMA 1A27A 1W73A 1RM3A 4MP6A 5BQFA 4D42A 2CZCA 4IXWA 5CDGA 1LEHA 1J6UA 3OETA 1PJ4A 1X7GA 3NTOA 2Q99A 2PZMA 2FZEA 1ONNA 4J1QA 4M49A 1LSUA 1I2CA 2FSSA 3QSGA 1DDOA 2VOJA 4I5DA 4U6QA 5ITVA 2Q2VA 2GPTA 1PJQA 4R51A 3TZCA 2DTXA 4J7XA 4MOWA 3EGOA 4HXYA 4CLDA 1NR1A 3KYDA 2ZK7A 4A27A 1ULUA 3MWDB 1P1HA 5JCXA 1ID1A 4OL9A 1O9BA 5IDQA 3IKTA 1NFRA 4R9RA 3OF2A 2D4AA 4ROSA 3LC1O 4O1MA 4UUPA 2PTGA 3N74A 4IBOA 4MVJF 1DB3A 1SOWA 3AM4A 3GT0A 3TJRA 2NADA 1P3DA 5I9LA 2ZTMA 1E5LA 1I24A 2ZTVA 4S3MA 1MP0A 2JFHA 4GWGA 4UUMA 1QLJA 5DULA 3W8DA 1P33A 2ZCUA 3I9MA 4KWHA 1LLUA 1KVRA 4J7UA 1KEWA 4D43A 3GZ4A 5CDUA 1YO6A 2FPPA 1PS0A 1LI4A 1PJ3A 3MCVA 4R4JA 4RF2A 4AL4A 1Z6ZA 4M8SA 1D1TA 4JLWA 4D3FA 1KC3A 1T4BA 4XWYA 5AXCA 2IYOA 2YV2A 3C8MA 3E6AA 1QV6A 1UAYA 4I5GA 4QX6A 4N5MA 2YW9A 4M89A 2GN9A 2NU7A 4XIJA 3DOJA 1ZXLA 1EVIA 1IYZA 4RVSA 4YJDA 3ZV5A 5JC1A 4K6CA 4CV0A 2CDCA 5B1YA 1GYRA 2X86A 1PL7A 2AEFA 4QT0A 3DTTA 4ALKA 1YWGO 4PZCA 2BELA 2X0NA 4I5FA 3NX4A 4HBGA 2AE1A 4ND5A 1QMGA 3G17A 1OMOA 4R1UA 5JNLA 4YWJA 1C0KA 1IZ9A 2QHXA 3HHPA 1ADFA 4MVJG 1JQBA 4BNXA 7MDHA 4JJGA 1TXGA 1LDGA 4MO2A 3IUPA 4NIMA 2VWQA 5TQVA 4AJHA 5KIAA 1VRWA 3SXPA 3GY0A 3ZI0A 1DAOA 3EZLA 3F46A 4EJ6A 2NTVA 1U1IA 1PZFA 1UZNA 3KV3O 4CMCA 4Z6KA 1UAGA 5DCWA 3HZZA 2EF1A 4UVHA 1PEDA 2DAPA 3VKUA 3FBGA 2GZ2A 3GN1A 2O3UA 3RC9A 1C1DA 5GZ6A 1OC2A 1WZEA 5K0ZA 2W2KB 5FI3A 5JMPA 4E2ZA 3U4HA 4CLXA 1HYEA 3KETA 3WICA 3TPCA 3PVZA 5BSHA 4EBFA 2P5UA 3KOUA 3PQDA 1I3KA 2EERA 3WDSA 2WD8A 1GZ4A 3BYZA 2OOSA 4MVJA 2PKRA 1Y81A 2Z5LA 4CODB 2PZKA 1B8VA 3WTBA 4R3NA 5JXWA 1F06A 1OZAA 3F5QA 3NKLA 5ADHA 5CDTA 2FY8A 2IZ1A 3OQ6A 3U0BA 3VZQA 1C14A 1JAXA 2W4QA 3IP1A 4JGBA 4RDHA 3BHIA 1I3MA 3H3JA 2EGGA 1U7TA 4E2YA 5FF9A 1VL8A 1FXSA 3JQAD 2FR1A 4CUJA 4XD2A 2EP5A 3S2FA 5JAZA 2IODA 1E1NA 3WIDA 3SLGA 1NR7A 1E3LA 2NQ8A 1EUZA 3GMSA 2BFAA 1Y8RB 3S55A 1ZIDA 4E0BA 3VVBA 3O8QA 1E6EA 2NWQA 4WEOA 4B7UA 8ADHA 4U0JA 4GX1A 4KTTE 1LSOA 3H7AA 3B1JA 3NT5A 2O48X 2X9GA 1L1FA 4TMFA 1LRLA 1GAEO 5CP8A 2F1KA 1FDTA 2C0CA 4TZTA 3OBBA 5TS3A 1WWKA 3CIFA 1O8CA 4NMHA 1QYVA 4BKQA 4IMPA 4DMMA 2VN8A 9LDBA 3E8XA 1H0KA 5K9ZA 4II2A 5IN4A 2GN6A 2RH8A 2ZB4A 4IIUA 4KUGA 1C3VA 3GVPA 3BTVA 3DAPA 1NTOA 3KLPX 1UR5A 4MVJI 5CPFA 5U4QA 3QVTA 1JA9A 4CPDA 2O7SA 4CL3A 3FPCA 4RPLA 4JBGA 1N5DA 4FN4A 3ZWAA 2DLDA 1PL6A 2B0JA 4CL8A 3JQ7A 4QEDA 1SO8A 4O63O 2UUPA 3WMWA 4CR7A 4FDAA 1V3VA 4J7CA 1WPQA 3FD8A 4XGIA 3SC6A 1AHHA 2VHVA 4G5HA 4J0FA 3PDUA 4JN6B 3GAFA 3HUDA 3DFZA 4R16A 1T1RA 5DCUA 3MEQA 5I7SA 4B3HA 1GUZA 1HRDA 3D64A 2IEDA 4NU5A 2XAAA 5COQA 4L4SA 3W4KA 5A06A 3ZDFA 4NDNE 1HLPA 4QSMA 4BGEA 1VI2A 1Y9EA 2O4CA 3RUAA 5T64A 4JP2A 3NDRA 1T26A 1DO8A 3OHSX 2H6EA 2C54A 2AMFA 1PU2A 1E3SA 1N1EA 5A9TA 4UREA 1EDZA 1RJWA 3DTYA 4AJPA 1WDLA 3CEAA 4KP7A 1RWBA 1W6UA 1SEVA 2VHYA 2UUOA 2HLPA 1YQGA 2IEBA 1BSVA 2XOXA 1Q0LA 3RUEA 4BB6A 3H9JA 5L95A 3L07A 2YV1A 1DPGA 4E5YA 5JBIA 3M1AA 3NV9A 3Q11A 1ENPA 3ZCXA 5AOVA 3E48A 3ASUA 1CQJA 1LC3A 5TC4A 3WR5A 2DTEA 3NYWA 3DR3A 1LRJA 4NQZA 4BO9A 2P91A 3R0IA 2SCUA 3WWYA 4E13A 2Y1EA 4ZQGA 3H4VA 3JQFC 5TT1A 3A14A 1E7WA 3ZW9A 1WNTA 3DMTC 4R69A 1WW8A 1I36A 1MXHA 2PR2A 2TMGA 3PLRA 3WYCA 2W90A 1U3VA 3UW3A 3IC5A 4D46A 1UP7A 2OHXA 3AI1A 1YBVA 3AUSA 3V1YA 2HMVA 1XG5A 4XGKA 1HWYA 5A3VA 1E3WA 3AU8A 3WMXA 1JW9B 2RHCA 3W6UA 3LYLA 2EKLA 3ETDA 4TKLA 1YS4A 3TRIA 4YRBA 2BF7A 1QRRA 2HO5A 3WJ7A 1KEVA 1ZK3A 4BNVA 4UUNA 3HN2A 3GGOA 2W2LA 1M76A 1PZHA 4G81A 1EE9A 3QVOA 4GLLA 4GH5A 2G5CA 2O3SA 3QIVA 1J4AA 2G76A 2XPCA 4PLHA 2Q1WA 3OFSA 5DN9A 1H6BA 1Q7GA 1H2BA 3ETEA 5DF1A 1YL5A 5EINA 1HE4A 1VC2A 4AJIA 2Y1CA 5HTOA 4UEOA 2BHLA 4BQRA 3HDQA 4F6CA 5JAIA 1JKJA 2CVZA 2VUUA 4ZD6A 4J90A 2DBRA 3ULKA 2QZZA 1X15A 4GSKA 1HYHA 3GLQA 1VSUA 3B20A 4EUHA 2VYND 4BO3A 2JFFA 4U0KA 1DRWA 1VJ1A 4BNWA 1TT5B 5KWEA 4BKPA 2X22A 3WQRA 1QR6A 2CSUA 3ZHYA 2RAFA 4GMGA 4HY3A 4PG8A 3NGXA 4ND1A 2B69A 1NFFA 4YRAA 3WGZA 2D59A 3OEWA 3RFVA 5BSGA 3INRA 3TZKA 3L4SO 4YAEA 3W8EA 3ZV6A 1R6DA 3JYOA 4A26A 3JTMA 5I7VA 2VYVA 4AJEA 1BHSA 1QXSA 5IJZA 1KY4A 1E3EA 1LQTA 3BMOA 4WLNA 2OMEA 3EC7A 4J9VA 3G1TA 3L0DA 4OH1A 1Q1NA 1GEEA 1R0KA 3BHJA 1U2GA 1P1IA 2VRCD 1EK5A 1NFQA 4PLFA 2JD1A 2D1YA 5FWNA 1U7HA 3NGLA 1NVTA 2GZ3A 3G0OA 3K92A 5TLSA 4YA6A 4E5KA 1PJLA 2OUIA 2D8AA 3V5NA 4K9DA 1HZJA 5L3ZA 2J5QA 2DT5A 5A9SB 2G82A 4BUCA 2FMUA 1K6XA 4J4TA 1M67A 3GEDA 4L76A 5AVOA 2NTJA 1GYQA 4HP8A 3GN2A 4QQRA 5CAEA 4TRNA 3JQ9C 1DRVA 4B8ZA 2G0TA 3SX2A 5MDHA 4N54A 2PWZA 3Q0EA 1TLTA 1YH3A 4FPXA 4RVUA 2PZJA 4YB8A 2PGDA 3JD3A 1ZMTA 2ILTA 5T67A 3K31A 3IS3A 4HADA 3OJFA 4LVCA 3O4RA 2W2KA 3GHHA 3QVWA 1UXHA 3AI3A 1G6KA 3F3SA 1ZSNA 2HK7A 1ENZA 3V2GA 2HUNA 2O3TA 2ZJ1A 4MKXA 3NDIA 4H7PA 4CMAA 2DPGA 2OP1A 4PRLA 1ZEJA 4FC7A 3ZWWA 5JDIA 1C0PA 2C5AA 5KKAA 1HDXA 3T7EA 2NU6A 5IN5A 5DBGA 4FJ2A 3RUIA 3KZVA 5G0TA 4GBJA 5IZCC 4XR9A 4J9UE 1ZSYA 2Q46A 4HFJA 3S2GA 4JIGA 3V1TC 2Q2QA 3ZHZA 3L9XA 4DUPA 1N8KA 1HE2A 3I6QA 4EJ0A 3PI7A 3EK2A 3DBLB 3IMFA 1BDMA 1D4FA 1F14A 2PNFA 1FDUA 1MFZA 4B7XA 4IDEA 5HBRA 3FPLA 2V6MA 3AOEC 1ZSVA 4YACA 4PG4A 1AGNA 3HB5X 4AICA 1DSSG 1Y8RA 1ZK4A 1R16A 4HNGA 4IJUA 3ZNOA 2HK8A 2WD7B 3G1UA 4KQWA 1H9BA 3ZWBA 4WLVA 1UXJA 4FFRA 4P4GA 5EMHA 1JAYA 5JCJA 1I2BA 1EK6A 1QYWA 1F8FA 1PJTA 3ROMA 2HMWA 4MVJP 3UHAA 4YDRA 2YV3A 3DMYA 1SMKA 4CLRB 4GX2A 4RZIA 5JO0A 3PYMA 4WGGA 4EITA 1M66A 3RCBA 5JMWA 2CNBA 3FCOA 4TZKA 5T8KC 1B14A 5HRUA 3E1KA 3WTCA 4WUVA 2ZB7A 3UVEA 1DIAA 3GNQA 5IFLA 1V3TA 3BXXA 1H6AA 1F8GA 1HXHA 2O23A 4E12A 3NTRA 4XQEA 5EPOA 5A03A 3MZ0A 1U8FO 3WOHA 4FB5A 3PFFA 4A5OA 4LMPA 3FWZA 1GQ2A 4CM8A 1LA2A 2GCGA 3X2EA 4ND4A 4MKZA 1X1TA 2Q1UA 3MJCA 5JPIA 5ITWA 3P5SA 1HDRA 4R1SA 3SVTA 4ND2A 4DYDA 2C29D 2UVDA 2YDYA 3GHYA 4RPGA 3WGTA 4D7AA 4H16A 4PG7A 3W1VA 2OL4A 1I30A 2IXBA 1MGOA 1NPYA 1P77A 4Q3DA 3GVXA 4YT4A 2V65A 4GMFA 4BMNA 2C82A 4B3IA 5KJ1A 3PJFA 3GRPA 1GU7A 1DC5A 1R4NA 2X0RA 3PFWO 3ORFA 4BNZA 2EGHA 1HDOA 1PWXA 1WXDA 2E37A 4Y98A 1UDBA 2IYPA 3U5TA 5JFOA 4MJLA 2X9NA 3VPSA 1E1KA 2JHFA 4L73A 2Q1TA 4ZQBA 2A4KA 4BVAA 4O0LA 1DIGA 1JKIA 1R4MB 2JKVA 4OMUA 2Y1FA 2P4QA 1SB8A 4GKBA 3PJDA 5LCXA 1V8BA 4NH4A 4IDBA 2D2IA 1I3NA 3R3JA 3OECA 4TRRA 5F5LA 3ZV4A 5GMOA 1VKNA 4AVYA 4LK3A 4FCCA 3T4XA 3COSA 3S1LA 1SCUA 4RCVA 5U9CA 1GZ3A 4PZDA 3TZHA 2B36A 4Y6RA 3F1KA 3FNGA 1BDBA 2AEJA 1I3LA 4XJTA 1DAPA 4R01A 3WB9A 4IZHA 5CEEA 4CJXA 3WSVA 3WGYA 3SC4A 2NU9A 3HE3A 1IPEA 2J5KA 1UXKA 2NLOA 2H63A 4F46A 4TSKA 4LVUA 1V6AA 1XKQA 4G65A 2Y0DA 1OC4A 4R5MA 1E7YA 2O3QA 3ASVA 1D8AA 2YYYA 4WEQA 4DWVA 4OIMA 1H2HA 3RFTA 2JD0A 2HK9A 4RQUA 1WMAA 3TOXA 4XEHA 3LT4A 1ORRA 4EEXA 2YJZA 1DIHA 3JQCA 4QO8A 3U49A 5JYDA 1GV1A 4U5QA 2A92A 5HWSA 2JD2A 1ULSA 3VPGA 2Q45A 4R54A 4RF4A 4A0SA 4D0RA 5H82A 1ZCJA 1JU9A 4RLSA 4ILKA 3JQEA 3WSWA 4WLUA 3JQAB 3GDFA 1CDOA 2JL1A 3ROQA 4PN3A 4JXKA 4K6FA 5KNLA 4LRTB 4CV2A 1E6UA 4JBIA 3F9IA 3DAGA 2J3KA 2YFHA 3ENNA 5GY7A 4PRKA 5G0UA 3I4CA 3OJ0A 4L74A 4LRSB 4UEKA 1E1MA 2VT3A 3NAQA 4UUOA 1HDCA 3TN7A 4EUEA 1AN9A 3EW7A 4KDFA 2VTDA 3H5NA 3DOOA 3JCZA 2HRBA 1KBZA 4WLFA 3WBBA 1LDEA 2FR8A 4NZ9A 1PGNA 4BO8A 3RU7A 4CMIA 4DLBA 4P8RA 1GY8A 4FJ1A 2JJYA 4A10A 4JJIA 1IL0A 5BNFA 3LSYA 1BTOA 3I23A 3O03A 3DXFA 4GVXA 4JJFA 5HM8A 2GDZA 1NYTA 2I66A 3AM3A 3PYXA 4C4OA 4P22A 4OO3A 5ILOA 2BD0A 2JCVA 3PDJA 1UH5A 2F00A 4YT2A 3WGOA 1P31A 4FQ8A 2YQ4A 5ER6A 4FOSA 5KJ6A 3RUDA 1ISIA 4BNKA 4CM9A 4DIBA 3GEGA 1IHXA 2FSVA 5C3MA 1PL8A 4AJKA 2PH5A 1XR3A 3KBOA 1K2WA 3AJRA 2Q50A 1X0VA 2VNAA 4BNIA 4HV4A 4NPCA 4NG5A 2NVUB 1CF2O 1O6ZA 2VZ9A 3PIDA 3JQGB 3K30A 3LLSA 1PR9A 1UDAA 1GUFA 2QQ5A 2ZIZA 4MKRA 1LDNA 2Y68A 1GEGA 1X14A 4Q3EA 1CIVA 3DZFA 1V3UA 2P9EA 3P19A 3DL2A 2E49A 3AI2A 4BGIA 1YB4A 1HEUA 5KVVA 2FPGA 5EESA 1EQUA 2D0IA 1VJ0A 3ZU2A 4RF3A 4PFJA 1B8UA 1PS9A 3BIOA 4URFA 3VPXA 4E21A 1QYCA 3UF0A 3G79A 1IE3A 1LU9A 3KSDO 4I1IA 4J0EA 3LZ6A 3OMLA 1JTVA 2BH9A 1PSDA 2X9VA 3U3XA 4BNLA 3I1JA 3I4FA 4YT8A 4BKRA 3JYPA 1WLYA 2OZPA 4J2HA 3RUFA 1M2WA 5CEFA 1Q7BA 5JAMA 5KJEA 4CLOB 4PG5A 1QKIA 1SB9A 3ETGA 5A9SA 2E48A 1K3TA 1XQ1A 1B3RA 4RL6A 1FK8A 1IPFA 3GFGA 3VKVA 1E3IA 5JC8A 3UCEA 1EBFA 3HN7A 4DL9A 1T25A 1P44A 5LDHA 3A1NA 2X1HA 4BO7A 3ANMA 3AOGA 3Q1LA 5EJ2A 3WQSB 4CMJA 1KVUA 1AE1A 4NK5A 5K6AC 5KOIA 1GQYA 1I01A 2DU8A 2VUSA 2C20A 3D3WB 3PXXA 4BO4A 3U4IA 3VH3A 2J3JA 3BMCB 2DQ4A 4RVGA 3MOIA 3NDJA 2WJPA 3FTPA 4E4YA 1UP4A 4K26A 5GZ3A 2NU8A 2FN7A 1BXKA 2EWMA 3OICA 4ID9A 4HKTA 1Y8QB 3K2BA 1YBMA 3MJEA 1PZEA 4CR8A 4E5PA 1ML3A 2ZYGA 4CM5A 1NAIA 3RBXA 3P7MA 3OM9A 1W4ZA 2Y66A 3BTOA 5JLAA 4Q39A 3CH6A 2ZTUA 3ST7A 1J5PA 4YQYA 3FR7A 1H94A 1JVBA 3Q2IA 4AJOA 2PLAA 4BNFA 4Z3KA 3F1LA 8LDHA 4AJNA 3VOSA 3GRKA 2CDBA 1A71A 2ZYDA 1NPDA 3H5RA 3HJAA 2EP7A 2OBNA 2HRZA 3JQFA 4L4XA 2O7QA 4U7WA 3DMTA 3W8FA 1F17A 1QSGA 2E6UX 3DBLA 1YKFA 2EKPA 1I32A 1LNQA 4OGWA 1ZBQA 5BSFA 3VZSA 5U1PA 2NUAA 2DBVO 1EFKA 4D3SA 2EV9A 2P68A 4CMHA 4ZU3A 2WD7A 1VL6A 2UAGA 4OAQA 1N92A 4XJSA 2QX7A 2BFMA 2GRAA 1P45A 2WDZA 2YHIA 5TJ9A 1TA4A 4QUKA 1GUYA 1IOLA 4FFPA 1XIVA 3RU9A 4FFOA 4FGWA 5G4KB 5FYDA 1NAHA 2W2LD 3JQ8A 4OXYA 5EQDA 2GF2A 4WASA 4DXHA 4CLRA 1PJBA 3KLMX 2YQ5A 3Q9UA 3KEQA 1GTMA 1MA0A 3HNPA 5LC1A 4NHEA 1T2EA 3PGJA 2CF5A 2DM6A 2X5KO 3PWKA 4HWKA 4Z9XA 3AWDA 1UXGA 2GN4A 4J49A 2CD9A 3EYWA 4E32A 1B26A 2AG5A 4CQMA 1CWUA 4IQ0A 4Y67A 2I3AA 1UXIA 4QTZA 3INGA 1Y5RA 5A04A 1YBAA 5I8WA 4CMKA 2QRKA 4XQ9A 5TGDA 4FR5A 4FSHA 2UDPA 4Z9YA 3JYQA 1DRUA 2CVQA 3CMCO 2R6JA 1WDKA 4ZJUA 4NI5A 4YJFA 3MWEB 1RYEA 3R6DA 1KVQA 1G1AA 4INAA 2C5EA 1KERA 3MOGA 4CM7A 2QIOA 2QYSA 1W8DA 3CTMA 3B6ZA 4AJ4A 4BNTA 4RPKA 5B12A 3HDYA 4BKOA 1HTBA 4OHUA 2Y67A 3ZNPA 4CLEA 4FJ0A 3PJEA 1RPNA 2I6TA 1KS9A 3ZWXA 7ADHA 2O3JA 1JWBB 2PKQO 4ONEA 3RIHA 1UJMA 1GV0A 1J0XO 4IPTA 3VDQA 3QW2A 3PQEA 5DP2A 2VT2A 2Q49A 2JFGA 1DC4A 3GF4A 4GAEA 2VQ3A 4II3A 1H5QA 3ZHBA 4W99A 1H6DA 5DZSA 4E6PA 4ALMA 1BVUA 1R4MA 2EJVA 4LSWA 3UN1A 4AFNA 1N1GA 3PHLA 2B35A 4DA9A 3FRJA 1NWHA 3TQHA 2IXAA 4NFSA 3FNHA 2ZCVA 2NVBA 2P4HX 4CM1A 5G4LA 1FDWA 4ZGWA 1Y7TA 1XQ6A 4F6LA 1A7AA 3E9NA 1FJHA 1Y9AA 3H9QA 2VHWA 2VZ8A 4PCVA 3VPHA 4BNJA 4EZBA 3QRWA 3W4IA 1NHWA 3CE6A 4BL5A 1E92A 3RUCA 2VHXA 3MJSA 4DREA 3JQ9A 4CMEC 1YL7A 3H9EO 4QXMA 4DQUA 3BTUA 1K6JA 2AW5A 3ZU5A 2X0JA 1BW9B 4UVDA 1AXEA 4W7IA 5KVQA 4FGSA 3GUYA 4L4RA 5GZ1A 3A9WA 5G2OA 3UFXA 4M86A 4OQZA 4IGEA 5L40A 3IP3A 3KXDA 4E33A 5IDWA 2ET6A 1HDGO 2RIRA 4XYLA 3B1FA 4WOKA 4AJJA 1OOEA 1FF9A 1HSZA 3QP9A 2A9FA 2WYUA 3E18A 3JD4A 5JDCC 4MVJH 1LDBA 4ALIA 4DC0A 3LDHA 1DIRA 2X58A 1T2FA 1MX3A 1O95A 1IUKA 3L6DA 2VOEA 3VH1A 3AUUA 4KQXA 1NVMB 1U3WA 1T4DA 1LC0A 3NRCA 4O59O 2B83A 3O26A 4DQXA 5IZCA 4UVEA 3IQDB 3QV1A 1TEHA 4DGSA 3O9ZA 3GZNB 3UUWA 1BGVA 1ZK0A 1ZJYA 3BA1A 3WGHA 4NBWA 5CPBA 3UKOA 4CQLB 1HLDA 2WE8A 1LX6A 4ALLA 3OIGA 1B7GO 4ALNA 2WSBA 3AOEA 3WQQA 5CG2A 1BMDA 1P0FA 4PLPA 2YY7A 4WLEA 1IB6A 2O2YA 1N9GB 3LT1A 4D3DA 3KVOA 2P2SA 3W4JA 3U62A 3C7DB 1V9LA 4O5OA 5JCJD 1NM5A 1GZ6A 4J91A 1ZO8A 4BIIA 5F21A 5IXYA 1EBUA 3PTZA 4E30A 3HQ4O 4OXKA 3MTGA 3IAHA 2B5WA 2DTDA 1WMBA 4XB2A 1ISJA 1EZ4A 2Y05A 3H9GA 4W9NC 1ENYA 1NP3A 4OKNA 3WGIA 2DPHA 3JQGA 5DOVA 3PWZA 2BLLA 5T8KA 2POQX 4TWRA 1HKUA 1Z82A 3NTQA 1T1SA 2A35A 2ZB3A 4M55A 3DQPA 4GVLA 2CUKA 4QFCA 3RASA 2HDHA 4AJ1A 3GC6A 3IIEA 3RSHA 4PLTA 4D79A 4BQPA 3N7UA 1A7KA 3S2IA 2GYYA 1CETA 1X1EA 2XXJA 2WTBA 4IQ8A 4IXTA 1GCUA 1P1FA 1TB4A 3K8ZA 5TF4A 1DOHA 2Q4BA 3ZWYA 3PLNA 1MG5A 3QWHA 3FTNA 4XYEA 5JAQA 5JYEA 3RC2A 3JSAA 3G3EA 4R68A 3I9LA 1DFHA 3CKYA 3LLVA 5A05A 2UV8A 3VC7A 2YUTA 2GERA 5EL0A 2DFVA 1GCOA 4W6ZA 4ZA2A 2ZTLA 3ABIA 1QYDA 3GEMA 4WNIA 3U4CA 1VSVA 4EI2A 3E5RA 2PK3A 2HMUA 4YRDA 4CLOA 2HU2A 3VTZA 1WZIA 5L7TA 2DBZA 2O50A 4DIFA 1YVEI 3ZNQA 4PLYA 3T7CA 3RKUA 3GAZA 3ZWOA 2NTNA 1H9AA 1ISMA 5JO9A 1KIFA 1YL6A 1NBOA 1RM0A 2AQ8A 3NT4A 1KEPA 3L9WA 4FOOA 2G1UA 2B4RO 1NQAO 3QJ5A 1DJNA 2B4TO 4YQZA 1EFLA 4YXFA 1SEPA 1LJ8A 3CSDA 3K5PA 4XRGA 1PQWA 3JV7A 3D3WA 2OORA 1DEHA 4NBRA 4IQGA 3BMCA 3HG7A 3ZU4A 3Q2KA 2VTEA 3KSZO 2E82A 4PLVA 4OSOA 3KTDA 3NJ8A 3M2TA 3SEFA 3PRJA 5CG1A 1Y8QA 2Y1DA 3JYLA 3HFSA 3KYCB 1R66A 3K6JA 2BFPA 4BNGA 4IDCA 1U5CA 3Q6IA 4L9RA 4JBHA 1MB4A 2YFQA 4Y6PA 2QRLA 3RROA 5KVSA 4CV1A 1ISGA 1BXZA 3TZQA 4ITUA 4OKIA 4ALJA 3RI3A 3H6KA 2EJWA 2IRWA 2RBEA 3HWRA 4IS2A 4OQYA 4F3YA 1KVTA 5KTKA 4XR4A 1NASA 1R15A 4NNJA 4OSPA 4Y8VA 4BO5A 3QVSA 1B2LA 2JAHA 2QYTA 3JYNA 3R1IA 2HCTA 2I76A 2OP0A 2QG4A 1LDYA 1E7QA 4N5NA 5F3RA 1A9ZA 1R12A 2XF8A 2ZYAA 4CM4B 1UP6A 5AXAA 2D3TA 4BNNA 1AXGA 4XRRA 3TSCA 1DLIA 2PV7A 4I08A 1C1XB 3GGPA 4LISA 5AYVA 3TL3A 4PG6A 3O8QB 2NSDA 4RQTA 3X2FA 3VDRA 4QFDA 3GPDG 3VTFA 4XQGA 5G4KA 4PLGA 1UUFA 1YGYA 4RVDA 1D3AA 5FI5A 4O6VA 1GADO 2WWRA 4NJMB 1OI7A 3ZN2A 1B16A 1JN0A 2UYYA 2VYNA 3LK7A 3HSKA 4GGOA 4FBGA 1FDVA 4GGPA 5KKCA 4RPJA 4U8GA 1CJCA 3BZUA 3KO8A 2Y0EA 3DHEA 3UAGA 1ZEMA 3JQDA 4GLOA 1B8PA 3IOYA 4MDHA 5JW6A 1V0JA 1DFIA 4LMRA 4XYMA 1LLQA 2CF6A 3GOHA 1VE9A 2HAEA 4CLHA 5CDYA 4BGUA 2EKQA 4LCEA 3I9JA 4K28A 3DBVO 4W82A 1T2CA 3CINA 3QA9A 3DHYA 4I8XA 5L51A 3L6EA 3P2YA 1EVZA 2TMDA 3SLKA 2AEMA 2O4UX 3F47A 2VRCA 3FSRA 3IKVA 1TT7A 3PHJA 1XGKA 5FEUA 1E1LA 1U3TA 1AUPA 4ZRNA 3TZ6A 3V2HA 2VZ0A 5JY1A 3U9LA 4PLWA 1YB1A 1WDMA 1YE3A 1XSEA 2WYVA 3WS7A 1U9JA 1PJ2A 3S2EA 5L4LA 1S6YA 2RCYA 5DP1A 2B5VA 5G0SA 3D4NA 5CHEA 4FC6A 2ZQZA 4YAIA 4B4OA 1ZXBA 3QWFA 3ZU3A 2P9CA 2C2XA 2GO1A 1PGQA 4PGFA 5C37A 4TRMA 4E2WA 5BNIA 4PLCA 1ZK1A 1ADGA 3RWBA 1I10A 4MIYA 1SNYA 4UVIA 4AJLA 1ZH8A 2YZ7A 5MGBA 3ONEA 2IE0A 3ZWPA 2I5PO 4BNUA 4I9HA 2J3HA 2Y0CA 2HSDA 1KYQA 3AUTA 4BNYA 2VCYA 3UOGA 1Y6JA 3G49A 3JD2A 3LC2O 3I3OA 1P0CA 4KOAA 4YPOA 5KCZA 1ZW1A 5T6BA 5L4SA 2AHRA 3GVIA 4YR9A 4WJZA 1L7DA 3O38A 3BAZA 4WCFC 1UDCA 1JKFA 3M6IA 1BW9A 3NUGA 2VWGA 2ZB8A 3ONDA 3LT2A 5T5QA 1PX0A 4IJWA 3CPSA 4IZIA 5K6AA 4UVGA 3I5MA 1G0OA 1XYGA 1P1JA 1Z73A 3UH1A 3GK3A 3I9KA 1HL3A 2C59A 3C7CB 4P4NA 4Z0TA 4MVJD 4OOEA 3INTA 4MVJE 2VWPA 3RBVA 1E7RA 3WYBA 3DZIA 2I67A 4DRYA 3HDHA 3WIEA 3K9QO 5J23A 3KB6A 2HMSA 3WJAA 1BG6A 4J16A 2X7HA 2OBYA 4R9SA 2DKNA 2PH3A 1LSSA 3CXRA 3RKRA 1B15A 3EVTA 1IZ0A 5C7IO 4E3ZA 2Q4EA 5DNAA 4I5EA 4TKMA 3WBFA 4JP3A 4D45A 4LGVA 3ANLA 1NNUA 3PGXA 3V2UA 1N7GA 1JVSA 2HJRA 3IJRA 1GDHA 3A28A 1LQUA 2J5RA 3GZNA 4JK3A 3UCXA 3VH2A 3DDNA 3T4EA 5BT9A 4CQLA 5ENVA 1HYGA 3PYLA 2J8ZA 3EZYA 3GH3A 1RYDA 4IJKA 1GPJA 4YTEA 5DBIA 1BVRA 1BRMA 4QO7A 2GGSA 1ONOA 4K1LA 4BGVA 1MFPA 2QRJA 1JDJA 5IDXA 1N9GA 3D4PA 3FF4A 3JD1A 1I5RA 2C7GA 4GKVA 4XYBA 1XCBA 2CDAA 4IDGA 2V6GA 4IMRA 4RDIA 3C1OA 1MV8A 1PGPA 4WOJA 1TT5A 4LSMA 4Q3CA 5COBA 4ZVVA 4GX0A 4OXNA 3GNTA 3DZGA 3WFIA 5L9AA 5JSFA 1T24A 1ZMOA 3F4BA 4P4LA 1EVYA 2NV6A 1NQTA 1YJ8A 1VPDA 4CM6A 1VL0A 3ZH2A 4BO6A 4RJTA 1U28A 3FNFA 5DDIP 2B4QA 3WFJA 4GI2A 5BSEA 1S7CA 4ESOA 1NQ5A 3AU9A 4CQMD 1NQOA 2Y1GA 3F5SA 5TJHA 1YB5A 4KDEA 1VJTA 3L6OO 4ZQEA 2EW8A 3KSUA 2BGMA 4YT5A 4RO0A 4I9NA 3D1LA 3DO5A 4MP8A 1XDWA 3WGQA 2P5YA 3BMOB 4NBTA 3UCFA 3PHGA 3B70A 3C3XA 4NBVA 2PZLA 1SAYA 2LDXA 1Z74A 3ZWCA 3ONFA 1BXGB 1ADBA 5IZ4A 3JQ6A 4IY1A 5H83A 4NR0A 4BO2A 1TVEA 4CM3A 1Z7BA 5L53A 1Z7EA 1U8XX 2X8LA 4Q3BA 3UICA 1KOLA 1E5QA 4TRJA 4NFYA 1ZVMA 4BNMA 1PGOA 2NQTA 1DHRA 4N5LA 3IDSA 4Z3DA 4P38A 2EXXA 2GZ1A 1HSOA 4YJHB 1MXFA 1GL3A 3B1KA 2E4AA 3PEFA 5C7LO 2O2SA 4XZ3A 4YJGB 3DZKA 1LTHR 3OA0A 2WM3A 4L75A 1DC3A 3TF5A 1TI7A 4R1NA 4W4TA 3BMQB 1DFGA 3OQBA 1O0SA 1SC6A 1LLCA 4WE3A 4DVJA 3LT0A 2J6IA 4J1SA 2FP4A 1I0ZA 1PQUA 1ADCA 4KTVE 2FPIA 5L7WA 2BI8A 3VH4A 5TIIA 2V6BA 3PZBA 1LLDA 1YXMA 3C85A 4GSLA 4J6FA 3OJOA 4J2OA 2VUTA 3N58A 5A5EA 4KUEA 1A4IA 2JCXA 1EEHA 1QYXA 3JQBC 3R3SA 2Z1MA 3AK4A 1QV7A 1SZJG 5A1TA 1YOVB 3EY4A 1SBYA 3KYCA 1K89A 3QWAA 5C5IA 4MIEA 4CMEA 2YHUA 1L7EA 1Z75A 1Q2XA 5KJFA 1ZK2A 3F4LA 5I7FA 1U2DA 1HDYA 4YBZA 4D44A 4EW6A 1E6WA 2VHZA 3S8MA 4DLAA 2CFCA 4DPMA 2OGUA 3DONA 4ZQHA 4G2NA 4MP3A 4YVFA 3ZHXA 4DQVA 1ZKMA 3DOCA 1NWCA 3C7AA 4FFNA 4HX5A 4LN1A 4TVOA 1CERA 2PKQP 5JDCA 1DXYA 3IL2A 4PIVA 3ADPA 1DC6A 1EDOA 1PWZA 4GX5A 4BV8A 3E9QA 4TQGA 5AXBA 2WEKA 4EJMA 2IDZA 4A7PA 4BNHA 4CM4A 3ZZNA 3OEYA 1YQDA 3LF1A 3NEPX 2JAPA 1T2DA 3TNLA 3RC1A 3CZRA 1C1XA 1KY5A 4IINA 2X5OA 2DUUA 4NFHA 2X0IA 1SPXA 3WG9A 4XQCA 1I33A 3OQ1A 4TVBA 4YYZA 1NPTO 5COAA 1XLTA 1LDMA 2Q1SA 4NJMA 4TROA 1OAAA 4U6SA 2VNSA 3DHNA 1A4UA 1IY8A 3FHLA 3PJGA 3QE3A 4BHTA 1PJSA 4JQCA 3ZW8A 3KHUA 5I7EA 4WKGA 4YAGA 5DT9A 3FWNA 3V1UA 1PS8A 3FR8A 4C7KA 1MUUA 1DHTA 4R5HA 1T2AA 3KEOA 2PFGA 4FS3A 4HFMA 5EQFA 3TFQA 1PGJA 4MINA 4NBUA 3DFUA 1QP8A 3H2SA 4Q3AA 4B4UA 4CM8B 3I6IA 4OYRA 3OJLA 4RV9A 3EMKA 3H8VA 4YAKA 3I9OA 4W9NA 4PLZA 4OOFA 1LXCA 1Q0QA 2VYVD 4RVHA 5I9MA 1CRWG 3BMNB 4XCVA 1Y5MA 1VLLA 1GPDG 3FNEA 3JD0A 1RM4A 4MIOA 5TRTA 1EVJA 3HADA 2H9IA 3ROPA 2PY6A 1W0CA 5TNXA 4A2CA 1MC5A 2X6TA 4IUYA 1R4NB 3C1AA 3RVDA 2OFPA 1GQQA 2RH4A 5F1PA 4BMSA 4IGFA 4BMVA 4CMBA 3PK0A 1Z45A 3DBHB 9LDTA 2PD3A 3OH8A 4WECA 1U3UA 2I9PA 1Q0HA 3E9MA 1A72A 1K5HA 4WCDA 3WNQA 5CEJA 1ISFA 4RGBA 2FHSA 3PQFA 4H15A 5A5FA 4YAJA 3I52A 4KMSA 3STHA 2X5JO 2FR0A 2NNLD 2C2YA 2V7PA 4PVCA 3RBZA 1H93A 3DZHA 4AG3A 4DBZA 3H5AA 5AQ1A 5BR7A 1J49A 5F1OA 3OA2A 3RJ5A 4M87A 3ICCA 4WNCA 4E31A 3D0OA 5ICSA 3MJVA 3DZBA 1VM6A 3LC7O 3GG9A 3OJEA 5L45A 1G0NA 1ZJZA 2I3GA 3UGKA 2C7VA 5DCYA 1D1SA 4GPD1 4D0SA 3UXYA 4B4WA 1R37A 4ND3A 3CZMA 5B4VA 2FRDA 4NU6A 1O5IA 5F5NA 5CFZA 2PA3A 4R41A 3ICPA 3MTJA 3HB4X 4A03A 3AFNA 4PZEA 5ER9A 5B4UA 3GGGA 2AG8A 2DFDA 3JQAA 1XA0A 3PZRA 4DLLA 5T57A 4L0QA 1A9YA 1MLDA 1P1RA 4RVFA 3TFOA 5IF3A 3LQFA 1QG6A 1DJQA 3AY6A 4Z0HO 4X54A 3DBRB 3M1LA 4N18A 4DMLA 2J3IA 2ZQYA 1H6CA 1KEUA 4LCJA 2I99A 4EGFA 1P74A 2EG9A 3LVFO 5AXDA 1F0YA 1JLLA 4QECA 2WE7A 3ADOA 1P9LA 5TX7A 1YDEA 1CQIA 1YDWA 1IHYA 5LDGA 3TOZA 3U4DA 3VZPA 4CUZA 1V35A 3WXBA 1EMDA 1C0IA 1K0UA 2AXQA 2W98A 3KUXA 1EE2A 4M54A 1XU7A 4WK6A 4CR6A 1GD1O 4IDAA 1ONPA 4NJOA 3PWSA 1X0XA 3PPIA 1XEAA 3K73O 3BHMA 3DAFA 1HDZA 3H2ZA 4CMIB 2PGJA 1PTJA 1E77A 3A4VA 3EDMA 2I65A 3ITKA 3C24A 3ZWVA 4EEZA 3SBOA 3BTSA 1FDSA 3KYDB 2V6FA 3LF2A 2OXIA 3DEYX 1Q7CA 4ZRMA 4I9UA 3D7LA 4D41A 3GFBA 2A94A 2VRBA 5DOZA 3WWZA 2NACA 3RFXA 2NVUA 3GDOA 4IJVA 1E7SA 5A9RA 2DBQA 4HUJA 2BI7A 2LDBA 1XWFA 5H81A 4XGNA 3ENKA 3K96A 3Q3CA 4DPKA 4DPLA 3U09A 4KWIA 4DTIA 4FD3A 4DYVA 3GA0A 4DBVO 3V8BA 5IXSA 3P2OA 3TWOA 2JHGA 2EHDA 1HE5A 1OFGA 2NVWA 5ENDA 3FI9A 5I8ZA 1NVGA 2PD4A 3ZV3A 3PP8A 3NT2A 5L7YA 3WGGA 3WLFA 1CEQA 1WP4A 3A06A 3GQVA 5BNTA 1IULA 4WPGA 4A73A 2AQIA 2HKIA 4B79A 3RC7A 1GR0A 3C1TA 4KZPA 4S1VA 5CDSA 1DIBA 3WX0A 3E5MA 1ZZEA 3DB2A 1BXGA 3NJ4A 3OSUA 5DBFA 3QWIA 2YDXA 4ZICA 4NK4A 3ON5A 4J43A 4FFLA 4UEJA 5C7OO 3ITDA 5A02A 4C7JA 1X13A 2BKAA 2Z1NA 4R3WA 1U4SA 1C0LA 1I8TA 1LUAA 4XDYA 5THKA 2Y93A 1LRKA 6ADHA 2G17A 5EIOA 3RJ9A 4YJHA 4J4HA 4IDFA 4R1TA 3E82A 4J1TA 3GPIA 3AW9A 2BMAA 4JROA 4YJGA 3ZNNA 5HS4A 5KJCA 2CY0A 3PHIA 3ZGYA 1O94A 2PD6A 4J3FA 2P9GA 4BO1A 3BMQA 4B8WA 1JWAB 5IG2A 2IZ0A 5HS6A 3L4BA 1OBFO 1PJCA 4ZN6A 4JX8A 1QORA 1C1DB 3QQPA 3D3EA 1I2ZA 2VWHA 3H65A 2O3RA 5A3JA 1HT0A 3FN4A 4RPHA 3VPFA 1HF3A 4IS3A 4XKJA 3HDJA 2HJSA 4IM7A 2R00A 2GASA 4LW8A 4YEDA 3TL2A 3K2EA 4B7CA 1XU9A 1MC4A 1YOVA 1YQXA 2ZKLA 4XB1A 1YONA 3HFGA 1YRLA 4BB5A 3LU1A 5IAAA 1E0DA 5TT0A 4WCFA 4DC1A 3AM5A 1Y1PA 2PGLA 4XDZA 1R0SA 5TSDA 4B4VA 4IDDA 3AUAA 4BOYA 1WVGA 5I9NA 2GD1O 4E2XA 1ZUD1 3FBTA 4B3JA 2W8ZA 3ROKA 2D5CA 1UZLA 2BRUA 2DVMA 2FWMX 1EUCA 3VHRA 4UULA 2CVOA 3RAJA 2WMDA 3F6YA 5ILGA 4FIZA 2GR9A 2DUWA 3ZWMA 2GSDA 1FMCA 1K6IA 1NX6A 4Z9FA 5L4NA 1KVSA 2EIHA 2ZJ0A 4RF5A 1GFSA 3DC2A 3I83A 1LSJA 3GR6A 2HQ1A 1UZMA 1PR3A 4OM8A 5ES3A 4F45A 4L8VA 3D5TA 2GNAA 1F12A 3GNSA 2EW2A 3D5QA 5THQA 1HETA 4EUFA 4FW8A 4W7HA 3DWFA 1X7HA 5EN4A 2YHIB 4BO0A 3DZJA 4XX0A 3KM0A 4HFRA 4DIOA 4RORA 2AE2A 4H3VA 5JS6A 1D7OA 3H9UA 2FOIA 3JQ8B 1E3JA 2GLXA 4Q3NA 1PIWA 4MPDA 3AFMA 3AY3A 5JY6A 5G0VA 1WAMA 3RQSA 3RUHA 3VVCA 1RM5A 3PHHA 3MJTA 4JCOA 4CM9D 4OJNA 6LDHA 1DLJA 2X4GA 3IUSA 1RKXA 3M2PA 2RHRA 4XA8A 4Z0PA 1B3BA 1N7HA 1QLHA 1A5ZA 1M75A 4CQMB 4ZQFA 5FFFA 2NM0A 2WYWA 3JQ7B 2BFOA 1NHGA 3EAGA 4XIYA 2BGLA 5F1KA 4J4BA 3VZRA 4PVDA 3SJUA
chains in the Genus database with same CATH superfamily
4L27A 3H6GA 3JZFA 3G0CA 3VX4A 1BN7A 3ND7A 4YJFB 1MB3A 4DC9A 4U7DA 1MVLA 5GM2A 3ZI4A 1R6VA 5FAKA 2GTHA 1CE8A 4JNKA 3IP5A 4FFMA 4ZI7B 4IXMA 4EG3A 2HV8A 4CQNA 4TQ9A 2IY7A 4HB4A 3LV8A 2OO5A 5CA0B 2QUBA 1YJQA 1K7SN 3CUKA 1CPYA 1ESCA 1NMZA 3M3PA 5IDVA 1K7EB 1HEYA 4D5GA 1P39A 4CKBA 3X44A 4F8EA 2CMDA 5AK6A 1O89A 5EXTA 2WFMA 5GV7A 3FPFA 4BS9A 3TDKA 4D8XA 3R7LA 4KL8S 4HS9A 4E5UA 4KR6A 1KYIA 4KRYA 4W1QA 4DNFA 1C30A 4JBYA 2XMGA 3NHUA 4FE7A 3SF8B 4CU5A 4L28A 5IBRA 2YS7A 2ZATA 2N42A 4LOKA 3T7KA 1LZLA 1Q44A 2JCYA 3KR2A 3RT9A 4JLUA 4Y6SA 3HM9A 3KTFA 1YZVA 3D4OA 3OM1A 1WMEA 1DKMA 3NC0C 1N2SA 1XELA 4HEHA 3W9BA 1D1QA 4BLQA 3EXHA 4I4TB 3MB5A 1P5HA 4X61A 2NZVG 2BGKA 1NYQA 2A3NA 4GQAA 1RQNA 1ZN8A 4GM0A 4J76A 1HNNA 1NUAA 5DRYA 5DYGA 1PQPA 3F9CA 3WHIA 1X7DA 4MYUA 5B1DA 3BULA 4CUKA 4BVJA 3LY9A 4M83A 1BWSA 1TMOA 2VHJA 3MJFA 3QHAA 3GP5A 1UDRA 3F6BX 4G85A 2X40A 3GVCA 3BXPA 2J1LA 5CB8A 5HZHA 3VAZA 2I6UA 3QVXA 2DFLA 4DV7B 3EAQA 3OLZA 3V7UA 2PZAA 3M89A 4BKUA 5HKAA 3P4YA 1OKKD 4G56A 3PFBA 1L4UA 5DH9A 5FBZA 2ZANA 1DT5A 2PLNA 1Q19A 3MTBA 2RDMA 3R5KA 4RULA 4AY6A 5BVHB 4N7RA 3ODPA 3AFHA 4JT2A 5JXJA 4ALJA 2HIGA 1G8HA 2NO0A 1ZOPA 2AA3A 1Z8DA 2WJIA 2XA9A 1P5FA 3COWA 4LC9A 2L19A 1XHLA 1NRJB 2ZT7A 2PVSA 5B58T 1E2QA 1RI4A 3P9PA 5A4DA 3BWVA 3UMCA 2R4QA 4HVAA 3ZHUA 4E4TA 1PZGA 3NRBA 5TEWA 4H0NA 2JFVA 1QCZA 1U4OA 2AJBA 3CMMA 4RLHA 1W0KA 5AK0A 4AF7A 5B4TA 4KKVA 1RM3A 2C99A 3K20A 3NW9A 3TQTA 5BQFA 1DKUA 1QBKC 5C4IA 4D42A 2CZCA 1MZVA 4POOA 4JI8B 4IXWA 1EXNA 1MDFA 3OETA 3ZYZA 2DCUA 1LK5A 4X63A 3TOVA 1ZM9A 1W35A 2Q99A 4V0QA 4J0GA 3PNSA 1QP4A 5ELMA 1FQKA 3LWDA 2V7XA 3BXGA 1SU7A 2CB9A 3ZGLA 2VOJA 2XE7A 4I5DA 2XB9A 1PJQA 4LCBA 4QELA 3IE2A 3DTVA 4MOWA 3CT4A 4YUAA 4HRVA 4WXYB 3EGOA 3L1KA 4Y3UA 3KYDA 1QH9A 1Z2CA 5JPDA 1P1HA 4KIFA 3MBOA 4Y2RA 1ID8A 2P4EA 2R84A 4IXNA 1KYXA 5CYGA 2SKEA 3P2MA 1KYYA 3QMPA 3LC1O 4O1MA 1DKQA 5KSOA 2PXAA 1DARA 3OLXA 4JBXA 4MVJF 2WKSA 2ZR7A 4OHVA 5DT2A 4JKYA 4DJJA 2P30A 2OK8A 1ISPA 3LC0A 1YI1A 4UUMA 3TAXA 3K9BA 3W2TA 1QLJA 3D8UA 4J0IA 3QPCA 4L22A 2ONJA 1D2HA 3I9MA 4X24A 4K8RB 3W8DA 1T3ZA 1Q0RA 4JQZA 5KHAA 3FOEC 1L3BA 1HH4A 2X7JA 2HPZA 2BONA 4J7UA 4P58A 3GZ4A 1K6EA 2QPTA 1NQWA 2Y2UA 4ECEA 2YX1A 3O3NB 1TCCA 4G5XA 3PKJA 4W1SA 4UEQA 4QPDA 2AXEA 3WLHA 3IBFA 3S27A 4NCKA 4XWYA 3SE7A 3TNFA 1WABA 1Z38A 1XO1A 4D8UA 3C8MA 2YV2A 1XCGB 4OHBA 4ZQCB 2QAIA 1ZESA 3E6AA 5E6RA 4DEYA 5KIAA 1OB5A 1A2OA 3LLCA 1CC1S 1MQ8B 4I5GA 4N5MA 2YW9A 4QX6A 4R4JA 2Z56A 3SXUB 2GN9A 3RWOA 1YK1A 2O8FA 3DOJA 4YJDA 1FL9A 1IYZA 2Z58A 3ZV5A 4EJFA 5JC1A 5EP1A 4CV0A 1S3GA 2CDCA 3LX4A 3USCS 3VU9A 5M7EA 1PL7A 1L5OA 2ZJ6A 1RFGE 5C34B 1JDUA 2V8BA 3LOUA 2BELA 1P62B 3G2QA 3NHZA 4AIRA 1QKKA 3N28A 4ND5A 3G17A 5EJEA 1VYTA 1IK4A 4Q3OA 4Z3OA 3AHJA 5HJ5A 1Y34E 3CWQA 1UOPA 4H7KA 3HHPA 1Z68A 4I3GA 1KP2A 2QYOA 4LS3A 1MBZA 4JJGA 1TXGA 2VNHA 2L69A 5ITZA 1KXZA 5KDOA 2IV7A 4NIMA 4X6XA 3TNJA 2VWQA 2QRZA 1GG5A 1UKCA 2FJ0A 2XYRA 5SY6A 3SXPA 1S9DA 4AY5A 1RRPA 5CAEB 4JOBA 1U1IA 3SQWA 4LDZA 3A3NA 4X0EA 4Q48A 4JL6A 4H6PA 4KQIA 2ZULA 1J99A 1U1EA 5DCWA 3IO3A 4ASUD 1ST3A 1IXRC 2EF1A 1P9WA 4NCJA 4U5XA 1SPBS 5MGNA 3U44A 3TKAA 2GZ2A 5T41A 5I3ZA 3RC9A 1ZONA 5GZ6A 2H2DA 2N75A 4KPGA 1V47A 1XCLA 3VU3A 1DTWA 1W4AA 3T7JA 4OHXA 2JJ2D 3OZSA 2GAJA 1VBNA 1Z4JA 3TEFA 2YKGA 1IN1A 3HKEA 3EQ2A 3TPCA 3MMZA 3PVZA 2BFDA 3AR2A 4DHWA 2PQMA 1MNAA 2JF0A 2QTAA 4U3JA 2P5UA 5BP7A 4I50B 4N7JA 4BRSA 1VKHA 4GZ5A 2QT0A 3N8KA 3WDSA 1GGVA 1WMSA 4QQ8A 2OOSA 4HMPA 3PFIA 1SXJD 2HWYA 3O7WA 3EVBA 2YMPA 2GCIA 3NBFA 4CODB 3WTBA 3X0DA 3G9QA 5CDTA 3DO6A 2IZ1A 4A5SA 4UBJA 4ZDKA 3VZQA 3T38A 2W4QA 3V4VB 1E2NA 2OCPA 2VDMB 2J85A 5FUQA 1YIAA 3BHIA 1ZHOA 4IFTA 4DJ5X 1U7TA 4QUHA 4PYOA 3JQAD 2F62A 5FIUA 1OXBB 1ORWA 3OT5A 1SVLA 3DNFA 5J4VA 3ZR4B 4G97A 3BQ9A 1XRSB 3BFJA 3ECAA 2QVCA 4FSXA 1C7QA 4PPNA 4WZAA 1FP6A 1JXOA 1WXFA 5KYUA 1NR7A 2Z08A 2JJ8A 3SKVA 3WNCA 1PFYA 3FTEA 1EUZA 3GMSA 3RNLA 1Y8RB 3M5CA 4Y2UA 4JVNA 3G8CA 4E0BA 1I3OA 2FOLA 2F4NA 1GNQA 4H0FA 2NWQA 8ADHA 1KI4A 4YHHB 1ISRA 2J3EA 3L8MA 4GX1A 1C4KA 3NT5A 4XWTA 1P9RA 1DE0A 1ZPDA 1LRLA 2A1TS 3FVQA 2HDOA 4TMFA 2GBFA 1FDTA 4FP9A 5D5HA 5BRNA 3OBBA 5TS3A 3O82A 2PUGA 1WWKA 1GPLA 4NH0A 2C3OA 2ZGVA 4UBNA 4F2WA 1O8CA 3B3JA 4NMHA 2IPMA 4ZKDA 3DZDA 4HAIA 4WFIA 4BKQA 4DMMA 3GLFA 4KFRA 1SM4A 3ZDQA 1H0KA 1XJ5A 2ES4A 3FOBA 3P9XA 5FL7A 2GN6A 3UUEA 2VXCA 4YQFA 4NL4H 2X2FA 3DAPA 1UR5A 2F3PA 5U4QA 3QVTA 2A84A 1GSOA 3CF4G 3V80A 2Z3VA 1YRAA 1NUUA 1MO2A 2IP4A 3TTWA 2ZKIA 5ALSA 5GINE 1PK7A 3BL6A 2HRRA 1KOFA 3I6BA 1PK8A 2IU6A 1JRLA 1Q1BA 2PJUA 2H29A 4FEAA 1JIUA 4RA9A 2DLDA 3VZDA 5JAHA 1PL6A 4IAOA 3LUHA 5EP2A 4E6EA 1SO8A 2WQ7A 3CLRD 1X8XA 2EWWA 2XHZA 3PUHA 1B6SA 4G5FA 4OBBA 1J2YA 5G1PA 2HU7A 4ZEWA 3T35A 2VHVA 3SIRA 4G5HA 3TOSA 3L7NA 4BC0A 3GLHE 3AP2A 4JN6B 4MGKR 3LGXA 3GYBA 1SQ5A 4GYKA 1PNQA 4S2EA 4TKVA 3DFZA 1BIFA 4AMYA 4YLGA 5TARA 1GUZA 4FE4A 4LAFA 4AULA 3RTBA 4NU5A 1GDTA 3ZHQA 5COQA 1Y3FE 3G1WA 2QMUA 4GECA 1XMJA 4GOOD 4CCAA 4HPXB 1JB9A 3KSRA 3UTCA 1XMIA 4OQNA 3N5CA 3ZDFA 4Q3KA 4G8BA 1Y9EA 1Z83A 3EMVA 5T64A 4H3HB 4GXQA 3BWDD 4JP2A 3RUAA 1WD7A 3RODA 1UPAA 1OSNA 3OHSX 4XD7D 3T3DA 1M1NB 1N0UA 2AMFA 2Z8XA 5ALUA 4AQYB 1PT8A 2M6SA 1YS9A 2QTHA 1YR9A 2XTNA 2XGOA 1BYUA 1T3GA 5A9TA 2H4FA 3GJRA 3O1IC 3R5TA 2R25B 2RE8A 4UREA 4LF4B 1ZGAA 4EYQA 2MSCB 3OE5A 2VPXA 2BGTA 3GRCA 4QHSA 5K3CA 3OF5A 3KD2A 4EZEA 2BGNA 5JD3A 5HOEA 1H9CA 4XUDA 5B1EA 1E2PA 5AFSA 5CVUA 1TAUA 2RGNA 3FAKA 1GQSA 2UUOA 5EE9A 1Z8NA 2I22A 3O8NA 5ALIA 2IEBA 3GPCA 3SDSA 4JLSA 1RMQA 1XNGA 4PNEA 1JA0A 1XKTA 3PC7A 4MGEA 1D2CA 2IYSA 3H9JA 4ESEA 3CNNA 2YV1A 3H4IA 3OQNA 2BCJQ 3AWIA 4IOLA 1A4RA 5JBIA 3M1AA 4KH1A 3L46A 1CJKC 3EZNA 1IN6A 4JBLA 3VC2A 2I91A 1NN5A 1JAHA 3ZCXA 4KIWA 2IU3A 3UPUA 3E48A 4KQHA 3VR3A 4HLUA 5KKNB 2JFBA 3LHFA 4HQFA 3RS4A 3P94A 1H1DA 3DGFC 4AS2A 4F92B 3DR3A 1LPAB 1R10A 1Z2OX 3GELA 2PBFA 2P91A 4NQZA 2A8YA 3OT1B 3WWYA 4ZQGA 3H4VA 4YRTA 5E9JA 5L3QA 2GEKA 4MRPA 5LZ2A 1WW8A 4ARSA 1I36A 1MXHA 3GRYA 4Q1AA 2QY9A 2V7GA 3PLRA 2W90A 1CVIA 1UP7A 5DM0A 4C5CA 1TPYA 4DEXA 5KQPA 3DV9A 4ZDWA 2AWNA 1JJVA 1H2XA 4K9OA 1IQRA 1SVWA 3ETJA 4XGKA 4XM1A 3EPRA 2YWGA 3GXBA 3IQGX 2EFCB 4OQLA 3AU8A 4D9GA 2PLRA 3V4FA 2DUNA 3I0MA 3JY6A 3L43A 3W2GA 3WMXA 4BP1A 4EB6B 1EB8A 1QO7A 3TR5A 3W6UA 3KQLA 2ZIGA 3T3NA 3LYLA 2EKLA 1CJBA 3AB7A 2EJUA 2O7VA 2BF7A 3IBCA 4MUJA 5H0IA 2RHOA 4GLFA 4RFLA 3WJ7A 1JL3A 1E2IA 4JT4A 3DKIA 1VLZA 3GGOA 3NIFB 3ZDXB 5LMNB 4TS1A 3ZJ4A 2W2TA 4GP6A 5D00A 3O8CA 4L5AA 1Y80A 3B48A 1J4AA 1CZUA 1V6SA 5J2TA 3WRVA 2LXNA 2OMKA 2XPCA 4QPZA 4Z54A 3LIIA 3OFSA 3KFLA 1Y8AA 4JC0A 2AC2A 1I6MA 1UBUS 1JG2A 1FSFA 2A5GA 3HBLA 5DF1A 2NZYA 4KBGA 3ZLUA 2WM2A 3C43A 3DDCA 3WLTA 4YDSA 4F1KA 3I04A 4OMDA 5IK2A 3EXFA 4LI0A 4JLNA 1BC5A 2VUUA 1KHTA 4ZD6A 3ULKA 3D43A 3HUFA 4A92A 1X15A 3JR3A 3B20A 3NAMA 1UADA 2VYND 1RKBA 3TR6A 4X1YB 4BO3A 2JFFA 5C52B 4LGYA 4QWMA 3WQHA 3WWOA 1TT5B 1OCEA 2KB0A 3K0KA 4MQFA 1KQFA 2C03A 2CSUA 4R1LA 4MEAA 5JSZA 2A1UB 4HY3A 4RD6A 4ND1A 4PG8A 3UT6A 1T6BY 3AUYA 5K3FB 1R9JA 3HDTA 1X1DA 2GTPA 5LJLA 2XQGA 3TZKA 2J4CA 3L4SO 4NCXA 5LB2A 3ZV6A 1GPKA 5ARDA 2PUWA 3ZX4A 2OHVA 2ZBEA 3ML1A 1V7ZA 4IDNA 5I7VA 4DE5A 5IJZA 1E3EA 4WLNA 3EEBA 2QM0A 4O02B 3G1TA 4L8GA 1Q1NA 1GEEA 1U2GA 2ADFA 2WHRA 1KL7A 1NI4A 1P1IA 1Z2AA 2VRCD 4ZZ1A 3THYA 1EK5A 2REXB 3IAS6 2DCMA 4BRZA 2XZTA 3UPTA 4L8FA 3UPDA 5JH7F 2QM7A 3WAGA 1L7BA 1XZAA 3I58A 5JAUA 3Q8XB 5GONB 5FWNA 5LD2C 3NGLA 4L50A 1GARA 3G0OA 2KJQA 3K92A 4N8SA 4QDXA 3EIOA 3EFOB 5CNKA 3WO1A 3UAXA 3D02A 3OD5A 3RRNA 2WB4A 3ZU6A 1Y98A 1JDSA 5I8PA 2ZWOA 4EF4A 4D4MA 1HZJA 1FFXB 3LBFA 2ZPUA 5GGYA 4C4XA 1VP9A 5SZJA 1LX7A 3K9CA 2JLYA 1H69A 3ROZA 1W87A 2FMUA 1YJ5A 4HF7A 4JBNA 3QELB 5H59A 3SKXA 1AUXA 4RTQA 5CBKA 4EH1A 5JS2A 3JW8A 3KG2A 3LBNA 3MSCA 3K72B 2BHTA 2BM9A 4X8OA 1CV2A 2XRZA 4GP7A 2C8LA 2GF0A 1ECLA 2C2HA 5ALPA 1XEXB 1VXRA 2C5GA 1M72A 2N1MA 1C2TA 3JQ9C 3PFCA 2OAQ1 3SIXA 1FDIA 1A5TA 1U1DA 1ABEA 4C07A 4N54A 5KSZA 2FZVA 1T0UA 3V1MA 4PCLA 1J24A 4RVUA 1DRJA 1Y63A 2A4MA 2PGDA 2PX8A 2W37A 3A3YA 4QA9A 4YB8A 2IPAB 3N2YA 2E4VA 4UBLA 1OU0A 3K31A 4HADA 1ZYUA 2RHLA 2WJHA 3OJFA 4LVCA 3WLSA 4TUYA 4MLZA 1WXXA 1U9ZA 2D5BA 2IGBA 1UXHA 4UCXA 4JI0B 2J0SA 3NOOA 3A4LA 1BS9A 1R8YA 1I7SB 2QL9A 5AVRA 3NFRA 3UJ3X 4L6IA 3NDIA 4C03A 4CMAA 2DPGA 1T2NA 3FB4A 5C51B 4N8EA 3C4QA 4HR7A 3BXEA 4QBHA 1FJ2A 1O95C 2RC5A 5JDIA 1GR1A 2C5AA 3C6QA 5KKAA 3AM1A 2JLRA 5JTTA 2PYIA 2ZBQA 3NGMA 5IN5A 5HDQA 5DBGA 1IHPA 3A26A 2R97A 3RUIA 3CISA 1KH3A 3C0KA 2ERXA 5ALKA 2GCEA 4S1OA 4OQXA 1M34A 5G0TA 2O8DA 5M3BA 1RXYA 4MB6A 4AO7A 1R0BA 2Q46A 2XIQA 1C7ZA 3NXKA 2QF7A 3Q5EA 3RM3A 4CI0B 1M5RA 5KAMA 5K0TA 4XH9B 3LCRA 2Q07A 4IIFA 3CSUA 4TLDA 4XSVA 1CUCA 3S29A 4QYIA 2R8OA 4Y9TA 3EK2A 1CJMA 1YVDA 4NEGA 1BDMA 3H6HA 3TTYA 3VNAA 1I2MA 2PNFA 3HP7A 4X8MA 3OPMA 4GNKA 3FPLA 4IEIA 3WK4A 3AOEC 4Q02A 1WKVA 2XH8A 1E5TA 3W90A 1RWOA 1CLEA 4IRUB 2F55A 1JF8A 4HNGA 2J7KA 3G8DA 4IJUA 4WL0A 3NWBA 3WWPA 5EUBA 2I80A 2ZSAA 3K0CA 1USKA 3ADBA 3H87A 4JKIA 4G5QA 3K71B 4KRFA 4FFRA 3HA5A 1P2VA 1E1CA 1U0OC 1JAYA 3IDQA 4D9NA 5JCJA 1I2BA 2QI9F 4TS3A 2GBLC 1QYWA 3ROMA 1RYYA 2VUHB 5E6UA 4MVWA 4MVJP 3UNXA 3DMYA 4X7MA 1XYVA 5JO0A 3F7NA 4ZCTA 2IS2A 1GUBA 2CNBA 2E1PA 5ULLA 1Q0ZA 3VBCA 1LW6E 2VDRB 3RRYA 5HRUA 3H2ZA 4KREA 2WF8A 1GAXA 3WTCA 4G5RA 4FNMA 2FAXA 4WUVA 4CZ2A 3EIQA 4XI9A 1M6VA 3BXXA 1HXHA 2O23A 4JLPA 4M76B 1GNRA 4ZOLF 2GARA 3KPYA 5FUXA 3WYAA 4LV8B 4BC1A 4CIWA 3IE1A 1YCDA 2JIZA 1H1TA 3MWGA 5AM3A 3SQDA 1OH5A 1Q16A 3MOSA 2Z2KA 3PFFA 1ZHHA 4OJYA 2F43B 2ONYA 4RY2A 3N9IA 5DNVA 3T0IA 4HYTA 3FOAA 4KHZA 3X2EA 4ND4A 5LQKA 1X1TA 5JPIA 2GHRA 5BV8A 4PZ9A 3E4CA 3FBWA 3L41A 3RU3A 4QBFA 4H4EA 1D6MA 3P0FA 5HE8A 2HA4A 2QTLA 4WMLA 4RPGA 5P8WA 5LWHA 2OL4A 3IT1A 4POAA 2IXBA 4D8WA 1NPYA 2RGCA 4FCTA 4AN0A 3DBOB 4F7DA 2ISSD 2GN2A 3U7HB 4PY2A 2R66A 4OP2A 2PUTA 3ADCA 5AIAA 1W94A 3PJFA 5BRJA 3GRPA 1LI5A 1WTCA 4YGXB 1GU7A 4QVGA 1R4NA 3PFWO 2H8KA 4RENA 4TMWA 1PWXA 3TZBA 1COWA 2FCAA 1WXDA 4QOGA 4ZVNA 4O2LA 1J5EB 4DYHA 2B7BA 3QITA 1M2JA 3KAKA 4L07A 1Q83A 3U5TA 4DV2B 4B3RB 4ZXFA 3RVPA 3TRKA 1VFNA 4L73A 3B6MA 1NBHA 1SELA 1XKXA 2QU8A 4ZDIA 1V4BA 2WIDA 4ZO4A 1G8FA 5IJ0A 3AKDA 5LP1A 5LOVB 5ERXA 2JKVA 4OMUA 1H4VB 4HDMA 3O1HB 4NC9A 4JB2A 3VNBA 4X92A 3ZPXA 4HX9A 1DZIA 4IDBA 1I3NA 1OLSB 1SVOA 3ZD7A 1TJ5A 4NJEB 4XAQA 3SFTA 4B87A 2P8SA 3S1LA 4RCVA 4MDFA 1GZ3A 3Q7EA 3TZHA 2HDNB 4UPVA 1BDBA 1DWUA 1F9EA 1M6EX 1RJGA 2AEJA 1O0CA 1BCSB 1DAPA 4IF4A 1TFUA 3DWGA 4YMSA 1FMLA 1PKEA 2PFSA 2IH5A 3AHEA 5CB6A 1RI2A 2NU9A 3FGOA 4RGYA 4A8HA 3UGTA 2PGNA 5HKOA 4F46A 1NF8A 1G42A 3C3WA 1C9NA 2JJ1D 1SR8A 4AWBA 5JCOA 2Y0DA 3L79A 4R5MA 1C8KA 3ASVA 4CIVA 5KOIA 2RGXA 4F56A 3D0KA 5JD6A 5I9SA 1OF1A 3ISTA 2GSWA 2XWPA 2AKAB 3GRVA 4M21A 4OF4A 4XEHA 1J1UA 3LT4A 2AR9A 2B92A 2YJZA 3OWOA 2B82A 1M1YA 3UFXB 1XTUA 2Z9CA 4DIDA 2O19A 2D7CA 4QO8A 5IYZB 1AURA 4DEVA 4O4IF 1WSDA 2A92A 5EI5A 1JECA 2NO4A 3UJ6A 3VR5D 1BDJA 5KTMA 5JWOA 4IHAA 2IT1A 4H6XA 4NAVA 2BM0A 5MN4A 1FTYA 3FYSA 4RKWA 2BOVA 1SWWA 3PVCA 3GDFA 2JL1A 3ROQA 1E1RA 4OQ4A 5DK4A 1O5TA 4PN3A 4MQBA 5KNDA 3MYYA 4B8YA 4CV2A 5KNLA 4DCVA 4MRVA 1GNPA 2PBZA 2ZRCA 1B43A 3KOOA 3QKTA 4D6YA 2VBIA 1EX9A 2OAGA 4MYTA 4LTMA 2DSNA 4ZU6X 5LZ5A 3SZLA 4IHJF 2VT3A 3E84A 2RGGA 2ZJ8A 4PC3A 1ZOIA 3M0EA 1PO7A 3EW7A 1NJ2A 2AJCA 2VTDA 2JIQA 2VHEA 3H5NA 3C6YA 1I4EB 1EQAA 1QE5A 4GI3A 1TCAA 1FSPA 2FR8A 2HYIC 1D8TA 5FTJA 3VYSB 4LGMA 1GY8A 2B1QA 3T5PA 4JJZA 3UXEA 4FJ1A 4ETNA 5HUQA 1IL0A 2X2OA 4YJ2B 2QVBA 4RESA 1BNCA 4KQMA 5A62A 4DADA 2M98A 3DXXA 3AM3A 1M1UA 2C31A 3LCCA 3NBUA 4OO3A 1FC0A 2BD0A 2ZAGA 2A0WA 3I8OA 4P22A 3NBZC 1IEXA 2KLBA 4FMDB 3KPVA 4I55B 3PUWA 4FQ8A 2YQ4A 5TMDA 4D4IA 1PRYA 1NW6A 5KJ6A 3AUXA 1XQVA 4DLYA 3H5TA 2IHJA 3IRUA 4UATA 4AX4A 5C3MA 4GNRA 4AJKA 2WTXA 1XR3A 1KTIA 1EX7A 1RXVA 3AJRA 1IAVA 4QYXA 3ZV7A 4JHXA 2XMZA 4NPCA 4OBWA 5AT1A 4HV4A 4JODA 2NVUB 1CF2O 3SZUA 1O6ZA 4O08A 3PIDA 3JQGB 1MIOB 4C78A 1QHHB 3E53A 4TLBA 5JBQA 2QQ5A 5FWYB 4F84A 3PGVA 4YLEA 1X14A 3EZ6A 4QAQA 4Q3EA 4PHGA 4IICA 2H92A 1RU3A 3DZFA 4WTOA 5FUMA 2E49A 3AI2A 1S3FA 3LWNA 3SHVA 2DLCX 5HCUA 5K6RA 1P2TA 4MV5A 5EESA 3L0OA 1EQUA 5IJ9B 1VJ0A 2C3YA 3E35A 4R1MA 4E03A 5FNVB 3E5NA 2C9ZA 3RS3A 1MU0A 2G72A 2IHKA 2JFUA 4UMDA 2R6FA 3VPXA 4YCMA 2OXTA 4E21A 2I1WA 3BD6A 1I14A 1QYCA 3LCJA 4YCLA 2ZI7A 1X9HA 2P2NA 3G79A 3KSDO 2DFPA 3L1JA 3EPKA 3NTXA 4YBRA 3ZZTA 1L9KA 2PUAA 2BM8A 2C77A 1JTVA 1N5OX 1YULA 4NPAA 1R1DA 1PSDA 1R2QA 4BNLA 721PA 1NULA 4F97A 1N2OA 3I1JA 2E55A 3TJRA 2VF5X 4ZTUB 3NVKI 1JXAA 3JYPA 2BMWA 2OZPA 4ZC1A 1M2WA 2BEWA 1FMJA 1XLVA 2Q3MA 4CLOB 1QKIA 2YR0A 3AETA 2CNNA 4LUCA 1P4HA 2JGJA 5FULA 4ZVTA 3OSZA 3DXZA 2AFIB 3FHJA 1A88A 4FYVA 1UMKA 1AJEA 1ZINA 3FYTA 4GWLA 5DM60 5HR5A 3GFGA 3VKVA 2HF2A 1F6DA 4KDRA 3UCEA 1NU8A 3FAZA 1WV1A 3RVLA 4AW9A 2P1RA 1ATIA 1X7ZB 4AI6A 2W2OA 4BMCA 3E3OA 5T4BA 2MSNA 2X5XA 3AOGA 4UNPA 4AX8A 3MS4A 1TRHA 1VBMA 1VMAA 3FMFA 4QU8A 3MCTA 5K6AC 5C5DA 1GQYA 2HTFA 1I01A 2DU8A 2V6IA 2WJVA 4Q19A 3L06A 4CGYA 1PV2A 4U7FA 2EC5A 1B2RA 3KZXA 5CFMA 3KUUA 1EXMA 1U63A 3R74A 3WL3A 1GFZA 1Z25A 4LBZA 1OKKA 2VDLB 3H2JA 2MR6A 2ZWAA 1M0WA 2IEAA 2MINA 2WJPA 3FTPA 4GYWA 5DEOA 5JANA 1XQYA 2JPDA 3RYIB 1IK6A 3IHWA 1UBRS 1X1SA 3G5AA 4A0HA 1RLUA 2C8KA 5GVSA 2FN7A 4YDHB 1BXKA 1TMKA 2O0KA 3TQSA 5JJIA 4E5PA 5DSTA 5F7ZA 1ML3A 2ZYGA 4CM5A 2GB4A 3RFCA 4AMZA 5HILA 5ILQA 3OM9A 1W4ZA 2O7NA 3TCXB 5B57C 3BTOA 1IVYA 2ODTX 1EVEA 4HDOB 3NDBB 3MAGA 2QD4A 2ZTUA 4Q39A 3WLRA 1O6CA 4HMOA 1NU6A 4Z3KA 4Y6LA 3N6RA 5SY4A 3FGZA 2PLAA 1RYBA 1G5QA 2YY5A 3O8BA 4BNFA 3VOSA 2IL1A 1DG9A 2I4IA 3LDGA 4BB9A 2CDBA 1Z0DA 1A71A 2ZYDA 5I9NA 3JQFA 4ZALA 2RKWA 1R50A 1TZJA 1L5ZA 3ENVA 1YI0A 4DR2B 4PBRA 3K6SA 2WB2A 2GK6A 1AVTA 3TTTA 2WZQA 1IBKB 3PGKA 4YRFA 5BN5A 1MB9A 1VJDA 2IYUA 4L8LA 3SU8A 5D2CA 5IH3A 3UMMA 2IYAA 3ONNA 4M0LA 5JZVA 2VJBA 5JQGA 4RVCA 3BJEA 3NVMB 4IX9A 2GMWA 5UKDA 3WIOA 2DBVO 2OCBA 2P68A 3TLBA 4ZTZB 2WD7A 5ECYA 2B3DA 3ICWA 2I6QA 1V26A 2QX7A 5KMGB 2BFMA 3PJRA 1ZISA 2OBLA 2CL7X 2GRAA 2Q4TA 4ZPJA 4MX8A 4FFSA 4N5HX 2CLIB 3K0AA 4QUKA 5EWJA 5TJ9A 3UMVA 3VSBA 3WLIA 1ADYA 3A32A 5HCIA 3NLLA 4ARAA 3QNUA 2AOWA 2KHZA 2VJDA 4Z7JA 5IKPA 3DL0A 3L6CA 4LI3X 5FYDA 4OXYA 2GF2A 3MXTA 4G0NA 1KJZA 4CLRA 2VTBB 4HN9A 1YA6A 2ZE5A 3KB8A 3U81A 3BB3A 3QF4B 2YQ5A 3Q9UA 2VK8A 3GIWA 4I8IA 1RAAA 4ES6A 5KX5B 4C4PA 3ER9A 1T2EA 2OV1A 4YV1A 3ZDYB 2ORYA 1RPTA 1WJGA 2ZWPA 1A1VA 1GXSB 2M6LA 3UXHA 5BV7A 1JE0A 2GNOA 3MTDA 1RZVA 1U1CA 3LDAA 3RJMA 4N76A 1QG0A 2AG5A 4JI7B 1CWUA 1DQRA 1SZPA 1TCUA 4JVOA 4UQLA 1OXSC 4XDHA 4R2WA 1UXIA 1QRTA 3INGA 2WTAA 5A04A 3OZXA 3L4JA 1J9ZA 4LHWA 2QRVA 1M7GA 2J0QA 1IU9A 4LNHA 4C6RA 3JYQA 1NVXQ 3WK9A 5HW0A 3CMCO 3MPOA 4HDRA 1ITZA 2JARA 4NI5A 2BN4A 2W71A 3MWEB 3IA2A 1WKBA 4KN9S 4INAA 1IHDA 1KERA 1OVMA 3WLKX 4WT7A 3SYLA 5EWMB 4CM7A 1BKYA 2YRWA 2QYSA 3R4VA 3B8EA 4KPUB 3LWZA 4I81A 1VPVA 3RS5A 2I7XA 3HDYA 3VR6H 1HA3A 1E2MA 4RIIA 2CE2X 1L0BA 1ZR4A 4HBZA 4RHYA 2CXPA 4K6HA 1DQZA 4CLEA 5K20A 3PJEA 3CC8A 4NMLA 1KS9A 3KALA 3GNLA 4EGJA 2X4IA 3RIHA 3WA6A 2B3TA 1GOTA 1TW2A 3NVAA 1W8IA 1GV0A 2G4CA 1KI2A 1EJ6A 3R6GA 4IPTA 3CNBA 1J0DA 1WB4A 1N2GA 3A6GA 3DAYA 5LYJA 4PTZA 2HQOA 4DLPA 3ROGA 3ZS9A 4Z4GA 2JFGA 1DC4A 3GF4A 1ETHA 2QLLA 4OREX 1UJ6A 3QQ5A 1VLVA 4KXYA 2Q9CA 3KC2A 1QAQA 2DT8A 1XD2A 4QQFA 1Z2NX 3VDNB 4R7GA 3VUEA 1SUFA 1HNXB 1ZL2A 2VKQA 3QVMA 4HTFA 4B31A 3NS7A 2SHKA 2WUEA 5E1MA 1RXIA 2QZJA 3PHLA 1R6UA 3UN1A 4EMUA 4LYGA 2J3MA 3AERB 3H5OA 2IXAA 3WGVA 5HJ7A 5F77A 4UFNA 2OOKA 2IZ7A 2ZCVA 4ASUA 2NVBA 2P4HX 5A5GA 1TD1A 1TGYA 4ZGWA 1Y7TA 2FUNB 2XZOA 3K3PA 3S1AA 3UJ9A 5K0FA 3TNYA 4EGQA 4QXPA 2B25A 4HYEA 2AMLA 3NR2A 1FJHA 2JJ2A 3A6KA 3D3KA 3QRWA 3W4IA 3C15C 2JC3A 1E92A 3DP9A 4G1MB 3FHCB 3QEJA 4TTAA 1GRNA 4X00A 4BV2A 4DM7A 4DREA 5AICA 1CY0A 1YL7A 1BEEA 2D4HA 4MUFA 2ZETA 3WGKA 1SG9A 1ABFA 1K6JA 4HN2A 3GLGE 1BHJA 1KK1A 4I9FA 5FUWA 3ESXA 4MWDA 4QLAA 1H8ED 4M98A 1CDZA 4EUKA 3F3YA 3SSMA 1N36B 5JS7A 1OGIA 3AF2A 3TM5A 1VXOA 3L0BA 3TSZA 3KXDA 4E33A 1XXHE 6AT1A 5IDWA 1HDGO 1CY4A 2DJIA 2LRHA 3TH5A 2POCA 4IIJA 4BZXA 1RZRD 3I1IA 1FF9A 1QK4A 1HSZA 3ACBA 1ZGBA 4DC0A 3JD4A 4Y2GA 3LDHA 1T1IA 2XMBA 1DIRA 3WWCA 1RWNA 2B8NA 3V8PA 4E5DA 1MX3A 4JX9A 4ENWA 1NXSA 3KT3A 4KI0A 4JEMA 4XSHA 2PL3A 3B7WA 2CYBA 3L6DA 1XZMA 2VOEA 4G5YA 2I1LA 4LY0A 2RHDA 4N65A 4QJ5A 4CTKA 1R0CA 3NRCA 5LP6A 4DUZB 5DN6A 1J21A 1LTKA 3LGAA 2R6CA 5AJVB 5A2QA 3IAM1 4LYJA 4RWEA 4UVEA 1M7HA 3COVA 1DOAA 3T1YB 2OSVA 3VOTA 3QV1A 3O9ZA 1UQUA 1SKYB 2B99A 1XOIA 4JGIA 1BGVA 5EIAA 1Q1GA 4H77A 5I5GA 3TLAA 1SHLA 3B5IA 4N49A 3IDAA 4NBWA 5KO2A 3UKOA 3G2HA 1ODCA 1HFEL 2WE8A 3W9UA 2XE8A 1GT91 2K7ZA 5K2OA 4EG4A 2OWEA 4YV7A 1UM9B 2PRJA 2GQ0A 4FD2A 4PLPA 4JH0A 2AT1A 1J00A 1E4EB 1NBEA 3FGNA 5IT4A 2QQGA 3A4TA 4DV6B 1V1MB 4MH0R 5AHWA 5DTQA 2OV2A 4QZVA 1YBFA 5IC6A 1UDWA 2PUVA 2P2SA 3U62A 2V59A 4YREA 1NM5A 1GZ6A 2CDRA 4J91A 4KX5A 1ZO8A 4R2KA 4DSZA 2WJ6A 5F21A 1O2DA 1EBUA 2NZ2A 4E30A 1HMPA 1TJNA 1N34B 1U8EA 1C2YA 4OXKA 4PINA 3MTGA 4IHKA 2B5WA 3BC1A 3H9BA 3JR7A 5CT4A 2Y05A 3GYGA 3MXOA 1RAEA 2DR0A 3HVUA 1DT3A 3LK6A 1TU0A 2UVQA 4GKAA 3KPWA 4OKNA 4N82A 2XNJA 2BLLA 3PWZA 4YP7A 2POQX 1F0PA 1Z82A 1RQGA 1UPTA 521PA 1T1SA 1FTWA 2CMKA 3EGEA 5EHGA 1E3TA 2A35A 4XM0A 2O52A 2V6JA 1R00A 2J87A 3R7FA 2AEEA 3GROA 4QFCA 5CLHA 3OZWA 3QOXA 4X7PA 3S2YA 4D79A 4F8YA 4G4SO 4AM8A 4RTSA 3KD3A 3R75A 1YC5A 4MYSA 4JLBA 2RBGA 3F9RA 2GYYA 3G82C 4IXTA 2GM4A 5IU6A 4QFMA 2VJQA 1CUGA 1QOPB 1VYHA 4KWTA 3HR7A 3ZVMA 3PLNA 3QWHA 5DGHA 4F2PA 5JYEA 3CX4A 3GRZA 3K6RA 3JSAA 5JAQA 2DJ5A 2GS9A 3AQ4A 3UJCA 3VR0A 3IE0A 1JZTA 2DBYA 1G7RA 3MQ2A 5E4YA 3CKYA 3LLVA 1K3FA 2JCSA 1K97A 4HAUA 3VC7A 1MO5A 4XD7A 5HG0A 5EL0A 3ABIA 4N8DA 3JVEA 3PNMA 4NZPA 3FWPA 1OI3A 3H16A 3U4CA 4DA6A 3T7IA 3MS7A 3FZGA 2F1JA 1MVNA 4EI2A 2WJYA 4TYWA 1JPJA 1U2ZA 2VDJA 3WB0A 4G37A 4LQ4A 2JW5A 2ZI4A 4C7OA 5L7TA 1BGXT 4LJ6A 2YRXA 2DBZA 1P2DA 5TMBA 4MV4A 1N2CB 3ZNQA 3RKUA 2EX0A 3KELA 4D99A 4HG2A 2GJ9A 3GCXA 5CHYA 3R9WA 1SXJC 2NP6A 1YJAA 3DL7A 1KIFA 1VIAA 1ZC3A 2F9FA 1KPGA 1KEPA 3HTXA 3P2JA 4R8LA 4DCNA 3SDZA 4A6XA 5LN1A 4YXFA 3KQTA 2PWPA 1G20E 2QZPA 3QYJA 1ZG3A 3AHIA 3D3WA 1KARA 2FMXA 2FEAA 5BUCA 1MEOA 4NATA 4EEKA 4QU5A 5BNZA 4XM2A 3OFJA 1U98A 4OU5A 2J0EA 3ZYCA 2ZPAA 3B9PA 1MJGM 3ZU4A 3PLAE 3Q2KA 4JZYA 1O4VA 2WWWA 2JCBA 5DWQA 5IKOA 4F2HA 4OSOA 3ZJTA 5CG1A 1KOJA 2ZAMA 4XWOA 3OJWA 3UWDA 3GQBA 5HIIA 1WEHA 4U3JB 4G0UA 4D25A 2W9XA 1G5PA 3D2AA 3FYDA 3HACA 3T5MA 4BNGA 4G4JA 2Z57A 1Z56C 3EA5A 4TYNA 3QGMA 2TMYA 4L9RA 4OY3A 1K4YA 3G7UA 3QBVA 1U8YA 2X2EA 4N9WA 3E22A 4ITUA 4X20B 3R7NA 3VJLA 4MW1A 1RAIA 4LXTA 4MPPA 4QDUA 3RI3A 3FWKA 2RBEA 2IRWA 3H6KA 3HWRA 3OD1A 4IS2A 2CK3D 2FPSA 4OQYA 4Y9SA 2MYTA 4KXMA 2R7AA 1NASA 2ZWMA 1SVUA 3LUGA 4NNJA 1CB7A 1RSZA 2IDJA 3T54A 4JU9A 3HHEA 3WMRA 5EC8A 1AMNA 1MAHA 3JASA 1AQ6A 1II8A 1TAGA 4UM9B 2HCTA 2I76A 2OP0A 1CDEA 1M8KA 2G8LA 4N5NA 4E1VA 1A9ZA 1UKEA 2QTBA 4RIHA 4FCWA 3UO8B 1LFAA 5BN3A 4DV1B 2ZYAA 3I4LA 2ZRLA 3OPVA 3URMA 2C88A 1RVDA 1UP6A 4X7RA 1NVVQ 2JI8A 2R6R1 4WNAB 3L92A 1DLIA 2Z2IA 4G1FA 3HZRA 5JEDA 4I08A 5AVYA 1AD2A 1Y3DE 4M22A 3GGPA 3SIWA 5CCXA 1QTNA 4ERNA 1IM8A 3EWNA 3JAWB 4PG6A 4DABA 1XX6A 5A4IS 1YZYA 4A36A 2LCIA 2PX2A 3OHPA 1OX6A 5G4KA 2ZJ5A 4C5AA 2F4VB 3KXKA 5E2BA 4RVDA 2FFBA 2GN1A 3VTAA 4O6VA 1GADO 4HVCA 2C4VA 1B16A 1MF7A 2VYNA 2N1BA 2D8MA 3HSKA 3LK7A 4L16A 4Y2YA 1JYFA 2PGIA 3X1DA 4MS3B 2C9BA 1NDUA 1KFEB <